data_1ZQ3
# 
_entry.id   1ZQ3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.356 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   1ZQ3         pdb_00001zq3 10.2210/pdb1zq3/pdb 
RCSB  RCSB033010   ?            ?                   
WWPDB D_1000033010 ?            ?                   
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZQ3 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-18 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Baird-Titus, J.M.' 1 
'Rance, M.'         2 
'Clark-Baldwin, K.' 3 
'Ma, J.'            4 
'Vrushank, D.'      5 
# 
_citation.id                        primary 
_citation.title                     
'The solution structure of the native K50 Bicoid homeodomain bound to the consensus TAATCC DNA-binding site.' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            356 
_citation.page_first                1137 
_citation.page_last                 1151 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16406070 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.007 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Baird-Titus, J.M.' 1 ? 
primary 'Clark-Baldwin, K.' 2 ? 
primary 'Dave, V.'          3 ? 
primary 'Caperelli, C.A.'   4 ? 
primary 'Ma, J.'            5 ? 
primary 'Rance, M.'         6 ? 
# 
_cell.entry_id           1ZQ3 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZQ3 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer syn "5'-D(*GP*CP*TP*CP*TP*AP*AP*TP*CP*CP*CP*CP*G)-3'" 3887.537 1 ? ? ?                               
'CONSENSUS DNA BINDING SITE SENSE STRAND'      
2 polymer syn "5'-D(*CP*GP*GP*GP*GP*AP*TP*TP*AP*GP*AP*GP*C)-3'" 4056.646 1 ? ? ?                               
'CONSENSUS DNA BINDING SITE ANTI-SENSE STRAND' 
3 polymer man 'Homeotic bicoid protein'                         7963.067 1 ? ? 'Homeodomain (residues 97-163)' ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        PRD-4 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DG)(DC)(DT)(DC)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DG)'               GCTCTAATCCCCG A ? 
2 polydeoxyribonucleotide no no '(DC)(DG)(DG)(DG)(DG)(DA)(DT)(DT)(DA)(DG)(DA)(DG)(DC)'               CGGGGATTAGAGC B ? 
3 'polypeptide(L)'        no no GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS 
GPRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  DG  n 
1 2  DC  n 
1 3  DT  n 
1 4  DC  n 
1 5  DT  n 
1 6  DA  n 
1 7  DA  n 
1 8  DT  n 
1 9  DC  n 
1 10 DC  n 
1 11 DC  n 
1 12 DC  n 
1 13 DG  n 
2 1  DC  n 
2 2  DG  n 
2 3  DG  n 
2 4  DG  n 
2 5  DG  n 
2 6  DA  n 
2 7  DT  n 
2 8  DT  n 
2 9  DA  n 
2 10 DG  n 
2 11 DA  n 
2 12 DG  n 
2 13 DC  n 
3 1  GLY n 
3 2  PRO n 
3 3  ARG n 
3 4  ARG n 
3 5  THR n 
3 6  ARG n 
3 7  THR n 
3 8  THR n 
3 9  PHE n 
3 10 THR n 
3 11 SER n 
3 12 SER n 
3 13 GLN n 
3 14 ILE n 
3 15 ALA n 
3 16 GLU n 
3 17 LEU n 
3 18 GLU n 
3 19 GLN n 
3 20 HIS n 
3 21 PHE n 
3 22 LEU n 
3 23 GLN n 
3 24 GLY n 
3 25 ARG n 
3 26 TYR n 
3 27 LEU n 
3 28 THR n 
3 29 ALA n 
3 30 PRO n 
3 31 ARG n 
3 32 LEU n 
3 33 ALA n 
3 34 ASP n 
3 35 LEU n 
3 36 SER n 
3 37 ALA n 
3 38 LYS n 
3 39 LEU n 
3 40 ALA n 
3 41 LEU n 
3 42 GLY n 
3 43 THR n 
3 44 ALA n 
3 45 GLN n 
3 46 VAL n 
3 47 LYS n 
3 48 ILE n 
3 49 TRP n 
3 50 PHE n 
3 51 LYS n 
3 52 ASN n 
3 53 ARG n 
3 54 ARG n 
3 55 ARG n 
3 56 ARG n 
3 57 HIS n 
3 58 LYS n 
3 59 ILE n 
3 60 GLN n 
3 61 SER n 
3 62 ASP n 
3 63 GLN n 
3 64 HIS n 
3 65 LYS n 
3 66 ASP n 
3 67 GLN n 
3 68 SER n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'fruit fly' 
_entity_src_gen.gene_src_genus                     Drosophila 
_entity_src_gen.pdbx_gene_src_gene                 bcd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Drosophila melanogaster' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     7227 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21Star 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET41a-Novagen 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP BCD_DROME Q9UAM0 3 PRRTRTTFTSSQIAELEQHFLQGRYLTAPRLADLSAKLALGTAQVKIWFKNRRRRHKIQSDQHKDQS 97 ? 
2 PDB 1ZQ3      1ZQ3   1 ?                                                                   ?  ? 
3 PDB 1ZQ3      1ZQ3   2 ?                                                                   ?  ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZQ3 P 2 ? 68 ? Q9UAM0 97 ? 163 ? 2  68 
2 2 1ZQ3 A 1 ? 13 ? 1ZQ3   69 ? 81  ? 69 81 
3 3 1ZQ3 B 1 ? 13 ? 1ZQ3   82 ? 94  ? 82 94 
# 
_struct_ref_seq_dif.align_id                     1 
_struct_ref_seq_dif.pdbx_pdb_id_code             1ZQ3 
_struct_ref_seq_dif.mon_id                       GLY 
_struct_ref_seq_dif.pdbx_pdb_strand_id           P 
_struct_ref_seq_dif.seq_num                      1 
_struct_ref_seq_dif.pdbx_pdb_ins_code            ? 
_struct_ref_seq_dif.pdbx_seq_db_name             UNP 
_struct_ref_seq_dif.pdbx_seq_db_accession_code   Q9UAM0 
_struct_ref_seq_dif.db_mon_id                    ? 
_struct_ref_seq_dif.pdbx_seq_db_seq_num          ? 
_struct_ref_seq_dif.details                      'cloning artifact' 
_struct_ref_seq_dif.pdbx_auth_seq_num            1 
_struct_ref_seq_dif.pdbx_ordinal                 1 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 3D_13C-separated_NOESY 1 
2 1 3D_15N-separated_NOESY 1 
3 1 HNHA                   1 
4 1 '2D NOESY'             1 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         295 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      ? 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
_pdbx_nmr_sample_details.solution_id      1 
_pdbx_nmr_sample_details.contents         
;1mM Bicoid Homeodomain (15N/13C), 1mM Duplex DNA (unlabeled), 10mM phosphate buffer, pH 7.0, 1mM DTT, 1mM PMSF, 1mM EDTA, 1mM sodium azide, 0.3mM leupeptin, 0.2mM pefabloc (Roche), 90% H2O, 10% D2O
;
_pdbx_nmr_sample_details.solvent_system   '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 INOVA Varian 600 ? 
2 INOVA Varian 800 ? 
# 
_pdbx_nmr_refine.entry_id           1ZQ3 
_pdbx_nmr_refine.method             
;protein structure - fast torsion angle dynamics algorithm (CYANA2.0), DNA structure - NUCGEN and simulated annealing with NMR-derived energy restraints (AMBER7.0), protein-DNA complex - simulated annealing with NMR-derived energy restraints (AMBER7.0), protein-DNA complex refinement - explicit solvent MD simulations (AMBER7.0)
;
_pdbx_nmr_refine.details            
;1724 total restraints used, 1076 protein distance restraints(NOESY), 34 protein hydrogen bond restraints(3D NOESY ,i-i+4), 134 angle restraints(HNHA), 192 DNA distance restraints(2D NOESY), 55 watson-crick restraints(B-DNA), 200 DNA angle restraints(B-DNA), 33 protein-DNA distance restraints (2D NOESY)
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      1ZQ3 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             20 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1ZQ3 
_pdbx_nmr_representative.conformer_id         3 
_pdbx_nmr_representative.selection_criteria   'closest to the average' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
'structure solution' CYANA   2.0   'Peter Guntert' 1 
refinement           Amber   7.0   
;D.A. Case, T.A. Darden, T.E. Cheatham, III, C.L. Simmerling, J. Wang, R.E. Duke, R. Luo, K.M. Merz, B. Wang, D.A. Pearlman, M. Crowley, S. Brozell, V. Tsui, H. Gohlke, J. Mongan, V. Hornak, G. Cui, P. Beroza, C. Schafmeister, J.W. Caldwell, W.S. Ross, and P.A. Kollman.
;
2 
'data analysis'      Sparky  3.109 'T. D. Goddard and D. G. Kneller' 3 
processing           NMRPipe .     'F. Delaglio, S. Grzesiek, G. W. Vuister, G. Zhu, J. Pfeifer and A. Bax' 4 
# 
_exptl.entry_id          1ZQ3 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1ZQ3 
_struct.title                     'NMR Solution Structure of the Bicoid Homeodomain Bound to the Consensus DNA Binding Site TAATCC' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZQ3 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
_struct_keywords.text            
;PROTEIN-DNA COMPLEX, DOUBLE HELIX, HELIX-TURN-HELIX, HOMEODOMAIN, DNA-BINDING DOMAIN, K50, RECOGNITION HELIX, TRANSCRIPTION FACTOR, TRANSLATIONAL CONTROL, TRANSCRIPTION-DNA COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR C 10 ? LEU C 22 ? THR P 10 LEU P 22 1 ? 13 
HELX_P HELX_P2 2 THR C 28 ? ALA C 40 ? THR P 28 ALA P 40 1 ? 13 
HELX_P HELX_P3 3 GLY C 42 ? GLN C 63 ? GLY P 42 GLN P 63 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
hydrog1  hydrog ? ? A DG 1  N1 ? ? ? 1_555 B DC 13 N3 ? ? A DG 69 B DC 94 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog2  hydrog ? ? A DG 1  N2 ? ? ? 1_555 B DC 13 O2 ? ? A DG 69 B DC 94 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog3  hydrog ? ? A DG 1  O6 ? ? ? 1_555 B DC 13 N4 ? ? A DG 69 B DC 94 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog4  hydrog ? ? A DC 2  N3 ? ? ? 1_555 B DG 12 N1 ? ? A DC 70 B DG 93 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog5  hydrog ? ? A DC 2  N4 ? ? ? 1_555 B DG 12 O6 ? ? A DC 70 B DG 93 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog6  hydrog ? ? A DC 2  O2 ? ? ? 1_555 B DG 12 N2 ? ? A DC 70 B DG 93 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog7  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 11 N1 ? ? A DT 71 B DA 92 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog8  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 11 N6 ? ? A DT 71 B DA 92 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog9  hydrog ? ? A DC 4  N3 ? ? ? 1_555 B DG 10 N1 ? ? A DC 72 B DG 91 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog10 hydrog ? ? A DC 4  N4 ? ? ? 1_555 B DG 10 O6 ? ? A DC 72 B DG 91 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog11 hydrog ? ? A DC 4  O2 ? ? ? 1_555 B DG 10 N2 ? ? A DC 72 B DG 91 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog12 hydrog ? ? A DT 5  N3 ? ? ? 1_555 B DA 9  N1 ? ? A DT 73 B DA 90 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog13 hydrog ? ? A DT 5  O4 ? ? ? 1_555 B DA 9  N6 ? ? A DT 73 B DA 90 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog14 hydrog ? ? A DA 6  N1 ? ? ? 1_555 B DT 8  N3 ? ? A DA 74 B DT 89 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog15 hydrog ? ? A DA 6  N6 ? ? ? 1_555 B DT 8  O4 ? ? A DA 74 B DT 89 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog16 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 7  N3 ? ? A DA 75 B DT 88 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog17 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 7  O4 ? ? A DA 75 B DT 88 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog18 hydrog ? ? A DT 8  N3 ? ? ? 1_555 B DA 6  N1 ? ? A DT 76 B DA 87 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog19 hydrog ? ? A DT 8  O4 ? ? ? 1_555 B DA 6  N6 ? ? A DT 76 B DA 87 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog20 hydrog ? ? A DC 9  N3 ? ? ? 1_555 B DG 5  N1 ? ? A DC 77 B DG 86 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog21 hydrog ? ? A DC 9  N4 ? ? ? 1_555 B DG 5  O6 ? ? A DC 77 B DG 86 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog22 hydrog ? ? A DC 9  O2 ? ? ? 1_555 B DG 5  N2 ? ? A DC 77 B DG 86 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog23 hydrog ? ? A DC 10 N3 ? ? ? 1_555 B DG 4  N1 ? ? A DC 78 B DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog24 hydrog ? ? A DC 10 N4 ? ? ? 1_555 B DG 4  O6 ? ? A DC 78 B DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog25 hydrog ? ? A DC 10 O2 ? ? ? 1_555 B DG 4  N2 ? ? A DC 78 B DG 85 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog26 hydrog ? ? A DC 11 N3 ? ? ? 1_555 B DG 3  N1 ? ? A DC 79 B DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog27 hydrog ? ? A DC 11 N4 ? ? ? 1_555 B DG 3  O6 ? ? A DC 79 B DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog28 hydrog ? ? A DC 11 O2 ? ? ? 1_555 B DG 3  N2 ? ? A DC 79 B DG 84 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog29 hydrog ? ? A DC 12 N3 ? ? ? 1_555 B DG 2  N1 ? ? A DC 80 B DG 83 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog30 hydrog ? ? A DC 12 N4 ? ? ? 1_555 B DG 2  O6 ? ? A DC 80 B DG 83 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog31 hydrog ? ? A DC 12 O2 ? ? ? 1_555 B DG 2  N2 ? ? A DC 80 B DG 83 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog32 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 1  N3 ? ? A DG 81 B DC 82 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog33 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 1  O2 ? ? A DG 81 B DC 82 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
hydrog34 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 1  N4 ? ? A DG 81 B DC 82 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ZQ3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZQ3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
P 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     O "O5'"  . DG  A 1 1  ? 7.705   -23.024 -7.003  1.00 0.00 ? 69 DG  A "O5'"  1  
ATOM 2     C "C5'"  . DG  A 1 1  ? 7.482   -23.830 -8.181  1.00 0.00 ? 69 DG  A "C5'"  1  
ATOM 3     C "C4'"  . DG  A 1 1  ? 6.671   -23.198 -9.320  1.00 0.00 ? 69 DG  A "C4'"  1  
ATOM 4     O "O4'"  . DG  A 1 1  ? 5.258   -23.258 -9.089  1.00 0.00 ? 69 DG  A "O4'"  1  
ATOM 5     C "C3'"  . DG  A 1 1  ? 6.939   -21.696 -9.745  1.00 0.00 ? 69 DG  A "C3'"  1  
ATOM 6     O "O3'"  . DG  A 1 1  ? 6.608   -21.503 -11.076 1.00 0.00 ? 69 DG  A "O3'"  1  
ATOM 7     C "C2'"  . DG  A 1 1  ? 5.915   -20.974 -8.904  1.00 0.00 ? 69 DG  A "C2'"  1  
ATOM 8     C "C1'"  . DG  A 1 1  ? 4.638   -21.915 -8.962  1.00 0.00 ? 69 DG  A "C1'"  1  
ATOM 9     N N9     . DG  A 1 1  ? 3.799   -21.994 -7.763  1.00 0.00 ? 69 DG  A N9     1  
ATOM 10    C C8     . DG  A 1 1  ? 4.146   -21.920 -6.507  1.00 0.00 ? 69 DG  A C8     1  
ATOM 11    N N7     . DG  A 1 1  ? 3.239   -22.103 -5.577  1.00 0.00 ? 69 DG  A N7     1  
ATOM 12    C C5     . DG  A 1 1  ? 2.078   -22.175 -6.368  1.00 0.00 ? 69 DG  A C5     1  
ATOM 13    C C6     . DG  A 1 1  ? 0.688   -22.170 -6.038  1.00 0.00 ? 69 DG  A C6     1  
ATOM 14    O O6     . DG  A 1 1  ? 0.161   -22.295 -4.941  1.00 0.00 ? 69 DG  A O6     1  
ATOM 15    N N1     . DG  A 1 1  ? -0.107  -22.074 -7.160  1.00 0.00 ? 69 DG  A N1     1  
ATOM 16    C C2     . DG  A 1 1  ? 0.307   -22.002 -8.414  1.00 0.00 ? 69 DG  A C2     1  
ATOM 17    N N2     . DG  A 1 1  ? -0.562  -22.255 -9.348  1.00 0.00 ? 69 DG  A N2     1  
ATOM 18    N N3     . DG  A 1 1  ? 1.553   -21.997 -8.770  1.00 0.00 ? 69 DG  A N3     1  
ATOM 19    C C4     . DG  A 1 1  ? 2.381   -22.004 -7.700  1.00 0.00 ? 69 DG  A C4     1  
ATOM 20    H "H5'"  . DG  A 1 1  ? 7.037   -24.796 -7.941  1.00 0.00 ? 69 DG  A "H5'"  1  
ATOM 21    H "H5''" . DG  A 1 1  ? 8.518   -23.908 -8.513  1.00 0.00 ? 69 DG  A "H5''" 1  
ATOM 22    H "H4'"  . DG  A 1 1  ? 6.858   -23.766 -10.231 1.00 0.00 ? 69 DG  A "H4'"  1  
ATOM 23    H "H3'"  . DG  A 1 1  ? 7.983   -21.437 -9.572  1.00 0.00 ? 69 DG  A "H3'"  1  
ATOM 24    H "H2'"  . DG  A 1 1  ? 6.313   -20.714 -7.923  1.00 0.00 ? 69 DG  A "H2'"  1  
ATOM 25    H "H2''" . DG  A 1 1  ? 5.647   -20.033 -9.386  1.00 0.00 ? 69 DG  A "H2''" 1  
ATOM 26    H "H1'"  . DG  A 1 1  ? 4.068   -21.609 -9.838  1.00 0.00 ? 69 DG  A "H1'"  1  
ATOM 27    H H8     . DG  A 1 1  ? 5.206   -21.885 -6.303  1.00 0.00 ? 69 DG  A H8     1  
ATOM 28    H H1     . DG  A 1 1  ? -1.085  -21.902 -6.979  1.00 0.00 ? 69 DG  A H1     1  
ATOM 29    H H21    . DG  A 1 1  ? -0.103  -22.382 -10.239 1.00 0.00 ? 69 DG  A H21    1  
ATOM 30    H H22    . DG  A 1 1  ? -1.558  -22.142 -9.227  1.00 0.00 ? 69 DG  A H22    1  
ATOM 31    H "HO5'" . DG  A 1 1  ? 8.243   -22.271 -7.259  1.00 0.00 ? 69 DG  A "HO5'" 1  
ATOM 32    P P      . DC  A 1 2  ? 7.119   -20.311 -11.968 1.00 0.00 ? 70 DC  A P      1  
ATOM 33    O OP1    . DC  A 1 2  ? 7.926   -20.729 -13.142 1.00 0.00 ? 70 DC  A OP1    1  
ATOM 34    O OP2    . DC  A 1 2  ? 7.675   -19.212 -11.132 1.00 0.00 ? 70 DC  A OP2    1  
ATOM 35    O "O5'"  . DC  A 1 2  ? 5.660   -19.729 -12.444 1.00 0.00 ? 70 DC  A "O5'"  1  
ATOM 36    C "C5'"  . DC  A 1 2  ? 4.823   -20.650 -13.208 1.00 0.00 ? 70 DC  A "C5'"  1  
ATOM 37    C "C4'"  . DC  A 1 2  ? 3.443   -20.032 -13.562 1.00 0.00 ? 70 DC  A "C4'"  1  
ATOM 38    O "O4'"  . DC  A 1 2  ? 2.569   -20.144 -12.429 1.00 0.00 ? 70 DC  A "O4'"  1  
ATOM 39    C "C3'"  . DC  A 1 2  ? 3.459   -18.564 -14.033 1.00 0.00 ? 70 DC  A "C3'"  1  
ATOM 40    O "O3'"  . DC  A 1 2  ? 2.480   -18.442 -15.069 1.00 0.00 ? 70 DC  A "O3'"  1  
ATOM 41    C "C2'"  . DC  A 1 2  ? 2.931   -17.910 -12.727 1.00 0.00 ? 70 DC  A "C2'"  1  
ATOM 42    C "C1'"  . DC  A 1 2  ? 2.004   -19.002 -12.025 1.00 0.00 ? 70 DC  A "C1'"  1  
ATOM 43    N N1     . DC  A 1 2  ? 2.079   -18.872 -10.540 1.00 0.00 ? 70 DC  A N1     1  
ATOM 44    C C2     . DC  A 1 2  ? 0.916   -18.847 -9.813  1.00 0.00 ? 70 DC  A C2     1  
ATOM 45    O O2     . DC  A 1 2  ? -0.216  -18.879 -10.371 1.00 0.00 ? 70 DC  A O2     1  
ATOM 46    N N3     . DC  A 1 2  ? 0.862   -18.715 -8.494  1.00 0.00 ? 70 DC  A N3     1  
ATOM 47    C C4     . DC  A 1 2  ? 2.006   -18.561 -7.848  1.00 0.00 ? 70 DC  A C4     1  
ATOM 48    N N4     . DC  A 1 2  ? 1.895   -18.527 -6.523  1.00 0.00 ? 70 DC  A N4     1  
ATOM 49    C C5     . DC  A 1 2  ? 3.248   -18.599 -8.476  1.00 0.00 ? 70 DC  A C5     1  
ATOM 50    C C6     . DC  A 1 2  ? 3.247   -18.888 -9.839  1.00 0.00 ? 70 DC  A C6     1  
ATOM 51    H "H5'"  . DC  A 1 2  ? 4.657   -21.590 -12.682 1.00 0.00 ? 70 DC  A "H5'"  1  
ATOM 52    H "H5''" . DC  A 1 2  ? 5.232   -20.914 -14.184 1.00 0.00 ? 70 DC  A "H5''" 1  
ATOM 53    H "H4'"  . DC  A 1 2  ? 3.015   -20.621 -14.372 1.00 0.00 ? 70 DC  A "H4'"  1  
ATOM 54    H "H3'"  . DC  A 1 2  ? 4.427   -18.248 -14.420 1.00 0.00 ? 70 DC  A "H3'"  1  
ATOM 55    H "H2'"  . DC  A 1 2  ? 3.763   -17.553 -12.120 1.00 0.00 ? 70 DC  A "H2'"  1  
ATOM 56    H "H2''" . DC  A 1 2  ? 2.262   -17.060 -12.859 1.00 0.00 ? 70 DC  A "H2''" 1  
ATOM 57    H "H1'"  . DC  A 1 2  ? 0.955   -18.894 -12.303 1.00 0.00 ? 70 DC  A "H1'"  1  
ATOM 58    H H41    . DC  A 1 2  ? 2.777   -18.518 -6.032  1.00 0.00 ? 70 DC  A H41    1  
ATOM 59    H H42    . DC  A 1 2  ? 1.054   -18.050 -6.230  1.00 0.00 ? 70 DC  A H42    1  
ATOM 60    H H5     . DC  A 1 2  ? 4.201   -18.488 -7.979  1.00 0.00 ? 70 DC  A H5     1  
ATOM 61    H H6     . DC  A 1 2  ? 4.138   -18.951 -10.445 1.00 0.00 ? 70 DC  A H6     1  
ATOM 62    P P      . DT  A 1 3  ? 2.099   -17.069 -15.841 1.00 0.00 ? 71 DT  A P      1  
ATOM 63    O OP1    . DT  A 1 3  ? 1.363   -17.347 -17.075 1.00 0.00 ? 71 DT  A OP1    1  
ATOM 64    O OP2    . DT  A 1 3  ? 3.236   -16.160 -15.849 1.00 0.00 ? 71 DT  A OP2    1  
ATOM 65    O "O5'"  . DT  A 1 3  ? 0.937   -16.548 -14.823 1.00 0.00 ? 71 DT  A "O5'"  1  
ATOM 66    C "C5'"  . DT  A 1 3  ? -0.259  -17.337 -14.748 1.00 0.00 ? 71 DT  A "C5'"  1  
ATOM 67    C "C4'"  . DT  A 1 3  ? -1.280  -16.680 -13.810 1.00 0.00 ? 71 DT  A "C4'"  1  
ATOM 68    O "O4'"  . DT  A 1 3  ? -0.856  -16.840 -12.474 1.00 0.00 ? 71 DT  A "O4'"  1  
ATOM 69    C "C3'"  . DT  A 1 3  ? -1.493  -15.178 -14.079 1.00 0.00 ? 71 DT  A "C3'"  1  
ATOM 70    O "O3'"  . DT  A 1 3  ? -2.832  -14.919 -14.073 1.00 0.00 ? 71 DT  A "O3'"  1  
ATOM 71    C "C2'"  . DT  A 1 3  ? -0.698  -14.619 -12.879 1.00 0.00 ? 71 DT  A "C2'"  1  
ATOM 72    C "C1'"  . DT  A 1 3  ? -1.001  -15.636 -11.745 1.00 0.00 ? 71 DT  A "C1'"  1  
ATOM 73    N N1     . DT  A 1 3  ? -0.134  -15.587 -10.488 1.00 0.00 ? 71 DT  A N1     1  
ATOM 74    C C2     . DT  A 1 3  ? -0.760  -15.667 -9.201  1.00 0.00 ? 71 DT  A C2     1  
ATOM 75    O O2     . DT  A 1 3  ? -1.977  -15.666 -8.992  1.00 0.00 ? 71 DT  A O2     1  
ATOM 76    N N3     . DT  A 1 3  ? 0.094   -15.582 -8.105  1.00 0.00 ? 71 DT  A N3     1  
ATOM 77    C C4     . DT  A 1 3  ? 1.484   -15.436 -8.092  1.00 0.00 ? 71 DT  A C4     1  
ATOM 78    O O4     . DT  A 1 3  ? 2.119   -15.430 -7.075  1.00 0.00 ? 71 DT  A O4     1  
ATOM 79    C C5     . DT  A 1 3  ? 2.062   -15.299 -9.441  1.00 0.00 ? 71 DT  A C5     1  
ATOM 80    C C7     . DT  A 1 3  ? 3.541   -15.214 -9.654  1.00 0.00 ? 71 DT  A C7     1  
ATOM 81    C C6     . DT  A 1 3  ? 1.241   -15.490 -10.568 1.00 0.00 ? 71 DT  A C6     1  
ATOM 82    H "H5'"  . DT  A 1 3  ? -0.094  -18.372 -14.447 1.00 0.00 ? 71 DT  A "H5'"  1  
ATOM 83    H "H5''" . DT  A 1 3  ? -0.795  -17.494 -15.684 1.00 0.00 ? 71 DT  A "H5''" 1  
ATOM 84    H "H4'"  . DT  A 1 3  ? -2.262  -17.112 -14.007 1.00 0.00 ? 71 DT  A "H4'"  1  
ATOM 85    H "H3'"  . DT  A 1 3  ? -1.048  -14.859 -15.022 1.00 0.00 ? 71 DT  A "H3'"  1  
ATOM 86    H "H2'"  . DT  A 1 3  ? 0.369   -14.526 -13.079 1.00 0.00 ? 71 DT  A "H2'"  1  
ATOM 87    H "H2''" . DT  A 1 3  ? -1.193  -13.694 -12.581 1.00 0.00 ? 71 DT  A "H2''" 1  
ATOM 88    H "H1'"  . DT  A 1 3  ? -2.073  -15.508 -11.598 1.00 0.00 ? 71 DT  A "H1'"  1  
ATOM 89    H H3     . DT  A 1 3  ? -0.305  -15.377 -7.200  1.00 0.00 ? 71 DT  A H3     1  
ATOM 90    H H71    . DT  A 1 3  ? 3.813   -15.772 -10.550 1.00 0.00 ? 71 DT  A H71    1  
ATOM 91    H H72    . DT  A 1 3  ? 3.794   -14.156 -9.721  1.00 0.00 ? 71 DT  A H72    1  
ATOM 92    H H73    . DT  A 1 3  ? 4.022   -15.685 -8.796  1.00 0.00 ? 71 DT  A H73    1  
ATOM 93    H H6     . DT  A 1 3  ? 1.693   -15.569 -11.547 1.00 0.00 ? 71 DT  A H6     1  
ATOM 94    P P      . DC  A 1 4  ? -3.388  -13.486 -14.398 1.00 0.00 ? 72 DC  A P      1  
ATOM 95    O OP1    . DC  A 1 4  ? -4.634  -13.708 -15.168 1.00 0.00 ? 72 DC  A OP1    1  
ATOM 96    O OP2    . DC  A 1 4  ? -2.370  -12.690 -15.039 1.00 0.00 ? 72 DC  A OP2    1  
ATOM 97    O "O5'"  . DC  A 1 4  ? -3.772  -12.918 -12.955 1.00 0.00 ? 72 DC  A "O5'"  1  
ATOM 98    C "C5'"  . DC  A 1 4  ? -4.917  -13.402 -12.319 1.00 0.00 ? 72 DC  A "C5'"  1  
ATOM 99    C "C4'"  . DC  A 1 4  ? -5.280  -12.723 -10.980 1.00 0.00 ? 72 DC  A "C4'"  1  
ATOM 100   O "O4'"  . DC  A 1 4  ? -4.205  -12.902 -10.043 1.00 0.00 ? 72 DC  A "O4'"  1  
ATOM 101   C "C3'"  . DC  A 1 4  ? -5.417  -11.224 -11.083 1.00 0.00 ? 72 DC  A "C3'"  1  
ATOM 102   O "O3'"  . DC  A 1 4  ? -6.448  -10.744 -10.195 1.00 0.00 ? 72 DC  A "O3'"  1  
ATOM 103   C "C2'"  . DC  A 1 4  ? -4.003  -10.687 -10.742 1.00 0.00 ? 72 DC  A "C2'"  1  
ATOM 104   C "C1'"  . DC  A 1 4  ? -3.699  -11.666 -9.590  1.00 0.00 ? 72 DC  A "C1'"  1  
ATOM 105   N N1     . DC  A 1 4  ? -2.205  -11.659 -9.318  1.00 0.00 ? 72 DC  A N1     1  
ATOM 106   C C2     . DC  A 1 4  ? -1.791  -11.909 -7.987  1.00 0.00 ? 72 DC  A C2     1  
ATOM 107   O O2     . DC  A 1 4  ? -2.632  -11.932 -7.049  1.00 0.00 ? 72 DC  A O2     1  
ATOM 108   N N3     . DC  A 1 4  ? -0.500  -12.026 -7.625  1.00 0.00 ? 72 DC  A N3     1  
ATOM 109   C C4     . DC  A 1 4  ? 0.460   -12.075 -8.538  1.00 0.00 ? 72 DC  A C4     1  
ATOM 110   N N4     . DC  A 1 4  ? 1.685   -12.055 -8.123  1.00 0.00 ? 72 DC  A N4     1  
ATOM 111   C C5     . DC  A 1 4  ? 0.121   -12.008 -9.946  1.00 0.00 ? 72 DC  A C5     1  
ATOM 112   C C6     . DC  A 1 4  ? -1.184  -11.774 -10.291 1.00 0.00 ? 72 DC  A C6     1  
ATOM 113   H "H5'"  . DC  A 1 4  ? -4.767  -14.462 -12.114 1.00 0.00 ? 72 DC  A "H5'"  1  
ATOM 114   H "H5''" . DC  A 1 4  ? -5.715  -13.260 -13.049 1.00 0.00 ? 72 DC  A "H5''" 1  
ATOM 115   H "H4'"  . DC  A 1 4  ? -6.243  -13.097 -10.630 1.00 0.00 ? 72 DC  A "H4'"  1  
ATOM 116   H "H3'"  . DC  A 1 4  ? -5.622  -10.942 -12.115 1.00 0.00 ? 72 DC  A "H3'"  1  
ATOM 117   H "H2'"  . DC  A 1 4  ? -3.346  -10.786 -11.606 1.00 0.00 ? 72 DC  A "H2'"  1  
ATOM 118   H "H2''" . DC  A 1 4  ? -3.989  -9.653  -10.399 1.00 0.00 ? 72 DC  A "H2''" 1  
ATOM 119   H "H1'"  . DC  A 1 4  ? -4.257  -11.367 -8.703  1.00 0.00 ? 72 DC  A "H1'"  1  
ATOM 120   H H41    . DC  A 1 4  ? 2.443   -12.017 -8.790  1.00 0.00 ? 72 DC  A H41    1  
ATOM 121   H H42    . DC  A 1 4  ? 1.981   -12.003 -7.159  1.00 0.00 ? 72 DC  A H42    1  
ATOM 122   H H5     . DC  A 1 4  ? 0.914   -12.218 -10.648 1.00 0.00 ? 72 DC  A H5     1  
ATOM 123   H H6     . DC  A 1 4  ? -1.440  -11.835 -11.338 1.00 0.00 ? 72 DC  A H6     1  
ATOM 124   P P      . DT  A 1 5  ? -7.044  -9.243  -10.348 1.00 0.00 ? 73 DT  A P      1  
ATOM 125   O OP1    . DT  A 1 5  ? -8.350  -9.074  -9.733  1.00 0.00 ? 73 DT  A OP1    1  
ATOM 126   O OP2    . DT  A 1 5  ? -6.925  -8.770  -11.713 1.00 0.00 ? 73 DT  A OP2    1  
ATOM 127   O "O5'"  . DT  A 1 5  ? -6.055  -8.345  -9.514  1.00 0.00 ? 73 DT  A "O5'"  1  
ATOM 128   C "C5'"  . DT  A 1 5  ? -5.942  -8.501  -8.042  1.00 0.00 ? 73 DT  A "C5'"  1  
ATOM 129   C "C4'"  . DT  A 1 5  ? -4.854  -7.544  -7.554  1.00 0.00 ? 73 DT  A "C4'"  1  
ATOM 130   O "O4'"  . DT  A 1 5  ? -3.530  -8.059  -7.599  1.00 0.00 ? 73 DT  A "O4'"  1  
ATOM 131   C "C3'"  . DT  A 1 5  ? -4.834  -6.177  -8.158  1.00 0.00 ? 73 DT  A "C3'"  1  
ATOM 132   O "O3'"  . DT  A 1 5  ? -4.825  -5.131  -7.224  1.00 0.00 ? 73 DT  A "O3'"  1  
ATOM 133   C "C2'"  . DT  A 1 5  ? -3.581  -6.222  -8.911  1.00 0.00 ? 73 DT  A "C2'"  1  
ATOM 134   C "C1'"  . DT  A 1 5  ? -2.624  -7.034  -8.015  1.00 0.00 ? 73 DT  A "C1'"  1  
ATOM 135   N N1     . DT  A 1 5  ? -1.357  -7.544  -8.605  1.00 0.00 ? 73 DT  A N1     1  
ATOM 136   C C2     . DT  A 1 5  ? -0.425  -8.035  -7.666  1.00 0.00 ? 73 DT  A C2     1  
ATOM 137   O O2     . DT  A 1 5  ? -0.600  -8.030  -6.492  1.00 0.00 ? 73 DT  A O2     1  
ATOM 138   N N3     . DT  A 1 5  ? 0.727   -8.485  -8.162  1.00 0.00 ? 73 DT  A N3     1  
ATOM 139   C C4     . DT  A 1 5  ? 1.082   -8.614  -9.475  1.00 0.00 ? 73 DT  A C4     1  
ATOM 140   O O4     . DT  A 1 5  ? 2.175   -9.071  -9.750  1.00 0.00 ? 73 DT  A O4     1  
ATOM 141   C C5     . DT  A 1 5  ? 0.104   -8.119  -10.450 1.00 0.00 ? 73 DT  A C5     1  
ATOM 142   C C7     . DT  A 1 5  ? 0.317   -8.129  -11.954 1.00 0.00 ? 73 DT  A C7     1  
ATOM 143   C C6     . DT  A 1 5  ? -1.032  -7.516  -9.964  1.00 0.00 ? 73 DT  A C6     1  
ATOM 144   H "H5'"  . DT  A 1 5  ? -5.675  -9.536  -7.829  1.00 0.00 ? 73 DT  A "H5'"  1  
ATOM 145   H "H5''" . DT  A 1 5  ? -6.911  -8.421  -7.550  1.00 0.00 ? 73 DT  A "H5''" 1  
ATOM 146   H "H4'"  . DT  A 1 5  ? -5.104  -7.358  -6.510  1.00 0.00 ? 73 DT  A "H4'"  1  
ATOM 147   H "H3'"  . DT  A 1 5  ? -5.633  -6.072  -8.891  1.00 0.00 ? 73 DT  A "H3'"  1  
ATOM 148   H "H2'"  . DT  A 1 5  ? -3.862  -6.720  -9.839  1.00 0.00 ? 73 DT  A "H2'"  1  
ATOM 149   H "H2''" . DT  A 1 5  ? -3.248  -5.198  -9.083  1.00 0.00 ? 73 DT  A "H2''" 1  
ATOM 150   H "H1'"  . DT  A 1 5  ? -2.311  -6.348  -7.228  1.00 0.00 ? 73 DT  A "H1'"  1  
ATOM 151   H H3     . DT  A 1 5  ? 1.298   -8.969  -7.483  1.00 0.00 ? 73 DT  A H3     1  
ATOM 152   H H71    . DT  A 1 5  ? 1.279   -7.676  -12.194 1.00 0.00 ? 73 DT  A H71    1  
ATOM 153   H H72    . DT  A 1 5  ? 0.297   -9.171  -12.272 1.00 0.00 ? 73 DT  A H72    1  
ATOM 154   H H73    . DT  A 1 5  ? -0.595  -7.808  -12.458 1.00 0.00 ? 73 DT  A H73    1  
ATOM 155   H H6     . DT  A 1 5  ? -1.810  -7.113  -10.593 1.00 0.00 ? 73 DT  A H6     1  
ATOM 156   P P      . DA  A 1 6  ? -6.147  -4.436  -6.759  1.00 0.00 ? 74 DA  A P      1  
ATOM 157   O OP1    . DA  A 1 6  ? -7.302  -5.262  -7.162  1.00 0.00 ? 74 DA  A OP1    1  
ATOM 158   O OP2    . DA  A 1 6  ? -6.116  -2.994  -7.237  1.00 0.00 ? 74 DA  A OP2    1  
ATOM 159   O "O5'"  . DA  A 1 6  ? -6.242  -4.349  -5.129  1.00 0.00 ? 74 DA  A "O5'"  1  
ATOM 160   C "C5'"  . DA  A 1 6  ? -6.161  -5.543  -4.407  1.00 0.00 ? 74 DA  A "C5'"  1  
ATOM 161   C "C4'"  . DA  A 1 6  ? -5.066  -5.651  -3.376  1.00 0.00 ? 74 DA  A "C4'"  1  
ATOM 162   O "O4'"  . DA  A 1 6  ? -3.788  -5.817  -4.034  1.00 0.00 ? 74 DA  A "O4'"  1  
ATOM 163   C "C3'"  . DA  A 1 6  ? -5.022  -4.373  -2.498  1.00 0.00 ? 74 DA  A "C3'"  1  
ATOM 164   O "O3'"  . DA  A 1 6  ? -4.770  -4.711  -1.177  1.00 0.00 ? 74 DA  A "O3'"  1  
ATOM 165   C "C2'"  . DA  A 1 6  ? -3.859  -3.595  -3.153  1.00 0.00 ? 74 DA  A "C2'"  1  
ATOM 166   C "C1'"  . DA  A 1 6  ? -2.949  -4.700  -3.536  1.00 0.00 ? 74 DA  A "C1'"  1  
ATOM 167   N N9     . DA  A 1 6  ? -2.086  -4.421  -4.713  1.00 0.00 ? 74 DA  A N9     1  
ATOM 168   C C8     . DA  A 1 6  ? -2.415  -3.994  -5.988  1.00 0.00 ? 74 DA  A C8     1  
ATOM 169   N N7     . DA  A 1 6  ? -1.463  -4.040  -6.938  1.00 0.00 ? 74 DA  A N7     1  
ATOM 170   C C5     . DA  A 1 6  ? -0.464  -4.649  -6.191  1.00 0.00 ? 74 DA  A C5     1  
ATOM 171   C C6     . DA  A 1 6  ? 0.884   -5.177  -6.500  1.00 0.00 ? 74 DA  A C6     1  
ATOM 172   N N6     . DA  A 1 6  ? 1.478   -5.037  -7.695  1.00 0.00 ? 74 DA  A N6     1  
ATOM 173   N N1     . DA  A 1 6  ? 1.642   -5.840  -5.599  1.00 0.00 ? 74 DA  A N1     1  
ATOM 174   C C2     . DA  A 1 6  ? 1.010   -6.118  -4.483  1.00 0.00 ? 74 DA  A C2     1  
ATOM 175   N N3     . DA  A 1 6  ? -0.182  -5.721  -4.013  1.00 0.00 ? 74 DA  A N3     1  
ATOM 176   C C4     . DA  A 1 6  ? -0.805  -4.903  -4.899  1.00 0.00 ? 74 DA  A C4     1  
ATOM 177   H "H5'"  . DA  A 1 6  ? -6.093  -6.407  -5.068  1.00 0.00 ? 74 DA  A "H5'"  1  
ATOM 178   H "H5''" . DA  A 1 6  ? -7.056  -5.589  -3.786  1.00 0.00 ? 74 DA  A "H5''" 1  
ATOM 179   H "H4'"  . DA  A 1 6  ? -5.252  -6.474  -2.684  1.00 0.00 ? 74 DA  A "H4'"  1  
ATOM 180   H "H3'"  . DA  A 1 6  ? -5.985  -3.876  -2.610  1.00 0.00 ? 74 DA  A "H3'"  1  
ATOM 181   H "H2'"  . DA  A 1 6  ? -4.240  -3.081  -4.035  1.00 0.00 ? 74 DA  A "H2'"  1  
ATOM 182   H "H2''" . DA  A 1 6  ? -3.451  -2.859  -2.460  1.00 0.00 ? 74 DA  A "H2''" 1  
ATOM 183   H "H1'"  . DA  A 1 6  ? -2.349  -5.163  -2.753  1.00 0.00 ? 74 DA  A "H1'"  1  
ATOM 184   H H8     . DA  A 1 6  ? -3.340  -3.477  -6.200  1.00 0.00 ? 74 DA  A H8     1  
ATOM 185   H H61    . DA  A 1 6  ? 2.397   -5.427  -7.851  1.00 0.00 ? 74 DA  A H61    1  
ATOM 186   H H62    . DA  A 1 6  ? 0.933   -4.519  -8.370  1.00 0.00 ? 74 DA  A H62    1  
ATOM 187   H H2     . DA  A 1 6  ? 1.647   -6.704  -3.838  1.00 0.00 ? 74 DA  A H2     1  
ATOM 188   P P      . DA  A 1 7  ? -4.830  -3.682  0.035   1.00 0.00 ? 75 DA  A P      1  
ATOM 189   O OP1    . DA  A 1 7  ? -5.419  -4.353  1.205   1.00 0.00 ? 75 DA  A OP1    1  
ATOM 190   O OP2    . DA  A 1 7  ? -5.518  -2.475  -0.500  1.00 0.00 ? 75 DA  A OP2    1  
ATOM 191   O "O5'"  . DA  A 1 7  ? -3.251  -3.449  0.211   1.00 0.00 ? 75 DA  A "O5'"  1  
ATOM 192   C "C5'"  . DA  A 1 7  ? -2.540  -4.546  0.808   1.00 0.00 ? 75 DA  A "C5'"  1  
ATOM 193   C "C4'"  . DA  A 1 7  ? -1.069  -4.451  0.475   1.00 0.00 ? 75 DA  A "C4'"  1  
ATOM 194   O "O4'"  . DA  A 1 7  ? -0.812  -4.218  -0.935  1.00 0.00 ? 75 DA  A "O4'"  1  
ATOM 195   C "C3'"  . DA  A 1 7  ? -0.220  -3.347  1.157   1.00 0.00 ? 75 DA  A "C3'"  1  
ATOM 196   O "O3'"  . DA  A 1 7  ? 0.784   -3.975  1.975   1.00 0.00 ? 75 DA  A "O3'"  1  
ATOM 197   C "C2'"  . DA  A 1 7  ? 0.465   -2.578  0.030   1.00 0.00 ? 75 DA  A "C2'"  1  
ATOM 198   C "C1'"  . DA  A 1 7  ? 0.418   -3.570  -1.110  1.00 0.00 ? 75 DA  A "C1'"  1  
ATOM 199   N N9     . DA  A 1 7  ? 0.542   -2.864  -2.411  1.00 0.00 ? 75 DA  A N9     1  
ATOM 200   C C8     . DA  A 1 7  ? -0.402  -2.052  -3.057  1.00 0.00 ? 75 DA  A C8     1  
ATOM 201   N N7     . DA  A 1 7  ? -0.121  -1.750  -4.313  1.00 0.00 ? 75 DA  A N7     1  
ATOM 202   C C5     . DA  A 1 7  ? 1.161   -2.315  -4.439  1.00 0.00 ? 75 DA  A C5     1  
ATOM 203   C C6     . DA  A 1 7  ? 2.117   -2.414  -5.468  1.00 0.00 ? 75 DA  A C6     1  
ATOM 204   N N6     . DA  A 1 7  ? 1.979   -1.912  -6.643  1.00 0.00 ? 75 DA  A N6     1  
ATOM 205   N N1     . DA  A 1 7  ? 3.334   -2.909  -5.304  1.00 0.00 ? 75 DA  A N1     1  
ATOM 206   C C2     . DA  A 1 7  ? 3.618   -3.472  -4.124  1.00 0.00 ? 75 DA  A C2     1  
ATOM 207   N N3     . DA  A 1 7  ? 2.830   -3.542  -3.048  1.00 0.00 ? 75 DA  A N3     1  
ATOM 208   C C4     . DA  A 1 7  ? 1.598   -2.964  -3.295  1.00 0.00 ? 75 DA  A C4     1  
ATOM 209   H "H5'"  . DA  A 1 7  ? -2.976  -5.472  0.432   1.00 0.00 ? 75 DA  A "H5'"  1  
ATOM 210   H "H5''" . DA  A 1 7  ? -2.648  -4.486  1.891   1.00 0.00 ? 75 DA  A "H5''" 1  
ATOM 211   H "H4'"  . DA  A 1 7  ? -0.689  -5.438  0.737   1.00 0.00 ? 75 DA  A "H4'"  1  
ATOM 212   H "H3'"  . DA  A 1 7  ? -0.895  -2.712  1.732   1.00 0.00 ? 75 DA  A "H3'"  1  
ATOM 213   H "H2'"  . DA  A 1 7  ? -0.097  -1.659  -0.134  1.00 0.00 ? 75 DA  A "H2'"  1  
ATOM 214   H "H2''" . DA  A 1 7  ? 1.525   -2.405  0.221   1.00 0.00 ? 75 DA  A "H2''" 1  
ATOM 215   H "H1'"  . DA  A 1 7  ? 1.233   -4.283  -0.990  1.00 0.00 ? 75 DA  A "H1'"  1  
ATOM 216   H H8     . DA  A 1 7  ? -1.286  -1.754  -2.513  1.00 0.00 ? 75 DA  A H8     1  
ATOM 217   H H61    . DA  A 1 7  ? 2.819   -1.978  -7.202  1.00 0.00 ? 75 DA  A H61    1  
ATOM 218   H H62    . DA  A 1 7  ? 1.149   -1.373  -6.839  1.00 0.00 ? 75 DA  A H62    1  
ATOM 219   H H2     . DA  A 1 7  ? 4.645   -3.741  -3.930  1.00 0.00 ? 75 DA  A H2     1  
ATOM 220   P P      . DT  A 1 8  ? 1.792   -3.263  3.064   1.00 0.00 ? 76 DT  A P      1  
ATOM 221   O OP1    . DT  A 1 8  ? 2.084   -4.272  4.123   1.00 0.00 ? 76 DT  A OP1    1  
ATOM 222   O OP2    . DT  A 1 8  ? 1.105   -2.035  3.506   1.00 0.00 ? 76 DT  A OP2    1  
ATOM 223   O "O5'"  . DT  A 1 8  ? 3.104   -2.965  2.286   1.00 0.00 ? 76 DT  A "O5'"  1  
ATOM 224   C "C5'"  . DT  A 1 8  ? 3.994   -3.965  1.854   1.00 0.00 ? 76 DT  A "C5'"  1  
ATOM 225   C "C4'"  . DT  A 1 8  ? 5.272   -3.511  1.084   1.00 0.00 ? 76 DT  A "C4'"  1  
ATOM 226   O "O4'"  . DT  A 1 8  ? 4.966   -3.141  -0.214  1.00 0.00 ? 76 DT  A "O4'"  1  
ATOM 227   C "C3'"  . DT  A 1 8  ? 6.051   -2.421  1.755   1.00 0.00 ? 76 DT  A "C3'"  1  
ATOM 228   O "O3'"  . DT  A 1 8  ? 7.421   -2.937  2.010   1.00 0.00 ? 76 DT  A "O3'"  1  
ATOM 229   C "C2'"  . DT  A 1 8  ? 6.033   -1.270  0.734   1.00 0.00 ? 76 DT  A "C2'"  1  
ATOM 230   C "C1'"  . DT  A 1 8  ? 5.652   -1.983  -0.537  1.00 0.00 ? 76 DT  A "C1'"  1  
ATOM 231   N N1     . DT  A 1 8  ? 4.772   -1.158  -1.443  1.00 0.00 ? 76 DT  A N1     1  
ATOM 232   C C2     . DT  A 1 8  ? 5.205   -1.070  -2.736  1.00 0.00 ? 76 DT  A C2     1  
ATOM 233   O O2     . DT  A 1 8  ? 6.087   -1.764  -3.238  1.00 0.00 ? 76 DT  A O2     1  
ATOM 234   N N3     . DT  A 1 8  ? 4.653   -0.075  -3.488  1.00 0.00 ? 76 DT  A N3     1  
ATOM 235   C C4     . DT  A 1 8  ? 3.357   0.386   -3.279  1.00 0.00 ? 76 DT  A C4     1  
ATOM 236   O O4     . DT  A 1 8  ? 2.706   0.944   -4.146  1.00 0.00 ? 76 DT  A O4     1  
ATOM 237   C C5     . DT  A 1 8  ? 2.917   0.188   -1.928  1.00 0.00 ? 76 DT  A C5     1  
ATOM 238   C C7     . DT  A 1 8  ? 1.631   0.830   -1.523  1.00 0.00 ? 76 DT  A C7     1  
ATOM 239   C C6     . DT  A 1 8  ? 3.636   -0.576  -1.069  1.00 0.00 ? 76 DT  A C6     1  
ATOM 240   H "H5'"  . DT  A 1 8  ? 3.422   -4.617  1.192   1.00 0.00 ? 76 DT  A "H5'"  1  
ATOM 241   H "H5''" . DT  A 1 8  ? 4.283   -4.568  2.715   1.00 0.00 ? 76 DT  A "H5''" 1  
ATOM 242   H "H4'"  . DT  A 1 8  ? 5.948   -4.365  1.085   1.00 0.00 ? 76 DT  A "H4'"  1  
ATOM 243   H "H3'"  . DT  A 1 8  ? 5.661   -2.174  2.742   1.00 0.00 ? 76 DT  A "H3'"  1  
ATOM 244   H "H2'"  . DT  A 1 8  ? 5.421   -0.424  1.048   1.00 0.00 ? 76 DT  A "H2'"  1  
ATOM 245   H "H2''" . DT  A 1 8  ? 6.997   -0.819  0.499   1.00 0.00 ? 76 DT  A "H2''" 1  
ATOM 246   H "H1'"  . DT  A 1 8  ? 6.557   -2.316  -1.046  1.00 0.00 ? 76 DT  A "H1'"  1  
ATOM 247   H H3     . DT  A 1 8  ? 5.047   0.108   -4.400  1.00 0.00 ? 76 DT  A H3     1  
ATOM 248   H H71    . DT  A 1 8  ? 0.768   0.266   -1.879  1.00 0.00 ? 76 DT  A H71    1  
ATOM 249   H H72    . DT  A 1 8  ? 1.574   0.840   -0.435  1.00 0.00 ? 76 DT  A H72    1  
ATOM 250   H H73    . DT  A 1 8  ? 1.691   1.874   -1.833  1.00 0.00 ? 76 DT  A H73    1  
ATOM 251   H H6     . DT  A 1 8  ? 3.283   -0.740  -0.062  1.00 0.00 ? 76 DT  A H6     1  
ATOM 252   P P      . DC  A 1 9  ? 8.345   -2.088  2.879   1.00 0.00 ? 77 DC  A P      1  
ATOM 253   O OP1    . DC  A 1 9  ? 9.290   -2.946  3.675   1.00 0.00 ? 77 DC  A OP1    1  
ATOM 254   O OP2    . DC  A 1 9  ? 7.550   -1.129  3.687   1.00 0.00 ? 77 DC  A OP2    1  
ATOM 255   O "O5'"  . DC  A 1 9  ? 9.317   -1.204  1.963   1.00 0.00 ? 77 DC  A "O5'"  1  
ATOM 256   C "C5'"  . DC  A 1 9  ? 10.397  -1.796  1.279   1.00 0.00 ? 77 DC  A "C5'"  1  
ATOM 257   C "C4'"  . DC  A 1 9  ? 10.991  -0.872  0.245   1.00 0.00 ? 77 DC  A "C4'"  1  
ATOM 258   O "O4'"  . DC  A 1 9  ? 9.886   -0.401  -0.639  1.00 0.00 ? 77 DC  A "O4'"  1  
ATOM 259   C "C3'"  . DC  A 1 9  ? 11.647  0.403   0.877   1.00 0.00 ? 77 DC  A "C3'"  1  
ATOM 260   O "O3'"  . DC  A 1 9  ? 12.890  0.751   0.283   1.00 0.00 ? 77 DC  A "O3'"  1  
ATOM 261   C "C2'"  . DC  A 1 9  ? 10.575  1.484   0.577   1.00 0.00 ? 77 DC  A "C2'"  1  
ATOM 262   C "C1'"  . DC  A 1 9  ? 9.979   1.040   -0.738  1.00 0.00 ? 77 DC  A "C1'"  1  
ATOM 263   N N1     . DC  A 1 9  ? 8.522   1.484   -1.098  1.00 0.00 ? 77 DC  A N1     1  
ATOM 264   C C2     . DC  A 1 9  ? 8.210   1.945   -2.433  1.00 0.00 ? 77 DC  A C2     1  
ATOM 265   O O2     . DC  A 1 9  ? 9.040   2.059   -3.309  1.00 0.00 ? 77 DC  A O2     1  
ATOM 266   N N3     . DC  A 1 9  ? 6.978   2.317   -2.789  1.00 0.00 ? 77 DC  A N3     1  
ATOM 267   C C4     . DC  A 1 9  ? 6.066   2.303   -1.760  1.00 0.00 ? 77 DC  A C4     1  
ATOM 268   N N4     . DC  A 1 9  ? 4.897   2.816   -2.111  1.00 0.00 ? 77 DC  A N4     1  
ATOM 269   C C5     . DC  A 1 9  ? 6.333   1.993   -0.401  1.00 0.00 ? 77 DC  A C5     1  
ATOM 270   C C6     . DC  A 1 9  ? 7.566   1.500   -0.079  1.00 0.00 ? 77 DC  A C6     1  
ATOM 271   H "H5'"  . DC  A 1 9  ? 10.127  -2.743  0.811   1.00 0.00 ? 77 DC  A "H5'"  1  
ATOM 272   H "H5''" . DC  A 1 9  ? 11.251  -2.050  1.908   1.00 0.00 ? 77 DC  A "H5''" 1  
ATOM 273   H "H4'"  . DC  A 1 9  ? 11.810  -1.391  -0.252  1.00 0.00 ? 77 DC  A "H4'"  1  
ATOM 274   H "H3'"  . DC  A 1 9  ? 11.850  0.252   1.938   1.00 0.00 ? 77 DC  A "H3'"  1  
ATOM 275   H "H2'"  . DC  A 1 9  ? 9.767   1.474   1.307   1.00 0.00 ? 77 DC  A "H2'"  1  
ATOM 276   H "H2''" . DC  A 1 9  ? 11.064  2.450   0.456   1.00 0.00 ? 77 DC  A "H2''" 1  
ATOM 277   H "H1'"  . DC  A 1 9  ? 10.722  1.296   -1.495  1.00 0.00 ? 77 DC  A "H1'"  1  
ATOM 278   H H41    . DC  A 1 9  ? 4.281   3.137   -1.377  1.00 0.00 ? 77 DC  A H41    1  
ATOM 279   H H42    . DC  A 1 9  ? 4.705   3.095   -3.062  1.00 0.00 ? 77 DC  A H42    1  
ATOM 280   H H5     . DC  A 1 9  ? 5.678   2.169   0.440   1.00 0.00 ? 77 DC  A H5     1  
ATOM 281   H H6     . DC  A 1 9  ? 7.844   1.199   0.920   1.00 0.00 ? 77 DC  A H6     1  
ATOM 282   P P      . DC  A 1 10 ? 13.777  1.968   0.870   1.00 0.00 ? 78 DC  A P      1  
ATOM 283   O OP1    . DC  A 1 10 ? 15.172  1.509   0.899   1.00 0.00 ? 78 DC  A OP1    1  
ATOM 284   O OP2    . DC  A 1 10 ? 13.205  2.468   2.102   1.00 0.00 ? 78 DC  A OP2    1  
ATOM 285   O "O5'"  . DC  A 1 10 ? 13.675  3.169   -0.170  1.00 0.00 ? 78 DC  A "O5'"  1  
ATOM 286   C "C5'"  . DC  A 1 10 ? 14.494  3.152   -1.320  1.00 0.00 ? 78 DC  A "C5'"  1  
ATOM 287   C "C4'"  . DC  A 1 10 ? 14.083  4.241   -2.294  1.00 0.00 ? 78 DC  A "C4'"  1  
ATOM 288   O "O4'"  . DC  A 1 10 ? 12.681  4.065   -2.540  1.00 0.00 ? 78 DC  A "O4'"  1  
ATOM 289   C "C3'"  . DC  A 1 10 ? 14.303  5.731   -2.070  1.00 0.00 ? 78 DC  A "C3'"  1  
ATOM 290   O "O3'"  . DC  A 1 10 ? 15.163  6.328   -2.964  1.00 0.00 ? 78 DC  A "O3'"  1  
ATOM 291   C "C2'"  . DC  A 1 10 ? 12.905  6.371   -1.896  1.00 0.00 ? 78 DC  A "C2'"  1  
ATOM 292   C "C1'"  . DC  A 1 10 ? 12.006  5.314   -2.617  1.00 0.00 ? 78 DC  A "C1'"  1  
ATOM 293   N N1     . DC  A 1 10 ? 10.642  5.137   -1.884  1.00 0.00 ? 78 DC  A N1     1  
ATOM 294   C C2     . DC  A 1 10 ? 9.489   5.404   -2.593  1.00 0.00 ? 78 DC  A C2     1  
ATOM 295   O O2     . DC  A 1 10 ? 9.591   5.575   -3.797  1.00 0.00 ? 78 DC  A O2     1  
ATOM 296   N N3     . DC  A 1 10 ? 8.283   5.390   -1.974  1.00 0.00 ? 78 DC  A N3     1  
ATOM 297   C C4     . DC  A 1 10 ? 8.248   5.046   -0.690  1.00 0.00 ? 78 DC  A C4     1  
ATOM 298   N N4     . DC  A 1 10 ? 7.111   5.155   -0.074  1.00 0.00 ? 78 DC  A N4     1  
ATOM 299   C C5     . DC  A 1 10 ? 9.433   4.674   0.105   1.00 0.00 ? 78 DC  A C5     1  
ATOM 300   C C6     . DC  A 1 10 ? 10.603  4.701   -0.552  1.00 0.00 ? 78 DC  A C6     1  
ATOM 301   H "H5'"  . DC  A 1 10 ? 14.288  2.169   -1.741  1.00 0.00 ? 78 DC  A "H5'"  1  
ATOM 302   H "H5''" . DC  A 1 10 ? 15.562  3.106   -1.106  1.00 0.00 ? 78 DC  A "H5''" 1  
ATOM 303   H "H4'"  . DC  A 1 10 ? 14.684  4.006   -3.173  1.00 0.00 ? 78 DC  A "H4'"  1  
ATOM 304   H "H3'"  . DC  A 1 10 ? 14.825  5.820   -1.117  1.00 0.00 ? 78 DC  A "H3'"  1  
ATOM 305   H "H2'"  . DC  A 1 10 ? 12.591  6.559   -0.869  1.00 0.00 ? 78 DC  A "H2'"  1  
ATOM 306   H "H2''" . DC  A 1 10 ? 12.858  7.319   -2.432  1.00 0.00 ? 78 DC  A "H2''" 1  
ATOM 307   H "H1'"  . DC  A 1 10 ? 11.933  5.626   -3.660  1.00 0.00 ? 78 DC  A "H1'"  1  
ATOM 308   H H41    . DC  A 1 10 ? 7.035   4.968   0.915   1.00 0.00 ? 78 DC  A H41    1  
ATOM 309   H H42    . DC  A 1 10 ? 6.346   5.408   -0.683  1.00 0.00 ? 78 DC  A H42    1  
ATOM 310   H H5     . DC  A 1 10 ? 9.360   4.520   1.172   1.00 0.00 ? 78 DC  A H5     1  
ATOM 311   H H6     . DC  A 1 10 ? 11.529  4.542   -0.020  1.00 0.00 ? 78 DC  A H6     1  
ATOM 312   P P      . DC  A 1 11 ? 15.573  7.877   -2.979  1.00 0.00 ? 79 DC  A P      1  
ATOM 313   O OP1    . DC  A 1 11 ? 16.905  8.062   -3.591  1.00 0.00 ? 79 DC  A OP1    1  
ATOM 314   O OP2    . DC  A 1 11 ? 15.465  8.366   -1.612  1.00 0.00 ? 79 DC  A OP2    1  
ATOM 315   O "O5'"  . DC  A 1 11 ? 14.471  8.629   -3.850  1.00 0.00 ? 79 DC  A "O5'"  1  
ATOM 316   C "C5'"  . DC  A 1 11 ? 14.255  8.290   -5.185  1.00 0.00 ? 79 DC  A "C5'"  1  
ATOM 317   C "C4'"  . DC  A 1 11 ? 13.080  9.068   -5.768  1.00 0.00 ? 79 DC  A "C4'"  1  
ATOM 318   O "O4'"  . DC  A 1 11 ? 11.792  8.686   -5.267  1.00 0.00 ? 79 DC  A "O4'"  1  
ATOM 319   C "C3'"  . DC  A 1 11 ? 13.047  10.616  -5.672  1.00 0.00 ? 79 DC  A "C3'"  1  
ATOM 320   O "O3'"  . DC  A 1 11 ? 12.775  11.180  -6.974  1.00 0.00 ? 79 DC  A "O3'"  1  
ATOM 321   C "C2'"  . DC  A 1 11 ? 12.047  10.837  -4.484  1.00 0.00 ? 79 DC  A "C2'"  1  
ATOM 322   C "C1'"  . DC  A 1 11 ? 11.012  9.764   -4.900  1.00 0.00 ? 79 DC  A "C1'"  1  
ATOM 323   N N1     . DC  A 1 11 ? 10.017  9.382   -3.854  1.00 0.00 ? 79 DC  A N1     1  
ATOM 324   C C2     . DC  A 1 11 ? 8.657   9.613   -4.141  1.00 0.00 ? 79 DC  A C2     1  
ATOM 325   O O2     . DC  A 1 11 ? 8.288   10.145  -5.186  1.00 0.00 ? 79 DC  A O2     1  
ATOM 326   N N3     . DC  A 1 11 ? 7.781   9.303   -3.143  1.00 0.00 ? 79 DC  A N3     1  
ATOM 327   C C4     . DC  A 1 11 ? 8.158   8.725   -1.986  1.00 0.00 ? 79 DC  A C4     1  
ATOM 328   N N4     . DC  A 1 11 ? 7.240   8.250   -1.212  1.00 0.00 ? 79 DC  A N4     1  
ATOM 329   C C5     . DC  A 1 11 ? 9.509   8.459   -1.751  1.00 0.00 ? 79 DC  A C5     1  
ATOM 330   C C6     . DC  A 1 11 ? 10.382  8.872   -2.639  1.00 0.00 ? 79 DC  A C6     1  
ATOM 331   H "H5'"  . DC  A 1 11 ? 14.114  7.219   -5.325  1.00 0.00 ? 79 DC  A "H5'"  1  
ATOM 332   H "H5''" . DC  A 1 11 ? 15.160  8.674   -5.658  1.00 0.00 ? 79 DC  A "H5''" 1  
ATOM 333   H "H4'"  . DC  A 1 11 ? 13.044  8.763   -6.814  1.00 0.00 ? 79 DC  A "H4'"  1  
ATOM 334   H "H3'"  . DC  A 1 11 ? 14.040  10.917  -5.336  1.00 0.00 ? 79 DC  A "H3'"  1  
ATOM 335   H "H2'"  . DC  A 1 11 ? 12.477  10.587  -3.515  1.00 0.00 ? 79 DC  A "H2'"  1  
ATOM 336   H "H2''" . DC  A 1 11 ? 11.643  11.850  -4.501  1.00 0.00 ? 79 DC  A "H2''" 1  
ATOM 337   H "H1'"  . DC  A 1 11 ? 10.483  10.222  -5.737  1.00 0.00 ? 79 DC  A "H1'"  1  
ATOM 338   H H41    . DC  A 1 11 ? 7.560   7.784   -0.375  1.00 0.00 ? 79 DC  A H41    1  
ATOM 339   H H42    . DC  A 1 11 ? 6.346   8.677   -1.407  1.00 0.00 ? 79 DC  A H42    1  
ATOM 340   H H5     . DC  A 1 11 ? 9.820   7.960   -0.845  1.00 0.00 ? 79 DC  A H5     1  
ATOM 341   H H6     . DC  A 1 11 ? 11.434  8.658   -2.511  1.00 0.00 ? 79 DC  A H6     1  
ATOM 342   P P      . DC  A 1 12 ? 12.756  12.714  -7.348  1.00 0.00 ? 80 DC  A P      1  
ATOM 343   O OP1    . DC  A 1 12 ? 13.200  12.701  -8.779  1.00 0.00 ? 80 DC  A OP1    1  
ATOM 344   O OP2    . DC  A 1 12 ? 13.510  13.513  -6.339  1.00 0.00 ? 80 DC  A OP2    1  
ATOM 345   O "O5'"  . DC  A 1 12 ? 11.220  13.158  -7.258  1.00 0.00 ? 80 DC  A "O5'"  1  
ATOM 346   C "C5'"  . DC  A 1 12 ? 10.300  12.738  -8.235  1.00 0.00 ? 80 DC  A "C5'"  1  
ATOM 347   C "C4'"  . DC  A 1 12 ? 9.009   13.621  -8.302  1.00 0.00 ? 80 DC  A "C4'"  1  
ATOM 348   O "O4'"  . DC  A 1 12 ? 8.207   13.257  -7.194  1.00 0.00 ? 80 DC  A "O4'"  1  
ATOM 349   C "C3'"  . DC  A 1 12 ? 9.342   15.148  -8.230  1.00 0.00 ? 80 DC  A "C3'"  1  
ATOM 350   O "O3'"  . DC  A 1 12 ? 8.426   15.739  -9.116  1.00 0.00 ? 80 DC  A "O3'"  1  
ATOM 351   C "C2'"  . DC  A 1 12 ? 9.150   15.376  -6.785  1.00 0.00 ? 80 DC  A "C2'"  1  
ATOM 352   C "C1'"  . DC  A 1 12 ? 8.046   14.423  -6.343  1.00 0.00 ? 80 DC  A "C1'"  1  
ATOM 353   N N1     . DC  A 1 12 ? 8.096   13.936  -4.862  1.00 0.00 ? 80 DC  A N1     1  
ATOM 354   C C2     . DC  A 1 12 ? 6.862   13.694  -4.221  1.00 0.00 ? 80 DC  A C2     1  
ATOM 355   O O2     . DC  A 1 12 ? 5.808   14.126  -4.689  1.00 0.00 ? 80 DC  A O2     1  
ATOM 356   N N3     . DC  A 1 12 ? 6.868   13.221  -2.990  1.00 0.00 ? 80 DC  A N3     1  
ATOM 357   C C4     . DC  A 1 12 ? 7.952   12.901  -2.393  1.00 0.00 ? 80 DC  A C4     1  
ATOM 358   N N4     . DC  A 1 12 ? 7.780   12.396  -1.209  1.00 0.00 ? 80 DC  A N4     1  
ATOM 359   C C5     . DC  A 1 12 ? 9.218   13.061  -2.992  1.00 0.00 ? 80 DC  A C5     1  
ATOM 360   C C6     . DC  A 1 12 ? 9.262   13.515  -4.269  1.00 0.00 ? 80 DC  A C6     1  
ATOM 361   H "H5'"  . DC  A 1 12 ? 9.966   11.724  -8.011  1.00 0.00 ? 80 DC  A "H5'"  1  
ATOM 362   H "H5''" . DC  A 1 12 ? 10.810  12.804  -9.196  1.00 0.00 ? 80 DC  A "H5''" 1  
ATOM 363   H "H4'"  . DC  A 1 12 ? 8.475   13.476  -9.241  1.00 0.00 ? 80 DC  A "H4'"  1  
ATOM 364   H "H3'"  . DC  A 1 12 ? 10.368  15.401  -8.496  1.00 0.00 ? 80 DC  A "H3'"  1  
ATOM 365   H "H2'"  . DC  A 1 12 ? 10.068  15.150  -6.242  1.00 0.00 ? 80 DC  A "H2'"  1  
ATOM 366   H "H2''" . DC  A 1 12 ? 8.848   16.410  -6.616  1.00 0.00 ? 80 DC  A "H2''" 1  
ATOM 367   H "H1'"  . DC  A 1 12 ? 7.109   14.969  -6.447  1.00 0.00 ? 80 DC  A "H1'"  1  
ATOM 368   H H41    . DC  A 1 12 ? 8.537   12.208  -0.569  1.00 0.00 ? 80 DC  A H41    1  
ATOM 369   H H42    . DC  A 1 12 ? 6.866   12.293  -0.792  1.00 0.00 ? 80 DC  A H42    1  
ATOM 370   H H5     . DC  A 1 12 ? 10.172  12.787  -2.564  1.00 0.00 ? 80 DC  A H5     1  
ATOM 371   H H6     . DC  A 1 12 ? 10.178  13.731  -4.800  1.00 0.00 ? 80 DC  A H6     1  
ATOM 372   P P      . DG  A 1 13 ? 8.567   17.271  -9.710  1.00 0.00 ? 81 DG  A P      1  
ATOM 373   O OP1    . DG  A 1 13 ? 7.805   17.501  -10.959 1.00 0.00 ? 81 DG  A OP1    1  
ATOM 374   O OP2    . DG  A 1 13 ? 9.995   17.677  -9.595  1.00 0.00 ? 81 DG  A OP2    1  
ATOM 375   O "O5'"  . DG  A 1 13 ? 7.773   18.028  -8.512  1.00 0.00 ? 81 DG  A "O5'"  1  
ATOM 376   C "C5'"  . DG  A 1 13 ? 6.341   18.001  -8.460  1.00 0.00 ? 81 DG  A "C5'"  1  
ATOM 377   C "C4'"  . DG  A 1 13 ? 5.794   18.541  -7.140  1.00 0.00 ? 81 DG  A "C4'"  1  
ATOM 378   O "O4'"  . DG  A 1 13 ? 6.112   17.575  -6.126  1.00 0.00 ? 81 DG  A "O4'"  1  
ATOM 379   C "C3'"  . DG  A 1 13 ? 6.512   19.883  -6.763  1.00 0.00 ? 81 DG  A "C3'"  1  
ATOM 380   O "O3'"  . DG  A 1 13 ? 5.568   20.904  -6.415  1.00 0.00 ? 81 DG  A "O3'"  1  
ATOM 381   C "C2'"  . DG  A 1 13 ? 7.373   19.409  -5.611  1.00 0.00 ? 81 DG  A "C2'"  1  
ATOM 382   C "C1'"  . DG  A 1 13 ? 6.400   18.379  -5.064  1.00 0.00 ? 81 DG  A "C1'"  1  
ATOM 383   N N9     . DG  A 1 13 ? 6.997   17.567  -4.011  1.00 0.00 ? 81 DG  A N9     1  
ATOM 384   C C8     . DG  A 1 13 ? 8.297   17.403  -3.773  1.00 0.00 ? 81 DG  A C8     1  
ATOM 385   N N7     . DG  A 1 13 ? 8.570   16.678  -2.703  1.00 0.00 ? 81 DG  A N7     1  
ATOM 386   C C5     . DG  A 1 13 ? 7.288   16.392  -2.207  1.00 0.00 ? 81 DG  A C5     1  
ATOM 387   C C6     . DG  A 1 13 ? 6.924   15.877  -0.923  1.00 0.00 ? 81 DG  A C6     1  
ATOM 388   O O6     . DG  A 1 13 ? 7.691   15.339  -0.098  1.00 0.00 ? 81 DG  A O6     1  
ATOM 389   N N1     . DG  A 1 13 ? 5.600   16.067  -0.597  1.00 0.00 ? 81 DG  A N1     1  
ATOM 390   C C2     . DG  A 1 13 ? 4.683   16.589  -1.504  1.00 0.00 ? 81 DG  A C2     1  
ATOM 391   N N2     . DG  A 1 13 ? 3.456   16.522  -1.109  1.00 0.00 ? 81 DG  A N2     1  
ATOM 392   N N3     . DG  A 1 13 ? 5.045   17.078  -2.684  1.00 0.00 ? 81 DG  A N3     1  
ATOM 393   C C4     . DG  A 1 13 ? 6.313   16.930  -2.976  1.00 0.00 ? 81 DG  A C4     1  
ATOM 394   H "H5'"  . DG  A 1 13 ? 5.870   17.032  -8.632  1.00 0.00 ? 81 DG  A "H5'"  1  
ATOM 395   H "H5''" . DG  A 1 13 ? 6.025   18.655  -9.272  1.00 0.00 ? 81 DG  A "H5''" 1  
ATOM 396   H "H4'"  . DG  A 1 13 ? 4.709   18.585  -7.035  1.00 0.00 ? 81 DG  A "H4'"  1  
ATOM 397   H "H3'"  . DG  A 1 13 ? 7.156   20.169  -7.597  1.00 0.00 ? 81 DG  A "H3'"  1  
ATOM 398   H "HO3'" . DG  A 1 13 ? 5.409   21.397  -7.222  1.00 0.00 ? 81 DG  A "HO3'" 1  
ATOM 399   H "H2'"  . DG  A 1 13 ? 8.318   18.989  -5.954  1.00 0.00 ? 81 DG  A "H2'"  1  
ATOM 400   H "H2''" . DG  A 1 13 ? 7.546   20.168  -4.849  1.00 0.00 ? 81 DG  A "H2''" 1  
ATOM 401   H "H1'"  . DG  A 1 13 ? 5.452   18.760  -4.682  1.00 0.00 ? 81 DG  A "H1'"  1  
ATOM 402   H H8     . DG  A 1 13 ? 8.993   17.776  -4.508  1.00 0.00 ? 81 DG  A H8     1  
ATOM 403   H H1     . DG  A 1 13 ? 5.301   15.665  0.280   1.00 0.00 ? 81 DG  A H1     1  
ATOM 404   H H21    . DG  A 1 13 ? 2.732   16.973  -1.650  1.00 0.00 ? 81 DG  A H21    1  
ATOM 405   H H22    . DG  A 1 13 ? 3.271   16.181  -0.176  1.00 0.00 ? 81 DG  A H22    1  
ATOM 406   O "O5'"  . DC  B 2 1  ? 1.673   14.269  7.715   1.00 0.00 ? 82 DC  B "O5'"  1  
ATOM 407   C "C5'"  . DC  B 2 1  ? 0.751   14.943  6.834   1.00 0.00 ? 82 DC  B "C5'"  1  
ATOM 408   C "C4'"  . DC  B 2 1  ? 0.618   14.209  5.458   1.00 0.00 ? 82 DC  B "C4'"  1  
ATOM 409   O "O4'"  . DC  B 2 1  ? 1.785   14.602  4.758   1.00 0.00 ? 82 DC  B "O4'"  1  
ATOM 410   C "C3'"  . DC  B 2 1  ? 0.397   12.719  5.315   1.00 0.00 ? 82 DC  B "C3'"  1  
ATOM 411   O "O3'"  . DC  B 2 1  ? -0.942  12.421  5.057   1.00 0.00 ? 82 DC  B "O3'"  1  
ATOM 412   C "C2'"  . DC  B 2 1  ? 1.284   12.439  4.040   1.00 0.00 ? 82 DC  B "C2'"  1  
ATOM 413   C "C1'"  . DC  B 2 1  ? 1.870   13.765  3.606   1.00 0.00 ? 82 DC  B "C1'"  1  
ATOM 414   N N1     . DC  B 2 1  ? 3.319   13.689  3.240   1.00 0.00 ? 82 DC  B N1     1  
ATOM 415   C C2     . DC  B 2 1  ? 3.835   14.472  2.148   1.00 0.00 ? 82 DC  B C2     1  
ATOM 416   O O2     . DC  B 2 1  ? 3.183   15.302  1.520   1.00 0.00 ? 82 DC  B O2     1  
ATOM 417   N N3     . DC  B 2 1  ? 5.110   14.442  1.756   1.00 0.00 ? 82 DC  B N3     1  
ATOM 418   C C4     . DC  B 2 1  ? 5.909   13.711  2.472   1.00 0.00 ? 82 DC  B C4     1  
ATOM 419   N N4     . DC  B 2 1  ? 7.167   13.622  2.054   1.00 0.00 ? 82 DC  B N4     1  
ATOM 420   C C5     . DC  B 2 1  ? 5.567   13.057  3.662   1.00 0.00 ? 82 DC  B C5     1  
ATOM 421   C C6     . DC  B 2 1  ? 4.235   13.016  4.003   1.00 0.00 ? 82 DC  B C6     1  
ATOM 422   H "H5'"  . DC  B 2 1  ? 1.087   15.972  6.699   1.00 0.00 ? 82 DC  B "H5'"  1  
ATOM 423   H "H5''" . DC  B 2 1  ? -0.238  15.071  7.273   1.00 0.00 ? 82 DC  B "H5''" 1  
ATOM 424   H "H4'"  . DC  B 2 1  ? -0.198  14.682  4.912   1.00 0.00 ? 82 DC  B "H4'"  1  
ATOM 425   H "H3'"  . DC  B 2 1  ? 0.791   12.164  6.167   1.00 0.00 ? 82 DC  B "H3'"  1  
ATOM 426   H "H2'"  . DC  B 2 1  ? 2.083   11.734  4.270   1.00 0.00 ? 82 DC  B "H2'"  1  
ATOM 427   H "H2''" . DC  B 2 1  ? 0.695   11.995  3.236   1.00 0.00 ? 82 DC  B "H2''" 1  
ATOM 428   H "H1'"  . DC  B 2 1  ? 1.421   14.108  2.673   1.00 0.00 ? 82 DC  B "H1'"  1  
ATOM 429   H H41    . DC  B 2 1  ? 7.788   12.900  2.390   1.00 0.00 ? 82 DC  B H41    1  
ATOM 430   H H42    . DC  B 2 1  ? 7.357   14.095  1.183   1.00 0.00 ? 82 DC  B H42    1  
ATOM 431   H H5     . DC  B 2 1  ? 6.232   12.536  4.333   1.00 0.00 ? 82 DC  B H5     1  
ATOM 432   H H6     . DC  B 2 1  ? 3.889   12.511  4.892   1.00 0.00 ? 82 DC  B H6     1  
ATOM 433   H "HO5'" . DC  B 2 1  ? 2.583   14.303  7.412   1.00 0.00 ? 82 DC  B "HO5'" 1  
ATOM 434   P P      . DG  B 2 2  ? -1.666  11.007  4.739   1.00 0.00 ? 83 DG  B P      1  
ATOM 435   O OP1    . DG  B 2 2  ? -2.966  11.023  5.413   1.00 0.00 ? 83 DG  B OP1    1  
ATOM 436   O OP2    . DG  B 2 2  ? -0.620  10.015  5.168   1.00 0.00 ? 83 DG  B OP2    1  
ATOM 437   O "O5'"  . DG  B 2 2  ? -1.865  10.983  3.171   1.00 0.00 ? 83 DG  B "O5'"  1  
ATOM 438   C "C5'"  . DG  B 2 2  ? -2.751  11.903  2.595   1.00 0.00 ? 83 DG  B "C5'"  1  
ATOM 439   C "C4'"  . DG  B 2 2  ? -2.450  12.045  1.039   1.00 0.00 ? 83 DG  B "C4'"  1  
ATOM 440   O "O4'"  . DG  B 2 2  ? -1.114  12.374  0.758   1.00 0.00 ? 83 DG  B "O4'"  1  
ATOM 441   C "C3'"  . DG  B 2 2  ? -2.760  10.819  0.182   1.00 0.00 ? 83 DG  B "C3'"  1  
ATOM 442   O "O3'"  . DG  B 2 2  ? -3.209  11.300  -1.080  1.00 0.00 ? 83 DG  B "O3'"  1  
ATOM 443   C "C2'"  . DG  B 2 2  ? -1.351  10.182  0.148   1.00 0.00 ? 83 DG  B "C2'"  1  
ATOM 444   C "C1'"  . DG  B 2 2  ? -0.517  11.457  -0.090  1.00 0.00 ? 83 DG  B "C1'"  1  
ATOM 445   N N9     . DG  B 2 2  ? 0.925   11.309  0.138   1.00 0.00 ? 83 DG  B N9     1  
ATOM 446   C C8     . DG  B 2 2  ? 1.459   10.539  1.099   1.00 0.00 ? 83 DG  B C8     1  
ATOM 447   N N7     . DG  B 2 2  ? 2.762   10.637  1.248   1.00 0.00 ? 83 DG  B N7     1  
ATOM 448   C C5     . DG  B 2 2  ? 3.140   11.365  0.119   1.00 0.00 ? 83 DG  B C5     1  
ATOM 449   C C6     . DG  B 2 2  ? 4.503   11.739  -0.281  1.00 0.00 ? 83 DG  B C6     1  
ATOM 450   O O6     . DG  B 2 2  ? 5.530   11.370  0.252   1.00 0.00 ? 83 DG  B O6     1  
ATOM 451   N N1     . DG  B 2 2  ? 4.435   12.528  -1.396  1.00 0.00 ? 83 DG  B N1     1  
ATOM 452   C C2     . DG  B 2 2  ? 3.287   12.953  -2.007  1.00 0.00 ? 83 DG  B C2     1  
ATOM 453   N N2     . DG  B 2 2  ? 3.476   13.753  -2.992  1.00 0.00 ? 83 DG  B N2     1  
ATOM 454   N N3     . DG  B 2 2  ? 2.013   12.618  -1.664  1.00 0.00 ? 83 DG  B N3     1  
ATOM 455   C C4     . DG  B 2 2  ? 2.037   11.826  -0.564  1.00 0.00 ? 83 DG  B C4     1  
ATOM 456   H "H5'"  . DG  B 2 2  ? -2.676  12.930  2.956   1.00 0.00 ? 83 DG  B "H5'"  1  
ATOM 457   H "H5''" . DG  B 2 2  ? -3.742  11.514  2.831   1.00 0.00 ? 83 DG  B "H5''" 1  
ATOM 458   H "H4'"  . DG  B 2 2  ? -3.075  12.884  0.734   1.00 0.00 ? 83 DG  B "H4'"  1  
ATOM 459   H "H3'"  . DG  B 2 2  ? -3.565  10.237  0.631   1.00 0.00 ? 83 DG  B "H3'"  1  
ATOM 460   H "H2'"  . DG  B 2 2  ? -1.053  9.790   1.120   1.00 0.00 ? 83 DG  B "H2'"  1  
ATOM 461   H "H2''" . DG  B 2 2  ? -1.241  9.399   -0.603  1.00 0.00 ? 83 DG  B "H2''" 1  
ATOM 462   H "H1'"  . DG  B 2 2  ? -0.665  11.791  -1.117  1.00 0.00 ? 83 DG  B "H1'"  1  
ATOM 463   H H8     . DG  B 2 2  ? 0.764   10.177  1.843   1.00 0.00 ? 83 DG  B H8     1  
ATOM 464   H H1     . DG  B 2 2  ? 5.316   12.826  -1.792  1.00 0.00 ? 83 DG  B H1     1  
ATOM 465   H H21    . DG  B 2 2  ? 2.680   14.206  -3.419  1.00 0.00 ? 83 DG  B H21    1  
ATOM 466   H H22    . DG  B 2 2  ? 4.359   13.723  -3.480  1.00 0.00 ? 83 DG  B H22    1  
ATOM 467   P P      . DG  B 2 3  ? -3.850  10.373  -2.186  1.00 0.00 ? 84 DG  B P      1  
ATOM 468   O OP1    . DG  B 2 3  ? -5.246  10.827  -2.378  1.00 0.00 ? 84 DG  B OP1    1  
ATOM 469   O OP2    . DG  B 2 3  ? -3.537  8.992   -1.803  1.00 0.00 ? 84 DG  B OP2    1  
ATOM 470   O "O5'"  . DG  B 2 3  ? -3.019  10.632  -3.615  1.00 0.00 ? 84 DG  B "O5'"  1  
ATOM 471   C "C5'"  . DG  B 2 3  ? -2.730  11.915  -4.088  1.00 0.00 ? 84 DG  B "C5'"  1  
ATOM 472   C "C4'"  . DG  B 2 3  ? -1.673  11.975  -5.247  1.00 0.00 ? 84 DG  B "C4'"  1  
ATOM 473   O "O4'"  . DG  B 2 3  ? -0.331  11.855  -4.666  1.00 0.00 ? 84 DG  B "O4'"  1  
ATOM 474   C "C3'"  . DG  B 2 3  ? -1.770  10.859  -6.305  1.00 0.00 ? 84 DG  B "C3'"  1  
ATOM 475   O "O3'"  . DG  B 2 3  ? -1.348  11.503  -7.459  1.00 0.00 ? 84 DG  B "O3'"  1  
ATOM 476   C "C2'"  . DG  B 2 3  ? -0.837  9.811   -5.733  1.00 0.00 ? 84 DG  B "C2'"  1  
ATOM 477   C "C1'"  . DG  B 2 3  ? 0.324   10.705  -5.247  1.00 0.00 ? 84 DG  B "C1'"  1  
ATOM 478   N N9     . DG  B 2 3  ? 1.083   10.046  -4.189  1.00 0.00 ? 84 DG  B N9     1  
ATOM 479   C C8     . DG  B 2 3  ? 0.566   9.476   -3.056  1.00 0.00 ? 84 DG  B C8     1  
ATOM 480   N N7     . DG  B 2 3  ? 1.472   9.133   -2.206  1.00 0.00 ? 84 DG  B N7     1  
ATOM 481   C C5     . DG  B 2 3  ? 2.699   9.490   -2.886  1.00 0.00 ? 84 DG  B C5     1  
ATOM 482   C C6     . DG  B 2 3  ? 4.084   9.345   -2.546  1.00 0.00 ? 84 DG  B C6     1  
ATOM 483   O O6     . DG  B 2 3  ? 4.552   8.800   -1.595  1.00 0.00 ? 84 DG  B O6     1  
ATOM 484   N N1     . DG  B 2 3  ? 4.931   9.839   -3.518  1.00 0.00 ? 84 DG  B N1     1  
ATOM 485   C C2     . DG  B 2 3  ? 4.565   10.296  -4.713  1.00 0.00 ? 84 DG  B C2     1  
ATOM 486   N N2     . DG  B 2 3  ? 5.452   10.783  -5.466  1.00 0.00 ? 84 DG  B N2     1  
ATOM 487   N N3     . DG  B 2 3  ? 3.323   10.486  -5.078  1.00 0.00 ? 84 DG  B N3     1  
ATOM 488   C C4     . DG  B 2 3  ? 2.411   9.978   -4.102  1.00 0.00 ? 84 DG  B C4     1  
ATOM 489   H "H5'"  . DG  B 2 3  ? -2.279  12.390  -3.217  1.00 0.00 ? 84 DG  B "H5'"  1  
ATOM 490   H "H5''" . DG  B 2 3  ? -3.663  12.381  -4.408  1.00 0.00 ? 84 DG  B "H5''" 1  
ATOM 491   H "H4'"  . DG  B 2 3  ? -1.775  12.919  -5.783  1.00 0.00 ? 84 DG  B "H4'"  1  
ATOM 492   H "H3'"  . DG  B 2 3  ? -2.799  10.504  -6.371  1.00 0.00 ? 84 DG  B "H3'"  1  
ATOM 493   H "H2'"  . DG  B 2 3  ? -1.349  9.339   -4.894  1.00 0.00 ? 84 DG  B "H2'"  1  
ATOM 494   H "H2''" . DG  B 2 3  ? -0.480  8.942   -6.287  1.00 0.00 ? 84 DG  B "H2''" 1  
ATOM 495   H "H1'"  . DG  B 2 3  ? 0.967   10.998  -6.077  1.00 0.00 ? 84 DG  B "H1'"  1  
ATOM 496   H H8     . DG  B 2 3  ? -0.499  9.493   -2.875  1.00 0.00 ? 84 DG  B H8     1  
ATOM 497   H H1     . DG  B 2 3  ? 5.921   9.755   -3.338  1.00 0.00 ? 84 DG  B H1     1  
ATOM 498   H H21    . DG  B 2 3  ? 5.145   11.098  -6.374  1.00 0.00 ? 84 DG  B H21    1  
ATOM 499   H H22    . DG  B 2 3  ? 6.428   10.525  -5.418  1.00 0.00 ? 84 DG  B H22    1  
ATOM 500   P P      . DG  B 2 4  ? -1.115  10.788  -8.871  1.00 0.00 ? 85 DG  B P      1  
ATOM 501   O OP1    . DG  B 2 4  ? -0.672  11.872  -9.808  1.00 0.00 ? 85 DG  B OP1    1  
ATOM 502   O OP2    . DG  B 2 4  ? -2.344  10.137  -9.289  1.00 0.00 ? 85 DG  B OP2    1  
ATOM 503   O "O5'"  . DG  B 2 4  ? 0.004   9.681   -8.699  1.00 0.00 ? 85 DG  B "O5'"  1  
ATOM 504   C "C5'"  . DG  B 2 4  ? 1.335   10.005  -9.010  1.00 0.00 ? 85 DG  B "C5'"  1  
ATOM 505   C "C4'"  . DG  B 2 4  ? 2.285   8.853   -8.786  1.00 0.00 ? 85 DG  B "C4'"  1  
ATOM 506   O "O4'"  . DG  B 2 4  ? 2.665   8.645   -7.430  1.00 0.00 ? 85 DG  B "O4'"  1  
ATOM 507   C "C3'"  . DG  B 2 4  ? 1.716   7.524   -9.280  1.00 0.00 ? 85 DG  B "C3'"  1  
ATOM 508   O "O3'"  . DG  B 2 4  ? 2.557   6.855   -10.192 1.00 0.00 ? 85 DG  B "O3'"  1  
ATOM 509   C "C2'"  . DG  B 2 4  ? 1.308   6.775   -7.915  1.00 0.00 ? 85 DG  B "C2'"  1  
ATOM 510   C "C1'"  . DG  B 2 4  ? 2.613   7.199   -7.188  1.00 0.00 ? 85 DG  B "C1'"  1  
ATOM 511   N N9     . DG  B 2 4  ? 2.791   6.788   -5.757  1.00 0.00 ? 85 DG  B N9     1  
ATOM 512   C C8     . DG  B 2 4  ? 1.858   6.456   -4.823  1.00 0.00 ? 85 DG  B C8     1  
ATOM 513   N N7     . DG  B 2 4  ? 2.354   6.123   -3.690  1.00 0.00 ? 85 DG  B N7     1  
ATOM 514   C C5     . DG  B 2 4  ? 3.723   6.107   -3.919  1.00 0.00 ? 85 DG  B C5     1  
ATOM 515   C C6     . DG  B 2 4  ? 4.812   5.987   -2.975  1.00 0.00 ? 85 DG  B C6     1  
ATOM 516   O O6     . DG  B 2 4  ? 4.769   5.803   -1.740  1.00 0.00 ? 85 DG  B O6     1  
ATOM 517   N N1     . DG  B 2 4  ? 6.029   6.107   -3.552  1.00 0.00 ? 85 DG  B N1     1  
ATOM 518   C C2     . DG  B 2 4  ? 6.176   6.514   -4.895  1.00 0.00 ? 85 DG  B C2     1  
ATOM 519   N N2     . DG  B 2 4  ? 7.425   6.410   -5.318  1.00 0.00 ? 85 DG  B N2     1  
ATOM 520   N N3     . DG  B 2 4  ? 5.244   6.767   -5.774  1.00 0.00 ? 85 DG  B N3     1  
ATOM 521   C C4     . DG  B 2 4  ? 4.010   6.564   -5.180  1.00 0.00 ? 85 DG  B C4     1  
ATOM 522   H "H5'"  . DG  B 2 4  ? 1.751   10.868  -8.491  1.00 0.00 ? 85 DG  B "H5'"  1  
ATOM 523   H "H5''" . DG  B 2 4  ? 1.466   10.232  -10.068 1.00 0.00 ? 85 DG  B "H5''" 1  
ATOM 524   H "H4'"  . DG  B 2 4  ? 3.125   9.097   -9.437  1.00 0.00 ? 85 DG  B "H4'"  1  
ATOM 525   H "H3'"  . DG  B 2 4  ? 0.757   7.721   -9.760  1.00 0.00 ? 85 DG  B "H3'"  1  
ATOM 526   H "H2'"  . DG  B 2 4  ? 0.522   7.240   -7.321  1.00 0.00 ? 85 DG  B "H2'"  1  
ATOM 527   H "H2''" . DG  B 2 4  ? 1.248   5.698   -8.074  1.00 0.00 ? 85 DG  B "H2''" 1  
ATOM 528   H "H1'"  . DG  B 2 4  ? 3.415   6.720   -7.749  1.00 0.00 ? 85 DG  B "H1'"  1  
ATOM 529   H H8     . DG  B 2 4  ? 0.812   6.565   -5.073  1.00 0.00 ? 85 DG  B H8     1  
ATOM 530   H H1     . DG  B 2 4  ? 6.855   6.026   -2.977  1.00 0.00 ? 85 DG  B H1     1  
ATOM 531   H H21    . DG  B 2 4  ? 7.541   6.980   -6.143  1.00 0.00 ? 85 DG  B H21    1  
ATOM 532   H H22    . DG  B 2 4  ? 8.119   5.780   -4.940  1.00 0.00 ? 85 DG  B H22    1  
ATOM 533   P P      . DG  B 2 5  ? 2.773   7.250   -11.667 1.00 0.00 ? 86 DG  B P      1  
ATOM 534   O OP1    . DG  B 2 5  ? 2.788   8.748   -11.726 1.00 0.00 ? 86 DG  B OP1    1  
ATOM 535   O OP2    . DG  B 2 5  ? 2.021   6.433   -12.644 1.00 0.00 ? 86 DG  B OP2    1  
ATOM 536   O "O5'"  . DG  B 2 5  ? 4.324   6.676   -11.875 1.00 0.00 ? 86 DG  B "O5'"  1  
ATOM 537   C "C5'"  . DG  B 2 5  ? 5.436   7.468   -11.805 1.00 0.00 ? 86 DG  B "C5'"  1  
ATOM 538   C "C4'"  . DG  B 2 5  ? 6.659   6.602   -11.831 1.00 0.00 ? 86 DG  B "C4'"  1  
ATOM 539   O "O4'"  . DG  B 2 5  ? 6.900   6.032   -10.614 1.00 0.00 ? 86 DG  B "O4'"  1  
ATOM 540   C "C3'"  . DG  B 2 5  ? 6.620   5.333   -12.718 1.00 0.00 ? 86 DG  B "C3'"  1  
ATOM 541   O "O3'"  . DG  B 2 5  ? 7.987   5.237   -13.313 1.00 0.00 ? 86 DG  B "O3'"  1  
ATOM 542   C "C2'"  . DG  B 2 5  ? 6.109   4.088   -11.925 1.00 0.00 ? 86 DG  B "C2'"  1  
ATOM 543   C "C1'"  . DG  B 2 5  ? 6.653   4.656   -10.581 1.00 0.00 ? 86 DG  B "C1'"  1  
ATOM 544   N N9     . DG  B 2 5  ? 5.784   4.310   -9.462  1.00 0.00 ? 86 DG  B N9     1  
ATOM 545   C C8     . DG  B 2 5  ? 4.463   4.531   -9.340  1.00 0.00 ? 86 DG  B C8     1  
ATOM 546   N N7     . DG  B 2 5  ? 4.032   4.136   -8.185  1.00 0.00 ? 86 DG  B N7     1  
ATOM 547   C C5     . DG  B 2 5  ? 5.144   3.804   -7.463  1.00 0.00 ? 86 DG  B C5     1  
ATOM 548   C C6     . DG  B 2 5  ? 5.368   3.401   -6.080  1.00 0.00 ? 86 DG  B C6     1  
ATOM 549   O O6     . DG  B 2 5  ? 4.535   3.288   -5.166  1.00 0.00 ? 86 DG  B O6     1  
ATOM 550   N N1     . DG  B 2 5  ? 6.663   3.002   -5.821  1.00 0.00 ? 86 DG  B N1     1  
ATOM 551   C C2     . DG  B 2 5  ? 7.701   3.198   -6.627  1.00 0.00 ? 86 DG  B C2     1  
ATOM 552   N N2     . DG  B 2 5  ? 8.865   2.705   -6.213  1.00 0.00 ? 86 DG  B N2     1  
ATOM 553   N N3     . DG  B 2 5  ? 7.567   3.598   -7.915  1.00 0.00 ? 86 DG  B N3     1  
ATOM 554   C C4     . DG  B 2 5  ? 6.271   3.884   -8.225  1.00 0.00 ? 86 DG  B C4     1  
ATOM 555   H "H5'"  . DG  B 2 5  ? 5.400   8.035   -10.874 1.00 0.00 ? 86 DG  B "H5'"  1  
ATOM 556   H "H5''" . DG  B 2 5  ? 5.432   8.187   -12.624 1.00 0.00 ? 86 DG  B "H5''" 1  
ATOM 557   H "H4'"  . DG  B 2 5  ? 7.529   7.183   -12.140 1.00 0.00 ? 86 DG  B "H4'"  1  
ATOM 558   H "H3'"  . DG  B 2 5  ? 6.017   5.391   -13.623 1.00 0.00 ? 86 DG  B "H3'"  1  
ATOM 559   H "H2'"  . DG  B 2 5  ? 5.028   4.047   -12.060 1.00 0.00 ? 86 DG  B "H2'"  1  
ATOM 560   H "H2''" . DG  B 2 5  ? 6.644   3.180   -12.205 1.00 0.00 ? 86 DG  B "H2''" 1  
ATOM 561   H "H1'"  . DG  B 2 5  ? 7.592   4.145   -10.366 1.00 0.00 ? 86 DG  B "H1'"  1  
ATOM 562   H H8     . DG  B 2 5  ? 3.863   4.871   -10.171 1.00 0.00 ? 86 DG  B H8     1  
ATOM 563   H H1     . DG  B 2 5  ? 6.852   2.649   -4.895  1.00 0.00 ? 86 DG  B H1     1  
ATOM 564   H H21    . DG  B 2 5  ? 9.711   2.907   -6.724  1.00 0.00 ? 86 DG  B H21    1  
ATOM 565   H H22    . DG  B 2 5  ? 8.971   2.464   -5.238  1.00 0.00 ? 86 DG  B H22    1  
ATOM 566   P P      . DA  B 2 6  ? 8.362   4.102   -14.402 1.00 0.00 ? 87 DA  B P      1  
ATOM 567   O OP1    . DA  B 2 6  ? 9.631   4.437   -15.075 1.00 0.00 ? 87 DA  B OP1    1  
ATOM 568   O OP2    . DA  B 2 6  ? 7.184   3.809   -15.203 1.00 0.00 ? 87 DA  B OP2    1  
ATOM 569   O "O5'"  . DA  B 2 6  ? 8.703   2.824   -13.505 1.00 0.00 ? 87 DA  B "O5'"  1  
ATOM 570   C "C5'"  . DA  B 2 6  ? 9.777   2.860   -12.601 1.00 0.00 ? 87 DA  B "C5'"  1  
ATOM 571   C "C4'"  . DA  B 2 6  ? 9.963   1.612   -11.747 1.00 0.00 ? 87 DA  B "C4'"  1  
ATOM 572   O "O4'"  . DA  B 2 6  ? 8.989   1.607   -10.666 1.00 0.00 ? 87 DA  B "O4'"  1  
ATOM 573   C "C3'"  . DA  B 2 6  ? 9.797   0.237   -12.441 1.00 0.00 ? 87 DA  B "C3'"  1  
ATOM 574   O "O3'"  . DA  B 2 6  ? 10.894  -0.541  -12.029 1.00 0.00 ? 87 DA  B "O3'"  1  
ATOM 575   C "C2'"  . DA  B 2 6  ? 8.343   -0.134  -12.053 1.00 0.00 ? 87 DA  B "C2'"  1  
ATOM 576   C "C1'"  . DA  B 2 6  ? 8.384   0.344   -10.550 1.00 0.00 ? 87 DA  B "C1'"  1  
ATOM 577   N N9     . DA  B 2 6  ? 6.952   0.455   -9.919  1.00 0.00 ? 87 DA  B N9     1  
ATOM 578   C C8     . DA  B 2 6  ? 5.753   0.766   -10.531 1.00 0.00 ? 87 DA  B C8     1  
ATOM 579   N N7     . DA  B 2 6  ? 4.692   0.801   -9.777  1.00 0.00 ? 87 DA  B N7     1  
ATOM 580   C C5     . DA  B 2 6  ? 5.291   0.466   -8.540  1.00 0.00 ? 87 DA  B C5     1  
ATOM 581   C C6     . DA  B 2 6  ? 4.793   0.281   -7.231  1.00 0.00 ? 87 DA  B C6     1  
ATOM 582   N N6     . DA  B 2 6  ? 3.477   0.417   -6.895  1.00 0.00 ? 87 DA  B N6     1  
ATOM 583   N N1     . DA  B 2 6  ? 5.573   -0.138  -6.272  1.00 0.00 ? 87 DA  B N1     1  
ATOM 584   C C2     . DA  B 2 6  ? 6.838   -0.415  -6.555  1.00 0.00 ? 87 DA  B C2     1  
ATOM 585   N N3     . DA  B 2 6  ? 7.509   -0.259  -7.664  1.00 0.00 ? 87 DA  B N3     1  
ATOM 586   C C4     . DA  B 2 6  ? 6.630   0.231   -8.647  1.00 0.00 ? 87 DA  B C4     1  
ATOM 587   H "H5'"  . DA  B 2 6  ? 9.696   3.724   -11.942 1.00 0.00 ? 87 DA  B "H5'"  1  
ATOM 588   H "H5''" . DA  B 2 6  ? 10.728  3.024   -13.110 1.00 0.00 ? 87 DA  B "H5''" 1  
ATOM 589   H "H4'"  . DA  B 2 6  ? 10.975  1.676   -11.345 1.00 0.00 ? 87 DA  B "H4'"  1  
ATOM 590   H "H3'"  . DA  B 2 6  ? 9.850   0.343   -13.525 1.00 0.00 ? 87 DA  B "H3'"  1  
ATOM 591   H "H2'"  . DA  B 2 6  ? 7.634   0.489   -12.597 1.00 0.00 ? 87 DA  B "H2'"  1  
ATOM 592   H "H2''" . DA  B 2 6  ? 8.203   -1.212  -12.130 1.00 0.00 ? 87 DA  B "H2''" 1  
ATOM 593   H "H1'"  . DA  B 2 6  ? 9.024   -0.426  -10.119 1.00 0.00 ? 87 DA  B "H1'"  1  
ATOM 594   H H8     . DA  B 2 6  ? 5.770   0.976   -11.591 1.00 0.00 ? 87 DA  B H8     1  
ATOM 595   H H61    . DA  B 2 6  ? 3.195   0.266   -5.937  1.00 0.00 ? 87 DA  B H61    1  
ATOM 596   H H62    . DA  B 2 6  ? 2.859   0.733   -7.628  1.00 0.00 ? 87 DA  B H62    1  
ATOM 597   H H2     . DA  B 2 6  ? 7.400   -0.811  -5.721  1.00 0.00 ? 87 DA  B H2     1  
ATOM 598   P P      . DT  B 2 7  ? 11.004  -2.120  -12.440 1.00 0.00 ? 88 DT  B P      1  
ATOM 599   O OP1    . DT  B 2 7  ? 12.431  -2.395  -12.702 1.00 0.00 ? 88 DT  B OP1    1  
ATOM 600   O OP2    . DT  B 2 7  ? 10.006  -2.414  -13.512 1.00 0.00 ? 88 DT  B OP2    1  
ATOM 601   O "O5'"  . DT  B 2 7  ? 10.649  -2.665  -10.973 1.00 0.00 ? 88 DT  B "O5'"  1  
ATOM 602   C "C5'"  . DT  B 2 7  ? 11.483  -2.538  -9.846  1.00 0.00 ? 88 DT  B "C5'"  1  
ATOM 603   C "C4'"  . DT  B 2 7  ? 10.900  -3.234  -8.615  1.00 0.00 ? 88 DT  B "C4'"  1  
ATOM 604   O "O4'"  . DT  B 2 7  ? 9.569   -2.876  -8.594  1.00 0.00 ? 88 DT  B "O4'"  1  
ATOM 605   C "C3'"  . DT  B 2 7  ? 10.969  -4.760  -8.697  1.00 0.00 ? 88 DT  B "C3'"  1  
ATOM 606   O "O3'"  . DT  B 2 7  ? 11.693  -5.088  -7.597  1.00 0.00 ? 88 DT  B "O3'"  1  
ATOM 607   C "C2'"  . DT  B 2 7  ? 9.441   -5.167  -8.605  1.00 0.00 ? 88 DT  B "C2'"  1  
ATOM 608   C "C1'"  . DT  B 2 7  ? 8.772   -3.942  -8.047  1.00 0.00 ? 88 DT  B "C1'"  1  
ATOM 609   N N1     . DT  B 2 7  ? 7.320   -3.810  -8.250  1.00 0.00 ? 88 DT  B N1     1  
ATOM 610   C C2     . DT  B 2 7  ? 6.459   -3.640  -7.169  1.00 0.00 ? 88 DT  B C2     1  
ATOM 611   O O2     . DT  B 2 7  ? 6.798   -3.691  -5.999  1.00 0.00 ? 88 DT  B O2     1  
ATOM 612   N N3     . DT  B 2 7  ? 5.167   -3.314  -7.447  1.00 0.00 ? 88 DT  B N3     1  
ATOM 613   C C4     . DT  B 2 7  ? 4.641   -3.144  -8.725  1.00 0.00 ? 88 DT  B C4     1  
ATOM 614   O O4     . DT  B 2 7  ? 3.466   -2.662  -8.863  1.00 0.00 ? 88 DT  B O4     1  
ATOM 615   C C5     . DT  B 2 7  ? 5.561   -3.403  -9.780  1.00 0.00 ? 88 DT  B C5     1  
ATOM 616   C C7     . DT  B 2 7  ? 5.206   -3.066  -11.232 1.00 0.00 ? 88 DT  B C7     1  
ATOM 617   C C6     . DT  B 2 7  ? 6.843   -3.762  -9.573  1.00 0.00 ? 88 DT  B C6     1  
ATOM 618   H "H5'"  . DT  B 2 7  ? 11.614  -1.484  -9.603  1.00 0.00 ? 88 DT  B "H5'"  1  
ATOM 619   H "H5''" . DT  B 2 7  ? 12.461  -2.986  -10.023 1.00 0.00 ? 88 DT  B "H5''" 1  
ATOM 620   H "H4'"  . DT  B 2 7  ? 11.368  -2.816  -7.724  1.00 0.00 ? 88 DT  B "H4'"  1  
ATOM 621   H "H3'"  . DT  B 2 7  ? 11.387  -5.076  -9.652  1.00 0.00 ? 88 DT  B "H3'"  1  
ATOM 622   H "H2'"  . DT  B 2 7  ? 9.036   -5.306  -9.607  1.00 0.00 ? 88 DT  B "H2'"  1  
ATOM 623   H "H2''" . DT  B 2 7  ? 9.240   -6.004  -7.937  1.00 0.00 ? 88 DT  B "H2''" 1  
ATOM 624   H "H1'"  . DT  B 2 7  ? 8.935   -4.020  -6.972  1.00 0.00 ? 88 DT  B "H1'"  1  
ATOM 625   H H3     . DT  B 2 7  ? 4.459   -3.287  -6.726  1.00 0.00 ? 88 DT  B H3     1  
ATOM 626   H H71    . DT  B 2 7  ? 5.919   -2.338  -11.620 1.00 0.00 ? 88 DT  B H71    1  
ATOM 627   H H72    . DT  B 2 7  ? 5.094   -3.964  -11.839 1.00 0.00 ? 88 DT  B H72    1  
ATOM 628   H H73    . DT  B 2 7  ? 4.208   -2.650  -11.091 1.00 0.00 ? 88 DT  B H73    1  
ATOM 629   H H6     . DT  B 2 7  ? 7.458   -3.908  -10.449 1.00 0.00 ? 88 DT  B H6     1  
ATOM 630   P P      . DT  B 2 8  ? 11.959  -6.695  -7.199  1.00 0.00 ? 89 DT  B P      1  
ATOM 631   O OP1    . DT  B 2 8  ? 13.195  -6.845  -6.372  1.00 0.00 ? 89 DT  B OP1    1  
ATOM 632   O OP2    . DT  B 2 8  ? 11.762  -7.613  -8.324  1.00 0.00 ? 89 DT  B OP2    1  
ATOM 633   O "O5'"  . DT  B 2 8  ? 10.777  -6.898  -6.051  1.00 0.00 ? 89 DT  B "O5'"  1  
ATOM 634   C "C5'"  . DT  B 2 8  ? 10.842  -5.987  -4.949  1.00 0.00 ? 89 DT  B "C5'"  1  
ATOM 635   C "C4'"  . DT  B 2 8  ? 9.904   -6.282  -3.826  1.00 0.00 ? 89 DT  B "C4'"  1  
ATOM 636   O "O4'"  . DT  B 2 8  ? 8.535   -5.990  -4.129  1.00 0.00 ? 89 DT  B "O4'"  1  
ATOM 637   C "C3'"  . DT  B 2 8  ? 10.024  -7.757  -3.376  1.00 0.00 ? 89 DT  B "C3'"  1  
ATOM 638   O "O3'"  . DT  B 2 8  ? 9.799   -7.811  -2.011  1.00 0.00 ? 89 DT  B "O3'"  1  
ATOM 639   C "C2'"  . DT  B 2 8  ? 8.790   -8.324  -4.120  1.00 0.00 ? 89 DT  B "C2'"  1  
ATOM 640   C "C1'"  . DT  B 2 8  ? 7.793   -7.194  -4.017  1.00 0.00 ? 89 DT  B "C1'"  1  
ATOM 641   N N1     . DT  B 2 8  ? 6.819   -7.084  -5.110  1.00 0.00 ? 89 DT  B N1     1  
ATOM 642   C C2     . DT  B 2 8  ? 5.489   -6.833  -4.776  1.00 0.00 ? 89 DT  B C2     1  
ATOM 643   O O2     . DT  B 2 8  ? 5.091   -6.666  -3.638  1.00 0.00 ? 89 DT  B O2     1  
ATOM 644   N N3     . DT  B 2 8  ? 4.680   -6.475  -5.803  1.00 0.00 ? 89 DT  B N3     1  
ATOM 645   C C4     . DT  B 2 8  ? 4.948   -6.587  -7.163  1.00 0.00 ? 89 DT  B C4     1  
ATOM 646   O O4     . DT  B 2 8  ? 4.119   -6.242  -7.986  1.00 0.00 ? 89 DT  B O4     1  
ATOM 647   C C5     . DT  B 2 8  ? 6.314   -7.124  -7.456  1.00 0.00 ? 89 DT  B C5     1  
ATOM 648   C C7     . DT  B 2 8  ? 6.727   -7.254  -8.911  1.00 0.00 ? 89 DT  B C7     1  
ATOM 649   C C6     . DT  B 2 8  ? 7.198   -7.367  -6.421  1.00 0.00 ? 89 DT  B C6     1  
ATOM 650   H "H5'"  . DT  B 2 8  ? 10.641  -4.982  -5.320  1.00 0.00 ? 89 DT  B "H5'"  1  
ATOM 651   H "H5''" . DT  B 2 8  ? 11.840  -5.927  -4.515  1.00 0.00 ? 89 DT  B "H5''" 1  
ATOM 652   H "H4'"  . DT  B 2 8  ? 10.233  -5.644  -3.006  1.00 0.00 ? 89 DT  B "H4'"  1  
ATOM 653   H "H3'"  . DT  B 2 8  ? 11.008  -8.141  -3.643  1.00 0.00 ? 89 DT  B "H3'"  1  
ATOM 654   H "H2'"  . DT  B 2 8  ? 9.087   -8.723  -5.090  1.00 0.00 ? 89 DT  B "H2'"  1  
ATOM 655   H "H2''" . DT  B 2 8  ? 8.516   -9.221  -3.564  1.00 0.00 ? 89 DT  B "H2''" 1  
ATOM 656   H "H1'"  . DT  B 2 8  ? 7.332   -7.152  -3.030  1.00 0.00 ? 89 DT  B "H1'"  1  
ATOM 657   H H3     . DT  B 2 8  ? 3.721   -6.247  -5.580  1.00 0.00 ? 89 DT  B H3     1  
ATOM 658   H H71    . DT  B 2 8  ? 7.727   -7.686  -8.963  1.00 0.00 ? 89 DT  B H71    1  
ATOM 659   H H72    . DT  B 2 8  ? 6.026   -7.950  -9.372  1.00 0.00 ? 89 DT  B H72    1  
ATOM 660   H H73    . DT  B 2 8  ? 6.575   -6.316  -9.446  1.00 0.00 ? 89 DT  B H73    1  
ATOM 661   H H6     . DT  B 2 8  ? 8.238   -7.501  -6.681  1.00 0.00 ? 89 DT  B H6     1  
ATOM 662   P P      . DA  B 2 9  ? 10.028  -9.106  -1.058  1.00 0.00 ? 90 DA  B P      1  
ATOM 663   O OP1    . DA  B 2 9  ? 10.590  -8.642  0.272   1.00 0.00 ? 90 DA  B OP1    1  
ATOM 664   O OP2    . DA  B 2 9  ? 10.796  -10.149 -1.780  1.00 0.00 ? 90 DA  B OP2    1  
ATOM 665   O "O5'"  . DA  B 2 9  ? 8.510   -9.642  -0.819  1.00 0.00 ? 90 DA  B "O5'"  1  
ATOM 666   C "C5'"  . DA  B 2 9  ? 7.583   -9.016  -0.004  1.00 0.00 ? 90 DA  B "C5'"  1  
ATOM 667   C "C4'"  . DA  B 2 9  ? 6.202   -9.624  0.009   1.00 0.00 ? 90 DA  B "C4'"  1  
ATOM 668   O "O4'"  . DA  B 2 9  ? 5.586   -9.379  -1.197  1.00 0.00 ? 90 DA  B "O4'"  1  
ATOM 669   C "C3'"  . DA  B 2 9  ? 6.188   -11.148 0.212   1.00 0.00 ? 90 DA  B "C3'"  1  
ATOM 670   O "O3'"  . DA  B 2 9  ? 4.931   -11.462 0.844   1.00 0.00 ? 90 DA  B "O3'"  1  
ATOM 671   C "C2'"  . DA  B 2 9  ? 6.208   -11.657 -1.209  1.00 0.00 ? 90 DA  B "C2'"  1  
ATOM 672   C "C1'"  . DA  B 2 9  ? 5.329   -10.599 -1.810  1.00 0.00 ? 90 DA  B "C1'"  1  
ATOM 673   N N9     . DA  B 2 9  ? 5.381   -10.511 -3.304  1.00 0.00 ? 90 DA  B N9     1  
ATOM 674   C C8     . DA  B 2 9  ? 6.383   -10.727 -4.194  1.00 0.00 ? 90 DA  B C8     1  
ATOM 675   N N7     . DA  B 2 9  ? 6.119   -10.478 -5.421  1.00 0.00 ? 90 DA  B N7     1  
ATOM 676   C C5     . DA  B 2 9  ? 4.777   -10.157 -5.344  1.00 0.00 ? 90 DA  B C5     1  
ATOM 677   C C6     . DA  B 2 9  ? 3.815   -9.880  -6.318  1.00 0.00 ? 90 DA  B C6     1  
ATOM 678   N N6     . DA  B 2 9  ? 4.009   -9.920  -7.619  1.00 0.00 ? 90 DA  B N6     1  
ATOM 679   N N1     . DA  B 2 9  ? 2.591   -9.458  -5.964  1.00 0.00 ? 90 DA  B N1     1  
ATOM 680   C C2     . DA  B 2 9  ? 2.303   -9.416  -4.671  1.00 0.00 ? 90 DA  B C2     1  
ATOM 681   N N3     . DA  B 2 9  ? 3.109   -9.741  -3.646  1.00 0.00 ? 90 DA  B N3     1  
ATOM 682   C C4     . DA  B 2 9  ? 4.329   -10.125 -4.070  1.00 0.00 ? 90 DA  B C4     1  
ATOM 683   H "H5'"  . DA  B 2 9  ? 7.367   -7.990  -0.303  1.00 0.00 ? 90 DA  B "H5'"  1  
ATOM 684   H "H5''" . DA  B 2 9  ? 7.961   -8.967  1.017   1.00 0.00 ? 90 DA  B "H5''" 1  
ATOM 685   H "H4'"  . DA  B 2 9  ? 5.648   -9.219  0.855   1.00 0.00 ? 90 DA  B "H4'"  1  
ATOM 686   H "H3'"  . DA  B 2 9  ? 7.098   -11.465 0.722   1.00 0.00 ? 90 DA  B "H3'"  1  
ATOM 687   H "H2'"  . DA  B 2 9  ? 7.202   -11.571 -1.649  1.00 0.00 ? 90 DA  B "H2'"  1  
ATOM 688   H "H2''" . DA  B 2 9  ? 5.816   -12.667 -1.316  1.00 0.00 ? 90 DA  B "H2''" 1  
ATOM 689   H "H1'"  . DA  B 2 9  ? 4.298   -10.813 -1.526  1.00 0.00 ? 90 DA  B "H1'"  1  
ATOM 690   H H8     . DA  B 2 9  ? 7.358   -11.001 -3.819  1.00 0.00 ? 90 DA  B H8     1  
ATOM 691   H H61    . DA  B 2 9  ? 3.345   -9.580  -8.300  1.00 0.00 ? 90 DA  B H61    1  
ATOM 692   H H62    . DA  B 2 9  ? 4.962   -10.131 -7.879  1.00 0.00 ? 90 DA  B H62    1  
ATOM 693   H H2     . DA  B 2 9  ? 1.282   -9.191  -4.401  1.00 0.00 ? 90 DA  B H2     1  
ATOM 694   P P      . DG  B 2 10 ? 4.866   -12.804 1.751   1.00 0.00 ? 91 DG  B P      1  
ATOM 695   O OP1    . DG  B 2 10 ? 5.474   -12.427 3.068   1.00 0.00 ? 91 DG  B OP1    1  
ATOM 696   O OP2    . DG  B 2 10 ? 5.484   -13.880 1.078   1.00 0.00 ? 91 DG  B OP2    1  
ATOM 697   O "O5'"  . DG  B 2 10 ? 3.399   -13.249 2.013   1.00 0.00 ? 91 DG  B "O5'"  1  
ATOM 698   C "C5'"  . DG  B 2 10 ? 2.567   -12.296 2.759   1.00 0.00 ? 91 DG  B "C5'"  1  
ATOM 699   C "C4'"  . DG  B 2 10 ? 1.119   -12.088 2.282   1.00 0.00 ? 91 DG  B "C4'"  1  
ATOM 700   O "O4'"  . DG  B 2 10 ? 1.112   -11.764 0.855   1.00 0.00 ? 91 DG  B "O4'"  1  
ATOM 701   C "C3'"  . DG  B 2 10 ? 0.455   -13.484 2.274   1.00 0.00 ? 91 DG  B "C3'"  1  
ATOM 702   O "O3'"  . DG  B 2 10 ? -0.965  -13.274 2.574   1.00 0.00 ? 91 DG  B "O3'"  1  
ATOM 703   C "C2'"  . DG  B 2 10 ? 0.659   -14.108 0.920   1.00 0.00 ? 91 DG  B "C2'"  1  
ATOM 704   C "C1'"  . DG  B 2 10 ? 0.671   -12.866 0.045   1.00 0.00 ? 91 DG  B "C1'"  1  
ATOM 705   N N9     . DG  B 2 10 ? 1.509   -13.130 -1.163  1.00 0.00 ? 91 DG  B N9     1  
ATOM 706   C C8     . DG  B 2 10 ? 2.801   -13.461 -1.285  1.00 0.00 ? 91 DG  B C8     1  
ATOM 707   N N7     . DG  B 2 10 ? 3.320   -13.421 -2.473  1.00 0.00 ? 91 DG  B N7     1  
ATOM 708   C C5     . DG  B 2 10 ? 2.167   -13.076 -3.251  1.00 0.00 ? 91 DG  B C5     1  
ATOM 709   C C6     . DG  B 2 10 ? 1.921   -12.833 -4.678  1.00 0.00 ? 91 DG  B C6     1  
ATOM 710   O O6     . DG  B 2 10 ? 2.704   -12.865 -5.636  1.00 0.00 ? 91 DG  B O6     1  
ATOM 711   N N1     . DG  B 2 10 ? 0.646   -12.434 -5.011  1.00 0.00 ? 91 DG  B N1     1  
ATOM 712   C C2     . DG  B 2 10 ? -0.275  -12.145 -4.109  1.00 0.00 ? 91 DG  B C2     1  
ATOM 713   N N2     . DG  B 2 10 ? -1.374  -11.571 -4.495  1.00 0.00 ? 91 DG  B N2     1  
ATOM 714   N N3     . DG  B 2 10 ? -0.089  -12.335 -2.779  1.00 0.00 ? 91 DG  B N3     1  
ATOM 715   C C4     . DG  B 2 10 ? 1.053   -12.901 -2.476  1.00 0.00 ? 91 DG  B C4     1  
ATOM 716   H "H5'"  . DG  B 2 10 ? 2.984   -11.292 2.679   1.00 0.00 ? 91 DG  B "H5'"  1  
ATOM 717   H "H5''" . DG  B 2 10 ? 2.691   -12.409 3.836   1.00 0.00 ? 91 DG  B "H5''" 1  
ATOM 718   H "H4'"  . DG  B 2 10 ? 0.564   -11.253 2.709   1.00 0.00 ? 91 DG  B "H4'"  1  
ATOM 719   H "H3'"  . DG  B 2 10 ? 0.997   -14.084 3.005   1.00 0.00 ? 91 DG  B "H3'"  1  
ATOM 720   H "H2'"  . DG  B 2 10 ? 1.635   -14.578 0.797   1.00 0.00 ? 91 DG  B "H2'"  1  
ATOM 721   H "H2''" . DG  B 2 10 ? -0.131  -14.790 0.609   1.00 0.00 ? 91 DG  B "H2''" 1  
ATOM 722   H "H1'"  . DG  B 2 10 ? -0.368  -12.716 -0.248  1.00 0.00 ? 91 DG  B "H1'"  1  
ATOM 723   H H8     . DG  B 2 10 ? 3.456   -13.572 -0.433  1.00 0.00 ? 91 DG  B H8     1  
ATOM 724   H H1     . DG  B 2 10 ? 0.348   -12.281 -5.963  1.00 0.00 ? 91 DG  B H1     1  
ATOM 725   H H21    . DG  B 2 10 ? -2.031  -11.178 -3.835  1.00 0.00 ? 91 DG  B H21    1  
ATOM 726   H H22    . DG  B 2 10 ? -1.598  -11.561 -5.480  1.00 0.00 ? 91 DG  B H22    1  
ATOM 727   P P      . DA  B 2 11 ? -2.023  -14.355 2.843   1.00 0.00 ? 92 DA  B P      1  
ATOM 728   O OP1    . DA  B 2 11 ? -2.753  -13.958 4.054   1.00 0.00 ? 92 DA  B OP1    1  
ATOM 729   O OP2    . DA  B 2 11 ? -1.387  -15.680 2.771   1.00 0.00 ? 92 DA  B OP2    1  
ATOM 730   O "O5'"  . DA  B 2 11 ? -2.889  -14.178 1.513   1.00 0.00 ? 92 DA  B "O5'"  1  
ATOM 731   C "C5'"  . DA  B 2 11 ? -3.802  -13.125 1.306   1.00 0.00 ? 92 DA  B "C5'"  1  
ATOM 732   C "C4'"  . DA  B 2 11 ? -4.815  -13.372 0.126   1.00 0.00 ? 92 DA  B "C4'"  1  
ATOM 733   O "O4'"  . DA  B 2 11 ? -4.110  -13.420 -1.102  1.00 0.00 ? 92 DA  B "O4'"  1  
ATOM 734   C "C3'"  . DA  B 2 11 ? -5.684  -14.616 0.117   1.00 0.00 ? 92 DA  B "C3'"  1  
ATOM 735   O "O3'"  . DA  B 2 11 ? -6.915  -14.287 -0.548  1.00 0.00 ? 92 DA  B "O3'"  1  
ATOM 736   C "C2'"  . DA  B 2 11 ? -4.884  -15.542 -0.759  1.00 0.00 ? 92 DA  B "C2'"  1  
ATOM 737   C "C1'"  . DA  B 2 11 ? -4.118  -14.669 -1.701  1.00 0.00 ? 92 DA  B "C1'"  1  
ATOM 738   N N9     . DA  B 2 11 ? -2.763  -15.251 -2.043  1.00 0.00 ? 92 DA  B N9     1  
ATOM 739   C C8     . DA  B 2 11 ? -1.915  -15.892 -1.167  1.00 0.00 ? 92 DA  B C8     1  
ATOM 740   N N7     . DA  B 2 11 ? -0.672  -16.131 -1.621  1.00 0.00 ? 92 DA  B N7     1  
ATOM 741   C C5     . DA  B 2 11 ? -0.816  -15.692 -2.959  1.00 0.00 ? 92 DA  B C5     1  
ATOM 742   C C6     . DA  B 2 11 ? 0.000   -15.611 -4.118  1.00 0.00 ? 92 DA  B C6     1  
ATOM 743   N N6     . DA  B 2 11 ? 1.250   -15.978 -4.278  1.00 0.00 ? 92 DA  B N6     1  
ATOM 744   N N1     . DA  B 2 11 ? -0.523  -15.243 -5.300  1.00 0.00 ? 92 DA  B N1     1  
ATOM 745   C C2     . DA  B 2 11 ? -1.693  -14.721 -5.361  1.00 0.00 ? 92 DA  B C2     1  
ATOM 746   N N3     . DA  B 2 11 ? -2.495  -14.584 -4.357  1.00 0.00 ? 92 DA  B N3     1  
ATOM 747   C C4     . DA  B 2 11 ? -2.046  -15.110 -3.229  1.00 0.00 ? 92 DA  B C4     1  
ATOM 748   H "H5'"  . DA  B 2 11 ? -3.202  -12.225 1.169   1.00 0.00 ? 92 DA  B "H5'"  1  
ATOM 749   H "H5''" . DA  B 2 11 ? -4.269  -12.907 2.266   1.00 0.00 ? 92 DA  B "H5''" 1  
ATOM 750   H "H4'"  . DA  B 2 11 ? -5.515  -12.538 0.075   1.00 0.00 ? 92 DA  B "H4'"  1  
ATOM 751   H "H3'"  . DA  B 2 11 ? -5.846  -15.069 1.096   1.00 0.00 ? 92 DA  B "H3'"  1  
ATOM 752   H "H2'"  . DA  B 2 11 ? -4.273  -16.115 -0.062  1.00 0.00 ? 92 DA  B "H2'"  1  
ATOM 753   H "H2''" . DA  B 2 11 ? -5.522  -16.246 -1.292  1.00 0.00 ? 92 DA  B "H2''" 1  
ATOM 754   H "H1'"  . DA  B 2 11 ? -4.661  -14.758 -2.642  1.00 0.00 ? 92 DA  B "H1'"  1  
ATOM 755   H H8     . DA  B 2 11 ? -2.113  -15.979 -0.108  1.00 0.00 ? 92 DA  B H8     1  
ATOM 756   H H61    . DA  B 2 11 ? 1.502   -15.847 -5.248  1.00 0.00 ? 92 DA  B H61    1  
ATOM 757   H H62    . DA  B 2 11 ? 1.800   -16.600 -3.702  1.00 0.00 ? 92 DA  B H62    1  
ATOM 758   H H2     . DA  B 2 11 ? -1.971  -14.386 -6.349  1.00 0.00 ? 92 DA  B H2     1  
ATOM 759   P P      . DG  B 2 12 ? -8.170  -15.314 -0.512  1.00 0.00 ? 93 DG  B P      1  
ATOM 760   O OP1    . DG  B 2 12 ? -9.442  -14.532 -0.560  1.00 0.00 ? 93 DG  B OP1    1  
ATOM 761   O OP2    . DG  B 2 12 ? -7.986  -16.293 0.597   1.00 0.00 ? 93 DG  B OP2    1  
ATOM 762   O "O5'"  . DG  B 2 12 ? -7.961  -16.091 -1.855  1.00 0.00 ? 93 DG  B "O5'"  1  
ATOM 763   C "C5'"  . DG  B 2 12 ? -8.249  -15.456 -3.038  1.00 0.00 ? 93 DG  B "C5'"  1  
ATOM 764   C "C4'"  . DG  B 2 12 ? -7.905  -16.181 -4.302  1.00 0.00 ? 93 DG  B "C4'"  1  
ATOM 765   O "O4'"  . DG  B 2 12 ? -6.476  -16.316 -4.394  1.00 0.00 ? 93 DG  B "O4'"  1  
ATOM 766   C "C3'"  . DG  B 2 12 ? -8.529  -17.560 -4.573  1.00 0.00 ? 93 DG  B "C3'"  1  
ATOM 767   O "O3'"  . DG  B 2 12 ? -9.213  -17.597 -5.844  1.00 0.00 ? 93 DG  B "O3'"  1  
ATOM 768   C "C2'"  . DG  B 2 12 ? -7.215  -18.315 -4.635  1.00 0.00 ? 93 DG  B "C2'"  1  
ATOM 769   C "C1'"  . DG  B 2 12 ? -6.084  -17.479 -5.091  1.00 0.00 ? 93 DG  B "C1'"  1  
ATOM 770   N N9     . DG  B 2 12 ? -4.776  -17.881 -4.704  1.00 0.00 ? 93 DG  B N9     1  
ATOM 771   C C8     . DG  B 2 12 ? -4.454  -18.289 -3.438  1.00 0.00 ? 93 DG  B C8     1  
ATOM 772   N N7     . DG  B 2 12 ? -3.208  -18.684 -3.307  1.00 0.00 ? 93 DG  B N7     1  
ATOM 773   C C5     . DG  B 2 12 ? -2.698  -18.705 -4.630  1.00 0.00 ? 93 DG  B C5     1  
ATOM 774   C C6     . DG  B 2 12 ? -1.444  -19.053 -5.213  1.00 0.00 ? 93 DG  B C6     1  
ATOM 775   O O6     . DG  B 2 12 ? -0.453  -19.511 -4.677  1.00 0.00 ? 93 DG  B O6     1  
ATOM 776   N N1     . DG  B 2 12 ? -1.456  -18.867 -6.600  1.00 0.00 ? 93 DG  B N1     1  
ATOM 777   C C2     . DG  B 2 12 ? -2.569  -18.581 -7.346  1.00 0.00 ? 93 DG  B C2     1  
ATOM 778   N N2     . DG  B 2 12 ? -2.554  -18.698 -8.657  1.00 0.00 ? 93 DG  B N2     1  
ATOM 779   N N3     . DG  B 2 12 ? -3.651  -18.026 -6.824  1.00 0.00 ? 93 DG  B N3     1  
ATOM 780   C C4     . DG  B 2 12 ? -3.706  -18.189 -5.462  1.00 0.00 ? 93 DG  B C4     1  
ATOM 781   H "H5'"  . DG  B 2 12 ? -7.797  -14.478 -3.203  1.00 0.00 ? 93 DG  B "H5'"  1  
ATOM 782   H "H5''" . DG  B 2 12 ? -9.325  -15.386 -3.195  1.00 0.00 ? 93 DG  B "H5''" 1  
ATOM 783   H "H4'"  . DG  B 2 12 ? -8.252  -15.590 -5.149  1.00 0.00 ? 93 DG  B "H4'"  1  
ATOM 784   H "H3'"  . DG  B 2 12 ? -9.104  -17.759 -3.669  1.00 0.00 ? 93 DG  B "H3'"  1  
ATOM 785   H "H2'"  . DG  B 2 12 ? -7.099  -18.585 -3.586  1.00 0.00 ? 93 DG  B "H2'"  1  
ATOM 786   H "H2''" . DG  B 2 12 ? -7.223  -19.286 -5.130  1.00 0.00 ? 93 DG  B "H2''" 1  
ATOM 787   H "H1'"  . DG  B 2 12 ? -6.109  -17.360 -6.175  1.00 0.00 ? 93 DG  B "H1'"  1  
ATOM 788   H H8     . DG  B 2 12 ? -5.205  -18.116 -2.681  1.00 0.00 ? 93 DG  B H8     1  
ATOM 789   H H1     . DG  B 2 12 ? -0.628  -19.077 -7.139  1.00 0.00 ? 93 DG  B H1     1  
ATOM 790   H H21    . DG  B 2 12 ? -3.379  -18.378 -9.144  1.00 0.00 ? 93 DG  B H21    1  
ATOM 791   H H22    . DG  B 2 12 ? -1.675  -18.859 -9.127  1.00 0.00 ? 93 DG  B H22    1  
ATOM 792   P P      . DC  B 2 13 ? -10.205 -18.745 -6.295  1.00 0.00 ? 94 DC  B P      1  
ATOM 793   O OP1    . DC  B 2 13 ? -11.307 -18.134 -7.079  1.00 0.00 ? 94 DC  B OP1    1  
ATOM 794   O OP2    . DC  B 2 13 ? -10.511 -19.650 -5.159  1.00 0.00 ? 94 DC  B OP2    1  
ATOM 795   O "O5'"  . DC  B 2 13 ? -9.295  -19.597 -7.382  1.00 0.00 ? 94 DC  B "O5'"  1  
ATOM 796   C "C5'"  . DC  B 2 13 ? -8.927  -18.877 -8.580  1.00 0.00 ? 94 DC  B "C5'"  1  
ATOM 797   C "C4'"  . DC  B 2 13 ? -7.841  -19.560 -9.457  1.00 0.00 ? 94 DC  B "C4'"  1  
ATOM 798   O "O4'"  . DC  B 2 13 ? -6.586  -19.565 -8.796  1.00 0.00 ? 94 DC  B "O4'"  1  
ATOM 799   C "C3'"  . DC  B 2 13 ? -8.250  -21.011 -9.767  1.00 0.00 ? 94 DC  B "C3'"  1  
ATOM 800   O "O3'"  . DC  B 2 13 ? -8.422  -21.278 -11.056 1.00 0.00 ? 94 DC  B "O3'"  1  
ATOM 801   C "C2'"  . DC  B 2 13 ? -7.088  -21.902 -9.249  1.00 0.00 ? 94 DC  B "C2'"  1  
ATOM 802   C "C1'"  . DC  B 2 13 ? -5.945  -20.808 -9.053  1.00 0.00 ? 94 DC  B "C1'"  1  
ATOM 803   N N1     . DC  B 2 13 ? -5.147  -20.999 -7.825  1.00 0.00 ? 94 DC  B N1     1  
ATOM 804   C C2     . DC  B 2 13 ? -3.845  -21.444 -8.063  1.00 0.00 ? 94 DC  B C2     1  
ATOM 805   O O2     . DC  B 2 13 ? -3.323  -21.629 -9.180  1.00 0.00 ? 94 DC  B O2     1  
ATOM 806   N N3     . DC  B 2 13 ? -3.075  -21.753 -7.022  1.00 0.00 ? 94 DC  B N3     1  
ATOM 807   C C4     . DC  B 2 13 ? -3.560  -21.610 -5.836  1.00 0.00 ? 94 DC  B C4     1  
ATOM 808   N N4     . DC  B 2 13 ? -2.771  -21.887 -4.866  1.00 0.00 ? 94 DC  B N4     1  
ATOM 809   C C5     . DC  B 2 13 ? -4.914  -21.353 -5.486  1.00 0.00 ? 94 DC  B C5     1  
ATOM 810   C C6     . DC  B 2 13 ? -5.668  -20.971 -6.557  1.00 0.00 ? 94 DC  B C6     1  
ATOM 811   H "H5'"  . DC  B 2 13 ? -8.351  -18.054 -8.157  1.00 0.00 ? 94 DC  B "H5'"  1  
ATOM 812   H "H5''" . DC  B 2 13 ? -9.743  -18.390 -9.115  1.00 0.00 ? 94 DC  B "H5''" 1  
ATOM 813   H "H4'"  . DC  B 2 13 ? -7.745  -18.951 -10.357 1.00 0.00 ? 94 DC  B "H4'"  1  
ATOM 814   H "H3'"  . DC  B 2 13 ? -9.156  -21.294 -9.230  1.00 0.00 ? 94 DC  B "H3'"  1  
ATOM 815   H "HO3'" . DC  B 2 13 ? -8.975  -20.560 -11.375 1.00 0.00 ? 94 DC  B "HO3'" 1  
ATOM 816   H "H2'"  . DC  B 2 13 ? -7.453  -22.425 -8.366  1.00 0.00 ? 94 DC  B "H2'"  1  
ATOM 817   H "H2''" . DC  B 2 13 ? -6.709  -22.648 -9.948  1.00 0.00 ? 94 DC  B "H2''" 1  
ATOM 818   H "H1'"  . DC  B 2 13 ? -5.328  -20.758 -9.950  1.00 0.00 ? 94 DC  B "H1'"  1  
ATOM 819   H H41    . DC  B 2 13 ? -3.249  -22.069 -3.996  1.00 0.00 ? 94 DC  B H41    1  
ATOM 820   H H42    . DC  B 2 13 ? -1.940  -22.430 -5.051  1.00 0.00 ? 94 DC  B H42    1  
ATOM 821   H H5     . DC  B 2 13 ? -5.347  -21.311 -4.498  1.00 0.00 ? 94 DC  B H5     1  
ATOM 822   H H6     . DC  B 2 13 ? -6.727  -20.779 -6.470  1.00 0.00 ? 94 DC  B H6     1  
ATOM 823   N N      . GLY C 3 1  ? 8.393   -5.703  3.200   1.00 0.00 ? 1  GLY P N      1  
ATOM 824   C CA     . GLY C 3 1  ? 6.975   -5.747  3.587   1.00 0.00 ? 1  GLY P CA     1  
ATOM 825   C C      . GLY C 3 1  ? 6.785   -6.735  4.676   1.00 0.00 ? 1  GLY P C      1  
ATOM 826   O O      . GLY C 3 1  ? 6.779   -7.923  4.338   1.00 0.00 ? 1  GLY P O      1  
ATOM 827   H H1     . GLY C 3 1  ? 8.512   -5.113  2.390   1.00 0.00 ? 1  GLY P H1     1  
ATOM 828   H H2     . GLY C 3 1  ? 8.603   -6.663  2.968   1.00 0.00 ? 1  GLY P H2     1  
ATOM 829   H H3     . GLY C 3 1  ? 8.953   -5.424  3.993   1.00 0.00 ? 1  GLY P H3     1  
ATOM 830   H HA2    . GLY C 3 1  ? 6.680   -4.752  3.918   1.00 0.00 ? 1  GLY P HA2    1  
ATOM 831   H HA3    . GLY C 3 1  ? 6.334   -6.171  2.814   1.00 0.00 ? 1  GLY P HA3    1  
ATOM 832   N N      . PRO C 3 2  ? 6.794   -6.424  6.007   1.00 0.00 ? 2  PRO P N      1  
ATOM 833   C CA     . PRO C 3 2  ? 6.808   -7.591  6.964   1.00 0.00 ? 2  PRO P CA     1  
ATOM 834   C C      . PRO C 3 2  ? 5.586   -8.533  6.972   1.00 0.00 ? 2  PRO P C      1  
ATOM 835   O O      . PRO C 3 2  ? 5.728   -9.718  7.395   1.00 0.00 ? 2  PRO P O      1  
ATOM 836   C CB     . PRO C 3 2  ? 6.993   -6.880  8.315   1.00 0.00 ? 2  PRO P CB     1  
ATOM 837   C CG     . PRO C 3 2  ? 7.594   -5.542  7.948   1.00 0.00 ? 2  PRO P CG     1  
ATOM 838   C CD     . PRO C 3 2  ? 6.907   -5.171  6.622   1.00 0.00 ? 2  PRO P CD     1  
ATOM 839   H HA     . PRO C 3 2  ? 7.692   -8.208  6.803   1.00 0.00 ? 2  PRO P HA     1  
ATOM 840   H HB2    . PRO C 3 2  ? 5.966   -6.753  8.655   1.00 0.00 ? 2  PRO P HB2    1  
ATOM 841   H HB3    . PRO C 3 2  ? 7.648   -7.474  8.952   1.00 0.00 ? 2  PRO P HB3    1  
ATOM 842   H HG2    . PRO C 3 2  ? 7.237   -4.843  8.705   1.00 0.00 ? 2  PRO P HG2    1  
ATOM 843   H HG3    . PRO C 3 2  ? 8.674   -5.570  7.808   1.00 0.00 ? 2  PRO P HG3    1  
ATOM 844   H HD2    . PRO C 3 2  ? 5.935   -4.729  6.840   1.00 0.00 ? 2  PRO P HD2    1  
ATOM 845   H HD3    . PRO C 3 2  ? 7.426   -4.336  6.152   1.00 0.00 ? 2  PRO P HD3    1  
ATOM 846   N N      . ARG C 3 3  ? 4.386   -8.097  6.562   1.00 0.00 ? 3  ARG P N      1  
ATOM 847   C CA     . ARG C 3 3  ? 3.071   -8.706  6.474   1.00 0.00 ? 3  ARG P CA     1  
ATOM 848   C C      . ARG C 3 3  ? 2.120   -7.934  5.611   1.00 0.00 ? 3  ARG P C      1  
ATOM 849   O O      . ARG C 3 3  ? 1.161   -7.371  6.144   1.00 0.00 ? 3  ARG P O      1  
ATOM 850   C CB     . ARG C 3 3  ? 2.573   -9.091  7.848   1.00 0.00 ? 3  ARG P CB     1  
ATOM 851   C CG     . ARG C 3 3  ? 1.637   -10.306 7.953   1.00 0.00 ? 3  ARG P CG     1  
ATOM 852   C CD     . ARG C 3 3  ? 0.265   -10.095 7.329   1.00 0.00 ? 3  ARG P CD     1  
ATOM 853   N NE     . ARG C 3 3  ? -0.579  -11.276 7.388   1.00 0.00 ? 3  ARG P NE     1  
ATOM 854   C CZ     . ARG C 3 3  ? -0.960  -11.922 6.313   1.00 0.00 ? 3  ARG P CZ     1  
ATOM 855   N NH1    . ARG C 3 3  ? -0.855  -11.458 5.117   1.00 0.00 ? 3  ARG P NH1    1  
ATOM 856   N NH2    . ARG C 3 3  ? -1.458  -13.120 6.416   1.00 0.00 ? 3  ARG P NH2    1  
ATOM 857   H H      . ARG C 3 3  ? 4.441   -7.117  6.326   1.00 0.00 ? 3  ARG P H      1  
ATOM 858   H HA     . ARG C 3 3  ? 3.256   -9.671  6.000   1.00 0.00 ? 3  ARG P HA     1  
ATOM 859   H HB2    . ARG C 3 3  ? 3.426   -9.322  8.486   1.00 0.00 ? 3  ARG P HB2    1  
ATOM 860   H HB3    . ARG C 3 3  ? 1.993   -8.343  8.390   1.00 0.00 ? 3  ARG P HB3    1  
ATOM 861   H HG2    . ARG C 3 3  ? 2.079   -11.057 7.299   1.00 0.00 ? 3  ARG P HG2    1  
ATOM 862   H HG3    . ARG C 3 3  ? 1.356   -10.594 8.966   1.00 0.00 ? 3  ARG P HG3    1  
ATOM 863   H HD2    . ARG C 3 3  ? -0.259  -9.219  7.711   1.00 0.00 ? 3  ARG P HD2    1  
ATOM 864   H HD3    . ARG C 3 3  ? 0.441   -9.923  6.267   1.00 0.00 ? 3  ARG P HD3    1  
ATOM 865   H HE     . ARG C 3 3  ? -0.810  -11.668 8.290   1.00 0.00 ? 3  ARG P HE     1  
ATOM 866   H HH11   . ARG C 3 3  ? -0.373  -10.601 4.886   1.00 0.00 ? 3  ARG P HH11   1  
ATOM 867   H HH12   . ARG C 3 3  ? -1.113  -12.106 4.386   1.00 0.00 ? 3  ARG P HH12   1  
ATOM 868   H HH21   . ARG C 3 3  ? -1.314  -13.597 7.295   1.00 0.00 ? 3  ARG P HH21   1  
ATOM 869   H HH22   . ARG C 3 3  ? -1.795  -13.702 5.663   1.00 0.00 ? 3  ARG P HH22   1  
ATOM 870   N N      . ARG C 3 4  ? 2.350   -7.932  4.306   1.00 0.00 ? 4  ARG P N      1  
ATOM 871   C CA     . ARG C 3 4  ? 1.358   -7.407  3.313   1.00 0.00 ? 4  ARG P CA     1  
ATOM 872   C C      . ARG C 3 4  ? 0.011   -8.116  3.320   1.00 0.00 ? 4  ARG P C      1  
ATOM 873   O O      . ARG C 3 4  ? -0.126  -9.160  4.015   1.00 0.00 ? 4  ARG P O      1  
ATOM 874   C CB     . ARG C 3 4  ? 2.038   -7.431  1.917   1.00 0.00 ? 4  ARG P CB     1  
ATOM 875   C CG     . ARG C 3 4  ? 2.383   -8.862  1.630   1.00 0.00 ? 4  ARG P CG     1  
ATOM 876   C CD     . ARG C 3 4  ? 2.732   -9.086  0.144   1.00 0.00 ? 4  ARG P CD     1  
ATOM 877   N NE     . ARG C 3 4  ? 1.641   -9.547  -0.791  1.00 0.00 ? 4  ARG P NE     1  
ATOM 878   C CZ     . ARG C 3 4  ? 0.757   -8.780  -1.467  1.00 0.00 ? 4  ARG P CZ     1  
ATOM 879   N NH1    . ARG C 3 4  ? 0.780   -7.490  -1.650  1.00 0.00 ? 4  ARG P NH1    1  
ATOM 880   N NH2    . ARG C 3 4  ? -0.235  -9.362  -2.051  1.00 0.00 ? 4  ARG P NH2    1  
ATOM 881   H H      . ARG C 3 4  ? 3.178   -8.380  3.941   1.00 0.00 ? 4  ARG P H      1  
ATOM 882   H HA     . ARG C 3 4  ? 1.092   -6.373  3.534   1.00 0.00 ? 4  ARG P HA     1  
ATOM 883   H HB2    . ARG C 3 4  ? 1.404   -6.975  1.157   1.00 0.00 ? 4  ARG P HB2    1  
ATOM 884   H HB3    . ARG C 3 4  ? 2.977   -6.880  1.870   1.00 0.00 ? 4  ARG P HB3    1  
ATOM 885   H HG2    . ARG C 3 4  ? 3.256   -9.094  2.240   1.00 0.00 ? 4  ARG P HG2    1  
ATOM 886   H HG3    . ARG C 3 4  ? 1.514   -9.467  1.890   1.00 0.00 ? 4  ARG P HG3    1  
ATOM 887   H HD2    . ARG C 3 4  ? 3.069   -8.126  -0.245  1.00 0.00 ? 4  ARG P HD2    1  
ATOM 888   H HD3    . ARG C 3 4  ? 3.503   -9.856  0.100   1.00 0.00 ? 4  ARG P HD3    1  
ATOM 889   H HE     . ARG C 3 4  ? 1.445   -10.538 -0.740  1.00 0.00 ? 4  ARG P HE     1  
ATOM 890   H HH11   . ARG C 3 4  ? 1.650   -7.040  -1.404  1.00 0.00 ? 4  ARG P HH11   1  
ATOM 891   H HH12   . ARG C 3 4  ? 0.141   -7.098  -2.327  1.00 0.00 ? 4  ARG P HH12   1  
ATOM 892   H HH21   . ARG C 3 4  ? -0.332  -10.341 -1.828  1.00 0.00 ? 4  ARG P HH21   1  
ATOM 893   H HH22   . ARG C 3 4  ? -1.063  -8.881  -2.373  1.00 0.00 ? 4  ARG P HH22   1  
ATOM 894   N N      . THR C 3 5  ? -0.994  -7.500  2.622   1.00 0.00 ? 5  THR P N      1  
ATOM 895   C CA     . THR C 3 5  ? -2.323  -7.991  2.478   1.00 0.00 ? 5  THR P CA     1  
ATOM 896   C C      . THR C 3 5  ? -2.967  -8.561  3.728   1.00 0.00 ? 5  THR P C      1  
ATOM 897   O O      . THR C 3 5  ? -3.694  -9.554  3.763   1.00 0.00 ? 5  THR P O      1  
ATOM 898   C CB     . THR C 3 5  ? -2.428  -8.967  1.283   1.00 0.00 ? 5  THR P CB     1  
ATOM 899   O OG1    . THR C 3 5  ? -1.371  -9.889  1.188   1.00 0.00 ? 5  THR P OG1    1  
ATOM 900   C CG2    . THR C 3 5  ? -2.487  -8.154  0.052   1.00 0.00 ? 5  THR P CG2    1  
ATOM 901   H H      . THR C 3 5  ? -0.743  -6.719  2.032   1.00 0.00 ? 5  THR P H      1  
ATOM 902   H HA     . THR C 3 5  ? -2.953  -7.156  2.171   1.00 0.00 ? 5  THR P HA     1  
ATOM 903   H HB     . THR C 3 5  ? -3.372  -9.503  1.386   1.00 0.00 ? 5  THR P HB     1  
ATOM 904   H HG1    . THR C 3 5  ? -1.537  -10.541 0.502   1.00 0.00 ? 5  THR P HG1    1  
ATOM 905   H HG21   . THR C 3 5  ? -1.699  -7.408  -0.044  1.00 0.00 ? 5  THR P HG21   1  
ATOM 906   H HG22   . THR C 3 5  ? -3.398  -7.557  0.097   1.00 0.00 ? 5  THR P HG22   1  
ATOM 907   H HG23   . THR C 3 5  ? -2.346  -8.825  -0.796  1.00 0.00 ? 5  THR P HG23   1  
ATOM 908   N N      . ARG C 3 6  ? -2.825  -7.691  4.782   1.00 0.00 ? 6  ARG P N      1  
ATOM 909   C CA     . ARG C 3 6  ? -3.501  -7.646  6.068   1.00 0.00 ? 6  ARG P CA     1  
ATOM 910   C C      . ARG C 3 6  ? -5.016  -7.381  5.932   1.00 0.00 ? 6  ARG P C      1  
ATOM 911   O O      . ARG C 3 6  ? -5.710  -7.101  6.954   1.00 0.00 ? 6  ARG P O      1  
ATOM 912   C CB     . ARG C 3 6  ? -2.813  -6.565  7.053   1.00 0.00 ? 6  ARG P CB     1  
ATOM 913   C CG     . ARG C 3 6  ? -3.007  -5.123  6.480   1.00 0.00 ? 6  ARG P CG     1  
ATOM 914   C CD     . ARG C 3 6  ? -2.426  -4.002  7.346   1.00 0.00 ? 6  ARG P CD     1  
ATOM 915   N NE     . ARG C 3 6  ? -0.936  -4.073  7.227   1.00 0.00 ? 6  ARG P NE     1  
ATOM 916   C CZ     . ARG C 3 6  ? -0.269  -3.273  6.416   1.00 0.00 ? 6  ARG P CZ     1  
ATOM 917   N NH1    . ARG C 3 6  ? -0.937  -2.606  5.544   1.00 0.00 ? 6  ARG P NH1    1  
ATOM 918   N NH2    . ARG C 3 6  ? 1.019   -3.283  6.393   1.00 0.00 ? 6  ARG P NH2    1  
ATOM 919   H H      . ARG C 3 6  ? -2.191  -6.966  4.479   1.00 0.00 ? 6  ARG P H      1  
ATOM 920   H HA     . ARG C 3 6  ? -3.334  -8.678  6.378   1.00 0.00 ? 6  ARG P HA     1  
ATOM 921   H HB2    . ARG C 3 6  ? -3.181  -6.745  8.063   1.00 0.00 ? 6  ARG P HB2    1  
ATOM 922   H HB3    . ARG C 3 6  ? -1.748  -6.801  7.046   1.00 0.00 ? 6  ARG P HB3    1  
ATOM 923   H HG2    . ARG C 3 6  ? -2.483  -5.036  5.529   1.00 0.00 ? 6  ARG P HG2    1  
ATOM 924   H HG3    . ARG C 3 6  ? -4.063  -4.854  6.440   1.00 0.00 ? 6  ARG P HG3    1  
ATOM 925   H HD2    . ARG C 3 6  ? -2.744  -3.000  7.058   1.00 0.00 ? 6  ARG P HD2    1  
ATOM 926   H HD3    . ARG C 3 6  ? -2.745  -4.130  8.381   1.00 0.00 ? 6  ARG P HD3    1  
ATOM 927   H HE     . ARG C 3 6  ? -0.389  -4.592  7.899   1.00 0.00 ? 6  ARG P HE     1  
ATOM 928   H HH11   . ARG C 3 6  ? -1.920  -2.409  5.666   1.00 0.00 ? 6  ARG P HH11   1  
ATOM 929   H HH12   . ARG C 3 6  ? -0.488  -2.281  4.699   1.00 0.00 ? 6  ARG P HH12   1  
ATOM 930   H HH21   . ARG C 3 6  ? 1.380   -4.118  6.833   1.00 0.00 ? 6  ARG P HH21   1  
ATOM 931   H HH22   . ARG C 3 6  ? 1.389   -2.940  5.518   1.00 0.00 ? 6  ARG P HH22   1  
ATOM 932   N N      . THR C 3 7  ? -5.505  -7.433  4.712   1.00 0.00 ? 7  THR P N      1  
ATOM 933   C CA     . THR C 3 7  ? -6.846  -7.138  4.280   1.00 0.00 ? 7  THR P CA     1  
ATOM 934   C C      . THR C 3 7  ? -6.980  -7.777  2.884   1.00 0.00 ? 7  THR P C      1  
ATOM 935   O O      . THR C 3 7  ? -6.047  -8.053  2.113   1.00 0.00 ? 7  THR P O      1  
ATOM 936   C CB     . THR C 3 7  ? -7.089  -5.585  4.281   1.00 0.00 ? 7  THR P CB     1  
ATOM 937   O OG1    . THR C 3 7  ? -7.083  -5.024  5.616   1.00 0.00 ? 7  THR P OG1    1  
ATOM 938   C CG2    . THR C 3 7  ? -8.432  -5.196  3.585   1.00 0.00 ? 7  THR P CG2    1  
ATOM 939   H H      . THR C 3 7  ? -4.892  -7.679  3.949   1.00 0.00 ? 7  THR P H      1  
ATOM 940   H HA     . THR C 3 7  ? -7.586  -7.626  4.915   1.00 0.00 ? 7  THR P HA     1  
ATOM 941   H HB     . THR C 3 7  ? -6.242  -5.110  3.787   1.00 0.00 ? 7  THR P HB     1  
ATOM 942   H HG1    . THR C 3 7  ? -6.598  -5.614  6.196   1.00 0.00 ? 7  THR P HG1    1  
ATOM 943   H HG21   . THR C 3 7  ? -8.532  -4.129  3.787   1.00 0.00 ? 7  THR P HG21   1  
ATOM 944   H HG22   . THR C 3 7  ? -9.288  -5.645  4.087   1.00 0.00 ? 7  THR P HG22   1  
ATOM 945   H HG23   . THR C 3 7  ? -8.346  -5.510  2.545   1.00 0.00 ? 7  THR P HG23   1  
ATOM 946   N N      . THR C 3 8  ? -8.206  -8.028  2.643   1.00 0.00 ? 8  THR P N      1  
ATOM 947   C CA     . THR C 3 8  ? -8.708  -8.435  1.332   1.00 0.00 ? 8  THR P CA     1  
ATOM 948   C C      . THR C 3 8  ? -10.091 -7.808  1.086   1.00 0.00 ? 8  THR P C      1  
ATOM 949   O O      . THR C 3 8  ? -10.990 -8.055  1.888   1.00 0.00 ? 8  THR P O      1  
ATOM 950   C CB     . THR C 3 8  ? -8.581  -9.950  1.256   1.00 0.00 ? 8  THR P CB     1  
ATOM 951   O OG1    . THR C 3 8  ? -7.217  -10.340 1.134   1.00 0.00 ? 8  THR P OG1    1  
ATOM 952   C CG2    . THR C 3 8  ? -9.351  -10.517 0.071   1.00 0.00 ? 8  THR P CG2    1  
ATOM 953   H H      . THR C 3 8  ? -8.848  -7.827  3.396   1.00 0.00 ? 8  THR P H      1  
ATOM 954   H HA     . THR C 3 8  ? -8.036  -8.032  0.574   1.00 0.00 ? 8  THR P HA     1  
ATOM 955   H HB     . THR C 3 8  ? -8.925  -10.434 2.169   1.00 0.00 ? 8  THR P HB     1  
ATOM 956   H HG1    . THR C 3 8  ? -6.686  -9.747  1.672   1.00 0.00 ? 8  THR P HG1    1  
ATOM 957   H HG21   . THR C 3 8  ? -9.141  -11.584 0.009   1.00 0.00 ? 8  THR P HG21   1  
ATOM 958   H HG22   . THR C 3 8  ? -9.059  -10.016 -0.853  1.00 0.00 ? 8  THR P HG22   1  
ATOM 959   H HG23   . THR C 3 8  ? -10.403 -10.464 0.349   1.00 0.00 ? 8  THR P HG23   1  
ATOM 960   N N      . PHE C 3 9  ? -10.237 -6.974  0.051   1.00 0.00 ? 9  PHE P N      1  
ATOM 961   C CA     . PHE C 3 9  ? -11.439 -6.321  -0.466  1.00 0.00 ? 9  PHE P CA     1  
ATOM 962   C C      . PHE C 3 9  ? -12.413 -7.338  -1.020  1.00 0.00 ? 9  PHE P C      1  
ATOM 963   O O      . PHE C 3 9  ? -12.145 -8.517  -1.354  1.00 0.00 ? 9  PHE P O      1  
ATOM 964   C CB     . PHE C 3 9  ? -11.088 -5.232  -1.566  1.00 0.00 ? 9  PHE P CB     1  
ATOM 965   C CG     . PHE C 3 9  ? -10.194 -4.004  -1.147  1.00 0.00 ? 9  PHE P CG     1  
ATOM 966   C CD1    . PHE C 3 9  ? -9.813  -3.855  0.184   1.00 0.00 ? 9  PHE P CD1    1  
ATOM 967   C CD2    . PHE C 3 9  ? -9.910  -3.025  -2.115  1.00 0.00 ? 9  PHE P CD2    1  
ATOM 968   C CE1    . PHE C 3 9  ? -9.067  -2.675  0.509   1.00 0.00 ? 9  PHE P CE1    1  
ATOM 969   C CE2    . PHE C 3 9  ? -9.235  -1.880  -1.764  1.00 0.00 ? 9  PHE P CE2    1  
ATOM 970   C CZ     . PHE C 3 9  ? -8.887  -1.635  -0.441  1.00 0.00 ? 9  PHE P CZ     1  
ATOM 971   H H      . PHE C 3 9  ? -9.378  -6.874  -0.470  1.00 0.00 ? 9  PHE P H      1  
ATOM 972   H HA     . PHE C 3 9  ? -12.018 -5.885  0.349   1.00 0.00 ? 9  PHE P HA     1  
ATOM 973   H HB2    . PHE C 3 9  ? -10.592 -5.620  -2.455  1.00 0.00 ? 9  PHE P HB2    1  
ATOM 974   H HB3    . PHE C 3 9  ? -12.025 -4.810  -1.927  1.00 0.00 ? 9  PHE P HB3    1  
ATOM 975   H HD1    . PHE C 3 9  ? -9.971  -4.598  0.952   1.00 0.00 ? 9  PHE P HD1    1  
ATOM 976   H HD2    . PHE C 3 9  ? -10.189 -3.137  -3.153  1.00 0.00 ? 9  PHE P HD2    1  
ATOM 977   H HE1    . PHE C 3 9  ? -8.595  -2.471  1.460   1.00 0.00 ? 9  PHE P HE1    1  
ATOM 978   H HE2    . PHE C 3 9  ? -8.926  -1.118  -2.464  1.00 0.00 ? 9  PHE P HE2    1  
ATOM 979   H HZ     . PHE C 3 9  ? -8.197  -0.843  -0.187  1.00 0.00 ? 9  PHE P HZ     1  
ATOM 980   N N      . THR C 3 10 ? -13.590 -6.683  -1.143  1.00 0.00 ? 10 THR P N      1  
ATOM 981   C CA     . THR C 3 10 ? -14.741 -7.174  -1.867  1.00 0.00 ? 10 THR P CA     1  
ATOM 982   C C      . THR C 3 10 ? -15.416 -6.052  -2.552  1.00 0.00 ? 10 THR P C      1  
ATOM 983   O O      . THR C 3 10 ? -15.088 -4.905  -2.309  1.00 0.00 ? 10 THR P O      1  
ATOM 984   C CB     . THR C 3 10 ? -15.653 -7.846  -0.859  1.00 0.00 ? 10 THR P CB     1  
ATOM 985   O OG1    . THR C 3 10 ? -16.238 -6.876  -0.059  1.00 0.00 ? 10 THR P OG1    1  
ATOM 986   C CG2    . THR C 3 10 ? -15.097 -8.883  0.140   1.00 0.00 ? 10 THR P CG2    1  
ATOM 987   H H      . THR C 3 10 ? -13.669 -5.749  -0.767  1.00 0.00 ? 10 THR P H      1  
ATOM 988   H HA     . THR C 3 10 ? -14.484 -7.905  -2.633  1.00 0.00 ? 10 THR P HA     1  
ATOM 989   H HB     . THR C 3 10 ? -16.414 -8.502  -1.281  1.00 0.00 ? 10 THR P HB     1  
ATOM 990   H HG1    . THR C 3 10 ? -16.685 -7.328  0.660   1.00 0.00 ? 10 THR P HG1    1  
ATOM 991   H HG21   . THR C 3 10 ? -14.782 -9.751  -0.439  1.00 0.00 ? 10 THR P HG21   1  
ATOM 992   H HG22   . THR C 3 10 ? -15.978 -9.046  0.760   1.00 0.00 ? 10 THR P HG22   1  
ATOM 993   H HG23   . THR C 3 10 ? -14.266 -8.437  0.687   1.00 0.00 ? 10 THR P HG23   1  
ATOM 994   N N      . SER C 3 11 ? -16.411 -6.322  -3.387  1.00 0.00 ? 11 SER P N      1  
ATOM 995   C CA     . SER C 3 11 ? -17.364 -5.354  -3.970  1.00 0.00 ? 11 SER P CA     1  
ATOM 996   C C      . SER C 3 11 ? -18.017 -4.360  -2.963  1.00 0.00 ? 11 SER P C      1  
ATOM 997   O O      . SER C 3 11 ? -18.199 -3.218  -3.350  1.00 0.00 ? 11 SER P O      1  
ATOM 998   C CB     . SER C 3 11 ? -18.558 -6.166  -4.529  1.00 0.00 ? 11 SER P CB     1  
ATOM 999   O OG     . SER C 3 11 ? -18.191 -6.915  -5.699  1.00 0.00 ? 11 SER P OG     1  
ATOM 1000  H H      . SER C 3 11 ? -16.623 -7.308  -3.446  1.00 0.00 ? 11 SER P H      1  
ATOM 1001  H HA     . SER C 3 11 ? -16.942 -4.733  -4.761  1.00 0.00 ? 11 SER P HA     1  
ATOM 1002  H HB2    . SER C 3 11 ? -19.014 -6.759  -3.737  1.00 0.00 ? 11 SER P HB2    1  
ATOM 1003  H HB3    . SER C 3 11 ? -19.325 -5.505  -4.933  1.00 0.00 ? 11 SER P HB3    1  
ATOM 1004  H HG     . SER C 3 11 ? -18.937 -6.882  -6.303  1.00 0.00 ? 11 SER P HG     1  
ATOM 1005  N N      . SER C 3 12 ? -18.228 -4.732  -1.639  1.00 0.00 ? 12 SER P N      1  
ATOM 1006  C CA     . SER C 3 12 ? -18.731 -3.917  -0.585  1.00 0.00 ? 12 SER P CA     1  
ATOM 1007  C C      . SER C 3 12 ? -17.695 -2.828  -0.157  1.00 0.00 ? 12 SER P C      1  
ATOM 1008  O O      . SER C 3 12 ? -18.070 -1.693  0.016   1.00 0.00 ? 12 SER P O      1  
ATOM 1009  C CB     . SER C 3 12 ? -19.193 -4.665  0.659   1.00 0.00 ? 12 SER P CB     1  
ATOM 1010  O OG     . SER C 3 12 ? -20.119 -5.727  0.462   1.00 0.00 ? 12 SER P OG     1  
ATOM 1011  H H      . SER C 3 12 ? -18.217 -5.720  -1.429  1.00 0.00 ? 12 SER P H      1  
ATOM 1012  H HA     . SER C 3 12 ? -19.644 -3.406  -0.889  1.00 0.00 ? 12 SER P HA     1  
ATOM 1013  H HB2    . SER C 3 12 ? -18.268 -4.982  1.140   1.00 0.00 ? 12 SER P HB2    1  
ATOM 1014  H HB3    . SER C 3 12 ? -19.679 -3.998  1.371   1.00 0.00 ? 12 SER P HB3    1  
ATOM 1015  H HG     . SER C 3 12 ? -20.323 -6.195  1.274   1.00 0.00 ? 12 SER P HG     1  
ATOM 1016  N N      . GLN C 3 13 ? -16.387 -3.196  -0.057  1.00 0.00 ? 13 GLN P N      1  
ATOM 1017  C CA     . GLN C 3 13 ? -15.355 -2.174  0.113   1.00 0.00 ? 13 GLN P CA     1  
ATOM 1018  C C      . GLN C 3 13 ? -15.169 -1.270  -1.084  1.00 0.00 ? 13 GLN P C      1  
ATOM 1019  O O      . GLN C 3 13 ? -15.120 -0.014  -0.861  1.00 0.00 ? 13 GLN P O      1  
ATOM 1020  C CB     . GLN C 3 13 ? -14.029 -2.822  0.492   1.00 0.00 ? 13 GLN P CB     1  
ATOM 1021  C CG     . GLN C 3 13 ? -14.099 -3.812  1.696   1.00 0.00 ? 13 GLN P CG     1  
ATOM 1022  C CD     . GLN C 3 13 ? -15.049 -3.465  2.791   1.00 0.00 ? 13 GLN P CD     1  
ATOM 1023  O OE1    . GLN C 3 13 ? -16.263 -3.325  2.658   1.00 0.00 ? 13 GLN P OE1    1  
ATOM 1024  N NE2    . GLN C 3 13 ? -14.566 -3.600  3.960   1.00 0.00 ? 13 GLN P NE2    1  
ATOM 1025  H H      . GLN C 3 13 ? -16.102 -4.158  -0.172  1.00 0.00 ? 13 GLN P H      1  
ATOM 1026  H HA     . GLN C 3 13 ? -15.627 -1.519  0.942   1.00 0.00 ? 13 GLN P HA     1  
ATOM 1027  H HB2    . GLN C 3 13 ? -13.644 -3.409  -0.342  1.00 0.00 ? 13 GLN P HB2    1  
ATOM 1028  H HB3    . GLN C 3 13 ? -13.350 -2.019  0.779   1.00 0.00 ? 13 GLN P HB3    1  
ATOM 1029  H HG2    . GLN C 3 13 ? -14.543 -4.757  1.381   1.00 0.00 ? 13 GLN P HG2    1  
ATOM 1030  H HG3    . GLN C 3 13 ? -13.097 -3.857  2.123   1.00 0.00 ? 13 GLN P HG3    1  
ATOM 1031  H HE21   . GLN C 3 13 ? -13.745 -4.158  4.144   1.00 0.00 ? 13 GLN P HE21   1  
ATOM 1032  H HE22   . GLN C 3 13 ? -15.100 -3.144  4.686   1.00 0.00 ? 13 GLN P HE22   1  
ATOM 1033  N N      . ILE C 3 14 ? -15.154 -1.815  -2.287  1.00 0.00 ? 14 ILE P N      1  
ATOM 1034  C CA     . ILE C 3 14 ? -15.175 -0.941  -3.475  1.00 0.00 ? 14 ILE P CA     1  
ATOM 1035  C C      . ILE C 3 14 ? -16.456 -0.114  -3.513  1.00 0.00 ? 14 ILE P C      1  
ATOM 1036  O O      . ILE C 3 14 ? -16.378 1.059   -3.966  1.00 0.00 ? 14 ILE P O      1  
ATOM 1037  C CB     . ILE C 3 14 ? -14.877 -1.749  -4.712  1.00 0.00 ? 14 ILE P CB     1  
ATOM 1038  C CG1    . ILE C 3 14 ? -13.487 -2.365  -4.558  1.00 0.00 ? 14 ILE P CG1    1  
ATOM 1039  C CG2    . ILE C 3 14 ? -15.124 -1.089  -6.032  1.00 0.00 ? 14 ILE P CG2    1  
ATOM 1040  C CD1    . ILE C 3 14 ? -13.218 -3.581  -5.471  1.00 0.00 ? 14 ILE P CD1    1  
ATOM 1041  H H      . ILE C 3 14 ? -15.229 -2.820  -2.355  1.00 0.00 ? 14 ILE P H      1  
ATOM 1042  H HA     . ILE C 3 14 ? -14.327 -0.265  -3.357  1.00 0.00 ? 14 ILE P HA     1  
ATOM 1043  H HB     . ILE C 3 14 ? -15.564 -2.595  -4.727  1.00 0.00 ? 14 ILE P HB     1  
ATOM 1044  H HG12   . ILE C 3 14 ? -12.698 -1.670  -4.847  1.00 0.00 ? 14 ILE P HG12   1  
ATOM 1045  H HG13   . ILE C 3 14 ? -13.409 -2.729  -3.533  1.00 0.00 ? 14 ILE P HG13   1  
ATOM 1046  H HG21   . ILE C 3 14 ? -16.150 -0.749  -6.167  1.00 0.00 ? 14 ILE P HG21   1  
ATOM 1047  H HG22   . ILE C 3 14 ? -14.465 -0.225  -6.121  1.00 0.00 ? 14 ILE P HG22   1  
ATOM 1048  H HG23   . ILE C 3 14 ? -14.894 -1.774  -6.849  1.00 0.00 ? 14 ILE P HG23   1  
ATOM 1049  H HD11   . ILE C 3 14 ? -13.304 -3.299  -6.519  1.00 0.00 ? 14 ILE P HD11   1  
ATOM 1050  H HD12   . ILE C 3 14 ? -12.250 -4.057  -5.313  1.00 0.00 ? 14 ILE P HD12   1  
ATOM 1051  H HD13   . ILE C 3 14 ? -14.068 -4.230  -5.258  1.00 0.00 ? 14 ILE P HD13   1  
ATOM 1052  N N      . ALA C 3 15 ? -17.590 -0.562  -3.028  1.00 0.00 ? 15 ALA P N      1  
ATOM 1053  C CA     . ALA C 3 15 ? -18.826 0.235   -3.011  1.00 0.00 ? 15 ALA P CA     1  
ATOM 1054  C C      . ALA C 3 15 ? -18.812 1.474   -2.044  1.00 0.00 ? 15 ALA P C      1  
ATOM 1055  O O      . ALA C 3 15 ? -19.148 2.608   -2.400  1.00 0.00 ? 15 ALA P O      1  
ATOM 1056  C CB     . ALA C 3 15 ? -19.935 -0.735  -2.653  1.00 0.00 ? 15 ALA P CB     1  
ATOM 1057  H H      . ALA C 3 15 ? -17.452 -1.446  -2.558  1.00 0.00 ? 15 ALA P H      1  
ATOM 1058  H HA     . ALA C 3 15 ? -18.997 0.540   -4.044  1.00 0.00 ? 15 ALA P HA     1  
ATOM 1059  H HB1    . ALA C 3 15 ? -20.833 -0.206  -2.333  1.00 0.00 ? 15 ALA P HB1    1  
ATOM 1060  H HB2    . ALA C 3 15 ? -20.281 -1.278  -3.533  1.00 0.00 ? 15 ALA P HB2    1  
ATOM 1061  H HB3    . ALA C 3 15 ? -19.791 -1.440  -1.834  1.00 0.00 ? 15 ALA P HB3    1  
ATOM 1062  N N      . GLU C 3 16 ? -18.266 1.223   -0.872  1.00 0.00 ? 16 GLU P N      1  
ATOM 1063  C CA     . GLU C 3 16 ? -17.923 2.324   0.088   1.00 0.00 ? 16 GLU P CA     1  
ATOM 1064  C C      . GLU C 3 16 ? -16.896 3.269   -0.332  1.00 0.00 ? 16 GLU P C      1  
ATOM 1065  O O      . GLU C 3 16 ? -17.133 4.448   -0.365  1.00 0.00 ? 16 GLU P O      1  
ATOM 1066  C CB     . GLU C 3 16 ? -17.319 1.664   1.341   1.00 0.00 ? 16 GLU P CB     1  
ATOM 1067  C CG     . GLU C 3 16 ? -18.095 1.063   2.464   1.00 0.00 ? 16 GLU P CG     1  
ATOM 1068  C CD     . GLU C 3 16 ? -19.484 1.584   2.778   1.00 0.00 ? 16 GLU P CD     1  
ATOM 1069  O OE1    . GLU C 3 16 ? -19.669 2.309   3.745   1.00 0.00 ? 16 GLU P OE1    1  
ATOM 1070  O OE2    . GLU C 3 16 ? -20.448 1.185   2.103   1.00 0.00 ? 16 GLU P OE2    1  
ATOM 1071  H H      . GLU C 3 16 ? -18.127 0.243   -0.672  1.00 0.00 ? 16 GLU P H      1  
ATOM 1072  H HA     . GLU C 3 16 ? -18.820 2.890   0.339   1.00 0.00 ? 16 GLU P HA     1  
ATOM 1073  H HB2    . GLU C 3 16 ? -16.785 0.840   0.869   1.00 0.00 ? 16 GLU P HB2    1  
ATOM 1074  H HB3    . GLU C 3 16 ? -16.633 2.302   1.897   1.00 0.00 ? 16 GLU P HB3    1  
ATOM 1075  H HG2    . GLU C 3 16 ? -18.208 -0.011  2.317   1.00 0.00 ? 16 GLU P HG2    1  
ATOM 1076  H HG3    . GLU C 3 16 ? -17.523 1.320   3.356   1.00 0.00 ? 16 GLU P HG3    1  
ATOM 1077  N N      . LEU C 3 17 ? -15.745 2.740   -0.729  1.00 0.00 ? 17 LEU P N      1  
ATOM 1078  C CA     . LEU C 3 17 ? -14.577 3.443   -1.130  1.00 0.00 ? 17 LEU P CA     1  
ATOM 1079  C C      . LEU C 3 17 ? -14.845 4.481   -2.210  1.00 0.00 ? 17 LEU P C      1  
ATOM 1080  O O      . LEU C 3 17 ? -14.472 5.646   -2.041  1.00 0.00 ? 17 LEU P O      1  
ATOM 1081  C CB     . LEU C 3 17 ? -13.426 2.516   -1.423  1.00 0.00 ? 17 LEU P CB     1  
ATOM 1082  C CG     . LEU C 3 17 ? -12.704 2.064   -0.089  1.00 0.00 ? 17 LEU P CG     1  
ATOM 1083  C CD1    . LEU C 3 17 ? -11.801 0.857   -0.156  1.00 0.00 ? 17 LEU P CD1    1  
ATOM 1084  C CD2    . LEU C 3 17 ? -11.812 3.221   0.438   1.00 0.00 ? 17 LEU P CD2    1  
ATOM 1085  H H      . LEU C 3 17 ? -15.659 1.736   -0.803  1.00 0.00 ? 17 LEU P H      1  
ATOM 1086  H HA     . LEU C 3 17 ? -14.265 3.923   -0.202  1.00 0.00 ? 17 LEU P HA     1  
ATOM 1087  H HB2    . LEU C 3 17 ? -13.779 1.606   -1.909  1.00 0.00 ? 17 LEU P HB2    1  
ATOM 1088  H HB3    . LEU C 3 17 ? -12.779 3.016   -2.144  1.00 0.00 ? 17 LEU P HB3    1  
ATOM 1089  H HG     . LEU C 3 17 ? -13.508 1.930   0.634   1.00 0.00 ? 17 LEU P HG     1  
ATOM 1090  H HD11   . LEU C 3 17 ? -11.011 0.852   0.594   1.00 0.00 ? 17 LEU P HD11   1  
ATOM 1091  H HD12   . LEU C 3 17 ? -11.231 0.848   -1.085  1.00 0.00 ? 17 LEU P HD12   1  
ATOM 1092  H HD13   . LEU C 3 17 ? -12.345 -0.070  0.023   1.00 0.00 ? 17 LEU P HD13   1  
ATOM 1093  H HD21   . LEU C 3 17 ? -10.868 3.074   -0.086  1.00 0.00 ? 17 LEU P HD21   1  
ATOM 1094  H HD22   . LEU C 3 17 ? -11.656 3.132   1.513   1.00 0.00 ? 17 LEU P HD22   1  
ATOM 1095  H HD23   . LEU C 3 17 ? -12.268 4.160   0.126   1.00 0.00 ? 17 LEU P HD23   1  
ATOM 1096  N N      . GLU C 3 18 ? -15.461 3.988   -3.284  1.00 0.00 ? 18 GLU P N      1  
ATOM 1097  C CA     . GLU C 3 18 ? -15.975 4.838   -4.393  1.00 0.00 ? 18 GLU P CA     1  
ATOM 1098  C C      . GLU C 3 18 ? -17.093 5.871   -3.980  1.00 0.00 ? 18 GLU P C      1  
ATOM 1099  O O      . GLU C 3 18 ? -16.984 7.059   -4.337  1.00 0.00 ? 18 GLU P O      1  
ATOM 1100  C CB     . GLU C 3 18 ? -16.601 3.964   -5.529  1.00 0.00 ? 18 GLU P CB     1  
ATOM 1101  C CG     . GLU C 3 18 ? -15.497 3.344   -6.326  1.00 0.00 ? 18 GLU P CG     1  
ATOM 1102  C CD     . GLU C 3 18 ? -15.857 2.717   -7.619  1.00 0.00 ? 18 GLU P CD     1  
ATOM 1103  O OE1    . GLU C 3 18 ? -16.441 1.587   -7.661  1.00 0.00 ? 18 GLU P OE1    1  
ATOM 1104  O OE2    . GLU C 3 18 ? -15.607 3.356   -8.634  1.00 0.00 ? 18 GLU P OE2    1  
ATOM 1105  H H      . GLU C 3 18 ? -15.529 2.997   -3.473  1.00 0.00 ? 18 GLU P H      1  
ATOM 1106  H HA     . GLU C 3 18 ? -15.211 5.511   -4.781  1.00 0.00 ? 18 GLU P HA     1  
ATOM 1107  H HB2    . GLU C 3 18 ? -17.219 3.213   -5.037  1.00 0.00 ? 18 GLU P HB2    1  
ATOM 1108  H HB3    . GLU C 3 18 ? -17.203 4.634   -6.142  1.00 0.00 ? 18 GLU P HB3    1  
ATOM 1109  H HG2    . GLU C 3 18 ? -14.814 4.155   -6.579  1.00 0.00 ? 18 GLU P HG2    1  
ATOM 1110  H HG3    . GLU C 3 18 ? -15.064 2.675   -5.581  1.00 0.00 ? 18 GLU P HG3    1  
ATOM 1111  N N      . GLN C 3 19 ? -18.071 5.531   -3.201  1.00 0.00 ? 19 GLN P N      1  
ATOM 1112  C CA     . GLN C 3 19 ? -19.182 6.435   -2.798  1.00 0.00 ? 19 GLN P CA     1  
ATOM 1113  C C      . GLN C 3 19 ? -18.711 7.418   -1.819  1.00 0.00 ? 19 GLN P C      1  
ATOM 1114  O O      . GLN C 3 19 ? -19.255 8.498   -1.849  1.00 0.00 ? 19 GLN P O      1  
ATOM 1115  C CB     . GLN C 3 19 ? -20.295 5.624   -2.171  1.00 0.00 ? 19 GLN P CB     1  
ATOM 1116  C CG     . GLN C 3 19 ? -20.999 4.967   -3.308  1.00 0.00 ? 19 GLN P CG     1  
ATOM 1117  C CD     . GLN C 3 19 ? -21.855 5.904   -4.163  1.00 0.00 ? 19 GLN P CD     1  
ATOM 1118  O OE1    . GLN C 3 19 ? -22.841 6.409   -3.720  1.00 0.00 ? 19 GLN P OE1    1  
ATOM 1119  N NE2    . GLN C 3 19 ? -21.505 6.317   -5.331  1.00 0.00 ? 19 GLN P NE2    1  
ATOM 1120  H H      . GLN C 3 19 ? -18.005 4.622   -2.765  1.00 0.00 ? 19 GLN P H      1  
ATOM 1121  H HA     . GLN C 3 19 ? -19.405 6.970   -3.721  1.00 0.00 ? 19 GLN P HA     1  
ATOM 1122  H HB2    . GLN C 3 19 ? -19.865 4.865   -1.517  1.00 0.00 ? 19 GLN P HB2    1  
ATOM 1123  H HB3    . GLN C 3 19 ? -20.924 6.219   -1.510  1.00 0.00 ? 19 GLN P HB3    1  
ATOM 1124  H HG2    . GLN C 3 19 ? -20.303 4.436   -3.958  1.00 0.00 ? 19 GLN P HG2    1  
ATOM 1125  H HG3    . GLN C 3 19 ? -21.619 4.167   -2.904  1.00 0.00 ? 19 GLN P HG3    1  
ATOM 1126  H HE21   . GLN C 3 19 ? -20.741 5.944   -5.876  1.00 0.00 ? 19 GLN P HE21   1  
ATOM 1127  H HE22   . GLN C 3 19 ? -22.094 6.959   -5.842  1.00 0.00 ? 19 GLN P HE22   1  
ATOM 1128  N N      . HIS C 3 20 ? -17.829 7.164   -0.862  1.00 0.00 ? 20 HIS P N      1  
ATOM 1129  C CA     . HIS C 3 20 ? -17.258 8.274   -0.022  1.00 0.00 ? 20 HIS P CA     1  
ATOM 1130  C C      . HIS C 3 20 ? -16.117 9.076   -0.649  1.00 0.00 ? 20 HIS P C      1  
ATOM 1131  O O      . HIS C 3 20 ? -16.122 10.300  -0.488  1.00 0.00 ? 20 HIS P O      1  
ATOM 1132  C CB     . HIS C 3 20 ? -16.984 7.736   1.365   1.00 0.00 ? 20 HIS P CB     1  
ATOM 1133  C CG     . HIS C 3 20 ? -18.197 7.118   1.971   1.00 0.00 ? 20 HIS P CG     1  
ATOM 1134  N ND1    . HIS C 3 20 ? -19.262 7.845   2.449   1.00 0.00 ? 20 HIS P ND1    1  
ATOM 1135  C CD2    . HIS C 3 20 ? -18.415 5.772   2.132   1.00 0.00 ? 20 HIS P CD2    1  
ATOM 1136  C CE1    . HIS C 3 20 ? -20.195 6.959   2.875   1.00 0.00 ? 20 HIS P CE1    1  
ATOM 1137  N NE2    . HIS C 3 20 ? -19.713 5.675   2.755   1.00 0.00 ? 20 HIS P NE2    1  
ATOM 1138  H H      . HIS C 3 20 ? -17.398 6.255   -0.756  1.00 0.00 ? 20 HIS P H      1  
ATOM 1139  H HA     . HIS C 3 20 ? -18.074 8.979   0.143   1.00 0.00 ? 20 HIS P HA     1  
ATOM 1140  H HB2    . HIS C 3 20 ? -16.197 6.984   1.305   1.00 0.00 ? 20 HIS P HB2    1  
ATOM 1141  H HB3    . HIS C 3 20 ? -16.611 8.498   2.050   1.00 0.00 ? 20 HIS P HB3    1  
ATOM 1142  H HD1    . HIS C 3 20 ? -19.416 8.833   2.299   1.00 0.00 ? 20 HIS P HD1    1  
ATOM 1143  H HD2    . HIS C 3 20 ? -17.806 4.902   1.934   1.00 0.00 ? 20 HIS P HD2    1  
ATOM 1144  H HE1    . HIS C 3 20 ? -21.189 7.151   3.251   1.00 0.00 ? 20 HIS P HE1    1  
ATOM 1145  N N      . PHE C 3 21 ? -15.402 8.452   -1.604  1.00 0.00 ? 21 PHE P N      1  
ATOM 1146  C CA     . PHE C 3 21 ? -14.530 9.125   -2.526  1.00 0.00 ? 21 PHE P CA     1  
ATOM 1147  C C      . PHE C 3 21 ? -15.139 10.275  -3.298  1.00 0.00 ? 21 PHE P C      1  
ATOM 1148  O O      . PHE C 3 21 ? -14.581 11.341  -3.344  1.00 0.00 ? 21 PHE P O      1  
ATOM 1149  C CB     . PHE C 3 21 ? -13.879 8.076   -3.440  1.00 0.00 ? 21 PHE P CB     1  
ATOM 1150  C CG     . PHE C 3 21 ? -13.422 8.529   -4.822  1.00 0.00 ? 21 PHE P CG     1  
ATOM 1151  C CD1    . PHE C 3 21 ? -14.264 8.463   -5.965  1.00 0.00 ? 21 PHE P CD1    1  
ATOM 1152  C CD2    . PHE C 3 21 ? -12.146 9.086   -4.857  1.00 0.00 ? 21 PHE P CD2    1  
ATOM 1153  C CE1    . PHE C 3 21 ? -13.851 9.072   -7.175  1.00 0.00 ? 21 PHE P CE1    1  
ATOM 1154  C CE2    . PHE C 3 21 ? -11.733 9.654   -6.105  1.00 0.00 ? 21 PHE P CE2    1  
ATOM 1155  C CZ     . PHE C 3 21 ? -12.553 9.574   -7.297  1.00 0.00 ? 21 PHE P CZ     1  
ATOM 1156  H H      . PHE C 3 21 ? -15.409 7.442   -1.604  1.00 0.00 ? 21 PHE P H      1  
ATOM 1157  H HA     . PHE C 3 21 ? -13.699 9.582   -1.988  1.00 0.00 ? 21 PHE P HA     1  
ATOM 1158  H HB2    . PHE C 3 21 ? -13.015 7.640   -2.939  1.00 0.00 ? 21 PHE P HB2    1  
ATOM 1159  H HB3    . PHE C 3 21 ? -14.665 7.366   -3.694  1.00 0.00 ? 21 PHE P HB3    1  
ATOM 1160  H HD1    . PHE C 3 21 ? -15.258 8.043   -5.899  1.00 0.00 ? 21 PHE P HD1    1  
ATOM 1161  H HD2    . PHE C 3 21 ? -11.450 8.989   -4.037  1.00 0.00 ? 21 PHE P HD2    1  
ATOM 1162  H HE1    . PHE C 3 21 ? -14.547 8.913   -7.985  1.00 0.00 ? 21 PHE P HE1    1  
ATOM 1163  H HE2    . PHE C 3 21 ? -10.804 10.203  -6.116  1.00 0.00 ? 21 PHE P HE2    1  
ATOM 1164  H HZ     . PHE C 3 21 ? -12.135 9.840   -8.256  1.00 0.00 ? 21 PHE P HZ     1  
ATOM 1165  N N      . LEU C 3 22 ? -16.392 10.048  -3.739  1.00 0.00 ? 22 LEU P N      1  
ATOM 1166  C CA     . LEU C 3 22 ? -17.074 11.054  -4.559  1.00 0.00 ? 22 LEU P CA     1  
ATOM 1167  C C      . LEU C 3 22 ? -17.126 12.400  -3.807  1.00 0.00 ? 22 LEU P C      1  
ATOM 1168  O O      . LEU C 3 22 ? -17.020 13.467  -4.443  1.00 0.00 ? 22 LEU P O      1  
ATOM 1169  C CB     . LEU C 3 22 ? -18.603 10.696  -4.912  1.00 0.00 ? 22 LEU P CB     1  
ATOM 1170  C CG     . LEU C 3 22 ? -18.796 9.440   -5.814  1.00 0.00 ? 22 LEU P CG     1  
ATOM 1171  C CD1    . LEU C 3 22 ? -20.252 9.285   -6.279  1.00 0.00 ? 22 LEU P CD1    1  
ATOM 1172  C CD2    . LEU C 3 22 ? -17.930 9.479   -7.077  1.00 0.00 ? 22 LEU P CD2    1  
ATOM 1173  H H      . LEU C 3 22 ? -16.775 9.113   -3.736  1.00 0.00 ? 22 LEU P H      1  
ATOM 1174  H HA     . LEU C 3 22 ? -16.552 11.214  -5.501  1.00 0.00 ? 22 LEU P HA     1  
ATOM 1175  H HB2    . LEU C 3 22 ? -19.023 10.483  -3.929  1.00 0.00 ? 22 LEU P HB2    1  
ATOM 1176  H HB3    . LEU C 3 22 ? -19.148 11.490  -5.423  1.00 0.00 ? 22 LEU P HB3    1  
ATOM 1177  H HG     . LEU C 3 22 ? -18.582 8.522   -5.268  1.00 0.00 ? 22 LEU P HG     1  
ATOM 1178  H HD11   . LEU C 3 22 ? -20.750 9.495   -5.333  1.00 0.00 ? 22 LEU P HD11   1  
ATOM 1179  H HD12   . LEU C 3 22 ? -20.327 8.230   -6.543  1.00 0.00 ? 22 LEU P HD12   1  
ATOM 1180  H HD13   . LEU C 3 22 ? -20.509 10.071  -6.989  1.00 0.00 ? 22 LEU P HD13   1  
ATOM 1181  H HD21   . LEU C 3 22 ? -16.868 9.548   -6.841  1.00 0.00 ? 22 LEU P HD21   1  
ATOM 1182  H HD22   . LEU C 3 22 ? -18.155 10.384  -7.641  1.00 0.00 ? 22 LEU P HD22   1  
ATOM 1183  H HD23   . LEU C 3 22 ? -17.973 8.532   -7.615  1.00 0.00 ? 22 LEU P HD23   1  
ATOM 1184  N N      . GLN C 3 23 ? -17.321 12.373  -2.466  1.00 0.00 ? 23 GLN P N      1  
ATOM 1185  C CA     . GLN C 3 23 ? -17.359 13.499  -1.628  1.00 0.00 ? 23 GLN P CA     1  
ATOM 1186  C C      . GLN C 3 23 ? -16.047 14.180  -1.310  1.00 0.00 ? 23 GLN P C      1  
ATOM 1187  O O      . GLN C 3 23 ? -15.992 15.348  -1.096  1.00 0.00 ? 23 GLN P O      1  
ATOM 1188  C CB     . GLN C 3 23 ? -18.093 13.172  -0.354  1.00 0.00 ? 23 GLN P CB     1  
ATOM 1189  C CG     . GLN C 3 23 ? -19.441 12.405  -0.408  1.00 0.00 ? 23 GLN P CG     1  
ATOM 1190  C CD     . GLN C 3 23 ? -20.557 12.941  -1.362  1.00 0.00 ? 23 GLN P CD     1  
ATOM 1191  O OE1    . GLN C 3 23 ? -20.990 14.114  -1.177  1.00 0.00 ? 23 GLN P OE1    1  
ATOM 1192  N NE2    . GLN C 3 23 ? -20.834 12.197  -2.396  1.00 0.00 ? 23 GLN P NE2    1  
ATOM 1193  H H      . GLN C 3 23 ? -17.321 11.476  -2.001  1.00 0.00 ? 23 GLN P H      1  
ATOM 1194  H HA     . GLN C 3 23 ? -18.016 14.212  -2.126  1.00 0.00 ? 23 GLN P HA     1  
ATOM 1195  H HB2    . GLN C 3 23 ? -17.398 12.553  0.214   1.00 0.00 ? 23 GLN P HB2    1  
ATOM 1196  H HB3    . GLN C 3 23 ? -18.326 14.163  0.036   1.00 0.00 ? 23 GLN P HB3    1  
ATOM 1197  H HG2    . GLN C 3 23 ? -19.258 11.363  -0.671  1.00 0.00 ? 23 GLN P HG2    1  
ATOM 1198  H HG3    . GLN C 3 23 ? -19.783 12.344  0.624   1.00 0.00 ? 23 GLN P HG3    1  
ATOM 1199  H HE21   . GLN C 3 23 ? -20.536 11.239  -2.515  1.00 0.00 ? 23 GLN P HE21   1  
ATOM 1200  H HE22   . GLN C 3 23 ? -21.476 12.658  -3.024  1.00 0.00 ? 23 GLN P HE22   1  
ATOM 1201  N N      . GLY C 3 24 ? -14.906 13.432  -1.424  1.00 0.00 ? 24 GLY P N      1  
ATOM 1202  C CA     . GLY C 3 24 ? -13.509 13.990  -1.377  1.00 0.00 ? 24 GLY P CA     1  
ATOM 1203  C C      . GLY C 3 24 ? -12.552 13.087  -2.153  1.00 0.00 ? 24 GLY P C      1  
ATOM 1204  O O      . GLY C 3 24 ? -12.094 12.071  -1.642  1.00 0.00 ? 24 GLY P O      1  
ATOM 1205  H H      . GLY C 3 24 ? -14.985 12.490  -1.782  1.00 0.00 ? 24 GLY P H      1  
ATOM 1206  H HA2    . GLY C 3 24 ? -13.477 15.017  -1.742  1.00 0.00 ? 24 GLY P HA2    1  
ATOM 1207  H HA3    . GLY C 3 24 ? -13.058 14.018  -0.385  1.00 0.00 ? 24 GLY P HA3    1  
ATOM 1208  N N      . ARG C 3 25 ? -12.300 13.408  -3.442  1.00 0.00 ? 25 ARG P N      1  
ATOM 1209  C CA     . ARG C 3 25 ? -11.533 12.641  -4.460  1.00 0.00 ? 25 ARG P CA     1  
ATOM 1210  C C      . ARG C 3 25 ? -10.003 12.537  -4.175  1.00 0.00 ? 25 ARG P C      1  
ATOM 1211  O O      . ARG C 3 25 ? -9.266  11.899  -4.926  1.00 0.00 ? 25 ARG P O      1  
ATOM 1212  C CB     . ARG C 3 25 ? -11.851 13.146  -5.913  1.00 0.00 ? 25 ARG P CB     1  
ATOM 1213  C CG     . ARG C 3 25 ? -13.319 12.829  -6.366  1.00 0.00 ? 25 ARG P CG     1  
ATOM 1214  C CD     . ARG C 3 25 ? -14.369 13.776  -5.716  1.00 0.00 ? 25 ARG P CD     1  
ATOM 1215  N NE     . ARG C 3 25 ? -14.095 15.193  -5.951  1.00 0.00 ? 25 ARG P NE     1  
ATOM 1216  C CZ     . ARG C 3 25 ? -14.831 16.252  -5.593  1.00 0.00 ? 25 ARG P CZ     1  
ATOM 1217  N NH1    . ARG C 3 25 ? -15.958 16.060  -5.004  1.00 0.00 ? 25 ARG P NH1    1  
ATOM 1218  N NH2    . ARG C 3 25 ? -14.409 17.431  -5.955  1.00 0.00 ? 25 ARG P NH2    1  
ATOM 1219  H H      . ARG C 3 25 ? -12.447 14.377  -3.683  1.00 0.00 ? 25 ARG P H      1  
ATOM 1220  H HA     . ARG C 3 25 ? -11.802 11.584  -4.460  1.00 0.00 ? 25 ARG P HA     1  
ATOM 1221  H HB2    . ARG C 3 25 ? -11.656 14.215  -5.829  1.00 0.00 ? 25 ARG P HB2    1  
ATOM 1222  H HB3    . ARG C 3 25 ? -11.179 12.637  -6.604  1.00 0.00 ? 25 ARG P HB3    1  
ATOM 1223  H HG2    . ARG C 3 25 ? -13.223 12.967  -7.444  1.00 0.00 ? 25 ARG P HG2    1  
ATOM 1224  H HG3    . ARG C 3 25 ? -13.592 11.788  -6.197  1.00 0.00 ? 25 ARG P HG3    1  
ATOM 1225  H HD2    . ARG C 3 25 ? -15.334 13.509  -6.146  1.00 0.00 ? 25 ARG P HD2    1  
ATOM 1226  H HD3    . ARG C 3 25 ? -14.500 13.591  -4.650  1.00 0.00 ? 25 ARG P HD3    1  
ATOM 1227  H HE     . ARG C 3 25 ? -13.359 15.446  -6.594  1.00 0.00 ? 25 ARG P HE     1  
ATOM 1228  H HH11   . ARG C 3 25 ? -16.307 15.136  -4.794  1.00 0.00 ? 25 ARG P HH11   1  
ATOM 1229  H HH12   . ARG C 3 25 ? -16.524 16.878  -4.827  1.00 0.00 ? 25 ARG P HH12   1  
ATOM 1230  H HH21   . ARG C 3 25 ? -13.506 17.380  -6.403  1.00 0.00 ? 25 ARG P HH21   1  
ATOM 1231  H HH22   . ARG C 3 25 ? -14.954 18.280  -5.888  1.00 0.00 ? 25 ARG P HH22   1  
ATOM 1232  N N      . TYR C 3 26 ? -9.548  13.165  -3.137  1.00 0.00 ? 26 TYR P N      1  
ATOM 1233  C CA     . TYR C 3 26 ? -8.145  13.172  -2.602  1.00 0.00 ? 26 TYR P CA     1  
ATOM 1234  C C      . TYR C 3 26 ? -8.219  12.860  -1.121  1.00 0.00 ? 26 TYR P C      1  
ATOM 1235  O O      . TYR C 3 26 ? -9.161  13.323  -0.426  1.00 0.00 ? 26 TYR P O      1  
ATOM 1236  C CB     . TYR C 3 26 ? -7.411  14.485  -2.828  1.00 0.00 ? 26 TYR P CB     1  
ATOM 1237  C CG     . TYR C 3 26 ? -7.224  14.777  -4.320  1.00 0.00 ? 26 TYR P CG     1  
ATOM 1238  C CD1    . TYR C 3 26 ? -8.376  15.033  -5.052  1.00 0.00 ? 26 TYR P CD1    1  
ATOM 1239  C CD2    . TYR C 3 26 ? -5.917  14.632  -4.969  1.00 0.00 ? 26 TYR P CD2    1  
ATOM 1240  C CE1    . TYR C 3 26 ? -8.357  15.084  -6.441  1.00 0.00 ? 26 TYR P CE1    1  
ATOM 1241  C CE2    . TYR C 3 26 ? -5.879  14.784  -6.359  1.00 0.00 ? 26 TYR P CE2    1  
ATOM 1242  C CZ     . TYR C 3 26 ? -7.075  14.975  -7.068  1.00 0.00 ? 26 TYR P CZ     1  
ATOM 1243  O OH     . TYR C 3 26 ? -7.126  15.109  -8.425  1.00 0.00 ? 26 TYR P OH     1  
ATOM 1244  H H      . TYR C 3 26 ? -10.173 13.855  -2.746  1.00 0.00 ? 26 TYR P H      1  
ATOM 1245  H HA     . TYR C 3 26 ? -7.575  12.433  -3.167  1.00 0.00 ? 26 TYR P HA     1  
ATOM 1246  H HB2    . TYR C 3 26 ? -7.953  15.311  -2.369  1.00 0.00 ? 26 TYR P HB2    1  
ATOM 1247  H HB3    . TYR C 3 26 ? -6.394  14.486  -2.437  1.00 0.00 ? 26 TYR P HB3    1  
ATOM 1248  H HD1    . TYR C 3 26 ? -9.317  15.218  -4.554  1.00 0.00 ? 26 TYR P HD1    1  
ATOM 1249  H HD2    . TYR C 3 26 ? -5.064  14.537  -4.314  1.00 0.00 ? 26 TYR P HD2    1  
ATOM 1250  H HE1    . TYR C 3 26 ? -9.191  15.377  -7.061  1.00 0.00 ? 26 TYR P HE1    1  
ATOM 1251  H HE2    . TYR C 3 26 ? -4.958  14.626  -6.901  1.00 0.00 ? 26 TYR P HE2    1  
ATOM 1252  H HH     . TYR C 3 26 ? -8.077  15.107  -8.555  1.00 0.00 ? 26 TYR P HH     1  
ATOM 1253  N N      . LEU C 3 27 ? -7.298  12.100  -0.509  1.00 0.00 ? 27 LEU P N      1  
ATOM 1254  C CA     . LEU C 3 27 ? -7.245  11.860  0.872   1.00 0.00 ? 27 LEU P CA     1  
ATOM 1255  C C      . LEU C 3 27 ? -6.494  12.930  1.698   1.00 0.00 ? 27 LEU P C      1  
ATOM 1256  O O      . LEU C 3 27 ? -5.472  13.574  1.395   1.00 0.00 ? 27 LEU P O      1  
ATOM 1257  C CB     . LEU C 3 27 ? -6.602  10.459  1.194   1.00 0.00 ? 27 LEU P CB     1  
ATOM 1258  C CG     . LEU C 3 27 ? -7.574  9.298   1.103   1.00 0.00 ? 27 LEU P CG     1  
ATOM 1259  C CD1    . LEU C 3 27 ? -6.859  7.945   1.052   1.00 0.00 ? 27 LEU P CD1    1  
ATOM 1260  C CD2    . LEU C 3 27 ? -8.649  9.244   2.211   1.00 0.00 ? 27 LEU P CD2    1  
ATOM 1261  H H      . LEU C 3 27 ? -6.400  11.939  -0.943  1.00 0.00 ? 27 LEU P H      1  
ATOM 1262  H HA     . LEU C 3 27 ? -8.257  11.846  1.274   1.00 0.00 ? 27 LEU P HA     1  
ATOM 1263  H HB2    . LEU C 3 27 ? -5.736  10.350  0.543   1.00 0.00 ? 27 LEU P HB2    1  
ATOM 1264  H HB3    . LEU C 3 27 ? -6.243  10.385  2.221   1.00 0.00 ? 27 LEU P HB3    1  
ATOM 1265  H HG     . LEU C 3 27 ? -8.123  9.484   0.180   1.00 0.00 ? 27 LEU P HG     1  
ATOM 1266  H HD11   . LEU C 3 27 ? -6.067  7.967   1.801   1.00 0.00 ? 27 LEU P HD11   1  
ATOM 1267  H HD12   . LEU C 3 27 ? -6.526  7.876   0.015   1.00 0.00 ? 27 LEU P HD12   1  
ATOM 1268  H HD13   . LEU C 3 27 ? -7.482  7.079   1.274   1.00 0.00 ? 27 LEU P HD13   1  
ATOM 1269  H HD21   . LEU C 3 27 ? -9.598  9.117   1.688   1.00 0.00 ? 27 LEU P HD21   1  
ATOM 1270  H HD22   . LEU C 3 27 ? -8.747  10.196  2.733   1.00 0.00 ? 27 LEU P HD22   1  
ATOM 1271  H HD23   . LEU C 3 27 ? -8.532  8.341   2.809   1.00 0.00 ? 27 LEU P HD23   1  
ATOM 1272  N N      . THR C 3 28 ? -7.044  12.979  2.884   1.00 0.00 ? 28 THR P N      1  
ATOM 1273  C CA     . THR C 3 28 ? -6.571  13.606  4.152   1.00 0.00 ? 28 THR P CA     1  
ATOM 1274  C C      . THR C 3 28 ? -6.950  12.695  5.285   1.00 0.00 ? 28 THR P C      1  
ATOM 1275  O O      . THR C 3 28 ? -7.822  11.806  5.169   1.00 0.00 ? 28 THR P O      1  
ATOM 1276  C CB     . THR C 3 28 ? -7.280  14.951  4.356   1.00 0.00 ? 28 THR P CB     1  
ATOM 1277  O OG1    . THR C 3 28 ? -8.637  14.908  4.425   1.00 0.00 ? 28 THR P OG1    1  
ATOM 1278  C CG2    . THR C 3 28 ? -6.950  15.919  3.255   1.00 0.00 ? 28 THR P CG2    1  
ATOM 1279  H H      . THR C 3 28 ? -7.920  12.495  3.028   1.00 0.00 ? 28 THR P H      1  
ATOM 1280  H HA     . THR C 3 28 ? -5.508  13.847  4.165   1.00 0.00 ? 28 THR P HA     1  
ATOM 1281  H HB     . THR C 3 28 ? -6.866  15.367  5.275   1.00 0.00 ? 28 THR P HB     1  
ATOM 1282  H HG1    . THR C 3 28 ? -8.891  15.804  4.193   1.00 0.00 ? 28 THR P HG1    1  
ATOM 1283  H HG21   . THR C 3 28 ? -7.256  15.581  2.266   1.00 0.00 ? 28 THR P HG21   1  
ATOM 1284  H HG22   . THR C 3 28 ? -5.865  16.028  3.238   1.00 0.00 ? 28 THR P HG22   1  
ATOM 1285  H HG23   . THR C 3 28 ? -7.288  16.942  3.424   1.00 0.00 ? 28 THR P HG23   1  
ATOM 1286  N N      . ALA C 3 29 ? -6.415  12.974  6.462   1.00 0.00 ? 29 ALA P N      1  
ATOM 1287  C CA     . ALA C 3 29 ? -6.709  12.305  7.733   1.00 0.00 ? 29 ALA P CA     1  
ATOM 1288  C C      . ALA C 3 29 ? -8.260  12.122  7.955   1.00 0.00 ? 29 ALA P C      1  
ATOM 1289  O O      . ALA C 3 29 ? -8.637  10.923  8.072   1.00 0.00 ? 29 ALA P O      1  
ATOM 1290  C CB     . ALA C 3 29 ? -5.910  12.848  8.922   1.00 0.00 ? 29 ALA P CB     1  
ATOM 1291  H H      . ALA C 3 29 ? -5.858  13.816  6.501   1.00 0.00 ? 29 ALA P H      1  
ATOM 1292  H HA     . ALA C 3 29 ? -6.341  11.282  7.657   1.00 0.00 ? 29 ALA P HA     1  
ATOM 1293  H HB1    . ALA C 3 29 ? -5.938  12.070  9.686   1.00 0.00 ? 29 ALA P HB1    1  
ATOM 1294  H HB2    . ALA C 3 29 ? -4.893  13.073  8.604   1.00 0.00 ? 29 ALA P HB2    1  
ATOM 1295  H HB3    . ALA C 3 29 ? -6.470  13.697  9.314   1.00 0.00 ? 29 ALA P HB3    1  
ATOM 1296  N N      . PRO C 3 30 ? -9.087  13.184  7.871   1.00 0.00 ? 30 PRO P N      1  
ATOM 1297  C CA     . PRO C 3 30 ? -10.537 13.111  7.998   1.00 0.00 ? 30 PRO P CA     1  
ATOM 1298  C C      . PRO C 3 30 ? -11.220 12.247  6.955   1.00 0.00 ? 30 PRO P C      1  
ATOM 1299  O O      . PRO C 3 30 ? -12.188 11.527  7.328   1.00 0.00 ? 30 PRO P O      1  
ATOM 1300  C CB     . PRO C 3 30 ? -11.123 14.544  8.051   1.00 0.00 ? 30 PRO P CB     1  
ATOM 1301  C CG     . PRO C 3 30 ? -9.968  15.366  7.484   1.00 0.00 ? 30 PRO P CG     1  
ATOM 1302  C CD     . PRO C 3 30 ? -8.706  14.580  8.012   1.00 0.00 ? 30 PRO P CD     1  
ATOM 1303  H HA     . PRO C 3 30 ? -10.681 12.739  9.013   1.00 0.00 ? 30 PRO P HA     1  
ATOM 1304  H HB2    . PRO C 3 30 ? -11.973 14.693  7.383   1.00 0.00 ? 30 PRO P HB2    1  
ATOM 1305  H HB3    . PRO C 3 30 ? -11.204 14.915  9.073   1.00 0.00 ? 30 PRO P HB3    1  
ATOM 1306  H HG2    . PRO C 3 30 ? -9.923  15.194  6.409   1.00 0.00 ? 30 PRO P HG2    1  
ATOM 1307  H HG3    . PRO C 3 30 ? -10.006 16.388  7.860   1.00 0.00 ? 30 PRO P HG3    1  
ATOM 1308  H HD2    . PRO C 3 30 ? -7.820  14.729  7.393   1.00 0.00 ? 30 PRO P HD2    1  
ATOM 1309  H HD3    . PRO C 3 30 ? -8.496  14.861  9.043   1.00 0.00 ? 30 PRO P HD3    1  
ATOM 1310  N N      . ARG C 3 31 ? -10.764 12.276  5.707   1.00 0.00 ? 31 ARG P N      1  
ATOM 1311  C CA     . ARG C 3 31 ? -11.354 11.408  4.603   1.00 0.00 ? 31 ARG P CA     1  
ATOM 1312  C C      . ARG C 3 31 ? -11.102 9.893   4.869   1.00 0.00 ? 31 ARG P C      1  
ATOM 1313  O O      . ARG C 3 31 ? -12.010 9.057   4.865   1.00 0.00 ? 31 ARG P O      1  
ATOM 1314  C CB     . ARG C 3 31 ? -10.801 11.824  3.250   1.00 0.00 ? 31 ARG P CB     1  
ATOM 1315  C CG     . ARG C 3 31 ? -11.465 12.937  2.519   1.00 0.00 ? 31 ARG P CG     1  
ATOM 1316  C CD     . ARG C 3 31 ? -11.954 14.115  3.397   1.00 0.00 ? 31 ARG P CD     1  
ATOM 1317  N NE     . ARG C 3 31 ? -12.674 15.134  2.634   1.00 0.00 ? 31 ARG P NE     1  
ATOM 1318  C CZ     . ARG C 3 31 ? -13.974 15.422  2.723   1.00 0.00 ? 31 ARG P CZ     1  
ATOM 1319  N NH1    . ARG C 3 31 ? -14.788 14.903  3.581   1.00 0.00 ? 31 ARG P NH1    1  
ATOM 1320  N NH2    . ARG C 3 31 ? -14.497 16.205  1.805   1.00 0.00 ? 31 ARG P NH2    1  
ATOM 1321  H H      . ARG C 3 31 ? -9.844  12.647  5.517   1.00 0.00 ? 31 ARG P H      1  
ATOM 1322  H HA     . ARG C 3 31 ? -12.404 11.687  4.517   1.00 0.00 ? 31 ARG P HA     1  
ATOM 1323  H HB2    . ARG C 3 31 ? -9.766  12.121  3.422   1.00 0.00 ? 31 ARG P HB2    1  
ATOM 1324  H HB3    . ARG C 3 31 ? -10.992 11.001  2.562   1.00 0.00 ? 31 ARG P HB3    1  
ATOM 1325  H HG2    . ARG C 3 31 ? -10.806 13.407  1.789   1.00 0.00 ? 31 ARG P HG2    1  
ATOM 1326  H HG3    . ARG C 3 31 ? -12.320 12.586  1.942   1.00 0.00 ? 31 ARG P HG3    1  
ATOM 1327  H HD2    . ARG C 3 31 ? -12.607 13.817  4.218   1.00 0.00 ? 31 ARG P HD2    1  
ATOM 1328  H HD3    . ARG C 3 31 ? -11.191 14.513  4.065   1.00 0.00 ? 31 ARG P HD3    1  
ATOM 1329  H HE     . ARG C 3 31 ? -12.226 15.608  1.863   1.00 0.00 ? 31 ARG P HE     1  
ATOM 1330  H HH11   . ARG C 3 31 ? -14.470 14.367  4.375   1.00 0.00 ? 31 ARG P HH11   1  
ATOM 1331  H HH12   . ARG C 3 31 ? -15.749 15.213  3.537   1.00 0.00 ? 31 ARG P HH12   1  
ATOM 1332  H HH21   . ARG C 3 31 ? -13.866 16.607  1.126   1.00 0.00 ? 31 ARG P HH21   1  
ATOM 1333  H HH22   . ARG C 3 31 ? -15.490 16.375  1.735   1.00 0.00 ? 31 ARG P HH22   1  
ATOM 1334  N N      . LEU C 3 32 ? -9.836  9.631   5.166   1.00 0.00 ? 32 LEU P N      1  
ATOM 1335  C CA     . LEU C 3 32 ? -9.201  8.377   5.588   1.00 0.00 ? 32 LEU P CA     1  
ATOM 1336  C C      . LEU C 3 32 ? -9.856  7.876   6.920   1.00 0.00 ? 32 LEU P C      1  
ATOM 1337  O O      . LEU C 3 32 ? -10.260 6.727   6.986   1.00 0.00 ? 32 LEU P O      1  
ATOM 1338  C CB     . LEU C 3 32 ? -7.639  8.724   5.693   1.00 0.00 ? 32 LEU P CB     1  
ATOM 1339  C CG     . LEU C 3 32 ? -6.571  7.616   5.856   1.00 0.00 ? 32 LEU P CG     1  
ATOM 1340  C CD1    . LEU C 3 32 ? -5.951  7.454   4.454   1.00 0.00 ? 32 LEU P CD1    1  
ATOM 1341  C CD2    . LEU C 3 32 ? -5.541  8.128   6.860   1.00 0.00 ? 32 LEU P CD2    1  
ATOM 1342  H H      . LEU C 3 32 ? -9.139  10.358  5.089   1.00 0.00 ? 32 LEU P H      1  
ATOM 1343  H HA     . LEU C 3 32 ? -9.283  7.651   4.780   1.00 0.00 ? 32 LEU P HA     1  
ATOM 1344  H HB2    . LEU C 3 32 ? -7.354  9.284   4.803   1.00 0.00 ? 32 LEU P HB2    1  
ATOM 1345  H HB3    . LEU C 3 32 ? -7.594  9.385   6.558   1.00 0.00 ? 32 LEU P HB3    1  
ATOM 1346  H HG     . LEU C 3 32 ? -7.011  6.688   6.220   1.00 0.00 ? 32 LEU P HG     1  
ATOM 1347  H HD11   . LEU C 3 32 ? -5.616  8.386   3.998   1.00 0.00 ? 32 LEU P HD11   1  
ATOM 1348  H HD12   . LEU C 3 32 ? -6.662  6.942   3.805   1.00 0.00 ? 32 LEU P HD12   1  
ATOM 1349  H HD13   . LEU C 3 32 ? -5.064  6.860   4.670   1.00 0.00 ? 32 LEU P HD13   1  
ATOM 1350  H HD21   . LEU C 3 32 ? -4.780  7.394   7.126   1.00 0.00 ? 32 LEU P HD21   1  
ATOM 1351  H HD22   . LEU C 3 32 ? -6.113  8.493   7.712   1.00 0.00 ? 32 LEU P HD22   1  
ATOM 1352  H HD23   . LEU C 3 32 ? -4.901  8.927   6.487   1.00 0.00 ? 32 LEU P HD23   1  
ATOM 1353  N N      . ALA C 3 33 ? -10.101 8.688   7.994   1.00 0.00 ? 33 ALA P N      1  
ATOM 1354  C CA     . ALA C 3 33 ? -10.779 8.208   9.267   1.00 0.00 ? 33 ALA P CA     1  
ATOM 1355  C C      . ALA C 3 33 ? -12.251 7.787   9.065   1.00 0.00 ? 33 ALA P C      1  
ATOM 1356  O O      . ALA C 3 33 ? -12.710 6.752   9.516   1.00 0.00 ? 33 ALA P O      1  
ATOM 1357  C CB     . ALA C 3 33 ? -10.700 9.399   10.256  1.00 0.00 ? 33 ALA P CB     1  
ATOM 1358  H H      . ALA C 3 33 ? -9.701  9.615   8.017   1.00 0.00 ? 33 ALA P H      1  
ATOM 1359  H HA     . ALA C 3 33 ? -10.214 7.408   9.744   1.00 0.00 ? 33 ALA P HA     1  
ATOM 1360  H HB1    . ALA C 3 33 ? -9.794  10.003  10.289  1.00 0.00 ? 33 ALA P HB1    1  
ATOM 1361  H HB2    . ALA C 3 33 ? -11.543 10.036  9.985   1.00 0.00 ? 33 ALA P HB2    1  
ATOM 1362  H HB3    . ALA C 3 33 ? -10.827 8.894   11.214  1.00 0.00 ? 33 ALA P HB3    1  
ATOM 1363  N N      . ASP C 3 34 ? -12.980 8.656   8.398   1.00 0.00 ? 34 ASP P N      1  
ATOM 1364  C CA     . ASP C 3 34 ? -14.359 8.416   7.974   1.00 0.00 ? 34 ASP P CA     1  
ATOM 1365  C C      . ASP C 3 34 ? -14.611 7.158   7.120   1.00 0.00 ? 34 ASP P C      1  
ATOM 1366  O O      . ASP C 3 34 ? -15.494 6.351   7.463   1.00 0.00 ? 34 ASP P O      1  
ATOM 1367  C CB     . ASP C 3 34 ? -14.782 9.685   7.255   1.00 0.00 ? 34 ASP P CB     1  
ATOM 1368  C CG     . ASP C 3 34 ? -16.180 9.654   6.806   1.00 0.00 ? 34 ASP P CG     1  
ATOM 1369  O OD1    . ASP C 3 34 ? -16.465 9.205   5.636   1.00 0.00 ? 34 ASP P OD1    1  
ATOM 1370  O OD2    . ASP C 3 34 ? -17.024 10.146  7.604   1.00 0.00 ? 34 ASP P OD2    1  
ATOM 1371  H H      . ASP C 3 34 ? -12.528 9.473   8.014   1.00 0.00 ? 34 ASP P H      1  
ATOM 1372  H HA     . ASP C 3 34 ? -15.005 8.136   8.806   1.00 0.00 ? 34 ASP P HA     1  
ATOM 1373  H HB2    . ASP C 3 34 ? -14.625 10.595  7.836   1.00 0.00 ? 34 ASP P HB2    1  
ATOM 1374  H HB3    . ASP C 3 34 ? -14.167 9.750   6.358   1.00 0.00 ? 34 ASP P HB3    1  
ATOM 1375  N N      . LEU C 3 35 ? -13.800 6.904   6.124   1.00 0.00 ? 35 LEU P N      1  
ATOM 1376  C CA     . LEU C 3 35 ? -13.849 5.680   5.326   1.00 0.00 ? 35 LEU P CA     1  
ATOM 1377  C C      . LEU C 3 35 ? -13.440 4.447   6.106   1.00 0.00 ? 35 LEU P C      1  
ATOM 1378  O O      . LEU C 3 35 ? -13.969 3.343   5.962   1.00 0.00 ? 35 LEU P O      1  
ATOM 1379  C CB     . LEU C 3 35 ? -13.078 5.817   3.960   1.00 0.00 ? 35 LEU P CB     1  
ATOM 1380  C CG     . LEU C 3 35 ? -13.818 5.281   2.689   1.00 0.00 ? 35 LEU P CG     1  
ATOM 1381  C CD1    . LEU C 3 35 ? -15.364 5.025   2.818   1.00 0.00 ? 35 LEU P CD1    1  
ATOM 1382  C CD2    . LEU C 3 35 ? -13.564 6.268   1.532   1.00 0.00 ? 35 LEU P CD2    1  
ATOM 1383  H H      . LEU C 3 35 ? -13.278 7.681   5.745   1.00 0.00 ? 35 LEU P H      1  
ATOM 1384  H HA     . LEU C 3 35 ? -14.919 5.592   5.141   1.00 0.00 ? 35 LEU P HA     1  
ATOM 1385  H HB2    . LEU C 3 35 ? -12.699 6.831   3.830   1.00 0.00 ? 35 LEU P HB2    1  
ATOM 1386  H HB3    . LEU C 3 35 ? -12.199 5.175   4.010   1.00 0.00 ? 35 LEU P HB3    1  
ATOM 1387  H HG     . LEU C 3 35 ? -13.330 4.340   2.432   1.00 0.00 ? 35 LEU P HG     1  
ATOM 1388  H HD11   . LEU C 3 35 ? -15.436 4.229   3.559   1.00 0.00 ? 35 LEU P HD11   1  
ATOM 1389  H HD12   . LEU C 3 35 ? -15.798 4.760   1.854   1.00 0.00 ? 35 LEU P HD12   1  
ATOM 1390  H HD13   . LEU C 3 35 ? -15.867 5.924   3.173   1.00 0.00 ? 35 LEU P HD13   1  
ATOM 1391  H HD21   . LEU C 3 35 ? -12.518 6.402   1.259   1.00 0.00 ? 35 LEU P HD21   1  
ATOM 1392  H HD22   . LEU C 3 35 ? -14.003 7.228   1.802   1.00 0.00 ? 35 LEU P HD22   1  
ATOM 1393  H HD23   . LEU C 3 35 ? -14.080 5.827   0.679   1.00 0.00 ? 35 LEU P HD23   1  
ATOM 1394  N N      . SER C 3 36 ? -12.440 4.624   7.034   1.00 0.00 ? 36 SER P N      1  
ATOM 1395  C CA     . SER C 3 36 ? -11.938 3.499   7.891   1.00 0.00 ? 36 SER P CA     1  
ATOM 1396  C C      . SER C 3 36 ? -13.076 2.959   8.791   1.00 0.00 ? 36 SER P C      1  
ATOM 1397  O O      . SER C 3 36 ? -13.153 1.793   9.140   1.00 0.00 ? 36 SER P O      1  
ATOM 1398  C CB     . SER C 3 36 ? -10.540 3.827   8.582   1.00 0.00 ? 36 SER P CB     1  
ATOM 1399  O OG     . SER C 3 36 ? -10.289 3.110   9.740   1.00 0.00 ? 36 SER P OG     1  
ATOM 1400  H H      . SER C 3 36 ? -11.931 5.496   7.080   1.00 0.00 ? 36 SER P H      1  
ATOM 1401  H HA     . SER C 3 36 ? -11.706 2.693   7.195   1.00 0.00 ? 36 SER P HA     1  
ATOM 1402  H HB2    . SER C 3 36 ? -9.773  3.594   7.844   1.00 0.00 ? 36 SER P HB2    1  
ATOM 1403  H HB3    . SER C 3 36 ? -10.492 4.909   8.704   1.00 0.00 ? 36 SER P HB3    1  
ATOM 1404  H HG     . SER C 3 36 ? -10.272 2.202   9.428   1.00 0.00 ? 36 SER P HG     1  
ATOM 1405  N N      . ALA C 3 37 ? -13.851 3.859   9.372   1.00 0.00 ? 37 ALA P N      1  
ATOM 1406  C CA     . ALA C 3 37 ? -15.010 3.481   10.208  1.00 0.00 ? 37 ALA P CA     1  
ATOM 1407  C C      . ALA C 3 37 ? -16.102 2.790   9.329   1.00 0.00 ? 37 ALA P C      1  
ATOM 1408  O O      . ALA C 3 37 ? -16.725 1.800   9.802   1.00 0.00 ? 37 ALA P O      1  
ATOM 1409  C CB     . ALA C 3 37 ? -15.694 4.753   11.001  1.00 0.00 ? 37 ALA P CB     1  
ATOM 1410  H H      . ALA C 3 37 ? -13.613 4.840   9.355   1.00 0.00 ? 37 ALA P H      1  
ATOM 1411  H HA     . ALA C 3 37 ? -14.722 2.696   10.907  1.00 0.00 ? 37 ALA P HA     1  
ATOM 1412  H HB1    . ALA C 3 37 ? -16.583 4.325   11.466  1.00 0.00 ? 37 ALA P HB1    1  
ATOM 1413  H HB2    . ALA C 3 37 ? -15.027 5.318   11.651  1.00 0.00 ? 37 ALA P HB2    1  
ATOM 1414  H HB3    . ALA C 3 37 ? -16.123 5.449   10.282  1.00 0.00 ? 37 ALA P HB3    1  
ATOM 1415  N N      . LYS C 3 38 ? -16.369 3.271   8.157   1.00 0.00 ? 38 LYS P N      1  
ATOM 1416  C CA     . LYS C 3 38 ? -17.481 2.806   7.338   1.00 0.00 ? 38 LYS P CA     1  
ATOM 1417  C C      . LYS C 3 38 ? -17.225 1.496   6.584   1.00 0.00 ? 38 LYS P C      1  
ATOM 1418  O O      . LYS C 3 38 ? -18.090 0.634   6.540   1.00 0.00 ? 38 LYS P O      1  
ATOM 1419  C CB     . LYS C 3 38 ? -18.035 3.911   6.448   1.00 0.00 ? 38 LYS P CB     1  
ATOM 1420  C CG     . LYS C 3 38 ? -18.727 4.906   7.358   1.00 0.00 ? 38 LYS P CG     1  
ATOM 1421  C CD     . LYS C 3 38 ? -19.371 5.863   6.369   1.00 0.00 ? 38 LYS P CD     1  
ATOM 1422  C CE     . LYS C 3 38 ? -18.449 7.060   6.215   1.00 0.00 ? 38 LYS P CE     1  
ATOM 1423  N NZ     . LYS C 3 38 ? -19.054 8.173   5.454   1.00 0.00 ? 38 LYS P NZ     1  
ATOM 1424  H H      . LYS C 3 38 ? -15.813 4.027   7.786   1.00 0.00 ? 38 LYS P H      1  
ATOM 1425  H HA     . LYS C 3 38 ? -18.287 2.492   8.002   1.00 0.00 ? 38 LYS P HA     1  
ATOM 1426  H HB2    . LYS C 3 38 ? -17.259 4.392   5.853   1.00 0.00 ? 38 LYS P HB2    1  
ATOM 1427  H HB3    . LYS C 3 38 ? -18.766 3.464   5.775   1.00 0.00 ? 38 LYS P HB3    1  
ATOM 1428  H HG2    . LYS C 3 38 ? -19.506 4.314   7.839   1.00 0.00 ? 38 LYS P HG2    1  
ATOM 1429  H HG3    . LYS C 3 38 ? -18.076 5.391   8.086   1.00 0.00 ? 38 LYS P HG3    1  
ATOM 1430  H HD2    . LYS C 3 38 ? -19.519 5.398   5.395   1.00 0.00 ? 38 LYS P HD2    1  
ATOM 1431  H HD3    . LYS C 3 38 ? -20.357 6.229   6.656   1.00 0.00 ? 38 LYS P HD3    1  
ATOM 1432  H HE2    . LYS C 3 38 ? -18.163 7.320   7.234   1.00 0.00 ? 38 LYS P HE2    1  
ATOM 1433  H HE3    . LYS C 3 38 ? -17.620 6.645   5.641   1.00 0.00 ? 38 LYS P HE3    1  
ATOM 1434  H HZ1    . LYS C 3 38 ? -19.345 7.842   4.545   1.00 0.00 ? 38 LYS P HZ1    1  
ATOM 1435  H HZ2    . LYS C 3 38 ? -18.305 8.850   5.478   1.00 0.00 ? 38 LYS P HZ2    1  
ATOM 1436  H HZ3    . LYS C 3 38 ? -19.878 8.607   5.845   1.00 0.00 ? 38 LYS P HZ3    1  
ATOM 1437  N N      . LEU C 3 39 ? -16.041 1.396   5.976   1.00 0.00 ? 39 LEU P N      1  
ATOM 1438  C CA     . LEU C 3 39 ? -15.589 0.159   5.299   1.00 0.00 ? 39 LEU P CA     1  
ATOM 1439  C C      . LEU C 3 39 ? -15.348 -0.917  6.368   1.00 0.00 ? 39 LEU P C      1  
ATOM 1440  O O      . LEU C 3 39 ? -15.471 -2.103  6.137   1.00 0.00 ? 39 LEU P O      1  
ATOM 1441  C CB     . LEU C 3 39 ? -14.230 0.339   4.636   1.00 0.00 ? 39 LEU P CB     1  
ATOM 1442  C CG     . LEU C 3 39 ? -14.055 1.109   3.317   1.00 0.00 ? 39 LEU P CG     1  
ATOM 1443  C CD1    . LEU C 3 39 ? -12.555 1.561   3.427   1.00 0.00 ? 39 LEU P CD1    1  
ATOM 1444  C CD2    . LEU C 3 39 ? -14.414 0.053   2.394   1.00 0.00 ? 39 LEU P CD2    1  
ATOM 1445  H H      . LEU C 3 39 ? -15.427 2.197   5.997   1.00 0.00 ? 39 LEU P H      1  
ATOM 1446  H HA     . LEU C 3 39 ? -16.302 -0.268  4.594   1.00 0.00 ? 39 LEU P HA     1  
ATOM 1447  H HB2    . LEU C 3 39 ? -13.633 0.811   5.416   1.00 0.00 ? 39 LEU P HB2    1  
ATOM 1448  H HB3    . LEU C 3 39 ? -13.852 -0.683  4.594   1.00 0.00 ? 39 LEU P HB3    1  
ATOM 1449  H HG     . LEU C 3 39 ? -14.765 1.929   3.213   1.00 0.00 ? 39 LEU P HG     1  
ATOM 1450  H HD11   . LEU C 3 39 ? -12.481 2.632   3.617   1.00 0.00 ? 39 LEU P HD11   1  
ATOM 1451  H HD12   . LEU C 3 39 ? -12.000 1.319   2.521   1.00 0.00 ? 39 LEU P HD12   1  
ATOM 1452  H HD13   . LEU C 3 39 ? -12.011 1.008   4.192   1.00 0.00 ? 39 LEU P HD13   1  
ATOM 1453  H HD21   . LEU C 3 39 ? -15.318 -0.437  2.756   1.00 0.00 ? 39 LEU P HD21   1  
ATOM 1454  H HD22   . LEU C 3 39 ? -13.555 -0.572  2.153   1.00 0.00 ? 39 LEU P HD22   1  
ATOM 1455  H HD23   . LEU C 3 39 ? -14.695 0.396   1.398   1.00 0.00 ? 39 LEU P HD23   1  
ATOM 1456  N N      . ALA C 3 40 ? -15.041 -0.461  7.604   1.00 0.00 ? 40 ALA P N      1  
ATOM 1457  C CA     . ALA C 3 40 ? -14.457 -1.292  8.631   1.00 0.00 ? 40 ALA P CA     1  
ATOM 1458  C C      . ALA C 3 40 ? -13.042 -1.878  8.326   1.00 0.00 ? 40 ALA P C      1  
ATOM 1459  O O      . ALA C 3 40 ? -12.750 -3.100  8.553   1.00 0.00 ? 40 ALA P O      1  
ATOM 1460  C CB     . ALA C 3 40 ? -15.436 -2.272  9.318   1.00 0.00 ? 40 ALA P CB     1  
ATOM 1461  H H      . ALA C 3 40 ? -14.855 0.527   7.693   1.00 0.00 ? 40 ALA P H      1  
ATOM 1462  H HA     . ALA C 3 40 ? -14.302 -0.583  9.444   1.00 0.00 ? 40 ALA P HA     1  
ATOM 1463  H HB1    . ALA C 3 40 ? -16.269 -1.635  9.615   1.00 0.00 ? 40 ALA P HB1    1  
ATOM 1464  H HB2    . ALA C 3 40 ? -15.873 -2.909  8.549   1.00 0.00 ? 40 ALA P HB2    1  
ATOM 1465  H HB3    . ALA C 3 40 ? -14.981 -2.790  10.163  1.00 0.00 ? 40 ALA P HB3    1  
ATOM 1466  N N      . LEU C 3 41 ? -12.141 -1.008  7.786   1.00 0.00 ? 41 LEU P N      1  
ATOM 1467  C CA     . LEU C 3 41 ? -10.744 -1.266  7.310   1.00 0.00 ? 41 LEU P CA     1  
ATOM 1468  C C      . LEU C 3 41 ? -9.899  -0.284  7.966   1.00 0.00 ? 41 LEU P C      1  
ATOM 1469  O O      . LEU C 3 41 ? -10.312 0.887   8.126   1.00 0.00 ? 41 LEU P O      1  
ATOM 1470  C CB     . LEU C 3 41 ? -10.515 -1.059  5.839   1.00 0.00 ? 41 LEU P CB     1  
ATOM 1471  C CG     . LEU C 3 41 ? -11.155 -2.133  4.960   1.00 0.00 ? 41 LEU P CG     1  
ATOM 1472  C CD1    . LEU C 3 41 ? -10.528 -2.012  3.510   1.00 0.00 ? 41 LEU P CD1    1  
ATOM 1473  C CD2    . LEU C 3 41 ? -10.941 -3.510  5.516   1.00 0.00 ? 41 LEU P CD2    1  
ATOM 1474  H H      . LEU C 3 41 ? -12.390 -0.030  7.787   1.00 0.00 ? 41 LEU P H      1  
ATOM 1475  H HA     . LEU C 3 41 ? -10.291 -2.206  7.622   1.00 0.00 ? 41 LEU P HA     1  
ATOM 1476  H HB2    . LEU C 3 41 ? -10.768 -0.085  5.419   1.00 0.00 ? 41 LEU P HB2    1  
ATOM 1477  H HB3    . LEU C 3 41 ? -9.440  -1.122  5.673   1.00 0.00 ? 41 LEU P HB3    1  
ATOM 1478  H HG     . LEU C 3 41 ? -12.231 -1.991  4.858   1.00 0.00 ? 41 LEU P HG     1  
ATOM 1479  H HD11   . LEU C 3 41 ? -9.458  -2.154  3.666   1.00 0.00 ? 41 LEU P HD11   1  
ATOM 1480  H HD12   . LEU C 3 41 ? -10.711 -0.999  3.155   1.00 0.00 ? 41 LEU P HD12   1  
ATOM 1481  H HD13   . LEU C 3 41 ? -10.930 -2.759  2.826   1.00 0.00 ? 41 LEU P HD13   1  
ATOM 1482  H HD21   . LEU C 3 41 ? -9.892  -3.565  5.804   1.00 0.00 ? 41 LEU P HD21   1  
ATOM 1483  H HD22   . LEU C 3 41 ? -11.181 -4.257  4.760   1.00 0.00 ? 41 LEU P HD22   1  
ATOM 1484  H HD23   . LEU C 3 41 ? -11.694 -3.779  6.256   1.00 0.00 ? 41 LEU P HD23   1  
ATOM 1485  N N      . GLY C 3 42 ? -8.595  -0.516  8.181   1.00 0.00 ? 42 GLY P N      1  
ATOM 1486  C CA     . GLY C 3 42 ? -7.561  0.490   8.586   1.00 0.00 ? 42 GLY P CA     1  
ATOM 1487  C C      . GLY C 3 42 ? -7.481  1.744   7.663   1.00 0.00 ? 42 GLY P C      1  
ATOM 1488  O O      . GLY C 3 42 ? -7.470  1.675   6.424   1.00 0.00 ? 42 GLY P O      1  
ATOM 1489  H H      . GLY C 3 42 ? -8.336  -1.468  7.963   1.00 0.00 ? 42 GLY P H      1  
ATOM 1490  H HA2    . GLY C 3 42 ? -7.759  0.737   9.629   1.00 0.00 ? 42 GLY P HA2    1  
ATOM 1491  H HA3    . GLY C 3 42 ? -6.671  -0.121  8.436   1.00 0.00 ? 42 GLY P HA3    1  
ATOM 1492  N N      . THR C 3 43 ? -6.974  2.794   8.265   1.00 0.00 ? 43 THR P N      1  
ATOM 1493  C CA     . THR C 3 43 ? -6.697  4.070   7.528   1.00 0.00 ? 43 THR P CA     1  
ATOM 1494  C C      . THR C 3 43 ? -5.596  3.942   6.494   1.00 0.00 ? 43 THR P C      1  
ATOM 1495  O O      . THR C 3 43 ? -5.610  4.696   5.485   1.00 0.00 ? 43 THR P O      1  
ATOM 1496  C CB     . THR C 3 43 ? -6.330  5.231   8.394   1.00 0.00 ? 43 THR P CB     1  
ATOM 1497  O OG1    . THR C 3 43 ? -5.472  4.851   9.426   1.00 0.00 ? 43 THR P OG1    1  
ATOM 1498  C CG2    . THR C 3 43 ? -7.617  5.790   8.967   1.00 0.00 ? 43 THR P CG2    1  
ATOM 1499  H H      . THR C 3 43 ? -6.925  2.697   9.270   1.00 0.00 ? 43 THR P H      1  
ATOM 1500  H HA     . THR C 3 43 ? -7.565  4.477   7.008   1.00 0.00 ? 43 THR P HA     1  
ATOM 1501  H HB     . THR C 3 43 ? -5.766  5.972   7.827   1.00 0.00 ? 43 THR P HB     1  
ATOM 1502  H HG1    . THR C 3 43 ? -5.212  5.660   9.873   1.00 0.00 ? 43 THR P HG1    1  
ATOM 1503  H HG21   . THR C 3 43 ? -7.421  6.718   9.505   1.00 0.00 ? 43 THR P HG21   1  
ATOM 1504  H HG22   . THR C 3 43 ? -8.040  5.073   9.672   1.00 0.00 ? 43 THR P HG22   1  
ATOM 1505  H HG23   . THR C 3 43 ? -8.318  6.077   8.184   1.00 0.00 ? 43 THR P HG23   1  
ATOM 1506  N N      . ALA C 3 44 ? -4.691  2.977   6.613   1.00 0.00 ? 44 ALA P N      1  
ATOM 1507  C CA     . ALA C 3 44 ? -3.662  2.712   5.595   1.00 0.00 ? 44 ALA P CA     1  
ATOM 1508  C C      . ALA C 3 44 ? -4.158  2.066   4.251   1.00 0.00 ? 44 ALA P C      1  
ATOM 1509  O O      . ALA C 3 44 ? -3.665  2.365   3.178   1.00 0.00 ? 44 ALA P O      1  
ATOM 1510  C CB     . ALA C 3 44 ? -2.583  1.828   6.225   1.00 0.00 ? 44 ALA P CB     1  
ATOM 1511  H H      . ALA C 3 44 ? -4.661  2.544   7.525   1.00 0.00 ? 44 ALA P H      1  
ATOM 1512  H HA     . ALA C 3 44 ? -3.217  3.674   5.340   1.00 0.00 ? 44 ALA P HA     1  
ATOM 1513  H HB1    . ALA C 3 44 ? -2.944  0.815   6.408   1.00 0.00 ? 44 ALA P HB1    1  
ATOM 1514  H HB2    . ALA C 3 44 ? -1.690  1.718   5.611   1.00 0.00 ? 44 ALA P HB2    1  
ATOM 1515  H HB3    . ALA C 3 44 ? -2.350  2.246   7.203   1.00 0.00 ? 44 ALA P HB3    1  
ATOM 1516  N N      . GLN C 3 45 ? -5.101  1.145   4.370   1.00 0.00 ? 45 GLN P N      1  
ATOM 1517  C CA     . GLN C 3 45 ? -5.742  0.652   3.218   1.00 0.00 ? 45 GLN P CA     1  
ATOM 1518  C C      . GLN C 3 45 ? -6.472  1.756   2.439   1.00 0.00 ? 45 GLN P C      1  
ATOM 1519  O O      . GLN C 3 45 ? -6.347  1.675   1.224   1.00 0.00 ? 45 GLN P O      1  
ATOM 1520  C CB     . GLN C 3 45 ? -6.769  -0.446  3.613   1.00 0.00 ? 45 GLN P CB     1  
ATOM 1521  C CG     . GLN C 3 45 ? -6.053  -1.857  3.831   1.00 0.00 ? 45 GLN P CG     1  
ATOM 1522  C CD     . GLN C 3 45 ? -5.035  -1.856  4.974   1.00 0.00 ? 45 GLN P CD     1  
ATOM 1523  O OE1    . GLN C 3 45 ? -3.824  -1.998  4.844   1.00 0.00 ? 45 GLN P OE1    1  
ATOM 1524  N NE2    . GLN C 3 45 ? -5.440  -1.655  6.168   1.00 0.00 ? 45 GLN P NE2    1  
ATOM 1525  H H      . GLN C 3 45 ? -5.332  0.802   5.292   1.00 0.00 ? 45 GLN P H      1  
ATOM 1526  H HA     . GLN C 3 45 ? -4.962  0.353   2.517   1.00 0.00 ? 45 GLN P HA     1  
ATOM 1527  H HB2    . GLN C 3 45 ? -7.359  -0.078  4.453   1.00 0.00 ? 45 GLN P HB2    1  
ATOM 1528  H HB3    . GLN C 3 45 ? -7.515  -0.581  2.830   1.00 0.00 ? 45 GLN P HB3    1  
ATOM 1529  H HG2    . GLN C 3 45 ? -6.838  -2.540  4.158   1.00 0.00 ? 45 GLN P HG2    1  
ATOM 1530  H HG3    . GLN C 3 45 ? -5.601  -2.233  2.915   1.00 0.00 ? 45 GLN P HG3    1  
ATOM 1531  H HE21   . GLN C 3 45 ? -6.424  -1.547  6.368   1.00 0.00 ? 45 GLN P HE21   1  
ATOM 1532  H HE22   . GLN C 3 45 ? -4.809  -1.655  6.956   1.00 0.00 ? 45 GLN P HE22   1  
ATOM 1533  N N      . VAL C 3 46 ? -7.082  2.835   3.038   1.00 0.00 ? 46 VAL P N      1  
ATOM 1534  C CA     . VAL C 3 46 ? -7.810  3.828   2.264   1.00 0.00 ? 46 VAL P CA     1  
ATOM 1535  C C      . VAL C 3 46 ? -6.924  4.563   1.355   1.00 0.00 ? 46 VAL P C      1  
ATOM 1536  O O      . VAL C 3 46 ? -7.205  4.489   0.155   1.00 0.00 ? 46 VAL P O      1  
ATOM 1537  C CB     . VAL C 3 46 ? -8.701  4.743   3.094   1.00 0.00 ? 46 VAL P CB     1  
ATOM 1538  C CG1    . VAL C 3 46 ? -9.724  5.530   2.188   1.00 0.00 ? 46 VAL P CG1    1  
ATOM 1539  C CG2    . VAL C 3 46 ? -9.536  4.063   4.227   1.00 0.00 ? 46 VAL P CG2    1  
ATOM 1540  H H      . VAL C 3 46 ? -7.045  2.958   4.040   1.00 0.00 ? 46 VAL P H      1  
ATOM 1541  H HA     . VAL C 3 46 ? -8.464  3.179   1.681   1.00 0.00 ? 46 VAL P HA     1  
ATOM 1542  H HB     . VAL C 3 46 ? -8.082  5.497   3.583   1.00 0.00 ? 46 VAL P HB     1  
ATOM 1543  H HG11   . VAL C 3 46 ? -10.565 4.909   1.879   1.00 0.00 ? 46 VAL P HG11   1  
ATOM 1544  H HG12   . VAL C 3 46 ? -10.135 6.397   2.706   1.00 0.00 ? 46 VAL P HG12   1  
ATOM 1545  H HG13   . VAL C 3 46 ? -9.200  5.961   1.335   1.00 0.00 ? 46 VAL P HG13   1  
ATOM 1546  H HG21   . VAL C 3 46 ? -10.215 4.675   4.821   1.00 0.00 ? 46 VAL P HG21   1  
ATOM 1547  H HG22   . VAL C 3 46 ? -10.122 3.234   3.830   1.00 0.00 ? 46 VAL P HG22   1  
ATOM 1548  H HG23   . VAL C 3 46 ? -8.832  3.541   4.875   1.00 0.00 ? 46 VAL P HG23   1  
ATOM 1549  N N      . LYS C 3 47 ? -5.772  5.098   1.846   1.00 0.00 ? 47 LYS P N      1  
ATOM 1550  C CA     . LYS C 3 47 ? -4.678  5.623   1.031   1.00 0.00 ? 47 LYS P CA     1  
ATOM 1551  C C      . LYS C 3 47 ? -4.336  4.660   -0.093  1.00 0.00 ? 47 LYS P C      1  
ATOM 1552  O O      . LYS C 3 47 ? -4.321  5.075   -1.221  1.00 0.00 ? 47 LYS P O      1  
ATOM 1553  C CB     . LYS C 3 47 ? -3.538  5.876   2.025   1.00 0.00 ? 47 LYS P CB     1  
ATOM 1554  C CG     . LYS C 3 47 ? -3.160  7.362   2.288   1.00 0.00 ? 47 LYS P CG     1  
ATOM 1555  C CD     . LYS C 3 47 ? -2.631  7.591   3.724   1.00 0.00 ? 47 LYS P CD     1  
ATOM 1556  C CE     . LYS C 3 47 ? -2.270  6.413   4.689   1.00 0.00 ? 47 LYS P CE     1  
ATOM 1557  N NZ     . LYS C 3 47 ? -1.624  7.037   5.908   1.00 0.00 ? 47 LYS P NZ     1  
ATOM 1558  H H      . LYS C 3 47 ? -5.665  5.107   2.850   1.00 0.00 ? 47 LYS P H      1  
ATOM 1559  H HA     . LYS C 3 47 ? -4.963  6.559   0.551   1.00 0.00 ? 47 LYS P HA     1  
ATOM 1560  H HB2    . LYS C 3 47 ? -3.667  5.362   2.977   1.00 0.00 ? 47 LYS P HB2    1  
ATOM 1561  H HB3    . LYS C 3 47 ? -2.647  5.516   1.510   1.00 0.00 ? 47 LYS P HB3    1  
ATOM 1562  H HG2    . LYS C 3 47 ? -2.412  7.639   1.546   1.00 0.00 ? 47 LYS P HG2    1  
ATOM 1563  H HG3    . LYS C 3 47 ? -4.068  7.955   2.178   1.00 0.00 ? 47 LYS P HG3    1  
ATOM 1564  H HD2    . LYS C 3 47 ? -1.700  8.150   3.635   1.00 0.00 ? 47 LYS P HD2    1  
ATOM 1565  H HD3    . LYS C 3 47 ? -3.392  8.116   4.300   1.00 0.00 ? 47 LYS P HD3    1  
ATOM 1566  H HE2    . LYS C 3 47 ? -3.211  5.911   4.909   1.00 0.00 ? 47 LYS P HE2    1  
ATOM 1567  H HE3    . LYS C 3 47 ? -1.618  5.698   4.186   1.00 0.00 ? 47 LYS P HE3    1  
ATOM 1568  H HZ1    . LYS C 3 47 ? -1.778  8.034   5.951   1.00 0.00 ? 47 LYS P HZ1    1  
ATOM 1569  H HZ2    . LYS C 3 47 ? -0.660  6.767   6.043   1.00 0.00 ? 47 LYS P HZ2    1  
ATOM 1570  H HZ3    . LYS C 3 47 ? -1.964  6.688   6.793   1.00 0.00 ? 47 LYS P HZ3    1  
ATOM 1571  N N      . ILE C 3 48 ? -4.062  3.406   0.214   1.00 0.00 ? 48 ILE P N      1  
ATOM 1572  C CA     . ILE C 3 48 ? -3.535  2.452   -0.737  1.00 0.00 ? 48 ILE P CA     1  
ATOM 1573  C C      . ILE C 3 48 ? -4.632  2.231   -1.797  1.00 0.00 ? 48 ILE P C      1  
ATOM 1574  O O      . ILE C 3 48 ? -4.254  1.901   -2.931  1.00 0.00 ? 48 ILE P O      1  
ATOM 1575  C CB     . ILE C 3 48 ? -3.012  1.168   -0.058  1.00 0.00 ? 48 ILE P CB     1  
ATOM 1576  C CG1    . ILE C 3 48 ? -1.797  1.545   0.838   1.00 0.00 ? 48 ILE P CG1    1  
ATOM 1577  C CG2    . ILE C 3 48 ? -2.653  0.068   -1.078  1.00 0.00 ? 48 ILE P CG2    1  
ATOM 1578  C CD1    . ILE C 3 48 ? -1.509  0.376   1.757   1.00 0.00 ? 48 ILE P CD1    1  
ATOM 1579  H H      . ILE C 3 48 ? -4.048  3.168   1.195   1.00 0.00 ? 48 ILE P H      1  
ATOM 1580  H HA     . ILE C 3 48 ? -2.700  2.877   -1.294  1.00 0.00 ? 48 ILE P HA     1  
ATOM 1581  H HB     . ILE C 3 48 ? -3.834  0.774   0.539   1.00 0.00 ? 48 ILE P HB     1  
ATOM 1582  H HG12   . ILE C 3 48 ? -0.950  1.733   0.178   1.00 0.00 ? 48 ILE P HG12   1  
ATOM 1583  H HG13   . ILE C 3 48 ? -1.994  2.459   1.397   1.00 0.00 ? 48 ILE P HG13   1  
ATOM 1584  H HG21   . ILE C 3 48 ? -2.021  0.556   -1.820  1.00 0.00 ? 48 ILE P HG21   1  
ATOM 1585  H HG22   . ILE C 3 48 ? -2.311  -0.888  -0.682  1.00 0.00 ? 48 ILE P HG22   1  
ATOM 1586  H HG23   . ILE C 3 48 ? -3.482  -0.268  -1.702  1.00 0.00 ? 48 ILE P HG23   1  
ATOM 1587  H HD11   . ILE C 3 48 ? -0.438  0.275   1.932   1.00 0.00 ? 48 ILE P HD11   1  
ATOM 1588  H HD12   . ILE C 3 48 ? -2.045  0.516   2.696   1.00 0.00 ? 48 ILE P HD12   1  
ATOM 1589  H HD13   . ILE C 3 48 ? -1.861  -0.494  1.201   1.00 0.00 ? 48 ILE P HD13   1  
ATOM 1590  N N      . TRP C 3 49 ? -5.899  2.285   -1.498  1.00 0.00 ? 49 TRP P N      1  
ATOM 1591  C CA     . TRP C 3 49 ? -6.901  2.239   -2.513  1.00 0.00 ? 49 TRP P CA     1  
ATOM 1592  C C      . TRP C 3 49 ? -6.973  3.459   -3.407  1.00 0.00 ? 49 TRP P C      1  
ATOM 1593  O O      . TRP C 3 49 ? -7.003  3.260   -4.608  1.00 0.00 ? 49 TRP P O      1  
ATOM 1594  C CB     . TRP C 3 49 ? -8.267  1.889   -1.891  1.00 0.00 ? 49 TRP P CB     1  
ATOM 1595  C CG     . TRP C 3 49 ? -9.400  2.029   -2.910  1.00 0.00 ? 49 TRP P CG     1  
ATOM 1596  C CD1    . TRP C 3 49 ? -9.556  1.184   -3.998  1.00 0.00 ? 49 TRP P CD1    1  
ATOM 1597  C CD2    . TRP C 3 49 ? -10.422 3.054   -3.107  1.00 0.00 ? 49 TRP P CD2    1  
ATOM 1598  N NE1    . TRP C 3 49 ? -10.648 1.507   -4.705  1.00 0.00 ? 49 TRP P NE1    1  
ATOM 1599  C CE2    . TRP C 3 49 ? -11.138 2.720   -4.278  1.00 0.00 ? 49 TRP P CE2    1  
ATOM 1600  C CE3    . TRP C 3 49 ? -10.568 4.351   -2.604  1.00 0.00 ? 49 TRP P CE3    1  
ATOM 1601  C CZ2    . TRP C 3 49 ? -12.124 3.599   -4.873  1.00 0.00 ? 49 TRP P CZ2    1  
ATOM 1602  C CZ3    . TRP C 3 49 ? -11.566 5.235   -3.150  1.00 0.00 ? 49 TRP P CZ3    1  
ATOM 1603  C CH2    . TRP C 3 49 ? -12.390 4.780   -4.153  1.00 0.00 ? 49 TRP P CH2    1  
ATOM 1604  H H      . TRP C 3 49 ? -6.133  2.338   -0.518  1.00 0.00 ? 49 TRP P H      1  
ATOM 1605  H HA     . TRP C 3 49 ? -6.646  1.477   -3.251  1.00 0.00 ? 49 TRP P HA     1  
ATOM 1606  H HB2    . TRP C 3 49 ? -8.263  0.926   -1.381  1.00 0.00 ? 49 TRP P HB2    1  
ATOM 1607  H HB3    . TRP C 3 49 ? -8.473  2.775   -1.291  1.00 0.00 ? 49 TRP P HB3    1  
ATOM 1608  H HD1    . TRP C 3 49 ? -8.912  0.345   -4.219  1.00 0.00 ? 49 TRP P HD1    1  
ATOM 1609  H HE1    . TRP C 3 49 ? -11.116 0.986   -5.433  1.00 0.00 ? 49 TRP P HE1    1  
ATOM 1610  H HE3    . TRP C 3 49 ? -9.883  4.563   -1.797  1.00 0.00 ? 49 TRP P HE3    1  
ATOM 1611  H HZ2    . TRP C 3 49 ? -12.497 3.412   -5.869  1.00 0.00 ? 49 TRP P HZ2    1  
ATOM 1612  H HZ3    . TRP C 3 49 ? -11.634 6.220   -2.712  1.00 0.00 ? 49 TRP P HZ3    1  
ATOM 1613  H HH2    . TRP C 3 49 ? -13.064 5.504   -4.585  1.00 0.00 ? 49 TRP P HH2    1  
ATOM 1614  N N      . PHE C 3 50 ? -6.971  4.658   -2.874  1.00 0.00 ? 50 PHE P N      1  
ATOM 1615  C CA     . PHE C 3 50 ? -6.994  5.933   -3.701  1.00 0.00 ? 50 PHE P CA     1  
ATOM 1616  C C      . PHE C 3 50 ? -5.858  6.051   -4.715  1.00 0.00 ? 50 PHE P C      1  
ATOM 1617  O O      . PHE C 3 50 ? -5.995  6.404   -5.849  1.00 0.00 ? 50 PHE P O      1  
ATOM 1618  C CB     . PHE C 3 50 ? -6.998  7.181   -2.753  1.00 0.00 ? 50 PHE P CB     1  
ATOM 1619  C CG     . PHE C 3 50 ? -8.311  7.655   -2.220  1.00 0.00 ? 50 PHE P CG     1  
ATOM 1620  C CD1    . PHE C 3 50 ? -8.725  8.986   -2.516  1.00 0.00 ? 50 PHE P CD1    1  
ATOM 1621  C CD2    . PHE C 3 50 ? -9.091  6.870   -1.383  1.00 0.00 ? 50 PHE P CD2    1  
ATOM 1622  C CE1    . PHE C 3 50 ? -9.990  9.384   -2.104  1.00 0.00 ? 50 PHE P CE1    1  
ATOM 1623  C CE2    . PHE C 3 50 ? -10.288 7.321   -0.825  1.00 0.00 ? 50 PHE P CE2    1  
ATOM 1624  C CZ     . PHE C 3 50 ? -10.769 8.541   -1.275  1.00 0.00 ? 50 PHE P CZ     1  
ATOM 1625  H H      . PHE C 3 50 ? -7.067  4.667   -1.868  1.00 0.00 ? 50 PHE P H      1  
ATOM 1626  H HA     . PHE C 3 50 ? -7.924  5.850   -4.263  1.00 0.00 ? 50 PHE P HA     1  
ATOM 1627  H HB2    . PHE C 3 50 ? -6.387  7.014   -1.867  1.00 0.00 ? 50 PHE P HB2    1  
ATOM 1628  H HB3    . PHE C 3 50 ? -6.534  7.965   -3.353  1.00 0.00 ? 50 PHE P HB3    1  
ATOM 1629  H HD1    . PHE C 3 50 ? -8.156  9.694   -3.100  1.00 0.00 ? 50 PHE P HD1    1  
ATOM 1630  H HD2    . PHE C 3 50 ? -8.691  5.968   -0.941  1.00 0.00 ? 50 PHE P HD2    1  
ATOM 1631  H HE1    . PHE C 3 50 ? -10.268 10.400  -2.337  1.00 0.00 ? 50 PHE P HE1    1  
ATOM 1632  H HE2    . PHE C 3 50 ? -10.854 6.685   -0.159  1.00 0.00 ? 50 PHE P HE2    1  
ATOM 1633  H HZ     . PHE C 3 50 ? -11.684 8.898   -0.827  1.00 0.00 ? 50 PHE P HZ     1  
ATOM 1634  N N      . LYS C 3 51 ? -4.701  5.615   -4.235  1.00 0.00 ? 51 LYS P N      1  
ATOM 1635  C CA     . LYS C 3 51 ? -3.419  5.435   -5.027  1.00 0.00 ? 51 LYS P CA     1  
ATOM 1636  C C      . LYS C 3 51 ? -3.614  4.417   -6.090  1.00 0.00 ? 51 LYS P C      1  
ATOM 1637  O O      . LYS C 3 51 ? -3.433  4.759   -7.207  1.00 0.00 ? 51 LYS P O      1  
ATOM 1638  C CB     . LYS C 3 51 ? -2.245  4.981   -4.177  1.00 0.00 ? 51 LYS P CB     1  
ATOM 1639  C CG     . LYS C 3 51 ? -1.735  6.270   -3.334  1.00 0.00 ? 51 LYS P CG     1  
ATOM 1640  C CD     . LYS C 3 51 ? -0.659  5.984   -2.203  1.00 0.00 ? 51 LYS P CD     1  
ATOM 1641  C CE     . LYS C 3 51 ? -0.029  4.614   -2.049  1.00 0.00 ? 51 LYS P CE     1  
ATOM 1642  N NZ     . LYS C 3 51 ? 1.295   4.826   -1.515  1.00 0.00 ? 51 LYS P NZ     1  
ATOM 1643  H H      . LYS C 3 51 ? -4.692  5.343   -3.262  1.00 0.00 ? 51 LYS P H      1  
ATOM 1644  H HA     . LYS C 3 51 ? -3.166  6.363   -5.540  1.00 0.00 ? 51 LYS P HA     1  
ATOM 1645  H HB2    . LYS C 3 51 ? -2.543  4.092   -3.623  1.00 0.00 ? 51 LYS P HB2    1  
ATOM 1646  H HB3    . LYS C 3 51 ? -1.439  4.781   -4.884  1.00 0.00 ? 51 LYS P HB3    1  
ATOM 1647  H HG2    . LYS C 3 51 ? -1.297  6.990   -4.026  1.00 0.00 ? 51 LYS P HG2    1  
ATOM 1648  H HG3    . LYS C 3 51 ? -2.598  6.665   -2.796  1.00 0.00 ? 51 LYS P HG3    1  
ATOM 1649  H HD2    . LYS C 3 51 ? 0.128   6.718   -2.377  1.00 0.00 ? 51 LYS P HD2    1  
ATOM 1650  H HD3    . LYS C 3 51 ? -1.046  6.282   -1.229  1.00 0.00 ? 51 LYS P HD3    1  
ATOM 1651  H HE2    . LYS C 3 51 ? -0.638  4.178   -1.256  1.00 0.00 ? 51 LYS P HE2    1  
ATOM 1652  H HE3    . LYS C 3 51 ? -0.054  4.034   -2.972  1.00 0.00 ? 51 LYS P HE3    1  
ATOM 1653  H HZ1    . LYS C 3 51 ? 1.574   4.144   -0.825  1.00 0.00 ? 51 LYS P HZ1    1  
ATOM 1654  H HZ2    . LYS C 3 51 ? 1.302   5.686   -0.986  1.00 0.00 ? 51 LYS P HZ2    1  
ATOM 1655  H HZ3    . LYS C 3 51 ? 2.044   4.929   -2.185  1.00 0.00 ? 51 LYS P HZ3    1  
ATOM 1656  N N      . ASN C 3 52 ? -4.003  3.173   -5.757  1.00 0.00 ? 52 ASN P N      1  
ATOM 1657  C CA     . ASN C 3 52 ? -4.312  2.107   -6.755  1.00 0.00 ? 52 ASN P CA     1  
ATOM 1658  C C      . ASN C 3 52 ? -5.399  2.639   -7.732  1.00 0.00 ? 52 ASN P C      1  
ATOM 1659  O O      . ASN C 3 52 ? -5.290  2.247   -8.915  1.00 0.00 ? 52 ASN P O      1  
ATOM 1660  C CB     . ASN C 3 52 ? -4.881  0.854   -6.039  1.00 0.00 ? 52 ASN P CB     1  
ATOM 1661  C CG     . ASN C 3 52 ? -3.849  -0.244  -5.864  1.00 0.00 ? 52 ASN P CG     1  
ATOM 1662  O OD1    . ASN C 3 52 ? -3.314  -0.753  -6.810  1.00 0.00 ? 52 ASN P OD1    1  
ATOM 1663  N ND2    . ASN C 3 52 ? -3.450  -0.620  -4.687  1.00 0.00 ? 52 ASN P ND2    1  
ATOM 1664  H H      . ASN C 3 52 ? -4.082  2.948   -4.776  1.00 0.00 ? 52 ASN P H      1  
ATOM 1665  H HA     . ASN C 3 52 ? -3.484  1.983   -7.453  1.00 0.00 ? 52 ASN P HA     1  
ATOM 1666  H HB2    . ASN C 3 52 ? -5.248  1.145   -5.054  1.00 0.00 ? 52 ASN P HB2    1  
ATOM 1667  H HB3    . ASN C 3 52 ? -5.660  0.453   -6.689  1.00 0.00 ? 52 ASN P HB3    1  
ATOM 1668  H HD21   . ASN C 3 52 ? -3.865  -0.222  -3.858  1.00 0.00 ? 52 ASN P HD21   1  
ATOM 1669  H HD22   . ASN C 3 52 ? -2.755  -1.351  -4.628  1.00 0.00 ? 52 ASN P HD22   1  
ATOM 1670  N N      . ARG C 3 53 ? -6.463  3.406   -7.293  1.00 0.00 ? 53 ARG P N      1  
ATOM 1671  C CA     . ARG C 3 53 ? -7.524  3.857   -8.227  1.00 0.00 ? 53 ARG P CA     1  
ATOM 1672  C C      . ARG C 3 53 ? -6.917  4.793   -9.227  1.00 0.00 ? 53 ARG P C      1  
ATOM 1673  O O      . ARG C 3 53 ? -7.113  4.508   -10.451 1.00 0.00 ? 53 ARG P O      1  
ATOM 1674  C CB     . ARG C 3 53 ? -8.678  4.556   -7.467  1.00 0.00 ? 53 ARG P CB     1  
ATOM 1675  C CG     . ARG C 3 53 ? -9.762  5.204   -8.372  1.00 0.00 ? 53 ARG P CG     1  
ATOM 1676  C CD     . ARG C 3 53 ? -10.885 5.855   -7.589  1.00 0.00 ? 53 ARG P CD     1  
ATOM 1677  N NE     . ARG C 3 53 ? -11.935 6.361   -8.469  1.00 0.00 ? 53 ARG P NE     1  
ATOM 1678  C CZ     . ARG C 3 53 ? -12.990 5.713   -8.905  1.00 0.00 ? 53 ARG P CZ     1  
ATOM 1679  N NH1    . ARG C 3 53 ? -13.073 4.425   -8.615  1.00 0.00 ? 53 ARG P NH1    1  
ATOM 1680  N NH2    . ARG C 3 53 ? -13.862 6.337   -9.587  1.00 0.00 ? 53 ARG P NH2    1  
ATOM 1681  H H      . ARG C 3 53 ? -6.631  3.684   -6.337  1.00 0.00 ? 53 ARG P H      1  
ATOM 1682  H HA     . ARG C 3 53 ? -7.877  3.011   -8.816  1.00 0.00 ? 53 ARG P HA     1  
ATOM 1683  H HB2    . ARG C 3 53 ? -9.022  3.694   -6.897  1.00 0.00 ? 53 ARG P HB2    1  
ATOM 1684  H HB3    . ARG C 3 53 ? -8.398  5.287   -6.709  1.00 0.00 ? 53 ARG P HB3    1  
ATOM 1685  H HG2    . ARG C 3 53 ? -9.342  5.863   -9.132  1.00 0.00 ? 53 ARG P HG2    1  
ATOM 1686  H HG3    . ARG C 3 53 ? -10.202 4.523   -9.101  1.00 0.00 ? 53 ARG P HG3    1  
ATOM 1687  H HD2    . ARG C 3 53 ? -11.234 5.036   -6.961  1.00 0.00 ? 53 ARG P HD2    1  
ATOM 1688  H HD3    . ARG C 3 53 ? -10.425 6.615   -6.957  1.00 0.00 ? 53 ARG P HD3    1  
ATOM 1689  H HE     . ARG C 3 53 ? -11.652 7.138   -9.049  1.00 0.00 ? 53 ARG P HE     1  
ATOM 1690  H HH11   . ARG C 3 53 ? -12.318 3.833   -8.298  1.00 0.00 ? 53 ARG P HH11   1  
ATOM 1691  H HH12   . ARG C 3 53 ? -13.893 4.043   -9.065  1.00 0.00 ? 53 ARG P HH12   1  
ATOM 1692  H HH21   . ARG C 3 53 ? -13.638 7.278   -9.876  1.00 0.00 ? 53 ARG P HH21   1  
ATOM 1693  H HH22   . ARG C 3 53 ? -14.734 5.915   -9.875  1.00 0.00 ? 53 ARG P HH22   1  
ATOM 1694  N N      . ARG C 3 54 ? -6.159  5.849   -8.888  1.00 0.00 ? 54 ARG P N      1  
ATOM 1695  C CA     . ARG C 3 54 ? -5.533  6.712   -9.896  1.00 0.00 ? 54 ARG P CA     1  
ATOM 1696  C C      . ARG C 3 54 ? -4.700  5.978   -10.895 1.00 0.00 ? 54 ARG P C      1  
ATOM 1697  O O      . ARG C 3 54 ? -4.747  6.152   -12.108 1.00 0.00 ? 54 ARG P O      1  
ATOM 1698  C CB     . ARG C 3 54 ? -4.724  7.753   -9.161  1.00 0.00 ? 54 ARG P CB     1  
ATOM 1699  C CG     . ARG C 3 54 ? -5.725  8.876   -8.908  1.00 0.00 ? 54 ARG P CG     1  
ATOM 1700  C CD     . ARG C 3 54 ? -5.183  9.673   -7.808  1.00 0.00 ? 54 ARG P CD     1  
ATOM 1701  N NE     . ARG C 3 54 ? -6.145  10.320  -6.991  1.00 0.00 ? 54 ARG P NE     1  
ATOM 1702  C CZ     . ARG C 3 54 ? -6.004  10.343  -5.657  1.00 0.00 ? 54 ARG P CZ     1  
ATOM 1703  N NH1    . ARG C 3 54 ? -5.328  9.393   -5.074  1.00 0.00 ? 54 ARG P NH1    1  
ATOM 1704  N NH2    . ARG C 3 54 ? -6.373  11.393  -4.984  1.00 0.00 ? 54 ARG P NH2    1  
ATOM 1705  H H      . ARG C 3 54 ? -6.123  6.198   -7.942  1.00 0.00 ? 54 ARG P H      1  
ATOM 1706  H HA     . ARG C 3 54 ? -6.314  7.192   -10.485 1.00 0.00 ? 54 ARG P HA     1  
ATOM 1707  H HB2    . ARG C 3 54 ? -4.356  7.331   -8.227  1.00 0.00 ? 54 ARG P HB2    1  
ATOM 1708  H HB3    . ARG C 3 54 ? -3.829  8.070   -9.694  1.00 0.00 ? 54 ARG P HB3    1  
ATOM 1709  H HG2    . ARG C 3 54 ? -5.792  9.482   -9.812  1.00 0.00 ? 54 ARG P HG2    1  
ATOM 1710  H HG3    . ARG C 3 54 ? -6.719  8.547   -8.604  1.00 0.00 ? 54 ARG P HG3    1  
ATOM 1711  H HD2    . ARG C 3 54 ? -4.591  8.995   -7.193  1.00 0.00 ? 54 ARG P HD2    1  
ATOM 1712  H HD3    . ARG C 3 54 ? -4.426  10.362  -8.183  1.00 0.00 ? 54 ARG P HD3    1  
ATOM 1713  H HE     . ARG C 3 54 ? -6.809  10.961  -7.401  1.00 0.00 ? 54 ARG P HE     1  
ATOM 1714  H HH11   . ARG C 3 54 ? -5.304  8.555   -5.638  1.00 0.00 ? 54 ARG P HH11   1  
ATOM 1715  H HH12   . ARG C 3 54 ? -4.891  9.497   -4.170  1.00 0.00 ? 54 ARG P HH12   1  
ATOM 1716  H HH21   . ARG C 3 54 ? -7.124  11.965  -5.345  1.00 0.00 ? 54 ARG P HH21   1  
ATOM 1717  H HH22   . ARG C 3 54 ? -6.162  11.570  -4.012  1.00 0.00 ? 54 ARG P HH22   1  
ATOM 1718  N N      . ARG C 3 55 ? -3.866  5.016   -10.409 1.00 0.00 ? 55 ARG P N      1  
ATOM 1719  C CA     . ARG C 3 55 ? -2.927  4.163   -11.260 1.00 0.00 ? 55 ARG P CA     1  
ATOM 1720  C C      . ARG C 3 55 ? -3.799  3.401   -12.282 1.00 0.00 ? 55 ARG P C      1  
ATOM 1721  O O      . ARG C 3 55 ? -3.576  3.521   -13.502 1.00 0.00 ? 55 ARG P O      1  
ATOM 1722  C CB     . ARG C 3 55 ? -2.065  3.274   -10.313 1.00 0.00 ? 55 ARG P CB     1  
ATOM 1723  C CG     . ARG C 3 55 ? -0.957  4.059   -9.508  1.00 0.00 ? 55 ARG P CG     1  
ATOM 1724  C CD     . ARG C 3 55 ? 0.149   4.654   -10.422 1.00 0.00 ? 55 ARG P CD     1  
ATOM 1725  N NE     . ARG C 3 55 ? 0.808   3.703   -11.372 1.00 0.00 ? 55 ARG P NE     1  
ATOM 1726  C CZ     . ARG C 3 55 ? 1.598   2.694   -11.073 1.00 0.00 ? 55 ARG P CZ     1  
ATOM 1727  N NH1    . ARG C 3 55 ? 1.869   2.456   -9.837  1.00 0.00 ? 55 ARG P NH1    1  
ATOM 1728  N NH2    . ARG C 3 55 ? 2.137   2.011   -12.051 1.00 0.00 ? 55 ARG P NH2    1  
ATOM 1729  H H      . ARG C 3 55 ? -3.730  4.934   -9.411  1.00 0.00 ? 55 ARG P H      1  
ATOM 1730  H HA     . ARG C 3 55 ? -2.277  4.776   -11.883 1.00 0.00 ? 55 ARG P HA     1  
ATOM 1731  H HB2    . ARG C 3 55 ? -2.682  2.716   -9.610  1.00 0.00 ? 55 ARG P HB2    1  
ATOM 1732  H HB3    . ARG C 3 55 ? -1.543  2.496   -10.871 1.00 0.00 ? 55 ARG P HB3    1  
ATOM 1733  H HG2    . ARG C 3 55 ? -1.513  4.900   -9.092  1.00 0.00 ? 55 ARG P HG2    1  
ATOM 1734  H HG3    . ARG C 3 55 ? -0.543  3.450   -8.705  1.00 0.00 ? 55 ARG P HG3    1  
ATOM 1735  H HD2    . ARG C 3 55 ? -0.226  5.513   -10.980 1.00 0.00 ? 55 ARG P HD2    1  
ATOM 1736  H HD3    . ARG C 3 55 ? 1.000   5.022   -9.850  1.00 0.00 ? 55 ARG P HD3    1  
ATOM 1737  H HE     . ARG C 3 55 ? 0.578   3.750   -12.354 1.00 0.00 ? 55 ARG P HE     1  
ATOM 1738  H HH11   . ARG C 3 55 ? 1.326   2.819   -9.065  1.00 0.00 ? 55 ARG P HH11   1  
ATOM 1739  H HH12   . ARG C 3 55 ? 2.559   1.746   -9.640  1.00 0.00 ? 55 ARG P HH12   1  
ATOM 1740  H HH21   . ARG C 3 55 ? 1.811   2.146   -12.997 1.00 0.00 ? 55 ARG P HH21   1  
ATOM 1741  H HH22   . ARG C 3 55 ? 2.766   1.250   -11.839 1.00 0.00 ? 55 ARG P HH22   1  
ATOM 1742  N N      . ARG C 3 56 ? -4.869  2.759   -11.842 1.00 0.00 ? 56 ARG P N      1  
ATOM 1743  C CA     . ARG C 3 56 ? -5.853  1.955   -12.746 1.00 0.00 ? 56 ARG P CA     1  
ATOM 1744  C C      . ARG C 3 56 ? -6.506  2.881   -13.774 1.00 0.00 ? 56 ARG P C      1  
ATOM 1745  O O      . ARG C 3 56 ? -6.575  2.492   -14.947 1.00 0.00 ? 56 ARG P O      1  
ATOM 1746  C CB     . ARG C 3 56 ? -6.950  1.293   -11.775 1.00 0.00 ? 56 ARG P CB     1  
ATOM 1747  C CG     . ARG C 3 56 ? -7.473  -0.052  -12.280 1.00 0.00 ? 56 ARG P CG     1  
ATOM 1748  C CD     . ARG C 3 56 ? -6.441  -1.205  -12.178 1.00 0.00 ? 56 ARG P CD     1  
ATOM 1749  N NE     . ARG C 3 56 ? -6.085  -1.477  -10.767 1.00 0.00 ? 56 ARG P NE     1  
ATOM 1750  C CZ     . ARG C 3 56 ? -4.921  -1.110  -10.170 1.00 0.00 ? 56 ARG P CZ     1  
ATOM 1751  N NH1    . ARG C 3 56 ? -4.116  -0.234  -10.794 1.00 0.00 ? 56 ARG P NH1    1  
ATOM 1752  N NH2    . ARG C 3 56 ? -4.470  -1.665  -9.091  1.00 0.00 ? 56 ARG P NH2    1  
ATOM 1753  H H      . ARG C 3 56 ? -5.115  2.955   -10.882 1.00 0.00 ? 56 ARG P H      1  
ATOM 1754  H HA     . ARG C 3 56 ? -5.248  1.179   -13.216 1.00 0.00 ? 56 ARG P HA     1  
ATOM 1755  H HB2    . ARG C 3 56 ? -6.454  1.312   -10.804 1.00 0.00 ? 56 ARG P HB2    1  
ATOM 1756  H HB3    . ARG C 3 56 ? -7.763  2.010   -11.665 1.00 0.00 ? 56 ARG P HB3    1  
ATOM 1757  H HG2    . ARG C 3 56 ? -8.379  -0.238  -11.702 1.00 0.00 ? 56 ARG P HG2    1  
ATOM 1758  H HG3    . ARG C 3 56 ? -7.818  0.055   -13.308 1.00 0.00 ? 56 ARG P HG3    1  
ATOM 1759  H HD2    . ARG C 3 56 ? -6.779  -2.138  -12.631 1.00 0.00 ? 56 ARG P HD2    1  
ATOM 1760  H HD3    . ARG C 3 56 ? -5.618  -0.904  -12.827 1.00 0.00 ? 56 ARG P HD3    1  
ATOM 1761  H HE     . ARG C 3 56 ? -6.706  -2.177  -10.386 1.00 0.00 ? 56 ARG P HE     1  
ATOM 1762  H HH11   . ARG C 3 56 ? -4.411  0.331   -11.577 1.00 0.00 ? 56 ARG P HH11   1  
ATOM 1763  H HH12   . ARG C 3 56 ? -3.231  -0.149  -10.315 1.00 0.00 ? 56 ARG P HH12   1  
ATOM 1764  H HH21   . ARG C 3 56 ? -5.073  -2.291  -8.576  1.00 0.00 ? 56 ARG P HH21   1  
ATOM 1765  H HH22   . ARG C 3 56 ? -3.670  -1.384  -8.541  1.00 0.00 ? 56 ARG P HH22   1  
ATOM 1766  N N      . HIS C 3 57 ? -6.897  4.064   -13.417 1.00 0.00 ? 57 HIS P N      1  
ATOM 1767  C CA     . HIS C 3 57 ? -7.420  5.023   -14.320 1.00 0.00 ? 57 HIS P CA     1  
ATOM 1768  C C      . HIS C 3 57 ? -6.416  5.445   -15.379 1.00 0.00 ? 57 HIS P C      1  
ATOM 1769  O O      . HIS C 3 57 ? -6.667  5.176   -16.562 1.00 0.00 ? 57 HIS P O      1  
ATOM 1770  C CB     . HIS C 3 57 ? -7.900  6.213   -13.477 1.00 0.00 ? 57 HIS P CB     1  
ATOM 1771  C CG     . HIS C 3 57 ? -9.248  5.980   -12.879 1.00 0.00 ? 57 HIS P CG     1  
ATOM 1772  N ND1    . HIS C 3 57 ? -10.183 5.011   -13.196 1.00 0.00 ? 57 HIS P ND1    1  
ATOM 1773  C CD2    . HIS C 3 57 ? -9.754  6.652   -11.747 1.00 0.00 ? 57 HIS P CD2    1  
ATOM 1774  C CE1    . HIS C 3 57 ? -11.183 5.109   -12.259 1.00 0.00 ? 57 HIS P CE1    1  
ATOM 1775  N NE2    . HIS C 3 57 ? -10.988 6.083   -11.401 1.00 0.00 ? 57 HIS P NE2    1  
ATOM 1776  H H      . HIS C 3 57 ? -6.779  4.372   -12.461 1.00 0.00 ? 57 HIS P H      1  
ATOM 1777  H HA     . HIS C 3 57 ? -8.231  4.542   -14.866 1.00 0.00 ? 57 HIS P HA     1  
ATOM 1778  H HB2    . HIS C 3 57 ? -7.253  6.484   -12.643 1.00 0.00 ? 57 HIS P HB2    1  
ATOM 1779  H HB3    . HIS C 3 57 ? -7.920  7.067   -14.153 1.00 0.00 ? 57 HIS P HB3    1  
ATOM 1780  H HD1    . HIS C 3 57 ? -10.063 4.301   -13.903 1.00 0.00 ? 57 HIS P HD1    1  
ATOM 1781  H HD2    . HIS C 3 57 ? -9.372  7.582   -11.349 1.00 0.00 ? 57 HIS P HD2    1  
ATOM 1782  H HE1    . HIS C 3 57 ? -11.966 4.370   -12.182 1.00 0.00 ? 57 HIS P HE1    1  
ATOM 1783  N N      . LYS C 3 58 ? -5.284  6.011   -14.947 1.00 0.00 ? 58 LYS P N      1  
ATOM 1784  C CA     . LYS C 3 58 ? -4.341  6.510   -15.890 1.00 0.00 ? 58 LYS P CA     1  
ATOM 1785  C C      . LYS C 3 58 ? -3.579  5.423   -16.737 1.00 0.00 ? 58 LYS P C      1  
ATOM 1786  O O      . LYS C 3 58 ? -3.174  5.756   -17.863 1.00 0.00 ? 58 LYS P O      1  
ATOM 1787  C CB     . LYS C 3 58 ? -3.342  7.445   -15.219 1.00 0.00 ? 58 LYS P CB     1  
ATOM 1788  C CG     . LYS C 3 58 ? -2.181  6.838   -14.350 1.00 0.00 ? 58 LYS P CG     1  
ATOM 1789  C CD     . LYS C 3 58 ? -1.406  7.954   -13.747 1.00 0.00 ? 58 LYS P CD     1  
ATOM 1790  C CE     . LYS C 3 58 ? -1.919  8.054   -12.326 1.00 0.00 ? 58 LYS P CE     1  
ATOM 1791  N NZ     . LYS C 3 58 ? -1.941  9.464   -11.873 1.00 0.00 ? 58 LYS P NZ     1  
ATOM 1792  H H      . LYS C 3 58 ? -5.124  6.018   -13.950 1.00 0.00 ? 58 LYS P H      1  
ATOM 1793  H HA     . LYS C 3 58 ? -4.842  7.155   -16.611 1.00 0.00 ? 58 LYS P HA     1  
ATOM 1794  H HB2    . LYS C 3 58 ? -2.931  7.996   -16.065 1.00 0.00 ? 58 LYS P HB2    1  
ATOM 1795  H HB3    . LYS C 3 58 ? -3.908  8.134   -14.590 1.00 0.00 ? 58 LYS P HB3    1  
ATOM 1796  H HG2    . LYS C 3 58 ? -2.637  6.171   -13.617 1.00 0.00 ? 58 LYS P HG2    1  
ATOM 1797  H HG3    . LYS C 3 58 ? -1.463  6.346   -15.006 1.00 0.00 ? 58 LYS P HG3    1  
ATOM 1798  H HD2    . LYS C 3 58 ? -0.337  7.763   -13.658 1.00 0.00 ? 58 LYS P HD2    1  
ATOM 1799  H HD3    . LYS C 3 58 ? -1.562  8.939   -14.188 1.00 0.00 ? 58 LYS P HD3    1  
ATOM 1800  H HE2    . LYS C 3 58 ? -2.938  7.676   -12.240 1.00 0.00 ? 58 LYS P HE2    1  
ATOM 1801  H HE3    . LYS C 3 58 ? -1.249  7.497   -11.672 1.00 0.00 ? 58 LYS P HE3    1  
ATOM 1802  H HZ1    . LYS C 3 58 ? -2.416  10.155  -12.437 1.00 0.00 ? 58 LYS P HZ1    1  
ATOM 1803  H HZ2    . LYS C 3 58 ? -1.028  9.892   -11.813 1.00 0.00 ? 58 LYS P HZ2    1  
ATOM 1804  H HZ3    . LYS C 3 58 ? -2.270  9.558   -10.924 1.00 0.00 ? 58 LYS P HZ3    1  
ATOM 1805  N N      . ILE C 3 59 ? -3.476  4.178   -16.230 1.00 0.00 ? 59 ILE P N      1  
ATOM 1806  C CA     . ILE C 3 59 ? -2.984  3.007   -17.000 1.00 0.00 ? 59 ILE P CA     1  
ATOM 1807  C C      . ILE C 3 59 ? -3.896  2.728   -18.143 1.00 0.00 ? 59 ILE P C      1  
ATOM 1808  O O      . ILE C 3 59 ? -3.392  2.526   -19.293 1.00 0.00 ? 59 ILE P O      1  
ATOM 1809  C CB     . ILE C 3 59 ? -2.737  1.762   -16.111 1.00 0.00 ? 59 ILE P CB     1  
ATOM 1810  C CG1    . ILE C 3 59 ? -1.434  2.097   -15.339 1.00 0.00 ? 59 ILE P CG1    1  
ATOM 1811  C CG2    . ILE C 3 59 ? -2.503  0.442   -16.926 1.00 0.00 ? 59 ILE P CG2    1  
ATOM 1812  C CD1    . ILE C 3 59 ? -1.258  1.290   -13.976 1.00 0.00 ? 59 ILE P CD1    1  
ATOM 1813  H H      . ILE C 3 59 ? -3.707  3.988   -15.265 1.00 0.00 ? 59 ILE P H      1  
ATOM 1814  H HA     . ILE C 3 59 ? -2.058  3.346   -17.466 1.00 0.00 ? 59 ILE P HA     1  
ATOM 1815  H HB     . ILE C 3 59 ? -3.583  1.569   -15.452 1.00 0.00 ? 59 ILE P HB     1  
ATOM 1816  H HG12   . ILE C 3 59 ? -0.497  2.050   -15.893 1.00 0.00 ? 59 ILE P HG12   1  
ATOM 1817  H HG13   . ILE C 3 59 ? -1.567  3.159   -15.134 1.00 0.00 ? 59 ILE P HG13   1  
ATOM 1818  H HG21   . ILE C 3 59 ? -1.653  0.451   -17.607 1.00 0.00 ? 59 ILE P HG21   1  
ATOM 1819  H HG22   . ILE C 3 59 ? -2.277  -0.308  -16.168 1.00 0.00 ? 59 ILE P HG22   1  
ATOM 1820  H HG23   . ILE C 3 59 ? -3.425  0.223   -17.466 1.00 0.00 ? 59 ILE P HG23   1  
ATOM 1821  H HD11   . ILE C 3 59 ? -0.441  1.772   -13.438 1.00 0.00 ? 59 ILE P HD11   1  
ATOM 1822  H HD12   . ILE C 3 59 ? -2.164  1.277   -13.371 1.00 0.00 ? 59 ILE P HD12   1  
ATOM 1823  H HD13   . ILE C 3 59 ? -0.836  0.325   -14.254 1.00 0.00 ? 59 ILE P HD13   1  
ATOM 1824  N N      . GLN C 3 60 ? -5.203  2.567   -17.833 1.00 0.00 ? 60 GLN P N      1  
ATOM 1825  C CA     . GLN C 3 60 ? -6.137  2.225   -18.872 1.00 0.00 ? 60 GLN P CA     1  
ATOM 1826  C C      . GLN C 3 60 ? -6.320  3.379   -19.902 1.00 0.00 ? 60 GLN P C      1  
ATOM 1827  O O      . GLN C 3 60 ? -6.482  3.056   -21.114 1.00 0.00 ? 60 GLN P O      1  
ATOM 1828  C CB     . GLN C 3 60 ? -7.444  1.799   -18.184 1.00 0.00 ? 60 GLN P CB     1  
ATOM 1829  C CG     . GLN C 3 60 ? -7.414  0.406   -17.555 1.00 0.00 ? 60 GLN P CG     1  
ATOM 1830  C CD     . GLN C 3 60 ? -8.641  0.068   -16.666 1.00 0.00 ? 60 GLN P CD     1  
ATOM 1831  O OE1    . GLN C 3 60 ? -9.612  0.779   -16.547 1.00 0.00 ? 60 GLN P OE1    1  
ATOM 1832  N NE2    . GLN C 3 60 ? -8.628  -1.107  -16.089 1.00 0.00 ? 60 GLN P NE2    1  
ATOM 1833  H H      . GLN C 3 60 ? -5.545  2.666   -16.888 1.00 0.00 ? 60 GLN P H      1  
ATOM 1834  H HA     . GLN C 3 60 ? -5.632  1.424   -19.411 1.00 0.00 ? 60 GLN P HA     1  
ATOM 1835  H HB2    . GLN C 3 60 ? -7.688  2.549   -17.432 1.00 0.00 ? 60 GLN P HB2    1  
ATOM 1836  H HB3    . GLN C 3 60 ? -8.242  1.688   -18.918 1.00 0.00 ? 60 GLN P HB3    1  
ATOM 1837  H HG2    . GLN C 3 60 ? -7.334  -0.353  -18.334 1.00 0.00 ? 60 GLN P HG2    1  
ATOM 1838  H HG3    . GLN C 3 60 ? -6.499  0.330   -16.969 1.00 0.00 ? 60 GLN P HG3    1  
ATOM 1839  H HE21   . GLN C 3 60 ? -7.772  -1.640  -16.139 1.00 0.00 ? 60 GLN P HE21   1  
ATOM 1840  H HE22   . GLN C 3 60 ? -9.467  -1.302  -15.562 1.00 0.00 ? 60 GLN P HE22   1  
ATOM 1841  N N      . SER C 3 61 ? -6.117  4.633   -19.588 1.00 0.00 ? 61 SER P N      1  
ATOM 1842  C CA     . SER C 3 61 ? -6.242  5.734   -20.496 1.00 0.00 ? 61 SER P CA     1  
ATOM 1843  C C      . SER C 3 61 ? -4.974  5.818   -21.307 1.00 0.00 ? 61 SER P C      1  
ATOM 1844  O O      . SER C 3 61 ? -5.051  6.084   -22.498 1.00 0.00 ? 61 SER P O      1  
ATOM 1845  C CB     . SER C 3 61 ? -6.752  6.933   -19.762 1.00 0.00 ? 61 SER P CB     1  
ATOM 1846  O OG     . SER C 3 61 ? -5.755  7.812   -19.149 1.00 0.00 ? 61 SER P OG     1  
ATOM 1847  H H      . SER C 3 61 ? -5.941  4.916   -18.634 1.00 0.00 ? 61 SER P H      1  
ATOM 1848  H HA     . SER C 3 61 ? -7.071  5.575   -21.185 1.00 0.00 ? 61 SER P HA     1  
ATOM 1849  H HB2    . SER C 3 61 ? -7.282  7.541   -20.495 1.00 0.00 ? 61 SER P HB2    1  
ATOM 1850  H HB3    . SER C 3 61 ? -7.501  6.673   -19.014 1.00 0.00 ? 61 SER P HB3    1  
ATOM 1851  H HG     . SER C 3 61 ? -6.232  8.467   -18.634 1.00 0.00 ? 61 SER P HG     1  
ATOM 1852  N N      . ASP C 3 62 ? -3.774  5.553   -20.737 1.00 0.00 ? 62 ASP P N      1  
ATOM 1853  C CA     . ASP C 3 62 ? -2.544  5.633   -21.517 1.00 0.00 ? 62 ASP P CA     1  
ATOM 1854  C C      . ASP C 3 62 ? -2.504  4.583   -22.635 1.00 0.00 ? 62 ASP P C      1  
ATOM 1855  O O      . ASP C 3 62 ? -2.051  4.901   -23.756 1.00 0.00 ? 62 ASP P O      1  
ATOM 1856  C CB     . ASP C 3 62 ? -1.496  5.322   -20.444 1.00 0.00 ? 62 ASP P CB     1  
ATOM 1857  C CG     . ASP C 3 62 ? -0.166  4.825   -20.973 1.00 0.00 ? 62 ASP P CG     1  
ATOM 1858  O OD1    . ASP C 3 62 ? 0.795   5.613   -21.168 1.00 0.00 ? 62 ASP P OD1    1  
ATOM 1859  O OD2    . ASP C 3 62 ? 0.056   3.612   -21.161 1.00 0.00 ? 62 ASP P OD2    1  
ATOM 1860  H H      . ASP C 3 62 ? -3.724  5.299   -19.760 1.00 0.00 ? 62 ASP P H      1  
ATOM 1861  H HA     . ASP C 3 62 ? -2.352  6.630   -21.912 1.00 0.00 ? 62 ASP P HA     1  
ATOM 1862  H HB2    . ASP C 3 62 ? -1.383  6.348   -20.096 1.00 0.00 ? 62 ASP P HB2    1  
ATOM 1863  H HB3    . ASP C 3 62 ? -1.790  4.664   -19.625 1.00 0.00 ? 62 ASP P HB3    1  
ATOM 1864  N N      . GLN C 3 63 ? -2.982  3.353   -22.400 1.00 0.00 ? 63 GLN P N      1  
ATOM 1865  C CA     . GLN C 3 63 ? -3.275  2.344   -23.366 1.00 0.00 ? 63 GLN P CA     1  
ATOM 1866  C C      . GLN C 3 63 ? -4.307  2.682   -24.476 1.00 0.00 ? 63 GLN P C      1  
ATOM 1867  O O      . GLN C 3 63 ? -4.534  1.832   -25.362 1.00 0.00 ? 63 GLN P O      1  
ATOM 1868  C CB     . GLN C 3 63 ? -3.723  1.040   -22.680 1.00 0.00 ? 63 GLN P CB     1  
ATOM 1869  C CG     . GLN C 3 63 ? -2.629  0.466   -21.748 1.00 0.00 ? 63 GLN P CG     1  
ATOM 1870  C CD     . GLN C 3 63 ? -1.331  0.205   -22.441 1.00 0.00 ? 63 GLN P CD     1  
ATOM 1871  O OE1    . GLN C 3 63 ? -1.199  -0.470  -23.476 1.00 0.00 ? 63 GLN P OE1    1  
ATOM 1872  N NE2    . GLN C 3 63 ? -0.263  0.723   -21.895 1.00 0.00 ? 63 GLN P NE2    1  
ATOM 1873  H H      . GLN C 3 63 ? -3.150  3.186   -21.417 1.00 0.00 ? 63 GLN P H      1  
ATOM 1874  H HA     . GLN C 3 63 ? -2.348  2.131   -23.900 1.00 0.00 ? 63 GLN P HA     1  
ATOM 1875  H HB2    . GLN C 3 63 ? -4.618  1.156   -22.068 1.00 0.00 ? 63 GLN P HB2    1  
ATOM 1876  H HB3    . GLN C 3 63 ? -3.948  0.312   -23.460 1.00 0.00 ? 63 GLN P HB3    1  
ATOM 1877  H HG2    . GLN C 3 63 ? -2.402  1.106   -20.896 1.00 0.00 ? 63 GLN P HG2    1  
ATOM 1878  H HG3    . GLN C 3 63 ? -3.034  -0.482  -21.391 1.00 0.00 ? 63 GLN P HG3    1  
ATOM 1879  H HE21   . GLN C 3 63 ? -0.195  1.608   -21.413 1.00 0.00 ? 63 GLN P HE21   1  
ATOM 1880  H HE22   . GLN C 3 63 ? 0.565   0.423   -22.389 1.00 0.00 ? 63 GLN P HE22   1  
ATOM 1881  N N      . HIS C 3 64 ? -4.846  3.859   -24.376 1.00 0.00 ? 64 HIS P N      1  
ATOM 1882  C CA     . HIS C 3 64 ? -5.803  4.542   -25.315 1.00 0.00 ? 64 HIS P CA     1  
ATOM 1883  C C      . HIS C 3 64 ? -5.433  5.975   -25.640 1.00 0.00 ? 64 HIS P C      1  
ATOM 1884  O O      . HIS C 3 64 ? -6.306  6.790   -25.925 1.00 0.00 ? 64 HIS P O      1  
ATOM 1885  C CB     . HIS C 3 64 ? -7.246  4.499   -24.613 1.00 0.00 ? 64 HIS P CB     1  
ATOM 1886  C CG     . HIS C 3 64 ? -7.843  3.101   -24.563 1.00 0.00 ? 64 HIS P CG     1  
ATOM 1887  N ND1    . HIS C 3 64 ? -7.814  2.307   -23.446 1.00 0.00 ? 64 HIS P ND1    1  
ATOM 1888  C CD2    . HIS C 3 64 ? -8.376  2.339   -25.574 1.00 0.00 ? 64 HIS P CD2    1  
ATOM 1889  C CE1    . HIS C 3 64 ? -8.461  1.151   -23.693 1.00 0.00 ? 64 HIS P CE1    1  
ATOM 1890  N NE2    . HIS C 3 64 ? -8.852  1.137   -25.026 1.00 0.00 ? 64 HIS P NE2    1  
ATOM 1891  H H      . HIS C 3 64 ? -4.578  4.399   -23.564 1.00 0.00 ? 64 HIS P H      1  
ATOM 1892  H HA     . HIS C 3 64 ? -5.884  3.948   -26.225 1.00 0.00 ? 64 HIS P HA     1  
ATOM 1893  H HB2    . HIS C 3 64 ? -7.202  4.872   -23.591 1.00 0.00 ? 64 HIS P HB2    1  
ATOM 1894  H HB3    . HIS C 3 64 ? -7.832  5.150   -25.263 1.00 0.00 ? 64 HIS P HB3    1  
ATOM 1895  H HD1    . HIS C 3 64 ? -7.373  2.482   -22.554 1.00 0.00 ? 64 HIS P HD1    1  
ATOM 1896  H HD2    . HIS C 3 64 ? -8.502  2.632   -26.606 1.00 0.00 ? 64 HIS P HD2    1  
ATOM 1897  H HE1    . HIS C 3 64 ? -8.646  0.334   -23.012 1.00 0.00 ? 64 HIS P HE1    1  
ATOM 1898  N N      . LYS C 3 65 ? -4.116  6.229   -25.640 1.00 0.00 ? 65 LYS P N      1  
ATOM 1899  C CA     . LYS C 3 65 ? -3.639  7.500   -26.182 1.00 0.00 ? 65 LYS P CA     1  
ATOM 1900  C C      . LYS C 3 65 ? -4.061  7.772   -27.618 1.00 0.00 ? 65 LYS P C      1  
ATOM 1901  O O      . LYS C 3 65 ? -4.136  6.856   -28.488 1.00 0.00 ? 65 LYS P O      1  
ATOM 1902  C CB     . LYS C 3 65 ? -2.138  7.479   -25.909 1.00 0.00 ? 65 LYS P CB     1  
ATOM 1903  C CG     . LYS C 3 65 ? -1.233  8.601   -26.500 1.00 0.00 ? 65 LYS P CG     1  
ATOM 1904  C CD     . LYS C 3 65 ? -1.346  9.978   -25.843 1.00 0.00 ? 65 LYS P CD     1  
ATOM 1905  C CE     . LYS C 3 65 ? -0.571  11.096  -26.565 1.00 0.00 ? 65 LYS P CE     1  
ATOM 1906  N NZ     . LYS C 3 65 ? 0.801   10.971  -26.176 1.00 0.00 ? 65 LYS P NZ     1  
ATOM 1907  H H      . LYS C 3 65 ? -3.535  5.534   -25.194 1.00 0.00 ? 65 LYS P H      1  
ATOM 1908  H HA     . LYS C 3 65 ? -4.083  8.291   -25.578 1.00 0.00 ? 65 LYS P HA     1  
ATOM 1909  H HB2    . LYS C 3 65 ? -1.947  7.558   -24.839 1.00 0.00 ? 65 LYS P HB2    1  
ATOM 1910  H HB3    . LYS C 3 65 ? -1.765  6.511   -26.245 1.00 0.00 ? 65 LYS P HB3    1  
ATOM 1911  H HG2    . LYS C 3 65 ? -0.208  8.275   -26.316 1.00 0.00 ? 65 LYS P HG2    1  
ATOM 1912  H HG3    . LYS C 3 65 ? -1.275  8.646   -27.588 1.00 0.00 ? 65 LYS P HG3    1  
ATOM 1913  H HD2    . LYS C 3 65 ? -2.397  10.266  -25.813 1.00 0.00 ? 65 LYS P HD2    1  
ATOM 1914  H HD3    . LYS C 3 65 ? -1.165  9.893   -24.772 1.00 0.00 ? 65 LYS P HD3    1  
ATOM 1915  H HE2    . LYS C 3 65 ? -0.560  10.860  -27.629 1.00 0.00 ? 65 LYS P HE2    1  
ATOM 1916  H HE3    . LYS C 3 65 ? -0.928  12.106  -26.365 1.00 0.00 ? 65 LYS P HE3    1  
ATOM 1917  H HZ1    . LYS C 3 65 ? 1.403   11.562  -26.731 1.00 0.00 ? 65 LYS P HZ1    1  
ATOM 1918  H HZ2    . LYS C 3 65 ? 1.200   10.050  -26.287 1.00 0.00 ? 65 LYS P HZ2    1  
ATOM 1919  H HZ3    . LYS C 3 65 ? 0.818   11.226  -25.200 1.00 0.00 ? 65 LYS P HZ3    1  
ATOM 1920  N N      . ASP C 3 66 ? -4.286  9.011   -27.876 1.00 0.00 ? 66 ASP P N      1  
ATOM 1921  C CA     . ASP C 3 66 ? -4.434  9.576   -29.230 1.00 0.00 ? 66 ASP P CA     1  
ATOM 1922  C C      . ASP C 3 66 ? -3.507  10.686  -29.568 1.00 0.00 ? 66 ASP P C      1  
ATOM 1923  O O      . ASP C 3 66 ? -2.696  11.061  -28.730 1.00 0.00 ? 66 ASP P O      1  
ATOM 1924  C CB     . ASP C 3 66 ? -5.912  10.047  -29.438 1.00 0.00 ? 66 ASP P CB     1  
ATOM 1925  C CG     . ASP C 3 66 ? -6.182  11.450  -28.836 1.00 0.00 ? 66 ASP P CG     1  
ATOM 1926  O OD1    . ASP C 3 66 ? -6.164  12.483  -29.577 1.00 0.00 ? 66 ASP P OD1    1  
ATOM 1927  O OD2    . ASP C 3 66 ? -6.363  11.499  -27.592 1.00 0.00 ? 66 ASP P OD2    1  
ATOM 1928  H H      . ASP C 3 66 ? -4.395  9.587   -27.055 1.00 0.00 ? 66 ASP P H      1  
ATOM 1929  H HA     . ASP C 3 66 ? -4.226  8.838   -30.006 1.00 0.00 ? 66 ASP P HA     1  
ATOM 1930  H HB2    . ASP C 3 66 ? -6.157  10.134  -30.497 1.00 0.00 ? 66 ASP P HB2    1  
ATOM 1931  H HB3    . ASP C 3 66 ? -6.659  9.367   -29.027 1.00 0.00 ? 66 ASP P HB3    1  
ATOM 1932  N N      . GLN C 3 67 ? -3.640  11.276  -30.737 1.00 0.00 ? 67 GLN P N      1  
ATOM 1933  C CA     . GLN C 3 67 ? -2.838  12.397  -31.208 1.00 0.00 ? 67 GLN P CA     1  
ATOM 1934  C C      . GLN C 3 67 ? -3.681  13.166  -32.345 1.00 0.00 ? 67 GLN P C      1  
ATOM 1935  O O      . GLN C 3 67 ? -4.718  12.647  -32.838 1.00 0.00 ? 67 GLN P O      1  
ATOM 1936  C CB     . GLN C 3 67 ? -1.478  11.908  -31.692 1.00 0.00 ? 67 GLN P CB     1  
ATOM 1937  C CG     . GLN C 3 67 ? -1.433  11.220  -33.082 1.00 0.00 ? 67 GLN P CG     1  
ATOM 1938  C CD     . GLN C 3 67 ? -1.376  12.173  -34.241 1.00 0.00 ? 67 GLN P CD     1  
ATOM 1939  O OE1    . GLN C 3 67 ? -0.701  13.110  -34.227 1.00 0.00 ? 67 GLN P OE1    1  
ATOM 1940  N NE2    . GLN C 3 67 ? -2.125  11.929  -35.260 1.00 0.00 ? 67 GLN P NE2    1  
ATOM 1941  H H      . GLN C 3 67 ? -4.520  11.162  -31.221 1.00 0.00 ? 67 GLN P H      1  
ATOM 1942  H HA     . GLN C 3 67 ? -2.714  13.151  -30.431 1.00 0.00 ? 67 GLN P HA     1  
ATOM 1943  H HB2    . GLN C 3 67 ? -0.780  12.739  -31.591 1.00 0.00 ? 67 GLN P HB2    1  
ATOM 1944  H HB3    . GLN C 3 67 ? -1.026  11.221  -30.977 1.00 0.00 ? 67 GLN P HB3    1  
ATOM 1945  H HG2    . GLN C 3 67 ? -0.491  10.673  -33.030 1.00 0.00 ? 67 GLN P HG2    1  
ATOM 1946  H HG3    . GLN C 3 67 ? -2.283  10.539  -33.120 1.00 0.00 ? 67 GLN P HG3    1  
ATOM 1947  H HE21   . GLN C 3 67 ? -2.850  11.230  -35.340 1.00 0.00 ? 67 GLN P HE21   1  
ATOM 1948  H HE22   . GLN C 3 67 ? -2.189  12.627  -35.988 1.00 0.00 ? 67 GLN P HE22   1  
ATOM 1949  N N      . SER C 3 68 ? -3.205  14.370  -32.644 1.00 0.00 ? 68 SER P N      1  
ATOM 1950  C CA     . SER C 3 68 ? -3.745  15.314  -33.607 1.00 0.00 ? 68 SER P CA     1  
ATOM 1951  C C      . SER C 3 68 ? -2.597  16.107  -34.334 1.00 0.00 ? 68 SER P C      1  
ATOM 1952  O O      . SER C 3 68 ? -1.784  16.707  -33.648 1.00 0.00 ? 68 SER P O      1  
ATOM 1953  C CB     . SER C 3 68 ? -4.719  16.282  -33.007 1.00 0.00 ? 68 SER P CB     1  
ATOM 1954  O OG     . SER C 3 68 ? -4.233  16.987  -31.915 1.00 0.00 ? 68 SER P OG     1  
ATOM 1955  O OXT    . SER C 3 68 ? -2.503  16.105  -35.594 1.00 0.00 ? 68 SER P OXT    1  
ATOM 1956  H H      . SER C 3 68 ? -2.390  14.648  -32.117 1.00 0.00 ? 68 SER P H      1  
ATOM 1957  H HA     . SER C 3 68 ? -4.270  14.710  -34.348 1.00 0.00 ? 68 SER P HA     1  
ATOM 1958  H HB2    . SER C 3 68 ? -5.226  16.922  -33.730 1.00 0.00 ? 68 SER P HB2    1  
ATOM 1959  H HB3    . SER C 3 68 ? -5.449  15.603  -32.566 1.00 0.00 ? 68 SER P HB3    1  
ATOM 1960  H HG     . SER C 3 68 ? -3.307  17.183  -32.075 1.00 0.00 ? 68 SER P HG     1  
ATOM 1961  O "O5'"  . DG  A 1 1  ? 8.620   -24.116 -9.079  1.00 0.00 ? 69 DG  A "O5'"  2  
ATOM 1962  C "C5'"  . DG  A 1 1  ? 8.818   -24.799 -10.285 1.00 0.00 ? 69 DG  A "C5'"  2  
ATOM 1963  C "C4'"  . DG  A 1 1  ? 8.271   -24.137 -11.577 1.00 0.00 ? 69 DG  A "C4'"  2  
ATOM 1964  O "O4'"  . DG  A 1 1  ? 6.888   -23.983 -11.567 1.00 0.00 ? 69 DG  A "O4'"  2  
ATOM 1965  C "C3'"  . DG  A 1 1  ? 8.952   -22.834 -12.073 1.00 0.00 ? 69 DG  A "C3'"  2  
ATOM 1966  O "O3'"  . DG  A 1 1  ? 8.777   -22.734 -13.464 1.00 0.00 ? 69 DG  A "O3'"  2  
ATOM 1967  C "C2'"  . DG  A 1 1  ? 7.948   -21.928 -11.295 1.00 0.00 ? 69 DG  A "C2'"  2  
ATOM 1968  C "C1'"  . DG  A 1 1  ? 6.529   -22.567 -11.393 1.00 0.00 ? 69 DG  A "C1'"  2  
ATOM 1969  N N9     . DG  A 1 1  ? 5.741   -22.194 -10.179 1.00 0.00 ? 69 DG  A N9     2  
ATOM 1970  C C8     . DG  A 1 1  ? 6.200   -22.057 -8.910  1.00 0.00 ? 69 DG  A C8     2  
ATOM 1971  N N7     . DG  A 1 1  ? 5.275   -21.837 -8.032  1.00 0.00 ? 69 DG  A N7     2  
ATOM 1972  C C5     . DG  A 1 1  ? 4.068   -21.883 -8.740  1.00 0.00 ? 69 DG  A C5     2  
ATOM 1973  C C6     . DG  A 1 1  ? 2.715   -21.809 -8.387  1.00 0.00 ? 69 DG  A C6     2  
ATOM 1974  O O6     . DG  A 1 1  ? 2.114   -21.692 -7.313  1.00 0.00 ? 69 DG  A O6     2  
ATOM 1975  N N1     . DG  A 1 1  ? 1.891   -21.861 -9.482  1.00 0.00 ? 69 DG  A N1     2  
ATOM 1976  C C2     . DG  A 1 1  ? 2.270   -22.042 -10.753 1.00 0.00 ? 69 DG  A C2     2  
ATOM 1977  N N2     . DG  A 1 1  ? 1.370   -21.999 -11.677 1.00 0.00 ? 69 DG  A N2     2  
ATOM 1978  N N3     . DG  A 1 1  ? 3.540   -22.258 -11.155 1.00 0.00 ? 69 DG  A N3     2  
ATOM 1979  C C4     . DG  A 1 1  ? 4.380   -22.078 -10.068 1.00 0.00 ? 69 DG  A C4     2  
ATOM 1980  H "H5'"  . DG  A 1 1  ? 8.346   -25.778 -10.204 1.00 0.00 ? 69 DG  A "H5'"  2  
ATOM 1981  H "H5''" . DG  A 1 1  ? 9.785   -25.235 -10.535 1.00 0.00 ? 69 DG  A "H5''" 2  
ATOM 1982  H "H4'"  . DG  A 1 1  ? 8.558   -24.847 -12.352 1.00 0.00 ? 69 DG  A "H4'"  2  
ATOM 1983  H "H3'"  . DG  A 1 1  ? 9.964   -22.692 -11.698 1.00 0.00 ? 69 DG  A "H3'"  2  
ATOM 1984  H "H2'"  . DG  A 1 1  ? 8.310   -21.922 -10.267 1.00 0.00 ? 69 DG  A "H2'"  2  
ATOM 1985  H "H2''" . DG  A 1 1  ? 8.030   -20.956 -11.782 1.00 0.00 ? 69 DG  A "H2''" 2  
ATOM 1986  H "H1'"  . DG  A 1 1  ? 6.058   -22.158 -12.288 1.00 0.00 ? 69 DG  A "H1'"  2  
ATOM 1987  H H8     . DG  A 1 1  ? 7.236   -22.197 -8.642  1.00 0.00 ? 69 DG  A H8     2  
ATOM 1988  H H1     . DG  A 1 1  ? 0.917   -21.733 -9.246  1.00 0.00 ? 69 DG  A H1     2  
ATOM 1989  H H21    . DG  A 1 1  ? 1.762   -22.391 -12.521 1.00 0.00 ? 69 DG  A H21    2  
ATOM 1990  H H22    . DG  A 1 1  ? 0.387   -22.016 -11.446 1.00 0.00 ? 69 DG  A H22    2  
ATOM 1991  H "HO5'" . DG  A 1 1  ? 9.486   -23.822 -8.787  1.00 0.00 ? 69 DG  A "HO5'" 2  
ATOM 1992  P P      . DC  A 1 2  ? 9.331   -21.470 -14.306 1.00 0.00 ? 70 DC  A P      2  
ATOM 1993  O OP1    . DC  A 1 2  ? 9.767   -22.049 -15.523 1.00 0.00 ? 70 DC  A OP1    2  
ATOM 1994  O OP2    . DC  A 1 2  ? 10.286  -20.581 -13.569 1.00 0.00 ? 70 DC  A OP2    2  
ATOM 1995  O "O5'"  . DC  A 1 2  ? 7.996   -20.593 -14.518 1.00 0.00 ? 70 DC  A "O5'"  2  
ATOM 1996  C "C5'"  . DC  A 1 2  ? 6.980   -21.130 -15.415 1.00 0.00 ? 70 DC  A "C5'"  2  
ATOM 1997  C "C4'"  . DC  A 1 2  ? 5.677   -20.331 -15.457 1.00 0.00 ? 70 DC  A "C4'"  2  
ATOM 1998  O "O4'"  . DC  A 1 2  ? 4.893   -20.340 -14.253 1.00 0.00 ? 70 DC  A "O4'"  2  
ATOM 1999  C "C3'"  . DC  A 1 2  ? 5.879   -18.832 -15.856 1.00 0.00 ? 70 DC  A "C3'"  2  
ATOM 2000  O "O3'"  . DC  A 1 2  ? 5.314   -18.447 -17.152 1.00 0.00 ? 70 DC  A "O3'"  2  
ATOM 2001  C "C2'"  . DC  A 1 2  ? 5.215   -18.159 -14.627 1.00 0.00 ? 70 DC  A "C2'"  2  
ATOM 2002  C "C1'"  . DC  A 1 2  ? 4.290   -19.102 -14.029 1.00 0.00 ? 70 DC  A "C1'"  2  
ATOM 2003  N N1     . DC  A 1 2  ? 4.172   -18.852 -12.584 1.00 0.00 ? 70 DC  A N1     2  
ATOM 2004  C C2     . DC  A 1 2  ? 2.920   -18.669 -11.975 1.00 0.00 ? 70 DC  A C2     2  
ATOM 2005  O O2     . DC  A 1 2  ? 1.884   -18.672 -12.651 1.00 0.00 ? 70 DC  A O2     2  
ATOM 2006  N N3     . DC  A 1 2  ? 2.754   -18.595 -10.619 1.00 0.00 ? 70 DC  A N3     2  
ATOM 2007  C C4     . DC  A 1 2  ? 3.811   -18.611 -9.906  1.00 0.00 ? 70 DC  A C4     2  
ATOM 2008  N N4     . DC  A 1 2  ? 3.586   -18.394 -8.636  1.00 0.00 ? 70 DC  A N4     2  
ATOM 2009  C C5     . DC  A 1 2  ? 5.092   -18.916 -10.373 1.00 0.00 ? 70 DC  A C5     2  
ATOM 2010  C C6     . DC  A 1 2  ? 5.267   -18.982 -11.759 1.00 0.00 ? 70 DC  A C6     2  
ATOM 2011  H "H5'"  . DC  A 1 2  ? 6.749   -22.155 -15.126 1.00 0.00 ? 70 DC  A "H5'"  2  
ATOM 2012  H "H5''" . DC  A 1 2  ? 7.352   -21.141 -16.440 1.00 0.00 ? 70 DC  A "H5''" 2  
ATOM 2013  H "H4'"  . DC  A 1 2  ? 5.078   -20.782 -16.248 1.00 0.00 ? 70 DC  A "H4'"  2  
ATOM 2014  H "H3'"  . DC  A 1 2  ? 6.954   -18.656 -15.868 1.00 0.00 ? 70 DC  A "H3'"  2  
ATOM 2015  H "H2'"  . DC  A 1 2  ? 5.979   -17.854 -13.913 1.00 0.00 ? 70 DC  A "H2'"  2  
ATOM 2016  H "H2''" . DC  A 1 2  ? 4.799   -17.200 -14.937 1.00 0.00 ? 70 DC  A "H2''" 2  
ATOM 2017  H "H1'"  . DC  A 1 2  ? 3.344   -18.853 -14.511 1.00 0.00 ? 70 DC  A "H1'"  2  
ATOM 2018  H H41    . DC  A 1 2  ? 4.369   -18.484 -8.005  1.00 0.00 ? 70 DC  A H41    2  
ATOM 2019  H H42    . DC  A 1 2  ? 2.770   -17.834 -8.430  1.00 0.00 ? 70 DC  A H42    2  
ATOM 2020  H H5     . DC  A 1 2  ? 5.989   -19.060 -9.789  1.00 0.00 ? 70 DC  A H5     2  
ATOM 2021  H H6     . DC  A 1 2  ? 6.222   -19.052 -12.258 1.00 0.00 ? 70 DC  A H6     2  
ATOM 2022  P P      . DT  A 1 3  ? 5.211   -16.961 -17.723 1.00 0.00 ? 71 DT  A P      2  
ATOM 2023  O OP1    . DT  A 1 3  ? 4.942   -17.102 -19.166 1.00 0.00 ? 71 DT  A OP1    2  
ATOM 2024  O OP2    . DT  A 1 3  ? 6.418   -16.229 -17.339 1.00 0.00 ? 71 DT  A OP2    2  
ATOM 2025  O "O5'"  . DT  A 1 3  ? 3.944   -16.283 -17.033 1.00 0.00 ? 71 DT  A "O5'"  2  
ATOM 2026  C "C5'"  . DT  A 1 3  ? 2.566   -16.746 -17.079 1.00 0.00 ? 71 DT  A "C5'"  2  
ATOM 2027  C "C4'"  . DT  A 1 3  ? 1.628   -16.236 -15.991 1.00 0.00 ? 71 DT  A "C4'"  2  
ATOM 2028  O "O4'"  . DT  A 1 3  ? 1.965   -16.595 -14.689 1.00 0.00 ? 71 DT  A "O4'"  2  
ATOM 2029  C "C3'"  . DT  A 1 3  ? 1.738   -14.710 -16.042 1.00 0.00 ? 71 DT  A "C3'"  2  
ATOM 2030  O "O3'"  . DT  A 1 3  ? 0.951   -14.185 -17.071 1.00 0.00 ? 71 DT  A "O3'"  2  
ATOM 2031  C "C2'"  . DT  A 1 3  ? 1.191   -14.478 -14.619 1.00 0.00 ? 71 DT  A "C2'"  2  
ATOM 2032  C "C1'"  . DT  A 1 3  ? 1.188   -15.765 -13.816 1.00 0.00 ? 71 DT  A "C1'"  2  
ATOM 2033  N N1     . DT  A 1 3  ? 1.884   -15.605 -12.510 1.00 0.00 ? 71 DT  A N1     2  
ATOM 2034  C C2     . DT  A 1 3  ? 0.973   -15.424 -11.460 1.00 0.00 ? 71 DT  A C2     2  
ATOM 2035  O O2     . DT  A 1 3  ? -0.203  -15.050 -11.637 1.00 0.00 ? 71 DT  A O2     2  
ATOM 2036  N N3     . DT  A 1 3  ? 1.549   -15.313 -10.166 1.00 0.00 ? 71 DT  A N3     2  
ATOM 2037  C C4     . DT  A 1 3  ? 2.874   -15.398 -9.922  1.00 0.00 ? 71 DT  A C4     2  
ATOM 2038  O O4     . DT  A 1 3  ? 3.229   -15.318 -8.766  1.00 0.00 ? 71 DT  A O4     2  
ATOM 2039  C C5     . DT  A 1 3  ? 3.769   -15.398 -11.073 1.00 0.00 ? 71 DT  A C5     2  
ATOM 2040  C C7     . DT  A 1 3  ? 5.208   -15.227 -10.835 1.00 0.00 ? 71 DT  A C7     2  
ATOM 2041  C C6     . DT  A 1 3  ? 3.254   -15.555 -12.319 1.00 0.00 ? 71 DT  A C6     2  
ATOM 2042  H "H5'"  . DT  A 1 3  ? 2.587   -17.832 -16.982 1.00 0.00 ? 71 DT  A "H5'"  2  
ATOM 2043  H "H5''" . DT  A 1 3  ? 2.228   -16.407 -18.059 1.00 0.00 ? 71 DT  A "H5''" 2  
ATOM 2044  H "H4'"  . DT  A 1 3  ? 0.604   -16.570 -16.164 1.00 0.00 ? 71 DT  A "H4'"  2  
ATOM 2045  H "H3'"  . DT  A 1 3  ? 2.787   -14.413 -16.020 1.00 0.00 ? 71 DT  A "H3'"  2  
ATOM 2046  H "H2'"  . DT  A 1 3  ? 1.853   -13.706 -14.229 1.00 0.00 ? 71 DT  A "H2'"  2  
ATOM 2047  H "H2''" . DT  A 1 3  ? 0.144   -14.175 -14.650 1.00 0.00 ? 71 DT  A "H2''" 2  
ATOM 2048  H "H1'"  . DT  A 1 3  ? 0.171   -16.154 -13.782 1.00 0.00 ? 71 DT  A "H1'"  2  
ATOM 2049  H H3     . DT  A 1 3  ? 0.967   -15.112 -9.366  1.00 0.00 ? 71 DT  A H3     2  
ATOM 2050  H H71    . DT  A 1 3  ? 5.660   -15.947 -10.152 1.00 0.00 ? 71 DT  A H71    2  
ATOM 2051  H H72    . DT  A 1 3  ? 5.743   -15.285 -11.784 1.00 0.00 ? 71 DT  A H72    2  
ATOM 2052  H H73    . DT  A 1 3  ? 5.319   -14.219 -10.438 1.00 0.00 ? 71 DT  A H73    2  
ATOM 2053  H H6     . DT  A 1 3  ? 3.961   -15.772 -13.107 1.00 0.00 ? 71 DT  A H6     2  
ATOM 2054  P P      . DC  A 1 4  ? 0.763   -12.673 -17.217 1.00 0.00 ? 72 DC  A P      2  
ATOM 2055  O OP1    . DC  A 1 4  ? 0.196   -12.465 -18.584 1.00 0.00 ? 72 DC  A OP1    2  
ATOM 2056  O OP2    . DC  A 1 4  ? 2.031   -12.017 -16.821 1.00 0.00 ? 72 DC  A OP2    2  
ATOM 2057  O "O5'"  . DC  A 1 4  ? -0.286  -12.083 -16.212 1.00 0.00 ? 72 DC  A "O5'"  2  
ATOM 2058  C "C5'"  . DC  A 1 4  ? -1.596  -12.566 -16.116 1.00 0.00 ? 72 DC  A "C5'"  2  
ATOM 2059  C "C4'"  . DC  A 1 4  ? -2.244  -11.881 -14.945 1.00 0.00 ? 72 DC  A "C4'"  2  
ATOM 2060  O "O4'"  . DC  A 1 4  ? -1.530  -12.276 -13.782 1.00 0.00 ? 72 DC  A "O4'"  2  
ATOM 2061  C "C3'"  . DC  A 1 4  ? -2.280  -10.352 -14.981 1.00 0.00 ? 72 DC  A "C3'"  2  
ATOM 2062  O "O3'"  . DC  A 1 4  ? -3.600  -9.900  -14.761 1.00 0.00 ? 72 DC  A "O3'"  2  
ATOM 2063  C "C2'"  . DC  A 1 4  ? -1.331  -9.944  -13.837 1.00 0.00 ? 72 DC  A "C2'"  2  
ATOM 2064  C "C1'"  . DC  A 1 4  ? -1.284  -11.111 -12.866 1.00 0.00 ? 72 DC  A "C1'"  2  
ATOM 2065  N N1     . DC  A 1 4  ? 0.072   -11.328 -12.205 1.00 0.00 ? 72 DC  A N1     2  
ATOM 2066  C C2     . DC  A 1 4  ? 0.164   -11.325 -10.794 1.00 0.00 ? 72 DC  A C2     2  
ATOM 2067  O O2     . DC  A 1 4  ? -0.805  -10.956 -10.114 1.00 0.00 ? 72 DC  A O2     2  
ATOM 2068  N N3     . DC  A 1 4  ? 1.306   -11.494 -10.128 1.00 0.00 ? 72 DC  A N3     2  
ATOM 2069  C C4     . DC  A 1 4  ? 2.438   -11.649 -10.805 1.00 0.00 ? 72 DC  A C4     2  
ATOM 2070  N N4     . DC  A 1 4  ? 3.548   -11.722 -10.136 1.00 0.00 ? 72 DC  A N4     2  
ATOM 2071  C C5     . DC  A 1 4  ? 2.425   -11.639 -12.219 1.00 0.00 ? 72 DC  A C5     2  
ATOM 2072  C C6     . DC  A 1 4  ? 1.264   -11.437 -12.866 1.00 0.00 ? 72 DC  A C6     2  
ATOM 2073  H "H5'"  . DC  A 1 4  ? -1.657  -13.595 -15.761 1.00 0.00 ? 72 DC  A "H5'"  2  
ATOM 2074  H "H5''" . DC  A 1 4  ? -2.205  -12.400 -17.005 1.00 0.00 ? 72 DC  A "H5''" 2  
ATOM 2075  H "H4'"  . DC  A 1 4  ? -3.247  -12.298 -14.861 1.00 0.00 ? 72 DC  A "H4'"  2  
ATOM 2076  H "H3'"  . DC  A 1 4  ? -2.037  -9.993  -15.981 1.00 0.00 ? 72 DC  A "H3'"  2  
ATOM 2077  H "H2'"  . DC  A 1 4  ? -0.318  -9.802  -14.212 1.00 0.00 ? 72 DC  A "H2'"  2  
ATOM 2078  H "H2''" . DC  A 1 4  ? -1.718  -9.102  -13.265 1.00 0.00 ? 72 DC  A "H2''" 2  
ATOM 2079  H "H1'"  . DC  A 1 4  ? -2.102  -11.050 -12.147 1.00 0.00 ? 72 DC  A "H1'"  2  
ATOM 2080  H H41    . DC  A 1 4  ? 4.348   -11.646 -10.748 1.00 0.00 ? 72 DC  A H41    2  
ATOM 2081  H H42    . DC  A 1 4  ? 3.668   -11.788 -9.135  1.00 0.00 ? 72 DC  A H42    2  
ATOM 2082  H H5     . DC  A 1 4  ? 3.328   -11.793 -12.791 1.00 0.00 ? 72 DC  A H5     2  
ATOM 2083  H H6     . DC  A 1 4  ? 1.276   -11.289 -13.936 1.00 0.00 ? 72 DC  A H6     2  
ATOM 2084  P P      . DT  A 1 5  ? -4.019  -8.412  -14.956 1.00 0.00 ? 73 DT  A P      2  
ATOM 2085  O OP1    . DT  A 1 5  ? -5.511  -8.443  -14.989 1.00 0.00 ? 73 DT  A OP1    2  
ATOM 2086  O OP2    . DT  A 1 5  ? -3.353  -7.945  -16.149 1.00 0.00 ? 73 DT  A OP2    2  
ATOM 2087  O "O5'"  . DT  A 1 5  ? -3.553  -7.653  -13.628 1.00 0.00 ? 73 DT  A "O5'"  2  
ATOM 2088  C "C5'"  . DT  A 1 5  ? -4.179  -7.923  -12.338 1.00 0.00 ? 73 DT  A "C5'"  2  
ATOM 2089  C "C4'"  . DT  A 1 5  ? -3.392  -7.314  -11.139 1.00 0.00 ? 73 DT  A "C4'"  2  
ATOM 2090  O "O4'"  . DT  A 1 5  ? -2.271  -8.043  -10.869 1.00 0.00 ? 73 DT  A "O4'"  2  
ATOM 2091  C "C3'"  . DT  A 1 5  ? -2.986  -5.813  -11.356 1.00 0.00 ? 73 DT  A "C3'"  2  
ATOM 2092  O "O3'"  . DT  A 1 5  ? -3.296  -5.090  -10.200 1.00 0.00 ? 73 DT  A "O3'"  2  
ATOM 2093  C "C2'"  . DT  A 1 5  ? -1.523  -6.013  -11.620 1.00 0.00 ? 73 DT  A "C2'"  2  
ATOM 2094  C "C1'"  . DT  A 1 5  ? -1.176  -7.149  -10.575 1.00 0.00 ? 73 DT  A "C1'"  2  
ATOM 2095  N N1     . DT  A 1 5  ? 0.237   -7.665  -10.629 1.00 0.00 ? 73 DT  A N1     2  
ATOM 2096  C C2     . DT  A 1 5  ? 0.909   -7.900  -9.419  1.00 0.00 ? 73 DT  A C2     2  
ATOM 2097  O O2     . DT  A 1 5  ? 0.310   -7.953  -8.380  1.00 0.00 ? 73 DT  A O2     2  
ATOM 2098  N N3     . DT  A 1 5  ? 2.233   -8.286  -9.535  1.00 0.00 ? 73 DT  A N3     2  
ATOM 2099  C C4     . DT  A 1 5  ? 2.993   -8.341  -10.727 1.00 0.00 ? 73 DT  A C4     2  
ATOM 2100  O O4     . DT  A 1 5  ? 4.119   -8.722  -10.740 1.00 0.00 ? 73 DT  A O4     2  
ATOM 2101  C C5     . DT  A 1 5  ? 2.216   -7.992  -11.875 1.00 0.00 ? 73 DT  A C5     2  
ATOM 2102  C C7     . DT  A 1 5  ? 2.793   -8.103  -13.264 1.00 0.00 ? 73 DT  A C7     2  
ATOM 2103  C C6     . DT  A 1 5  ? 0.906   -7.713  -11.807 1.00 0.00 ? 73 DT  A C6     2  
ATOM 2104  H "H5'"  . DT  A 1 5  ? -4.340  -8.998  -12.243 1.00 0.00 ? 73 DT  A "H5'"  2  
ATOM 2105  H "H5''" . DT  A 1 5  ? -5.180  -7.491  -12.369 1.00 0.00 ? 73 DT  A "H5''" 2  
ATOM 2106  H "H4'"  . DT  A 1 5  ? -3.998  -7.442  -10.241 1.00 0.00 ? 73 DT  A "H4'"  2  
ATOM 2107  H "H3'"  . DT  A 1 5  ? -3.588  -5.445  -12.187 1.00 0.00 ? 73 DT  A "H3'"  2  
ATOM 2108  H "H2'"  . DT  A 1 5  ? -1.340  -6.192  -12.679 1.00 0.00 ? 73 DT  A "H2'"  2  
ATOM 2109  H "H2''" . DT  A 1 5  ? -0.923  -5.155  -11.316 1.00 0.00 ? 73 DT  A "H2''" 2  
ATOM 2110  H "H1'"  . DT  A 1 5  ? -1.261  -6.754  -9.562  1.00 0.00 ? 73 DT  A "H1'"  2  
ATOM 2111  H H3     . DT  A 1 5  ? 2.773   -8.703  -8.790  1.00 0.00 ? 73 DT  A H3     2  
ATOM 2112  H H71    . DT  A 1 5  ? 3.694   -7.492  -13.285 1.00 0.00 ? 73 DT  A H71    2  
ATOM 2113  H H72    . DT  A 1 5  ? 2.958   -9.133  -13.579 1.00 0.00 ? 73 DT  A H72    2  
ATOM 2114  H H73    . DT  A 1 5  ? 2.147   -7.609  -13.990 1.00 0.00 ? 73 DT  A H73    2  
ATOM 2115  H H6     . DT  A 1 5  ? 0.408   -7.426  -12.721 1.00 0.00 ? 73 DT  A H6     2  
ATOM 2116  P P      . DA  A 1 6  ? -4.680  -4.670  -9.738  1.00 0.00 ? 74 DA  A P      2  
ATOM 2117  O OP1    . DA  A 1 6  ? -5.685  -5.647  -10.195 1.00 0.00 ? 74 DA  A OP1    2  
ATOM 2118  O OP2    . DA  A 1 6  ? -4.900  -3.319  -10.249 1.00 0.00 ? 74 DA  A OP2    2  
ATOM 2119  O "O5'"  . DA  A 1 6  ? -4.625  -4.546  -8.090  1.00 0.00 ? 74 DA  A "O5'"  2  
ATOM 2120  C "C5'"  . DA  A 1 6  ? -4.919  -5.665  -7.274  1.00 0.00 ? 74 DA  A "C5'"  2  
ATOM 2121  C "C4'"  . DA  A 1 6  ? -4.432  -5.782  -5.815  1.00 0.00 ? 74 DA  A "C4'"  2  
ATOM 2122  O "O4'"  . DA  A 1 6  ? -3.073  -6.229  -5.670  1.00 0.00 ? 74 DA  A "O4'"  2  
ATOM 2123  C "C3'"  . DA  A 1 6  ? -4.574  -4.587  -5.039  1.00 0.00 ? 74 DA  A "C3'"  2  
ATOM 2124  O "O3'"  . DA  A 1 6  ? -4.868  -4.957  -3.711  1.00 0.00 ? 74 DA  A "O3'"  2  
ATOM 2125  C "C2'"  . DA  A 1 6  ? -3.208  -3.834  -5.312  1.00 0.00 ? 74 DA  A "C2'"  2  
ATOM 2126  C "C1'"  . DA  A 1 6  ? -2.243  -5.035  -5.389  1.00 0.00 ? 74 DA  A "C1'"  2  
ATOM 2127  N N9     . DA  A 1 6  ? -1.165  -5.049  -6.371  1.00 0.00 ? 74 DA  A N9     2  
ATOM 2128  C C8     . DA  A 1 6  ? -1.284  -4.639  -7.671  1.00 0.00 ? 74 DA  A C8     2  
ATOM 2129  N N7     . DA  A 1 6  ? -0.152  -4.778  -8.325  1.00 0.00 ? 74 DA  A N7     2  
ATOM 2130  C C5     . DA  A 1 6  ? 0.744   -5.355  -7.385  1.00 0.00 ? 74 DA  A C5     2  
ATOM 2131  C C6     . DA  A 1 6  ? 2.150   -5.567  -7.346  1.00 0.00 ? 74 DA  A C6     2  
ATOM 2132  N N6     . DA  A 1 6  ? 2.967   -5.553  -8.409  1.00 0.00 ? 74 DA  A N6     2  
ATOM 2133  N N1     . DA  A 1 6  ? 2.784   -5.976  -6.251  1.00 0.00 ? 74 DA  A N1     2  
ATOM 2134  C C2     . DA  A 1 6  ? 2.044   -6.235  -5.170  1.00 0.00 ? 74 DA  A C2     2  
ATOM 2135  N N3     . DA  A 1 6  ? 0.728   -5.948  -5.023  1.00 0.00 ? 74 DA  A N3     2  
ATOM 2136  C C4     . DA  A 1 6  ? 0.148   -5.550  -6.195  1.00 0.00 ? 74 DA  A C4     2  
ATOM 2137  H "H5'"  . DA  A 1 6  ? -4.533  -6.512  -7.841  1.00 0.00 ? 74 DA  A "H5'"  2  
ATOM 2138  H "H5''" . DA  A 1 6  ? -5.999  -5.812  -7.276  1.00 0.00 ? 74 DA  A "H5''" 2  
ATOM 2139  H "H4'"  . DA  A 1 6  ? -5.054  -6.577  -5.402  1.00 0.00 ? 74 DA  A "H4'"  2  
ATOM 2140  H "H3'"  . DA  A 1 6  ? -5.462  -4.049  -5.372  1.00 0.00 ? 74 DA  A "H3'"  2  
ATOM 2141  H "H2'"  . DA  A 1 6  ? -3.244  -3.361  -6.293  1.00 0.00 ? 74 DA  A "H2'"  2  
ATOM 2142  H "H2''" . DA  A 1 6  ? -2.933  -3.014  -4.649  1.00 0.00 ? 74 DA  A "H2''" 2  
ATOM 2143  H "H1'"  . DA  A 1 6  ? -1.817  -5.142  -4.392  1.00 0.00 ? 74 DA  A "H1'"  2  
ATOM 2144  H H8     . DA  A 1 6  ? -2.206  -4.296  -8.118  1.00 0.00 ? 74 DA  A H8     2  
ATOM 2145  H H61    . DA  A 1 6  ? 3.894   -5.941  -8.305  1.00 0.00 ? 74 DA  A H61    2  
ATOM 2146  H H62    . DA  A 1 6  ? 2.567   -5.251  -9.285  1.00 0.00 ? 74 DA  A H62    2  
ATOM 2147  H H2     . DA  A 1 6  ? 2.506   -6.683  -4.304  1.00 0.00 ? 74 DA  A H2     2  
ATOM 2148  P P      . DA  A 1 7  ? -5.112  -3.926  -2.462  1.00 0.00 ? 75 DA  A P      2  
ATOM 2149  O OP1    . DA  A 1 7  ? -5.796  -4.751  -1.475  1.00 0.00 ? 75 DA  A OP1    2  
ATOM 2150  O OP2    . DA  A 1 7  ? -5.800  -2.663  -2.899  1.00 0.00 ? 75 DA  A OP2    2  
ATOM 2151  O "O5'"  . DA  A 1 7  ? -3.634  -3.615  -1.993  1.00 0.00 ? 75 DA  A "O5'"  2  
ATOM 2152  C "C5'"  . DA  A 1 7  ? -2.926  -4.646  -1.372  1.00 0.00 ? 75 DA  A "C5'"  2  
ATOM 2153  C "C4'"  . DA  A 1 7  ? -1.443  -4.381  -1.021  1.00 0.00 ? 75 DA  A "C4'"  2  
ATOM 2154  O "O4'"  . DA  A 1 7  ? -0.669  -4.271  -2.176  1.00 0.00 ? 75 DA  A "O4'"  2  
ATOM 2155  C "C3'"  . DA  A 1 7  ? -1.185  -3.067  -0.165  1.00 0.00 ? 75 DA  A "C3'"  2  
ATOM 2156  O "O3'"  . DA  A 1 7  ? -0.333  -3.544  0.849   1.00 0.00 ? 75 DA  A "O3'"  2  
ATOM 2157  C "C2'"  . DA  A 1 7  ? -0.550  -2.145  -1.161  1.00 0.00 ? 75 DA  A "C2'"  2  
ATOM 2158  C "C1'"  . DA  A 1 7  ? 0.134   -3.165  -2.140  1.00 0.00 ? 75 DA  A "C1'"  2  
ATOM 2159  N N9     . DA  A 1 7  ? 0.472   -2.655  -3.431  1.00 0.00 ? 75 DA  A N9     2  
ATOM 2160  C C8     . DA  A 1 7  ? -0.309  -2.013  -4.340  1.00 0.00 ? 75 DA  A C8     2  
ATOM 2161  N N7     . DA  A 1 7  ? 0.211   -1.813  -5.511  1.00 0.00 ? 75 DA  A N7     2  
ATOM 2162  C C5     . DA  A 1 7  ? 1.492   -2.377  -5.324  1.00 0.00 ? 75 DA  A C5     2  
ATOM 2163  C C6     . DA  A 1 7  ? 2.571   -2.592  -6.199  1.00 0.00 ? 75 DA  A C6     2  
ATOM 2164  N N6     . DA  A 1 7  ? 2.579   -2.349  -7.490  1.00 0.00 ? 75 DA  A N6     2  
ATOM 2165  N N1     . DA  A 1 7  ? 3.737   -3.003  -5.724  1.00 0.00 ? 75 DA  A N1     2  
ATOM 2166  C C2     . DA  A 1 7  ? 3.823   -3.419  -4.456  1.00 0.00 ? 75 DA  A C2     2  
ATOM 2167  N N3     . DA  A 1 7  ? 2.798   -3.423  -3.617  1.00 0.00 ? 75 DA  A N3     2  
ATOM 2168  C C4     . DA  A 1 7  ? 1.652   -2.826  -4.088  1.00 0.00 ? 75 DA  A C4     2  
ATOM 2169  H "H5'"  . DA  A 1 7  ? -2.902  -5.517  -2.027  1.00 0.00 ? 75 DA  A "H5'"  2  
ATOM 2170  H "H5''" . DA  A 1 7  ? -3.332  -4.997  -0.424  1.00 0.00 ? 75 DA  A "H5''" 2  
ATOM 2171  H "H4'"  . DA  A 1 7  ? -1.105  -5.296  -0.534  1.00 0.00 ? 75 DA  A "H4'"  2  
ATOM 2172  H "H3'"  . DA  A 1 7  ? -2.122  -2.667  0.224   1.00 0.00 ? 75 DA  A "H3'"  2  
ATOM 2173  H "H2'"  . DA  A 1 7  ? -1.317  -1.605  -1.717  1.00 0.00 ? 75 DA  A "H2'"  2  
ATOM 2174  H "H2''" . DA  A 1 7  ? 0.133   -1.401  -0.755  1.00 0.00 ? 75 DA  A "H2''" 2  
ATOM 2175  H "H1'"  . DA  A 1 7  ? 1.044   -3.405  -1.589  1.00 0.00 ? 75 DA  A "H1'"  2  
ATOM 2176  H H8     . DA  A 1 7  ? -1.268  -1.608  -4.050  1.00 0.00 ? 75 DA  A H8     2  
ATOM 2177  H H61    . DA  A 1 7  ? 3.481   -2.447  -7.936  1.00 0.00 ? 75 DA  A H61    2  
ATOM 2178  H H62    . DA  A 1 7  ? 1.729   -2.135  -7.989  1.00 0.00 ? 75 DA  A H62    2  
ATOM 2179  H H2     . DA  A 1 7  ? 4.775   -3.703  -4.031  1.00 0.00 ? 75 DA  A H2     2  
ATOM 2180  P P      . DT  A 1 8  ? 0.206   -2.527  1.995   1.00 0.00 ? 76 DT  A P      2  
ATOM 2181  O OP1    . DT  A 1 8  ? 0.316   -3.261  3.276   1.00 0.00 ? 76 DT  A OP1    2  
ATOM 2182  O OP2    . DT  A 1 8  ? -0.616  -1.318  1.982   1.00 0.00 ? 76 DT  A OP2    2  
ATOM 2183  O "O5'"  . DT  A 1 8  ? 1.682   -2.290  1.475   1.00 0.00 ? 76 DT  A "O5'"  2  
ATOM 2184  C "C5'"  . DT  A 1 8  ? 2.604   -3.391  1.415   1.00 0.00 ? 76 DT  A "C5'"  2  
ATOM 2185  C "C4'"  . DT  A 1 8  ? 4.021   -3.017  1.062   1.00 0.00 ? 76 DT  A "C4'"  2  
ATOM 2186  O "O4'"  . DT  A 1 8  ? 4.148   -2.677  -0.276  1.00 0.00 ? 76 DT  A "O4'"  2  
ATOM 2187  C "C3'"  . DT  A 1 8  ? 4.437   -1.805  1.925   1.00 0.00 ? 76 DT  A "C3'"  2  
ATOM 2188  O "O3'"  . DT  A 1 8  ? 5.768   -2.059  2.478   1.00 0.00 ? 76 DT  A "O3'"  2  
ATOM 2189  C "C2'"  . DT  A 1 8  ? 4.521   -0.683  0.875   1.00 0.00 ? 76 DT  A "C2'"  2  
ATOM 2190  C "C1'"  . DT  A 1 8  ? 4.700   -1.424  -0.416  1.00 0.00 ? 76 DT  A "C1'"  2  
ATOM 2191  N N1     . DT  A 1 8  ? 4.079   -0.690  -1.625  1.00 0.00 ? 76 DT  A N1     2  
ATOM 2192  C C2     . DT  A 1 8  ? 5.029   -0.458  -2.664  1.00 0.00 ? 76 DT  A C2     2  
ATOM 2193  O O2     . DT  A 1 8  ? 6.211   -0.749  -2.729  1.00 0.00 ? 76 DT  A O2     2  
ATOM 2194  N N3     . DT  A 1 8  ? 4.477   -0.029  -3.814  1.00 0.00 ? 76 DT  A N3     2  
ATOM 2195  C C4     . DT  A 1 8  ? 3.153   0.378   -4.004  1.00 0.00 ? 76 DT  A C4     2  
ATOM 2196  O O4     . DT  A 1 8  ? 2.746   0.663   -5.131  1.00 0.00 ? 76 DT  A O4     2  
ATOM 2197  C C5     . DT  A 1 8  ? 2.357   0.347   -2.749  1.00 0.00 ? 76 DT  A C5     2  
ATOM 2198  C C7     . DT  A 1 8  ? 0.981   0.958   -2.765  1.00 0.00 ? 76 DT  A C7     2  
ATOM 2199  C C6     . DT  A 1 8  ? 2.798   -0.214  -1.606  1.00 0.00 ? 76 DT  A C6     2  
ATOM 2200  H "H5'"  . DT  A 1 8  ? 2.335   -4.123  0.653   1.00 0.00 ? 76 DT  A "H5'"  2  
ATOM 2201  H "H5''" . DT  A 1 8  ? 2.607   -4.008  2.314   1.00 0.00 ? 76 DT  A "H5''" 2  
ATOM 2202  H "H4'"  . DT  A 1 8  ? 4.702   -3.799  1.397   1.00 0.00 ? 76 DT  A "H4'"  2  
ATOM 2203  H "H3'"  . DT  A 1 8  ? 3.753   -1.561  2.738   1.00 0.00 ? 76 DT  A "H3'"  2  
ATOM 2204  H "H2'"  . DT  A 1 8  ? 3.597   -0.119  1.004   1.00 0.00 ? 76 DT  A "H2'"  2  
ATOM 2205  H "H2''" . DT  A 1 8  ? 5.377   -0.030  1.039   1.00 0.00 ? 76 DT  A "H2''" 2  
ATOM 2206  H "H1'"  . DT  A 1 8  ? 5.784   -1.523  -0.473  1.00 0.00 ? 76 DT  A "H1'"  2  
ATOM 2207  H H3     . DT  A 1 8  ? 5.038   -0.019  -4.653  1.00 0.00 ? 76 DT  A H3     2  
ATOM 2208  H H71    . DT  A 1 8  ? 0.569   0.997   -1.757  1.00 0.00 ? 76 DT  A H71    2  
ATOM 2209  H H72    . DT  A 1 8  ? 1.012   2.013   -3.041  1.00 0.00 ? 76 DT  A H72    2  
ATOM 2210  H H73    . DT  A 1 8  ? 0.363   0.403   -3.469  1.00 0.00 ? 76 DT  A H73    2  
ATOM 2211  H H6     . DT  A 1 8  ? 2.164   -0.159  -0.733  1.00 0.00 ? 76 DT  A H6     2  
ATOM 2212  P P      . DC  A 1 9  ? 6.418   -1.176  3.636   1.00 0.00 ? 77 DC  A P      2  
ATOM 2213  O OP1    . DC  A 1 9  ? 7.092   -2.116  4.549   1.00 0.00 ? 77 DC  A OP1    2  
ATOM 2214  O OP2    . DC  A 1 9  ? 5.556   -0.220  4.294   1.00 0.00 ? 77 DC  A OP2    2  
ATOM 2215  O "O5'"  . DC  A 1 9  ? 7.440   -0.289  2.785   1.00 0.00 ? 77 DC  A "O5'"  2  
ATOM 2216  C "C5'"  . DC  A 1 9  ? 8.638   -0.865  2.284   1.00 0.00 ? 77 DC  A "C5'"  2  
ATOM 2217  C "C4'"  . DC  A 1 9  ? 9.571   -0.007  1.354   1.00 0.00 ? 77 DC  A "C4'"  2  
ATOM 2218  O "O4'"  . DC  A 1 9  ? 8.712   0.328   0.267   1.00 0.00 ? 77 DC  A "O4'"  2  
ATOM 2219  C "C3'"  . DC  A 1 9  ? 10.097  1.301   2.003   1.00 0.00 ? 77 DC  A "C3'"  2  
ATOM 2220  O "O3'"  . DC  A 1 9  ? 11.437  1.544   1.684   1.00 0.00 ? 77 DC  A "O3'"  2  
ATOM 2221  C "C2'"  . DC  A 1 9  ? 9.094   2.259   1.376   1.00 0.00 ? 77 DC  A "C2'"  2  
ATOM 2222  C "C1'"  . DC  A 1 9  ? 8.786   1.706   0.024   1.00 0.00 ? 77 DC  A "C1'"  2  
ATOM 2223  N N1     . DC  A 1 9  ? 7.522   2.206   -0.672  1.00 0.00 ? 77 DC  A N1     2  
ATOM 2224  C C2     . DC  A 1 9  ? 7.552   2.628   -2.032  1.00 0.00 ? 77 DC  A C2     2  
ATOM 2225  O O2     . DC  A 1 9  ? 8.614   2.710   -2.630  1.00 0.00 ? 77 DC  A O2     2  
ATOM 2226  N N3     . DC  A 1 9  ? 6.445   2.909   -2.672  1.00 0.00 ? 77 DC  A N3     2  
ATOM 2227  C C4     . DC  A 1 9  ? 5.292   2.961   -2.039  1.00 0.00 ? 77 DC  A C4     2  
ATOM 2228  N N4     . DC  A 1 9  ? 4.266   3.218   -2.753  1.00 0.00 ? 77 DC  A N4     2  
ATOM 2229  C C5     . DC  A 1 9  ? 5.219   2.708   -0.645  1.00 0.00 ? 77 DC  A C5     2  
ATOM 2230  C C6     . DC  A 1 9  ? 6.350   2.315   -0.014  1.00 0.00 ? 77 DC  A C6     2  
ATOM 2231  H "H5'"  . DC  A 1 9  ? 8.368   -1.726  1.674   1.00 0.00 ? 77 DC  A "H5'"  2  
ATOM 2232  H "H5''" . DC  A 1 9  ? 9.224   -1.192  3.144   1.00 0.00 ? 77 DC  A "H5''" 2  
ATOM 2233  H "H4'"  . DC  A 1 9  ? 10.404  -0.630  1.028   1.00 0.00 ? 77 DC  A "H4'"  2  
ATOM 2234  H "H3'"  . DC  A 1 9  ? 9.981   1.260   3.086   1.00 0.00 ? 77 DC  A "H3'"  2  
ATOM 2235  H "H2'"  . DC  A 1 9  ? 8.213   2.283   2.019   1.00 0.00 ? 77 DC  A "H2'"  2  
ATOM 2236  H "H2''" . DC  A 1 9  ? 9.437   3.292   1.319   1.00 0.00 ? 77 DC  A "H2''" 2  
ATOM 2237  H "H1'"  . DC  A 1 9  ? 9.665   1.830   -0.610  1.00 0.00 ? 77 DC  A "H1'"  2  
ATOM 2238  H H41    . DC  A 1 9  ? 3.366   3.134   -2.304  1.00 0.00 ? 77 DC  A H41    2  
ATOM 2239  H H42    . DC  A 1 9  ? 4.380   3.280   -3.755  1.00 0.00 ? 77 DC  A H42    2  
ATOM 2240  H H5     . DC  A 1 9  ? 4.331   2.806   -0.037  1.00 0.00 ? 77 DC  A H5     2  
ATOM 2241  H H6     . DC  A 1 9  ? 6.388   2.118   1.048   1.00 0.00 ? 77 DC  A H6     2  
ATOM 2242  P P      . DC  A 1 10 ? 12.301  2.727   2.155   1.00 0.00 ? 78 DC  A P      2  
ATOM 2243  O OP1    . DC  A 1 10 ? 13.577  2.271   2.754   1.00 0.00 ? 78 DC  A OP1    2  
ATOM 2244  O OP2    . DC  A 1 10 ? 11.503  3.671   2.962   1.00 0.00 ? 78 DC  A OP2    2  
ATOM 2245  O "O5'"  . DC  A 1 10 ? 12.634  3.453   0.741   1.00 0.00 ? 78 DC  A "O5'"  2  
ATOM 2246  C "C5'"  . DC  A 1 10 ? 13.158  2.734   -0.369  1.00 0.00 ? 78 DC  A "C5'"  2  
ATOM 2247  C "C4'"  . DC  A 1 10 ? 13.470  3.554   -1.606  1.00 0.00 ? 78 DC  A "C4'"  2  
ATOM 2248  O "O4'"  . DC  A 1 10 ? 12.267  3.908   -2.280  1.00 0.00 ? 78 DC  A "O4'"  2  
ATOM 2249  C "C3'"  . DC  A 1 10 ? 14.348  4.800   -1.458  1.00 0.00 ? 78 DC  A "C3'"  2  
ATOM 2250  O "O3'"  . DC  A 1 10 ? 15.327  4.869   -2.440  1.00 0.00 ? 78 DC  A "O3'"  2  
ATOM 2251  C "C2'"  . DC  A 1 10 ? 13.211  5.831   -1.361  1.00 0.00 ? 78 DC  A "C2'"  2  
ATOM 2252  C "C1'"  . DC  A 1 10 ? 11.998  5.302   -2.060  1.00 0.00 ? 78 DC  A "C1'"  2  
ATOM 2253  N N1     . DC  A 1 10 ? 10.640  5.630   -1.543  1.00 0.00 ? 78 DC  A N1     2  
ATOM 2254  C C2     . DC  A 1 10 ? 9.620   5.841   -2.409  1.00 0.00 ? 78 DC  A C2     2  
ATOM 2255  O O2     . DC  A 1 10 ? 9.796   5.962   -3.634  1.00 0.00 ? 78 DC  A O2     2  
ATOM 2256  N N3     . DC  A 1 10 ? 8.327   6.008   -1.996  1.00 0.00 ? 78 DC  A N3     2  
ATOM 2257  C C4     . DC  A 1 10 ? 8.092   5.914   -0.717  1.00 0.00 ? 78 DC  A C4     2  
ATOM 2258  N N4     . DC  A 1 10 ? 6.888   5.780   -0.306  1.00 0.00 ? 78 DC  A N4     2  
ATOM 2259  C C5     . DC  A 1 10 ? 9.078   5.743   0.230   1.00 0.00 ? 78 DC  A C5     2  
ATOM 2260  C C6     . DC  A 1 10 ? 10.332  5.501   -0.184  1.00 0.00 ? 78 DC  A C6     2  
ATOM 2261  H "H5'"  . DC  A 1 10 ? 12.479  1.948   -0.699  1.00 0.00 ? 78 DC  A "H5'"  2  
ATOM 2262  H "H5''" . DC  A 1 10 ? 14.134  2.292   -0.163  1.00 0.00 ? 78 DC  A "H5''" 2  
ATOM 2263  H "H4'"  . DC  A 1 10 ? 14.019  2.908   -2.291  1.00 0.00 ? 78 DC  A "H4'"  2  
ATOM 2264  H "H3'"  . DC  A 1 10 ? 14.769  4.612   -0.471  1.00 0.00 ? 78 DC  A "H3'"  2  
ATOM 2265  H "H2'"  . DC  A 1 10 ? 12.998  6.010   -0.307  1.00 0.00 ? 78 DC  A "H2'"  2  
ATOM 2266  H "H2''" . DC  A 1 10 ? 13.514  6.808   -1.737  1.00 0.00 ? 78 DC  A "H2''" 2  
ATOM 2267  H "H1'"  . DC  A 1 10 ? 11.992  5.807   -3.025  1.00 0.00 ? 78 DC  A "H1'"  2  
ATOM 2268  H H41    . DC  A 1 10 ? 6.755   5.724   0.693   1.00 0.00 ? 78 DC  A H41    2  
ATOM 2269  H H42    . DC  A 1 10 ? 6.110   5.911   -0.938  1.00 0.00 ? 78 DC  A H42    2  
ATOM 2270  H H5     . DC  A 1 10 ? 8.766   5.625   1.257   1.00 0.00 ? 78 DC  A H5     2  
ATOM 2271  H H6     . DC  A 1 10 ? 11.158  5.282   0.476   1.00 0.00 ? 78 DC  A H6     2  
ATOM 2272  P P      . DC  A 1 11 ? 16.190  6.170   -2.682  1.00 0.00 ? 79 DC  A P      2  
ATOM 2273  O OP1    . DC  A 1 11 ? 17.316  5.829   -3.587  1.00 0.00 ? 79 DC  A OP1    2  
ATOM 2274  O OP2    . DC  A 1 11 ? 16.538  6.786   -1.368  1.00 0.00 ? 79 DC  A OP2    2  
ATOM 2275  O "O5'"  . DC  A 1 11 ? 15.235  7.225   -3.381  1.00 0.00 ? 79 DC  A "O5'"  2  
ATOM 2276  C "C5'"  . DC  A 1 11 ? 14.515  6.907   -4.542  1.00 0.00 ? 79 DC  A "C5'"  2  
ATOM 2277  C "C4'"  . DC  A 1 11 ? 13.412  7.970   -4.935  1.00 0.00 ? 79 DC  A "C4'"  2  
ATOM 2278  O "O4'"  . DC  A 1 11 ? 12.200  7.885   -4.147  1.00 0.00 ? 79 DC  A "O4'"  2  
ATOM 2279  C "C3'"  . DC  A 1 11 ? 13.880  9.461   -4.809  1.00 0.00 ? 79 DC  A "C3'"  2  
ATOM 2280  O "O3'"  . DC  A 1 11 ? 13.620  10.133  -6.074  1.00 0.00 ? 79 DC  A "O3'"  2  
ATOM 2281  C "C2'"  . DC  A 1 11 ? 13.018  9.986   -3.697  1.00 0.00 ? 79 DC  A "C2'"  2  
ATOM 2282  C "C1'"  . DC  A 1 11 ? 11.671  9.175   -3.813  1.00 0.00 ? 79 DC  A "C1'"  2  
ATOM 2283  N N1     . DC  A 1 11 ? 10.732  9.105   -2.618  1.00 0.00 ? 79 DC  A N1     2  
ATOM 2284  C C2     . DC  A 1 11 ? 9.384   9.375   -2.885  1.00 0.00 ? 79 DC  A C2     2  
ATOM 2285  O O2     . DC  A 1 11 ? 9.014   9.869   -3.911  1.00 0.00 ? 79 DC  A O2     2  
ATOM 2286  N N3     . DC  A 1 11 ? 8.449   9.262   -1.876  1.00 0.00 ? 79 DC  A N3     2  
ATOM 2287  C C4     . DC  A 1 11 ? 8.903   8.944   -0.670  1.00 0.00 ? 79 DC  A C4     2  
ATOM 2288  N N4     . DC  A 1 11 ? 8.024   8.816   0.260   1.00 0.00 ? 79 DC  A N4     2  
ATOM 2289  C C5     . DC  A 1 11 ? 10.249  8.667   -0.415  1.00 0.00 ? 79 DC  A C5     2  
ATOM 2290  C C6     . DC  A 1 11 ? 11.177  8.803   -1.372  1.00 0.00 ? 79 DC  A C6     2  
ATOM 2291  H "H5'"  . DC  A 1 11 ? 14.021  5.949   -4.381  1.00 0.00 ? 79 DC  A "H5'"  2  
ATOM 2292  H "H5''" . DC  A 1 11 ? 15.284  6.914   -5.314  1.00 0.00 ? 79 DC  A "H5''" 2  
ATOM 2293  H "H4'"  . DC  A 1 11 ? 13.236  7.681   -5.971  1.00 0.00 ? 79 DC  A "H4'"  2  
ATOM 2294  H "H3'"  . DC  A 1 11 ? 14.940  9.555   -4.574  1.00 0.00 ? 79 DC  A "H3'"  2  
ATOM 2295  H "H2'"  . DC  A 1 11 ? 13.458  9.664   -2.754  1.00 0.00 ? 79 DC  A "H2'"  2  
ATOM 2296  H "H2''" . DC  A 1 11 ? 12.864  11.054  -3.846  1.00 0.00 ? 79 DC  A "H2''" 2  
ATOM 2297  H "H1'"  . DC  A 1 11 ? 11.246  9.595   -4.725  1.00 0.00 ? 79 DC  A "H1'"  2  
ATOM 2298  H H41    . DC  A 1 11 ? 8.257   8.468   1.180   1.00 0.00 ? 79 DC  A H41    2  
ATOM 2299  H H42    . DC  A 1 11 ? 7.073   9.006   -0.023  1.00 0.00 ? 79 DC  A H42    2  
ATOM 2300  H H5     . DC  A 1 11 ? 10.572  8.443   0.591   1.00 0.00 ? 79 DC  A H5     2  
ATOM 2301  H H6     . DC  A 1 11 ? 12.217  8.568   -1.195  1.00 0.00 ? 79 DC  A H6     2  
ATOM 2302  P P      . DC  A 1 12 ? 13.900  11.658  -6.420  1.00 0.00 ? 80 DC  A P      2  
ATOM 2303  O OP1    . DC  A 1 12 ? 14.288  11.729  -7.880  1.00 0.00 ? 80 DC  A OP1    2  
ATOM 2304  O OP2    . DC  A 1 12 ? 14.788  12.285  -5.417  1.00 0.00 ? 80 DC  A OP2    2  
ATOM 2305  O "O5'"  . DC  A 1 12 ? 12.530  12.445  -6.231  1.00 0.00 ? 80 DC  A "O5'"  2  
ATOM 2306  C "C5'"  . DC  A 1 12 ? 11.529  12.487  -7.279  1.00 0.00 ? 80 DC  A "C5'"  2  
ATOM 2307  C "C4'"  . DC  A 1 12 ? 10.358  13.386  -6.962  1.00 0.00 ? 80 DC  A "C4'"  2  
ATOM 2308  O "O4'"  . DC  A 1 12 ? 9.730   13.028  -5.717  1.00 0.00 ? 80 DC  A "O4'"  2  
ATOM 2309  C "C3'"  . DC  A 1 12 ? 10.941  14.797  -6.574  1.00 0.00 ? 80 DC  A "C3'"  2  
ATOM 2310  O "O3'"  . DC  A 1 12 ? 10.209  15.747  -7.334  1.00 0.00 ? 80 DC  A "O3'"  2  
ATOM 2311  C "C2'"  . DC  A 1 12 ? 10.793  14.994  -5.122  1.00 0.00 ? 80 DC  A "C2'"  2  
ATOM 2312  C "C1'"  . DC  A 1 12 ? 9.612   14.107  -4.845  1.00 0.00 ? 80 DC  A "C1'"  2  
ATOM 2313  N N1     . DC  A 1 12 ? 9.497   13.561  -3.469  1.00 0.00 ? 80 DC  A N1     2  
ATOM 2314  C C2     . DC  A 1 12 ? 8.332   13.605  -2.771  1.00 0.00 ? 80 DC  A C2     2  
ATOM 2315  O O2     . DC  A 1 12 ? 7.263   14.140  -3.128  1.00 0.00 ? 80 DC  A O2     2  
ATOM 2316  N N3     . DC  A 1 12 ? 8.247   12.952  -1.554  1.00 0.00 ? 80 DC  A N3     2  
ATOM 2317  C C4     . DC  A 1 12 ? 9.311   12.500  -0.970  1.00 0.00 ? 80 DC  A C4     2  
ATOM 2318  N N4     . DC  A 1 12 ? 9.215   12.010  0.227   1.00 0.00 ? 80 DC  A N4     2  
ATOM 2319  C C5     . DC  A 1 12 ? 10.568  12.482  -1.646  1.00 0.00 ? 80 DC  A C5     2  
ATOM 2320  C C6     . DC  A 1 12 ? 10.647  12.995  -2.938  1.00 0.00 ? 80 DC  A C6     2  
ATOM 2321  H "H5'"  . DC  A 1 12 ? 11.107  11.501  -7.468  1.00 0.00 ? 80 DC  A "H5'"  2  
ATOM 2322  H "H5''" . DC  A 1 12 ? 12.021  12.841  -8.185  1.00 0.00 ? 80 DC  A "H5''" 2  
ATOM 2323  H "H4'"  . DC  A 1 12 ? 9.657   13.395  -7.798  1.00 0.00 ? 80 DC  A "H4'"  2  
ATOM 2324  H "H3'"  . DC  A 1 12 ? 11.979  14.933  -6.880  1.00 0.00 ? 80 DC  A "H3'"  2  
ATOM 2325  H "H2'"  . DC  A 1 12 ? 11.713  14.720  -4.605  1.00 0.00 ? 80 DC  A "H2'"  2  
ATOM 2326  H "H2''" . DC  A 1 12 ? 10.630  16.039  -4.862  1.00 0.00 ? 80 DC  A "H2''" 2  
ATOM 2327  H "H1'"  . DC  A 1 12 ? 8.802   14.801  -5.067  1.00 0.00 ? 80 DC  A "H1'"  2  
ATOM 2328  H H41    . DC  A 1 12 ? 9.992   11.806  0.841   1.00 0.00 ? 80 DC  A H41    2  
ATOM 2329  H H42    . DC  A 1 12 ? 8.278   11.911  0.590   1.00 0.00 ? 80 DC  A H42    2  
ATOM 2330  H H5     . DC  A 1 12 ? 11.392  11.922  -1.228  1.00 0.00 ? 80 DC  A H5     2  
ATOM 2331  H H6     . DC  A 1 12 ? 11.572  12.823  -3.470  1.00 0.00 ? 80 DC  A H6     2  
ATOM 2332  P P      . DG  A 1 13 ? 10.481  17.311  -7.292  1.00 0.00 ? 81 DG  A P      2  
ATOM 2333  O OP1    . DG  A 1 13 ? 9.913   17.933  -8.516  1.00 0.00 ? 81 DG  A OP1    2  
ATOM 2334  O OP2    . DG  A 1 13 ? 11.922  17.581  -6.840  1.00 0.00 ? 81 DG  A OP2    2  
ATOM 2335  O "O5'"  . DG  A 1 13 ? 9.429   17.521  -6.029  1.00 0.00 ? 81 DG  A "O5'"  2  
ATOM 2336  C "C5'"  . DG  A 1 13 ? 8.117   17.786  -6.330  1.00 0.00 ? 81 DG  A "C5'"  2  
ATOM 2337  C "C4'"  . DG  A 1 13 ? 7.371   18.255  -5.085  1.00 0.00 ? 81 DG  A "C4'"  2  
ATOM 2338  O "O4'"  . DG  A 1 13 ? 7.368   17.283  -4.057  1.00 0.00 ? 81 DG  A "O4'"  2  
ATOM 2339  C "C3'"  . DG  A 1 13 ? 7.950   19.552  -4.496  1.00 0.00 ? 81 DG  A "C3'"  2  
ATOM 2340  O "O3'"  . DG  A 1 13 ? 6.902   20.456  -4.203  1.00 0.00 ? 81 DG  A "O3'"  2  
ATOM 2341  C "C2'"  . DG  A 1 13 ? 8.667   18.964  -3.278  1.00 0.00 ? 81 DG  A "C2'"  2  
ATOM 2342  C "C1'"  . DG  A 1 13 ? 7.657   17.887  -2.899  1.00 0.00 ? 81 DG  A "C1'"  2  
ATOM 2343  N N9     . DG  A 1 13 ? 8.129   16.935  -1.907  1.00 0.00 ? 81 DG  A N9     2  
ATOM 2344  C C8     . DG  A 1 13 ? 9.462   16.703  -1.566  1.00 0.00 ? 81 DG  A C8     2  
ATOM 2345  N N7     . DG  A 1 13 ? 9.667   16.097  -0.466  1.00 0.00 ? 81 DG  A N7     2  
ATOM 2346  C C5     . DG  A 1 13 ? 8.318   15.949  -0.010  1.00 0.00 ? 81 DG  A C5     2  
ATOM 2347  C C6     . DG  A 1 13 ? 7.785   15.216  1.163   1.00 0.00 ? 81 DG  A C6     2  
ATOM 2348  O O6     . DG  A 1 13 ? 8.452   14.601  1.974   1.00 0.00 ? 81 DG  A O6     2  
ATOM 2349  N N1     . DG  A 1 13 ? 6.440   15.205  1.246   1.00 0.00 ? 81 DG  A N1     2  
ATOM 2350  C C2     . DG  A 1 13 ? 5.638   15.784  0.325   1.00 0.00 ? 81 DG  A C2     2  
ATOM 2351  N N2     . DG  A 1 13 ? 4.378   15.661  0.523   1.00 0.00 ? 81 DG  A N2     2  
ATOM 2352  N N3     . DG  A 1 13 ? 6.069   16.378  -0.729  1.00 0.00 ? 81 DG  A N3     2  
ATOM 2353  C C4     . DG  A 1 13 ? 7.409   16.404  -0.878  1.00 0.00 ? 81 DG  A C4     2  
ATOM 2354  H "H5'"  . DG  A 1 13 ? 7.593   16.980  -6.842  1.00 0.00 ? 81 DG  A "H5'"  2  
ATOM 2355  H "H5''" . DG  A 1 13 ? 8.149   18.613  -7.041  1.00 0.00 ? 81 DG  A "H5''" 2  
ATOM 2356  H "H4'"  . DG  A 1 13 ? 6.340   18.455  -5.376  1.00 0.00 ? 81 DG  A "H4'"  2  
ATOM 2357  H "H3'"  . DG  A 1 13 ? 8.651   20.066  -5.153  1.00 0.00 ? 81 DG  A "H3'"  2  
ATOM 2358  H "HO3'" . DG  A 1 13 ? 6.493   20.810  -4.996  1.00 0.00 ? 81 DG  A "HO3'" 2  
ATOM 2359  H "H2'"  . DG  A 1 13 ? 9.606   18.547  -3.643  1.00 0.00 ? 81 DG  A "H2'"  2  
ATOM 2360  H "H2''" . DG  A 1 13 ? 8.879   19.745  -2.548  1.00 0.00 ? 81 DG  A "H2''" 2  
ATOM 2361  H "H1'"  . DG  A 1 13 ? 6.791   18.415  -2.499  1.00 0.00 ? 81 DG  A "H1'"  2  
ATOM 2362  H H8     . DG  A 1 13 ? 10.246  17.118  -2.184  1.00 0.00 ? 81 DG  A H8     2  
ATOM 2363  H H1     . DG  A 1 13 ? 6.004   14.649  1.967   1.00 0.00 ? 81 DG  A H1     2  
ATOM 2364  H H21    . DG  A 1 13 ? 3.805   16.224  -0.091  1.00 0.00 ? 81 DG  A H21    2  
ATOM 2365  H H22    . DG  A 1 13 ? 3.998   15.273  1.374   1.00 0.00 ? 81 DG  A H22    2  
ATOM 2366  O "O5'"  . DC  B 2 1  ? 1.801   10.650  7.589   1.00 0.00 ? 82 DC  B "O5'"  2  
ATOM 2367  C "C5'"  . DC  B 2 1  ? 0.916   11.656  7.948   1.00 0.00 ? 82 DC  B "C5'"  2  
ATOM 2368  C "C4'"  . DC  B 2 1  ? 0.630   12.699  6.851   1.00 0.00 ? 82 DC  B "C4'"  2  
ATOM 2369  O "O4'"  . DC  B 2 1  ? 1.919   13.337  6.466   1.00 0.00 ? 82 DC  B "O4'"  2  
ATOM 2370  C "C3'"  . DC  B 2 1  ? -0.060  12.195  5.609   1.00 0.00 ? 82 DC  B "C3'"  2  
ATOM 2371  O "O3'"  . DC  B 2 1  ? -0.978  13.183  5.071   1.00 0.00 ? 82 DC  B "O3'"  2  
ATOM 2372  C "C2'"  . DC  B 2 1  ? 1.173   11.924  4.681   1.00 0.00 ? 82 DC  B "C2'"  2  
ATOM 2373  C "C1'"  . DC  B 2 1  ? 2.047   13.101  5.039   1.00 0.00 ? 82 DC  B "C1'"  2  
ATOM 2374  N N1     . DC  B 2 1  ? 3.521   13.005  4.727   1.00 0.00 ? 82 DC  B N1     2  
ATOM 2375  C C2     . DC  B 2 1  ? 4.182   13.715  3.746   1.00 0.00 ? 82 DC  B C2     2  
ATOM 2376  O O2     . DC  B 2 1  ? 3.600   14.572  3.041   1.00 0.00 ? 82 DC  B O2     2  
ATOM 2377  N N3     . DC  B 2 1  ? 5.486   13.575  3.507   1.00 0.00 ? 82 DC  B N3     2  
ATOM 2378  C C4     . DC  B 2 1  ? 6.164   12.746  4.285   1.00 0.00 ? 82 DC  B C4     2  
ATOM 2379  N N4     . DC  B 2 1  ? 7.469   12.668  4.046   1.00 0.00 ? 82 DC  B N4     2  
ATOM 2380  C C5     . DC  B 2 1  ? 5.574   11.972  5.338   1.00 0.00 ? 82 DC  B C5     2  
ATOM 2381  C C6     . DC  B 2 1  ? 4.254   12.114  5.489   1.00 0.00 ? 82 DC  B C6     2  
ATOM 2382  H "H5'"  . DC  B 2 1  ? 1.300   12.241  8.784   1.00 0.00 ? 82 DC  B "H5'"  2  
ATOM 2383  H "H5''" . DC  B 2 1  ? -0.016  11.146  8.188   1.00 0.00 ? 82 DC  B "H5''" 2  
ATOM 2384  H "H4'"  . DC  B 2 1  ? 0.075   13.534  7.280   1.00 0.00 ? 82 DC  B "H4'"  2  
ATOM 2385  H "H3'"  . DC  B 2 1  ? -0.571  11.238  5.702   1.00 0.00 ? 82 DC  B "H3'"  2  
ATOM 2386  H "H2'"  . DC  B 2 1  ? 1.720   10.991  4.820   1.00 0.00 ? 82 DC  B "H2'"  2  
ATOM 2387  H "H2''" . DC  B 2 1  ? 0.874   11.955  3.633   1.00 0.00 ? 82 DC  B "H2''" 2  
ATOM 2388  H "H1'"  . DC  B 2 1  ? 1.655   13.969  4.510   1.00 0.00 ? 82 DC  B "H1'"  2  
ATOM 2389  H H41    . DC  B 2 1  ? 8.002   11.997  4.581   1.00 0.00 ? 82 DC  B H41    2  
ATOM 2390  H H42    . DC  B 2 1  ? 7.833   13.213  3.277   1.00 0.00 ? 82 DC  B H42    2  
ATOM 2391  H H5     . DC  B 2 1  ? 6.099   11.262  5.958   1.00 0.00 ? 82 DC  B H5     2  
ATOM 2392  H H6     . DC  B 2 1  ? 3.661   11.521  6.170   1.00 0.00 ? 82 DC  B H6     2  
ATOM 2393  H "HO5'" . DC  B 2 1  ? 1.857   9.952   8.245   1.00 0.00 ? 82 DC  B "HO5'" 2  
ATOM 2394  P P      . DG  B 2 2  ? -2.221  12.771  4.248   1.00 0.00 ? 83 DG  B P      2  
ATOM 2395  O OP1    . DG  B 2 2  ? -3.089  13.957  4.304   1.00 0.00 ? 83 DG  B OP1    2  
ATOM 2396  O OP2    . DG  B 2 2  ? -2.692  11.468  4.726   1.00 0.00 ? 83 DG  B OP2    2  
ATOM 2397  O "O5'"  . DG  B 2 2  ? -1.560  12.669  2.802   1.00 0.00 ? 83 DG  B "O5'"  2  
ATOM 2398  C "C5'"  . DG  B 2 2  ? -1.785  13.592  1.742   1.00 0.00 ? 83 DG  B "C5'"  2  
ATOM 2399  C "C4'"  . DG  B 2 2  ? -1.361  13.024  0.335   1.00 0.00 ? 83 DG  B "C4'"  2  
ATOM 2400  O "O4'"  . DG  B 2 2  ? 0.058   13.163  0.135   1.00 0.00 ? 83 DG  B "O4'"  2  
ATOM 2401  C "C3'"  . DG  B 2 2  ? -1.750  11.531  0.158   1.00 0.00 ? 83 DG  B "C3'"  2  
ATOM 2402  O "O3'"  . DG  B 2 2  ? -2.242  11.516  -1.182  1.00 0.00 ? 83 DG  B "O3'"  2  
ATOM 2403  C "C2'"  . DG  B 2 2  ? -0.458  10.861  0.481   1.00 0.00 ? 83 DG  B "C2'"  2  
ATOM 2404  C "C1'"  . DG  B 2 2  ? 0.567   11.831  -0.047  1.00 0.00 ? 83 DG  B "C1'"  2  
ATOM 2405  N N9     . DG  B 2 2  ? 1.930   11.604  0.599   1.00 0.00 ? 83 DG  B N9     2  
ATOM 2406  C C8     . DG  B 2 2  ? 2.205   10.944  1.698   1.00 0.00 ? 83 DG  B C8     2  
ATOM 2407  N N7     . DG  B 2 2  ? 3.493   11.027  1.968   1.00 0.00 ? 83 DG  B N7     2  
ATOM 2408  C C5     . DG  B 2 2  ? 4.016   11.794  0.949   1.00 0.00 ? 83 DG  B C5     2  
ATOM 2409  C C6     . DG  B 2 2  ? 5.362   12.124  0.587   1.00 0.00 ? 83 DG  B C6     2  
ATOM 2410  O O6     . DG  B 2 2  ? 6.388   11.821  1.170   1.00 0.00 ? 83 DG  B O6     2  
ATOM 2411  N N1     . DG  B 2 2  ? 5.502   12.803  -0.629  1.00 0.00 ? 83 DG  B N1     2  
ATOM 2412  C C2     . DG  B 2 2  ? 4.451   13.290  -1.292  1.00 0.00 ? 83 DG  B C2     2  
ATOM 2413  N N2     . DG  B 2 2  ? 4.670   14.062  -2.323  1.00 0.00 ? 83 DG  B N2     2  
ATOM 2414  N N3     . DG  B 2 2  ? 3.148   12.925  -1.080  1.00 0.00 ? 83 DG  B N3     2  
ATOM 2415  C C4     . DG  B 2 2  ? 3.028   12.224  0.093   1.00 0.00 ? 83 DG  B C4     2  
ATOM 2416  H "H5'"  . DG  B 2 2  ? -1.248  14.512  1.970   1.00 0.00 ? 83 DG  B "H5'"  2  
ATOM 2417  H "H5''" . DG  B 2 2  ? -2.839  13.866  1.695   1.00 0.00 ? 83 DG  B "H5''" 2  
ATOM 2418  H "H4'"  . DG  B 2 2  ? -1.826  13.649  -0.427  1.00 0.00 ? 83 DG  B "H4'"  2  
ATOM 2419  H "H3'"  . DG  B 2 2  ? -2.562  11.164  0.786   1.00 0.00 ? 83 DG  B "H3'"  2  
ATOM 2420  H "H2'"  . DG  B 2 2  ? -0.460  10.697  1.558   1.00 0.00 ? 83 DG  B "H2'"  2  
ATOM 2421  H "H2''" . DG  B 2 2  ? -0.348  9.981   -0.153  1.00 0.00 ? 83 DG  B "H2''" 2  
ATOM 2422  H "H1'"  . DG  B 2 2  ? 0.683   11.573  -1.100  1.00 0.00 ? 83 DG  B "H1'"  2  
ATOM 2423  H H8     . DG  B 2 2  ? 1.433   10.484  2.298   1.00 0.00 ? 83 DG  B H8     2  
ATOM 2424  H H1     . DG  B 2 2  ? 6.434   13.036  -0.940  1.00 0.00 ? 83 DG  B H1     2  
ATOM 2425  H H21    . DG  B 2 2  ? 3.853   14.371  -2.829  1.00 0.00 ? 83 DG  B H21    2  
ATOM 2426  H H22    . DG  B 2 2  ? 5.568   14.467  -2.544  1.00 0.00 ? 83 DG  B H22    2  
ATOM 2427  P P      . DG  B 2 3  ? -2.535  10.205  -2.049  1.00 0.00 ? 84 DG  B P      2  
ATOM 2428  O OP1    . DG  B 2 3  ? -3.917  10.278  -2.656  1.00 0.00 ? 84 DG  B OP1    2  
ATOM 2429  O OP2    . DG  B 2 3  ? -2.083  8.976   -1.359  1.00 0.00 ? 84 DG  B OP2    2  
ATOM 2430  O "O5'"  . DG  B 2 3  ? -1.416  10.650  -3.178  1.00 0.00 ? 84 DG  B "O5'"  2  
ATOM 2431  C "C5'"  . DG  B 2 3  ? -1.636  11.770  -3.986  1.00 0.00 ? 84 DG  B "C5'"  2  
ATOM 2432  C "C4'"  . DG  B 2 3  ? -0.667  11.723  -5.197  1.00 0.00 ? 84 DG  B "C4'"  2  
ATOM 2433  O "O4'"  . DG  B 2 3  ? 0.693   11.672  -4.723  1.00 0.00 ? 84 DG  B "O4'"  2  
ATOM 2434  C "C3'"  . DG  B 2 3  ? -0.829  10.437  -6.110  1.00 0.00 ? 84 DG  B "C3'"  2  
ATOM 2435  O "O3'"  . DG  B 2 3  ? -0.747  10.808  -7.492  1.00 0.00 ? 84 DG  B "O3'"  2  
ATOM 2436  C "C2'"  . DG  B 2 3  ? 0.262   9.507   -5.526  1.00 0.00 ? 84 DG  B "C2'"  2  
ATOM 2437  C "C1'"  . DG  B 2 3  ? 1.346   10.488  -4.987  1.00 0.00 ? 84 DG  B "C1'"  2  
ATOM 2438  N N9     . DG  B 2 3  ? 1.987   9.997   -3.681  1.00 0.00 ? 84 DG  B N9     2  
ATOM 2439  C C8     . DG  B 2 3  ? 1.496   9.249   -2.649  1.00 0.00 ? 84 DG  B C8     2  
ATOM 2440  N N7     . DG  B 2 3  ? 2.393   8.806   -1.840  1.00 0.00 ? 84 DG  B N7     2  
ATOM 2441  C C5     . DG  B 2 3  ? 3.613   9.377   -2.318  1.00 0.00 ? 84 DG  B C5     2  
ATOM 2442  C C6     . DG  B 2 3  ? 4.922   9.417   -1.746  1.00 0.00 ? 84 DG  B C6     2  
ATOM 2443  O O6     . DG  B 2 3  ? 5.259   8.980   -0.638  1.00 0.00 ? 84 DG  B O6     2  
ATOM 2444  N N1     . DG  B 2 3  ? 5.870   10.043  -2.513  1.00 0.00 ? 84 DG  B N1     2  
ATOM 2445  C C2     . DG  B 2 3  ? 5.531   10.652  -3.670  1.00 0.00 ? 84 DG  B C2     2  
ATOM 2446  N N2     . DG  B 2 3  ? 6.548   10.962  -4.390  1.00 0.00 ? 84 DG  B N2     2  
ATOM 2447  N N3     . DG  B 2 3  ? 4.314   10.736  -4.213  1.00 0.00 ? 84 DG  B N3     2  
ATOM 2448  C C4     . DG  B 2 3  ? 3.376   10.080  -3.473  1.00 0.00 ? 84 DG  B C4     2  
ATOM 2449  H "H5'"  . DG  B 2 3  ? -1.535  12.715  -3.451  1.00 0.00 ? 84 DG  B "H5'"  2  
ATOM 2450  H "H5''" . DG  B 2 3  ? -2.638  11.632  -4.395  1.00 0.00 ? 84 DG  B "H5''" 2  
ATOM 2451  H "H4'"  . DG  B 2 3  ? -0.902  12.628  -5.757  1.00 0.00 ? 84 DG  B "H4'"  2  
ATOM 2452  H "H3'"  . DG  B 2 3  ? -1.812  10.050  -5.842  1.00 0.00 ? 84 DG  B "H3'"  2  
ATOM 2453  H "H2'"  . DG  B 2 3  ? -0.250  8.948   -4.742  1.00 0.00 ? 84 DG  B "H2'"  2  
ATOM 2454  H "H2''" . DG  B 2 3  ? 0.711   8.780   -6.204  1.00 0.00 ? 84 DG  B "H2''" 2  
ATOM 2455  H "H1'"  . DG  B 2 3  ? 2.071   10.549  -5.799  1.00 0.00 ? 84 DG  B "H1'"  2  
ATOM 2456  H H8     . DG  B 2 3  ? 0.448   8.995   -2.696  1.00 0.00 ? 84 DG  B H8     2  
ATOM 2457  H H1     . DG  B 2 3  ? 6.807   9.913   -2.159  1.00 0.00 ? 84 DG  B H1     2  
ATOM 2458  H H21    . DG  B 2 3  ? 6.392   11.613  -5.147  1.00 0.00 ? 84 DG  B H21    2  
ATOM 2459  H H22    . DG  B 2 3  ? 7.481   10.648  -4.164  1.00 0.00 ? 84 DG  B H22    2  
ATOM 2460  P P      . DG  B 2 4  ? -0.970  9.716   -8.583  1.00 0.00 ? 85 DG  B P      2  
ATOM 2461  O OP1    . DG  B 2 4  ? -1.090  10.388  -9.848  1.00 0.00 ? 85 DG  B OP1    2  
ATOM 2462  O OP2    . DG  B 2 4  ? -2.093  8.924   -8.174  1.00 0.00 ? 85 DG  B OP2    2  
ATOM 2463  O "O5'"  . DG  B 2 4  ? 0.374   8.893   -8.553  1.00 0.00 ? 85 DG  B "O5'"  2  
ATOM 2464  C "C5'"  . DG  B 2 4  ? 1.514   9.422   -9.256  1.00 0.00 ? 85 DG  B "C5'"  2  
ATOM 2465  C "C4'"  . DG  B 2 4  ? 2.591   8.404   -9.318  1.00 0.00 ? 85 DG  B "C4'"  2  
ATOM 2466  O "O4'"  . DG  B 2 4  ? 3.131   8.316   -7.948  1.00 0.00 ? 85 DG  B "O4'"  2  
ATOM 2467  C "C3'"  . DG  B 2 4  ? 2.151   7.053   -9.781  1.00 0.00 ? 85 DG  B "C3'"  2  
ATOM 2468  O "O3'"  . DG  B 2 4  ? 3.168   6.362   -10.524 1.00 0.00 ? 85 DG  B "O3'"  2  
ATOM 2469  C "C2'"  . DG  B 2 4  ? 2.065   6.382   -8.420  1.00 0.00 ? 85 DG  B "C2'"  2  
ATOM 2470  C "C1'"  . DG  B 2 4  ? 3.257   6.859   -7.650  1.00 0.00 ? 85 DG  B "C1'"  2  
ATOM 2471  N N9     . DG  B 2 4  ? 3.229   6.603   -6.225  1.00 0.00 ? 85 DG  B N9     2  
ATOM 2472  C C8     . DG  B 2 4  ? 2.126   6.496   -5.398  1.00 0.00 ? 85 DG  B C8     2  
ATOM 2473  N N7     . DG  B 2 4  ? 2.515   6.258   -4.165  1.00 0.00 ? 85 DG  B N7     2  
ATOM 2474  C C5     . DG  B 2 4  ? 3.895   6.468   -4.214  1.00 0.00 ? 85 DG  B C5     2  
ATOM 2475  C C6     . DG  B 2 4  ? 4.866   6.415   -3.187  1.00 0.00 ? 85 DG  B C6     2  
ATOM 2476  O O6     . DG  B 2 4  ? 4.716   6.182   -1.990  1.00 0.00 ? 85 DG  B O6     2  
ATOM 2477  N N1     . DG  B 2 4  ? 6.133   6.784   -3.552  1.00 0.00 ? 85 DG  B N1     2  
ATOM 2478  C C2     . DG  B 2 4  ? 6.525   7.138   -4.761  1.00 0.00 ? 85 DG  B C2     2  
ATOM 2479  N N2     . DG  B 2 4  ? 7.748   7.173   -4.978  1.00 0.00 ? 85 DG  B N2     2  
ATOM 2480  N N3     . DG  B 2 4  ? 5.663   7.116   -5.755  1.00 0.00 ? 85 DG  B N3     2  
ATOM 2481  C C4     . DG  B 2 4  ? 4.371   6.806   -5.475  1.00 0.00 ? 85 DG  B C4     2  
ATOM 2482  H "H5'"  . DG  B 2 4  ? 1.802   10.330  -8.727  1.00 0.00 ? 85 DG  B "H5'"  2  
ATOM 2483  H "H5''" . DG  B 2 4  ? 1.257   9.564   -10.306 1.00 0.00 ? 85 DG  B "H5''" 2  
ATOM 2484  H "H4'"  . DG  B 2 4  ? 3.396   8.754   -9.963  1.00 0.00 ? 85 DG  B "H4'"  2  
ATOM 2485  H "H3'"  . DG  B 2 4  ? 1.233   7.053   -10.367 1.00 0.00 ? 85 DG  B "H3'"  2  
ATOM 2486  H "H2'"  . DG  B 2 4  ? 1.131   6.659   -7.933  1.00 0.00 ? 85 DG  B "H2'"  2  
ATOM 2487  H "H2''" . DG  B 2 4  ? 2.028   5.325   -8.686  1.00 0.00 ? 85 DG  B "H2''" 2  
ATOM 2488  H "H1'"  . DG  B 2 4  ? 4.156   6.447   -8.109  1.00 0.00 ? 85 DG  B "H1'"  2  
ATOM 2489  H H8     . DG  B 2 4  ? 1.113   6.456   -5.772  1.00 0.00 ? 85 DG  B H8     2  
ATOM 2490  H H1     . DG  B 2 4  ? 6.799   6.577   -2.822  1.00 0.00 ? 85 DG  B H1     2  
ATOM 2491  H H21    . DG  B 2 4  ? 8.022   7.189   -5.949  1.00 0.00 ? 85 DG  B H21    2  
ATOM 2492  H H22    . DG  B 2 4  ? 8.469   6.953   -4.306  1.00 0.00 ? 85 DG  B H22    2  
ATOM 2493  P P      . DG  B 2 5  ? 3.117   6.534   -12.092 1.00 0.00 ? 86 DG  B P      2  
ATOM 2494  O OP1    . DG  B 2 5  ? 2.863   7.977   -12.454 1.00 0.00 ? 86 DG  B OP1    2  
ATOM 2495  O OP2    . DG  B 2 5  ? 2.236   5.488   -12.601 1.00 0.00 ? 86 DG  B OP2    2  
ATOM 2496  O "O5'"  . DG  B 2 5  ? 4.626   6.157   -12.417 1.00 0.00 ? 86 DG  B "O5'"  2  
ATOM 2497  C "C5'"  . DG  B 2 5  ? 5.694   6.958   -11.925 1.00 0.00 ? 86 DG  B "C5'"  2  
ATOM 2498  C "C4'"  . DG  B 2 5  ? 7.122   6.396   -11.996 1.00 0.00 ? 86 DG  B "C4'"  2  
ATOM 2499  O "O4'"  . DG  B 2 5  ? 7.575   5.998   -10.716 1.00 0.00 ? 86 DG  B "O4'"  2  
ATOM 2500  C "C3'"  . DG  B 2 5  ? 7.369   5.104   -12.827 1.00 0.00 ? 86 DG  B "C3'"  2  
ATOM 2501  O "O3'"  . DG  B 2 5  ? 8.702   5.038   -13.241 1.00 0.00 ? 86 DG  B "O3'"  2  
ATOM 2502  C "C2'"  . DG  B 2 5  ? 6.996   3.985   -11.868 1.00 0.00 ? 86 DG  B "C2'"  2  
ATOM 2503  C "C1'"  . DG  B 2 5  ? 7.241   4.647   -10.463 1.00 0.00 ? 86 DG  B "C1'"  2  
ATOM 2504  N N9     . DG  B 2 5  ? 6.231   4.426   -9.368  1.00 0.00 ? 86 DG  B N9     2  
ATOM 2505  C C8     . DG  B 2 5  ? 4.892   4.186   -9.714  1.00 0.00 ? 86 DG  B C8     2  
ATOM 2506  N N7     . DG  B 2 5  ? 4.187   3.838   -8.716  1.00 0.00 ? 86 DG  B N7     2  
ATOM 2507  C C5     . DG  B 2 5  ? 5.073   3.981   -7.628  1.00 0.00 ? 86 DG  B C5     2  
ATOM 2508  C C6     . DG  B 2 5  ? 4.930   3.648   -6.223  1.00 0.00 ? 86 DG  B C6     2  
ATOM 2509  O O6     . DG  B 2 5  ? 3.879   3.384   -5.557  1.00 0.00 ? 86 DG  B O6     2  
ATOM 2510  N N1     . DG  B 2 5  ? 6.128   3.723   -5.465  1.00 0.00 ? 86 DG  B N1     2  
ATOM 2511  C C2     . DG  B 2 5  ? 7.227   4.141   -5.985  1.00 0.00 ? 86 DG  B C2     2  
ATOM 2512  N N2     . DG  B 2 5  ? 8.286   3.966   -5.262  1.00 0.00 ? 86 DG  B N2     2  
ATOM 2513  N N3     . DG  B 2 5  ? 7.489   4.452   -7.303  1.00 0.00 ? 86 DG  B N3     2  
ATOM 2514  C C4     . DG  B 2 5  ? 6.363   4.273   -8.041  1.00 0.00 ? 86 DG  B C4     2  
ATOM 2515  H "H5'"  . DG  B 2 5  ? 5.547   7.220   -10.878 1.00 0.00 ? 86 DG  B "H5'"  2  
ATOM 2516  H "H5''" . DG  B 2 5  ? 5.580   7.894   -12.472 1.00 0.00 ? 86 DG  B "H5''" 2  
ATOM 2517  H "H4'"  . DG  B 2 5  ? 7.795   7.165   -12.376 1.00 0.00 ? 86 DG  B "H4'"  2  
ATOM 2518  H "H3'"  . DG  B 2 5  ? 6.684   5.068   -13.675 1.00 0.00 ? 86 DG  B "H3'"  2  
ATOM 2519  H "H2'"  . DG  B 2 5  ? 5.969   3.709   -12.108 1.00 0.00 ? 86 DG  B "H2'"  2  
ATOM 2520  H "H2''" . DG  B 2 5  ? 7.770   3.224   -11.952 1.00 0.00 ? 86 DG  B "H2''" 2  
ATOM 2521  H "H1'"  . DG  B 2 5  ? 8.180   4.195   -10.142 1.00 0.00 ? 86 DG  B "H1'"  2  
ATOM 2522  H H8     . DG  B 2 5  ? 4.528   4.400   -10.708 1.00 0.00 ? 86 DG  B H8     2  
ATOM 2523  H H1     . DG  B 2 5  ? 6.234   3.108   -4.671  1.00 0.00 ? 86 DG  B H1     2  
ATOM 2524  H H21    . DG  B 2 5  ? 9.128   4.345   -5.670  1.00 0.00 ? 86 DG  B H21    2  
ATOM 2525  H H22    . DG  B 2 5  ? 8.223   3.742   -4.279  1.00 0.00 ? 86 DG  B H22    2  
ATOM 2526  P P      . DA  B 2 6  ? 9.328   3.800   -14.045 1.00 0.00 ? 87 DA  B P      2  
ATOM 2527  O OP1    . DA  B 2 6  ? 10.511  4.326   -14.737 1.00 0.00 ? 87 DA  B OP1    2  
ATOM 2528  O OP2    . DA  B 2 6  ? 8.221   3.170   -14.769 1.00 0.00 ? 87 DA  B OP2    2  
ATOM 2529  O "O5'"  . DA  B 2 6  ? 9.853   2.881   -12.806 1.00 0.00 ? 87 DA  B "O5'"  2  
ATOM 2530  C "C5'"  . DA  B 2 6  ? 11.007  3.220   -12.056 1.00 0.00 ? 87 DA  B "C5'"  2  
ATOM 2531  C "C4'"  . DA  B 2 6  ? 11.068  2.188   -10.943 1.00 0.00 ? 87 DA  B "C4'"  2  
ATOM 2532  O "O4'"  . DA  B 2 6  ? 9.914   2.317   -10.140 1.00 0.00 ? 87 DA  B "O4'"  2  
ATOM 2533  C "C3'"  . DA  B 2 6  ? 11.149  0.759   -11.426 1.00 0.00 ? 87 DA  B "C3'"  2  
ATOM 2534  O "O3'"  . DA  B 2 6  ? 12.137  0.138   -10.635 1.00 0.00 ? 87 DA  B "O3'"  2  
ATOM 2535  C "C2'"  . DA  B 2 6  ? 9.860   0.212   -11.059 1.00 0.00 ? 87 DA  B "C2'"  2  
ATOM 2536  C "C1'"  . DA  B 2 6  ? 9.546   1.040   -9.852  1.00 0.00 ? 87 DA  B "C1'"  2  
ATOM 2537  N N9     . DA  B 2 6  ? 8.092   1.014   -9.593  1.00 0.00 ? 87 DA  B N9     2  
ATOM 2538  C C8     . DA  B 2 6  ? 7.103   0.876   -10.508 1.00 0.00 ? 87 DA  B C8     2  
ATOM 2539  N N7     . DA  B 2 6  ? 5.908   0.600   -10.010 1.00 0.00 ? 87 DA  B N7     2  
ATOM 2540  C C5     . DA  B 2 6  ? 6.180   0.489   -8.623  1.00 0.00 ? 87 DA  B C5     2  
ATOM 2541  C C6     . DA  B 2 6  ? 5.404   0.393   -7.492  1.00 0.00 ? 87 DA  B C6     2  
ATOM 2542  N N6     . DA  B 2 6  ? 4.107   0.323   -7.490  1.00 0.00 ? 87 DA  B N6     2  
ATOM 2543  N N1     . DA  B 2 6  ? 5.989   0.283   -6.284  1.00 0.00 ? 87 DA  B N1     2  
ATOM 2544  C C2     . DA  B 2 6  ? 7.268   0.442   -6.219  1.00 0.00 ? 87 DA  B C2     2  
ATOM 2545  N N3     . DA  B 2 6  ? 8.119   0.586   -7.214  1.00 0.00 ? 87 DA  B N3     2  
ATOM 2546  C C4     . DA  B 2 6  ? 7.501   0.679   -8.413  1.00 0.00 ? 87 DA  B C4     2  
ATOM 2547  H "H5'"  . DA  B 2 6  ? 10.885  4.214   -11.624 1.00 0.00 ? 87 DA  B "H5'"  2  
ATOM 2548  H "H5''" . DA  B 2 6  ? 11.855  3.117   -12.733 1.00 0.00 ? 87 DA  B "H5''" 2  
ATOM 2549  H "H4'"  . DA  B 2 6  ? 11.945  2.324   -10.311 1.00 0.00 ? 87 DA  B "H4'"  2  
ATOM 2550  H "H3'"  . DA  B 2 6  ? 11.366  0.573   -12.478 1.00 0.00 ? 87 DA  B "H3'"  2  
ATOM 2551  H "H2'"  . DA  B 2 6  ? 9.232   0.462   -11.914 1.00 0.00 ? 87 DA  B "H2'"  2  
ATOM 2552  H "H2''" . DA  B 2 6  ? 9.824   -0.870  -10.934 1.00 0.00 ? 87 DA  B "H2''" 2  
ATOM 2553  H "H1'"  . DA  B 2 6  ? 10.042  0.625   -8.976  1.00 0.00 ? 87 DA  B "H1'"  2  
ATOM 2554  H H8     . DA  B 2 6  ? 7.213   1.001   -11.575 1.00 0.00 ? 87 DA  B H8     2  
ATOM 2555  H H61    . DA  B 2 6  ? 3.629   0.164   -6.614  1.00 0.00 ? 87 DA  B H61    2  
ATOM 2556  H H62    . DA  B 2 6  ? 3.585   0.363   -8.354  1.00 0.00 ? 87 DA  B H62    2  
ATOM 2557  H H2     . DA  B 2 6  ? 7.717   0.373   -5.239  1.00 0.00 ? 87 DA  B H2     2  
ATOM 2558  P P      . DT  B 2 7  ? 12.587  -1.382  -10.602 1.00 0.00 ? 88 DT  B P      2  
ATOM 2559  O OP1    . DT  B 2 7  ? 14.029  -1.397  -10.544 1.00 0.00 ? 88 DT  B OP1    2  
ATOM 2560  O OP2    . DT  B 2 7  ? 11.913  -2.177  -11.687 1.00 0.00 ? 88 DT  B OP2    2  
ATOM 2561  O "O5'"  . DT  B 2 7  ? 12.006  -1.800  -9.241  1.00 0.00 ? 88 DT  B "O5'"  2  
ATOM 2562  C "C5'"  . DT  B 2 7  ? 12.596  -1.176  -8.081  1.00 0.00 ? 88 DT  B "C5'"  2  
ATOM 2563  C "C4'"  . DT  B 2 7  ? 12.073  -1.648  -6.724  1.00 0.00 ? 88 DT  B "C4'"  2  
ATOM 2564  O "O4'"  . DT  B 2 7  ? 10.636  -1.463  -6.700  1.00 0.00 ? 88 DT  B "O4'"  2  
ATOM 2565  C "C3'"  . DT  B 2 7  ? 12.364  -3.170  -6.490  1.00 0.00 ? 88 DT  B "C3'"  2  
ATOM 2566  O "O3'"  . DT  B 2 7  ? 12.699  -3.414  -5.099  1.00 0.00 ? 88 DT  B "O3'"  2  
ATOM 2567  C "C2'"  . DT  B 2 7  ? 11.060  -3.815  -6.998  1.00 0.00 ? 88 DT  B "C2'"  2  
ATOM 2568  C "C1'"  . DT  B 2 7  ? 10.029  -2.776  -6.624  1.00 0.00 ? 88 DT  B "C1'"  2  
ATOM 2569  N N1     . DT  B 2 7  ? 8.704   -2.830  -7.368  1.00 0.00 ? 88 DT  B N1     2  
ATOM 2570  C C2     . DT  B 2 7  ? 7.566   -3.010  -6.583  1.00 0.00 ? 88 DT  B C2     2  
ATOM 2571  O O2     . DT  B 2 7  ? 7.610   -3.067  -5.338  1.00 0.00 ? 88 DT  B O2     2  
ATOM 2572  N N3     . DT  B 2 7  ? 6.349   -2.868  -7.223  1.00 0.00 ? 88 DT  B N3     2  
ATOM 2573  C C4     . DT  B 2 7  ? 6.205   -2.824  -8.547  1.00 0.00 ? 88 DT  B C4     2  
ATOM 2574  O O4     . DT  B 2 7  ? 4.996   -2.767  -8.887  1.00 0.00 ? 88 DT  B O4     2  
ATOM 2575  C C5     . DT  B 2 7  ? 7.439   -2.759  -9.329  1.00 0.00 ? 88 DT  B C5     2  
ATOM 2576  C C7     . DT  B 2 7  ? 7.461   -2.750  -10.849 1.00 0.00 ? 88 DT  B C7     2  
ATOM 2577  C C6     . DT  B 2 7  ? 8.656   -2.884  -8.740  1.00 0.00 ? 88 DT  B C6     2  
ATOM 2578  H "H5'"  . DT  B 2 7  ? 12.464  -0.094  -8.083  1.00 0.00 ? 88 DT  B "H5'"  2  
ATOM 2579  H "H5''" . DT  B 2 7  ? 13.677  -1.310  -8.111  1.00 0.00 ? 88 DT  B "H5''" 2  
ATOM 2580  H "H4'"  . DT  B 2 7  ? 12.475  -1.074  -5.889  1.00 0.00 ? 88 DT  B "H4'"  2  
ATOM 2581  H "H3'"  . DT  B 2 7  ? 13.100  -3.609  -7.163  1.00 0.00 ? 88 DT  B "H3'"  2  
ATOM 2582  H "H2'"  . DT  B 2 7  ? 11.051  -4.148  -8.035  1.00 0.00 ? 88 DT  B "H2'"  2  
ATOM 2583  H "H2''" . DT  B 2 7  ? 10.933  -4.769  -6.486  1.00 0.00 ? 88 DT  B "H2''" 2  
ATOM 2584  H "H1'"  . DT  B 2 7  ? 9.887   -2.893  -5.550  1.00 0.00 ? 88 DT  B "H1'"  2  
ATOM 2585  H H3     . DT  B 2 7  ? 5.466   -2.921  -6.738  1.00 0.00 ? 88 DT  B H3     2  
ATOM 2586  H H71    . DT  B 2 7  ? 8.506   -2.604  -11.124 1.00 0.00 ? 88 DT  B H71    2  
ATOM 2587  H H72    . DT  B 2 7  ? 6.911   -3.586  -11.280 1.00 0.00 ? 88 DT  B H72    2  
ATOM 2588  H H73    . DT  B 2 7  ? 6.840   -1.898  -11.124 1.00 0.00 ? 88 DT  B H73    2  
ATOM 2589  H H6     . DT  B 2 7  ? 9.611   -2.978  -9.236  1.00 0.00 ? 88 DT  B H6     2  
ATOM 2590  P P      . DT  B 2 8  ? 13.011  -4.819  -4.434  1.00 0.00 ? 89 DT  B P      2  
ATOM 2591  O OP1    . DT  B 2 8  ? 14.094  -4.514  -3.449  1.00 0.00 ? 89 DT  B OP1    2  
ATOM 2592  O OP2    . DT  B 2 8  ? 13.226  -5.775  -5.566  1.00 0.00 ? 89 DT  B OP2    2  
ATOM 2593  O "O5'"  . DT  B 2 8  ? 11.684  -5.251  -3.784  1.00 0.00 ? 89 DT  B "O5'"  2  
ATOM 2594  C "C5'"  . DT  B 2 8  ? 11.098  -4.288  -2.902  1.00 0.00 ? 89 DT  B "C5'"  2  
ATOM 2595  C "C4'"  . DT  B 2 8  ? 9.845   -4.677  -2.166  1.00 0.00 ? 89 DT  B "C4'"  2  
ATOM 2596  O "O4'"  . DT  B 2 8  ? 8.643   -4.512  -3.026  1.00 0.00 ? 89 DT  B "O4'"  2  
ATOM 2597  C "C3'"  . DT  B 2 8  ? 9.801   -6.124  -1.717  1.00 0.00 ? 89 DT  B "C3'"  2  
ATOM 2598  O "O3'"  . DT  B 2 8  ? 9.234   -6.143  -0.414  1.00 0.00 ? 89 DT  B "O3'"  2  
ATOM 2599  C "C2'"  . DT  B 2 8  ? 9.134   -6.932  -2.804  1.00 0.00 ? 89 DT  B "C2'"  2  
ATOM 2600  C "C1'"  . DT  B 2 8  ? 8.180   -5.874  -3.255  1.00 0.00 ? 89 DT  B "C1'"  2  
ATOM 2601  N N1     . DT  B 2 8  ? 7.620   -6.104  -4.610  1.00 0.00 ? 89 DT  B N1     2  
ATOM 2602  C C2     . DT  B 2 8  ? 6.207   -6.007  -4.762  1.00 0.00 ? 89 DT  B C2     2  
ATOM 2603  O O2     . DT  B 2 8  ? 5.404   -5.861  -3.811  1.00 0.00 ? 89 DT  B O2     2  
ATOM 2604  N N3     . DT  B 2 8  ? 5.723   -6.023  -6.031  1.00 0.00 ? 89 DT  B N3     2  
ATOM 2605  C C4     . DT  B 2 8  ? 6.471   -6.126  -7.152  1.00 0.00 ? 89 DT  B C4     2  
ATOM 2606  O O4     . DT  B 2 8  ? 5.831   -6.153  -8.195  1.00 0.00 ? 89 DT  B O4     2  
ATOM 2607  C C5     . DT  B 2 8  ? 7.925   -6.205  -6.938  1.00 0.00 ? 89 DT  B C5     2  
ATOM 2608  C C7     . DT  B 2 8  ? 8.865   -6.510  -8.039  1.00 0.00 ? 89 DT  B C7     2  
ATOM 2609  C C6     . DT  B 2 8  ? 8.425   -6.193  -5.702  1.00 0.00 ? 89 DT  B C6     2  
ATOM 2610  H "H5'"  . DT  B 2 8  ? 10.838  -3.380  -3.446  1.00 0.00 ? 89 DT  B "H5'"  2  
ATOM 2611  H "H5''" . DT  B 2 8  ? 11.881  -3.937  -2.230  1.00 0.00 ? 89 DT  B "H5''" 2  
ATOM 2612  H "H4'"  . DT  B 2 8  ? 9.775   -4.032  -1.290  1.00 0.00 ? 89 DT  B "H4'"  2  
ATOM 2613  H "H3'"  . DT  B 2 8  ? 10.816  -6.493  -1.575  1.00 0.00 ? 89 DT  B "H3'"  2  
ATOM 2614  H "H2'"  . DT  B 2 8  ? 9.999   -7.238  -3.392  1.00 0.00 ? 89 DT  B "H2'"  2  
ATOM 2615  H "H2''" . DT  B 2 8  ? 8.585   -7.803  -2.448  1.00 0.00 ? 89 DT  B "H2''" 2  
ATOM 2616  H "H1'"  . DT  B 2 8  ? 7.392   -6.049  -2.523  1.00 0.00 ? 89 DT  B "H1'"  2  
ATOM 2617  H H3     . DT  B 2 8  ? 4.718   -6.058  -6.115  1.00 0.00 ? 89 DT  B H3     2  
ATOM 2618  H H71    . DT  B 2 8  ? 8.912   -5.663  -8.723  1.00 0.00 ? 89 DT  B H71    2  
ATOM 2619  H H72    . DT  B 2 8  ? 9.898   -6.768  -7.804  1.00 0.00 ? 89 DT  B H72    2  
ATOM 2620  H H73    . DT  B 2 8  ? 8.577   -7.420  -8.564  1.00 0.00 ? 89 DT  B H73    2  
ATOM 2621  H H6     . DT  B 2 8  ? 9.472   -6.401  -5.535  1.00 0.00 ? 89 DT  B H6     2  
ATOM 2622  P P      . DA  B 2 9  ? 9.087   -7.404  0.498   1.00 0.00 ? 90 DA  B P      2  
ATOM 2623  O OP1    . DA  B 2 9  ? 8.986   -6.933  1.881   1.00 0.00 ? 90 DA  B OP1    2  
ATOM 2624  O OP2    . DA  B 2 9  ? 10.158  -8.382  0.197   1.00 0.00 ? 90 DA  B OP2    2  
ATOM 2625  O "O5'"  . DA  B 2 9  ? 7.699   -8.034  0.088   1.00 0.00 ? 90 DA  B "O5'"  2  
ATOM 2626  C "C5'"  . DA  B 2 9  ? 6.476   -7.410  0.276   1.00 0.00 ? 90 DA  B "C5'"  2  
ATOM 2627  C "C4'"  . DA  B 2 9  ? 5.315   -8.082  -0.413  1.00 0.00 ? 90 DA  B "C4'"  2  
ATOM 2628  O "O4'"  . DA  B 2 9  ? 5.598   -7.990  -1.814  1.00 0.00 ? 90 DA  B "O4'"  2  
ATOM 2629  C "C3'"  . DA  B 2 9  ? 5.232   -9.577  -0.014  1.00 0.00 ? 90 DA  B "C3'"  2  
ATOM 2630  O "O3'"  . DA  B 2 9  ? 3.939   -9.945  0.424   1.00 0.00 ? 90 DA  B "O3'"  2  
ATOM 2631  C "C2'"  . DA  B 2 9  ? 5.606   -10.202 -1.306  1.00 0.00 ? 90 DA  B "C2'"  2  
ATOM 2632  C "C1'"  . DA  B 2 9  ? 5.028   -9.241  -2.313  1.00 0.00 ? 90 DA  B "C1'"  2  
ATOM 2633  N N9     . DA  B 2 9  ? 5.421   -9.426  -3.691  1.00 0.00 ? 90 DA  B N9     2  
ATOM 2634  C C8     . DA  B 2 9  ? 6.698   -9.807  -4.119  1.00 0.00 ? 90 DA  B C8     2  
ATOM 2635  N N7     . DA  B 2 9  ? 6.796   -9.857  -5.464  1.00 0.00 ? 90 DA  B N7     2  
ATOM 2636  C C5     . DA  B 2 9  ? 5.475   -9.588  -5.880  1.00 0.00 ? 90 DA  B C5     2  
ATOM 2637  C C6     . DA  B 2 9  ? 4.837   -9.534  -7.104  1.00 0.00 ? 90 DA  B C6     2  
ATOM 2638  N N6     . DA  B 2 9  ? 5.369   -9.804  -8.305  1.00 0.00 ? 90 DA  B N6     2  
ATOM 2639  N N1     . DA  B 2 9  ? 3.592   -9.225  -7.185  1.00 0.00 ? 90 DA  B N1     2  
ATOM 2640  C C2     . DA  B 2 9  ? 2.865   -9.083  -6.077  1.00 0.00 ? 90 DA  B C2     2  
ATOM 2641  N N3     . DA  B 2 9  ? 3.336   -9.139  -4.809  1.00 0.00 ? 90 DA  B N3     2  
ATOM 2642  C C4     . DA  B 2 9  ? 4.684   -9.352  -4.783  1.00 0.00 ? 90 DA  B C4     2  
ATOM 2643  H "H5'"  . DA  B 2 9  ? 6.638   -6.406  -0.116  1.00 0.00 ? 90 DA  B "H5'"  2  
ATOM 2644  H "H5''" . DA  B 2 9  ? 6.139   -7.369  1.312   1.00 0.00 ? 90 DA  B "H5''" 2  
ATOM 2645  H "H4'"  . DA  B 2 9  ? 4.377   -7.562  -0.220  1.00 0.00 ? 90 DA  B "H4'"  2  
ATOM 2646  H "H3'"  . DA  B 2 9  ? 5.923   -9.833  0.789   1.00 0.00 ? 90 DA  B "H3'"  2  
ATOM 2647  H "H2'"  . DA  B 2 9  ? 6.690   -10.311 -1.266  1.00 0.00 ? 90 DA  B "H2'"  2  
ATOM 2648  H "H2''" . DA  B 2 9  ? 5.134   -11.173 -1.456  1.00 0.00 ? 90 DA  B "H2''" 2  
ATOM 2649  H "H1'"  . DA  B 2 9  ? 3.941   -9.202  -2.248  1.00 0.00 ? 90 DA  B "H1'"  2  
ATOM 2650  H H8     . DA  B 2 9  ? 7.515   -10.026 -3.446  1.00 0.00 ? 90 DA  B H8     2  
ATOM 2651  H H61    . DA  B 2 9  ? 4.824   -9.564  -9.121  1.00 0.00 ? 90 DA  B H61    2  
ATOM 2652  H H62    . DA  B 2 9  ? 6.374   -9.877  -8.365  1.00 0.00 ? 90 DA  B H62    2  
ATOM 2653  H H2     . DA  B 2 9  ? 1.896   -8.622  -6.204  1.00 0.00 ? 90 DA  B H2     2  
ATOM 2654  P P      . DG  B 2 10 ? 3.576   -11.385 1.134   1.00 0.00 ? 91 DG  B P      2  
ATOM 2655  O OP1    . DG  B 2 10 ? 3.247   -11.165 2.611   1.00 0.00 ? 91 DG  B OP1    2  
ATOM 2656  O OP2    . DG  B 2 10 ? 4.574   -12.408 0.839   1.00 0.00 ? 91 DG  B OP2    2  
ATOM 2657  O "O5'"  . DG  B 2 10 ? 2.264   -11.920 0.467   1.00 0.00 ? 91 DG  B "O5'"  2  
ATOM 2658  C "C5'"  . DG  B 2 10 ? 1.136   -11.084 0.643   1.00 0.00 ? 91 DG  B "C5'"  2  
ATOM 2659  C "C4'"  . DG  B 2 10 ? 0.098   -11.323 -0.441  1.00 0.00 ? 91 DG  B "C4'"  2  
ATOM 2660  O "O4'"  . DG  B 2 10 ? 0.569   -11.061 -1.759  1.00 0.00 ? 91 DG  B "O4'"  2  
ATOM 2661  C "C3'"  . DG  B 2 10 ? -0.542  -12.739 -0.463  1.00 0.00 ? 91 DG  B "C3'"  2  
ATOM 2662  O "O3'"  . DG  B 2 10 ? -1.901  -12.573 -0.823  1.00 0.00 ? 91 DG  B "O3'"  2  
ATOM 2663  C "C2'"  . DG  B 2 10 ? 0.284   -13.442 -1.537  1.00 0.00 ? 91 DG  B "C2'"  2  
ATOM 2664  C "C1'"  . DG  B 2 10 ? 0.415   -12.278 -2.507  1.00 0.00 ? 91 DG  B "C1'"  2  
ATOM 2665  N N9     . DG  B 2 10 ? 1.595   -12.436 -3.426  1.00 0.00 ? 91 DG  B N9     2  
ATOM 2666  C C8     . DG  B 2 10 ? 2.941   -12.522 -3.147  1.00 0.00 ? 91 DG  B C8     2  
ATOM 2667  N N7     . DG  B 2 10 ? 3.741   -12.672 -4.180  1.00 0.00 ? 91 DG  B N7     2  
ATOM 2668  C C5     . DG  B 2 10 ? 2.815   -12.405 -5.265  1.00 0.00 ? 91 DG  B C5     2  
ATOM 2669  C C6     . DG  B 2 10 ? 3.000   -12.320 -6.688  1.00 0.00 ? 91 DG  B C6     2  
ATOM 2670  O O6     . DG  B 2 10 ? 4.015   -12.505 -7.350  1.00 0.00 ? 91 DG  B O6     2  
ATOM 2671  N N1     . DG  B 2 10 ? 1.810   -11.986 -7.343  1.00 0.00 ? 91 DG  B N1     2  
ATOM 2672  C C2     . DG  B 2 10 ? 0.612   -11.603 -6.703  1.00 0.00 ? 91 DG  B C2     2  
ATOM 2673  N N2     . DG  B 2 10 ? -0.458  -11.244 -7.407  1.00 0.00 ? 91 DG  B N2     2  
ATOM 2674  N N3     . DG  B 2 10 ? 0.363   -11.858 -5.427  1.00 0.00 ? 91 DG  B N3     2  
ATOM 2675  C C4     . DG  B 2 10 ? 1.564   -12.230 -4.752  1.00 0.00 ? 91 DG  B C4     2  
ATOM 2676  H "H5'"  . DG  B 2 10 ? 1.488   -10.062 0.504   1.00 0.00 ? 91 DG  B "H5'"  2  
ATOM 2677  H "H5''" . DG  B 2 10 ? 0.704   -11.227 1.634   1.00 0.00 ? 91 DG  B "H5''" 2  
ATOM 2678  H "H4'"  . DG  B 2 10 ? -0.684  -10.665 -0.061  1.00 0.00 ? 91 DG  B "H4'"  2  
ATOM 2679  H "H3'"  . DG  B 2 10 ? -0.565  -13.245 0.502   1.00 0.00 ? 91 DG  B "H3'"  2  
ATOM 2680  H "H2'"  . DG  B 2 10 ? 1.244   -13.728 -1.107  1.00 0.00 ? 91 DG  B "H2'"  2  
ATOM 2681  H "H2''" . DG  B 2 10 ? -0.225  -14.315 -1.946  1.00 0.00 ? 91 DG  B "H2''" 2  
ATOM 2682  H "H1'"  . DG  B 2 10 ? -0.488  -12.273 -3.117  1.00 0.00 ? 91 DG  B "H1'"  2  
ATOM 2683  H H8     . DG  B 2 10 ? 3.322   -12.562 -2.137  1.00 0.00 ? 91 DG  B H8     2  
ATOM 2684  H H1     . DG  B 2 10 ? 1.868   -11.887 -8.347  1.00 0.00 ? 91 DG  B H1     2  
ATOM 2685  H H21    . DG  B 2 10 ? -1.357  -11.285 -6.947  1.00 0.00 ? 91 DG  B H21    2  
ATOM 2686  H H22    . DG  B 2 10 ? -0.366  -11.117 -8.404  1.00 0.00 ? 91 DG  B H22    2  
ATOM 2687  P P      . DA  B 2 11 ? -3.101  -13.729 -0.653  1.00 0.00 ? 92 DA  B P      2  
ATOM 2688  O OP1    . DA  B 2 11 ? -3.887  -13.225 0.484   1.00 0.00 ? 92 DA  B OP1    2  
ATOM 2689  O OP2    . DA  B 2 11 ? -2.613  -15.082 -0.558  1.00 0.00 ? 92 DA  B OP2    2  
ATOM 2690  O "O5'"  . DA  B 2 11 ? -3.947  -13.753 -2.012  1.00 0.00 ? 92 DA  B "O5'"  2  
ATOM 2691  C "C5'"  . DA  B 2 11 ? -4.689  -12.578 -2.454  1.00 0.00 ? 92 DA  B "C5'"  2  
ATOM 2692  C "C4'"  . DA  B 2 11 ? -5.391  -12.731 -3.825  1.00 0.00 ? 92 DA  B "C4'"  2  
ATOM 2693  O "O4'"  . DA  B 2 11 ? -4.416  -13.047 -4.834  1.00 0.00 ? 92 DA  B "O4'"  2  
ATOM 2694  C "C3'"  . DA  B 2 11 ? -6.286  -14.000 -3.774  1.00 0.00 ? 92 DA  B "C3'"  2  
ATOM 2695  O "O3'"  . DA  B 2 11 ? -7.235  -13.661 -4.790  1.00 0.00 ? 92 DA  B "O3'"  2  
ATOM 2696  C "C2'"  . DA  B 2 11 ? -5.299  -15.132 -4.027  1.00 0.00 ? 92 DA  B "C2'"  2  
ATOM 2697  C "C1'"  . DA  B 2 11 ? -4.378  -14.434 -5.094  1.00 0.00 ? 92 DA  B "C1'"  2  
ATOM 2698  N N9     . DA  B 2 11 ? -2.962  -14.843 -5.166  1.00 0.00 ? 92 DA  B N9     2  
ATOM 2699  C C8     . DA  B 2 11 ? -2.160  -15.425 -4.223  1.00 0.00 ? 92 DA  B C8     2  
ATOM 2700  N N7     . DA  B 2 11 ? -0.948  -15.677 -4.588  1.00 0.00 ? 92 DA  B N7     2  
ATOM 2701  C C5     . DA  B 2 11 ? -0.946  -15.295 -5.907  1.00 0.00 ? 92 DA  B C5     2  
ATOM 2702  C C6     . DA  B 2 11 ? 0.018   -15.237 -6.956  1.00 0.00 ? 92 DA  B C6     2  
ATOM 2703  N N6     . DA  B 2 11 ? 1.304   -15.632 -6.842  1.00 0.00 ? 92 DA  B N6     2  
ATOM 2704  N N1     . DA  B 2 11 ? -0.233  -14.697 -8.105  1.00 0.00 ? 92 DA  B N1     2  
ATOM 2705  C C2     . DA  B 2 11 ? -1.443  -14.182 -8.308  1.00 0.00 ? 92 DA  B C2     2  
ATOM 2706  N N3     . DA  B 2 11 ? -2.453  -14.204 -7.423  1.00 0.00 ? 92 DA  B N3     2  
ATOM 2707  C C4     . DA  B 2 11 ? -2.138  -14.743 -6.275  1.00 0.00 ? 92 DA  B C4     2  
ATOM 2708  H "H5'"  . DA  B 2 11 ? -3.985  -11.765 -2.627  1.00 0.00 ? 92 DA  B "H5'"  2  
ATOM 2709  H "H5''" . DA  B 2 11 ? -5.337  -12.290 -1.627  1.00 0.00 ? 92 DA  B "H5''" 2  
ATOM 2710  H "H4'"  . DA  B 2 11 ? -5.972  -11.829 -4.019  1.00 0.00 ? 92 DA  B "H4'"  2  
ATOM 2711  H "H3'"  . DA  B 2 11 ? -6.756  -13.994 -2.791  1.00 0.00 ? 92 DA  B "H3'"  2  
ATOM 2712  H "H2'"  . DA  B 2 11 ? -4.736  -15.501 -3.170  1.00 0.00 ? 92 DA  B "H2'"  2  
ATOM 2713  H "H2''" . DA  B 2 11 ? -5.777  -15.956 -4.558  1.00 0.00 ? 92 DA  B "H2''" 2  
ATOM 2714  H "H1'"  . DA  B 2 11 ? -4.832  -14.572 -6.074  1.00 0.00 ? 92 DA  B "H1'"  2  
ATOM 2715  H H8     . DA  B 2 11 ? -2.524  -15.461 -3.207  1.00 0.00 ? 92 DA  B H8     2  
ATOM 2716  H H61    . DA  B 2 11 ? 1.999   -15.339 -7.513  1.00 0.00 ? 92 DA  B H61    2  
ATOM 2717  H H62    . DA  B 2 11 ? 1.524   -16.111 -5.980  1.00 0.00 ? 92 DA  B H62    2  
ATOM 2718  H H2     . DA  B 2 11 ? -1.567  -13.693 -9.263  1.00 0.00 ? 92 DA  B H2     2  
ATOM 2719  P P      . DG  B 2 12 ? -8.330  -14.649 -5.185  1.00 0.00 ? 93 DG  B P      2  
ATOM 2720  O OP1    . DG  B 2 12 ? -9.417  -13.932 -5.892  1.00 0.00 ? 93 DG  B OP1    2  
ATOM 2721  O OP2    . DG  B 2 12 ? -8.689  -15.466 -4.056  1.00 0.00 ? 93 DG  B OP2    2  
ATOM 2722  O "O5'"  . DG  B 2 12 ? -7.652  -15.604 -6.280  1.00 0.00 ? 93 DG  B "O5'"  2  
ATOM 2723  C "C5'"  . DG  B 2 12 ? -7.203  -15.132 -7.557  1.00 0.00 ? 93 DG  B "C5'"  2  
ATOM 2724  C "C4'"  . DG  B 2 12 ? -6.540  -16.282 -8.337  1.00 0.00 ? 93 DG  B "C4'"  2  
ATOM 2725  O "O4'"  . DG  B 2 12 ? -5.268  -16.472 -7.934  1.00 0.00 ? 93 DG  B "O4'"  2  
ATOM 2726  C "C3'"  . DG  B 2 12 ? -7.206  -17.647 -8.193  1.00 0.00 ? 93 DG  B "C3'"  2  
ATOM 2727  O "O3'"  . DG  B 2 12 ? -7.815  -18.018 -9.438  1.00 0.00 ? 93 DG  B "O3'"  2  
ATOM 2728  C "C2'"  . DG  B 2 12 ? -6.061  -18.618 -7.738  1.00 0.00 ? 93 DG  B "C2'"  2  
ATOM 2729  C "C1'"  . DG  B 2 12 ? -4.947  -17.762 -8.321  1.00 0.00 ? 93 DG  B "C1'"  2  
ATOM 2730  N N9     . DG  B 2 12 ? -3.681  -18.167 -7.763  1.00 0.00 ? 93 DG  B N9     2  
ATOM 2731  C C8     . DG  B 2 12 ? -3.378  -18.406 -6.467  1.00 0.00 ? 93 DG  B C8     2  
ATOM 2732  N N7     . DG  B 2 12 ? -2.093  -18.656 -6.235  1.00 0.00 ? 93 DG  B N7     2  
ATOM 2733  C C5     . DG  B 2 12 ? -1.520  -18.546 -7.506  1.00 0.00 ? 93 DG  B C5     2  
ATOM 2734  C C6     . DG  B 2 12 ? -0.167  -18.843 -7.879  1.00 0.00 ? 93 DG  B C6     2  
ATOM 2735  O O6     . DG  B 2 12 ? 0.816   -19.143 -7.225  1.00 0.00 ? 93 DG  B O6     2  
ATOM 2736  N N1     . DG  B 2 12 ? 0.009   -18.793 -9.305  1.00 0.00 ? 93 DG  B N1     2  
ATOM 2737  C C2     . DG  B 2 12 ? -1.012  -18.439 -10.147 1.00 0.00 ? 93 DG  B C2     2  
ATOM 2738  N N2     . DG  B 2 12 ? -0.668  -18.427 -11.415 1.00 0.00 ? 93 DG  B N2     2  
ATOM 2739  N N3     . DG  B 2 12 ? -2.264  -18.085 -9.808  1.00 0.00 ? 93 DG  B N3     2  
ATOM 2740  C C4     . DG  B 2 12 ? -2.468  -18.137 -8.445  1.00 0.00 ? 93 DG  B C4     2  
ATOM 2741  H "H5'"  . DG  B 2 12 ? -6.558  -14.261 -7.442  1.00 0.00 ? 93 DG  B "H5'"  2  
ATOM 2742  H "H5''" . DG  B 2 12 ? -8.079  -14.824 -8.127  1.00 0.00 ? 93 DG  B "H5''" 2  
ATOM 2743  H "H4'"  . DG  B 2 12 ? -6.640  -16.094 -9.406  1.00 0.00 ? 93 DG  B "H4'"  2  
ATOM 2744  H "H3'"  . DG  B 2 12 ? -8.028  -17.614 -7.478  1.00 0.00 ? 93 DG  B "H3'"  2  
ATOM 2745  H "H2'"  . DG  B 2 12 ? -6.081  -18.637 -6.648  1.00 0.00 ? 93 DG  B "H2'"  2  
ATOM 2746  H "H2''" . DG  B 2 12 ? -6.106  -19.649 -8.089  1.00 0.00 ? 93 DG  B "H2''" 2  
ATOM 2747  H "H1'"  . DG  B 2 12 ? -4.904  -17.827 -9.409  1.00 0.00 ? 93 DG  B "H1'"  2  
ATOM 2748  H H8     . DG  B 2 12 ? -4.246  -18.323 -5.831  1.00 0.00 ? 93 DG  B H8     2  
ATOM 2749  H H1     . DG  B 2 12 ? 0.957   -18.860 -9.648  1.00 0.00 ? 93 DG  B H1     2  
ATOM 2750  H H21    . DG  B 2 12 ? -1.373  -18.335 -12.132 1.00 0.00 ? 93 DG  B H21    2  
ATOM 2751  H H22    . DG  B 2 12 ? 0.274   -18.691 -11.663 1.00 0.00 ? 93 DG  B H22    2  
ATOM 2752  P P      . DC  B 2 13 ? -8.730  -19.289 -9.650  1.00 0.00 ? 94 DC  B P      2  
ATOM 2753  O OP1    . DC  B 2 13 ? -9.655  -18.950 -10.708 1.00 0.00 ? 94 DC  B OP1    2  
ATOM 2754  O OP2    . DC  B 2 13 ? -9.141  -19.891 -8.356  1.00 0.00 ? 94 DC  B OP2    2  
ATOM 2755  O "O5'"  . DC  B 2 13 ? -7.586  -20.175 -10.267 1.00 0.00 ? 94 DC  B "O5'"  2  
ATOM 2756  C "C5'"  . DC  B 2 13 ? -7.042  -19.834 -11.524 1.00 0.00 ? 94 DC  B "C5'"  2  
ATOM 2757  C "C4'"  . DC  B 2 13 ? -5.916  -20.793 -12.066 1.00 0.00 ? 94 DC  B "C4'"  2  
ATOM 2758  O "O4'"  . DC  B 2 13 ? -4.753  -20.570 -11.311 1.00 0.00 ? 94 DC  B "O4'"  2  
ATOM 2759  C "C3'"  . DC  B 2 13 ? -6.284  -22.257 -11.957 1.00 0.00 ? 94 DC  B "C3'"  2  
ATOM 2760  O "O3'"  . DC  B 2 13 ? -5.896  -22.947 -13.181 1.00 0.00 ? 94 DC  B "O3'"  2  
ATOM 2761  C "C2'"  . DC  B 2 13 ? -5.549  -22.730 -10.735 1.00 0.00 ? 94 DC  B "C2'"  2  
ATOM 2762  C "C1'"  . DC  B 2 13 ? -4.257  -21.872 -10.875 1.00 0.00 ? 94 DC  B "C1'"  2  
ATOM 2763  N N1     . DC  B 2 13 ? -3.279  -21.804 -9.712  1.00 0.00 ? 94 DC  B N1     2  
ATOM 2764  C C2     . DC  B 2 13 ? -1.898  -21.977 -9.888  1.00 0.00 ? 94 DC  B C2     2  
ATOM 2765  O O2     . DC  B 2 13 ? -1.448  -22.432 -10.991 1.00 0.00 ? 94 DC  B O2     2  
ATOM 2766  N N3     . DC  B 2 13 ? -1.078  -21.949 -8.825  1.00 0.00 ? 94 DC  B N3     2  
ATOM 2767  C C4     . DC  B 2 13 ? -1.618  -21.825 -7.587  1.00 0.00 ? 94 DC  B C4     2  
ATOM 2768  N N4     . DC  B 2 13 ? -0.788  -21.803 -6.594  1.00 0.00 ? 94 DC  B N4     2  
ATOM 2769  C C5     . DC  B 2 13 ? -2.981  -21.553 -7.403  1.00 0.00 ? 94 DC  B C5     2  
ATOM 2770  C C6     . DC  B 2 13 ? -3.762  -21.537 -8.485  1.00 0.00 ? 94 DC  B C6     2  
ATOM 2771  H "H5'"  . DC  B 2 13 ? -6.587  -18.867 -11.309 1.00 0.00 ? 94 DC  B "H5'"  2  
ATOM 2772  H "H5''" . DC  B 2 13 ? -7.836  -19.942 -12.262 1.00 0.00 ? 94 DC  B "H5''" 2  
ATOM 2773  H "H4'"  . DC  B 2 13 ? -5.675  -20.533 -13.097 1.00 0.00 ? 94 DC  B "H4'"  2  
ATOM 2774  H "H3'"  . DC  B 2 13 ? -7.339  -22.479 -11.795 1.00 0.00 ? 94 DC  B "H3'"  2  
ATOM 2775  H "HO3'" . DC  B 2 13 ? -6.545  -22.662 -13.829 1.00 0.00 ? 94 DC  B "HO3'" 2  
ATOM 2776  H "H2'"  . DC  B 2 13 ? -6.164  -22.498 -9.866  1.00 0.00 ? 94 DC  B "H2'"  2  
ATOM 2777  H "H2''" . DC  B 2 13 ? -5.366  -23.804 -10.675 1.00 0.00 ? 94 DC  B "H2''" 2  
ATOM 2778  H "H1'"  . DC  B 2 13 ? -3.724  -22.178 -11.775 1.00 0.00 ? 94 DC  B "H1'"  2  
ATOM 2779  H H41    . DC  B 2 13 ? -1.096  -21.561 -5.663  1.00 0.00 ? 94 DC  B H41    2  
ATOM 2780  H H42    . DC  B 2 13 ? 0.157   -21.537 -6.832  1.00 0.00 ? 94 DC  B H42    2  
ATOM 2781  H H5     . DC  B 2 13 ? -3.501  -21.297 -6.491  1.00 0.00 ? 94 DC  B H5     2  
ATOM 2782  H H6     . DC  B 2 13 ? -4.836  -21.495 -8.370  1.00 0.00 ? 94 DC  B H6     2  
ATOM 2783  N N      . GLY C 3 1  ? 8.713   -6.632  4.645   1.00 0.00 ? 1  GLY P N      2  
ATOM 2784  C CA     . GLY C 3 1  ? 7.844   -7.614  5.210   1.00 0.00 ? 1  GLY P CA     2  
ATOM 2785  C C      . GLY C 3 1  ? 8.041   -9.031  4.659   1.00 0.00 ? 1  GLY P C      2  
ATOM 2786  O O      . GLY C 3 1  ? 7.438   -9.272  3.611   1.00 0.00 ? 1  GLY P O      2  
ATOM 2787  H H1     . GLY C 3 1  ? 8.650   -5.819  5.240   1.00 0.00 ? 1  GLY P H1     2  
ATOM 2788  H H2     . GLY C 3 1  ? 8.525   -6.523  3.659   1.00 0.00 ? 1  GLY P H2     2  
ATOM 2789  H H3     . GLY C 3 1  ? 9.683   -6.912  4.633   1.00 0.00 ? 1  GLY P H3     2  
ATOM 2790  H HA2    . GLY C 3 1  ? 8.155   -7.709  6.249   1.00 0.00 ? 1  GLY P HA2    2  
ATOM 2791  H HA3    . GLY C 3 1  ? 6.846   -7.187  5.114   1.00 0.00 ? 1  GLY P HA3    2  
ATOM 2792  N N      . PRO C 3 2  ? 8.839   -9.922  5.329   1.00 0.00 ? 2  PRO P N      2  
ATOM 2793  C CA     . PRO C 3 2  ? 8.803   -11.324 5.046   1.00 0.00 ? 2  PRO P CA     2  
ATOM 2794  C C      . PRO C 3 2  ? 7.461   -11.903 4.846   1.00 0.00 ? 2  PRO P C      2  
ATOM 2795  O O      . PRO C 3 2  ? 7.270   -12.746 3.987   1.00 0.00 ? 2  PRO P O      2  
ATOM 2796  C CB     . PRO C 3 2  ? 9.610   -12.006 6.150   1.00 0.00 ? 2  PRO P CB     2  
ATOM 2797  C CG     . PRO C 3 2  ? 10.584  -10.948 6.661   1.00 0.00 ? 2  PRO P CG     2  
ATOM 2798  C CD     . PRO C 3 2  ? 9.605   -9.666  6.569   1.00 0.00 ? 2  PRO P CD     2  
ATOM 2799  H HA     . PRO C 3 2  ? 9.382   -11.521 4.144   1.00 0.00 ? 2  PRO P HA     2  
ATOM 2800  H HB2    . PRO C 3 2  ? 8.929   -12.439 6.882   1.00 0.00 ? 2  PRO P HB2    2  
ATOM 2801  H HB3    . PRO C 3 2  ? 10.148  -12.793 5.622   1.00 0.00 ? 2  PRO P HB3    2  
ATOM 2802  H HG2    . PRO C 3 2  ? 10.924  -11.177 7.671   1.00 0.00 ? 2  PRO P HG2    2  
ATOM 2803  H HG3    . PRO C 3 2  ? 11.450  -10.818 6.013   1.00 0.00 ? 2  PRO P HG3    2  
ATOM 2804  H HD2    . PRO C 3 2  ? 8.880   -9.701  7.381   1.00 0.00 ? 2  PRO P HD2    2  
ATOM 2805  H HD3    . PRO C 3 2  ? 10.186  -8.744  6.571   1.00 0.00 ? 2  PRO P HD3    2  
ATOM 2806  N N      . ARG C 3 3  ? 6.490   -11.580 5.635   1.00 0.00 ? 3  ARG P N      2  
ATOM 2807  C CA     . ARG C 3 3  ? 5.105   -12.071 5.604   1.00 0.00 ? 3  ARG P CA     2  
ATOM 2808  C C      . ARG C 3 3  ? 4.226   -10.918 6.136   1.00 0.00 ? 3  ARG P C      2  
ATOM 2809  O O      . ARG C 3 3  ? 4.466   -10.414 7.248   1.00 0.00 ? 3  ARG P O      2  
ATOM 2810  C CB     . ARG C 3 3  ? 5.043   -13.336 6.510   1.00 0.00 ? 3  ARG P CB     2  
ATOM 2811  C CG     . ARG C 3 3  ? 3.677   -13.894 6.643   1.00 0.00 ? 3  ARG P CG     2  
ATOM 2812  C CD     . ARG C 3 3  ? 2.819   -13.393 7.858   1.00 0.00 ? 3  ARG P CD     2  
ATOM 2813  N NE     . ARG C 3 3  ? 3.175   -13.934 9.193   1.00 0.00 ? 3  ARG P NE     2  
ATOM 2814  C CZ     . ARG C 3 3  ? 3.839   -13.188 10.107  1.00 0.00 ? 3  ARG P CZ     2  
ATOM 2815  N NH1    . ARG C 3 3  ? 4.356   -11.999 9.807   1.00 0.00 ? 3  ARG P NH1    2  
ATOM 2816  N NH2    . ARG C 3 3  ? 4.103   -13.661 11.341  1.00 0.00 ? 3  ARG P NH2    2  
ATOM 2817  H H      . ARG C 3 3  ? 6.787   -11.294 6.557   1.00 0.00 ? 3  ARG P H      2  
ATOM 2818  H HA     . ARG C 3 3  ? 4.802   -12.327 4.588   1.00 0.00 ? 3  ARG P HA     2  
ATOM 2819  H HB2    . ARG C 3 3  ? 5.690   -14.079 6.044   1.00 0.00 ? 3  ARG P HB2    2  
ATOM 2820  H HB3    . ARG C 3 3  ? 5.444   -12.966 7.454   1.00 0.00 ? 3  ARG P HB3    2  
ATOM 2821  H HG2    . ARG C 3 3  ? 3.130   -13.608 5.745   1.00 0.00 ? 3  ARG P HG2    2  
ATOM 2822  H HG3    . ARG C 3 3  ? 3.739   -14.982 6.645   1.00 0.00 ? 3  ARG P HG3    2  
ATOM 2823  H HD2    . ARG C 3 3  ? 2.973   -12.315 7.833   1.00 0.00 ? 3  ARG P HD2    2  
ATOM 2824  H HD3    . ARG C 3 3  ? 1.757   -13.453 7.615   1.00 0.00 ? 3  ARG P HD3    2  
ATOM 2825  H HE     . ARG C 3 3  ? 2.957   -14.903 9.372   1.00 0.00 ? 3  ARG P HE     2  
ATOM 2826  H HH11   . ARG C 3 3  ? 4.238   -11.658 8.864   1.00 0.00 ? 3  ARG P HH11   2  
ATOM 2827  H HH12   . ARG C 3 3  ? 4.941   -11.521 10.477  1.00 0.00 ? 3  ARG P HH12   2  
ATOM 2828  H HH21   . ARG C 3 3  ? 3.705   -14.523 11.685  1.00 0.00 ? 3  ARG P HH21   2  
ATOM 2829  H HH22   . ARG C 3 3  ? 4.267   -12.939 12.027  1.00 0.00 ? 3  ARG P HH22   2  
ATOM 2830  N N      . ARG C 3 4  ? 3.336   -10.439 5.299   1.00 0.00 ? 4  ARG P N      2  
ATOM 2831  C CA     . ARG C 3 4  ? 2.648   -9.155  5.682   1.00 0.00 ? 4  ARG P CA     2  
ATOM 2832  C C      . ARG C 3 4  ? 1.207   -9.159  5.150   1.00 0.00 ? 4  ARG P C      2  
ATOM 2833  O O      . ARG C 3 4  ? 0.914   -9.725  4.073   1.00 0.00 ? 4  ARG P O      2  
ATOM 2834  C CB     . ARG C 3 4  ? 3.506   -8.007  5.114   1.00 0.00 ? 4  ARG P CB     2  
ATOM 2835  C CG     . ARG C 3 4  ? 3.918   -8.117  3.672   1.00 0.00 ? 4  ARG P CG     2  
ATOM 2836  C CD     . ARG C 3 4  ? 2.986   -7.574  2.595   1.00 0.00 ? 4  ARG P CD     2  
ATOM 2837  N NE     . ARG C 3 4  ? 1.875   -6.751  3.001   1.00 0.00 ? 4  ARG P NE     2  
ATOM 2838  C CZ     . ARG C 3 4  ? 0.710   -6.881  2.479   1.00 0.00 ? 4  ARG P CZ     2  
ATOM 2839  N NH1    . ARG C 3 4  ? 0.290   -7.948  1.867   1.00 0.00 ? 4  ARG P NH1    2  
ATOM 2840  N NH2    . ARG C 3 4  ? -0.180  -5.890  2.590   1.00 0.00 ? 4  ARG P NH2    2  
ATOM 2841  H H      . ARG C 3 4  ? 3.162   -10.849 4.392   1.00 0.00 ? 4  ARG P H      2  
ATOM 2842  H HA     . ARG C 3 4  ? 2.644   -9.075  6.769   1.00 0.00 ? 4  ARG P HA     2  
ATOM 2843  H HB2    . ARG C 3 4  ? 2.987   -7.081  5.359   1.00 0.00 ? 4  ARG P HB2    2  
ATOM 2844  H HB3    . ARG C 3 4  ? 4.383   -8.121  5.751   1.00 0.00 ? 4  ARG P HB3    2  
ATOM 2845  H HG2    . ARG C 3 4  ? 4.817   -7.533  3.477   1.00 0.00 ? 4  ARG P HG2    2  
ATOM 2846  H HG3    . ARG C 3 4  ? 4.342   -9.082  3.389   1.00 0.00 ? 4  ARG P HG3    2  
ATOM 2847  H HD2    . ARG C 3 4  ? 3.595   -6.930  1.960   1.00 0.00 ? 4  ARG P HD2    2  
ATOM 2848  H HD3    . ARG C 3 4  ? 2.659   -8.373  1.929   1.00 0.00 ? 4  ARG P HD3    2  
ATOM 2849  H HE     . ARG C 3 4  ? 2.074   -5.959  3.595   1.00 0.00 ? 4  ARG P HE     2  
ATOM 2850  H HH11   . ARG C 3 4  ? 0.712   -8.809  2.184   1.00 0.00 ? 4  ARG P HH11   2  
ATOM 2851  H HH12   . ARG C 3 4  ? -0.660  -7.967  1.528   1.00 0.00 ? 4  ARG P HH12   2  
ATOM 2852  H HH21   . ARG C 3 4  ? 0.007   -4.946  2.898   1.00 0.00 ? 4  ARG P HH21   2  
ATOM 2853  H HH22   . ARG C 3 4  ? -1.057  -6.050  2.114   1.00 0.00 ? 4  ARG P HH22   2  
ATOM 2854  N N      . THR C 3 5  ? 0.395   -8.454  5.923   1.00 0.00 ? 5  THR P N      2  
ATOM 2855  C CA     . THR C 3 5  ? -1.030  -8.457  5.863   1.00 0.00 ? 5  THR P CA     2  
ATOM 2856  C C      . THR C 3 5  ? -1.651  -7.089  5.512   1.00 0.00 ? 5  THR P C      2  
ATOM 2857  O O      . THR C 3 5  ? -1.025  -6.031  5.641   1.00 0.00 ? 5  THR P O      2  
ATOM 2858  C CB     . THR C 3 5  ? -1.703  -8.979  7.166   1.00 0.00 ? 5  THR P CB     2  
ATOM 2859  O OG1    . THR C 3 5  ? -1.016  -8.536  8.329   1.00 0.00 ? 5  THR P OG1    2  
ATOM 2860  C CG2    . THR C 3 5  ? -1.729  -10.484 7.256   1.00 0.00 ? 5  THR P CG2    2  
ATOM 2861  H H      . THR C 3 5  ? 0.660   -8.119  6.839   1.00 0.00 ? 5  THR P H      2  
ATOM 2862  H HA     . THR C 3 5  ? -1.278  -9.122  5.034   1.00 0.00 ? 5  THR P HA     2  
ATOM 2863  H HB     . THR C 3 5  ? -2.727  -8.606  7.145   1.00 0.00 ? 5  THR P HB     2  
ATOM 2864  H HG1    . THR C 3 5  ? -1.652  -8.531  9.048   1.00 0.00 ? 5  THR P HG1    2  
ATOM 2865  H HG21   . THR C 3 5  ? -1.988  -11.073 6.376   1.00 0.00 ? 5  THR P HG21   2  
ATOM 2866  H HG22   . THR C 3 5  ? -2.413  -10.737 8.065   1.00 0.00 ? 5  THR P HG22   2  
ATOM 2867  H HG23   . THR C 3 5  ? -0.754  -10.809 7.614   1.00 0.00 ? 5  THR P HG23   2  
ATOM 2868  N N      . ARG C 3 6  ? -2.918  -7.209  5.091   1.00 0.00 ? 6  ARG P N      2  
ATOM 2869  C CA     . ARG C 3 6  ? -3.867  -6.098  5.041   1.00 0.00 ? 6  ARG P CA     2  
ATOM 2870  C C      . ARG C 3 6  ? -5.350  -6.618  5.220   1.00 0.00 ? 6  ARG P C      2  
ATOM 2871  O O      . ARG C 3 6  ? -5.782  -7.604  4.582   1.00 0.00 ? 6  ARG P O      2  
ATOM 2872  C CB     . ARG C 3 6  ? -3.620  -5.364  3.658   1.00 0.00 ? 6  ARG P CB     2  
ATOM 2873  C CG     . ARG C 3 6  ? -4.721  -4.400  3.164   1.00 0.00 ? 6  ARG P CG     2  
ATOM 2874  C CD     . ARG C 3 6  ? -5.413  -4.794  1.880   1.00 0.00 ? 6  ARG P CD     2  
ATOM 2875  N NE     . ARG C 3 6  ? -6.060  -6.153  1.922   1.00 0.00 ? 6  ARG P NE     2  
ATOM 2876  C CZ     . ARG C 3 6  ? -5.787  -7.140  1.139   1.00 0.00 ? 6  ARG P CZ     2  
ATOM 2877  N NH1    . ARG C 3 6  ? -5.195  -6.979  -0.001  1.00 0.00 ? 6  ARG P NH1    2  
ATOM 2878  N NH2    . ARG C 3 6  ? -6.072  -8.334  1.532   1.00 0.00 ? 6  ARG P NH2    2  
ATOM 2879  H H      . ARG C 3 6  ? -3.333  -8.130  5.073   1.00 0.00 ? 6  ARG P H      2  
ATOM 2880  H HA     . ARG C 3 6  ? -3.549  -5.362  5.779   1.00 0.00 ? 6  ARG P HA     2  
ATOM 2881  H HB2    . ARG C 3 6  ? -2.748  -4.725  3.806   1.00 0.00 ? 6  ARG P HB2    2  
ATOM 2882  H HB3    . ARG C 3 6  ? -3.510  -6.212  2.982   1.00 0.00 ? 6  ARG P HB3    2  
ATOM 2883  H HG2    . ARG C 3 6  ? -5.552  -4.244  3.851   1.00 0.00 ? 6  ARG P HG2    2  
ATOM 2884  H HG3    . ARG C 3 6  ? -4.395  -3.371  3.014   1.00 0.00 ? 6  ARG P HG3    2  
ATOM 2885  H HD2    . ARG C 3 6  ? -6.210  -4.100  1.611   1.00 0.00 ? 6  ARG P HD2    2  
ATOM 2886  H HD3    . ARG C 3 6  ? -4.693  -4.804  1.063   1.00 0.00 ? 6  ARG P HD3    2  
ATOM 2887  H HE     . ARG C 3 6  ? -6.824  -6.277  2.571   1.00 0.00 ? 6  ARG P HE     2  
ATOM 2888  H HH11   . ARG C 3 6  ? -5.192  -6.064  -0.430  1.00 0.00 ? 6  ARG P HH11   2  
ATOM 2889  H HH12   . ARG C 3 6  ? -4.967  -7.769  -0.587  1.00 0.00 ? 6  ARG P HH12   2  
ATOM 2890  H HH21   . ARG C 3 6  ? -6.405  -8.379  2.485   1.00 0.00 ? 6  ARG P HH21   2  
ATOM 2891  H HH22   . ARG C 3 6  ? -6.082  -9.161  0.952   1.00 0.00 ? 6  ARG P HH22   2  
ATOM 2892  N N      . THR C 3 7  ? -6.030  -5.894  6.082   1.00 0.00 ? 7  THR P N      2  
ATOM 2893  C CA     . THR C 3 7  ? -7.558  -5.799  6.104   1.00 0.00 ? 7  THR P CA     2  
ATOM 2894  C C      . THR C 3 7  ? -8.280  -6.032  4.796   1.00 0.00 ? 7  THR P C      2  
ATOM 2895  O O      . THR C 3 7  ? -7.995  -5.412  3.781   1.00 0.00 ? 7  THR P O      2  
ATOM 2896  C CB     . THR C 3 7  ? -8.086  -4.528  6.787   1.00 0.00 ? 7  THR P CB     2  
ATOM 2897  O OG1    . THR C 3 7  ? -7.685  -4.654  8.100   1.00 0.00 ? 7  THR P OG1    2  
ATOM 2898  C CG2    . THR C 3 7  ? -9.622  -4.306  6.862   1.00 0.00 ? 7  THR P CG2    2  
ATOM 2899  H H      . THR C 3 7  ? -5.554  -5.100  6.487   1.00 0.00 ? 7  THR P H      2  
ATOM 2900  H HA     . THR C 3 7  ? -7.901  -6.589  6.771   1.00 0.00 ? 7  THR P HA     2  
ATOM 2901  H HB     . THR C 3 7  ? -7.582  -3.686  6.311   1.00 0.00 ? 7  THR P HB     2  
ATOM 2902  H HG1    . THR C 3 7  ? -6.728  -4.714  8.071   1.00 0.00 ? 7  THR P HG1    2  
ATOM 2903  H HG21   . THR C 3 7  ? -9.760  -3.384  7.427   1.00 0.00 ? 7  THR P HG21   2  
ATOM 2904  H HG22   . THR C 3 7  ? -9.996  -5.188  7.379   1.00 0.00 ? 7  THR P HG22   2  
ATOM 2905  H HG23   . THR C 3 7  ? -10.033 -4.260  5.854   1.00 0.00 ? 7  THR P HG23   2  
ATOM 2906  N N      . THR C 3 8  ? -9.184  -7.022  4.746   1.00 0.00 ? 8  THR P N      2  
ATOM 2907  C CA     . THR C 3 8  ? -9.763  -7.501  3.521   1.00 0.00 ? 8  THR P CA     2  
ATOM 2908  C C      . THR C 3 8  ? -11.174 -6.856  3.348   1.00 0.00 ? 8  THR P C      2  
ATOM 2909  O O      . THR C 3 8  ? -12.060 -7.085  4.175   1.00 0.00 ? 8  THR P O      2  
ATOM 2910  C CB     . THR C 3 8  ? -9.800  -9.032  3.513   1.00 0.00 ? 8  THR P CB     2  
ATOM 2911  O OG1    . THR C 3 8  ? -8.422  -9.437  3.727   1.00 0.00 ? 8  THR P OG1    2  
ATOM 2912  C CG2    . THR C 3 8  ? -10.329 -9.577  2.146   1.00 0.00 ? 8  THR P CG2    2  
ATOM 2913  H H      . THR C 3 8  ? -9.552  -7.340  5.631   1.00 0.00 ? 8  THR P H      2  
ATOM 2914  H HA     . THR C 3 8  ? -9.183  -7.216  2.642   1.00 0.00 ? 8  THR P HA     2  
ATOM 2915  H HB     . THR C 3 8  ? -10.358 -9.496  4.326   1.00 0.00 ? 8  THR P HB     2  
ATOM 2916  H HG1    . THR C 3 8  ? -8.273  -9.312  4.667   1.00 0.00 ? 8  THR P HG1    2  
ATOM 2917  H HG21   . THR C 3 8  ? -10.073 -10.637 2.135   1.00 0.00 ? 8  THR P HG21   2  
ATOM 2918  H HG22   . THR C 3 8  ? -9.882  -9.121  1.264   1.00 0.00 ? 8  THR P HG22   2  
ATOM 2919  H HG23   . THR C 3 8  ? -11.409 -9.455  2.073   1.00 0.00 ? 8  THR P HG23   2  
ATOM 2920  N N      . PHE C 3 9  ? -11.293 -5.983  2.353   1.00 0.00 ? 9  PHE P N      2  
ATOM 2921  C CA     . PHE C 3 9  ? -12.488 -5.222  2.211   1.00 0.00 ? 9  PHE P CA     2  
ATOM 2922  C C      . PHE C 3 9  ? -13.794 -6.027  2.043   1.00 0.00 ? 9  PHE P C      2  
ATOM 2923  O O      . PHE C 3 9  ? -13.718 -7.088  1.452   1.00 0.00 ? 9  PHE P O      2  
ATOM 2924  C CB     . PHE C 3 9  ? -12.334 -4.396  0.910   1.00 0.00 ? 9  PHE P CB     2  
ATOM 2925  C CG     . PHE C 3 9  ? -11.086 -3.474  0.856   1.00 0.00 ? 9  PHE P CG     2  
ATOM 2926  C CD1    . PHE C 3 9  ? -11.152 -2.263  1.489   1.00 0.00 ? 9  PHE P CD1    2  
ATOM 2927  C CD2    . PHE C 3 9  ? -9.942  -3.896  0.259   1.00 0.00 ? 9  PHE P CD2    2  
ATOM 2928  C CE1    . PHE C 3 9  ? -10.071 -1.333  1.525   1.00 0.00 ? 9  PHE P CE1    2  
ATOM 2929  C CE2    . PHE C 3 9  ? -8.827  -2.993  0.160   1.00 0.00 ? 9  PHE P CE2    2  
ATOM 2930  C CZ     . PHE C 3 9  ? -8.840  -1.734  0.817   1.00 0.00 ? 9  PHE P CZ     2  
ATOM 2931  H H      . PHE C 3 9  ? -10.488 -5.668  1.830   1.00 0.00 ? 9  PHE P H      2  
ATOM 2932  H HA     . PHE C 3 9  ? -12.653 -4.492  3.003   1.00 0.00 ? 9  PHE P HA     2  
ATOM 2933  H HB2    . PHE C 3 9  ? -12.335 -5.145  0.118   1.00 0.00 ? 9  PHE P HB2    2  
ATOM 2934  H HB3    . PHE C 3 9  ? -13.208 -3.745  0.912   1.00 0.00 ? 9  PHE P HB3    2  
ATOM 2935  H HD1    . PHE C 3 9  ? -12.018 -1.981  2.067   1.00 0.00 ? 9  PHE P HD1    2  
ATOM 2936  H HD2    . PHE C 3 9  ? -9.864  -4.832  -0.274  1.00 0.00 ? 9  PHE P HD2    2  
ATOM 2937  H HE1    . PHE C 3 9  ? -10.286 -0.380  1.986   1.00 0.00 ? 9  PHE P HE1    2  
ATOM 2938  H HE2    . PHE C 3 9  ? -7.926  -3.330  -0.331  1.00 0.00 ? 9  PHE P HE2    2  
ATOM 2939  H HZ     . PHE C 3 9  ? -8.035  -1.046  0.606   1.00 0.00 ? 9  PHE P HZ     2  
ATOM 2940  N N      . THR C 3 10 ? -14.970 -5.510  2.338   1.00 0.00 ? 10 THR P N      2  
ATOM 2941  C CA     . THR C 3 10 ? -16.254 -6.144  1.973   1.00 0.00 ? 10 THR P CA     2  
ATOM 2942  C C      . THR C 3 10 ? -17.051 -5.204  1.109   1.00 0.00 ? 10 THR P C      2  
ATOM 2943  O O      . THR C 3 10 ? -16.814 -4.007  0.971   1.00 0.00 ? 10 THR P O      2  
ATOM 2944  C CB     . THR C 3 10 ? -17.076 -6.556  3.173   1.00 0.00 ? 10 THR P CB     2  
ATOM 2945  O OG1    . THR C 3 10 ? -17.600 -5.434  3.914   1.00 0.00 ? 10 THR P OG1    2  
ATOM 2946  C CG2    . THR C 3 10 ? -16.368 -7.390  4.210   1.00 0.00 ? 10 THR P CG2    2  
ATOM 2947  H H      . THR C 3 10 ? -15.005 -4.593  2.761   1.00 0.00 ? 10 THR P H      2  
ATOM 2948  H HA     . THR C 3 10 ? -16.109 -7.049  1.383   1.00 0.00 ? 10 THR P HA     2  
ATOM 2949  H HB     . THR C 3 10 ? -17.959 -7.048  2.768   1.00 0.00 ? 10 THR P HB     2  
ATOM 2950  H HG1    . THR C 3 10 ? -18.452 -5.723  4.249   1.00 0.00 ? 10 THR P HG1    2  
ATOM 2951  H HG21   . THR C 3 10 ? -16.882 -7.380  5.172   1.00 0.00 ? 10 THR P HG21   2  
ATOM 2952  H HG22   . THR C 3 10 ? -15.345 -7.015  4.199   1.00 0.00 ? 10 THR P HG22   2  
ATOM 2953  H HG23   . THR C 3 10 ? -16.299 -8.432  3.899   1.00 0.00 ? 10 THR P HG23   2  
ATOM 2954  N N      . SER C 3 11 ? -18.072 -5.758  0.503   1.00 0.00 ? 11 SER P N      2  
ATOM 2955  C CA     . SER C 3 11 ? -19.006 -5.086  -0.435  1.00 0.00 ? 11 SER P CA     2  
ATOM 2956  C C      . SER C 3 11 ? -19.503 -3.721  0.075   1.00 0.00 ? 11 SER P C      2  
ATOM 2957  O O      . SER C 3 11 ? -19.370 -2.760  -0.662  1.00 0.00 ? 11 SER P O      2  
ATOM 2958  C CB     . SER C 3 11 ? -20.127 -6.031  -0.721  1.00 0.00 ? 11 SER P CB     2  
ATOM 2959  O OG     . SER C 3 11 ? -19.631 -7.318  -0.940  1.00 0.00 ? 11 SER P OG     2  
ATOM 2960  H H      . SER C 3 11 ? -18.125 -6.765  0.578   1.00 0.00 ? 11 SER P H      2  
ATOM 2961  H HA     . SER C 3 11 ? -18.544 -4.948  -1.413  1.00 0.00 ? 11 SER P HA     2  
ATOM 2962  H HB2    . SER C 3 11 ? -20.884 -6.037  0.065   1.00 0.00 ? 11 SER P HB2    2  
ATOM 2963  H HB3    . SER C 3 11 ? -20.647 -5.544  -1.545  1.00 0.00 ? 11 SER P HB3    2  
ATOM 2964  H HG     . SER C 3 11 ? -20.372 -7.920  -0.834  1.00 0.00 ? 11 SER P HG     2  
ATOM 2965  N N      . SER C 3 12 ? -19.899 -3.664  1.379   1.00 0.00 ? 12 SER P N      2  
ATOM 2966  C CA     . SER C 3 12 ? -20.428 -2.398  2.033   1.00 0.00 ? 12 SER P CA     2  
ATOM 2967  C C      . SER C 3 12 ? -19.329 -1.463  2.345   1.00 0.00 ? 12 SER P C      2  
ATOM 2968  O O      . SER C 3 12 ? -19.592 -0.247  2.343   1.00 0.00 ? 12 SER P O      2  
ATOM 2969  C CB     . SER C 3 12 ? -21.235 -2.719  3.280   1.00 0.00 ? 12 SER P CB     2  
ATOM 2970  O OG     . SER C 3 12 ? -22.565 -2.891  2.909   1.00 0.00 ? 12 SER P OG     2  
ATOM 2971  H H      . SER C 3 12 ? -19.989 -4.512  1.919   1.00 0.00 ? 12 SER P H      2  
ATOM 2972  H HA     . SER C 3 12 ? -21.087 -1.924  1.305   1.00 0.00 ? 12 SER P HA     2  
ATOM 2973  H HB2    . SER C 3 12 ? -20.802 -3.507  3.897   1.00 0.00 ? 12 SER P HB2    2  
ATOM 2974  H HB3    . SER C 3 12 ? -21.338 -1.835  3.909   1.00 0.00 ? 12 SER P HB3    2  
ATOM 2975  H HG     . SER C 3 12 ? -22.628 -3.797  2.600   1.00 0.00 ? 12 SER P HG     2  
ATOM 2976  N N      . GLN C 3 13 ? -18.096 -1.923  2.502   1.00 0.00 ? 13 GLN P N      2  
ATOM 2977  C CA     . GLN C 3 13 ? -16.973 -0.932  2.714   1.00 0.00 ? 13 GLN P CA     2  
ATOM 2978  C C      . GLN C 3 13 ? -16.773 -0.260  1.393   1.00 0.00 ? 13 GLN P C      2  
ATOM 2979  O O      . GLN C 3 13 ? -16.852 0.979   1.363   1.00 0.00 ? 13 GLN P O      2  
ATOM 2980  C CB     . GLN C 3 13 ? -15.738 -1.587  3.220   1.00 0.00 ? 13 GLN P CB     2  
ATOM 2981  C CG     . GLN C 3 13 ? -15.990 -2.103  4.577   1.00 0.00 ? 13 GLN P CG     2  
ATOM 2982  C CD     . GLN C 3 13 ? -14.820 -2.721  5.237   1.00 0.00 ? 13 GLN P CD     2  
ATOM 2983  O OE1    . GLN C 3 13 ? -14.234 -3.675  4.774   1.00 0.00 ? 13 GLN P OE1    2  
ATOM 2984  N NE2    . GLN C 3 13 ? -14.390 -2.134  6.329   1.00 0.00 ? 13 GLN P NE2    2  
ATOM 2985  H H      . GLN C 3 13 ? -17.897 -2.908  2.394   1.00 0.00 ? 13 GLN P H      2  
ATOM 2986  H HA     . GLN C 3 13 ? -17.133 -0.089  3.387   1.00 0.00 ? 13 GLN P HA     2  
ATOM 2987  H HB2    . GLN C 3 13 ? -15.534 -2.454  2.592   1.00 0.00 ? 13 GLN P HB2    2  
ATOM 2988  H HB3    . GLN C 3 13 ? -14.902 -0.891  3.298   1.00 0.00 ? 13 GLN P HB3    2  
ATOM 2989  H HG2    . GLN C 3 13 ? -16.361 -1.287  5.199   1.00 0.00 ? 13 GLN P HG2    2  
ATOM 2990  H HG3    . GLN C 3 13 ? -16.727 -2.888  4.404   1.00 0.00 ? 13 GLN P HG3    2  
ATOM 2991  H HE21   . GLN C 3 13 ? -14.850 -1.396  6.843   1.00 0.00 ? 13 GLN P HE21   2  
ATOM 2992  H HE22   . GLN C 3 13 ? -13.521 -2.449  6.739   1.00 0.00 ? 13 GLN P HE22   2  
ATOM 2993  N N      . ILE C 3 14 ? -16.550 -1.070  0.361   1.00 0.00 ? 14 ILE P N      2  
ATOM 2994  C CA     . ILE C 3 14 ? -16.335 -0.450  -0.982  1.00 0.00 ? 14 ILE P CA     2  
ATOM 2995  C C      . ILE C 3 14 ? -17.503 0.452   -1.372  1.00 0.00 ? 14 ILE P C      2  
ATOM 2996  O O      . ILE C 3 14 ? -17.248 1.507   -1.922  1.00 0.00 ? 14 ILE P O      2  
ATOM 2997  C CB     . ILE C 3 14 ? -16.039 -1.617  -2.000  1.00 0.00 ? 14 ILE P CB     2  
ATOM 2998  C CG1    . ILE C 3 14 ? -14.743 -2.335  -1.679  1.00 0.00 ? 14 ILE P CG1    2  
ATOM 2999  C CG2    . ILE C 3 14 ? -15.980 -1.026  -3.387  1.00 0.00 ? 14 ILE P CG2    2  
ATOM 3000  C CD1    . ILE C 3 14 ? -14.566 -3.654  -2.334  1.00 0.00 ? 14 ILE P CD1    2  
ATOM 3001  H H      . ILE C 3 14 ? -16.495 -2.072  0.467   1.00 0.00 ? 14 ILE P H      2  
ATOM 3002  H HA     . ILE C 3 14 ? -15.476 0.209   -0.860  1.00 0.00 ? 14 ILE P HA     2  
ATOM 3003  H HB     . ILE C 3 14 ? -16.819 -2.374  -2.076  1.00 0.00 ? 14 ILE P HB     2  
ATOM 3004  H HG12   . ILE C 3 14 ? -13.903 -1.654  -1.819  1.00 0.00 ? 14 ILE P HG12   2  
ATOM 3005  H HG13   . ILE C 3 14 ? -14.668 -2.585  -0.621  1.00 0.00 ? 14 ILE P HG13   2  
ATOM 3006  H HG21   . ILE C 3 14 ? -15.358 -0.134  -3.313  1.00 0.00 ? 14 ILE P HG21   2  
ATOM 3007  H HG22   . ILE C 3 14 ? -15.554 -1.739  -4.091  1.00 0.00 ? 14 ILE P HG22   2  
ATOM 3008  H HG23   . ILE C 3 14 ? -17.008 -0.848  -3.707  1.00 0.00 ? 14 ILE P HG23   2  
ATOM 3009  H HD11   . ILE C 3 14 ? -15.484 -4.228  -2.211  1.00 0.00 ? 14 ILE P HD11   2  
ATOM 3010  H HD12   . ILE C 3 14 ? -14.279 -3.565  -3.382  1.00 0.00 ? 14 ILE P HD12   2  
ATOM 3011  H HD13   . ILE C 3 14 ? -13.799 -4.208  -1.793  1.00 0.00 ? 14 ILE P HD13   2  
ATOM 3012  N N      . ALA C 3 15 ? -18.771 0.151   -0.996  1.00 0.00 ? 15 ALA P N      2  
ATOM 3013  C CA     . ALA C 3 15 ? -19.916 1.039   -1.249  1.00 0.00 ? 15 ALA P CA     2  
ATOM 3014  C C      . ALA C 3 15 ? -19.878 2.398   -0.523  1.00 0.00 ? 15 ALA P C      2  
ATOM 3015  O O      . ALA C 3 15 ? -20.476 3.380   -1.042  1.00 0.00 ? 15 ALA P O      2  
ATOM 3016  C CB     . ALA C 3 15 ? -21.221 0.366   -0.800  1.00 0.00 ? 15 ALA P CB     2  
ATOM 3017  H H      . ALA C 3 15 ? -18.835 -0.699  -0.453  1.00 0.00 ? 15 ALA P H      2  
ATOM 3018  H HA     . ALA C 3 15 ? -20.004 1.133   -2.331  1.00 0.00 ? 15 ALA P HA     2  
ATOM 3019  H HB1    . ALA C 3 15 ? -21.224 0.422   0.289   1.00 0.00 ? 15 ALA P HB1    2  
ATOM 3020  H HB2    . ALA C 3 15 ? -22.169 0.814   -1.100  1.00 0.00 ? 15 ALA P HB2    2  
ATOM 3021  H HB3    . ALA C 3 15 ? -21.185 -0.621  -1.261  1.00 0.00 ? 15 ALA P HB3    2  
ATOM 3022  N N      . GLU C 3 16 ? -19.297 2.457   0.660   1.00 0.00 ? 16 GLU P N      2  
ATOM 3023  C CA     . GLU C 3 16 ? -19.117 3.650   1.489   1.00 0.00 ? 16 GLU P CA     2  
ATOM 3024  C C      . GLU C 3 16 ? -18.044 4.536   0.921   1.00 0.00 ? 16 GLU P C      2  
ATOM 3025  O O      . GLU C 3 16 ? -18.125 5.765   0.957   1.00 0.00 ? 16 GLU P O      2  
ATOM 3026  C CB     . GLU C 3 16 ? -18.566 3.387   2.886   1.00 0.00 ? 16 GLU P CB     2  
ATOM 3027  C CG     . GLU C 3 16 ? -19.492 2.796   3.942   1.00 0.00 ? 16 GLU P CG     2  
ATOM 3028  C CD     . GLU C 3 16 ? -20.859 3.447   3.973   1.00 0.00 ? 16 GLU P CD     2  
ATOM 3029  O OE1    . GLU C 3 16 ? -21.053 4.497   4.582   1.00 0.00 ? 16 GLU P OE1    2  
ATOM 3030  O OE2    . GLU C 3 16 ? -21.822 2.848   3.450   1.00 0.00 ? 16 GLU P OE2    2  
ATOM 3031  H H      . GLU C 3 16 ? -18.925 1.630   1.105   1.00 0.00 ? 16 GLU P H      2  
ATOM 3032  H HA     . GLU C 3 16 ? -20.080 4.158   1.536   1.00 0.00 ? 16 GLU P HA     2  
ATOM 3033  H HB2    . GLU C 3 16 ? -17.726 2.698   2.801   1.00 0.00 ? 16 GLU P HB2    2  
ATOM 3034  H HB3    . GLU C 3 16 ? -18.183 4.358   3.201   1.00 0.00 ? 16 GLU P HB3    2  
ATOM 3035  H HG2    . GLU C 3 16 ? -19.621 1.722   3.801   1.00 0.00 ? 16 GLU P HG2    2  
ATOM 3036  H HG3    . GLU C 3 16 ? -18.971 3.009   4.874   1.00 0.00 ? 16 GLU P HG3    2  
ATOM 3037  N N      . LEU C 3 17 ? -16.950 3.803   0.573   1.00 0.00 ? 17 LEU P N      2  
ATOM 3038  C CA     . LEU C 3 17 ? -15.716 4.362   0.095   1.00 0.00 ? 17 LEU P CA     2  
ATOM 3039  C C      . LEU C 3 17 ? -16.076 5.166   -1.195  1.00 0.00 ? 17 LEU P C      2  
ATOM 3040  O O      . LEU C 3 17 ? -15.738 6.331   -1.281  1.00 0.00 ? 17 LEU P O      2  
ATOM 3041  C CB     . LEU C 3 17 ? -14.686 3.228   -0.209  1.00 0.00 ? 17 LEU P CB     2  
ATOM 3042  C CG     . LEU C 3 17 ? -13.879 2.776   1.010   1.00 0.00 ? 17 LEU P CG     2  
ATOM 3043  C CD1    . LEU C 3 17 ? -13.189 1.445   1.084   1.00 0.00 ? 17 LEU P CD1    2  
ATOM 3044  C CD2    . LEU C 3 17 ? -12.799 3.826   1.265   1.00 0.00 ? 17 LEU P CD2    2  
ATOM 3045  H H      . LEU C 3 17 ? -17.000 2.794   0.611   1.00 0.00 ? 17 LEU P H      2  
ATOM 3046  H HA     . LEU C 3 17 ? -15.242 5.017   0.826   1.00 0.00 ? 17 LEU P HA     2  
ATOM 3047  H HB2    . LEU C 3 17 ? -15.183 2.421   -0.747  1.00 0.00 ? 17 LEU P HB2    2  
ATOM 3048  H HB3    . LEU C 3 17 ? -13.824 3.576   -0.778  1.00 0.00 ? 17 LEU P HB3    2  
ATOM 3049  H HG     . LEU C 3 17 ? -14.663 2.816   1.768   1.00 0.00 ? 17 LEU P HG     2  
ATOM 3050  H HD11   . LEU C 3 17 ? -12.689 1.318   2.043   1.00 0.00 ? 17 LEU P HD11   2  
ATOM 3051  H HD12   . LEU C 3 17 ? -12.338 1.519   0.407   1.00 0.00 ? 17 LEU P HD12   2  
ATOM 3052  H HD13   . LEU C 3 17 ? -13.893 0.639   0.875   1.00 0.00 ? 17 LEU P HD13   2  
ATOM 3053  H HD21   . LEU C 3 17 ? -12.065 3.942   0.467   1.00 0.00 ? 17 LEU P HD21   2  
ATOM 3054  H HD22   . LEU C 3 17 ? -12.169 3.523   2.101   1.00 0.00 ? 17 LEU P HD22   2  
ATOM 3055  H HD23   . LEU C 3 17 ? -13.276 4.761   1.560   1.00 0.00 ? 17 LEU P HD23   2  
ATOM 3056  N N      . GLU C 3 18 ? -16.820 4.565   -2.104  1.00 0.00 ? 18 GLU P N      2  
ATOM 3057  C CA     . GLU C 3 18 ? -17.449 5.184   -3.304  1.00 0.00 ? 18 GLU P CA     2  
ATOM 3058  C C      . GLU C 3 18 ? -18.316 6.406   -2.980  1.00 0.00 ? 18 GLU P C      2  
ATOM 3059  O O      . GLU C 3 18 ? -17.957 7.474   -3.462  1.00 0.00 ? 18 GLU P O      2  
ATOM 3060  C CB     . GLU C 3 18 ? -18.358 4.196   -4.077  1.00 0.00 ? 18 GLU P CB     2  
ATOM 3061  C CG     . GLU C 3 18 ? -17.638 2.989   -4.750  1.00 0.00 ? 18 GLU P CG     2  
ATOM 3062  C CD     . GLU C 3 18 ? -17.018 3.359   -6.068  1.00 0.00 ? 18 GLU P CD     2  
ATOM 3063  O OE1    . GLU C 3 18 ? -16.492 4.486   -6.265  1.00 0.00 ? 18 GLU P OE1    2  
ATOM 3064  O OE2    . GLU C 3 18 ? -17.002 2.572   -7.032  1.00 0.00 ? 18 GLU P OE2    2  
ATOM 3065  H H      . GLU C 3 18 ? -16.870 3.559   -2.024  1.00 0.00 ? 18 GLU P H      2  
ATOM 3066  H HA     . GLU C 3 18 ? -16.684 5.464   -4.027  1.00 0.00 ? 18 GLU P HA     2  
ATOM 3067  H HB2    . GLU C 3 18 ? -19.151 3.888   -3.395  1.00 0.00 ? 18 GLU P HB2    2  
ATOM 3068  H HB3    . GLU C 3 18 ? -18.893 4.736   -4.857  1.00 0.00 ? 18 GLU P HB3    2  
ATOM 3069  H HG2    . GLU C 3 18 ? -16.819 2.607   -4.141  1.00 0.00 ? 18 GLU P HG2    2  
ATOM 3070  H HG3    . GLU C 3 18 ? -18.307 2.147   -4.930  1.00 0.00 ? 18 GLU P HG3    2  
ATOM 3071  N N      . GLN C 3 19 ? -19.273 6.328   -2.044  1.00 0.00 ? 19 GLN P N      2  
ATOM 3072  C CA     . GLN C 3 19 ? -20.180 7.367   -1.712  1.00 0.00 ? 19 GLN P CA     2  
ATOM 3073  C C      . GLN C 3 19 ? -19.492 8.651   -1.161  1.00 0.00 ? 19 GLN P C      2  
ATOM 3074  O O      . GLN C 3 19 ? -19.832 9.752   -1.572  1.00 0.00 ? 19 GLN P O      2  
ATOM 3075  C CB     . GLN C 3 19 ? -21.241 7.033   -0.687  1.00 0.00 ? 19 GLN P CB     2  
ATOM 3076  C CG     . GLN C 3 19 ? -22.476 6.270   -1.337  1.00 0.00 ? 19 GLN P CG     2  
ATOM 3077  C CD     . GLN C 3 19 ? -23.281 7.066   -2.251  1.00 0.00 ? 19 GLN P CD     2  
ATOM 3078  O OE1    . GLN C 3 19 ? -24.136 7.862   -1.904  1.00 0.00 ? 19 GLN P OE1    2  
ATOM 3079  N NE2    . GLN C 3 19 ? -23.129 6.879   -3.541  1.00 0.00 ? 19 GLN P NE2    2  
ATOM 3080  H H      . GLN C 3 19 ? -19.514 5.385   -1.773  1.00 0.00 ? 19 GLN P H      2  
ATOM 3081  H HA     . GLN C 3 19 ? -20.619 7.709   -2.649  1.00 0.00 ? 19 GLN P HA     2  
ATOM 3082  H HB2    . GLN C 3 19 ? -20.682 6.420   0.020   1.00 0.00 ? 19 GLN P HB2    2  
ATOM 3083  H HB3    . GLN C 3 19 ? -21.665 7.934   -0.244  1.00 0.00 ? 19 GLN P HB3    2  
ATOM 3084  H HG2    . GLN C 3 19 ? -22.082 5.385   -1.835  1.00 0.00 ? 19 GLN P HG2    2  
ATOM 3085  H HG3    . GLN C 3 19 ? -23.126 6.023   -0.497  1.00 0.00 ? 19 GLN P HG3    2  
ATOM 3086  H HE21   . GLN C 3 19 ? -22.519 6.185   -3.950  1.00 0.00 ? 19 GLN P HE21   2  
ATOM 3087  H HE22   . GLN C 3 19 ? -23.667 7.412   -4.209  1.00 0.00 ? 19 GLN P HE22   2  
ATOM 3088  N N      . HIS C 3 20 ? -18.479 8.544   -0.303  1.00 0.00 ? 20 HIS P N      2  
ATOM 3089  C CA     . HIS C 3 20 ? -17.649 9.685   0.057   1.00 0.00 ? 20 HIS P CA     2  
ATOM 3090  C C      . HIS C 3 20 ? -16.588 10.111  -1.025  1.00 0.00 ? 20 HIS P C      2  
ATOM 3091  O O      . HIS C 3 20 ? -16.298 11.268  -1.204  1.00 0.00 ? 20 HIS P O      2  
ATOM 3092  C CB     . HIS C 3 20 ? -17.101 9.512   1.490   1.00 0.00 ? 20 HIS P CB     2  
ATOM 3093  C CG     . HIS C 3 20 ? -18.234 9.326   2.559   1.00 0.00 ? 20 HIS P CG     2  
ATOM 3094  N ND1    . HIS C 3 20 ? -19.138 10.301  2.851   1.00 0.00 ? 20 HIS P ND1    2  
ATOM 3095  C CD2    . HIS C 3 20 ? -18.777 8.125   3.065   1.00 0.00 ? 20 HIS P CD2    2  
ATOM 3096  C CE1    . HIS C 3 20 ? -20.169 9.772   3.504   1.00 0.00 ? 20 HIS P CE1    2  
ATOM 3097  N NE2    . HIS C 3 20 ? -19.999 8.424   3.588   1.00 0.00 ? 20 HIS P NE2    2  
ATOM 3098  H H      . HIS C 3 20 ? -18.074 7.649   -0.071  1.00 0.00 ? 20 HIS P H      2  
ATOM 3099  H HA     . HIS C 3 20 ? -18.229 10.603  0.153   1.00 0.00 ? 20 HIS P HA     2  
ATOM 3100  H HB2    . HIS C 3 20 ? -16.395 8.681   1.497   1.00 0.00 ? 20 HIS P HB2    2  
ATOM 3101  H HB3    . HIS C 3 20 ? -16.434 10.336  1.744   1.00 0.00 ? 20 HIS P HB3    2  
ATOM 3102  H HD1    . HIS C 3 20 ? -18.983 11.252  2.549   1.00 0.00 ? 20 HIS P HD1    2  
ATOM 3103  H HD2    . HIS C 3 20 ? -18.319 7.155   2.932   1.00 0.00 ? 20 HIS P HD2    2  
ATOM 3104  H HE1    . HIS C 3 20 ? -21.034 10.296  3.882   1.00 0.00 ? 20 HIS P HE1    2  
ATOM 3105  N N      . PHE C 3 21 ? -15.898 9.199   -1.759  1.00 0.00 ? 21 PHE P N      2  
ATOM 3106  C CA     . PHE C 3 21 ? -15.134 9.475   -2.981  1.00 0.00 ? 21 PHE P CA     2  
ATOM 3107  C C      . PHE C 3 21 ? -15.826 10.406  -4.031  1.00 0.00 ? 21 PHE P C      2  
ATOM 3108  O O      . PHE C 3 21 ? -15.139 11.155  -4.730  1.00 0.00 ? 21 PHE P O      2  
ATOM 3109  C CB     . PHE C 3 21 ? -14.756 8.147   -3.708  1.00 0.00 ? 21 PHE P CB     2  
ATOM 3110  C CG     . PHE C 3 21 ? -14.644 8.164   -5.185  1.00 0.00 ? 21 PHE P CG     2  
ATOM 3111  C CD1    . PHE C 3 21 ? -15.774 7.950   -5.949  1.00 0.00 ? 21 PHE P CD1    2  
ATOM 3112  C CD2    . PHE C 3 21 ? -13.386 8.567   -5.794  1.00 0.00 ? 21 PHE P CD2    2  
ATOM 3113  C CE1    . PHE C 3 21 ? -15.683 8.031   -7.392  1.00 0.00 ? 21 PHE P CE1    2  
ATOM 3114  C CE2    . PHE C 3 21 ? -13.271 8.609   -7.187  1.00 0.00 ? 21 PHE P CE2    2  
ATOM 3115  C CZ     . PHE C 3 21 ? -14.401 8.350   -7.966  1.00 0.00 ? 21 PHE P CZ     2  
ATOM 3116  H H      . PHE C 3 21 ? -15.928 8.246   -1.427  1.00 0.00 ? 21 PHE P H      2  
ATOM 3117  H HA     . PHE C 3 21 ? -14.219 9.964   -2.645  1.00 0.00 ? 21 PHE P HA     2  
ATOM 3118  H HB2    . PHE C 3 21 ? -13.806 7.865   -3.256  1.00 0.00 ? 21 PHE P HB2    2  
ATOM 3119  H HB3    . PHE C 3 21 ? -15.456 7.332   -3.523  1.00 0.00 ? 21 PHE P HB3    2  
ATOM 3120  H HD1    . PHE C 3 21 ? -16.747 7.825   -5.498  1.00 0.00 ? 21 PHE P HD1    2  
ATOM 3121  H HD2    . PHE C 3 21 ? -12.525 8.902   -5.233  1.00 0.00 ? 21 PHE P HD2    2  
ATOM 3122  H HE1    . PHE C 3 21 ? -16.475 7.884   -8.111  1.00 0.00 ? 21 PHE P HE1    2  
ATOM 3123  H HE2    . PHE C 3 21 ? -12.321 8.708   -7.690  1.00 0.00 ? 21 PHE P HE2    2  
ATOM 3124  H HZ     . PHE C 3 21 ? -14.331 8.285   -9.041  1.00 0.00 ? 21 PHE P HZ     2  
ATOM 3125  N N      . LEU C 3 22 ? -17.172 10.373  -4.072  1.00 0.00 ? 22 LEU P N      2  
ATOM 3126  C CA     . LEU C 3 22 ? -18.007 11.308  -4.865  1.00 0.00 ? 22 LEU P CA     2  
ATOM 3127  C C      . LEU C 3 22 ? -17.718 12.805  -4.498  1.00 0.00 ? 22 LEU P C      2  
ATOM 3128  O O      . LEU C 3 22 ? -18.002 13.654  -5.325  1.00 0.00 ? 22 LEU P O      2  
ATOM 3129  C CB     . LEU C 3 22 ? -19.514 10.897  -4.761  1.00 0.00 ? 22 LEU P CB     2  
ATOM 3130  C CG     . LEU C 3 22 ? -19.925 9.494   -5.154  1.00 0.00 ? 22 LEU P CG     2  
ATOM 3131  C CD1    . LEU C 3 22 ? -21.408 9.284   -4.800  1.00 0.00 ? 22 LEU P CD1    2  
ATOM 3132  C CD2    . LEU C 3 22 ? -19.776 9.246   -6.686  1.00 0.00 ? 22 LEU P CD2    2  
ATOM 3133  H H      . LEU C 3 22 ? -17.576 9.549   -3.653  1.00 0.00 ? 22 LEU P H      2  
ATOM 3134  H HA     . LEU C 3 22 ? -17.733 11.135  -5.905  1.00 0.00 ? 22 LEU P HA     2  
ATOM 3135  H HB2    . LEU C 3 22 ? -19.913 11.177  -3.787  1.00 0.00 ? 22 LEU P HB2    2  
ATOM 3136  H HB3    . LEU C 3 22 ? -20.093 11.573  -5.390  1.00 0.00 ? 22 LEU P HB3    2  
ATOM 3137  H HG     . LEU C 3 22 ? -19.434 8.783   -4.490  1.00 0.00 ? 22 LEU P HG     2  
ATOM 3138  H HD11   . LEU C 3 22 ? -21.539 9.169   -3.724  1.00 0.00 ? 22 LEU P HD11   2  
ATOM 3139  H HD12   . LEU C 3 22 ? -21.829 8.380   -5.241  1.00 0.00 ? 22 LEU P HD12   2  
ATOM 3140  H HD13   . LEU C 3 22 ? -22.037 10.116  -5.120  1.00 0.00 ? 22 LEU P HD13   2  
ATOM 3141  H HD21   . LEU C 3 22 ? -20.405 9.918   -7.270  1.00 0.00 ? 22 LEU P HD21   2  
ATOM 3142  H HD22   . LEU C 3 22 ? -20.049 8.242   -7.011  1.00 0.00 ? 22 LEU P HD22   2  
ATOM 3143  H HD23   . LEU C 3 22 ? -18.731 9.386   -6.959  1.00 0.00 ? 22 LEU P HD23   2  
ATOM 3144  N N      . GLN C 3 23 ? -17.157 13.003  -3.302  1.00 0.00 ? 23 GLN P N      2  
ATOM 3145  C CA     . GLN C 3 23 ? -16.809 14.319  -2.813  1.00 0.00 ? 23 GLN P CA     2  
ATOM 3146  C C      . GLN C 3 23 ? -15.343 14.788  -3.113  1.00 0.00 ? 23 GLN P C      2  
ATOM 3147  O O      . GLN C 3 23 ? -15.053 15.979  -3.071  1.00 0.00 ? 23 GLN P O      2  
ATOM 3148  C CB     . GLN C 3 23 ? -17.115 14.393  -1.265  1.00 0.00 ? 23 GLN P CB     2  
ATOM 3149  C CG     . GLN C 3 23 ? -18.452 13.834  -0.868  1.00 0.00 ? 23 GLN P CG     2  
ATOM 3150  C CD     . GLN C 3 23 ? -19.507 14.627  -1.546  1.00 0.00 ? 23 GLN P CD     2  
ATOM 3151  O OE1    . GLN C 3 23 ? -19.645 15.826  -1.259  1.00 0.00 ? 23 GLN P OE1    2  
ATOM 3152  N NE2    . GLN C 3 23 ? -20.335 14.079  -2.335  1.00 0.00 ? 23 GLN P NE2    2  
ATOM 3153  H H      . GLN C 3 23 ? -17.108 12.265  -2.614  1.00 0.00 ? 23 GLN P H      2  
ATOM 3154  H HA     . GLN C 3 23 ? -17.458 15.072  -3.262  1.00 0.00 ? 23 GLN P HA     2  
ATOM 3155  H HB2    . GLN C 3 23 ? -16.477 13.653  -0.782  1.00 0.00 ? 23 GLN P HB2    2  
ATOM 3156  H HB3    . GLN C 3 23 ? -17.108 15.435  -0.945  1.00 0.00 ? 23 GLN P HB3    2  
ATOM 3157  H HG2    . GLN C 3 23 ? -18.554 12.765  -1.051  1.00 0.00 ? 23 GLN P HG2    2  
ATOM 3158  H HG3    . GLN C 3 23 ? -18.482 13.976  0.212   1.00 0.00 ? 23 GLN P HG3    2  
ATOM 3159  H HE21   . GLN C 3 23 ? -20.369 13.090  -2.537  1.00 0.00 ? 23 GLN P HE21   2  
ATOM 3160  H HE22   . GLN C 3 23 ? -20.870 14.787  -2.819  1.00 0.00 ? 23 GLN P HE22   2  
ATOM 3161  N N      . GLY C 3 24 ? -14.541 13.800  -3.499  1.00 0.00 ? 24 GLY P N      2  
ATOM 3162  C CA     . GLY C 3 24 ? -13.064 13.977  -3.799  1.00 0.00 ? 24 GLY P CA     2  
ATOM 3163  C C      . GLY C 3 24 ? -12.402 12.684  -4.232  1.00 0.00 ? 24 GLY P C      2  
ATOM 3164  O O      . GLY C 3 24 ? -12.649 11.627  -3.661  1.00 0.00 ? 24 GLY P O      2  
ATOM 3165  H H      . GLY C 3 24 ? -14.919 12.863  -3.494  1.00 0.00 ? 24 GLY P H      2  
ATOM 3166  H HA2    . GLY C 3 24 ? -12.947 14.657  -4.642  1.00 0.00 ? 24 GLY P HA2    2  
ATOM 3167  H HA3    . GLY C 3 24 ? -12.474 14.367  -2.969  1.00 0.00 ? 24 GLY P HA3    2  
ATOM 3168  N N      . ARG C 3 25 ? -11.698 12.703  -5.375  1.00 0.00 ? 25 ARG P N      2  
ATOM 3169  C CA     . ARG C 3 25 ? -11.089 11.487  -6.056  1.00 0.00 ? 25 ARG P CA     2  
ATOM 3170  C C      . ARG C 3 25 ? -9.853  10.887  -5.356  1.00 0.00 ? 25 ARG P C      2  
ATOM 3171  O O      . ARG C 3 25 ? -9.355  9.809   -5.663  1.00 0.00 ? 25 ARG P O      2  
ATOM 3172  C CB     . ARG C 3 25 ? -10.663 11.822  -7.538  1.00 0.00 ? 25 ARG P CB     2  
ATOM 3173  C CG     . ARG C 3 25 ? -11.941 12.291  -8.254  1.00 0.00 ? 25 ARG P CG     2  
ATOM 3174  C CD     . ARG C 3 25 ? -11.564 12.858  -9.651  1.00 0.00 ? 25 ARG P CD     2  
ATOM 3175  N NE     . ARG C 3 25 ? -11.234 11.853  -10.644 1.00 0.00 ? 25 ARG P NE     2  
ATOM 3176  C CZ     . ARG C 3 25 ? -10.036 11.545  -10.985 1.00 0.00 ? 25 ARG P CZ     2  
ATOM 3177  N NH1    . ARG C 3 25 ? -8.949  12.038  -10.409 1.00 0.00 ? 25 ARG P NH1    2  
ATOM 3178  N NH2    . ARG C 3 25 ? -9.912  10.583  -11.818 1.00 0.00 ? 25 ARG P NH2    2  
ATOM 3179  H H      . ARG C 3 25 ? -11.587 13.621  -5.781  1.00 0.00 ? 25 ARG P H      2  
ATOM 3180  H HA     . ARG C 3 25 ? -11.911 10.770  -6.083  1.00 0.00 ? 25 ARG P HA     2  
ATOM 3181  H HB2    . ARG C 3 25 ? -9.850  12.548  -7.561  1.00 0.00 ? 25 ARG P HB2    2  
ATOM 3182  H HB3    . ARG C 3 25 ? -10.461 10.927  -8.126  1.00 0.00 ? 25 ARG P HB3    2  
ATOM 3183  H HG2    . ARG C 3 25 ? -12.678 11.511  -8.447  1.00 0.00 ? 25 ARG P HG2    2  
ATOM 3184  H HG3    . ARG C 3 25 ? -12.550 13.006  -7.699  1.00 0.00 ? 25 ARG P HG3    2  
ATOM 3185  H HD2    . ARG C 3 25 ? -12.467 13.296  -10.073 1.00 0.00 ? 25 ARG P HD2    2  
ATOM 3186  H HD3    . ARG C 3 25 ? -10.767 13.588  -9.508  1.00 0.00 ? 25 ARG P HD3    2  
ATOM 3187  H HE     . ARG C 3 25 ? -12.032 11.413  -11.081 1.00 0.00 ? 25 ARG P HE     2  
ATOM 3188  H HH11   . ARG C 3 25 ? -9.106  12.903  -9.912  1.00 0.00 ? 25 ARG P HH11   2  
ATOM 3189  H HH12   . ARG C 3 25 ? -8.189  12.099  -11.072 1.00 0.00 ? 25 ARG P HH12   2  
ATOM 3190  H HH21   . ARG C 3 25 ? -10.694 10.261  -12.369 1.00 0.00 ? 25 ARG P HH21   2  
ATOM 3191  H HH22   . ARG C 3 25 ? -8.980  10.310  -12.096 1.00 0.00 ? 25 ARG P HH22   2  
ATOM 3192  N N      . TYR C 3 26 ? -9.237  11.633  -4.442  1.00 0.00 ? 26 TYR P N      2  
ATOM 3193  C CA     . TYR C 3 26 ? -8.106  11.271  -3.586  1.00 0.00 ? 26 TYR P CA     2  
ATOM 3194  C C      . TYR C 3 26 ? -8.098  11.886  -2.204  1.00 0.00 ? 26 TYR P C      2  
ATOM 3195  O O      . TYR C 3 26 ? -8.840  12.834  -1.962  1.00 0.00 ? 26 TYR P O      2  
ATOM 3196  C CB     . TYR C 3 26 ? -6.750  11.531  -4.213  1.00 0.00 ? 26 TYR P CB     2  
ATOM 3197  C CG     . TYR C 3 26 ? -6.232  12.927  -4.431  1.00 0.00 ? 26 TYR P CG     2  
ATOM 3198  C CD1    . TYR C 3 26 ? -4.953  13.212  -3.932  1.00 0.00 ? 26 TYR P CD1    2  
ATOM 3199  C CD2    . TYR C 3 26 ? -6.993  14.012  -4.958  1.00 0.00 ? 26 TYR P CD2    2  
ATOM 3200  C CE1    . TYR C 3 26 ? -4.364  14.452  -4.127  1.00 0.00 ? 26 TYR P CE1    2  
ATOM 3201  C CE2    . TYR C 3 26 ? -6.407  15.293  -5.079  1.00 0.00 ? 26 TYR P CE2    2  
ATOM 3202  C CZ     . TYR C 3 26 ? -5.065  15.521  -4.718  1.00 0.00 ? 26 TYR P CZ     2  
ATOM 3203  O OH     . TYR C 3 26 ? -4.664  16.871  -4.639  1.00 0.00 ? 26 TYR P OH     2  
ATOM 3204  H H      . TYR C 3 26 ? -9.544  12.595  -4.393  1.00 0.00 ? 26 TYR P H      2  
ATOM 3205  H HA     . TYR C 3 26 ? -8.070  10.196  -3.408  1.00 0.00 ? 26 TYR P HA     2  
ATOM 3206  H HB2    . TYR C 3 26 ? -6.010  10.973  -3.641  1.00 0.00 ? 26 TYR P HB2    2  
ATOM 3207  H HB3    . TYR C 3 26 ? -6.760  11.038  -5.186  1.00 0.00 ? 26 TYR P HB3    2  
ATOM 3208  H HD1    . TYR C 3 26 ? -4.407  12.439  -3.414  1.00 0.00 ? 26 TYR P HD1    2  
ATOM 3209  H HD2    . TYR C 3 26 ? -8.022  13.894  -5.260  1.00 0.00 ? 26 TYR P HD2    2  
ATOM 3210  H HE1    . TYR C 3 26 ? -3.351  14.578  -3.775  1.00 0.00 ? 26 TYR P HE1    2  
ATOM 3211  H HE2    . TYR C 3 26 ? -6.945  16.151  -5.457  1.00 0.00 ? 26 TYR P HE2    2  
ATOM 3212  H HH     . TYR C 3 26 ? -3.856  16.975  -4.131  1.00 0.00 ? 26 TYR P HH     2  
ATOM 3213  N N      . LEU C 3 27 ? -7.407  11.415  -1.241  1.00 0.00 ? 27 LEU P N      2  
ATOM 3214  C CA     . LEU C 3 27 ? -7.418  11.643  0.181   1.00 0.00 ? 27 LEU P CA     2  
ATOM 3215  C C      . LEU C 3 27 ? -6.545  12.793  0.717   1.00 0.00 ? 27 LEU P C      2  
ATOM 3216  O O      . LEU C 3 27 ? -5.569  13.257  0.168   1.00 0.00 ? 27 LEU P O      2  
ATOM 3217  C CB     . LEU C 3 27 ? -6.995  10.423  0.986   1.00 0.00 ? 27 LEU P CB     2  
ATOM 3218  C CG     . LEU C 3 27 ? -7.672  9.100   0.899   1.00 0.00 ? 27 LEU P CG     2  
ATOM 3219  C CD1    . LEU C 3 27 ? -9.189  9.233   1.030   1.00 0.00 ? 27 LEU P CD1    2  
ATOM 3220  C CD2    . LEU C 3 27 ? -7.380  8.451   -0.363  1.00 0.00 ? 27 LEU P CD2    2  
ATOM 3221  H H      . LEU C 3 27 ? -6.762  10.656  -1.404  1.00 0.00 ? 27 LEU P H      2  
ATOM 3222  H HA     . LEU C 3 27 ? -8.448  11.863  0.463   1.00 0.00 ? 27 LEU P HA     2  
ATOM 3223  H HB2    . LEU C 3 27 ? -5.931  10.280  0.795   1.00 0.00 ? 27 LEU P HB2    2  
ATOM 3224  H HB3    . LEU C 3 27 ? -7.014  10.668  2.048   1.00 0.00 ? 27 LEU P HB3    2  
ATOM 3225  H HG     . LEU C 3 27 ? -7.288  8.526   1.742   1.00 0.00 ? 27 LEU P HG     2  
ATOM 3226  H HD11   . LEU C 3 27 ? -9.359  9.877   1.892   1.00 0.00 ? 27 LEU P HD11   2  
ATOM 3227  H HD12   . LEU C 3 27 ? -9.618  8.242   1.174   1.00 0.00 ? 27 LEU P HD12   2  
ATOM 3228  H HD13   . LEU C 3 27 ? -9.600  9.781   0.181   1.00 0.00 ? 27 LEU P HD13   2  
ATOM 3229  H HD21   . LEU C 3 27 ? -6.300  8.471   -0.500  1.00 0.00 ? 27 LEU P HD21   2  
ATOM 3230  H HD22   . LEU C 3 27 ? -7.850  8.869   -1.253  1.00 0.00 ? 27 LEU P HD22   2  
ATOM 3231  H HD23   . LEU C 3 27 ? -7.603  7.405   -0.148  1.00 0.00 ? 27 LEU P HD23   2  
ATOM 3232  N N      . THR C 3 28 ? -6.937  13.196  1.925   1.00 0.00 ? 28 THR P N      2  
ATOM 3233  C CA     . THR C 3 28 ? -6.116  13.898  2.929   1.00 0.00 ? 28 THR P CA     2  
ATOM 3234  C C      . THR C 3 28 ? -6.406  13.153  4.252   1.00 0.00 ? 28 THR P C      2  
ATOM 3235  O O      . THR C 3 28 ? -7.363  12.366  4.323   1.00 0.00 ? 28 THR P O      2  
ATOM 3236  C CB     . THR C 3 28 ? -6.655  15.297  3.142   1.00 0.00 ? 28 THR P CB     2  
ATOM 3237  O OG1    . THR C 3 28 ? -8.025  15.082  3.332   1.00 0.00 ? 28 THR P OG1    2  
ATOM 3238  C CG2    . THR C 3 28 ? -6.523  16.271  1.931   1.00 0.00 ? 28 THR P CG2    2  
ATOM 3239  H H      . THR C 3 28 ? -7.798  12.848  2.323   1.00 0.00 ? 28 THR P H      2  
ATOM 3240  H HA     . THR C 3 28 ? -5.058  13.895  2.661   1.00 0.00 ? 28 THR P HA     2  
ATOM 3241  H HB     . THR C 3 28 ? -6.214  15.737  4.038   1.00 0.00 ? 28 THR P HB     2  
ATOM 3242  H HG1    . THR C 3 28 ? -8.459  15.937  3.388   1.00 0.00 ? 28 THR P HG1    2  
ATOM 3243  H HG21   . THR C 3 28 ? -5.502  16.226  1.554   1.00 0.00 ? 28 THR P HG21   2  
ATOM 3244  H HG22   . THR C 3 28 ? -6.684  17.262  2.355   1.00 0.00 ? 28 THR P HG22   2  
ATOM 3245  H HG23   . THR C 3 28 ? -7.298  16.088  1.187   1.00 0.00 ? 28 THR P HG23   2  
ATOM 3246  N N      . ALA C 3 29 ? -5.700  13.375  5.349   1.00 0.00 ? 29 ALA P N      2  
ATOM 3247  C CA     . ALA C 3 29 ? -5.898  12.747  6.662   1.00 0.00 ? 29 ALA P CA     2  
ATOM 3248  C C      . ALA C 3 29 ? -7.426  12.869  7.211   1.00 0.00 ? 29 ALA P C      2  
ATOM 3249  O O      . ALA C 3 29 ? -7.992  11.895  7.682   1.00 0.00 ? 29 ALA P O      2  
ATOM 3250  C CB     . ALA C 3 29 ? -4.810  13.330  7.585   1.00 0.00 ? 29 ALA P CB     2  
ATOM 3251  H H      . ALA C 3 29 ? -4.847  13.892  5.187   1.00 0.00 ? 29 ALA P H      2  
ATOM 3252  H HA     . ALA C 3 29 ? -5.726  11.676  6.562   1.00 0.00 ? 29 ALA P HA     2  
ATOM 3253  H HB1    . ALA C 3 29 ? -4.800  12.707  8.479   1.00 0.00 ? 29 ALA P HB1    2  
ATOM 3254  H HB2    . ALA C 3 29 ? -3.926  13.470  6.964   1.00 0.00 ? 29 ALA P HB2    2  
ATOM 3255  H HB3    . ALA C 3 29 ? -5.029  14.313  8.001   1.00 0.00 ? 29 ALA P HB3    2  
ATOM 3256  N N      . PRO C 3 30 ? -8.122  14.023  7.091   1.00 0.00 ? 30 PRO P N      2  
ATOM 3257  C CA     . PRO C 3 30 ? -9.547  14.119  7.452   1.00 0.00 ? 30 PRO P CA     2  
ATOM 3258  C C      . PRO C 3 30 ? -10.378 13.223  6.622   1.00 0.00 ? 30 PRO P C      2  
ATOM 3259  O O      . PRO C 3 30 ? -11.237 12.542  7.214   1.00 0.00 ? 30 PRO P O      2  
ATOM 3260  C CB     . PRO C 3 30 ? -10.026 15.615  7.316   1.00 0.00 ? 30 PRO P CB     2  
ATOM 3261  C CG     . PRO C 3 30 ? -8.749  16.187  6.591   1.00 0.00 ? 30 PRO P CG     2  
ATOM 3262  C CD     . PRO C 3 30 ? -7.491  15.323  6.918   1.00 0.00 ? 30 PRO P CD     2  
ATOM 3263  H HA     . PRO C 3 30 ? -9.628  13.742  8.472   1.00 0.00 ? 30 PRO P HA     2  
ATOM 3264  H HB2    . PRO C 3 30 ? -10.983 15.622  6.793   1.00 0.00 ? 30 PRO P HB2    2  
ATOM 3265  H HB3    . PRO C 3 30 ? -10.123 15.999  8.332   1.00 0.00 ? 30 PRO P HB3    2  
ATOM 3266  H HG2    . PRO C 3 30 ? -8.946  16.210  5.518   1.00 0.00 ? 30 PRO P HG2    2  
ATOM 3267  H HG3    . PRO C 3 30 ? -8.631  17.191  6.995   1.00 0.00 ? 30 PRO P HG3    2  
ATOM 3268  H HD2    . PRO C 3 30 ? -6.727  15.302  6.140   1.00 0.00 ? 30 PRO P HD2    2  
ATOM 3269  H HD3    . PRO C 3 30 ? -6.977  15.692  7.806   1.00 0.00 ? 30 PRO P HD3    2  
ATOM 3270  N N      . ARG C 3 31 ? -10.112 13.038  5.276   1.00 0.00 ? 31 ARG P N      2  
ATOM 3271  C CA     . ARG C 3 31 ? -10.825 12.079  4.406   1.00 0.00 ? 31 ARG P CA     2  
ATOM 3272  C C      . ARG C 3 31 ? -10.442 10.604  4.744   1.00 0.00 ? 31 ARG P C      2  
ATOM 3273  O O      . ARG C 3 31 ? -11.311 9.782   5.033   1.00 0.00 ? 31 ARG P O      2  
ATOM 3274  C CB     . ARG C 3 31 ? -10.538 12.324  2.889   1.00 0.00 ? 31 ARG P CB     2  
ATOM 3275  C CG     . ARG C 3 31 ? -11.432 13.216  2.042   1.00 0.00 ? 31 ARG P CG     2  
ATOM 3276  C CD     . ARG C 3 31 ? -11.584 14.589  2.648   1.00 0.00 ? 31 ARG P CD     2  
ATOM 3277  N NE     . ARG C 3 31 ? -11.827 15.544  1.505   1.00 0.00 ? 31 ARG P NE     2  
ATOM 3278  C CZ     . ARG C 3 31 ? -12.780 16.422  1.394   1.00 0.00 ? 31 ARG P CZ     2  
ATOM 3279  N NH1    . ARG C 3 31 ? -13.737 16.728  2.277   1.00 0.00 ? 31 ARG P NH1    2  
ATOM 3280  N NH2    . ARG C 3 31 ? -12.804 17.065  0.293   1.00 0.00 ? 31 ARG P NH2    2  
ATOM 3281  H H      . ARG C 3 31 ? -9.415  13.662  4.895   1.00 0.00 ? 31 ARG P H      2  
ATOM 3282  H HA     . ARG C 3 31 ? -11.888 12.201  4.613   1.00 0.00 ? 31 ARG P HA     2  
ATOM 3283  H HB2    . ARG C 3 31 ? -9.529  12.731  2.832   1.00 0.00 ? 31 ARG P HB2    2  
ATOM 3284  H HB3    . ARG C 3 31 ? -10.515 11.352  2.396   1.00 0.00 ? 31 ARG P HB3    2  
ATOM 3285  H HG2    . ARG C 3 31 ? -10.881 13.315  1.107   1.00 0.00 ? 31 ARG P HG2    2  
ATOM 3286  H HG3    . ARG C 3 31 ? -12.400 12.788  1.782   1.00 0.00 ? 31 ARG P HG3    2  
ATOM 3287  H HD2    . ARG C 3 31 ? -12.366 14.698  3.398   1.00 0.00 ? 31 ARG P HD2    2  
ATOM 3288  H HD3    . ARG C 3 31 ? -10.658 14.888  3.138   1.00 0.00 ? 31 ARG P HD3    2  
ATOM 3289  H HE     . ARG C 3 31 ? -11.223 15.410  0.707   1.00 0.00 ? 31 ARG P HE     2  
ATOM 3290  H HH11   . ARG C 3 31 ? -13.638 16.305  3.188   1.00 0.00 ? 31 ARG P HH11   2  
ATOM 3291  H HH12   . ARG C 3 31 ? -14.462 17.387  2.030   1.00 0.00 ? 31 ARG P HH12   2  
ATOM 3292  H HH21   . ARG C 3 31 ? -12.060 17.007  -0.388  1.00 0.00 ? 31 ARG P HH21   2  
ATOM 3293  H HH22   . ARG C 3 31 ? -13.604 17.644  0.083   1.00 0.00 ? 31 ARG P HH22   2  
ATOM 3294  N N      . LEU C 3 32 ? -9.158  10.308  4.693   1.00 0.00 ? 32 LEU P N      2  
ATOM 3295  C CA     . LEU C 3 32 ? -8.642  8.985   5.086   1.00 0.00 ? 32 LEU P CA     2  
ATOM 3296  C C      . LEU C 3 32 ? -9.258  8.533   6.491   1.00 0.00 ? 32 LEU P C      2  
ATOM 3297  O O      . LEU C 3 32 ? -9.706  7.400   6.573   1.00 0.00 ? 32 LEU P O      2  
ATOM 3298  C CB     . LEU C 3 32 ? -7.085  9.148   5.193   1.00 0.00 ? 32 LEU P CB     2  
ATOM 3299  C CG     . LEU C 3 32 ? -6.275  7.863   5.293   1.00 0.00 ? 32 LEU P CG     2  
ATOM 3300  C CD1    . LEU C 3 32 ? -6.116  7.422   3.856   1.00 0.00 ? 32 LEU P CD1    2  
ATOM 3301  C CD2    . LEU C 3 32 ? -4.920  8.202   5.961   1.00 0.00 ? 32 LEU P CD2    2  
ATOM 3302  H H      . LEU C 3 32 ? -8.447  11.004  4.522   1.00 0.00 ? 32 LEU P H      2  
ATOM 3303  H HA     . LEU C 3 32 ? -8.956  8.212   4.385   1.00 0.00 ? 32 LEU P HA     2  
ATOM 3304  H HB2    . LEU C 3 32 ? -6.838  9.656   4.261   1.00 0.00 ? 32 LEU P HB2    2  
ATOM 3305  H HB3    . LEU C 3 32 ? -6.947  9.695   6.126   1.00 0.00 ? 32 LEU P HB3    2  
ATOM 3306  H HG     . LEU C 3 32 ? -6.834  7.174   5.927   1.00 0.00 ? 32 LEU P HG     2  
ATOM 3307  H HD11   . LEU C 3 32 ? -5.793  8.229   3.197   1.00 0.00 ? 32 LEU P HD11   2  
ATOM 3308  H HD12   . LEU C 3 32 ? -7.088  7.089   3.495   1.00 0.00 ? 32 LEU P HD12   2  
ATOM 3309  H HD13   . LEU C 3 32 ? -5.430  6.577   3.794   1.00 0.00 ? 32 LEU P HD13   2  
ATOM 3310  H HD21   . LEU C 3 32 ? -4.375  7.258   5.950   1.00 0.00 ? 32 LEU P HD21   2  
ATOM 3311  H HD22   . LEU C 3 32 ? -5.129  8.593   6.957   1.00 0.00 ? 32 LEU P HD22   2  
ATOM 3312  H HD23   . LEU C 3 32 ? -4.327  9.020   5.553   1.00 0.00 ? 32 LEU P HD23   2  
ATOM 3313  N N      . ALA C 3 33 ? -9.231  9.415   7.520   1.00 0.00 ? 33 ALA P N      2  
ATOM 3314  C CA     . ALA C 3 33 ? -9.655  9.064   8.894   1.00 0.00 ? 33 ALA P CA     2  
ATOM 3315  C C      . ALA C 3 33 ? -11.188 8.928   9.036   1.00 0.00 ? 33 ALA P C      2  
ATOM 3316  O O      . ALA C 3 33 ? -11.673 7.933   9.630   1.00 0.00 ? 33 ALA P O      2  
ATOM 3317  C CB     . ALA C 3 33 ? -9.226  10.206  9.796   1.00 0.00 ? 33 ALA P CB     2  
ATOM 3318  H H      . ALA C 3 33 ? -8.866  10.353  7.431   1.00 0.00 ? 33 ALA P H      2  
ATOM 3319  H HA     . ALA C 3 33 ? -9.223  8.116   9.212   1.00 0.00 ? 33 ALA P HA     2  
ATOM 3320  H HB1    . ALA C 3 33 ? -9.613  10.051  10.804  1.00 0.00 ? 33 ALA P HB1    2  
ATOM 3321  H HB2    . ALA C 3 33 ? -8.137  10.167  9.824   1.00 0.00 ? 33 ALA P HB2    2  
ATOM 3322  H HB3    . ALA C 3 33 ? -9.564  11.200  9.502   1.00 0.00 ? 33 ALA P HB3    2  
ATOM 3323  N N      . ASP C 3 34 ? -11.975 9.844   8.425   1.00 0.00 ? 34 ASP P N      2  
ATOM 3324  C CA     . ASP C 3 34 ? -13.421 9.832   8.499   1.00 0.00 ? 34 ASP P CA     2  
ATOM 3325  C C      . ASP C 3 34 ? -14.090 8.607   7.873   1.00 0.00 ? 34 ASP P C      2  
ATOM 3326  O O      . ASP C 3 34 ? -15.011 8.009   8.339   1.00 0.00 ? 34 ASP P O      2  
ATOM 3327  C CB     . ASP C 3 34 ? -13.884 11.159  7.912   1.00 0.00 ? 34 ASP P CB     2  
ATOM 3328  C CG     . ASP C 3 34 ? -15.406 11.363  7.998   1.00 0.00 ? 34 ASP P CG     2  
ATOM 3329  O OD1    . ASP C 3 34 ? -15.962 11.559  6.853   1.00 0.00 ? 34 ASP P OD1    2  
ATOM 3330  O OD2    . ASP C 3 34 ? -15.959 11.522  9.113   1.00 0.00 ? 34 ASP P OD2    2  
ATOM 3331  H H      . ASP C 3 34 ? -11.541 10.564  7.864   1.00 0.00 ? 34 ASP P H      2  
ATOM 3332  H HA     . ASP C 3 34 ? -13.631 9.774   9.566   1.00 0.00 ? 34 ASP P HA     2  
ATOM 3333  H HB2    . ASP C 3 34 ? -13.448 11.941  8.533   1.00 0.00 ? 34 ASP P HB2    2  
ATOM 3334  H HB3    . ASP C 3 34 ? -13.587 11.276  6.870   1.00 0.00 ? 34 ASP P HB3    2  
ATOM 3335  N N      . LEU C 3 35 ? -13.621 8.208   6.690   1.00 0.00 ? 35 LEU P N      2  
ATOM 3336  C CA     . LEU C 3 35 ? -13.896 6.904   6.121   1.00 0.00 ? 35 LEU P CA     2  
ATOM 3337  C C      . LEU C 3 35 ? -13.415 5.759   7.035   1.00 0.00 ? 35 LEU P C      2  
ATOM 3338  O O      . LEU C 3 35 ? -14.183 4.838   7.222   1.00 0.00 ? 35 LEU P O      2  
ATOM 3339  C CB     . LEU C 3 35 ? -13.495 6.876   4.629   1.00 0.00 ? 35 LEU P CB     2  
ATOM 3340  C CG     . LEU C 3 35 ? -14.445 6.686   3.455   1.00 0.00 ? 35 LEU P CG     2  
ATOM 3341  C CD1    . LEU C 3 35 ? -15.806 7.310   3.678   1.00 0.00 ? 35 LEU P CD1    2  
ATOM 3342  C CD2    . LEU C 3 35 ? -13.751 7.246   2.198   1.00 0.00 ? 35 LEU P CD2    2  
ATOM 3343  H H      . LEU C 3 35 ? -12.922 8.813   6.283   1.00 0.00 ? 35 LEU P H      2  
ATOM 3344  H HA     . LEU C 3 35 ? -14.982 6.829   6.167   1.00 0.00 ? 35 LEU P HA     2  
ATOM 3345  H HB2    . LEU C 3 35 ? -12.983 7.826   4.483   1.00 0.00 ? 35 LEU P HB2    2  
ATOM 3346  H HB3    . LEU C 3 35 ? -12.726 6.104   4.575   1.00 0.00 ? 35 LEU P HB3    2  
ATOM 3347  H HG     . LEU C 3 35 ? -14.595 5.635   3.211   1.00 0.00 ? 35 LEU P HG     2  
ATOM 3348  H HD11   . LEU C 3 35 ? -16.293 7.138   2.718   1.00 0.00 ? 35 LEU P HD11   2  
ATOM 3349  H HD12   . LEU C 3 35 ? -15.643 8.380   3.812   1.00 0.00 ? 35 LEU P HD12   2  
ATOM 3350  H HD13   . LEU C 3 35 ? -16.364 6.802   4.463   1.00 0.00 ? 35 LEU P HD13   2  
ATOM 3351  H HD21   . LEU C 3 35 ? -13.985 8.308   2.126   1.00 0.00 ? 35 LEU P HD21   2  
ATOM 3352  H HD22   . LEU C 3 35 ? -14.004 6.762   1.255   1.00 0.00 ? 35 LEU P HD22   2  
ATOM 3353  H HD23   . LEU C 3 35 ? -12.684 7.079   2.345   1.00 0.00 ? 35 LEU P HD23   2  
ATOM 3354  N N      . SER C 3 36 ? -12.236 5.859   7.617   1.00 0.00 ? 36 SER P N      2  
ATOM 3355  C CA     . SER C 3 36 ? -11.625 4.852   8.553   1.00 0.00 ? 36 SER P CA     2  
ATOM 3356  C C      . SER C 3 36 ? -12.558 4.547   9.751   1.00 0.00 ? 36 SER P C      2  
ATOM 3357  O O      . SER C 3 36 ? -12.697 3.360   10.072  1.00 0.00 ? 36 SER P O      2  
ATOM 3358  C CB     . SER C 3 36 ? -10.231 5.326   8.973   1.00 0.00 ? 36 SER P CB     2  
ATOM 3359  O OG     . SER C 3 36 ? -9.569  4.420   9.931   1.00 0.00 ? 36 SER P OG     2  
ATOM 3360  H H      . SER C 3 36 ? -11.654 6.639   7.344   1.00 0.00 ? 36 SER P H      2  
ATOM 3361  H HA     . SER C 3 36 ? -11.502 3.901   8.034   1.00 0.00 ? 36 SER P HA     2  
ATOM 3362  H HB2    . SER C 3 36 ? -9.491  5.399   8.177   1.00 0.00 ? 36 SER P HB2    2  
ATOM 3363  H HB3    . SER C 3 36 ? -10.286 6.275   9.506   1.00 0.00 ? 36 SER P HB3    2  
ATOM 3364  H HG     . SER C 3 36 ? -9.807  3.503   9.772   1.00 0.00 ? 36 SER P HG     2  
ATOM 3365  N N      . ALA C 3 37 ? -13.199 5.591   10.206  1.00 0.00 ? 37 ALA P N      2  
ATOM 3366  C CA     . ALA C 3 37 ? -14.202 5.474   11.237  1.00 0.00 ? 37 ALA P CA     2  
ATOM 3367  C C      . ALA C 3 37 ? -15.411 4.752   10.666  1.00 0.00 ? 37 ALA P C      2  
ATOM 3368  O O      . ALA C 3 37 ? -15.696 3.750   11.277  1.00 0.00 ? 37 ALA P O      2  
ATOM 3369  C CB     . ALA C 3 37 ? -14.546 6.844   11.762  1.00 0.00 ? 37 ALA P CB     2  
ATOM 3370  H H      . ALA C 3 37 ? -13.123 6.463   9.701   1.00 0.00 ? 37 ALA P H      2  
ATOM 3371  H HA     . ALA C 3 37 ? -13.809 4.833   12.024  1.00 0.00 ? 37 ALA P HA     2  
ATOM 3372  H HB1    . ALA C 3 37 ? -15.107 7.492   11.087  1.00 0.00 ? 37 ALA P HB1    2  
ATOM 3373  H HB2    . ALA C 3 37 ? -14.998 6.850   12.753  1.00 0.00 ? 37 ALA P HB2    2  
ATOM 3374  H HB3    . ALA C 3 37 ? -13.623 7.412   11.877  1.00 0.00 ? 37 ALA P HB3    2  
ATOM 3375  N N      . LYS C 3 38 ? -15.987 5.239   9.569   1.00 0.00 ? 38 LYS P N      2  
ATOM 3376  C CA     . LYS C 3 38 ? -17.347 4.868   9.193   1.00 0.00 ? 38 LYS P CA     2  
ATOM 3377  C C      . LYS C 3 38 ? -17.363 3.491   8.462   1.00 0.00 ? 38 LYS P C      2  
ATOM 3378  O O      . LYS C 3 38 ? -18.317 2.754   8.790   1.00 0.00 ? 38 LYS P O      2  
ATOM 3379  C CB     . LYS C 3 38 ? -17.954 5.989   8.278   1.00 0.00 ? 38 LYS P CB     2  
ATOM 3380  C CG     . LYS C 3 38 ? -18.307 7.198   9.201   1.00 0.00 ? 38 LYS P CG     2  
ATOM 3381  C CD     . LYS C 3 38 ? -18.885 8.403   8.478   1.00 0.00 ? 38 LYS P CD     2  
ATOM 3382  C CE     . LYS C 3 38 ? -18.011 8.859   7.307   1.00 0.00 ? 38 LYS P CE     2  
ATOM 3383  N NZ     . LYS C 3 38 ? -18.669 10.070  6.656   1.00 0.00 ? 38 LYS P NZ     2  
ATOM 3384  H H      . LYS C 3 38 ? -15.630 6.129   9.251   1.00 0.00 ? 38 LYS P H      2  
ATOM 3385  H HA     . LYS C 3 38 ? -17.992 4.811   10.071  1.00 0.00 ? 38 LYS P HA     2  
ATOM 3386  H HB2    . LYS C 3 38 ? -17.392 6.270   7.388   1.00 0.00 ? 38 LYS P HB2    2  
ATOM 3387  H HB3    . LYS C 3 38 ? -18.926 5.640   7.927   1.00 0.00 ? 38 LYS P HB3    2  
ATOM 3388  H HG2    . LYS C 3 38 ? -19.014 6.815   9.937   1.00 0.00 ? 38 LYS P HG2    2  
ATOM 3389  H HG3    . LYS C 3 38 ? -17.381 7.369   9.752   1.00 0.00 ? 38 LYS P HG3    2  
ATOM 3390  H HD2    . LYS C 3 38 ? -19.805 7.977   8.078   1.00 0.00 ? 38 LYS P HD2    2  
ATOM 3391  H HD3    . LYS C 3 38 ? -19.125 9.253   9.117   1.00 0.00 ? 38 LYS P HD3    2  
ATOM 3392  H HE2    . LYS C 3 38 ? -16.979 9.036   7.607   1.00 0.00 ? 38 LYS P HE2    2  
ATOM 3393  H HE3    . LYS C 3 38 ? -18.071 8.148   6.483   1.00 0.00 ? 38 LYS P HE3    2  
ATOM 3394  H HZ1    . LYS C 3 38 ? -18.681 10.750  7.403   1.00 0.00 ? 38 LYS P HZ1    2  
ATOM 3395  H HZ2    . LYS C 3 38 ? -19.643 9.919   6.433   1.00 0.00 ? 38 LYS P HZ2    2  
ATOM 3396  H HZ3    . LYS C 3 38 ? -18.057 10.474  5.962   1.00 0.00 ? 38 LYS P HZ3    2  
ATOM 3397  N N      . LEU C 3 39 ? -16.512 3.244   7.559   1.00 0.00 ? 39 LEU P N      2  
ATOM 3398  C CA     . LEU C 3 39 ? -16.334 1.875   6.971   1.00 0.00 ? 39 LEU P CA     2  
ATOM 3399  C C      . LEU C 3 39 ? -15.827 0.903   8.098   1.00 0.00 ? 39 LEU P C      2  
ATOM 3400  O O      . LEU C 3 39 ? -16.044 -0.270  7.854   1.00 0.00 ? 39 LEU P O      2  
ATOM 3401  C CB     . LEU C 3 39 ? -15.274 1.925   5.862   1.00 0.00 ? 39 LEU P CB     2  
ATOM 3402  C CG     . LEU C 3 39 ? -15.372 2.773   4.612   1.00 0.00 ? 39 LEU P CG     2  
ATOM 3403  C CD1    . LEU C 3 39 ? -16.163 4.101   4.752   1.00 0.00 ? 39 LEU P CD1    2  
ATOM 3404  C CD2    . LEU C 3 39 ? -13.911 3.200   4.393   1.00 0.00 ? 39 LEU P CD2    2  
ATOM 3405  H H      . LEU C 3 39 ? -15.816 3.932   7.309   1.00 0.00 ? 39 LEU P H      2  
ATOM 3406  H HA     . LEU C 3 39 ? -17.242 1.467   6.528   1.00 0.00 ? 39 LEU P HA     2  
ATOM 3407  H HB2    . LEU C 3 39 ? -14.430 2.157   6.513   1.00 0.00 ? 39 LEU P HB2    2  
ATOM 3408  H HB3    . LEU C 3 39 ? -15.112 0.916   5.486   1.00 0.00 ? 39 LEU P HB3    2  
ATOM 3409  H HG     . LEU C 3 39 ? -15.867 2.182   3.842   1.00 0.00 ? 39 LEU P HG     2  
ATOM 3410  H HD11   . LEU C 3 39 ? -16.220 4.518   3.745   1.00 0.00 ? 39 LEU P HD11   2  
ATOM 3411  H HD12   . LEU C 3 39 ? -15.600 4.818   5.351   1.00 0.00 ? 39 LEU P HD12   2  
ATOM 3412  H HD13   . LEU C 3 39 ? -17.208 4.013   5.047   1.00 0.00 ? 39 LEU P HD13   2  
ATOM 3413  H HD21   . LEU C 3 39 ? -13.258 2.329   4.329   1.00 0.00 ? 39 LEU P HD21   2  
ATOM 3414  H HD22   . LEU C 3 39 ? -13.641 3.936   5.150   1.00 0.00 ? 39 LEU P HD22   2  
ATOM 3415  H HD23   . LEU C 3 39 ? -13.745 3.798   3.498   1.00 0.00 ? 39 LEU P HD23   2  
ATOM 3416  N N      . ALA C 3 40 ? -15.282 1.343   9.235   1.00 0.00 ? 40 ALA P N      2  
ATOM 3417  C CA     . ALA C 3 40 ? -14.602 0.515   10.249  1.00 0.00 ? 40 ALA P CA     2  
ATOM 3418  C C      . ALA C 3 40 ? -13.431 -0.287  9.647   1.00 0.00 ? 40 ALA P C      2  
ATOM 3419  O O      . ALA C 3 40 ? -13.349 -1.503  9.709   1.00 0.00 ? 40 ALA P O      2  
ATOM 3420  C CB     . ALA C 3 40 ? -15.600 -0.440  11.016  1.00 0.00 ? 40 ALA P CB     2  
ATOM 3421  H H      . ALA C 3 40 ? -15.086 2.329   9.330   1.00 0.00 ? 40 ALA P H      2  
ATOM 3422  H HA     . ALA C 3 40 ? -14.127 1.213   10.938  1.00 0.00 ? 40 ALA P HA     2  
ATOM 3423  H HB1    . ALA C 3 40 ? -15.195 -0.889  11.923  1.00 0.00 ? 40 ALA P HB1    2  
ATOM 3424  H HB2    . ALA C 3 40 ? -16.505 0.123   11.242  1.00 0.00 ? 40 ALA P HB2    2  
ATOM 3425  H HB3    . ALA C 3 40 ? -15.802 -1.323  10.410  1.00 0.00 ? 40 ALA P HB3    2  
ATOM 3426  N N      . LEU C 3 41 ? -12.418 0.416   9.121   1.00 0.00 ? 41 LEU P N      2  
ATOM 3427  C CA     . LEU C 3 41 ? -11.104 -0.161  8.732   1.00 0.00 ? 41 LEU P CA     2  
ATOM 3428  C C      . LEU C 3 41 ? -9.864  0.724   8.844   1.00 0.00 ? 41 LEU P C      2  
ATOM 3429  O O      . LEU C 3 41 ? -9.956  1.923   9.141   1.00 0.00 ? 41 LEU P O      2  
ATOM 3430  C CB     . LEU C 3 41 ? -11.240 -0.913  7.375   1.00 0.00 ? 41 LEU P CB     2  
ATOM 3431  C CG     . LEU C 3 41 ? -11.689 -0.184  6.094   1.00 0.00 ? 41 LEU P CG     2  
ATOM 3432  C CD1    . LEU C 3 41 ? -11.032 1.090   5.914   1.00 0.00 ? 41 LEU P CD1    2  
ATOM 3433  C CD2    . LEU C 3 41 ? -11.460 -1.036  4.892   1.00 0.00 ? 41 LEU P CD2    2  
ATOM 3434  H H      . LEU C 3 41 ? -12.353 1.413   9.267   1.00 0.00 ? 41 LEU P H      2  
ATOM 3435  H HA     . LEU C 3 41 ? -10.801 -0.941  9.429   1.00 0.00 ? 41 LEU P HA     2  
ATOM 3436  H HB2    . LEU C 3 41 ? -10.245 -1.307  7.165   1.00 0.00 ? 41 LEU P HB2    2  
ATOM 3437  H HB3    . LEU C 3 41 ? -11.847 -1.817  7.435   1.00 0.00 ? 41 LEU P HB3    2  
ATOM 3438  H HG     . LEU C 3 41 ? -12.758 -0.040  6.244   1.00 0.00 ? 41 LEU P HG     2  
ATOM 3439  H HD11   . LEU C 3 41 ? -9.981  1.060   6.200   1.00 0.00 ? 41 LEU P HD11   2  
ATOM 3440  H HD12   . LEU C 3 41 ? -11.401 1.790   6.663   1.00 0.00 ? 41 LEU P HD12   2  
ATOM 3441  H HD13   . LEU C 3 41 ? -11.303 1.439   4.917   1.00 0.00 ? 41 LEU P HD13   2  
ATOM 3442  H HD21   . LEU C 3 41 ? -11.695 -0.428  4.019   1.00 0.00 ? 41 LEU P HD21   2  
ATOM 3443  H HD22   . LEU C 3 41 ? -12.116 -1.902  4.981   1.00 0.00 ? 41 LEU P HD22   2  
ATOM 3444  H HD23   . LEU C 3 41 ? -10.411 -1.327  4.835   1.00 0.00 ? 41 LEU P HD23   2  
ATOM 3445  N N      . GLY C 3 42 ? -8.630  0.217   8.803   1.00 0.00 ? 42 GLY P N      2  
ATOM 3446  C CA     . GLY C 3 42 ? -7.463  1.097   9.062   1.00 0.00 ? 42 GLY P CA     2  
ATOM 3447  C C      . GLY C 3 42 ? -7.371  2.248   7.977   1.00 0.00 ? 42 GLY P C      2  
ATOM 3448  O O      . GLY C 3 42 ? -7.839  2.196   6.836   1.00 0.00 ? 42 GLY P O      2  
ATOM 3449  H H      . GLY C 3 42 ? -8.494  -0.763  8.599   1.00 0.00 ? 42 GLY P H      2  
ATOM 3450  H HA2    . GLY C 3 42 ? -7.520  1.516   10.067  1.00 0.00 ? 42 GLY P HA2    2  
ATOM 3451  H HA3    . GLY C 3 42 ? -6.549  0.504   9.017   1.00 0.00 ? 42 GLY P HA3    2  
ATOM 3452  N N      . THR C 3 43 ? -6.843  3.422   8.400   1.00 0.00 ? 43 THR P N      2  
ATOM 3453  C CA     . THR C 3 43 ? -6.605  4.588   7.450   1.00 0.00 ? 43 THR P CA     2  
ATOM 3454  C C      . THR C 3 43 ? -5.805  4.224   6.239   1.00 0.00 ? 43 THR P C      2  
ATOM 3455  O O      . THR C 3 43 ? -6.180  4.653   5.162   1.00 0.00 ? 43 THR P O      2  
ATOM 3456  C CB     . THR C 3 43 ? -5.912  5.695   8.112   1.00 0.00 ? 43 THR P CB     2  
ATOM 3457  O OG1    . THR C 3 43 ? -4.858  5.218   8.928   1.00 0.00 ? 43 THR P OG1    2  
ATOM 3458  C CG2    . THR C 3 43 ? -6.788  6.705   8.869   1.00 0.00 ? 43 THR P CG2    2  
ATOM 3459  H H      . THR C 3 43 ? -6.566  3.561   9.360   1.00 0.00 ? 43 THR P H      2  
ATOM 3460  H HA     . THR C 3 43 ? -7.540  5.047   7.129   1.00 0.00 ? 43 THR P HA     2  
ATOM 3461  H HB     . THR C 3 43 ? -5.407  6.327   7.381   1.00 0.00 ? 43 THR P HB     2  
ATOM 3462  H HG1    . THR C 3 43 ? -5.287  4.613   9.536   1.00 0.00 ? 43 THR P HG1    2  
ATOM 3463  H HG21   . THR C 3 43 ? -7.232  7.266   8.046   1.00 0.00 ? 43 THR P HG21   2  
ATOM 3464  H HG22   . THR C 3 43 ? -6.264  7.391   9.535   1.00 0.00 ? 43 THR P HG22   2  
ATOM 3465  H HG23   . THR C 3 43 ? -7.604  6.131   9.309   1.00 0.00 ? 43 THR P HG23   2  
ATOM 3466  N N      . ALA C 3 44 ? -4.863  3.305   6.337   1.00 0.00 ? 44 ALA P N      2  
ATOM 3467  C CA     . ALA C 3 44 ? -4.011  3.008   5.160   1.00 0.00 ? 44 ALA P CA     2  
ATOM 3468  C C      . ALA C 3 44 ? -4.817  2.302   4.083   1.00 0.00 ? 44 ALA P C      2  
ATOM 3469  O O      . ALA C 3 44 ? -4.596  2.494   2.896   1.00 0.00 ? 44 ALA P O      2  
ATOM 3470  C CB     . ALA C 3 44 ? -2.907  2.146   5.632   1.00 0.00 ? 44 ALA P CB     2  
ATOM 3471  H H      . ALA C 3 44 ? -4.602  2.857   7.203   1.00 0.00 ? 44 ALA P H      2  
ATOM 3472  H HA     . ALA C 3 44 ? -3.607  3.917   4.715   1.00 0.00 ? 44 ALA P HA     2  
ATOM 3473  H HB1    . ALA C 3 44 ? -2.125  2.087   4.875   1.00 0.00 ? 44 ALA P HB1    2  
ATOM 3474  H HB2    . ALA C 3 44 ? -2.528  2.623   6.536   1.00 0.00 ? 44 ALA P HB2    2  
ATOM 3475  H HB3    . ALA C 3 44 ? -3.241  1.155   5.940   1.00 0.00 ? 44 ALA P HB3    2  
ATOM 3476  N N      . GLN C 3 45 ? -5.759  1.412   4.430   1.00 0.00 ? 45 GLN P N      2  
ATOM 3477  C CA     . GLN C 3 45 ? -6.659  0.807   3.466   1.00 0.00 ? 45 GLN P CA     2  
ATOM 3478  C C      . GLN C 3 45 ? -7.470  1.840   2.631   1.00 0.00 ? 45 GLN P C      2  
ATOM 3479  O O      . GLN C 3 45 ? -7.768  1.653   1.443   1.00 0.00 ? 45 GLN P O      2  
ATOM 3480  C CB     . GLN C 3 45 ? -7.667  -0.091  4.222   1.00 0.00 ? 45 GLN P CB     2  
ATOM 3481  C CG     . GLN C 3 45 ? -7.283  -1.524  4.548   1.00 0.00 ? 45 GLN P CG     2  
ATOM 3482  C CD     . GLN C 3 45 ? -6.153  -1.585  5.580   1.00 0.00 ? 45 GLN P CD     2  
ATOM 3483  O OE1    . GLN C 3 45 ? -5.238  -2.390  5.464   1.00 0.00 ? 45 GLN P OE1    2  
ATOM 3484  N NE2    . GLN C 3 45 ? -6.192  -0.786  6.644   1.00 0.00 ? 45 GLN P NE2    2  
ATOM 3485  H H      . GLN C 3 45 ? -5.895  1.202   5.408   1.00 0.00 ? 45 GLN P H      2  
ATOM 3486  H HA     . GLN C 3 45 ? -6.071  0.286   2.710   1.00 0.00 ? 45 GLN P HA     2  
ATOM 3487  H HB2    . GLN C 3 45 ? -7.989  0.472   5.098   1.00 0.00 ? 45 GLN P HB2    2  
ATOM 3488  H HB3    . GLN C 3 45 ? -8.612  -0.147  3.680   1.00 0.00 ? 45 GLN P HB3    2  
ATOM 3489  H HG2    . GLN C 3 45 ? -8.166  -1.957  5.017   1.00 0.00 ? 45 GLN P HG2    2  
ATOM 3490  H HG3    . GLN C 3 45 ? -7.054  -2.159  3.693   1.00 0.00 ? 45 GLN P HG3    2  
ATOM 3491  H HE21   . GLN C 3 45 ? -7.028  -0.244  6.805   1.00 0.00 ? 45 GLN P HE21   2  
ATOM 3492  H HE22   . GLN C 3 45 ? -5.389  -0.866  7.253   1.00 0.00 ? 45 GLN P HE22   2  
ATOM 3493  N N      . VAL C 3 46 ? -7.761  3.001   3.269   1.00 0.00 ? 46 VAL P N      2  
ATOM 3494  C CA     . VAL C 3 46 ? -8.565  4.037   2.607   1.00 0.00 ? 46 VAL P CA     2  
ATOM 3495  C C      . VAL C 3 46 ? -7.733  4.686   1.507   1.00 0.00 ? 46 VAL P C      2  
ATOM 3496  O O      . VAL C 3 46 ? -8.229  4.761   0.393   1.00 0.00 ? 46 VAL P O      2  
ATOM 3497  C CB     . VAL C 3 46 ? -9.225  5.028   3.604   1.00 0.00 ? 46 VAL P CB     2  
ATOM 3498  C CG1    . VAL C 3 46 ? -10.253 5.875   2.838   1.00 0.00 ? 46 VAL P CG1    2  
ATOM 3499  C CG2    . VAL C 3 46 ? -10.125 4.345   4.672   1.00 0.00 ? 46 VAL P CG2    2  
ATOM 3500  H H      . VAL C 3 46 ? -7.364  3.117   4.190   1.00 0.00 ? 46 VAL P H      2  
ATOM 3501  H HA     . VAL C 3 46 ? -9.396  3.532   2.116   1.00 0.00 ? 46 VAL P HA     2  
ATOM 3502  H HB     . VAL C 3 46 ? -8.472  5.724   3.973   1.00 0.00 ? 46 VAL P HB     2  
ATOM 3503  H HG11   . VAL C 3 46 ? -10.629 6.640   3.519   1.00 0.00 ? 46 VAL P HG11   2  
ATOM 3504  H HG12   . VAL C 3 46 ? -9.813  6.294   1.934   1.00 0.00 ? 46 VAL P HG12   2  
ATOM 3505  H HG13   . VAL C 3 46 ? -11.151 5.271   2.706   1.00 0.00 ? 46 VAL P HG13   2  
ATOM 3506  H HG21   . VAL C 3 46 ? -10.722 3.567   4.197   1.00 0.00 ? 46 VAL P HG21   2  
ATOM 3507  H HG22   . VAL C 3 46 ? -9.402  3.968   5.396   1.00 0.00 ? 46 VAL P HG22   2  
ATOM 3508  H HG23   . VAL C 3 46 ? -10.856 5.068   5.035   1.00 0.00 ? 46 VAL P HG23   2  
ATOM 3509  N N      . LYS C 3 47 ? -6.462  5.034   1.790   1.00 0.00 ? 47 LYS P N      2  
ATOM 3510  C CA     . LYS C 3 47 ? -5.419  5.440   0.857   1.00 0.00 ? 47 LYS P CA     2  
ATOM 3511  C C      . LYS C 3 47 ? -5.278  4.429   -0.267  1.00 0.00 ? 47 LYS P C      2  
ATOM 3512  O O      . LYS C 3 47 ? -5.516  4.893   -1.373  1.00 0.00 ? 47 LYS P O      2  
ATOM 3513  C CB     . LYS C 3 47 ? -4.097  5.504   1.681   1.00 0.00 ? 47 LYS P CB     2  
ATOM 3514  C CG     . LYS C 3 47 ? -3.389  6.865   1.801   1.00 0.00 ? 47 LYS P CG     2  
ATOM 3515  C CD     . LYS C 3 47 ? -2.592  7.012   3.113   1.00 0.00 ? 47 LYS P CD     2  
ATOM 3516  C CE     . LYS C 3 47 ? -2.291  8.461   3.160   1.00 0.00 ? 47 LYS P CE     2  
ATOM 3517  N NZ     . LYS C 3 47 ? -1.586  8.980   4.370   1.00 0.00 ? 47 LYS P NZ     2  
ATOM 3518  H H      . LYS C 3 47 ? -6.127  4.964   2.741   1.00 0.00 ? 47 LYS P H      2  
ATOM 3519  H HA     . LYS C 3 47 ? -5.626  6.413   0.414   1.00 0.00 ? 47 LYS P HA     2  
ATOM 3520  H HB2    . LYS C 3 47 ? -4.224  5.133   2.699   1.00 0.00 ? 47 LYS P HB2    2  
ATOM 3521  H HB3    . LYS C 3 47 ? -3.309  4.833   1.338   1.00 0.00 ? 47 LYS P HB3    2  
ATOM 3522  H HG2    . LYS C 3 47 ? -2.701  7.089   0.985   1.00 0.00 ? 47 LYS P HG2    2  
ATOM 3523  H HG3    . LYS C 3 47 ? -4.178  7.612   1.710   1.00 0.00 ? 47 LYS P HG3    2  
ATOM 3524  H HD2    . LYS C 3 47 ? -3.259  6.796   3.947   1.00 0.00 ? 47 LYS P HD2    2  
ATOM 3525  H HD3    . LYS C 3 47 ? -1.673  6.425   3.134   1.00 0.00 ? 47 LYS P HD3    2  
ATOM 3526  H HE2    . LYS C 3 47 ? -1.684  8.718   2.293   1.00 0.00 ? 47 LYS P HE2    2  
ATOM 3527  H HE3    . LYS C 3 47 ? -3.256  8.967   3.124   1.00 0.00 ? 47 LYS P HE3    2  
ATOM 3528  H HZ1    . LYS C 3 47 ? -1.965  9.876   4.641   1.00 0.00 ? 47 LYS P HZ1    2  
ATOM 3529  H HZ2    . LYS C 3 47 ? -0.588  9.035   4.229   1.00 0.00 ? 47 LYS P HZ2    2  
ATOM 3530  H HZ3    . LYS C 3 47 ? -1.608  8.253   5.071   1.00 0.00 ? 47 LYS P HZ3    2  
ATOM 3531  N N      . ILE C 3 48 ? -4.996  3.196   0.115   1.00 0.00 ? 48 ILE P N      2  
ATOM 3532  C CA     . ILE C 3 48 ? -4.671  2.205   -0.936  1.00 0.00 ? 48 ILE P CA     2  
ATOM 3533  C C      . ILE C 3 48 ? -5.870  1.956   -1.848  1.00 0.00 ? 48 ILE P C      2  
ATOM 3534  O O      . ILE C 3 48 ? -5.643  1.926   -3.034  1.00 0.00 ? 48 ILE P O      2  
ATOM 3535  C CB     . ILE C 3 48 ? -4.103  0.869   -0.359  1.00 0.00 ? 48 ILE P CB     2  
ATOM 3536  C CG1    . ILE C 3 48 ? -2.740  1.107   0.126   1.00 0.00 ? 48 ILE P CG1    2  
ATOM 3537  C CG2    . ILE C 3 48 ? -4.037  -0.230  -1.419  1.00 0.00 ? 48 ILE P CG2    2  
ATOM 3538  C CD1    . ILE C 3 48 ? -1.658  1.832   -0.783  1.00 0.00 ? 48 ILE P CD1    2  
ATOM 3539  H H      . ILE C 3 48 ? -4.538  3.079   1.008   1.00 0.00 ? 48 ILE P H      2  
ATOM 3540  H HA     . ILE C 3 48 ? -3.948  2.594   -1.653  1.00 0.00 ? 48 ILE P HA     2  
ATOM 3541  H HB     . ILE C 3 48 ? -4.743  0.601   0.482   1.00 0.00 ? 48 ILE P HB     2  
ATOM 3542  H HG12   . ILE C 3 48 ? -2.909  1.835   0.920   1.00 0.00 ? 48 ILE P HG12   2  
ATOM 3543  H HG13   . ILE C 3 48 ? -2.279  0.194   0.504   1.00 0.00 ? 48 ILE P HG13   2  
ATOM 3544  H HG21   . ILE C 3 48 ? -3.461  0.148   -2.264  1.00 0.00 ? 48 ILE P HG21   2  
ATOM 3545  H HG22   . ILE C 3 48 ? -3.477  -1.124  -1.143  1.00 0.00 ? 48 ILE P HG22   2  
ATOM 3546  H HG23   . ILE C 3 48 ? -4.946  -0.559  -1.922  1.00 0.00 ? 48 ILE P HG23   2  
ATOM 3547  H HD11   . ILE C 3 48 ? -1.713  1.442   -1.800  1.00 0.00 ? 48 ILE P HD11   2  
ATOM 3548  H HD12   . ILE C 3 48 ? -1.782  2.909   -0.903  1.00 0.00 ? 48 ILE P HD12   2  
ATOM 3549  H HD13   . ILE C 3 48 ? -0.704  1.715   -0.271  1.00 0.00 ? 48 ILE P HD13   2  
ATOM 3550  N N      . TRP C 3 49 ? -7.078  2.021   -1.378  1.00 0.00 ? 49 TRP P N      2  
ATOM 3551  C CA     . TRP C 3 49 ? -8.293  1.985   -2.215  1.00 0.00 ? 49 TRP P CA     2  
ATOM 3552  C C      . TRP C 3 49 ? -8.439  3.082   -3.239  1.00 0.00 ? 49 TRP P C      2  
ATOM 3553  O O      . TRP C 3 49 ? -8.215  2.797   -4.411  1.00 0.00 ? 49 TRP P O      2  
ATOM 3554  C CB     . TRP C 3 49 ? -9.595  2.031   -1.331  1.00 0.00 ? 49 TRP P CB     2  
ATOM 3555  C CG     . TRP C 3 49 ? -10.811 1.886   -2.205  1.00 0.00 ? 49 TRP P CG     2  
ATOM 3556  C CD1    . TRP C 3 49 ? -11.094 0.775   -2.940  1.00 0.00 ? 49 TRP P CD1    2  
ATOM 3557  C CD2    . TRP C 3 49 ? -11.792 2.831   -2.672  1.00 0.00 ? 49 TRP P CD2    2  
ATOM 3558  N NE1    . TRP C 3 49 ? -12.253 0.927   -3.638  1.00 0.00 ? 49 TRP P NE1    2  
ATOM 3559  C CE2    . TRP C 3 49 ? -12.707 2.208   -3.600  1.00 0.00 ? 49 TRP P CE2    2  
ATOM 3560  C CE3    . TRP C 3 49 ? -11.879 4.183   -2.398  1.00 0.00 ? 49 TRP P CE3    2  
ATOM 3561  C CZ2    . TRP C 3 49 ? -13.743 2.959   -4.299  1.00 0.00 ? 49 TRP P CZ2    2  
ATOM 3562  C CZ3    . TRP C 3 49 ? -12.972 4.927   -2.920  1.00 0.00 ? 49 TRP P CZ3    2  
ATOM 3563  C CH2    . TRP C 3 49 ? -13.849 4.338   -3.897  1.00 0.00 ? 49 TRP P CH2    2  
ATOM 3564  H H      . TRP C 3 49 ? -7.156  1.954   -0.374  1.00 0.00 ? 49 TRP P H      2  
ATOM 3565  H HA     . TRP C 3 49 ? -8.358  1.060   -2.787  1.00 0.00 ? 49 TRP P HA     2  
ATOM 3566  H HB2    . TRP C 3 49 ? -9.659  1.139   -0.709  1.00 0.00 ? 49 TRP P HB2    2  
ATOM 3567  H HB3    . TRP C 3 49 ? -9.574  2.894   -0.665  1.00 0.00 ? 49 TRP P HB3    2  
ATOM 3568  H HD1    . TRP C 3 49 ? -10.402 -0.050  -3.032  1.00 0.00 ? 49 TRP P HD1    2  
ATOM 3569  H HE1    . TRP C 3 49 ? -12.483 0.252   -4.353  1.00 0.00 ? 49 TRP P HE1    2  
ATOM 3570  H HE3    . TRP C 3 49 ? -11.170 4.461   -1.632  1.00 0.00 ? 49 TRP P HE3    2  
ATOM 3571  H HZ2    . TRP C 3 49 ? -14.385 2.495   -5.033  1.00 0.00 ? 49 TRP P HZ2    2  
ATOM 3572  H HZ3    . TRP C 3 49 ? -13.111 5.936   -2.562  1.00 0.00 ? 49 TRP P HZ3    2  
ATOM 3573  H HH2    . TRP C 3 49 ? -14.577 4.988   -4.359  1.00 0.00 ? 49 TRP P HH2    2  
ATOM 3574  N N      . PHE C 3 50 ? -8.622  4.349   -2.796  1.00 0.00 ? 50 PHE P N      2  
ATOM 3575  C CA     . PHE C 3 50 ? -8.621  5.481   -3.723  1.00 0.00 ? 50 PHE P CA     2  
ATOM 3576  C C      . PHE C 3 50 ? -7.381  5.556   -4.631  1.00 0.00 ? 50 PHE P C      2  
ATOM 3577  O O      . PHE C 3 50 ? -7.491  5.908   -5.835  1.00 0.00 ? 50 PHE P O      2  
ATOM 3578  C CB     . PHE C 3 50 ? -8.591  6.842   -2.967  1.00 0.00 ? 50 PHE P CB     2  
ATOM 3579  C CG     . PHE C 3 50 ? -9.851  7.348   -2.247  1.00 0.00 ? 50 PHE P CG     2  
ATOM 3580  C CD1    . PHE C 3 50 ? -10.380 8.614   -2.522  1.00 0.00 ? 50 PHE P CD1    2  
ATOM 3581  C CD2    . PHE C 3 50 ? -10.290 6.698   -1.061  1.00 0.00 ? 50 PHE P CD2    2  
ATOM 3582  C CE1    . PHE C 3 50 ? -11.368 9.177   -1.714  1.00 0.00 ? 50 PHE P CE1    2  
ATOM 3583  C CE2    . PHE C 3 50 ? -11.432 7.162   -0.330  1.00 0.00 ? 50 PHE P CE2    2  
ATOM 3584  C CZ     . PHE C 3 50 ? -11.864 8.442   -0.633  1.00 0.00 ? 50 PHE P CZ     2  
ATOM 3585  H H      . PHE C 3 50 ? -8.694  4.461   -1.795  1.00 0.00 ? 50 PHE P H      2  
ATOM 3586  H HA     . PHE C 3 50 ? -9.519  5.331   -4.322  1.00 0.00 ? 50 PHE P HA     2  
ATOM 3587  H HB2    . PHE C 3 50 ? -7.763  6.793   -2.259  1.00 0.00 ? 50 PHE P HB2    2  
ATOM 3588  H HB3    . PHE C 3 50 ? -8.333  7.622   -3.682  1.00 0.00 ? 50 PHE P HB3    2  
ATOM 3589  H HD1    . PHE C 3 50 ? -9.962  9.266   -3.275  1.00 0.00 ? 50 PHE P HD1    2  
ATOM 3590  H HD2    . PHE C 3 50 ? -9.989  5.677   -0.875  1.00 0.00 ? 50 PHE P HD2    2  
ATOM 3591  H HE1    . PHE C 3 50 ? -11.685 10.194  -1.891  1.00 0.00 ? 50 PHE P HE1    2  
ATOM 3592  H HE2    . PHE C 3 50 ? -11.818 6.513   0.442   1.00 0.00 ? 50 PHE P HE2    2  
ATOM 3593  H HZ     . PHE C 3 50 ? -12.706 8.858   -0.101  1.00 0.00 ? 50 PHE P HZ     2  
ATOM 3594  N N      . LYS C 3 51 ? -6.195  5.302   -4.067  1.00 0.00 ? 51 LYS P N      2  
ATOM 3595  C CA     . LYS C 3 51 ? -4.866  5.300   -4.728  1.00 0.00 ? 51 LYS P CA     2  
ATOM 3596  C C      . LYS C 3 51 ? -4.915  4.246   -5.891  1.00 0.00 ? 51 LYS P C      2  
ATOM 3597  O O      . LYS C 3 51 ? -4.788  4.644   -7.063  1.00 0.00 ? 51 LYS P O      2  
ATOM 3598  C CB     . LYS C 3 51 ? -3.663  5.202   -3.836  1.00 0.00 ? 51 LYS P CB     2  
ATOM 3599  C CG     . LYS C 3 51 ? -2.481  6.013   -4.463  1.00 0.00 ? 51 LYS P CG     2  
ATOM 3600  C CD     . LYS C 3 51 ? -1.271  6.119   -3.481  1.00 0.00 ? 51 LYS P CD     2  
ATOM 3601  C CE     . LYS C 3 51 ? -0.759  4.718   -3.111  1.00 0.00 ? 51 LYS P CE     2  
ATOM 3602  N NZ     . LYS C 3 51 ? 0.462   4.756   -2.446  1.00 0.00 ? 51 LYS P NZ     2  
ATOM 3603  H H      . LYS C 3 51 ? -6.164  5.062   -3.087  1.00 0.00 ? 51 LYS P H      2  
ATOM 3604  H HA     . LYS C 3 51 ? -4.748  6.221   -5.299  1.00 0.00 ? 51 LYS P HA     2  
ATOM 3605  H HB2    . LYS C 3 51 ? -3.888  5.786   -2.944  1.00 0.00 ? 51 LYS P HB2    2  
ATOM 3606  H HB3    . LYS C 3 51 ? -3.342  4.192   -3.581  1.00 0.00 ? 51 LYS P HB3    2  
ATOM 3607  H HG2    . LYS C 3 51 ? -2.245  5.449   -5.365  1.00 0.00 ? 51 LYS P HG2    2  
ATOM 3608  H HG3    . LYS C 3 51 ? -2.790  7.025   -4.724  1.00 0.00 ? 51 LYS P HG3    2  
ATOM 3609  H HD2    . LYS C 3 51 ? -0.384  6.686   -3.764  1.00 0.00 ? 51 LYS P HD2    2  
ATOM 3610  H HD3    . LYS C 3 51 ? -1.582  6.586   -2.546  1.00 0.00 ? 51 LYS P HD3    2  
ATOM 3611  H HE2    . LYS C 3 51 ? -1.591  4.283   -2.558  1.00 0.00 ? 51 LYS P HE2    2  
ATOM 3612  H HE3    . LYS C 3 51 ? -0.593  4.067   -3.971  1.00 0.00 ? 51 LYS P HE3    2  
ATOM 3613  H HZ1    . LYS C 3 51 ? 1.301   4.786   -3.007  1.00 0.00 ? 51 LYS P HZ1    2  
ATOM 3614  H HZ2    . LYS C 3 51 ? 0.614   3.935   -1.876  1.00 0.00 ? 51 LYS P HZ2    2  
ATOM 3615  H HZ3    . LYS C 3 51 ? 0.585   5.530   -1.809  1.00 0.00 ? 51 LYS P HZ3    2  
ATOM 3616  N N      . ASN C 3 52 ? -5.193  2.959   -5.613  1.00 0.00 ? 52 ASN P N      2  
ATOM 3617  C CA     . ASN C 3 52 ? -5.352  1.949   -6.658  1.00 0.00 ? 52 ASN P CA     2  
ATOM 3618  C C      . ASN C 3 52 ? -6.488  2.297   -7.664  1.00 0.00 ? 52 ASN P C      2  
ATOM 3619  O O      . ASN C 3 52 ? -6.267  2.240   -8.882  1.00 0.00 ? 52 ASN P O      2  
ATOM 3620  C CB     . ASN C 3 52 ? -5.434  0.566   -5.982  1.00 0.00 ? 52 ASN P CB     2  
ATOM 3621  C CG     . ASN C 3 52 ? -6.779  -0.007  -5.616  1.00 0.00 ? 52 ASN P CG     2  
ATOM 3622  O OD1    . ASN C 3 52 ? -7.654  -0.011  -6.460  1.00 0.00 ? 52 ASN P OD1    2  
ATOM 3623  N ND2    . ASN C 3 52 ? -6.969  -0.539  -4.399  1.00 0.00 ? 52 ASN P ND2    2  
ATOM 3624  H H      . ASN C 3 52 ? -5.289  2.623   -4.665  1.00 0.00 ? 52 ASN P H      2  
ATOM 3625  H HA     . ASN C 3 52 ? -4.397  2.028   -7.178  1.00 0.00 ? 52 ASN P HA     2  
ATOM 3626  H HB2    . ASN C 3 52 ? -4.938  -0.156  -6.632  1.00 0.00 ? 52 ASN P HB2    2  
ATOM 3627  H HB3    . ASN C 3 52 ? -4.776  0.470   -5.119  1.00 0.00 ? 52 ASN P HB3    2  
ATOM 3628  H HD21   . ASN C 3 52 ? -6.131  -0.769  -3.885  1.00 0.00 ? 52 ASN P HD21   2  
ATOM 3629  H HD22   . ASN C 3 52 ? -7.838  -1.027  -4.231  1.00 0.00 ? 52 ASN P HD22   2  
ATOM 3630  N N      . ARG C 3 53 ? -7.616  2.830   -7.198  1.00 0.00 ? 53 ARG P N      2  
ATOM 3631  C CA     . ARG C 3 53 ? -8.798  3.079   -8.050  1.00 0.00 ? 53 ARG P CA     2  
ATOM 3632  C C      . ARG C 3 53 ? -8.546  4.164   -9.141  1.00 0.00 ? 53 ARG P C      2  
ATOM 3633  O O      . ARG C 3 53 ? -8.913  3.936   -10.298 1.00 0.00 ? 53 ARG P O      2  
ATOM 3634  C CB     . ARG C 3 53 ? -10.076 3.216   -7.231  1.00 0.00 ? 53 ARG P CB     2  
ATOM 3635  C CG     . ARG C 3 53 ? -10.668 4.679   -7.072  1.00 0.00 ? 53 ARG P CG     2  
ATOM 3636  C CD     . ARG C 3 53 ? -11.443 5.190   -8.255  1.00 0.00 ? 53 ARG P CD     2  
ATOM 3637  N NE     . ARG C 3 53 ? -12.510 4.371   -8.631  1.00 0.00 ? 53 ARG P NE     2  
ATOM 3638  C CZ     . ARG C 3 53 ? -13.727 4.449   -8.106  1.00 0.00 ? 53 ARG P CZ     2  
ATOM 3639  N NH1    . ARG C 3 53 ? -14.143 5.275   -7.137  1.00 0.00 ? 53 ARG P NH1    2  
ATOM 3640  N NH2    . ARG C 3 53 ? -14.576 3.561   -8.533  1.00 0.00 ? 53 ARG P NH2    2  
ATOM 3641  H H      . ARG C 3 53 ? -7.569  2.987   -6.201  1.00 0.00 ? 53 ARG P H      2  
ATOM 3642  H HA     . ARG C 3 53 ? -9.073  2.211   -8.649  1.00 0.00 ? 53 ARG P HA     2  
ATOM 3643  H HB2    . ARG C 3 53 ? -10.847 2.692   -7.793  1.00 0.00 ? 53 ARG P HB2    2  
ATOM 3644  H HB3    . ARG C 3 53 ? -9.992  2.798   -6.228  1.00 0.00 ? 53 ARG P HB3    2  
ATOM 3645  H HG2    . ARG C 3 53 ? -11.397 4.662   -6.263  1.00 0.00 ? 53 ARG P HG2    2  
ATOM 3646  H HG3    . ARG C 3 53 ? -9.997  5.448   -6.689  1.00 0.00 ? 53 ARG P HG3    2  
ATOM 3647  H HD2    . ARG C 3 53 ? -11.752 6.233   -8.186  1.00 0.00 ? 53 ARG P HD2    2  
ATOM 3648  H HD3    . ARG C 3 53 ? -10.765 5.176   -9.109  1.00 0.00 ? 53 ARG P HD3    2  
ATOM 3649  H HE     . ARG C 3 53 ? -12.302 3.640   -9.296  1.00 0.00 ? 53 ARG P HE     2  
ATOM 3650  H HH11   . ARG C 3 53 ? -13.547 5.992   -6.746  1.00 0.00 ? 53 ARG P HH11   2  
ATOM 3651  H HH12   . ARG C 3 53 ? -15.080 5.077   -6.818  1.00 0.00 ? 53 ARG P HH12   2  
ATOM 3652  H HH21   . ARG C 3 53 ? -14.277 2.767   -9.081  1.00 0.00 ? 53 ARG P HH21   2  
ATOM 3653  H HH22   . ARG C 3 53 ? -15.467 3.504   -8.063  1.00 0.00 ? 53 ARG P HH22   2  
ATOM 3654  N N      . ARG C 3 54 ? -7.907  5.243   -8.690  1.00 0.00 ? 54 ARG P N      2  
ATOM 3655  C CA     . ARG C 3 54 ? -7.600  6.260   -9.712  1.00 0.00 ? 54 ARG P CA     2  
ATOM 3656  C C      . ARG C 3 54 ? -6.532  5.723   -10.737 1.00 0.00 ? 54 ARG P C      2  
ATOM 3657  O O      . ARG C 3 54 ? -6.815  5.858   -11.954 1.00 0.00 ? 54 ARG P O      2  
ATOM 3658  C CB     . ARG C 3 54 ? -7.483  7.656   -9.100  1.00 0.00 ? 54 ARG P CB     2  
ATOM 3659  C CG     . ARG C 3 54 ? -6.109  8.239   -9.045  1.00 0.00 ? 54 ARG P CG     2  
ATOM 3660  C CD     . ARG C 3 54 ? -5.175  7.595   -8.015  1.00 0.00 ? 54 ARG P CD     2  
ATOM 3661  N NE     . ARG C 3 54 ? -4.535  8.603   -7.119  1.00 0.00 ? 54 ARG P NE     2  
ATOM 3662  C CZ     . ARG C 3 54 ? -4.866  8.977   -5.907  1.00 0.00 ? 54 ARG P CZ     2  
ATOM 3663  N NH1    . ARG C 3 54 ? -5.982  8.613   -5.425  1.00 0.00 ? 54 ARG P NH1    2  
ATOM 3664  N NH2    . ARG C 3 54 ? -4.068  9.732   -5.252  1.00 0.00 ? 54 ARG P NH2    2  
ATOM 3665  H H      . ARG C 3 54 ? -7.607  5.383   -7.736  1.00 0.00 ? 54 ARG P H      2  
ATOM 3666  H HA     . ARG C 3 54 ? -8.479  6.387   -10.344 1.00 0.00 ? 54 ARG P HA     2  
ATOM 3667  H HB2    . ARG C 3 54 ? -8.095  8.406   -9.599  1.00 0.00 ? 54 ARG P HB2    2  
ATOM 3668  H HB3    . ARG C 3 54 ? -7.895  7.645   -8.091  1.00 0.00 ? 54 ARG P HB3    2  
ATOM 3669  H HG2    . ARG C 3 54 ? -5.823  8.166   -10.095 1.00 0.00 ? 54 ARG P HG2    2  
ATOM 3670  H HG3    . ARG C 3 54 ? -6.220  9.277   -8.728  1.00 0.00 ? 54 ARG P HG3    2  
ATOM 3671  H HD2    . ARG C 3 54 ? -5.864  7.003   -7.414  1.00 0.00 ? 54 ARG P HD2    2  
ATOM 3672  H HD3    . ARG C 3 54 ? -4.492  6.946   -8.565  1.00 0.00 ? 54 ARG P HD3    2  
ATOM 3673  H HE     . ARG C 3 54 ? -3.609  8.886   -7.405  1.00 0.00 ? 54 ARG P HE     2  
ATOM 3674  H HH11   . ARG C 3 54 ? -6.676  8.267   -6.072  1.00 0.00 ? 54 ARG P HH11   2  
ATOM 3675  H HH12   . ARG C 3 54 ? -6.291  8.849   -4.493  1.00 0.00 ? 54 ARG P HH12   2  
ATOM 3676  H HH21   . ARG C 3 54 ? -3.397  10.308  -5.739  1.00 0.00 ? 54 ARG P HH21   2  
ATOM 3677  H HH22   . ARG C 3 54 ? -4.154  10.046  -4.297  1.00 0.00 ? 54 ARG P HH22   2  
ATOM 3678  N N      . ARG C 3 55 ? -5.480  5.087   -10.199 1.00 0.00 ? 55 ARG P N      2  
ATOM 3679  C CA     . ARG C 3 55 ? -4.287  4.648   -11.001 1.00 0.00 ? 55 ARG P CA     2  
ATOM 3680  C C      . ARG C 3 55 ? -4.984  3.795   -12.098 1.00 0.00 ? 55 ARG P C      2  
ATOM 3681  O O      . ARG C 3 55 ? -4.780  4.020   -13.272 1.00 0.00 ? 55 ARG P O      2  
ATOM 3682  C CB     . ARG C 3 55 ? -3.311  3.815   -10.078 1.00 0.00 ? 55 ARG P CB     2  
ATOM 3683  C CG     . ARG C 3 55 ? -2.431  4.789   -9.280  1.00 0.00 ? 55 ARG P CG     2  
ATOM 3684  C CD     . ARG C 3 55 ? -1.138  5.422   -9.881  1.00 0.00 ? 55 ARG P CD     2  
ATOM 3685  N NE     . ARG C 3 55 ? -0.368  4.677   -10.841 1.00 0.00 ? 55 ARG P NE     2  
ATOM 3686  C CZ     . ARG C 3 55 ? 0.307   3.539   -10.719 1.00 0.00 ? 55 ARG P CZ     2  
ATOM 3687  N NH1    . ARG C 3 55 ? 0.367   2.889   -9.598  1.00 0.00 ? 55 ARG P NH1    2  
ATOM 3688  N NH2    . ARG C 3 55 ? 1.085   3.158   -11.667 1.00 0.00 ? 55 ARG P NH2    2  
ATOM 3689  H H      . ARG C 3 55 ? -5.466  4.914   -9.203  1.00 0.00 ? 55 ARG P H      2  
ATOM 3690  H HA     . ARG C 3 55 ? -3.758  5.497   -11.431 1.00 0.00 ? 55 ARG P HA     2  
ATOM 3691  H HB2    . ARG C 3 55 ? -3.970  3.230   -9.437  1.00 0.00 ? 55 ARG P HB2    2  
ATOM 3692  H HB3    . ARG C 3 55 ? -2.640  3.114   -10.573 1.00 0.00 ? 55 ARG P HB3    2  
ATOM 3693  H HG2    . ARG C 3 55 ? -2.978  5.604   -8.807  1.00 0.00 ? 55 ARG P HG2    2  
ATOM 3694  H HG3    . ARG C 3 55 ? -2.074  4.206   -8.430  1.00 0.00 ? 55 ARG P HG3    2  
ATOM 3695  H HD2    . ARG C 3 55 ? -1.401  6.385   -10.318 1.00 0.00 ? 55 ARG P HD2    2  
ATOM 3696  H HD3    . ARG C 3 55 ? -0.370  5.578   -9.123  1.00 0.00 ? 55 ARG P HD3    2  
ATOM 3697  H HE     . ARG C 3 55 ? -0.355  5.085   -11.765 1.00 0.00 ? 55 ARG P HE     2  
ATOM 3698  H HH11   . ARG C 3 55 ? -0.167  3.096   -8.766  1.00 0.00 ? 55 ARG P HH11   2  
ATOM 3699  H HH12   . ARG C 3 55 ? 0.937   2.067   -9.458  1.00 0.00 ? 55 ARG P HH12   2  
ATOM 3700  H HH21   . ARG C 3 55 ? 1.450   3.865   -12.290 1.00 0.00 ? 55 ARG P HH21   2  
ATOM 3701  H HH22   . ARG C 3 55 ? 1.606   2.308   -11.504 1.00 0.00 ? 55 ARG P HH22   2  
ATOM 3702  N N      . ARG C 3 56 ? -5.844  2.827   -11.703 1.00 0.00 ? 56 ARG P N      2  
ATOM 3703  C CA     . ARG C 3 56 ? -6.386  1.816   -12.609 1.00 0.00 ? 56 ARG P CA     2  
ATOM 3704  C C      . ARG C 3 56 ? -7.297  2.455   -13.685 1.00 0.00 ? 56 ARG P C      2  
ATOM 3705  O O      . ARG C 3 56 ? -7.332  2.060   -14.817 1.00 0.00 ? 56 ARG P O      2  
ATOM 3706  C CB     . ARG C 3 56 ? -7.122  0.818   -11.698 1.00 0.00 ? 56 ARG P CB     2  
ATOM 3707  C CG     . ARG C 3 56 ? -7.805  -0.296  -12.617 1.00 0.00 ? 56 ARG P CG     2  
ATOM 3708  C CD     . ARG C 3 56 ? -8.308  -1.454  -11.733 1.00 0.00 ? 56 ARG P CD     2  
ATOM 3709  N NE     . ARG C 3 56 ? -9.474  -1.093  -10.863 1.00 0.00 ? 56 ARG P NE     2  
ATOM 3710  C CZ     . ARG C 3 56 ? -9.516  -0.569  -9.640  1.00 0.00 ? 56 ARG P CZ     2  
ATOM 3711  N NH1    . ARG C 3 56 ? -8.463  -0.279  -8.963  1.00 0.00 ? 56 ARG P NH1    2  
ATOM 3712  N NH2    . ARG C 3 56 ? -10.718 -0.388  -9.082  1.00 0.00 ? 56 ARG P NH2    2  
ATOM 3713  H H      . ARG C 3 56 ? -5.935  2.680   -10.707 1.00 0.00 ? 56 ARG P H      2  
ATOM 3714  H HA     . ARG C 3 56 ? -5.592  1.276   -13.124 1.00 0.00 ? 56 ARG P HA     2  
ATOM 3715  H HB2    . ARG C 3 56 ? -6.421  0.307   -11.038 1.00 0.00 ? 56 ARG P HB2    2  
ATOM 3716  H HB3    . ARG C 3 56 ? -7.825  1.319   -11.033 1.00 0.00 ? 56 ARG P HB3    2  
ATOM 3717  H HG2    . ARG C 3 56 ? -8.531  0.218   -13.246 1.00 0.00 ? 56 ARG P HG2    2  
ATOM 3718  H HG3    . ARG C 3 56 ? -7.071  -0.693  -13.317 1.00 0.00 ? 56 ARG P HG3    2  
ATOM 3719  H HD2    . ARG C 3 56 ? -8.604  -2.218  -12.452 1.00 0.00 ? 56 ARG P HD2    2  
ATOM 3720  H HD3    . ARG C 3 56 ? -7.622  -1.771  -10.947 1.00 0.00 ? 56 ARG P HD3    2  
ATOM 3721  H HE     . ARG C 3 56 ? -10.403 -1.367  -11.147 1.00 0.00 ? 56 ARG P HE     2  
ATOM 3722  H HH11   . ARG C 3 56 ? -7.537  -0.531  -9.280  1.00 0.00 ? 56 ARG P HH11   2  
ATOM 3723  H HH12   . ARG C 3 56 ? -8.514  -0.063  -7.978  1.00 0.00 ? 56 ARG P HH12   2  
ATOM 3724  H HH21   . ARG C 3 56 ? -11.474 -0.481  -9.745  1.00 0.00 ? 56 ARG P HH21   2  
ATOM 3725  H HH22   . ARG C 3 56 ? -10.825 -0.204  -8.095  1.00 0.00 ? 56 ARG P HH22   2  
ATOM 3726  N N      . HIS C 3 57 ? -8.135  3.385   -13.231 1.00 0.00 ? 57 HIS P N      2  
ATOM 3727  C CA     . HIS C 3 57 ? -9.084  4.157   -14.068 1.00 0.00 ? 57 HIS P CA     2  
ATOM 3728  C C      . HIS C 3 57 ? -8.314  4.820   -15.235 1.00 0.00 ? 57 HIS P C      2  
ATOM 3729  O O      . HIS C 3 57 ? -8.707  4.652   -16.384 1.00 0.00 ? 57 HIS P O      2  
ATOM 3730  C CB     . HIS C 3 57 ? -9.767  5.210   -13.176 1.00 0.00 ? 57 HIS P CB     2  
ATOM 3731  C CG     . HIS C 3 57 ? -10.540 6.191   -14.035 1.00 0.00 ? 57 HIS P CG     2  
ATOM 3732  N ND1    . HIS C 3 57 ? -11.274 5.946   -15.188 1.00 0.00 ? 57 HIS P ND1    2  
ATOM 3733  C CD2    . HIS C 3 57 ? -10.315 7.513   -13.964 1.00 0.00 ? 57 HIS P CD2    2  
ATOM 3734  C CE1    . HIS C 3 57 ? -11.505 7.121   -15.800 1.00 0.00 ? 57 HIS P CE1    2  
ATOM 3735  N NE2    . HIS C 3 57 ? -11.032 8.129   -15.020 1.00 0.00 ? 57 HIS P NE2    2  
ATOM 3736  H H      . HIS C 3 57 ? -8.153  3.400   -12.221 1.00 0.00 ? 57 HIS P H      2  
ATOM 3737  H HA     . HIS C 3 57 ? -9.922  3.594   -14.477 1.00 0.00 ? 57 HIS P HA     2  
ATOM 3738  H HB2    . HIS C 3 57 ? -10.477 4.723   -12.508 1.00 0.00 ? 57 HIS P HB2    2  
ATOM 3739  H HB3    . HIS C 3 57 ? -9.076  5.779   -12.554 1.00 0.00 ? 57 HIS P HB3    2  
ATOM 3740  H HD1    . HIS C 3 57 ? -11.596 5.051   -15.528 1.00 0.00 ? 57 HIS P HD1    2  
ATOM 3741  H HD2    . HIS C 3 57 ? -9.788  8.069   -13.204 1.00 0.00 ? 57 HIS P HD2    2  
ATOM 3742  H HE1    . HIS C 3 57 ? -12.101 7.263   -16.689 1.00 0.00 ? 57 HIS P HE1    2  
ATOM 3743  N N      . LYS C 3 58 ? -7.276  5.550   -14.883 1.00 0.00 ? 58 LYS P N      2  
ATOM 3744  C CA     . LYS C 3 58 ? -6.403  6.161   -15.881 1.00 0.00 ? 58 LYS P CA     2  
ATOM 3745  C C      . LYS C 3 58 ? -5.590  5.211   -16.763 1.00 0.00 ? 58 LYS P C      2  
ATOM 3746  O O      . LYS C 3 58 ? -5.480  5.421   -17.962 1.00 0.00 ? 58 LYS P O      2  
ATOM 3747  C CB     . LYS C 3 58 ? -5.538  7.311   -15.282 1.00 0.00 ? 58 LYS P CB     2  
ATOM 3748  C CG     . LYS C 3 58 ? -4.473  6.920   -14.228 1.00 0.00 ? 58 LYS P CG     2  
ATOM 3749  C CD     . LYS C 3 58 ? -3.705  8.218   -13.762 1.00 0.00 ? 58 LYS P CD     2  
ATOM 3750  C CE     . LYS C 3 58 ? -3.228  8.051   -12.322 1.00 0.00 ? 58 LYS P CE     2  
ATOM 3751  N NZ     . LYS C 3 58 ? -2.150  9.053   -12.051 1.00 0.00 ? 58 LYS P NZ     2  
ATOM 3752  H H      . LYS C 3 58 ? -6.978  5.541   -13.918 1.00 0.00 ? 58 LYS P H      2  
ATOM 3753  H HA     . LYS C 3 58 ? -7.041  6.630   -16.630 1.00 0.00 ? 58 LYS P HA     2  
ATOM 3754  H HB2    . LYS C 3 58 ? -4.934  7.828   -16.027 1.00 0.00 ? 58 LYS P HB2    2  
ATOM 3755  H HB3    . LYS C 3 58 ? -6.227  8.026   -14.835 1.00 0.00 ? 58 LYS P HB3    2  
ATOM 3756  H HG2    . LYS C 3 58 ? -5.130  6.590   -13.423 1.00 0.00 ? 58 LYS P HG2    2  
ATOM 3757  H HG3    . LYS C 3 58 ? -3.824  6.186   -14.708 1.00 0.00 ? 58 LYS P HG3    2  
ATOM 3758  H HD2    . LYS C 3 58 ? -2.830  8.287   -14.407 1.00 0.00 ? 58 LYS P HD2    2  
ATOM 3759  H HD3    . LYS C 3 58 ? -4.282  9.137   -13.872 1.00 0.00 ? 58 LYS P HD3    2  
ATOM 3760  H HE2    . LYS C 3 58 ? -4.095  8.038   -11.662 1.00 0.00 ? 58 LYS P HE2    2  
ATOM 3761  H HE3    . LYS C 3 58 ? -2.777  7.063   -12.220 1.00 0.00 ? 58 LYS P HE3    2  
ATOM 3762  H HZ1    . LYS C 3 58 ? -1.304  8.881   -12.575 1.00 0.00 ? 58 LYS P HZ1    2  
ATOM 3763  H HZ2    . LYS C 3 58 ? -1.885  9.141   -11.080 1.00 0.00 ? 58 LYS P HZ2    2  
ATOM 3764  H HZ3    . LYS C 3 58 ? -2.512  9.940   -12.370 1.00 0.00 ? 58 LYS P HZ3    2  
ATOM 3765  N N      . ILE C 3 59 ? -4.967  4.222   -16.069 1.00 0.00 ? 59 ILE P N      2  
ATOM 3766  C CA     . ILE C 3 59 ? -4.268  3.121   -16.746 1.00 0.00 ? 59 ILE P CA     2  
ATOM 3767  C C      . ILE C 3 59 ? -5.110  2.364   -17.777 1.00 0.00 ? 59 ILE P C      2  
ATOM 3768  O O      . ILE C 3 59 ? -4.709  2.279   -18.939 1.00 0.00 ? 59 ILE P O      2  
ATOM 3769  C CB     . ILE C 3 59 ? -3.561  2.140   -15.748 1.00 0.00 ? 59 ILE P CB     2  
ATOM 3770  C CG1    . ILE C 3 59 ? -2.372  2.815   -14.987 1.00 0.00 ? 59 ILE P CG1    2  
ATOM 3771  C CG2    . ILE C 3 59 ? -3.066  0.815   -16.433 1.00 0.00 ? 59 ILE P CG2    2  
ATOM 3772  C CD1    . ILE C 3 59 ? -2.044  2.237   -13.567 1.00 0.00 ? 59 ILE P CD1    2  
ATOM 3773  H H      . ILE C 3 59 ? -4.912  4.201   -15.061 1.00 0.00 ? 59 ILE P H      2  
ATOM 3774  H HA     . ILE C 3 59 ? -3.480  3.490   -17.402 1.00 0.00 ? 59 ILE P HA     2  
ATOM 3775  H HB     . ILE C 3 59 ? -4.309  1.865   -15.005 1.00 0.00 ? 59 ILE P HB     2  
ATOM 3776  H HG12   . ILE C 3 59 ? -1.436  2.763   -15.544 1.00 0.00 ? 59 ILE P HG12   2  
ATOM 3777  H HG13   . ILE C 3 59 ? -2.592  3.867   -14.808 1.00 0.00 ? 59 ILE P HG13   2  
ATOM 3778  H HG21   . ILE C 3 59 ? -2.517  0.062   -15.866 1.00 0.00 ? 59 ILE P HG21   2  
ATOM 3779  H HG22   . ILE C 3 59 ? -3.961  0.328   -16.821 1.00 0.00 ? 59 ILE P HG22   2  
ATOM 3780  H HG23   . ILE C 3 59 ? -2.498  1.126   -17.309 1.00 0.00 ? 59 ILE P HG23   2  
ATOM 3781  H HD11   . ILE C 3 59 ? -1.367  1.399   -13.732 1.00 0.00 ? 59 ILE P HD11   2  
ATOM 3782  H HD12   . ILE C 3 59 ? -1.512  3.024   -13.031 1.00 0.00 ? 59 ILE P HD12   2  
ATOM 3783  H HD13   . ILE C 3 59 ? -2.980  1.902   -13.120 1.00 0.00 ? 59 ILE P HD13   2  
ATOM 3784  N N      . GLN C 3 60 ? -6.263  1.834   -17.362 1.00 0.00 ? 60 GLN P N      2  
ATOM 3785  C CA     . GLN C 3 60 ? -7.250  1.245   -18.334 1.00 0.00 ? 60 GLN P CA     2  
ATOM 3786  C C      . GLN C 3 60 ? -7.619  2.214   -19.491 1.00 0.00 ? 60 GLN P C      2  
ATOM 3787  O O      . GLN C 3 60 ? -7.815  1.707   -20.585 1.00 0.00 ? 60 GLN P O      2  
ATOM 3788  C CB     . GLN C 3 60 ? -8.539  0.817   -17.605 1.00 0.00 ? 60 GLN P CB     2  
ATOM 3789  C CG     . GLN C 3 60 ? -8.389  -0.376  -16.604 1.00 0.00 ? 60 GLN P CG     2  
ATOM 3790  C CD     . GLN C 3 60 ? -8.010  -1.694  -17.242 1.00 0.00 ? 60 GLN P CD     2  
ATOM 3791  O OE1    . GLN C 3 60 ? -7.983  -1.824  -18.443 1.00 0.00 ? 60 GLN P OE1    2  
ATOM 3792  N NE2    . GLN C 3 60 ? -7.646  -2.699  -16.477 1.00 0.00 ? 60 GLN P NE2    2  
ATOM 3793  H H      . GLN C 3 60 ? -6.620  2.042   -16.441 1.00 0.00 ? 60 GLN P H      2  
ATOM 3794  H HA     . GLN C 3 60 ? -6.749  0.397   -18.799 1.00 0.00 ? 60 GLN P HA     2  
ATOM 3795  H HB2    . GLN C 3 60 ? -8.846  1.599   -16.911 1.00 0.00 ? 60 GLN P HB2    2  
ATOM 3796  H HB3    . GLN C 3 60 ? -9.324  0.686   -18.351 1.00 0.00 ? 60 GLN P HB3    2  
ATOM 3797  H HG2    . GLN C 3 60 ? -7.722  -0.087  -15.792 1.00 0.00 ? 60 GLN P HG2    2  
ATOM 3798  H HG3    . GLN C 3 60 ? -9.406  -0.536  -16.248 1.00 0.00 ? 60 GLN P HG3    2  
ATOM 3799  H HE21   . GLN C 3 60 ? -7.898  -2.565  -15.508 1.00 0.00 ? 60 GLN P HE21   2  
ATOM 3800  H HE22   . GLN C 3 60 ? -7.470  -3.611  -16.873 1.00 0.00 ? 60 GLN P HE22   2  
ATOM 3801  N N      . SER C 3 61 ? -7.660  3.549   -19.167 1.00 0.00 ? 61 SER P N      2  
ATOM 3802  C CA     . SER C 3 61 ? -7.915  4.622   -20.109 1.00 0.00 ? 61 SER P CA     2  
ATOM 3803  C C      . SER C 3 61 ? -6.863  4.975   -21.164 1.00 0.00 ? 61 SER P C      2  
ATOM 3804  O O      . SER C 3 61 ? -7.140  5.525   -22.229 1.00 0.00 ? 61 SER P O      2  
ATOM 3805  C CB     . SER C 3 61 ? -8.483  5.921   -19.462 1.00 0.00 ? 61 SER P CB     2  
ATOM 3806  O OG     . SER C 3 61 ? -9.646  5.661   -18.771 1.00 0.00 ? 61 SER P OG     2  
ATOM 3807  H H      . SER C 3 61 ? -7.537  3.793   -18.194 1.00 0.00 ? 61 SER P H      2  
ATOM 3808  H HA     . SER C 3 61 ? -8.725  4.153   -20.668 1.00 0.00 ? 61 SER P HA     2  
ATOM 3809  H HB2    . SER C 3 61 ? -7.746  6.276   -18.741 1.00 0.00 ? 61 SER P HB2    2  
ATOM 3810  H HB3    . SER C 3 61 ? -8.674  6.700   -20.201 1.00 0.00 ? 61 SER P HB3    2  
ATOM 3811  H HG     . SER C 3 61 ? -9.395  5.657   -17.845 1.00 0.00 ? 61 SER P HG     2  
ATOM 3812  N N      . ASP C 3 62 ? -5.631  4.664   -20.836 1.00 0.00 ? 62 ASP P N      2  
ATOM 3813  C CA     . ASP C 3 62 ? -4.544  4.601   -21.857 1.00 0.00 ? 62 ASP P CA     2  
ATOM 3814  C C      . ASP C 3 62 ? -4.609  3.223   -22.541 1.00 0.00 ? 62 ASP P C      2  
ATOM 3815  O O      . ASP C 3 62 ? -4.813  3.158   -23.736 1.00 0.00 ? 62 ASP P O      2  
ATOM 3816  C CB     . ASP C 3 62 ? -3.172  4.928   -21.181 1.00 0.00 ? 62 ASP P CB     2  
ATOM 3817  C CG     . ASP C 3 62 ? -2.021  4.670   -22.123 1.00 0.00 ? 62 ASP P CG     2  
ATOM 3818  O OD1    . ASP C 3 62 ? -1.176  3.770   -21.937 1.00 0.00 ? 62 ASP P OD1    2  
ATOM 3819  O OD2    . ASP C 3 62 ? -1.887  5.382   -23.157 1.00 0.00 ? 62 ASP P OD2    2  
ATOM 3820  H H      . ASP C 3 62 ? -5.456  4.282   -19.917 1.00 0.00 ? 62 ASP P H      2  
ATOM 3821  H HA     . ASP C 3 62 ? -4.704  5.307   -22.672 1.00 0.00 ? 62 ASP P HA     2  
ATOM 3822  H HB2    . ASP C 3 62 ? -3.163  6.009   -21.042 1.00 0.00 ? 62 ASP P HB2    2  
ATOM 3823  H HB3    . ASP C 3 62 ? -2.998  4.419   -20.233 1.00 0.00 ? 62 ASP P HB3    2  
ATOM 3824  N N      . GLN C 3 63 ? -4.449  2.074   -21.810 1.00 0.00 ? 63 GLN P N      2  
ATOM 3825  C CA     . GLN C 3 63 ? -4.134  0.792   -22.490 1.00 0.00 ? 63 GLN P CA     2  
ATOM 3826  C C      . GLN C 3 63 ? -5.207  0.172   -23.387 1.00 0.00 ? 63 GLN P C      2  
ATOM 3827  O O      . GLN C 3 63 ? -5.029  -0.829  -24.058 1.00 0.00 ? 63 GLN P O      2  
ATOM 3828  C CB     . GLN C 3 63 ? -3.490  -0.137  -21.416 1.00 0.00 ? 63 GLN P CB     2  
ATOM 3829  C CG     . GLN C 3 63 ? -4.658  -0.720  -20.628 1.00 0.00 ? 63 GLN P CG     2  
ATOM 3830  C CD     . GLN C 3 63 ? -4.244  -1.795  -19.588 1.00 0.00 ? 63 GLN P CD     2  
ATOM 3831  O OE1    . GLN C 3 63 ? -3.091  -2.227  -19.532 1.00 0.00 ? 63 GLN P OE1    2  
ATOM 3832  N NE2    . GLN C 3 63 ? -5.210  -2.327  -18.851 1.00 0.00 ? 63 GLN P NE2    2  
ATOM 3833  H H      . GLN C 3 63 ? -4.304  2.090   -20.811 1.00 0.00 ? 63 GLN P H      2  
ATOM 3834  H HA     . GLN C 3 63 ? -3.367  0.959   -23.246 1.00 0.00 ? 63 GLN P HA     2  
ATOM 3835  H HB2    . GLN C 3 63 ? -2.940  -0.899  -21.969 1.00 0.00 ? 63 GLN P HB2    2  
ATOM 3836  H HB3    . GLN C 3 63 ? -2.875  0.482   -20.762 1.00 0.00 ? 63 GLN P HB3    2  
ATOM 3837  H HG2    . GLN C 3 63 ? -5.098  0.068   -20.017 1.00 0.00 ? 63 GLN P HG2    2  
ATOM 3838  H HG3    . GLN C 3 63 ? -5.335  -1.257  -21.292 1.00 0.00 ? 63 GLN P HG3    2  
ATOM 3839  H HE21   . GLN C 3 63 ? -6.160  -1.986  -18.856 1.00 0.00 ? 63 GLN P HE21   2  
ATOM 3840  H HE22   . GLN C 3 63 ? -4.990  -3.099  -18.237 1.00 0.00 ? 63 GLN P HE22   2  
ATOM 3841  N N      . HIS C 3 64 ? -6.395  0.782   -23.472 1.00 0.00 ? 64 HIS P N      2  
ATOM 3842  C CA     . HIS C 3 64 ? -7.502  0.432   -24.313 1.00 0.00 ? 64 HIS P CA     2  
ATOM 3843  C C      . HIS C 3 64 ? -7.983  1.521   -25.305 1.00 0.00 ? 64 HIS P C      2  
ATOM 3844  O O      . HIS C 3 64 ? -8.860  1.284   -26.157 1.00 0.00 ? 64 HIS P O      2  
ATOM 3845  C CB     . HIS C 3 64 ? -8.704  -0.069  -23.520 1.00 0.00 ? 64 HIS P CB     2  
ATOM 3846  C CG     . HIS C 3 64 ? -8.305  -1.245  -22.724 1.00 0.00 ? 64 HIS P CG     2  
ATOM 3847  N ND1    . HIS C 3 64 ? -7.886  -1.243  -21.395 1.00 0.00 ? 64 HIS P ND1    2  
ATOM 3848  C CD2    . HIS C 3 64 ? -8.206  -2.523  -23.263 1.00 0.00 ? 64 HIS P CD2    2  
ATOM 3849  C CE1    . HIS C 3 64 ? -7.657  -2.512  -21.124 1.00 0.00 ? 64 HIS P CE1    2  
ATOM 3850  N NE2    . HIS C 3 64 ? -7.666  -3.309  -22.229 1.00 0.00 ? 64 HIS P NE2    2  
ATOM 3851  H H      . HIS C 3 64 ? -6.518  1.658   -22.987 1.00 0.00 ? 64 HIS P H      2  
ATOM 3852  H HA     . HIS C 3 64 ? -7.244  -0.346  -25.031 1.00 0.00 ? 64 HIS P HA     2  
ATOM 3853  H HB2    . HIS C 3 64 ? -9.188  0.709   -22.931 1.00 0.00 ? 64 HIS P HB2    2  
ATOM 3854  H HB3    . HIS C 3 64 ? -9.490  -0.481  -24.154 1.00 0.00 ? 64 HIS P HB3    2  
ATOM 3855  H HD1    . HIS C 3 64 ? -7.847  -0.466  -20.752 1.00 0.00 ? 64 HIS P HD1    2  
ATOM 3856  H HD2    . HIS C 3 64 ? -8.349  -2.721  -24.316 1.00 0.00 ? 64 HIS P HD2    2  
ATOM 3857  H HE1    . HIS C 3 64 ? -7.214  -2.919  -20.228 1.00 0.00 ? 64 HIS P HE1    2  
ATOM 3858  N N      . LYS C 3 65 ? -7.335  2.680   -25.334 1.00 0.00 ? 65 LYS P N      2  
ATOM 3859  C CA     . LYS C 3 65 ? -7.611  3.855   -26.215 1.00 0.00 ? 65 LYS P CA     2  
ATOM 3860  C C      . LYS C 3 65 ? -6.305  4.469   -26.830 1.00 0.00 ? 65 LYS P C      2  
ATOM 3861  O O      . LYS C 3 65 ? -5.231  4.259   -26.297 1.00 0.00 ? 65 LYS P O      2  
ATOM 3862  C CB     . LYS C 3 65 ? -8.526  4.934   -25.564 1.00 0.00 ? 65 LYS P CB     2  
ATOM 3863  C CG     . LYS C 3 65 ? -9.843  4.279   -25.010 1.00 0.00 ? 65 LYS P CG     2  
ATOM 3864  C CD     . LYS C 3 65 ? -11.032 5.372   -24.722 1.00 0.00 ? 65 LYS P CD     2  
ATOM 3865  C CE     . LYS C 3 65 ? -10.785 6.171   -23.425 1.00 0.00 ? 65 LYS P CE     2  
ATOM 3866  N NZ     . LYS C 3 65 ? -11.703 7.354   -23.264 1.00 0.00 ? 65 LYS P NZ     2  
ATOM 3867  H H      . LYS C 3 65 ? -6.521  2.732   -24.738 1.00 0.00 ? 65 LYS P H      2  
ATOM 3868  H HA     . LYS C 3 65 ? -8.182  3.516   -27.078 1.00 0.00 ? 65 LYS P HA     2  
ATOM 3869  H HB2    . LYS C 3 65 ? -8.038  5.509   -24.777 1.00 0.00 ? 65 LYS P HB2    2  
ATOM 3870  H HB3    . LYS C 3 65 ? -8.735  5.671   -26.339 1.00 0.00 ? 65 LYS P HB3    2  
ATOM 3871  H HG2    . LYS C 3 65 ? -10.237 3.558   -25.725 1.00 0.00 ? 65 LYS P HG2    2  
ATOM 3872  H HG3    . LYS C 3 65 ? -9.747  3.753   -24.060 1.00 0.00 ? 65 LYS P HG3    2  
ATOM 3873  H HD2    . LYS C 3 65 ? -11.084 6.021   -25.597 1.00 0.00 ? 65 LYS P HD2    2  
ATOM 3874  H HD3    . LYS C 3 65 ? -11.968 4.813   -24.726 1.00 0.00 ? 65 LYS P HD3    2  
ATOM 3875  H HE2    . LYS C 3 65 ? -10.803 5.475   -22.586 1.00 0.00 ? 65 LYS P HE2    2  
ATOM 3876  H HE3    . LYS C 3 65 ? -9.721  6.363   -23.562 1.00 0.00 ? 65 LYS P HE3    2  
ATOM 3877  H HZ1    . LYS C 3 65 ? -11.788 7.828   -24.152 1.00 0.00 ? 65 LYS P HZ1    2  
ATOM 3878  H HZ2    . LYS C 3 65 ? -11.343 8.095   -22.679 1.00 0.00 ? 65 LYS P HZ2    2  
ATOM 3879  H HZ3    . LYS C 3 65 ? -12.582 7.113   -22.829 1.00 0.00 ? 65 LYS P HZ3    2  
ATOM 3880  N N      . ASP C 3 66 ? -6.477  5.232   -27.872 1.00 0.00 ? 66 ASP P N      2  
ATOM 3881  C CA     . ASP C 3 66 ? -5.403  5.975   -28.600 1.00 0.00 ? 66 ASP P CA     2  
ATOM 3882  C C      . ASP C 3 66 ? -5.532  7.560   -28.612 1.00 0.00 ? 66 ASP P C      2  
ATOM 3883  O O      . ASP C 3 66 ? -6.613  8.145   -28.489 1.00 0.00 ? 66 ASP P O      2  
ATOM 3884  C CB     . ASP C 3 66 ? -5.443  5.487   -30.106 1.00 0.00 ? 66 ASP P CB     2  
ATOM 3885  C CG     . ASP C 3 66 ? -4.113  5.736   -30.768 1.00 0.00 ? 66 ASP P CG     2  
ATOM 3886  O OD1    . ASP C 3 66 ? -3.912  6.870   -31.249 1.00 0.00 ? 66 ASP P OD1    2  
ATOM 3887  O OD2    . ASP C 3 66 ? -3.324  4.784   -30.959 1.00 0.00 ? 66 ASP P OD2    2  
ATOM 3888  H H      . ASP C 3 66 ? -7.439  5.488   -28.040 1.00 0.00 ? 66 ASP P H      2  
ATOM 3889  H HA     . ASP C 3 66 ? -4.400  5.700   -28.271 1.00 0.00 ? 66 ASP P HA     2  
ATOM 3890  H HB2    . ASP C 3 66 ? -5.668  4.420   -30.075 1.00 0.00 ? 66 ASP P HB2    2  
ATOM 3891  H HB3    . ASP C 3 66 ? -6.228  6.024   -30.638 1.00 0.00 ? 66 ASP P HB3    2  
ATOM 3892  N N      . GLN C 3 67 ? -4.407  8.176   -28.691 1.00 0.00 ? 67 GLN P N      2  
ATOM 3893  C CA     . GLN C 3 67 ? -4.288  9.635   -28.908 1.00 0.00 ? 67 GLN P CA     2  
ATOM 3894  C C      . GLN C 3 67 ? -2.879  9.986   -29.445 1.00 0.00 ? 67 GLN P C      2  
ATOM 3895  O O      . GLN C 3 67 ? -2.717  10.765  -30.390 1.00 0.00 ? 67 GLN P O      2  
ATOM 3896  C CB     . GLN C 3 67 ? -4.496  10.294  -27.561 1.00 0.00 ? 67 GLN P CB     2  
ATOM 3897  C CG     . GLN C 3 67 ? -4.303  11.843  -27.498 1.00 0.00 ? 67 GLN P CG     2  
ATOM 3898  C CD     . GLN C 3 67 ? -3.592  12.263  -26.139 1.00 0.00 ? 67 GLN P CD     2  
ATOM 3899  O OE1    . GLN C 3 67 ? -4.201  12.736  -25.239 1.00 0.00 ? 67 GLN P OE1    2  
ATOM 3900  N NE2    . GLN C 3 67 ? -2.281  12.280  -26.018 1.00 0.00 ? 67 GLN P NE2    2  
ATOM 3901  H H      . GLN C 3 67 ? -3.608  7.560   -28.732 1.00 0.00 ? 67 GLN P H      2  
ATOM 3902  H HA     . GLN C 3 67 ? -4.952  10.089  -29.644 1.00 0.00 ? 67 GLN P HA     2  
ATOM 3903  H HB2    . GLN C 3 67 ? -5.542  10.059  -27.366 1.00 0.00 ? 67 GLN P HB2    2  
ATOM 3904  H HB3    . GLN C 3 67 ? -3.888  9.870   -26.763 1.00 0.00 ? 67 GLN P HB3    2  
ATOM 3905  H HG2    . GLN C 3 67 ? -3.747  12.236  -28.349 1.00 0.00 ? 67 GLN P HG2    2  
ATOM 3906  H HG3    . GLN C 3 67 ? -5.265  12.351  -27.427 1.00 0.00 ? 67 GLN P HG3    2  
ATOM 3907  H HE21   . GLN C 3 67 ? -1.665  12.127  -26.804 1.00 0.00 ? 67 GLN P HE21   2  
ATOM 3908  H HE22   . GLN C 3 67 ? -1.933  12.501  -25.096 1.00 0.00 ? 67 GLN P HE22   2  
ATOM 3909  N N      . SER C 3 68 ? -1.825  9.505   -28.759 1.00 0.00 ? 68 SER P N      2  
ATOM 3910  C CA     . SER C 3 68 ? -0.362  9.854   -29.056 1.00 0.00 ? 68 SER P CA     2  
ATOM 3911  C C      . SER C 3 68 ? 0.530   8.759   -28.608 1.00 0.00 ? 68 SER P C      2  
ATOM 3912  O O      . SER C 3 68 ? 1.087   8.787   -27.503 1.00 0.00 ? 68 SER P O      2  
ATOM 3913  C CB     . SER C 3 68 ? 0.013   11.205  -28.410 1.00 0.00 ? 68 SER P CB     2  
ATOM 3914  O OG     . SER C 3 68 ? -0.804  12.313  -28.791 1.00 0.00 ? 68 SER P OG     2  
ATOM 3915  O OXT    . SER C 3 68 ? 0.567   7.690   -29.295 1.00 0.00 ? 68 SER P OXT    2  
ATOM 3916  H H      . SER C 3 68 ? -2.075  9.054   -27.890 1.00 0.00 ? 68 SER P H      2  
ATOM 3917  H HA     . SER C 3 68 ? -0.188  10.003  -30.122 1.00 0.00 ? 68 SER P HA     2  
ATOM 3918  H HB2    . SER C 3 68 ? 0.067   11.117  -27.325 1.00 0.00 ? 68 SER P HB2    2  
ATOM 3919  H HB3    . SER C 3 68 ? 0.988   11.519  -28.783 1.00 0.00 ? 68 SER P HB3    2  
ATOM 3920  H HG     . SER C 3 68 ? -0.850  12.629  -29.697 1.00 0.00 ? 68 SER P HG     2  
ATOM 3921  O "O5'"  . DG  A 1 1  ? 7.216   -23.406 -9.620  1.00 0.00 ? 69 DG  A "O5'"  3  
ATOM 3922  C "C5'"  . DG  A 1 1  ? 7.401   -24.038 -10.879 1.00 0.00 ? 69 DG  A "C5'"  3  
ATOM 3923  C "C4'"  . DG  A 1 1  ? 6.852   -23.110 -12.042 1.00 0.00 ? 69 DG  A "C4'"  3  
ATOM 3924  O "O4'"  . DG  A 1 1  ? 5.468   -22.847 -12.000 1.00 0.00 ? 69 DG  A "O4'"  3  
ATOM 3925  C "C3'"  . DG  A 1 1  ? 7.584   -21.886 -12.170 1.00 0.00 ? 69 DG  A "C3'"  3  
ATOM 3926  O "O3'"  . DG  A 1 1  ? 7.695   -21.514 -13.513 1.00 0.00 ? 69 DG  A "O3'"  3  
ATOM 3927  C "C2'"  . DG  A 1 1  ? 6.631   -20.956 -11.370 1.00 0.00 ? 69 DG  A "C2'"  3  
ATOM 3928  C "C1'"  . DG  A 1 1  ? 5.253   -21.482 -11.607 1.00 0.00 ? 69 DG  A "C1'"  3  
ATOM 3929  N N9     . DG  A 1 1  ? 4.366   -21.566 -10.447 1.00 0.00 ? 69 DG  A N9     3  
ATOM 3930  C C8     . DG  A 1 1  ? 4.571   -21.635 -9.106  1.00 0.00 ? 69 DG  A C8     3  
ATOM 3931  N N7     . DG  A 1 1  ? 3.502   -21.686 -8.387  1.00 0.00 ? 69 DG  A N7     3  
ATOM 3932  C C5     . DG  A 1 1  ? 2.472   -21.674 -9.367  1.00 0.00 ? 69 DG  A C5     3  
ATOM 3933  C C6     . DG  A 1 1  ? 1.050   -21.692 -9.215  1.00 0.00 ? 69 DG  A C6     3  
ATOM 3934  O O6     . DG  A 1 1  ? 0.344   -21.857 -8.209  1.00 0.00 ? 69 DG  A O6     3  
ATOM 3935  N N1     . DG  A 1 1  ? 0.368   -21.588 -10.427 1.00 0.00 ? 69 DG  A N1     3  
ATOM 3936  C C2     . DG  A 1 1  ? 0.939   -21.627 -11.635 1.00 0.00 ? 69 DG  A C2     3  
ATOM 3937  N N2     . DG  A 1 1  ? 0.141   -21.646 -12.725 1.00 0.00 ? 69 DG  A N2     3  
ATOM 3938  N N3     . DG  A 1 1  ? 2.260   -21.542 -11.850 1.00 0.00 ? 69 DG  A N3     3  
ATOM 3939  C C4     . DG  A 1 1  ? 2.980   -21.551 -10.641 1.00 0.00 ? 69 DG  A C4     3  
ATOM 3940  H "H5'"  . DG  A 1 1  ? 6.720   -24.886 -10.930 1.00 0.00 ? 69 DG  A "H5'"  3  
ATOM 3941  H "H5''" . DG  A 1 1  ? 8.435   -24.298 -11.104 1.00 0.00 ? 69 DG  A "H5''" 3  
ATOM 3942  H "H4'"  . DG  A 1 1  ? 7.022   -23.636 -12.982 1.00 0.00 ? 69 DG  A "H4'"  3  
ATOM 3943  H "H3'"  . DG  A 1 1  ? 8.590   -21.987 -11.761 1.00 0.00 ? 69 DG  A "H3'"  3  
ATOM 3944  H "H2'"  . DG  A 1 1  ? 6.888   -20.978 -10.312 1.00 0.00 ? 69 DG  A "H2'"  3  
ATOM 3945  H "H2''" . DG  A 1 1  ? 6.715   -19.883 -11.543 1.00 0.00 ? 69 DG  A "H2''" 3  
ATOM 3946  H "H1'"  . DG  A 1 1  ? 4.848   -20.885 -12.425 1.00 0.00 ? 69 DG  A "H1'"  3  
ATOM 3947  H H8     . DG  A 1 1  ? 5.561   -21.541 -8.683  1.00 0.00 ? 69 DG  A H8     3  
ATOM 3948  H H1     . DG  A 1 1  ? -0.637  -21.516 -10.373 1.00 0.00 ? 69 DG  A H1     3  
ATOM 3949  H H21    . DG  A 1 1  ? 0.529   -21.623 -13.657 1.00 0.00 ? 69 DG  A H21    3  
ATOM 3950  H H22    . DG  A 1 1  ? -0.859  -21.531 -12.640 1.00 0.00 ? 69 DG  A H22    3  
ATOM 3951  H "HO5'" . DG  A 1 1  ? 8.012   -22.958 -9.325  1.00 0.00 ? 69 DG  A "HO5'" 3  
ATOM 3952  P P      . DC  A 1 2  ? 8.361   -20.168 -14.196 1.00 0.00 ? 70 DC  A P      3  
ATOM 3953  O OP1    . DC  A 1 2  ? 9.216   -20.600 -15.291 1.00 0.00 ? 70 DC  A OP1    3  
ATOM 3954  O OP2    . DC  A 1 2  ? 8.844   -19.322 -13.133 1.00 0.00 ? 70 DC  A OP2    3  
ATOM 3955  O "O5'"  . DC  A 1 2  ? 7.071   -19.440 -14.801 1.00 0.00 ? 70 DC  A "O5'"  3  
ATOM 3956  C "C5'"  . DC  A 1 2  ? 6.152   -20.174 -15.708 1.00 0.00 ? 70 DC  A "C5'"  3  
ATOM 3957  C "C4'"  . DC  A 1 2  ? 4.835   -19.500 -15.962 1.00 0.00 ? 70 DC  A "C4'"  3  
ATOM 3958  O "O4'"  . DC  A 1 2  ? 3.978   -19.583 -14.819 1.00 0.00 ? 70 DC  A "O4'"  3  
ATOM 3959  C "C3'"  . DC  A 1 2  ? 4.884   -18.038 -16.470 1.00 0.00 ? 70 DC  A "C3'"  3  
ATOM 3960  O "O3'"  . DC  A 1 2  ? 3.947   -17.751 -17.429 1.00 0.00 ? 70 DC  A "O3'"  3  
ATOM 3961  C "C2'"  . DC  A 1 2  ? 4.480   -17.337 -15.168 1.00 0.00 ? 70 DC  A "C2'"  3  
ATOM 3962  C "C1'"  . DC  A 1 2  ? 3.494   -18.308 -14.481 1.00 0.00 ? 70 DC  A "C1'"  3  
ATOM 3963  N N1     . DC  A 1 2  ? 3.528   -18.257 -12.991 1.00 0.00 ? 70 DC  A N1     3  
ATOM 3964  C C2     . DC  A 1 2  ? 2.283   -18.335 -12.356 1.00 0.00 ? 70 DC  A C2     3  
ATOM 3965  O O2     . DC  A 1 2  ? 1.255   -18.319 -13.083 1.00 0.00 ? 70 DC  A O2     3  
ATOM 3966  N N3     . DC  A 1 2  ? 2.167   -18.222 -11.016 1.00 0.00 ? 70 DC  A N3     3  
ATOM 3967  C C4     . DC  A 1 2  ? 3.274   -18.226 -10.247 1.00 0.00 ? 70 DC  A C4     3  
ATOM 3968  N N4     . DC  A 1 2  ? 3.062   -17.979 -8.984  1.00 0.00 ? 70 DC  A N4     3  
ATOM 3969  C C5     . DC  A 1 2  ? 4.602   -18.270 -10.800 1.00 0.00 ? 70 DC  A C5     3  
ATOM 3970  C C6     . DC  A 1 2  ? 4.687   -18.219 -12.181 1.00 0.00 ? 70 DC  A C6     3  
ATOM 3971  H "H5'"  . DC  A 1 2  ? 5.941   -21.164 -15.303 1.00 0.00 ? 70 DC  A "H5'"  3  
ATOM 3972  H "H5''" . DC  A 1 2  ? 6.785   -20.312 -16.585 1.00 0.00 ? 70 DC  A "H5''" 3  
ATOM 3973  H "H4'"  . DC  A 1 2  ? 4.389   -20.070 -16.777 1.00 0.00 ? 70 DC  A "H4'"  3  
ATOM 3974  H "H3'"  . DC  A 1 2  ? 5.860   -17.776 -16.877 1.00 0.00 ? 70 DC  A "H3'"  3  
ATOM 3975  H "H2'"  . DC  A 1 2  ? 5.341   -17.151 -14.524 1.00 0.00 ? 70 DC  A "H2'"  3  
ATOM 3976  H "H2''" . DC  A 1 2  ? 4.074   -16.336 -15.306 1.00 0.00 ? 70 DC  A "H2''" 3  
ATOM 3977  H "H1'"  . DC  A 1 2  ? 2.518   -18.067 -14.900 1.00 0.00 ? 70 DC  A "H1'"  3  
ATOM 3978  H H41    . DC  A 1 2  ? 3.865   -17.810 -8.394  1.00 0.00 ? 70 DC  A H41    3  
ATOM 3979  H H42    . DC  A 1 2  ? 2.145   -17.582 -8.839  1.00 0.00 ? 70 DC  A H42    3  
ATOM 3980  H H5     . DC  A 1 2  ? 5.575   -18.149 -10.347 1.00 0.00 ? 70 DC  A H5     3  
ATOM 3981  H H6     . DC  A 1 2  ? 5.597   -18.170 -12.759 1.00 0.00 ? 70 DC  A H6     3  
ATOM 3982  P P      . DT  A 1 3  ? 3.913   -16.290 -18.147 1.00 0.00 ? 71 DT  A P      3  
ATOM 3983  O OP1    . DT  A 1 3  ? 3.344   -16.428 -19.494 1.00 0.00 ? 71 DT  A OP1    3  
ATOM 3984  O OP2    . DT  A 1 3  ? 5.206   -15.576 -17.930 1.00 0.00 ? 71 DT  A OP2    3  
ATOM 3985  O "O5'"  . DT  A 1 3  ? 2.763   -15.490 -17.296 1.00 0.00 ? 71 DT  A "O5'"  3  
ATOM 3986  C "C5'"  . DT  A 1 3  ? 1.346   -15.636 -17.547 1.00 0.00 ? 71 DT  A "C5'"  3  
ATOM 3987  C "C4'"  . DT  A 1 3  ? 0.474   -14.887 -16.501 1.00 0.00 ? 71 DT  A "C4'"  3  
ATOM 3988  O "O4'"  . DT  A 1 3  ? 0.693   -15.398 -15.175 1.00 0.00 ? 71 DT  A "O4'"  3  
ATOM 3989  C "C3'"  . DT  A 1 3  ? 0.805   -13.373 -16.438 1.00 0.00 ? 71 DT  A "C3'"  3  
ATOM 3990  O "O3'"  . DT  A 1 3  ? -0.361  -12.588 -16.172 1.00 0.00 ? 71 DT  A "O3'"  3  
ATOM 3991  C "C2'"  . DT  A 1 3  ? 1.653   -13.259 -15.188 1.00 0.00 ? 71 DT  A "C2'"  3  
ATOM 3992  C "C1'"  . DT  A 1 3  ? 0.807   -14.260 -14.312 1.00 0.00 ? 71 DT  A "C1'"  3  
ATOM 3993  N N1     . DT  A 1 3  ? 1.398   -14.619 -13.008 1.00 0.00 ? 71 DT  A N1     3  
ATOM 3994  C C2     . DT  A 1 3  ? 0.622   -14.509 -11.896 1.00 0.00 ? 71 DT  A C2     3  
ATOM 3995  O O2     . DT  A 1 3  ? -0.595  -14.377 -11.820 1.00 0.00 ? 71 DT  A O2     3  
ATOM 3996  N N3     . DT  A 1 3  ? 1.212   -14.622 -10.680 1.00 0.00 ? 71 DT  A N3     3  
ATOM 3997  C C4     . DT  A 1 3  ? 2.531   -14.798 -10.445 1.00 0.00 ? 71 DT  A C4     3  
ATOM 3998  O O4     . DT  A 1 3  ? 2.929   -14.854 -9.283  1.00 0.00 ? 71 DT  A O4     3  
ATOM 3999  C C5     . DT  A 1 3  ? 3.326   -14.753 -11.710 1.00 0.00 ? 71 DT  A C5     3  
ATOM 4000  C C7     . DT  A 1 3  ? 4.789   -14.575 -11.644 1.00 0.00 ? 71 DT  A C7     3  
ATOM 4001  C C6     . DT  A 1 3  ? 2.712   -14.732 -12.895 1.00 0.00 ? 71 DT  A C6     3  
ATOM 4002  H "H5'"  . DT  A 1 3  ? 1.131   -16.699 -17.435 1.00 0.00 ? 71 DT  A "H5'"  3  
ATOM 4003  H "H5''" . DT  A 1 3  ? 1.091   -15.314 -18.556 1.00 0.00 ? 71 DT  A "H5''" 3  
ATOM 4004  H "H4'"  . DT  A 1 3  ? -0.566  -15.112 -16.741 1.00 0.00 ? 71 DT  A "H4'"  3  
ATOM 4005  H "H3'"  . DT  A 1 3  ? 1.334   -12.988 -17.309 1.00 0.00 ? 71 DT  A "H3'"  3  
ATOM 4006  H "H2'"  . DT  A 1 3  ? 2.667   -13.637 -15.323 1.00 0.00 ? 71 DT  A "H2'"  3  
ATOM 4007  H "H2''" . DT  A 1 3  ? 1.724   -12.271 -14.732 1.00 0.00 ? 71 DT  A "H2''" 3  
ATOM 4008  H "H1'"  . DT  A 1 3  ? -0.222  -13.921 -14.179 1.00 0.00 ? 71 DT  A "H1'"  3  
ATOM 4009  H H3     . DT  A 1 3  ? 0.614   -14.704 -9.870  1.00 0.00 ? 71 DT  A H3     3  
ATOM 4010  H H71    . DT  A 1 3  ? 5.129   -15.466 -11.115 1.00 0.00 ? 71 DT  A H71    3  
ATOM 4011  H H72    . DT  A 1 3  ? 5.193   -14.539 -12.655 1.00 0.00 ? 71 DT  A H72    3  
ATOM 4012  H H73    . DT  A 1 3  ? 5.036   -13.651 -11.121 1.00 0.00 ? 71 DT  A H73    3  
ATOM 4013  H H6     . DT  A 1 3  ? 3.323   -14.850 -13.778 1.00 0.00 ? 71 DT  A H6     3  
ATOM 4014  P P      . DC  A 1 4  ? -1.381  -12.232 -17.324 1.00 0.00 ? 72 DC  A P      3  
ATOM 4015  O OP1    . DC  A 1 4  ? -1.667  -13.335 -18.204 1.00 0.00 ? 72 DC  A OP1    3  
ATOM 4016  O OP2    . DC  A 1 4  ? -0.922  -10.931 -17.948 1.00 0.00 ? 72 DC  A OP2    3  
ATOM 4017  O "O5'"  . DC  A 1 4  ? -2.692  -11.721 -16.601 1.00 0.00 ? 72 DC  A "O5'"  3  
ATOM 4018  C "C5'"  . DC  A 1 4  ? -3.383  -12.501 -15.667 1.00 0.00 ? 72 DC  A "C5'"  3  
ATOM 4019  C "C4'"  . DC  A 1 4  ? -3.325  -12.013 -14.208 1.00 0.00 ? 72 DC  A "C4'"  3  
ATOM 4020  O "O4'"  . DC  A 1 4  ? -2.056  -12.243 -13.512 1.00 0.00 ? 72 DC  A "O4'"  3  
ATOM 4021  C "C3'"  . DC  A 1 4  ? -3.637  -10.519 -14.026 1.00 0.00 ? 72 DC  A "C3'"  3  
ATOM 4022  O "O3'"  . DC  A 1 4  ? -4.964  -10.287 -13.582 1.00 0.00 ? 72 DC  A "O3'"  3  
ATOM 4023  C "C2'"  . DC  A 1 4  ? -2.488  -10.073 -12.962 1.00 0.00 ? 72 DC  A "C2'"  3  
ATOM 4024  C "C1'"  . DC  A 1 4  ? -1.897  -11.372 -12.425 1.00 0.00 ? 72 DC  A "C1'"  3  
ATOM 4025  N N1     . DC  A 1 4  ? -0.505  -11.255 -11.853 1.00 0.00 ? 72 DC  A N1     3  
ATOM 4026  C C2     . DC  A 1 4  ? -0.331  -11.475 -10.466 1.00 0.00 ? 72 DC  A C2     3  
ATOM 4027  O O2     . DC  A 1 4  ? -1.270  -11.609 -9.748  1.00 0.00 ? 72 DC  A O2     3  
ATOM 4028  N N3     . DC  A 1 4  ? 0.900   -11.689 -9.943  1.00 0.00 ? 72 DC  A N3     3  
ATOM 4029  C C4     . DC  A 1 4  ? 1.961   -11.422 -10.688 1.00 0.00 ? 72 DC  A C4     3  
ATOM 4030  N N4     . DC  A 1 4  ? 3.119   -11.719 -10.217 1.00 0.00 ? 72 DC  A N4     3  
ATOM 4031  C C5     . DC  A 1 4  ? 1.802   -10.999 -12.106 1.00 0.00 ? 72 DC  A C5     3  
ATOM 4032  C C6     . DC  A 1 4  ? 0.556   -10.926 -12.655 1.00 0.00 ? 72 DC  A C6     3  
ATOM 4033  H "H5'"  . DC  A 1 4  ? -3.065  -13.544 -15.672 1.00 0.00 ? 72 DC  A "H5'"  3  
ATOM 4034  H "H5''" . DC  A 1 4  ? -4.425  -12.442 -15.980 1.00 0.00 ? 72 DC  A "H5''" 3  
ATOM 4035  H "H4'"  . DC  A 1 4  ? -4.123  -12.571 -13.716 1.00 0.00 ? 72 DC  A "H4'"  3  
ATOM 4036  H "H3'"  . DC  A 1 4  ? -3.399  -9.937  -14.917 1.00 0.00 ? 72 DC  A "H3'"  3  
ATOM 4037  H "H2'"  . DC  A 1 4  ? -1.695  -9.622  -13.559 1.00 0.00 ? 72 DC  A "H2'"  3  
ATOM 4038  H "H2''" . DC  A 1 4  ? -2.735  -9.351  -12.184 1.00 0.00 ? 72 DC  A "H2''" 3  
ATOM 4039  H "H1'"  . DC  A 1 4  ? -2.563  -11.644 -11.606 1.00 0.00 ? 72 DC  A "H1'"  3  
ATOM 4040  H H41    . DC  A 1 4  ? 3.947   -11.382 -10.686 1.00 0.00 ? 72 DC  A H41    3  
ATOM 4041  H H42    . DC  A 1 4  ? 3.236   -12.157 -9.314  1.00 0.00 ? 72 DC  A H42    3  
ATOM 4042  H H5     . DC  A 1 4  ? 2.696   -10.914 -12.706 1.00 0.00 ? 72 DC  A H5     3  
ATOM 4043  H H6     . DC  A 1 4  ? 0.425   -10.588 -13.672 1.00 0.00 ? 72 DC  A H6     3  
ATOM 4044  P P      . DT  A 1 5  ? -5.547  -8.811  -13.237 1.00 0.00 ? 73 DT  A P      3  
ATOM 4045  O OP1    . DT  A 1 5  ? -7.011  -8.898  -13.144 1.00 0.00 ? 73 DT  A OP1    3  
ATOM 4046  O OP2    . DT  A 1 5  ? -4.880  -7.891  -14.198 1.00 0.00 ? 73 DT  A OP2    3  
ATOM 4047  O "O5'"  . DT  A 1 5  ? -5.039  -8.516  -11.773 1.00 0.00 ? 73 DT  A "O5'"  3  
ATOM 4048  C "C5'"  . DT  A 1 5  ? -5.529  -9.159  -10.670 1.00 0.00 ? 73 DT  A "C5'"  3  
ATOM 4049  C "C4'"  . DT  A 1 5  ? -4.731  -8.791  -9.404  1.00 0.00 ? 73 DT  A "C4'"  3  
ATOM 4050  O "O4'"  . DT  A 1 5  ? -3.352  -9.044  -9.523  1.00 0.00 ? 73 DT  A "O4'"  3  
ATOM 4051  C "C3'"  . DT  A 1 5  ? -4.958  -7.321  -9.007  1.00 0.00 ? 73 DT  A "C3'"  3  
ATOM 4052  O "O3'"  . DT  A 1 5  ? -5.247  -7.183  -7.564  1.00 0.00 ? 73 DT  A "O3'"  3  
ATOM 4053  C "C2'"  . DT  A 1 5  ? -3.540  -6.743  -9.268  1.00 0.00 ? 73 DT  A "C2'"  3  
ATOM 4054  C "C1'"  . DT  A 1 5  ? -2.752  -7.938  -8.876  1.00 0.00 ? 73 DT  A "C1'"  3  
ATOM 4055  N N1     . DT  A 1 5  ? -1.353  -7.954  -9.270  1.00 0.00 ? 73 DT  A N1     3  
ATOM 4056  C C2     . DT  A 1 5  ? -0.452  -8.413  -8.313  1.00 0.00 ? 73 DT  A C2     3  
ATOM 4057  O O2     . DT  A 1 5  ? -0.829  -8.789  -7.212  1.00 0.00 ? 73 DT  A O2     3  
ATOM 4058  N N3     . DT  A 1 5  ? 0.886   -8.363  -8.593  1.00 0.00 ? 73 DT  A N3     3  
ATOM 4059  C C4     . DT  A 1 5  ? 1.357   -7.968  -9.831  1.00 0.00 ? 73 DT  A C4     3  
ATOM 4060  O O4     . DT  A 1 5  ? 2.541   -8.167  -10.097 1.00 0.00 ? 73 DT  A O4     3  
ATOM 4061  C C5     . DT  A 1 5  ? 0.331   -7.560  -10.829 1.00 0.00 ? 73 DT  A C5     3  
ATOM 4062  C C7     . DT  A 1 5  ? 0.766   -7.085  -12.204 1.00 0.00 ? 73 DT  A C7     3  
ATOM 4063  C C6     . DT  A 1 5  ? -0.976  -7.499  -10.510 1.00 0.00 ? 73 DT  A C6     3  
ATOM 4064  H "H5'"  . DT  A 1 5  ? -5.405  -10.231 -10.827 1.00 0.00 ? 73 DT  A "H5'"  3  
ATOM 4065  H "H5''" . DT  A 1 5  ? -6.584  -8.937  -10.511 1.00 0.00 ? 73 DT  A "H5''" 3  
ATOM 4066  H "H4'"  . DT  A 1 5  ? -5.076  -9.440  -8.598  1.00 0.00 ? 73 DT  A "H4'"  3  
ATOM 4067  H "H3'"  . DT  A 1 5  ? -5.676  -6.795  -9.635  1.00 0.00 ? 73 DT  A "H3'"  3  
ATOM 4068  H "H2'"  . DT  A 1 5  ? -3.502  -6.483  -10.326 1.00 0.00 ? 73 DT  A "H2'"  3  
ATOM 4069  H "H2''" . DT  A 1 5  ? -3.367  -5.861  -8.650  1.00 0.00 ? 73 DT  A "H2''" 3  
ATOM 4070  H "H1'"  . DT  A 1 5  ? -2.909  -7.967  -7.797  1.00 0.00 ? 73 DT  A "H1'"  3  
ATOM 4071  H H3     . DT  A 1 5  ? 1.457   -8.390  -7.761  1.00 0.00 ? 73 DT  A H3     3  
ATOM 4072  H H71    . DT  A 1 5  ? 1.141   -7.991  -12.680 1.00 0.00 ? 73 DT  A H71    3  
ATOM 4073  H H72    . DT  A 1 5  ? -0.022  -6.659  -12.826 1.00 0.00 ? 73 DT  A H72    3  
ATOM 4074  H H73    . DT  A 1 5  ? 1.518   -6.299  -12.266 1.00 0.00 ? 73 DT  A H73    3  
ATOM 4075  H H6     . DT  A 1 5  ? -1.668  -7.017  -11.184 1.00 0.00 ? 73 DT  A H6     3  
ATOM 4076  P P      . DA  A 1 6  ? -6.217  -5.988  -7.082  1.00 0.00 ? 74 DA  A P      3  
ATOM 4077  O OP1    . DA  A 1 6  ? -7.574  -6.548  -6.722  1.00 0.00 ? 74 DA  A OP1    3  
ATOM 4078  O OP2    . DA  A 1 6  ? -6.147  -4.962  -8.129  1.00 0.00 ? 74 DA  A OP2    3  
ATOM 4079  O "O5'"  . DA  A 1 6  ? -5.409  -5.506  -5.808  1.00 0.00 ? 74 DA  A "O5'"  3  
ATOM 4080  C "C5'"  . DA  A 1 6  ? -5.168  -6.392  -4.711  1.00 0.00 ? 74 DA  A "C5'"  3  
ATOM 4081  C "C4'"  . DA  A 1 6  ? -4.236  -5.838  -3.611  1.00 0.00 ? 74 DA  A "C4'"  3  
ATOM 4082  O "O4'"  . DA  A 1 6  ? -2.990  -5.617  -4.243  1.00 0.00 ? 74 DA  A "O4'"  3  
ATOM 4083  C "C3'"  . DA  A 1 6  ? -4.609  -4.527  -2.917  1.00 0.00 ? 74 DA  A "C3'"  3  
ATOM 4084  O "O3'"  . DA  A 1 6  ? -4.434  -4.700  -1.530  1.00 0.00 ? 74 DA  A "O3'"  3  
ATOM 4085  C "C2'"  . DA  A 1 6  ? -3.585  -3.537  -3.535  1.00 0.00 ? 74 DA  A "C2'"  3  
ATOM 4086  C "C1'"  . DA  A 1 6  ? -2.387  -4.392  -3.832  1.00 0.00 ? 74 DA  A "C1'"  3  
ATOM 4087  N N9     . DA  A 1 6  ? -1.521  -4.022  -5.038  1.00 0.00 ? 74 DA  A N9     3  
ATOM 4088  C C8     . DA  A 1 6  ? -1.797  -3.082  -6.008  1.00 0.00 ? 74 DA  A C8     3  
ATOM 4089  N N7     . DA  A 1 6  ? -0.950  -3.038  -6.984  1.00 0.00 ? 74 DA  A N7     3  
ATOM 4090  C C5     . DA  A 1 6  ? 0.004   -3.982  -6.573  1.00 0.00 ? 74 DA  A C5     3  
ATOM 4091  C C6     . DA  A 1 6  ? 1.290   -4.432  -7.031  1.00 0.00 ? 74 DA  A C6     3  
ATOM 4092  N N6     . DA  A 1 6  ? 1.851   -4.220  -8.185  1.00 0.00 ? 74 DA  A N6     3  
ATOM 4093  N N1     . DA  A 1 6  ? 2.071   -5.311  -6.330  1.00 0.00 ? 74 DA  A N1     3  
ATOM 4094  C C2     . DA  A 1 6  ? 1.531   -5.792  -5.252  1.00 0.00 ? 74 DA  A C2     3  
ATOM 4095  N N3     . DA  A 1 6  ? 0.363   -5.485  -4.645  1.00 0.00 ? 74 DA  A N3     3  
ATOM 4096  C C4     . DA  A 1 6  ? -0.362  -4.569  -5.397  1.00 0.00 ? 74 DA  A C4     3  
ATOM 4097  H "H5'"  . DA  A 1 6  ? -4.717  -7.336  -5.015  1.00 0.00 ? 74 DA  A "H5'"  3  
ATOM 4098  H "H5''" . DA  A 1 6  ? -6.106  -6.673  -4.231  1.00 0.00 ? 74 DA  A "H5''" 3  
ATOM 4099  H "H4'"  . DA  A 1 6  ? -4.147  -6.649  -2.886  1.00 0.00 ? 74 DA  A "H4'"  3  
ATOM 4100  H "H3'"  . DA  A 1 6  ? -5.599  -4.181  -3.213  1.00 0.00 ? 74 DA  A "H3'"  3  
ATOM 4101  H "H2'"  . DA  A 1 6  ? -4.056  -3.169  -4.446  1.00 0.00 ? 74 DA  A "H2'"  3  
ATOM 4102  H "H2''" . DA  A 1 6  ? -3.359  -2.696  -2.878  1.00 0.00 ? 74 DA  A "H2''" 3  
ATOM 4103  H "H1'"  . DA  A 1 6  ? -1.763  -4.514  -2.948  1.00 0.00 ? 74 DA  A "H1'"  3  
ATOM 4104  H H8     . DA  A 1 6  ? -2.595  -2.372  -5.850  1.00 0.00 ? 74 DA  A H8     3  
ATOM 4105  H H61    . DA  A 1 6  ? 2.820   -4.497  -8.245  1.00 0.00 ? 74 DA  A H61    3  
ATOM 4106  H H62    . DA  A 1 6  ? 1.384   -3.966  -9.044  1.00 0.00 ? 74 DA  A H62    3  
ATOM 4107  H H2     . DA  A 1 6  ? 2.252   -6.325  -4.651  1.00 0.00 ? 74 DA  A H2     3  
ATOM 4108  P P      . DA  A 1 7  ? -4.298  -3.628  -0.419  1.00 0.00 ? 75 DA  A P      3  
ATOM 4109  O OP1    . DA  A 1 7  ? -4.742  -4.164  0.894   1.00 0.00 ? 75 DA  A OP1    3  
ATOM 4110  O OP2    . DA  A 1 7  ? -4.728  -2.288  -0.876  1.00 0.00 ? 75 DA  A OP2    3  
ATOM 4111  O "O5'"  . DA  A 1 7  ? -2.683  -3.664  -0.313  1.00 0.00 ? 75 DA  A "O5'"  3  
ATOM 4112  C "C5'"  . DA  A 1 7  ? -2.048  -4.809  0.201   1.00 0.00 ? 75 DA  A "C5'"  3  
ATOM 4113  C "C4'"  . DA  A 1 7  ? -0.567  -4.566  0.309   1.00 0.00 ? 75 DA  A "C4'"  3  
ATOM 4114  O "O4'"  . DA  A 1 7  ? 0.076   -4.376  -0.919  1.00 0.00 ? 75 DA  A "O4'"  3  
ATOM 4115  C "C3'"  . DA  A 1 7  ? -0.317  -3.328  1.159   1.00 0.00 ? 75 DA  A "C3'"  3  
ATOM 4116  O "O3'"  . DA  A 1 7  ? 0.533   -3.811  2.191   1.00 0.00 ? 75 DA  A "O3'"  3  
ATOM 4117  C "C2'"  . DA  A 1 7  ? 0.277   -2.259  0.268   1.00 0.00 ? 75 DA  A "C2'"  3  
ATOM 4118  C "C1'"  . DA  A 1 7  ? 0.819   -3.135  -0.856  1.00 0.00 ? 75 DA  A "C1'"  3  
ATOM 4119  N N9     . DA  A 1 7  ? 0.951   -2.427  -2.180  1.00 0.00 ? 75 DA  A N9     3  
ATOM 4120  C C8     . DA  A 1 7  ? 0.150   -1.461  -2.768  1.00 0.00 ? 75 DA  A C8     3  
ATOM 4121  N N7     . DA  A 1 7  ? 0.476   -1.212  -3.973  1.00 0.00 ? 75 DA  A N7     3  
ATOM 4122  C C5     . DA  A 1 7  ? 1.695   -1.861  -4.182  1.00 0.00 ? 75 DA  A C5     3  
ATOM 4123  C C6     . DA  A 1 7  ? 2.600   -1.983  -5.225  1.00 0.00 ? 75 DA  A C6     3  
ATOM 4124  N N6     . DA  A 1 7  ? 2.439   -1.516  -6.427  1.00 0.00 ? 75 DA  A N6     3  
ATOM 4125  N N1     . DA  A 1 7  ? 3.705   -2.741  -5.134  1.00 0.00 ? 75 DA  A N1     3  
ATOM 4126  C C2     . DA  A 1 7  ? 3.870   -3.337  -3.990  1.00 0.00 ? 75 DA  A C2     3  
ATOM 4127  N N3     . DA  A 1 7  ? 3.066   -3.381  -2.926  1.00 0.00 ? 75 DA  A N3     3  
ATOM 4128  C C4     . DA  A 1 7  ? 2.005   -2.602  -3.033  1.00 0.00 ? 75 DA  A C4     3  
ATOM 4129  H "H5'"  . DA  A 1 7  ? -2.185  -5.630  -0.503  1.00 0.00 ? 75 DA  A "H5'"  3  
ATOM 4130  H "H5''" . DA  A 1 7  ? -2.571  -5.167  1.088   1.00 0.00 ? 75 DA  A "H5''" 3  
ATOM 4131  H "H4'"  . DA  A 1 7  ? -0.143  -5.453  0.780   1.00 0.00 ? 75 DA  A "H4'"  3  
ATOM 4132  H "H3'"  . DA  A 1 7  ? -1.262  -2.900  1.493   1.00 0.00 ? 75 DA  A "H3'"  3  
ATOM 4133  H "H2'"  . DA  A 1 7  ? -0.494  -1.572  -0.081  1.00 0.00 ? 75 DA  A "H2'"  3  
ATOM 4134  H "H2''" . DA  A 1 7  ? 1.142   -1.779  0.727   1.00 0.00 ? 75 DA  A "H2''" 3  
ATOM 4135  H "H1'"  . DA  A 1 7  ? 1.840   -3.372  -0.555  1.00 0.00 ? 75 DA  A "H1'"  3  
ATOM 4136  H H8     . DA  A 1 7  ? -0.671  -1.036  -2.210  1.00 0.00 ? 75 DA  A H8     3  
ATOM 4137  H H61    . DA  A 1 7  ? 3.103   -1.671  -7.173  1.00 0.00 ? 75 DA  A H61    3  
ATOM 4138  H H62    . DA  A 1 7  ? 1.534   -1.154  -6.696  1.00 0.00 ? 75 DA  A H62    3  
ATOM 4139  H H2     . DA  A 1 7  ? 4.718   -4.007  -3.977  1.00 0.00 ? 75 DA  A H2     3  
ATOM 4140  P P      . DT  A 1 8  ? 1.311   -2.943  3.285   1.00 0.00 ? 76 DT  A P      3  
ATOM 4141  O OP1    . DT  A 1 8  ? 1.600   -3.756  4.450   1.00 0.00 ? 76 DT  A OP1    3  
ATOM 4142  O OP2    . DT  A 1 8  ? 0.620   -1.652  3.425   1.00 0.00 ? 76 DT  A OP2    3  
ATOM 4143  O "O5'"  . DT  A 1 8  ? 2.711   -2.644  2.536   1.00 0.00 ? 76 DT  A "O5'"  3  
ATOM 4144  C "C5'"  . DT  A 1 8  ? 3.520   -3.736  2.123   1.00 0.00 ? 76 DT  A "C5'"  3  
ATOM 4145  C "C4'"  . DT  A 1 8  ? 4.726   -3.324  1.331   1.00 0.00 ? 76 DT  A "C4'"  3  
ATOM 4146  O "O4'"  . DT  A 1 8  ? 4.290   -2.690  0.221   1.00 0.00 ? 76 DT  A "O4'"  3  
ATOM 4147  C "C3'"  . DT  A 1 8  ? 5.625   -2.283  2.045   1.00 0.00 ? 76 DT  A "C3'"  3  
ATOM 4148  O "O3'"  . DT  A 1 8  ? 6.895   -2.715  2.497   1.00 0.00 ? 76 DT  A "O3'"  3  
ATOM 4149  C "C2'"  . DT  A 1 8  ? 5.714   -1.153  0.999   1.00 0.00 ? 76 DT  A "C2'"  3  
ATOM 4150  C "C1'"  . DT  A 1 8  ? 5.320   -1.858  -0.286  1.00 0.00 ? 76 DT  A "C1'"  3  
ATOM 4151  N N1     . DT  A 1 8  ? 4.825   -0.937  -1.318  1.00 0.00 ? 76 DT  A N1     3  
ATOM 4152  C C2     . DT  A 1 8  ? 5.392   -0.847  -2.582  1.00 0.00 ? 76 DT  A C2     3  
ATOM 4153  O O2     . DT  A 1 8  ? 6.472   -1.358  -2.782  1.00 0.00 ? 76 DT  A O2     3  
ATOM 4154  N N3     . DT  A 1 8  ? 4.696   -0.186  -3.590  1.00 0.00 ? 76 DT  A N3     3  
ATOM 4155  C C4     . DT  A 1 8  ? 3.592   0.571   -3.381  1.00 0.00 ? 76 DT  A C4     3  
ATOM 4156  O O4     . DT  A 1 8  ? 2.988   0.991   -4.352  1.00 0.00 ? 76 DT  A O4     3  
ATOM 4157  C C5     . DT  A 1 8  ? 3.100   0.543   -1.997  1.00 0.00 ? 76 DT  A C5     3  
ATOM 4158  C C7     . DT  A 1 8  ? 1.784   1.441   -1.686  1.00 0.00 ? 76 DT  A C7     3  
ATOM 4159  C C6     . DT  A 1 8  ? 3.628   -0.249  -1.067  1.00 0.00 ? 76 DT  A C6     3  
ATOM 4160  H "H5'"  . DT  A 1 8  ? 2.935   -4.308  1.402   1.00 0.00 ? 76 DT  A "H5'"  3  
ATOM 4161  H "H5''" . DT  A 1 8  ? 3.785   -4.289  3.024   1.00 0.00 ? 76 DT  A "H5''" 3  
ATOM 4162  H "H4'"  . DT  A 1 8  ? 5.216   -4.236  0.992   1.00 0.00 ? 76 DT  A "H4'"  3  
ATOM 4163  H "H3'"  . DT  A 1 8  ? 5.039   -1.985  2.914   1.00 0.00 ? 76 DT  A "H3'"  3  
ATOM 4164  H "H2'"  . DT  A 1 8  ? 5.053   -0.370  1.370   1.00 0.00 ? 76 DT  A "H2'"  3  
ATOM 4165  H "H2''" . DT  A 1 8  ? 6.676   -0.669  0.833   1.00 0.00 ? 76 DT  A "H2''" 3  
ATOM 4166  H "H1'"  . DT  A 1 8  ? 6.130   -2.473  -0.680  1.00 0.00 ? 76 DT  A "H1'"  3  
ATOM 4167  H H3     . DT  A 1 8  ? 5.044   -0.082  -4.532  1.00 0.00 ? 76 DT  A H3     3  
ATOM 4168  H H71    . DT  A 1 8  ? 2.106   2.483   -1.663  1.00 0.00 ? 76 DT  A H71    3  
ATOM 4169  H H72    . DT  A 1 8  ? 1.019   1.296   -2.449  1.00 0.00 ? 76 DT  A H72    3  
ATOM 4170  H H73    . DT  A 1 8  ? 1.325   1.082   -0.765  1.00 0.00 ? 76 DT  A H73    3  
ATOM 4171  H H6     . DT  A 1 8  ? 3.087   -0.287  -0.133  1.00 0.00 ? 76 DT  A H6     3  
ATOM 4172  P P      . DC  A 1 9  ? 7.718   -2.027  3.654   1.00 0.00 ? 77 DC  A P      3  
ATOM 4173  O OP1    . DC  A 1 9  ? 8.417   -3.143  4.423   1.00 0.00 ? 77 DC  A OP1    3  
ATOM 4174  O OP2    . DC  A 1 9  ? 6.874   -1.020  4.328   1.00 0.00 ? 77 DC  A OP2    3  
ATOM 4175  O "O5'"  . DC  A 1 9  ? 8.813   -1.134  2.793   1.00 0.00 ? 77 DC  A "O5'"  3  
ATOM 4176  C "C5'"  . DC  A 1 9  ? 9.883   -1.790  2.120   1.00 0.00 ? 77 DC  A "C5'"  3  
ATOM 4177  C "C4'"  . DC  A 1 9  ? 10.582  -0.918  1.096   1.00 0.00 ? 77 DC  A "C4'"  3  
ATOM 4178  O "O4'"  . DC  A 1 9  ? 9.652   -0.367  0.117   1.00 0.00 ? 77 DC  A "O4'"  3  
ATOM 4179  C "C3'"  . DC  A 1 9  ? 11.204  0.311   1.733   1.00 0.00 ? 77 DC  A "C3'"  3  
ATOM 4180  O "O3'"  . DC  A 1 9  ? 12.539  0.324   1.218   1.00 0.00 ? 77 DC  A "O3'"  3  
ATOM 4181  C "C2'"  . DC  A 1 9  ? 10.280  1.468   1.336   1.00 0.00 ? 77 DC  A "C2'"  3  
ATOM 4182  C "C1'"  . DC  A 1 9  ? 9.779   1.013   -0.028  1.00 0.00 ? 77 DC  A "C1'"  3  
ATOM 4183  N N1     . DC  A 1 9  ? 8.473   1.621   -0.470  1.00 0.00 ? 77 DC  A N1     3  
ATOM 4184  C C2     . DC  A 1 9  ? 8.352   2.163   -1.813  1.00 0.00 ? 77 DC  A C2     3  
ATOM 4185  O O2     . DC  A 1 9  ? 9.302   2.283   -2.619  1.00 0.00 ? 77 DC  A O2     3  
ATOM 4186  N N3     . DC  A 1 9  ? 7.068   2.589   -2.210  1.00 0.00 ? 77 DC  A N3     3  
ATOM 4187  C C4     . DC  A 1 9  ? 6.092   2.599   -1.344  1.00 0.00 ? 77 DC  A C4     3  
ATOM 4188  N N4     . DC  A 1 9  ? 4.959   3.088   -1.799  1.00 0.00 ? 77 DC  A N4     3  
ATOM 4189  C C5     . DC  A 1 9  ? 6.189   2.229   0.046   1.00 0.00 ? 77 DC  A C5     3  
ATOM 4190  C C6     . DC  A 1 9  ? 7.433   1.764   0.389   1.00 0.00 ? 77 DC  A C6     3  
ATOM 4191  H "H5'"  . DC  A 1 9  ? 9.560   -2.666  1.556   1.00 0.00 ? 77 DC  A "H5'"  3  
ATOM 4192  H "H5''" . DC  A 1 9  ? 10.669  -2.108  2.805   1.00 0.00 ? 77 DC  A "H5''" 3  
ATOM 4193  H "H4'"  . DC  A 1 9  ? 11.305  -1.394  0.435   1.00 0.00 ? 77 DC  A "H4'"  3  
ATOM 4194  H "H3'"  . DC  A 1 9  ? 11.285  0.288   2.820   1.00 0.00 ? 77 DC  A "H3'"  3  
ATOM 4195  H "H2'"  . DC  A 1 9  ? 9.546   1.659   2.120   1.00 0.00 ? 77 DC  A "H2'"  3  
ATOM 4196  H "H2''" . DC  A 1 9  ? 10.903  2.359   1.257   1.00 0.00 ? 77 DC  A "H2''" 3  
ATOM 4197  H "H1'"  . DC  A 1 9  ? 10.578  1.187   -0.750  1.00 0.00 ? 77 DC  A "H1'"  3  
ATOM 4198  H H41    . DC  A 1 9  ? 4.291   3.552   -1.200  1.00 0.00 ? 77 DC  A H41    3  
ATOM 4199  H H42    . DC  A 1 9  ? 4.909   3.404   -2.757  1.00 0.00 ? 77 DC  A H42    3  
ATOM 4200  H H5     . DC  A 1 9  ? 5.387   2.309   0.765   1.00 0.00 ? 77 DC  A H5     3  
ATOM 4201  H H6     . DC  A 1 9  ? 7.667   1.516   1.414   1.00 0.00 ? 77 DC  A H6     3  
ATOM 4202  P P      . DC  A 1 10 ? 13.658  1.312   1.837   1.00 0.00 ? 78 DC  A P      3  
ATOM 4203  O OP1    . DC  A 1 10 ? 14.977  0.784   1.402   1.00 0.00 ? 78 DC  A OP1    3  
ATOM 4204  O OP2    . DC  A 1 10 ? 13.285  1.536   3.258   1.00 0.00 ? 78 DC  A OP2    3  
ATOM 4205  O "O5'"  . DC  A 1 10 ? 13.352  2.715   0.978   1.00 0.00 ? 78 DC  A "O5'"  3  
ATOM 4206  C "C5'"  . DC  A 1 10 ? 13.594  2.744   -0.434  1.00 0.00 ? 78 DC  A "C5'"  3  
ATOM 4207  C "C4'"  . DC  A 1 10 ? 13.212  4.046   -1.111  1.00 0.00 ? 78 DC  A "C4'"  3  
ATOM 4208  O "O4'"  . DC  A 1 10 ? 11.844  4.022   -1.284  1.00 0.00 ? 78 DC  A "O4'"  3  
ATOM 4209  C "C3'"  . DC  A 1 10 ? 13.645  5.404   -0.381  1.00 0.00 ? 78 DC  A "C3'"  3  
ATOM 4210  O "O3'"  . DC  A 1 10 ? 14.677  6.006   -1.187  1.00 0.00 ? 78 DC  A "O3'"  3  
ATOM 4211  C "C2'"  . DC  A 1 10 ? 12.305  6.219   -0.449  1.00 0.00 ? 78 DC  A "C2'"  3  
ATOM 4212  C "C1'"  . DC  A 1 10 ? 11.331  5.348   -1.207  1.00 0.00 ? 78 DC  A "C1'"  3  
ATOM 4213  N N1     . DC  A 1 10 ? 9.888   5.301   -0.716  1.00 0.00 ? 78 DC  A N1     3  
ATOM 4214  C C2     . DC  A 1 10 ? 8.871   5.737   -1.579  1.00 0.00 ? 78 DC  A C2     3  
ATOM 4215  O O2     . DC  A 1 10 ? 9.102   6.176   -2.697  1.00 0.00 ? 78 DC  A O2     3  
ATOM 4216  N N3     . DC  A 1 10 ? 7.569   5.762   -1.123  1.00 0.00 ? 78 DC  A N3     3  
ATOM 4217  C C4     . DC  A 1 10 ? 7.339   5.367   0.139   1.00 0.00 ? 78 DC  A C4     3  
ATOM 4218  N N4     . DC  A 1 10 ? 6.139   5.505   0.549   1.00 0.00 ? 78 DC  A N4     3  
ATOM 4219  C C5     . DC  A 1 10 ? 8.367   5.016   1.040   1.00 0.00 ? 78 DC  A C5     3  
ATOM 4220  C C6     . DC  A 1 10 ? 9.643   4.938   0.556   1.00 0.00 ? 78 DC  A C6     3  
ATOM 4221  H "H5'"  . DC  A 1 10 ? 13.185  1.865   -0.933  1.00 0.00 ? 78 DC  A "H5'"  3  
ATOM 4222  H "H5''" . DC  A 1 10 ? 14.641  2.724   -0.738  1.00 0.00 ? 78 DC  A "H5''" 3  
ATOM 4223  H "H4'"  . DC  A 1 10 ? 13.681  4.094   -2.095  1.00 0.00 ? 78 DC  A "H4'"  3  
ATOM 4224  H "H3'"  . DC  A 1 10 ? 13.862  5.191   0.666   1.00 0.00 ? 78 DC  A "H3'"  3  
ATOM 4225  H "H2'"  . DC  A 1 10 ? 11.961  6.628   0.501   1.00 0.00 ? 78 DC  A "H2'"  3  
ATOM 4226  H "H2''" . DC  A 1 10 ? 12.518  7.049   -1.123  1.00 0.00 ? 78 DC  A "H2''" 3  
ATOM 4227  H "H1'"  . DC  A 1 10 ? 11.313  5.700   -2.239  1.00 0.00 ? 78 DC  A "H1'"  3  
ATOM 4228  H H41    . DC  A 1 10 ? 5.833   4.974   1.351   1.00 0.00 ? 78 DC  A H41    3  
ATOM 4229  H H42    . DC  A 1 10 ? 5.495   5.763   -0.186  1.00 0.00 ? 78 DC  A H42    3  
ATOM 4230  H H5     . DC  A 1 10 ? 8.125   4.727   2.053   1.00 0.00 ? 78 DC  A H5     3  
ATOM 4231  H H6     . DC  A 1 10 ? 10.476  4.548   1.121   1.00 0.00 ? 78 DC  A H6     3  
ATOM 4232  P P      . DC  A 1 11 ? 15.129  7.546   -1.050  1.00 0.00 ? 79 DC  A P      3  
ATOM 4233  O OP1    . DC  A 1 11 ? 16.573  7.522   -1.387  1.00 0.00 ? 79 DC  A OP1    3  
ATOM 4234  O OP2    . DC  A 1 11 ? 14.701  7.967   0.275   1.00 0.00 ? 79 DC  A OP2    3  
ATOM 4235  O "O5'"  . DC  A 1 11 ? 14.286  8.309   -2.121  1.00 0.00 ? 79 DC  A "O5'"  3  
ATOM 4236  C "C5'"  . DC  A 1 11 ? 14.132  7.895   -3.482  1.00 0.00 ? 79 DC  A "C5'"  3  
ATOM 4237  C "C4'"  . DC  A 1 11 ? 13.171  8.743   -4.294  1.00 0.00 ? 79 DC  A "C4'"  3  
ATOM 4238  O "O4'"  . DC  A 1 11 ? 11.937  8.496   -3.732  1.00 0.00 ? 79 DC  A "O4'"  3  
ATOM 4239  C "C3'"  . DC  A 1 11 ? 13.415  10.225  -4.158  1.00 0.00 ? 79 DC  A "C3'"  3  
ATOM 4240  O "O3'"  . DC  A 1 11 ? 13.514  10.722  -5.472  1.00 0.00 ? 79 DC  A "O3'"  3  
ATOM 4241  C "C2'"  . DC  A 1 11 ? 12.193  10.711  -3.342  1.00 0.00 ? 79 DC  A "C2'"  3  
ATOM 4242  C "C1'"  . DC  A 1 11 ? 11.166  9.713   -3.678  1.00 0.00 ? 79 DC  A "C1'"  3  
ATOM 4243  N N1     . DC  A 1 11 ? 10.096  9.545   -2.672  1.00 0.00 ? 79 DC  A N1     3  
ATOM 4244  C C2     . DC  A 1 11 ? 8.727   9.771   -2.974  1.00 0.00 ? 79 DC  A C2     3  
ATOM 4245  O O2     . DC  A 1 11 ? 8.393   10.128  -4.101  1.00 0.00 ? 79 DC  A O2     3  
ATOM 4246  N N3     . DC  A 1 11 ? 7.791   9.654   -1.977  1.00 0.00 ? 79 DC  A N3     3  
ATOM 4247  C C4     . DC  A 1 11 ? 8.134   9.241   -0.828  1.00 0.00 ? 79 DC  A C4     3  
ATOM 4248  N N4     . DC  A 1 11 ? 7.227   8.996   0.034   1.00 0.00 ? 79 DC  A N4     3  
ATOM 4249  C C5     . DC  A 1 11 ? 9.509   8.920   -0.509  1.00 0.00 ? 79 DC  A C5     3  
ATOM 4250  C C6     . DC  A 1 11 ? 10.459  9.184   -1.423  1.00 0.00 ? 79 DC  A C6     3  
ATOM 4251  H "H5'"  . DC  A 1 11 ? 13.588  6.952   -3.531  1.00 0.00 ? 79 DC  A "H5'"  3  
ATOM 4252  H "H5''" . DC  A 1 11 ? 15.089  7.698   -3.964  1.00 0.00 ? 79 DC  A "H5''" 3  
ATOM 4253  H "H4'"  . DC  A 1 11 ? 13.077  8.423   -5.332  1.00 0.00 ? 79 DC  A "H4'"  3  
ATOM 4254  H "H3'"  . DC  A 1 11 ? 14.299  10.443  -3.558  1.00 0.00 ? 79 DC  A "H3'"  3  
ATOM 4255  H "H2'"  . DC  A 1 11 ? 12.462  10.610  -2.291  1.00 0.00 ? 79 DC  A "H2'"  3  
ATOM 4256  H "H2''" . DC  A 1 11 ? 11.968  11.694  -3.755  1.00 0.00 ? 79 DC  A "H2''" 3  
ATOM 4257  H "H1'"  . DC  A 1 11 ? 10.808  10.055  -4.648  1.00 0.00 ? 79 DC  A "H1'"  3  
ATOM 4258  H H41    . DC  A 1 11 ? 7.606   8.754   0.938   1.00 0.00 ? 79 DC  A H41    3  
ATOM 4259  H H42    . DC  A 1 11 ? 6.306   9.309   -0.238  1.00 0.00 ? 79 DC  A H42    3  
ATOM 4260  H H5     . DC  A 1 11 ? 9.870   8.510   0.424   1.00 0.00 ? 79 DC  A H5     3  
ATOM 4261  H H6     . DC  A 1 11 ? 11.494  8.929   -1.255  1.00 0.00 ? 79 DC  A H6     3  
ATOM 4262  P P      . DC  A 1 12 ? 13.762  12.281  -5.785  1.00 0.00 ? 80 DC  A P      3  
ATOM 4263  O OP1    . DC  A 1 12 ? 14.014  12.409  -7.241  1.00 0.00 ? 80 DC  A OP1    3  
ATOM 4264  O OP2    . DC  A 1 12 ? 14.706  12.715  -4.795  1.00 0.00 ? 80 DC  A OP2    3  
ATOM 4265  O "O5'"  . DC  A 1 12 ? 12.403  13.063  -5.568  1.00 0.00 ? 80 DC  A "O5'"  3  
ATOM 4266  C "C5'"  . DC  A 1 12 ? 11.417  13.299  -6.560  1.00 0.00 ? 80 DC  A "C5'"  3  
ATOM 4267  C "C4'"  . DC  A 1 12 ? 10.163  14.024  -6.146  1.00 0.00 ? 80 DC  A "C4'"  3  
ATOM 4268  O "O4'"  . DC  A 1 12 ? 9.538   13.447  -5.047  1.00 0.00 ? 80 DC  A "O4'"  3  
ATOM 4269  C "C3'"  . DC  A 1 12 ? 10.540  15.446  -5.834  1.00 0.00 ? 80 DC  A "C3'"  3  
ATOM 4270  O "O3'"  . DC  A 1 12 ? 9.538   16.380  -6.236  1.00 0.00 ? 80 DC  A "O3'"  3  
ATOM 4271  C "C2'"  . DC  A 1 12 ? 10.417  15.329  -4.290  1.00 0.00 ? 80 DC  A "C2'"  3  
ATOM 4272  C "C1'"  . DC  A 1 12 ? 9.154   14.424  -4.170  1.00 0.00 ? 80 DC  A "C1'"  3  
ATOM 4273  N N1     . DC  A 1 12 ? 8.897   13.877  -2.820  1.00 0.00 ? 80 DC  A N1     3  
ATOM 4274  C C2     . DC  A 1 12 ? 7.611   13.935  -2.241  1.00 0.00 ? 80 DC  A C2     3  
ATOM 4275  O O2     . DC  A 1 12 ? 6.644   14.413  -2.809  1.00 0.00 ? 80 DC  A O2     3  
ATOM 4276  N N3     . DC  A 1 12 ? 7.387   13.572  -0.986  1.00 0.00 ? 80 DC  A N3     3  
ATOM 4277  C C4     . DC  A 1 12 ? 8.425   13.007  -0.372  1.00 0.00 ? 80 DC  A C4     3  
ATOM 4278  N N4     . DC  A 1 12 ? 8.150   12.436  0.733   1.00 0.00 ? 80 DC  A N4     3  
ATOM 4279  C C5     . DC  A 1 12 ? 9.734   12.810  -0.843  1.00 0.00 ? 80 DC  A C5     3  
ATOM 4280  C C6     . DC  A 1 12 ? 9.939   13.281  -2.151  1.00 0.00 ? 80 DC  A C6     3  
ATOM 4281  H "H5'"  . DC  A 1 12 ? 11.099  12.356  -7.005  1.00 0.00 ? 80 DC  A "H5'"  3  
ATOM 4282  H "H5''" . DC  A 1 12 ? 11.935  13.894  -7.311  1.00 0.00 ? 80 DC  A "H5''" 3  
ATOM 4283  H "H4'"  . DC  A 1 12 ? 9.501   14.004  -7.011  1.00 0.00 ? 80 DC  A "H4'"  3  
ATOM 4284  H "H3'"  . DC  A 1 12 ? 11.548  15.655  -6.194  1.00 0.00 ? 80 DC  A "H3'"  3  
ATOM 4285  H "H2'"  . DC  A 1 12 ? 11.280  14.778  -3.913  1.00 0.00 ? 80 DC  A "H2'"  3  
ATOM 4286  H "H2''" . DC  A 1 12 ? 10.383  16.268  -3.739  1.00 0.00 ? 80 DC  A "H2''" 3  
ATOM 4287  H "H1'"  . DC  A 1 12 ? 8.287   14.941  -4.581  1.00 0.00 ? 80 DC  A "H1'"  3  
ATOM 4288  H H41    . DC  A 1 12 ? 8.834   11.907  1.255   1.00 0.00 ? 80 DC  A H41    3  
ATOM 4289  H H42    . DC  A 1 12 ? 7.151   12.407  0.885   1.00 0.00 ? 80 DC  A H42    3  
ATOM 4290  H H5     . DC  A 1 12 ? 10.505  12.400  -0.208  1.00 0.00 ? 80 DC  A H5     3  
ATOM 4291  H H6     . DC  A 1 12 ? 10.866  13.277  -2.704  1.00 0.00 ? 80 DC  A H6     3  
ATOM 4292  P P      . DG  A 1 13 ? 9.486   16.806  -7.769  1.00 0.00 ? 81 DG  A P      3  
ATOM 4293  O OP1    . DG  A 1 13 ? 9.255   15.665  -8.611  1.00 0.00 ? 81 DG  A OP1    3  
ATOM 4294  O OP2    . DG  A 1 13 ? 10.722  17.480  -8.082  1.00 0.00 ? 81 DG  A OP2    3  
ATOM 4295  O "O5'"  . DG  A 1 13 ? 8.252   17.764  -7.943  1.00 0.00 ? 81 DG  A "O5'"  3  
ATOM 4296  C "C5'"  . DG  A 1 13 ? 6.881   17.419  -7.622  1.00 0.00 ? 81 DG  A "C5'"  3  
ATOM 4297  C "C4'"  . DG  A 1 13 ? 6.069   18.443  -6.768  1.00 0.00 ? 81 DG  A "C4'"  3  
ATOM 4298  O "O4'"  . DG  A 1 13 ? 5.856   17.900  -5.386  1.00 0.00 ? 81 DG  A "O4'"  3  
ATOM 4299  C "C3'"  . DG  A 1 13 ? 6.802   19.837  -6.607  1.00 0.00 ? 81 DG  A "C3'"  3  
ATOM 4300  O "O3'"  . DG  A 1 13 ? 5.783   20.819  -6.439  1.00 0.00 ? 81 DG  A "O3'"  3  
ATOM 4301  C "C2'"  . DG  A 1 13 ? 7.647   19.522  -5.367  1.00 0.00 ? 81 DG  A "C2'"  3  
ATOM 4302  C "C1'"  . DG  A 1 13 ? 6.666   18.716  -4.527  1.00 0.00 ? 81 DG  A "C1'"  3  
ATOM 4303  N N9     . DG  A 1 13 ? 7.219   17.910  -3.392  1.00 0.00 ? 81 DG  A N9     3  
ATOM 4304  C C8     . DG  A 1 13 ? 8.499   17.876  -2.893  1.00 0.00 ? 81 DG  A C8     3  
ATOM 4305  N N7     . DG  A 1 13 ? 8.671   17.427  -1.678  1.00 0.00 ? 81 DG  A N7     3  
ATOM 4306  C C5     . DG  A 1 13 ? 7.333   17.247  -1.250  1.00 0.00 ? 81 DG  A C5     3  
ATOM 4307  C C6     . DG  A 1 13 ? 6.843   16.818  0.008   1.00 0.00 ? 81 DG  A C6     3  
ATOM 4308  O O6     . DG  A 1 13 ? 7.518   16.445  0.965   1.00 0.00 ? 81 DG  A O6     3  
ATOM 4309  N N1     . DG  A 1 13 ? 5.498   16.701  0.077   1.00 0.00 ? 81 DG  A N1     3  
ATOM 4310  C C2     . DG  A 1 13 ? 4.710   17.043  -0.948  1.00 0.00 ? 81 DG  A C2     3  
ATOM 4311  N N2     . DG  A 1 13 ? 3.467   16.931  -0.791  1.00 0.00 ? 81 DG  A N2     3  
ATOM 4312  N N3     . DG  A 1 13 ? 5.083   17.436  -2.180  1.00 0.00 ? 81 DG  A N3     3  
ATOM 4313  C C4     . DG  A 1 13 ? 6.448   17.462  -2.327  1.00 0.00 ? 81 DG  A C4     3  
ATOM 4314  H "H5'"  . DG  A 1 13 ? 6.754   16.434  -7.171  1.00 0.00 ? 81 DG  A "H5'"  3  
ATOM 4315  H "H5''" . DG  A 1 13 ? 6.371   17.389  -8.585  1.00 0.00 ? 81 DG  A "H5''" 3  
ATOM 4316  H "H4'"  . DG  A 1 13 ? 5.093   18.657  -7.203  1.00 0.00 ? 81 DG  A "H4'"  3  
ATOM 4317  H "H3'"  . DG  A 1 13 ? 7.436   19.946  -7.487  1.00 0.00 ? 81 DG  A "H3'"  3  
ATOM 4318  H "HO3'" . DG  A 1 13 ? 5.389   20.944  -7.305  1.00 0.00 ? 81 DG  A "HO3'" 3  
ATOM 4319  H "H2'"  . DG  A 1 13 ? 8.555   19.003  -5.677  1.00 0.00 ? 81 DG  A "H2'"  3  
ATOM 4320  H "H2''" . DG  A 1 13 ? 7.833   20.448  -4.823  1.00 0.00 ? 81 DG  A "H2''" 3  
ATOM 4321  H "H1'"  . DG  A 1 13 ? 6.003   19.461  -4.086  1.00 0.00 ? 81 DG  A "H1'"  3  
ATOM 4322  H H8     . DG  A 1 13 ? 9.317   18.268  -3.478  1.00 0.00 ? 81 DG  A H8     3  
ATOM 4323  H H1     . DG  A 1 13 ? 5.105   16.461  0.976   1.00 0.00 ? 81 DG  A H1     3  
ATOM 4324  H H21    . DG  A 1 13 ? 2.870   17.325  -1.504  1.00 0.00 ? 81 DG  A H21    3  
ATOM 4325  H H22    . DG  A 1 13 ? 3.113   16.406  -0.004  1.00 0.00 ? 81 DG  A H22    3  
ATOM 4326  O "O5'"  . DC  B 2 1  ? 0.374   14.723  8.039   1.00 0.00 ? 82 DC  B "O5'"  3  
ATOM 4327  C "C5'"  . DC  B 2 1  ? -0.251  15.594  7.154   1.00 0.00 ? 82 DC  B "C5'"  3  
ATOM 4328  C "C4'"  . DC  B 2 1  ? -0.220  15.141  5.684   1.00 0.00 ? 82 DC  B "C4'"  3  
ATOM 4329  O "O4'"  . DC  B 2 1  ? 1.008   15.387  5.047   1.00 0.00 ? 82 DC  B "O4'"  3  
ATOM 4330  C "C3'"  . DC  B 2 1  ? -0.598  13.654  5.452   1.00 0.00 ? 82 DC  B "C3'"  3  
ATOM 4331  O "O3'"  . DC  B 2 1  ? -2.012  13.483  5.210   1.00 0.00 ? 82 DC  B "O3'"  3  
ATOM 4332  C "C2'"  . DC  B 2 1  ? 0.185   13.281  4.160   1.00 0.00 ? 82 DC  B "C2'"  3  
ATOM 4333  C "C1'"  . DC  B 2 1  ? 1.104   14.549  3.917   1.00 0.00 ? 82 DC  B "C1'"  3  
ATOM 4334  N N1     . DC  B 2 1  ? 2.557   14.405  3.660   1.00 0.00 ? 82 DC  B N1     3  
ATOM 4335  C C2     . DC  B 2 1  ? 3.150   15.086  2.588   1.00 0.00 ? 82 DC  B C2     3  
ATOM 4336  O O2     . DC  B 2 1  ? 2.430   15.599  1.706   1.00 0.00 ? 82 DC  B O2     3  
ATOM 4337  N N3     . DC  B 2 1  ? 4.431   15.321  2.485   1.00 0.00 ? 82 DC  B N3     3  
ATOM 4338  C C4     . DC  B 2 1  ? 5.232   14.654  3.306   1.00 0.00 ? 82 DC  B C4     3  
ATOM 4339  N N4     . DC  B 2 1  ? 6.516   14.966  3.312   1.00 0.00 ? 82 DC  B N4     3  
ATOM 4340  C C5     . DC  B 2 1  ? 4.718   13.745  4.288   1.00 0.00 ? 82 DC  B C5     3  
ATOM 4341  C C6     . DC  B 2 1  ? 3.365   13.766  4.496   1.00 0.00 ? 82 DC  B C6     3  
ATOM 4342  H "H5'"  . DC  B 2 1  ? 0.331   16.503  7.299   1.00 0.00 ? 82 DC  B "H5'"  3  
ATOM 4343  H "H5''" . DC  B 2 1  ? -1.263  15.797  7.506   1.00 0.00 ? 82 DC  B "H5''" 3  
ATOM 4344  H "H4'"  . DC  B 2 1  ? -0.949  15.761  5.162   1.00 0.00 ? 82 DC  B "H4'"  3  
ATOM 4345  H "H3'"  . DC  B 2 1  ? -0.271  12.999  6.258   1.00 0.00 ? 82 DC  B "H3'"  3  
ATOM 4346  H "H2'"  . DC  B 2 1  ? 0.791   12.384  4.287   1.00 0.00 ? 82 DC  B "H2'"  3  
ATOM 4347  H "H2''" . DC  B 2 1  ? -0.533  13.115  3.357   1.00 0.00 ? 82 DC  B "H2''" 3  
ATOM 4348  H "H1'"  . DC  B 2 1  ? 0.636   14.945  3.017   1.00 0.00 ? 82 DC  B "H1'"  3  
ATOM 4349  H H41    . DC  B 2 1  ? 7.178   14.470  3.893   1.00 0.00 ? 82 DC  B H41    3  
ATOM 4350  H H42    . DC  B 2 1  ? 6.929   15.475  2.544   1.00 0.00 ? 82 DC  B H42    3  
ATOM 4351  H H5     . DC  B 2 1  ? 5.359   13.279  5.021   1.00 0.00 ? 82 DC  B H5     3  
ATOM 4352  H H6     . DC  B 2 1  ? 2.914   13.168  5.274   1.00 0.00 ? 82 DC  B H6     3  
ATOM 4353  H "HO5'" . DC  B 2 1  ? 1.268   14.642  7.699   1.00 0.00 ? 82 DC  B "HO5'" 3  
ATOM 4354  P P      . DG  B 2 2  ? -2.611  11.994  5.030   1.00 0.00 ? 83 DG  B P      3  
ATOM 4355  O OP1    . DG  B 2 2  ? -4.037  12.109  5.237   1.00 0.00 ? 83 DG  B OP1    3  
ATOM 4356  O OP2    . DG  B 2 2  ? -1.875  11.044  5.861   1.00 0.00 ? 83 DG  B OP2    3  
ATOM 4357  O "O5'"  . DG  B 2 2  ? -2.341  11.728  3.471   1.00 0.00 ? 83 DG  B "O5'"  3  
ATOM 4358  C "C5'"  . DG  B 2 2  ? -3.231  12.394  2.504   1.00 0.00 ? 83 DG  B "C5'"  3  
ATOM 4359  C "C4'"  . DG  B 2 2  ? -2.660  12.541  1.063   1.00 0.00 ? 83 DG  B "C4'"  3  
ATOM 4360  O "O4'"  . DG  B 2 2  ? -1.291  12.795  0.999   1.00 0.00 ? 83 DG  B "O4'"  3  
ATOM 4361  C "C3'"  . DG  B 2 2  ? -2.825  11.257  0.264   1.00 0.00 ? 83 DG  B "C3'"  3  
ATOM 4362  O "O3'"  . DG  B 2 2  ? -3.231  11.711  -1.000  1.00 0.00 ? 83 DG  B "O3'"  3  
ATOM 4363  C "C2'"  . DG  B 2 2  ? -1.424  10.702  0.164   1.00 0.00 ? 83 DG  B "C2'"  3  
ATOM 4364  C "C1'"  . DG  B 2 2  ? -0.605  11.997  0.137   1.00 0.00 ? 83 DG  B "C1'"  3  
ATOM 4365  N N9     . DG  B 2 2  ? 0.752   11.754  0.608   1.00 0.00 ? 83 DG  B N9     3  
ATOM 4366  C C8     . DG  B 2 2  ? 1.070   11.251  1.849   1.00 0.00 ? 83 DG  B C8     3  
ATOM 4367  N N7     . DG  B 2 2  ? 2.334   11.267  2.153   1.00 0.00 ? 83 DG  B N7     3  
ATOM 4368  C C5     . DG  B 2 2  ? 2.965   11.836  1.032   1.00 0.00 ? 83 DG  B C5     3  
ATOM 4369  C C6     . DG  B 2 2  ? 4.325   12.283  0.762   1.00 0.00 ? 83 DG  B C6     3  
ATOM 4370  O O6     . DG  B 2 2  ? 5.335   12.088  1.422   1.00 0.00 ? 83 DG  B O6     3  
ATOM 4371  N N1     . DG  B 2 2  ? 4.505   13.009  -0.412  1.00 0.00 ? 83 DG  B N1     3  
ATOM 4372  C C2     . DG  B 2 2  ? 3.416   13.315  -1.206  1.00 0.00 ? 83 DG  B C2     3  
ATOM 4373  N N2     . DG  B 2 2  ? 3.646   13.990  -2.289  1.00 0.00 ? 83 DG  B N2     3  
ATOM 4374  N N3     . DG  B 2 2  ? 2.190   12.905  -1.055  1.00 0.00 ? 83 DG  B N3     3  
ATOM 4375  C C4     . DG  B 2 2  ? 1.975   12.205  0.099   1.00 0.00 ? 83 DG  B C4     3  
ATOM 4376  H "H5'"  . DG  B 2 2  ? -3.493  13.334  2.989   1.00 0.00 ? 83 DG  B "H5'"  3  
ATOM 4377  H "H5''" . DG  B 2 2  ? -4.215  11.928  2.539   1.00 0.00 ? 83 DG  B "H5''" 3  
ATOM 4378  H "H4'"  . DG  B 2 2  ? -3.095  13.339  0.462   1.00 0.00 ? 83 DG  B "H4'"  3  
ATOM 4379  H "H3'"  . DG  B 2 2  ? -3.557  10.533  0.621   1.00 0.00 ? 83 DG  B "H3'"  3  
ATOM 4380  H "H2'"  . DG  B 2 2  ? -1.201  10.034  0.997   1.00 0.00 ? 83 DG  B "H2'"  3  
ATOM 4381  H "H2''" . DG  B 2 2  ? -1.264  10.185  -0.782  1.00 0.00 ? 83 DG  B "H2''" 3  
ATOM 4382  H "H1'"  . DG  B 2 2  ? -0.626  12.345  -0.896  1.00 0.00 ? 83 DG  B "H1'"  3  
ATOM 4383  H H8     . DG  B 2 2  ? 0.258   10.984  2.507   1.00 0.00 ? 83 DG  B H8     3  
ATOM 4384  H H1     . DG  B 2 2  ? 5.444   13.334  -0.589  1.00 0.00 ? 83 DG  B H1     3  
ATOM 4385  H H21    . DG  B 2 2  ? 2.816   14.021  -2.864  1.00 0.00 ? 83 DG  B H21    3  
ATOM 4386  H H22    . DG  B 2 2  ? 4.591   14.192  -2.580  1.00 0.00 ? 83 DG  B H22    3  
ATOM 4387  P P      . DG  B 2 3  ? -3.777  10.752  -2.109  1.00 0.00 ? 84 DG  B P      3  
ATOM 4388  O OP1    . DG  B 2 3  ? -4.993  11.352  -2.643  1.00 0.00 ? 84 DG  B OP1    3  
ATOM 4389  O OP2    . DG  B 2 3  ? -3.820  9.390   -1.509  1.00 0.00 ? 84 DG  B OP2    3  
ATOM 4390  O "O5'"  . DG  B 2 3  ? -2.692  10.887  -3.224  1.00 0.00 ? 84 DG  B "O5'"  3  
ATOM 4391  C "C5'"  . DG  B 2 3  ? -2.586  12.153  -3.878  1.00 0.00 ? 84 DG  B "C5'"  3  
ATOM 4392  C "C4'"  . DG  B 2 3  ? -1.485  12.224  -4.962  1.00 0.00 ? 84 DG  B "C4'"  3  
ATOM 4393  O "O4'"  . DG  B 2 3  ? -0.224  12.158  -4.346  1.00 0.00 ? 84 DG  B "O4'"  3  
ATOM 4394  C "C3'"  . DG  B 2 3  ? -1.534  11.146  -6.055  1.00 0.00 ? 84 DG  B "C3'"  3  
ATOM 4395  O "O3'"  . DG  B 2 3  ? -1.196  11.932  -7.210  1.00 0.00 ? 84 DG  B "O3'"  3  
ATOM 4396  C "C2'"  . DG  B 2 3  ? -0.513  10.130  -5.429  1.00 0.00 ? 84 DG  B "C2'"  3  
ATOM 4397  C "C1'"  . DG  B 2 3  ? 0.551   11.089  -4.868  1.00 0.00 ? 84 DG  B "C1'"  3  
ATOM 4398  N N9     . DG  B 2 3  ? 1.230   10.519  -3.706  1.00 0.00 ? 84 DG  B N9     3  
ATOM 4399  C C8     . DG  B 2 3  ? 0.673   9.942   -2.594  1.00 0.00 ? 84 DG  B C8     3  
ATOM 4400  N N7     . DG  B 2 3  ? 1.446   9.469   -1.708  1.00 0.00 ? 84 DG  B N7     3  
ATOM 4401  C C5     . DG  B 2 3  ? 2.749   9.773   -2.229  1.00 0.00 ? 84 DG  B C5     3  
ATOM 4402  C C6     . DG  B 2 3  ? 4.100   9.735   -1.675  1.00 0.00 ? 84 DG  B C6     3  
ATOM 4403  O O6     . DG  B 2 3  ? 4.542   9.192   -0.615  1.00 0.00 ? 84 DG  B O6     3  
ATOM 4404  N N1     . DG  B 2 3  ? 5.067   10.355  -2.478  1.00 0.00 ? 84 DG  B N1     3  
ATOM 4405  C C2     . DG  B 2 3  ? 4.856   10.909  -3.681  1.00 0.00 ? 84 DG  B C2     3  
ATOM 4406  N N2     . DG  B 2 3  ? 5.850   11.349  -4.423  1.00 0.00 ? 84 DG  B N2     3  
ATOM 4407  N N3     . DG  B 2 3  ? 3.666   10.920  -4.220  1.00 0.00 ? 84 DG  B N3     3  
ATOM 4408  C C4     . DG  B 2 3  ? 2.567   10.418  -3.464  1.00 0.00 ? 84 DG  B C4     3  
ATOM 4409  H "H5'"  . DG  B 2 3  ? -2.330  12.924  -3.152  1.00 0.00 ? 84 DG  B "H5'"  3  
ATOM 4410  H "H5''" . DG  B 2 3  ? -3.540  12.402  -4.343  1.00 0.00 ? 84 DG  B "H5''" 3  
ATOM 4411  H "H4'"  . DG  B 2 3  ? -1.456  13.187  -5.474  1.00 0.00 ? 84 DG  B "H4'"  3  
ATOM 4412  H "H3'"  . DG  B 2 3  ? -2.513  10.678  -6.155  1.00 0.00 ? 84 DG  B "H3'"  3  
ATOM 4413  H "H2'"  . DG  B 2 3  ? -1.125  9.650   -4.667  1.00 0.00 ? 84 DG  B "H2'"  3  
ATOM 4414  H "H2''" . DG  B 2 3  ? -0.179  9.301   -6.052  1.00 0.00 ? 84 DG  B "H2''" 3  
ATOM 4415  H "H1'"  . DG  B 2 3  ? 1.180   11.468  -5.674  1.00 0.00 ? 84 DG  B "H1'"  3  
ATOM 4416  H H8     . DG  B 2 3  ? -0.404  9.861   -2.582  1.00 0.00 ? 84 DG  B H8     3  
ATOM 4417  H H1     . DG  B 2 3  ? 6.015   10.328  -2.130  1.00 0.00 ? 84 DG  B H1     3  
ATOM 4418  H H21    . DG  B 2 3  ? 5.654   11.630  -5.373  1.00 0.00 ? 84 DG  B H21    3  
ATOM 4419  H H22    . DG  B 2 3  ? 6.810   11.163  -4.170  1.00 0.00 ? 84 DG  B H22    3  
ATOM 4420  P P      . DG  B 2 4  ? -1.007  11.295  -8.558  1.00 0.00 ? 85 DG  B P      3  
ATOM 4421  O OP1    . DG  B 2 4  ? -0.626  12.353  -9.535  1.00 0.00 ? 85 DG  B OP1    3  
ATOM 4422  O OP2    . DG  B 2 4  ? -2.018  10.348  -8.961  1.00 0.00 ? 85 DG  B OP2    3  
ATOM 4423  O "O5'"  . DG  B 2 4  ? 0.235   10.432  -8.235  1.00 0.00 ? 85 DG  B "O5'"  3  
ATOM 4424  C "C5'"  . DG  B 2 4  ? 1.615   10.672  -8.405  1.00 0.00 ? 85 DG  B "C5'"  3  
ATOM 4425  C "C4'"  . DG  B 2 4  ? 2.434   9.448   -8.346  1.00 0.00 ? 85 DG  B "C4'"  3  
ATOM 4426  O "O4'"  . DG  B 2 4  ? 2.630   9.094   -7.000  1.00 0.00 ? 85 DG  B "O4'"  3  
ATOM 4427  C "C3'"  . DG  B 2 4  ? 1.826   8.209   -8.899  1.00 0.00 ? 85 DG  B "C3'"  3  
ATOM 4428  O "O3'"  . DG  B 2 4  ? 2.701   7.463   -9.741  1.00 0.00 ? 85 DG  B "O3'"  3  
ATOM 4429  C "C2'"  . DG  B 2 4  ? 1.410   7.342   -7.721  1.00 0.00 ? 85 DG  B "C2'"  3  
ATOM 4430  C "C1'"  . DG  B 2 4  ? 2.588   7.686   -6.843  1.00 0.00 ? 85 DG  B "C1'"  3  
ATOM 4431  N N9     . DG  B 2 4  ? 2.460   7.291   -5.415  1.00 0.00 ? 85 DG  B N9     3  
ATOM 4432  C C8     . DG  B 2 4  ? 1.382   6.875   -4.745  1.00 0.00 ? 85 DG  B C8     3  
ATOM 4433  N N7     . DG  B 2 4  ? 1.619   6.383   -3.535  1.00 0.00 ? 85 DG  B N7     3  
ATOM 4434  C C5     . DG  B 2 4  ? 2.972   6.592   -3.303  1.00 0.00 ? 85 DG  B C5     3  
ATOM 4435  C C6     . DG  B 2 4  ? 3.919   6.269   -2.231  1.00 0.00 ? 85 DG  B C6     3  
ATOM 4436  O O6     . DG  B 2 4  ? 3.857   5.743   -1.167  1.00 0.00 ? 85 DG  B O6     3  
ATOM 4437  N N1     . DG  B 2 4  ? 5.194   6.687   -2.546  1.00 0.00 ? 85 DG  B N1     3  
ATOM 4438  C C2     . DG  B 2 4  ? 5.595   7.111   -3.788  1.00 0.00 ? 85 DG  B C2     3  
ATOM 4439  N N2     . DG  B 2 4  ? 6.853   7.376   -3.907  1.00 0.00 ? 85 DG  B N2     3  
ATOM 4440  N N3     . DG  B 2 4  ? 4.799   7.310   -4.791  1.00 0.00 ? 85 DG  B N3     3  
ATOM 4441  C C4     . DG  B 2 4  ? 3.472   7.121   -4.512  1.00 0.00 ? 85 DG  B C4     3  
ATOM 4442  H "H5'"  . DG  B 2 4  ? 1.917   11.439  -7.692  1.00 0.00 ? 85 DG  B "H5'"  3  
ATOM 4443  H "H5''" . DG  B 2 4  ? 1.641   11.217  -9.349  1.00 0.00 ? 85 DG  B "H5''" 3  
ATOM 4444  H "H4'"  . DG  B 2 4  ? 3.421   9.607   -8.778  1.00 0.00 ? 85 DG  B "H4'"  3  
ATOM 4445  H "H3'"  . DG  B 2 4  ? 0.986   8.497   -9.533  1.00 0.00 ? 85 DG  B "H3'"  3  
ATOM 4446  H "H2'"  . DG  B 2 4  ? 0.476   7.676   -7.272  1.00 0.00 ? 85 DG  B "H2'"  3  
ATOM 4447  H "H2''" . DG  B 2 4  ? 1.379   6.305   -8.054  1.00 0.00 ? 85 DG  B "H2''" 3  
ATOM 4448  H "H1'"  . DG  B 2 4  ? 3.441   7.153   -7.262  1.00 0.00 ? 85 DG  B "H1'"  3  
ATOM 4449  H H8     . DG  B 2 4  ? 0.400   6.820   -5.191  1.00 0.00 ? 85 DG  B H8     3  
ATOM 4450  H H1     . DG  B 2 4  ? 5.931   6.638   -1.858  1.00 0.00 ? 85 DG  B H1     3  
ATOM 4451  H H21    . DG  B 2 4  ? 7.305   7.686   -4.756  1.00 0.00 ? 85 DG  B H21    3  
ATOM 4452  H H22    . DG  B 2 4  ? 7.370   7.298   -3.042  1.00 0.00 ? 85 DG  B H22    3  
ATOM 4453  P P      . DG  B 2 5  ? 3.187   8.052   -11.152 1.00 0.00 ? 86 DG  B P      3  
ATOM 4454  O OP1    . DG  B 2 5  ? 3.143   9.496   -11.075 1.00 0.00 ? 86 DG  B OP1    3  
ATOM 4455  O OP2    . DG  B 2 5  ? 2.514   7.363   -12.286 1.00 0.00 ? 86 DG  B OP2    3  
ATOM 4456  O "O5'"  . DG  B 2 5  ? 4.698   7.675   -11.130 1.00 0.00 ? 86 DG  B "O5'"  3  
ATOM 4457  C "C5'"  . DG  B 2 5  ? 5.720   8.395   -10.441 1.00 0.00 ? 86 DG  B "C5'"  3  
ATOM 4458  C "C4'"  . DG  B 2 5  ? 7.105   7.668   -10.615 1.00 0.00 ? 86 DG  B "C4'"  3  
ATOM 4459  O "O4'"  . DG  B 2 5  ? 7.638   6.991   -9.444  1.00 0.00 ? 86 DG  B "O4'"  3  
ATOM 4460  C "C3'"  . DG  B 2 5  ? 7.198   6.562   -11.706 1.00 0.00 ? 86 DG  B "C3'"  3  
ATOM 4461  O "O3'"  . DG  B 2 5  ? 8.542   6.574   -12.226 1.00 0.00 ? 86 DG  B "O3'"  3  
ATOM 4462  C "C2'"  . DG  B 2 5  ? 6.854   5.264   -11.056 1.00 0.00 ? 86 DG  B "C2'"  3  
ATOM 4463  C "C1'"  . DG  B 2 5  ? 7.246   5.613   -9.594  1.00 0.00 ? 86 DG  B "C1'"  3  
ATOM 4464  N N9     . DG  B 2 5  ? 6.249   5.274   -8.582  1.00 0.00 ? 86 DG  B N9     3  
ATOM 4465  C C8     . DG  B 2 5  ? 4.893   5.293   -8.702  1.00 0.00 ? 86 DG  B C8     3  
ATOM 4466  N N7     . DG  B 2 5  ? 4.253   4.740   -7.700  1.00 0.00 ? 86 DG  B N7     3  
ATOM 4467  C C5     . DG  B 2 5  ? 5.306   4.570   -6.741  1.00 0.00 ? 86 DG  B C5     3  
ATOM 4468  C C6     . DG  B 2 5  ? 5.358   4.140   -5.388  1.00 0.00 ? 86 DG  B C6     3  
ATOM 4469  O O6     . DG  B 2 5  ? 4.510   3.823   -4.605  1.00 0.00 ? 86 DG  B O6     3  
ATOM 4470  N N1     . DG  B 2 5  ? 6.664   4.068   -4.866  1.00 0.00 ? 86 DG  B N1     3  
ATOM 4471  C C2     . DG  B 2 5  ? 7.780   4.398   -5.569  1.00 0.00 ? 86 DG  B C2     3  
ATOM 4472  N N2     . DG  B 2 5  ? 8.964   4.075   -5.078  1.00 0.00 ? 86 DG  B N2     3  
ATOM 4473  N N3     . DG  B 2 5  ? 7.764   4.873   -6.748  1.00 0.00 ? 86 DG  B N3     3  
ATOM 4474  C C4     . DG  B 2 5  ? 6.524   4.910   -7.268  1.00 0.00 ? 86 DG  B C4     3  
ATOM 4475  H "H5'"  . DG  B 2 5  ? 5.573   8.279   -9.367  1.00 0.00 ? 86 DG  B "H5'"  3  
ATOM 4476  H "H5''" . DG  B 2 5  ? 5.764   9.478   -10.563 1.00 0.00 ? 86 DG  B "H5''" 3  
ATOM 4477  H "H4'"  . DG  B 2 5  ? 7.821   8.426   -10.932 1.00 0.00 ? 86 DG  B "H4'"  3  
ATOM 4478  H "H3'"  . DG  B 2 5  ? 6.589   6.704   -12.600 1.00 0.00 ? 86 DG  B "H3'"  3  
ATOM 4479  H "H2'"  . DG  B 2 5  ? 5.880   4.784   -11.154 1.00 0.00 ? 86 DG  B "H2'"  3  
ATOM 4480  H "H2''" . DG  B 2 5  ? 7.504   4.435   -11.340 1.00 0.00 ? 86 DG  B "H2''" 3  
ATOM 4481  H "H1'"  . DG  B 2 5  ? 8.161   5.031   -9.479  1.00 0.00 ? 86 DG  B "H1'"  3  
ATOM 4482  H H8     . DG  B 2 5  ? 4.411   5.493   -9.648  1.00 0.00 ? 86 DG  B H8     3  
ATOM 4483  H H1     . DG  B 2 5  ? 6.805   3.775   -3.910  1.00 0.00 ? 86 DG  B H1     3  
ATOM 4484  H H21    . DG  B 2 5  ? 9.819   4.373   -5.524  1.00 0.00 ? 86 DG  B H21    3  
ATOM 4485  H H22    . DG  B 2 5  ? 9.063   3.662   -4.162  1.00 0.00 ? 86 DG  B H22    3  
ATOM 4486  P P      . DA  B 2 6  ? 9.132   5.537   -13.386 1.00 0.00 ? 87 DA  B P      3  
ATOM 4487  O OP1    . DA  B 2 6  ? 10.219  6.230   -14.066 1.00 0.00 ? 87 DA  B OP1    3  
ATOM 4488  O OP2    . DA  B 2 6  ? 8.028   5.028   -14.226 1.00 0.00 ? 87 DA  B OP2    3  
ATOM 4489  O "O5'"  . DA  B 2 6  ? 9.671   4.289   -12.560 1.00 0.00 ? 87 DA  B "O5'"  3  
ATOM 4490  C "C5'"  . DA  B 2 6  ? 10.880  4.398   -11.715 1.00 0.00 ? 87 DA  B "C5'"  3  
ATOM 4491  C "C4'"  . DA  B 2 6  ? 11.025  3.180   -10.794 1.00 0.00 ? 87 DA  B "C4'"  3  
ATOM 4492  O "O4'"  . DA  B 2 6  ? 9.897   2.985   -9.892  1.00 0.00 ? 87 DA  B "O4'"  3  
ATOM 4493  C "C3'"  . DA  B 2 6  ? 11.240  1.777   -11.446 1.00 0.00 ? 87 DA  B "C3'"  3  
ATOM 4494  O "O3'"  . DA  B 2 6  ? 12.153  1.123   -10.548 1.00 0.00 ? 87 DA  B "O3'"  3  
ATOM 4495  C "C2'"  . DA  B 2 6  ? 9.796   1.275   -11.322 1.00 0.00 ? 87 DA  B "C2'"  3  
ATOM 4496  C "C1'"  . DA  B 2 6  ? 9.467   1.594   -9.895  1.00 0.00 ? 87 DA  B "C1'"  3  
ATOM 4497  N N9     . DA  B 2 6  ? 8.010   1.544   -9.493  1.00 0.00 ? 87 DA  B N9     3  
ATOM 4498  C C8     . DA  B 2 6  ? 6.884   1.685   -10.290 1.00 0.00 ? 87 DA  B C8     3  
ATOM 4499  N N7     . DA  B 2 6  ? 5.704   1.571   -9.676  1.00 0.00 ? 87 DA  B N7     3  
ATOM 4500  C C5     . DA  B 2 6  ? 6.097   1.383   -8.338  1.00 0.00 ? 87 DA  B C5     3  
ATOM 4501  C C6     . DA  B 2 6  ? 5.411   1.044   -7.143  1.00 0.00 ? 87 DA  B C6     3  
ATOM 4502  N N6     . DA  B 2 6  ? 4.112   0.948   -7.090  1.00 0.00 ? 87 DA  B N6     3  
ATOM 4503  N N1     . DA  B 2 6  ? 6.087   0.874   -5.989  1.00 0.00 ? 87 DA  B N1     3  
ATOM 4504  C C2     . DA  B 2 6  ? 7.405   0.850   -6.078  1.00 0.00 ? 87 DA  B C2     3  
ATOM 4505  N N3     . DA  B 2 6  ? 8.189   1.063   -7.138  1.00 0.00 ? 87 DA  B N3     3  
ATOM 4506  C C4     . DA  B 2 6  ? 7.439   1.384   -8.242  1.00 0.00 ? 87 DA  B C4     3  
ATOM 4507  H "H5'"  . DA  B 2 6  ? 10.893  5.342   -11.172 1.00 0.00 ? 87 DA  B "H5'"  3  
ATOM 4508  H "H5''" . DA  B 2 6  ? 11.730  4.396   -12.398 1.00 0.00 ? 87 DA  B "H5''" 3  
ATOM 4509  H "H4'"  . DA  B 2 6  ? 11.949  3.440   -10.279 1.00 0.00 ? 87 DA  B "H4'"  3  
ATOM 4510  H "H3'"  . DA  B 2 6  ? 11.503  1.768   -12.504 1.00 0.00 ? 87 DA  B "H3'"  3  
ATOM 4511  H "H2'"  . DA  B 2 6  ? 9.159   1.852   -11.992 1.00 0.00 ? 87 DA  B "H2'"  3  
ATOM 4512  H "H2''" . DA  B 2 6  ? 9.672   0.207   -11.496 1.00 0.00 ? 87 DA  B "H2''" 3  
ATOM 4513  H "H1'"  . DA  B 2 6  ? 10.018  0.897   -9.262  1.00 0.00 ? 87 DA  B "H1'"  3  
ATOM 4514  H H8     . DA  B 2 6  ? 6.920   1.914   -11.345 1.00 0.00 ? 87 DA  B H8     3  
ATOM 4515  H H61    . DA  B 2 6  ? 3.730   0.859   -6.159  1.00 0.00 ? 87 DA  B H61    3  
ATOM 4516  H H62    . DA  B 2 6  ? 3.495   0.984   -7.888  1.00 0.00 ? 87 DA  B H62    3  
ATOM 4517  H H2     . DA  B 2 6  ? 7.949   0.672   -5.162  1.00 0.00 ? 87 DA  B H2     3  
ATOM 4518  P P      . DT  B 2 7  ? 12.494  -0.457  -10.694 1.00 0.00 ? 88 DT  B P      3  
ATOM 4519  O OP1    . DT  B 2 7  ? 13.913  -0.547  -10.313 1.00 0.00 ? 88 DT  B OP1    3  
ATOM 4520  O OP2    . DT  B 2 7  ? 12.046  -1.069  -11.893 1.00 0.00 ? 88 DT  B OP2    3  
ATOM 4521  O "O5'"  . DT  B 2 7  ? 11.687  -1.133  -9.501  1.00 0.00 ? 88 DT  B "O5'"  3  
ATOM 4522  C "C5'"  . DT  B 2 7  ? 11.778  -2.500  -9.186  1.00 0.00 ? 88 DT  B "C5'"  3  
ATOM 4523  C "C4'"  . DT  B 2 7  ? 11.747  -2.736  -7.638  1.00 0.00 ? 88 DT  B "C4'"  3  
ATOM 4524  O "O4'"  . DT  B 2 7  ? 10.564  -2.061  -7.053  1.00 0.00 ? 88 DT  B "O4'"  3  
ATOM 4525  C "C3'"  . DT  B 2 7  ? 11.621  -4.233  -7.400  1.00 0.00 ? 88 DT  B "C3'"  3  
ATOM 4526  O "O3'"  . DT  B 2 7  ? 12.036  -4.464  -6.061  1.00 0.00 ? 88 DT  B "O3'"  3  
ATOM 4527  C "C2'"  . DT  B 2 7  ? 10.147  -4.419  -7.625  1.00 0.00 ? 88 DT  B "C2'"  3  
ATOM 4528  C "C1'"  . DT  B 2 7  ? 9.618   -3.179  -6.915  1.00 0.00 ? 88 DT  B "C1'"  3  
ATOM 4529  N N1     . DT  B 2 7  ? 8.236   -2.751  -7.301  1.00 0.00 ? 88 DT  B N1     3  
ATOM 4530  C C2     . DT  B 2 7  ? 7.159   -2.899  -6.415  1.00 0.00 ? 88 DT  B C2     3  
ATOM 4531  O O2     . DT  B 2 7  ? 7.284   -3.160  -5.220  1.00 0.00 ? 88 DT  B O2     3  
ATOM 4532  N N3     . DT  B 2 7  ? 5.913   -2.670  -7.022  1.00 0.00 ? 88 DT  B N3     3  
ATOM 4533  C C4     . DT  B 2 7  ? 5.663   -2.277  -8.391  1.00 0.00 ? 88 DT  B C4     3  
ATOM 4534  O O4     . DT  B 2 7  ? 4.482   -2.143  -8.726  1.00 0.00 ? 88 DT  B O4     3  
ATOM 4535  C C5     . DT  B 2 7  ? 6.860   -2.216  -9.262  1.00 0.00 ? 88 DT  B C5     3  
ATOM 4536  C C7     . DT  B 2 7  ? 6.891   -1.828  -10.681 1.00 0.00 ? 88 DT  B C7     3  
ATOM 4537  C C6     . DT  B 2 7  ? 8.084   -2.402  -8.632  1.00 0.00 ? 88 DT  B C6     3  
ATOM 4538  H "H5'"  . DT  B 2 7  ? 12.689  -2.867  -9.657  1.00 0.00 ? 88 DT  B "H5'"  3  
ATOM 4539  H "H5''" . DT  B 2 7  ? 10.981  -2.888  -9.821  1.00 0.00 ? 88 DT  B "H5''" 3  
ATOM 4540  H "H4'"  . DT  B 2 7  ? 12.651  -2.296  -7.218  1.00 0.00 ? 88 DT  B "H4'"  3  
ATOM 4541  H "H3'"  . DT  B 2 7  ? 12.220  -4.837  -8.081  1.00 0.00 ? 88 DT  B "H3'"  3  
ATOM 4542  H "H2'"  . DT  B 2 7  ? 9.853   -4.568  -8.664  1.00 0.00 ? 88 DT  B "H2'"  3  
ATOM 4543  H "H2''" . DT  B 2 7  ? 9.700   -5.243  -7.069  1.00 0.00 ? 88 DT  B "H2''" 3  
ATOM 4544  H "H1'"  . DT  B 2 7  ? 9.569   -3.478  -5.868  1.00 0.00 ? 88 DT  B "H1'"  3  
ATOM 4545  H H3     . DT  B 2 7  ? 5.116   -2.703  -6.403  1.00 0.00 ? 88 DT  B H3     3  
ATOM 4546  H H71    . DT  B 2 7  ? 6.172   -1.042  -10.913 1.00 0.00 ? 88 DT  B H71    3  
ATOM 4547  H H72    . DT  B 2 7  ? 7.885   -1.455  -10.927 1.00 0.00 ? 88 DT  B H72    3  
ATOM 4548  H H73    . DT  B 2 7  ? 6.788   -2.687  -11.344 1.00 0.00 ? 88 DT  B H73    3  
ATOM 4549  H H6     . DT  B 2 7  ? 8.942   -2.364  -9.285  1.00 0.00 ? 88 DT  B H6     3  
ATOM 4550  P P      . DT  B 2 8  ? 12.081  -5.964  -5.509  1.00 0.00 ? 89 DT  B P      3  
ATOM 4551  O OP1    . DT  B 2 8  ? 13.113  -5.849  -4.466  1.00 0.00 ? 89 DT  B OP1    3  
ATOM 4552  O OP2    . DT  B 2 8  ? 12.190  -6.837  -6.637  1.00 0.00 ? 89 DT  B OP2    3  
ATOM 4553  O "O5'"  . DT  B 2 8  ? 10.650  -6.111  -4.828  1.00 0.00 ? 89 DT  B "O5'"  3  
ATOM 4554  C "C5'"  . DT  B 2 8  ? 10.493  -6.355  -3.413  1.00 0.00 ? 89 DT  B "C5'"  3  
ATOM 4555  C "C4'"  . DT  B 2 8  ? 9.338   -7.272  -3.013  1.00 0.00 ? 89 DT  B "C4'"  3  
ATOM 4556  O "O4'"  . DT  B 2 8  ? 8.153   -6.660  -3.605  1.00 0.00 ? 89 DT  B "O4'"  3  
ATOM 4557  C "C3'"  . DT  B 2 8  ? 9.531   -8.755  -3.536  1.00 0.00 ? 89 DT  B "C3'"  3  
ATOM 4558  O "O3'"  . DT  B 2 8  ? 8.953   -9.706  -2.669  1.00 0.00 ? 89 DT  B "O3'"  3  
ATOM 4559  C "C2'"  . DT  B 2 8  ? 8.782   -8.628  -4.849  1.00 0.00 ? 89 DT  B "C2'"  3  
ATOM 4560  C "C1'"  . DT  B 2 8  ? 7.654   -7.650  -4.532  1.00 0.00 ? 89 DT  B "C1'"  3  
ATOM 4561  N N1     . DT  B 2 8  ? 6.920   -7.016  -5.638  1.00 0.00 ? 89 DT  B N1     3  
ATOM 4562  C C2     . DT  B 2 8  ? 5.547   -6.645  -5.415  1.00 0.00 ? 89 DT  B C2     3  
ATOM 4563  O O2     . DT  B 2 8  ? 4.994   -6.900  -4.372  1.00 0.00 ? 89 DT  B O2     3  
ATOM 4564  N N3     . DT  B 2 8  ? 4.780   -6.219  -6.497  1.00 0.00 ? 89 DT  B N3     3  
ATOM 4565  C C4     . DT  B 2 8  ? 5.270   -5.951  -7.756  1.00 0.00 ? 89 DT  B C4     3  
ATOM 4566  O O4     . DT  B 2 8  ? 4.606   -5.408  -8.601  1.00 0.00 ? 89 DT  B O4     3  
ATOM 4567  C C5     . DT  B 2 8  ? 6.610   -6.372  -7.923  1.00 0.00 ? 89 DT  B C5     3  
ATOM 4568  C C7     . DT  B 2 8  ? 7.335   -6.179  -9.244  1.00 0.00 ? 89 DT  B C7     3  
ATOM 4569  C C6     . DT  B 2 8  ? 7.450   -6.788  -6.895  1.00 0.00 ? 89 DT  B C6     3  
ATOM 4570  H "H5'"  . DT  B 2 8  ? 10.373  -5.388  -2.926  1.00 0.00 ? 89 DT  B "H5'"  3  
ATOM 4571  H "H5''" . DT  B 2 8  ? 11.353  -6.970  -3.147  1.00 0.00 ? 89 DT  B "H5''" 3  
ATOM 4572  H "H4'"  . DT  B 2 8  ? 9.273   -7.361  -1.929  1.00 0.00 ? 89 DT  B "H4'"  3  
ATOM 4573  H "H3'"  . DT  B 2 8  ? 10.546  -9.061  -3.788  1.00 0.00 ? 89 DT  B "H3'"  3  
ATOM 4574  H "H2'"  . DT  B 2 8  ? 9.568   -8.205  -5.474  1.00 0.00 ? 89 DT  B "H2'"  3  
ATOM 4575  H "H2''" . DT  B 2 8  ? 8.385   -9.557  -5.258  1.00 0.00 ? 89 DT  B "H2''" 3  
ATOM 4576  H "H1'"  . DT  B 2 8  ? 6.887   -8.212  -3.999  1.00 0.00 ? 89 DT  B "H1'"  3  
ATOM 4577  H H3     . DT  B 2 8  ? 3.807   -6.003  -6.333  1.00 0.00 ? 89 DT  B H3     3  
ATOM 4578  H H71    . DT  B 2 8  ? 6.945   -6.881  -9.981  1.00 0.00 ? 89 DT  B H71    3  
ATOM 4579  H H72    . DT  B 2 8  ? 7.058   -5.159  -9.507  1.00 0.00 ? 89 DT  B H72    3  
ATOM 4580  H H73    . DT  B 2 8  ? 8.393   -6.369  -9.064  1.00 0.00 ? 89 DT  B H73    3  
ATOM 4581  H H6     . DT  B 2 8  ? 8.503   -6.985  -7.036  1.00 0.00 ? 89 DT  B H6     3  
ATOM 4582  P P      . DA  B 2 9  ? 9.767   -10.235 -1.452  1.00 0.00 ? 90 DA  B P      3  
ATOM 4583  O OP1    . DA  B 2 9  ? 10.745  -9.268  -0.811  1.00 0.00 ? 90 DA  B OP1    3  
ATOM 4584  O OP2    . DA  B 2 9  ? 10.306  -11.555 -1.857  1.00 0.00 ? 90 DA  B OP2    3  
ATOM 4585  O "O5'"  . DA  B 2 9  ? 8.563   -10.510 -0.374  1.00 0.00 ? 90 DA  B "O5'"  3  
ATOM 4586  C "C5'"  . DA  B 2 9  ? 7.524   -9.628  -0.079  1.00 0.00 ? 90 DA  B "C5'"  3  
ATOM 4587  C "C4'"  . DA  B 2 9  ? 6.145   -10.233 -0.572  1.00 0.00 ? 90 DA  B "C4'"  3  
ATOM 4588  O "O4'"  . DA  B 2 9  ? 5.916   -9.911  -1.935  1.00 0.00 ? 90 DA  B "O4'"  3  
ATOM 4589  C "C3'"  . DA  B 2 9  ? 5.875   -11.730 -0.441  1.00 0.00 ? 90 DA  B "C3'"  3  
ATOM 4590  O "O3'"  . DA  B 2 9  ? 4.513   -11.947 0.028   1.00 0.00 ? 90 DA  B "O3'"  3  
ATOM 4591  C "C2'"  . DA  B 2 9  ? 5.869   -12.240 -1.897  1.00 0.00 ? 90 DA  B "C2'"  3  
ATOM 4592  C "C1'"  . DA  B 2 9  ? 5.216   -10.992 -2.510  1.00 0.00 ? 90 DA  B "C1'"  3  
ATOM 4593  N N9     . DA  B 2 9  ? 5.229   -10.840 -3.957  1.00 0.00 ? 90 DA  B N9     3  
ATOM 4594  C C8     . DA  B 2 9  ? 6.309   -11.148 -4.809  1.00 0.00 ? 90 DA  B C8     3  
ATOM 4595  N N7     . DA  B 2 9  ? 6.071   -10.752 -6.040  1.00 0.00 ? 90 DA  B N7     3  
ATOM 4596  C C5     . DA  B 2 9  ? 4.799   -10.121 -5.916  1.00 0.00 ? 90 DA  B C5     3  
ATOM 4597  C C6     . DA  B 2 9  ? 3.914   -9.491  -6.863  1.00 0.00 ? 90 DA  B C6     3  
ATOM 4598  N N6     . DA  B 2 9  ? 4.294   -9.216  -8.092  1.00 0.00 ? 90 DA  B N6     3  
ATOM 4599  N N1     . DA  B 2 9  ? 2.742   -8.945  -6.529  1.00 0.00 ? 90 DA  B N1     3  
ATOM 4600  C C2     . DA  B 2 9  ? 2.428   -9.131  -5.292  1.00 0.00 ? 90 DA  B C2     3  
ATOM 4601  N N3     . DA  B 2 9  ? 3.002   -9.795  -4.350  1.00 0.00 ? 90 DA  B N3     3  
ATOM 4602  C C4     . DA  B 2 9  ? 4.270   -10.225 -4.684  1.00 0.00 ? 90 DA  B C4     3  
ATOM 4603  H "H5'"  . DA  B 2 9  ? 7.713   -8.620  -0.446  1.00 0.00 ? 90 DA  B "H5'"  3  
ATOM 4604  H "H5''" . DA  B 2 9  ? 7.444   -9.569  1.006   1.00 0.00 ? 90 DA  B "H5''" 3  
ATOM 4605  H "H4'"  . DA  B 2 9  ? 5.419   -9.733  0.070   1.00 0.00 ? 90 DA  B "H4'"  3  
ATOM 4606  H "H3'"  . DA  B 2 9  ? 6.627   -12.065 0.273   1.00 0.00 ? 90 DA  B "H3'"  3  
ATOM 4607  H "H2'"  . DA  B 2 9  ? 6.887   -12.362 -2.267  1.00 0.00 ? 90 DA  B "H2'"  3  
ATOM 4608  H "H2''" . DA  B 2 9  ? 5.338   -13.171 -2.101  1.00 0.00 ? 90 DA  B "H2''" 3  
ATOM 4609  H "H1'"  . DA  B 2 9  ? 4.195   -11.008 -2.127  1.00 0.00 ? 90 DA  B "H1'"  3  
ATOM 4610  H H8     . DA  B 2 9  ? 7.184   -11.661 -4.437  1.00 0.00 ? 90 DA  B H8     3  
ATOM 4611  H H61    . DA  B 2 9  ? 3.641   -8.781  -8.728  1.00 0.00 ? 90 DA  B H61    3  
ATOM 4612  H H62    . DA  B 2 9  ? 5.158   -9.630  -8.410  1.00 0.00 ? 90 DA  B H62    3  
ATOM 4613  H H2     . DA  B 2 9  ? 1.449   -8.734  -5.068  1.00 0.00 ? 90 DA  B H2     3  
ATOM 4614  P P      . DG  B 2 10 ? 3.972   -13.242 0.796   1.00 0.00 ? 91 DG  B P      3  
ATOM 4615  O OP1    . DG  B 2 10 ? 3.906   -13.033 2.207   1.00 0.00 ? 91 DG  B OP1    3  
ATOM 4616  O OP2    . DG  B 2 10 ? 4.788   -14.367 0.312   1.00 0.00 ? 91 DG  B OP2    3  
ATOM 4617  O "O5'"  . DG  B 2 10 ? 2.595   -13.278 0.177   1.00 0.00 ? 91 DG  B "O5'"  3  
ATOM 4618  C "C5'"  . DG  B 2 10 ? 1.679   -12.260 0.492   1.00 0.00 ? 91 DG  B "C5'"  3  
ATOM 4619  C "C4'"  . DG  B 2 10 ? 0.340   -12.412 -0.089  1.00 0.00 ? 91 DG  B "C4'"  3  
ATOM 4620  O "O4'"  . DG  B 2 10 ? 0.362   -12.063 -1.457  1.00 0.00 ? 91 DG  B "O4'"  3  
ATOM 4621  C "C3'"  . DG  B 2 10 ? -0.131  -13.960 0.032   1.00 0.00 ? 91 DG  B "C3'"  3  
ATOM 4622  O "O3'"  . DG  B 2 10 ? -1.495  -14.117 0.230   1.00 0.00 ? 91 DG  B "O3'"  3  
ATOM 4623  C "C2'"  . DG  B 2 10 ? 0.314   -14.516 -1.305  1.00 0.00 ? 91 DG  B "C2'"  3  
ATOM 4624  C "C1'"  . DG  B 2 10 ? 0.327   -13.231 -2.186  1.00 0.00 ? 91 DG  B "C1'"  3  
ATOM 4625  N N9     . DG  B 2 10 ? 1.394   -13.240 -3.220  1.00 0.00 ? 91 DG  B N9     3  
ATOM 4626  C C8     . DG  B 2 10 ? 2.699   -13.556 -3.151  1.00 0.00 ? 91 DG  B C8     3  
ATOM 4627  N N7     . DG  B 2 10 ? 3.386   -13.539 -4.264  1.00 0.00 ? 91 DG  B N7     3  
ATOM 4628  C C5     . DG  B 2 10 ? 2.494   -12.966 -5.132  1.00 0.00 ? 91 DG  B C5     3  
ATOM 4629  C C6     . DG  B 2 10 ? 2.643   -12.553 -6.506  1.00 0.00 ? 91 DG  B C6     3  
ATOM 4630  O O6     . DG  B 2 10 ? 3.571   -12.573 -7.313  1.00 0.00 ? 91 DG  B O6     3  
ATOM 4631  N N1     . DG  B 2 10 ? 1.441   -12.158 -6.969  1.00 0.00 ? 91 DG  B N1     3  
ATOM 4632  C C2     . DG  B 2 10 ? 0.218   -12.047 -6.288  1.00 0.00 ? 91 DG  B C2     3  
ATOM 4633  N N2     . DG  B 2 10 ? -0.877  -11.797 -6.942  1.00 0.00 ? 91 DG  B N2     3  
ATOM 4634  N N3     . DG  B 2 10 ? 0.075   -12.262 -4.993  1.00 0.00 ? 91 DG  B N3     3  
ATOM 4635  C C4     . DG  B 2 10 ? 1.248   -12.753 -4.492  1.00 0.00 ? 91 DG  B C4     3  
ATOM 4636  H "H5'"  . DG  B 2 10 ? 2.142   -11.338 0.142   1.00 0.00 ? 91 DG  B "H5'"  3  
ATOM 4637  H "H5''" . DG  B 2 10 ? 1.720   -12.263 1.581   1.00 0.00 ? 91 DG  B "H5''" 3  
ATOM 4638  H "H4'"  . DG  B 2 10 ? -0.323  -11.821 0.542   1.00 0.00 ? 91 DG  B "H4'"  3  
ATOM 4639  H "H3'"  . DG  B 2 10 ? 0.402   -14.397 0.876   1.00 0.00 ? 91 DG  B "H3'"  3  
ATOM 4640  H "H2'"  . DG  B 2 10 ? 1.295   -14.986 -1.232  1.00 0.00 ? 91 DG  B "H2'"  3  
ATOM 4641  H "H2''" . DG  B 2 10 ? -0.325  -15.260 -1.780  1.00 0.00 ? 91 DG  B "H2''" 3  
ATOM 4642  H "H1'"  . DG  B 2 10 ? -0.570  -13.234 -2.806  1.00 0.00 ? 91 DG  B "H1'"  3  
ATOM 4643  H H8     . DG  B 2 10 ? 3.191   -13.919 -2.260  1.00 0.00 ? 91 DG  B H8     3  
ATOM 4644  H H1     . DG  B 2 10 ? 1.361   -12.057 -7.971  1.00 0.00 ? 91 DG  B H1     3  
ATOM 4645  H H21    . DG  B 2 10 ? -1.773  -11.905 -6.492  1.00 0.00 ? 91 DG  B H21    3  
ATOM 4646  H H22    . DG  B 2 10 ? -0.885  -11.456 -7.893  1.00 0.00 ? 91 DG  B H22    3  
ATOM 4647  P P      . DA  B 2 11 ? -2.334  -15.567 0.242   1.00 0.00 ? 92 DA  B P      3  
ATOM 4648  O OP1    . DA  B 2 11 ? -3.207  -15.567 1.419   1.00 0.00 ? 92 DA  B OP1    3  
ATOM 4649  O OP2    . DA  B 2 11 ? -1.480  -16.722 0.007   1.00 0.00 ? 92 DA  B OP2    3  
ATOM 4650  O "O5'"  . DA  B 2 11 ? -3.238  -15.478 -1.095  1.00 0.00 ? 92 DA  B "O5'"  3  
ATOM 4651  C "C5'"  . DA  B 2 11 ? -3.969  -14.273 -1.348  1.00 0.00 ? 92 DA  B "C5'"  3  
ATOM 4652  C "C4'"  . DA  B 2 11 ? -4.622  -14.107 -2.735  1.00 0.00 ? 92 DA  B "C4'"  3  
ATOM 4653  O "O4'"  . DA  B 2 11 ? -3.597  -14.032 -3.744  1.00 0.00 ? 92 DA  B "O4'"  3  
ATOM 4654  C "C3'"  . DA  B 2 11 ? -5.574  -15.197 -3.181  1.00 0.00 ? 92 DA  B "C3'"  3  
ATOM 4655  O "O3'"  . DA  B 2 11 ? -6.603  -14.697 -3.954  1.00 0.00 ? 92 DA  B "O3'"  3  
ATOM 4656  C "C2'"  . DA  B 2 11 ? -4.559  -16.167 -3.846  1.00 0.00 ? 92 DA  B "C2'"  3  
ATOM 4657  C "C1'"  . DA  B 2 11 ? -3.697  -15.154 -4.542  1.00 0.00 ? 92 DA  B "C1'"  3  
ATOM 4658  N N9     . DA  B 2 11 ? -2.388  -15.684 -4.914  1.00 0.00 ? 92 DA  B N9     3  
ATOM 4659  C C8     . DA  B 2 11 ? -1.561  -16.322 -4.120  1.00 0.00 ? 92 DA  B C8     3  
ATOM 4660  N N7     . DA  B 2 11 ? -0.393  -16.565 -4.600  1.00 0.00 ? 92 DA  B N7     3  
ATOM 4661  C C5     . DA  B 2 11 ? -0.471  -15.922 -5.790  1.00 0.00 ? 92 DA  B C5     3  
ATOM 4662  C C6     . DA  B 2 11 ? 0.411   -15.694 -6.863  1.00 0.00 ? 92 DA  B C6     3  
ATOM 4663  N N6     . DA  B 2 11 ? 1.715   -15.867 -6.847  1.00 0.00 ? 92 DA  B N6     3  
ATOM 4664  N N1     . DA  B 2 11 ? -0.035  -15.101 -8.018  1.00 0.00 ? 92 DA  B N1     3  
ATOM 4665  C C2     . DA  B 2 11 ? -1.267  -14.705 -8.084  1.00 0.00 ? 92 DA  B C2     3  
ATOM 4666  N N3     . DA  B 2 11 ? -2.191  -14.836 -7.149  1.00 0.00 ? 92 DA  B N3     3  
ATOM 4667  C C4     . DA  B 2 11 ? -1.697  -15.413 -6.055  1.00 0.00 ? 92 DA  B C4     3  
ATOM 4668  H "H5'"  . DA  B 2 11 ? -3.260  -13.452 -1.254  1.00 0.00 ? 92 DA  B "H5'"  3  
ATOM 4669  H "H5''" . DA  B 2 11 ? -4.731  -14.227 -0.570  1.00 0.00 ? 92 DA  B "H5''" 3  
ATOM 4670  H "H4'"  . DA  B 2 11 ? -5.175  -13.168 -2.711  1.00 0.00 ? 92 DA  B "H4'"  3  
ATOM 4671  H "H3'"  . DA  B 2 11 ? -6.040  -15.589 -2.277  1.00 0.00 ? 92 DA  B "H3'"  3  
ATOM 4672  H "H2'"  . DA  B 2 11 ? -4.022  -16.821 -3.160  1.00 0.00 ? 92 DA  B "H2'"  3  
ATOM 4673  H "H2''" . DA  B 2 11 ? -5.018  -16.792 -4.612  1.00 0.00 ? 92 DA  B "H2''" 3  
ATOM 4674  H "H1'"  . DA  B 2 11 ? -4.253  -14.953 -5.458  1.00 0.00 ? 92 DA  B "H1'"  3  
ATOM 4675  H H8     . DA  B 2 11 ? -1.917  -16.712 -3.177  1.00 0.00 ? 92 DA  B H8     3  
ATOM 4676  H H61    . DA  B 2 11 ? 2.107   -15.564 -7.727  1.00 0.00 ? 92 DA  B H61    3  
ATOM 4677  H H62    . DA  B 2 11 ? 2.166   -16.501 -6.203  1.00 0.00 ? 92 DA  B H62    3  
ATOM 4678  H H2     . DA  B 2 11 ? -1.508  -14.036 -8.899  1.00 0.00 ? 92 DA  B H2     3  
ATOM 4679  P P      . DG  B 2 12 ? -7.619  -15.619 -4.776  1.00 0.00 ? 93 DG  B P      3  
ATOM 4680  O OP1    . DG  B 2 12 ? -8.981  -14.956 -4.864  1.00 0.00 ? 93 DG  B OP1    3  
ATOM 4681  O OP2    . DG  B 2 12 ? -7.649  -16.986 -4.196  1.00 0.00 ? 93 DG  B OP2    3  
ATOM 4682  O "O5'"  . DG  B 2 12 ? -6.892  -15.582 -6.194  1.00 0.00 ? 93 DG  B "O5'"  3  
ATOM 4683  C "C5'"  . DG  B 2 12 ? -6.845  -14.428 -6.987  1.00 0.00 ? 93 DG  B "C5'"  3  
ATOM 4684  C "C4'"  . DG  B 2 12 ? -6.780  -14.669 -8.494  1.00 0.00 ? 93 DG  B "C4'"  3  
ATOM 4685  O "O4'"  . DG  B 2 12 ? -5.487  -14.942 -8.928  1.00 0.00 ? 93 DG  B "O4'"  3  
ATOM 4686  C "C3'"  . DG  B 2 12 ? -7.754  -15.834 -8.865  1.00 0.00 ? 93 DG  B "C3'"  3  
ATOM 4687  O "O3'"  . DG  B 2 12 ? -8.315  -15.563 -10.112 1.00 0.00 ? 93 DG  B "O3'"  3  
ATOM 4688  C "C2'"  . DG  B 2 12 ? -6.667  -16.961 -8.891  1.00 0.00 ? 93 DG  B "C2'"  3  
ATOM 4689  C "C1'"  . DG  B 2 12 ? -5.336  -16.291 -9.283  1.00 0.00 ? 93 DG  B "C1'"  3  
ATOM 4690  N N9     . DG  B 2 12 ? -4.122  -16.931 -8.796  1.00 0.00 ? 93 DG  B N9     3  
ATOM 4691  C C8     . DG  B 2 12 ? -4.070  -17.614 -7.560  1.00 0.00 ? 93 DG  B C8     3  
ATOM 4692  N N7     . DG  B 2 12 ? -2.917  -18.131 -7.204  1.00 0.00 ? 93 DG  B N7     3  
ATOM 4693  C C5     . DG  B 2 12 ? -2.212  -17.861 -8.414  1.00 0.00 ? 93 DG  B C5     3  
ATOM 4694  C C6     . DG  B 2 12 ? -0.918  -18.297 -8.810  1.00 0.00 ? 93 DG  B C6     3  
ATOM 4695  O O6     . DG  B 2 12 ? -0.020  -18.818 -8.168  1.00 0.00 ? 93 DG  B O6     3  
ATOM 4696  N N1     . DG  B 2 12 ? -0.559  -18.001 -10.092 1.00 0.00 ? 93 DG  B N1     3  
ATOM 4697  C C2     . DG  B 2 12 ? -1.332  -17.350 -10.953 1.00 0.00 ? 93 DG  B C2     3  
ATOM 4698  N N2     . DG  B 2 12 ? -1.078  -17.297 -12.215 1.00 0.00 ? 93 DG  B N2     3  
ATOM 4699  N N3     . DG  B 2 12 ? -2.488  -16.792 -10.613 1.00 0.00 ? 93 DG  B N3     3  
ATOM 4700  C C4     . DG  B 2 12 ? -2.889  -17.158 -9.347  1.00 0.00 ? 93 DG  B C4     3  
ATOM 4701  H "H5'"  . DG  B 2 12 ? -6.035  -13.743 -6.740  1.00 0.00 ? 93 DG  B "H5'"  3  
ATOM 4702  H "H5''" . DG  B 2 12 ? -7.707  -13.767 -6.898  1.00 0.00 ? 93 DG  B "H5''" 3  
ATOM 4703  H "H4'"  . DG  B 2 12 ? -7.128  -13.793 -9.039  1.00 0.00 ? 93 DG  B "H4'"  3  
ATOM 4704  H "H3'"  . DG  B 2 12 ? -8.536  -15.982 -8.120  1.00 0.00 ? 93 DG  B "H3'"  3  
ATOM 4705  H "H2'"  . DG  B 2 12 ? -6.608  -17.363 -7.879  1.00 0.00 ? 93 DG  B "H2'"  3  
ATOM 4706  H "H2''" . DG  B 2 12 ? -6.918  -17.773 -9.573  1.00 0.00 ? 93 DG  B "H2''" 3  
ATOM 4707  H "H1'"  . DG  B 2 12 ? -5.242  -16.382 -10.365 1.00 0.00 ? 93 DG  B "H1'"  3  
ATOM 4708  H H8     . DG  B 2 12 ? -4.891  -17.564 -6.860  1.00 0.00 ? 93 DG  B H8     3  
ATOM 4709  H H1     . DG  B 2 12 ? 0.356   -18.228 -10.453 1.00 0.00 ? 93 DG  B H1     3  
ATOM 4710  H H21    . DG  B 2 12 ? -1.664  -16.884 -12.926 1.00 0.00 ? 93 DG  B H21    3  
ATOM 4711  H H22    . DG  B 2 12 ? -0.222  -17.763 -12.480 1.00 0.00 ? 93 DG  B H22    3  
ATOM 4712  P P      . DC  B 2 13 ? -9.438  -16.514 -10.764 1.00 0.00 ? 94 DC  B P      3  
ATOM 4713  O OP1    . DC  B 2 13 ? -10.246 -15.719 -11.678 1.00 0.00 ? 94 DC  B OP1    3  
ATOM 4714  O OP2    . DC  B 2 13 ? -10.157 -17.226 -9.650  1.00 0.00 ? 94 DC  B OP2    3  
ATOM 4715  O "O5'"  . DC  B 2 13 ? -8.603  -17.590 -11.621 1.00 0.00 ? 94 DC  B "O5'"  3  
ATOM 4716  C "C5'"  . DC  B 2 13 ? -7.576  -17.228 -12.539 1.00 0.00 ? 94 DC  B "C5'"  3  
ATOM 4717  C "C4'"  . DC  B 2 13 ? -6.675  -18.321 -13.105 1.00 0.00 ? 94 DC  B "C4'"  3  
ATOM 4718  O "O4'"  . DC  B 2 13 ? -5.762  -18.701 -12.127 1.00 0.00 ? 94 DC  B "O4'"  3  
ATOM 4719  C "C3'"  . DC  B 2 13 ? -7.358  -19.557 -13.608 1.00 0.00 ? 94 DC  B "C3'"  3  
ATOM 4720  O "O3'"  . DC  B 2 13 ? -7.077  -19.815 -15.005 1.00 0.00 ? 94 DC  B "O3'"  3  
ATOM 4721  C "C2'"  . DC  B 2 13 ? -6.729  -20.657 -12.756 1.00 0.00 ? 94 DC  B "C2'"  3  
ATOM 4722  C "C1'"  . DC  B 2 13 ? -5.383  -20.012 -12.384 1.00 0.00 ? 94 DC  B "C1'"  3  
ATOM 4723  N N1     . DC  B 2 13 ? -4.553  -20.521 -11.241 1.00 0.00 ? 94 DC  B N1     3  
ATOM 4724  C C2     . DC  B 2 13 ? -3.291  -21.012 -11.426 1.00 0.00 ? 94 DC  B C2     3  
ATOM 4725  O O2     . DC  B 2 13 ? -2.811  -21.218 -12.520 1.00 0.00 ? 94 DC  B O2     3  
ATOM 4726  N N3     . DC  B 2 13 ? -2.576  -21.283 -10.284 1.00 0.00 ? 94 DC  B N3     3  
ATOM 4727  C C4     . DC  B 2 13 ? -3.160  -21.161 -9.104  1.00 0.00 ? 94 DC  B C4     3  
ATOM 4728  N N4     . DC  B 2 13 ? -2.497  -21.570 -8.064  1.00 0.00 ? 94 DC  B N4     3  
ATOM 4729  C C5     . DC  B 2 13 ? -4.498  -20.844 -8.908  1.00 0.00 ? 94 DC  B C5     3  
ATOM 4730  C C6     . DC  B 2 13 ? -5.127  -20.431 -10.024 1.00 0.00 ? 94 DC  B C6     3  
ATOM 4731  H "H5'"  . DC  B 2 13 ? -6.921  -16.636 -11.899 1.00 0.00 ? 94 DC  B "H5'"  3  
ATOM 4732  H "H5''" . DC  B 2 13 ? -8.102  -16.755 -13.368 1.00 0.00 ? 94 DC  B "H5''" 3  
ATOM 4733  H "H4'"  . DC  B 2 13 ? -6.080  -17.775 -13.837 1.00 0.00 ? 94 DC  B "H4'"  3  
ATOM 4734  H "H3'"  . DC  B 2 13 ? -8.428  -19.455 -13.431 1.00 0.00 ? 94 DC  B "H3'"  3  
ATOM 4735  H "HO3'" . DC  B 2 13 ? -7.557  -19.178 -15.540 1.00 0.00 ? 94 DC  B "HO3'" 3  
ATOM 4736  H "H2'"  . DC  B 2 13 ? -7.274  -20.930 -11.852 1.00 0.00 ? 94 DC  B "H2'"  3  
ATOM 4737  H "H2''" . DC  B 2 13 ? -6.584  -21.512 -13.415 1.00 0.00 ? 94 DC  B "H2''" 3  
ATOM 4738  H "H1'"  . DC  B 2 13 ? -4.810  -19.972 -13.311 1.00 0.00 ? 94 DC  B "H1'"  3  
ATOM 4739  H H41    . DC  B 2 13 ? -3.066  -21.731 -7.245  1.00 0.00 ? 94 DC  B H41    3  
ATOM 4740  H H42    . DC  B 2 13 ? -1.509  -21.774 -8.086  1.00 0.00 ? 94 DC  B H42    3  
ATOM 4741  H H5     . DC  B 2 13 ? -4.985  -20.787 -7.946  1.00 0.00 ? 94 DC  B H5     3  
ATOM 4742  H H6     . DC  B 2 13 ? -6.111  -19.986 -10.012 1.00 0.00 ? 94 DC  B H6     3  
ATOM 4743  N N      . GLY C 3 1  ? 6.646   -13.541 3.195   1.00 0.00 ? 1  GLY P N      3  
ATOM 4744  C CA     . GLY C 3 1  ? 6.510   -12.396 4.152   1.00 0.00 ? 1  GLY P CA     3  
ATOM 4745  C C      . GLY C 3 1  ? 5.716   -12.899 5.406   1.00 0.00 ? 1  GLY P C      3  
ATOM 4746  O O      . GLY C 3 1  ? 4.564   -13.362 5.284   1.00 0.00 ? 1  GLY P O      3  
ATOM 4747  H H1     . GLY C 3 1  ? 7.212   -13.226 2.421   1.00 0.00 ? 1  GLY P H1     3  
ATOM 4748  H H2     . GLY C 3 1  ? 5.757   -13.893 2.872   1.00 0.00 ? 1  GLY P H2     3  
ATOM 4749  H H3     . GLY C 3 1  ? 7.231   -14.308 3.497   1.00 0.00 ? 1  GLY P H3     3  
ATOM 4750  H HA2    . GLY C 3 1  ? 7.462   -11.937 4.419   1.00 0.00 ? 1  GLY P HA2    3  
ATOM 4751  H HA3    . GLY C 3 1  ? 5.995   -11.576 3.652   1.00 0.00 ? 1  GLY P HA3    3  
ATOM 4752  N N      . PRO C 3 2  ? 6.308   -12.899 6.636   1.00 0.00 ? 2  PRO P N      3  
ATOM 4753  C CA     . PRO C 3 2  ? 5.537   -13.037 7.871   1.00 0.00 ? 2  PRO P CA     3  
ATOM 4754  C C      . PRO C 3 2  ? 4.354   -12.062 8.125   1.00 0.00 ? 2  PRO P C      3  
ATOM 4755  O O      . PRO C 3 2  ? 3.417   -12.344 8.877   1.00 0.00 ? 2  PRO P O      3  
ATOM 4756  C CB     . PRO C 3 2  ? 6.583   -12.863 9.018   1.00 0.00 ? 2  PRO P CB     3  
ATOM 4757  C CG     . PRO C 3 2  ? 7.928   -12.787 8.302   1.00 0.00 ? 2  PRO P CG     3  
ATOM 4758  C CD     . PRO C 3 2  ? 7.693   -12.526 6.855   1.00 0.00 ? 2  PRO P CD     3  
ATOM 4759  H HA     . PRO C 3 2  ? 5.104   -14.036 7.933   1.00 0.00 ? 2  PRO P HA     3  
ATOM 4760  H HB2    . PRO C 3 2  ? 6.395   -11.911 9.515   1.00 0.00 ? 2  PRO P HB2    3  
ATOM 4761  H HB3    . PRO C 3 2  ? 6.539   -13.684 9.734   1.00 0.00 ? 2  PRO P HB3    3  
ATOM 4762  H HG2    . PRO C 3 2  ? 8.614   -12.041 8.704   1.00 0.00 ? 2  PRO P HG2    3  
ATOM 4763  H HG3    . PRO C 3 2  ? 8.454   -13.695 8.596   1.00 0.00 ? 2  PRO P HG3    3  
ATOM 4764  H HD2    . PRO C 3 2  ? 7.819   -11.467 6.623   1.00 0.00 ? 2  PRO P HD2    3  
ATOM 4765  H HD3    . PRO C 3 2  ? 8.299   -13.234 6.290   1.00 0.00 ? 2  PRO P HD3    3  
ATOM 4766  N N      . ARG C 3 3  ? 4.433   -10.875 7.535   1.00 0.00 ? 3  ARG P N      3  
ATOM 4767  C CA     . ARG C 3 3  ? 3.364   -9.869  7.370   1.00 0.00 ? 3  ARG P CA     3  
ATOM 4768  C C      . ARG C 3 3  ? 3.718   -9.094  6.106   1.00 0.00 ? 3  ARG P C      3  
ATOM 4769  O O      . ARG C 3 3  ? 4.882   -9.094  5.645   1.00 0.00 ? 3  ARG P O      3  
ATOM 4770  C CB     . ARG C 3 3  ? 3.267   -9.091  8.661   1.00 0.00 ? 3  ARG P CB     3  
ATOM 4771  C CG     . ARG C 3 3  ? 4.445   -8.158  9.128   1.00 0.00 ? 3  ARG P CG     3  
ATOM 4772  C CD     . ARG C 3 3  ? 3.985   -6.689  8.907   1.00 0.00 ? 3  ARG P CD     3  
ATOM 4773  N NE     . ARG C 3 3  ? 4.039   -6.209  7.537   1.00 0.00 ? 3  ARG P NE     3  
ATOM 4774  C CZ     . ARG C 3 3  ? 3.106   -5.730  6.780   1.00 0.00 ? 3  ARG P CZ     3  
ATOM 4775  N NH1    . ARG C 3 3  ? 1.810   -5.625  7.183   1.00 0.00 ? 3  ARG P NH1    3  
ATOM 4776  N NH2    . ARG C 3 3  ? 3.416   -5.339  5.581   1.00 0.00 ? 3  ARG P NH2    3  
ATOM 4777  H H      . ARG C 3 3  ? 5.237   -10.562 7.011   1.00 0.00 ? 3  ARG P H      3  
ATOM 4778  H HA     . ARG C 3 3  ? 2.410   -10.390 7.295   1.00 0.00 ? 3  ARG P HA     3  
ATOM 4779  H HB2    . ARG C 3 3  ? 2.341   -8.516  8.695   1.00 0.00 ? 3  ARG P HB2    3  
ATOM 4780  H HB3    . ARG C 3 3  ? 3.089   -9.844  9.429   1.00 0.00 ? 3  ARG P HB3    3  
ATOM 4781  H HG2    . ARG C 3 3  ? 4.659   -8.275  10.191  1.00 0.00 ? 3  ARG P HG2    3  
ATOM 4782  H HG3    . ARG C 3 3  ? 5.387   -8.351  8.615   1.00 0.00 ? 3  ARG P HG3    3  
ATOM 4783  H HD2    . ARG C 3 3  ? 3.027   -6.457  9.370   1.00 0.00 ? 3  ARG P HD2    3  
ATOM 4784  H HD3    . ARG C 3 3  ? 4.707   -6.081  9.454   1.00 0.00 ? 3  ARG P HD3    3  
ATOM 4785  H HE     . ARG C 3 3  ? 4.963   -6.092  7.143   1.00 0.00 ? 3  ARG P HE     3  
ATOM 4786  H HH11   . ARG C 3 3  ? 1.583   -5.724  8.163   1.00 0.00 ? 3  ARG P HH11   3  
ATOM 4787  H HH12   . ARG C 3 3  ? 1.088   -5.451  6.499   1.00 0.00 ? 3  ARG P HH12   3  
ATOM 4788  H HH21   . ARG C 3 3  ? 4.363   -5.432  5.243   1.00 0.00 ? 3  ARG P HH21   3  
ATOM 4789  H HH22   . ARG C 3 3  ? 2.737   -4.850  5.015   1.00 0.00 ? 3  ARG P HH22   3  
ATOM 4790  N N      . ARG C 3 4  ? 2.675   -8.662  5.350   1.00 0.00 ? 4  ARG P N      3  
ATOM 4791  C CA     . ARG C 3 4  ? 2.750   -8.095  4.036   1.00 0.00 ? 4  ARG P CA     3  
ATOM 4792  C C      . ARG C 3 4  ? 1.581   -7.183  3.621   1.00 0.00 ? 4  ARG P C      3  
ATOM 4793  O O      . ARG C 3 4  ? 1.658   -6.446  2.631   1.00 0.00 ? 4  ARG P O      3  
ATOM 4794  C CB     . ARG C 3 4  ? 2.896   -9.232  3.065   1.00 0.00 ? 4  ARG P CB     3  
ATOM 4795  C CG     . ARG C 3 4  ? 2.840   -8.896  1.556   1.00 0.00 ? 4  ARG P CG     3  
ATOM 4796  C CD     . ARG C 3 4  ? 4.003   -7.901  1.185   1.00 0.00 ? 4  ARG P CD     3  
ATOM 4797  N NE     . ARG C 3 4  ? 4.001   -7.477  -0.288  1.00 0.00 ? 4  ARG P NE     3  
ATOM 4798  C CZ     . ARG C 3 4  ? 3.105   -6.653  -0.804  1.00 0.00 ? 4  ARG P CZ     3  
ATOM 4799  N NH1    . ARG C 3 4  ? 2.112   -6.171  -0.173  1.00 0.00 ? 4  ARG P NH1    3  
ATOM 4800  N NH2    . ARG C 3 4  ? 3.217   -6.252  -2.014  1.00 0.00 ? 4  ARG P NH2    3  
ATOM 4801  H H      . ARG C 3 4  ? 1.733   -8.761  5.699   1.00 0.00 ? 4  ARG P H      3  
ATOM 4802  H HA     . ARG C 3 4  ? 3.611   -7.434  3.942   1.00 0.00 ? 4  ARG P HA     3  
ATOM 4803  H HB2    . ARG C 3 4  ? 3.776   -9.848  3.249   1.00 0.00 ? 4  ARG P HB2    3  
ATOM 4804  H HB3    . ARG C 3 4  ? 2.004   -9.846  3.185   1.00 0.00 ? 4  ARG P HB3    3  
ATOM 4805  H HG2    . ARG C 3 4  ? 3.118   -9.810  1.033   1.00 0.00 ? 4  ARG P HG2    3  
ATOM 4806  H HG3    . ARG C 3 4  ? 1.898   -8.446  1.243   1.00 0.00 ? 4  ARG P HG3    3  
ATOM 4807  H HD2    . ARG C 3 4  ? 3.824   -7.031  1.818   1.00 0.00 ? 4  ARG P HD2    3  
ATOM 4808  H HD3    . ARG C 3 4  ? 4.961   -8.370  1.409   1.00 0.00 ? 4  ARG P HD3    3  
ATOM 4809  H HE     . ARG C 3 4  ? 4.703   -7.839  -0.916  1.00 0.00 ? 4  ARG P HE     3  
ATOM 4810  H HH11   . ARG C 3 4  ? 2.105   -6.284  0.831   1.00 0.00 ? 4  ARG P HH11   3  
ATOM 4811  H HH12   . ARG C 3 4  ? 1.405   -5.620  -0.640  1.00 0.00 ? 4  ARG P HH12   3  
ATOM 4812  H HH21   . ARG C 3 4  ? 3.880   -6.597  -2.693  1.00 0.00 ? 4  ARG P HH21   3  
ATOM 4813  H HH22   . ARG C 3 4  ? 2.775   -5.376  -2.252  1.00 0.00 ? 4  ARG P HH22   3  
ATOM 4814  N N      . THR C 3 5  ? 0.491   -7.328  4.391   1.00 0.00 ? 5  THR P N      3  
ATOM 4815  C CA     . THR C 3 5  ? -0.875  -6.752  4.112   1.00 0.00 ? 5  THR P CA     3  
ATOM 4816  C C      . THR C 3 5  ? -1.425  -6.374  5.501   1.00 0.00 ? 5  THR P C      3  
ATOM 4817  O O      . THR C 3 5  ? -0.716  -6.401  6.527   1.00 0.00 ? 5  THR P O      3  
ATOM 4818  C CB     . THR C 3 5  ? -1.817  -7.863  3.538   1.00 0.00 ? 5  THR P CB     3  
ATOM 4819  O OG1    . THR C 3 5  ? -1.720  -9.134  4.146   1.00 0.00 ? 5  THR P OG1    3  
ATOM 4820  C CG2    . THR C 3 5  ? -1.433  -8.099  2.072   1.00 0.00 ? 5  THR P CG2    3  
ATOM 4821  H H      . THR C 3 5  ? 0.492   -7.885  5.234   1.00 0.00 ? 5  THR P H      3  
ATOM 4822  H HA     . THR C 3 5  ? -0.762  -5.911  3.428   1.00 0.00 ? 5  THR P HA     3  
ATOM 4823  H HB     . THR C 3 5  ? -2.863  -7.562  3.611   1.00 0.00 ? 5  THR P HB     3  
ATOM 4824  H HG1    . THR C 3 5  ? -2.515  -9.601  3.876   1.00 0.00 ? 5  THR P HG1    3  
ATOM 4825  H HG21   . THR C 3 5  ? -0.359  -8.283  2.041   1.00 0.00 ? 5  THR P HG21   3  
ATOM 4826  H HG22   . THR C 3 5  ? -1.636  -7.188  1.508   1.00 0.00 ? 5  THR P HG22   3  
ATOM 4827  H HG23   . THR C 3 5  ? -1.975  -8.982  1.732   1.00 0.00 ? 5  THR P HG23   3  
ATOM 4828  N N      . ARG C 3 6  ? -2.711  -6.004  5.583   1.00 0.00 ? 6  ARG P N      3  
ATOM 4829  C CA     . ARG C 3 6  ? -3.447  -5.805  6.895   1.00 0.00 ? 6  ARG P CA     3  
ATOM 4830  C C      . ARG C 3 6  ? -4.922  -6.253  6.941   1.00 0.00 ? 6  ARG P C      3  
ATOM 4831  O O      . ARG C 3 6  ? -5.483  -6.419  8.059   1.00 0.00 ? 6  ARG P O      3  
ATOM 4832  C CB     . ARG C 3 6  ? -3.265  -4.314  7.366   1.00 0.00 ? 6  ARG P CB     3  
ATOM 4833  C CG     . ARG C 3 6  ? -3.406  -4.171  8.904   1.00 0.00 ? 6  ARG P CG     3  
ATOM 4834  C CD     . ARG C 3 6  ? -4.776  -3.514  9.091   1.00 0.00 ? 6  ARG P CD     3  
ATOM 4835  N NE     . ARG C 3 6  ? -5.030  -3.345  10.520  1.00 0.00 ? 6  ARG P NE     3  
ATOM 4836  C CZ     . ARG C 3 6  ? -5.186  -4.294  11.378  1.00 0.00 ? 6  ARG P CZ     3  
ATOM 4837  N NH1    . ARG C 3 6  ? -5.495  -5.527  11.066  1.00 0.00 ? 6  ARG P NH1    3  
ATOM 4838  N NH2    . ARG C 3 6  ? -5.071  -3.964  12.568  1.00 0.00 ? 6  ARG P NH2    3  
ATOM 4839  H H      . ARG C 3 6  ? -3.297  -5.883  4.770   1.00 0.00 ? 6  ARG P H      3  
ATOM 4840  H HA     . ARG C 3 6  ? -2.939  -6.408  7.648   1.00 0.00 ? 6  ARG P HA     3  
ATOM 4841  H HB2    . ARG C 3 6  ? -2.255  -3.991  7.113   1.00 0.00 ? 6  ARG P HB2    3  
ATOM 4842  H HB3    . ARG C 3 6  ? -3.975  -3.640  6.886   1.00 0.00 ? 6  ARG P HB3    3  
ATOM 4843  H HG2    . ARG C 3 6  ? -3.358  -5.169  9.337   1.00 0.00 ? 6  ARG P HG2    3  
ATOM 4844  H HG3    . ARG C 3 6  ? -2.611  -3.555  9.323   1.00 0.00 ? 6  ARG P HG3    3  
ATOM 4845  H HD2    . ARG C 3 6  ? -4.731  -2.542  8.601   1.00 0.00 ? 6  ARG P HD2    3  
ATOM 4846  H HD3    . ARG C 3 6  ? -5.587  -4.149  8.731   1.00 0.00 ? 6  ARG P HD3    3  
ATOM 4847  H HE     . ARG C 3 6  ? -4.836  -2.421  10.878  1.00 0.00 ? 6  ARG P HE     3  
ATOM 4848  H HH11   . ARG C 3 6  ? -5.416  -5.891  10.128  1.00 0.00 ? 6  ARG P HH11   3  
ATOM 4849  H HH12   . ARG C 3 6  ? -5.596  -6.204  11.810  1.00 0.00 ? 6  ARG P HH12   3  
ATOM 4850  H HH21   . ARG C 3 6  ? -4.725  -3.064  12.869  1.00 0.00 ? 6  ARG P HH21   3  
ATOM 4851  H HH22   . ARG C 3 6  ? -4.917  -4.706  13.235  1.00 0.00 ? 6  ARG P HH22   3  
ATOM 4852  N N      . THR C 3 7  ? -5.504  -6.308  5.786   1.00 0.00 ? 7  THR P N      3  
ATOM 4853  C CA     . THR C 3 7  ? -6.971  -6.389  5.538   1.00 0.00 ? 7  THR P CA     3  
ATOM 4854  C C      . THR C 3 7  ? -7.211  -6.804  4.118   1.00 0.00 ? 7  THR P C      3  
ATOM 4855  O O      . THR C 3 7  ? -6.606  -6.273  3.159   1.00 0.00 ? 7  THR P O      3  
ATOM 4856  C CB     . THR C 3 7  ? -7.705  -5.042  5.941   1.00 0.00 ? 7  THR P CB     3  
ATOM 4857  O OG1    . THR C 3 7  ? -7.546  -4.623  7.273   1.00 0.00 ? 7  THR P OG1    3  
ATOM 4858  C CG2    . THR C 3 7  ? -9.175  -4.903  5.453   1.00 0.00 ? 7  THR P CG2    3  
ATOM 4859  H H      . THR C 3 7  ? -5.006  -5.894  5.012   1.00 0.00 ? 7  THR P H      3  
ATOM 4860  H HA     . THR C 3 7  ? -7.411  -7.141  6.192   1.00 0.00 ? 7  THR P HA     3  
ATOM 4861  H HB     . THR C 3 7  ? -7.245  -4.314  5.272   1.00 0.00 ? 7  THR P HB     3  
ATOM 4862  H HG1    . THR C 3 7  ? -7.613  -5.439  7.775   1.00 0.00 ? 7  THR P HG1    3  
ATOM 4863  H HG21   . THR C 3 7  ? -9.299  -4.687  4.391   1.00 0.00 ? 7  THR P HG21   3  
ATOM 4864  H HG22   . THR C 3 7  ? -9.637  -4.058  5.965   1.00 0.00 ? 7  THR P HG22   3  
ATOM 4865  H HG23   . THR C 3 7  ? -9.702  -5.781  5.824   1.00 0.00 ? 7  THR P HG23   3  
ATOM 4866  N N      . THR C 3 8  ? -8.123  -7.745  3.973   1.00 0.00 ? 8  THR P N      3  
ATOM 4867  C CA     . THR C 3 8  ? -8.776  -8.142  2.725   1.00 0.00 ? 8  THR P CA     3  
ATOM 4868  C C      . THR C 3 8  ? -10.180 -7.485  2.720   1.00 0.00 ? 8  THR P C      3  
ATOM 4869  O O      . THR C 3 8  ? -11.009 -7.763  3.565   1.00 0.00 ? 8  THR P O      3  
ATOM 4870  C CB     . THR C 3 8  ? -8.875  -9.692  2.740   1.00 0.00 ? 8  THR P CB     3  
ATOM 4871  O OG1    . THR C 3 8  ? -7.632  -10.297 2.945   1.00 0.00 ? 8  THR P OG1    3  
ATOM 4872  C CG2    . THR C 3 8  ? -9.340  -10.119 1.332   1.00 0.00 ? 8  THR P CG2    3  
ATOM 4873  H H      . THR C 3 8  ? -8.616  -8.101  4.780   1.00 0.00 ? 8  THR P H      3  
ATOM 4874  H HA     . THR C 3 8  ? -8.179  -7.820  1.871   1.00 0.00 ? 8  THR P HA     3  
ATOM 4875  H HB     . THR C 3 8  ? -9.572  -9.978  3.526   1.00 0.00 ? 8  THR P HB     3  
ATOM 4876  H HG1    . THR C 3 8  ? -7.282  -10.539 2.084   1.00 0.00 ? 8  THR P HG1    3  
ATOM 4877  H HG21   . THR C 3 8  ? -9.312  -11.208 1.297   1.00 0.00 ? 8  THR P HG21   3  
ATOM 4878  H HG22   . THR C 3 8  ? -8.818  -9.622  0.514   1.00 0.00 ? 8  THR P HG22   3  
ATOM 4879  H HG23   . THR C 3 8  ? -10.405 -9.937  1.189   1.00 0.00 ? 8  THR P HG23   3  
ATOM 4880  N N      . PHE C 3 9  ? -10.379 -6.662  1.666   1.00 0.00 ? 9  PHE P N      3  
ATOM 4881  C CA     . PHE C 3 9  ? -11.473 -5.760  1.462   1.00 0.00 ? 9  PHE P CA     3  
ATOM 4882  C C      . PHE C 3 9  ? -12.821 -6.451  1.119   1.00 0.00 ? 9  PHE P C      3  
ATOM 4883  O O      . PHE C 3 9  ? -12.883 -7.646  0.854   1.00 0.00 ? 9  PHE P O      3  
ATOM 4884  C CB     . PHE C 3 9  ? -11.062 -4.789  0.377   1.00 0.00 ? 9  PHE P CB     3  
ATOM 4885  C CG     . PHE C 3 9  ? -10.041 -3.660  0.727   1.00 0.00 ? 9  PHE P CG     3  
ATOM 4886  C CD1    . PHE C 3 9  ? -8.715  -3.930  0.991   1.00 0.00 ? 9  PHE P CD1    3  
ATOM 4887  C CD2    . PHE C 3 9  ? -10.351 -2.302  0.638   1.00 0.00 ? 9  PHE P CD2    3  
ATOM 4888  C CE1    . PHE C 3 9  ? -7.795  -2.959  1.293   1.00 0.00 ? 9  PHE P CE1    3  
ATOM 4889  C CE2    . PHE C 3 9  ? -9.457  -1.221  0.968   1.00 0.00 ? 9  PHE P CE2    3  
ATOM 4890  C CZ     . PHE C 3 9  ? -8.164  -1.650  1.358   1.00 0.00 ? 9  PHE P CZ     3  
ATOM 4891  H H      . PHE C 3 9  ? -9.644  -6.517  0.989   1.00 0.00 ? 9  PHE P H      3  
ATOM 4892  H HA     . PHE C 3 9  ? -11.737 -5.129  2.311   1.00 0.00 ? 9  PHE P HA     3  
ATOM 4893  H HB2    . PHE C 3 9  ? -10.651 -5.389  -0.435  1.00 0.00 ? 9  PHE P HB2    3  
ATOM 4894  H HB3    . PHE C 3 9  ? -11.963 -4.353  -0.054  1.00 0.00 ? 9  PHE P HB3    3  
ATOM 4895  H HD1    . PHE C 3 9  ? -8.373  -4.925  1.230   1.00 0.00 ? 9  PHE P HD1    3  
ATOM 4896  H HD2    . PHE C 3 9  ? -11.408 -2.094  0.555   1.00 0.00 ? 9  PHE P HD2    3  
ATOM 4897  H HE1    . PHE C 3 9  ? -6.818  -3.223  1.671   1.00 0.00 ? 9  PHE P HE1    3  
ATOM 4898  H HE2    . PHE C 3 9  ? -9.787  -0.193  0.945   1.00 0.00 ? 9  PHE P HE2    3  
ATOM 4899  H HZ     . PHE C 3 9  ? -7.439  -0.888  1.606   1.00 0.00 ? 9  PHE P HZ     3  
ATOM 4900  N N      . THR C 3 10 ? -13.944 -5.799  0.954   1.00 0.00 ? 10 THR P N      3  
ATOM 4901  C CA     . THR C 3 10 ? -15.231 -6.347  0.580   1.00 0.00 ? 10 THR P CA     3  
ATOM 4902  C C      . THR C 3 10 ? -15.888 -5.520  -0.557  1.00 0.00 ? 10 THR P C      3  
ATOM 4903  O O      . THR C 3 10 ? -15.603 -4.314  -0.663  1.00 0.00 ? 10 THR P O      3  
ATOM 4904  C CB     . THR C 3 10 ? -16.157 -6.625  1.801   1.00 0.00 ? 10 THR P CB     3  
ATOM 4905  O OG1    . THR C 3 10 ? -16.703 -5.372  2.186   1.00 0.00 ? 10 THR P OG1    3  
ATOM 4906  C CG2    . THR C 3 10 ? -15.669 -7.345  3.085   1.00 0.00 ? 10 THR P CG2    3  
ATOM 4907  H H      . THR C 3 10 ? -13.888 -4.861  1.325   1.00 0.00 ? 10 THR P H      3  
ATOM 4908  H HA     . THR C 3 10 ? -15.170 -7.328  0.107   1.00 0.00 ? 10 THR P HA     3  
ATOM 4909  H HB     . THR C 3 10 ? -17.033 -7.122  1.385   1.00 0.00 ? 10 THR P HB     3  
ATOM 4910  H HG1    . THR C 3 10 ? -17.363 -5.517  2.868   1.00 0.00 ? 10 THR P HG1    3  
ATOM 4911  H HG21   . THR C 3 10 ? -15.336 -8.380  3.025   1.00 0.00 ? 10 THR P HG21   3  
ATOM 4912  H HG22   . THR C 3 10 ? -16.434 -7.150  3.837   1.00 0.00 ? 10 THR P HG22   3  
ATOM 4913  H HG23   . THR C 3 10 ? -14.759 -6.774  3.269   1.00 0.00 ? 10 THR P HG23   3  
ATOM 4914  N N      . SER C 3 11 ? -16.881 -6.025  -1.321  1.00 0.00 ? 11 SER P N      3  
ATOM 4915  C CA     . SER C 3 11 ? -17.663 -5.288  -2.355  1.00 0.00 ? 11 SER P CA     3  
ATOM 4916  C C      . SER C 3 11 ? -18.292 -4.044  -1.712  1.00 0.00 ? 11 SER P C      3  
ATOM 4917  O O      . SER C 3 11 ? -18.295 -3.005  -2.318  1.00 0.00 ? 11 SER P O      3  
ATOM 4918  C CB     . SER C 3 11 ? -18.768 -6.184  -2.914  1.00 0.00 ? 11 SER P CB     3  
ATOM 4919  O OG     . SER C 3 11 ? -18.282 -7.354  -3.517  1.00 0.00 ? 11 SER P OG     3  
ATOM 4920  H H      . SER C 3 11 ? -17.054 -7.011  -1.192  1.00 0.00 ? 11 SER P H      3  
ATOM 4921  H HA     . SER C 3 11 ? -16.999 -5.107  -3.201  1.00 0.00 ? 11 SER P HA     3  
ATOM 4922  H HB2    . SER C 3 11 ? -19.396 -6.508  -2.084  1.00 0.00 ? 11 SER P HB2    3  
ATOM 4923  H HB3    . SER C 3 11 ? -19.372 -5.541  -3.554  1.00 0.00 ? 11 SER P HB3    3  
ATOM 4924  H HG     . SER C 3 11 ? -18.982 -8.012  -3.498  1.00 0.00 ? 11 SER P HG     3  
ATOM 4925  N N      . SER C 3 12 ? -18.829 -4.096  -0.489  1.00 0.00 ? 12 SER P N      3  
ATOM 4926  C CA     . SER C 3 12 ? -19.417 -2.787  0.036   1.00 0.00 ? 12 SER P CA     3  
ATOM 4927  C C      . SER C 3 12 ? -18.412 -1.736  0.447   1.00 0.00 ? 12 SER P C      3  
ATOM 4928  O O      . SER C 3 12 ? -18.698 -0.552  0.374   1.00 0.00 ? 12 SER P O      3  
ATOM 4929  C CB     . SER C 3 12 ? -20.395 -3.154  1.179   1.00 0.00 ? 12 SER P CB     3  
ATOM 4930  O OG     . SER C 3 12 ? -21.598 -3.727  0.650   1.00 0.00 ? 12 SER P OG     3  
ATOM 4931  H H      . SER C 3 12 ? -18.741 -4.993  -0.033  1.00 0.00 ? 12 SER P H      3  
ATOM 4932  H HA     . SER C 3 12 ? -19.936 -2.392  -0.836  1.00 0.00 ? 12 SER P HA     3  
ATOM 4933  H HB2    . SER C 3 12 ? -19.909 -3.864  1.847   1.00 0.00 ? 12 SER P HB2    3  
ATOM 4934  H HB3    . SER C 3 12 ? -20.691 -2.205  1.628   1.00 0.00 ? 12 SER P HB3    3  
ATOM 4935  H HG     . SER C 3 12 ? -21.294 -4.355  -0.010  1.00 0.00 ? 12 SER P HG     3  
ATOM 4936  N N      . GLN C 3 13 ? -17.201 -2.144  0.928   1.00 0.00 ? 13 GLN P N      3  
ATOM 4937  C CA     . GLN C 3 13 ? -16.081 -1.136  1.229   1.00 0.00 ? 13 GLN P CA     3  
ATOM 4938  C C      . GLN C 3 13 ? -15.631 -0.345  0.027   1.00 0.00 ? 13 GLN P C      3  
ATOM 4939  O O      . GLN C 3 13 ? -15.431 0.858   0.100   1.00 0.00 ? 13 GLN P O      3  
ATOM 4940  C CB     . GLN C 3 13 ? -14.912 -1.864  1.779   1.00 0.00 ? 13 GLN P CB     3  
ATOM 4941  C CG     . GLN C 3 13 ? -15.304 -2.462  3.115   1.00 0.00 ? 13 GLN P CG     3  
ATOM 4942  C CD     . GLN C 3 13 ? -14.121 -3.110  3.765   1.00 0.00 ? 13 GLN P CD     3  
ATOM 4943  O OE1    . GLN C 3 13 ? -13.589 -4.131  3.327   1.00 0.00 ? 13 GLN P OE1    3  
ATOM 4944  N NE2    . GLN C 3 13 ? -13.676 -2.490  4.824   1.00 0.00 ? 13 GLN P NE2    3  
ATOM 4945  H H      . GLN C 3 13 ? -16.922 -3.114  0.965   1.00 0.00 ? 13 GLN P H      3  
ATOM 4946  H HA     . GLN C 3 13 ? -16.490 -0.426  1.947   1.00 0.00 ? 13 GLN P HA     3  
ATOM 4947  H HB2    . GLN C 3 13 ? -14.591 -2.676  1.127   1.00 0.00 ? 13 GLN P HB2    3  
ATOM 4948  H HB3    . GLN C 3 13 ? -14.104 -1.160  1.982   1.00 0.00 ? 13 GLN P HB3    3  
ATOM 4949  H HG2    . GLN C 3 13 ? -15.784 -1.810  3.845   1.00 0.00 ? 13 GLN P HG2    3  
ATOM 4950  H HG3    . GLN C 3 13 ? -16.001 -3.251  2.828   1.00 0.00 ? 13 GLN P HG3    3  
ATOM 4951  H HE21   . GLN C 3 13 ? -14.132 -1.650  5.152   1.00 0.00 ? 13 GLN P HE21   3  
ATOM 4952  H HE22   . GLN C 3 13 ? -12.890 -2.967  5.244   1.00 0.00 ? 13 GLN P HE22   3  
ATOM 4953  N N      . ILE C 3 14 ? -15.446 -1.045  -1.137  1.00 0.00 ? 14 ILE P N      3  
ATOM 4954  C CA     . ILE C 3 14 ? -15.168 -0.385  -2.427  1.00 0.00 ? 14 ILE P CA     3  
ATOM 4955  C C      . ILE C 3 14 ? -16.296 0.490   -2.940  1.00 0.00 ? 14 ILE P C      3  
ATOM 4956  O O      . ILE C 3 14 ? -16.102 1.601   -3.536  1.00 0.00 ? 14 ILE P O      3  
ATOM 4957  C CB     . ILE C 3 14 ? -14.857 -1.440  -3.532  1.00 0.00 ? 14 ILE P CB     3  
ATOM 4958  C CG1    . ILE C 3 14 ? -13.727 -2.330  -2.948  1.00 0.00 ? 14 ILE P CG1    3  
ATOM 4959  C CG2    . ILE C 3 14 ? -14.491 -0.829  -4.918  1.00 0.00 ? 14 ILE P CG2    3  
ATOM 4960  C CD1    . ILE C 3 14 ? -13.236 -3.548  -3.763  1.00 0.00 ? 14 ILE P CD1    3  
ATOM 4961  H H      . ILE C 3 14 ? -15.607 -2.034  -1.015  1.00 0.00 ? 14 ILE P H      3  
ATOM 4962  H HA     . ILE C 3 14 ? -14.299 0.273   -2.396  1.00 0.00 ? 14 ILE P HA     3  
ATOM 4963  H HB     . ILE C 3 14 ? -15.756 -2.049  -3.627  1.00 0.00 ? 14 ILE P HB     3  
ATOM 4964  H HG12   . ILE C 3 14 ? -12.848 -1.719  -2.740  1.00 0.00 ? 14 ILE P HG12   3  
ATOM 4965  H HG13   . ILE C 3 14 ? -14.020 -2.760  -1.990  1.00 0.00 ? 14 ILE P HG13   3  
ATOM 4966  H HG21   . ILE C 3 14 ? -14.462 -1.603  -5.687  1.00 0.00 ? 14 ILE P HG21   3  
ATOM 4967  H HG22   . ILE C 3 14 ? -15.284 -0.120  -5.159  1.00 0.00 ? 14 ILE P HG22   3  
ATOM 4968  H HG23   . ILE C 3 14 ? -13.610 -0.199  -5.042  1.00 0.00 ? 14 ILE P HG23   3  
ATOM 4969  H HD11   . ILE C 3 14 ? -14.097 -4.035  -4.222  1.00 0.00 ? 14 ILE P HD11   3  
ATOM 4970  H HD12   . ILE C 3 14 ? -12.529 -3.230  -4.529  1.00 0.00 ? 14 ILE P HD12   3  
ATOM 4971  H HD13   . ILE C 3 14 ? -12.815 -4.273  -3.066  1.00 0.00 ? 14 ILE P HD13   3  
ATOM 4972  N N      . ALA C 3 15 ? -17.556 0.077   -2.666  1.00 0.00 ? 15 ALA P N      3  
ATOM 4973  C CA     . ALA C 3 15 ? -18.759 0.795   -2.993  1.00 0.00 ? 15 ALA P CA     3  
ATOM 4974  C C      . ALA C 3 15 ? -18.786 2.238   -2.279  1.00 0.00 ? 15 ALA P C      3  
ATOM 4975  O O      . ALA C 3 15 ? -18.958 3.291   -2.910  1.00 0.00 ? 15 ALA P O      3  
ATOM 4976  C CB     . ALA C 3 15 ? -19.942 -0.017  -2.563  1.00 0.00 ? 15 ALA P CB     3  
ATOM 4977  H H      . ALA C 3 15 ? -17.687 -0.746  -2.096  1.00 0.00 ? 15 ALA P H      3  
ATOM 4978  H HA     . ALA C 3 15 ? -18.762 0.826   -4.082  1.00 0.00 ? 15 ALA P HA     3  
ATOM 4979  H HB1    . ALA C 3 15 ? -20.036 -1.058  -2.867  1.00 0.00 ? 15 ALA P HB1    3  
ATOM 4980  H HB2    . ALA C 3 15 ? -20.105 0.061   -1.487  1.00 0.00 ? 15 ALA P HB2    3  
ATOM 4981  H HB3    . ALA C 3 15 ? -20.839 0.394   -3.027  1.00 0.00 ? 15 ALA P HB3    3  
ATOM 4982  N N      . GLU C 3 16 ? -18.567 2.214   -0.936  1.00 0.00 ? 16 GLU P N      3  
ATOM 4983  C CA     . GLU C 3 16 ? -18.387 3.382   -0.136  1.00 0.00 ? 16 GLU P CA     3  
ATOM 4984  C C      . GLU C 3 16 ? -17.225 4.171   -0.640  1.00 0.00 ? 16 GLU P C      3  
ATOM 4985  O O      . GLU C 3 16 ? -17.359 5.388   -0.837  1.00 0.00 ? 16 GLU P O      3  
ATOM 4986  C CB     . GLU C 3 16 ? -17.980 2.953   1.307   1.00 0.00 ? 16 GLU P CB     3  
ATOM 4987  C CG     . GLU C 3 16 ? -18.860 2.575   2.455   1.00 0.00 ? 16 GLU P CG     3  
ATOM 4988  C CD     . GLU C 3 16 ? -20.165 3.391   2.435   1.00 0.00 ? 16 GLU P CD     3  
ATOM 4989  O OE1    . GLU C 3 16 ? -20.637 3.871   3.486   1.00 0.00 ? 16 GLU P OE1    3  
ATOM 4990  O OE2    . GLU C 3 16 ? -20.885 3.427   1.403   1.00 0.00 ? 16 GLU P OE2    3  
ATOM 4991  H H      . GLU C 3 16 ? -18.511 1.302   -0.504  1.00 0.00 ? 16 GLU P H      3  
ATOM 4992  H HA     . GLU C 3 16 ? -19.277 4.012   -0.094  1.00 0.00 ? 16 GLU P HA     3  
ATOM 4993  H HB2    . GLU C 3 16 ? -17.241 2.178   1.102   1.00 0.00 ? 16 GLU P HB2    3  
ATOM 4994  H HB3    . GLU C 3 16 ? -17.401 3.811   1.645   1.00 0.00 ? 16 GLU P HB3    3  
ATOM 4995  H HG2    . GLU C 3 16 ? -18.849 1.496   2.611   1.00 0.00 ? 16 GLU P HG2    3  
ATOM 4996  H HG3    . GLU C 3 16 ? -18.337 2.938   3.339   1.00 0.00 ? 16 GLU P HG3    3  
ATOM 4997  N N      . LEU C 3 17 ? -16.038 3.594   -0.892  1.00 0.00 ? 17 LEU P N      3  
ATOM 4998  C CA     . LEU C 3 17 ? -14.761 4.310   -1.155  1.00 0.00 ? 17 LEU P CA     3  
ATOM 4999  C C      . LEU C 3 17 ? -14.940 5.048   -2.434  1.00 0.00 ? 17 LEU P C      3  
ATOM 5000  O O      . LEU C 3 17 ? -14.518 6.162   -2.556  1.00 0.00 ? 17 LEU P O      3  
ATOM 5001  C CB     . LEU C 3 17 ? -13.653 3.242   -1.284  1.00 0.00 ? 17 LEU P CB     3  
ATOM 5002  C CG     . LEU C 3 17 ? -12.974 2.814   0.030   1.00 0.00 ? 17 LEU P CG     3  
ATOM 5003  C CD1    . LEU C 3 17 ? -12.081 1.615   -0.025  1.00 0.00 ? 17 LEU P CD1    3  
ATOM 5004  C CD2    . LEU C 3 17 ? -12.066 3.969   0.449   1.00 0.00 ? 17 LEU P CD2    3  
ATOM 5005  H H      . LEU C 3 17 ? -15.992 2.608   -0.679  1.00 0.00 ? 17 LEU P H      3  
ATOM 5006  H HA     . LEU C 3 17 ? -14.611 5.057   -0.377  1.00 0.00 ? 17 LEU P HA     3  
ATOM 5007  H HB2    . LEU C 3 17 ? -14.107 2.316   -1.636  1.00 0.00 ? 17 LEU P HB2    3  
ATOM 5008  H HB3    . LEU C 3 17 ? -12.946 3.537   -2.059  1.00 0.00 ? 17 LEU P HB3    3  
ATOM 5009  H HG     . LEU C 3 17 ? -13.812 2.643   0.706   1.00 0.00 ? 17 LEU P HG     3  
ATOM 5010  H HD11   . LEU C 3 17 ? -11.164 1.741   -0.600  1.00 0.00 ? 17 LEU P HD11   3  
ATOM 5011  H HD12   . LEU C 3 17 ? -12.517 0.652   -0.289  1.00 0.00 ? 17 LEU P HD12   3  
ATOM 5012  H HD13   . LEU C 3 17 ? -11.730 1.438   0.992   1.00 0.00 ? 17 LEU P HD13   3  
ATOM 5013  H HD21   . LEU C 3 17 ? -12.629 4.858   0.736   1.00 0.00 ? 17 LEU P HD21   3  
ATOM 5014  H HD22   . LEU C 3 17 ? -11.349 4.241   -0.326  1.00 0.00 ? 17 LEU P HD22   3  
ATOM 5015  H HD23   . LEU C 3 17 ? -11.481 3.547   1.266   1.00 0.00 ? 17 LEU P HD23   3  
ATOM 5016  N N      . GLU C 3 18 ? -15.600 4.471   -3.469  1.00 0.00 ? 18 GLU P N      3  
ATOM 5017  C CA     . GLU C 3 18 ? -15.957 5.132   -4.724  1.00 0.00 ? 18 GLU P CA     3  
ATOM 5018  C C      . GLU C 3 18 ? -16.898 6.286   -4.425  1.00 0.00 ? 18 GLU P C      3  
ATOM 5019  O O      . GLU C 3 18 ? -16.645 7.436   -4.872  1.00 0.00 ? 18 GLU P O      3  
ATOM 5020  C CB     . GLU C 3 18 ? -16.543 4.157   -5.764  1.00 0.00 ? 18 GLU P CB     3  
ATOM 5021  C CG     . GLU C 3 18 ? -15.633 3.155   -6.611  1.00 0.00 ? 18 GLU P CG     3  
ATOM 5022  C CD     . GLU C 3 18 ? -16.115 3.060   -7.994  1.00 0.00 ? 18 GLU P CD     3  
ATOM 5023  O OE1    . GLU C 3 18 ? -17.334 2.817   -8.215  1.00 0.00 ? 18 GLU P OE1    3  
ATOM 5024  O OE2    . GLU C 3 18 ? -15.414 3.329   -9.041  1.00 0.00 ? 18 GLU P OE2    3  
ATOM 5025  H H      . GLU C 3 18 ? -15.815 3.493   -3.341  1.00 0.00 ? 18 GLU P H      3  
ATOM 5026  H HA     . GLU C 3 18 ? -15.036 5.573   -5.104  1.00 0.00 ? 18 GLU P HA     3  
ATOM 5027  H HB2    . GLU C 3 18 ? -17.399 3.637   -5.332  1.00 0.00 ? 18 GLU P HB2    3  
ATOM 5028  H HB3    . GLU C 3 18 ? -16.864 4.896   -6.498  1.00 0.00 ? 18 GLU P HB3    3  
ATOM 5029  H HG2    . GLU C 3 18 ? -14.628 3.570   -6.677  1.00 0.00 ? 18 GLU P HG2    3  
ATOM 5030  H HG3    . GLU C 3 18 ? -15.640 2.223   -6.046  1.00 0.00 ? 18 GLU P HG3    3  
ATOM 5031  N N      . GLN C 3 19 ? -17.972 6.114   -3.651  1.00 0.00 ? 19 GLN P N      3  
ATOM 5032  C CA     . GLN C 3 19 ? -19.005 7.093   -3.513  1.00 0.00 ? 19 GLN P CA     3  
ATOM 5033  C C      . GLN C 3 19 ? -18.464 8.406   -2.815  1.00 0.00 ? 19 GLN P C      3  
ATOM 5034  O O      . GLN C 3 19 ? -19.006 9.467   -3.147  1.00 0.00 ? 19 GLN P O      3  
ATOM 5035  C CB     . GLN C 3 19 ? -20.042 6.390   -2.526  1.00 0.00 ? 19 GLN P CB     3  
ATOM 5036  C CG     . GLN C 3 19 ? -21.376 7.174   -2.196  1.00 0.00 ? 19 GLN P CG     3  
ATOM 5037  C CD     . GLN C 3 19 ? -21.982 7.906   -3.404  1.00 0.00 ? 19 GLN P CD     3  
ATOM 5038  O OE1    . GLN C 3 19 ? -22.620 7.324   -4.179  1.00 0.00 ? 19 GLN P OE1    3  
ATOM 5039  N NE2    . GLN C 3 19 ? -21.848 9.131   -3.555  1.00 0.00 ? 19 GLN P NE2    3  
ATOM 5040  H H      . GLN C 3 19 ? -18.111 5.199   -3.247  1.00 0.00 ? 19 GLN P H      3  
ATOM 5041  H HA     . GLN C 3 19 ? -19.476 7.367   -4.457  1.00 0.00 ? 19 GLN P HA     3  
ATOM 5042  H HB2    . GLN C 3 19 ? -20.278 5.470   -3.060  1.00 0.00 ? 19 GLN P HB2    3  
ATOM 5043  H HB3    . GLN C 3 19 ? -19.533 6.236   -1.575  1.00 0.00 ? 19 GLN P HB3    3  
ATOM 5044  H HG2    . GLN C 3 19 ? -22.068 6.477   -1.725  1.00 0.00 ? 19 GLN P HG2    3  
ATOM 5045  H HG3    . GLN C 3 19 ? -21.112 7.887   -1.414  1.00 0.00 ? 19 GLN P HG3    3  
ATOM 5046  H HE21   . GLN C 3 19 ? -21.174 9.609   -2.974  1.00 0.00 ? 19 GLN P HE21   3  
ATOM 5047  H HE22   . GLN C 3 19 ? -22.312 9.536   -4.355  1.00 0.00 ? 19 GLN P HE22   3  
ATOM 5048  N N      . HIS C 3 20 ? -17.677 8.298   -1.771  1.00 0.00 ? 20 HIS P N      3  
ATOM 5049  C CA     . HIS C 3 20 ? -17.083 9.506   -1.081  1.00 0.00 ? 20 HIS P CA     3  
ATOM 5050  C C      . HIS C 3 20 ? -15.899 10.049  -1.919  1.00 0.00 ? 20 HIS P C      3  
ATOM 5051  O O      . HIS C 3 20 ? -15.691 11.228  -1.928  1.00 0.00 ? 20 HIS P O      3  
ATOM 5052  C CB     . HIS C 3 20 ? -16.836 9.177   0.430   1.00 0.00 ? 20 HIS P CB     3  
ATOM 5053  C CG     . HIS C 3 20 ? -18.041 8.643   1.104   1.00 0.00 ? 20 HIS P CG     3  
ATOM 5054  N ND1    . HIS C 3 20 ? -19.031 9.512   1.528   1.00 0.00 ? 20 HIS P ND1    3  
ATOM 5055  C CD2    . HIS C 3 20 ? -18.378 7.395   1.506   1.00 0.00 ? 20 HIS P CD2    3  
ATOM 5056  C CE1    . HIS C 3 20 ? -20.040 8.808   2.120   1.00 0.00 ? 20 HIS P CE1    3  
ATOM 5057  N NE2    . HIS C 3 20 ? -19.602 7.512   2.116   1.00 0.00 ? 20 HIS P NE2    3  
ATOM 5058  H H      . HIS C 3 20 ? -17.353 7.402   -1.437  1.00 0.00 ? 20 HIS P H      3  
ATOM 5059  H HA     . HIS C 3 20 ? -17.823 10.305  -1.115  1.00 0.00 ? 20 HIS P HA     3  
ATOM 5060  H HB2    . HIS C 3 20 ? -16.065 8.408   0.473   1.00 0.00 ? 20 HIS P HB2    3  
ATOM 5061  H HB3    . HIS C 3 20 ? -16.530 10.066  0.981   1.00 0.00 ? 20 HIS P HB3    3  
ATOM 5062  H HD1    . HIS C 3 20 ? -18.989 10.512  1.396   1.00 0.00 ? 20 HIS P HD1    3  
ATOM 5063  H HD2    . HIS C 3 20 ? -17.823 6.495   1.286   1.00 0.00 ? 20 HIS P HD2    3  
ATOM 5064  H HE1    . HIS C 3 20 ? -20.903 9.250   2.596   1.00 0.00 ? 20 HIS P HE1    3  
ATOM 5065  N N      . PHE C 3 21 ? -15.122 9.194   -2.612  1.00 0.00 ? 21 PHE P N      3  
ATOM 5066  C CA     . PHE C 3 21 ? -14.160 9.716   -3.662  1.00 0.00 ? 21 PHE P CA     3  
ATOM 5067  C C      . PHE C 3 21 ? -14.915 10.635  -4.670  1.00 0.00 ? 21 PHE P C      3  
ATOM 5068  O O      . PHE C 3 21 ? -14.282 11.573  -5.056  1.00 0.00 ? 21 PHE P O      3  
ATOM 5069  C CB     . PHE C 3 21 ? -13.607 8.491   -4.378  1.00 0.00 ? 21 PHE P CB     3  
ATOM 5070  C CG     . PHE C 3 21 ? -13.251 8.687   -5.828  1.00 0.00 ? 21 PHE P CG     3  
ATOM 5071  C CD1    . PHE C 3 21 ? -14.113 8.238   -6.796  1.00 0.00 ? 21 PHE P CD1    3  
ATOM 5072  C CD2    . PHE C 3 21 ? -12.065 9.266   -6.273  1.00 0.00 ? 21 PHE P CD2    3  
ATOM 5073  C CE1    . PHE C 3 21 ? -13.919 8.507   -8.142  1.00 0.00 ? 21 PHE P CE1    3  
ATOM 5074  C CE2    . PHE C 3 21 ? -11.783 9.450   -7.634  1.00 0.00 ? 21 PHE P CE2    3  
ATOM 5075  C CZ     . PHE C 3 21 ? -12.740 9.112   -8.627  1.00 0.00 ? 21 PHE P CZ     3  
ATOM 5076  H H      . PHE C 3 21 ? -15.158 8.200   -2.441  1.00 0.00 ? 21 PHE P H      3  
ATOM 5077  H HA     . PHE C 3 21 ? -13.406 10.300  -3.135  1.00 0.00 ? 21 PHE P HA     3  
ATOM 5078  H HB2    . PHE C 3 21 ? -12.779 8.094   -3.791  1.00 0.00 ? 21 PHE P HB2    3  
ATOM 5079  H HB3    . PHE C 3 21 ? -14.402 7.748   -4.454  1.00 0.00 ? 21 PHE P HB3    3  
ATOM 5080  H HD1    . PHE C 3 21 ? -15.018 7.693   -6.570  1.00 0.00 ? 21 PHE P HD1    3  
ATOM 5081  H HD2    . PHE C 3 21 ? -11.394 9.586   -5.489  1.00 0.00 ? 21 PHE P HD2    3  
ATOM 5082  H HE1    . PHE C 3 21 ? -14.798 8.453   -8.768  1.00 0.00 ? 21 PHE P HE1    3  
ATOM 5083  H HE2    . PHE C 3 21 ? -10.868 9.929   -7.953  1.00 0.00 ? 21 PHE P HE2    3  
ATOM 5084  H HZ     . PHE C 3 21 ? -12.564 9.325   -9.670  1.00 0.00 ? 21 PHE P HZ     3  
ATOM 5085  N N      . LEU C 3 22 ? -16.142 10.371  -5.063  1.00 0.00 ? 22 LEU P N      3  
ATOM 5086  C CA     . LEU C 3 22 ? -16.926 11.326  -5.874  1.00 0.00 ? 22 LEU P CA     3  
ATOM 5087  C C      . LEU C 3 22 ? -16.945 12.748  -5.302  1.00 0.00 ? 22 LEU P C      3  
ATOM 5088  O O      . LEU C 3 22 ? -17.193 13.728  -6.044  1.00 0.00 ? 22 LEU P O      3  
ATOM 5089  C CB     . LEU C 3 22 ? -18.398 10.873  -6.322  1.00 0.00 ? 22 LEU P CB     3  
ATOM 5090  C CG     . LEU C 3 22 ? -18.577 9.394   -6.756  1.00 0.00 ? 22 LEU P CG     3  
ATOM 5091  C CD1    . LEU C 3 22 ? -20.032 9.197   -7.056  1.00 0.00 ? 22 LEU P CD1    3  
ATOM 5092  C CD2    . LEU C 3 22 ? -17.780 9.171   -8.006  1.00 0.00 ? 22 LEU P CD2    3  
ATOM 5093  H H      . LEU C 3 22 ? -16.435 9.407   -4.988  1.00 0.00 ? 22 LEU P H      3  
ATOM 5094  H HA     . LEU C 3 22 ? -16.315 11.357  -6.776  1.00 0.00 ? 22 LEU P HA     3  
ATOM 5095  H HB2    . LEU C 3 22 ? -19.031 11.114  -5.467  1.00 0.00 ? 22 LEU P HB2    3  
ATOM 5096  H HB3    . LEU C 3 22 ? -18.746 11.509  -7.137  1.00 0.00 ? 22 LEU P HB3    3  
ATOM 5097  H HG     . LEU C 3 22 ? -18.338 8.638   -6.008  1.00 0.00 ? 22 LEU P HG     3  
ATOM 5098  H HD11   . LEU C 3 22 ? -20.526 8.797   -6.171  1.00 0.00 ? 22 LEU P HD11   3  
ATOM 5099  H HD12   . LEU C 3 22 ? -20.283 8.483   -7.841  1.00 0.00 ? 22 LEU P HD12   3  
ATOM 5100  H HD13   . LEU C 3 22 ? -20.542 10.142  -7.241  1.00 0.00 ? 22 LEU P HD13   3  
ATOM 5101  H HD21   . LEU C 3 22 ? -16.712 9.161   -7.788  1.00 0.00 ? 22 LEU P HD21   3  
ATOM 5102  H HD22   . LEU C 3 22 ? -18.121 9.888   -8.753  1.00 0.00 ? 22 LEU P HD22   3  
ATOM 5103  H HD23   . LEU C 3 22 ? -18.001 8.198   -8.446  1.00 0.00 ? 22 LEU P HD23   3  
ATOM 5104  N N      . GLN C 3 23 ? -16.862 12.901  -4.002  1.00 0.00 ? 23 GLN P N      3  
ATOM 5105  C CA     . GLN C 3 23 ? -16.901 14.147  -3.272  1.00 0.00 ? 23 GLN P CA     3  
ATOM 5106  C C      . GLN C 3 23 ? -15.473 14.757  -3.039  1.00 0.00 ? 23 GLN P C      3  
ATOM 5107  O O      . GLN C 3 23 ? -15.266 15.921  -2.571  1.00 0.00 ? 23 GLN P O      3  
ATOM 5108  C CB     . GLN C 3 23 ? -17.633 13.899  -1.900  1.00 0.00 ? 23 GLN P CB     3  
ATOM 5109  C CG     . GLN C 3 23 ? -18.924 13.089  -2.026  1.00 0.00 ? 23 GLN P CG     3  
ATOM 5110  C CD     . GLN C 3 23 ? -19.909 13.572  -3.107  1.00 0.00 ? 23 GLN P CD     3  
ATOM 5111  O OE1    . GLN C 3 23 ? -20.193 14.684  -3.338  1.00 0.00 ? 23 GLN P OE1    3  
ATOM 5112  N NE2    . GLN C 3 23 ? -20.693 12.674  -3.724  1.00 0.00 ? 23 GLN P NE2    3  
ATOM 5113  H H      . GLN C 3 23 ? -16.733 12.010  -3.544  1.00 0.00 ? 23 GLN P H      3  
ATOM 5114  H HA     . GLN C 3 23 ? -17.583 14.851  -3.748  1.00 0.00 ? 23 GLN P HA     3  
ATOM 5115  H HB2    . GLN C 3 23 ? -16.887 13.278  -1.404  1.00 0.00 ? 23 GLN P HB2    3  
ATOM 5116  H HB3    . GLN C 3 23 ? -17.919 14.799  -1.357  1.00 0.00 ? 23 GLN P HB3    3  
ATOM 5117  H HG2    . GLN C 3 23 ? -18.737 12.052  -2.305  1.00 0.00 ? 23 GLN P HG2    3  
ATOM 5118  H HG3    . GLN C 3 23 ? -19.409 13.057  -1.052  1.00 0.00 ? 23 GLN P HG3    3  
ATOM 5119  H HE21   . GLN C 3 23 ? -20.558 11.738  -3.369  1.00 0.00 ? 23 GLN P HE21   3  
ATOM 5120  H HE22   . GLN C 3 23 ? -21.270 13.080  -4.447  1.00 0.00 ? 23 GLN P HE22   3  
ATOM 5121  N N      . GLY C 3 24 ? -14.526 13.906  -3.323  1.00 0.00 ? 24 GLY P N      3  
ATOM 5122  C CA     . GLY C 3 24 ? -13.119 14.293  -3.203  1.00 0.00 ? 24 GLY P CA     3  
ATOM 5123  C C      . GLY C 3 24 ? -12.157 13.374  -3.822  1.00 0.00 ? 24 GLY P C      3  
ATOM 5124  O O      . GLY C 3 24 ? -11.827 12.332  -3.236  1.00 0.00 ? 24 GLY P O      3  
ATOM 5125  H H      . GLY C 3 24 ? -14.684 12.982  -3.698  1.00 0.00 ? 24 GLY P H      3  
ATOM 5126  H HA2    . GLY C 3 24 ? -12.954 15.216  -3.760  1.00 0.00 ? 24 GLY P HA2    3  
ATOM 5127  H HA3    . GLY C 3 24 ? -12.922 14.451  -2.143  1.00 0.00 ? 24 GLY P HA3    3  
ATOM 5128  N N      . ARG C 3 25 ? -11.722 13.700  -5.020  1.00 0.00 ? 25 ARG P N      3  
ATOM 5129  C CA     . ARG C 3 25 ? -10.888 12.898  -5.850  1.00 0.00 ? 25 ARG P CA     3  
ATOM 5130  C C      . ARG C 3 25 ? -9.482  12.589  -5.294  1.00 0.00 ? 25 ARG P C      3  
ATOM 5131  O O      . ARG C 3 25 ? -8.833  11.591  -5.646  1.00 0.00 ? 25 ARG P O      3  
ATOM 5132  C CB     . ARG C 3 25 ? -10.719 13.570  -7.250  1.00 0.00 ? 25 ARG P CB     3  
ATOM 5133  C CG     . ARG C 3 25 ? -12.106 13.866  -7.885  1.00 0.00 ? 25 ARG P CG     3  
ATOM 5134  C CD     . ARG C 3 25 ? -12.862 12.562  -8.216  1.00 0.00 ? 25 ARG P CD     3  
ATOM 5135  N NE     . ARG C 3 25 ? -14.034 12.903  -9.020  1.00 0.00 ? 25 ARG P NE     3  
ATOM 5136  C CZ     . ARG C 3 25 ? -14.367 12.496  -10.234 1.00 0.00 ? 25 ARG P CZ     3  
ATOM 5137  N NH1    . ARG C 3 25 ? -13.475 11.891  -10.969 1.00 0.00 ? 25 ARG P NH1    3  
ATOM 5138  N NH2    . ARG C 3 25 ? -15.510 12.689  -10.802 1.00 0.00 ? 25 ARG P NH2    3  
ATOM 5139  H H      . ARG C 3 25 ? -11.980 14.632  -5.309  1.00 0.00 ? 25 ARG P H      3  
ATOM 5140  H HA     . ARG C 3 25 ? -11.300 11.896  -5.978  1.00 0.00 ? 25 ARG P HA     3  
ATOM 5141  H HB2    . ARG C 3 25 ? -10.234 14.546  -7.272  1.00 0.00 ? 25 ARG P HB2    3  
ATOM 5142  H HB3    . ARG C 3 25 ? -10.173 12.918  -7.932  1.00 0.00 ? 25 ARG P HB3    3  
ATOM 5143  H HG2    . ARG C 3 25 ? -12.661 14.596  -7.295  1.00 0.00 ? 25 ARG P HG2    3  
ATOM 5144  H HG3    . ARG C 3 25 ? -11.970 14.443  -8.801  1.00 0.00 ? 25 ARG P HG3    3  
ATOM 5145  H HD2    . ARG C 3 25 ? -12.206 11.878  -8.755  1.00 0.00 ? 25 ARG P HD2    3  
ATOM 5146  H HD3    . ARG C 3 25 ? -13.163 12.067  -7.292  1.00 0.00 ? 25 ARG P HD3    3  
ATOM 5147  H HE     . ARG C 3 25 ? -14.684 13.536  -8.577  1.00 0.00 ? 25 ARG P HE     3  
ATOM 5148  H HH11   . ARG C 3 25 ? -12.512 12.020  -10.696 1.00 0.00 ? 25 ARG P HH11   3  
ATOM 5149  H HH12   . ARG C 3 25 ? -13.684 11.306  -11.766 1.00 0.00 ? 25 ARG P HH12   3  
ATOM 5150  H HH21   . ARG C 3 25 ? -16.163 13.333  -10.380 1.00 0.00 ? 25 ARG P HH21   3  
ATOM 5151  H HH22   . ARG C 3 25 ? -15.629 12.417  -11.767 1.00 0.00 ? 25 ARG P HH22   3  
ATOM 5152  N N      . TYR C 3 26 ? -9.011  13.410  -4.310  1.00 0.00 ? 26 TYR P N      3  
ATOM 5153  C CA     . TYR C 3 26 ? -7.774  13.369  -3.590  1.00 0.00 ? 26 TYR P CA     3  
ATOM 5154  C C      . TYR C 3 26 ? -8.008  13.309  -2.094  1.00 0.00 ? 26 TYR P C      3  
ATOM 5155  O O      . TYR C 3 26 ? -8.657  14.162  -1.535  1.00 0.00 ? 26 TYR P O      3  
ATOM 5156  C CB     . TYR C 3 26 ? -6.935  14.630  -3.826  1.00 0.00 ? 26 TYR P CB     3  
ATOM 5157  C CG     . TYR C 3 26 ? -6.398  14.812  -5.193  1.00 0.00 ? 26 TYR P CG     3  
ATOM 5158  C CD1    . TYR C 3 26 ? -5.023  14.623  -5.479  1.00 0.00 ? 26 TYR P CD1    3  
ATOM 5159  C CD2    . TYR C 3 26 ? -7.282  15.098  -6.272  1.00 0.00 ? 26 TYR P CD2    3  
ATOM 5160  C CE1    . TYR C 3 26 ? -4.566  14.707  -6.795  1.00 0.00 ? 26 TYR P CE1    3  
ATOM 5161  C CE2    . TYR C 3 26 ? -6.827  15.142  -7.623  1.00 0.00 ? 26 TYR P CE2    3  
ATOM 5162  C CZ     . TYR C 3 26 ? -5.452  14.933  -7.849  1.00 0.00 ? 26 TYR P CZ     3  
ATOM 5163  O OH     . TYR C 3 26 ? -5.028  14.938  -9.127  1.00 0.00 ? 26 TYR P OH     3  
ATOM 5164  H H      . TYR C 3 26 ? -9.619  14.218  -4.313  1.00 0.00 ? 26 TYR P H      3  
ATOM 5165  H HA     . TYR C 3 26 ? -7.272  12.446  -3.878  1.00 0.00 ? 26 TYR P HA     3  
ATOM 5166  H HB2    . TYR C 3 26 ? -7.371  15.589  -3.547  1.00 0.00 ? 26 TYR P HB2    3  
ATOM 5167  H HB3    . TYR C 3 26 ? -6.118  14.437  -3.131  1.00 0.00 ? 26 TYR P HB3    3  
ATOM 5168  H HD1    . TYR C 3 26 ? -4.352  14.525  -4.638  1.00 0.00 ? 26 TYR P HD1    3  
ATOM 5169  H HD2    . TYR C 3 26 ? -8.300  15.366  -6.033  1.00 0.00 ? 26 TYR P HD2    3  
ATOM 5170  H HE1    . TYR C 3 26 ? -3.492  14.744  -6.902  1.00 0.00 ? 26 TYR P HE1    3  
ATOM 5171  H HE2    . TYR C 3 26 ? -7.561  15.323  -8.395  1.00 0.00 ? 26 TYR P HE2    3  
ATOM 5172  H HH     . TYR C 3 26 ? -4.081  14.783  -9.152  1.00 0.00 ? 26 TYR P HH     3  
ATOM 5173  N N      . LEU C 3 27 ? -7.504  12.278  -1.434  1.00 0.00 ? 27 LEU P N      3  
ATOM 5174  C CA     . LEU C 3 27 ? -7.495  12.258  -0.029  1.00 0.00 ? 27 LEU P CA     3  
ATOM 5175  C C      . LEU C 3 27 ? -6.811  13.375  0.653   1.00 0.00 ? 27 LEU P C      3  
ATOM 5176  O O      . LEU C 3 27 ? -5.764  13.837  0.207   1.00 0.00 ? 27 LEU P O      3  
ATOM 5177  C CB     . LEU C 3 27 ? -6.943  10.951  0.612   1.00 0.00 ? 27 LEU P CB     3  
ATOM 5178  C CG     . LEU C 3 27 ? -7.808  9.697   0.725   1.00 0.00 ? 27 LEU P CG     3  
ATOM 5179  C CD1    . LEU C 3 27 ? -6.960  8.729   1.439   1.00 0.00 ? 27 LEU P CD1    3  
ATOM 5180  C CD2    . LEU C 3 27 ? -9.124  9.842   1.456   1.00 0.00 ? 27 LEU P CD2    3  
ATOM 5181  H H      . LEU C 3 27 ? -6.904  11.677  -1.980  1.00 0.00 ? 27 LEU P H      3  
ATOM 5182  H HA     . LEU C 3 27 ? -8.514  12.357  0.347   1.00 0.00 ? 27 LEU P HA     3  
ATOM 5183  H HB2    . LEU C 3 27 ? -6.077  10.699  -0.001  1.00 0.00 ? 27 LEU P HB2    3  
ATOM 5184  H HB3    . LEU C 3 27 ? -6.736  11.168  1.661   1.00 0.00 ? 27 LEU P HB3    3  
ATOM 5185  H HG     . LEU C 3 27 ? -8.020  9.223   -0.233  1.00 0.00 ? 27 LEU P HG     3  
ATOM 5186  H HD11   . LEU C 3 27 ? -7.003  8.845   2.522   1.00 0.00 ? 27 LEU P HD11   3  
ATOM 5187  H HD12   . LEU C 3 27 ? -5.960  8.797   1.011   1.00 0.00 ? 27 LEU P HD12   3  
ATOM 5188  H HD13   . LEU C 3 27 ? -7.324  7.724   1.229   1.00 0.00 ? 27 LEU P HD13   3  
ATOM 5189  H HD21   . LEU C 3 27 ? -9.827  10.317  0.772   1.00 0.00 ? 27 LEU P HD21   3  
ATOM 5190  H HD22   . LEU C 3 27 ? -8.987  10.594  2.234   1.00 0.00 ? 27 LEU P HD22   3  
ATOM 5191  H HD23   . LEU C 3 27 ? -9.640  8.941   1.789   1.00 0.00 ? 27 LEU P HD23   3  
ATOM 5192  N N      . THR C 3 28 ? -7.455  13.779  1.693   1.00 0.00 ? 28 THR P N      3  
ATOM 5193  C CA     . THR C 3 28 ? -6.890  14.637  2.772   1.00 0.00 ? 28 THR P CA     3  
ATOM 5194  C C      . THR C 3 28 ? -7.047  13.885  4.116   1.00 0.00 ? 28 THR P C      3  
ATOM 5195  O O      . THR C 3 28 ? -7.803  12.900  4.188   1.00 0.00 ? 28 THR P O      3  
ATOM 5196  C CB     . THR C 3 28 ? -7.649  15.965  2.813   1.00 0.00 ? 28 THR P CB     3  
ATOM 5197  O OG1    . THR C 3 28 ? -8.946  15.773  3.235   1.00 0.00 ? 28 THR P OG1    3  
ATOM 5198  C CG2    . THR C 3 28 ? -7.541  16.681  1.456   1.00 0.00 ? 28 THR P CG2    3  
ATOM 5199  H H      . THR C 3 28 ? -8.339  13.334  1.897   1.00 0.00 ? 28 THR P H      3  
ATOM 5200  H HA     . THR C 3 28 ? -5.840  14.865  2.590   1.00 0.00 ? 28 THR P HA     3  
ATOM 5201  H HB     . THR C 3 28 ? -7.170  16.542  3.604   1.00 0.00 ? 28 THR P HB     3  
ATOM 5202  H HG1    . THR C 3 28 ? -9.305  16.662  3.191   1.00 0.00 ? 28 THR P HG1    3  
ATOM 5203  H HG21   . THR C 3 28 ? -7.817  17.711  1.677   1.00 0.00 ? 28 THR P HG21   3  
ATOM 5204  H HG22   . THR C 3 28 ? -8.266  16.166  0.827   1.00 0.00 ? 28 THR P HG22   3  
ATOM 5205  H HG23   . THR C 3 28 ? -6.597  16.434  0.969   1.00 0.00 ? 28 THR P HG23   3  
ATOM 5206  N N      . ALA C 3 29 ? -6.377  14.325  5.217   1.00 0.00 ? 29 ALA P N      3  
ATOM 5207  C CA     . ALA C 3 29 ? -6.610  13.684  6.507   1.00 0.00 ? 29 ALA P CA     3  
ATOM 5208  C C      . ALA C 3 29 ? -8.118  13.610  6.936   1.00 0.00 ? 29 ALA P C      3  
ATOM 5209  O O      . ALA C 3 29 ? -8.593  12.519  7.344   1.00 0.00 ? 29 ALA P O      3  
ATOM 5210  C CB     . ALA C 3 29 ? -5.609  14.256  7.485   1.00 0.00 ? 29 ALA P CB     3  
ATOM 5211  H H      . ALA C 3 29 ? -5.605  14.975  5.199   1.00 0.00 ? 29 ALA P H      3  
ATOM 5212  H HA     . ALA C 3 29 ? -6.417  12.619  6.370   1.00 0.00 ? 29 ALA P HA     3  
ATOM 5213  H HB1    . ALA C 3 29 ? -4.643  14.300  6.981   1.00 0.00 ? 29 ALA P HB1    3  
ATOM 5214  H HB2    . ALA C 3 29 ? -5.778  15.255  7.888   1.00 0.00 ? 29 ALA P HB2    3  
ATOM 5215  H HB3    . ALA C 3 29 ? -5.660  13.615  8.365   1.00 0.00 ? 29 ALA P HB3    3  
ATOM 5216  N N      . PRO C 3 30 ? -8.980  14.597  6.784   1.00 0.00 ? 30 PRO P N      3  
ATOM 5217  C CA     . PRO C 3 30 ? -10.419 14.463  7.057   1.00 0.00 ? 30 PRO P CA     3  
ATOM 5218  C C      . PRO C 3 30 ? -11.264 13.498  6.138   1.00 0.00 ? 30 PRO P C      3  
ATOM 5219  O O      . PRO C 3 30 ? -12.010 12.720  6.715   1.00 0.00 ? 30 PRO P O      3  
ATOM 5220  C CB     . PRO C 3 30 ? -11.048 15.823  7.149   1.00 0.00 ? 30 PRO P CB     3  
ATOM 5221  C CG     . PRO C 3 30 ? -9.878  16.759  6.774   1.00 0.00 ? 30 PRO P CG     3  
ATOM 5222  C CD     . PRO C 3 30 ? -8.619  15.956  6.775   1.00 0.00 ? 30 PRO P CD     3  
ATOM 5223  H HA     . PRO C 3 30 ? -10.429 13.978  8.034   1.00 0.00 ? 30 PRO P HA     3  
ATOM 5224  H HB2    . PRO C 3 30 ? -11.894 15.946  6.472   1.00 0.00 ? 30 PRO P HB2    3  
ATOM 5225  H HB3    . PRO C 3 30 ? -11.328 15.922  8.198   1.00 0.00 ? 30 PRO P HB3    3  
ATOM 5226  H HG2    . PRO C 3 30 ? -10.047 17.020  5.730   1.00 0.00 ? 30 PRO P HG2    3  
ATOM 5227  H HG3    . PRO C 3 30 ? -9.762  17.666  7.367   1.00 0.00 ? 30 PRO P HG3    3  
ATOM 5228  H HD2    . PRO C 3 30 ? -8.044  16.181  5.878   1.00 0.00 ? 30 PRO P HD2    3  
ATOM 5229  H HD3    . PRO C 3 30 ? -8.129  16.183  7.723   1.00 0.00 ? 30 PRO P HD3    3  
ATOM 5230  N N      . ARG C 3 31 ? -11.046 13.516  4.805   1.00 0.00 ? 31 ARG P N      3  
ATOM 5231  C CA     . ARG C 3 31 ? -11.634 12.636  3.827   1.00 0.00 ? 31 ARG P CA     3  
ATOM 5232  C C      . ARG C 3 31 ? -11.353 11.221  4.257   1.00 0.00 ? 31 ARG P C      3  
ATOM 5233  O O      . ARG C 3 31 ? -12.213 10.435  4.556   1.00 0.00 ? 31 ARG P O      3  
ATOM 5234  C CB     . ARG C 3 31 ? -10.929 12.756  2.453   1.00 0.00 ? 31 ARG P CB     3  
ATOM 5235  C CG     . ARG C 3 31 ? -11.384 13.902  1.541   1.00 0.00 ? 31 ARG P CG     3  
ATOM 5236  C CD     . ARG C 3 31 ? -12.201 15.097  2.209   1.00 0.00 ? 31 ARG P CD     3  
ATOM 5237  N NE     . ARG C 3 31 ? -12.519 16.208  1.315   1.00 0.00 ? 31 ARG P NE     3  
ATOM 5238  C CZ     . ARG C 3 31 ? -13.466 16.312  0.378   1.00 0.00 ? 31 ARG P CZ     3  
ATOM 5239  N NH1    . ARG C 3 31 ? -14.315 15.320  0.199   1.00 0.00 ? 31 ARG P NH1    3  
ATOM 5240  N NH2    . ARG C 3 31 ? -13.532 17.345  -0.467  1.00 0.00 ? 31 ARG P NH2    3  
ATOM 5241  H H      . ARG C 3 31 ? -10.345 14.188  4.528   1.00 0.00 ? 31 ARG P H      3  
ATOM 5242  H HA     . ARG C 3 31 ? -12.708 12.823  3.843   1.00 0.00 ? 31 ARG P HA     3  
ATOM 5243  H HB2    . ARG C 3 31 ? -9.869  12.875  2.679   1.00 0.00 ? 31 ARG P HB2    3  
ATOM 5244  H HB3    . ARG C 3 31 ? -11.002 11.794  1.944   1.00 0.00 ? 31 ARG P HB3    3  
ATOM 5245  H HG2    . ARG C 3 31 ? -10.469 14.363  1.167   1.00 0.00 ? 31 ARG P HG2    3  
ATOM 5246  H HG3    . ARG C 3 31 ? -11.925 13.536  0.668   1.00 0.00 ? 31 ARG P HG3    3  
ATOM 5247  H HD2    . ARG C 3 31 ? -13.135 14.785  2.677   1.00 0.00 ? 31 ARG P HD2    3  
ATOM 5248  H HD3    . ARG C 3 31 ? -11.452 15.472  2.906   1.00 0.00 ? 31 ARG P HD3    3  
ATOM 5249  H HE     . ARG C 3 31 ? -11.816 16.934  1.311   1.00 0.00 ? 31 ARG P HE     3  
ATOM 5250  H HH11   . ARG C 3 31 ? -14.286 14.466  0.739   1.00 0.00 ? 31 ARG P HH11   3  
ATOM 5251  H HH12   . ARG C 3 31 ? -15.039 15.365  -0.503  1.00 0.00 ? 31 ARG P HH12   3  
ATOM 5252  H HH21   . ARG C 3 31 ? -13.075 18.233  -0.308  1.00 0.00 ? 31 ARG P HH21   3  
ATOM 5253  H HH22   . ARG C 3 31 ? -14.195 17.358  -1.228  1.00 0.00 ? 31 ARG P HH22   3  
ATOM 5254  N N      . LEU C 3 32 ? -10.109 10.900  4.427   1.00 0.00 ? 32 LEU P N      3  
ATOM 5255  C CA     . LEU C 3 32 ? -9.551  9.659   4.863   1.00 0.00 ? 32 LEU P CA     3  
ATOM 5256  C C      . LEU C 3 32 ? -10.233 9.198   6.163   1.00 0.00 ? 32 LEU P C      3  
ATOM 5257  O O      . LEU C 3 32 ? -10.829 8.163   6.241   1.00 0.00 ? 32 LEU P O      3  
ATOM 5258  C CB     . LEU C 3 32 ? -7.981  9.926   5.063   1.00 0.00 ? 32 LEU P CB     3  
ATOM 5259  C CG     . LEU C 3 32 ? -7.081  8.699   5.306   1.00 0.00 ? 32 LEU P CG     3  
ATOM 5260  C CD1    . LEU C 3 32 ? -5.696  9.256   5.552   1.00 0.00 ? 32 LEU P CD1    3  
ATOM 5261  C CD2    . LEU C 3 32 ? -7.507  7.859   6.435   1.00 0.00 ? 32 LEU P CD2    3  
ATOM 5262  H H      . LEU C 3 32 ? -9.413  11.558  4.105   1.00 0.00 ? 32 LEU P H      3  
ATOM 5263  H HA     . LEU C 3 32 ? -9.740  8.891   4.115   1.00 0.00 ? 32 LEU P HA     3  
ATOM 5264  H HB2    . LEU C 3 32 ? -7.589  10.394  4.160   1.00 0.00 ? 32 LEU P HB2    3  
ATOM 5265  H HB3    . LEU C 3 32 ? -7.881  10.669  5.854   1.00 0.00 ? 32 LEU P HB3    3  
ATOM 5266  H HG     . LEU C 3 32 ? -6.995  8.023   4.455   1.00 0.00 ? 32 LEU P HG     3  
ATOM 5267  H HD11   . LEU C 3 32 ? -5.733  9.980   6.366   1.00 0.00 ? 32 LEU P HD11   3  
ATOM 5268  H HD12   . LEU C 3 32 ? -5.353  9.759   4.648   1.00 0.00 ? 32 LEU P HD12   3  
ATOM 5269  H HD13   . LEU C 3 32 ? -5.015  8.465   5.868   1.00 0.00 ? 32 LEU P HD13   3  
ATOM 5270  H HD21   . LEU C 3 32 ? -7.602  8.536   7.282   1.00 0.00 ? 32 LEU P HD21   3  
ATOM 5271  H HD22   . LEU C 3 32 ? -6.645  7.231   6.660   1.00 0.00 ? 32 LEU P HD22   3  
ATOM 5272  H HD23   . LEU C 3 32 ? -8.307  7.180   6.137   1.00 0.00 ? 32 LEU P HD23   3  
ATOM 5273  N N      . ALA C 3 33 ? -10.245 10.094  7.174   1.00 0.00 ? 33 ALA P N      3  
ATOM 5274  C CA     . ALA C 3 33 ? -10.796 9.843   8.570   1.00 0.00 ? 33 ALA P CA     3  
ATOM 5275  C C      . ALA C 3 33 ? -12.268 9.347   8.503   1.00 0.00 ? 33 ALA P C      3  
ATOM 5276  O O      . ALA C 3 33 ? -12.589 8.278   9.011   1.00 0.00 ? 33 ALA P O      3  
ATOM 5277  C CB     . ALA C 3 33 ? -10.695 11.119  9.387   1.00 0.00 ? 33 ALA P CB     3  
ATOM 5278  H H      . ALA C 3 33 ? -9.990  11.042  6.935   1.00 0.00 ? 33 ALA P H      3  
ATOM 5279  H HA     . ALA C 3 33 ? -10.249 9.025   9.038   1.00 0.00 ? 33 ALA P HA     3  
ATOM 5280  H HB1    . ALA C 3 33 ? -11.272 10.973  10.300  1.00 0.00 ? 33 ALA P HB1    3  
ATOM 5281  H HB2    . ALA C 3 33 ? -9.648  11.281  9.640   1.00 0.00 ? 33 ALA P HB2    3  
ATOM 5282  H HB3    . ALA C 3 33 ? -11.114 12.016  8.930   1.00 0.00 ? 33 ALA P HB3    3  
ATOM 5283  N N      . ASP C 3 34 ? -13.065 10.126  7.735   1.00 0.00 ? 34 ASP P N      3  
ATOM 5284  C CA     . ASP C 3 34 ? -14.429 9.851   7.543   1.00 0.00 ? 34 ASP P CA     3  
ATOM 5285  C C      . ASP C 3 34 ? -14.670 8.526   6.796   1.00 0.00 ? 34 ASP P C      3  
ATOM 5286  O O      . ASP C 3 34 ? -15.529 7.682   7.262   1.00 0.00 ? 34 ASP P O      3  
ATOM 5287  C CB     . ASP C 3 34 ? -15.116 11.043  6.941   1.00 0.00 ? 34 ASP P CB     3  
ATOM 5288  C CG     . ASP C 3 34 ? -16.564 11.155  7.496   1.00 0.00 ? 34 ASP P CG     3  
ATOM 5289  O OD1    . ASP C 3 34 ? -16.742 11.457  8.695   1.00 0.00 ? 34 ASP P OD1    3  
ATOM 5290  O OD2    . ASP C 3 34 ? -17.456 10.853  6.727   1.00 0.00 ? 34 ASP P OD2    3  
ATOM 5291  H H      . ASP C 3 34 ? -12.669 10.985  7.381   1.00 0.00 ? 34 ASP P H      3  
ATOM 5292  H HA     . ASP C 3 34 ? -14.837 9.738   8.548   1.00 0.00 ? 34 ASP P HA     3  
ATOM 5293  H HB2    . ASP C 3 34 ? -14.639 11.965  7.276   1.00 0.00 ? 34 ASP P HB2    3  
ATOM 5294  H HB3    . ASP C 3 34 ? -15.049 11.004  5.854   1.00 0.00 ? 34 ASP P HB3    3  
ATOM 5295  N N      . LEU C 3 35 ? -13.875 8.284   5.758   1.00 0.00 ? 35 LEU P N      3  
ATOM 5296  C CA     . LEU C 3 35 ? -13.949 6.939   5.171   1.00 0.00 ? 35 LEU P CA     3  
ATOM 5297  C C      . LEU C 3 35 ? -13.438 5.770   6.083   1.00 0.00 ? 35 LEU P C      3  
ATOM 5298  O O      . LEU C 3 35 ? -14.059 4.696   6.192   1.00 0.00 ? 35 LEU P O      3  
ATOM 5299  C CB     . LEU C 3 35 ? -13.213 6.887   3.769   1.00 0.00 ? 35 LEU P CB     3  
ATOM 5300  C CG     . LEU C 3 35 ? -14.111 6.713   2.561   1.00 0.00 ? 35 LEU P CG     3  
ATOM 5301  C CD1    . LEU C 3 35 ? -15.583 7.069   2.714   1.00 0.00 ? 35 LEU P CD1    3  
ATOM 5302  C CD2    . LEU C 3 35 ? -13.423 7.438   1.412   1.00 0.00 ? 35 LEU P CD2    3  
ATOM 5303  H H      . LEU C 3 35 ? -13.157 8.925   5.456   1.00 0.00 ? 35 LEU P H      3  
ATOM 5304  H HA     . LEU C 3 35 ? -14.963 6.560   5.051   1.00 0.00 ? 35 LEU P HA     3  
ATOM 5305  H HB2    . LEU C 3 35 ? -12.583 7.769   3.654   1.00 0.00 ? 35 LEU P HB2    3  
ATOM 5306  H HB3    . LEU C 3 35 ? -12.500 6.066   3.695   1.00 0.00 ? 35 LEU P HB3    3  
ATOM 5307  H HG     . LEU C 3 35 ? -14.029 5.696   2.175   1.00 0.00 ? 35 LEU P HG     3  
ATOM 5308  H HD11   . LEU C 3 35 ? -16.076 6.473   3.482   1.00 0.00 ? 35 LEU P HD11   3  
ATOM 5309  H HD12   . LEU C 3 35 ? -15.962 6.867   1.713   1.00 0.00 ? 35 LEU P HD12   3  
ATOM 5310  H HD13   . LEU C 3 35 ? -15.638 8.132   2.948   1.00 0.00 ? 35 LEU P HD13   3  
ATOM 5311  H HD21   . LEU C 3 35 ? -12.384 7.113   1.354   1.00 0.00 ? 35 LEU P HD21   3  
ATOM 5312  H HD22   . LEU C 3 35 ? -13.505 8.501   1.644   1.00 0.00 ? 35 LEU P HD22   3  
ATOM 5313  H HD23   . LEU C 3 35 ? -13.899 7.098   0.494   1.00 0.00 ? 35 LEU P HD23   3  
ATOM 5314  N N      . SER C 3 36 ? -12.369 6.000   6.832   1.00 0.00 ? 36 SER P N      3  
ATOM 5315  C CA     . SER C 3 36 ? -11.938 5.025   7.903   1.00 0.00 ? 36 SER P CA     3  
ATOM 5316  C C      . SER C 3 36 ? -13.004 4.731   8.978   1.00 0.00 ? 36 SER P C      3  
ATOM 5317  O O      . SER C 3 36 ? -12.989 3.593   9.395   1.00 0.00 ? 36 SER P O      3  
ATOM 5318  C CB     . SER C 3 36 ? -10.613 5.456   8.499   1.00 0.00 ? 36 SER P CB     3  
ATOM 5319  O OG     . SER C 3 36 ? -10.203 4.718   9.577   1.00 0.00 ? 36 SER P OG     3  
ATOM 5320  H H      . SER C 3 36 ? -11.914 6.901   6.804   1.00 0.00 ? 36 SER P H      3  
ATOM 5321  H HA     . SER C 3 36 ? -11.729 4.087   7.390   1.00 0.00 ? 36 SER P HA     3  
ATOM 5322  H HB2    . SER C 3 36 ? -9.826  5.392   7.747   1.00 0.00 ? 36 SER P HB2    3  
ATOM 5323  H HB3    . SER C 3 36 ? -10.612 6.537   8.643   1.00 0.00 ? 36 SER P HB3    3  
ATOM 5324  H HG     . SER C 3 36 ? -10.262 3.816   9.250   1.00 0.00 ? 36 SER P HG     3  
ATOM 5325  N N      . ALA C 3 37 ? -13.886 5.650   9.203   1.00 0.00 ? 37 ALA P N      3  
ATOM 5326  C CA     . ALA C 3 37 ? -15.043 5.510   10.144  1.00 0.00 ? 37 ALA P CA     3  
ATOM 5327  C C      . ALA C 3 37 ? -16.128 4.564   9.444   1.00 0.00 ? 37 ALA P C      3  
ATOM 5328  O O      . ALA C 3 37 ? -16.505 3.460   9.935   1.00 0.00 ? 37 ALA P O      3  
ATOM 5329  C CB     . ALA C 3 37 ? -15.617 6.861   10.622  1.00 0.00 ? 37 ALA P CB     3  
ATOM 5330  H H      . ALA C 3 37 ? -13.798 6.542   8.740   1.00 0.00 ? 37 ALA P H      3  
ATOM 5331  H HA     . ALA C 3 37 ? -14.665 4.935   10.990  1.00 0.00 ? 37 ALA P HA     3  
ATOM 5332  H HB1    . ALA C 3 37 ? -16.413 6.630   11.331  1.00 0.00 ? 37 ALA P HB1    3  
ATOM 5333  H HB2    . ALA C 3 37 ? -14.885 7.555   11.035  1.00 0.00 ? 37 ALA P HB2    3  
ATOM 5334  H HB3    . ALA C 3 37 ? -16.197 7.420   9.888   1.00 0.00 ? 37 ALA P HB3    3  
ATOM 5335  N N      . LYS C 3 38 ? -16.450 4.934   8.208   1.00 0.00 ? 38 LYS P N      3  
ATOM 5336  C CA     . LYS C 3 38 ? -17.598 4.434   7.402   1.00 0.00 ? 38 LYS P CA     3  
ATOM 5337  C C      . LYS C 3 38 ? -17.358 3.105   6.649   1.00 0.00 ? 38 LYS P C      3  
ATOM 5338  O O      . LYS C 3 38 ? -18.181 2.250   6.653   1.00 0.00 ? 38 LYS P O      3  
ATOM 5339  C CB     . LYS C 3 38 ? -17.977 5.467   6.350   1.00 0.00 ? 38 LYS P CB     3  
ATOM 5340  C CG     . LYS C 3 38 ? -18.501 6.823   6.808   1.00 0.00 ? 38 LYS P CG     3  
ATOM 5341  C CD     . LYS C 3 38 ? -19.400 7.552   5.742   1.00 0.00 ? 38 LYS P CD     3  
ATOM 5342  C CE     . LYS C 3 38 ? -20.740 6.789   5.737   1.00 0.00 ? 38 LYS P CE     3  
ATOM 5343  N NZ     . LYS C 3 38 ? -21.756 7.294   4.744   1.00 0.00 ? 38 LYS P NZ     3  
ATOM 5344  H H      . LYS C 3 38 ? -15.964 5.780   7.944   1.00 0.00 ? 38 LYS P H      3  
ATOM 5345  H HA     . LYS C 3 38 ? -18.397 4.202   8.106   1.00 0.00 ? 38 LYS P HA     3  
ATOM 5346  H HB2    . LYS C 3 38 ? -17.134 5.558   5.665   1.00 0.00 ? 38 LYS P HB2    3  
ATOM 5347  H HB3    . LYS C 3 38 ? -18.739 4.988   5.736   1.00 0.00 ? 38 LYS P HB3    3  
ATOM 5348  H HG2    . LYS C 3 38 ? -19.107 6.576   7.681   1.00 0.00 ? 38 LYS P HG2    3  
ATOM 5349  H HG3    . LYS C 3 38 ? -17.682 7.462   7.139   1.00 0.00 ? 38 LYS P HG3    3  
ATOM 5350  H HD2    . LYS C 3 38 ? -19.671 8.547   6.092   1.00 0.00 ? 38 LYS P HD2    3  
ATOM 5351  H HD3    . LYS C 3 38 ? -18.842 7.611   4.807   1.00 0.00 ? 38 LYS P HD3    3  
ATOM 5352  H HE2    . LYS C 3 38 ? -20.630 5.718   5.565   1.00 0.00 ? 38 LYS P HE2    3  
ATOM 5353  H HE3    . LYS C 3 38 ? -21.123 6.951   6.745   1.00 0.00 ? 38 LYS P HE3    3  
ATOM 5354  H HZ1    . LYS C 3 38 ? -21.891 8.289   4.852   1.00 0.00 ? 38 LYS P HZ1    3  
ATOM 5355  H HZ2    . LYS C 3 38 ? -22.659 6.859   4.865   1.00 0.00 ? 38 LYS P HZ2    3  
ATOM 5356  H HZ3    . LYS C 3 38 ? -21.526 6.936   3.828   1.00 0.00 ? 38 LYS P HZ3    3  
ATOM 5357  N N      . LEU C 3 39 ? -16.202 2.846   6.078   1.00 0.00 ? 39 LEU P N      3  
ATOM 5358  C CA     . LEU C 3 39 ? -15.811 1.524   5.529   1.00 0.00 ? 39 LEU P CA     3  
ATOM 5359  C C      . LEU C 3 39 ? -15.289 0.534   6.590   1.00 0.00 ? 39 LEU P C      3  
ATOM 5360  O O      . LEU C 3 39 ? -15.095 -0.674  6.297   1.00 0.00 ? 39 LEU P O      3  
ATOM 5361  C CB     . LEU C 3 39 ? -14.577 1.724   4.608   1.00 0.00 ? 39 LEU P CB     3  
ATOM 5362  C CG     . LEU C 3 39 ? -14.669 2.638   3.364   1.00 0.00 ? 39 LEU P CG     3  
ATOM 5363  C CD1    . LEU C 3 39 ? -15.508 3.871   3.421   1.00 0.00 ? 39 LEU P CD1    3  
ATOM 5364  C CD2    . LEU C 3 39 ? -13.289 3.205   3.240   1.00 0.00 ? 39 LEU P CD2    3  
ATOM 5365  H H      . LEU C 3 39 ? -15.479 3.543   5.968   1.00 0.00 ? 39 LEU P H      3  
ATOM 5366  H HA     . LEU C 3 39 ? -16.572 0.980   4.969   1.00 0.00 ? 39 LEU P HA     3  
ATOM 5367  H HB2    . LEU C 3 39 ? -13.791 2.031   5.298   1.00 0.00 ? 39 LEU P HB2    3  
ATOM 5368  H HB3    . LEU C 3 39 ? -14.436 0.745   4.151   1.00 0.00 ? 39 LEU P HB3    3  
ATOM 5369  H HG     . LEU C 3 39 ? -15.000 2.047   2.510   1.00 0.00 ? 39 LEU P HG     3  
ATOM 5370  H HD11   . LEU C 3 39 ? -15.480 4.290   2.416   1.00 0.00 ? 39 LEU P HD11   3  
ATOM 5371  H HD12   . LEU C 3 39 ? -15.104 4.574   4.149   1.00 0.00 ? 39 LEU P HD12   3  
ATOM 5372  H HD13   . LEU C 3 39 ? -16.557 3.708   3.671   1.00 0.00 ? 39 LEU P HD13   3  
ATOM 5373  H HD21   . LEU C 3 39 ? -12.648 2.387   2.914   1.00 0.00 ? 39 LEU P HD21   3  
ATOM 5374  H HD22   . LEU C 3 39 ? -12.875 3.650   4.145   1.00 0.00 ? 39 LEU P HD22   3  
ATOM 5375  H HD23   . LEU C 3 39 ? -13.324 3.880   2.384   1.00 0.00 ? 39 LEU P HD23   3  
ATOM 5376  N N      . ALA C 3 40 ? -15.015 1.088   7.777   1.00 0.00 ? 40 ALA P N      3  
ATOM 5377  C CA     . ALA C 3 40 ? -14.574 0.457   8.993   1.00 0.00 ? 40 ALA P CA     3  
ATOM 5378  C C      . ALA C 3 40 ? -13.253 -0.288  8.881   1.00 0.00 ? 40 ALA P C      3  
ATOM 5379  O O      . ALA C 3 40 ? -13.229 -1.520  8.914   1.00 0.00 ? 40 ALA P O      3  
ATOM 5380  C CB     . ALA C 3 40 ? -15.699 -0.364  9.505   1.00 0.00 ? 40 ALA P CB     3  
ATOM 5381  H H      . ALA C 3 40 ? -15.096 2.094   7.761   1.00 0.00 ? 40 ALA P H      3  
ATOM 5382  H HA     . ALA C 3 40 ? -14.299 1.227   9.714   1.00 0.00 ? 40 ALA P HA     3  
ATOM 5383  H HB1    . ALA C 3 40 ? -16.516 0.324   9.727   1.00 0.00 ? 40 ALA P HB1    3  
ATOM 5384  H HB2    . ALA C 3 40 ? -15.876 -1.227  8.863   1.00 0.00 ? 40 ALA P HB2    3  
ATOM 5385  H HB3    . ALA C 3 40 ? -15.383 -0.717  10.486  1.00 0.00 ? 40 ALA P HB3    3  
ATOM 5386  N N      . LEU C 3 41 ? -12.172 0.447   8.818   1.00 0.00 ? 41 LEU P N      3  
ATOM 5387  C CA     . LEU C 3 41 ? -10.813 -0.125  8.621   1.00 0.00 ? 41 LEU P CA     3  
ATOM 5388  C C      . LEU C 3 41 ? -9.790  0.953   8.886   1.00 0.00 ? 41 LEU P C      3  
ATOM 5389  O O      . LEU C 3 41 ? -10.094 2.169   8.895   1.00 0.00 ? 41 LEU P O      3  
ATOM 5390  C CB     . LEU C 3 41 ? -10.739 -0.875  7.229   1.00 0.00 ? 41 LEU P CB     3  
ATOM 5391  C CG     . LEU C 3 41 ? -11.156 -0.189  5.918   1.00 0.00 ? 41 LEU P CG     3  
ATOM 5392  C CD1    . LEU C 3 41 ? -10.723 1.264   5.680   1.00 0.00 ? 41 LEU P CD1    3  
ATOM 5393  C CD2    . LEU C 3 41 ? -10.588 -0.901  4.679   1.00 0.00 ? 41 LEU P CD2    3  
ATOM 5394  H H      . LEU C 3 41 ? -12.244 1.450   8.914   1.00 0.00 ? 41 LEU P H      3  
ATOM 5395  H HA     . LEU C 3 41 ? -10.606 -0.872  9.388   1.00 0.00 ? 41 LEU P HA     3  
ATOM 5396  H HB2    . LEU C 3 41 ? -9.729  -1.260  7.094   1.00 0.00 ? 41 LEU P HB2    3  
ATOM 5397  H HB3    . LEU C 3 41 ? -11.284 -1.801  7.410   1.00 0.00 ? 41 LEU P HB3    3  
ATOM 5398  H HG     . LEU C 3 41 ? -12.237 -0.207  5.781   1.00 0.00 ? 41 LEU P HG     3  
ATOM 5399  H HD11   . LEU C 3 41 ? -11.250 1.553   4.771   1.00 0.00 ? 41 LEU P HD11   3  
ATOM 5400  H HD12   . LEU C 3 41 ? -9.640  1.278   5.560   1.00 0.00 ? 41 LEU P HD12   3  
ATOM 5401  H HD13   . LEU C 3 41 ? -11.003 1.920   6.504   1.00 0.00 ? 41 LEU P HD13   3  
ATOM 5402  H HD21   . LEU C 3 41 ? -10.879 -1.944  4.558   1.00 0.00 ? 41 LEU P HD21   3  
ATOM 5403  H HD22   . LEU C 3 41 ? -9.503  -0.965  4.752   1.00 0.00 ? 41 LEU P HD22   3  
ATOM 5404  H HD23   . LEU C 3 41 ? -10.913 -0.476  3.730   1.00 0.00 ? 41 LEU P HD23   3  
ATOM 5405  N N      . GLY C 3 42 ? -8.552  0.580   8.900   1.00 0.00 ? 42 GLY P N      3  
ATOM 5406  C CA     . GLY C 3 42 ? -7.401  1.423   9.231   1.00 0.00 ? 42 GLY P CA     3  
ATOM 5407  C C      . GLY C 3 42 ? -7.131  2.543   8.204   1.00 0.00 ? 42 GLY P C      3  
ATOM 5408  O O      . GLY C 3 42 ? -7.309  2.329   7.026   1.00 0.00 ? 42 GLY P O      3  
ATOM 5409  H H      . GLY C 3 42 ? -8.336  -0.379  8.668   1.00 0.00 ? 42 GLY P H      3  
ATOM 5410  H HA2    . GLY C 3 42 ? -7.413  1.757   10.268  1.00 0.00 ? 42 GLY P HA2    3  
ATOM 5411  H HA3    . GLY C 3 42 ? -6.477  0.845   9.235   1.00 0.00 ? 42 GLY P HA3    3  
ATOM 5412  N N      . THR C 3 43 ? -6.651  3.734   8.675   1.00 0.00 ? 43 THR P N      3  
ATOM 5413  C CA     . THR C 3 43 ? -6.364  4.894   7.821   1.00 0.00 ? 43 THR P CA     3  
ATOM 5414  C C      . THR C 3 43 ? -5.472  4.655   6.613   1.00 0.00 ? 43 THR P C      3  
ATOM 5415  O O      . THR C 3 43 ? -5.677  5.332   5.584   1.00 0.00 ? 43 THR P O      3  
ATOM 5416  C CB     . THR C 3 43 ? -5.599  5.971   8.617   1.00 0.00 ? 43 THR P CB     3  
ATOM 5417  O OG1    . THR C 3 43 ? -4.631  5.460   9.375   1.00 0.00 ? 43 THR P OG1    3  
ATOM 5418  C CG2    . THR C 3 43 ? -6.473  6.785   9.627   1.00 0.00 ? 43 THR P CG2    3  
ATOM 5419  H H      . THR C 3 43 ? -6.607  3.823   9.680   1.00 0.00 ? 43 THR P H      3  
ATOM 5420  H HA     . THR C 3 43 ? -7.309  5.334   7.502   1.00 0.00 ? 43 THR P HA     3  
ATOM 5421  H HB     . THR C 3 43 ? -5.123  6.631   7.891   1.00 0.00 ? 43 THR P HB     3  
ATOM 5422  H HG1    . THR C 3 43 ? -3.998  6.165   9.524   1.00 0.00 ? 43 THR P HG1    3  
ATOM 5423  H HG21   . THR C 3 43 ? -6.573  6.211   10.548  1.00 0.00 ? 43 THR P HG21   3  
ATOM 5424  H HG22   . THR C 3 43 ? -7.458  6.841   9.165   1.00 0.00 ? 43 THR P HG22   3  
ATOM 5425  H HG23   . THR C 3 43 ? -6.141  7.822   9.659   1.00 0.00 ? 43 THR P HG23   3  
ATOM 5426  N N      . ALA C 3 44 ? -4.584  3.691   6.715   1.00 0.00 ? 44 ALA P N      3  
ATOM 5427  C CA     . ALA C 3 44 ? -3.687  3.343   5.690   1.00 0.00 ? 44 ALA P CA     3  
ATOM 5428  C C      . ALA C 3 44 ? -4.379  2.684   4.403   1.00 0.00 ? 44 ALA P C      3  
ATOM 5429  O O      . ALA C 3 44 ? -3.985  3.050   3.294   1.00 0.00 ? 44 ALA P O      3  
ATOM 5430  C CB     . ALA C 3 44 ? -2.602  2.486   6.258   1.00 0.00 ? 44 ALA P CB     3  
ATOM 5431  H H      . ALA C 3 44 ? -4.500  3.341   7.659   1.00 0.00 ? 44 ALA P H      3  
ATOM 5432  H HA     . ALA C 3 44 ? -3.162  4.242   5.365   1.00 0.00 ? 44 ALA P HA     3  
ATOM 5433  H HB1    . ALA C 3 44 ? -2.095  2.098   5.375   1.00 0.00 ? 44 ALA P HB1    3  
ATOM 5434  H HB2    . ALA C 3 44 ? -1.902  3.053   6.872   1.00 0.00 ? 44 ALA P HB2    3  
ATOM 5435  H HB3    . ALA C 3 44 ? -2.999  1.634   6.809   1.00 0.00 ? 44 ALA P HB3    3  
ATOM 5436  N N      . GLN C 3 45 ? -5.353  1.851   4.713   1.00 0.00 ? 45 GLN P N      3  
ATOM 5437  C CA     . GLN C 3 45 ? -6.137  1.271   3.622   1.00 0.00 ? 45 GLN P CA     3  
ATOM 5438  C C      . GLN C 3 45 ? -6.855  2.217   2.718   1.00 0.00 ? 45 GLN P C      3  
ATOM 5439  O O      . GLN C 3 45 ? -6.969  1.894   1.521   1.00 0.00 ? 45 GLN P O      3  
ATOM 5440  C CB     . GLN C 3 45 ? -7.104  0.280   4.275   1.00 0.00 ? 45 GLN P CB     3  
ATOM 5441  C CG     . GLN C 3 45 ? -6.451  -1.026  4.702   1.00 0.00 ? 45 GLN P CG     3  
ATOM 5442  C CD     . GLN C 3 45 ? -5.268  -0.969  5.669   1.00 0.00 ? 45 GLN P CD     3  
ATOM 5443  O OE1    . GLN C 3 45 ? -4.091  -1.077  5.271   1.00 0.00 ? 45 GLN P OE1    3  
ATOM 5444  N NE2    . GLN C 3 45 ? -5.523  -0.846  6.957   1.00 0.00 ? 45 GLN P NE2    3  
ATOM 5445  H H      . GLN C 3 45 ? -5.568  1.628   5.675   1.00 0.00 ? 45 GLN P H      3  
ATOM 5446  H HA     . GLN C 3 45 ? -5.519  0.737   2.900   1.00 0.00 ? 45 GLN P HA     3  
ATOM 5447  H HB2    . GLN C 3 45 ? -7.496  0.748   5.178   1.00 0.00 ? 45 GLN P HB2    3  
ATOM 5448  H HB3    . GLN C 3 45 ? -7.936  0.033   3.614   1.00 0.00 ? 45 GLN P HB3    3  
ATOM 5449  H HG2    . GLN C 3 45 ? -7.244  -1.526  5.260   1.00 0.00 ? 45 GLN P HG2    3  
ATOM 5450  H HG3    . GLN C 3 45 ? -6.261  -1.662  3.838   1.00 0.00 ? 45 GLN P HG3    3  
ATOM 5451  H HE21   . GLN C 3 45 ? -6.446  -0.891  7.363   1.00 0.00 ? 45 GLN P HE21   3  
ATOM 5452  H HE22   . GLN C 3 45 ? -4.744  -0.788  7.597   1.00 0.00 ? 45 GLN P HE22   3  
ATOM 5453  N N      . VAL C 3 46 ? -7.297  3.406   3.211   1.00 0.00 ? 46 VAL P N      3  
ATOM 5454  C CA     . VAL C 3 46 ? -8.132  4.324   2.389   1.00 0.00 ? 46 VAL P CA     3  
ATOM 5455  C C      . VAL C 3 46 ? -7.154  5.055   1.422   1.00 0.00 ? 46 VAL P C      3  
ATOM 5456  O O      . VAL C 3 46 ? -7.359  5.196   0.212   1.00 0.00 ? 46 VAL P O      3  
ATOM 5457  C CB     . VAL C 3 46 ? -8.862  5.460   3.245   1.00 0.00 ? 46 VAL P CB     3  
ATOM 5458  C CG1    . VAL C 3 46 ? -10.065 6.061   2.616   1.00 0.00 ? 46 VAL P CG1    3  
ATOM 5459  C CG2    . VAL C 3 46 ? -9.348  4.880   4.654   1.00 0.00 ? 46 VAL P CG2    3  
ATOM 5460  H H      . VAL C 3 46 ? -7.119  3.711   4.157   1.00 0.00 ? 46 VAL P H      3  
ATOM 5461  H HA     . VAL C 3 46 ? -8.877  3.809   1.782   1.00 0.00 ? 46 VAL P HA     3  
ATOM 5462  H HB     . VAL C 3 46 ? -8.151  6.228   3.552   1.00 0.00 ? 46 VAL P HB     3  
ATOM 5463  H HG11   . VAL C 3 46 ? -10.437 6.882   3.228   1.00 0.00 ? 46 VAL P HG11   3  
ATOM 5464  H HG12   . VAL C 3 46 ? -9.764  6.376   1.616   1.00 0.00 ? 46 VAL P HG12   3  
ATOM 5465  H HG13   . VAL C 3 46 ? -10.904 5.368   2.569   1.00 0.00 ? 46 VAL P HG13   3  
ATOM 5466  H HG21   . VAL C 3 46 ? -8.487  4.491   5.196   1.00 0.00 ? 46 VAL P HG21   3  
ATOM 5467  H HG22   . VAL C 3 46 ? -9.727  5.691   5.276   1.00 0.00 ? 46 VAL P HG22   3  
ATOM 5468  H HG23   . VAL C 3 46 ? -10.162 4.178   4.475   1.00 0.00 ? 46 VAL P HG23   3  
ATOM 5469  N N      . LYS C 3 47 ? -6.005  5.588   1.933   1.00 0.00 ? 47 LYS P N      3  
ATOM 5470  C CA     . LYS C 3 47 ? -4.866  6.052   1.245   1.00 0.00 ? 47 LYS P CA     3  
ATOM 5471  C C      . LYS C 3 47 ? -4.350  4.997   0.174   1.00 0.00 ? 47 LYS P C      3  
ATOM 5472  O O      . LYS C 3 47 ? -4.267  5.331   -0.986  1.00 0.00 ? 47 LYS P O      3  
ATOM 5473  C CB     . LYS C 3 47 ? -3.779  6.272   2.333   1.00 0.00 ? 47 LYS P CB     3  
ATOM 5474  C CG     . LYS C 3 47 ? -3.956  7.586   2.967   1.00 0.00 ? 47 LYS P CG     3  
ATOM 5475  C CD     . LYS C 3 47 ? -3.015  8.119   4.107   1.00 0.00 ? 47 LYS P CD     3  
ATOM 5476  C CE     . LYS C 3 47 ? -2.839  7.248   5.368   1.00 0.00 ? 47 LYS P CE     3  
ATOM 5477  N NZ     . LYS C 3 47 ? -2.154  8.100   6.434   1.00 0.00 ? 47 LYS P NZ     3  
ATOM 5478  H H      . LYS C 3 47 ? -5.866  5.579   2.933   1.00 0.00 ? 47 LYS P H      3  
ATOM 5479  H HA     . LYS C 3 47 ? -5.219  6.962   0.760   1.00 0.00 ? 47 LYS P HA     3  
ATOM 5480  H HB2    . LYS C 3 47 ? -3.771  5.490   3.091   1.00 0.00 ? 47 LYS P HB2    3  
ATOM 5481  H HB3    . LYS C 3 47 ? -2.787  6.266   1.882   1.00 0.00 ? 47 LYS P HB3    3  
ATOM 5482  H HG2    . LYS C 3 47 ? -3.964  8.398   2.240   1.00 0.00 ? 47 LYS P HG2    3  
ATOM 5483  H HG3    . LYS C 3 47 ? -4.985  7.618   3.324   1.00 0.00 ? 47 LYS P HG3    3  
ATOM 5484  H HD2    . LYS C 3 47 ? -2.058  8.182   3.588   1.00 0.00 ? 47 LYS P HD2    3  
ATOM 5485  H HD3    . LYS C 3 47 ? -3.398  9.062   4.496   1.00 0.00 ? 47 LYS P HD3    3  
ATOM 5486  H HE2    . LYS C 3 47 ? -3.813  6.902   5.713   1.00 0.00 ? 47 LYS P HE2    3  
ATOM 5487  H HE3    . LYS C 3 47 ? -2.256  6.363   5.113   1.00 0.00 ? 47 LYS P HE3    3  
ATOM 5488  H HZ1    . LYS C 3 47 ? -2.657  7.886   7.283   1.00 0.00 ? 47 LYS P HZ1    3  
ATOM 5489  H HZ2    . LYS C 3 47 ? -2.423  9.043   6.195   1.00 0.00 ? 47 LYS P HZ2    3  
ATOM 5490  H HZ3    . LYS C 3 47 ? -1.170  7.897   6.542   1.00 0.00 ? 47 LYS P HZ3    3  
ATOM 5491  N N      . ILE C 3 48 ? -4.176  3.756   0.611   1.00 0.00 ? 48 ILE P N      3  
ATOM 5492  C CA     . ILE C 3 48 ? -3.650  2.692   -0.206  1.00 0.00 ? 48 ILE P CA     3  
ATOM 5493  C C      . ILE C 3 48 ? -4.625  2.527   -1.379  1.00 0.00 ? 48 ILE P C      3  
ATOM 5494  O O      . ILE C 3 48 ? -4.222  2.445   -2.545  1.00 0.00 ? 48 ILE P O      3  
ATOM 5495  C CB     . ILE C 3 48 ? -3.361  1.325   0.530   1.00 0.00 ? 48 ILE P CB     3  
ATOM 5496  C CG1    . ILE C 3 48 ? -2.015  1.476   1.253   1.00 0.00 ? 48 ILE P CG1    3  
ATOM 5497  C CG2    . ILE C 3 48 ? -3.109  0.168   -0.496  1.00 0.00 ? 48 ILE P CG2    3  
ATOM 5498  C CD1    . ILE C 3 48 ? -1.808  0.265   2.174   1.00 0.00 ? 48 ILE P CD1    3  
ATOM 5499  H H      . ILE C 3 48 ? -4.270  3.469   1.574   1.00 0.00 ? 48 ILE P H      3  
ATOM 5500  H HA     . ILE C 3 48 ? -2.680  3.041   -0.561  1.00 0.00 ? 48 ILE P HA     3  
ATOM 5501  H HB     . ILE C 3 48 ? -4.227  1.238   1.185   1.00 0.00 ? 48 ILE P HB     3  
ATOM 5502  H HG12   . ILE C 3 48 ? -1.134  1.566   0.617   1.00 0.00 ? 48 ILE P HG12   3  
ATOM 5503  H HG13   . ILE C 3 48 ? -2.001  2.371   1.875   1.00 0.00 ? 48 ILE P HG13   3  
ATOM 5504  H HG21   . ILE C 3 48 ? -2.219  0.367   -1.092  1.00 0.00 ? 48 ILE P HG21   3  
ATOM 5505  H HG22   . ILE C 3 48 ? -3.073  -0.752  0.089   1.00 0.00 ? 48 ILE P HG22   3  
ATOM 5506  H HG23   . ILE C 3 48 ? -4.044  0.066   -1.046  1.00 0.00 ? 48 ILE P HG23   3  
ATOM 5507  H HD11   . ILE C 3 48 ? -2.783  -0.054  2.542   1.00 0.00 ? 48 ILE P HD11   3  
ATOM 5508  H HD12   . ILE C 3 48 ? -1.170  -0.485  1.705   1.00 0.00 ? 48 ILE P HD12   3  
ATOM 5509  H HD13   . ILE C 3 48 ? -1.451  0.530   3.169   1.00 0.00 ? 48 ILE P HD13   3  
ATOM 5510  N N      . TRP C 3 49 ? -5.886  2.466   -1.095  1.00 0.00 ? 49 TRP P N      3  
ATOM 5511  C CA     . TRP C 3 49 ? -6.936  2.331   -2.146  1.00 0.00 ? 49 TRP P CA     3  
ATOM 5512  C C      . TRP C 3 49 ? -6.981  3.446   -3.099  1.00 0.00 ? 49 TRP P C      3  
ATOM 5513  O O      . TRP C 3 49 ? -6.921  3.137   -4.328  1.00 0.00 ? 49 TRP P O      3  
ATOM 5514  C CB     . TRP C 3 49 ? -8.295  2.181   -1.486  1.00 0.00 ? 49 TRP P CB     3  
ATOM 5515  C CG     . TRP C 3 49 ? -9.452  2.106   -2.525  1.00 0.00 ? 49 TRP P CG     3  
ATOM 5516  C CD1    . TRP C 3 49 ? -9.707  1.078   -3.284  1.00 0.00 ? 49 TRP P CD1    3  
ATOM 5517  C CD2    . TRP C 3 49 ? -10.371 3.089   -3.052  1.00 0.00 ? 49 TRP P CD2    3  
ATOM 5518  N NE1    . TRP C 3 49 ? -10.804 1.198   -4.073  1.00 0.00 ? 49 TRP P NE1    3  
ATOM 5519  C CE2    . TRP C 3 49 ? -11.273 2.514   -4.042  1.00 0.00 ? 49 TRP P CE2    3  
ATOM 5520  C CE3    . TRP C 3 49 ? -10.480 4.479   -2.912  1.00 0.00 ? 49 TRP P CE3    3  
ATOM 5521  C CZ2    . TRP C 3 49 ? -12.293 3.270   -4.637  1.00 0.00 ? 49 TRP P CZ2    3  
ATOM 5522  C CZ3    . TRP C 3 49 ? -11.281 5.332   -3.713  1.00 0.00 ? 49 TRP P CZ3    3  
ATOM 5523  C CH2    . TRP C 3 49 ? -12.208 4.700   -4.534  1.00 0.00 ? 49 TRP P CH2    3  
ATOM 5524  H H      . TRP C 3 49 ? -6.113  2.241   -0.137  1.00 0.00 ? 49 TRP P H      3  
ATOM 5525  H HA     . TRP C 3 49 ? -6.780  1.360   -2.614  1.00 0.00 ? 49 TRP P HA     3  
ATOM 5526  H HB2    . TRP C 3 49 ? -8.363  1.317   -0.825  1.00 0.00 ? 49 TRP P HB2    3  
ATOM 5527  H HB3    . TRP C 3 49 ? -8.390  3.078   -0.873  1.00 0.00 ? 49 TRP P HB3    3  
ATOM 5528  H HD1    . TRP C 3 49 ? -8.954  0.305   -3.264  1.00 0.00 ? 49 TRP P HD1    3  
ATOM 5529  H HE1    . TRP C 3 49 ? -11.026 0.467   -4.734  1.00 0.00 ? 49 TRP P HE1    3  
ATOM 5530  H HE3    . TRP C 3 49 ? -9.651  4.920   -2.379  1.00 0.00 ? 49 TRP P HE3    3  
ATOM 5531  H HZ2    . TRP C 3 49 ? -12.952 2.748   -5.314  1.00 0.00 ? 49 TRP P HZ2    3  
ATOM 5532  H HZ3    . TRP C 3 49 ? -11.210 6.409   -3.697  1.00 0.00 ? 49 TRP P HZ3    3  
ATOM 5533  H HH2    . TRP C 3 49 ? -12.911 5.172   -5.205  1.00 0.00 ? 49 TRP P HH2    3  
ATOM 5534  N N      . PHE C 3 50 ? -6.868  4.703   -2.671  1.00 0.00 ? 50 PHE P N      3  
ATOM 5535  C CA     . PHE C 3 50 ? -6.798  5.857   -3.569  1.00 0.00 ? 50 PHE P CA     3  
ATOM 5536  C C      . PHE C 3 50 ? -5.475  5.928   -4.467  1.00 0.00 ? 50 PHE P C      3  
ATOM 5537  O O      . PHE C 3 50 ? -5.397  6.171   -5.698  1.00 0.00 ? 50 PHE P O      3  
ATOM 5538  C CB     . PHE C 3 50 ? -6.925  7.078   -2.637  1.00 0.00 ? 50 PHE P CB     3  
ATOM 5539  C CG     . PHE C 3 50 ? -8.278  7.820   -2.466  1.00 0.00 ? 50 PHE P CG     3  
ATOM 5540  C CD1    . PHE C 3 50 ? -8.455  9.062   -3.063  1.00 0.00 ? 50 PHE P CD1    3  
ATOM 5541  C CD2    . PHE C 3 50 ? -9.219  7.316   -1.587  1.00 0.00 ? 50 PHE P CD2    3  
ATOM 5542  C CE1    . PHE C 3 50 ? -9.624  9.818   -2.873  1.00 0.00 ? 50 PHE P CE1    3  
ATOM 5543  C CE2    . PHE C 3 50 ? -10.322 8.079   -1.316  1.00 0.00 ? 50 PHE P CE2    3  
ATOM 5544  C CZ     . PHE C 3 50 ? -10.567 9.369   -1.939  1.00 0.00 ? 50 PHE P CZ     3  
ATOM 5545  H H      . PHE C 3 50 ? -7.011  4.913   -1.693  1.00 0.00 ? 50 PHE P H      3  
ATOM 5546  H HA     . PHE C 3 50 ? -7.602  5.671   -4.282  1.00 0.00 ? 50 PHE P HA     3  
ATOM 5547  H HB2    . PHE C 3 50 ? -6.666  6.860   -1.600  1.00 0.00 ? 50 PHE P HB2    3  
ATOM 5548  H HB3    . PHE C 3 50 ? -6.138  7.780   -2.914  1.00 0.00 ? 50 PHE P HB3    3  
ATOM 5549  H HD1    . PHE C 3 50 ? -7.797  9.489   -3.806  1.00 0.00 ? 50 PHE P HD1    3  
ATOM 5550  H HD2    . PHE C 3 50 ? -9.023  6.344   -1.158  1.00 0.00 ? 50 PHE P HD2    3  
ATOM 5551  H HE1    . PHE C 3 50 ? -9.795  10.760  -3.374  1.00 0.00 ? 50 PHE P HE1    3  
ATOM 5552  H HE2    . PHE C 3 50 ? -11.176 7.690   -0.781  1.00 0.00 ? 50 PHE P HE2    3  
ATOM 5553  H HZ     . PHE C 3 50 ? -11.434 9.956   -1.677  1.00 0.00 ? 50 PHE P HZ     3  
ATOM 5554  N N      . LYS C 3 51 ? -4.434  5.409   -3.823  1.00 0.00 ? 51 LYS P N      3  
ATOM 5555  C CA     . LYS C 3 51 ? -3.083  5.316   -4.473  1.00 0.00 ? 51 LYS P CA     3  
ATOM 5556  C C      . LYS C 3 51 ? -3.103  4.224   -5.548  1.00 0.00 ? 51 LYS P C      3  
ATOM 5557  O O      . LYS C 3 51 ? -2.627  4.463   -6.631  1.00 0.00 ? 51 LYS P O      3  
ATOM 5558  C CB     . LYS C 3 51 ? -2.017  4.921   -3.384  1.00 0.00 ? 51 LYS P CB     3  
ATOM 5559  C CG     . LYS C 3 51 ? -1.755  6.195   -2.416  1.00 0.00 ? 51 LYS P CG     3  
ATOM 5560  C CD     . LYS C 3 51 ? -0.843  5.892   -1.198  1.00 0.00 ? 51 LYS P CD     3  
ATOM 5561  C CE     . LYS C 3 51 ? 0.140   4.766   -1.338  1.00 0.00 ? 51 LYS P CE     3  
ATOM 5562  N NZ     . LYS C 3 51 ? 0.931   4.737   -0.112  1.00 0.00 ? 51 LYS P NZ     3  
ATOM 5563  H H      . LYS C 3 51 ? -4.467  5.031   -2.887  1.00 0.00 ? 51 LYS P H      3  
ATOM 5564  H HA     . LYS C 3 51 ? -2.928  6.262   -4.992  1.00 0.00 ? 51 LYS P HA     3  
ATOM 5565  H HB2    . LYS C 3 51 ? -2.357  4.108   -2.744  1.00 0.00 ? 51 LYS P HB2    3  
ATOM 5566  H HB3    . LYS C 3 51 ? -1.116  4.609   -3.911  1.00 0.00 ? 51 LYS P HB3    3  
ATOM 5567  H HG2    . LYS C 3 51 ? -1.360  7.003   -3.031  1.00 0.00 ? 51 LYS P HG2    3  
ATOM 5568  H HG3    . LYS C 3 51 ? -2.622  6.691   -1.979  1.00 0.00 ? 51 LYS P HG3    3  
ATOM 5569  H HD2    . LYS C 3 51 ? -0.293  6.780   -0.884  1.00 0.00 ? 51 LYS P HD2    3  
ATOM 5570  H HD3    . LYS C 3 51 ? -1.443  5.760   -0.297  1.00 0.00 ? 51 LYS P HD3    3  
ATOM 5571  H HE2    . LYS C 3 51 ? -0.435  3.839   -1.355  1.00 0.00 ? 51 LYS P HE2    3  
ATOM 5572  H HE3    . LYS C 3 51 ? 0.801   4.818   -2.202  1.00 0.00 ? 51 LYS P HE3    3  
ATOM 5573  H HZ1    . LYS C 3 51 ? 1.704   4.092   -0.192  1.00 0.00 ? 51 LYS P HZ1    3  
ATOM 5574  H HZ2    . LYS C 3 51 ? 0.290   4.532   0.641   1.00 0.00 ? 51 LYS P HZ2    3  
ATOM 5575  H HZ3    . LYS C 3 51 ? 1.328   5.649   0.071   1.00 0.00 ? 51 LYS P HZ3    3  
ATOM 5576  N N      . ASN C 3 52 ? -3.485  2.977   -5.301  1.00 0.00 ? 52 ASN P N      3  
ATOM 5577  C CA     . ASN C 3 52 ? -3.578  1.823   -6.225  1.00 0.00 ? 52 ASN P CA     3  
ATOM 5578  C C      . ASN C 3 52 ? -4.733  1.991   -7.243  1.00 0.00 ? 52 ASN P C      3  
ATOM 5579  O O      . ASN C 3 52 ? -4.543  1.579   -8.389  1.00 0.00 ? 52 ASN P O      3  
ATOM 5580  C CB     . ASN C 3 52 ? -3.542  0.462   -5.505  1.00 0.00 ? 52 ASN P CB     3  
ATOM 5581  C CG     . ASN C 3 52 ? -4.855  -0.021  -4.889  1.00 0.00 ? 52 ASN P CG     3  
ATOM 5582  O OD1    . ASN C 3 52 ? -5.827  -0.089  -5.613  1.00 0.00 ? 52 ASN P OD1    3  
ATOM 5583  N ND2    . ASN C 3 52 ? -4.891  -0.127  -3.573  1.00 0.00 ? 52 ASN P ND2    3  
ATOM 5584  H H      . ASN C 3 52 ? -3.659  2.781   -4.326  1.00 0.00 ? 52 ASN P H      3  
ATOM 5585  H HA     . ASN C 3 52 ? -2.696  1.906   -6.860  1.00 0.00 ? 52 ASN P HA     3  
ATOM 5586  H HB2    . ASN C 3 52 ? -3.294  -0.261  -6.284  1.00 0.00 ? 52 ASN P HB2    3  
ATOM 5587  H HB3    . ASN C 3 52 ? -2.728  0.441   -4.781  1.00 0.00 ? 52 ASN P HB3    3  
ATOM 5588  H HD21   . ASN C 3 52 ? -4.330  0.392   -2.912  1.00 0.00 ? 52 ASN P HD21   3  
ATOM 5589  H HD22   . ASN C 3 52 ? -5.680  -0.565  -3.119  1.00 0.00 ? 52 ASN P HD22   3  
ATOM 5590  N N      . ARG C 3 53 ? -5.823  2.709   -6.897  1.00 0.00 ? 53 ARG P N      3  
ATOM 5591  C CA     . ARG C 3 53 ? -6.853  3.149   -7.769  1.00 0.00 ? 53 ARG P CA     3  
ATOM 5592  C C      . ARG C 3 53 ? -6.358  4.124   -8.877  1.00 0.00 ? 53 ARG P C      3  
ATOM 5593  O O      . ARG C 3 53 ? -6.680  3.795   -10.039 1.00 0.00 ? 53 ARG P O      3  
ATOM 5594  C CB     . ARG C 3 53 ? -7.974  3.846   -7.045  1.00 0.00 ? 53 ARG P CB     3  
ATOM 5595  C CG     . ARG C 3 53 ? -9.091  4.466   -7.987  1.00 0.00 ? 53 ARG P CG     3  
ATOM 5596  C CD     . ARG C 3 53 ? -10.363 4.922   -7.299  1.00 0.00 ? 53 ARG P CD     3  
ATOM 5597  N NE     . ARG C 3 53 ? -11.421 5.434   -8.261  1.00 0.00 ? 53 ARG P NE     3  
ATOM 5598  C CZ     . ARG C 3 53 ? -12.490 4.782   -8.739  1.00 0.00 ? 53 ARG P CZ     3  
ATOM 5599  N NH1    . ARG C 3 53 ? -12.795 3.532   -8.420  1.00 0.00 ? 53 ARG P NH1    3  
ATOM 5600  N NH2    . ARG C 3 53 ? -13.266 5.365   -9.590  1.00 0.00 ? 53 ARG P NH2    3  
ATOM 5601  H H      . ARG C 3 53 ? -5.898  2.931   -5.914  1.00 0.00 ? 53 ARG P H      3  
ATOM 5602  H HA     . ARG C 3 53 ? -7.330  2.312   -8.281  1.00 0.00 ? 53 ARG P HA     3  
ATOM 5603  H HB2    . ARG C 3 53 ? -8.610  3.234   -6.405  1.00 0.00 ? 53 ARG P HB2    3  
ATOM 5604  H HB3    . ARG C 3 53 ? -7.554  4.578   -6.355  1.00 0.00 ? 53 ARG P HB3    3  
ATOM 5605  H HG2    . ARG C 3 53 ? -8.625  5.349   -8.424  1.00 0.00 ? 53 ARG P HG2    3  
ATOM 5606  H HG3    . ARG C 3 53 ? -9.272  3.772   -8.808  1.00 0.00 ? 53 ARG P HG3    3  
ATOM 5607  H HD2    . ARG C 3 53 ? -10.589 4.022   -6.726  1.00 0.00 ? 53 ARG P HD2    3  
ATOM 5608  H HD3    . ARG C 3 53 ? -10.189 5.812   -6.695  1.00 0.00 ? 53 ARG P HD3    3  
ATOM 5609  H HE     . ARG C 3 53 ? -11.240 6.349   -8.646  1.00 0.00 ? 53 ARG P HE     3  
ATOM 5610  H HH11   . ARG C 3 53 ? -12.129 2.939   -7.946  1.00 0.00 ? 53 ARG P HH11   3  
ATOM 5611  H HH12   . ARG C 3 53 ? -13.659 3.178   -8.805  1.00 0.00 ? 53 ARG P HH12   3  
ATOM 5612  H HH21   . ARG C 3 53 ? -13.199 6.331   -9.875  1.00 0.00 ? 53 ARG P HH21   3  
ATOM 5613  H HH22   . ARG C 3 53 ? -14.114 4.925   -9.914  1.00 0.00 ? 53 ARG P HH22   3  
ATOM 5614  N N      . ARG C 3 54 ? -5.574  5.186   -8.558  1.00 0.00 ? 54 ARG P N      3  
ATOM 5615  C CA     . ARG C 3 54 ? -4.899  6.035   -9.506  1.00 0.00 ? 54 ARG P CA     3  
ATOM 5616  C C      . ARG C 3 54 ? -3.975  5.210   -10.414 1.00 0.00 ? 54 ARG P C      3  
ATOM 5617  O O      . ARG C 3 54 ? -4.197  5.276   -11.643 1.00 0.00 ? 54 ARG P O      3  
ATOM 5618  C CB     . ARG C 3 54 ? -4.061  7.073   -8.789  1.00 0.00 ? 54 ARG P CB     3  
ATOM 5619  C CG     . ARG C 3 54 ? -5.032  8.105   -8.222  1.00 0.00 ? 54 ARG P CG     3  
ATOM 5620  C CD     . ARG C 3 54 ? -4.237  8.849   -7.213  1.00 0.00 ? 54 ARG P CD     3  
ATOM 5621  N NE     . ARG C 3 54 ? -4.822  10.133  -6.899  1.00 0.00 ? 54 ARG P NE     3  
ATOM 5622  C CZ     . ARG C 3 54 ? -5.362  10.437  -5.800  1.00 0.00 ? 54 ARG P CZ     3  
ATOM 5623  N NH1    . ARG C 3 54 ? -5.777  9.528   -5.033  1.00 0.00 ? 54 ARG P NH1    3  
ATOM 5624  N NH2    . ARG C 3 54 ? -5.546  11.675  -5.474  1.00 0.00 ? 54 ARG P NH2    3  
ATOM 5625  H H      . ARG C 3 54 ? -5.351  5.352   -7.588  1.00 0.00 ? 54 ARG P H      3  
ATOM 5626  H HA     . ARG C 3 54 ? -5.630  6.590   -10.094 1.00 0.00 ? 54 ARG P HA     3  
ATOM 5627  H HB2    . ARG C 3 54 ? -3.496  6.631   -7.968  1.00 0.00 ? 54 ARG P HB2    3  
ATOM 5628  H HB3    . ARG C 3 54 ? -3.442  7.685   -9.444  1.00 0.00 ? 54 ARG P HB3    3  
ATOM 5629  H HG2    . ARG C 3 54 ? -5.336  8.824   -8.983  1.00 0.00 ? 54 ARG P HG2    3  
ATOM 5630  H HG3    . ARG C 3 54 ? -5.925  7.692   -7.751  1.00 0.00 ? 54 ARG P HG3    3  
ATOM 5631  H HD2    . ARG C 3 54 ? -4.137  8.165   -6.370  1.00 0.00 ? 54 ARG P HD2    3  
ATOM 5632  H HD3    . ARG C 3 54 ? -3.293  9.111   -7.690  1.00 0.00 ? 54 ARG P HD3    3  
ATOM 5633  H HE     . ARG C 3 54 ? -4.642  10.942  -7.478  1.00 0.00 ? 54 ARG P HE     3  
ATOM 5634  H HH11   . ARG C 3 54 ? -5.861  8.645   -5.516  1.00 0.00 ? 54 ARG P HH11   3  
ATOM 5635  H HH12   . ARG C 3 54 ? -6.159  9.705   -4.114  1.00 0.00 ? 54 ARG P HH12   3  
ATOM 5636  H HH21   . ARG C 3 54 ? -5.225  12.503  -5.956  1.00 0.00 ? 54 ARG P HH21   3  
ATOM 5637  H HH22   . ARG C 3 54 ? -5.668  11.830  -4.484  1.00 0.00 ? 54 ARG P HH22   3  
ATOM 5638  N N      . ARG C 3 55 ? -3.008  4.420   -9.863  1.00 0.00 ? 55 ARG P N      3  
ATOM 5639  C CA     . ARG C 3 55 ? -2.190  3.474   -10.674 1.00 0.00 ? 55 ARG P CA     3  
ATOM 5640  C C      . ARG C 3 55 ? -3.006  2.588   -11.662 1.00 0.00 ? 55 ARG P C      3  
ATOM 5641  O O      . ARG C 3 55 ? -2.690  2.534   -12.824 1.00 0.00 ? 55 ARG P O      3  
ATOM 5642  C CB     . ARG C 3 55 ? -1.266  2.641   -9.762  1.00 0.00 ? 55 ARG P CB     3  
ATOM 5643  C CG     . ARG C 3 55 ? -0.074  3.431   -9.111  1.00 0.00 ? 55 ARG P CG     3  
ATOM 5644  C CD     . ARG C 3 55 ? 0.786   4.249   -10.088 1.00 0.00 ? 55 ARG P CD     3  
ATOM 5645  N NE     . ARG C 3 55 ? 1.511   3.416   -11.060 1.00 0.00 ? 55 ARG P NE     3  
ATOM 5646  C CZ     . ARG C 3 55 ? 2.619   2.700   -10.767 1.00 0.00 ? 55 ARG P CZ     3  
ATOM 5647  N NH1    . ARG C 3 55 ? 3.121   2.669   -9.569  1.00 0.00 ? 55 ARG P NH1    3  
ATOM 5648  N NH2    . ARG C 3 55 ? 3.355   2.079   -11.668 1.00 0.00 ? 55 ARG P NH2    3  
ATOM 5649  H H      . ARG C 3 55 ? -2.957  4.337   -8.858  1.00 0.00 ? 55 ARG P H      3  
ATOM 5650  H HA     . ARG C 3 55 ? -1.566  4.097   -11.315 1.00 0.00 ? 55 ARG P HA     3  
ATOM 5651  H HB2    . ARG C 3 55 ? -1.896  2.240   -8.968  1.00 0.00 ? 55 ARG P HB2    3  
ATOM 5652  H HB3    . ARG C 3 55 ? -0.899  1.776   -10.315 1.00 0.00 ? 55 ARG P HB3    3  
ATOM 5653  H HG2    . ARG C 3 55 ? -0.490  4.225   -8.494  1.00 0.00 ? 55 ARG P HG2    3  
ATOM 5654  H HG3    . ARG C 3 55 ? 0.508   2.722   -8.522  1.00 0.00 ? 55 ARG P HG3    3  
ATOM 5655  H HD2    . ARG C 3 55 ? 0.179   4.906   -10.712 1.00 0.00 ? 55 ARG P HD2    3  
ATOM 5656  H HD3    . ARG C 3 55 ? 1.471   4.903   -9.547  1.00 0.00 ? 55 ARG P HD3    3  
ATOM 5657  H HE     . ARG C 3 55 ? 1.174   3.508   -12.008 1.00 0.00 ? 55 ARG P HE     3  
ATOM 5658  H HH11   . ARG C 3 55 ? 2.906   3.453   -8.969  1.00 0.00 ? 55 ARG P HH11   3  
ATOM 5659  H HH12   . ARG C 3 55 ? 4.063   2.309   -9.516  1.00 0.00 ? 55 ARG P HH12   3  
ATOM 5660  H HH21   . ARG C 3 55 ? 3.132   1.981   -12.648 1.00 0.00 ? 55 ARG P HH21   3  
ATOM 5661  H HH22   . ARG C 3 55 ? 4.215   1.720   -11.278 1.00 0.00 ? 55 ARG P HH22   3  
ATOM 5662  N N      . ARG C 3 56 ? -4.170  1.966   -11.206 1.00 0.00 ? 56 ARG P N      3  
ATOM 5663  C CA     . ARG C 3 56 ? -5.067  1.241   -12.086 1.00 0.00 ? 56 ARG P CA     3  
ATOM 5664  C C      . ARG C 3 56 ? -5.619  1.999   -13.213 1.00 0.00 ? 56 ARG P C      3  
ATOM 5665  O O      . ARG C 3 56 ? -5.397  1.648   -14.393 1.00 0.00 ? 56 ARG P O      3  
ATOM 5666  C CB     . ARG C 3 56 ? -6.249  0.830   -11.149 1.00 0.00 ? 56 ARG P CB     3  
ATOM 5667  C CG     . ARG C 3 56 ? -6.343  -0.653  -10.943 1.00 0.00 ? 56 ARG P CG     3  
ATOM 5668  C CD     . ARG C 3 56 ? -6.804  -1.080  -9.555  1.00 0.00 ? 56 ARG P CD     3  
ATOM 5669  N NE     . ARG C 3 56 ? -5.967  -2.248  -9.081  1.00 0.00 ? 56 ARG P NE     3  
ATOM 5670  C CZ     . ARG C 3 56 ? -4.660  -2.209  -8.897  1.00 0.00 ? 56 ARG P CZ     3  
ATOM 5671  N NH1    . ARG C 3 56 ? -4.020  -1.153  -8.989  1.00 0.00 ? 56 ARG P NH1    3  
ATOM 5672  N NH2    . ARG C 3 56 ? -4.029  -3.224  -8.530  1.00 0.00 ? 56 ARG P NH2    3  
ATOM 5673  H H      . ARG C 3 56 ? -4.310  1.940   -10.206 1.00 0.00 ? 56 ARG P H      3  
ATOM 5674  H HA     . ARG C 3 56 ? -4.614  0.360   -12.540 1.00 0.00 ? 56 ARG P HA     3  
ATOM 5675  H HB2    . ARG C 3 56 ? -6.056  1.283   -10.176 1.00 0.00 ? 56 ARG P HB2    3  
ATOM 5676  H HB3    . ARG C 3 56 ? -7.204  1.251   -11.464 1.00 0.00 ? 56 ARG P HB3    3  
ATOM 5677  H HG2    . ARG C 3 56 ? -7.014  -0.977  -11.738 1.00 0.00 ? 56 ARG P HG2    3  
ATOM 5678  H HG3    . ARG C 3 56 ? -5.355  -1.059  -11.162 1.00 0.00 ? 56 ARG P HG3    3  
ATOM 5679  H HD2    . ARG C 3 56 ? -6.746  -0.307  -8.788  1.00 0.00 ? 56 ARG P HD2    3  
ATOM 5680  H HD3    . ARG C 3 56 ? -7.881  -1.238  -9.503  1.00 0.00 ? 56 ARG P HD3    3  
ATOM 5681  H HE     . ARG C 3 56 ? -6.412  -3.086  -8.735  1.00 0.00 ? 56 ARG P HE     3  
ATOM 5682  H HH11   . ARG C 3 56 ? -4.535  -0.290  -9.082  1.00 0.00 ? 56 ARG P HH11   3  
ATOM 5683  H HH12   . ARG C 3 56 ? -3.018  -1.200  -8.873  1.00 0.00 ? 56 ARG P HH12   3  
ATOM 5684  H HH21   . ARG C 3 56 ? -4.526  -4.020  -8.156  1.00 0.00 ? 56 ARG P HH21   3  
ATOM 5685  H HH22   . ARG C 3 56 ? -3.037  -3.120  -8.373  1.00 0.00 ? 56 ARG P HH22   3  
ATOM 5686  N N      . HIS C 3 57 ? -6.133  3.213   -12.891 1.00 0.00 ? 57 HIS P N      3  
ATOM 5687  C CA     . HIS C 3 57 ? -6.831  4.105   -13.804 1.00 0.00 ? 57 HIS P CA     3  
ATOM 5688  C C      . HIS C 3 57 ? -5.891  4.790   -14.868 1.00 0.00 ? 57 HIS P C      3  
ATOM 5689  O O      . HIS C 3 57 ? -6.252  4.833   -16.037 1.00 0.00 ? 57 HIS P O      3  
ATOM 5690  C CB     . HIS C 3 57 ? -7.626  5.185   -12.930 1.00 0.00 ? 57 HIS P CB     3  
ATOM 5691  C CG     . HIS C 3 57 ? -9.047  4.750   -12.525 1.00 0.00 ? 57 HIS P CG     3  
ATOM 5692  N ND1    . HIS C 3 57 ? -10.240 5.319   -12.937 1.00 0.00 ? 57 HIS P ND1    3  
ATOM 5693  C CD2    . HIS C 3 57 ? -9.324  3.706   -11.698 1.00 0.00 ? 57 HIS P CD2    3  
ATOM 5694  C CE1    . HIS C 3 57 ? -11.216 4.650   -12.342 1.00 0.00 ? 57 HIS P CE1    3  
ATOM 5695  N NE2    . HIS C 3 57 ? -10.731 3.685   -11.496 1.00 0.00 ? 57 HIS P NE2    3  
ATOM 5696  H H      . HIS C 3 57 ? -6.013  3.471   -11.922 1.00 0.00 ? 57 HIS P H      3  
ATOM 5697  H HA     . HIS C 3 57 ? -7.493  3.529   -14.449 1.00 0.00 ? 57 HIS P HA     3  
ATOM 5698  H HB2    . HIS C 3 57 ? -6.945  5.491   -12.135 1.00 0.00 ? 57 HIS P HB2    3  
ATOM 5699  H HB3    . HIS C 3 57 ? -7.669  6.155   -13.424 1.00 0.00 ? 57 HIS P HB3    3  
ATOM 5700  H HD1    . HIS C 3 57 ? -10.262 6.010   -13.673 1.00 0.00 ? 57 HIS P HD1    3  
ATOM 5701  H HD2    . HIS C 3 57 ? -8.585  3.173   -11.119 1.00 0.00 ? 57 HIS P HD2    3  
ATOM 5702  H HE1    . HIS C 3 57 ? -12.280 4.811   -12.430 1.00 0.00 ? 57 HIS P HE1    3  
ATOM 5703  N N      . LYS C 3 58 ? -4.682  5.242   -14.459 1.00 0.00 ? 58 LYS P N      3  
ATOM 5704  C CA     . LYS C 3 58 ? -3.646  5.641   -15.302 1.00 0.00 ? 58 LYS P CA     3  
ATOM 5705  C C      . LYS C 3 58 ? -3.050  4.523   -16.224 1.00 0.00 ? 58 LYS P C      3  
ATOM 5706  O O      . LYS C 3 58 ? -2.845  4.761   -17.408 1.00 0.00 ? 58 LYS P O      3  
ATOM 5707  C CB     . LYS C 3 58 ? -2.657  6.644   -14.639 1.00 0.00 ? 58 LYS P CB     3  
ATOM 5708  C CG     . LYS C 3 58 ? -1.723  5.827   -13.717 1.00 0.00 ? 58 LYS P CG     3  
ATOM 5709  C CD     . LYS C 3 58 ? -0.868  6.828   -12.945 1.00 0.00 ? 58 LYS P CD     3  
ATOM 5710  C CE     . LYS C 3 58 ? -1.598  7.393   -11.677 1.00 0.00 ? 58 LYS P CE     3  
ATOM 5711  N NZ     . LYS C 3 58 ? -1.169  8.829   -11.348 1.00 0.00 ? 58 LYS P NZ     3  
ATOM 5712  H H      . LYS C 3 58 ? -4.475  5.189   -13.472 1.00 0.00 ? 58 LYS P H      3  
ATOM 5713  H HA     . LYS C 3 58 ? -4.182  6.276   -16.006 1.00 0.00 ? 58 LYS P HA     3  
ATOM 5714  H HB2    . LYS C 3 58 ? -2.045  7.144   -15.389 1.00 0.00 ? 58 LYS P HB2    3  
ATOM 5715  H HB3    . LYS C 3 58 ? -3.276  7.321   -14.051 1.00 0.00 ? 58 LYS P HB3    3  
ATOM 5716  H HG2    . LYS C 3 58 ? -2.285  5.188   -13.035 1.00 0.00 ? 58 LYS P HG2    3  
ATOM 5717  H HG3    . LYS C 3 58 ? -1.084  5.286   -14.414 1.00 0.00 ? 58 LYS P HG3    3  
ATOM 5718  H HD2    . LYS C 3 58 ? 0.088   6.395   -12.652 1.00 0.00 ? 58 LYS P HD2    3  
ATOM 5719  H HD3    . LYS C 3 58 ? -0.642  7.641   -13.635 1.00 0.00 ? 58 LYS P HD3    3  
ATOM 5720  H HE2    . LYS C 3 58 ? -2.641  7.583   -11.933 1.00 0.00 ? 58 LYS P HE2    3  
ATOM 5721  H HE3    . LYS C 3 58 ? -1.403  6.617   -10.936 1.00 0.00 ? 58 LYS P HE3    3  
ATOM 5722  H HZ1    . LYS C 3 58 ? -1.590  9.473   -12.002 1.00 0.00 ? 58 LYS P HZ1    3  
ATOM 5723  H HZ2    . LYS C 3 58 ? -0.195  8.866   -11.615 1.00 0.00 ? 58 LYS P HZ2    3  
ATOM 5724  H HZ3    . LYS C 3 58 ? -1.329  9.173   -10.411 1.00 0.00 ? 58 LYS P HZ3    3  
ATOM 5725  N N      . ILE C 3 59 ? -2.911  3.285   -15.689 1.00 0.00 ? 59 ILE P N      3  
ATOM 5726  C CA     . ILE C 3 59 ? -2.409  2.049   -16.371 1.00 0.00 ? 59 ILE P CA     3  
ATOM 5727  C C      . ILE C 3 59 ? -3.428  1.593   -17.483 1.00 0.00 ? 59 ILE P C      3  
ATOM 5728  O O      . ILE C 3 59 ? -3.091  1.439   -18.648 1.00 0.00 ? 59 ILE P O      3  
ATOM 5729  C CB     . ILE C 3 59 ? -1.955  0.891   -15.391 1.00 0.00 ? 59 ILE P CB     3  
ATOM 5730  C CG1    . ILE C 3 59 ? -0.665  1.306   -14.643 1.00 0.00 ? 59 ILE P CG1    3  
ATOM 5731  C CG2    . ILE C 3 59 ? -1.757  -0.405  -16.071 1.00 0.00 ? 59 ILE P CG2    3  
ATOM 5732  C CD1    . ILE C 3 59 ? -0.416  0.478   -13.398 1.00 0.00 ? 59 ILE P CD1    3  
ATOM 5733  H H      . ILE C 3 59 ? -2.918  3.246   -14.679 1.00 0.00 ? 59 ILE P H      3  
ATOM 5734  H HA     . ILE C 3 59 ? -1.595  2.226   -17.073 1.00 0.00 ? 59 ILE P HA     3  
ATOM 5735  H HB     . ILE C 3 59 ? -2.717  0.816   -14.615 1.00 0.00 ? 59 ILE P HB     3  
ATOM 5736  H HG12   . ILE C 3 59 ? 0.201   1.218   -15.300 1.00 0.00 ? 59 ILE P HG12   3  
ATOM 5737  H HG13   . ILE C 3 59 ? -0.750  2.344   -14.321 1.00 0.00 ? 59 ILE P HG13   3  
ATOM 5738  H HG21   . ILE C 3 59 ? -0.833  -0.348  -16.646 1.00 0.00 ? 59 ILE P HG21   3  
ATOM 5739  H HG22   . ILE C 3 59 ? -1.644  -1.161  -15.293 1.00 0.00 ? 59 ILE P HG22   3  
ATOM 5740  H HG23   . ILE C 3 59 ? -2.554  -0.762  -16.723 1.00 0.00 ? 59 ILE P HG23   3  
ATOM 5741  H HD11   . ILE C 3 59 ? -1.214  0.312   -12.673 1.00 0.00 ? 59 ILE P HD11   3  
ATOM 5742  H HD12   . ILE C 3 59 ? -0.077  -0.532  -13.627 1.00 0.00 ? 59 ILE P HD12   3  
ATOM 5743  H HD13   . ILE C 3 59 ? 0.267   1.064   -12.784 1.00 0.00 ? 59 ILE P HD13   3  
ATOM 5744  N N      . GLN C 3 60 ? -4.699  1.521   -17.158 1.00 0.00 ? 60 GLN P N      3  
ATOM 5745  C CA     . GLN C 3 60 ? -5.755  1.209   -18.121 1.00 0.00 ? 60 GLN P CA     3  
ATOM 5746  C C      . GLN C 3 60 ? -5.748  2.219   -19.318 1.00 0.00 ? 60 GLN P C      3  
ATOM 5747  O O      . GLN C 3 60 ? -5.873  1.785   -20.433 1.00 0.00 ? 60 GLN P O      3  
ATOM 5748  C CB     . GLN C 3 60 ? -7.139  1.168   -17.374 1.00 0.00 ? 60 GLN P CB     3  
ATOM 5749  C CG     . GLN C 3 60 ? -7.493  -0.096  -16.517 1.00 0.00 ? 60 GLN P CG     3  
ATOM 5750  C CD     . GLN C 3 60 ? -8.247  0.280   -15.253 1.00 0.00 ? 60 GLN P CD     3  
ATOM 5751  O OE1    . GLN C 3 60 ? -9.193  1.056   -15.288 1.00 0.00 ? 60 GLN P OE1    3  
ATOM 5752  N NE2    . GLN C 3 60 ? -7.828  -0.283  -14.124 1.00 0.00 ? 60 GLN P NE2    3  
ATOM 5753  H H      . GLN C 3 60 ? -4.954  1.474   -16.183 1.00 0.00 ? 60 GLN P H      3  
ATOM 5754  H HA     . GLN C 3 60 ? -5.631  0.224   -18.571 1.00 0.00 ? 60 GLN P HA     3  
ATOM 5755  H HB2    . GLN C 3 60 ? -7.243  2.093   -16.808 1.00 0.00 ? 60 GLN P HB2    3  
ATOM 5756  H HB3    . GLN C 3 60 ? -7.942  1.308   -18.097 1.00 0.00 ? 60 GLN P HB3    3  
ATOM 5757  H HG2    . GLN C 3 60 ? -8.240  -0.707  -17.023 1.00 0.00 ? 60 GLN P HG2    3  
ATOM 5758  H HG3    . GLN C 3 60 ? -6.540  -0.578  -16.296 1.00 0.00 ? 60 GLN P HG3    3  
ATOM 5759  H HE21   . GLN C 3 60 ? -7.111  -0.992  -14.082 1.00 0.00 ? 60 GLN P HE21   3  
ATOM 5760  H HE22   . GLN C 3 60 ? -8.186  0.099   -13.260 1.00 0.00 ? 60 GLN P HE22   3  
ATOM 5761  N N      . SER C 3 61 ? -5.484  3.532   -19.164 1.00 0.00 ? 61 SER P N      3  
ATOM 5762  C CA     . SER C 3 61 ? -5.270  4.480   -20.356 1.00 0.00 ? 61 SER P CA     3  
ATOM 5763  C C      . SER C 3 61 ? -4.117  4.149   -21.262 1.00 0.00 ? 61 SER P C      3  
ATOM 5764  O O      . SER C 3 61 ? -4.202  4.401   -22.419 1.00 0.00 ? 61 SER P O      3  
ATOM 5765  C CB     . SER C 3 61 ? -5.017  5.908   -19.844 1.00 0.00 ? 61 SER P CB     3  
ATOM 5766  O OG     . SER C 3 61 ? -6.232  6.582   -19.516 1.00 0.00 ? 61 SER P OG     3  
ATOM 5767  H H      . SER C 3 61 ? -5.470  3.892   -18.220 1.00 0.00 ? 61 SER P H      3  
ATOM 5768  H HA     . SER C 3 61 ? -6.186  4.584   -20.936 1.00 0.00 ? 61 SER P HA     3  
ATOM 5769  H HB2    . SER C 3 61 ? -4.251  5.888   -19.068 1.00 0.00 ? 61 SER P HB2    3  
ATOM 5770  H HB3    . SER C 3 61 ? -4.554  6.488   -20.641 1.00 0.00 ? 61 SER P HB3    3  
ATOM 5771  H HG     . SER C 3 61 ? -5.985  7.368   -19.024 1.00 0.00 ? 61 SER P HG     3  
ATOM 5772  N N      . ASP C 3 62 ? -3.063  3.604   -20.668 1.00 0.00 ? 62 ASP P N      3  
ATOM 5773  C CA     . ASP C 3 62 ? -1.828  3.176   -21.447 1.00 0.00 ? 62 ASP P CA     3  
ATOM 5774  C C      . ASP C 3 62 ? -2.042  1.926   -22.359 1.00 0.00 ? 62 ASP P C      3  
ATOM 5775  O O      . ASP C 3 62 ? -1.791  1.912   -23.557 1.00 0.00 ? 62 ASP P O      3  
ATOM 5776  C CB     . ASP C 3 62 ? -0.708  2.955   -20.392 1.00 0.00 ? 62 ASP P CB     3  
ATOM 5777  C CG     . ASP C 3 62 ? 0.660   3.105   -20.964 1.00 0.00 ? 62 ASP P CG     3  
ATOM 5778  O OD1    . ASP C 3 62 ? 1.257   4.213   -21.014 1.00 0.00 ? 62 ASP P OD1    3  
ATOM 5779  O OD2    . ASP C 3 62 ? 1.274   2.118   -21.426 1.00 0.00 ? 62 ASP P OD2    3  
ATOM 5780  H H      . ASP C 3 62 ? -3.076  3.292   -19.708 1.00 0.00 ? 62 ASP P H      3  
ATOM 5781  H HA     . ASP C 3 62 ? -1.514  3.955   -22.144 1.00 0.00 ? 62 ASP P HA     3  
ATOM 5782  H HB2    . ASP C 3 62 ? -0.750  3.714   -19.610 1.00 0.00 ? 62 ASP P HB2    3  
ATOM 5783  H HB3    . ASP C 3 62 ? -0.869  1.979   -19.936 1.00 0.00 ? 62 ASP P HB3    3  
ATOM 5784  N N      . GLN C 3 63 ? -2.772  0.891   -21.815 1.00 0.00 ? 63 GLN P N      3  
ATOM 5785  C CA     . GLN C 3 63 ? -2.942  -0.419  -22.528 1.00 0.00 ? 63 GLN P CA     3  
ATOM 5786  C C      . GLN C 3 63 ? -4.338  -0.923  -22.775 1.00 0.00 ? 63 GLN P C      3  
ATOM 5787  O O      . GLN C 3 63 ? -4.389  -2.052  -23.290 1.00 0.00 ? 63 GLN P O      3  
ATOM 5788  C CB     . GLN C 3 63 ? -2.000  -1.428  -21.835 1.00 0.00 ? 63 GLN P CB     3  
ATOM 5789  C CG     . GLN C 3 63 ? -2.367  -1.581  -20.349 1.00 0.00 ? 63 GLN P CG     3  
ATOM 5790  C CD     . GLN C 3 63 ? -1.707  -2.835  -19.634 1.00 0.00 ? 63 GLN P CD     3  
ATOM 5791  O OE1    . GLN C 3 63 ? -0.739  -3.471  -20.067 1.00 0.00 ? 63 GLN P OE1    3  
ATOM 5792  N NE2    . GLN C 3 63 ? -2.072  -3.055  -18.437 1.00 0.00 ? 63 GLN P NE2    3  
ATOM 5793  H H      . GLN C 3 63 ? -3.141  1.125   -20.905 1.00 0.00 ? 63 GLN P H      3  
ATOM 5794  H HA     . GLN C 3 63 ? -2.576  -0.360  -23.553 1.00 0.00 ? 63 GLN P HA     3  
ATOM 5795  H HB2    . GLN C 3 63 ? -2.241  -2.398  -22.269 1.00 0.00 ? 63 GLN P HB2    3  
ATOM 5796  H HB3    . GLN C 3 63 ? -0.976  -1.071  -21.950 1.00 0.00 ? 63 GLN P HB3    3  
ATOM 5797  H HG2    . GLN C 3 63 ? -2.060  -0.698  -19.789 1.00 0.00 ? 63 GLN P HG2    3  
ATOM 5798  H HG3    . GLN C 3 63 ? -3.440  -1.751  -20.259 1.00 0.00 ? 63 GLN P HG3    3  
ATOM 5799  H HE21   . GLN C 3 63 ? -2.962  -2.718  -18.099 1.00 0.00 ? 63 GLN P HE21   3  
ATOM 5800  H HE22   . GLN C 3 63 ? -1.749  -3.914  -18.017 1.00 0.00 ? 63 GLN P HE22   3  
ATOM 5801  N N      . HIS C 3 64 ? -5.374  -0.184  -22.395 1.00 0.00 ? 64 HIS P N      3  
ATOM 5802  C CA     . HIS C 3 64 ? -6.740  -0.815  -22.212 1.00 0.00 ? 64 HIS P CA     3  
ATOM 5803  C C      . HIS C 3 64 ? -7.895  0.101   -22.638 1.00 0.00 ? 64 HIS P C      3  
ATOM 5804  O O      . HIS C 3 64 ? -9.037  -0.283  -22.494 1.00 0.00 ? 64 HIS P O      3  
ATOM 5805  C CB     . HIS C 3 64 ? -6.868  -1.261  -20.763 1.00 0.00 ? 64 HIS P CB     3  
ATOM 5806  C CG     . HIS C 3 64 ? -7.543  -2.602  -20.503 1.00 0.00 ? 64 HIS P CG     3  
ATOM 5807  N ND1    . HIS C 3 64 ? -7.088  -3.806  -20.940 1.00 0.00 ? 64 HIS P ND1    3  
ATOM 5808  C CD2    . HIS C 3 64 ? -8.865  -2.850  -20.112 1.00 0.00 ? 64 HIS P CD2    3  
ATOM 5809  C CE1    . HIS C 3 64 ? -8.001  -4.760  -20.719 1.00 0.00 ? 64 HIS P CE1    3  
ATOM 5810  N NE2    . HIS C 3 64 ? -9.152  -4.204  -20.290 1.00 0.00 ? 64 HIS P NE2    3  
ATOM 5811  H H      . HIS C 3 64 ? -5.228  0.700   -21.930 1.00 0.00 ? 64 HIS P H      3  
ATOM 5812  H HA     . HIS C 3 64 ? -6.783  -1.700  -22.846 1.00 0.00 ? 64 HIS P HA     3  
ATOM 5813  H HB2    . HIS C 3 64 ? -5.881  -1.299  -20.301 1.00 0.00 ? 64 HIS P HB2    3  
ATOM 5814  H HB3    . HIS C 3 64 ? -7.439  -0.476  -20.267 1.00 0.00 ? 64 HIS P HB3    3  
ATOM 5815  H HD1    . HIS C 3 64 ? -6.205  -4.003  -21.388 1.00 0.00 ? 64 HIS P HD1    3  
ATOM 5816  H HD2    . HIS C 3 64 ? -9.560  -2.090  -19.789 1.00 0.00 ? 64 HIS P HD2    3  
ATOM 5817  H HE1    . HIS C 3 64 ? -7.945  -5.820  -20.920 1.00 0.00 ? 64 HIS P HE1    3  
ATOM 5818  N N      . LYS C 3 65 ? -7.617  1.367   -23.071 1.00 0.00 ? 65 LYS P N      3  
ATOM 5819  C CA     . LYS C 3 65 ? -8.750  2.287   -23.335 1.00 0.00 ? 65 LYS P CA     3  
ATOM 5820  C C      . LYS C 3 65 ? -8.506  2.999   -24.645 1.00 0.00 ? 65 LYS P C      3  
ATOM 5821  O O      . LYS C 3 65 ? -7.405  3.005   -25.166 1.00 0.00 ? 65 LYS P O      3  
ATOM 5822  C CB     . LYS C 3 65 ? -8.714  3.292   -22.150 1.00 0.00 ? 65 LYS P CB     3  
ATOM 5823  C CG     . LYS C 3 65 ? -9.315  2.807   -20.837 1.00 0.00 ? 65 LYS P CG     3  
ATOM 5824  C CD     . LYS C 3 65 ? -9.194  3.630   -19.574 1.00 0.00 ? 65 LYS P CD     3  
ATOM 5825  C CE     . LYS C 3 65 ? -9.730  5.101   -19.584 1.00 0.00 ? 65 LYS P CE     3  
ATOM 5826  N NZ     . LYS C 3 65 ? -8.943  6.140   -20.288 1.00 0.00 ? 65 LYS P NZ     3  
ATOM 5827  H H      . LYS C 3 65 ? -6.694  1.761   -22.960 1.00 0.00 ? 65 LYS P H      3  
ATOM 5828  H HA     . LYS C 3 65 ? -9.725  1.802   -23.286 1.00 0.00 ? 65 LYS P HA     3  
ATOM 5829  H HB2    . LYS C 3 65 ? -7.689  3.580   -21.911 1.00 0.00 ? 65 LYS P HB2    3  
ATOM 5830  H HB3    . LYS C 3 65 ? -9.204  4.219   -22.446 1.00 0.00 ? 65 LYS P HB3    3  
ATOM 5831  H HG2    . LYS C 3 65 ? -10.367 2.578   -21.012 1.00 0.00 ? 65 LYS P HG2    3  
ATOM 5832  H HG3    . LYS C 3 65 ? -8.776  1.896   -20.578 1.00 0.00 ? 65 LYS P HG3    3  
ATOM 5833  H HD2    . LYS C 3 65 ? -9.663  3.105   -18.741 1.00 0.00 ? 65 LYS P HD2    3  
ATOM 5834  H HD3    . LYS C 3 65 ? -8.168  3.720   -19.218 1.00 0.00 ? 65 LYS P HD3    3  
ATOM 5835  H HE2    . LYS C 3 65 ? -10.723 5.123   -20.033 1.00 0.00 ? 65 LYS P HE2    3  
ATOM 5836  H HE3    . LYS C 3 65 ? -9.849  5.455   -18.561 1.00 0.00 ? 65 LYS P HE3    3  
ATOM 5837  H HZ1    . LYS C 3 65 ? -9.285  7.033   -19.964 1.00 0.00 ? 65 LYS P HZ1    3  
ATOM 5838  H HZ2    . LYS C 3 65 ? -9.092  6.111   -21.287 1.00 0.00 ? 65 LYS P HZ2    3  
ATOM 5839  H HZ3    . LYS C 3 65 ? -7.948  6.114   -20.118 1.00 0.00 ? 65 LYS P HZ3    3  
ATOM 5840  N N      . ASP C 3 66 ? -9.602  3.608   -25.132 1.00 0.00 ? 66 ASP P N      3  
ATOM 5841  C CA     . ASP C 3 66 ? -9.709  4.485   -26.317 1.00 0.00 ? 66 ASP P CA     3  
ATOM 5842  C C      . ASP C 3 66 ? -10.716 5.585   -26.039 1.00 0.00 ? 66 ASP P C      3  
ATOM 5843  O O      . ASP C 3 66 ? -11.925 5.288   -25.934 1.00 0.00 ? 66 ASP P O      3  
ATOM 5844  C CB     . ASP C 3 66 ? -10.061 3.604   -27.606 1.00 0.00 ? 66 ASP P CB     3  
ATOM 5845  C CG     . ASP C 3 66 ? -9.618  4.368   -28.825 1.00 0.00 ? 66 ASP P CG     3  
ATOM 5846  O OD1    . ASP C 3 66 ? -10.427 4.639   -29.738 1.00 0.00 ? 66 ASP P OD1    3  
ATOM 5847  O OD2    . ASP C 3 66 ? -8.429  4.616   -29.000 1.00 0.00 ? 66 ASP P OD2    3  
ATOM 5848  H H      . ASP C 3 66 ? -10.429 3.450   -24.574 1.00 0.00 ? 66 ASP P H      3  
ATOM 5849  H HA     . ASP C 3 66 ? -8.680  4.805   -26.487 1.00 0.00 ? 66 ASP P HA     3  
ATOM 5850  H HB2    . ASP C 3 66 ? -9.579  2.628   -27.539 1.00 0.00 ? 66 ASP P HB2    3  
ATOM 5851  H HB3    . ASP C 3 66 ? -11.148 3.533   -27.629 1.00 0.00 ? 66 ASP P HB3    3  
ATOM 5852  N N      . GLN C 3 67 ? -10.131 6.786   -25.902 1.00 0.00 ? 67 GLN P N      3  
ATOM 5853  C CA     . GLN C 3 67 ? -10.893 8.031   -25.663 1.00 0.00 ? 67 GLN P CA     3  
ATOM 5854  C C      . GLN C 3 67 ? -10.338 9.247   -26.451 1.00 0.00 ? 67 GLN P C      3  
ATOM 5855  O O      . GLN C 3 67 ? -10.751 10.420  -26.046 1.00 0.00 ? 67 GLN P O      3  
ATOM 5856  C CB     . GLN C 3 67 ? -10.966 8.273   -24.101 1.00 0.00 ? 67 GLN P CB     3  
ATOM 5857  C CG     . GLN C 3 67 ? -9.679  8.792   -23.413 1.00 0.00 ? 67 GLN P CG     3  
ATOM 5858  C CD     . GLN C 3 67 ? -8.531  7.858   -23.674 1.00 0.00 ? 67 GLN P CD     3  
ATOM 5859  O OE1    . GLN C 3 67 ? -8.494  6.755   -23.201 1.00 0.00 ? 67 GLN P OE1    3  
ATOM 5860  N NE2    . GLN C 3 67 ? -7.505  8.197   -24.450 1.00 0.00 ? 67 GLN P NE2    3  
ATOM 5861  H H      . GLN C 3 67 ? -9.134  6.853   -26.054 1.00 0.00 ? 67 GLN P H      3  
ATOM 5862  H HA     . GLN C 3 67 ? -11.961 7.915   -25.846 1.00 0.00 ? 67 GLN P HA     3  
ATOM 5863  H HB2    . GLN C 3 67 ? -11.773 8.946   -23.813 1.00 0.00 ? 67 GLN P HB2    3  
ATOM 5864  H HB3    . GLN C 3 67 ? -11.208 7.282   -23.716 1.00 0.00 ? 67 GLN P HB3    3  
ATOM 5865  H HG2    . GLN C 3 67 ? -9.325  9.790   -23.675 1.00 0.00 ? 67 GLN P HG2    3  
ATOM 5866  H HG3    . GLN C 3 67 ? -9.878  8.845   -22.342 1.00 0.00 ? 67 GLN P HG3    3  
ATOM 5867  H HE21   . GLN C 3 67 ? -7.559  9.122   -24.850 1.00 0.00 ? 67 GLN P HE21   3  
ATOM 5868  H HE22   . GLN C 3 67 ? -6.690  7.604   -24.520 1.00 0.00 ? 67 GLN P HE22   3  
ATOM 5869  N N      . SER C 3 68 ? -9.547  9.011   -27.452 1.00 0.00 ? 68 SER P N      3  
ATOM 5870  C CA     . SER C 3 68 ? -8.870  10.046  -28.171 1.00 0.00 ? 68 SER P CA     3  
ATOM 5871  C C      . SER C 3 68 ? -8.499  9.552   -29.686 1.00 0.00 ? 68 SER P C      3  
ATOM 5872  O O      . SER C 3 68 ? -9.272  8.664   -30.163 1.00 0.00 ? 68 SER P O      3  
ATOM 5873  C CB     . SER C 3 68 ? -7.708  10.613  -27.303 1.00 0.00 ? 68 SER P CB     3  
ATOM 5874  O OG     . SER C 3 68 ? -8.096  10.971  -25.900 1.00 0.00 ? 68 SER P OG     3  
ATOM 5875  O OXT    . SER C 3 68 ? -7.441  9.906   -30.235 1.00 0.00 ? 68 SER P OXT    3  
ATOM 5876  H H      . SER C 3 68 ? -9.284  8.084   -27.754 1.00 0.00 ? 68 SER P H      3  
ATOM 5877  H HA     . SER C 3 68 ? -9.579  10.867  -28.283 1.00 0.00 ? 68 SER P HA     3  
ATOM 5878  H HB2    . SER C 3 68 ? -6.902  9.881   -27.248 1.00 0.00 ? 68 SER P HB2    3  
ATOM 5879  H HB3    . SER C 3 68 ? -7.262  11.460  -27.824 1.00 0.00 ? 68 SER P HB3    3  
ATOM 5880  H HG     . SER C 3 68 ? -9.034  10.800  -25.789 1.00 0.00 ? 68 SER P HG     3  
ATOM 5881  O "O5'"  . DG  A 1 1  ? 7.446   -25.069 -10.713 1.00 0.00 ? 69 DG  A "O5'"  4  
ATOM 5882  C "C5'"  . DG  A 1 1  ? 7.719   -24.873 -12.088 1.00 0.00 ? 69 DG  A "C5'"  4  
ATOM 5883  C "C4'"  . DG  A 1 1  ? 7.271   -23.442 -12.543 1.00 0.00 ? 69 DG  A "C4'"  4  
ATOM 5884  O "O4'"  . DG  A 1 1  ? 5.948   -23.313 -12.190 1.00 0.00 ? 69 DG  A "O4'"  4  
ATOM 5885  C "C3'"  . DG  A 1 1  ? 7.942   -22.118 -11.958 1.00 0.00 ? 69 DG  A "C3'"  4  
ATOM 5886  O "O3'"  . DG  A 1 1  ? 8.094   -21.102 -12.858 1.00 0.00 ? 69 DG  A "O3'"  4  
ATOM 5887  C "C2'"  . DG  A 1 1  ? 6.866   -21.711 -10.896 1.00 0.00 ? 69 DG  A "C2'"  4  
ATOM 5888  C "C1'"  . DG  A 1 1  ? 5.610   -22.061 -11.686 1.00 0.00 ? 69 DG  A "C1'"  4  
ATOM 5889  N N9     . DG  A 1 1  ? 4.364   -22.076 -10.951 1.00 0.00 ? 69 DG  A N9     4  
ATOM 5890  C C8     . DG  A 1 1  ? 4.193   -22.541 -9.657  1.00 0.00 ? 69 DG  A C8     4  
ATOM 5891  N N7     . DG  A 1 1  ? 2.941   -22.583 -9.275  1.00 0.00 ? 69 DG  A N7     4  
ATOM 5892  C C5     . DG  A 1 1  ? 2.249   -22.128 -10.400 1.00 0.00 ? 69 DG  A C5     4  
ATOM 5893  C C6     . DG  A 1 1  ? 0.837   -21.893 -10.604 1.00 0.00 ? 69 DG  A C6     4  
ATOM 5894  O O6     . DG  A 1 1  ? -0.143  -22.257 -9.950  1.00 0.00 ? 69 DG  A O6     4  
ATOM 5895  N N1     . DG  A 1 1  ? 0.478   -21.351 -11.815 1.00 0.00 ? 69 DG  A N1     4  
ATOM 5896  C C2     . DG  A 1 1  ? 1.447   -20.959 -12.686 1.00 0.00 ? 69 DG  A C2     4  
ATOM 5897  N N2     . DG  A 1 1  ? 1.028   -20.615 -13.846 1.00 0.00 ? 69 DG  A N2     4  
ATOM 5898  N N3     . DG  A 1 1  ? 2.766   -21.191 -12.572 1.00 0.00 ? 69 DG  A N3     4  
ATOM 5899  C C4     . DG  A 1 1  ? 3.103   -21.762 -11.401 1.00 0.00 ? 69 DG  A C4     4  
ATOM 5900  H "H5'"  . DG  A 1 1  ? 7.097   -25.567 -12.653 1.00 0.00 ? 69 DG  A "H5'"  4  
ATOM 5901  H "H5''" . DG  A 1 1  ? 8.750   -25.146 -12.310 1.00 0.00 ? 69 DG  A "H5''" 4  
ATOM 5902  H "H4'"  . DG  A 1 1  ? 7.396   -23.270 -13.611 1.00 0.00 ? 69 DG  A "H4'"  4  
ATOM 5903  H "H3'"  . DG  A 1 1  ? 8.874   -22.285 -11.420 1.00 0.00 ? 69 DG  A "H3'"  4  
ATOM 5904  H "H2'"  . DG  A 1 1  ? 6.906   -22.282 -9.968  1.00 0.00 ? 69 DG  A "H2'"  4  
ATOM 5905  H "H2''" . DG  A 1 1  ? 6.967   -20.651 -10.662 1.00 0.00 ? 69 DG  A "H2''" 4  
ATOM 5906  H "H1'"  . DG  A 1 1  ? 5.547   -21.286 -12.451 1.00 0.00 ? 69 DG  A "H1'"  4  
ATOM 5907  H H8     . DG  A 1 1  ? 5.005   -22.918 -9.052  1.00 0.00 ? 69 DG  A H8     4  
ATOM 5908  H H1     . DG  A 1 1  ? -0.479  -21.045 -11.915 1.00 0.00 ? 69 DG  A H1     4  
ATOM 5909  H H21    . DG  A 1 1  ? 1.612   -20.425 -14.647 1.00 0.00 ? 69 DG  A H21    4  
ATOM 5910  H H22    . DG  A 1 1  ? 0.022   -20.588 -13.928 1.00 0.00 ? 69 DG  A H22    4  
ATOM 5911  H "HO5'" . DG  A 1 1  ? 8.184   -24.771 -10.178 1.00 0.00 ? 69 DG  A "HO5'" 4  
ATOM 5912  P P      . DC  A 1 2  ? 9.459   -21.076 -13.726 1.00 0.00 ? 70 DC  A P      4  
ATOM 5913  O OP1    . DC  A 1 2  ? 9.596   -22.386 -14.371 1.00 0.00 ? 70 DC  A OP1    4  
ATOM 5914  O OP2    . DC  A 1 2  ? 10.463  -20.674 -12.715 1.00 0.00 ? 70 DC  A OP2    4  
ATOM 5915  O "O5'"  . DC  A 1 2  ? 9.146   -19.866 -14.604 1.00 0.00 ? 70 DC  A "O5'"  4  
ATOM 5916  C "C5'"  . DC  A 1 2  ? 8.299   -19.887 -15.682 1.00 0.00 ? 70 DC  A "C5'"  4  
ATOM 5917  C "C4'"  . DC  A 1 2  ? 7.140   -18.909 -15.691 1.00 0.00 ? 70 DC  A "C4'"  4  
ATOM 5918  O "O4'"  . DC  A 1 2  ? 6.106   -19.287 -14.735 1.00 0.00 ? 70 DC  A "O4'"  4  
ATOM 5919  C "C3'"  . DC  A 1 2  ? 7.557   -17.401 -15.535 1.00 0.00 ? 70 DC  A "C3'"  4  
ATOM 5920  O "O3'"  . DC  A 1 2  ? 7.250   -16.805 -16.757 1.00 0.00 ? 70 DC  A "O3'"  4  
ATOM 5921  C "C2'"  . DC  A 1 2  ? 6.679   -16.998 -14.374 1.00 0.00 ? 70 DC  A "C2'"  4  
ATOM 5922  C "C1'"  . DC  A 1 2  ? 5.535   -18.020 -14.326 1.00 0.00 ? 70 DC  A "C1'"  4  
ATOM 5923  N N1     . DC  A 1 2  ? 4.997   -18.312 -12.951 1.00 0.00 ? 70 DC  A N1     4  
ATOM 5924  C C2     . DC  A 1 2  ? 3.600   -17.978 -12.850 1.00 0.00 ? 70 DC  A C2     4  
ATOM 5925  O O2     . DC  A 1 2  ? 2.846   -17.829 -13.811 1.00 0.00 ? 70 DC  A O2     4  
ATOM 5926  N N3     . DC  A 1 2  ? 3.000   -17.992 -11.616 1.00 0.00 ? 70 DC  A N3     4  
ATOM 5927  C C4     . DC  A 1 2  ? 3.758   -18.408 -10.604 1.00 0.00 ? 70 DC  A C4     4  
ATOM 5928  N N4     . DC  A 1 2  ? 3.137   -18.316 -9.529  1.00 0.00 ? 70 DC  A N4     4  
ATOM 5929  C C5     . DC  A 1 2  ? 5.163   -18.726 -10.669 1.00 0.00 ? 70 DC  A C5     4  
ATOM 5930  C C6     . DC  A 1 2  ? 5.800   -18.572 -11.870 1.00 0.00 ? 70 DC  A C6     4  
ATOM 5931  H "H5'"  . DC  A 1 2  ? 7.826   -20.867 -15.744 1.00 0.00 ? 70 DC  A "H5'"  4  
ATOM 5932  H "H5''" . DC  A 1 2  ? 8.867   -19.755 -16.602 1.00 0.00 ? 70 DC  A "H5''" 4  
ATOM 5933  H "H4'"  . DC  A 1 2  ? 6.687   -18.995 -16.678 1.00 0.00 ? 70 DC  A "H4'"  4  
ATOM 5934  H "H3'"  . DC  A 1 2  ? 8.598   -17.282 -15.237 1.00 0.00 ? 70 DC  A "H3'"  4  
ATOM 5935  H "H2'"  . DC  A 1 2  ? 7.206   -16.982 -13.420 1.00 0.00 ? 70 DC  A "H2'"  4  
ATOM 5936  H "H2''" . DC  A 1 2  ? 6.163   -16.055 -14.548 1.00 0.00 ? 70 DC  A "H2''" 4  
ATOM 5937  H "H1'"  . DC  A 1 2  ? 4.699   -17.764 -14.976 1.00 0.00 ? 70 DC  A "H1'"  4  
ATOM 5938  H H41    . DC  A 1 2  ? 3.590   -18.620 -8.678  1.00 0.00 ? 70 DC  A H41    4  
ATOM 5939  H H42    . DC  A 1 2  ? 2.398   -17.627 -9.543  1.00 0.00 ? 70 DC  A H42    4  
ATOM 5940  H H5     . DC  A 1 2  ? 5.771   -18.929 -9.800  1.00 0.00 ? 70 DC  A H5     4  
ATOM 5941  H H6     . DC  A 1 2  ? 6.857   -18.712 -12.041 1.00 0.00 ? 70 DC  A H6     4  
ATOM 5942  P P      . DT  A 1 3  ? 7.360   -15.208 -17.019 1.00 0.00 ? 71 DT  A P      4  
ATOM 5943  O OP1    . DT  A 1 3  ? 7.668   -15.000 -18.446 1.00 0.00 ? 71 DT  A OP1    4  
ATOM 5944  O OP2    . DT  A 1 3  ? 8.315   -14.727 -15.976 1.00 0.00 ? 71 DT  A OP2    4  
ATOM 5945  O "O5'"  . DT  A 1 3  ? 5.870   -14.696 -16.743 1.00 0.00 ? 71 DT  A "O5'"  4  
ATOM 5946  C "C5'"  . DT  A 1 3  ? 4.765   -15.422 -17.314 1.00 0.00 ? 71 DT  A "C5'"  4  
ATOM 5947  C "C4'"  . DT  A 1 3  ? 3.437   -14.927 -16.741 1.00 0.00 ? 71 DT  A "C4'"  4  
ATOM 5948  O "O4'"  . DT  A 1 3  ? 3.343   -15.348 -15.403 1.00 0.00 ? 71 DT  A "O4'"  4  
ATOM 5949  C "C3'"  . DT  A 1 3  ? 3.183   -13.402 -16.758 1.00 0.00 ? 71 DT  A "C3'"  4  
ATOM 5950  O "O3'"  . DT  A 1 3  ? 1.992   -12.970 -17.414 1.00 0.00 ? 71 DT  A "O3'"  4  
ATOM 5951  C "C2'"  . DT  A 1 3  ? 3.103   -13.031 -15.296 1.00 0.00 ? 71 DT  A "C2'"  4  
ATOM 5952  C "C1'"  . DT  A 1 3  ? 2.625   -14.367 -14.754 1.00 0.00 ? 71 DT  A "C1'"  4  
ATOM 5953  N N1     . DT  A 1 3  ? 3.069   -14.445 -13.291 1.00 0.00 ? 71 DT  A N1     4  
ATOM 5954  C C2     . DT  A 1 3  ? 2.058   -14.616 -12.298 1.00 0.00 ? 71 DT  A C2     4  
ATOM 5955  O O2     . DT  A 1 3  ? 0.818   -14.605 -12.516 1.00 0.00 ? 71 DT  A O2     4  
ATOM 5956  N N3     . DT  A 1 3  ? 2.495   -14.794 -11.060 1.00 0.00 ? 71 DT  A N3     4  
ATOM 5957  C C4     . DT  A 1 3  ? 3.776   -14.872 -10.615 1.00 0.00 ? 71 DT  A C4     4  
ATOM 5958  O O4     . DT  A 1 3  ? 4.009   -14.921 -9.405  1.00 0.00 ? 71 DT  A O4     4  
ATOM 5959  C C5     . DT  A 1 3  ? 4.753   -14.700 -11.668 1.00 0.00 ? 71 DT  A C5     4  
ATOM 5960  C C7     . DT  A 1 3  ? 6.225   -14.769 -11.280 1.00 0.00 ? 71 DT  A C7     4  
ATOM 5961  C C6     . DT  A 1 3  ? 4.461   -14.500 -12.958 1.00 0.00 ? 71 DT  A C6     4  
ATOM 5962  H "H5'"  . DT  A 1 3  ? 4.922   -16.481 -17.111 1.00 0.00 ? 71 DT  A "H5'"  4  
ATOM 5963  H "H5''" . DT  A 1 3  ? 4.789   -15.271 -18.393 1.00 0.00 ? 71 DT  A "H5''" 4  
ATOM 5964  H "H4'"  . DT  A 1 3  ? 2.659   -15.375 -17.360 1.00 0.00 ? 71 DT  A "H4'"  4  
ATOM 5965  H "H3'"  . DT  A 1 3  ? 4.040   -13.012 -17.307 1.00 0.00 ? 71 DT  A "H3'"  4  
ATOM 5966  H "H2'"  . DT  A 1 3  ? 4.061   -12.798 -14.833 1.00 0.00 ? 71 DT  A "H2'"  4  
ATOM 5967  H "H2''" . DT  A 1 3  ? 2.425   -12.199 -15.103 1.00 0.00 ? 71 DT  A "H2''" 4  
ATOM 5968  H "H1'"  . DT  A 1 3  ? 1.565   -14.437 -15.001 1.00 0.00 ? 71 DT  A "H1'"  4  
ATOM 5969  H H3     . DT  A 1 3  ? 1.931   -14.836 -10.224 1.00 0.00 ? 71 DT  A H3     4  
ATOM 5970  H H71    . DT  A 1 3  ? 6.903   -14.735 -12.134 1.00 0.00 ? 71 DT  A H71    4  
ATOM 5971  H H72    . DT  A 1 3  ? 6.399   -13.940 -10.595 1.00 0.00 ? 71 DT  A H72    4  
ATOM 5972  H H73    . DT  A 1 3  ? 6.427   -15.731 -10.810 1.00 0.00 ? 71 DT  A H73    4  
ATOM 5973  H H6     . DT  A 1 3  ? 5.239   -14.466 -13.706 1.00 0.00 ? 71 DT  A H6     4  
ATOM 5974  P P      . DC  A 1 4  ? 1.683   -11.456 -17.713 1.00 0.00 ? 72 DC  A P      4  
ATOM 5975  O OP1    . DC  A 1 4  ? 0.702   -11.283 -18.810 1.00 0.00 ? 72 DC  A OP1    4  
ATOM 5976  O OP2    . DC  A 1 4  ? 2.941   -10.676 -17.758 1.00 0.00 ? 72 DC  A OP2    4  
ATOM 5977  O "O5'"  . DC  A 1 4  ? 0.925   -11.001 -16.394 1.00 0.00 ? 72 DC  A "O5'"  4  
ATOM 5978  C "C5'"  . DC  A 1 4  ? -0.214  -11.721 -16.090 1.00 0.00 ? 72 DC  A "C5'"  4  
ATOM 5979  C "C4'"  . DC  A 1 4  ? -0.877  -11.360 -14.755 1.00 0.00 ? 72 DC  A "C4'"  4  
ATOM 5980  O "O4'"  . DC  A 1 4  ? -0.169  -11.953 -13.633 1.00 0.00 ? 72 DC  A "O4'"  4  
ATOM 5981  C "C3'"  . DC  A 1 4  ? -1.072  -9.818  -14.506 1.00 0.00 ? 72 DC  A "C3'"  4  
ATOM 5982  O "O3'"  . DC  A 1 4  ? -2.509  -9.686  -14.327 1.00 0.00 ? 72 DC  A "O3'"  4  
ATOM 5983  C "C2'"  . DC  A 1 4  ? -0.349  -9.584  -13.141 1.00 0.00 ? 72 DC  A "C2'"  4  
ATOM 5984  C "C1'"  . DC  A 1 4  ? -0.201  -10.987 -12.569 1.00 0.00 ? 72 DC  A "C1'"  4  
ATOM 5985  N N1     . DC  A 1 4  ? 1.012   -11.086 -11.704 1.00 0.00 ? 72 DC  A N1     4  
ATOM 5986  C C2     . DC  A 1 4  ? 0.894   -11.350 -10.351 1.00 0.00 ? 72 DC  A C2     4  
ATOM 5987  O O2     . DC  A 1 4  ? -0.218  -11.626 -9.821  1.00 0.00 ? 72 DC  A O2     4  
ATOM 5988  N N3     . DC  A 1 4  ? 2.025   -11.609 -9.644  1.00 0.00 ? 72 DC  A N3     4  
ATOM 5989  C C4     . DC  A 1 4  ? 3.173   -11.481 -10.263 1.00 0.00 ? 72 DC  A C4     4  
ATOM 5990  N N4     . DC  A 1 4  ? 4.233   -11.828 -9.521  1.00 0.00 ? 72 DC  A N4     4  
ATOM 5991  C C5     . DC  A 1 4  ? 3.296   -11.072 -11.667 1.00 0.00 ? 72 DC  A C5     4  
ATOM 5992  C C6     . DC  A 1 4  ? 2.184   -10.914 -12.359 1.00 0.00 ? 72 DC  A C6     4  
ATOM 5993  H "H5'"  . DC  A 1 4  ? 0.105   -12.757 -15.988 1.00 0.00 ? 72 DC  A "H5'"  4  
ATOM 5994  H "H5''" . DC  A 1 4  ? -0.984  -11.637 -16.857 1.00 0.00 ? 72 DC  A "H5''" 4  
ATOM 5995  H "H4'"  . DC  A 1 4  ? -1.913  -11.694 -14.814 1.00 0.00 ? 72 DC  A "H4'"  4  
ATOM 5996  H "H3'"  . DC  A 1 4  ? -0.688  -9.217  -15.331 1.00 0.00 ? 72 DC  A "H3'"  4  
ATOM 5997  H "H2'"  . DC  A 1 4  ? 0.557   -8.997  -13.295 1.00 0.00 ? 72 DC  A "H2'"  4  
ATOM 5998  H "H2''" . DC  A 1 4  ? -0.871  -8.915  -12.458 1.00 0.00 ? 72 DC  A "H2''" 4  
ATOM 5999  H "H1'"  . DC  A 1 4  ? -1.120  -11.169 -12.010 1.00 0.00 ? 72 DC  A "H1'"  4  
ATOM 6000  H H41    . DC  A 1 4  ? 5.154   -11.663 -9.903  1.00 0.00 ? 72 DC  A H41    4  
ATOM 6001  H H42    . DC  A 1 4  ? 4.079   -12.408 -8.709  1.00 0.00 ? 72 DC  A H42    4  
ATOM 6002  H H5     . DC  A 1 4  ? 4.252   -10.839 -12.112 1.00 0.00 ? 72 DC  A H5     4  
ATOM 6003  H H6     . DC  A 1 4  ? 2.260   -10.734 -13.421 1.00 0.00 ? 72 DC  A H6     4  
ATOM 6004  P P      . DT  A 1 5  ? -3.206  -8.191  -14.301 1.00 0.00 ? 73 DT  A P      4  
ATOM 6005  O OP1    . DT  A 1 5  ? -4.587  -8.468  -14.868 1.00 0.00 ? 73 DT  A OP1    4  
ATOM 6006  O OP2    . DT  A 1 5  ? -2.285  -7.227  -14.974 1.00 0.00 ? 73 DT  A OP2    4  
ATOM 6007  O "O5'"  . DT  A 1 5  ? -3.292  -7.785  -12.782 1.00 0.00 ? 73 DT  A "O5'"  4  
ATOM 6008  C "C5'"  . DT  A 1 5  ? -3.968  -8.569  -11.768 1.00 0.00 ? 73 DT  A "C5'"  4  
ATOM 6009  C "C4'"  . DT  A 1 5  ? -3.712  -8.009  -10.309 1.00 0.00 ? 73 DT  A "C4'"  4  
ATOM 6010  O "O4'"  . DT  A 1 5  ? -2.428  -8.264  -9.896  1.00 0.00 ? 73 DT  A "O4'"  4  
ATOM 6011  C "C3'"  . DT  A 1 5  ? -3.826  -6.520  -10.249 1.00 0.00 ? 73 DT  A "C3'"  4  
ATOM 6012  O "O3'"  . DT  A 1 5  ? -4.681  -6.230  -9.073  1.00 0.00 ? 73 DT  A "O3'"  4  
ATOM 6013  C "C2'"  . DT  A 1 5  ? -2.443  -6.035  -10.240 1.00 0.00 ? 73 DT  A "C2'"  4  
ATOM 6014  C "C1'"  . DT  A 1 5  ? -1.919  -7.112  -9.290  1.00 0.00 ? 73 DT  A "C1'"  4  
ATOM 6015  N N1     . DT  A 1 5  ? -0.493  -7.460  -9.208  1.00 0.00 ? 73 DT  A N1     4  
ATOM 6016  C C2     . DT  A 1 5  ? -0.013  -8.269  -8.105  1.00 0.00 ? 73 DT  A C2     4  
ATOM 6017  O O2     . DT  A 1 5  ? -0.747  -8.608  -7.200  1.00 0.00 ? 73 DT  A O2     4  
ATOM 6018  N N3     . DT  A 1 5  ? 1.315   -8.674  -8.206  1.00 0.00 ? 73 DT  A N3     4  
ATOM 6019  C C4     . DT  A 1 5  ? 2.218   -8.308  -9.224  1.00 0.00 ? 73 DT  A C4     4  
ATOM 6020  O O4     . DT  A 1 5  ? 3.373   -8.721  -9.178  1.00 0.00 ? 73 DT  A O4     4  
ATOM 6021  C C5     . DT  A 1 5  ? 1.627   -7.435  -10.228 1.00 0.00 ? 73 DT  A C5     4  
ATOM 6022  C C7     . DT  A 1 5  ? 2.513   -7.054  -11.456 1.00 0.00 ? 73 DT  A C7     4  
ATOM 6023  C C6     . DT  A 1 5  ? 0.372   -7.070  -10.187 1.00 0.00 ? 73 DT  A C6     4  
ATOM 6024  H "H5'"  . DT  A 1 5  ? -3.382  -9.484  -11.854 1.00 0.00 ? 73 DT  A "H5'"  4  
ATOM 6025  H "H5''" . DT  A 1 5  ? -5.002  -8.866  -11.940 1.00 0.00 ? 73 DT  A "H5''" 4  
ATOM 6026  H "H4'"  . DT  A 1 5  ? -4.334  -8.525  -9.577  1.00 0.00 ? 73 DT  A "H4'"  4  
ATOM 6027  H "H3'"  . DT  A 1 5  ? -4.294  -6.139  -11.156 1.00 0.00 ? 73 DT  A "H3'"  4  
ATOM 6028  H "H2'"  . DT  A 1 5  ? -2.005  -6.205  -11.224 1.00 0.00 ? 73 DT  A "H2'"  4  
ATOM 6029  H "H2''" . DT  A 1 5  ? -2.311  -5.052  -9.789  1.00 0.00 ? 73 DT  A "H2''" 4  
ATOM 6030  H "H1'"  . DT  A 1 5  ? -2.367  -7.094  -8.296  1.00 0.00 ? 73 DT  A "H1'"  4  
ATOM 6031  H H3     . DT  A 1 5  ? 1.778   -9.247  -7.514  1.00 0.00 ? 73 DT  A H3     4  
ATOM 6032  H H71    . DT  A 1 5  ? 2.846   -8.007  -11.866 1.00 0.00 ? 73 DT  A H71    4  
ATOM 6033  H H72    . DT  A 1 5  ? 1.991   -6.397  -12.152 1.00 0.00 ? 73 DT  A H72    4  
ATOM 6034  H H73    . DT  A 1 5  ? 3.395   -6.530  -11.087 1.00 0.00 ? 73 DT  A H73    4  
ATOM 6035  H H6     . DT  A 1 5  ? 0.066   -6.400  -10.976 1.00 0.00 ? 73 DT  A H6     4  
ATOM 6036  P P      . DA  A 1 6  ? -5.338  -4.841  -8.659  1.00 0.00 ? 74 DA  A P      4  
ATOM 6037  O OP1    . DA  A 1 6  ? -6.802  -5.061  -8.400  1.00 0.00 ? 74 DA  A OP1    4  
ATOM 6038  O OP2    . DA  A 1 6  ? -4.948  -3.747  -9.608  1.00 0.00 ? 74 DA  A OP2    4  
ATOM 6039  O "O5'"  . DA  A 1 6  ? -4.572  -4.622  -7.302  1.00 0.00 ? 74 DA  A "O5'"  4  
ATOM 6040  C "C5'"  . DA  A 1 6  ? -4.793  -5.556  -6.234  1.00 0.00 ? 74 DA  A "C5'"  4  
ATOM 6041  C "C4'"  . DA  A 1 6  ? -3.648  -5.513  -5.251  1.00 0.00 ? 74 DA  A "C4'"  4  
ATOM 6042  O "O4'"  . DA  A 1 6  ? -2.410  -5.694  -5.797  1.00 0.00 ? 74 DA  A "O4'"  4  
ATOM 6043  C "C3'"  . DA  A 1 6  ? -3.563  -4.166  -4.502  1.00 0.00 ? 74 DA  A "C3'"  4  
ATOM 6044  O "O3'"  . DA  A 1 6  ? -3.110  -4.325  -3.179  1.00 0.00 ? 74 DA  A "O3'"  4  
ATOM 6045  C "C2'"  . DA  A 1 6  ? -2.408  -3.446  -5.273  1.00 0.00 ? 74 DA  A "C2'"  4  
ATOM 6046  C "C1'"  . DA  A 1 6  ? -1.492  -4.730  -5.388  1.00 0.00 ? 74 DA  A "C1'"  4  
ATOM 6047  N N9     . DA  A 1 6  ? -0.337  -4.723  -6.352  1.00 0.00 ? 74 DA  A N9     4  
ATOM 6048  C C8     . DA  A 1 6  ? -0.265  -4.133  -7.588  1.00 0.00 ? 74 DA  A C8     4  
ATOM 6049  N N7     . DA  A 1 6  ? 0.850   -4.284  -8.196  1.00 0.00 ? 74 DA  A N7     4  
ATOM 6050  C C5     . DA  A 1 6  ? 1.657   -5.065  -7.280  1.00 0.00 ? 74 DA  A C5     4  
ATOM 6051  C C6     . DA  A 1 6  ? 2.915   -5.630  -7.200  1.00 0.00 ? 74 DA  A C6     4  
ATOM 6052  N N6     . DA  A 1 6  ? 3.790   -5.547  -8.201  1.00 0.00 ? 74 DA  A N6     4  
ATOM 6053  N N1     . DA  A 1 6  ? 3.365   -6.278  -6.124  1.00 0.00 ? 74 DA  A N1     4  
ATOM 6054  C C2     . DA  A 1 6  ? 2.574   -6.290  -5.076  1.00 0.00 ? 74 DA  A C2     4  
ATOM 6055  N N3     . DA  A 1 6  ? 1.356   -5.851  -4.953  1.00 0.00 ? 74 DA  A N3     4  
ATOM 6056  C C4     . DA  A 1 6  ? 0.922   -5.275  -6.114  1.00 0.00 ? 74 DA  A C4     4  
ATOM 6057  H "H5'"  . DA  A 1 6  ? -4.845  -6.582  -6.600  1.00 0.00 ? 74 DA  A "H5'"  4  
ATOM 6058  H "H5''" . DA  A 1 6  ? -5.723  -5.302  -5.725  1.00 0.00 ? 74 DA  A "H5''" 4  
ATOM 6059  H "H4'"  . DA  A 1 6  ? -3.852  -6.265  -4.489  1.00 0.00 ? 74 DA  A "H4'"  4  
ATOM 6060  H "H3'"  . DA  A 1 6  ? -4.412  -3.486  -4.573  1.00 0.00 ? 74 DA  A "H3'"  4  
ATOM 6061  H "H2'"  . DA  A 1 6  ? -2.762  -3.113  -6.248  1.00 0.00 ? 74 DA  A "H2'"  4  
ATOM 6062  H "H2''" . DA  A 1 6  ? -2.014  -2.641  -4.651  1.00 0.00 ? 74 DA  A "H2''" 4  
ATOM 6063  H "H1'"  . DA  A 1 6  ? -1.131  -5.039  -4.407  1.00 0.00 ? 74 DA  A "H1'"  4  
ATOM 6064  H H8     . DA  A 1 6  ? -1.094  -3.625  -8.061  1.00 0.00 ? 74 DA  A H8     4  
ATOM 6065  H H61    . DA  A 1 6  ? 4.693   -5.968  -8.034  1.00 0.00 ? 74 DA  A H61    4  
ATOM 6066  H H62    . DA  A 1 6  ? 3.683   -4.931  -8.993  1.00 0.00 ? 74 DA  A H62    4  
ATOM 6067  H H2     . DA  A 1 6  ? 2.929   -6.906  -4.263  1.00 0.00 ? 74 DA  A H2     4  
ATOM 6068  P P      . DA  A 1 7  ? -4.155  -4.672  -2.029  1.00 0.00 ? 75 DA  A P      4  
ATOM 6069  O OP1    . DA  A 1 7  ? -4.636  -6.053  -2.099  1.00 0.00 ? 75 DA  A OP1    4  
ATOM 6070  O OP2    . DA  A 1 7  ? -5.131  -3.577  -2.089  1.00 0.00 ? 75 DA  A OP2    4  
ATOM 6071  O "O5'"  . DA  A 1 7  ? -3.336  -4.599  -0.585  1.00 0.00 ? 75 DA  A "O5'"  4  
ATOM 6072  C "C5'"  . DA  A 1 7  ? -2.473  -5.690  -0.275  1.00 0.00 ? 75 DA  A "C5'"  4  
ATOM 6073  C "C4'"  . DA  A 1 7  ? -0.978  -5.268  -0.067  1.00 0.00 ? 75 DA  A "C4'"  4  
ATOM 6074  O "O4'"  . DA  A 1 7  ? -0.413  -4.843  -1.247  1.00 0.00 ? 75 DA  A "O4'"  4  
ATOM 6075  C "C3'"  . DA  A 1 7  ? -0.570  -4.218  0.997   1.00 0.00 ? 75 DA  A "C3'"  4  
ATOM 6076  O "O3'"  . DA  A 1 7  ? -0.085  -4.781  2.148   1.00 0.00 ? 75 DA  A "O3'"  4  
ATOM 6077  C "C2'"  . DA  A 1 7  ? 0.643   -3.545  0.262   1.00 0.00 ? 75 DA  A "C2'"  4  
ATOM 6078  C "C1'"  . DA  A 1 7  ? 0.789   -4.252  -1.011  1.00 0.00 ? 75 DA  A "C1'"  4  
ATOM 6079  N N9     . DA  A 1 7  ? 1.188   -3.390  -2.127  1.00 0.00 ? 75 DA  A N9     4  
ATOM 6080  C C8     . DA  A 1 7  ? 0.302   -2.685  -2.929  1.00 0.00 ? 75 DA  A C8     4  
ATOM 6081  N N7     . DA  A 1 7  ? 0.775   -2.363  -4.105  1.00 0.00 ? 75 DA  A N7     4  
ATOM 6082  C C5     . DA  A 1 7  ? 2.106   -2.857  -4.034  1.00 0.00 ? 75 DA  A C5     4  
ATOM 6083  C C6     . DA  A 1 7  ? 3.269   -2.850  -4.885  1.00 0.00 ? 75 DA  A C6     4  
ATOM 6084  N N6     . DA  A 1 7  ? 3.307   -2.369  -6.081  1.00 0.00 ? 75 DA  A N6     4  
ATOM 6085  N N1     . DA  A 1 7  ? 4.428   -3.450  -4.491  1.00 0.00 ? 75 DA  A N1     4  
ATOM 6086  C C2     . DA  A 1 7  ? 4.514   -4.064  -3.335  1.00 0.00 ? 75 DA  A C2     4  
ATOM 6087  N N3     . DA  A 1 7  ? 3.521   -4.143  -2.446  1.00 0.00 ? 75 DA  A N3     4  
ATOM 6088  C C4     . DA  A 1 7  ? 2.375   -3.474  -2.833  1.00 0.00 ? 75 DA  A C4     4  
ATOM 6089  H "H5'"  . DA  A 1 7  ? -2.588  -6.429  -1.068  1.00 0.00 ? 75 DA  A "H5'"  4  
ATOM 6090  H "H5''" . DA  A 1 7  ? -2.799  -6.169  0.648   1.00 0.00 ? 75 DA  A "H5''" 4  
ATOM 6091  H "H4'"  . DA  A 1 7  ? -0.396  -6.127  0.266   1.00 0.00 ? 75 DA  A "H4'"  4  
ATOM 6092  H "H3'"  . DA  A 1 7  ? -1.390  -3.517  1.157   1.00 0.00 ? 75 DA  A "H3'"  4  
ATOM 6093  H "H2'"  . DA  A 1 7  ? 0.483   -2.478  0.106   1.00 0.00 ? 75 DA  A "H2'"  4  
ATOM 6094  H "H2''" . DA  A 1 7  ? 1.584   -3.669  0.799   1.00 0.00 ? 75 DA  A "H2''" 4  
ATOM 6095  H "H1'"  . DA  A 1 7  ? 1.551   -4.996  -0.780  1.00 0.00 ? 75 DA  A "H1'"  4  
ATOM 6096  H H8     . DA  A 1 7  ? -0.713  -2.531  -2.594  1.00 0.00 ? 75 DA  A H8     4  
ATOM 6097  H H61    . DA  A 1 7  ? 4.028   -2.632  -6.738  1.00 0.00 ? 75 DA  A H61    4  
ATOM 6098  H H62    . DA  A 1 7  ? 2.492   -1.916  -6.468  1.00 0.00 ? 75 DA  A H62    4  
ATOM 6099  H H2     . DA  A 1 7  ? 5.457   -4.557  -3.147  1.00 0.00 ? 75 DA  A H2     4  
ATOM 6100  P P      . DT  A 1 8  ? 0.529   -4.003  3.358   1.00 0.00 ? 76 DT  A P      4  
ATOM 6101  O OP1    . DT  A 1 8  ? 0.386   -4.901  4.574   1.00 0.00 ? 76 DT  A OP1    4  
ATOM 6102  O OP2    . DT  A 1 8  ? -0.109  -2.690  3.359   1.00 0.00 ? 76 DT  A OP2    4  
ATOM 6103  O "O5'"  . DT  A 1 8  ? 2.090   -3.732  3.151   1.00 0.00 ? 76 DT  A "O5'"  4  
ATOM 6104  C "C5'"  . DT  A 1 8  ? 2.960   -4.778  3.044   1.00 0.00 ? 76 DT  A "C5'"  4  
ATOM 6105  C "C4'"  . DT  A 1 8  ? 4.309   -4.280  2.534   1.00 0.00 ? 76 DT  A "C4'"  4  
ATOM 6106  O "O4'"  . DT  A 1 8  ? 4.222   -3.709  1.231   1.00 0.00 ? 76 DT  A "O4'"  4  
ATOM 6107  C "C3'"  . DT  A 1 8  ? 4.898   -3.276  3.463   1.00 0.00 ? 76 DT  A "C3'"  4  
ATOM 6108  O "O3'"  . DT  A 1 8  ? 6.291   -3.466  3.837   1.00 0.00 ? 76 DT  A "O3'"  4  
ATOM 6109  C "C2'"  . DT  A 1 8  ? 4.902   -1.981  2.604   1.00 0.00 ? 76 DT  A "C2'"  4  
ATOM 6110  C "C1'"  . DT  A 1 8  ? 5.034   -2.589  1.199   1.00 0.00 ? 76 DT  A "C1'"  4  
ATOM 6111  N N1     . DT  A 1 8  ? 4.618   -1.660  0.088   1.00 0.00 ? 76 DT  A N1     4  
ATOM 6112  C C2     . DT  A 1 8  ? 5.474   -1.492  -1.013  1.00 0.00 ? 76 DT  A C2     4  
ATOM 6113  O O2     . DT  A 1 8  ? 6.540   -2.180  -1.251  1.00 0.00 ? 76 DT  A O2     4  
ATOM 6114  N N3     . DT  A 1 8  ? 5.108   -0.619  -2.006  1.00 0.00 ? 76 DT  A N3     4  
ATOM 6115  C C4     . DT  A 1 8  ? 3.834   -0.113  -2.182  1.00 0.00 ? 76 DT  A C4     4  
ATOM 6116  O O4     . DT  A 1 8  ? 3.559   0.448   -3.216  1.00 0.00 ? 76 DT  A O4     4  
ATOM 6117  C C5     . DT  A 1 8  ? 2.955   -0.387  -1.011  1.00 0.00 ? 76 DT  A C5     4  
ATOM 6118  C C7     . DT  A 1 8  ? 1.590   0.231   -0.909  1.00 0.00 ? 76 DT  A C7     4  
ATOM 6119  C C6     . DT  A 1 8  ? 3.335   -1.194  0.016   1.00 0.00 ? 76 DT  A C6     4  
ATOM 6120  H "H5'"  . DT  A 1 8  ? 2.620   -5.565  2.372   1.00 0.00 ? 76 DT  A "H5'"  4  
ATOM 6121  H "H5''" . DT  A 1 8  ? 3.041   -5.333  3.979   1.00 0.00 ? 76 DT  A "H5''" 4  
ATOM 6122  H "H4'"  . DT  A 1 8  ? 5.000   -5.118  2.433   1.00 0.00 ? 76 DT  A "H4'"  4  
ATOM 6123  H "H3'"  . DT  A 1 8  ? 4.285   -3.212  4.362   1.00 0.00 ? 76 DT  A "H3'"  4  
ATOM 6124  H "H2'"  . DT  A 1 8  ? 3.945   -1.464  2.674   1.00 0.00 ? 76 DT  A "H2'"  4  
ATOM 6125  H "H2''" . DT  A 1 8  ? 5.670   -1.229  2.786   1.00 0.00 ? 76 DT  A "H2''" 4  
ATOM 6126  H "H1'"  . DT  A 1 8  ? 6.057   -2.967  1.199   1.00 0.00 ? 76 DT  A "H1'"  4  
ATOM 6127  H H3     . DT  A 1 8  ? 5.721   -0.559  -2.806  1.00 0.00 ? 76 DT  A H3     4  
ATOM 6128  H H71    . DT  A 1 8  ? 1.009   -0.137  -0.064  1.00 0.00 ? 76 DT  A H71    4  
ATOM 6129  H H72    . DT  A 1 8  ? 1.623   1.315   -0.801  1.00 0.00 ? 76 DT  A H72    4  
ATOM 6130  H H73    . DT  A 1 8  ? 1.073   -0.022  -1.836  1.00 0.00 ? 76 DT  A H73    4  
ATOM 6131  H H6     . DT  A 1 8  ? 2.633   -1.392  0.811   1.00 0.00 ? 76 DT  A H6     4  
ATOM 6132  P P      . DC  A 1 9  ? 7.007   -2.656  4.984   1.00 0.00 ? 77 DC  A P      4  
ATOM 6133  O OP1    . DC  A 1 9  ? 7.773   -3.517  5.843   1.00 0.00 ? 77 DC  A OP1    4  
ATOM 6134  O OP2    . DC  A 1 9  ? 5.957   -1.825  5.633   1.00 0.00 ? 77 DC  A OP2    4  
ATOM 6135  O "O5'"  . DC  A 1 9  ? 8.040   -1.662  4.197   1.00 0.00 ? 77 DC  A "O5'"  4  
ATOM 6136  C "C5'"  . DC  A 1 9  ? 9.122   -2.024  3.395   1.00 0.00 ? 77 DC  A "C5'"  4  
ATOM 6137  C "C4'"  . DC  A 1 9  ? 9.773   -1.075  2.442   1.00 0.00 ? 77 DC  A "C4'"  4  
ATOM 6138  O "O4'"  . DC  A 1 9  ? 8.849   -0.655  1.416   1.00 0.00 ? 77 DC  A "O4'"  4  
ATOM 6139  C "C3'"  . DC  A 1 9  ? 10.306  0.214   3.136   1.00 0.00 ? 77 DC  A "C3'"  4  
ATOM 6140  O "O3'"  . DC  A 1 9  ? 11.632  0.404   2.688   1.00 0.00 ? 77 DC  A "O3'"  4  
ATOM 6141  C "C2'"  . DC  A 1 9  ? 9.314   1.255   2.605   1.00 0.00 ? 77 DC  A "C2'"  4  
ATOM 6142  C "C1'"  . DC  A 1 9  ? 8.967   0.764   1.211   1.00 0.00 ? 77 DC  A "C1'"  4  
ATOM 6143  N N1     . DC  A 1 9  ? 7.673   1.295   0.677   1.00 0.00 ? 77 DC  A N1     4  
ATOM 6144  C C2     . DC  A 1 9  ? 7.587   1.747   -0.687  1.00 0.00 ? 77 DC  A C2     4  
ATOM 6145  O O2     . DC  A 1 9  ? 8.519   1.628   -1.532  1.00 0.00 ? 77 DC  A O2     4  
ATOM 6146  N N3     . DC  A 1 9  ? 6.500   2.324   -1.153  1.00 0.00 ? 77 DC  A N3     4  
ATOM 6147  C C4     . DC  A 1 9  ? 5.419   2.322   -0.379  1.00 0.00 ? 77 DC  A C4     4  
ATOM 6148  N N4     . DC  A 1 9  ? 4.416   2.801   -1.025  1.00 0.00 ? 77 DC  A N4     4  
ATOM 6149  C C5     . DC  A 1 9  ? 5.485   1.915   0.965   1.00 0.00 ? 77 DC  A C5     4  
ATOM 6150  C C6     . DC  A 1 9  ? 6.594   1.405   1.477   1.00 0.00 ? 77 DC  A C6     4  
ATOM 6151  H "H5'"  . DC  A 1 9  ? 8.883   -2.936  2.846   1.00 0.00 ? 77 DC  A "H5'"  4  
ATOM 6152  H "H5''" . DC  A 1 9  ? 9.921   -2.408  4.030   1.00 0.00 ? 77 DC  A "H5''" 4  
ATOM 6153  H "H4'"  . DC  A 1 9  ? 10.635  -1.578  2.002   1.00 0.00 ? 77 DC  A "H4'"  4  
ATOM 6154  H "H3'"  . DC  A 1 9  ? 10.280  0.135   4.223   1.00 0.00 ? 77 DC  A "H3'"  4  
ATOM 6155  H "H2'"  . DC  A 1 9  ? 8.449   1.201   3.266   1.00 0.00 ? 77 DC  A "H2'"  4  
ATOM 6156  H "H2''" . DC  A 1 9  ? 9.750   2.253   2.678   1.00 0.00 ? 77 DC  A "H2''" 4  
ATOM 6157  H "H1'"  . DC  A 1 9  ? 9.681   1.025   0.430   1.00 0.00 ? 77 DC  A "H1'"  4  
ATOM 6158  H H41    . DC  A 1 9  ? 3.569   2.982   -0.505  1.00 0.00 ? 77 DC  A H41    4  
ATOM 6159  H H42    . DC  A 1 9  ? 4.501   3.067   -1.995  1.00 0.00 ? 77 DC  A H42    4  
ATOM 6160  H H5     . DC  A 1 9  ? 4.629   2.050   1.611   1.00 0.00 ? 77 DC  A H5     4  
ATOM 6161  H H6     . DC  A 1 9  ? 6.658   1.020   2.484   1.00 0.00 ? 77 DC  A H6     4  
ATOM 6162  P P      . DC  A 1 10 ? 12.640  1.609   3.057   1.00 0.00 ? 78 DC  A P      4  
ATOM 6163  O OP1    . DC  A 1 10 ? 13.987  1.135   3.343   1.00 0.00 ? 78 DC  A OP1    4  
ATOM 6164  O OP2    . DC  A 1 10 ? 11.984  2.418   4.082   1.00 0.00 ? 78 DC  A OP2    4  
ATOM 6165  O "O5'"  . DC  A 1 10 ? 12.645  2.543   1.767   1.00 0.00 ? 78 DC  A "O5'"  4  
ATOM 6166  C "C5'"  . DC  A 1 10 ? 13.310  2.078   0.574   1.00 0.00 ? 78 DC  A "C5'"  4  
ATOM 6167  C "C4'"  . DC  A 1 10 ? 12.922  2.973   -0.611  1.00 0.00 ? 78 DC  A "C4'"  4  
ATOM 6168  O "O4'"  . DC  A 1 10 ? 11.524  3.053   -0.873  1.00 0.00 ? 78 DC  A "O4'"  4  
ATOM 6169  C "C3'"  . DC  A 1 10 ? 13.540  4.364   -0.320  1.00 0.00 ? 78 DC  A "C3'"  4  
ATOM 6170  O "O3'"  . DC  A 1 10 ? 14.534  4.592   -1.330  1.00 0.00 ? 78 DC  A "O3'"  4  
ATOM 6171  C "C2'"  . DC  A 1 10 ? 12.292  5.255   -0.570  1.00 0.00 ? 78 DC  A "C2'"  4  
ATOM 6172  C "C1'"  . DC  A 1 10 ? 11.221  4.382   -1.205  1.00 0.00 ? 78 DC  A "C1'"  4  
ATOM 6173  N N1     . DC  A 1 10 ? 9.822   4.691   -0.686  1.00 0.00 ? 78 DC  A N1     4  
ATOM 6174  C C2     . DC  A 1 10 ? 8.819   5.069   -1.623  1.00 0.00 ? 78 DC  A C2     4  
ATOM 6175  O O2     . DC  A 1 10 ? 9.064   5.194   -2.825  1.00 0.00 ? 78 DC  A O2     4  
ATOM 6176  N N3     . DC  A 1 10 ? 7.622   5.435   -1.232  1.00 0.00 ? 78 DC  A N3     4  
ATOM 6177  C C4     . DC  A 1 10 ? 7.226   5.315   0.056   1.00 0.00 ? 78 DC  A C4     4  
ATOM 6178  N N4     . DC  A 1 10 ? 5.954   5.686   0.341   1.00 0.00 ? 78 DC  A N4     4  
ATOM 6179  C C5     . DC  A 1 10 ? 8.166   4.856   0.992   1.00 0.00 ? 78 DC  A C5     4  
ATOM 6180  C C6     . DC  A 1 10 ? 9.431   4.485   0.642   1.00 0.00 ? 78 DC  A C6     4  
ATOM 6181  H "H5'"  . DC  A 1 10 ? 13.120  1.042   0.293   1.00 0.00 ? 78 DC  A "H5'"  4  
ATOM 6182  H "H5''" . DC  A 1 10 ? 14.379  2.221   0.729   1.00 0.00 ? 78 DC  A "H5''" 4  
ATOM 6183  H "H4'"  . DC  A 1 10 ? 13.350  2.531   -1.511  1.00 0.00 ? 78 DC  A "H4'"  4  
ATOM 6184  H "H3'"  . DC  A 1 10 ? 13.856  4.507   0.713   1.00 0.00 ? 78 DC  A "H3'"  4  
ATOM 6185  H "H2'"  . DC  A 1 10 ? 11.907  5.511   0.417   1.00 0.00 ? 78 DC  A "H2'"  4  
ATOM 6186  H "H2''" . DC  A 1 10 ? 12.585  6.160   -1.101  1.00 0.00 ? 78 DC  A "H2''" 4  
ATOM 6187  H "H1'"  . DC  A 1 10 ? 11.188  4.589   -2.275  1.00 0.00 ? 78 DC  A "H1'"  4  
ATOM 6188  H H41    . DC  A 1 10 ? 5.683   5.838   1.302   1.00 0.00 ? 78 DC  A H41    4  
ATOM 6189  H H42    . DC  A 1 10 ? 5.425   5.797   -0.512  1.00 0.00 ? 78 DC  A H42    4  
ATOM 6190  H H5     . DC  A 1 10 ? 7.979   4.742   2.050   1.00 0.00 ? 78 DC  A H5     4  
ATOM 6191  H H6     . DC  A 1 10 ? 10.118  4.113   1.389   1.00 0.00 ? 78 DC  A H6     4  
ATOM 6192  P P      . DC  A 1 11 ? 15.435  5.930   -1.536  1.00 0.00 ? 79 DC  A P      4  
ATOM 6193  O OP1    . DC  A 1 11 ? 16.599  5.584   -2.331  1.00 0.00 ? 79 DC  A OP1    4  
ATOM 6194  O OP2    . DC  A 1 11 ? 15.667  6.526   -0.183  1.00 0.00 ? 79 DC  A OP2    4  
ATOM 6195  O "O5'"  . DC  A 1 11 ? 14.512  6.870   -2.380  1.00 0.00 ? 79 DC  A "O5'"  4  
ATOM 6196  C "C5'"  . DC  A 1 11 ? 14.080  6.612   -3.707  1.00 0.00 ? 79 DC  A "C5'"  4  
ATOM 6197  C "C4'"  . DC  A 1 11 ? 13.073  7.659   -4.176  1.00 0.00 ? 79 DC  A "C4'"  4  
ATOM 6198  O "O4'"  . DC  A 1 11 ? 11.716  7.407   -3.610  1.00 0.00 ? 79 DC  A "O4'"  4  
ATOM 6199  C "C3'"  . DC  A 1 11 ? 13.473  9.083   -3.692  1.00 0.00 ? 79 DC  A "C3'"  4  
ATOM 6200  O "O3'"  . DC  A 1 11 ? 13.675  9.799   -4.836  1.00 0.00 ? 79 DC  A "O3'"  4  
ATOM 6201  C "C2'"  . DC  A 1 11 ? 12.263  9.597   -2.927  1.00 0.00 ? 79 DC  A "C2'"  4  
ATOM 6202  C "C1'"  . DC  A 1 11 ? 11.147  8.721   -3.460  1.00 0.00 ? 79 DC  A "C1'"  4  
ATOM 6203  N N1     . DC  A 1 11 ? 10.017  8.683   -2.475  1.00 0.00 ? 79 DC  A N1     4  
ATOM 6204  C C2     . DC  A 1 11 ? 8.796   9.190   -2.868  1.00 0.00 ? 79 DC  A C2     4  
ATOM 6205  O O2     . DC  A 1 11 ? 8.624   9.609   -3.980  1.00 0.00 ? 79 DC  A O2     4  
ATOM 6206  N N3     . DC  A 1 11 ? 7.760   9.228   -2.020  1.00 0.00 ? 79 DC  A N3     4  
ATOM 6207  C C4     . DC  A 1 11 ? 7.917   8.763   -0.834  1.00 0.00 ? 79 DC  A C4     4  
ATOM 6208  N N4     . DC  A 1 11 ? 6.844   8.792   -0.084  1.00 0.00 ? 79 DC  A N4     4  
ATOM 6209  C C5     . DC  A 1 11 ? 9.166   8.193   -0.399  1.00 0.00 ? 79 DC  A C5     4  
ATOM 6210  C C6     . DC  A 1 11 ? 10.234  8.177   -1.211  1.00 0.00 ? 79 DC  A C6     4  
ATOM 6211  H "H5'"  . DC  A 1 11 ? 13.498  5.692   -3.752  1.00 0.00 ? 79 DC  A "H5'"  4  
ATOM 6212  H "H5''" . DC  A 1 11 ? 14.904  6.580   -4.419  1.00 0.00 ? 79 DC  A "H5''" 4  
ATOM 6213  H "H4'"  . DC  A 1 11 ? 13.113  7.564   -5.261  1.00 0.00 ? 79 DC  A "H4'"  4  
ATOM 6214  H "H3'"  . DC  A 1 11 ? 14.344  9.213   -3.051  1.00 0.00 ? 79 DC  A "H3'"  4  
ATOM 6215  H "H2'"  . DC  A 1 11 ? 12.418  9.403   -1.866  1.00 0.00 ? 79 DC  A "H2'"  4  
ATOM 6216  H "H2''" . DC  A 1 11 ? 12.022  10.655  -3.025  1.00 0.00 ? 79 DC  A "H2''" 4  
ATOM 6217  H "H1'"  . DC  A 1 11 ? 10.926  9.110   -4.454  1.00 0.00 ? 79 DC  A "H1'"  4  
ATOM 6218  H H41    . DC  A 1 11 ? 6.983   8.283   0.777   1.00 0.00 ? 79 DC  A H41    4  
ATOM 6219  H H42    . DC  A 1 11 ? 5.915   9.051   -0.384  1.00 0.00 ? 79 DC  A H42    4  
ATOM 6220  H H5     . DC  A 1 11 ? 9.289   7.712   0.561   1.00 0.00 ? 79 DC  A H5     4  
ATOM 6221  H H6     . DC  A 1 11 ? 11.122  7.636   -0.916  1.00 0.00 ? 79 DC  A H6     4  
ATOM 6222  P P      . DC  A 1 12 ? 14.181  11.329  -4.907  1.00 0.00 ? 80 DC  A P      4  
ATOM 6223  O OP1    . DC  A 1 12 ? 15.254  11.337  -5.975  1.00 0.00 ? 80 DC  A OP1    4  
ATOM 6224  O OP2    . DC  A 1 12 ? 14.546  11.848  -3.577  1.00 0.00 ? 80 DC  A OP2    4  
ATOM 6225  O "O5'"  . DC  A 1 12 ? 12.933  12.197  -5.393  1.00 0.00 ? 80 DC  A "O5'"  4  
ATOM 6226  C "C5'"  . DC  A 1 12 ? 12.262  11.828  -6.636  1.00 0.00 ? 80 DC  A "C5'"  4  
ATOM 6227  C "C4'"  . DC  A 1 12 ? 10.982  12.692  -7.020  1.00 0.00 ? 80 DC  A "C4'"  4  
ATOM 6228  O "O4'"  . DC  A 1 12 ? 9.933   12.314  -6.174  1.00 0.00 ? 80 DC  A "O4'"  4  
ATOM 6229  C "C3'"  . DC  A 1 12 ? 11.315  14.189  -6.814  1.00 0.00 ? 80 DC  A "C3'"  4  
ATOM 6230  O "O3'"  . DC  A 1 12 ? 10.738  14.776  -7.943  1.00 0.00 ? 80 DC  A "O3'"  4  
ATOM 6231  C "C2'"  . DC  A 1 12 ? 10.667  14.515  -5.479  1.00 0.00 ? 80 DC  A "C2'"  4  
ATOM 6232  C "C1'"  . DC  A 1 12 ? 9.598   13.424  -5.310  1.00 0.00 ? 80 DC  A "C1'"  4  
ATOM 6233  N N1     . DC  A 1 12 ? 9.367   12.990  -3.920  1.00 0.00 ? 80 DC  A N1     4  
ATOM 6234  C C2     . DC  A 1 12 ? 8.125   13.096  -3.310  1.00 0.00 ? 80 DC  A C2     4  
ATOM 6235  O O2     . DC  A 1 12 ? 7.105   13.465  -3.889  1.00 0.00 ? 80 DC  A O2     4  
ATOM 6236  N N3     . DC  A 1 12 ? 7.908   12.730  -2.016  1.00 0.00 ? 80 DC  A N3     4  
ATOM 6237  C C4     . DC  A 1 12 ? 8.943   12.359  -1.257  1.00 0.00 ? 80 DC  A C4     4  
ATOM 6238  N N4     . DC  A 1 12 ? 8.696   12.144  0.033   1.00 0.00 ? 80 DC  A N4     4  
ATOM 6239  C C5     . DC  A 1 12 ? 10.253  12.368  -1.802  1.00 0.00 ? 80 DC  A C5     4  
ATOM 6240  C C6     . DC  A 1 12 ? 10.440  12.677  -3.084  1.00 0.00 ? 80 DC  A C6     4  
ATOM 6241  H "H5'"  . DC  A 1 12 ? 12.000  10.771  -6.682  1.00 0.00 ? 80 DC  A "H5'"  4  
ATOM 6242  H "H5''" . DC  A 1 12 ? 12.996  11.974  -7.428  1.00 0.00 ? 80 DC  A "H5''" 4  
ATOM 6243  H "H4'"  . DC  A 1 12 ? 10.877  12.365  -8.056  1.00 0.00 ? 80 DC  A "H4'"  4  
ATOM 6244  H "H3'"  . DC  A 1 12 ? 12.386  14.391  -6.797  1.00 0.00 ? 80 DC  A "H3'"  4  
ATOM 6245  H "H2'"  . DC  A 1 12 ? 11.411  14.466  -4.682  1.00 0.00 ? 80 DC  A "H2'"  4  
ATOM 6246  H "H2''" . DC  A 1 12 ? 10.287  15.527  -5.337  1.00 0.00 ? 80 DC  A "H2''" 4  
ATOM 6247  H "H1'"  . DC  A 1 12 ? 8.773   14.006  -5.722  1.00 0.00 ? 80 DC  A "H1'"  4  
ATOM 6248  H H41    . DC  A 1 12 ? 9.436   11.833  0.646   1.00 0.00 ? 80 DC  A H41    4  
ATOM 6249  H H42    . DC  A 1 12 ? 7.780   12.339  0.412   1.00 0.00 ? 80 DC  A H42    4  
ATOM 6250  H H5     . DC  A 1 12 ? 11.077  12.115  -1.151  1.00 0.00 ? 80 DC  A H5     4  
ATOM 6251  H H6     . DC  A 1 12 ? 11.445  12.683  -3.477  1.00 0.00 ? 80 DC  A H6     4  
ATOM 6252  P P      . DG  A 1 13 ? 10.975  16.241  -8.300  1.00 0.00 ? 81 DG  A P      4  
ATOM 6253  O OP1    . DG  A 1 13 ? 10.636  16.369  -9.735  1.00 0.00 ? 81 DG  A OP1    4  
ATOM 6254  O OP2    . DG  A 1 13 ? 12.312  16.582  -7.765  1.00 0.00 ? 81 DG  A OP2    4  
ATOM 6255  O "O5'"  . DG  A 1 13 ? 9.928   17.031  -7.497  1.00 0.00 ? 81 DG  A "O5'"  4  
ATOM 6256  C "C5'"  . DG  A 1 13 ? 8.609   17.029  -7.956  1.00 0.00 ? 81 DG  A "C5'"  4  
ATOM 6257  C "C4'"  . DG  A 1 13 ? 7.813   17.548  -6.768  1.00 0.00 ? 81 DG  A "C4'"  4  
ATOM 6258  O "O4'"  . DG  A 1 13 ? 7.718   16.624  -5.683  1.00 0.00 ? 81 DG  A "O4'"  4  
ATOM 6259  C "C3'"  . DG  A 1 13 ? 8.311   18.940  -6.283  1.00 0.00 ? 81 DG  A "C3'"  4  
ATOM 6260  O "O3'"  . DG  A 1 13 ? 7.141   19.818  -5.990  1.00 0.00 ? 81 DG  A "O3'"  4  
ATOM 6261  C "C2'"  . DG  A 1 13 ? 9.043   18.492  -4.961  1.00 0.00 ? 81 DG  A "C2'"  4  
ATOM 6262  C "C1'"  . DG  A 1 13 ? 7.989   17.444  -4.573  1.00 0.00 ? 81 DG  A "C1'"  4  
ATOM 6263  N N9     . DG  A 1 13 ? 8.301   16.786  -3.303  1.00 0.00 ? 81 DG  A N9     4  
ATOM 6264  C C8     . DG  A 1 13 ? 9.475   16.668  -2.695  1.00 0.00 ? 81 DG  A C8     4  
ATOM 6265  N N7     . DG  A 1 13 ? 9.492   16.193  -1.448  1.00 0.00 ? 81 DG  A N7     4  
ATOM 6266  C C5     . DG  A 1 13 ? 8.155   16.136  -1.178  1.00 0.00 ? 81 DG  A C5     4  
ATOM 6267  C C6     . DG  A 1 13 ? 7.457   15.528  -0.054  1.00 0.00 ? 81 DG  A C6     4  
ATOM 6268  O O6     . DG  A 1 13 ? 7.940   15.075  0.998   1.00 0.00 ? 81 DG  A O6     4  
ATOM 6269  N N1     . DG  A 1 13 ? 6.105   15.480  -0.279  1.00 0.00 ? 81 DG  A N1     4  
ATOM 6270  C C2     . DG  A 1 13 ? 5.485   15.872  -1.344  1.00 0.00 ? 81 DG  A C2     4  
ATOM 6271  N N2     . DG  A 1 13 ? 4.165   15.907  -1.274  1.00 0.00 ? 81 DG  A N2     4  
ATOM 6272  N N3     . DG  A 1 13 ? 6.048   16.426  -2.445  1.00 0.00 ? 81 DG  A N3     4  
ATOM 6273  C C4     . DG  A 1 13 ? 7.416   16.479  -2.274  1.00 0.00 ? 81 DG  A C4     4  
ATOM 6274  H "H5'"  . DG  A 1 13 ? 8.263   16.050  -8.288  1.00 0.00 ? 81 DG  A "H5'"  4  
ATOM 6275  H "H5''" . DG  A 1 13 ? 8.432   17.682  -8.810  1.00 0.00 ? 81 DG  A "H5''" 4  
ATOM 6276  H "H4'"  . DG  A 1 13 ? 6.847   17.764  -7.225  1.00 0.00 ? 81 DG  A "H4'"  4  
ATOM 6277  H "H3'"  . DG  A 1 13 ? 9.096   19.403  -6.882  1.00 0.00 ? 81 DG  A "H3'"  4  
ATOM 6278  H "HO3'" . DG  A 1 13 ? 7.426   20.734  -5.959  1.00 0.00 ? 81 DG  A "HO3'" 4  
ATOM 6279  H "H2'"  . DG  A 1 13 ? 10.006  18.018  -5.149  1.00 0.00 ? 81 DG  A "H2'"  4  
ATOM 6280  H "H2''" . DG  A 1 13 ? 9.074   19.324  -4.258  1.00 0.00 ? 81 DG  A "H2''" 4  
ATOM 6281  H "H1'"  . DG  A 1 13 ? 7.027   17.948  -4.466  1.00 0.00 ? 81 DG  A "H1'"  4  
ATOM 6282  H H8     . DG  A 1 13 ? 10.396  16.705  -3.258  1.00 0.00 ? 81 DG  A H8     4  
ATOM 6283  H H1     . DG  A 1 13 ? 5.490   15.205  0.475   1.00 0.00 ? 81 DG  A H1     4  
ATOM 6284  H H21    . DG  A 1 13 ? 3.650   16.084  -2.125  1.00 0.00 ? 81 DG  A H21    4  
ATOM 6285  H H22    . DG  A 1 13 ? 3.771   16.062  -0.357  1.00 0.00 ? 81 DG  A H22    4  
ATOM 6286  O "O5'"  . DC  B 2 1  ? -0.633  15.058  6.977   1.00 0.00 ? 82 DC  B "O5'"  4  
ATOM 6287  C "C5'"  . DC  B 2 1  ? -1.386  15.546  5.892   1.00 0.00 ? 82 DC  B "C5'"  4  
ATOM 6288  C "C4'"  . DC  B 2 1  ? -0.899  14.995  4.565   1.00 0.00 ? 82 DC  B "C4'"  4  
ATOM 6289  O "O4'"  . DC  B 2 1  ? 0.364   15.456  4.296   1.00 0.00 ? 82 DC  B "O4'"  4  
ATOM 6290  C "C3'"  . DC  B 2 1  ? -0.891  13.470  4.332   1.00 0.00 ? 82 DC  B "C3'"  4  
ATOM 6291  O "O3'"  . DC  B 2 1  ? -2.158  12.998  3.908   1.00 0.00 ? 82 DC  B "O3'"  4  
ATOM 6292  C "C2'"  . DC  B 2 1  ? 0.207   13.323  3.325   1.00 0.00 ? 82 DC  B "C2'"  4  
ATOM 6293  C "C1'"  . DC  B 2 1  ? 0.948   14.656  3.302   1.00 0.00 ? 82 DC  B "C1'"  4  
ATOM 6294  N N1     . DC  B 2 1  ? 2.416   14.693  3.378   1.00 0.00 ? 82 DC  B N1     4  
ATOM 6295  C C2     . DC  B 2 1  ? 3.211   15.035  2.306   1.00 0.00 ? 82 DC  B C2     4  
ATOM 6296  O O2     . DC  B 2 1  ? 2.796   15.418  1.244   1.00 0.00 ? 82 DC  B O2     4  
ATOM 6297  N N3     . DC  B 2 1  ? 4.550   14.953  2.452   1.00 0.00 ? 82 DC  B N3     4  
ATOM 6298  C C4     . DC  B 2 1  ? 5.090   14.414  3.548   1.00 0.00 ? 82 DC  B C4     4  
ATOM 6299  N N4     . DC  B 2 1  ? 6.395   14.328  3.428   1.00 0.00 ? 82 DC  B N4     4  
ATOM 6300  C C5     . DC  B 2 1  ? 4.353   14.110  4.671   1.00 0.00 ? 82 DC  B C5     4  
ATOM 6301  C C6     . DC  B 2 1  ? 2.982   14.311  4.524   1.00 0.00 ? 82 DC  B C6     4  
ATOM 6302  H "H5'"  . DC  B 2 1  ? -1.328  16.635  5.914   1.00 0.00 ? 82 DC  B "H5'"  4  
ATOM 6303  H "H5''" . DC  B 2 1  ? -2.449  15.347  6.023   1.00 0.00 ? 82 DC  B "H5''" 4  
ATOM 6304  H "H4'"  . DC  B 2 1  ? -1.561  15.398  3.799   1.00 0.00 ? 82 DC  B "H4'"  4  
ATOM 6305  H "H3'"  . DC  B 2 1  ? -0.614  12.917  5.229   1.00 0.00 ? 82 DC  B "H3'"  4  
ATOM 6306  H "H2'"  . DC  B 2 1  ? 0.831   12.530  3.737   1.00 0.00 ? 82 DC  B "H2'"  4  
ATOM 6307  H "H2''" . DC  B 2 1  ? -0.198  13.146  2.328   1.00 0.00 ? 82 DC  B "H2''" 4  
ATOM 6308  H "H1'"  . DC  B 2 1  ? 0.777   15.037  2.295   1.00 0.00 ? 82 DC  B "H1'"  4  
ATOM 6309  H H41    . DC  B 2 1  ? 6.933   14.363  4.283   1.00 0.00 ? 82 DC  B H41    4  
ATOM 6310  H H42    . DC  B 2 1  ? 6.817   14.563  2.541   1.00 0.00 ? 82 DC  B H42    4  
ATOM 6311  H H5     . DC  B 2 1  ? 4.827   13.857  5.608   1.00 0.00 ? 82 DC  B H5     4  
ATOM 6312  H H6     . DC  B 2 1  ? 2.328   14.078  5.352   1.00 0.00 ? 82 DC  B H6     4  
ATOM 6313  H "HO5'" . DC  B 2 1  ? 0.292   14.973  6.740   1.00 0.00 ? 82 DC  B "HO5'" 4  
ATOM 6314  P P      . DG  B 2 2  ? -2.468  11.487  3.592   1.00 0.00 ? 83 DG  B P      4  
ATOM 6315  O OP1    . DG  B 2 2  ? -3.955  11.215  3.606   1.00 0.00 ? 83 DG  B OP1    4  
ATOM 6316  O OP2    . DG  B 2 2  ? -1.561  10.625  4.278   1.00 0.00 ? 83 DG  B OP2    4  
ATOM 6317  O "O5'"  . DG  B 2 2  ? -2.065  11.309  2.028   1.00 0.00 ? 83 DG  B "O5'"  4  
ATOM 6318  C "C5'"  . DG  B 2 2  ? -2.742  12.085  1.040   1.00 0.00 ? 83 DG  B "C5'"  4  
ATOM 6319  C "C4'"  . DG  B 2 2  ? -2.276  11.907  -0.412  1.00 0.00 ? 83 DG  B "C4'"  4  
ATOM 6320  O "O4'"  . DG  B 2 2  ? -1.008  12.563  -0.488  1.00 0.00 ? 83 DG  B "O4'"  4  
ATOM 6321  C "C3'"  . DG  B 2 2  ? -2.126  10.454  -0.910  1.00 0.00 ? 83 DG  B "C3'"  4  
ATOM 6322  O "O3'"  . DG  B 2 2  ? -2.207  10.235  -2.339  1.00 0.00 ? 83 DG  B "O3'"  4  
ATOM 6323  C "C2'"  . DG  B 2 2  ? -0.662  10.155  -0.465  1.00 0.00 ? 83 DG  B "C2'"  4  
ATOM 6324  C "C1'"  . DG  B 2 2  ? -0.037  11.574  -0.818  1.00 0.00 ? 83 DG  B "C1'"  4  
ATOM 6325  N N9     . DG  B 2 2  ? 1.283   11.761  -0.146  1.00 0.00 ? 83 DG  B N9     4  
ATOM 6326  C C8     . DG  B 2 2  ? 1.562   11.428  1.156   1.00 0.00 ? 83 DG  B C8     4  
ATOM 6327  N N7     . DG  B 2 2  ? 2.754   11.659  1.544   1.00 0.00 ? 83 DG  B N7     4  
ATOM 6328  C C5     . DG  B 2 2  ? 3.350   12.103  0.375   1.00 0.00 ? 83 DG  B C5     4  
ATOM 6329  C C6     . DG  B 2 2  ? 4.781   12.249  0.025   1.00 0.00 ? 83 DG  B C6     4  
ATOM 6330  O O6     . DG  B 2 2  ? 5.724   12.092  0.822   1.00 0.00 ? 83 DG  B O6     4  
ATOM 6331  N N1     . DG  B 2 2  ? 5.011   12.676  -1.293  1.00 0.00 ? 83 DG  B N1     4  
ATOM 6332  C C2     . DG  B 2 2  ? 4.006   12.892  -2.200  1.00 0.00 ? 83 DG  B C2     4  
ATOM 6333  N N2     . DG  B 2 2  ? 4.358   13.330  -3.368  1.00 0.00 ? 83 DG  B N2     4  
ATOM 6334  N N3     . DG  B 2 2  ? 2.734   12.631  -1.944  1.00 0.00 ? 83 DG  B N3     4  
ATOM 6335  C C4     . DG  B 2 2  ? 2.489   12.239  -0.646  1.00 0.00 ? 83 DG  B C4     4  
ATOM 6336  H "H5'"  . DG  B 2 2  ? -2.601  13.128  1.326   1.00 0.00 ? 83 DG  B "H5'"  4  
ATOM 6337  H "H5''" . DG  B 2 2  ? -3.811  11.884  0.967   1.00 0.00 ? 83 DG  B "H5''" 4  
ATOM 6338  H "H4'"  . DG  B 2 2  ? -2.963  12.433  -1.073  1.00 0.00 ? 83 DG  B "H4'"  4  
ATOM 6339  H "H3'"  . DG  B 2 2  ? -2.776  9.828   -0.298  1.00 0.00 ? 83 DG  B "H3'"  4  
ATOM 6340  H "H2'"  . DG  B 2 2  ? -0.555  9.821   0.567   1.00 0.00 ? 83 DG  B "H2'"  4  
ATOM 6341  H "H2''" . DG  B 2 2  ? -0.322  9.274   -1.010  1.00 0.00 ? 83 DG  B "H2''" 4  
ATOM 6342  H "H1'"  . DG  B 2 2  ? 0.151   11.702  -1.883  1.00 0.00 ? 83 DG  B "H1'"  4  
ATOM 6343  H H8     . DG  B 2 2  ? 0.710   11.034  1.690   1.00 0.00 ? 83 DG  B H8     4  
ATOM 6344  H H1     . DG  B 2 2  ? 5.966   12.778  -1.608  1.00 0.00 ? 83 DG  B H1     4  
ATOM 6345  H H21    . DG  B 2 2  ? 3.601   13.385  -4.035  1.00 0.00 ? 83 DG  B H21    4  
ATOM 6346  H H22    . DG  B 2 2  ? 5.312   13.492  -3.654  1.00 0.00 ? 83 DG  B H22    4  
ATOM 6347  P P      . DG  B 2 3  ? -3.545  10.333  -3.219  1.00 0.00 ? 84 DG  B P      4  
ATOM 6348  O OP1    . DG  B 2 3  ? -4.279  11.563  -3.021  1.00 0.00 ? 84 DG  B OP1    4  
ATOM 6349  O OP2    . DG  B 2 3  ? -4.257  9.047   -3.225  1.00 0.00 ? 84 DG  B OP2    4  
ATOM 6350  O "O5'"  . DG  B 2 3  ? -2.764  10.519  -4.588  1.00 0.00 ? 84 DG  B "O5'"  4  
ATOM 6351  C "C5'"  . DG  B 2 3  ? -2.075  11.729  -4.922  1.00 0.00 ? 84 DG  B "C5'"  4  
ATOM 6352  C "C4'"  . DG  B 2 3  ? -1.110  11.638  -6.141  1.00 0.00 ? 84 DG  B "C4'"  4  
ATOM 6353  O "O4'"  . DG  B 2 3  ? 0.238   11.379  -5.800  1.00 0.00 ? 84 DG  B "O4'"  4  
ATOM 6354  C "C3'"  . DG  B 2 3  ? -1.421  10.388  -7.001  1.00 0.00 ? 84 DG  B "C3'"  4  
ATOM 6355  O "O3'"  . DG  B 2 3  ? -1.070  10.767  -8.383  1.00 0.00 ? 84 DG  B "O3'"  4  
ATOM 6356  C "C2'"  . DG  B 2 3  ? -0.551  9.330   -6.398  1.00 0.00 ? 84 DG  B "C2'"  4  
ATOM 6357  C "C1'"  . DG  B 2 3  ? 0.670   10.053  -5.993  1.00 0.00 ? 84 DG  B "C1'"  4  
ATOM 6358  N N9     . DG  B 2 3  ? 1.300   9.579   -4.727  1.00 0.00 ? 84 DG  B N9     4  
ATOM 6359  C C8     . DG  B 2 3  ? 0.711   9.107   -3.573  1.00 0.00 ? 84 DG  B C8     4  
ATOM 6360  N N7     . DG  B 2 3  ? 1.516   8.859   -2.557  1.00 0.00 ? 84 DG  B N7     4  
ATOM 6361  C C5     . DG  B 2 3  ? 2.744   9.275   -3.022  1.00 0.00 ? 84 DG  B C5     4  
ATOM 6362  C C6     . DG  B 2 3  ? 4.024   9.387   -2.358  1.00 0.00 ? 84 DG  B C6     4  
ATOM 6363  O O6     . DG  B 2 3  ? 4.353   9.220   -1.205  1.00 0.00 ? 84 DG  B O6     4  
ATOM 6364  N N1     . DG  B 2 3  ? 5.037   9.790   -3.185  1.00 0.00 ? 84 DG  B N1     4  
ATOM 6365  C C2     . DG  B 2 3  ? 4.862   10.080  -4.473  1.00 0.00 ? 84 DG  B C2     4  
ATOM 6366  N N2     . DG  B 2 3  ? 6.037   10.210  -5.081  1.00 0.00 ? 84 DG  B N2     4  
ATOM 6367  N N3     . DG  B 2 3  ? 3.749   10.145  -5.114  1.00 0.00 ? 84 DG  B N3     4  
ATOM 6368  C C4     . DG  B 2 3  ? 2.667   9.694   -4.336  1.00 0.00 ? 84 DG  B C4     4  
ATOM 6369  H "H5'"  . DG  B 2 3  ? -1.567  12.073  -4.021  1.00 0.00 ? 84 DG  B "H5'"  4  
ATOM 6370  H "H5''" . DG  B 2 3  ? -2.770  12.540  -5.136  1.00 0.00 ? 84 DG  B "H5''" 4  
ATOM 6371  H "H4'"  . DG  B 2 3  ? -1.286  12.543  -6.723  1.00 0.00 ? 84 DG  B "H4'"  4  
ATOM 6372  H "H3'"  . DG  B 2 3  ? -2.498  10.249  -6.911  1.00 0.00 ? 84 DG  B "H3'"  4  
ATOM 6373  H "H2'"  . DG  B 2 3  ? -1.029  8.896   -5.518  1.00 0.00 ? 84 DG  B "H2'"  4  
ATOM 6374  H "H2''" . DG  B 2 3  ? -0.455  8.510   -7.108  1.00 0.00 ? 84 DG  B "H2''" 4  
ATOM 6375  H "H1'"  . DG  B 2 3  ? 1.409   10.065  -6.794  1.00 0.00 ? 84 DG  B "H1'"  4  
ATOM 6376  H H8     . DG  B 2 3  ? -0.368  9.091   -3.551  1.00 0.00 ? 84 DG  B H8     4  
ATOM 6377  H H1     . DG  B 2 3  ? 5.966   9.700   -2.798  1.00 0.00 ? 84 DG  B H1     4  
ATOM 6378  H H21    . DG  B 2 3  ? 6.048   10.318  -6.085  1.00 0.00 ? 84 DG  B H21    4  
ATOM 6379  H H22    . DG  B 2 3  ? 6.857   10.118  -4.498  1.00 0.00 ? 84 DG  B H22    4  
ATOM 6380  P P      . DG  B 2 4  ? -1.124  9.770   -9.594  1.00 0.00 ? 85 DG  B P      4  
ATOM 6381  O OP1    . DG  B 2 4  ? -0.991  10.554  -10.832 1.00 0.00 ? 85 DG  B OP1    4  
ATOM 6382  O OP2    . DG  B 2 4  ? -2.288  8.917   -9.497  1.00 0.00 ? 85 DG  B OP2    4  
ATOM 6383  O "O5'"  . DG  B 2 4  ? 0.232   8.888   -9.584  1.00 0.00 ? 85 DG  B "O5'"  4  
ATOM 6384  C "C5'"  . DG  B 2 4  ? 1.499   9.548   -9.651  1.00 0.00 ? 85 DG  B "C5'"  4  
ATOM 6385  C "C4'"  . DG  B 2 4  ? 2.662   8.618   -9.418  1.00 0.00 ? 85 DG  B "C4'"  4  
ATOM 6386  O "O4'"  . DG  B 2 4  ? 2.893   8.504   -8.048  1.00 0.00 ? 85 DG  B "O4'"  4  
ATOM 6387  C "C3'"  . DG  B 2 4  ? 2.445   7.132   -9.882  1.00 0.00 ? 85 DG  B "C3'"  4  
ATOM 6388  O "O3'"  . DG  B 2 4  ? 3.647   6.696   -10.464 1.00 0.00 ? 85 DG  B "O3'"  4  
ATOM 6389  C "C2'"  . DG  B 2 4  ? 2.274   6.314   -8.617  1.00 0.00 ? 85 DG  B "C2'"  4  
ATOM 6390  C "C1'"  . DG  B 2 4  ? 3.148   7.138   -7.707  1.00 0.00 ? 85 DG  B "C1'"  4  
ATOM 6391  N N9     . DG  B 2 4  ? 3.120   6.870   -6.253  1.00 0.00 ? 85 DG  B N9     4  
ATOM 6392  C C8     . DG  B 2 4  ? 2.055   6.494   -5.525  1.00 0.00 ? 85 DG  B C8     4  
ATOM 6393  N N7     . DG  B 2 4  ? 2.250   6.366   -4.230  1.00 0.00 ? 85 DG  B N7     4  
ATOM 6394  C C5     . DG  B 2 4  ? 3.688   6.476   -4.199  1.00 0.00 ? 85 DG  B C5     4  
ATOM 6395  C C6     . DG  B 2 4  ? 4.661   6.267   -3.107  1.00 0.00 ? 85 DG  B C6     4  
ATOM 6396  O O6     . DG  B 2 4  ? 4.315   5.885   -1.948  1.00 0.00 ? 85 DG  B O6     4  
ATOM 6397  N N1     . DG  B 2 4  ? 6.002   6.429   -3.508  1.00 0.00 ? 85 DG  B N1     4  
ATOM 6398  C C2     . DG  B 2 4  ? 6.339   6.654   -4.788  1.00 0.00 ? 85 DG  B C2     4  
ATOM 6399  N N2     . DG  B 2 4  ? 7.605   6.349   -5.073  1.00 0.00 ? 85 DG  B N2     4  
ATOM 6400  N N3     . DG  B 2 4  ? 5.481   6.743   -5.819  1.00 0.00 ? 85 DG  B N3     4  
ATOM 6401  C C4     . DG  B 2 4  ? 4.209   6.712   -5.458  1.00 0.00 ? 85 DG  B C4     4  
ATOM 6402  H "H5'"  . DG  B 2 4  ? 1.568   10.404  -8.981  1.00 0.00 ? 85 DG  B "H5'"  4  
ATOM 6403  H "H5''" . DG  B 2 4  ? 1.635   9.942   -10.658 1.00 0.00 ? 85 DG  B "H5''" 4  
ATOM 6404  H "H4'"  . DG  B 2 4  ? 3.547   9.046   -9.888  1.00 0.00 ? 85 DG  B "H4'"  4  
ATOM 6405  H "H3'"  . DG  B 2 4  ? 1.583   7.085   -10.547 1.00 0.00 ? 85 DG  B "H3'"  4  
ATOM 6406  H "H2'"  . DG  B 2 4  ? 1.262   6.396   -8.221  1.00 0.00 ? 85 DG  B "H2'"  4  
ATOM 6407  H "H2''" . DG  B 2 4  ? 2.660   5.295   -8.651  1.00 0.00 ? 85 DG  B "H2''" 4  
ATOM 6408  H "H1'"  . DG  B 2 4  ? 4.173   6.975   -8.041  1.00 0.00 ? 85 DG  B "H1'"  4  
ATOM 6409  H H8     . DG  B 2 4  ? 1.085   6.350   -5.978  1.00 0.00 ? 85 DG  B H8     4  
ATOM 6410  H H1     . DG  B 2 4  ? 6.623   5.865   -2.947  1.00 0.00 ? 85 DG  B H1     4  
ATOM 6411  H H21    . DG  B 2 4  ? 7.976   6.587   -5.983  1.00 0.00 ? 85 DG  B H21    4  
ATOM 6412  H H22    . DG  B 2 4  ? 8.257   6.159   -4.326  1.00 0.00 ? 85 DG  B H22    4  
ATOM 6413  P P      . DG  B 2 5  ? 3.719   5.544   -11.492 1.00 0.00 ? 86 DG  B P      4  
ATOM 6414  O OP1    . DG  B 2 5  ? 3.814   6.178   -12.842 1.00 0.00 ? 86 DG  B OP1    4  
ATOM 6415  O OP2    . DG  B 2 5  ? 2.799   4.369   -11.292 1.00 0.00 ? 86 DG  B OP2    4  
ATOM 6416  O "O5'"  . DG  B 2 5  ? 5.116   5.035   -10.950 1.00 0.00 ? 86 DG  B "O5'"  4  
ATOM 6417  C "C5'"  . DG  B 2 5  ? 6.360   5.558   -11.431 1.00 0.00 ? 86 DG  B "C5'"  4  
ATOM 6418  C "C4'"  . DG  B 2 5  ? 7.634   4.747   -11.115 1.00 0.00 ? 86 DG  B "C4'"  4  
ATOM 6419  O "O4'"  . DG  B 2 5  ? 7.838   4.562   -9.675  1.00 0.00 ? 86 DG  B "O4'"  4  
ATOM 6420  C "C3'"  . DG  B 2 5  ? 7.457   3.329   -11.618 1.00 0.00 ? 86 DG  B "C3'"  4  
ATOM 6421  O "O3'"  . DG  B 2 5  ? 8.755   2.932   -11.975 1.00 0.00 ? 86 DG  B "O3'"  4  
ATOM 6422  C "C2'"  . DG  B 2 5  ? 6.828   2.551   -10.536 1.00 0.00 ? 86 DG  B "C2'"  4  
ATOM 6423  C "C1'"  . DG  B 2 5  ? 7.372   3.269   -9.247  1.00 0.00 ? 86 DG  B "C1'"  4  
ATOM 6424  N N9     . DG  B 2 5  ? 6.329   3.467   -8.148  1.00 0.00 ? 86 DG  B N9     4  
ATOM 6425  C C8     . DG  B 2 5  ? 4.958   3.603   -8.304  1.00 0.00 ? 86 DG  B C8     4  
ATOM 6426  N N7     . DG  B 2 5  ? 4.347   3.512   -7.182  1.00 0.00 ? 86 DG  B N7     4  
ATOM 6427  C C5     . DG  B 2 5  ? 5.319   3.358   -6.266  1.00 0.00 ? 86 DG  B C5     4  
ATOM 6428  C C6     . DG  B 2 5  ? 5.221   3.201   -4.806  1.00 0.00 ? 86 DG  B C6     4  
ATOM 6429  O O6     . DG  B 2 5  ? 4.242   3.343   -4.028  1.00 0.00 ? 86 DG  B O6     4  
ATOM 6430  N N1     . DG  B 2 5  ? 6.429   2.854   -4.198  1.00 0.00 ? 86 DG  B N1     4  
ATOM 6431  C C2     . DG  B 2 5  ? 7.660   2.781   -4.867  1.00 0.00 ? 86 DG  B C2     4  
ATOM 6432  N N2     . DG  B 2 5  ? 8.724   2.500   -4.202  1.00 0.00 ? 86 DG  B N2     4  
ATOM 6433  N N3     . DG  B 2 5  ? 7.770   2.938   -6.174  1.00 0.00 ? 86 DG  B N3     4  
ATOM 6434  C C4     . DG  B 2 5  ? 6.583   3.221   -6.830  1.00 0.00 ? 86 DG  B C4     4  
ATOM 6435  H "H5'"  . DG  B 2 5  ? 6.541   6.510   -10.932 1.00 0.00 ? 86 DG  B "H5'"  4  
ATOM 6436  H "H5''" . DG  B 2 5  ? 6.297   5.713   -12.509 1.00 0.00 ? 86 DG  B "H5''" 4  
ATOM 6437  H "H4'"  . DG  B 2 5  ? 8.495   5.260   -11.543 1.00 0.00 ? 86 DG  B "H4'"  4  
ATOM 6438  H "H3'"  . DG  B 2 5  ? 6.748   3.167   -12.430 1.00 0.00 ? 86 DG  B "H3'"  4  
ATOM 6439  H "H2'"  . DG  B 2 5  ? 5.741   2.490   -10.589 1.00 0.00 ? 86 DG  B "H2'"  4  
ATOM 6440  H "H2''" . DG  B 2 5  ? 7.076   1.491   -10.605 1.00 0.00 ? 86 DG  B "H2''" 4  
ATOM 6441  H "H1'"  . DG  B 2 5  ? 8.225   2.717   -8.854  1.00 0.00 ? 86 DG  B "H1'"  4  
ATOM 6442  H H8     . DG  B 2 5  ? 4.443   3.655   -9.254  1.00 0.00 ? 86 DG  B H8     4  
ATOM 6443  H H1     . DG  B 2 5  ? 6.409   2.710   -3.198  1.00 0.00 ? 86 DG  B H1     4  
ATOM 6444  H H21    . DG  B 2 5  ? 9.660   2.520   -4.582  1.00 0.00 ? 86 DG  B H21    4  
ATOM 6445  H H22    . DG  B 2 5  ? 8.670   2.059   -3.294  1.00 0.00 ? 86 DG  B H22    4  
ATOM 6446  P P      . DA  B 2 6  ? 9.148   1.583   -12.695 1.00 0.00 ? 87 DA  B P      4  
ATOM 6447  O OP1    . DA  B 2 6  ? 10.122  1.971   -13.739 1.00 0.00 ? 87 DA  B OP1    4  
ATOM 6448  O OP2    . DA  B 2 6  ? 7.902   0.859   -13.083 1.00 0.00 ? 87 DA  B OP2    4  
ATOM 6449  O "O5'"  . DA  B 2 6  ? 9.919   0.635   -11.661 1.00 0.00 ? 87 DA  B "O5'"  4  
ATOM 6450  C "C5'"  . DA  B 2 6  ? 11.044  1.085   -10.865 1.00 0.00 ? 87 DA  B "C5'"  4  
ATOM 6451  C "C4'"  . DA  B 2 6  ? 11.632  0.132   -9.783  1.00 0.00 ? 87 DA  B "C4'"  4  
ATOM 6452  O "O4'"  . DA  B 2 6  ? 10.916  0.143   -8.529  1.00 0.00 ? 87 DA  B "O4'"  4  
ATOM 6453  C "C3'"  . DA  B 2 6  ? 11.644  -1.296  -10.247 1.00 0.00 ? 87 DA  B "C3'"  4  
ATOM 6454  O "O3'"  . DA  B 2 6  ? 12.767  -2.025  -9.782  1.00 0.00 ? 87 DA  B "O3'"  4  
ATOM 6455  C "C2'"  . DA  B 2 6  ? 10.296  -1.729  -9.748  1.00 0.00 ? 87 DA  B "C2'"  4  
ATOM 6456  C "C1'"  . DA  B 2 6  ? 10.113  -1.087  -8.424  1.00 0.00 ? 87 DA  B "C1'"  4  
ATOM 6457  N N9     . DA  B 2 6  ? 8.713   -0.755  -8.073  1.00 0.00 ? 87 DA  B N9     4  
ATOM 6458  C C8     . DA  B 2 6  ? 7.708   -0.437  -8.905  1.00 0.00 ? 87 DA  B C8     4  
ATOM 6459  N N7     . DA  B 2 6  ? 6.555   -0.185  -8.314  1.00 0.00 ? 87 DA  B N7     4  
ATOM 6460  C C5     . DA  B 2 6  ? 6.917   -0.296  -6.966  1.00 0.00 ? 87 DA  B C5     4  
ATOM 6461  C C6     . DA  B 2 6  ? 6.242   -0.200  -5.756  1.00 0.00 ? 87 DA  B C6     4  
ATOM 6462  N N6     . DA  B 2 6  ? 5.001   0.278   -5.717  1.00 0.00 ? 87 DA  B N6     4  
ATOM 6463  N N1     . DA  B 2 6  ? 6.750   -0.569  -4.627  1.00 0.00 ? 87 DA  B N1     4  
ATOM 6464  C C2     . DA  B 2 6  ? 8.050   -0.980  -4.611  1.00 0.00 ? 87 DA  B C2     4  
ATOM 6465  N N3     . DA  B 2 6  ? 8.838   -1.042  -5.652  1.00 0.00 ? 87 DA  B N3     4  
ATOM 6466  C C4     . DA  B 2 6  ? 8.209   -0.657  -6.822  1.00 0.00 ? 87 DA  B C4     4  
ATOM 6467  H "H5'"  . DA  B 2 6  ? 10.810  1.997   -10.316 1.00 0.00 ? 87 DA  B "H5'"  4  
ATOM 6468  H "H5''" . DA  B 2 6  ? 11.836  1.259   -11.592 1.00 0.00 ? 87 DA  B "H5''" 4  
ATOM 6469  H "H4'"  . DA  B 2 6  ? 12.658  0.397   -9.527  1.00 0.00 ? 87 DA  B "H4'"  4  
ATOM 6470  H "H3'"  . DA  B 2 6  ? 11.574  -1.245  -11.334 1.00 0.00 ? 87 DA  B "H3'"  4  
ATOM 6471  H "H2'"  . DA  B 2 6  ? 9.492   -1.467  -10.437 1.00 0.00 ? 87 DA  B "H2'"  4  
ATOM 6472  H "H2''" . DA  B 2 6  ? 10.176  -2.785  -9.503  1.00 0.00 ? 87 DA  B "H2''" 4  
ATOM 6473  H "H1'"  . DA  B 2 6  ? 10.536  -1.669  -7.605  1.00 0.00 ? 87 DA  B "H1'"  4  
ATOM 6474  H H8     . DA  B 2 6  ? 7.814   -0.443  -9.980  1.00 0.00 ? 87 DA  B H8     4  
ATOM 6475  H H61    . DA  B 2 6  ? 4.422   -0.128  -4.996  1.00 0.00 ? 87 DA  B H61    4  
ATOM 6476  H H62    . DA  B 2 6  ? 4.576   0.507   -6.604  1.00 0.00 ? 87 DA  B H62    4  
ATOM 6477  H H2     . DA  B 2 6  ? 8.528   -1.244  -3.679  1.00 0.00 ? 87 DA  B H2     4  
ATOM 6478  P P      . DT  B 2 7  ? 13.074  -3.494  -10.100 1.00 0.00 ? 88 DT  B P      4  
ATOM 6479  O OP1    . DT  B 2 7  ? 14.503  -3.584  -10.518 1.00 0.00 ? 88 DT  B OP1    4  
ATOM 6480  O OP2    . DT  B 2 7  ? 12.025  -3.985  -11.070 1.00 0.00 ? 88 DT  B OP2    4  
ATOM 6481  O "O5'"  . DT  B 2 7  ? 12.941  -4.239  -8.699  1.00 0.00 ? 88 DT  B "O5'"  4  
ATOM 6482  C "C5'"  . DT  B 2 7  ? 13.485  -3.646  -7.483  1.00 0.00 ? 88 DT  B "C5'"  4  
ATOM 6483  C "C4'"  . DT  B 2 7  ? 12.694  -4.153  -6.217  1.00 0.00 ? 88 DT  B "C4'"  4  
ATOM 6484  O "O4'"  . DT  B 2 7  ? 11.330  -3.675  -6.361  1.00 0.00 ? 88 DT  B "O4'"  4  
ATOM 6485  C "C3'"  . DT  B 2 7  ? 12.621  -5.680  -6.086  1.00 0.00 ? 88 DT  B "C3'"  4  
ATOM 6486  O "O3'"  . DT  B 2 7  ? 13.041  -6.064  -4.816  1.00 0.00 ? 88 DT  B "O3'"  4  
ATOM 6487  C "C2'"  . DT  B 2 7  ? 11.131  -5.984  -6.385  1.00 0.00 ? 88 DT  B "C2'"  4  
ATOM 6488  C "C1'"  . DT  B 2 7  ? 10.422  -4.708  -5.942  1.00 0.00 ? 88 DT  B "C1'"  4  
ATOM 6489  N N1     . DT  B 2 7  ? 9.048   -4.474  -6.424  1.00 0.00 ? 88 DT  B N1     4  
ATOM 6490  C C2     . DT  B 2 7  ? 7.994   -4.111  -5.560  1.00 0.00 ? 88 DT  B C2     4  
ATOM 6491  O O2     . DT  B 2 7  ? 8.135   -4.263  -4.358  1.00 0.00 ? 88 DT  B O2     4  
ATOM 6492  N N3     . DT  B 2 7  ? 6.875   -3.568  -6.060  1.00 0.00 ? 88 DT  B N3     4  
ATOM 6493  C C4     . DT  B 2 7  ? 6.510   -3.533  -7.402  1.00 0.00 ? 88 DT  B C4     4  
ATOM 6494  O O4     . DT  B 2 7  ? 5.412   -3.053  -7.726  1.00 0.00 ? 88 DT  B O4     4  
ATOM 6495  C C5     . DT  B 2 7  ? 7.608   -4.046  -8.243  1.00 0.00 ? 88 DT  B C5     4  
ATOM 6496  C C7     . DT  B 2 7  ? 7.478   -4.147  -9.751  1.00 0.00 ? 88 DT  B C7     4  
ATOM 6497  C C6     . DT  B 2 7  ? 8.848   -4.356  -7.760  1.00 0.00 ? 88 DT  B C6     4  
ATOM 6498  H "H5'"  . DT  B 2 7  ? 13.407  -2.562  -7.568  1.00 0.00 ? 88 DT  B "H5'"  4  
ATOM 6499  H "H5''" . DT  B 2 7  ? 14.557  -3.841  -7.445  1.00 0.00 ? 88 DT  B "H5''" 4  
ATOM 6500  H "H4'"  . DT  B 2 7  ? 13.132  -3.796  -5.285  1.00 0.00 ? 88 DT  B "H4'"  4  
ATOM 6501  H "H3'"  . DT  B 2 7  ? 13.313  -6.032  -6.850  1.00 0.00 ? 88 DT  B "H3'"  4  
ATOM 6502  H "H2'"  . DT  B 2 7  ? 11.133  -6.060  -7.473  1.00 0.00 ? 88 DT  B "H2'"  4  
ATOM 6503  H "H2''" . DT  B 2 7  ? 10.597  -6.786  -5.877  1.00 0.00 ? 88 DT  B "H2''" 4  
ATOM 6504  H "H1'"  . DT  B 2 7  ? 10.449  -4.687  -4.853  1.00 0.00 ? 88 DT  B "H1'"  4  
ATOM 6505  H H3     . DT  B 2 7  ? 6.145   -3.358  -5.394  1.00 0.00 ? 88 DT  B H3     4  
ATOM 6506  H H71    . DT  B 2 7  ? 6.966   -3.219  -10.008 1.00 0.00 ? 88 DT  B H71    4  
ATOM 6507  H H72    . DT  B 2 7  ? 8.422   -4.022  -10.281 1.00 0.00 ? 88 DT  B H72    4  
ATOM 6508  H H73    . DT  B 2 7  ? 6.958   -5.004  -10.180 1.00 0.00 ? 88 DT  B H73    4  
ATOM 6509  H H6     . DT  B 2 7  ? 9.665   -4.642  -8.405  1.00 0.00 ? 88 DT  B H6     4  
ATOM 6510  P P      . DT  B 2 8  ? 12.980  -7.540  -4.316  1.00 0.00 ? 89 DT  B P      4  
ATOM 6511  O OP1    . DT  B 2 8  ? 14.186  -7.743  -3.413  1.00 0.00 ? 89 DT  B OP1    4  
ATOM 6512  O OP2    . DT  B 2 8  ? 12.772  -8.461  -5.443  1.00 0.00 ? 89 DT  B OP2    4  
ATOM 6513  O "O5'"  . DT  B 2 8  ? 11.677  -7.551  -3.492  1.00 0.00 ? 89 DT  B "O5'"  4  
ATOM 6514  C "C5'"  . DT  B 2 8  ? 11.421  -6.622  -2.496  1.00 0.00 ? 89 DT  B "C5'"  4  
ATOM 6515  C "C4'"  . DT  B 2 8  ? 10.208  -6.822  -1.672  1.00 0.00 ? 89 DT  B "C4'"  4  
ATOM 6516  O "O4'"  . DT  B 2 8  ? 9.026   -6.597  -2.413  1.00 0.00 ? 89 DT  B "O4'"  4  
ATOM 6517  C "C3'"  . DT  B 2 8  ? 10.071  -8.261  -1.207  1.00 0.00 ? 89 DT  B "C3'"  4  
ATOM 6518  O "O3'"  . DT  B 2 8  ? 9.335   -8.119  0.024   1.00 0.00 ? 89 DT  B "O3'"  4  
ATOM 6519  C "C2'"  . DT  B 2 8  ? 9.181   -8.961  -2.301  1.00 0.00 ? 89 DT  B "C2'"  4  
ATOM 6520  C "C1'"  . DT  B 2 8  ? 8.220   -7.756  -2.587  1.00 0.00 ? 89 DT  B "C1'"  4  
ATOM 6521  N N1     . DT  B 2 8  ? 7.685   -7.745  -4.009  1.00 0.00 ? 89 DT  B N1     4  
ATOM 6522  C C2     . DT  B 2 8  ? 6.399   -7.288  -4.312  1.00 0.00 ? 89 DT  B C2     4  
ATOM 6523  O O2     . DT  B 2 8  ? 5.648   -6.883  -3.375  1.00 0.00 ? 89 DT  B O2     4  
ATOM 6524  N N3     . DT  B 2 8  ? 5.954   -7.267  -5.635  1.00 0.00 ? 89 DT  B N3     4  
ATOM 6525  C C4     . DT  B 2 8  ? 6.729   -7.451  -6.721  1.00 0.00 ? 89 DT  B C4     4  
ATOM 6526  O O4     . DT  B 2 8  ? 6.273   -7.227  -7.862  1.00 0.00 ? 89 DT  B O4     4  
ATOM 6527  C C5     . DT  B 2 8  ? 8.106   -7.914  -6.396  1.00 0.00 ? 89 DT  B C5     4  
ATOM 6528  C C7     . DT  B 2 8  ? 9.071   -8.171  -7.547  1.00 0.00 ? 89 DT  B C7     4  
ATOM 6529  C C6     . DT  B 2 8  ? 8.514   -8.081  -5.081  1.00 0.00 ? 89 DT  B C6     4  
ATOM 6530  H "H5'"  . DT  B 2 8  ? 11.235  -5.659  -2.971  1.00 0.00 ? 89 DT  B "H5'"  4  
ATOM 6531  H "H5''" . DT  B 2 8  ? 12.258  -6.561  -1.800  1.00 0.00 ? 89 DT  B "H5''" 4  
ATOM 6532  H "H4'"  . DT  B 2 8  ? 10.175  -6.008  -0.948  1.00 0.00 ? 89 DT  B "H4'"  4  
ATOM 6533  H "H3'"  . DT  B 2 8  ? 11.043  -8.751  -1.154  1.00 0.00 ? 89 DT  B "H3'"  4  
ATOM 6534  H "H2'"  . DT  B 2 8  ? 9.843   -9.223  -3.125  1.00 0.00 ? 89 DT  B "H2'"  4  
ATOM 6535  H "H2''" . DT  B 2 8  ? 8.608   -9.829  -1.975  1.00 0.00 ? 89 DT  B "H2''" 4  
ATOM 6536  H "H1'"  . DT  B 2 8  ? 7.390   -7.875  -1.892  1.00 0.00 ? 89 DT  B "H1'"  4  
ATOM 6537  H H3     . DT  B 2 8  ? 5.045   -6.953  -5.940  1.00 0.00 ? 89 DT  B H3     4  
ATOM 6538  H H71    . DT  B 2 8  ? 8.502   -8.852  -8.179  1.00 0.00 ? 89 DT  B H71    4  
ATOM 6539  H H72    . DT  B 2 8  ? 9.236   -7.177  -7.962  1.00 0.00 ? 89 DT  B H72    4  
ATOM 6540  H H73    . DT  B 2 8  ? 9.981   -8.628  -7.159  1.00 0.00 ? 89 DT  B H73    4  
ATOM 6541  H H6     . DT  B 2 8  ? 9.555   -8.316  -4.910  1.00 0.00 ? 89 DT  B H6     4  
ATOM 6542  P P      . DA  B 2 9  ? 9.109   -9.289  1.003   1.00 0.00 ? 90 DA  B P      4  
ATOM 6543  O OP1    . DA  B 2 9  ? 8.998   -8.835  2.370   1.00 0.00 ? 90 DA  B OP1    4  
ATOM 6544  O OP2    . DA  B 2 9  ? 10.010  -10.412 0.580   1.00 0.00 ? 90 DA  B OP2    4  
ATOM 6545  O "O5'"  . DA  B 2 9  ? 7.672   -9.780  0.589   1.00 0.00 ? 90 DA  B "O5'"  4  
ATOM 6546  C "C5'"  . DA  B 2 9  ? 6.592   -8.947  0.913   1.00 0.00 ? 90 DA  B "C5'"  4  
ATOM 6547  C "C4'"  . DA  B 2 9  ? 5.239   -9.551  0.496   1.00 0.00 ? 90 DA  B "C4'"  4  
ATOM 6548  O "O4'"  . DA  B 2 9  ? 5.158   -9.449  -0.919  1.00 0.00 ? 90 DA  B "O4'"  4  
ATOM 6549  C "C3'"  . DA  B 2 9  ? 5.019   -10.960 0.914   1.00 0.00 ? 90 DA  B "C3'"  4  
ATOM 6550  O "O3'"  . DA  B 2 9  ? 3.701   -11.155 1.358   1.00 0.00 ? 90 DA  B "O3'"  4  
ATOM 6551  C "C2'"  . DA  B 2 9  ? 5.184   -11.728 -0.456  1.00 0.00 ? 90 DA  B "C2'"  4  
ATOM 6552  C "C1'"  . DA  B 2 9  ? 4.603   -10.640 -1.338  1.00 0.00 ? 90 DA  B "C1'"  4  
ATOM 6553  N N9     . DA  B 2 9  ? 4.960   -10.704 -2.754  1.00 0.00 ? 90 DA  B N9     4  
ATOM 6554  C C8     . DA  B 2 9  ? 6.078   -11.139 -3.345  1.00 0.00 ? 90 DA  B C8     4  
ATOM 6555  N N7     . DA  B 2 9  ? 6.239   -10.900 -4.598  1.00 0.00 ? 90 DA  B N7     4  
ATOM 6556  C C5     . DA  B 2 9  ? 4.941   -10.364 -4.881  1.00 0.00 ? 90 DA  B C5     4  
ATOM 6557  C C6     . DA  B 2 9  ? 4.309   -10.001 -6.085  1.00 0.00 ? 90 DA  B C6     4  
ATOM 6558  N N6     . DA  B 2 9  ? 4.852   -10.028 -7.293  1.00 0.00 ? 90 DA  B N6     4  
ATOM 6559  N N1     . DA  B 2 9  ? 3.049   -9.526  -6.050  1.00 0.00 ? 90 DA  B N1     4  
ATOM 6560  C C2     . DA  B 2 9  ? 2.387   -9.556  -4.901  1.00 0.00 ? 90 DA  B C2     4  
ATOM 6561  N N3     . DA  B 2 9  ? 2.792   -10.096 -3.742  1.00 0.00 ? 90 DA  B N3     4  
ATOM 6562  C C4     . DA  B 2 9  ? 4.145   -10.350 -3.798  1.00 0.00 ? 90 DA  B C4     4  
ATOM 6563  H "H5'"  . DA  B 2 9  ? 6.700   -7.934  0.524   1.00 0.00 ? 90 DA  B "H5'"  4  
ATOM 6564  H "H5''" . DA  B 2 9  ? 6.656   -8.854  1.997   1.00 0.00 ? 90 DA  B "H5''" 4  
ATOM 6565  H "H4'"  . DA  B 2 9  ? 4.446   -8.995  0.995   1.00 0.00 ? 90 DA  B "H4'"  4  
ATOM 6566  H "H3'"  . DA  B 2 9  ? 5.712   -11.303 1.683   1.00 0.00 ? 90 DA  B "H3'"  4  
ATOM 6567  H "H2'"  . DA  B 2 9  ? 6.266   -11.833 -0.543  1.00 0.00 ? 90 DA  B "H2'"  4  
ATOM 6568  H "H2''" . DA  B 2 9  ? 4.625   -12.662 -0.515  1.00 0.00 ? 90 DA  B "H2''" 4  
ATOM 6569  H "H1'"  . DA  B 2 9  ? 3.513   -10.648 -1.332  1.00 0.00 ? 90 DA  B "H1'"  4  
ATOM 6570  H H8     . DA  B 2 9  ? 6.831   -11.627 -2.743  1.00 0.00 ? 90 DA  B H8     4  
ATOM 6571  H H61    . DA  B 2 9  ? 4.230   -9.718  -8.026  1.00 0.00 ? 90 DA  B H61    4  
ATOM 6572  H H62    . DA  B 2 9  ? 5.726   -10.508 -7.447  1.00 0.00 ? 90 DA  B H62    4  
ATOM 6573  H H2     . DA  B 2 9  ? 1.414   -9.109  -5.031  1.00 0.00 ? 90 DA  B H2     4  
ATOM 6574  P P      . DG  B 2 10 ? 3.176   -12.494 2.025   1.00 0.00 ? 91 DG  B P      4  
ATOM 6575  O OP1    . DG  B 2 10 ? 2.559   -12.239 3.299   1.00 0.00 ? 91 DG  B OP1    4  
ATOM 6576  O OP2    . DG  B 2 10 ? 4.208   -13.597 1.972   1.00 0.00 ? 91 DG  B OP2    4  
ATOM 6577  O "O5'"  . DG  B 2 10 ? 1.953   -12.925 1.132   1.00 0.00 ? 91 DG  B "O5'"  4  
ATOM 6578  C "C5'"  . DG  B 2 10 ? 0.790   -12.096 1.125   1.00 0.00 ? 91 DG  B "C5'"  4  
ATOM 6579  C "C4'"  . DG  B 2 10 ? -0.201  -12.428 -0.018  1.00 0.00 ? 91 DG  B "C4'"  4  
ATOM 6580  O "O4'"  . DG  B 2 10 ? 0.296   -12.085 -1.270  1.00 0.00 ? 91 DG  B "O4'"  4  
ATOM 6581  C "C3'"  . DG  B 2 10 ? -0.821  -13.804 -0.033  1.00 0.00 ? 91 DG  B "C3'"  4  
ATOM 6582  O "O3'"  . DG  B 2 10 ? -2.240  -13.675 -0.042  1.00 0.00 ? 91 DG  B "O3'"  4  
ATOM 6583  C "C2'"  . DG  B 2 10 ? -0.298  -14.328 -1.363  1.00 0.00 ? 91 DG  B "C2'"  4  
ATOM 6584  C "C1'"  . DG  B 2 10 ? -0.008  -13.138 -2.238  1.00 0.00 ? 91 DG  B "C1'"  4  
ATOM 6585  N N9     . DG  B 2 10 ? 1.143   -13.348 -3.102  1.00 0.00 ? 91 DG  B N9     4  
ATOM 6586  C C8     . DG  B 2 10 ? 2.454   -13.707 -2.804  1.00 0.00 ? 91 DG  B C8     4  
ATOM 6587  N N7     . DG  B 2 10 ? 3.206   -13.860 -3.837  1.00 0.00 ? 91 DG  B N7     4  
ATOM 6588  C C5     . DG  B 2 10 ? 2.417   -13.292 -4.845  1.00 0.00 ? 91 DG  B C5     4  
ATOM 6589  C C6     . DG  B 2 10 ? 2.718   -12.993 -6.252  1.00 0.00 ? 91 DG  B C6     4  
ATOM 6590  O O6     . DG  B 2 10 ? 3.745   -13.026 -6.892  1.00 0.00 ? 91 DG  B O6     4  
ATOM 6591  N N1     . DG  B 2 10 ? 1.672   -12.456 -6.916  1.00 0.00 ? 91 DG  B N1     4  
ATOM 6592  C C2     . DG  B 2 10 ? 0.480   -12.240 -6.400  1.00 0.00 ? 91 DG  B C2     4  
ATOM 6593  N N2     . DG  B 2 10 ? -0.334  -11.498 -7.052  1.00 0.00 ? 91 DG  B N2     4  
ATOM 6594  N N3     . DG  B 2 10 ? 0.142   -12.484 -5.136  1.00 0.00 ? 91 DG  B N3     4  
ATOM 6595  C C4     . DG  B 2 10 ? 1.154   -13.008 -4.426  1.00 0.00 ? 91 DG  B C4     4  
ATOM 6596  H "H5'"  . DG  B 2 10 ? 1.151   -11.070 1.045   1.00 0.00 ? 91 DG  B "H5'"  4  
ATOM 6597  H "H5''" . DG  B 2 10 ? 0.246   -12.164 2.067   1.00 0.00 ? 91 DG  B "H5''" 4  
ATOM 6598  H "H4'"  . DG  B 2 10 ? -0.960  -11.649 0.051   1.00 0.00 ? 91 DG  B "H4'"  4  
ATOM 6599  H "H3'"  . DG  B 2 10 ? -0.523  -14.462 0.783   1.00 0.00 ? 91 DG  B "H3'"  4  
ATOM 6600  H "H2'"  . DG  B 2 10 ? 0.611   -14.851 -1.066  1.00 0.00 ? 91 DG  B "H2'"  4  
ATOM 6601  H "H2''" . DG  B 2 10 ? -0.890  -15.076 -1.891  1.00 0.00 ? 91 DG  B "H2''" 4  
ATOM 6602  H "H1'"  . DG  B 2 10 ? -0.914  -12.861 -2.777  1.00 0.00 ? 91 DG  B "H1'"  4  
ATOM 6603  H H8     . DG  B 2 10 ? 2.811   -13.996 -1.826  1.00 0.00 ? 91 DG  B H8     4  
ATOM 6604  H H1     . DG  B 2 10 ? 1.884   -12.199 -7.869  1.00 0.00 ? 91 DG  B H1     4  
ATOM 6605  H H21    . DG  B 2 10 ? -1.172  -11.131 -6.625  1.00 0.00 ? 91 DG  B H21    4  
ATOM 6606  H H22    . DG  B 2 10 ? -0.112  -11.316 -8.021  1.00 0.00 ? 91 DG  B H22    4  
ATOM 6607  P P      . DA  B 2 11 ? -3.286  -14.808 -0.250  1.00 0.00 ? 92 DA  B P      4  
ATOM 6608  O OP1    . DA  B 2 11 ? -4.504  -14.407 0.460   1.00 0.00 ? 92 DA  B OP1    4  
ATOM 6609  O OP2    . DA  B 2 11 ? -2.696  -16.094 -0.087  1.00 0.00 ? 92 DA  B OP2    4  
ATOM 6610  O "O5'"  . DA  B 2 11 ? -3.521  -14.582 -1.817  1.00 0.00 ? 92 DA  B "O5'"  4  
ATOM 6611  C "C5'"  . DA  B 2 11 ? -4.148  -13.415 -2.355  1.00 0.00 ? 92 DA  B "C5'"  4  
ATOM 6612  C "C4'"  . DA  B 2 11 ? -4.345  -13.432 -3.857  1.00 0.00 ? 92 DA  B "C4'"  4  
ATOM 6613  O "O4'"  . DA  B 2 11 ? -3.116  -13.606 -4.577  1.00 0.00 ? 92 DA  B "O4'"  4  
ATOM 6614  C "C3'"  . DA  B 2 11 ? -5.226  -14.516 -4.381  1.00 0.00 ? 92 DA  B "C3'"  4  
ATOM 6615  O "O3'"  . DA  B 2 11 ? -6.100  -14.070 -5.378  1.00 0.00 ? 92 DA  B "O3'"  4  
ATOM 6616  C "C2'"  . DA  B 2 11 ? -4.252  -15.566 -4.925  1.00 0.00 ? 92 DA  B "C2'"  4  
ATOM 6617  C "C1'"  . DA  B 2 11 ? -3.215  -14.645 -5.528  1.00 0.00 ? 92 DA  B "C1'"  4  
ATOM 6618  N N9     . DA  B 2 11 ? -1.865  -15.197 -5.663  1.00 0.00 ? 92 DA  B N9     4  
ATOM 6619  C C8     . DA  B 2 11 ? -1.162  -15.857 -4.751  1.00 0.00 ? 92 DA  B C8     4  
ATOM 6620  N N7     . DA  B 2 11 ? 0.070   -16.188 -5.048  1.00 0.00 ? 92 DA  B N7     4  
ATOM 6621  C C5     . DA  B 2 11 ? 0.117   -15.807 -6.413  1.00 0.00 ? 92 DA  B C5     4  
ATOM 6622  C C6     . DA  B 2 11 ? 1.057   -15.909 -7.441  1.00 0.00 ? 92 DA  B C6     4  
ATOM 6623  N N6     . DA  B 2 11 ? 2.287   -16.381 -7.242  1.00 0.00 ? 92 DA  B N6     4  
ATOM 6624  N N1     . DA  B 2 11 ? 0.856   -15.461 -8.638  1.00 0.00 ? 92 DA  B N1     4  
ATOM 6625  C C2     . DA  B 2 11 ? -0.362  -14.864 -8.851  1.00 0.00 ? 92 DA  B C2     4  
ATOM 6626  N N3     . DA  B 2 11 ? -1.351  -14.628 -8.029  1.00 0.00 ? 92 DA  B N3     4  
ATOM 6627  C C4     . DA  B 2 11 ? -1.032  -15.174 -6.796  1.00 0.00 ? 92 DA  B C4     4  
ATOM 6628  H "H5'"  . DA  B 2 11 ? -3.588  -12.518 -2.089  1.00 0.00 ? 92 DA  B "H5'"  4  
ATOM 6629  H "H5''" . DA  B 2 11 ? -5.086  -13.336 -1.805  1.00 0.00 ? 92 DA  B "H5''" 4  
ATOM 6630  H "H4'"  . DA  B 2 11 ? -4.753  -12.459 -4.132  1.00 0.00 ? 92 DA  B "H4'"  4  
ATOM 6631  H "H3'"  . DA  B 2 11 ? -5.828  -14.781 -3.512  1.00 0.00 ? 92 DA  B "H3'"  4  
ATOM 6632  H "H2'"  . DA  B 2 11 ? -3.966  -16.110 -4.026  1.00 0.00 ? 92 DA  B "H2'"  4  
ATOM 6633  H "H2''" . DA  B 2 11 ? -4.563  -16.287 -5.682  1.00 0.00 ? 92 DA  B "H2''" 4  
ATOM 6634  H "H1'"  . DA  B 2 11 ? -3.441  -14.275 -6.527  1.00 0.00 ? 92 DA  B "H1'"  4  
ATOM 6635  H H8     . DA  B 2 11 ? -1.661  -16.006 -3.805  1.00 0.00 ? 92 DA  B H8     4  
ATOM 6636  H H61    . DA  B 2 11 ? 2.905   -15.913 -7.887  1.00 0.00 ? 92 DA  B H61    4  
ATOM 6637  H H62    . DA  B 2 11 ? 2.527   -16.628 -6.292  1.00 0.00 ? 92 DA  B H62    4  
ATOM 6638  H H2     . DA  B 2 11 ? -0.484  -14.467 -9.847  1.00 0.00 ? 92 DA  B H2     4  
ATOM 6639  P P      . DG  B 2 12 ? -7.206  -14.931 -6.182  1.00 0.00 ? 93 DG  B P      4  
ATOM 6640  O OP1    . DG  B 2 12 ? -8.366  -14.027 -6.206  1.00 0.00 ? 93 DG  B OP1    4  
ATOM 6641  O OP2    . DG  B 2 12 ? -7.299  -16.318 -5.655  1.00 0.00 ? 93 DG  B OP2    4  
ATOM 6642  O "O5'"  . DG  B 2 12 ? -6.615  -15.022 -7.669  1.00 0.00 ? 93 DG  B "O5'"  4  
ATOM 6643  C "C5'"  . DG  B 2 12 ? -6.204  -13.868 -8.421  1.00 0.00 ? 93 DG  B "C5'"  4  
ATOM 6644  C "C4'"  . DG  B 2 12 ? -5.726  -14.173 -9.811  1.00 0.00 ? 93 DG  B "C4'"  4  
ATOM 6645  O "O4'"  . DG  B 2 12 ? -4.471  -14.814 -9.724  1.00 0.00 ? 93 DG  B "O4'"  4  
ATOM 6646  C "C3'"  . DG  B 2 12 ? -6.663  -15.146 -10.568 1.00 0.00 ? 93 DG  B "C3'"  4  
ATOM 6647  O "O3'"  . DG  B 2 12 ? -6.765  -14.720 -11.931 1.00 0.00 ? 93 DG  B "O3'"  4  
ATOM 6648  C "C2'"  . DG  B 2 12 ? -5.905  -16.502 -10.277 1.00 0.00 ? 93 DG  B "C2'"  4  
ATOM 6649  C "C1'"  . DG  B 2 12 ? -4.459  -16.048 -10.486 1.00 0.00 ? 93 DG  B "C1'"  4  
ATOM 6650  N N9     . DG  B 2 12 ? -3.453  -16.951 -9.874  1.00 0.00 ? 93 DG  B N9     4  
ATOM 6651  C C8     . DG  B 2 12 ? -3.589  -17.512 -8.636  1.00 0.00 ? 93 DG  B C8     4  
ATOM 6652  N N7     . DG  B 2 12 ? -2.557  -18.242 -8.265  1.00 0.00 ? 93 DG  B N7     4  
ATOM 6653  C C5     . DG  B 2 12 ? -1.632  -18.089 -9.301  1.00 0.00 ? 93 DG  B C5     4  
ATOM 6654  C C6     . DG  B 2 12 ? -0.321  -18.647 -9.449  1.00 0.00 ? 93 DG  B C6     4  
ATOM 6655  O O6     . DG  B 2 12 ? 0.399   -19.267 -8.674  1.00 0.00 ? 93 DG  B O6     4  
ATOM 6656  N N1     . DG  B 2 12 ? 0.126   -18.377 -10.769 1.00 0.00 ? 93 DG  B N1     4  
ATOM 6657  C C2     . DG  B 2 12 ? -0.507  -17.626 -11.660 1.00 0.00 ? 93 DG  B C2     4  
ATOM 6658  N N2     . DG  B 2 12 ? 0.029   -17.539 -12.816 1.00 0.00 ? 93 DG  B N2     4  
ATOM 6659  N N3     . DG  B 2 12 ? -1.691  -17.053 -11.476 1.00 0.00 ? 93 DG  B N3     4  
ATOM 6660  C C4     . DG  B 2 12 ? -2.213  -17.344 -10.296 1.00 0.00 ? 93 DG  B C4     4  
ATOM 6661  H "H5'"  . DG  B 2 12 ? -5.441  -13.319 -7.870  1.00 0.00 ? 93 DG  B "H5'"  4  
ATOM 6662  H "H5''" . DG  B 2 12 ? -7.092  -13.253 -8.567  1.00 0.00 ? 93 DG  B "H5''" 4  
ATOM 6663  H "H4'"  . DG  B 2 12 ? -5.563  -13.290 -10.431 1.00 0.00 ? 93 DG  B "H4'"  4  
ATOM 6664  H "H3'"  . DG  B 2 12 ? -7.675  -15.186 -10.163 1.00 0.00 ? 93 DG  B "H3'"  4  
ATOM 6665  H "H2'"  . DG  B 2 12 ? -6.100  -16.841 -9.260  1.00 0.00 ? 93 DG  B "H2'"  4  
ATOM 6666  H "H2''" . DG  B 2 12 ? -5.977  -17.364 -10.939 1.00 0.00 ? 93 DG  B "H2''" 4  
ATOM 6667  H "H1'"  . DG  B 2 12 ? -4.219  -15.819 -11.525 1.00 0.00 ? 93 DG  B "H1'"  4  
ATOM 6668  H H8     . DG  B 2 12 ? -4.501  -17.327 -8.089  1.00 0.00 ? 93 DG  B H8     4  
ATOM 6669  H H1     . DG  B 2 12 ? 1.089   -18.571 -11.003 1.00 0.00 ? 93 DG  B H1     4  
ATOM 6670  H H21    . DG  B 2 12 ? -0.498  -17.222 -13.618 1.00 0.00 ? 93 DG  B H21    4  
ATOM 6671  H H22    . DG  B 2 12 ? 0.882   -18.040 -13.018 1.00 0.00 ? 93 DG  B H22    4  
ATOM 6672  P P      . DC  B 2 13 ? -7.569  -15.517 -12.963 1.00 0.00 ? 94 DC  B P      4  
ATOM 6673  O OP1    . DC  B 2 13 ? -7.955  -14.495 -13.874 1.00 0.00 ? 94 DC  B OP1    4  
ATOM 6674  O OP2    . DC  B 2 13 ? -8.578  -16.363 -12.327 1.00 0.00 ? 94 DC  B OP2    4  
ATOM 6675  O "O5'"  . DC  B 2 13 ? -6.502  -16.347 -13.696 1.00 0.00 ? 94 DC  B "O5'"  4  
ATOM 6676  C "C5'"  . DC  B 2 13 ? -5.410  -15.698 -14.439 1.00 0.00 ? 94 DC  B "C5'"  4  
ATOM 6677  C "C4'"  . DC  B 2 13 ? -4.660  -16.661 -15.323 1.00 0.00 ? 94 DC  B "C4'"  4  
ATOM 6678  O "O4'"  . DC  B 2 13 ? -3.871  -17.367 -14.371 1.00 0.00 ? 94 DC  B "O4'"  4  
ATOM 6679  C "C3'"  . DC  B 2 13 ? -5.547  -17.576 -16.160 1.00 0.00 ? 94 DC  B "C3'"  4  
ATOM 6680  O "O3'"  . DC  B 2 13 ? -4.922  -17.795 -17.426 1.00 0.00 ? 94 DC  B "O3'"  4  
ATOM 6681  C "C2'"  . DC  B 2 13 ? -5.442  -18.872 -15.267 1.00 0.00 ? 94 DC  B "C2'"  4  
ATOM 6682  C "C1'"  . DC  B 2 13 ? -4.058  -18.784 -14.612 1.00 0.00 ? 94 DC  B "C1'"  4  
ATOM 6683  N N1     . DC  B 2 13 ? -4.027  -19.605 -13.323 1.00 0.00 ? 94 DC  B N1     4  
ATOM 6684  C C2     . DC  B 2 13 ? -2.894  -20.476 -13.250 1.00 0.00 ? 94 DC  B C2     4  
ATOM 6685  O O2     . DC  B 2 13 ? -2.039  -20.701 -14.136 1.00 0.00 ? 94 DC  B O2     4  
ATOM 6686  N N3     . DC  B 2 13 ? -2.566  -21.020 -12.047 1.00 0.00 ? 94 DC  B N3     4  
ATOM 6687  C C4     . DC  B 2 13 ? -3.427  -20.845 -11.006 1.00 0.00 ? 94 DC  B C4     4  
ATOM 6688  N N4     . DC  B 2 13 ? -3.102  -21.559 -9.948  1.00 0.00 ? 94 DC  B N4     4  
ATOM 6689  C C5     . DC  B 2 13 ? -4.532  -19.980 -11.085 1.00 0.00 ? 94 DC  B C5     4  
ATOM 6690  C C6     . DC  B 2 13 ? -4.903  -19.461 -12.274 1.00 0.00 ? 94 DC  B C6     4  
ATOM 6691  H "H5'"  . DC  B 2 13 ? -4.689  -15.366 -13.692 1.00 0.00 ? 94 DC  B "H5'"  4  
ATOM 6692  H "H5''" . DC  B 2 13 ? -5.796  -14.819 -14.955 1.00 0.00 ? 94 DC  B "H5''" 4  
ATOM 6693  H "H4'"  . DC  B 2 13 ? -4.002  -16.008 -15.897 1.00 0.00 ? 94 DC  B "H4'"  4  
ATOM 6694  H "H3'"  . DC  B 2 13 ? -6.553  -17.169 -16.257 1.00 0.00 ? 94 DC  B "H3'"  4  
ATOM 6695  H "HO3'" . DC  B 2 13 ? -5.046  -17.109 -18.085 1.00 0.00 ? 94 DC  B "HO3'" 4  
ATOM 6696  H "H2'"  . DC  B 2 13 ? -6.206  -18.744 -14.500 1.00 0.00 ? 94 DC  B "H2'"  4  
ATOM 6697  H "H2''" . DC  B 2 13 ? -5.551  -19.781 -15.858 1.00 0.00 ? 94 DC  B "H2''" 4  
ATOM 6698  H "H1'"  . DC  B 2 13 ? -3.300  -19.180 -15.289 1.00 0.00 ? 94 DC  B "H1'"  4  
ATOM 6699  H H41    . DC  B 2 13 ? -3.670  -21.556 -9.113  1.00 0.00 ? 94 DC  B H41    4  
ATOM 6700  H H42    . DC  B 2 13 ? -2.185  -21.978 -10.011 1.00 0.00 ? 94 DC  B H42    4  
ATOM 6701  H H5     . DC  B 2 13 ? -5.159  -19.894 -10.211 1.00 0.00 ? 94 DC  B H5     4  
ATOM 6702  H H6     . DC  B 2 13 ? -5.756  -18.801 -12.303 1.00 0.00 ? 94 DC  B H6     4  
ATOM 6703  N N      . GLY C 3 1  ? 1.828   -6.309  8.570   1.00 0.00 ? 1  GLY P N      4  
ATOM 6704  C CA     . GLY C 3 1  ? 1.262   -6.208  7.206   1.00 0.00 ? 1  GLY P CA     4  
ATOM 6705  C C      . GLY C 3 1  ? -0.140  -5.562  7.350   1.00 0.00 ? 1  GLY P C      4  
ATOM 6706  O O      . GLY C 3 1  ? -1.112  -6.322  7.395   1.00 0.00 ? 1  GLY P O      4  
ATOM 6707  H H1     . GLY C 3 1  ? 2.157   -5.408  8.884   1.00 0.00 ? 1  GLY P H1     4  
ATOM 6708  H H2     . GLY C 3 1  ? 2.665   -6.871  8.494   1.00 0.00 ? 1  GLY P H2     4  
ATOM 6709  H H3     . GLY C 3 1  ? 1.225   -6.786  9.225   1.00 0.00 ? 1  GLY P H3     4  
ATOM 6710  H HA2    . GLY C 3 1  ? 1.921   -5.591  6.596   1.00 0.00 ? 1  GLY P HA2    4  
ATOM 6711  H HA3    . GLY C 3 1  ? 1.148   -7.183  6.733   1.00 0.00 ? 1  GLY P HA3    4  
ATOM 6712  N N      . PRO C 3 2  ? -0.310  -4.244  7.345   1.00 0.00 ? 2  PRO P N      4  
ATOM 6713  C CA     . PRO C 3 2  ? -1.577  -3.568  7.290   1.00 0.00 ? 2  PRO P CA     4  
ATOM 6714  C C      . PRO C 3 2  ? -2.653  -4.210  6.456   1.00 0.00 ? 2  PRO P C      4  
ATOM 6715  O O      . PRO C 3 2  ? -3.757  -4.298  7.007   1.00 0.00 ? 2  PRO P O      4  
ATOM 6716  C CB     . PRO C 3 2  ? -1.382  -2.061  6.955   1.00 0.00 ? 2  PRO P CB     4  
ATOM 6717  C CG     . PRO C 3 2  ? 0.119   -1.894  7.439   1.00 0.00 ? 2  PRO P CG     4  
ATOM 6718  C CD     . PRO C 3 2  ? 0.718   -3.296  7.148   1.00 0.00 ? 2  PRO P CD     4  
ATOM 6719  H HA     . PRO C 3 2  ? -1.915  -3.621  8.324   1.00 0.00 ? 2  PRO P HA     4  
ATOM 6720  H HB2    . PRO C 3 2  ? -1.439  -1.905  5.877   1.00 0.00 ? 2  PRO P HB2    4  
ATOM 6721  H HB3    . PRO C 3 2  ? -2.090  -1.425  7.486   1.00 0.00 ? 2  PRO P HB3    4  
ATOM 6722  H HG2    . PRO C 3 2  ? 0.690   -1.173  6.855   1.00 0.00 ? 2  PRO P HG2    4  
ATOM 6723  H HG3    . PRO C 3 2  ? 0.132   -1.620  8.494   1.00 0.00 ? 2  PRO P HG3    4  
ATOM 6724  H HD2    . PRO C 3 2  ? 0.969   -3.193  6.092   1.00 0.00 ? 2  PRO P HD2    4  
ATOM 6725  H HD3    . PRO C 3 2  ? 1.625   -3.472  7.728   1.00 0.00 ? 2  PRO P HD3    4  
ATOM 6726  N N      . ARG C 3 3  ? -2.381  -4.721  5.208   1.00 0.00 ? 3  ARG P N      4  
ATOM 6727  C CA     . ARG C 3 3  ? -3.269  -5.475  4.260   1.00 0.00 ? 3  ARG P CA     4  
ATOM 6728  C C      . ARG C 3 3  ? -2.768  -6.859  3.898   1.00 0.00 ? 3  ARG P C      4  
ATOM 6729  O O      . ARG C 3 3  ? -3.478  -7.744  3.575   1.00 0.00 ? 3  ARG P O      4  
ATOM 6730  C CB     . ARG C 3 3  ? -3.394  -4.631  2.969   1.00 0.00 ? 3  ARG P CB     4  
ATOM 6731  C CG     . ARG C 3 3  ? -4.836  -4.221  2.755   1.00 0.00 ? 3  ARG P CG     4  
ATOM 6732  C CD     . ARG C 3 3  ? -5.729  -5.400  2.374   1.00 0.00 ? 3  ARG P CD     4  
ATOM 6733  N NE     . ARG C 3 3  ? -5.370  -6.061  1.094   1.00 0.00 ? 3  ARG P NE     4  
ATOM 6734  C CZ     . ARG C 3 3  ? -5.536  -7.344  0.874   1.00 0.00 ? 3  ARG P CZ     4  
ATOM 6735  N NH1    . ARG C 3 3  ? -5.806  -8.149  1.771   1.00 0.00 ? 3  ARG P NH1    4  
ATOM 6736  N NH2    . ARG C 3 3  ? -5.329  -7.812  -0.289  1.00 0.00 ? 3  ARG P NH2    4  
ATOM 6737  H H      . ARG C 3 3  ? -1.411  -4.658  4.931   1.00 0.00 ? 3  ARG P H      4  
ATOM 6738  H HA     . ARG C 3 3  ? -4.220  -5.600  4.778   1.00 0.00 ? 3  ARG P HA     4  
ATOM 6739  H HB2    . ARG C 3 3  ? -2.870  -3.675  2.986   1.00 0.00 ? 3  ARG P HB2    4  
ATOM 6740  H HB3    . ARG C 3 3  ? -2.885  -5.191  2.183   1.00 0.00 ? 3  ARG P HB3    4  
ATOM 6741  H HG2    . ARG C 3 3  ? -5.283  -3.714  3.611   1.00 0.00 ? 3  ARG P HG2    4  
ATOM 6742  H HG3    . ARG C 3 3  ? -4.963  -3.520  1.931   1.00 0.00 ? 3  ARG P HG3    4  
ATOM 6743  H HD2    . ARG C 3 3  ? -5.708  -6.067  3.237   1.00 0.00 ? 3  ARG P HD2    4  
ATOM 6744  H HD3    . ARG C 3 3  ? -6.770  -5.077  2.352   1.00 0.00 ? 3  ARG P HD3    4  
ATOM 6745  H HE     . ARG C 3 3  ? -5.059  -5.510  0.306   1.00 0.00 ? 3  ARG P HE     4  
ATOM 6746  H HH11   . ARG C 3 3  ? -6.001  -7.791  2.695   1.00 0.00 ? 3  ARG P HH11   4  
ATOM 6747  H HH12   . ARG C 3 3  ? -6.131  -9.081  1.560   1.00 0.00 ? 3  ARG P HH12   4  
ATOM 6748  H HH21   . ARG C 3 3  ? -4.937  -7.252  -1.032  1.00 0.00 ? 3  ARG P HH21   4  
ATOM 6749  H HH22   . ARG C 3 3  ? -5.602  -8.769  -0.457  1.00 0.00 ? 3  ARG P HH22   4  
ATOM 6750  N N      . ARG C 3 4  ? -1.416  -7.039  4.005   1.00 0.00 ? 4  ARG P N      4  
ATOM 6751  C CA     . ARG C 3 4  ? -0.723  -8.322  3.939   1.00 0.00 ? 4  ARG P CA     4  
ATOM 6752  C C      . ARG C 3 4  ? -0.991  -9.260  5.117   1.00 0.00 ? 4  ARG P C      4  
ATOM 6753  O O      . ARG C 3 4  ? -0.910  -10.459 4.857   1.00 0.00 ? 4  ARG P O      4  
ATOM 6754  C CB     . ARG C 3 4  ? 0.728   -7.953  3.960   1.00 0.00 ? 4  ARG P CB     4  
ATOM 6755  C CG     . ARG C 3 4  ? 1.590   -9.135  3.509   1.00 0.00 ? 4  ARG P CG     4  
ATOM 6756  C CD     . ARG C 3 4  ? 3.099   -8.894  3.546   1.00 0.00 ? 4  ARG P CD     4  
ATOM 6757  N NE     . ARG C 3 4  ? 3.614   -8.647  4.908   1.00 0.00 ? 4  ARG P NE     4  
ATOM 6758  C CZ     . ARG C 3 4  ? 3.855   -9.580  5.798   1.00 0.00 ? 4  ARG P CZ     4  
ATOM 6759  N NH1    . ARG C 3 4  ? 3.477   -10.826 5.655   1.00 0.00 ? 4  ARG P NH1    4  
ATOM 6760  N NH2    . ARG C 3 4  ? 4.311   -9.331  6.978   1.00 0.00 ? 4  ARG P NH2    4  
ATOM 6761  H H      . ARG C 3 4  ? -0.874  -6.190  4.065   1.00 0.00 ? 4  ARG P H      4  
ATOM 6762  H HA     . ARG C 3 4  ? -1.052  -8.805  3.019   1.00 0.00 ? 4  ARG P HA     4  
ATOM 6763  H HB2    . ARG C 3 4  ? 1.001   -7.074  3.375   1.00 0.00 ? 4  ARG P HB2    4  
ATOM 6764  H HB3    . ARG C 3 4  ? 1.031   -7.647  4.961   1.00 0.00 ? 4  ARG P HB3    4  
ATOM 6765  H HG2    . ARG C 3 4  ? 1.394   -10.044 4.079   1.00 0.00 ? 4  ARG P HG2    4  
ATOM 6766  H HG3    . ARG C 3 4  ? 1.303   -9.307  2.471   1.00 0.00 ? 4  ARG P HG3    4  
ATOM 6767  H HD2    . ARG C 3 4  ? 3.498   -9.874  3.283   1.00 0.00 ? 4  ARG P HD2    4  
ATOM 6768  H HD3    . ARG C 3 4  ? 3.446   -8.124  2.858   1.00 0.00 ? 4  ARG P HD3    4  
ATOM 6769  H HE     . ARG C 3 4  ? 4.068   -7.773  5.132   1.00 0.00 ? 4  ARG P HE     4  
ATOM 6770  H HH11   . ARG C 3 4  ? 3.060   -11.149 4.794   1.00 0.00 ? 4  ARG P HH11   4  
ATOM 6771  H HH12   . ARG C 3 4  ? 3.794   -11.490 6.348   1.00 0.00 ? 4  ARG P HH12   4  
ATOM 6772  H HH21   . ARG C 3 4  ? 4.461   -8.385  7.298   1.00 0.00 ? 4  ARG P HH21   4  
ATOM 6773  H HH22   . ARG C 3 4  ? 4.499   -10.069 7.642   1.00 0.00 ? 4  ARG P HH22   4  
ATOM 6774  N N      . THR C 3 5  ? -1.272  -8.825  6.293   1.00 0.00 ? 5  THR P N      4  
ATOM 6775  C CA     . THR C 3 5  ? -1.490  -9.747  7.464   1.00 0.00 ? 5  THR P CA     4  
ATOM 6776  C C      . THR C 3 5  ? -2.737  -9.355  8.351   1.00 0.00 ? 5  THR P C      4  
ATOM 6777  O O      . THR C 3 5  ? -3.263  -10.233 9.042   1.00 0.00 ? 5  THR P O      4  
ATOM 6778  C CB     . THR C 3 5  ? -0.260  -9.709  8.361   1.00 0.00 ? 5  THR P CB     4  
ATOM 6779  O OG1    . THR C 3 5  ? 0.030   -8.456  8.972   1.00 0.00 ? 5  THR P OG1    4  
ATOM 6780  C CG2    . THR C 3 5  ? 0.976   -10.018 7.676   1.00 0.00 ? 5  THR P CG2    4  
ATOM 6781  H H      . THR C 3 5  ? -1.203  -7.825  6.417   1.00 0.00 ? 5  THR P H      4  
ATOM 6782  H HA     . THR C 3 5  ? -1.710  -10.754 7.109   1.00 0.00 ? 5  THR P HA     4  
ATOM 6783  H HB     . THR C 3 5  ? -0.399  -10.450 9.149   1.00 0.00 ? 5  THR P HB     4  
ATOM 6784  H HG1    . THR C 3 5  ? -0.535  -8.349  9.741   1.00 0.00 ? 5  THR P HG1    4  
ATOM 6785  H HG21   . THR C 3 5  ? 1.197   -9.391  6.812   1.00 0.00 ? 5  THR P HG21   4  
ATOM 6786  H HG22   . THR C 3 5  ? 0.813   -10.992 7.215   1.00 0.00 ? 5  THR P HG22   4  
ATOM 6787  H HG23   . THR C 3 5  ? 1.877   -10.078 8.285   1.00 0.00 ? 5  THR P HG23   4  
ATOM 6788  N N      . ARG C 3 6  ? -3.116  -8.090  8.276   1.00 0.00 ? 6  ARG P N      4  
ATOM 6789  C CA     . ARG C 3 6  ? -4.152  -7.411  9.081   1.00 0.00 ? 6  ARG P CA     4  
ATOM 6790  C C      . ARG C 3 6  ? -5.264  -6.618  8.450   1.00 0.00 ? 6  ARG P C      4  
ATOM 6791  O O      . ARG C 3 6  ? -5.988  -5.890  9.120   1.00 0.00 ? 6  ARG P O      4  
ATOM 6792  C CB     . ARG C 3 6  ? -3.437  -6.680  10.278  1.00 0.00 ? 6  ARG P CB     4  
ATOM 6793  C CG     . ARG C 3 6  ? -4.389  -6.462  11.475  1.00 0.00 ? 6  ARG P CG     4  
ATOM 6794  C CD     . ARG C 3 6  ? -4.522  -5.050  12.135  1.00 0.00 ? 6  ARG P CD     4  
ATOM 6795  N NE     . ARG C 3 6  ? -5.291  -4.118  11.307  1.00 0.00 ? 6  ARG P NE     4  
ATOM 6796  C CZ     . ARG C 3 6  ? -5.564  -2.859  11.718  1.00 0.00 ? 6  ARG P CZ     4  
ATOM 6797  N NH1    . ARG C 3 6  ? -5.299  -2.358  12.914  1.00 0.00 ? 6  ARG P NH1    4  
ATOM 6798  N NH2    . ARG C 3 6  ? -6.274  -2.131  10.993  1.00 0.00 ? 6  ARG P NH2    4  
ATOM 6799  H H      . ARG C 3 6  ? -2.584  -7.525  7.629   1.00 0.00 ? 6  ARG P H      4  
ATOM 6800  H HA     . ARG C 3 6  ? -4.667  -8.173  9.666   1.00 0.00 ? 6  ARG P HA     4  
ATOM 6801  H HB2    . ARG C 3 6  ? -2.613  -7.297  10.637  1.00 0.00 ? 6  ARG P HB2    4  
ATOM 6802  H HB3    . ARG C 3 6  ? -3.021  -5.749  9.891   1.00 0.00 ? 6  ARG P HB3    4  
ATOM 6803  H HG2    . ARG C 3 6  ? -5.372  -6.813  11.155  1.00 0.00 ? 6  ARG P HG2    4  
ATOM 6804  H HG3    . ARG C 3 6  ? -4.156  -7.250  12.191  1.00 0.00 ? 6  ARG P HG3    4  
ATOM 6805  H HD2    . ARG C 3 6  ? -5.021  -5.182  13.095  1.00 0.00 ? 6  ARG P HD2    4  
ATOM 6806  H HD3    . ARG C 3 6  ? -3.562  -4.540  12.218  1.00 0.00 ? 6  ARG P HD3    4  
ATOM 6807  H HE     . ARG C 3 6  ? -5.521  -4.518  10.409  1.00 0.00 ? 6  ARG P HE     4  
ATOM 6808  H HH11   . ARG C 3 6  ? -4.966  -3.038  13.584  1.00 0.00 ? 6  ARG P HH11   4  
ATOM 6809  H HH12   . ARG C 3 6  ? -5.631  -1.436  13.163  1.00 0.00 ? 6  ARG P HH12   4  
ATOM 6810  H HH21   . ARG C 3 6  ? -6.653  -2.521  10.142  1.00 0.00 ? 6  ARG P HH21   4  
ATOM 6811  H HH22   . ARG C 3 6  ? -6.544  -1.213  11.313  1.00 0.00 ? 6  ARG P HH22   4  
ATOM 6812  N N      . THR C 3 7  ? -5.586  -6.886  7.219   1.00 0.00 ? 7  THR P N      4  
ATOM 6813  C CA     . THR C 3 7  ? -6.802  -6.442  6.471   1.00 0.00 ? 7  THR P CA     4  
ATOM 6814  C C      . THR C 3 7  ? -7.186  -7.389  5.384   1.00 0.00 ? 7  THR P C      4  
ATOM 6815  O O      . THR C 3 7  ? -6.369  -7.802  4.624   1.00 0.00 ? 7  THR P O      4  
ATOM 6816  C CB     . THR C 3 7  ? -6.750  -4.971  5.865   1.00 0.00 ? 7  THR P CB     4  
ATOM 6817  O OG1    . THR C 3 7  ? -6.409  -3.966  6.740   1.00 0.00 ? 7  THR P OG1    4  
ATOM 6818  C CG2    . THR C 3 7  ? -8.058  -4.521  5.154   1.00 0.00 ? 7  THR P CG2    4  
ATOM 6819  H H      . THR C 3 7  ? -5.113  -7.685  6.820   1.00 0.00 ? 7  THR P H      4  
ATOM 6820  H HA     . THR C 3 7  ? -7.646  -6.472  7.162   1.00 0.00 ? 7  THR P HA     4  
ATOM 6821  H HB     . THR C 3 7  ? -6.005  -4.924  5.071   1.00 0.00 ? 7  THR P HB     4  
ATOM 6822  H HG1    . THR C 3 7  ? -5.488  -4.120  6.958   1.00 0.00 ? 7  THR P HG1    4  
ATOM 6823  H HG21   . THR C 3 7  ? -8.024  -3.464  4.888   1.00 0.00 ? 7  THR P HG21   4  
ATOM 6824  H HG22   . THR C 3 7  ? -8.999  -4.718  5.667   1.00 0.00 ? 7  THR P HG22   4  
ATOM 6825  H HG23   . THR C 3 7  ? -8.156  -5.075  4.222   1.00 0.00 ? 7  THR P HG23   4  
ATOM 6826  N N      . THR C 3 8  ? -8.458  -7.686  5.301   1.00 0.00 ? 8  THR P N      4  
ATOM 6827  C CA     . THR C 3 8  ? -9.159  -8.326  4.152   1.00 0.00 ? 8  THR P CA     4  
ATOM 6828  C C      . THR C 3 8  ? -10.285 -7.397  3.815   1.00 0.00 ? 8  THR P C      4  
ATOM 6829  O O      . THR C 3 8  ? -11.105 -7.153  4.740   1.00 0.00 ? 8  THR P O      4  
ATOM 6830  C CB     . THR C 3 8  ? -9.721  -9.676  4.578   1.00 0.00 ? 8  THR P CB     4  
ATOM 6831  O OG1    . THR C 3 8  ? -8.665  -10.548 4.740   1.00 0.00 ? 8  THR P OG1    4  
ATOM 6832  C CG2    . THR C 3 8  ? -10.728 -10.318 3.643   1.00 0.00 ? 8  THR P CG2    4  
ATOM 6833  H H      . THR C 3 8  ? -9.106  -7.232  5.930   1.00 0.00 ? 8  THR P H      4  
ATOM 6834  H HA     . THR C 3 8  ? -8.589  -8.334  3.223   1.00 0.00 ? 8  THR P HA     4  
ATOM 6835  H HB     . THR C 3 8  ? -10.250 -9.569  5.526   1.00 0.00 ? 8  THR P HB     4  
ATOM 6836  H HG1    . THR C 3 8  ? -8.892  -11.041 5.533   1.00 0.00 ? 8  THR P HG1    4  
ATOM 6837  H HG21   . THR C 3 8  ? -10.318 -10.268 2.635   1.00 0.00 ? 8  THR P HG21   4  
ATOM 6838  H HG22   . THR C 3 8  ? -11.708 -9.845  3.695   1.00 0.00 ? 8  THR P HG22   4  
ATOM 6839  H HG23   . THR C 3 8  ? -10.900 -11.354 3.937   1.00 0.00 ? 8  THR P HG23   4  
ATOM 6840  N N      . PHE C 3 9  ? -10.508 -6.785  2.666   1.00 0.00 ? 9  PHE P N      4  
ATOM 6841  C CA     . PHE C 3 9  ? -11.630 -5.918  2.315   1.00 0.00 ? 9  PHE P CA     4  
ATOM 6842  C C      . PHE C 3 9  ? -12.866 -6.710  2.109   1.00 0.00 ? 9  PHE P C      4  
ATOM 6843  O O      . PHE C 3 9  ? -12.806 -7.892  1.838   1.00 0.00 ? 9  PHE P O      4  
ATOM 6844  C CB     . PHE C 3 9  ? -11.441 -5.094  1.038   1.00 0.00 ? 9  PHE P CB     4  
ATOM 6845  C CG     . PHE C 3 9  ? -10.304 -4.094  0.898   1.00 0.00 ? 9  PHE P CG     4  
ATOM 6846  C CD1    . PHE C 3 9  ? -10.532 -2.783  1.255   1.00 0.00 ? 9  PHE P CD1    4  
ATOM 6847  C CD2    . PHE C 3 9  ? -8.954  -4.445  0.440   1.00 0.00 ? 9  PHE P CD2    4  
ATOM 6848  C CE1    . PHE C 3 9  ? -9.576  -1.769  1.192   1.00 0.00 ? 9  PHE P CE1    4  
ATOM 6849  C CE2    . PHE C 3 9  ? -8.011  -3.386  0.268   1.00 0.00 ? 9  PHE P CE2    4  
ATOM 6850  C CZ     . PHE C 3 9  ? -8.324  -2.027  0.614   1.00 0.00 ? 9  PHE P CZ     4  
ATOM 6851  H H      . PHE C 3 9  ? -9.925  -7.057  1.887   1.00 0.00 ? 9  PHE P H      4  
ATOM 6852  H HA     . PHE C 3 9  ? -11.748 -5.157  3.086   1.00 0.00 ? 9  PHE P HA     4  
ATOM 6853  H HB2    . PHE C 3 9  ? -11.294 -5.825  0.241   1.00 0.00 ? 9  PHE P HB2    4  
ATOM 6854  H HB3    . PHE C 3 9  ? -12.344 -4.575  0.718   1.00 0.00 ? 9  PHE P HB3    4  
ATOM 6855  H HD1    . PHE C 3 9  ? -11.526 -2.502  1.570   1.00 0.00 ? 9  PHE P HD1    4  
ATOM 6856  H HD2    . PHE C 3 9  ? -8.627  -5.474  0.434   1.00 0.00 ? 9  PHE P HD2    4  
ATOM 6857  H HE1    . PHE C 3 9  ? -9.925  -0.785  1.468   1.00 0.00 ? 9  PHE P HE1    4  
ATOM 6858  H HE2    . PHE C 3 9  ? -6.981  -3.564  -0.004  1.00 0.00 ? 9  PHE P HE2    4  
ATOM 6859  H HZ     . PHE C 3 9  ? -7.604  -1.237  0.466   1.00 0.00 ? 9  PHE P HZ     4  
ATOM 6860  N N      . THR C 3 10 ? -13.977 -5.974  2.145   1.00 0.00 ? 10 THR P N      4  
ATOM 6861  C CA     . THR C 3 10 ? -15.324 -6.466  1.744   1.00 0.00 ? 10 THR P CA     4  
ATOM 6862  C C      . THR C 3 10 ? -15.886 -5.677  0.577   1.00 0.00 ? 10 THR P C      4  
ATOM 6863  O O      . THR C 3 10 ? -15.309 -4.618  0.248   1.00 0.00 ? 10 THR P O      4  
ATOM 6864  C CB     . THR C 3 10 ? -16.310 -6.410  2.982   1.00 0.00 ? 10 THR P CB     4  
ATOM 6865  O OG1    . THR C 3 10 ? -16.593 -5.065  3.355   1.00 0.00 ? 10 THR P OG1    4  
ATOM 6866  C CG2    . THR C 3 10 ? -15.857 -7.047  4.284   1.00 0.00 ? 10 THR P CG2    4  
ATOM 6867  H H      . THR C 3 10 ? -13.840 -5.081  2.596   1.00 0.00 ? 10 THR P H      4  
ATOM 6868  H HA     . THR C 3 10 ? -15.279 -7.531  1.518   1.00 0.00 ? 10 THR P HA     4  
ATOM 6869  H HB     . THR C 3 10 ? -17.230 -6.943  2.744   1.00 0.00 ? 10 THR P HB     4  
ATOM 6870  H HG1    . THR C 3 10 ? -16.792 -5.105  4.293   1.00 0.00 ? 10 THR P HG1    4  
ATOM 6871  H HG21   . THR C 3 10 ? -14.927 -6.537  4.534   1.00 0.00 ? 10 THR P HG21   4  
ATOM 6872  H HG22   . THR C 3 10 ? -15.663 -8.079  3.993   1.00 0.00 ? 10 THR P HG22   4  
ATOM 6873  H HG23   . THR C 3 10 ? -16.636 -7.100  5.045   1.00 0.00 ? 10 THR P HG23   4  
ATOM 6874  N N      . SER C 3 11 ? -17.045 -6.036  0.057   1.00 0.00 ? 11 SER P N      4  
ATOM 6875  C CA     . SER C 3 11 ? -17.836 -5.225  -0.921  1.00 0.00 ? 11 SER P CA     4  
ATOM 6876  C C      . SER C 3 11 ? -18.380 -3.979  -0.344  1.00 0.00 ? 11 SER P C      4  
ATOM 6877  O O      . SER C 3 11 ? -18.479 -2.972  -1.002  1.00 0.00 ? 11 SER P O      4  
ATOM 6878  C CB     . SER C 3 11 ? -18.961 -6.056  -1.441  1.00 0.00 ? 11 SER P CB     4  
ATOM 6879  O OG     . SER C 3 11 ? -18.480 -6.922  -2.425  1.00 0.00 ? 11 SER P OG     4  
ATOM 6880  H H      . SER C 3 11 ? -17.343 -6.994  0.165   1.00 0.00 ? 11 SER P H      4  
ATOM 6881  H HA     . SER C 3 11 ? -17.269 -5.072  -1.840  1.00 0.00 ? 11 SER P HA     4  
ATOM 6882  H HB2    . SER C 3 11 ? -19.441 -6.678  -0.684  1.00 0.00 ? 11 SER P HB2    4  
ATOM 6883  H HB3    . SER C 3 11 ? -19.741 -5.452  -1.905  1.00 0.00 ? 11 SER P HB3    4  
ATOM 6884  H HG     . SER C 3 11 ? -17.866 -7.482  -1.945  1.00 0.00 ? 11 SER P HG     4  
ATOM 6885  N N      . SER C 3 12 ? -18.908 -4.038  0.901   1.00 0.00 ? 12 SER P N      4  
ATOM 6886  C CA     . SER C 3 12 ? -19.456 -2.843  1.606   1.00 0.00 ? 12 SER P CA     4  
ATOM 6887  C C      . SER C 3 12 ? -18.289 -1.790  1.693   1.00 0.00 ? 12 SER P C      4  
ATOM 6888  O O      . SER C 3 12 ? -18.611 -0.601  1.516   1.00 0.00 ? 12 SER P O      4  
ATOM 6889  C CB     . SER C 3 12 ? -19.870 -3.193  2.990   1.00 0.00 ? 12 SER P CB     4  
ATOM 6890  O OG     . SER C 3 12 ? -20.728 -4.349  3.099   1.00 0.00 ? 12 SER P OG     4  
ATOM 6891  H H      . SER C 3 12 ? -18.954 -4.961  1.308   1.00 0.00 ? 12 SER P H      4  
ATOM 6892  H HA     . SER C 3 12 ? -20.321 -2.407  1.105   1.00 0.00 ? 12 SER P HA     4  
ATOM 6893  H HB2    . SER C 3 12 ? -19.027 -3.231  3.680   1.00 0.00 ? 12 SER P HB2    4  
ATOM 6894  H HB3    . SER C 3 12 ? -20.319 -2.254  3.314   1.00 0.00 ? 12 SER P HB3    4  
ATOM 6895  H HG     . SER C 3 12 ? -21.246 -4.355  3.907   1.00 0.00 ? 12 SER P HG     4  
ATOM 6896  N N      . GLN C 3 13 ? -17.085 -2.205  2.166   1.00 0.00 ? 13 GLN P N      4  
ATOM 6897  C CA     . GLN C 3 13 ? -16.005 -1.274  2.292   1.00 0.00 ? 13 GLN P CA     4  
ATOM 6898  C C      . GLN C 3 13 ? -15.600 -0.607  0.893   1.00 0.00 ? 13 GLN P C      4  
ATOM 6899  O O      . GLN C 3 13 ? -15.568 0.629   0.833   1.00 0.00 ? 13 GLN P O      4  
ATOM 6900  C CB     . GLN C 3 13 ? -14.825 -1.971  2.894   1.00 0.00 ? 13 GLN P CB     4  
ATOM 6901  C CG     . GLN C 3 13 ? -15.006 -2.379  4.332   1.00 0.00 ? 13 GLN P CG     4  
ATOM 6902  C CD     . GLN C 3 13 ? -13.767 -2.918  4.946   1.00 0.00 ? 13 GLN P CD     4  
ATOM 6903  O OE1    . GLN C 3 13 ? -13.306 -4.008  4.606   1.00 0.00 ? 13 GLN P OE1    4  
ATOM 6904  N NE2    . GLN C 3 13 ? -13.185 -2.274  5.865   1.00 0.00 ? 13 GLN P NE2    4  
ATOM 6905  H H      . GLN C 3 13 ? -16.935 -3.134  2.532   1.00 0.00 ? 13 GLN P H      4  
ATOM 6906  H HA     . GLN C 3 13 ? -16.130 -0.450  2.995   1.00 0.00 ? 13 GLN P HA     4  
ATOM 6907  H HB2    . GLN C 3 13 ? -14.446 -2.879  2.423   1.00 0.00 ? 13 GLN P HB2    4  
ATOM 6908  H HB3    . GLN C 3 13 ? -14.016 -1.243  2.830   1.00 0.00 ? 13 GLN P HB3    4  
ATOM 6909  H HG2    . GLN C 3 13 ? -15.230 -1.439  4.836   1.00 0.00 ? 13 GLN P HG2    4  
ATOM 6910  H HG3    . GLN C 3 13 ? -15.803 -3.115  4.440   1.00 0.00 ? 13 GLN P HG3    4  
ATOM 6911  H HE21   . GLN C 3 13 ? -13.680 -1.482  6.251   1.00 0.00 ? 13 GLN P HE21   4  
ATOM 6912  H HE22   . GLN C 3 13 ? -12.230 -2.460  6.130   1.00 0.00 ? 13 GLN P HE22   4  
ATOM 6913  N N      . ILE C 3 14 ? -15.398 -1.438  -0.128  1.00 0.00 ? 14 ILE P N      4  
ATOM 6914  C CA     . ILE C 3 14 ? -15.184 -0.906  -1.547  1.00 0.00 ? 14 ILE P CA     4  
ATOM 6915  C C      . ILE C 3 14 ? -16.271 0.096   -2.044  1.00 0.00 ? 14 ILE P C      4  
ATOM 6916  O O      . ILE C 3 14 ? -16.002 1.015   -2.863  1.00 0.00 ? 14 ILE P O      4  
ATOM 6917  C CB     . ILE C 3 14 ? -15.060 -2.150  -2.514  1.00 0.00 ? 14 ILE P CB     4  
ATOM 6918  C CG1    . ILE C 3 14 ? -13.735 -2.931  -2.150  1.00 0.00 ? 14 ILE P CG1    4  
ATOM 6919  C CG2    . ILE C 3 14 ? -15.192 -1.633  -3.968  1.00 0.00 ? 14 ILE P CG2    4  
ATOM 6920  C CD1    . ILE C 3 14 ? -13.662 -4.216  -2.993  1.00 0.00 ? 14 ILE P CD1    4  
ATOM 6921  H H      . ILE C 3 14 ? -15.399 -2.433  0.046   1.00 0.00 ? 14 ILE P H      4  
ATOM 6922  H HA     . ILE C 3 14 ? -14.297 -0.278  -1.475  1.00 0.00 ? 14 ILE P HA     4  
ATOM 6923  H HB     . ILE C 3 14 ? -15.865 -2.858  -2.321  1.00 0.00 ? 14 ILE P HB     4  
ATOM 6924  H HG12   . ILE C 3 14 ? -12.846 -2.337  -2.364  1.00 0.00 ? 14 ILE P HG12   4  
ATOM 6925  H HG13   . ILE C 3 14 ? -13.843 -3.178  -1.095  1.00 0.00 ? 14 ILE P HG13   4  
ATOM 6926  H HG21   . ILE C 3 14 ? -14.466 -0.874  -4.262  1.00 0.00 ? 14 ILE P HG21   4  
ATOM 6927  H HG22   . ILE C 3 14 ? -14.746 -2.411  -4.587  1.00 0.00 ? 14 ILE P HG22   4  
ATOM 6928  H HG23   . ILE C 3 14 ? -16.219 -1.474  -4.296  1.00 0.00 ? 14 ILE P HG23   4  
ATOM 6929  H HD11   . ILE C 3 14 ? -14.627 -4.555  -3.366  1.00 0.00 ? 14 ILE P HD11   4  
ATOM 6930  H HD12   . ILE C 3 14 ? -12.876 -4.214  -3.749  1.00 0.00 ? 14 ILE P HD12   4  
ATOM 6931  H HD13   . ILE C 3 14 ? -13.481 -5.023  -2.282  1.00 0.00 ? 14 ILE P HD13   4  
ATOM 6932  N N      . ALA C 3 15 ? -17.502 -0.129  -1.562  1.00 0.00 ? 15 ALA P N      4  
ATOM 6933  C CA     . ALA C 3 15 ? -18.686 0.676   -1.843  1.00 0.00 ? 15 ALA P CA     4  
ATOM 6934  C C      . ALA C 3 15 ? -18.628 2.059   -1.170  1.00 0.00 ? 15 ALA P C      4  
ATOM 6935  O O      . ALA C 3 15 ? -18.780 3.046   -1.900  1.00 0.00 ? 15 ALA P O      4  
ATOM 6936  C CB     . ALA C 3 15 ? -19.913 0.030   -1.484  1.00 0.00 ? 15 ALA P CB     4  
ATOM 6937  H H      . ALA C 3 15 ? -17.581 -0.867  -0.877  1.00 0.00 ? 15 ALA P H      4  
ATOM 6938  H HA     . ALA C 3 15 ? -18.622 0.815   -2.922  1.00 0.00 ? 15 ALA P HA     4  
ATOM 6939  H HB1    . ALA C 3 15 ? -19.868 -0.202  -0.421  1.00 0.00 ? 15 ALA P HB1    4  
ATOM 6940  H HB2    . ALA C 3 15 ? -20.770 0.668   -1.698  1.00 0.00 ? 15 ALA P HB2    4  
ATOM 6941  H HB3    . ALA C 3 15 ? -20.008 -0.884  -2.068  1.00 0.00 ? 15 ALA P HB3    4  
ATOM 6942  N N      . GLU C 3 16 ? -18.427 2.087   0.119   1.00 0.00 ? 16 GLU P N      4  
ATOM 6943  C CA     . GLU C 3 16 ? -18.200 3.361   0.834   1.00 0.00 ? 16 GLU P CA     4  
ATOM 6944  C C      . GLU C 3 16 ? -16.982 4.081   0.211   1.00 0.00 ? 16 GLU P C      4  
ATOM 6945  O O      . GLU C 3 16 ? -17.059 5.292   0.021   1.00 0.00 ? 16 GLU P O      4  
ATOM 6946  C CB     . GLU C 3 16 ? -17.763 3.023   2.278   1.00 0.00 ? 16 GLU P CB     4  
ATOM 6947  C CG     . GLU C 3 16 ? -18.620 2.457   3.348   1.00 0.00 ? 16 GLU P CG     4  
ATOM 6948  C CD     . GLU C 3 16 ? -19.917 3.203   3.641   1.00 0.00 ? 16 GLU P CD     4  
ATOM 6949  O OE1    . GLU C 3 16 ? -19.918 3.947   4.626   1.00 0.00 ? 16 GLU P OE1    4  
ATOM 6950  O OE2    . GLU C 3 16 ? -20.975 3.030   2.999   1.00 0.00 ? 16 GLU P OE2    4  
ATOM 6951  H H      . GLU C 3 16 ? -18.210 1.200   0.552   1.00 0.00 ? 16 GLU P H      4  
ATOM 6952  H HA     . GLU C 3 16 ? -19.024 4.071   0.764   1.00 0.00 ? 16 GLU P HA     4  
ATOM 6953  H HB2    . GLU C 3 16 ? -16.921 2.334   2.229   1.00 0.00 ? 16 GLU P HB2    4  
ATOM 6954  H HB3    . GLU C 3 16 ? -17.409 4.010   2.579   1.00 0.00 ? 16 GLU P HB3    4  
ATOM 6955  H HG2    . GLU C 3 16 ? -18.903 1.461   3.009   1.00 0.00 ? 16 GLU P HG2    4  
ATOM 6956  H HG3    . GLU C 3 16 ? -18.022 2.337   4.252   1.00 0.00 ? 16 GLU P HG3    4  
ATOM 6957  N N      . LEU C 3 17 ? -15.864 3.342   -0.126  1.00 0.00 ? 17 LEU P N      4  
ATOM 6958  C CA     . LEU C 3 17 ? -14.608 3.882   -0.648  1.00 0.00 ? 17 LEU P CA     4  
ATOM 6959  C C      . LEU C 3 17 ? -14.953 4.549   -1.963  1.00 0.00 ? 17 LEU P C      4  
ATOM 6960  O O      . LEU C 3 17 ? -14.664 5.742   -1.988  1.00 0.00 ? 17 LEU P O      4  
ATOM 6961  C CB     . LEU C 3 17 ? -13.564 2.769   -0.815  1.00 0.00 ? 17 LEU P CB     4  
ATOM 6962  C CG     . LEU C 3 17 ? -12.833 2.455   0.470   1.00 0.00 ? 17 LEU P CG     4  
ATOM 6963  C CD1    . LEU C 3 17 ? -12.047 1.174   0.605   1.00 0.00 ? 17 LEU P CD1    4  
ATOM 6964  C CD2    . LEU C 3 17 ? -11.738 3.468   0.884   1.00 0.00 ? 17 LEU P CD2    4  
ATOM 6965  H H      . LEU C 3 17 ? -16.009 2.362   0.074   1.00 0.00 ? 17 LEU P H      4  
ATOM 6966  H HA     . LEU C 3 17 ? -14.281 4.658   0.044   1.00 0.00 ? 17 LEU P HA     4  
ATOM 6967  H HB2    . LEU C 3 17 ? -13.926 1.802   -1.161  1.00 0.00 ? 17 LEU P HB2    4  
ATOM 6968  H HB3    . LEU C 3 17 ? -12.896 3.054   -1.628  1.00 0.00 ? 17 LEU P HB3    4  
ATOM 6969  H HG     . LEU C 3 17 ? -13.598 2.444   1.247   1.00 0.00 ? 17 LEU P HG     4  
ATOM 6970  H HD11   . LEU C 3 17 ? -12.045 0.937   1.668   1.00 0.00 ? 17 LEU P HD11   4  
ATOM 6971  H HD12   . LEU C 3 17 ? -10.993 1.150   0.323   1.00 0.00 ? 17 LEU P HD12   4  
ATOM 6972  H HD13   . LEU C 3 17 ? -12.631 0.338   0.218   1.00 0.00 ? 17 LEU P HD13   4  
ATOM 6973  H HD21   . LEU C 3 17 ? -10.971 3.547   0.114   1.00 0.00 ? 17 LEU P HD21   4  
ATOM 6974  H HD22   . LEU C 3 17 ? -11.363 3.161   1.861   1.00 0.00 ? 17 LEU P HD22   4  
ATOM 6975  H HD23   . LEU C 3 17 ? -12.295 4.397   1.004   1.00 0.00 ? 17 LEU P HD23   4  
ATOM 6976  N N      . GLU C 3 18 ? -15.666 3.886   -2.892  1.00 0.00 ? 18 GLU P N      4  
ATOM 6977  C CA     . GLU C 3 18 ? -16.173 4.592   -4.076  1.00 0.00 ? 18 GLU P CA     4  
ATOM 6978  C C      . GLU C 3 18 ? -17.084 5.798   -3.795  1.00 0.00 ? 18 GLU P C      4  
ATOM 6979  O O      . GLU C 3 18 ? -16.924 6.872   -4.417  1.00 0.00 ? 18 GLU P O      4  
ATOM 6980  C CB     . GLU C 3 18 ? -16.934 3.575   -4.992  1.00 0.00 ? 18 GLU P CB     4  
ATOM 6981  C CG     . GLU C 3 18 ? -15.888 2.656   -5.642  1.00 0.00 ? 18 GLU P CG     4  
ATOM 6982  C CD     . GLU C 3 18 ? -16.264 2.108   -7.045  1.00 0.00 ? 18 GLU P CD     4  
ATOM 6983  O OE1    . GLU C 3 18 ? -15.354 1.955   -7.920  1.00 0.00 ? 18 GLU P OE1    4  
ATOM 6984  O OE2    . GLU C 3 18 ? -17.415 1.774   -7.272  1.00 0.00 ? 18 GLU P OE2    4  
ATOM 6985  H H      . GLU C 3 18 ? -15.747 2.880   -2.885  1.00 0.00 ? 18 GLU P H      4  
ATOM 6986  H HA     . GLU C 3 18 ? -15.377 5.024   -4.683  1.00 0.00 ? 18 GLU P HA     4  
ATOM 6987  H HB2    . GLU C 3 18 ? -17.674 3.005   -4.432  1.00 0.00 ? 18 GLU P HB2    4  
ATOM 6988  H HB3    . GLU C 3 18 ? -17.482 4.165   -5.727  1.00 0.00 ? 18 GLU P HB3    4  
ATOM 6989  H HG2    . GLU C 3 18 ? -14.941 3.174   -5.797  1.00 0.00 ? 18 GLU P HG2    4  
ATOM 6990  H HG3    . GLU C 3 18 ? -15.642 1.842   -4.960  1.00 0.00 ? 18 GLU P HG3    4  
ATOM 6991  N N      . GLN C 3 19 ? -17.998 5.750   -2.846  1.00 0.00 ? 19 GLN P N      4  
ATOM 6992  C CA     . GLN C 3 19 ? -18.933 6.821   -2.539  1.00 0.00 ? 19 GLN P CA     4  
ATOM 6993  C C      . GLN C 3 19 ? -18.375 8.114   -2.061  1.00 0.00 ? 19 GLN P C      4  
ATOM 6994  O O      . GLN C 3 19 ? -18.828 9.223   -2.389  1.00 0.00 ? 19 GLN P O      4  
ATOM 6995  C CB     . GLN C 3 19 ? -19.997 6.188   -1.574  1.00 0.00 ? 19 GLN P CB     4  
ATOM 6996  C CG     . GLN C 3 19 ? -21.286 6.980   -1.416  1.00 0.00 ? 19 GLN P CG     4  
ATOM 6997  C CD     . GLN C 3 19 ? -21.900 7.222   -2.753  1.00 0.00 ? 19 GLN P CD     4  
ATOM 6998  O OE1    . GLN C 3 19 ? -22.182 6.242   -3.443  1.00 0.00 ? 19 GLN P OE1    4  
ATOM 6999  N NE2    . GLN C 3 19 ? -22.210 8.472   -3.155  1.00 0.00 ? 19 GLN P NE2    4  
ATOM 7000  H H      . GLN C 3 19 ? -17.986 4.967   -2.210  1.00 0.00 ? 19 GLN P H      4  
ATOM 7001  H HA     . GLN C 3 19 ? -19.337 7.117   -3.507  1.00 0.00 ? 19 GLN P HA     4  
ATOM 7002  H HB2    . GLN C 3 19 ? -20.354 5.244   -1.986  1.00 0.00 ? 19 GLN P HB2    4  
ATOM 7003  H HB3    . GLN C 3 19 ? -19.618 6.082   -0.557  1.00 0.00 ? 19 GLN P HB3    4  
ATOM 7004  H HG2    . GLN C 3 19 ? -21.917 6.431   -0.717  1.00 0.00 ? 19 GLN P HG2    4  
ATOM 7005  H HG3    . GLN C 3 19 ? -21.066 7.934   -0.937  1.00 0.00 ? 19 GLN P HG3    4  
ATOM 7006  H HE21   . GLN C 3 19 ? -21.997 9.214   -2.503  1.00 0.00 ? 19 GLN P HE21   4  
ATOM 7007  H HE22   . GLN C 3 19 ? -22.702 8.524   -4.035  1.00 0.00 ? 19 GLN P HE22   4  
ATOM 7008  N N      . HIS C 3 20 ? -17.404 8.011   -1.181  1.00 0.00 ? 20 HIS P N      4  
ATOM 7009  C CA     . HIS C 3 20 ? -16.725 9.202   -0.526  1.00 0.00 ? 20 HIS P CA     4  
ATOM 7010  C C      . HIS C 3 20 ? -15.689 9.714   -1.544  1.00 0.00 ? 20 HIS P C      4  
ATOM 7011  O O      . HIS C 3 20 ? -15.749 10.921  -1.978  1.00 0.00 ? 20 HIS P O      4  
ATOM 7012  C CB     . HIS C 3 20 ? -16.267 8.874   0.891   1.00 0.00 ? 20 HIS P CB     4  
ATOM 7013  C CG     . HIS C 3 20 ? -17.415 8.692   1.763   1.00 0.00 ? 20 HIS P CG     4  
ATOM 7014  N ND1    . HIS C 3 20 ? -18.214 9.672   2.237   1.00 0.00 ? 20 HIS P ND1    4  
ATOM 7015  C CD2    . HIS C 3 20 ? -17.998 7.495   2.156   1.00 0.00 ? 20 HIS P CD2    4  
ATOM 7016  C CE1    . HIS C 3 20 ? -19.219 9.085   2.858   1.00 0.00 ? 20 HIS P CE1    4  
ATOM 7017  N NE2    . HIS C 3 20 ? -19.117 7.772   2.886   1.00 0.00 ? 20 HIS P NE2    4  
ATOM 7018  H H      . HIS C 3 20 ? -17.172 7.116   -0.772  1.00 0.00 ? 20 HIS P H      4  
ATOM 7019  H HA     . HIS C 3 20 ? -17.402 10.032  -0.326  1.00 0.00 ? 20 HIS P HA     4  
ATOM 7020  H HB2    . HIS C 3 20 ? -15.607 8.008   0.857   1.00 0.00 ? 20 HIS P HB2    4  
ATOM 7021  H HB3    . HIS C 3 20 ? -15.756 9.736   1.319   1.00 0.00 ? 20 HIS P HB3    4  
ATOM 7022  H HD1    . HIS C 3 20 ? -18.128 10.670  2.107   1.00 0.00 ? 20 HIS P HD1    4  
ATOM 7023  H HD2    . HIS C 3 20 ? -17.742 6.472   1.928   1.00 0.00 ? 20 HIS P HD2    4  
ATOM 7024  H HE1    . HIS C 3 20 ? -20.073 9.653   3.196   1.00 0.00 ? 20 HIS P HE1    4  
ATOM 7025  N N      . PHE C 3 21 ? -14.975 8.834   -2.252  1.00 0.00 ? 21 PHE P N      4  
ATOM 7026  C CA     . PHE C 3 21 ? -14.109 9.147   -3.467  1.00 0.00 ? 21 PHE P CA     4  
ATOM 7027  C C      . PHE C 3 21 ? -14.917 10.027  -4.394  1.00 0.00 ? 21 PHE P C      4  
ATOM 7028  O O      . PHE C 3 21 ? -14.381 11.021  -4.887  1.00 0.00 ? 21 PHE P O      4  
ATOM 7029  C CB     . PHE C 3 21 ? -13.652 7.890   -4.137  1.00 0.00 ? 21 PHE P CB     4  
ATOM 7030  C CG     . PHE C 3 21 ? -13.253 8.180   -5.612  1.00 0.00 ? 21 PHE P CG     4  
ATOM 7031  C CD1    . PHE C 3 21 ? -14.194 8.045   -6.562  1.00 0.00 ? 21 PHE P CD1    4  
ATOM 7032  C CD2    . PHE C 3 21 ? -11.928 8.454   -5.893  1.00 0.00 ? 21 PHE P CD2    4  
ATOM 7033  C CE1    . PHE C 3 21 ? -13.891 8.327   -7.905  1.00 0.00 ? 21 PHE P CE1    4  
ATOM 7034  C CE2    . PHE C 3 21 ? -11.596 8.604   -7.254  1.00 0.00 ? 21 PHE P CE2    4  
ATOM 7035  C CZ     . PHE C 3 21 ? -12.584 8.602   -8.208  1.00 0.00 ? 21 PHE P CZ     4  
ATOM 7036  H H      . PHE C 3 21 ? -14.968 7.896   -1.877  1.00 0.00 ? 21 PHE P H      4  
ATOM 7037  H HA     . PHE C 3 21 ? -13.206 9.701   -3.211  1.00 0.00 ? 21 PHE P HA     4  
ATOM 7038  H HB2    . PHE C 3 21 ? -12.803 7.574   -3.531  1.00 0.00 ? 21 PHE P HB2    4  
ATOM 7039  H HB3    . PHE C 3 21 ? -14.478 7.180   -4.082  1.00 0.00 ? 21 PHE P HB3    4  
ATOM 7040  H HD1    . PHE C 3 21 ? -15.212 7.736   -6.372  1.00 0.00 ? 21 PHE P HD1    4  
ATOM 7041  H HD2    . PHE C 3 21 ? -11.201 8.567   -5.102  1.00 0.00 ? 21 PHE P HD2    4  
ATOM 7042  H HE1    . PHE C 3 21 ? -14.740 8.492   -8.553  1.00 0.00 ? 21 PHE P HE1    4  
ATOM 7043  H HE2    . PHE C 3 21 ? -10.542 8.751   -7.433  1.00 0.00 ? 21 PHE P HE2    4  
ATOM 7044  H HZ     . PHE C 3 21 ? -12.305 8.808   -9.231  1.00 0.00 ? 21 PHE P HZ     4  
ATOM 7045  N N      . LEU C 3 22 ? -16.227 9.890   -4.655  1.00 0.00 ? 22 LEU P N      4  
ATOM 7046  C CA     . LEU C 3 22 ? -16.988 10.714  -5.647  1.00 0.00 ? 22 LEU P CA     4  
ATOM 7047  C C      . LEU C 3 22 ? -16.878 12.253  -5.252  1.00 0.00 ? 22 LEU P C      4  
ATOM 7048  O O      . LEU C 3 22 ? -16.826 13.148  -6.137  1.00 0.00 ? 22 LEU P O      4  
ATOM 7049  C CB     . LEU C 3 22 ? -18.462 10.379  -5.820  1.00 0.00 ? 22 LEU P CB     4  
ATOM 7050  C CG     . LEU C 3 22 ? -18.846 8.906   -6.136  1.00 0.00 ? 22 LEU P CG     4  
ATOM 7051  C CD1    . LEU C 3 22 ? -20.376 8.701   -6.159  1.00 0.00 ? 22 LEU P CD1    4  
ATOM 7052  C CD2    . LEU C 3 22 ? -18.334 8.491   -7.515  1.00 0.00 ? 22 LEU P CD2    4  
ATOM 7053  H H      . LEU C 3 22 ? -16.659 9.069   -4.258  1.00 0.00 ? 22 LEU P H      4  
ATOM 7054  H HA     . LEU C 3 22 ? -16.440 10.522  -6.569  1.00 0.00 ? 22 LEU P HA     4  
ATOM 7055  H HB2    . LEU C 3 22 ? -19.088 10.679  -4.980  1.00 0.00 ? 22 LEU P HB2    4  
ATOM 7056  H HB3    . LEU C 3 22 ? -18.822 10.912  -6.701  1.00 0.00 ? 22 LEU P HB3    4  
ATOM 7057  H HG     . LEU C 3 22 ? -18.343 8.338   -5.354  1.00 0.00 ? 22 LEU P HG     4  
ATOM 7058  H HD11   . LEU C 3 22 ? -20.914 9.336   -5.455  1.00 0.00 ? 22 LEU P HD11   4  
ATOM 7059  H HD12   . LEU C 3 22 ? -20.580 7.652   -5.942  1.00 0.00 ? 22 LEU P HD12   4  
ATOM 7060  H HD13   . LEU C 3 22 ? -20.663 8.997   -7.168  1.00 0.00 ? 22 LEU P HD13   4  
ATOM 7061  H HD21   . LEU C 3 22 ? -18.756 7.516   -7.760  1.00 0.00 ? 22 LEU P HD21   4  
ATOM 7062  H HD22   . LEU C 3 22 ? -17.259 8.583   -7.668  1.00 0.00 ? 22 LEU P HD22   4  
ATOM 7063  H HD23   . LEU C 3 22 ? -18.738 9.181   -8.257  1.00 0.00 ? 22 LEU P HD23   4  
ATOM 7064  N N      . GLN C 3 23 ? -16.756 12.551  -3.990  1.00 0.00 ? 23 GLN P N      4  
ATOM 7065  C CA     . GLN C 3 23 ? -16.666 13.888  -3.414  1.00 0.00 ? 23 GLN P CA     4  
ATOM 7066  C C      . GLN C 3 23 ? -15.295 14.574  -3.479  1.00 0.00 ? 23 GLN P C      4  
ATOM 7067  O O      . GLN C 3 23 ? -15.063 15.765  -3.370  1.00 0.00 ? 23 GLN P O      4  
ATOM 7068  C CB     . GLN C 3 23 ? -17.224 13.815  -1.977  1.00 0.00 ? 23 GLN P CB     4  
ATOM 7069  C CG     . GLN C 3 23 ? -18.532 12.942  -1.701  1.00 0.00 ? 23 GLN P CG     4  
ATOM 7070  C CD     . GLN C 3 23 ? -19.781 13.139  -2.622  1.00 0.00 ? 23 GLN P CD     4  
ATOM 7071  O OE1    . GLN C 3 23 ? -20.223 14.231  -2.902  1.00 0.00 ? 23 GLN P OE1    4  
ATOM 7072  N NE2    . GLN C 3 23 ? -20.367 12.024  -2.995  1.00 0.00 ? 23 GLN P NE2    4  
ATOM 7073  H H      . GLN C 3 23 ? -16.536 11.717  -3.465  1.00 0.00 ? 23 GLN P H      4  
ATOM 7074  H HA     . GLN C 3 23 ? -17.324 14.629  -3.867  1.00 0.00 ? 23 GLN P HA     4  
ATOM 7075  H HB2    . GLN C 3 23 ? -16.415 13.375  -1.393  1.00 0.00 ? 23 GLN P HB2    4  
ATOM 7076  H HB3    . GLN C 3 23 ? -17.371 14.818  -1.576  1.00 0.00 ? 23 GLN P HB3    4  
ATOM 7077  H HG2    . GLN C 3 23 ? -18.274 11.885  -1.638  1.00 0.00 ? 23 GLN P HG2    4  
ATOM 7078  H HG3    . GLN C 3 23 ? -18.889 13.177  -0.698  1.00 0.00 ? 23 GLN P HG3    4  
ATOM 7079  H HE21   . GLN C 3 23 ? -20.129 11.106  -2.650  1.00 0.00 ? 23 GLN P HE21   4  
ATOM 7080  H HE22   . GLN C 3 23 ? -21.065 12.049  -3.724  1.00 0.00 ? 23 GLN P HE22   4  
ATOM 7081  N N      . GLY C 3 24 ? -14.299 13.696  -3.535  1.00 0.00 ? 24 GLY P N      4  
ATOM 7082  C CA     . GLY C 3 24 ? -12.836 13.938  -3.602  1.00 0.00 ? 24 GLY P CA     4  
ATOM 7083  C C      . GLY C 3 24 ? -12.025 12.719  -3.965  1.00 0.00 ? 24 GLY P C      4  
ATOM 7084  O O      . GLY C 3 24 ? -11.860 11.829  -3.142  1.00 0.00 ? 24 GLY P O      4  
ATOM 7085  H H      . GLY C 3 24 ? -14.580 12.736  -3.676  1.00 0.00 ? 24 GLY P H      4  
ATOM 7086  H HA2    . GLY C 3 24 ? -12.680 14.789  -4.267  1.00 0.00 ? 24 GLY P HA2    4  
ATOM 7087  H HA3    . GLY C 3 24 ? -12.462 14.248  -2.626  1.00 0.00 ? 24 GLY P HA3    4  
ATOM 7088  N N      . ARG C 3 25 ? -11.669 12.710  -5.257  1.00 0.00 ? 25 ARG P N      4  
ATOM 7089  C CA     . ARG C 3 25 ? -10.907 11.729  -5.995  1.00 0.00 ? 25 ARG P CA     4  
ATOM 7090  C C      . ARG C 3 25 ? -9.490  11.415  -5.505  1.00 0.00 ? 25 ARG P C      4  
ATOM 7091  O O      . ARG C 3 25 ? -8.909  10.416  -5.973  1.00 0.00 ? 25 ARG P O      4  
ATOM 7092  C CB     . ARG C 3 25 ? -10.932 12.149  -7.503  1.00 0.00 ? 25 ARG P CB     4  
ATOM 7093  C CG     . ARG C 3 25 ? -12.287 12.192  -8.365  1.00 0.00 ? 25 ARG P CG     4  
ATOM 7094  C CD     . ARG C 3 25 ? -13.365 13.234  -7.963  1.00 0.00 ? 25 ARG P CD     4  
ATOM 7095  N NE     . ARG C 3 25 ? -12.795 14.585  -7.879  1.00 0.00 ? 25 ARG P NE     4  
ATOM 7096  C CZ     . ARG C 3 25 ? -13.453 15.641  -7.460  1.00 0.00 ? 25 ARG P CZ     4  
ATOM 7097  N NH1    . ARG C 3 25 ? -14.640 15.553  -7.010  1.00 0.00 ? 25 ARG P NH1    4  
ATOM 7098  N NH2    . ARG C 3 25 ? -12.833 16.846  -7.500  1.00 0.00 ? 25 ARG P NH2    4  
ATOM 7099  H H      . ARG C 3 25 ? -11.579 13.616  -5.693  1.00 0.00 ? 25 ARG P H      4  
ATOM 7100  H HA     . ARG C 3 25 ? -11.359 10.737  -5.997  1.00 0.00 ? 25 ARG P HA     4  
ATOM 7101  H HB2    . ARG C 3 25 ? -10.519 13.156  -7.560  1.00 0.00 ? 25 ARG P HB2    4  
ATOM 7102  H HB3    . ARG C 3 25 ? -10.180 11.475  -7.916  1.00 0.00 ? 25 ARG P HB3    4  
ATOM 7103  H HG2    . ARG C 3 25 ? -12.019 12.318  -9.413  1.00 0.00 ? 25 ARG P HG2    4  
ATOM 7104  H HG3    . ARG C 3 25 ? -12.758 11.210  -8.407  1.00 0.00 ? 25 ARG P HG3    4  
ATOM 7105  H HD2    . ARG C 3 25 ? -14.222 13.000  -8.594  1.00 0.00 ? 25 ARG P HD2    4  
ATOM 7106  H HD3    . ARG C 3 25 ? -13.741 12.954  -6.979  1.00 0.00 ? 25 ARG P HD3    4  
ATOM 7107  H HE     . ARG C 3 25 ? -11.920 14.726  -8.364  1.00 0.00 ? 25 ARG P HE     4  
ATOM 7108  H HH11   . ARG C 3 25 ? -15.102 14.657  -7.076  1.00 0.00 ? 25 ARG P HH11   4  
ATOM 7109  H HH12   . ARG C 3 25 ? -15.163 16.381  -6.765  1.00 0.00 ? 25 ARG P HH12   4  
ATOM 7110  H HH21   . ARG C 3 25 ? -11.880 16.986  -7.806  1.00 0.00 ? 25 ARG P HH21   4  
ATOM 7111  H HH22   . ARG C 3 25 ? -13.465 17.632  -7.429  1.00 0.00 ? 25 ARG P HH22   4  
ATOM 7112  N N      . TYR C 3 26 ? -9.028  12.197  -4.511  1.00 0.00 ? 26 TYR P N      4  
ATOM 7113  C CA     . TYR C 3 26 ? -7.640  12.196  -3.991  1.00 0.00 ? 26 TYR P CA     4  
ATOM 7114  C C      . TYR C 3 26 ? -7.685  12.286  -2.418  1.00 0.00 ? 26 TYR P C      4  
ATOM 7115  O O      . TYR C 3 26 ? -8.566  12.959  -1.831  1.00 0.00 ? 26 TYR P O      4  
ATOM 7116  C CB     . TYR C 3 26 ? -6.789  13.324  -4.531  1.00 0.00 ? 26 TYR P CB     4  
ATOM 7117  C CG     . TYR C 3 26 ? -6.673  13.263  -6.029  1.00 0.00 ? 26 TYR P CG     4  
ATOM 7118  C CD1    . TYR C 3 26 ? -5.527  12.689  -6.569  1.00 0.00 ? 26 TYR P CD1    4  
ATOM 7119  C CD2    . TYR C 3 26 ? -7.764  13.556  -6.868  1.00 0.00 ? 26 TYR P CD2    4  
ATOM 7120  C CE1    . TYR C 3 26 ? -5.510  12.361  -7.939  1.00 0.00 ? 26 TYR P CE1    4  
ATOM 7121  C CE2    . TYR C 3 26 ? -7.747  13.199  -8.223  1.00 0.00 ? 26 TYR P CE2    4  
ATOM 7122  C CZ     . TYR C 3 26 ? -6.581  12.609  -8.793  1.00 0.00 ? 26 TYR P CZ     4  
ATOM 7123  O OH     . TYR C 3 26 ? -6.587  12.071  -10.111 1.00 0.00 ? 26 TYR P OH     4  
ATOM 7124  H H      . TYR C 3 26 ? -9.639  12.955  -4.243  1.00 0.00 ? 26 TYR P H      4  
ATOM 7125  H HA     . TYR C 3 26 ? -7.182  11.246  -4.263  1.00 0.00 ? 26 TYR P HA     4  
ATOM 7126  H HB2    . TYR C 3 26 ? -7.218  14.306  -4.334  1.00 0.00 ? 26 TYR P HB2    4  
ATOM 7127  H HB3    . TYR C 3 26 ? -5.768  13.344  -4.150  1.00 0.00 ? 26 TYR P HB3    4  
ATOM 7128  H HD1    . TYR C 3 26 ? -4.725  12.310  -5.953  1.00 0.00 ? 26 TYR P HD1    4  
ATOM 7129  H HD2    . TYR C 3 26 ? -8.602  14.133  -6.505  1.00 0.00 ? 26 TYR P HD2    4  
ATOM 7130  H HE1    . TYR C 3 26 ? -4.687  11.779  -8.326  1.00 0.00 ? 26 TYR P HE1    4  
ATOM 7131  H HE2    . TYR C 3 26 ? -8.583  13.374  -8.884  1.00 0.00 ? 26 TYR P HE2    4  
ATOM 7132  H HH     . TYR C 3 26 ? -5.717  11.727  -10.329 1.00 0.00 ? 26 TYR P HH     4  
ATOM 7133  N N      . LEU C 3 27 ? -6.705  11.587  -1.719  1.00 0.00 ? 27 LEU P N      4  
ATOM 7134  C CA     . LEU C 3 27 ? -6.682  11.490  -0.219  1.00 0.00 ? 27 LEU P CA     4  
ATOM 7135  C C      . LEU C 3 27 ? -6.027  12.788  0.384   1.00 0.00 ? 27 LEU P C      4  
ATOM 7136  O O      . LEU C 3 27 ? -5.196  13.416  -0.245  1.00 0.00 ? 27 LEU P O      4  
ATOM 7137  C CB     . LEU C 3 27 ? -6.028  10.225  0.284   1.00 0.00 ? 27 LEU P CB     4  
ATOM 7138  C CG     . LEU C 3 27 ? -7.079  9.149   0.533   1.00 0.00 ? 27 LEU P CG     4  
ATOM 7139  C CD1    . LEU C 3 27 ? -6.490  7.777   0.742   1.00 0.00 ? 27 LEU P CD1    4  
ATOM 7140  C CD2    . LEU C 3 27 ? -8.100  9.455   1.551   1.00 0.00 ? 27 LEU P CD2    4  
ATOM 7141  H H      . LEU C 3 27 ? -5.885  11.260  -2.209  1.00 0.00 ? 27 LEU P H      4  
ATOM 7142  H HA     . LEU C 3 27 ? -7.701  11.622  0.145   1.00 0.00 ? 27 LEU P HA     4  
ATOM 7143  H HB2    . LEU C 3 27 ? -5.247  9.868   -0.386  1.00 0.00 ? 27 LEU P HB2    4  
ATOM 7144  H HB3    . LEU C 3 27 ? -5.666  10.469  1.283   1.00 0.00 ? 27 LEU P HB3    4  
ATOM 7145  H HG     . LEU C 3 27 ? -7.602  9.074   -0.420  1.00 0.00 ? 27 LEU P HG     4  
ATOM 7146  H HD11   . LEU C 3 27 ? -5.575  7.856   1.328   1.00 0.00 ? 27 LEU P HD11   4  
ATOM 7147  H HD12   . LEU C 3 27 ? -6.425  7.297   -0.234  1.00 0.00 ? 27 LEU P HD12   4  
ATOM 7148  H HD13   . LEU C 3 27 ? -7.143  7.239   1.429   1.00 0.00 ? 27 LEU P HD13   4  
ATOM 7149  H HD21   . LEU C 3 27 ? -8.671  8.576   1.850   1.00 0.00 ? 27 LEU P HD21   4  
ATOM 7150  H HD22   . LEU C 3 27 ? -8.770  10.253  1.231   1.00 0.00 ? 27 LEU P HD22   4  
ATOM 7151  H HD23   . LEU C 3 27 ? -7.699  9.919   2.453   1.00 0.00 ? 27 LEU P HD23   4  
ATOM 7152  N N      . THR C 3 28 ? -6.324  13.041  1.656   1.00 0.00 ? 28 THR P N      4  
ATOM 7153  C CA     . THR C 3 28 ? -5.819  13.974  2.634   1.00 0.00 ? 28 THR P CA     4  
ATOM 7154  C C      . THR C 3 28 ? -6.104  13.321  4.005   1.00 0.00 ? 28 THR P C      4  
ATOM 7155  O O      . THR C 3 28 ? -7.141  12.671  4.114   1.00 0.00 ? 28 THR P O      4  
ATOM 7156  C CB     . THR C 3 28 ? -6.410  15.398  2.595   1.00 0.00 ? 28 THR P CB     4  
ATOM 7157  O OG1    . THR C 3 28 ? -7.830  15.231  2.608   1.00 0.00 ? 28 THR P OG1    4  
ATOM 7158  C CG2    . THR C 3 28 ? -5.883  16.258  1.475   1.00 0.00 ? 28 THR P CG2    4  
ATOM 7159  H H      . THR C 3 28 ? -7.114  12.521  2.009   1.00 0.00 ? 28 THR P H      4  
ATOM 7160  H HA     . THR C 3 28 ? -4.741  14.032  2.482   1.00 0.00 ? 28 THR P HA     4  
ATOM 7161  H HB     . THR C 3 28 ? -5.991  15.877  3.479   1.00 0.00 ? 28 THR P HB     4  
ATOM 7162  H HG1    . THR C 3 28 ? -8.174  16.037  2.217   1.00 0.00 ? 28 THR P HG1    4  
ATOM 7163  H HG21   . THR C 3 28 ? -6.232  17.285  1.585   1.00 0.00 ? 28 THR P HG21   4  
ATOM 7164  H HG22   . THR C 3 28 ? -6.277  15.904  0.522   1.00 0.00 ? 28 THR P HG22   4  
ATOM 7165  H HG23   . THR C 3 28 ? -4.809  16.072  1.468   1.00 0.00 ? 28 THR P HG23   4  
ATOM 7166  N N      . ALA C 3 29 ? -5.389  13.729  5.042   1.00 0.00 ? 29 ALA P N      4  
ATOM 7167  C CA     . ALA C 3 29 ? -5.691  13.286  6.376   1.00 0.00 ? 29 ALA P CA     4  
ATOM 7168  C C      . ALA C 3 29 ? -7.145  13.405  6.826   1.00 0.00 ? 29 ALA P C      4  
ATOM 7169  O O      . ALA C 3 29 ? -7.628  12.437  7.404   1.00 0.00 ? 29 ALA P O      4  
ATOM 7170  C CB     . ALA C 3 29 ? -4.708  13.945  7.301   1.00 0.00 ? 29 ALA P CB     4  
ATOM 7171  H H      . ALA C 3 29 ? -4.589  14.333  4.920   1.00 0.00 ? 29 ALA P H      4  
ATOM 7172  H HA     . ALA C 3 29 ? -5.388  12.238  6.355   1.00 0.00 ? 29 ALA P HA     4  
ATOM 7173  H HB1    . ALA C 3 29 ? -4.421  14.954  7.004   1.00 0.00 ? 29 ALA P HB1    4  
ATOM 7174  H HB2    . ALA C 3 29 ? -4.883  13.776  8.364   1.00 0.00 ? 29 ALA P HB2    4  
ATOM 7175  H HB3    . ALA C 3 29 ? -3.799  13.345  7.250   1.00 0.00 ? 29 ALA P HB3    4  
ATOM 7176  N N      . PRO C 3 30 ? -7.884  14.502  6.541   1.00 0.00 ? 30 PRO P N      4  
ATOM 7177  C CA     . PRO C 3 30 ? -9.340  14.393  6.852   1.00 0.00 ? 30 PRO P CA     4  
ATOM 7178  C C      . PRO C 3 30 ? -10.132 13.352  6.075   1.00 0.00 ? 30 PRO P C      4  
ATOM 7179  O O      . PRO C 3 30 ? -10.905 12.680  6.699   1.00 0.00 ? 30 PRO P O      4  
ATOM 7180  C CB     . PRO C 3 30 ? -9.882  15.793  6.709   1.00 0.00 ? 30 PRO P CB     4  
ATOM 7181  C CG     . PRO C 3 30 ? -8.910  16.483  5.739   1.00 0.00 ? 30 PRO P CG     4  
ATOM 7182  C CD     . PRO C 3 30 ? -7.527  15.808  6.045   1.00 0.00 ? 30 PRO P CD     4  
ATOM 7183  H HA     . PRO C 3 30 ? -9.446  14.225  7.924   1.00 0.00 ? 30 PRO P HA     4  
ATOM 7184  H HB2    . PRO C 3 30 ? -10.870 15.909  6.264   1.00 0.00 ? 30 PRO P HB2    4  
ATOM 7185  H HB3    . PRO C 3 30 ? -9.828  16.323  7.661   1.00 0.00 ? 30 PRO P HB3    4  
ATOM 7186  H HG2    . PRO C 3 30 ? -9.216  16.275  4.713   1.00 0.00 ? 30 PRO P HG2    4  
ATOM 7187  H HG3    . PRO C 3 30 ? -8.840  17.554  5.933   1.00 0.00 ? 30 PRO P HG3    4  
ATOM 7188  H HD2    . PRO C 3 30 ? -6.895  15.762  5.158   1.00 0.00 ? 30 PRO P HD2    4  
ATOM 7189  H HD3    . PRO C 3 30 ? -6.978  16.343  6.820   1.00 0.00 ? 30 PRO P HD3    4  
ATOM 7190  N N      . ARG C 3 31 ? -9.886  13.167  4.736   1.00 0.00 ? 31 ARG P N      4  
ATOM 7191  C CA     . ARG C 3 31 ? -10.534 12.205  3.896   1.00 0.00 ? 31 ARG P CA     4  
ATOM 7192  C C      . ARG C 3 31 ? -10.219 10.782  4.405   1.00 0.00 ? 31 ARG P C      4  
ATOM 7193  O O      . ARG C 3 31 ? -11.122 9.980   4.545   1.00 0.00 ? 31 ARG P O      4  
ATOM 7194  C CB     . ARG C 3 31 ? -10.112 12.222  2.372   1.00 0.00 ? 31 ARG P CB     4  
ATOM 7195  C CG     . ARG C 3 31 ? -10.736 13.229  1.446   1.00 0.00 ? 31 ARG P CG     4  
ATOM 7196  C CD     . ARG C 3 31 ? -11.010 14.705  1.946   1.00 0.00 ? 31 ARG P CD     4  
ATOM 7197  N NE     . ARG C 3 31 ? -11.882 15.510  1.026   1.00 0.00 ? 31 ARG P NE     4  
ATOM 7198  C CZ     . ARG C 3 31 ? -13.205 15.562  1.029   1.00 0.00 ? 31 ARG P CZ     4  
ATOM 7199  N NH1    . ARG C 3 31 ? -13.860 14.920  1.934   1.00 0.00 ? 31 ARG P NH1    4  
ATOM 7200  N NH2    . ARG C 3 31 ? -13.851 16.214  0.029   1.00 0.00 ? 31 ARG P NH2    4  
ATOM 7201  H H      . ARG C 3 31 ? -9.332  13.855  4.244   1.00 0.00 ? 31 ARG P H      4  
ATOM 7202  H HA     . ARG C 3 31 ? -11.607 12.371  3.990   1.00 0.00 ? 31 ARG P HA     4  
ATOM 7203  H HB2    . ARG C 3 31 ? -9.034  12.380  2.342   1.00 0.00 ? 31 ARG P HB2    4  
ATOM 7204  H HB3    . ARG C 3 31 ? -10.337 11.233  1.974   1.00 0.00 ? 31 ARG P HB3    4  
ATOM 7205  H HG2    . ARG C 3 31 ? -10.098 13.217  0.562   1.00 0.00 ? 31 ARG P HG2    4  
ATOM 7206  H HG3    . ARG C 3 31 ? -11.738 12.852  1.244   1.00 0.00 ? 31 ARG P HG3    4  
ATOM 7207  H HD2    . ARG C 3 31 ? -11.492 14.790  2.920   1.00 0.00 ? 31 ARG P HD2    4  
ATOM 7208  H HD3    . ARG C 3 31 ? -10.068 15.253  1.958   1.00 0.00 ? 31 ARG P HD3    4  
ATOM 7209  H HE     . ARG C 3 31 ? -11.452 15.797  0.159   1.00 0.00 ? 31 ARG P HE     4  
ATOM 7210  H HH11   . ARG C 3 31 ? -13.323 14.440  2.643   1.00 0.00 ? 31 ARG P HH11   4  
ATOM 7211  H HH12   . ARG C 3 31 ? -14.848 14.795  1.763   1.00 0.00 ? 31 ARG P HH12   4  
ATOM 7212  H HH21   . ARG C 3 31 ? -13.348 16.771  -0.647  1.00 0.00 ? 31 ARG P HH21   4  
ATOM 7213  H HH22   . ARG C 3 31 ? -14.856 16.223  0.133   1.00 0.00 ? 31 ARG P HH22   4  
ATOM 7214  N N      . LEU C 3 32 ? -8.920  10.464  4.571   1.00 0.00 ? 32 LEU P N      4  
ATOM 7215  C CA     . LEU C 3 32 ? -8.349  9.248   5.088   1.00 0.00 ? 32 LEU P CA     4  
ATOM 7216  C C      . LEU C 3 32 ? -8.890  8.811   6.471   1.00 0.00 ? 32 LEU P C      4  
ATOM 7217  O O      . LEU C 3 32 ? -9.272  7.653   6.569   1.00 0.00 ? 32 LEU P O      4  
ATOM 7218  C CB     . LEU C 3 32 ? -6.802  9.511   5.054   1.00 0.00 ? 32 LEU P CB     4  
ATOM 7219  C CG     . LEU C 3 32 ? -5.957  8.254   5.223   1.00 0.00 ? 32 LEU P CG     4  
ATOM 7220  C CD1    . LEU C 3 32 ? -5.545  7.716   3.884   1.00 0.00 ? 32 LEU P CD1    4  
ATOM 7221  C CD2    . LEU C 3 32 ? -4.607  8.499   5.903   1.00 0.00 ? 32 LEU P CD2    4  
ATOM 7222  H H      . LEU C 3 32 ? -8.224  11.156  4.331   1.00 0.00 ? 32 LEU P H      4  
ATOM 7223  H HA     . LEU C 3 32 ? -8.636  8.430   4.428   1.00 0.00 ? 32 LEU P HA     4  
ATOM 7224  H HB2    . LEU C 3 32 ? -6.584  10.028  4.120   1.00 0.00 ? 32 LEU P HB2    4  
ATOM 7225  H HB3    . LEU C 3 32 ? -6.585  10.252  5.823   1.00 0.00 ? 32 LEU P HB3    4  
ATOM 7226  H HG     . LEU C 3 32 ? -6.482  7.538   5.854   1.00 0.00 ? 32 LEU P HG     4  
ATOM 7227  H HD11   . LEU C 3 32 ? -4.830  6.903   4.004   1.00 0.00 ? 32 LEU P HD11   4  
ATOM 7228  H HD12   . LEU C 3 32 ? -5.086  8.486   3.265   1.00 0.00 ? 32 LEU P HD12   4  
ATOM 7229  H HD13   . LEU C 3 32 ? -6.439  7.368   3.367   1.00 0.00 ? 32 LEU P HD13   4  
ATOM 7230  H HD21   . LEU C 3 32 ? -4.039  7.575   6.015   1.00 0.00 ? 32 LEU P HD21   4  
ATOM 7231  H HD22   . LEU C 3 32 ? -4.885  8.817   6.908   1.00 0.00 ? 32 LEU P HD22   4  
ATOM 7232  H HD23   . LEU C 3 32 ? -4.073  9.335   5.452   1.00 0.00 ? 32 LEU P HD23   4  
ATOM 7233  N N      . ALA C 3 33 ? -9.046  9.747   7.484   1.00 0.00 ? 33 ALA P N      4  
ATOM 7234  C CA     . ALA C 3 33 ? -9.580  9.525   8.833   1.00 0.00 ? 33 ALA P CA     4  
ATOM 7235  C C      . ALA C 3 33 ? -11.104 9.227   8.779   1.00 0.00 ? 33 ALA P C      4  
ATOM 7236  O O      . ALA C 3 33 ? -11.614 8.219   9.285   1.00 0.00 ? 33 ALA P O      4  
ATOM 7237  C CB     . ALA C 3 33 ? -9.348  10.771  9.778   1.00 0.00 ? 33 ALA P CB     4  
ATOM 7238  H H      . ALA C 3 33 ? -8.931  10.711  7.208   1.00 0.00 ? 33 ALA P H      4  
ATOM 7239  H HA     . ALA C 3 33 ? -9.046  8.740   9.368   1.00 0.00 ? 33 ALA P HA     4  
ATOM 7240  H HB1    . ALA C 3 33 ? -9.599  11.683  9.236   1.00 0.00 ? 33 ALA P HB1    4  
ATOM 7241  H HB2    . ALA C 3 33 ? -9.984  10.797  10.663  1.00 0.00 ? 33 ALA P HB2    4  
ATOM 7242  H HB3    . ALA C 3 33 ? -8.303  10.938  10.039  1.00 0.00 ? 33 ALA P HB3    4  
ATOM 7243  N N      . ASP C 3 34 ? -11.852 10.043  8.108   1.00 0.00 ? 34 ASP P N      4  
ATOM 7244  C CA     . ASP C 3 34 ? -13.316 9.869   7.903   1.00 0.00 ? 34 ASP P CA     4  
ATOM 7245  C C      . ASP C 3 34 ? -13.674 8.496   7.357   1.00 0.00 ? 34 ASP P C      4  
ATOM 7246  O O      . ASP C 3 34 ? -14.560 7.828   7.899   1.00 0.00 ? 34 ASP P O      4  
ATOM 7247  C CB     . ASP C 3 34 ? -13.764 10.998  6.913   1.00 0.00 ? 34 ASP P CB     4  
ATOM 7248  C CG     . ASP C 3 34 ? -15.310 11.002  6.726   1.00 0.00 ? 34 ASP P CG     4  
ATOM 7249  O OD1    . ASP C 3 34 ? -15.800 10.488  5.692   1.00 0.00 ? 34 ASP P OD1    4  
ATOM 7250  O OD2    . ASP C 3 34 ? -16.045 11.408  7.606   1.00 0.00 ? 34 ASP P OD2    4  
ATOM 7251  H H      . ASP C 3 34 ? -11.328 10.799  7.691   1.00 0.00 ? 34 ASP P H      4  
ATOM 7252  H HA     . ASP C 3 34 ? -13.771 10.030  8.880   1.00 0.00 ? 34 ASP P HA     4  
ATOM 7253  H HB2    . ASP C 3 34 ? -13.534 12.020  7.214   1.00 0.00 ? 34 ASP P HB2    4  
ATOM 7254  H HB3    . ASP C 3 34 ? -13.211 10.686  6.027   1.00 0.00 ? 34 ASP P HB3    4  
ATOM 7255  N N      . LEU C 3 35 ? -13.014 8.062   6.295   1.00 0.00 ? 35 LEU P N      4  
ATOM 7256  C CA     . LEU C 3 35 ? -13.302 6.720   5.719   1.00 0.00 ? 35 LEU P CA     4  
ATOM 7257  C C      . LEU C 3 35 ? -12.712 5.651   6.674   1.00 0.00 ? 35 LEU P C      4  
ATOM 7258  O O      . LEU C 3 35 ? -13.418 4.631   6.886   1.00 0.00 ? 35 LEU P O      4  
ATOM 7259  C CB     . LEU C 3 35 ? -12.820 6.674   4.255   1.00 0.00 ? 35 LEU P CB     4  
ATOM 7260  C CG     . LEU C 3 35 ? -13.715 6.576   3.038   1.00 0.00 ? 35 LEU P CG     4  
ATOM 7261  C CD1    . LEU C 3 35 ? -15.187 6.910   3.369   1.00 0.00 ? 35 LEU P CD1    4  
ATOM 7262  C CD2    . LEU C 3 35 ? -13.049 7.417   1.933   1.00 0.00 ? 35 LEU P CD2    4  
ATOM 7263  H H      . LEU C 3 35 ? -12.409 8.648   5.737   1.00 0.00 ? 35 LEU P H      4  
ATOM 7264  H HA     . LEU C 3 35 ? -14.383 6.611   5.799   1.00 0.00 ? 35 LEU P HA     4  
ATOM 7265  H HB2    . LEU C 3 35 ? -12.068 7.456   4.152   1.00 0.00 ? 35 LEU P HB2    4  
ATOM 7266  H HB3    . LEU C 3 35 ? -12.299 5.726   4.124   1.00 0.00 ? 35 LEU P HB3    4  
ATOM 7267  H HG     . LEU C 3 35 ? -13.727 5.551   2.666   1.00 0.00 ? 35 LEU P HG     4  
ATOM 7268  H HD11   . LEU C 3 35 ? -15.313 7.967   3.596   1.00 0.00 ? 35 LEU P HD11   4  
ATOM 7269  H HD12   . LEU C 3 35 ? -15.578 6.341   4.212   1.00 0.00 ? 35 LEU P HD12   4  
ATOM 7270  H HD13   . LEU C 3 35 ? -15.744 6.628   2.475   1.00 0.00 ? 35 LEU P HD13   4  
ATOM 7271  H HD21   . LEU C 3 35 ? -11.992 7.175   1.817   1.00 0.00 ? 35 LEU P HD21   4  
ATOM 7272  H HD22   . LEU C 3 35 ? -13.265 8.476   2.077   1.00 0.00 ? 35 LEU P HD22   4  
ATOM 7273  H HD23   . LEU C 3 35 ? -13.476 7.030   1.008   1.00 0.00 ? 35 LEU P HD23   4  
ATOM 7274  N N      . SER C 3 36 ? -11.534 5.830   7.235   1.00 0.00 ? 36 SER P N      4  
ATOM 7275  C CA     . SER C 3 36 ? -11.122 4.764   8.184   1.00 0.00 ? 36 SER P CA     4  
ATOM 7276  C C      . SER C 3 36 ? -12.179 4.359   9.242   1.00 0.00 ? 36 SER P C      4  
ATOM 7277  O O      . SER C 3 36 ? -12.435 3.130   9.402   1.00 0.00 ? 36 SER P O      4  
ATOM 7278  C CB     . SER C 3 36 ? -9.798  5.072   8.772   1.00 0.00 ? 36 SER P CB     4  
ATOM 7279  O OG     . SER C 3 36 ? -9.798  6.224   9.631   1.00 0.00 ? 36 SER P OG     4  
ATOM 7280  H H      . SER C 3 36 ? -11.000 6.662   7.027   1.00 0.00 ? 36 SER P H      4  
ATOM 7281  H HA     . SER C 3 36 ? -10.944 3.805   7.695   1.00 0.00 ? 36 SER P HA     4  
ATOM 7282  H HB2    . SER C 3 36 ? -9.539  4.272   9.466   1.00 0.00 ? 36 SER P HB2    4  
ATOM 7283  H HB3    . SER C 3 36 ? -9.079  5.204   7.962   1.00 0.00 ? 36 SER P HB3    4  
ATOM 7284  H HG     . SER C 3 36 ? -10.401 6.908   9.330   1.00 0.00 ? 36 SER P HG     4  
ATOM 7285  N N      . ALA C 3 37 ? -12.924 5.331   9.795   1.00 0.00 ? 37 ALA P N      4  
ATOM 7286  C CA     . ALA C 3 37 ? -14.053 5.064   10.769  1.00 0.00 ? 37 ALA P CA     4  
ATOM 7287  C C      . ALA C 3 37 ? -15.289 4.472   10.083  1.00 0.00 ? 37 ALA P C      4  
ATOM 7288  O O      . ALA C 3 37 ? -15.824 3.565   10.662  1.00 0.00 ? 37 ALA P O      4  
ATOM 7289  C CB     . ALA C 3 37 ? -14.342 6.474   11.379  1.00 0.00 ? 37 ALA P CB     4  
ATOM 7290  H H      . ALA C 3 37 ? -12.744 6.272   9.475   1.00 0.00 ? 37 ALA P H      4  
ATOM 7291  H HA     . ALA C 3 37 ? -13.715 4.425   11.585  1.00 0.00 ? 37 ALA P HA     4  
ATOM 7292  H HB1    . ALA C 3 37 ? -13.521 6.776   12.030  1.00 0.00 ? 37 ALA P HB1    4  
ATOM 7293  H HB2    . ALA C 3 37 ? -14.491 7.116   10.510  1.00 0.00 ? 37 ALA P HB2    4  
ATOM 7294  H HB3    . ALA C 3 37 ? -15.291 6.384   11.907  1.00 0.00 ? 37 ALA P HB3    4  
ATOM 7295  N N      . LYS C 3 38 ? -15.758 4.950   8.929   1.00 0.00 ? 38 LYS P N      4  
ATOM 7296  C CA     . LYS C 3 38 ? -16.976 4.632   8.221   1.00 0.00 ? 38 LYS P CA     4  
ATOM 7297  C C      . LYS C 3 38 ? -16.803 3.227   7.638   1.00 0.00 ? 38 LYS P C      4  
ATOM 7298  O O      . LYS C 3 38 ? -17.704 2.382   7.746   1.00 0.00 ? 38 LYS P O      4  
ATOM 7299  C CB     . LYS C 3 38 ? -17.267 5.728   7.196   1.00 0.00 ? 38 LYS P CB     4  
ATOM 7300  C CG     . LYS C 3 38 ? -18.709 6.359   7.312   1.00 0.00 ? 38 LYS P CG     4  
ATOM 7301  C CD     . LYS C 3 38 ? -19.123 7.424   6.280   1.00 0.00 ? 38 LYS P CD     4  
ATOM 7302  C CE     . LYS C 3 38 ? -18.146 8.579   6.070   1.00 0.00 ? 38 LYS P CE     4  
ATOM 7303  N NZ     . LYS C 3 38 ? -18.621 9.847   6.707   1.00 0.00 ? 38 LYS P NZ     4  
ATOM 7304  H H      . LYS C 3 38 ? -15.262 5.768   8.605   1.00 0.00 ? 38 LYS P H      4  
ATOM 7305  H HA     . LYS C 3 38 ? -17.796 4.576   8.937   1.00 0.00 ? 38 LYS P HA     4  
ATOM 7306  H HB2    . LYS C 3 38 ? -16.612 6.588   7.331   1.00 0.00 ? 38 LYS P HB2    4  
ATOM 7307  H HB3    . LYS C 3 38 ? -17.204 5.351   6.175   1.00 0.00 ? 38 LYS P HB3    4  
ATOM 7308  H HG2    . LYS C 3 38 ? -19.337 5.475   7.194   1.00 0.00 ? 38 LYS P HG2    4  
ATOM 7309  H HG3    . LYS C 3 38 ? -18.814 6.870   8.269   1.00 0.00 ? 38 LYS P HG3    4  
ATOM 7310  H HD2    . LYS C 3 38 ? -19.228 6.878   5.344   1.00 0.00 ? 38 LYS P HD2    4  
ATOM 7311  H HD3    . LYS C 3 38 ? -20.150 7.761   6.422   1.00 0.00 ? 38 LYS P HD3    4  
ATOM 7312  H HE2    . LYS C 3 38 ? -17.158 8.294   6.434   1.00 0.00 ? 38 LYS P HE2    4  
ATOM 7313  H HE3    . LYS C 3 38 ? -17.969 8.648   4.997   1.00 0.00 ? 38 LYS P HE3    4  
ATOM 7314  H HZ1    . LYS C 3 38 ? -18.696 9.773   7.711   1.00 0.00 ? 38 LYS P HZ1    4  
ATOM 7315  H HZ2    . LYS C 3 38 ? -19.531 10.165  6.405   1.00 0.00 ? 38 LYS P HZ2    4  
ATOM 7316  H HZ3    . LYS C 3 38 ? -17.983 10.611  6.534   1.00 0.00 ? 38 LYS P HZ3    4  
ATOM 7317  N N      . LEU C 3 39 ? -15.703 3.003   6.900   1.00 0.00 ? 39 LEU P N      4  
ATOM 7318  C CA     . LEU C 3 39 ? -15.395 1.655   6.274   1.00 0.00 ? 39 LEU P CA     4  
ATOM 7319  C C      . LEU C 3 39 ? -15.038 0.570   7.326   1.00 0.00 ? 39 LEU P C      4  
ATOM 7320  O O      . LEU C 3 39 ? -15.302 -0.587  7.063   1.00 0.00 ? 39 LEU P O      4  
ATOM 7321  C CB     . LEU C 3 39 ? -14.253 1.843   5.195   1.00 0.00 ? 39 LEU P CB     4  
ATOM 7322  C CG     . LEU C 3 39 ? -14.476 2.662   3.905   1.00 0.00 ? 39 LEU P CG     4  
ATOM 7323  C CD1    . LEU C 3 39 ? -15.332 3.796   4.181   1.00 0.00 ? 39 LEU P CD1    4  
ATOM 7324  C CD2    . LEU C 3 39 ? -13.076 3.220   3.795   1.00 0.00 ? 39 LEU P CD2    4  
ATOM 7325  H H      . LEU C 3 39 ? -15.072 3.782   6.776   1.00 0.00 ? 39 LEU P H      4  
ATOM 7326  H HA     . LEU C 3 39 ? -16.273 1.254   5.768   1.00 0.00 ? 39 LEU P HA     4  
ATOM 7327  H HB2    . LEU C 3 39 ? -13.502 2.371   5.783   1.00 0.00 ? 39 LEU P HB2    4  
ATOM 7328  H HB3    . LEU C 3 39 ? -13.857 0.848   4.989   1.00 0.00 ? 39 LEU P HB3    4  
ATOM 7329  H HG     . LEU C 3 39 ? -14.743 2.117   3.001   1.00 0.00 ? 39 LEU P HG     4  
ATOM 7330  H HD11   . LEU C 3 39 ? -15.368 4.347   3.241   1.00 0.00 ? 39 LEU P HD11   4  
ATOM 7331  H HD12   . LEU C 3 39 ? -14.923 4.461   4.941   1.00 0.00 ? 39 LEU P HD12   4  
ATOM 7332  H HD13   . LEU C 3 39 ? -16.267 3.360   4.537   1.00 0.00 ? 39 LEU P HD13   4  
ATOM 7333  H HD21   . LEU C 3 39 ? -12.851 3.927   4.593   1.00 0.00 ? 39 LEU P HD21   4  
ATOM 7334  H HD22   . LEU C 3 39 ? -13.083 3.669   2.802   1.00 0.00 ? 39 LEU P HD22   4  
ATOM 7335  H HD23   . LEU C 3 39 ? -12.360 2.399   3.779   1.00 0.00 ? 39 LEU P HD23   4  
ATOM 7336  N N      . ALA C 3 40 ? -14.511 0.995   8.531   1.00 0.00 ? 40 ALA P N      4  
ATOM 7337  C CA     . ALA C 3 40 ? -14.034 0.294   9.657   1.00 0.00 ? 40 ALA P CA     4  
ATOM 7338  C C      . ALA C 3 40 ? -12.758 -0.512  9.363   1.00 0.00 ? 40 ALA P C      4  
ATOM 7339  O O      . ALA C 3 40 ? -12.698 -1.749  9.511   1.00 0.00 ? 40 ALA P O      4  
ATOM 7340  C CB     . ALA C 3 40 ? -15.159 -0.467  10.386  1.00 0.00 ? 40 ALA P CB     4  
ATOM 7341  H H      . ALA C 3 40 ? -14.278 1.978   8.557   1.00 0.00 ? 40 ALA P H      4  
ATOM 7342  H HA     . ALA C 3 40 ? -13.799 1.154   10.284  1.00 0.00 ? 40 ALA P HA     4  
ATOM 7343  H HB1    . ALA C 3 40 ? -15.107 -1.491  10.019  1.00 0.00 ? 40 ALA P HB1    4  
ATOM 7344  H HB2    . ALA C 3 40 ? -14.869 -0.535  11.435  1.00 0.00 ? 40 ALA P HB2    4  
ATOM 7345  H HB3    . ALA C 3 40 ? -16.146 -0.016  10.270  1.00 0.00 ? 40 ALA P HB3    4  
ATOM 7346  N N      . LEU C 3 41 ? -11.704 0.247   8.950   1.00 0.00 ? 41 LEU P N      4  
ATOM 7347  C CA     . LEU C 3 41 ? -10.317 -0.184  8.679   1.00 0.00 ? 41 LEU P CA     4  
ATOM 7348  C C      . LEU C 3 41 ? -9.335  0.944   8.771   1.00 0.00 ? 41 LEU P C      4  
ATOM 7349  O O      . LEU C 3 41 ? -9.775  2.048   8.843   1.00 0.00 ? 41 LEU P O      4  
ATOM 7350  C CB     . LEU C 3 41 ? -10.231 -0.803  7.233   1.00 0.00 ? 41 LEU P CB     4  
ATOM 7351  C CG     . LEU C 3 41 ? -10.796 0.049   6.050   1.00 0.00 ? 41 LEU P CG     4  
ATOM 7352  C CD1    . LEU C 3 41 ? -10.200 1.399   5.834   1.00 0.00 ? 41 LEU P CD1    4  
ATOM 7353  C CD2    . LEU C 3 41 ? -10.536 -0.825  4.777   1.00 0.00 ? 41 LEU P CD2    4  
ATOM 7354  H H      . LEU C 3 41 ? -11.789 1.250   8.870   1.00 0.00 ? 41 LEU P H      4  
ATOM 7355  H HA     . LEU C 3 41 ? -10.164 -0.907  9.478   1.00 0.00 ? 41 LEU P HA     4  
ATOM 7356  H HB2    . LEU C 3 41 ? -9.218  -1.081  6.942   1.00 0.00 ? 41 LEU P HB2    4  
ATOM 7357  H HB3    . LEU C 3 41 ? -10.709 -1.778  7.318   1.00 0.00 ? 41 LEU P HB3    4  
ATOM 7358  H HG     . LEU C 3 41 ? -11.849 0.278   6.214   1.00 0.00 ? 41 LEU P HG     4  
ATOM 7359  H HD11   . LEU C 3 41 ? -9.125  1.269   5.961   1.00 0.00 ? 41 LEU P HD11   4  
ATOM 7360  H HD12   . LEU C 3 41 ? -10.573 2.067   6.611   1.00 0.00 ? 41 LEU P HD12   4  
ATOM 7361  H HD13   . LEU C 3 41 ? -10.387 1.849   4.859   1.00 0.00 ? 41 LEU P HD13   4  
ATOM 7362  H HD21   . LEU C 3 41 ? -11.008 -1.788  4.974   1.00 0.00 ? 41 LEU P HD21   4  
ATOM 7363  H HD22   . LEU C 3 41 ? -9.462  -0.892  4.603   1.00 0.00 ? 41 LEU P HD22   4  
ATOM 7364  H HD23   . LEU C 3 41 ? -10.987 -0.248  3.970   1.00 0.00 ? 41 LEU P HD23   4  
ATOM 7365  N N      . GLY C 3 42 ? -8.058  0.535   8.837   1.00 0.00 ? 42 GLY P N      4  
ATOM 7366  C CA     . GLY C 3 42 ? -6.934  1.336   9.034   1.00 0.00 ? 42 GLY P CA     4  
ATOM 7367  C C      . GLY C 3 42 ? -6.885  2.498   7.995   1.00 0.00 ? 42 GLY P C      4  
ATOM 7368  O O      . GLY C 3 42 ? -7.075  2.343   6.755   1.00 0.00 ? 42 GLY P O      4  
ATOM 7369  H H      . GLY C 3 42 ? -7.933  -0.460  8.715   1.00 0.00 ? 42 GLY P H      4  
ATOM 7370  H HA2    . GLY C 3 42 ? -7.032  1.802   10.013  1.00 0.00 ? 42 GLY P HA2    4  
ATOM 7371  H HA3    . GLY C 3 42 ? -6.076  0.670   8.941   1.00 0.00 ? 42 GLY P HA3    4  
ATOM 7372  N N      . THR C 3 43 ? -6.418  3.601   8.450   1.00 0.00 ? 43 THR P N      4  
ATOM 7373  C CA     . THR C 3 43 ? -6.071  4.769   7.616   1.00 0.00 ? 43 THR P CA     4  
ATOM 7374  C C      . THR C 3 43 ? -5.078  4.454   6.503   1.00 0.00 ? 43 THR P C      4  
ATOM 7375  O O      . THR C 3 43 ? -5.320  4.882   5.369   1.00 0.00 ? 43 THR P O      4  
ATOM 7376  C CB     . THR C 3 43 ? -5.503  5.903   8.449   1.00 0.00 ? 43 THR P CB     4  
ATOM 7377  O OG1    . THR C 3 43 ? -4.467  5.619   9.367   1.00 0.00 ? 43 THR P OG1    4  
ATOM 7378  C CG2    . THR C 3 43 ? -6.508  6.519   9.421   1.00 0.00 ? 43 THR P CG2    4  
ATOM 7379  H H      . THR C 3 43 ? -5.994  3.622   9.367   1.00 0.00 ? 43 THR P H      4  
ATOM 7380  H HA     . THR C 3 43 ? -6.937  5.222   7.130   1.00 0.00 ? 43 THR P HA     4  
ATOM 7381  H HB     . THR C 3 43 ? -5.162  6.627   7.709   1.00 0.00 ? 43 THR P HB     4  
ATOM 7382  H HG1    . THR C 3 43 ? -4.796  4.964   9.988   1.00 0.00 ? 43 THR P HG1    4  
ATOM 7383  H HG21   . THR C 3 43 ? -7.228  7.134   8.881   1.00 0.00 ? 43 THR P HG21   4  
ATOM 7384  H HG22   . THR C 3 43 ? -5.980  7.175   10.111  1.00 0.00 ? 43 THR P HG22   4  
ATOM 7385  H HG23   . THR C 3 43 ? -6.760  5.625   9.990   1.00 0.00 ? 43 THR P HG23   4  
ATOM 7386  N N      . ALA C 3 44 ? -4.034  3.611   6.767   1.00 0.00 ? 44 ALA P N      4  
ATOM 7387  C CA     . ALA C 3 44 ? -3.114  3.083   5.687   1.00 0.00 ? 44 ALA P CA     4  
ATOM 7388  C C      . ALA C 3 44 ? -3.802  2.384   4.459   1.00 0.00 ? 44 ALA P C      4  
ATOM 7389  O O      . ALA C 3 44 ? -3.410  2.568   3.320   1.00 0.00 ? 44 ALA P O      4  
ATOM 7390  C CB     . ALA C 3 44 ? -2.223  2.108   6.383   1.00 0.00 ? 44 ALA P CB     4  
ATOM 7391  H H      . ALA C 3 44 ? -3.943  3.230   7.698   1.00 0.00 ? 44 ALA P H      4  
ATOM 7392  H HA     . ALA C 3 44 ? -2.517  3.936   5.366   1.00 0.00 ? 44 ALA P HA     4  
ATOM 7393  H HB1    . ALA C 3 44 ? -1.650  2.552   7.198   1.00 0.00 ? 44 ALA P HB1    4  
ATOM 7394  H HB2    . ALA C 3 44 ? -2.725  1.221   6.772   1.00 0.00 ? 44 ALA P HB2    4  
ATOM 7395  H HB3    . ALA C 3 44 ? -1.499  1.747   5.654   1.00 0.00 ? 44 ALA P HB3    4  
ATOM 7396  N N      . GLN C 3 45 ? -4.898  1.686   4.718   1.00 0.00 ? 45 GLN P N      4  
ATOM 7397  C CA     . GLN C 3 45 ? -5.568  0.997   3.710   1.00 0.00 ? 45 GLN P CA     4  
ATOM 7398  C C      . GLN C 3 45 ? -6.210  1.966   2.680   1.00 0.00 ? 45 GLN P C      4  
ATOM 7399  O O      . GLN C 3 45 ? -6.222  1.718   1.492   1.00 0.00 ? 45 GLN P O      4  
ATOM 7400  C CB     . GLN C 3 45 ? -6.725  0.200   4.334   1.00 0.00 ? 45 GLN P CB     4  
ATOM 7401  C CG     . GLN C 3 45 ? -6.359  -1.161  4.930   1.00 0.00 ? 45 GLN P CG     4  
ATOM 7402  C CD     . GLN C 3 45 ? -5.118  -1.206  5.863   1.00 0.00 ? 45 GLN P CD     4  
ATOM 7403  O OE1    . GLN C 3 45 ? -4.082  -1.756  5.552   1.00 0.00 ? 45 GLN P OE1    4  
ATOM 7404  N NE2    . GLN C 3 45 ? -5.138  -0.408  6.977   1.00 0.00 ? 45 GLN P NE2    4  
ATOM 7405  H H      . GLN C 3 45 ? -5.192  1.692   5.684   1.00 0.00 ? 45 GLN P H      4  
ATOM 7406  H HA     . GLN C 3 45 ? -4.942  0.361   3.083   1.00 0.00 ? 45 GLN P HA     4  
ATOM 7407  H HB2    . GLN C 3 45 ? -7.157  0.785   5.146   1.00 0.00 ? 45 GLN P HB2    4  
ATOM 7408  H HB3    . GLN C 3 45 ? -7.493  -0.012  3.591   1.00 0.00 ? 45 GLN P HB3    4  
ATOM 7409  H HG2    . GLN C 3 45 ? -7.161  -1.394  5.630   1.00 0.00 ? 45 GLN P HG2    4  
ATOM 7410  H HG3    . GLN C 3 45 ? -6.327  -1.927  4.156   1.00 0.00 ? 45 GLN P HG3    4  
ATOM 7411  H HE21   . GLN C 3 45 ? -5.932  0.162   7.230   1.00 0.00 ? 45 GLN P HE21   4  
ATOM 7412  H HE22   . GLN C 3 45 ? -4.523  -0.647  7.741   1.00 0.00 ? 45 GLN P HE22   4  
ATOM 7413  N N      . VAL C 3 46 ? -6.768  3.097   3.159   1.00 0.00 ? 46 VAL P N      4  
ATOM 7414  C CA     . VAL C 3 46 ? -7.532  4.059   2.361   1.00 0.00 ? 46 VAL P CA     4  
ATOM 7415  C C      . VAL C 3 46 ? -6.595  4.684   1.350   1.00 0.00 ? 46 VAL P C      4  
ATOM 7416  O O      . VAL C 3 46 ? -6.824  4.484   0.136   1.00 0.00 ? 46 VAL P O      4  
ATOM 7417  C CB     . VAL C 3 46 ? -8.299  5.068   3.223   1.00 0.00 ? 46 VAL P CB     4  
ATOM 7418  C CG1    . VAL C 3 46 ? -9.475  5.851   2.486   1.00 0.00 ? 46 VAL P CG1    4  
ATOM 7419  C CG2    . VAL C 3 46 ? -9.078  4.520   4.438   1.00 0.00 ? 46 VAL P CG2    4  
ATOM 7420  H H      . VAL C 3 46 ? -6.648  3.366   4.125   1.00 0.00 ? 46 VAL P H      4  
ATOM 7421  H HA     . VAL C 3 46 ? -8.260  3.503   1.770   1.00 0.00 ? 46 VAL P HA     4  
ATOM 7422  H HB     . VAL C 3 46 ? -7.649  5.842   3.632   1.00 0.00 ? 46 VAL P HB     4  
ATOM 7423  H HG11   . VAL C 3 46 ? -9.717  6.702   3.122   1.00 0.00 ? 46 VAL P HG11   4  
ATOM 7424  H HG12   . VAL C 3 46 ? -9.022  6.132   1.535   1.00 0.00 ? 46 VAL P HG12   4  
ATOM 7425  H HG13   . VAL C 3 46 ? -10.294 5.188   2.206   1.00 0.00 ? 46 VAL P HG13   4  
ATOM 7426  H HG21   . VAL C 3 46 ? -9.745  5.320   4.760   1.00 0.00 ? 46 VAL P HG21   4  
ATOM 7427  H HG22   . VAL C 3 46 ? -9.742  3.676   4.256   1.00 0.00 ? 46 VAL P HG22   4  
ATOM 7428  H HG23   . VAL C 3 46 ? -8.392  4.359   5.270   1.00 0.00 ? 46 VAL P HG23   4  
ATOM 7429  N N      . LYS C 3 47 ? -5.397  5.081   1.710   1.00 0.00 ? 47 LYS P N      4  
ATOM 7430  C CA     . LYS C 3 47 ? -4.322  5.394   0.823   1.00 0.00 ? 47 LYS P CA     4  
ATOM 7431  C C      . LYS C 3 47 ? -3.899  4.283   -0.179  1.00 0.00 ? 47 LYS P C      4  
ATOM 7432  O O      . LYS C 3 47 ? -3.942  4.617   -1.353  1.00 0.00 ? 47 LYS P O      4  
ATOM 7433  C CB     . LYS C 3 47 ? -3.067  5.690   1.784   1.00 0.00 ? 47 LYS P CB     4  
ATOM 7434  C CG     . LYS C 3 47 ? -2.513  7.057   1.817   1.00 0.00 ? 47 LYS P CG     4  
ATOM 7435  C CD     . LYS C 3 47 ? -2.016  7.801   3.106   1.00 0.00 ? 47 LYS P CD     4  
ATOM 7436  C CE     . LYS C 3 47 ? -1.632  6.846   4.257   1.00 0.00 ? 47 LYS P CE     4  
ATOM 7437  N NZ     . LYS C 3 47 ? -0.934  7.669   5.337   1.00 0.00 ? 47 LYS P NZ     4  
ATOM 7438  H H      . LYS C 3 47 ? -5.248  5.287   2.688   1.00 0.00 ? 47 LYS P H      4  
ATOM 7439  H HA     . LYS C 3 47 ? -4.550  6.303   0.266   1.00 0.00 ? 47 LYS P HA     4  
ATOM 7440  H HB2    . LYS C 3 47 ? -3.420  5.552   2.806   1.00 0.00 ? 47 LYS P HB2    4  
ATOM 7441  H HB3    . LYS C 3 47 ? -2.244  5.016   1.548   1.00 0.00 ? 47 LYS P HB3    4  
ATOM 7442  H HG2    . LYS C 3 47 ? -1.642  7.097   1.164   1.00 0.00 ? 47 LYS P HG2    4  
ATOM 7443  H HG3    . LYS C 3 47 ? -3.275  7.685   1.355   1.00 0.00 ? 47 LYS P HG3    4  
ATOM 7444  H HD2    . LYS C 3 47 ? -1.117  8.374   2.878   1.00 0.00 ? 47 LYS P HD2    4  
ATOM 7445  H HD3    . LYS C 3 47 ? -2.852  8.382   3.497   1.00 0.00 ? 47 LYS P HD3    4  
ATOM 7446  H HE2    . LYS C 3 47 ? -2.505  6.469   4.790   1.00 0.00 ? 47 LYS P HE2    4  
ATOM 7447  H HE3    . LYS C 3 47 ? -0.975  6.038   3.936   1.00 0.00 ? 47 LYS P HE3    4  
ATOM 7448  H HZ1    . LYS C 3 47 ? -0.817  7.138   6.187   1.00 0.00 ? 47 LYS P HZ1    4  
ATOM 7449  H HZ2    . LYS C 3 47 ? -1.567  8.426   5.551   1.00 0.00 ? 47 LYS P HZ2    4  
ATOM 7450  H HZ3    . LYS C 3 47 ? -0.005  8.033   5.179   1.00 0.00 ? 47 LYS P HZ3    4  
ATOM 7451  N N      . ILE C 3 48 ? -3.780  2.959   0.221   1.00 0.00 ? 48 ILE P N      4  
ATOM 7452  C CA     . ILE C 3 48 ? -3.366  1.880   -0.725  1.00 0.00 ? 48 ILE P CA     4  
ATOM 7453  C C      . ILE C 3 48 ? -4.543  1.669   -1.739  1.00 0.00 ? 48 ILE P C      4  
ATOM 7454  O O      . ILE C 3 48 ? -4.248  1.293   -2.881  1.00 0.00 ? 48 ILE P O      4  
ATOM 7455  C CB     . ILE C 3 48 ? -3.157  0.563   0.059   1.00 0.00 ? 48 ILE P CB     4  
ATOM 7456  C CG1    . ILE C 3 48 ? -1.736  0.625   0.582   1.00 0.00 ? 48 ILE P CG1    4  
ATOM 7457  C CG2    . ILE C 3 48 ? -3.277  -0.664  -0.843  1.00 0.00 ? 48 ILE P CG2    4  
ATOM 7458  C CD1    . ILE C 3 48 ? -1.321  -0.526  1.477   1.00 0.00 ? 48 ILE P CD1    4  
ATOM 7459  H H      . ILE C 3 48 ? -4.042  2.652   1.147   1.00 0.00 ? 48 ILE P H      4  
ATOM 7460  H HA     . ILE C 3 48 ? -2.443  2.201   -1.204  1.00 0.00 ? 48 ILE P HA     4  
ATOM 7461  H HB     . ILE C 3 48 ? -3.865  0.609   0.887   1.00 0.00 ? 48 ILE P HB     4  
ATOM 7462  H HG12   . ILE C 3 48 ? -1.074  0.605   -0.284  1.00 0.00 ? 48 ILE P HG12   4  
ATOM 7463  H HG13   . ILE C 3 48 ? -1.594  1.561   1.124   1.00 0.00 ? 48 ILE P HG13   4  
ATOM 7464  H HG21   . ILE C 3 48 ? -3.046  -1.608  -0.350  1.00 0.00 ? 48 ILE P HG21   4  
ATOM 7465  H HG22   . ILE C 3 48 ? -4.281  -0.917  -1.184  1.00 0.00 ? 48 ILE P HG22   4  
ATOM 7466  H HG23   . ILE C 3 48 ? -2.597  -0.655  -1.694  1.00 0.00 ? 48 ILE P HG23   4  
ATOM 7467  H HD11   . ILE C 3 48 ? -1.927  -0.704  2.366   1.00 0.00 ? 48 ILE P HD11   4  
ATOM 7468  H HD12   . ILE C 3 48 ? -1.288  -1.465  0.924   1.00 0.00 ? 48 ILE P HD12   4  
ATOM 7469  H HD13   . ILE C 3 48 ? -0.284  -0.405  1.792   1.00 0.00 ? 48 ILE P HD13   4  
ATOM 7470  N N      . TRP C 3 49 ? -5.792  1.930   -1.307  1.00 0.00 ? 49 TRP P N      4  
ATOM 7471  C CA     . TRP C 3 49 ? -6.934  1.737   -2.195  1.00 0.00 ? 49 TRP P CA     4  
ATOM 7472  C C      . TRP C 3 49 ? -6.911  2.820   -3.228  1.00 0.00 ? 49 TRP P C      4  
ATOM 7473  O O      . TRP C 3 49 ? -6.918  2.535   -4.442  1.00 0.00 ? 49 TRP P O      4  
ATOM 7474  C CB     . TRP C 3 49 ? -8.224  1.834   -1.412  1.00 0.00 ? 49 TRP P CB     4  
ATOM 7475  C CG     . TRP C 3 49 ? -9.464  1.680   -2.314  1.00 0.00 ? 49 TRP P CG     4  
ATOM 7476  C CD1    . TRP C 3 49 ? -9.741  0.553   -3.022  1.00 0.00 ? 49 TRP P CD1    4  
ATOM 7477  C CD2    . TRP C 3 49 ? -10.317 2.685   -2.926  1.00 0.00 ? 49 TRP P CD2    4  
ATOM 7478  N NE1    . TRP C 3 49 ? -10.917 0.689   -3.767  1.00 0.00 ? 49 TRP P NE1    4  
ATOM 7479  C CE2    . TRP C 3 49 ? -11.310 2.046   -3.732  1.00 0.00 ? 49 TRP P CE2    4  
ATOM 7480  C CE3    . TRP C 3 49 ? -10.417 4.108   -2.812  1.00 0.00 ? 49 TRP P CE3    4  
ATOM 7481  C CZ2    . TRP C 3 49 ? -12.304 2.755   -4.390  1.00 0.00 ? 49 TRP P CZ2    4  
ATOM 7482  C CZ3    . TRP C 3 49 ? -11.411 4.812   -3.526  1.00 0.00 ? 49 TRP P CZ3    4  
ATOM 7483  C CH2    . TRP C 3 49 ? -12.399 4.110   -4.253  1.00 0.00 ? 49 TRP P CH2    4  
ATOM 7484  H H      . TRP C 3 49 ? -5.854  2.253   -0.352  1.00 0.00 ? 49 TRP P H      4  
ATOM 7485  H HA     . TRP C 3 49 ? -6.875  0.868   -2.851  1.00 0.00 ? 49 TRP P HA     4  
ATOM 7486  H HB2    . TRP C 3 49 ? -8.260  1.008   -0.702  1.00 0.00 ? 49 TRP P HB2    4  
ATOM 7487  H HB3    . TRP C 3 49 ? -8.287  2.755   -0.832  1.00 0.00 ? 49 TRP P HB3    4  
ATOM 7488  H HD1    . TRP C 3 49 ? -8.995  -0.222  -3.123  1.00 0.00 ? 49 TRP P HD1    4  
ATOM 7489  H HE1    . TRP C 3 49 ? -11.366 0.034   -4.391  1.00 0.00 ? 49 TRP P HE1    4  
ATOM 7490  H HE3    . TRP C 3 49 ? -9.741  4.659   -2.176  1.00 0.00 ? 49 TRP P HE3    4  
ATOM 7491  H HZ2    . TRP C 3 49 ? -12.917 2.218   -5.099  1.00 0.00 ? 49 TRP P HZ2    4  
ATOM 7492  H HZ3    . TRP C 3 49 ? -11.295 5.885   -3.547  1.00 0.00 ? 49 TRP P HZ3    4  
ATOM 7493  H HH2    . TRP C 3 49 ? -13.113 4.684   -4.826  1.00 0.00 ? 49 TRP P HH2    4  
ATOM 7494  N N      . PHE C 3 50 ? -6.919  4.113   -2.798  1.00 0.00 ? 50 PHE P N      4  
ATOM 7495  C CA     . PHE C 3 50 ? -6.879  5.255   -3.719  1.00 0.00 ? 50 PHE P CA     4  
ATOM 7496  C C      . PHE C 3 50 ? -5.719  5.162   -4.659  1.00 0.00 ? 50 PHE P C      4  
ATOM 7497  O O      . PHE C 3 50 ? -5.987  5.340   -5.833  1.00 0.00 ? 50 PHE P O      4  
ATOM 7498  C CB     . PHE C 3 50 ? -6.761  6.515   -2.825  1.00 0.00 ? 50 PHE P CB     4  
ATOM 7499  C CG     . PHE C 3 50 ? -8.094  7.146   -2.458  1.00 0.00 ? 50 PHE P CG     4  
ATOM 7500  C CD1    . PHE C 3 50 ? -8.537  8.220   -3.250  1.00 0.00 ? 50 PHE P CD1    4  
ATOM 7501  C CD2    . PHE C 3 50 ? -8.871  6.723   -1.377  1.00 0.00 ? 50 PHE P CD2    4  
ATOM 7502  C CE1    . PHE C 3 50 ? -9.727  8.845   -2.861  1.00 0.00 ? 50 PHE P CE1    4  
ATOM 7503  C CE2    . PHE C 3 50 ? -10.059 7.410   -0.987  1.00 0.00 ? 50 PHE P CE2    4  
ATOM 7504  C CZ     . PHE C 3 50 ? -10.521 8.469   -1.776  1.00 0.00 ? 50 PHE P CZ     4  
ATOM 7505  H H      . PHE C 3 50 ? -7.047  4.180   -1.799  1.00 0.00 ? 50 PHE P H      4  
ATOM 7506  H HA     . PHE C 3 50 ? -7.822  5.244   -4.264  1.00 0.00 ? 50 PHE P HA     4  
ATOM 7507  H HB2    . PHE C 3 50 ? -6.099  6.212   -2.015  1.00 0.00 ? 50 PHE P HB2    4  
ATOM 7508  H HB3    . PHE C 3 50 ? -6.207  7.236   -3.428  1.00 0.00 ? 50 PHE P HB3    4  
ATOM 7509  H HD1    . PHE C 3 50 ? -8.056  8.569   -4.151  1.00 0.00 ? 50 PHE P HD1    4  
ATOM 7510  H HD2    . PHE C 3 50 ? -8.611  5.831   -0.826  1.00 0.00 ? 50 PHE P HD2    4  
ATOM 7511  H HE1    . PHE C 3 50 ? -10.105 9.739   -3.334  1.00 0.00 ? 50 PHE P HE1    4  
ATOM 7512  H HE2    . PHE C 3 50 ? -10.618 7.009   -0.155  1.00 0.00 ? 50 PHE P HE2    4  
ATOM 7513  H HZ     . PHE C 3 50 ? -11.369 9.076   -1.494  1.00 0.00 ? 50 PHE P HZ     4  
ATOM 7514  N N      . LYS C 3 51 ? -4.533  4.858   -4.173  1.00 0.00 ? 51 LYS P N      4  
ATOM 7515  C CA     . LYS C 3 51 ? -3.322  4.916   -4.921  1.00 0.00 ? 51 LYS P CA     4  
ATOM 7516  C C      . LYS C 3 51 ? -3.377  3.901   -6.103  1.00 0.00 ? 51 LYS P C      4  
ATOM 7517  O O      . LYS C 3 51 ? -3.328  4.364   -7.222  1.00 0.00 ? 51 LYS P O      4  
ATOM 7518  C CB     . LYS C 3 51 ? -2.189  4.659   -3.959  1.00 0.00 ? 51 LYS P CB     4  
ATOM 7519  C CG     . LYS C 3 51 ? -0.762  5.001   -4.436  1.00 0.00 ? 51 LYS P CG     4  
ATOM 7520  C CD     . LYS C 3 51 ? 0.164   3.729   -4.515  1.00 0.00 ? 51 LYS P CD     4  
ATOM 7521  C CE     . LYS C 3 51 ? 0.643   3.158   -3.173  1.00 0.00 ? 51 LYS P CE     4  
ATOM 7522  N NZ     . LYS C 3 51 ? 1.803   3.908   -2.680  1.00 0.00 ? 51 LYS P NZ     4  
ATOM 7523  H H      . LYS C 3 51 ? -4.455  4.855   -3.166  1.00 0.00 ? 51 LYS P H      4  
ATOM 7524  H HA     . LYS C 3 51 ? -3.175  5.882   -5.401  1.00 0.00 ? 51 LYS P HA     4  
ATOM 7525  H HB2    . LYS C 3 51 ? -2.391  5.280   -3.087  1.00 0.00 ? 51 LYS P HB2    4  
ATOM 7526  H HB3    . LYS C 3 51 ? -2.223  3.650   -3.546  1.00 0.00 ? 51 LYS P HB3    4  
ATOM 7527  H HG2    . LYS C 3 51 ? -0.830  5.426   -5.436  1.00 0.00 ? 51 LYS P HG2    4  
ATOM 7528  H HG3    . LYS C 3 51 ? -0.411  5.806   -3.789  1.00 0.00 ? 51 LYS P HG3    4  
ATOM 7529  H HD2    . LYS C 3 51 ? -0.372  2.973   -5.087  1.00 0.00 ? 51 LYS P HD2    4  
ATOM 7530  H HD3    . LYS C 3 51 ? 1.098   3.963   -5.027  1.00 0.00 ? 51 LYS P HD3    4  
ATOM 7531  H HE2    . LYS C 3 51 ? -0.214  3.187   -2.501  1.00 0.00 ? 51 LYS P HE2    4  
ATOM 7532  H HE3    . LYS C 3 51 ? 0.905   2.116   -3.360  1.00 0.00 ? 51 LYS P HE3    4  
ATOM 7533  H HZ1    . LYS C 3 51 ? 1.973   3.753   -1.697  1.00 0.00 ? 51 LYS P HZ1    4  
ATOM 7534  H HZ2    . LYS C 3 51 ? 1.665   4.902   -2.786  1.00 0.00 ? 51 LYS P HZ2    4  
ATOM 7535  H HZ3    . LYS C 3 51 ? 2.665   3.712   -3.169  1.00 0.00 ? 51 LYS P HZ3    4  
ATOM 7536  N N      . ASN C 3 52 ? -3.585  2.637   -5.825  1.00 0.00 ? 52 ASN P N      4  
ATOM 7537  C CA     . ASN C 3 52 ? -3.651  1.642   -6.906  1.00 0.00 ? 52 ASN P CA     4  
ATOM 7538  C C      . ASN C 3 52 ? -4.828  2.020   -7.871  1.00 0.00 ? 52 ASN P C      4  
ATOM 7539  O O      . ASN C 3 52 ? -4.704  1.911   -9.100  1.00 0.00 ? 52 ASN P O      4  
ATOM 7540  C CB     . ASN C 3 52 ? -3.717  0.154   -6.483  1.00 0.00 ? 52 ASN P CB     4  
ATOM 7541  C CG     . ASN C 3 52 ? -5.016  -0.483  -6.078  1.00 0.00 ? 52 ASN P CG     4  
ATOM 7542  O OD1    . ASN C 3 52 ? -5.649  -1.254  -6.795  1.00 0.00 ? 52 ASN P OD1    4  
ATOM 7543  N ND2    . ASN C 3 52 ? -5.466  -0.154  -4.934  1.00 0.00 ? 52 ASN P ND2    4  
ATOM 7544  H H      . ASN C 3 52 ? -3.592  2.356   -4.855  1.00 0.00 ? 52 ASN P H      4  
ATOM 7545  H HA     . ASN C 3 52 ? -2.757  1.772   -7.516  1.00 0.00 ? 52 ASN P HA     4  
ATOM 7546  H HB2    . ASN C 3 52 ? -3.309  -0.511  -7.244  1.00 0.00 ? 52 ASN P HB2    4  
ATOM 7547  H HB3    . ASN C 3 52 ? -3.045  0.077   -5.629  1.00 0.00 ? 52 ASN P HB3    4  
ATOM 7548  H HD21   . ASN C 3 52 ? -5.150  0.665   -4.435  1.00 0.00 ? 52 ASN P HD21   4  
ATOM 7549  H HD22   . ASN C 3 52 ? -6.093  -0.783  -4.452  1.00 0.00 ? 52 ASN P HD22   4  
ATOM 7550  N N      . ARG C 3 53 ? -5.917  2.633   -7.408  1.00 0.00 ? 53 ARG P N      4  
ATOM 7551  C CA     . ARG C 3 53 ? -7.044  3.071   -8.216  1.00 0.00 ? 53 ARG P CA     4  
ATOM 7552  C C      . ARG C 3 53 ? -6.607  4.190   -9.181  1.00 0.00 ? 53 ARG P C      4  
ATOM 7553  O O      . ARG C 3 53 ? -6.952  4.146   -10.356 1.00 0.00 ? 53 ARG P O      4  
ATOM 7554  C CB     . ARG C 3 53 ? -8.221  3.558   -7.288  1.00 0.00 ? 53 ARG P CB     4  
ATOM 7555  C CG     . ARG C 3 53 ? -9.443  3.881   -8.133  1.00 0.00 ? 53 ARG P CG     4  
ATOM 7556  C CD     . ARG C 3 53 ? -10.517 4.506   -7.244  1.00 0.00 ? 53 ARG P CD     4  
ATOM 7557  N NE     . ARG C 3 53 ? -11.726 4.812   -8.075  1.00 0.00 ? 53 ARG P NE     4  
ATOM 7558  C CZ     . ARG C 3 53 ? -12.788 4.016   -8.048  1.00 0.00 ? 53 ARG P CZ     4  
ATOM 7559  N NH1    . ARG C 3 53 ? -12.741 2.811   -7.668  1.00 0.00 ? 53 ARG P NH1    4  
ATOM 7560  N NH2    . ARG C 3 53 ? -13.946 4.372   -8.566  1.00 0.00 ? 53 ARG P NH2    4  
ATOM 7561  H H      . ARG C 3 53 ? -5.935  2.786   -6.410  1.00 0.00 ? 53 ARG P H      4  
ATOM 7562  H HA     . ARG C 3 53 ? -7.383  2.202   -8.779  1.00 0.00 ? 53 ARG P HA     4  
ATOM 7563  H HB2    . ARG C 3 53 ? -8.547  2.858   -6.518  1.00 0.00 ? 53 ARG P HB2    4  
ATOM 7564  H HB3    . ARG C 3 53 ? -7.904  4.446   -6.742  1.00 0.00 ? 53 ARG P HB3    4  
ATOM 7565  H HG2    . ARG C 3 53 ? -9.169  4.613   -8.893  1.00 0.00 ? 53 ARG P HG2    4  
ATOM 7566  H HG3    . ARG C 3 53 ? -9.849  2.993   -8.619  1.00 0.00 ? 53 ARG P HG3    4  
ATOM 7567  H HD2    . ARG C 3 53 ? -10.834 3.842   -6.439  1.00 0.00 ? 53 ARG P HD2    4  
ATOM 7568  H HD3    . ARG C 3 53 ? -10.192 5.476   -6.869  1.00 0.00 ? 53 ARG P HD3    4  
ATOM 7569  H HE     . ARG C 3 53 ? -11.953 5.785   -8.226  1.00 0.00 ? 53 ARG P HE     4  
ATOM 7570  H HH11   . ARG C 3 53 ? -11.930 2.364   -7.264  1.00 0.00 ? 53 ARG P HH11   4  
ATOM 7571  H HH12   . ARG C 3 53 ? -13.655 2.381   -7.648  1.00 0.00 ? 53 ARG P HH12   4  
ATOM 7572  H HH21   . ARG C 3 53 ? -13.998 5.138   -9.224  1.00 0.00 ? 53 ARG P HH21   4  
ATOM 7573  H HH22   . ARG C 3 53 ? -14.710 3.716   -8.483  1.00 0.00 ? 53 ARG P HH22   4  
ATOM 7574  N N      . ARG C 3 54 ? -5.966  5.260   -8.690  1.00 0.00 ? 54 ARG P N      4  
ATOM 7575  C CA     . ARG C 3 54 ? -5.625  6.508   -9.419  1.00 0.00 ? 54 ARG P CA     4  
ATOM 7576  C C      . ARG C 3 54 ? -4.825  6.077   -10.703 1.00 0.00 ? 54 ARG P C      4  
ATOM 7577  O O      . ARG C 3 54 ? -5.112  6.477   -11.853 1.00 0.00 ? 54 ARG P O      4  
ATOM 7578  C CB     . ARG C 3 54 ? -4.850  7.610   -8.554  1.00 0.00 ? 54 ARG P CB     4  
ATOM 7579  C CG     . ARG C 3 54 ? -5.510  8.028   -7.236  1.00 0.00 ? 54 ARG P CG     4  
ATOM 7580  C CD     . ARG C 3 54 ? -7.026  8.028   -7.229  1.00 0.00 ? 54 ARG P CD     4  
ATOM 7581  N NE     . ARG C 3 54 ? -7.506  9.099   -8.126  1.00 0.00 ? 54 ARG P NE     4  
ATOM 7582  C CZ     . ARG C 3 54 ? -8.343  8.860   -9.091  1.00 0.00 ? 54 ARG P CZ     4  
ATOM 7583  N NH1    . ARG C 3 54 ? -8.931  7.767   -9.479  1.00 0.00 ? 54 ARG P NH1    4  
ATOM 7584  N NH2    . ARG C 3 54 ? -8.750  9.973   -9.676  1.00 0.00 ? 54 ARG P NH2    4  
ATOM 7585  H H      . ARG C 3 54 ? -5.553  5.148   -7.775  1.00 0.00 ? 54 ARG P H      4  
ATOM 7586  H HA     . ARG C 3 54 ? -6.509  7.038   -9.774  1.00 0.00 ? 54 ARG P HA     4  
ATOM 7587  H HB2    . ARG C 3 54 ? -3.883  7.190   -8.278  1.00 0.00 ? 54 ARG P HB2    4  
ATOM 7588  H HB3    . ARG C 3 54 ? -4.650  8.497   -9.155  1.00 0.00 ? 54 ARG P HB3    4  
ATOM 7589  H HG2    . ARG C 3 54 ? -5.058  7.412   -6.459  1.00 0.00 ? 54 ARG P HG2    4  
ATOM 7590  H HG3    . ARG C 3 54 ? -5.274  9.054   -6.952  1.00 0.00 ? 54 ARG P HG3    4  
ATOM 7591  H HD2    . ARG C 3 54 ? -7.304  7.021   -7.543  1.00 0.00 ? 54 ARG P HD2    4  
ATOM 7592  H HD3    . ARG C 3 54 ? -7.384  8.185   -6.212  1.00 0.00 ? 54 ARG P HD3    4  
ATOM 7593  H HE     . ARG C 3 54 ? -7.168  10.043  -8.008  1.00 0.00 ? 54 ARG P HE     4  
ATOM 7594  H HH11   . ARG C 3 54 ? -8.710  6.927   -8.964  1.00 0.00 ? 54 ARG P HH11   4  
ATOM 7595  H HH12   . ARG C 3 54 ? -9.468  7.740   -10.334 1.00 0.00 ? 54 ARG P HH12   4  
ATOM 7596  H HH21   . ARG C 3 54 ? -8.256  10.854  -9.710  1.00 0.00 ? 54 ARG P HH21   4  
ATOM 7597  H HH22   . ARG C 3 54 ? -9.444  9.862   -10.402 1.00 0.00 ? 54 ARG P HH22   4  
ATOM 7598  N N      . ARG C 3 55 ? -3.672  5.301   -10.479 1.00 0.00 ? 55 ARG P N      4  
ATOM 7599  C CA     . ARG C 3 55 ? -2.761  4.859   -11.514 1.00 0.00 ? 55 ARG P CA     4  
ATOM 7600  C C      . ARG C 3 55 ? -3.505  3.961   -12.479 1.00 0.00 ? 55 ARG P C      4  
ATOM 7601  O O      . ARG C 3 55 ? -3.369  4.204   -13.659 1.00 0.00 ? 55 ARG P O      4  
ATOM 7602  C CB     . ARG C 3 55 ? -1.509  4.296   -10.902 1.00 0.00 ? 55 ARG P CB     4  
ATOM 7603  C CG     . ARG C 3 55 ? -0.454  3.782   -12.002 1.00 0.00 ? 55 ARG P CG     4  
ATOM 7604  C CD     . ARG C 3 55 ? 0.035   4.989   -12.811 1.00 0.00 ? 55 ARG P CD     4  
ATOM 7605  N NE     . ARG C 3 55 ? 0.506   4.714   -14.206 1.00 0.00 ? 55 ARG P NE     4  
ATOM 7606  C CZ     . ARG C 3 55 ? 1.438   3.838   -14.521 1.00 0.00 ? 55 ARG P CZ     4  
ATOM 7607  N NH1    . ARG C 3 55 ? 2.277   3.310   -13.690 1.00 0.00 ? 55 ARG P NH1    4  
ATOM 7608  N NH2    . ARG C 3 55 ? 1.528   3.483   -15.771 1.00 0.00 ? 55 ARG P NH2    4  
ATOM 7609  H H      . ARG C 3 55 ? -3.469  5.191   -9.496  1.00 0.00 ? 55 ARG P H      4  
ATOM 7610  H HA     . ARG C 3 55 ? -2.567  5.781   -12.062 1.00 0.00 ? 55 ARG P HA     4  
ATOM 7611  H HB2    . ARG C 3 55 ? -1.086  4.925   -10.118 1.00 0.00 ? 55 ARG P HB2    4  
ATOM 7612  H HB3    . ARG C 3 55 ? -1.788  3.407   -10.338 1.00 0.00 ? 55 ARG P HB3    4  
ATOM 7613  H HG2    . ARG C 3 55 ? 0.425   3.359   -11.517 1.00 0.00 ? 55 ARG P HG2    4  
ATOM 7614  H HG3    . ARG C 3 55 ? -0.920  3.038   -12.649 1.00 0.00 ? 55 ARG P HG3    4  
ATOM 7615  H HD2    . ARG C 3 55 ? -0.767  5.683   -13.063 1.00 0.00 ? 55 ARG P HD2    4  
ATOM 7616  H HD3    . ARG C 3 55 ? 0.791   5.571   -12.284 1.00 0.00 ? 55 ARG P HD3    4  
ATOM 7617  H HE     . ARG C 3 55 ? 0.019   5.109   -14.998 1.00 0.00 ? 55 ARG P HE     4  
ATOM 7618  H HH11   . ARG C 3 55 ? 2.402   3.673   -12.757 1.00 0.00 ? 55 ARG P HH11   4  
ATOM 7619  H HH12   . ARG C 3 55 ? 3.030   2.741   -14.051 1.00 0.00 ? 55 ARG P HH12   4  
ATOM 7620  H HH21   . ARG C 3 55 ? 1.017   4.054   -16.429 1.00 0.00 ? 55 ARG P HH21   4  
ATOM 7621  H HH22   . ARG C 3 55 ? 2.295   2.927   -16.121 1.00 0.00 ? 55 ARG P HH22   4  
ATOM 7622  N N      . ARG C 3 56 ? -4.271  3.010   -12.024 1.00 0.00 ? 56 ARG P N      4  
ATOM 7623  C CA     . ARG C 3 56 ? -5.078  2.112   -12.906 1.00 0.00 ? 56 ARG P CA     4  
ATOM 7624  C C      . ARG C 3 56 ? -6.176  2.911   -13.701 1.00 0.00 ? 56 ARG P C      4  
ATOM 7625  O O      . ARG C 3 56 ? -6.464  2.569   -14.826 1.00 0.00 ? 56 ARG P O      4  
ATOM 7626  C CB     . ARG C 3 56 ? -5.743  1.000   -12.112 1.00 0.00 ? 56 ARG P CB     4  
ATOM 7627  C CG     . ARG C 3 56 ? -6.536  -0.026  -13.038 1.00 0.00 ? 56 ARG P CG     4  
ATOM 7628  C CD     . ARG C 3 56 ? -6.924  -1.332  -12.343 1.00 0.00 ? 56 ARG P CD     4  
ATOM 7629  N NE     . ARG C 3 56 ? -7.952  -1.161  -11.339 1.00 0.00 ? 56 ARG P NE     4  
ATOM 7630  C CZ     . ARG C 3 56 ? -7.786  -1.126  -10.014 1.00 0.00 ? 56 ARG P CZ     4  
ATOM 7631  N NH1    . ARG C 3 56 ? -6.586  -0.930  -9.469  1.00 0.00 ? 56 ARG P NH1    4  
ATOM 7632  N NH2    . ARG C 3 56 ? -8.815  -1.142  -9.250  1.00 0.00 ? 56 ARG P NH2    4  
ATOM 7633  H H      . ARG C 3 56 ? -4.131  2.827   -11.040 1.00 0.00 ? 56 ARG P H      4  
ATOM 7634  H HA     . ARG C 3 56 ? -4.380  1.634   -13.593 1.00 0.00 ? 56 ARG P HA     4  
ATOM 7635  H HB2    . ARG C 3 56 ? -5.071  0.582   -11.362 1.00 0.00 ? 56 ARG P HB2    4  
ATOM 7636  H HB3    . ARG C 3 56 ? -6.424  1.553   -11.466 1.00 0.00 ? 56 ARG P HB3    4  
ATOM 7637  H HG2    . ARG C 3 56 ? -7.364  0.508   -13.504 1.00 0.00 ? 56 ARG P HG2    4  
ATOM 7638  H HG3    . ARG C 3 56 ? -5.753  -0.293  -13.748 1.00 0.00 ? 56 ARG P HG3    4  
ATOM 7639  H HD2    . ARG C 3 56 ? -7.370  -2.033  -13.048 1.00 0.00 ? 56 ARG P HD2    4  
ATOM 7640  H HD3    . ARG C 3 56 ? -5.998  -1.796  -12.003 1.00 0.00 ? 56 ARG P HD3    4  
ATOM 7641  H HE     . ARG C 3 56 ? -8.904  -1.089  -11.670 1.00 0.00 ? 56 ARG P HE     4  
ATOM 7642  H HH11   . ARG C 3 56 ? -5.787  -0.754  -10.061 1.00 0.00 ? 56 ARG P HH11   4  
ATOM 7643  H HH12   . ARG C 3 56 ? -6.379  -0.936  -8.480  1.00 0.00 ? 56 ARG P HH12   4  
ATOM 7644  H HH21   . ARG C 3 56 ? -9.710  -1.460  -9.593  1.00 0.00 ? 56 ARG P HH21   4  
ATOM 7645  H HH22   . ARG C 3 56 ? -8.543  -1.272  -8.286  1.00 0.00 ? 56 ARG P HH22   4  
ATOM 7646  N N      . HIS C 3 57 ? -6.740  3.947   -13.123 1.00 0.00 ? 57 HIS P N      4  
ATOM 7647  C CA     . HIS C 3 57 ? -7.778  4.749   -13.744 1.00 0.00 ? 57 HIS P CA     4  
ATOM 7648  C C      . HIS C 3 57 ? -7.239  5.448   -14.983 1.00 0.00 ? 57 HIS P C      4  
ATOM 7649  O O      . HIS C 3 57 ? -7.822  5.350   -16.062 1.00 0.00 ? 57 HIS P O      4  
ATOM 7650  C CB     . HIS C 3 57 ? -8.401  5.581   -12.617 1.00 0.00 ? 57 HIS P CB     4  
ATOM 7651  C CG     . HIS C 3 57 ? -9.606  4.939   -11.922 1.00 0.00 ? 57 HIS P CG     4  
ATOM 7652  N ND1    . HIS C 3 57 ? -10.880 5.461   -11.765 1.00 0.00 ? 57 HIS P ND1    4  
ATOM 7653  C CD2    . HIS C 3 57 ? -9.665  3.603   -11.685 1.00 0.00 ? 57 HIS P CD2    4  
ATOM 7654  C CE1    . HIS C 3 57 ? -11.687 4.429   -11.379 1.00 0.00 ? 57 HIS P CE1    4  
ATOM 7655  N NE2    . HIS C 3 57 ? -11.042 3.312   -11.334 1.00 0.00 ? 57 HIS P NE2    4  
ATOM 7656  H H      . HIS C 3 57 ? -6.389  4.162   -12.202 1.00 0.00 ? 57 HIS P H      4  
ATOM 7657  H HA     . HIS C 3 57 ? -8.500  4.010   -14.092 1.00 0.00 ? 57 HIS P HA     4  
ATOM 7658  H HB2    . HIS C 3 57 ? -7.699  6.112   -11.974 1.00 0.00 ? 57 HIS P HB2    4  
ATOM 7659  H HB3    . HIS C 3 57 ? -8.798  6.417   -13.194 1.00 0.00 ? 57 HIS P HB3    4  
ATOM 7660  H HD1    . HIS C 3 57 ? -11.251 6.392   -11.895 1.00 0.00 ? 57 HIS P HD1    4  
ATOM 7661  H HD2    . HIS C 3 57 ? -8.876  2.875   -11.811 1.00 0.00 ? 57 HIS P HD2    4  
ATOM 7662  H HE1    . HIS C 3 57 ? -12.738 4.677   -11.373 1.00 0.00 ? 57 HIS P HE1    4  
ATOM 7663  N N      . LYS C 3 58 ? -6.130  6.154   -14.791 1.00 0.00 ? 58 LYS P N      4  
ATOM 7664  C CA     . LYS C 3 58 ? -5.414  6.748   -15.896 1.00 0.00 ? 58 LYS P CA     4  
ATOM 7665  C C      . LYS C 3 58 ? -4.964  5.813   -17.107 1.00 0.00 ? 58 LYS P C      4  
ATOM 7666  O O      . LYS C 3 58 ? -5.282  6.096   -18.268 1.00 0.00 ? 58 LYS P O      4  
ATOM 7667  C CB     . LYS C 3 58 ? -4.263  7.678   -15.558 1.00 0.00 ? 58 LYS P CB     4  
ATOM 7668  C CG     . LYS C 3 58 ? -3.098  7.041   -14.836 1.00 0.00 ? 58 LYS P CG     4  
ATOM 7669  C CD     . LYS C 3 58 ? -1.853  7.952   -14.659 1.00 0.00 ? 58 LYS P CD     4  
ATOM 7670  C CE     . LYS C 3 58 ? -1.709  8.275   -13.129 1.00 0.00 ? 58 LYS P CE     4  
ATOM 7671  N NZ     . LYS C 3 58 ? -0.466  8.930   -12.893 1.00 0.00 ? 58 LYS P NZ     4  
ATOM 7672  H H      . LYS C 3 58 ? -5.674  6.236   -13.893 1.00 0.00 ? 58 LYS P H      4  
ATOM 7673  H HA     . LYS C 3 58 ? -6.138  7.454   -16.304 1.00 0.00 ? 58 LYS P HA     4  
ATOM 7674  H HB2    . LYS C 3 58 ? -3.918  8.162   -16.472 1.00 0.00 ? 58 LYS P HB2    4  
ATOM 7675  H HB3    . LYS C 3 58 ? -4.672  8.492   -14.959 1.00 0.00 ? 58 LYS P HB3    4  
ATOM 7676  H HG2    . LYS C 3 58 ? -3.466  6.783   -13.843 1.00 0.00 ? 58 LYS P HG2    4  
ATOM 7677  H HG3    . LYS C 3 58 ? -2.777  6.084   -15.247 1.00 0.00 ? 58 LYS P HG3    4  
ATOM 7678  H HD2    . LYS C 3 58 ? -0.979  7.351   -14.913 1.00 0.00 ? 58 LYS P HD2    4  
ATOM 7679  H HD3    . LYS C 3 58 ? -1.997  8.881   -15.212 1.00 0.00 ? 58 LYS P HD3    4  
ATOM 7680  H HE2    . LYS C 3 58 ? -2.472  9.027   -12.928 1.00 0.00 ? 58 LYS P HE2    4  
ATOM 7681  H HE3    . LYS C 3 58 ? -1.881  7.424   -12.469 1.00 0.00 ? 58 LYS P HE3    4  
ATOM 7682  H HZ1    . LYS C 3 58 ? 0.344   8.340   -13.017 1.00 0.00 ? 58 LYS P HZ1    4  
ATOM 7683  H HZ2    . LYS C 3 58 ? -0.383  9.368   -11.987 1.00 0.00 ? 58 LYS P HZ2    4  
ATOM 7684  H HZ3    . LYS C 3 58 ? -0.280  9.720   -13.494 1.00 0.00 ? 58 LYS P HZ3    4  
ATOM 7685  N N      . ILE C 3 59 ? -4.324  4.696   -16.754 1.00 0.00 ? 59 ILE P N      4  
ATOM 7686  C CA     . ILE C 3 59 ? -3.924  3.573   -17.599 1.00 0.00 ? 59 ILE P CA     4  
ATOM 7687  C C      . ILE C 3 59 ? -5.127  3.046   -18.444 1.00 0.00 ? 59 ILE P C      4  
ATOM 7688  O O      . ILE C 3 59 ? -5.156  3.017   -19.695 1.00 0.00 ? 59 ILE P O      4  
ATOM 7689  C CB     . ILE C 3 59 ? -3.308  2.455   -16.658 1.00 0.00 ? 59 ILE P CB     4  
ATOM 7690  C CG1    . ILE C 3 59 ? -1.862  2.858   -16.119 1.00 0.00 ? 59 ILE P CG1    4  
ATOM 7691  C CG2    . ILE C 3 59 ? -3.243  1.163   -17.462 1.00 0.00 ? 59 ILE P CG2    4  
ATOM 7692  C CD1    . ILE C 3 59 ? -1.515  1.895   -15.027 1.00 0.00 ? 59 ILE P CD1    4  
ATOM 7693  H H      . ILE C 3 59 ? -4.293  4.521   -15.760 1.00 0.00 ? 59 ILE P H      4  
ATOM 7694  H HA     . ILE C 3 59 ? -3.133  3.770   -18.321 1.00 0.00 ? 59 ILE P HA     4  
ATOM 7695  H HB     . ILE C 3 59 ? -3.964  2.354   -15.794 1.00 0.00 ? 59 ILE P HB     4  
ATOM 7696  H HG12   . ILE C 3 59 ? -1.048  2.743   -16.834 1.00 0.00 ? 59 ILE P HG12   4  
ATOM 7697  H HG13   . ILE C 3 59 ? -1.879  3.893   -15.778 1.00 0.00 ? 59 ILE P HG13   4  
ATOM 7698  H HG21   . ILE C 3 59 ? -2.694  1.315   -18.391 1.00 0.00 ? 59 ILE P HG21   4  
ATOM 7699  H HG22   . ILE C 3 59 ? -2.841  0.340   -16.870 1.00 0.00 ? 59 ILE P HG22   4  
ATOM 7700  H HG23   . ILE C 3 59 ? -4.226  0.779   -17.736 1.00 0.00 ? 59 ILE P HG23   4  
ATOM 7701  H HD11   . ILE C 3 59 ? -2.310  1.857   -14.283 1.00 0.00 ? 59 ILE P HD11   4  
ATOM 7702  H HD12   . ILE C 3 59 ? -1.451  0.860   -15.360 1.00 0.00 ? 59 ILE P HD12   4  
ATOM 7703  H HD13   . ILE C 3 59 ? -0.570  2.184   -14.566 1.00 0.00 ? 59 ILE P HD13   4  
ATOM 7704  N N      . GLN C 3 60 ? -6.200  2.645   -17.701 1.00 0.00 ? 60 GLN P N      4  
ATOM 7705  C CA     . GLN C 3 60 ? -7.388  2.239   -18.433 1.00 0.00 ? 60 GLN P CA     4  
ATOM 7706  C C      . GLN C 3 60 ? -8.006  3.380   -19.348 1.00 0.00 ? 60 GLN P C      4  
ATOM 7707  O O      . GLN C 3 60 ? -8.540  3.075   -20.438 1.00 0.00 ? 60 GLN P O      4  
ATOM 7708  C CB     . GLN C 3 60 ? -8.508  1.825   -17.485 1.00 0.00 ? 60 GLN P CB     4  
ATOM 7709  C CG     . GLN C 3 60 ? -8.110  0.452   -16.927 1.00 0.00 ? 60 GLN P CG     4  
ATOM 7710  C CD     . GLN C 3 60 ? -8.934  -0.165  -15.781 1.00 0.00 ? 60 GLN P CD     4  
ATOM 7711  O OE1    . GLN C 3 60 ? -9.870  0.360   -15.194 1.00 0.00 ? 60 GLN P OE1    4  
ATOM 7712  N NE2    . GLN C 3 60 ? -8.639  -1.327  -15.416 1.00 0.00 ? 60 GLN P NE2    4  
ATOM 7713  H H      . GLN C 3 60 ? -6.213  2.586   -16.693 1.00 0.00 ? 60 GLN P H      4  
ATOM 7714  H HA     . GLN C 3 60 ? -7.246  1.422   -19.141 1.00 0.00 ? 60 GLN P HA     4  
ATOM 7715  H HB2    . GLN C 3 60 ? -8.494  2.561   -16.681 1.00 0.00 ? 60 GLN P HB2    4  
ATOM 7716  H HB3    . GLN C 3 60 ? -9.451  1.793   -18.029 1.00 0.00 ? 60 GLN P HB3    4  
ATOM 7717  H HG2    . GLN C 3 60 ? -8.119  -0.359  -17.656 1.00 0.00 ? 60 GLN P HG2    4  
ATOM 7718  H HG3    . GLN C 3 60 ? -7.076  0.584   -16.608 1.00 0.00 ? 60 GLN P HG3    4  
ATOM 7719  H HE21   . GLN C 3 60 ? -7.789  -1.784  -15.713 1.00 0.00 ? 60 GLN P HE21   4  
ATOM 7720  H HE22   . GLN C 3 60 ? -9.227  -1.724  -14.697 1.00 0.00 ? 60 GLN P HE22   4  
ATOM 7721  N N      . SER C 3 61 ? -7.867  4.659   -18.972 1.00 0.00 ? 61 SER P N      4  
ATOM 7722  C CA     . SER C 3 61 ? -8.350  5.807   -19.803 1.00 0.00 ? 61 SER P CA     4  
ATOM 7723  C C      . SER C 3 61 ? -7.529  5.951   -21.115 1.00 0.00 ? 61 SER P C      4  
ATOM 7724  O O      . SER C 3 61 ? -8.099  6.053   -22.171 1.00 0.00 ? 61 SER P O      4  
ATOM 7725  C CB     . SER C 3 61 ? -8.464  7.167   -19.006 1.00 0.00 ? 61 SER P CB     4  
ATOM 7726  O OG     . SER C 3 61 ? -9.227  6.745   -17.905 1.00 0.00 ? 61 SER P OG     4  
ATOM 7727  H H      . SER C 3 61 ? -7.173  4.841   -18.261 1.00 0.00 ? 61 SER P H      4  
ATOM 7728  H HA     . SER C 3 61 ? -9.382  5.610   -20.091 1.00 0.00 ? 61 SER P HA     4  
ATOM 7729  H HB2    . SER C 3 61 ? -7.481  7.560   -18.750 1.00 0.00 ? 61 SER P HB2    4  
ATOM 7730  H HB3    . SER C 3 61 ? -9.020  7.858   -19.640 1.00 0.00 ? 61 SER P HB3    4  
ATOM 7731  H HG     . SER C 3 61 ? -8.580  6.236   -17.409 1.00 0.00 ? 61 SER P HG     4  
ATOM 7732  N N      . ASP C 3 62 ? -6.222  5.705   -21.010 1.00 0.00 ? 62 ASP P N      4  
ATOM 7733  C CA     . ASP C 3 62 ? -5.336  5.663   -22.161 1.00 0.00 ? 62 ASP P CA     4  
ATOM 7734  C C      . ASP C 3 62 ? -5.566  4.496   -23.090 1.00 0.00 ? 62 ASP P C      4  
ATOM 7735  O O      . ASP C 3 62 ? -5.393  4.703   -24.293 1.00 0.00 ? 62 ASP P O      4  
ATOM 7736  C CB     . ASP C 3 62 ? -3.895  5.637   -21.596 1.00 0.00 ? 62 ASP P CB     4  
ATOM 7737  C CG     . ASP C 3 62 ? -2.896  5.547   -22.700 1.00 0.00 ? 62 ASP P CG     4  
ATOM 7738  O OD1    . ASP C 3 62 ? -2.545  6.574   -23.271 1.00 0.00 ? 62 ASP P OD1    4  
ATOM 7739  O OD2    . ASP C 3 62 ? -2.476  4.425   -23.121 1.00 0.00 ? 62 ASP P OD2    4  
ATOM 7740  H H      . ASP C 3 62 ? -5.758  5.444   -20.152 1.00 0.00 ? 62 ASP P H      4  
ATOM 7741  H HA     . ASP C 3 62 ? -5.455  6.583   -22.733 1.00 0.00 ? 62 ASP P HA     4  
ATOM 7742  H HB2    . ASP C 3 62 ? -3.898  6.584   -21.058 1.00 0.00 ? 62 ASP P HB2    4  
ATOM 7743  H HB3    . ASP C 3 62 ? -3.669  4.844   -20.882 1.00 0.00 ? 62 ASP P HB3    4  
ATOM 7744  N N      . GLN C 3 63 ? -6.123  3.418   -22.631 1.00 0.00 ? 63 GLN P N      4  
ATOM 7745  C CA     . GLN C 3 63 ? -6.413  2.166   -23.434 1.00 0.00 ? 63 GLN P CA     4  
ATOM 7746  C C      . GLN C 3 63 ? -7.823  2.204   -24.087 1.00 0.00 ? 63 GLN P C      4  
ATOM 7747  O O      . GLN C 3 63 ? -8.018  1.646   -25.182 1.00 0.00 ? 63 GLN P O      4  
ATOM 7748  C CB     . GLN C 3 63 ? -6.303  0.995   -22.506 1.00 0.00 ? 63 GLN P CB     4  
ATOM 7749  C CG     . GLN C 3 63 ? -4.887  0.599   -22.050 1.00 0.00 ? 63 GLN P CG     4  
ATOM 7750  C CD     . GLN C 3 63 ? -4.833  -0.782  -21.463 1.00 0.00 ? 63 GLN P CD     4  
ATOM 7751  O OE1    . GLN C 3 63 ? -5.632  -1.050  -20.564 1.00 0.00 ? 63 GLN P OE1    4  
ATOM 7752  N NE2    . GLN C 3 63 ? -4.033  -1.703  -21.885 1.00 0.00 ? 63 GLN P NE2    4  
ATOM 7753  H H      . GLN C 3 63 ? -6.407  3.389   -21.663 1.00 0.00 ? 63 GLN P H      4  
ATOM 7754  H HA     . GLN C 3 63 ? -5.705  1.980   -24.241 1.00 0.00 ? 63 GLN P HA     4  
ATOM 7755  H HB2    . GLN C 3 63 ? -6.885  1.270   -21.626 1.00 0.00 ? 63 GLN P HB2    4  
ATOM 7756  H HB3    . GLN C 3 63 ? -6.752  0.085   -22.905 1.00 0.00 ? 63 GLN P HB3    4  
ATOM 7757  H HG2    . GLN C 3 63 ? -4.189  0.569   -22.887 1.00 0.00 ? 63 GLN P HG2    4  
ATOM 7758  H HG3    . GLN C 3 63 ? -4.376  1.303   -21.393 1.00 0.00 ? 63 GLN P HG3    4  
ATOM 7759  H HE21   . GLN C 3 63 ? -3.499  -1.574  -22.732 1.00 0.00 ? 63 GLN P HE21   4  
ATOM 7760  H HE22   . GLN C 3 63 ? -4.084  -2.649  -21.535 1.00 0.00 ? 63 GLN P HE22   4  
ATOM 7761  N N      . HIS C 3 64 ? -8.812  2.851   -23.432 1.00 0.00 ? 64 HIS P N      4  
ATOM 7762  C CA     . HIS C 3 64 ? -10.256 2.804   -23.680 1.00 0.00 ? 64 HIS P CA     4  
ATOM 7763  C C      . HIS C 3 64 ? -10.905 4.180   -23.910 1.00 0.00 ? 64 HIS P C      4  
ATOM 7764  O O      . HIS C 3 64 ? -12.065 4.273   -24.336 1.00 0.00 ? 64 HIS P O      4  
ATOM 7765  C CB     . HIS C 3 64 ? -10.853 2.084   -22.412 1.00 0.00 ? 64 HIS P CB     4  
ATOM 7766  C CG     . HIS C 3 64 ? -10.222 0.769   -22.076 1.00 0.00 ? 64 HIS P CG     4  
ATOM 7767  N ND1    . HIS C 3 64 ? -9.550  0.494   -20.908 1.00 0.00 ? 64 HIS P ND1    4  
ATOM 7768  C CD2    . HIS C 3 64 ? -10.476 -0.396  -22.742 1.00 0.00 ? 64 HIS P CD2    4  
ATOM 7769  C CE1    . HIS C 3 64 ? -9.367  -0.816  -20.843 1.00 0.00 ? 64 HIS P CE1    4  
ATOM 7770  N NE2    . HIS C 3 64 ? -9.820  -1.403  -21.966 1.00 0.00 ? 64 HIS P NE2    4  
ATOM 7771  H H      . HIS C 3 64 ? -8.566  3.134   -22.494 1.00 0.00 ? 64 HIS P H      4  
ATOM 7772  H HA     . HIS C 3 64 ? -10.553 2.286   -24.592 1.00 0.00 ? 64 HIS P HA     4  
ATOM 7773  H HB2    . HIS C 3 64 ? -10.929 2.751   -21.554 1.00 0.00 ? 64 HIS P HB2    4  
ATOM 7774  H HB3    . HIS C 3 64 ? -11.890 1.956   -22.723 1.00 0.00 ? 64 HIS P HB3    4  
ATOM 7775  H HD1    . HIS C 3 64 ? -9.324  1.132   -20.159 1.00 0.00 ? 64 HIS P HD1    4  
ATOM 7776  H HD2    . HIS C 3 64 ? -11.039 -0.559  -23.649 1.00 0.00 ? 64 HIS P HD2    4  
ATOM 7777  H HE1    . HIS C 3 64 ? -8.742  -1.378  -20.165 1.00 0.00 ? 64 HIS P HE1    4  
ATOM 7778  N N      . LYS C 3 65 ? -10.177 5.243   -23.602 1.00 0.00 ? 65 LYS P N      4  
ATOM 7779  C CA     . LYS C 3 65 ? -10.736 6.611   -23.765 1.00 0.00 ? 65 LYS P CA     4  
ATOM 7780  C C      . LYS C 3 65 ? -9.928  7.768   -24.380 1.00 0.00 ? 65 LYS P C      4  
ATOM 7781  O O      . LYS C 3 65 ? -10.455 8.811   -24.681 1.00 0.00 ? 65 LYS P O      4  
ATOM 7782  C CB     . LYS C 3 65 ? -11.478 7.099   -22.487 1.00 0.00 ? 65 LYS P CB     4  
ATOM 7783  C CG     . LYS C 3 65 ? -12.678 8.052   -22.823 1.00 0.00 ? 65 LYS P CG     4  
ATOM 7784  C CD     . LYS C 3 65 ? -13.601 8.250   -21.564 1.00 0.00 ? 65 LYS P CD     4  
ATOM 7785  C CE     . LYS C 3 65 ? -14.564 7.045   -21.438 1.00 0.00 ? 65 LYS P CE     4  
ATOM 7786  N NZ     . LYS C 3 65 ? -15.580 7.361   -20.429 1.00 0.00 ? 65 LYS P NZ     4  
ATOM 7787  H H      . LYS C 3 65 ? -9.243  5.165   -23.225 1.00 0.00 ? 65 LYS P H      4  
ATOM 7788  H HA     . LYS C 3 65 ? -11.565 6.597   -24.474 1.00 0.00 ? 65 LYS P HA     4  
ATOM 7789  H HB2    . LYS C 3 65 ? -11.731 6.248   -21.855 1.00 0.00 ? 65 LYS P HB2    4  
ATOM 7790  H HB3    . LYS C 3 65 ? -10.777 7.670   -21.880 1.00 0.00 ? 65 LYS P HB3    4  
ATOM 7791  H HG2    . LYS C 3 65 ? -12.329 9.055   -23.070 1.00 0.00 ? 65 LYS P HG2    4  
ATOM 7792  H HG3    . LYS C 3 65 ? -13.237 7.651   -23.668 1.00 0.00 ? 65 LYS P HG3    4  
ATOM 7793  H HD2    . LYS C 3 65 ? -13.046 8.391   -20.637 1.00 0.00 ? 65 LYS P HD2    4  
ATOM 7794  H HD3    . LYS C 3 65 ? -14.109 9.194   -21.766 1.00 0.00 ? 65 LYS P HD3    4  
ATOM 7795  H HE2    . LYS C 3 65 ? -14.957 6.983   -22.452 1.00 0.00 ? 65 LYS P HE2    4  
ATOM 7796  H HE3    . LYS C 3 65 ? -14.054 6.104   -21.228 1.00 0.00 ? 65 LYS P HE3    4  
ATOM 7797  H HZ1    . LYS C 3 65 ? -15.146 7.433   -19.520 1.00 0.00 ? 65 LYS P HZ1    4  
ATOM 7798  H HZ2    . LYS C 3 65 ? -16.199 6.567   -20.340 1.00 0.00 ? 65 LYS P HZ2    4  
ATOM 7799  H HZ3    . LYS C 3 65 ? -16.125 8.184   -20.640 1.00 0.00 ? 65 LYS P HZ3    4  
ATOM 7800  N N      . ASP C 3 66 ? -8.598  7.677   -24.472 1.00 0.00 ? 66 ASP P N      4  
ATOM 7801  C CA     . ASP C 3 66 ? -7.782  8.748   -25.216 1.00 0.00 ? 66 ASP P CA     4  
ATOM 7802  C C      . ASP C 3 66 ? -8.156  8.834   -26.713 1.00 0.00 ? 66 ASP P C      4  
ATOM 7803  O O      . ASP C 3 66 ? -8.152  9.854   -27.409 1.00 0.00 ? 66 ASP P O      4  
ATOM 7804  C CB     . ASP C 3 66 ? -6.242  8.443   -24.967 1.00 0.00 ? 66 ASP P CB     4  
ATOM 7805  C CG     . ASP C 3 66 ? -5.424  9.480   -25.702 1.00 0.00 ? 66 ASP P CG     4  
ATOM 7806  O OD1    . ASP C 3 66 ? -5.698  10.709  -25.543 1.00 0.00 ? 66 ASP P OD1    4  
ATOM 7807  O OD2    . ASP C 3 66 ? -4.526  9.103   -26.509 1.00 0.00 ? 66 ASP P OD2    4  
ATOM 7808  H H      . ASP C 3 66 ? -8.147  7.007   -23.866 1.00 0.00 ? 66 ASP P H      4  
ATOM 7809  H HA     . ASP C 3 66 ? -7.937  9.742   -24.795 1.00 0.00 ? 66 ASP P HA     4  
ATOM 7810  H HB2    . ASP C 3 66 ? -6.018  8.456   -23.900 1.00 0.00 ? 66 ASP P HB2    4  
ATOM 7811  H HB3    . ASP C 3 66 ? -5.951  7.450   -25.310 1.00 0.00 ? 66 ASP P HB3    4  
ATOM 7812  N N      . GLN C 3 67 ? -8.689  7.755   -27.226 1.00 0.00 ? 67 GLN P N      4  
ATOM 7813  C CA     . GLN C 3 67 ? -9.177  7.567   -28.578 1.00 0.00 ? 67 GLN P CA     4  
ATOM 7814  C C      . GLN C 3 67 ? -10.389 6.607   -28.607 1.00 0.00 ? 67 GLN P C      4  
ATOM 7815  O O      . GLN C 3 67 ? -10.757 5.976   -27.614 1.00 0.00 ? 67 GLN P O      4  
ATOM 7816  C CB     . GLN C 3 67 ? -7.874  7.163   -29.351 1.00 0.00 ? 67 GLN P CB     4  
ATOM 7817  C CG     . GLN C 3 67 ? -8.149  6.829   -30.831 1.00 0.00 ? 67 GLN P CG     4  
ATOM 7818  C CD     . GLN C 3 67 ? -8.700  8.071   -31.532 1.00 0.00 ? 67 GLN P CD     4  
ATOM 7819  O OE1    . GLN C 3 67 ? -8.120  9.115   -31.436 1.00 0.00 ? 67 GLN P OE1    4  
ATOM 7820  N NE2    . GLN C 3 67 ? -9.860  8.025   -32.134 1.00 0.00 ? 67 GLN P NE2    4  
ATOM 7821  H H      . GLN C 3 67 ? -8.615  6.900   -26.694 1.00 0.00 ? 67 GLN P H      4  
ATOM 7822  H HA     . GLN C 3 67 ? -9.506  8.554   -28.903 1.00 0.00 ? 67 GLN P HA     4  
ATOM 7823  H HB2    . GLN C 3 67 ? -7.283  8.079   -29.379 1.00 0.00 ? 67 GLN P HB2    4  
ATOM 7824  H HB3    . GLN C 3 67 ? -7.361  6.350   -28.837 1.00 0.00 ? 67 GLN P HB3    4  
ATOM 7825  H HG2    . GLN C 3 67 ? -7.189  6.591   -31.289 1.00 0.00 ? 67 GLN P HG2    4  
ATOM 7826  H HG3    . GLN C 3 67 ? -8.859  6.003   -30.882 1.00 0.00 ? 67 GLN P HG3    4  
ATOM 7827  H HE21   . GLN C 3 67 ? -10.296 7.167   -32.439 1.00 0.00 ? 67 GLN P HE21   4  
ATOM 7828  H HE22   . GLN C 3 67 ? -10.100 8.899   -32.581 1.00 0.00 ? 67 GLN P HE22   4  
ATOM 7829  N N      . SER C 3 68 ? -11.119 6.629   -29.719 1.00 0.00 ? 68 SER P N      4  
ATOM 7830  C CA     . SER C 3 68 ? -12.384 5.811   -29.895 1.00 0.00 ? 68 SER P CA     4  
ATOM 7831  C C      . SER C 3 68 ? -12.656 5.508   -31.372 1.00 0.00 ? 68 SER P C      4  
ATOM 7832  O O      . SER C 3 68 ? -13.728 5.067   -31.766 1.00 0.00 ? 68 SER P O      4  
ATOM 7833  C CB     . SER C 3 68 ? -13.535 6.514   -29.201 1.00 0.00 ? 68 SER P CB     4  
ATOM 7834  O OG     . SER C 3 68 ? -13.518 6.055   -27.892 1.00 0.00 ? 68 SER P OG     4  
ATOM 7835  O OXT    . SER C 3 68 ? -11.704 5.691   -32.148 1.00 0.00 ? 68 SER P OXT    4  
ATOM 7836  H H      . SER C 3 68 ? -10.859 7.297   -30.431 1.00 0.00 ? 68 SER P H      4  
ATOM 7837  H HA     . SER C 3 68 ? -12.256 4.850   -29.395 1.00 0.00 ? 68 SER P HA     4  
ATOM 7838  H HB2    . SER C 3 68 ? -13.354 7.584   -29.296 1.00 0.00 ? 68 SER P HB2    4  
ATOM 7839  H HB3    . SER C 3 68 ? -14.508 6.334   -29.657 1.00 0.00 ? 68 SER P HB3    4  
ATOM 7840  H HG     . SER C 3 68 ? -12.621 6.122   -27.555 1.00 0.00 ? 68 SER P HG     4  
ATOM 7841  O "O5'"  . DG  A 1 1  ? 7.398   -23.009 -9.830  1.00 0.00 ? 69 DG  A "O5'"  5  
ATOM 7842  C "C5'"  . DG  A 1 1  ? 7.472   -23.607 -11.082 1.00 0.00 ? 69 DG  A "C5'"  5  
ATOM 7843  C "C4'"  . DG  A 1 1  ? 6.755   -22.708 -12.098 1.00 0.00 ? 69 DG  A "C4'"  5  
ATOM 7844  O "O4'"  . DG  A 1 1  ? 5.385   -22.501 -11.661 1.00 0.00 ? 69 DG  A "O4'"  5  
ATOM 7845  C "C3'"  . DG  A 1 1  ? 7.380   -21.387 -12.355 1.00 0.00 ? 69 DG  A "C3'"  5  
ATOM 7846  O "O3'"  . DG  A 1 1  ? 7.410   -21.085 -13.741 1.00 0.00 ? 69 DG  A "O3'"  5  
ATOM 7847  C "C2'"  . DG  A 1 1  ? 6.481   -20.406 -11.566 1.00 0.00 ? 69 DG  A "C2'"  5  
ATOM 7848  C "C1'"  . DG  A 1 1  ? 5.127   -21.124 -11.710 1.00 0.00 ? 69 DG  A "C1'"  5  
ATOM 7849  N N9     . DG  A 1 1  ? 4.220   -20.869 -10.556 1.00 0.00 ? 69 DG  A N9     5  
ATOM 7850  C C8     . DG  A 1 1  ? 4.581   -20.749 -9.232  1.00 0.00 ? 69 DG  A C8     5  
ATOM 7851  N N7     . DG  A 1 1  ? 3.538   -20.783 -8.441  1.00 0.00 ? 69 DG  A N7     5  
ATOM 7852  C C5     . DG  A 1 1  ? 2.457   -20.645 -9.326  1.00 0.00 ? 69 DG  A C5     5  
ATOM 7853  C C6     . DG  A 1 1  ? 1.008   -20.637 -9.168  1.00 0.00 ? 69 DG  A C6     5  
ATOM 7854  O O6     . DG  A 1 1  ? 0.415   -20.799 -8.108  1.00 0.00 ? 69 DG  A O6     5  
ATOM 7855  N N1     . DG  A 1 1  ? 0.290   -20.364 -10.343 1.00 0.00 ? 69 DG  A N1     5  
ATOM 7856  C C2     . DG  A 1 1  ? 0.843   -20.416 -11.590 1.00 0.00 ? 69 DG  A C2     5  
ATOM 7857  N N2     . DG  A 1 1  ? -0.008  -20.440 -12.553 1.00 0.00 ? 69 DG  A N2     5  
ATOM 7858  N N3     . DG  A 1 1  ? 2.103   -20.721 -11.867 1.00 0.00 ? 69 DG  A N3     5  
ATOM 7859  C C4     . DG  A 1 1  ? 2.873   -20.745 -10.686 1.00 0.00 ? 69 DG  A C4     5  
ATOM 7860  H "H5'"  . DG  A 1 1  ? 7.010   -24.592 -11.009 1.00 0.00 ? 69 DG  A "H5'"  5  
ATOM 7861  H "H5''" . DG  A 1 1  ? 8.516   -23.763 -11.348 1.00 0.00 ? 69 DG  A "H5''" 5  
ATOM 7862  H "H4'"  . DG  A 1 1  ? 6.916   -23.147 -13.084 1.00 0.00 ? 69 DG  A "H4'"  5  
ATOM 7863  H "H3'"  . DG  A 1 1  ? 8.377   -21.299 -11.923 1.00 0.00 ? 69 DG  A "H3'"  5  
ATOM 7864  H "H2'"  . DG  A 1 1  ? 6.905   -20.316 -10.566 1.00 0.00 ? 69 DG  A "H2'"  5  
ATOM 7865  H "H2''" . DG  A 1 1  ? 6.582   -19.382 -11.926 1.00 0.00 ? 69 DG  A "H2''" 5  
ATOM 7866  H "H1'"  . DG  A 1 1  ? 4.605   -20.791 -12.608 1.00 0.00 ? 69 DG  A "H1'"  5  
ATOM 7867  H H8     . DG  A 1 1  ? 5.609   -20.850 -8.916  1.00 0.00 ? 69 DG  A H8     5  
ATOM 7868  H H1     . DG  A 1 1  ? -0.709  -20.213 -10.331 1.00 0.00 ? 69 DG  A H1     5  
ATOM 7869  H H21    . DG  A 1 1  ? 0.221   -20.483 -13.536 1.00 0.00 ? 69 DG  A H21    5  
ATOM 7870  H H22    . DG  A 1 1  ? -0.945  -20.113 -12.367 1.00 0.00 ? 69 DG  A H22    5  
ATOM 7871  H "HO5'" . DG  A 1 1  ? 7.852   -22.163 -9.813  1.00 0.00 ? 69 DG  A "HO5'" 5  
ATOM 7872  P P      . DC  A 1 2  ? 7.825   -19.656 -14.399 1.00 0.00 ? 70 DC  A P      5  
ATOM 7873  O OP1    . DC  A 1 2  ? 8.596   -19.988 -15.630 1.00 0.00 ? 70 DC  A OP1    5  
ATOM 7874  O OP2    . DC  A 1 2  ? 8.456   -18.878 -13.335 1.00 0.00 ? 70 DC  A OP2    5  
ATOM 7875  O "O5'"  . DC  A 1 2  ? 6.427   -19.026 -14.781 1.00 0.00 ? 70 DC  A "O5'"  5  
ATOM 7876  C "C5'"  . DC  A 1 2  ? 5.689   -19.569 -15.943 1.00 0.00 ? 70 DC  A "C5'"  5  
ATOM 7877  C "C4'"  . DC  A 1 2  ? 4.511   -18.733 -16.306 1.00 0.00 ? 70 DC  A "C4'"  5  
ATOM 7878  O "O4'"  . DC  A 1 2  ? 3.461   -18.766 -15.362 1.00 0.00 ? 70 DC  A "O4'"  5  
ATOM 7879  C "C3'"  . DC  A 1 2  ? 4.739   -17.267 -16.594 1.00 0.00 ? 70 DC  A "C3'"  5  
ATOM 7880  O "O3'"  . DC  A 1 2  ? 4.116   -16.910 -17.781 1.00 0.00 ? 70 DC  A "O3'"  5  
ATOM 7881  C "C2'"  . DC  A 1 2  ? 4.125   -16.599 -15.331 1.00 0.00 ? 70 DC  A "C2'"  5  
ATOM 7882  C "C1'"  . DC  A 1 2  ? 3.040   -17.507 -14.794 1.00 0.00 ? 70 DC  A "C1'"  5  
ATOM 7883  N N1     . DC  A 1 2  ? 2.862   -17.623 -13.322 1.00 0.00 ? 70 DC  A N1     5  
ATOM 7884  C C2     . DC  A 1 2  ? 1.579   -17.338 -12.758 1.00 0.00 ? 70 DC  A C2     5  
ATOM 7885  O O2     . DC  A 1 2  ? 0.590   -17.116 -13.452 1.00 0.00 ? 70 DC  A O2     5  
ATOM 7886  N N3     . DC  A 1 2  ? 1.480   -17.212 -11.437 1.00 0.00 ? 70 DC  A N3     5  
ATOM 7887  C C4     . DC  A 1 2  ? 2.503   -17.312 -10.720 1.00 0.00 ? 70 DC  A C4     5  
ATOM 7888  N N4     . DC  A 1 2  ? 2.191   -17.102 -9.494  1.00 0.00 ? 70 DC  A N4     5  
ATOM 7889  C C5     . DC  A 1 2  ? 3.830   -17.701 -11.179 1.00 0.00 ? 70 DC  A C5     5  
ATOM 7890  C C6     . DC  A 1 2  ? 3.928   -17.889 -12.527 1.00 0.00 ? 70 DC  A C6     5  
ATOM 7891  H "H5'"  . DC  A 1 2  ? 5.331   -20.575 -15.723 1.00 0.00 ? 70 DC  A "H5'"  5  
ATOM 7892  H "H5''" . DC  A 1 2  ? 6.394   -19.627 -16.772 1.00 0.00 ? 70 DC  A "H5''" 5  
ATOM 7893  H "H4'"  . DC  A 1 2  ? 4.053   -19.132 -17.211 1.00 0.00 ? 70 DC  A "H4'"  5  
ATOM 7894  H "H3'"  . DC  A 1 2  ? 5.799   -17.014 -16.637 1.00 0.00 ? 70 DC  A "H3'"  5  
ATOM 7895  H "H2'"  . DC  A 1 2  ? 4.874   -16.426 -14.557 1.00 0.00 ? 70 DC  A "H2'"  5  
ATOM 7896  H "H2''" . DC  A 1 2  ? 3.752   -15.644 -15.698 1.00 0.00 ? 70 DC  A "H2''" 5  
ATOM 7897  H "H1'"  . DC  A 1 2  ? 2.122   -17.268 -15.329 1.00 0.00 ? 70 DC  A "H1'"  5  
ATOM 7898  H H41    . DC  A 1 2  ? 3.000   -17.162 -8.892  1.00 0.00 ? 70 DC  A H41    5  
ATOM 7899  H H42    . DC  A 1 2  ? 1.325   -16.636 -9.266  1.00 0.00 ? 70 DC  A H42    5  
ATOM 7900  H H5     . DC  A 1 2  ? 4.697   -17.936 -10.580 1.00 0.00 ? 70 DC  A H5     5  
ATOM 7901  H H6     . DC  A 1 2  ? 4.816   -18.216 -13.048 1.00 0.00 ? 70 DC  A H6     5  
ATOM 7902  P P      . DT  A 1 3  ? 4.173   -15.492 -18.497 1.00 0.00 ? 71 DT  A P      5  
ATOM 7903  O OP1    . DT  A 1 3  ? 3.997   -15.742 -19.906 1.00 0.00 ? 71 DT  A OP1    5  
ATOM 7904  O OP2    . DT  A 1 3  ? 5.381   -14.793 -18.146 1.00 0.00 ? 71 DT  A OP2    5  
ATOM 7905  O "O5'"  . DT  A 1 3  ? 2.980   -14.517 -18.081 1.00 0.00 ? 71 DT  A "O5'"  5  
ATOM 7906  C "C5'"  . DT  A 1 3  ? 1.715   -15.000 -18.300 1.00 0.00 ? 71 DT  A "C5'"  5  
ATOM 7907  C "C4'"  . DT  A 1 3  ? 0.780   -14.511 -17.191 1.00 0.00 ? 71 DT  A "C4'"  5  
ATOM 7908  O "O4'"  . DT  A 1 3  ? 1.232   -14.856 -15.870 1.00 0.00 ? 71 DT  A "O4'"  5  
ATOM 7909  C "C3'"  . DT  A 1 3  ? 0.432   -13.009 -17.315 1.00 0.00 ? 71 DT  A "C3'"  5  
ATOM 7910  O "O3'"  . DT  A 1 3  ? -0.873  -12.728 -17.783 1.00 0.00 ? 71 DT  A "O3'"  5  
ATOM 7911  C "C2'"  . DT  A 1 3  ? 0.665   -12.651 -15.844 1.00 0.00 ? 71 DT  A "C2'"  5  
ATOM 7912  C "C1'"  . DT  A 1 3  ? 0.511   -14.000 -15.061 1.00 0.00 ? 71 DT  A "C1'"  5  
ATOM 7913  N N1     . DT  A 1 3  ? 1.108   -13.834 -13.758 1.00 0.00 ? 71 DT  A N1     5  
ATOM 7914  C C2     . DT  A 1 3  ? 0.274   -13.912 -12.625 1.00 0.00 ? 71 DT  A C2     5  
ATOM 7915  O O2     . DT  A 1 3  ? -0.909  -13.558 -12.604 1.00 0.00 ? 71 DT  A O2     5  
ATOM 7916  N N3     . DT  A 1 3  ? 0.881   -14.136 -11.368 1.00 0.00 ? 71 DT  A N3     5  
ATOM 7917  C C4     . DT  A 1 3  ? 2.200   -14.086 -11.131 1.00 0.00 ? 71 DT  A C4     5  
ATOM 7918  O O4     . DT  A 1 3  ? 2.611   -14.077 -9.992  1.00 0.00 ? 71 DT  A O4     5  
ATOM 7919  C C5     . DT  A 1 3  ? 3.048   -14.010 -12.360 1.00 0.00 ? 71 DT  A C5     5  
ATOM 7920  C C7     . DT  A 1 3  ? 4.518   -14.103 -12.302 1.00 0.00 ? 71 DT  A C7     5  
ATOM 7921  C C6     . DT  A 1 3  ? 2.477   -13.895 -13.606 1.00 0.00 ? 71 DT  A C6     5  
ATOM 7922  H "H5'"  . DT  A 1 3  ? 1.676   -16.088 -18.320 1.00 0.00 ? 71 DT  A "H5'"  5  
ATOM 7923  H "H5''" . DT  A 1 3  ? 1.443   -14.584 -19.271 1.00 0.00 ? 71 DT  A "H5''" 5  
ATOM 7924  H "H4'"  . DT  A 1 3  ? -0.222  -14.939 -17.190 1.00 0.00 ? 71 DT  A "H4'"  5  
ATOM 7925  H "H3'"  . DT  A 1 3  ? 1.123   -12.600 -18.050 1.00 0.00 ? 71 DT  A "H3'"  5  
ATOM 7926  H "H2'"  . DT  A 1 3  ? 1.640   -12.171 -15.751 1.00 0.00 ? 71 DT  A "H2'"  5  
ATOM 7927  H "H2''" . DT  A 1 3  ? -0.073  -11.953 -15.449 1.00 0.00 ? 71 DT  A "H2''" 5  
ATOM 7928  H "H1'"  . DT  A 1 3  ? -0.508  -14.367 -14.931 1.00 0.00 ? 71 DT  A "H1'"  5  
ATOM 7929  H H3     . DT  A 1 3  ? 0.328   -14.142 -10.522 1.00 0.00 ? 71 DT  A H3     5  
ATOM 7930  H H71    . DT  A 1 3  ? 4.904   -13.417 -11.548 1.00 0.00 ? 71 DT  A H71    5  
ATOM 7931  H H72    . DT  A 1 3  ? 4.807   -15.074 -11.900 1.00 0.00 ? 71 DT  A H72    5  
ATOM 7932  H H73    . DT  A 1 3  ? 5.055   -13.858 -13.218 1.00 0.00 ? 71 DT  A H73    5  
ATOM 7933  H H6     . DT  A 1 3  ? 3.030   -13.887 -14.533 1.00 0.00 ? 71 DT  A H6     5  
ATOM 7934  P P      . DC  A 1 4  ? -1.200  -11.288 -18.291 1.00 0.00 ? 72 DC  A P      5  
ATOM 7935  O OP1    . DC  A 1 4  ? -2.415  -11.452 -19.073 1.00 0.00 ? 72 DC  A OP1    5  
ATOM 7936  O OP2    . DC  A 1 4  ? 0.010   -10.630 -18.819 1.00 0.00 ? 72 DC  A OP2    5  
ATOM 7937  O "O5'"  . DC  A 1 4  ? -1.491  -10.625 -16.895 1.00 0.00 ? 72 DC  A "O5'"  5  
ATOM 7938  C "C5'"  . DC  A 1 4  ? -2.662  -10.982 -16.227 1.00 0.00 ? 72 DC  A "C5'"  5  
ATOM 7939  C "C4'"  . DC  A 1 4  ? -2.768  -10.287 -14.866 1.00 0.00 ? 72 DC  A "C4'"  5  
ATOM 7940  O "O4'"  . DC  A 1 4  ? -1.723  -10.786 -14.056 1.00 0.00 ? 72 DC  A "O4'"  5  
ATOM 7941  C "C3'"  . DC  A 1 4  ? -2.554  -8.772  -14.951 1.00 0.00 ? 72 DC  A "C3'"  5  
ATOM 7942  O "O3'"  . DC  A 1 4  ? -3.933  -8.289  -14.990 1.00 0.00 ? 72 DC  A "O3'"  5  
ATOM 7943  C "C2'"  . DC  A 1 4  ? -1.666  -8.442  -13.625 1.00 0.00 ? 72 DC  A "C2'"  5  
ATOM 7944  C "C1'"  . DC  A 1 4  ? -1.519  -9.826  -12.970 1.00 0.00 ? 72 DC  A "C1'"  5  
ATOM 7945  N N1     . DC  A 1 4  ? -0.208  -9.979  -12.443 1.00 0.00 ? 72 DC  A N1     5  
ATOM 7946  C C2     . DC  A 1 4  ? -0.126  -10.066 -11.067 1.00 0.00 ? 72 DC  A C2     5  
ATOM 7947  O O2     . DC  A 1 4  ? -1.068  -9.721  -10.335 1.00 0.00 ? 72 DC  A O2     5  
ATOM 7948  N N3     . DC  A 1 4  ? 0.987   -10.490 -10.448 1.00 0.00 ? 72 DC  A N3     5  
ATOM 7949  C C4     . DC  A 1 4  ? 2.062   -10.608 -11.205 1.00 0.00 ? 72 DC  A C4     5  
ATOM 7950  N N4     . DC  A 1 4  ? 3.138   -11.056 -10.677 1.00 0.00 ? 72 DC  A N4     5  
ATOM 7951  C C5     . DC  A 1 4  ? 2.126   -10.245 -12.612 1.00 0.00 ? 72 DC  A C5     5  
ATOM 7952  C C6     . DC  A 1 4  ? 0.934   -9.933  -13.224 1.00 0.00 ? 72 DC  A C6     5  
ATOM 7953  H "H5'"  . DC  A 1 4  ? -2.623  -12.047 -16.001 1.00 0.00 ? 72 DC  A "H5'"  5  
ATOM 7954  H "H5''" . DC  A 1 4  ? -3.571  -10.773 -16.790 1.00 0.00 ? 72 DC  A "H5''" 5  
ATOM 7955  H "H4'"  . DC  A 1 4  ? -3.767  -10.519 -14.496 1.00 0.00 ? 72 DC  A "H4'"  5  
ATOM 7956  H "H3'"  . DC  A 1 4  ? -2.063  -8.373  -15.838 1.00 0.00 ? 72 DC  A "H3'"  5  
ATOM 7957  H "H2'"  . DC  A 1 4  ? -0.715  -8.078  -14.013 1.00 0.00 ? 72 DC  A "H2'"  5  
ATOM 7958  H "H2''" . DC  A 1 4  ? -2.095  -7.677  -12.978 1.00 0.00 ? 72 DC  A "H2''" 5  
ATOM 7959  H "H1'"  . DC  A 1 4  ? -2.306  -9.923  -12.222 1.00 0.00 ? 72 DC  A "H1'"  5  
ATOM 7960  H H41    . DC  A 1 4  ? 3.928   -11.313 -11.251 1.00 0.00 ? 72 DC  A H41    5  
ATOM 7961  H H42    . DC  A 1 4  ? 3.078   -11.398 -9.730  1.00 0.00 ? 72 DC  A H42    5  
ATOM 7962  H H5     . DC  A 1 4  ? 3.021   -10.306 -13.212 1.00 0.00 ? 72 DC  A H5     5  
ATOM 7963  H H6     . DC  A 1 4  ? 0.844   -9.714  -14.279 1.00 0.00 ? 72 DC  A H6     5  
ATOM 7964  P P      . DT  A 1 5  ? -4.202  -6.667  -14.881 1.00 0.00 ? 73 DT  A P      5  
ATOM 7965  O OP1    . DT  A 1 5  ? -5.617  -6.411  -15.192 1.00 0.00 ? 73 DT  A OP1    5  
ATOM 7966  O OP2    . DT  A 1 5  ? -3.179  -5.968  -15.640 1.00 0.00 ? 73 DT  A OP2    5  
ATOM 7967  O "O5'"  . DT  A 1 5  ? -4.057  -6.242  -13.317 1.00 0.00 ? 73 DT  A "O5'"  5  
ATOM 7968  C "C5'"  . DT  A 1 5  ? -5.014  -6.753  -12.356 1.00 0.00 ? 73 DT  A "C5'"  5  
ATOM 7969  C "C4'"  . DT  A 1 5  ? -4.881  -6.251  -10.902 1.00 0.00 ? 73 DT  A "C4'"  5  
ATOM 7970  O "O4'"  . DT  A 1 5  ? -3.820  -6.827  -10.088 1.00 0.00 ? 73 DT  A "O4'"  5  
ATOM 7971  C "C3'"  . DT  A 1 5  ? -4.768  -4.632  -10.911 1.00 0.00 ? 73 DT  A "C3'"  5  
ATOM 7972  O "O3'"  . DT  A 1 5  ? -5.780  -4.208  -10.061 1.00 0.00 ? 73 DT  A "O3'"  5  
ATOM 7973  C "C2'"  . DT  A 1 5  ? -3.284  -4.543  -10.492 1.00 0.00 ? 73 DT  A "C2'"  5  
ATOM 7974  C "C1'"  . DT  A 1 5  ? -3.024  -5.767  -9.622  1.00 0.00 ? 73 DT  A "C1'"  5  
ATOM 7975  N N1     . DT  A 1 5  ? -1.651  -6.333  -9.837  1.00 0.00 ? 73 DT  A N1     5  
ATOM 7976  C C2     . DT  A 1 5  ? -1.106  -6.935  -8.650  1.00 0.00 ? 73 DT  A C2     5  
ATOM 7977  O O2     . DT  A 1 5  ? -1.792  -7.055  -7.596  1.00 0.00 ? 73 DT  A O2     5  
ATOM 7978  N N3     . DT  A 1 5  ? 0.265   -7.121  -8.563  1.00 0.00 ? 73 DT  A N3     5  
ATOM 7979  C C4     . DT  A 1 5  ? 1.037   -7.163  -9.725  1.00 0.00 ? 73 DT  A C4     5  
ATOM 7980  O O4     . DT  A 1 5  ? 2.153   -7.633  -9.716  1.00 0.00 ? 73 DT  A O4     5  
ATOM 7981  C C5     . DT  A 1 5  ? 0.417   -6.538  -10.962 1.00 0.00 ? 73 DT  A C5     5  
ATOM 7982  C C7     . DT  A 1 5  ? 1.373   -6.360  -12.155 1.00 0.00 ? 73 DT  A C7     5  
ATOM 7983  C C6     . DT  A 1 5  ? -0.869  -6.139  -10.938 1.00 0.00 ? 73 DT  A C6     5  
ATOM 7984  H "H5'"  . DT  A 1 5  ? -5.001  -7.841  -12.297 1.00 0.00 ? 73 DT  A "H5'"  5  
ATOM 7985  H "H5''" . DT  A 1 5  ? -6.006  -6.477  -12.712 1.00 0.00 ? 73 DT  A "H5''" 5  
ATOM 7986  H "H4'"  . DT  A 1 5  ? -5.805  -6.622  -10.459 1.00 0.00 ? 73 DT  A "H4'"  5  
ATOM 7987  H "H3'"  . DT  A 1 5  ? -4.859  -4.264  -11.932 1.00 0.00 ? 73 DT  A "H3'"  5  
ATOM 7988  H "H2'"  . DT  A 1 5  ? -2.707  -4.558  -11.416 1.00 0.00 ? 73 DT  A "H2'"  5  
ATOM 7989  H "H2''" . DT  A 1 5  ? -3.042  -3.689  -9.858  1.00 0.00 ? 73 DT  A "H2''" 5  
ATOM 7990  H "H1'"  . DT  A 1 5  ? -3.320  -5.502  -8.607  1.00 0.00 ? 73 DT  A "H1'"  5  
ATOM 7991  H H3     . DT  A 1 5  ? 0.651   -7.562  -7.742  1.00 0.00 ? 73 DT  A H3     5  
ATOM 7992  H H71    . DT  A 1 5  ? 0.939   -5.875  -13.029 1.00 0.00 ? 73 DT  A H71    5  
ATOM 7993  H H72    . DT  A 1 5  ? 2.119   -5.606  -11.901 1.00 0.00 ? 73 DT  A H72    5  
ATOM 7994  H H73    . DT  A 1 5  ? 1.844   -7.329  -12.327 1.00 0.00 ? 73 DT  A H73    5  
ATOM 7995  H H6     . DT  A 1 5  ? -1.253  -5.635  -11.812 1.00 0.00 ? 73 DT  A H6     5  
ATOM 7996  P P      . DA  A 1 6  ? -5.673  -2.905  -9.275  1.00 0.00 ? 74 DA  A P      5  
ATOM 7997  O OP1    . DA  A 1 6  ? -7.102  -2.726  -8.885  1.00 0.00 ? 74 DA  A OP1    5  
ATOM 7998  O OP2    . DA  A 1 6  ? -4.984  -1.931  -10.097 1.00 0.00 ? 74 DA  A OP2    5  
ATOM 7999  O "O5'"  . DA  A 1 6  ? -4.832  -3.328  -8.000  1.00 0.00 ? 74 DA  A "O5'"  5  
ATOM 8000  C "C5'"  . DA  A 1 6  ? -5.344  -4.402  -7.117  1.00 0.00 ? 74 DA  A "C5'"  5  
ATOM 8001  C "C4'"  . DA  A 1 6  ? -4.521  -4.567  -5.879  1.00 0.00 ? 74 DA  A "C4'"  5  
ATOM 8002  O "O4'"  . DA  A 1 6  ? -3.230  -4.889  -6.238  1.00 0.00 ? 74 DA  A "O4'"  5  
ATOM 8003  C "C3'"  . DA  A 1 6  ? -4.431  -3.514  -4.837  1.00 0.00 ? 74 DA  A "C3'"  5  
ATOM 8004  O "O3'"  . DA  A 1 6  ? -4.748  -4.119  -3.576  1.00 0.00 ? 74 DA  A "O3'"  5  
ATOM 8005  C "C2'"  . DA  A 1 6  ? -3.076  -2.944  -4.994  1.00 0.00 ? 74 DA  A "C2'"  5  
ATOM 8006  C "C1'"  . DA  A 1 6  ? -2.322  -4.178  -5.387  1.00 0.00 ? 74 DA  A "C1'"  5  
ATOM 8007  N N9     . DA  A 1 6  ? -1.220  -3.812  -6.402  1.00 0.00 ? 74 DA  A N9     5  
ATOM 8008  C C8     . DA  A 1 6  ? -1.411  -3.148  -7.577  1.00 0.00 ? 74 DA  A C8     5  
ATOM 8009  N N7     . DA  A 1 6  ? -0.448  -3.242  -8.467  1.00 0.00 ? 74 DA  A N7     5  
ATOM 8010  C C5     . DA  A 1 6  ? 0.503   -3.962  -7.690  1.00 0.00 ? 74 DA  A C5     5  
ATOM 8011  C C6     . DA  A 1 6  ? 1.839   -4.338  -7.930  1.00 0.00 ? 74 DA  A C6     5  
ATOM 8012  N N6     . DA  A 1 6  ? 2.598   -4.036  -8.959  1.00 0.00 ? 74 DA  A N6     5  
ATOM 8013  N N1     . DA  A 1 6  ? 2.541   -5.061  -7.083  1.00 0.00 ? 74 DA  A N1     5  
ATOM 8014  C C2     . DA  A 1 6  ? 1.985   -5.363  -5.928  1.00 0.00 ? 74 DA  A C2     5  
ATOM 8015  N N3     . DA  A 1 6  ? 0.730   -5.111  -5.544  1.00 0.00 ? 74 DA  A N3     5  
ATOM 8016  C C4     . DA  A 1 6  ? 0.068   -4.300  -6.439  1.00 0.00 ? 74 DA  A C4     5  
ATOM 8017  H "H5'"  . DA  A 1 6  ? -5.376  -5.352  -7.651  1.00 0.00 ? 74 DA  A "H5'"  5  
ATOM 8018  H "H5''" . DA  A 1 6  ? -6.385  -4.247  -6.828  1.00 0.00 ? 74 DA  A "H5''" 5  
ATOM 8019  H "H4'"  . DA  A 1 6  ? -4.977  -5.458  -5.448  1.00 0.00 ? 74 DA  A "H4'"  5  
ATOM 8020  H "H3'"  . DA  A 1 6  ? -5.175  -2.751  -5.067  1.00 0.00 ? 74 DA  A "H3'"  5  
ATOM 8021  H "H2'"  . DA  A 1 6  ? -3.257  -2.272  -5.833  1.00 0.00 ? 74 DA  A "H2'"  5  
ATOM 8022  H "H2''" . DA  A 1 6  ? -2.805  -2.385  -4.097  1.00 0.00 ? 74 DA  A "H2''" 5  
ATOM 8023  H "H1'"  . DA  A 1 6  ? -1.973  -4.746  -4.524  1.00 0.00 ? 74 DA  A "H1'"  5  
ATOM 8024  H H8     . DA  A 1 6  ? -2.385  -2.754  -7.825  1.00 0.00 ? 74 DA  A H8     5  
ATOM 8025  H H61    . DA  A 1 6  ? 3.444   -4.578  -9.062  1.00 0.00 ? 74 DA  A H61    5  
ATOM 8026  H H62    . DA  A 1 6  ? 2.240   -3.574  -9.783  1.00 0.00 ? 74 DA  A H62    5  
ATOM 8027  H H2     . DA  A 1 6  ? 2.514   -6.046  -5.280  1.00 0.00 ? 74 DA  A H2     5  
ATOM 8028  P P      . DA  A 1 7  ? -4.837  -3.280  -2.270  1.00 0.00 ? 75 DA  A P      5  
ATOM 8029  O OP1    . DA  A 1 7  ? -5.729  -4.000  -1.324  1.00 0.00 ? 75 DA  A OP1    5  
ATOM 8030  O OP2    . DA  A 1 7  ? -5.145  -1.904  -2.645  1.00 0.00 ? 75 DA  A OP2    5  
ATOM 8031  O "O5'"  . DA  A 1 7  ? -3.296  -3.308  -1.877  1.00 0.00 ? 75 DA  A "O5'"  5  
ATOM 8032  C "C5'"  . DA  A 1 7  ? -2.569  -4.463  -1.624  1.00 0.00 ? 75 DA  A "C5'"  5  
ATOM 8033  C "C4'"  . DA  A 1 7  ? -1.051  -4.256  -1.421  1.00 0.00 ? 75 DA  A "C4'"  5  
ATOM 8034  O "O4'"  . DA  A 1 7  ? -0.405  -3.955  -2.632  1.00 0.00 ? 75 DA  A "O4'"  5  
ATOM 8035  C "C3'"  . DA  A 1 7  ? -0.616  -3.291  -0.312  1.00 0.00 ? 75 DA  A "C3'"  5  
ATOM 8036  O "O3'"  . DA  A 1 7  ? 0.310   -4.002  0.534   1.00 0.00 ? 75 DA  A "O3'"  5  
ATOM 8037  C "C2'"  . DA  A 1 7  ? 0.041   -2.298  -1.228  1.00 0.00 ? 75 DA  A "C2'"  5  
ATOM 8038  C "C1'"  . DA  A 1 7  ? 0.670   -3.080  -2.358  1.00 0.00 ? 75 DA  A "C1'"  5  
ATOM 8039  N N9     . DA  A 1 7  ? 0.963   -2.371  -3.669  1.00 0.00 ? 75 DA  A N9     5  
ATOM 8040  C C8     . DA  A 1 7  ? 0.149   -1.468  -4.384  1.00 0.00 ? 75 DA  A C8     5  
ATOM 8041  N N7     . DA  A 1 7  ? 0.708   -0.949  -5.429  1.00 0.00 ? 75 DA  A N7     5  
ATOM 8042  C C5     . DA  A 1 7  ? 1.945   -1.650  -5.499  1.00 0.00 ? 75 DA  A C5     5  
ATOM 8043  C C6     . DA  A 1 7  ? 3.124   -1.634  -6.291  1.00 0.00 ? 75 DA  A C6     5  
ATOM 8044  N N6     . DA  A 1 7  ? 3.103   -1.104  -7.523  1.00 0.00 ? 75 DA  A N6     5  
ATOM 8045  N N1     . DA  A 1 7  ? 4.225   -2.401  -6.074  1.00 0.00 ? 75 DA  A N1     5  
ATOM 8046  C C2     . DA  A 1 7  ? 4.160   -3.116  -4.966  1.00 0.00 ? 75 DA  A C2     5  
ATOM 8047  N N3     . DA  A 1 7  ? 3.167   -3.192  -4.088  1.00 0.00 ? 75 DA  A N3     5  
ATOM 8048  C C4     . DA  A 1 7  ? 2.092   -2.479  -4.410  1.00 0.00 ? 75 DA  A C4     5  
ATOM 8049  H "H5'"  . DA  A 1 7  ? -2.710  -5.033  -2.541  1.00 0.00 ? 75 DA  A "H5'"  5  
ATOM 8050  H "H5''" . DA  A 1 7  ? -2.992  -5.087  -0.836  1.00 0.00 ? 75 DA  A "H5''" 5  
ATOM 8051  H "H4'"  . DA  A 1 7  ? -0.627  -5.240  -1.224  1.00 0.00 ? 75 DA  A "H4'"  5  
ATOM 8052  H "H3'"  . DA  A 1 7  ? -1.473  -2.931  0.257   1.00 0.00 ? 75 DA  A "H3'"  5  
ATOM 8053  H "H2'"  . DA  A 1 7  ? -0.670  -1.539  -1.557  1.00 0.00 ? 75 DA  A "H2'"  5  
ATOM 8054  H "H2''" . DA  A 1 7  ? 0.866   -1.822  -0.696  1.00 0.00 ? 75 DA  A "H2''" 5  
ATOM 8055  H "H1'"  . DA  A 1 7  ? 1.566   -3.586  -1.998  1.00 0.00 ? 75 DA  A "H1'"  5  
ATOM 8056  H H8     . DA  A 1 7  ? -0.768  -1.118  -3.931  1.00 0.00 ? 75 DA  A H8     5  
ATOM 8057  H H61    . DA  A 1 7  ? 3.955   -1.127  -8.064  1.00 0.00 ? 75 DA  A H61    5  
ATOM 8058  H H62    . DA  A 1 7  ? 2.299   -0.556  -7.797  1.00 0.00 ? 75 DA  A H62    5  
ATOM 8059  H H2     . DA  A 1 7  ? 5.061   -3.674  -4.756  1.00 0.00 ? 75 DA  A H2     5  
ATOM 8060  P P      . DT  A 1 8  ? 1.063   -3.421  1.803   1.00 0.00 ? 76 DT  A P      5  
ATOM 8061  O OP1    . DT  A 1 8  ? 0.913   -4.287  2.986   1.00 0.00 ? 76 DT  A OP1    5  
ATOM 8062  O OP2    . DT  A 1 8  ? 0.677   -2.002  1.925   1.00 0.00 ? 76 DT  A OP2    5  
ATOM 8063  O "O5'"  . DT  A 1 8  ? 2.548   -3.514  1.355   1.00 0.00 ? 76 DT  A "O5'"  5  
ATOM 8064  C "C5'"  . DT  A 1 8  ? 3.339   -4.658  1.258   1.00 0.00 ? 76 DT  A "C5'"  5  
ATOM 8065  C "C4'"  . DT  A 1 8  ? 4.777   -4.343  0.806   1.00 0.00 ? 76 DT  A "C4'"  5  
ATOM 8066  O "O4'"  . DT  A 1 8  ? 4.725   -3.711  -0.473  1.00 0.00 ? 76 DT  A "O4'"  5  
ATOM 8067  C "C3'"  . DT  A 1 8  ? 5.464   -3.402  1.808   1.00 0.00 ? 76 DT  A "C3'"  5  
ATOM 8068  O "O3'"  . DT  A 1 8  ? 6.883   -3.725  1.964   1.00 0.00 ? 76 DT  A "O3'"  5  
ATOM 8069  C "C2'"  . DT  A 1 8  ? 5.365   -2.106  1.088   1.00 0.00 ? 76 DT  A "C2'"  5  
ATOM 8070  C "C1'"  . DT  A 1 8  ? 5.382   -2.434  -0.361  1.00 0.00 ? 76 DT  A "C1'"  5  
ATOM 8071  N N1     . DT  A 1 8  ? 4.806   -1.405  -1.352  1.00 0.00 ? 76 DT  A N1     5  
ATOM 8072  C C2     . DT  A 1 8  ? 5.451   -1.209  -2.609  1.00 0.00 ? 76 DT  A C2     5  
ATOM 8073  O O2     . DT  A 1 8  ? 6.456   -1.824  -2.976  1.00 0.00 ? 76 DT  A O2     5  
ATOM 8074  N N3     . DT  A 1 8  ? 4.941   -0.264  -3.432  1.00 0.00 ? 76 DT  A N3     5  
ATOM 8075  C C4     . DT  A 1 8  ? 3.724   0.401   -3.306  1.00 0.00 ? 76 DT  A C4     5  
ATOM 8076  O O4     . DT  A 1 8  ? 3.359   1.201   -4.193  1.00 0.00 ? 76 DT  A O4     5  
ATOM 8077  C C5     . DT  A 1 8  ? 3.002   0.038   -2.105  1.00 0.00 ? 76 DT  A C5     5  
ATOM 8078  C C7     . DT  A 1 8  ? 1.679   0.725   -1.934  1.00 0.00 ? 76 DT  A C7     5  
ATOM 8079  C C6     . DT  A 1 8  ? 3.554   -0.747  -1.113  1.00 0.00 ? 76 DT  A C6     5  
ATOM 8080  H "H5'"  . DT  A 1 8  ? 2.866   -5.362  0.573   1.00 0.00 ? 76 DT  A "H5'"  5  
ATOM 8081  H "H5''" . DT  A 1 8  ? 3.426   -5.185  2.208   1.00 0.00 ? 76 DT  A "H5''" 5  
ATOM 8082  H "H4'"  . DT  A 1 8  ? 5.375   -5.247  0.692   1.00 0.00 ? 76 DT  A "H4'"  5  
ATOM 8083  H "H3'"  . DT  A 1 8  ? 4.883   -3.284  2.723   1.00 0.00 ? 76 DT  A "H3'"  5  
ATOM 8084  H "H2'"  . DT  A 1 8  ? 4.428   -1.569  1.233   1.00 0.00 ? 76 DT  A "H2'"  5  
ATOM 8085  H "H2''" . DT  A 1 8  ? 6.114   -1.350  1.323   1.00 0.00 ? 76 DT  A "H2''" 5  
ATOM 8086  H "H1'"  . DT  A 1 8  ? 6.421   -2.696  -0.563  1.00 0.00 ? 76 DT  A "H1'"  5  
ATOM 8087  H H3     . DT  A 1 8  ? 5.592   0.101   -4.113  1.00 0.00 ? 76 DT  A H3     5  
ATOM 8088  H H71    . DT  A 1 8  ? 2.021   1.752   -1.813  1.00 0.00 ? 76 DT  A H71    5  
ATOM 8089  H H72    . DT  A 1 8  ? 1.017   0.611   -2.792  1.00 0.00 ? 76 DT  A H72    5  
ATOM 8090  H H73    . DT  A 1 8  ? 1.090   0.456   -1.057  1.00 0.00 ? 76 DT  A H73    5  
ATOM 8091  H H6     . DT  A 1 8  ? 2.904   -0.922  -0.268  1.00 0.00 ? 76 DT  A H6     5  
ATOM 8092  P P      . DC  A 1 9  ? 7.673   -3.428  3.277   1.00 0.00 ? 77 DC  A P      5  
ATOM 8093  O OP1    . DC  A 1 9  ? 8.466   -4.666  3.542   1.00 0.00 ? 77 DC  A OP1    5  
ATOM 8094  O OP2    . DC  A 1 9  ? 6.658   -2.986  4.317   1.00 0.00 ? 77 DC  A OP2    5  
ATOM 8095  O "O5'"  . DC  A 1 9  ? 8.741   -2.196  2.949   1.00 0.00 ? 77 DC  A "O5'"  5  
ATOM 8096  C "C5'"  . DC  A 1 9  ? 9.921   -2.568  2.321   1.00 0.00 ? 77 DC  A "C5'"  5  
ATOM 8097  C "C4'"  . DC  A 1 9  ? 10.646  -1.441  1.602   1.00 0.00 ? 77 DC  A "C4'"  5  
ATOM 8098  O "O4'"  . DC  A 1 9  ? 9.775   -0.990  0.555   1.00 0.00 ? 77 DC  A "O4'"  5  
ATOM 8099  C "C3'"  . DC  A 1 9  ? 11.090  -0.240  2.450   1.00 0.00 ? 77 DC  A "C3'"  5  
ATOM 8100  O "O3'"  . DC  A 1 9  ? 12.441  0.195   2.163   1.00 0.00 ? 77 DC  A "O3'"  5  
ATOM 8101  C "C2'"  . DC  A 1 9  ? 10.015  0.767   2.114   1.00 0.00 ? 77 DC  A "C2'"  5  
ATOM 8102  C "C1'"  . DC  A 1 9  ? 9.767   0.472   0.595   1.00 0.00 ? 77 DC  A "C1'"  5  
ATOM 8103  N N1     . DC  A 1 9  ? 8.458   1.095   0.040   1.00 0.00 ? 77 DC  A N1     5  
ATOM 8104  C C2     . DC  A 1 9  ? 8.389   1.621   -1.238  1.00 0.00 ? 77 DC  A C2     5  
ATOM 8105  O O2     . DC  A 1 9  ? 9.375   1.650   -1.939  1.00 0.00 ? 77 DC  A O2     5  
ATOM 8106  N N3     . DC  A 1 9  ? 7.216   2.060   -1.832  1.00 0.00 ? 77 DC  A N3     5  
ATOM 8107  C C4     . DC  A 1 9  ? 6.146   2.000   -1.054  1.00 0.00 ? 77 DC  A C4     5  
ATOM 8108  N N4     . DC  A 1 9  ? 5.049   2.560   -1.501  1.00 0.00 ? 77 DC  A N4     5  
ATOM 8109  C C5     . DC  A 1 9  ? 6.210   1.489   0.311   1.00 0.00 ? 77 DC  A C5     5  
ATOM 8110  C C6     . DC  A 1 9  ? 7.327   0.985   0.833   1.00 0.00 ? 77 DC  A C6     5  
ATOM 8111  H "H5'"  . DC  A 1 9  ? 9.782   -3.397  1.628   1.00 0.00 ? 77 DC  A "H5'"  5  
ATOM 8112  H "H5''" . DC  A 1 9  ? 10.591  -2.900  3.114   1.00 0.00 ? 77 DC  A "H5''" 5  
ATOM 8113  H "H4'"  . DC  A 1 9  ? 11.572  -1.784  1.142   1.00 0.00 ? 77 DC  A "H4'"  5  
ATOM 8114  H "H3'"  . DC  A 1 9  ? 11.034  -0.388  3.528   1.00 0.00 ? 77 DC  A "H3'"  5  
ATOM 8115  H "H2'"  . DC  A 1 9  ? 9.183   0.428   2.731   1.00 0.00 ? 77 DC  A "H2'"  5  
ATOM 8116  H "H2''" . DC  A 1 9  ? 10.279  1.802   2.325   1.00 0.00 ? 77 DC  A "H2''" 5  
ATOM 8117  H "H1'"  . DC  A 1 9  ? 10.601  0.887   0.028   1.00 0.00 ? 77 DC  A "H1'"  5  
ATOM 8118  H H41    . DC  A 1 9  ? 4.310   2.803   -0.857  1.00 0.00 ? 77 DC  A H41    5  
ATOM 8119  H H42    . DC  A 1 9  ? 5.063   2.816   -2.478  1.00 0.00 ? 77 DC  A H42    5  
ATOM 8120  H H5     . DC  A 1 9  ? 5.301   1.382   0.885   1.00 0.00 ? 77 DC  A H5     5  
ATOM 8121  H H6     . DC  A 1 9  ? 7.384   0.660   1.860   1.00 0.00 ? 77 DC  A H6     5  
ATOM 8122  P P      . DC  A 1 10 ? 13.057  1.492   2.707   1.00 0.00 ? 78 DC  A P      5  
ATOM 8123  O OP1    . DC  A 1 10 ? 14.457  1.140   2.824   1.00 0.00 ? 78 DC  A OP1    5  
ATOM 8124  O OP2    . DC  A 1 10 ? 12.342  1.891   3.922   1.00 0.00 ? 78 DC  A OP2    5  
ATOM 8125  O "O5'"  . DC  A 1 10 ? 12.734  2.462   1.519   1.00 0.00 ? 78 DC  A "O5'"  5  
ATOM 8126  C "C5'"  . DC  A 1 10 ? 13.215  2.253   0.217   1.00 0.00 ? 78 DC  A "C5'"  5  
ATOM 8127  C "C4'"  . DC  A 1 10 ? 13.341  3.545   -0.558  1.00 0.00 ? 78 DC  A "C4'"  5  
ATOM 8128  O "O4'"  . DC  A 1 10 ? 12.265  4.079   -1.293  1.00 0.00 ? 78 DC  A "O4'"  5  
ATOM 8129  C "C3'"  . DC  A 1 10 ? 13.989  4.781   0.121   1.00 0.00 ? 78 DC  A "C3'"  5  
ATOM 8130  O "O3'"  . DC  A 1 10 ? 15.020  5.372   -0.653  1.00 0.00 ? 78 DC  A "O3'"  5  
ATOM 8131  C "C2'"  . DC  A 1 10 ? 12.704  5.661   0.385   1.00 0.00 ? 78 DC  A "C2'"  5  
ATOM 8132  C "C1'"  . DC  A 1 10 ? 11.827  5.304   -0.816  1.00 0.00 ? 78 DC  A "C1'"  5  
ATOM 8133  N N1     . DC  A 1 10 ? 10.407  5.151   -0.449  1.00 0.00 ? 78 DC  A N1     5  
ATOM 8134  C C2     . DC  A 1 10 ? 9.427   5.707   -1.307  1.00 0.00 ? 78 DC  A C2     5  
ATOM 8135  O O2     . DC  A 1 10 ? 9.742   6.287   -2.381  1.00 0.00 ? 78 DC  A O2     5  
ATOM 8136  N N3     . DC  A 1 10 ? 8.116   5.586   -1.044  1.00 0.00 ? 78 DC  A N3     5  
ATOM 8137  C C4     . DC  A 1 10 ? 7.807   4.868   -0.025  1.00 0.00 ? 78 DC  A C4     5  
ATOM 8138  N N4     . DC  A 1 10 ? 6.547   4.818   0.262   1.00 0.00 ? 78 DC  A N4     5  
ATOM 8139  C C5     . DC  A 1 10 ? 8.729   4.208   0.799   1.00 0.00 ? 78 DC  A C5     5  
ATOM 8140  C C6     . DC  A 1 10 ? 10.040  4.317   0.551   1.00 0.00 ? 78 DC  A C6     5  
ATOM 8141  H "H5'"  . DC  A 1 10 ? 12.652  1.581   -0.432  1.00 0.00 ? 78 DC  A "H5'"  5  
ATOM 8142  H "H5''" . DC  A 1 10 ? 14.260  1.978   0.356   1.00 0.00 ? 78 DC  A "H5''" 5  
ATOM 8143  H "H4'"  . DC  A 1 10 ? 14.057  3.261   -1.330  1.00 0.00 ? 78 DC  A "H4'"  5  
ATOM 8144  H "H3'"  . DC  A 1 10 ? 14.455  4.557   1.081   1.00 0.00 ? 78 DC  A "H3'"  5  
ATOM 8145  H "H2'"  . DC  A 1 10 ? 12.288  5.590   1.390   1.00 0.00 ? 78 DC  A "H2'"  5  
ATOM 8146  H "H2''" . DC  A 1 10 ? 12.840  6.736   0.263   1.00 0.00 ? 78 DC  A "H2''" 5  
ATOM 8147  H "H1'"  . DC  A 1 10 ? 11.923  6.059   -1.596  1.00 0.00 ? 78 DC  A "H1'"  5  
ATOM 8148  H H41    . DC  A 1 10 ? 6.213   4.295   1.058   1.00 0.00 ? 78 DC  A H41    5  
ATOM 8149  H H42    . DC  A 1 10 ? 5.941   5.464   -0.223  1.00 0.00 ? 78 DC  A H42    5  
ATOM 8150  H H5     . DC  A 1 10 ? 8.427   3.671   1.685   1.00 0.00 ? 78 DC  A H5     5  
ATOM 8151  H H6     . DC  A 1 10 ? 10.802  3.782   1.099   1.00 0.00 ? 78 DC  A H6     5  
ATOM 8152  P P      . DC  A 1 11 ? 15.718  6.759   -0.266  1.00 0.00 ? 79 DC  A P      5  
ATOM 8153  O OP1    . DC  A 1 11 ? 16.898  6.791   -1.150  1.00 0.00 ? 79 DC  A OP1    5  
ATOM 8154  O OP2    . DC  A 1 11 ? 15.911  6.885   1.212   1.00 0.00 ? 79 DC  A OP2    5  
ATOM 8155  O "O5'"  . DC  A 1 11 ? 14.724  7.931   -0.850  1.00 0.00 ? 79 DC  A "O5'"  5  
ATOM 8156  C "C5'"  . DC  A 1 11 ? 14.508  8.095   -2.266  1.00 0.00 ? 79 DC  A "C5'"  5  
ATOM 8157  C "C4'"  . DC  A 1 11 ? 13.443  9.150   -2.620  1.00 0.00 ? 79 DC  A "C4'"  5  
ATOM 8158  O "O4'"  . DC  A 1 11 ? 12.168  8.538   -2.272  1.00 0.00 ? 79 DC  A "O4'"  5  
ATOM 8159  C "C3'"  . DC  A 1 11 ? 13.602  10.353  -1.708  1.00 0.00 ? 79 DC  A "C3'"  5  
ATOM 8160  O "O3'"  . DC  A 1 11 ? 13.454  11.696  -2.307  1.00 0.00 ? 79 DC  A "O3'"  5  
ATOM 8161  C "C2'"  . DC  A 1 11 ? 12.498  10.272  -0.635  1.00 0.00 ? 79 DC  A "C2'"  5  
ATOM 8162  C "C1'"  . DC  A 1 11 ? 11.458  9.529   -1.490  1.00 0.00 ? 79 DC  A "C1'"  5  
ATOM 8163  N N1     . DC  A 1 11 ? 10.245  9.074   -0.843  1.00 0.00 ? 79 DC  A N1     5  
ATOM 8164  C C2     . DC  A 1 11 ? 9.023   9.579   -1.294  1.00 0.00 ? 79 DC  A C2     5  
ATOM 8165  O O2     . DC  A 1 11 ? 8.950   10.306  -2.268  1.00 0.00 ? 79 DC  A O2     5  
ATOM 8166  N N3     . DC  A 1 11 ? 7.886   9.203   -0.590  1.00 0.00 ? 79 DC  A N3     5  
ATOM 8167  C C4     . DC  A 1 11 ? 7.984   8.466   0.505   1.00 0.00 ? 79 DC  A C4     5  
ATOM 8168  N N4     . DC  A 1 11 ? 6.898   8.162   1.035   1.00 0.00 ? 79 DC  A N4     5  
ATOM 8169  C C5     . DC  A 1 11 ? 9.262   8.021   1.009   1.00 0.00 ? 79 DC  A C5     5  
ATOM 8170  C C6     . DC  A 1 11 ? 10.367  8.442   0.360   1.00 0.00 ? 79 DC  A C6     5  
ATOM 8171  H "H5'"  . DC  A 1 11 ? 14.247  7.129   -2.697  1.00 0.00 ? 79 DC  A "H5'"  5  
ATOM 8172  H "H5''" . DC  A 1 11 ? 15.363  8.517   -2.793  1.00 0.00 ? 79 DC  A "H5''" 5  
ATOM 8173  H "H4'"  . DC  A 1 11 ? 13.497  9.507   -3.649  1.00 0.00 ? 79 DC  A "H4'"  5  
ATOM 8174  H "H3'"  . DC  A 1 11 ? 14.605  10.358  -1.283  1.00 0.00 ? 79 DC  A "H3'"  5  
ATOM 8175  H "H2'"  . DC  A 1 11 ? 12.848  9.695   0.222   1.00 0.00 ? 79 DC  A "H2'"  5  
ATOM 8176  H "H2''" . DC  A 1 11 ? 12.073  11.261  -0.465  1.00 0.00 ? 79 DC  A "H2''" 5  
ATOM 8177  H "H1'"  . DC  A 1 11 ? 11.100  10.243  -2.232  1.00 0.00 ? 79 DC  A "H1'"  5  
ATOM 8178  H H41    . DC  A 1 11 ? 6.851   7.522   1.815   1.00 0.00 ? 79 DC  A H41    5  
ATOM 8179  H H42    . DC  A 1 11 ? 6.074   8.553   0.601   1.00 0.00 ? 79 DC  A H42    5  
ATOM 8180  H H5     . DC  A 1 11 ? 9.481   7.488   1.924   1.00 0.00 ? 79 DC  A H5     5  
ATOM 8181  H H6     . DC  A 1 11 ? 11.338  8.151   0.731   1.00 0.00 ? 79 DC  A H6     5  
ATOM 8182  P P      . DC  A 1 12 ? 14.342  12.401  -3.355  1.00 0.00 ? 80 DC  A P      5  
ATOM 8183  O OP1    . DC  A 1 12 ? 15.004  11.291  -4.038  1.00 0.00 ? 80 DC  A OP1    5  
ATOM 8184  O OP2    . DC  A 1 12 ? 15.143  13.385  -2.568  1.00 0.00 ? 80 DC  A OP2    5  
ATOM 8185  O "O5'"  . DC  A 1 12 ? 13.236  13.034  -4.321  1.00 0.00 ? 80 DC  A "O5'"  5  
ATOM 8186  C "C5'"  . DC  A 1 12 ? 12.285  12.284  -5.019  1.00 0.00 ? 80 DC  A "C5'"  5  
ATOM 8187  C "C4'"  . DC  A 1 12 ? 11.171  13.176  -5.536  1.00 0.00 ? 80 DC  A "C4'"  5  
ATOM 8188  O "O4'"  . DC  A 1 12 ? 9.924   13.121  -4.771  1.00 0.00 ? 80 DC  A "O4'"  5  
ATOM 8189  C "C3'"  . DC  A 1 12 ? 11.570  14.645  -5.628  1.00 0.00 ? 80 DC  A "C3'"  5  
ATOM 8190  O "O3'"  . DC  A 1 12 ? 10.733  15.283  -6.663  1.00 0.00 ? 80 DC  A "O3'"  5  
ATOM 8191  C "C2'"  . DC  A 1 12 ? 11.123  15.082  -4.162  1.00 0.00 ? 80 DC  A "C2'"  5  
ATOM 8192  C "C1'"  . DC  A 1 12 ? 9.864   14.213  -3.889  1.00 0.00 ? 80 DC  A "C1'"  5  
ATOM 8193  N N1     . DC  A 1 12 ? 9.711   13.671  -2.516  1.00 0.00 ? 80 DC  A N1     5  
ATOM 8194  C C2     . DC  A 1 12 ? 8.391   13.437  -2.050  1.00 0.00 ? 80 DC  A C2     5  
ATOM 8195  O O2     . DC  A 1 12 ? 7.426   13.581  -2.821  1.00 0.00 ? 80 DC  A O2     5  
ATOM 8196  N N3     . DC  A 1 12 ? 8.122   13.156  -0.737  1.00 0.00 ? 80 DC  A N3     5  
ATOM 8197  C C4     . DC  A 1 12 ? 9.106   13.084  0.062   1.00 0.00 ? 80 DC  A C4     5  
ATOM 8198  N N4     . DC  A 1 12 ? 8.849   12.525  1.190   1.00 0.00 ? 80 DC  A N4     5  
ATOM 8199  C C5     . DC  A 1 12 ? 10.443  13.412  -0.284  1.00 0.00 ? 80 DC  A C5     5  
ATOM 8200  C C6     . DC  A 1 12 ? 10.684  13.653  -1.619  1.00 0.00 ? 80 DC  A C6     5  
ATOM 8201  H "H5'"  . DC  A 1 12 ? 11.850  11.583  -4.307  1.00 0.00 ? 80 DC  A "H5'"  5  
ATOM 8202  H "H5''" . DC  A 1 12 ? 12.649  11.734  -5.886  1.00 0.00 ? 80 DC  A "H5''" 5  
ATOM 8203  H "H4'"  . DC  A 1 12 ? 10.904  13.010  -6.580  1.00 0.00 ? 80 DC  A "H4'"  5  
ATOM 8204  H "H3'"  . DC  A 1 12 ? 12.604  14.904  -5.856  1.00 0.00 ? 80 DC  A "H3'"  5  
ATOM 8205  H "H2'"  . DC  A 1 12 ? 11.939  14.889  -3.465  1.00 0.00 ? 80 DC  A "H2'"  5  
ATOM 8206  H "H2''" . DC  A 1 12 ? 10.945  16.153  -4.259  1.00 0.00 ? 80 DC  A "H2''" 5  
ATOM 8207  H "H1'"  . DC  A 1 12 ? 9.008   14.831  -4.157  1.00 0.00 ? 80 DC  A "H1'"  5  
ATOM 8208  H H41    . DC  A 1 12 ? 9.599   12.183  1.774   1.00 0.00 ? 80 DC  A H41    5  
ATOM 8209  H H42    . DC  A 1 12 ? 7.909   12.345  1.510   1.00 0.00 ? 80 DC  A H42    5  
ATOM 8210  H H5     . DC  A 1 12 ? 11.309  13.363  0.359   1.00 0.00 ? 80 DC  A H5     5  
ATOM 8211  H H6     . DC  A 1 12 ? 11.719  13.799  -1.892  1.00 0.00 ? 80 DC  A H6     5  
ATOM 8212  P P      . DG  A 1 13 ? 10.733  16.840  -7.000  1.00 0.00 ? 81 DG  A P      5  
ATOM 8213  O OP1    . DG  A 1 13 ? 10.321  17.046  -8.357  1.00 0.00 ? 81 DG  A OP1    5  
ATOM 8214  O OP2    . DG  A 1 13 ? 11.923  17.430  -6.501  1.00 0.00 ? 81 DG  A OP2    5  
ATOM 8215  O "O5'"  . DG  A 1 13 ? 9.591   17.492  -6.072  1.00 0.00 ? 81 DG  A "O5'"  5  
ATOM 8216  C "C5'"  . DG  A 1 13 ? 8.198   17.247  -6.373  1.00 0.00 ? 81 DG  A "C5'"  5  
ATOM 8217  C "C4'"  . DG  A 1 13 ? 7.297   18.055  -5.450  1.00 0.00 ? 81 DG  A "C4'"  5  
ATOM 8218  O "O4'"  . DG  A 1 13 ? 7.141   17.355  -4.196  1.00 0.00 ? 81 DG  A "O4'"  5  
ATOM 8219  C "C3'"  . DG  A 1 13 ? 7.846   19.438  -5.081  1.00 0.00 ? 81 DG  A "C3'"  5  
ATOM 8220  O "O3'"  . DG  A 1 13 ? 6.879   20.475  -5.123  1.00 0.00 ? 81 DG  A "O3'"  5  
ATOM 8221  C "C2'"  . DG  A 1 13 ? 8.449   19.309  -3.690  1.00 0.00 ? 81 DG  A "C2'"  5  
ATOM 8222  C "C1'"  . DG  A 1 13 ? 7.404   18.317  -3.154  1.00 0.00 ? 81 DG  A "C1'"  5  
ATOM 8223  N N9     . DG  A 1 13 ? 7.909   17.510  -2.019  1.00 0.00 ? 81 DG  A N9     5  
ATOM 8224  C C8     . DG  A 1 13 ? 9.163   17.482  -1.482  1.00 0.00 ? 81 DG  A C8     5  
ATOM 8225  N N7     . DG  A 1 13 ? 9.292   16.821  -0.340  1.00 0.00 ? 81 DG  A N7     5  
ATOM 8226  C C5     . DG  A 1 13 ? 7.925   16.454  -0.088  1.00 0.00 ? 81 DG  A C5     5  
ATOM 8227  C C6     . DG  A 1 13 ? 7.380   15.907  1.070   1.00 0.00 ? 81 DG  A C6     5  
ATOM 8228  O O6     . DG  A 1 13 ? 7.934   15.595  2.112   1.00 0.00 ? 81 DG  A O6     5  
ATOM 8229  N N1     . DG  A 1 13 ? 6.016   15.747  1.108   1.00 0.00 ? 81 DG  A N1     5  
ATOM 8230  C C2     . DG  A 1 13 ? 5.225   16.159  0.055   1.00 0.00 ? 81 DG  A C2     5  
ATOM 8231  N N2     . DG  A 1 13 ? 3.893   16.065  0.202   1.00 0.00 ? 81 DG  A N2     5  
ATOM 8232  N N3     . DG  A 1 13 ? 5.747   16.881  -1.026  1.00 0.00 ? 81 DG  A N3     5  
ATOM 8233  C C4     . DG  A 1 13 ? 7.088   16.947  -1.043  1.00 0.00 ? 81 DG  A C4     5  
ATOM 8234  H "H5'"  . DG  A 1 13 ? 8.001   16.183  -6.244  1.00 0.00 ? 81 DG  A "H5'"  5  
ATOM 8235  H "H5''" . DG  A 1 13 ? 8.009   17.624  -7.378  1.00 0.00 ? 81 DG  A "H5''" 5  
ATOM 8236  H "H4'"  . DG  A 1 13 ? 6.313   18.209  -5.894  1.00 0.00 ? 81 DG  A "H4'"  5  
ATOM 8237  H "H3'"  . DG  A 1 13 ? 8.704   19.739  -5.680  1.00 0.00 ? 81 DG  A "H3'"  5  
ATOM 8238  H "HO3'" . DG  A 1 13 ? 7.280   21.312  -4.875  1.00 0.00 ? 81 DG  A "HO3'" 5  
ATOM 8239  H "H2'"  . DG  A 1 13 ? 9.476   18.986  -3.858  1.00 0.00 ? 81 DG  A "H2'"  5  
ATOM 8240  H "H2''" . DG  A 1 13 ? 8.359   20.220  -3.098  1.00 0.00 ? 81 DG  A "H2''" 5  
ATOM 8241  H "H1'"  . DG  A 1 13 ? 6.503   18.852  -2.853  1.00 0.00 ? 81 DG  A "H1'"  5  
ATOM 8242  H H8     . DG  A 1 13 ? 9.983   17.946  -2.009  1.00 0.00 ? 81 DG  A H8     5  
ATOM 8243  H H1     . DG  A 1 13 ? 5.620   15.457  1.992   1.00 0.00 ? 81 DG  A H1     5  
ATOM 8244  H H21    . DG  A 1 13 ? 3.254   16.520  -0.434  1.00 0.00 ? 81 DG  A H21    5  
ATOM 8245  H H22    . DG  A 1 13 ? 3.410   15.655  0.988   1.00 0.00 ? 81 DG  A H22    5  
ATOM 8246  O "O5'"  . DC  B 2 1  ? -0.076  13.877  8.521   1.00 0.00 ? 82 DC  B "O5'"  5  
ATOM 8247  C "C5'"  . DC  B 2 1  ? -0.538  14.690  7.502   1.00 0.00 ? 82 DC  B "C5'"  5  
ATOM 8248  C "C4'"  . DC  B 2 1  ? -0.081  14.383  6.134   1.00 0.00 ? 82 DC  B "C4'"  5  
ATOM 8249  O "O4'"  . DC  B 2 1  ? 1.216   14.823  5.942   1.00 0.00 ? 82 DC  B "O4'"  5  
ATOM 8250  C "C3'"  . DC  B 2 1  ? -0.216  12.892  5.719   1.00 0.00 ? 82 DC  B "C3'"  5  
ATOM 8251  O "O3'"  . DC  B 2 1  ? -1.275  12.683  4.855   1.00 0.00 ? 82 DC  B "O3'"  5  
ATOM 8252  C "C2'"  . DC  B 2 1  ? 1.136   12.682  4.979   1.00 0.00 ? 82 DC  B "C2'"  5  
ATOM 8253  C "C1'"  . DC  B 2 1  ? 1.650   14.124  4.816   1.00 0.00 ? 82 DC  B "C1'"  5  
ATOM 8254  N N1     . DC  B 2 1  ? 3.111   14.080  4.703   1.00 0.00 ? 82 DC  B N1     5  
ATOM 8255  C C2     . DC  B 2 1  ? 3.704   14.518  3.529   1.00 0.00 ? 82 DC  B C2     5  
ATOM 8256  O O2     . DC  B 2 1  ? 3.048   14.861  2.530   1.00 0.00 ? 82 DC  B O2     5  
ATOM 8257  N N3     . DC  B 2 1  ? 5.057   14.507  3.421   1.00 0.00 ? 82 DC  B N3     5  
ATOM 8258  C C4     . DC  B 2 1  ? 5.708   13.943  4.381   1.00 0.00 ? 82 DC  B C4     5  
ATOM 8259  N N4     . DC  B 2 1  ? 6.974   14.057  4.210   1.00 0.00 ? 82 DC  B N4     5  
ATOM 8260  C C5     . DC  B 2 1  ? 5.176   13.401  5.607   1.00 0.00 ? 82 DC  B C5     5  
ATOM 8261  C C6     . DC  B 2 1  ? 3.851   13.573  5.708   1.00 0.00 ? 82 DC  B C6     5  
ATOM 8262  H "H5'"  . DC  B 2 1  ? -0.280  15.741  7.624   1.00 0.00 ? 82 DC  B "H5'"  5  
ATOM 8263  H "H5''" . DC  B 2 1  ? -1.627  14.714  7.558   1.00 0.00 ? 82 DC  B "H5''" 5  
ATOM 8264  H "H4'"  . DC  B 2 1  ? -0.572  15.040  5.415   1.00 0.00 ? 82 DC  B "H4'"  5  
ATOM 8265  H "H3'"  . DC  B 2 1  ? -0.284  12.222  6.576   1.00 0.00 ? 82 DC  B "H3'"  5  
ATOM 8266  H "H2'"  . DC  B 2 1  ? 1.760   12.018  5.577   1.00 0.00 ? 82 DC  B "H2'"  5  
ATOM 8267  H "H2''" . DC  B 2 1  ? 0.743   12.289  4.041   1.00 0.00 ? 82 DC  B "H2''" 5  
ATOM 8268  H "H1'"  . DC  B 2 1  ? 1.111   14.364  3.900   1.00 0.00 ? 82 DC  B "H1'"  5  
ATOM 8269  H H41    . DC  B 2 1  ? 7.626   13.485  4.726   1.00 0.00 ? 82 DC  B H41    5  
ATOM 8270  H H42    . DC  B 2 1  ? 7.249   14.357  3.285   1.00 0.00 ? 82 DC  B H42    5  
ATOM 8271  H H5     . DC  B 2 1  ? 5.794   12.974  6.384   1.00 0.00 ? 82 DC  B H5     5  
ATOM 8272  H H6     . DC  B 2 1  ? 3.298   13.269  6.584   1.00 0.00 ? 82 DC  B H6     5  
ATOM 8273  H "HO5'" . DC  B 2 1  ? -0.597  13.987  9.319   1.00 0.00 ? 82 DC  B "HO5'" 5  
ATOM 8274  P P      . DG  B 2 2  ? -1.790  11.192  4.477   1.00 0.00 ? 83 DG  B P      5  
ATOM 8275  O OP1    . DG  B 2 2  ? -3.248  11.176  4.763   1.00 0.00 ? 83 DG  B OP1    5  
ATOM 8276  O OP2    . DG  B 2 2  ? -0.921  10.127  5.104   1.00 0.00 ? 83 DG  B OP2    5  
ATOM 8277  O "O5'"  . DG  B 2 2  ? -1.577  11.171  2.952   1.00 0.00 ? 83 DG  B "O5'"  5  
ATOM 8278  C "C5'"  . DG  B 2 2  ? -2.154  12.058  2.028   1.00 0.00 ? 83 DG  B "C5'"  5  
ATOM 8279  C "C4'"  . DG  B 2 2  ? -1.700  11.862  0.576   1.00 0.00 ? 83 DG  B "C4'"  5  
ATOM 8280  O "O4'"  . DG  B 2 2  ? -0.321  12.234  0.398   1.00 0.00 ? 83 DG  B "O4'"  5  
ATOM 8281  C "C3'"  . DG  B 2 2  ? -1.776  10.363  0.064   1.00 0.00 ? 83 DG  B "C3'"  5  
ATOM 8282  O "O3'"  . DG  B 2 2  ? -1.760  10.194  -1.413  1.00 0.00 ? 83 DG  B "O3'"  5  
ATOM 8283  C "C2'"  . DG  B 2 2  ? -0.430  9.794   0.494   1.00 0.00 ? 83 DG  B "C2'"  5  
ATOM 8284  C "C1'"  . DG  B 2 2  ? 0.415   11.044  0.242   1.00 0.00 ? 83 DG  B "C1'"  5  
ATOM 8285  N N9     . DG  B 2 2  ? 1.691   11.183  0.917   1.00 0.00 ? 83 DG  B N9     5  
ATOM 8286  C C8     . DG  B 2 2  ? 2.020   10.731  2.197   1.00 0.00 ? 83 DG  B C8     5  
ATOM 8287  N N7     . DG  B 2 2  ? 3.262   10.873  2.533   1.00 0.00 ? 83 DG  B N7     5  
ATOM 8288  C C5     . DG  B 2 2  ? 3.863   11.409  1.358   1.00 0.00 ? 83 DG  B C5     5  
ATOM 8289  C C6     . DG  B 2 2  ? 5.220   11.791  1.090   1.00 0.00 ? 83 DG  B C6     5  
ATOM 8290  O O6     . DG  B 2 2  ? 6.193   11.549  1.756   1.00 0.00 ? 83 DG  B O6     5  
ATOM 8291  N N1     . DG  B 2 2  ? 5.376   12.561  -0.047  1.00 0.00 ? 83 DG  B N1     5  
ATOM 8292  C C2     . DG  B 2 2  ? 4.366   12.806  -0.910  1.00 0.00 ? 83 DG  B C2     5  
ATOM 8293  N N2     . DG  B 2 2  ? 4.616   13.414  -2.005  1.00 0.00 ? 83 DG  B N2     5  
ATOM 8294  N N3     . DG  B 2 2  ? 3.061   12.436  -0.739  1.00 0.00 ? 83 DG  B N3     5  
ATOM 8295  C C4     . DG  B 2 2  ? 2.880   11.749  0.427   1.00 0.00 ? 83 DG  B C4     5  
ATOM 8296  H "H5'"  . DG  B 2 2  ? -1.926  13.042  2.438   1.00 0.00 ? 83 DG  B "H5'"  5  
ATOM 8297  H "H5''" . DG  B 2 2  ? -3.227  11.877  2.082   1.00 0.00 ? 83 DG  B "H5''" 5  
ATOM 8298  H "H4'"  . DG  B 2 2  ? -2.364  12.537  0.037   1.00 0.00 ? 83 DG  B "H4'"  5  
ATOM 8299  H "H3'"  . DG  B 2 2  ? -2.558  9.766   0.533   1.00 0.00 ? 83 DG  B "H3'"  5  
ATOM 8300  H "H2'"  . DG  B 2 2  ? -0.560  9.462   1.524   1.00 0.00 ? 83 DG  B "H2'"  5  
ATOM 8301  H "H2''" . DG  B 2 2  ? -0.107  8.989   -0.167  1.00 0.00 ? 83 DG  B "H2''" 5  
ATOM 8302  H "H1'"  . DG  B 2 2  ? 0.738   11.000  -0.799  1.00 0.00 ? 83 DG  B "H1'"  5  
ATOM 8303  H H8     . DG  B 2 2  ? 1.211   10.569  2.893   1.00 0.00 ? 83 DG  B H8     5  
ATOM 8304  H H1     . DG  B 2 2  ? 6.331   12.696  -0.348  1.00 0.00 ? 83 DG  B H1     5  
ATOM 8305  H H21    . DG  B 2 2  ? 3.789   13.424  -2.584  1.00 0.00 ? 83 DG  B H21    5  
ATOM 8306  H H22    . DG  B 2 2  ? 5.563   13.548  -2.334  1.00 0.00 ? 83 DG  B H22    5  
ATOM 8307  P P      . DG  B 2 3  ? -2.911  10.580  -2.396  1.00 0.00 ? 84 DG  B P      5  
ATOM 8308  O OP1    . DG  B 2 3  ? -3.506  11.862  -2.078  1.00 0.00 ? 84 DG  B OP1    5  
ATOM 8309  O OP2    . DG  B 2 3  ? -3.789  9.395   -2.441  1.00 0.00 ? 84 DG  B OP2    5  
ATOM 8310  O "O5'"  . DG  B 2 3  ? -2.130  10.696  -3.796  1.00 0.00 ? 84 DG  B "O5'"  5  
ATOM 8311  C "C5'"  . DG  B 2 3  ? -1.427  11.920  -4.200  1.00 0.00 ? 84 DG  B "C5'"  5  
ATOM 8312  C "C4'"  . DG  B 2 3  ? -0.491  11.891  -5.407  1.00 0.00 ? 84 DG  B "C4'"  5  
ATOM 8313  O "O4'"  . DG  B 2 3  ? 0.890   11.885  -5.126  1.00 0.00 ? 84 DG  B "O4'"  5  
ATOM 8314  C "C3'"  . DG  B 2 3  ? -0.655  10.818  -6.484  1.00 0.00 ? 84 DG  B "C3'"  5  
ATOM 8315  O "O3'"  . DG  B 2 3  ? -0.141  11.269  -7.629  1.00 0.00 ? 84 DG  B "O3'"  5  
ATOM 8316  C "C2'"  . DG  B 2 3  ? 0.164   9.745   -5.852  1.00 0.00 ? 84 DG  B "C2'"  5  
ATOM 8317  C "C1'"  . DG  B 2 3  ? 1.382   10.510  -5.252  1.00 0.00 ? 84 DG  B "C1'"  5  
ATOM 8318  N N9     . DG  B 2 3  ? 1.879   10.025  -3.931  1.00 0.00 ? 84 DG  B N9     5  
ATOM 8319  C C8     . DG  B 2 3  ? 1.110   9.594   -2.882  1.00 0.00 ? 84 DG  B C8     5  
ATOM 8320  N N7     . DG  B 2 3  ? 1.781   9.120   -1.920  1.00 0.00 ? 84 DG  B N7     5  
ATOM 8321  C C5     . DG  B 2 3  ? 3.112   9.484   -2.197  1.00 0.00 ? 84 DG  B C5     5  
ATOM 8322  C C6     . DG  B 2 3  ? 4.362   9.304   -1.420  1.00 0.00 ? 84 DG  B C6     5  
ATOM 8323  O O6     . DG  B 2 3  ? 4.571   8.891   -0.289  1.00 0.00 ? 84 DG  B O6     5  
ATOM 8324  N N1     . DG  B 2 3  ? 5.444   9.822   -2.033  1.00 0.00 ? 84 DG  B N1     5  
ATOM 8325  C C2     . DG  B 2 3  ? 5.439   10.325  -3.330  1.00 0.00 ? 84 DG  B C2     5  
ATOM 8326  N N2     . DG  B 2 3  ? 6.557   10.645  -3.796  1.00 0.00 ? 84 DG  B N2     5  
ATOM 8327  N N3     . DG  B 2 3  ? 4.343   10.455  -4.112  1.00 0.00 ? 84 DG  B N3     5  
ATOM 8328  C C4     . DG  B 2 3  ? 3.187   10.053  -3.468  1.00 0.00 ? 84 DG  B C4     5  
ATOM 8329  H "H5'"  . DG  B 2 3  ? -0.828  12.297  -3.371  1.00 0.00 ? 84 DG  B "H5'"  5  
ATOM 8330  H "H5''" . DG  B 2 3  ? -2.231  12.621  -4.419  1.00 0.00 ? 84 DG  B "H5''" 5  
ATOM 8331  H "H4'"  . DG  B 2 3  ? -0.787  12.853  -5.825  1.00 0.00 ? 84 DG  B "H4'"  5  
ATOM 8332  H "H3'"  . DG  B 2 3  ? -1.700  10.515  -6.540  1.00 0.00 ? 84 DG  B "H3'"  5  
ATOM 8333  H "H2'"  . DG  B 2 3  ? -0.484  9.284   -5.107  1.00 0.00 ? 84 DG  B "H2'"  5  
ATOM 8334  H "H2''" . DG  B 2 3  ? 0.500   8.970   -6.542  1.00 0.00 ? 84 DG  B "H2''" 5  
ATOM 8335  H "H1'"  . DG  B 2 3  ? 2.204   10.477  -5.967  1.00 0.00 ? 84 DG  B "H1'"  5  
ATOM 8336  H H8     . DG  B 2 3  ? 0.035   9.558   -2.969  1.00 0.00 ? 84 DG  B H8     5  
ATOM 8337  H H1     . DG  B 2 3  ? 6.316   9.879   -1.530  1.00 0.00 ? 84 DG  B H1     5  
ATOM 8338  H H21    . DG  B 2 3  ? 6.678   10.876  -4.772  1.00 0.00 ? 84 DG  B H21    5  
ATOM 8339  H H22    . DG  B 2 3  ? 7.361   10.674  -3.185  1.00 0.00 ? 84 DG  B H22    5  
ATOM 8340  P P      . DG  B 2 4  ? -0.273  10.533  -9.014  1.00 0.00 ? 85 DG  B P      5  
ATOM 8341  O OP1    . DG  B 2 4  ? 0.012   11.464  -10.106 1.00 0.00 ? 85 DG  B OP1    5  
ATOM 8342  O OP2    . DG  B 2 4  ? -1.481  9.701   -9.090  1.00 0.00 ? 85 DG  B OP2    5  
ATOM 8343  O "O5'"  . DG  B 2 4  ? 0.996   9.596   -8.889  1.00 0.00 ? 85 DG  B "O5'"  5  
ATOM 8344  C "C5'"  . DG  B 2 4  ? 2.296   10.142  -9.124  1.00 0.00 ? 85 DG  B "C5'"  5  
ATOM 8345  C "C4'"  . DG  B 2 4  ? 3.377   9.154   -8.801  1.00 0.00 ? 85 DG  B "C4'"  5  
ATOM 8346  O "O4'"  . DG  B 2 4  ? 3.447   9.017   -7.427  1.00 0.00 ? 85 DG  B "O4'"  5  
ATOM 8347  C "C3'"  . DG  B 2 4  ? 2.965   7.761   -9.482  1.00 0.00 ? 85 DG  B "C3'"  5  
ATOM 8348  O "O3'"  . DG  B 2 4  ? 4.034   7.152   -10.140 1.00 0.00 ? 85 DG  B "O3'"  5  
ATOM 8349  C "C2'"  . DG  B 2 4  ? 2.551   6.964   -8.259  1.00 0.00 ? 85 DG  B "C2'"  5  
ATOM 8350  C "C1'"  . DG  B 2 4  ? 3.429   7.574   -7.155  1.00 0.00 ? 85 DG  B "C1'"  5  
ATOM 8351  N N9     . DG  B 2 4  ? 3.185   7.168   -5.755  1.00 0.00 ? 85 DG  B N9     5  
ATOM 8352  C C8     . DG  B 2 4  ? 2.053   6.805   -5.122  1.00 0.00 ? 85 DG  B C8     5  
ATOM 8353  N N7     . DG  B 2 4  ? 2.308   6.256   -3.977  1.00 0.00 ? 85 DG  B N7     5  
ATOM 8354  C C5     . DG  B 2 4  ? 3.682   6.459   -3.677  1.00 0.00 ? 85 DG  B C5     5  
ATOM 8355  C C6     . DG  B 2 4  ? 4.563   6.238   -2.561  1.00 0.00 ? 85 DG  B C6     5  
ATOM 8356  O O6     . DG  B 2 4  ? 4.403   5.784   -1.397  1.00 0.00 ? 85 DG  B O6     5  
ATOM 8357  N N1     . DG  B 2 4  ? 5.856   6.655   -2.745  1.00 0.00 ? 85 DG  B N1     5  
ATOM 8358  C C2     . DG  B 2 4  ? 6.319   6.958   -3.990  1.00 0.00 ? 85 DG  B C2     5  
ATOM 8359  N N2     . DG  B 2 4  ? 7.581   7.228   -4.159  1.00 0.00 ? 85 DG  B N2     5  
ATOM 8360  N N3     . DG  B 2 4  ? 5.574   7.352   -5.095  1.00 0.00 ? 85 DG  B N3     5  
ATOM 8361  C C4     . DG  B 2 4  ? 4.224   7.023   -4.847  1.00 0.00 ? 85 DG  B C4     5  
ATOM 8362  H "H5'"  . DG  B 2 4  ? 2.403   11.005  -8.468  1.00 0.00 ? 85 DG  B "H5'"  5  
ATOM 8363  H "H5''" . DG  B 2 4  ? 2.397   10.296  -10.198 1.00 0.00 ? 85 DG  B "H5''" 5  
ATOM 8364  H "H4'"  . DG  B 2 4  ? 4.315   9.569   -9.168  1.00 0.00 ? 85 DG  B "H4'"  5  
ATOM 8365  H "H3'"  . DG  B 2 4  ? 2.155   7.858   -10.204 1.00 0.00 ? 85 DG  B "H3'"  5  
ATOM 8366  H "H2'"  . DG  B 2 4  ? 1.524   7.207   -7.984  1.00 0.00 ? 85 DG  B "H2'"  5  
ATOM 8367  H "H2''" . DG  B 2 4  ? 2.829   5.912   -8.330  1.00 0.00 ? 85 DG  B "H2''" 5  
ATOM 8368  H "H1'"  . DG  B 2 4  ? 4.426   7.181   -7.362  1.00 0.00 ? 85 DG  B "H1'"  5  
ATOM 8369  H H8     . DG  B 2 4  ? 1.090   6.832   -5.609  1.00 0.00 ? 85 DG  B H8     5  
ATOM 8370  H H1     . DG  B 2 4  ? 6.580   6.381   -2.097  1.00 0.00 ? 85 DG  B H1     5  
ATOM 8371  H H21    . DG  B 2 4  ? 7.848   7.636   -5.044  1.00 0.00 ? 85 DG  B H21    5  
ATOM 8372  H H22    . DG  B 2 4  ? 8.163   6.936   -3.387  1.00 0.00 ? 85 DG  B H22    5  
ATOM 8373  P P      . DG  B 2 5  ? 4.624   7.755   -11.486 1.00 0.00 ? 86 DG  B P      5  
ATOM 8374  O OP1    . DG  B 2 5  ? 4.546   9.216   -11.555 1.00 0.00 ? 86 DG  B OP1    5  
ATOM 8375  O OP2    . DG  B 2 5  ? 3.944   6.932   -12.495 1.00 0.00 ? 86 DG  B OP2    5  
ATOM 8376  O "O5'"  . DG  B 2 5  ? 6.119   7.302   -11.458 1.00 0.00 ? 86 DG  B "O5'"  5  
ATOM 8377  C "C5'"  . DG  B 2 5  ? 7.093   7.812   -10.539 1.00 0.00 ? 86 DG  B "C5'"  5  
ATOM 8378  C "C4'"  . DG  B 2 5  ? 8.412   7.076   -10.464 1.00 0.00 ? 86 DG  B "C4'"  5  
ATOM 8379  O "O4'"  . DG  B 2 5  ? 8.724   6.564   -9.195  1.00 0.00 ? 86 DG  B "O4'"  5  
ATOM 8380  C "C3'"  . DG  B 2 5  ? 8.450   5.779   -11.406 1.00 0.00 ? 86 DG  B "C3'"  5  
ATOM 8381  O "O3'"  . DG  B 2 5  ? 9.830   5.596   -11.728 1.00 0.00 ? 86 DG  B "O3'"  5  
ATOM 8382  C "C2'"  . DG  B 2 5  ? 7.881   4.707   -10.510 1.00 0.00 ? 86 DG  B "C2'"  5  
ATOM 8383  C "C1'"  . DG  B 2 5  ? 8.286   5.201   -9.077  1.00 0.00 ? 86 DG  B "C1'"  5  
ATOM 8384  N N9     . DG  B 2 5  ? 7.265   4.993   -8.099  1.00 0.00 ? 86 DG  B N9     5  
ATOM 8385  C C8     . DG  B 2 5  ? 5.909   5.131   -8.190  1.00 0.00 ? 86 DG  B C8     5  
ATOM 8386  N N7     . DG  B 2 5  ? 5.177   4.768   -7.180  1.00 0.00 ? 86 DG  B N7     5  
ATOM 8387  C C5     . DG  B 2 5  ? 6.092   4.231   -6.320  1.00 0.00 ? 86 DG  B C5     5  
ATOM 8388  C C6     . DG  B 2 5  ? 6.037   3.807   -4.940  1.00 0.00 ? 86 DG  B C6     5  
ATOM 8389  O O6     . DG  B 2 5  ? 5.085   3.738   -4.136  1.00 0.00 ? 86 DG  B O6     5  
ATOM 8390  N N1     . DG  B 2 5  ? 7.263   3.423   -4.346  1.00 0.00 ? 86 DG  B N1     5  
ATOM 8391  C C2     . DG  B 2 5  ? 8.465   3.512   -5.014  1.00 0.00 ? 86 DG  B C2     5  
ATOM 8392  N N2     . DG  B 2 5  ? 9.501   3.210   -4.297  1.00 0.00 ? 86 DG  B N2     5  
ATOM 8393  N N3     . DG  B 2 5  ? 8.612   4.066   -6.220  1.00 0.00 ? 86 DG  B N3     5  
ATOM 8394  C C4     . DG  B 2 5  ? 7.380   4.324   -6.858  1.00 0.00 ? 86 DG  B C4     5  
ATOM 8395  H "H5'"  . DG  B 2 5  ? 6.585   7.852   -9.576  1.00 0.00 ? 86 DG  B "H5'"  5  
ATOM 8396  H "H5''" . DG  B 2 5  ? 7.277   8.849   -10.822 1.00 0.00 ? 86 DG  B "H5''" 5  
ATOM 8397  H "H4'"  . DG  B 2 5  ? 9.105   7.805   -10.882 1.00 0.00 ? 86 DG  B "H4'"  5  
ATOM 8398  H "H3'"  . DG  B 2 5  ? 7.813   5.785   -12.290 1.00 0.00 ? 86 DG  B "H3'"  5  
ATOM 8399  H "H2'"  . DG  B 2 5  ? 6.793   4.663   -10.570 1.00 0.00 ? 86 DG  B "H2'"  5  
ATOM 8400  H "H2''" . DG  B 2 5  ? 8.322   3.768   -10.846 1.00 0.00 ? 86 DG  B "H2''" 5  
ATOM 8401  H "H1'"  . DG  B 2 5  ? 9.099   4.548   -8.760  1.00 0.00 ? 86 DG  B "H1'"  5  
ATOM 8402  H H8     . DG  B 2 5  ? 5.555   5.640   -9.075  1.00 0.00 ? 86 DG  B H8     5  
ATOM 8403  H H1     . DG  B 2 5  ? 7.219   3.199   -3.362  1.00 0.00 ? 86 DG  B H1     5  
ATOM 8404  H H21    . DG  B 2 5  ? 10.406  3.218   -4.746  1.00 0.00 ? 86 DG  B H21    5  
ATOM 8405  H H22    . DG  B 2 5  ? 9.385   2.752   -3.405  1.00 0.00 ? 86 DG  B H22    5  
ATOM 8406  P P      . DA  B 2 6  ? 10.327  4.361   -12.612 1.00 0.00 ? 87 DA  B P      5  
ATOM 8407  O OP1    . DA  B 2 6  ? 11.572  4.702   -13.319 1.00 0.00 ? 87 DA  B OP1    5  
ATOM 8408  O OP2    . DA  B 2 6  ? 9.204   3.870   -13.419 1.00 0.00 ? 87 DA  B OP2    5  
ATOM 8409  O "O5'"  . DA  B 2 6  ? 10.704  3.233   -11.610 1.00 0.00 ? 87 DA  B "O5'"  5  
ATOM 8410  C "C5'"  . DA  B 2 6  ? 11.711  3.465   -10.701 1.00 0.00 ? 87 DA  B "C5'"  5  
ATOM 8411  C "C4'"  . DA  B 2 6  ? 11.975  2.267   -9.873  1.00 0.00 ? 87 DA  B "C4'"  5  
ATOM 8412  O "O4'"  . DA  B 2 6  ? 10.965  1.980   -8.981  1.00 0.00 ? 87 DA  B "O4'"  5  
ATOM 8413  C "C3'"  . DA  B 2 6  ? 12.166  0.971   -10.588 1.00 0.00 ? 87 DA  B "C3'"  5  
ATOM 8414  O "O3'"  . DA  B 2 6  ? 13.214  0.251   -10.037 1.00 0.00 ? 87 DA  B "O3'"  5  
ATOM 8415  C "C2'"  . DA  B 2 6  ? 10.770  0.300   -10.526 1.00 0.00 ? 87 DA  B "C2'"  5  
ATOM 8416  C "C1'"  . DA  B 2 6  ? 10.335  0.698   -9.191  1.00 0.00 ? 87 DA  B "C1'"  5  
ATOM 8417  N N9     . DA  B 2 6  ? 8.862   0.857   -8.941  1.00 0.00 ? 87 DA  B N9     5  
ATOM 8418  C C8     . DA  B 2 6  ? 7.863   1.234   -9.769  1.00 0.00 ? 87 DA  B C8     5  
ATOM 8419  N N7     . DA  B 2 6  ? 6.723   1.425   -9.195  1.00 0.00 ? 87 DA  B N7     5  
ATOM 8420  C C5     . DA  B 2 6  ? 6.919   0.988   -7.854  1.00 0.00 ? 87 DA  B C5     5  
ATOM 8421  C C6     . DA  B 2 6  ? 6.161   0.898   -6.632  1.00 0.00 ? 87 DA  B C6     5  
ATOM 8422  N N6     . DA  B 2 6  ? 5.035   1.455   -6.481  1.00 0.00 ? 87 DA  B N6     5  
ATOM 8423  N N1     . DA  B 2 6  ? 6.817   0.557   -5.526  1.00 0.00 ? 87 DA  B N1     5  
ATOM 8424  C C2     . DA  B 2 6  ? 8.050   0.153   -5.605  1.00 0.00 ? 87 DA  B C2     5  
ATOM 8425  N N3     . DA  B 2 6  ? 8.860   0.210   -6.588  1.00 0.00 ? 87 DA  B N3     5  
ATOM 8426  C C4     . DA  B 2 6  ? 8.269   0.667   -7.759  1.00 0.00 ? 87 DA  B C4     5  
ATOM 8427  H "H5'"  . DA  B 2 6  ? 11.575  4.328   -10.050 1.00 0.00 ? 87 DA  B "H5'"  5  
ATOM 8428  H "H5''" . DA  B 2 6  ? 12.617  3.699   -11.258 1.00 0.00 ? 87 DA  B "H5''" 5  
ATOM 8429  H "H4'"  . DA  B 2 6  ? 12.867  2.496   -9.291  1.00 0.00 ? 87 DA  B "H4'"  5  
ATOM 8430  H "H3'"  . DA  B 2 6  ? 12.506  1.120   -11.612 1.00 0.00 ? 87 DA  B "H3'"  5  
ATOM 8431  H "H2'"  . DA  B 2 6  ? 10.208  0.876   -11.262 1.00 0.00 ? 87 DA  B "H2'"  5  
ATOM 8432  H "H2''" . DA  B 2 6  ? 10.777  -0.777  -10.690 1.00 0.00 ? 87 DA  B "H2''" 5  
ATOM 8433  H "H1'"  . DA  B 2 6  ? 10.755  -0.022  -8.489  1.00 0.00 ? 87 DA  B "H1'"  5  
ATOM 8434  H H8     . DA  B 2 6  ? 8.121   1.474   -10.791 1.00 0.00 ? 87 DA  B H8     5  
ATOM 8435  H H61    . DA  B 2 6  ? 4.697   1.585   -5.539  1.00 0.00 ? 87 DA  B H61    5  
ATOM 8436  H H62    . DA  B 2 6  ? 4.621   1.873   -7.301  1.00 0.00 ? 87 DA  B H62    5  
ATOM 8437  H H2     . DA  B 2 6  ? 8.452   -0.297  -4.709  1.00 0.00 ? 87 DA  B H2     5  
ATOM 8438  P P      . DT  B 2 7  ? 13.418  -1.267  -10.437 1.00 0.00 ? 88 DT  B P      5  
ATOM 8439  O OP1    . DT  B 2 7  ? 14.860  -1.444  -10.215 1.00 0.00 ? 88 DT  B OP1    5  
ATOM 8440  O OP2    . DT  B 2 7  ? 12.888  -1.518  -11.800 1.00 0.00 ? 88 DT  B OP2    5  
ATOM 8441  O "O5'"  . DT  B 2 7  ? 12.601  -2.076  -9.402  1.00 0.00 ? 88 DT  B "O5'"  5  
ATOM 8442  C "C5'"  . DT  B 2 7  ? 13.028  -1.974  -8.035  1.00 0.00 ? 88 DT  B "C5'"  5  
ATOM 8443  C "C4'"  . DT  B 2 7  ? 12.161  -2.594  -6.937  1.00 0.00 ? 88 DT  B "C4'"  5  
ATOM 8444  O "O4'"  . DT  B 2 7  ? 10.789  -2.302  -7.330  1.00 0.00 ? 88 DT  B "O4'"  5  
ATOM 8445  C "C3'"  . DT  B 2 7  ? 12.238  -4.131  -7.030  1.00 0.00 ? 88 DT  B "C3'"  5  
ATOM 8446  O "O3'"  . DT  B 2 7  ? 12.409  -4.586  -5.673  1.00 0.00 ? 88 DT  B "O3'"  5  
ATOM 8447  C "C2'"  . DT  B 2 7  ? 10.941  -4.461  -7.776  1.00 0.00 ? 88 DT  B "C2'"  5  
ATOM 8448  C "C1'"  . DT  B 2 7  ? 9.982   -3.493  -7.256  1.00 0.00 ? 88 DT  B "C1'"  5  
ATOM 8449  N N1     . DT  B 2 7  ? 8.704   -3.216  -7.972  1.00 0.00 ? 88 DT  B N1     5  
ATOM 8450  C C2     . DT  B 2 7  ? 7.560   -3.091  -7.165  1.00 0.00 ? 88 DT  B C2     5  
ATOM 8451  O O2     . DT  B 2 7  ? 7.478   -3.384  -6.007  1.00 0.00 ? 88 DT  B O2     5  
ATOM 8452  N N3     . DT  B 2 7  ? 6.497   -2.560  -7.786  1.00 0.00 ? 88 DT  B N3     5  
ATOM 8453  C C4     . DT  B 2 7  ? 6.306   -2.152  -9.056  1.00 0.00 ? 88 DT  B C4     5  
ATOM 8454  O O4     . DT  B 2 7  ? 5.248   -1.763  -9.388  1.00 0.00 ? 88 DT  B O4     5  
ATOM 8455  C C5     . DT  B 2 7  ? 7.559   -2.242  -9.870  1.00 0.00 ? 88 DT  B C5     5  
ATOM 8456  C C7     . DT  B 2 7  ? 7.599   -1.830  -11.320 1.00 0.00 ? 88 DT  B C7     5  
ATOM 8457  C C6     . DT  B 2 7  ? 8.670   -2.860  -9.321  1.00 0.00 ? 88 DT  B C6     5  
ATOM 8458  H "H5'"  . DT  B 2 7  ? 12.935  -0.908  -7.828  1.00 0.00 ? 88 DT  B "H5'"  5  
ATOM 8459  H "H5''" . DT  B 2 7  ? 14.072  -2.270  -7.939  1.00 0.00 ? 88 DT  B "H5''" 5  
ATOM 8460  H "H4'"  . DT  B 2 7  ? 12.348  -2.209  -5.935  1.00 0.00 ? 88 DT  B "H4'"  5  
ATOM 8461  H "H3'"  . DT  B 2 7  ? 13.052  -4.481  -7.663  1.00 0.00 ? 88 DT  B "H3'"  5  
ATOM 8462  H "H2'"  . DT  B 2 7  ? 11.230  -4.306  -8.816  1.00 0.00 ? 88 DT  B "H2'"  5  
ATOM 8463  H "H2''" . DT  B 2 7  ? 10.605  -5.497  -7.796  1.00 0.00 ? 88 DT  B "H2''" 5  
ATOM 8464  H "H1'"  . DT  B 2 7  ? 9.777   -3.675  -6.201  1.00 0.00 ? 88 DT  B "H1'"  5  
ATOM 8465  H H3     . DT  B 2 7  ? 5.685   -2.511  -7.187  1.00 0.00 ? 88 DT  B H3     5  
ATOM 8466  H H71    . DT  B 2 7  ? 8.601   -1.847  -11.749 1.00 0.00 ? 88 DT  B H71    5  
ATOM 8467  H H72    . DT  B 2 7  ? 6.980   -2.556  -11.848 1.00 0.00 ? 88 DT  B H72    5  
ATOM 8468  H H73    . DT  B 2 7  ? 7.174   -0.840  -11.486 1.00 0.00 ? 88 DT  B H73    5  
ATOM 8469  H H6     . DT  B 2 7  ? 9.608   -2.912  -9.852  1.00 0.00 ? 88 DT  B H6     5  
ATOM 8470  P P      . DT  B 2 8  ? 12.875  -6.019  -5.269  1.00 0.00 ? 89 DT  B P      5  
ATOM 8471  O OP1    . DT  B 2 8  ? 13.817  -5.820  -4.152  1.00 0.00 ? 89 DT  B OP1    5  
ATOM 8472  O OP2    . DT  B 2 8  ? 13.334  -6.806  -6.435  1.00 0.00 ? 89 DT  B OP2    5  
ATOM 8473  O "O5'"  . DT  B 2 8  ? 11.571  -6.673  -4.745  1.00 0.00 ? 89 DT  B "O5'"  5  
ATOM 8474  C "C5'"  . DT  B 2 8  ? 10.786  -6.179  -3.613  1.00 0.00 ? 89 DT  B "C5'"  5  
ATOM 8475  C "C4'"  . DT  B 2 8  ? 9.421   -6.814  -3.458  1.00 0.00 ? 89 DT  B "C4'"  5  
ATOM 8476  O "O4'"  . DT  B 2 8  ? 8.533   -6.141  -4.286  1.00 0.00 ? 89 DT  B "O4'"  5  
ATOM 8477  C "C3'"  . DT  B 2 8  ? 9.456   -8.357  -3.807  1.00 0.00 ? 89 DT  B "C3'"  5  
ATOM 8478  O "O3'"  . DT  B 2 8  ? 8.618   -9.041  -2.924  1.00 0.00 ? 89 DT  B "O3'"  5  
ATOM 8479  C "C2'"  . DT  B 2 8  ? 8.876   -8.356  -5.151  1.00 0.00 ? 89 DT  B "C2'"  5  
ATOM 8480  C "C1'"  . DT  B 2 8  ? 7.865   -7.150  -5.025  1.00 0.00 ? 89 DT  B "C1'"  5  
ATOM 8481  N N1     . DT  B 2 8  ? 7.215   -6.545  -6.237  1.00 0.00 ? 89 DT  B N1     5  
ATOM 8482  C C2     . DT  B 2 8  ? 5.886   -6.143  -6.134  1.00 0.00 ? 89 DT  B C2     5  
ATOM 8483  O O2     . DT  B 2 8  ? 5.284   -6.160  -5.100  1.00 0.00 ? 89 DT  B O2     5  
ATOM 8484  N N3     . DT  B 2 8  ? 5.210   -5.848  -7.271  1.00 0.00 ? 89 DT  B N3     5  
ATOM 8485  C C4     . DT  B 2 8  ? 5.718   -5.845  -8.545  1.00 0.00 ? 89 DT  B C4     5  
ATOM 8486  O O4     . DT  B 2 8  ? 4.959   -5.617  -9.481  1.00 0.00 ? 89 DT  B O4     5  
ATOM 8487  C C5     . DT  B 2 8  ? 7.185   -6.225  -8.534  1.00 0.00 ? 89 DT  B C5     5  
ATOM 8488  C C7     . DT  B 2 8  ? 8.053   -6.247  -9.804  1.00 0.00 ? 89 DT  B C7     5  
ATOM 8489  C C6     . DT  B 2 8  ? 7.844   -6.503  -7.441  1.00 0.00 ? 89 DT  B C6     5  
ATOM 8490  H "H5'"  . DT  B 2 8  ? 10.585  -5.137  -3.861  1.00 0.00 ? 89 DT  B "H5'"  5  
ATOM 8491  H "H5''" . DT  B 2 8  ? 11.401  -6.291  -2.721  1.00 0.00 ? 89 DT  B "H5''" 5  
ATOM 8492  H "H4'"  . DT  B 2 8  ? 9.117   -6.737  -2.414  1.00 0.00 ? 89 DT  B "H4'"  5  
ATOM 8493  H "H3'"  . DT  B 2 8  ? 10.459  -8.780  -3.761  1.00 0.00 ? 89 DT  B "H3'"  5  
ATOM 8494  H "H2'"  . DT  B 2 8  ? 9.688   -8.026  -5.798  1.00 0.00 ? 89 DT  B "H2'"  5  
ATOM 8495  H "H2''" . DT  B 2 8  ? 8.508   -9.358  -5.377  1.00 0.00 ? 89 DT  B "H2''" 5  
ATOM 8496  H "H1'"  . DT  B 2 8  ? 7.186   -7.552  -4.273  1.00 0.00 ? 89 DT  B "H1'"  5  
ATOM 8497  H H3     . DT  B 2 8  ? 4.225   -5.678  -7.130  1.00 0.00 ? 89 DT  B H3     5  
ATOM 8498  H H71    . DT  B 2 8  ? 7.933   -5.369  -10.438 1.00 0.00 ? 89 DT  B H71    5  
ATOM 8499  H H72    . DT  B 2 8  ? 9.116   -6.311  -9.570  1.00 0.00 ? 89 DT  B H72    5  
ATOM 8500  H H73    . DT  B 2 8  ? 7.830   -7.216  -10.251 1.00 0.00 ? 89 DT  B H73    5  
ATOM 8501  H H6     . DT  B 2 8  ? 8.887   -6.784  -7.440  1.00 0.00 ? 89 DT  B H6     5  
ATOM 8502  P P      . DA  B 2 9  ? 9.140   -9.612  -1.565  1.00 0.00 ? 90 DA  B P      5  
ATOM 8503  O OP1    . DA  B 2 9  ? 9.918   -8.594  -0.818  1.00 0.00 ? 90 DA  B OP1    5  
ATOM 8504  O OP2    . DA  B 2 9  ? 9.712   -10.922 -1.908  1.00 0.00 ? 90 DA  B OP2    5  
ATOM 8505  O "O5'"  . DA  B 2 9  ? 7.748   -9.747  -0.945  1.00 0.00 ? 90 DA  B "O5'"  5  
ATOM 8506  C "C5'"  . DA  B 2 9  ? 6.956   -8.614  -0.431  1.00 0.00 ? 90 DA  B "C5'"  5  
ATOM 8507  C "C4'"  . DA  B 2 9  ? 5.434   -8.948  -0.114  1.00 0.00 ? 90 DA  B "C4'"  5  
ATOM 8508  O "O4'"  . DA  B 2 9  ? 4.515   -8.525  -1.156  1.00 0.00 ? 90 DA  B "O4'"  5  
ATOM 8509  C "C3'"  . DA  B 2 9  ? 5.122   -10.447 0.112   1.00 0.00 ? 90 DA  B "C3'"  5  
ATOM 8510  O "O3'"  . DA  B 2 9  ? 3.966   -10.632 0.998   1.00 0.00 ? 90 DA  B "O3'"  5  
ATOM 8511  C "C2'"  . DA  B 2 9  ? 4.869   -10.932 -1.331  1.00 0.00 ? 90 DA  B "C2'"  5  
ATOM 8512  C "C1'"  . DA  B 2 9  ? 4.095   -9.708  -1.904  1.00 0.00 ? 90 DA  B "C1'"  5  
ATOM 8513  N N9     . DA  B 2 9  ? 4.359   -9.446  -3.279  1.00 0.00 ? 90 DA  B N9     5  
ATOM 8514  C C8     . DA  B 2 9  ? 5.474   -9.863  -4.057  1.00 0.00 ? 90 DA  B C8     5  
ATOM 8515  N N7     . DA  B 2 9  ? 5.425   -9.603  -5.323  1.00 0.00 ? 90 DA  B N7     5  
ATOM 8516  C C5     . DA  B 2 9  ? 4.083   -9.233  -5.518  1.00 0.00 ? 90 DA  B C5     5  
ATOM 8517  C C6     . DA  B 2 9  ? 3.239   -8.811  -6.587  1.00 0.00 ? 90 DA  B C6     5  
ATOM 8518  N N6     . DA  B 2 9  ? 3.634   -8.657  -7.770  1.00 0.00 ? 90 DA  B N6     5  
ATOM 8519  N N1     . DA  B 2 9  ? 1.983   -8.424  -6.354  1.00 0.00 ? 90 DA  B N1     5  
ATOM 8520  C C2     . DA  B 2 9  ? 1.519   -8.391  -5.124  1.00 0.00 ? 90 DA  B C2     5  
ATOM 8521  N N3     . DA  B 2 9  ? 2.143   -8.792  -4.063  1.00 0.00 ? 90 DA  B N3     5  
ATOM 8522  C C4     . DA  B 2 9  ? 3.448   -9.137  -4.283  1.00 0.00 ? 90 DA  B C4     5  
ATOM 8523  H "H5'"  . DA  B 2 9  ? 7.003   -7.826  -1.182  1.00 0.00 ? 90 DA  B "H5'"  5  
ATOM 8524  H "H5''" . DA  B 2 9  ? 7.491   -8.236  0.440   1.00 0.00 ? 90 DA  B "H5''" 5  
ATOM 8525  H "H4'"  . DA  B 2 9  ? 5.225   -8.394  0.800   1.00 0.00 ? 90 DA  B "H4'"  5  
ATOM 8526  H "H3'"  . DA  B 2 9  ? 6.092   -10.766 0.493   1.00 0.00 ? 90 DA  B "H3'"  5  
ATOM 8527  H "H2'"  . DA  B 2 9  ? 5.920   -11.061 -1.591  1.00 0.00 ? 90 DA  B "H2'"  5  
ATOM 8528  H "H2''" . DA  B 2 9  ? 4.327   -11.877 -1.378  1.00 0.00 ? 90 DA  B "H2''" 5  
ATOM 8529  H "H1'"  . DA  B 2 9  ? 3.013   -9.779  -1.791  1.00 0.00 ? 90 DA  B "H1'"  5  
ATOM 8530  H H8     . DA  B 2 9  ? 6.361   -10.168 -3.523  1.00 0.00 ? 90 DA  B H8     5  
ATOM 8531  H H61    . DA  B 2 9  ? 3.007   -8.114  -8.345  1.00 0.00 ? 90 DA  B H61    5  
ATOM 8532  H H62    . DA  B 2 9  ? 4.615   -8.762  -7.987  1.00 0.00 ? 90 DA  B H62    5  
ATOM 8533  H H2     . DA  B 2 9  ? 0.511   -8.062  -4.924  1.00 0.00 ? 90 DA  B H2     5  
ATOM 8534  P P      . DG  B 2 10 ? 3.275   -12.016 1.285   1.00 0.00 ? 91 DG  B P      5  
ATOM 8535  O OP1    . DG  B 2 10 ? 2.773   -11.901 2.637   1.00 0.00 ? 91 DG  B OP1    5  
ATOM 8536  O OP2    . DG  B 2 10 ? 4.333   -13.023 1.031   1.00 0.00 ? 91 DG  B OP2    5  
ATOM 8537  O "O5'"  . DG  B 2 10 ? 2.126   -12.122 0.255   1.00 0.00 ? 91 DG  B "O5'"  5  
ATOM 8538  C "C5'"  . DG  B 2 10 ? 1.175   -11.111 0.197   1.00 0.00 ? 91 DG  B "C5'"  5  
ATOM 8539  C "C4'"  . DG  B 2 10 ? -0.091  -11.260 -0.622  1.00 0.00 ? 91 DG  B "C4'"  5  
ATOM 8540  O "O4'"  . DG  B 2 10 ? 0.219   -10.991 -1.995  1.00 0.00 ? 91 DG  B "O4'"  5  
ATOM 8541  C "C3'"  . DG  B 2 10 ? -0.797  -12.604 -0.490  1.00 0.00 ? 91 DG  B "C3'"  5  
ATOM 8542  O "O3'"  . DG  B 2 10 ? -2.231  -12.439 -0.191  1.00 0.00 ? 91 DG  B "O3'"  5  
ATOM 8543  C "C2'"  . DG  B 2 10 ? -0.316  -13.308 -1.780  1.00 0.00 ? 91 DG  B "C2'"  5  
ATOM 8544  C "C1'"  . DG  B 2 10 ? -0.124  -12.087 -2.721  1.00 0.00 ? 91 DG  B "C1'"  5  
ATOM 8545  N N9     . DG  B 2 10 ? 0.840   -12.304 -3.813  1.00 0.00 ? 91 DG  B N9     5  
ATOM 8546  C C8     . DG  B 2 10 ? 2.159   -12.619 -3.638  1.00 0.00 ? 91 DG  B C8     5  
ATOM 8547  N N7     . DG  B 2 10 ? 2.848   -12.688 -4.715  1.00 0.00 ? 91 DG  B N7     5  
ATOM 8548  C C5     . DG  B 2 10 ? 1.951   -12.271 -5.750  1.00 0.00 ? 91 DG  B C5     5  
ATOM 8549  C C6     . DG  B 2 10 ? 2.137   -11.887 -7.127  1.00 0.00 ? 91 DG  B C6     5  
ATOM 8550  O O6     . DG  B 2 10 ? 3.164   -11.798 -7.719  1.00 0.00 ? 91 DG  B O6     5  
ATOM 8551  N N1     . DG  B 2 10 ? 1.024   -11.383 -7.749  1.00 0.00 ? 91 DG  B N1     5  
ATOM 8552  C C2     . DG  B 2 10 ? -0.137  -11.169 -7.096  1.00 0.00 ? 91 DG  B C2     5  
ATOM 8553  N N2     . DG  B 2 10 ? -1.159  -10.768 -7.782  1.00 0.00 ? 91 DG  B N2     5  
ATOM 8554  N N3     . DG  B 2 10 ? -0.401  -11.586 -5.857  1.00 0.00 ? 91 DG  B N3     5  
ATOM 8555  C C4     . DG  B 2 10 ? 0.715   -12.016 -5.213  1.00 0.00 ? 91 DG  B C4     5  
ATOM 8556  H "H5'"  . DG  B 2 10 ? 1.702   -10.197 -0.075  1.00 0.00 ? 91 DG  B "H5'"  5  
ATOM 8557  H "H5''" . DG  B 2 10 ? 0.919   -11.024 1.253   1.00 0.00 ? 91 DG  B "H5''" 5  
ATOM 8558  H "H4'"  . DG  B 2 10 ? -0.799  -10.518 -0.254  1.00 0.00 ? 91 DG  B "H4'"  5  
ATOM 8559  H "H3'"  . DG  B 2 10 ? -0.455  -13.180 0.370   1.00 0.00 ? 91 DG  B "H3'"  5  
ATOM 8560  H "H2'"  . DG  B 2 10 ? 0.588   -13.897 -1.618  1.00 0.00 ? 91 DG  B "H2'"  5  
ATOM 8561  H "H2''" . DG  B 2 10 ? -1.165  -13.889 -2.138  1.00 0.00 ? 91 DG  B "H2''" 5  
ATOM 8562  H "H1'"  . DG  B 2 10 ? -1.097  -11.858 -3.155  1.00 0.00 ? 91 DG  B "H1'"  5  
ATOM 8563  H H8     . DG  B 2 10 ? 2.641   -12.851 -2.700  1.00 0.00 ? 91 DG  B H8     5  
ATOM 8564  H H1     . DG  B 2 10 ? 1.101   -11.219 -8.742  1.00 0.00 ? 91 DG  B H1     5  
ATOM 8565  H H21    . DG  B 2 10 ? -2.048  -10.613 -7.328  1.00 0.00 ? 91 DG  B H21    5  
ATOM 8566  H H22    . DG  B 2 10 ? -0.943  -10.269 -8.633  1.00 0.00 ? 91 DG  B H22    5  
ATOM 8567  P P      . DA  B 2 11 ? -3.272  -13.698 -0.132  1.00 0.00 ? 92 DA  B P      5  
ATOM 8568  O OP1    . DA  B 2 11 ? -4.283  -13.419 0.934   1.00 0.00 ? 92 DA  B OP1    5  
ATOM 8569  O OP2    . DA  B 2 11 ? -2.527  -14.976 -0.114  1.00 0.00 ? 92 DA  B OP2    5  
ATOM 8570  O "O5'"  . DA  B 2 11 ? -3.994  -13.747 -1.577  1.00 0.00 ? 92 DA  B "O5'"  5  
ATOM 8571  C "C5'"  . DA  B 2 11 ? -4.506  -12.522 -2.185  1.00 0.00 ? 92 DA  B "C5'"  5  
ATOM 8572  C "C4'"  . DA  B 2 11 ? -5.232  -12.716 -3.530  1.00 0.00 ? 92 DA  B "C4'"  5  
ATOM 8573  O "O4'"  . DA  B 2 11 ? -4.372  -12.649 -4.654  1.00 0.00 ? 92 DA  B "O4'"  5  
ATOM 8574  C "C3'"  . DA  B 2 11 ? -6.097  -13.963 -3.703  1.00 0.00 ? 92 DA  B "C3'"  5  
ATOM 8575  O "O3'"  . DA  B 2 11 ? -7.286  -13.725 -4.385  1.00 0.00 ? 92 DA  B "O3'"  5  
ATOM 8576  C "C2'"  . DA  B 2 11 ? -5.152  -14.877 -4.483  1.00 0.00 ? 92 DA  B "C2'"  5  
ATOM 8577  C "C1'"  . DA  B 2 11 ? -4.489  -13.815 -5.380  1.00 0.00 ? 92 DA  B "C1'"  5  
ATOM 8578  N N9     . DA  B 2 11 ? -3.116  -14.182 -5.724  1.00 0.00 ? 92 DA  B N9     5  
ATOM 8579  C C8     . DA  B 2 11 ? -2.182  -14.770 -4.910  1.00 0.00 ? 92 DA  B C8     5  
ATOM 8580  N N7     . DA  B 2 11 ? -0.992  -14.843 -5.394  1.00 0.00 ? 92 DA  B N7     5  
ATOM 8581  C C5     . DA  B 2 11 ? -1.205  -14.440 -6.715  1.00 0.00 ? 92 DA  B C5     5  
ATOM 8582  C C6     . DA  B 2 11 ? -0.370  -14.316 -7.872  1.00 0.00 ? 92 DA  B C6     5  
ATOM 8583  N N6     . DA  B 2 11 ? 0.868   -14.674 -7.792  1.00 0.00 ? 92 DA  B N6     5  
ATOM 8584  N N1     . DA  B 2 11 ? -0.859  -14.030 -9.043  1.00 0.00 ? 92 DA  B N1     5  
ATOM 8585  C C2     . DA  B 2 11 ? -2.107  -13.662 -9.087  1.00 0.00 ? 92 DA  B C2     5  
ATOM 8586  N N3     . DA  B 2 11 ? -3.026  -13.594 -8.124  1.00 0.00 ? 92 DA  B N3     5  
ATOM 8587  C C4     . DA  B 2 11 ? -2.539  -14.032 -6.949  1.00 0.00 ? 92 DA  B C4     5  
ATOM 8588  H "H5'"  . DA  B 2 11 ? -3.725  -11.763 -2.244  1.00 0.00 ? 92 DA  B "H5'"  5  
ATOM 8589  H "H5''" . DA  B 2 11 ? -5.320  -12.136 -1.573  1.00 0.00 ? 92 DA  B "H5''" 5  
ATOM 8590  H "H4'"  . DA  B 2 11 ? -5.929  -11.882 -3.608  1.00 0.00 ? 92 DA  B "H4'"  5  
ATOM 8591  H "H3'"  . DA  B 2 11 ? -6.368  -14.323 -2.711  1.00 0.00 ? 92 DA  B "H3'"  5  
ATOM 8592  H "H2'"  . DA  B 2 11 ? -4.495  -15.322 -3.736  1.00 0.00 ? 92 DA  B "H2'"  5  
ATOM 8593  H "H2''" . DA  B 2 11 ? -5.733  -15.524 -5.141  1.00 0.00 ? 92 DA  B "H2''" 5  
ATOM 8594  H "H1'"  . DA  B 2 11 ? -5.113  -13.618 -6.252  1.00 0.00 ? 92 DA  B "H1'"  5  
ATOM 8595  H H8     . DA  B 2 11 ? -2.456  -15.012 -3.893  1.00 0.00 ? 92 DA  B H8     5  
ATOM 8596  H H61    . DA  B 2 11 ? 1.485   -14.391 -8.541  1.00 0.00 ? 92 DA  B H61    5  
ATOM 8597  H H62    . DA  B 2 11 ? 1.252   -14.912 -6.889  1.00 0.00 ? 92 DA  B H62    5  
ATOM 8598  H H2     . DA  B 2 11 ? -2.531  -13.293 -10.009 1.00 0.00 ? 92 DA  B H2     5  
ATOM 8599  P P      . DG  B 2 12 ? -8.424  -14.792 -4.682  1.00 0.00 ? 93 DG  B P      5  
ATOM 8600  O OP1    . DG  B 2 12 ? -9.685  -14.064 -4.567  1.00 0.00 ? 93 DG  B OP1    5  
ATOM 8601  O OP2    . DG  B 2 12 ? -8.161  -15.999 -3.903  1.00 0.00 ? 93 DG  B OP2    5  
ATOM 8602  O "O5'"  . DG  B 2 12 ? -8.125  -15.188 -6.189  1.00 0.00 ? 93 DG  B "O5'"  5  
ATOM 8603  C "C5'"  . DG  B 2 12 ? -8.418  -14.251 -7.197  1.00 0.00 ? 93 DG  B "C5'"  5  
ATOM 8604  C "C4'"  . DG  B 2 12 ? -8.187  -14.801 -8.619  1.00 0.00 ? 93 DG  B "C4'"  5  
ATOM 8605  O "O4'"  . DG  B 2 12 ? -6.778  -14.838 -9.033  1.00 0.00 ? 93 DG  B "O4'"  5  
ATOM 8606  C "C3'"  . DG  B 2 12 ? -8.806  -16.181 -8.770  1.00 0.00 ? 93 DG  B "C3'"  5  
ATOM 8607  O "O3'"  . DG  B 2 12 ? -9.492  -16.325 -10.014 1.00 0.00 ? 93 DG  B "O3'"  5  
ATOM 8608  C "C2'"  . DG  B 2 12 ? -7.591  -17.053 -8.588  1.00 0.00 ? 93 DG  B "C2'"  5  
ATOM 8609  C "C1'"  . DG  B 2 12 ? -6.464  -16.260 -9.169  1.00 0.00 ? 93 DG  B "C1'"  5  
ATOM 8610  N N9     . DG  B 2 12 ? -5.099  -16.579 -8.639  1.00 0.00 ? 93 DG  B N9     5  
ATOM 8611  C C8     . DG  B 2 12 ? -4.865  -16.997 -7.339  1.00 0.00 ? 93 DG  B C8     5  
ATOM 8612  N N7     . DG  B 2 12 ? -3.585  -17.274 -7.062  1.00 0.00 ? 93 DG  B N7     5  
ATOM 8613  C C5     . DG  B 2 12 ? -2.978  -17.146 -8.356  1.00 0.00 ? 93 DG  B C5     5  
ATOM 8614  C C6     . DG  B 2 12 ? -1.591  -17.417 -8.781  1.00 0.00 ? 93 DG  B C6     5  
ATOM 8615  O O6     . DG  B 2 12 ? -0.639  -17.805 -8.154  1.00 0.00 ? 93 DG  B O6     5  
ATOM 8616  N N1     . DG  B 2 12 ? -1.327  -17.181 -10.135 1.00 0.00 ? 93 DG  B N1     5  
ATOM 8617  C C2     . DG  B 2 12 ? -2.355  -16.691 -10.958 1.00 0.00 ? 93 DG  B C2     5  
ATOM 8618  N N2     . DG  B 2 12 ? -2.039  -16.705 -12.213 1.00 0.00 ? 93 DG  B N2     5  
ATOM 8619  N N3     . DG  B 2 12 ? -3.602  -16.426 -10.618 1.00 0.00 ? 93 DG  B N3     5  
ATOM 8620  C C4     . DG  B 2 12 ? -3.890  -16.760 -9.323  1.00 0.00 ? 93 DG  B C4     5  
ATOM 8621  H "H5'"  . DG  B 2 12 ? -7.722  -13.420 -7.085  1.00 0.00 ? 93 DG  B "H5'"  5  
ATOM 8622  H "H5''" . DG  B 2 12 ? -9.364  -13.720 -7.089  1.00 0.00 ? 93 DG  B "H5''" 5  
ATOM 8623  H "H4'"  . DG  B 2 12 ? -8.758  -14.244 -9.361  1.00 0.00 ? 93 DG  B "H4'"  5  
ATOM 8624  H "H3'"  . DG  B 2 12 ? -9.488  -16.276 -7.924  1.00 0.00 ? 93 DG  B "H3'"  5  
ATOM 8625  H "H2'"  . DG  B 2 12 ? -7.569  -17.215 -7.511  1.00 0.00 ? 93 DG  B "H2'"  5  
ATOM 8626  H "H2''" . DG  B 2 12 ? -7.601  -18.058 -9.012  1.00 0.00 ? 93 DG  B "H2''" 5  
ATOM 8627  H "H1'"  . DG  B 2 12 ? -6.387  -16.361 -10.252 1.00 0.00 ? 93 DG  B "H1'"  5  
ATOM 8628  H H8     . DG  B 2 12 ? -5.706  -17.124 -6.673  1.00 0.00 ? 93 DG  B H8     5  
ATOM 8629  H H1     . DG  B 2 12 ? -0.417  -17.364 -10.533 1.00 0.00 ? 93 DG  B H1     5  
ATOM 8630  H H21    . DG  B 2 12 ? -2.768  -16.429 -12.856 1.00 0.00 ? 93 DG  B H21    5  
ATOM 8631  H H22    . DG  B 2 12 ? -1.069  -16.836 -12.464 1.00 0.00 ? 93 DG  B H22    5  
ATOM 8632  P P      . DC  B 2 13 ? -10.196 -17.697 -10.426 1.00 0.00 ? 94 DC  B P      5  
ATOM 8633  O OP1    . DC  B 2 13 ? -11.232 -17.384 -11.442 1.00 0.00 ? 94 DC  B OP1    5  
ATOM 8634  O OP2    . DC  B 2 13 ? -10.636 -18.405 -9.144  1.00 0.00 ? 94 DC  B OP2    5  
ATOM 8635  O "O5'"  . DC  B 2 13 ? -9.044  -18.505 -11.162 1.00 0.00 ? 94 DC  B "O5'"  5  
ATOM 8636  C "C5'"  . DC  B 2 13 ? -8.505  -17.946 -12.296 1.00 0.00 ? 94 DC  B "C5'"  5  
ATOM 8637  C "C4'"  . DC  B 2 13 ? -7.331  -18.702 -12.736 1.00 0.00 ? 94 DC  B "C4'"  5  
ATOM 8638  O "O4'"  . DC  B 2 13 ? -6.263  -18.589 -11.791 1.00 0.00 ? 94 DC  B "O4'"  5  
ATOM 8639  C "C3'"  . DC  B 2 13 ? -7.678  -20.231 -12.843 1.00 0.00 ? 94 DC  B "C3'"  5  
ATOM 8640  O "O3'"  . DC  B 2 13 ? -7.634  -20.799 -14.158 1.00 0.00 ? 94 DC  B "O3'"  5  
ATOM 8641  C "C2'"  . DC  B 2 13 ? -6.581  -20.877 -11.976 1.00 0.00 ? 94 DC  B "C2'"  5  
ATOM 8642  C "C1'"  . DC  B 2 13 ? -5.525  -19.818 -11.899 1.00 0.00 ? 94 DC  B "C1'"  5  
ATOM 8643  N N1     . DC  B 2 13 ? -4.645  -19.900 -10.764 1.00 0.00 ? 94 DC  B N1     5  
ATOM 8644  C C2     . DC  B 2 13 ? -3.275  -20.190 -10.902 1.00 0.00 ? 94 DC  B C2     5  
ATOM 8645  O O2     . DC  B 2 13 ? -2.779  -20.327 -11.984 1.00 0.00 ? 94 DC  B O2     5  
ATOM 8646  N N3     . DC  B 2 13 ? -2.488  -20.376 -9.828  1.00 0.00 ? 94 DC  B N3     5  
ATOM 8647  C C4     . DC  B 2 13 ? -3.082  -20.383 -8.658  1.00 0.00 ? 94 DC  B C4     5  
ATOM 8648  N N4     . DC  B 2 13 ? -2.298  -20.492 -7.641  1.00 0.00 ? 94 DC  B N4     5  
ATOM 8649  C C5     . DC  B 2 13 ? -4.437  -20.150 -8.400  1.00 0.00 ? 94 DC  B C5     5  
ATOM 8650  C C6     . DC  B 2 13 ? -5.231  -19.883 -9.544  1.00 0.00 ? 94 DC  B C6     5  
ATOM 8651  H "H5'"  . DC  B 2 13 ? -8.217  -16.946 -11.973 1.00 0.00 ? 94 DC  B "H5'"  5  
ATOM 8652  H "H5''" . DC  B 2 13 ? -9.255  -17.890 -13.085 1.00 0.00 ? 94 DC  B "H5''" 5  
ATOM 8653  H "H4'"  . DC  B 2 13 ? -6.908  -18.337 -13.672 1.00 0.00 ? 94 DC  B "H4'"  5  
ATOM 8654  H "H3'"  . DC  B 2 13 ? -8.691  -20.425 -12.489 1.00 0.00 ? 94 DC  B "H3'"  5  
ATOM 8655  H "HO3'" . DC  B 2 13 ? -7.222  -21.665 -14.192 1.00 0.00 ? 94 DC  B "HO3'" 5  
ATOM 8656  H "H2'"  . DC  B 2 13 ? -6.928  -21.195 -10.994 1.00 0.00 ? 94 DC  B "H2'"  5  
ATOM 8657  H "H2''" . DC  B 2 13 ? -6.117  -21.805 -12.311 1.00 0.00 ? 94 DC  B "H2''" 5  
ATOM 8658  H "H1'"  . DC  B 2 13 ? -5.046  -19.883 -12.876 1.00 0.00 ? 94 DC  B "H1'"  5  
ATOM 8659  H H41    . DC  B 2 13 ? -2.684  -20.617 -6.716  1.00 0.00 ? 94 DC  B H41    5  
ATOM 8660  H H42    . DC  B 2 13 ? -1.297  -20.545 -7.768  1.00 0.00 ? 94 DC  B H42    5  
ATOM 8661  H H5     . DC  B 2 13 ? -4.748  -20.175 -7.366  1.00 0.00 ? 94 DC  B H5     5  
ATOM 8662  H H6     . DC  B 2 13 ? -6.249  -19.597 -9.323  1.00 0.00 ? 94 DC  B H6     5  
ATOM 8663  N N      . GLY C 3 1  ? 4.557   -3.700  5.946   1.00 0.00 ? 1  GLY P N      5  
ATOM 8664  C CA     . GLY C 3 1  ? 3.502   -4.257  5.091   1.00 0.00 ? 1  GLY P CA     5  
ATOM 8665  C C      . GLY C 3 1  ? 2.211   -4.247  5.819   1.00 0.00 ? 1  GLY P C      5  
ATOM 8666  O O      . GLY C 3 1  ? 1.886   -5.310  6.486   1.00 0.00 ? 1  GLY P O      5  
ATOM 8667  H H1     . GLY C 3 1  ? 4.430   -2.742  6.240   1.00 0.00 ? 1  GLY P H1     5  
ATOM 8668  H H2     . GLY C 3 1  ? 5.359   -3.637  5.335   1.00 0.00 ? 1  GLY P H2     5  
ATOM 8669  H H3     . GLY C 3 1  ? 4.723   -4.343  6.707   1.00 0.00 ? 1  GLY P H3     5  
ATOM 8670  H HA2    . GLY C 3 1  ? 3.463   -3.684  4.164   1.00 0.00 ? 1  GLY P HA2    5  
ATOM 8671  H HA3    . GLY C 3 1  ? 3.622   -5.337  5.020   1.00 0.00 ? 1  GLY P HA3    5  
ATOM 8672  N N      . PRO C 3 2  ? 1.550   -3.029  5.839   1.00 0.00 ? 2  PRO P N      5  
ATOM 8673  C CA     . PRO C 3 2  ? 0.246   -2.832  6.530   1.00 0.00 ? 2  PRO P CA     5  
ATOM 8674  C C      . PRO C 3 2  ? -0.924  -3.651  6.098   1.00 0.00 ? 2  PRO P C      5  
ATOM 8675  O O      . PRO C 3 2  ? -1.740  -3.986  6.980   1.00 0.00 ? 2  PRO P O      5  
ATOM 8676  C CB     . PRO C 3 2  ? 0.071   -1.331  6.562   1.00 0.00 ? 2  PRO P CB     5  
ATOM 8677  C CG     . PRO C 3 2  ? 0.893   -0.759  5.471   1.00 0.00 ? 2  PRO P CG     5  
ATOM 8678  C CD     . PRO C 3 2  ? 2.066   -1.774  5.315   1.00 0.00 ? 2  PRO P CD     5  
ATOM 8679  H HA     . PRO C 3 2  ? 0.475   -3.232  7.517   1.00 0.00 ? 2  PRO P HA     5  
ATOM 8680  H HB2    . PRO C 3 2  ? -0.929  -1.100  6.199   1.00 0.00 ? 2  PRO P HB2    5  
ATOM 8681  H HB3    . PRO C 3 2  ? 0.246   -0.946  7.567   1.00 0.00 ? 2  PRO P HB3    5  
ATOM 8682  H HG2    . PRO C 3 2  ? 0.378   -0.694  4.512   1.00 0.00 ? 2  PRO P HG2    5  
ATOM 8683  H HG3    . PRO C 3 2  ? 1.244   0.263   5.610   1.00 0.00 ? 2  PRO P HG3    5  
ATOM 8684  H HD2    . PRO C 3 2  ? 2.359   -1.822  4.265   1.00 0.00 ? 2  PRO P HD2    5  
ATOM 8685  H HD3    . PRO C 3 2  ? 2.898   -1.503  5.965   1.00 0.00 ? 2  PRO P HD3    5  
ATOM 8686  N N      . ARG C 3 3  ? -1.019  -3.954  4.787   1.00 0.00 ? 3  ARG P N      5  
ATOM 8687  C CA     . ARG C 3 3  ? -2.179  -4.553  4.177   1.00 0.00 ? 3  ARG P CA     5  
ATOM 8688  C C      . ARG C 3 3  ? -1.947  -6.007  3.697   1.00 0.00 ? 3  ARG P C      5  
ATOM 8689  O O      . ARG C 3 3  ? -2.859  -6.729  3.414   1.00 0.00 ? 3  ARG P O      5  
ATOM 8690  C CB     . ARG C 3 3  ? -2.752  -3.551  3.077   1.00 0.00 ? 3  ARG P CB     5  
ATOM 8691  C CG     . ARG C 3 3  ? -3.349  -4.305  1.893   1.00 0.00 ? 3  ARG P CG     5  
ATOM 8692  C CD     . ARG C 3 3  ? -4.809  -4.759  2.169   1.00 0.00 ? 3  ARG P CD     5  
ATOM 8693  N NE     . ARG C 3 3  ? -5.318  -5.354  0.919   1.00 0.00 ? 3  ARG P NE     5  
ATOM 8694  C CZ     . ARG C 3 3  ? -5.285  -6.585  0.470   1.00 0.00 ? 3  ARG P CZ     5  
ATOM 8695  N NH1    . ARG C 3 3  ? -4.838  -7.610  1.128   1.00 0.00 ? 3  ARG P NH1    5  
ATOM 8696  N NH2    . ARG C 3 3  ? -5.740  -6.763  -0.690  1.00 0.00 ? 3  ARG P NH2    5  
ATOM 8697  H H      . ARG C 3 3  ? -0.338  -3.618  4.122   1.00 0.00 ? 3  ARG P H      5  
ATOM 8698  H HA     . ARG C 3 3  ? -2.972  -4.626  4.921   1.00 0.00 ? 3  ARG P HA     5  
ATOM 8699  H HB2    . ARG C 3 3  ? -3.448  -2.931  3.644   1.00 0.00 ? 3  ARG P HB2    5  
ATOM 8700  H HB3    . ARG C 3 3  ? -1.978  -2.860  2.745   1.00 0.00 ? 3  ARG P HB3    5  
ATOM 8701  H HG2    . ARG C 3 3  ? -3.459  -3.522  1.144   1.00 0.00 ? 3  ARG P HG2    5  
ATOM 8702  H HG3    . ARG C 3 3  ? -2.659  -5.051  1.499   1.00 0.00 ? 3  ARG P HG3    5  
ATOM 8703  H HD2    . ARG C 3 3  ? -4.876  -5.480  2.983   1.00 0.00 ? 3  ARG P HD2    5  
ATOM 8704  H HD3    . ARG C 3 3  ? -5.437  -3.948  2.539   1.00 0.00 ? 3  ARG P HD3    5  
ATOM 8705  H HE     . ARG C 3 3  ? -5.490  -4.624  0.241   1.00 0.00 ? 3  ARG P HE     5  
ATOM 8706  H HH11   . ARG C 3 3  ? -4.437  -7.553  2.053   1.00 0.00 ? 3  ARG P HH11   5  
ATOM 8707  H HH12   . ARG C 3 3  ? -4.676  -8.452  0.595   1.00 0.00 ? 3  ARG P HH12   5  
ATOM 8708  H HH21   . ARG C 3 3  ? -6.100  -5.991  -1.232  1.00 0.00 ? 3  ARG P HH21   5  
ATOM 8709  H HH22   . ARG C 3 3  ? -5.600  -7.689  -1.065  1.00 0.00 ? 3  ARG P HH22   5  
ATOM 8710  N N      . ARG C 3 4  ? -0.663  -6.444  3.565   1.00 0.00 ? 4  ARG P N      5  
ATOM 8711  C CA     . ARG C 3 4  ? -0.244  -7.837  3.262   1.00 0.00 ? 4  ARG P CA     5  
ATOM 8712  C C      . ARG C 3 4  ? -0.883  -8.953  4.059   1.00 0.00 ? 4  ARG P C      5  
ATOM 8713  O O      . ARG C 3 4  ? -0.787  -10.128 3.628   1.00 0.00 ? 4  ARG P O      5  
ATOM 8714  C CB     . ARG C 3 4  ? 1.223   -7.808  3.515   1.00 0.00 ? 4  ARG P CB     5  
ATOM 8715  C CG     . ARG C 3 4  ? 2.086   -9.009  3.064   1.00 0.00 ? 4  ARG P CG     5  
ATOM 8716  C CD     . ARG C 3 4  ? 3.591   -8.700  3.331   1.00 0.00 ? 4  ARG P CD     5  
ATOM 8717  N NE     . ARG C 3 4  ? 3.920   -8.295  4.719   1.00 0.00 ? 4  ARG P NE     5  
ATOM 8718  C CZ     . ARG C 3 4  ? 3.730   -8.999  5.802   1.00 0.00 ? 4  ARG P CZ     5  
ATOM 8719  N NH1    . ARG C 3 4  ? 3.243   -10.188 5.680   1.00 0.00 ? 4  ARG P NH1    5  
ATOM 8720  N NH2    . ARG C 3 4  ? 4.117   -8.713  6.965   1.00 0.00 ? 4  ARG P NH2    5  
ATOM 8721  H H      . ARG C 3 4  ? 0.023   -5.708  3.662   1.00 0.00 ? 4  ARG P H      5  
ATOM 8722  H HA     . ARG C 3 4  ? -0.523  -8.132  2.252   1.00 0.00 ? 4  ARG P HA     5  
ATOM 8723  H HB2    . ARG C 3 4  ? 1.679   -6.909  3.102   1.00 0.00 ? 4  ARG P HB2    5  
ATOM 8724  H HB3    . ARG C 3 4  ? 1.321   -7.801  4.600   1.00 0.00 ? 4  ARG P HB3    5  
ATOM 8725  H HG2    . ARG C 3 4  ? 1.767   -9.862  3.665   1.00 0.00 ? 4  ARG P HG2    5  
ATOM 8726  H HG3    . ARG C 3 4  ? 1.802   -8.929  2.015   1.00 0.00 ? 4  ARG P HG3    5  
ATOM 8727  H HD2    . ARG C 3 4  ? 4.081   -9.665  3.201   1.00 0.00 ? 4  ARG P HD2    5  
ATOM 8728  H HD3    . ARG C 3 4  ? 4.056   -8.073  2.570   1.00 0.00 ? 4  ARG P HD3    5  
ATOM 8729  H HE     . ARG C 3 4  ? 4.444   -7.436  4.810   1.00 0.00 ? 4  ARG P HE     5  
ATOM 8730  H HH11   . ARG C 3 4  ? 2.933   -10.443 4.753   1.00 0.00 ? 4  ARG P HH11   5  
ATOM 8731  H HH12   . ARG C 3 4  ? 3.139   -10.878 6.409   1.00 0.00 ? 4  ARG P HH12   5  
ATOM 8732  H HH21   . ARG C 3 4  ? 4.376   -7.790  7.282   1.00 0.00 ? 4  ARG P HH21   5  
ATOM 8733  H HH22   . ARG C 3 4  ? 4.090   -9.445  7.660   1.00 0.00 ? 4  ARG P HH22   5  
ATOM 8734  N N      . THR C 3 5  ? -1.475  -8.648  5.193   1.00 0.00 ? 5  THR P N      5  
ATOM 8735  C CA     . THR C 3 5  ? -2.096  -9.517  6.091   1.00 0.00 ? 5  THR P CA     5  
ATOM 8736  C C      . THR C 3 5  ? -3.246  -8.812  6.859   1.00 0.00 ? 5  THR P C      5  
ATOM 8737  O O      . THR C 3 5  ? -3.436  -7.574  6.760   1.00 0.00 ? 5  THR P O      5  
ATOM 8738  C CB     . THR C 3 5  ? -1.089  -10.181 7.007   1.00 0.00 ? 5  THR P CB     5  
ATOM 8739  O OG1    . THR C 3 5  ? -1.700  -10.939 8.027   1.00 0.00 ? 5  THR P OG1    5  
ATOM 8740  C CG2    . THR C 3 5  ? -0.026  -9.221  7.604   1.00 0.00 ? 5  THR P CG2    5  
ATOM 8741  H H      . THR C 3 5  ? -1.573  -7.687  5.491   1.00 0.00 ? 5  THR P H      5  
ATOM 8742  H HA     . THR C 3 5  ? -2.538  -10.342 5.533   1.00 0.00 ? 5  THR P HA     5  
ATOM 8743  H HB     . THR C 3 5  ? -0.422  -10.891 6.517   1.00 0.00 ? 5  THR P HB     5  
ATOM 8744  H HG1    . THR C 3 5  ? -1.025  -11.519 8.388   1.00 0.00 ? 5  THR P HG1    5  
ATOM 8745  H HG21   . THR C 3 5  ? -0.586  -8.376  8.006   1.00 0.00 ? 5  THR P HG21   5  
ATOM 8746  H HG22   . THR C 3 5  ? 0.617   -8.876  6.794   1.00 0.00 ? 5  THR P HG22   5  
ATOM 8747  H HG23   . THR C 3 5  ? 0.498   -9.787  8.373   1.00 0.00 ? 5  THR P HG23   5  
ATOM 8748  N N      . ARG C 3 6  ? -4.040  -9.575  7.606   1.00 0.00 ? 6  ARG P N      5  
ATOM 8749  C CA     . ARG C 3 6  ? -5.098  -9.175  8.572   1.00 0.00 ? 6  ARG P CA     5  
ATOM 8750  C C      . ARG C 3 6  ? -6.325  -8.388  8.078   1.00 0.00 ? 6  ARG P C      5  
ATOM 8751  O O      . ARG C 3 6  ? -7.351  -8.208  8.870   1.00 0.00 ? 6  ARG P O      5  
ATOM 8752  C CB     . ARG C 3 6  ? -4.410  -8.473  9.774   1.00 0.00 ? 6  ARG P CB     5  
ATOM 8753  C CG     . ARG C 3 6  ? -3.319  -9.360  10.352  1.00 0.00 ? 6  ARG P CG     5  
ATOM 8754  C CD     . ARG C 3 6  ? -3.833  -10.695 10.930  1.00 0.00 ? 6  ARG P CD     5  
ATOM 8755  N NE     . ARG C 3 6  ? -5.032  -10.533 11.767  1.00 0.00 ? 6  ARG P NE     5  
ATOM 8756  C CZ     . ARG C 3 6  ? -5.746  -11.511 12.234  1.00 0.00 ? 6  ARG P CZ     5  
ATOM 8757  N NH1    . ARG C 3 6  ? -5.760  -12.746 11.686  1.00 0.00 ? 6  ARG P NH1    5  
ATOM 8758  N NH2    . ARG C 3 6  ? -6.465  -11.311 13.308  1.00 0.00 ? 6  ARG P NH2    5  
ATOM 8759  H H      . ARG C 3 6  ? -3.664  -10.489 7.814   1.00 0.00 ? 6  ARG P H      5  
ATOM 8760  H HA     . ARG C 3 6  ? -5.562  -10.088 8.946   1.00 0.00 ? 6  ARG P HA     5  
ATOM 8761  H HB2    . ARG C 3 6  ? -3.930  -7.579  9.375   1.00 0.00 ? 6  ARG P HB2    5  
ATOM 8762  H HB3    . ARG C 3 6  ? -5.120  -8.256  10.574  1.00 0.00 ? 6  ARG P HB3    5  
ATOM 8763  H HG2    . ARG C 3 6  ? -2.493  -9.449  9.645   1.00 0.00 ? 6  ARG P HG2    5  
ATOM 8764  H HG3    . ARG C 3 6  ? -2.868  -8.757  11.140  1.00 0.00 ? 6  ARG P HG3    5  
ATOM 8765  H HD2    . ARG C 3 6  ? -3.960  -11.311 10.039  1.00 0.00 ? 6  ARG P HD2    5  
ATOM 8766  H HD3    . ARG C 3 6  ? -2.978  -11.144 11.433  1.00 0.00 ? 6  ARG P HD3    5  
ATOM 8767  H HE     . ARG C 3 6  ? -5.135  -9.672  12.287  1.00 0.00 ? 6  ARG P HE     5  
ATOM 8768  H HH11   . ARG C 3 6  ? -5.322  -12.816 10.778  1.00 0.00 ? 6  ARG P HH11   5  
ATOM 8769  H HH12   . ARG C 3 6  ? -6.178  -13.512 12.194  1.00 0.00 ? 6  ARG P HH12   5  
ATOM 8770  H HH21   . ARG C 3 6  ? -6.501  -10.363 13.651  1.00 0.00 ? 6  ARG P HH21   5  
ATOM 8771  H HH22   . ARG C 3 6  ? -7.009  -12.074 13.686  1.00 0.00 ? 6  ARG P HH22   5  
ATOM 8772  N N      . THR C 3 7  ? -6.230  -7.834  6.883   1.00 0.00 ? 7  THR P N      5  
ATOM 8773  C CA     . THR C 3 7  ? -7.242  -7.134  6.092   1.00 0.00 ? 7  THR P CA     5  
ATOM 8774  C C      . THR C 3 7  ? -7.036  -7.326  4.602   1.00 0.00 ? 7  THR P C      5  
ATOM 8775  O O      . THR C 3 7  ? -5.892  -7.392  4.135   1.00 0.00 ? 7  THR P O      5  
ATOM 8776  C CB     . THR C 3 7  ? -7.235  -5.642  6.498   1.00 0.00 ? 7  THR P CB     5  
ATOM 8777  O OG1    . THR C 3 7  ? -7.038  -5.427  7.848   1.00 0.00 ? 7  THR P OG1    5  
ATOM 8778  C CG2    . THR C 3 7  ? -8.236  -4.653  5.764   1.00 0.00 ? 7  THR P CG2    5  
ATOM 8779  H H      . THR C 3 7  ? -5.425  -8.181  6.380   1.00 0.00 ? 7  THR P H      5  
ATOM 8780  H HA     . THR C 3 7  ? -8.217  -7.578  6.296   1.00 0.00 ? 7  THR P HA     5  
ATOM 8781  H HB     . THR C 3 7  ? -6.280  -5.395  6.032   1.00 0.00 ? 7  THR P HB     5  
ATOM 8782  H HG1    . THR C 3 7  ? -6.151  -5.702  8.095   1.00 0.00 ? 7  THR P HG1    5  
ATOM 8783  H HG21   . THR C 3 7  ? -8.201  -3.637  6.158   1.00 0.00 ? 7  THR P HG21   5  
ATOM 8784  H HG22   . THR C 3 7  ? -9.256  -5.035  5.758   1.00 0.00 ? 7  THR P HG22   5  
ATOM 8785  H HG23   . THR C 3 7  ? -7.987  -4.609  4.703   1.00 0.00 ? 7  THR P HG23   5  
ATOM 8786  N N      . THR C 3 8  ? -8.143  -7.492  3.855   1.00 0.00 ? 8  THR P N      5  
ATOM 8787  C CA     . THR C 3 8  ? -8.039  -7.762  2.415   1.00 0.00 ? 8  THR P CA     5  
ATOM 8788  C C      . THR C 3 8  ? -9.150  -7.138  1.536   1.00 0.00 ? 8  THR P C      5  
ATOM 8789  O O      . THR C 3 8  ? -9.379  -7.507  0.377   1.00 0.00 ? 8  THR P O      5  
ATOM 8790  C CB     . THR C 3 8  ? -7.987  -9.238  2.204   1.00 0.00 ? 8  THR P CB     5  
ATOM 8791  O OG1    . THR C 3 8  ? -7.208  -9.567  1.069   1.00 0.00 ? 8  THR P OG1    5  
ATOM 8792  C CG2    . THR C 3 8  ? -9.350  -9.965  2.054   1.00 0.00 ? 8  THR P CG2    5  
ATOM 8793  H H      . THR C 3 8  ? -9.036  -7.613  4.312   1.00 0.00 ? 8  THR P H      5  
ATOM 8794  H HA     . THR C 3 8  ? -7.124  -7.262  2.097   1.00 0.00 ? 8  THR P HA     5  
ATOM 8795  H HB     . THR C 3 8  ? -7.628  -9.673  3.137   1.00 0.00 ? 8  THR P HB     5  
ATOM 8796  H HG1    . THR C 3 8  ? -7.644  -9.102  0.351   1.00 0.00 ? 8  THR P HG1    5  
ATOM 8797  H HG21   . THR C 3 8  ? -9.652  -10.137 1.021   1.00 0.00 ? 8  THR P HG21   5  
ATOM 8798  H HG22   . THR C 3 8  ? -10.053 -9.246  2.474   1.00 0.00 ? 8  THR P HG22   5  
ATOM 8799  H HG23   . THR C 3 8  ? -9.423  -10.958 2.498   1.00 0.00 ? 8  THR P HG23   5  
ATOM 8800  N N      . PHE C 3 9  ? -9.835  -6.102  2.102   1.00 0.00 ? 9  PHE P N      5  
ATOM 8801  C CA     . PHE C 3 9  ? -11.018 -5.435  1.749   1.00 0.00 ? 9  PHE P CA     5  
ATOM 8802  C C      . PHE C 3 9  ? -12.313 -6.344  1.617   1.00 0.00 ? 9  PHE P C      5  
ATOM 8803  O O      . PHE C 3 9  ? -12.297 -7.557  1.670   1.00 0.00 ? 9  PHE P O      5  
ATOM 8804  C CB     . PHE C 3 9  ? -10.765 -4.553  0.526   1.00 0.00 ? 9  PHE P CB     5  
ATOM 8805  C CG     . PHE C 3 9  ? -9.756  -3.413  0.708   1.00 0.00 ? 9  PHE P CG     5  
ATOM 8806  C CD1    . PHE C 3 9  ? -8.392  -3.714  0.671   1.00 0.00 ? 9  PHE P CD1    5  
ATOM 8807  C CD2    . PHE C 3 9  ? -10.178 -2.011  0.699   1.00 0.00 ? 9  PHE P CD2    5  
ATOM 8808  C CE1    . PHE C 3 9  ? -7.407  -2.684  0.737   1.00 0.00 ? 9  PHE P CE1    5  
ATOM 8809  C CE2    . PHE C 3 9  ? -9.170  -0.978  0.645   1.00 0.00 ? 9  PHE P CE2    5  
ATOM 8810  C CZ     . PHE C 3 9  ? -7.770  -1.325  0.659   1.00 0.00 ? 9  PHE P CZ     5  
ATOM 8811  H H      . PHE C 3 9  ? -9.511  -5.769  2.999   1.00 0.00 ? 9  PHE P H      5  
ATOM 8812  H HA     . PHE C 3 9  ? -11.051 -4.724  2.575   1.00 0.00 ? 9  PHE P HA     5  
ATOM 8813  H HB2    . PHE C 3 9  ? -10.466 -5.216  -0.288  1.00 0.00 ? 9  PHE P HB2    5  
ATOM 8814  H HB3    . PHE C 3 9  ? -11.731 -4.049  0.519   1.00 0.00 ? 9  PHE P HB3    5  
ATOM 8815  H HD1    . PHE C 3 9  ? -8.027  -4.722  0.544   1.00 0.00 ? 9  PHE P HD1    5  
ATOM 8816  H HD2    . PHE C 3 9  ? -11.209 -1.689  0.701   1.00 0.00 ? 9  PHE P HD2    5  
ATOM 8817  H HE1    . PHE C 3 9  ? -6.364  -2.903  0.565   1.00 0.00 ? 9  PHE P HE1    5  
ATOM 8818  H HE2    . PHE C 3 9  ? -9.553  0.032   0.655   1.00 0.00 ? 9  PHE P HE2    5  
ATOM 8819  H HZ     . PHE C 3 9  ? -7.032  -0.538  0.725   1.00 0.00 ? 9  PHE P HZ     5  
ATOM 8820  N N      . THR C 3 10 ? -13.505 -5.770  1.385   1.00 0.00 ? 10 THR P N      5  
ATOM 8821  C CA     . THR C 3 10 ? -14.732 -6.428  0.919   1.00 0.00 ? 10 THR P CA     5  
ATOM 8822  C C      . THR C 3 10 ? -15.485 -5.577  -0.082  1.00 0.00 ? 10 THR P C      5  
ATOM 8823  O O      . THR C 3 10 ? -15.216 -4.342  -0.150  1.00 0.00 ? 10 THR P O      5  
ATOM 8824  C CB     . THR C 3 10 ? -15.685 -6.897  2.123   1.00 0.00 ? 10 THR P CB     5  
ATOM 8825  O OG1    . THR C 3 10 ? -16.341 -5.805  2.569   1.00 0.00 ? 10 THR P OG1    5  
ATOM 8826  C CG2    . THR C 3 10 ? -15.072 -7.262  3.455   1.00 0.00 ? 10 THR P CG2    5  
ATOM 8827  H H      . THR C 3 10 ? -13.500 -4.765  1.277   1.00 0.00 ? 10 THR P H      5  
ATOM 8828  H HA     . THR C 3 10 ? -14.518 -7.318  0.326   1.00 0.00 ? 10 THR P HA     5  
ATOM 8829  H HB     . THR C 3 10 ? -16.433 -7.601  1.759   1.00 0.00 ? 10 THR P HB     5  
ATOM 8830  H HG1    . THR C 3 10 ? -16.869 -6.076  3.322   1.00 0.00 ? 10 THR P HG1    5  
ATOM 8831  H HG21   . THR C 3 10 ? -15.801 -7.247  4.265   1.00 0.00 ? 10 THR P HG21   5  
ATOM 8832  H HG22   . THR C 3 10 ? -14.245 -6.627  3.777   1.00 0.00 ? 10 THR P HG22   5  
ATOM 8833  H HG23   . THR C 3 10 ? -14.774 -8.301  3.319   1.00 0.00 ? 10 THR P HG23   5  
ATOM 8834  N N      . SER C 3 11 ? -16.358 -6.144  -0.840  1.00 0.00 ? 11 SER P N      5  
ATOM 8835  C CA     . SER C 3 11 ? -17.216 -5.419  -1.747  1.00 0.00 ? 11 SER P CA     5  
ATOM 8836  C C      . SER C 3 11 ? -17.919 -4.243  -1.102  1.00 0.00 ? 11 SER P C      5  
ATOM 8837  O O      . SER C 3 11 ? -18.093 -3.204  -1.737  1.00 0.00 ? 11 SER P O      5  
ATOM 8838  C CB     . SER C 3 11 ? -18.282 -6.334  -2.388  1.00 0.00 ? 11 SER P CB     5  
ATOM 8839  O OG     . SER C 3 11 ? -17.684 -7.561  -2.757  1.00 0.00 ? 11 SER P OG     5  
ATOM 8840  H H      . SER C 3 11 ? -16.408 -7.148  -0.750  1.00 0.00 ? 11 SER P H      5  
ATOM 8841  H HA     . SER C 3 11 ? -16.618 -5.049  -2.579  1.00 0.00 ? 11 SER P HA     5  
ATOM 8842  H HB2    . SER C 3 11 ? -19.060 -6.540  -1.652  1.00 0.00 ? 11 SER P HB2    5  
ATOM 8843  H HB3    . SER C 3 11 ? -18.623 -5.860  -3.309  1.00 0.00 ? 11 SER P HB3    5  
ATOM 8844  H HG     . SER C 3 11 ? -17.147 -7.368  -3.529  1.00 0.00 ? 11 SER P HG     5  
ATOM 8845  N N      . SER C 3 12 ? -18.376 -4.333  0.133   1.00 0.00 ? 12 SER P N      5  
ATOM 8846  C CA     . SER C 3 12 ? -19.066 -3.302  0.907   1.00 0.00 ? 12 SER P CA     5  
ATOM 8847  C C      . SER C 3 12 ? -18.131 -2.129  1.443   1.00 0.00 ? 12 SER P C      5  
ATOM 8848  O O      . SER C 3 12 ? -18.609 -1.020  1.554   1.00 0.00 ? 12 SER P O      5  
ATOM 8849  C CB     . SER C 3 12 ? -19.609 -4.006  2.104   1.00 0.00 ? 12 SER P CB     5  
ATOM 8850  O OG     . SER C 3 12 ? -20.510 -5.052  1.818   1.00 0.00 ? 12 SER P OG     5  
ATOM 8851  H H      . SER C 3 12 ? -18.364 -5.229  0.597   1.00 0.00 ? 12 SER P H      5  
ATOM 8852  H HA     . SER C 3 12 ? -19.873 -2.716  0.470   1.00 0.00 ? 12 SER P HA     5  
ATOM 8853  H HB2    . SER C 3 12 ? -18.763 -4.354  2.696   1.00 0.00 ? 12 SER P HB2    5  
ATOM 8854  H HB3    . SER C 3 12 ? -20.119 -3.294  2.753   1.00 0.00 ? 12 SER P HB3    5  
ATOM 8855  H HG     . SER C 3 12 ? -21.147 -4.941  2.529   1.00 0.00 ? 12 SER P HG     5  
ATOM 8856  N N      . GLN C 3 13 ? -16.886 -2.340  1.668   1.00 0.00 ? 13 GLN P N      5  
ATOM 8857  C CA     . GLN C 3 13 ? -15.810 -1.386  1.898   1.00 0.00 ? 13 GLN P CA     5  
ATOM 8858  C C      . GLN C 3 13 ? -15.423 -0.687  0.689   1.00 0.00 ? 13 GLN P C      5  
ATOM 8859  O O      . GLN C 3 13 ? -15.228 0.490   0.766   1.00 0.00 ? 13 GLN P O      5  
ATOM 8860  C CB     . GLN C 3 13 ? -14.484 -2.068  2.406   1.00 0.00 ? 13 GLN P CB     5  
ATOM 8861  C CG     . GLN C 3 13 ? -14.945 -2.828  3.662   1.00 0.00 ? 13 GLN P CG     5  
ATOM 8862  C CD     . GLN C 3 13 ? -13.732 -3.355  4.459   1.00 0.00 ? 13 GLN P CD     5  
ATOM 8863  O OE1    . GLN C 3 13 ? -13.001 -4.243  4.044   1.00 0.00 ? 13 GLN P OE1    5  
ATOM 8864  N NE2    . GLN C 3 13 ? -13.431 -2.703  5.573   1.00 0.00 ? 13 GLN P NE2    5  
ATOM 8865  H H      . GLN C 3 13 ? -16.606 -3.255  1.348   1.00 0.00 ? 13 GLN P H      5  
ATOM 8866  H HA     . GLN C 3 13 ? -16.164 -0.708  2.674   1.00 0.00 ? 13 GLN P HA     5  
ATOM 8867  H HB2    . GLN C 3 13 ? -13.950 -2.694  1.690   1.00 0.00 ? 13 GLN P HB2    5  
ATOM 8868  H HB3    . GLN C 3 13 ? -13.773 -1.268  2.615   1.00 0.00 ? 13 GLN P HB3    5  
ATOM 8869  H HG2    . GLN C 3 13 ? -15.563 -2.190  4.293   1.00 0.00 ? 13 GLN P HG2    5  
ATOM 8870  H HG3    . GLN C 3 13 ? -15.578 -3.701  3.504   1.00 0.00 ? 13 GLN P HG3    5  
ATOM 8871  H HE21   . GLN C 3 13 ? -13.972 -1.923  5.920   1.00 0.00 ? 13 GLN P HE21   5  
ATOM 8872  H HE22   . GLN C 3 13 ? -12.701 -3.121  6.133   1.00 0.00 ? 13 GLN P HE22   5  
ATOM 8873  N N      . ILE C 3 14 ? -15.118 -1.317  -0.477  1.00 0.00 ? 14 ILE P N      5  
ATOM 8874  C CA     . ILE C 3 14 ? -15.013 -0.569  -1.730  1.00 0.00 ? 14 ILE P CA     5  
ATOM 8875  C C      . ILE C 3 14 ? -16.293 0.178   -2.054  1.00 0.00 ? 14 ILE P C      5  
ATOM 8876  O O      . ILE C 3 14 ? -16.331 1.299   -2.615  1.00 0.00 ? 14 ILE P O      5  
ATOM 8877  C CB     . ILE C 3 14 ? -14.524 -1.546  -2.852  1.00 0.00 ? 14 ILE P CB     5  
ATOM 8878  C CG1    . ILE C 3 14 ? -13.206 -2.258  -2.477  1.00 0.00 ? 14 ILE P CG1    5  
ATOM 8879  C CG2    . ILE C 3 14 ? -14.374 -0.860  -4.137  1.00 0.00 ? 14 ILE P CG2    5  
ATOM 8880  C CD1    . ILE C 3 14 ? -13.165 -3.565  -3.232  1.00 0.00 ? 14 ILE P CD1    5  
ATOM 8881  H H      . ILE C 3 14 ? -15.035 -2.323  -0.474  1.00 0.00 ? 14 ILE P H      5  
ATOM 8882  H HA     . ILE C 3 14 ? -14.285 0.240   -1.687  1.00 0.00 ? 14 ILE P HA     5  
ATOM 8883  H HB     . ILE C 3 14 ? -15.302 -2.307  -2.919  1.00 0.00 ? 14 ILE P HB     5  
ATOM 8884  H HG12   . ILE C 3 14 ? -12.333 -1.673  -2.765  1.00 0.00 ? 14 ILE P HG12   5  
ATOM 8885  H HG13   . ILE C 3 14 ? -13.134 -2.602  -1.445  1.00 0.00 ? 14 ILE P HG13   5  
ATOM 8886  H HG21   . ILE C 3 14 ? -15.361 -0.542  -4.471  1.00 0.00 ? 14 ILE P HG21   5  
ATOM 8887  H HG22   . ILE C 3 14 ? -13.772 0.039   -4.004  1.00 0.00 ? 14 ILE P HG22   5  
ATOM 8888  H HG23   . ILE C 3 14 ? -13.932 -1.482  -4.915  1.00 0.00 ? 14 ILE P HG23   5  
ATOM 8889  H HD11   . ILE C 3 14 ? -13.285 -3.482  -4.312  1.00 0.00 ? 14 ILE P HD11   5  
ATOM 8890  H HD12   . ILE C 3 14 ? -12.155 -3.937  -3.058  1.00 0.00 ? 14 ILE P HD12   5  
ATOM 8891  H HD13   . ILE C 3 14 ? -13.885 -4.194  -2.707  1.00 0.00 ? 14 ILE P HD13   5  
ATOM 8892  N N      . ALA C 3 15 ? -17.460 -0.378  -1.720  1.00 0.00 ? 15 ALA P N      5  
ATOM 8893  C CA     . ALA C 3 15 ? -18.744 0.318   -1.938  1.00 0.00 ? 15 ALA P CA     5  
ATOM 8894  C C      . ALA C 3 15 ? -18.853 1.652   -1.197  1.00 0.00 ? 15 ALA P C      5  
ATOM 8895  O O      . ALA C 3 15 ? -19.374 2.661   -1.732  1.00 0.00 ? 15 ALA P O      5  
ATOM 8896  C CB     . ALA C 3 15 ? -19.880 -0.695  -1.578  1.00 0.00 ? 15 ALA P CB     5  
ATOM 8897  H H      . ALA C 3 15 ? -17.443 -1.308  -1.325  1.00 0.00 ? 15 ALA P H      5  
ATOM 8898  H HA     . ALA C 3 15 ? -18.756 0.517   -3.010  1.00 0.00 ? 15 ALA P HA     5  
ATOM 8899  H HB1    . ALA C 3 15 ? -19.786 -1.624  -2.142  1.00 0.00 ? 15 ALA P HB1    5  
ATOM 8900  H HB2    . ALA C 3 15 ? -20.033 -0.788  -0.503  1.00 0.00 ? 15 ALA P HB2    5  
ATOM 8901  H HB3    . ALA C 3 15 ? -20.782 -0.262  -2.008  1.00 0.00 ? 15 ALA P HB3    5  
ATOM 8902  N N      . GLU C 3 16 ? -18.398 1.730   0.050   1.00 0.00 ? 16 GLU P N      5  
ATOM 8903  C CA     . GLU C 3 16 ? -18.301 2.932   0.840   1.00 0.00 ? 16 GLU P CA     5  
ATOM 8904  C C      . GLU C 3 16 ? -17.168 3.766   0.191   1.00 0.00 ? 16 GLU P C      5  
ATOM 8905  O O      . GLU C 3 16 ? -17.470 4.949   0.140   1.00 0.00 ? 16 GLU P O      5  
ATOM 8906  C CB     . GLU C 3 16 ? -17.786 2.546   2.240   1.00 0.00 ? 16 GLU P CB     5  
ATOM 8907  C CG     . GLU C 3 16 ? -18.609 2.188   3.480   1.00 0.00 ? 16 GLU P CG     5  
ATOM 8908  C CD     . GLU C 3 16 ? -19.914 2.995   3.763   1.00 0.00 ? 16 GLU P CD     5  
ATOM 8909  O OE1    . GLU C 3 16 ? -20.549 3.382   2.830   1.00 0.00 ? 16 GLU P OE1    5  
ATOM 8910  O OE2    . GLU C 3 16 ? -20.328 3.261   4.862   1.00 0.00 ? 16 GLU P OE2    5  
ATOM 8911  H H      . GLU C 3 16 ? -18.096 0.861   0.467   1.00 0.00 ? 16 GLU P H      5  
ATOM 8912  H HA     . GLU C 3 16 ? -19.178 3.579   0.808   1.00 0.00 ? 16 GLU P HA     5  
ATOM 8913  H HB2    . GLU C 3 16 ? -16.981 1.823   2.115   1.00 0.00 ? 16 GLU P HB2    5  
ATOM 8914  H HB3    . GLU C 3 16 ? -17.314 3.507   2.447   1.00 0.00 ? 16 GLU P HB3    5  
ATOM 8915  H HG2    . GLU C 3 16 ? -18.781 1.114   3.415   1.00 0.00 ? 16 GLU P HG2    5  
ATOM 8916  H HG3    . GLU C 3 16 ? -17.859 2.376   4.249   1.00 0.00 ? 16 GLU P HG3    5  
ATOM 8917  N N      . LEU C 3 17 ? -16.018 3.181   -0.235  1.00 0.00 ? 17 LEU P N      5  
ATOM 8918  C CA     . LEU C 3 17 ? -14.909 4.002   -0.661  1.00 0.00 ? 17 LEU P CA     5  
ATOM 8919  C C      . LEU C 3 17 ? -15.275 4.818   -1.898  1.00 0.00 ? 17 LEU P C      5  
ATOM 8920  O O      . LEU C 3 17 ? -15.026 6.032   -1.895  1.00 0.00 ? 17 LEU P O      5  
ATOM 8921  C CB     . LEU C 3 17 ? -13.703 3.106   -1.016  1.00 0.00 ? 17 LEU P CB     5  
ATOM 8922  C CG     . LEU C 3 17 ? -12.948 2.713   0.232   1.00 0.00 ? 17 LEU P CG     5  
ATOM 8923  C CD1    . LEU C 3 17 ? -12.107 1.416   0.236   1.00 0.00 ? 17 LEU P CD1    5  
ATOM 8924  C CD2    . LEU C 3 17 ? -12.105 3.870   0.632   1.00 0.00 ? 17 LEU P CD2    5  
ATOM 8925  H H      . LEU C 3 17 ? -15.882 2.198   -0.051  1.00 0.00 ? 17 LEU P H      5  
ATOM 8926  H HA     . LEU C 3 17 ? -14.586 4.590   0.198   1.00 0.00 ? 17 LEU P HA     5  
ATOM 8927  H HB2    . LEU C 3 17 ? -14.158 2.219   -1.457  1.00 0.00 ? 17 LEU P HB2    5  
ATOM 8928  H HB3    . LEU C 3 17 ? -13.057 3.607   -1.737  1.00 0.00 ? 17 LEU P HB3    5  
ATOM 8929  H HG     . LEU C 3 17 ? -13.755 2.548   0.946   1.00 0.00 ? 17 LEU P HG     5  
ATOM 8930  H HD11   . LEU C 3 17 ? -11.352 1.394   -0.551  1.00 0.00 ? 17 LEU P HD11   5  
ATOM 8931  H HD12   . LEU C 3 17 ? -12.773 0.593   -0.022  1.00 0.00 ? 17 LEU P HD12   5  
ATOM 8932  H HD13   . LEU C 3 17 ? -11.791 1.139   1.242   1.00 0.00 ? 17 LEU P HD13   5  
ATOM 8933  H HD21   . LEU C 3 17 ? -11.371 3.533   1.364   1.00 0.00 ? 17 LEU P HD21   5  
ATOM 8934  H HD22   . LEU C 3 17 ? -12.723 4.601   1.155   1.00 0.00 ? 17 LEU P HD22   5  
ATOM 8935  H HD23   . LEU C 3 17 ? -11.696 4.421   -0.215  1.00 0.00 ? 17 LEU P HD23   5  
ATOM 8936  N N      . GLU C 3 18 ? -15.980 4.195   -2.830  1.00 0.00 ? 18 GLU P N      5  
ATOM 8937  C CA     . GLU C 3 18 ? -16.666 4.690   -4.023  1.00 0.00 ? 18 GLU P CA     5  
ATOM 8938  C C      . GLU C 3 18 ? -17.668 5.801   -3.750  1.00 0.00 ? 18 GLU P C      5  
ATOM 8939  O O      . GLU C 3 18 ? -17.584 6.867   -4.322  1.00 0.00 ? 18 GLU P O      5  
ATOM 8940  C CB     . GLU C 3 18 ? -17.233 3.535   -4.918  1.00 0.00 ? 18 GLU P CB     5  
ATOM 8941  C CG     . GLU C 3 18 ? -16.375 2.508   -5.578  1.00 0.00 ? 18 GLU P CG     5  
ATOM 8942  C CD     . GLU C 3 18 ? -15.702 2.915   -6.869  1.00 0.00 ? 18 GLU P CD     5  
ATOM 8943  O OE1    . GLU C 3 18 ? -14.927 2.125   -7.477  1.00 0.00 ? 18 GLU P OE1    5  
ATOM 8944  O OE2    . GLU C 3 18 ? -15.894 4.047   -7.318  1.00 0.00 ? 18 GLU P OE2    5  
ATOM 8945  H H      . GLU C 3 18 ? -16.175 3.215   -2.680  1.00 0.00 ? 18 GLU P H      5  
ATOM 8946  H HA     . GLU C 3 18 ? -15.905 5.195   -4.619  1.00 0.00 ? 18 GLU P HA     5  
ATOM 8947  H HB2    . GLU C 3 18 ? -17.885 2.882   -4.336  1.00 0.00 ? 18 GLU P HB2    5  
ATOM 8948  H HB3    . GLU C 3 18 ? -17.966 3.948   -5.612  1.00 0.00 ? 18 GLU P HB3    5  
ATOM 8949  H HG2    . GLU C 3 18 ? -15.677 2.220   -4.792  1.00 0.00 ? 18 GLU P HG2    5  
ATOM 8950  H HG3    . GLU C 3 18 ? -17.004 1.644   -5.796  1.00 0.00 ? 18 GLU P HG3    5  
ATOM 8951  N N      . GLN C 3 19 ? -18.597 5.548   -2.825  1.00 0.00 ? 19 GLN P N      5  
ATOM 8952  C CA     . GLN C 3 19 ? -19.576 6.591   -2.465  1.00 0.00 ? 19 GLN P CA     5  
ATOM 8953  C C      . GLN C 3 19 ? -18.989 7.887   -1.881  1.00 0.00 ? 19 GLN P C      5  
ATOM 8954  O O      . GLN C 3 19 ? -19.328 8.956   -2.410  1.00 0.00 ? 19 GLN P O      5  
ATOM 8955  C CB     . GLN C 3 19 ? -20.526 6.012   -1.397  1.00 0.00 ? 19 GLN P CB     5  
ATOM 8956  C CG     . GLN C 3 19 ? -21.951 6.604   -1.483  1.00 0.00 ? 19 GLN P CG     5  
ATOM 8957  C CD     . GLN C 3 19 ? -22.608 6.630   -2.875  1.00 0.00 ? 19 GLN P CD     5  
ATOM 8958  O OE1    . GLN C 3 19 ? -22.513 5.689   -3.696  1.00 0.00 ? 19 GLN P OE1    5  
ATOM 8959  N NE2    . GLN C 3 19 ? -23.204 7.709   -3.191  1.00 0.00 ? 19 GLN P NE2    5  
ATOM 8960  H H      . GLN C 3 19 ? -18.588 4.741   -2.219  1.00 0.00 ? 19 GLN P H      5  
ATOM 8961  H HA     . GLN C 3 19 ? -20.164 6.834   -3.351  1.00 0.00 ? 19 GLN P HA     5  
ATOM 8962  H HB2    . GLN C 3 19 ? -20.607 4.935   -1.545  1.00 0.00 ? 19 GLN P HB2    5  
ATOM 8963  H HB3    . GLN C 3 19 ? -19.995 6.173   -0.458  1.00 0.00 ? 19 GLN P HB3    5  
ATOM 8964  H HG2    . GLN C 3 19 ? -22.532 5.917   -0.866  1.00 0.00 ? 19 GLN P HG2    5  
ATOM 8965  H HG3    . GLN C 3 19 ? -22.020 7.540   -0.929  1.00 0.00 ? 19 GLN P HG3    5  
ATOM 8966  H HE21   . GLN C 3 19 ? -23.365 8.451   -2.526  1.00 0.00 ? 19 GLN P HE21   5  
ATOM 8967  H HE22   . GLN C 3 19 ? -23.515 7.728   -4.153  1.00 0.00 ? 19 GLN P HE22   5  
ATOM 8968  N N      . HIS C 3 20 ? -18.052 7.817   -0.928  1.00 0.00 ? 20 HIS P N      5  
ATOM 8969  C CA     . HIS C 3 20 ? -17.468 9.012   -0.422  1.00 0.00 ? 20 HIS P CA     5  
ATOM 8970  C C      . HIS C 3 20 ? -16.429 9.610   -1.303  1.00 0.00 ? 20 HIS P C      5  
ATOM 8971  O O      . HIS C 3 20 ? -16.319 10.820  -1.309  1.00 0.00 ? 20 HIS P O      5  
ATOM 8972  C CB     . HIS C 3 20 ? -17.002 8.777   1.052   1.00 0.00 ? 20 HIS P CB     5  
ATOM 8973  C CG     . HIS C 3 20 ? -18.247 8.621   1.925   1.00 0.00 ? 20 HIS P CG     5  
ATOM 8974  N ND1    . HIS C 3 20 ? -19.203 9.479   2.282   1.00 0.00 ? 20 HIS P ND1    5  
ATOM 8975  C CD2    . HIS C 3 20 ? -18.698 7.387   2.368   1.00 0.00 ? 20 HIS P CD2    5  
ATOM 8976  C CE1    . HIS C 3 20 ? -20.204 8.793   2.808   1.00 0.00 ? 20 HIS P CE1    5  
ATOM 8977  N NE2    . HIS C 3 20 ? -19.996 7.498   2.859   1.00 0.00 ? 20 HIS P NE2    5  
ATOM 8978  H H      . HIS C 3 20 ? -17.788 6.973   -0.439  1.00 0.00 ? 20 HIS P H      5  
ATOM 8979  H HA     . HIS C 3 20 ? -18.246 9.773   -0.360  1.00 0.00 ? 20 HIS P HA     5  
ATOM 8980  H HB2    . HIS C 3 20 ? -16.228 8.017   1.157   1.00 0.00 ? 20 HIS P HB2    5  
ATOM 8981  H HB3    . HIS C 3 20 ? -16.484 9.675   1.390   1.00 0.00 ? 20 HIS P HB3    5  
ATOM 8982  H HD1    . HIS C 3 20 ? -19.038 10.474  2.331   1.00 0.00 ? 20 HIS P HD1    5  
ATOM 8983  H HD2    . HIS C 3 20 ? -18.119 6.483   2.255   1.00 0.00 ? 20 HIS P HD2    5  
ATOM 8984  H HE1    . HIS C 3 20 ? -21.051 9.280   3.266   1.00 0.00 ? 20 HIS P HE1    5  
ATOM 8985  N N      . PHE C 3 21 ? -15.772 8.816   -2.123  1.00 0.00 ? 21 PHE P N      5  
ATOM 8986  C CA     . PHE C 3 21 ? -14.990 9.292   -3.292  1.00 0.00 ? 21 PHE P CA     5  
ATOM 8987  C C      . PHE C 3 21 ? -15.853 10.111  -4.228  1.00 0.00 ? 21 PHE P C      5  
ATOM 8988  O O      . PHE C 3 21 ? -15.339 11.115  -4.770  1.00 0.00 ? 21 PHE P O      5  
ATOM 8989  C CB     . PHE C 3 21 ? -14.509 8.115   -4.107  1.00 0.00 ? 21 PHE P CB     5  
ATOM 8990  C CG     . PHE C 3 21 ? -14.289 8.308   -5.618  1.00 0.00 ? 21 PHE P CG     5  
ATOM 8991  C CD1    . PHE C 3 21 ? -15.280 7.909   -6.522  1.00 0.00 ? 21 PHE P CD1    5  
ATOM 8992  C CD2    . PHE C 3 21 ? -13.132 8.935   -6.149  1.00 0.00 ? 21 PHE P CD2    5  
ATOM 8993  C CE1    . PHE C 3 21 ? -15.153 8.204   -7.886  1.00 0.00 ? 21 PHE P CE1    5  
ATOM 8994  C CE2    . PHE C 3 21 ? -13.074 9.254   -7.539  1.00 0.00 ? 21 PHE P CE2    5  
ATOM 8995  C CZ     . PHE C 3 21 ? -14.021 8.842   -8.451  1.00 0.00 ? 21 PHE P CZ     5  
ATOM 8996  H H      . PHE C 3 21 ? -15.663 7.848   -1.858  1.00 0.00 ? 21 PHE P H      5  
ATOM 8997  H HA     . PHE C 3 21 ? -14.082 9.837   -3.037  1.00 0.00 ? 21 PHE P HA     5  
ATOM 8998  H HB2    . PHE C 3 21 ? -13.616 7.690   -3.649  1.00 0.00 ? 21 PHE P HB2    5  
ATOM 8999  H HB3    . PHE C 3 21 ? -15.285 7.363   -3.972  1.00 0.00 ? 21 PHE P HB3    5  
ATOM 9000  H HD1    . PHE C 3 21 ? -16.195 7.474   -6.149  1.00 0.00 ? 21 PHE P HD1    5  
ATOM 9001  H HD2    . PHE C 3 21 ? -12.380 9.333   -5.484  1.00 0.00 ? 21 PHE P HD2    5  
ATOM 9002  H HE1    . PHE C 3 21 ? -16.020 8.067   -8.515  1.00 0.00 ? 21 PHE P HE1    5  
ATOM 9003  H HE2    . PHE C 3 21 ? -12.197 9.746   -7.931  1.00 0.00 ? 21 PHE P HE2    5  
ATOM 9004  H HZ     . PHE C 3 21 ? -13.962 8.978   -9.521  1.00 0.00 ? 21 PHE P HZ     5  
ATOM 9005  N N      . LEU C 3 22 ? -17.184 9.898   -4.368  1.00 0.00 ? 22 LEU P N      5  
ATOM 9006  C CA     . LEU C 3 22 ? -18.015 10.764  -5.259  1.00 0.00 ? 22 LEU P CA     5  
ATOM 9007  C C      . LEU C 3 22 ? -17.822 12.282  -4.859  1.00 0.00 ? 22 LEU P C      5  
ATOM 9008  O O      . LEU C 3 22 ? -17.769 13.203  -5.692  1.00 0.00 ? 22 LEU P O      5  
ATOM 9009  C CB     . LEU C 3 22 ? -19.517 10.406  -5.240  1.00 0.00 ? 22 LEU P CB     5  
ATOM 9010  C CG     . LEU C 3 22 ? -19.724 8.961   -5.668  1.00 0.00 ? 22 LEU P CG     5  
ATOM 9011  C CD1    . LEU C 3 22 ? -21.165 8.655   -5.862  1.00 0.00 ? 22 LEU P CD1    5  
ATOM 9012  C CD2    . LEU C 3 22 ? -18.905 8.336   -6.901  1.00 0.00 ? 22 LEU P CD2    5  
ATOM 9013  H H      . LEU C 3 22 ? -17.630 9.128   -3.891  1.00 0.00 ? 22 LEU P H      5  
ATOM 9014  H HA     . LEU C 3 22 ? -17.662 10.804  -6.289  1.00 0.00 ? 22 LEU P HA     5  
ATOM 9015  H HB2    . LEU C 3 22 ? -19.831 10.478  -4.199  1.00 0.00 ? 22 LEU P HB2    5  
ATOM 9016  H HB3    . LEU C 3 22 ? -20.065 11.115  -5.861  1.00 0.00 ? 22 LEU P HB3    5  
ATOM 9017  H HG     . LEU C 3 22 ? -19.448 8.317   -4.833  1.00 0.00 ? 22 LEU P HG     5  
ATOM 9018  H HD11   . LEU C 3 22 ? -21.440 9.406   -6.602  1.00 0.00 ? 22 LEU P HD11   5  
ATOM 9019  H HD12   . LEU C 3 22 ? -21.576 8.893   -4.881  1.00 0.00 ? 22 LEU P HD12   5  
ATOM 9020  H HD13   . LEU C 3 22 ? -21.267 7.630   -6.220  1.00 0.00 ? 22 LEU P HD13   5  
ATOM 9021  H HD21   . LEU C 3 22 ? -17.902 8.735   -7.046  1.00 0.00 ? 22 LEU P HD21   5  
ATOM 9022  H HD22   . LEU C 3 22 ? -19.463 8.388   -7.836  1.00 0.00 ? 22 LEU P HD22   5  
ATOM 9023  H HD23   . LEU C 3 22 ? -18.696 7.288   -6.686  1.00 0.00 ? 22 LEU P HD23   5  
ATOM 9024  N N      . GLN C 3 23 ? -17.700 12.487  -3.527  1.00 0.00 ? 23 GLN P N      5  
ATOM 9025  C CA     . GLN C 3 23 ? -17.485 13.778  -2.827  1.00 0.00 ? 23 GLN P CA     5  
ATOM 9026  C C      . GLN C 3 23 ? -15.976 14.181  -2.853  1.00 0.00 ? 23 GLN P C      5  
ATOM 9027  O O      . GLN C 3 23 ? -15.604 15.251  -2.398  1.00 0.00 ? 23 GLN P O      5  
ATOM 9028  C CB     . GLN C 3 23 ? -17.929 13.730  -1.415  1.00 0.00 ? 23 GLN P CB     5  
ATOM 9029  C CG     . GLN C 3 23 ? -19.243 13.087  -1.106  1.00 0.00 ? 23 GLN P CG     5  
ATOM 9030  C CD     . GLN C 3 23 ? -20.530 13.781  -1.493  1.00 0.00 ? 23 GLN P CD     5  
ATOM 9031  O OE1    . GLN C 3 23 ? -20.699 14.877  -1.128  1.00 0.00 ? 23 GLN P OE1    5  
ATOM 9032  N NE2    . GLN C 3 23 ? -21.461 13.171  -2.201  1.00 0.00 ? 23 GLN P NE2    5  
ATOM 9033  H H      . GLN C 3 23 ? -17.708 11.666  -2.939  1.00 0.00 ? 23 GLN P H      5  
ATOM 9034  H HA     . GLN C 3 23 ? -18.047 14.593  -3.286  1.00 0.00 ? 23 GLN P HA     5  
ATOM 9035  H HB2    . GLN C 3 23 ? -17.196 13.122  -0.885  1.00 0.00 ? 23 GLN P HB2    5  
ATOM 9036  H HB3    . GLN C 3 23 ? -17.826 14.671  -0.874  1.00 0.00 ? 23 GLN P HB3    5  
ATOM 9037  H HG2    . GLN C 3 23 ? -19.232 12.060  -1.471  1.00 0.00 ? 23 GLN P HG2    5  
ATOM 9038  H HG3    . GLN C 3 23 ? -19.266 12.966  -0.023  1.00 0.00 ? 23 GLN P HG3    5  
ATOM 9039  H HE21   . GLN C 3 23 ? -21.276 12.275  -2.626  1.00 0.00 ? 23 GLN P HE21   5  
ATOM 9040  H HE22   . GLN C 3 23 ? -22.312 13.698  -2.337  1.00 0.00 ? 23 GLN P HE22   5  
ATOM 9041  N N      . GLY C 3 24 ? -15.017 13.438  -3.251  1.00 0.00 ? 24 GLY P N      5  
ATOM 9042  C CA     . GLY C 3 24 ? -13.564 13.799  -3.193  1.00 0.00 ? 24 GLY P CA     5  
ATOM 9043  C C      . GLY C 3 24 ? -12.699 12.789  -3.931  1.00 0.00 ? 24 GLY P C      5  
ATOM 9044  O O      . GLY C 3 24 ? -12.527 11.641  -3.523  1.00 0.00 ? 24 GLY P O      5  
ATOM 9045  H H      . GLY C 3 24 ? -15.306 12.564  -3.670  1.00 0.00 ? 24 GLY P H      5  
ATOM 9046  H HA2    . GLY C 3 24 ? -13.328 14.800  -3.553  1.00 0.00 ? 24 GLY P HA2    5  
ATOM 9047  H HA3    . GLY C 3 24 ? -13.108 13.839  -2.204  1.00 0.00 ? 24 GLY P HA3    5  
ATOM 9048  N N      . ARG C 3 25 ? -12.099 13.137  -5.089  1.00 0.00 ? 25 ARG P N      5  
ATOM 9049  C CA     . ARG C 3 25 ? -11.397 12.178  -5.999  1.00 0.00 ? 25 ARG P CA     5  
ATOM 9050  C C      . ARG C 3 25 ? -10.119 11.577  -5.362  1.00 0.00 ? 25 ARG P C      5  
ATOM 9051  O O      . ARG C 3 25 ? -9.558  10.687  -5.973  1.00 0.00 ? 25 ARG P O      5  
ATOM 9052  C CB     . ARG C 3 25 ? -11.163 12.813  -7.364  1.00 0.00 ? 25 ARG P CB     5  
ATOM 9053  C CG     . ARG C 3 25 ? -12.536 13.314  -8.020  1.00 0.00 ? 25 ARG P CG     5  
ATOM 9054  C CD     . ARG C 3 25 ? -13.754 12.347  -8.083  1.00 0.00 ? 25 ARG P CD     5  
ATOM 9055  N NE     . ARG C 3 25 ? -14.912 13.040  -8.748  1.00 0.00 ? 25 ARG P NE     5  
ATOM 9056  C CZ     . ARG C 3 25 ? -16.052 12.448  -9.182  1.00 0.00 ? 25 ARG P CZ     5  
ATOM 9057  N NH1    . ARG C 3 25 ? -16.282 11.143  -9.031  1.00 0.00 ? 25 ARG P NH1    5  
ATOM 9058  N NH2    . ARG C 3 25 ? -16.964 13.206  -9.774  1.00 0.00 ? 25 ARG P NH2    5  
ATOM 9059  H H      . ARG C 3 25 ? -12.146 14.081  -5.446  1.00 0.00 ? 25 ARG P H      5  
ATOM 9060  H HA     . ARG C 3 25 ? -12.077 11.355  -6.214  1.00 0.00 ? 25 ARG P HA     5  
ATOM 9061  H HB2    . ARG C 3 25 ? -10.515 13.675  -7.208  1.00 0.00 ? 25 ARG P HB2    5  
ATOM 9062  H HB3    . ARG C 3 25 ? -10.589 12.161  -8.024  1.00 0.00 ? 25 ARG P HB3    5  
ATOM 9063  H HG2    . ARG C 3 25 ? -12.854 14.188  -7.451  1.00 0.00 ? 25 ARG P HG2    5  
ATOM 9064  H HG3    . ARG C 3 25 ? -12.277 13.617  -9.035  1.00 0.00 ? 25 ARG P HG3    5  
ATOM 9065  H HD2    . ARG C 3 25 ? -13.369 11.475  -8.614  1.00 0.00 ? 25 ARG P HD2    5  
ATOM 9066  H HD3    . ARG C 3 25 ? -14.144 12.144  -7.086  1.00 0.00 ? 25 ARG P HD3    5  
ATOM 9067  H HE     . ARG C 3 25 ? -14.978 14.048  -8.763  1.00 0.00 ? 25 ARG P HE     5  
ATOM 9068  H HH11   . ARG C 3 25 ? -15.505 10.572  -8.731  1.00 0.00 ? 25 ARG P HH11   5  
ATOM 9069  H HH12   . ARG C 3 25 ? -17.198 10.860  -9.347  1.00 0.00 ? 25 ARG P HH12   5  
ATOM 9070  H HH21   . ARG C 3 25 ? -16.741 14.178  -9.934  1.00 0.00 ? 25 ARG P HH21   5  
ATOM 9071  H HH22   . ARG C 3 25 ? -17.922 12.901  -9.868  1.00 0.00 ? 25 ARG P HH22   5  
ATOM 9072  N N      . TYR C 3 26 ? -9.609  12.158  -4.317  1.00 0.00 ? 26 TYR P N      5  
ATOM 9073  C CA     . TYR C 3 26 ? -8.388  11.658  -3.637  1.00 0.00 ? 26 TYR P CA     5  
ATOM 9074  C C      . TYR C 3 26 ? -8.410  12.036  -2.143  1.00 0.00 ? 26 TYR P C      5  
ATOM 9075  O O      . TYR C 3 26 ? -9.418  12.620  -1.722  1.00 0.00 ? 26 TYR P O      5  
ATOM 9076  C CB     . TYR C 3 26 ? -7.132  11.831  -4.368  1.00 0.00 ? 26 TYR P CB     5  
ATOM 9077  C CG     . TYR C 3 26 ? -6.681  13.173  -5.078  1.00 0.00 ? 26 TYR P CG     5  
ATOM 9078  C CD1    . TYR C 3 26 ? -5.322  13.585  -5.088  1.00 0.00 ? 26 TYR P CD1    5  
ATOM 9079  C CD2    . TYR C 3 26 ? -7.638  13.870  -5.852  1.00 0.00 ? 26 TYR P CD2    5  
ATOM 9080  C CE1    . TYR C 3 26 ? -4.852  14.731  -5.836  1.00 0.00 ? 26 TYR P CE1    5  
ATOM 9081  C CE2    . TYR C 3 26 ? -7.159  15.063  -6.510  1.00 0.00 ? 26 TYR P CE2    5  
ATOM 9082  C CZ     . TYR C 3 26 ? -5.792  15.478  -6.465  1.00 0.00 ? 26 TYR P CZ     5  
ATOM 9083  O OH     . TYR C 3 26 ? -5.357  16.523  -7.286  1.00 0.00 ? 26 TYR P OH     5  
ATOM 9084  H H      . TYR C 3 26 ? -9.874  13.069  -3.969  1.00 0.00 ? 26 TYR P H      5  
ATOM 9085  H HA     . TYR C 3 26 ? -8.480  10.581  -3.503  1.00 0.00 ? 26 TYR P HA     5  
ATOM 9086  H HB2    . TYR C 3 26 ? -6.358  11.592  -3.638  1.00 0.00 ? 26 TYR P HB2    5  
ATOM 9087  H HB3    . TYR C 3 26 ? -6.977  10.988  -5.042  1.00 0.00 ? 26 TYR P HB3    5  
ATOM 9088  H HD1    . TYR C 3 26 ? -4.588  12.964  -4.596  1.00 0.00 ? 26 TYR P HD1    5  
ATOM 9089  H HD2    . TYR C 3 26 ? -8.644  13.548  -6.077  1.00 0.00 ? 26 TYR P HD2    5  
ATOM 9090  H HE1    . TYR C 3 26 ? -3.813  15.023  -5.856  1.00 0.00 ? 26 TYR P HE1    5  
ATOM 9091  H HE2    . TYR C 3 26 ? -7.852  15.741  -6.986  1.00 0.00 ? 26 TYR P HE2    5  
ATOM 9092  H HH     . TYR C 3 26 ? -4.427  16.681  -7.114  1.00 0.00 ? 26 TYR P HH     5  
ATOM 9093  N N      . LEU C 3 27 ? -7.411  11.690  -1.321  1.00 0.00 ? 27 LEU P N      5  
ATOM 9094  C CA     . LEU C 3 27 ? -7.496  11.834  0.144   1.00 0.00 ? 27 LEU P CA     5  
ATOM 9095  C C      . LEU C 3 27 ? -6.325  12.402  0.950   1.00 0.00 ? 27 LEU P C      5  
ATOM 9096  O O      . LEU C 3 27 ? -5.199  12.579  0.495   1.00 0.00 ? 27 LEU P O      5  
ATOM 9097  C CB     . LEU C 3 27 ? -8.190  10.631  0.761   1.00 0.00 ? 27 LEU P CB     5  
ATOM 9098  C CG     . LEU C 3 27 ? -7.422  9.279   0.894   1.00 0.00 ? 27 LEU P CG     5  
ATOM 9099  C CD1    . LEU C 3 27 ? -6.048  9.480   1.451   1.00 0.00 ? 27 LEU P CD1    5  
ATOM 9100  C CD2    . LEU C 3 27 ? -8.274  8.318   1.652   1.00 0.00 ? 27 LEU P CD2    5  
ATOM 9101  H H      . LEU C 3 27 ? -6.608  11.255  -1.751  1.00 0.00 ? 27 LEU P H      5  
ATOM 9102  H HA     . LEU C 3 27 ? -8.196  12.660  0.270   1.00 0.00 ? 27 LEU P HA     5  
ATOM 9103  H HB2    . LEU C 3 27 ? -8.450  10.782  1.809   1.00 0.00 ? 27 LEU P HB2    5  
ATOM 9104  H HB3    . LEU C 3 27 ? -9.100  10.405  0.206   1.00 0.00 ? 27 LEU P HB3    5  
ATOM 9105  H HG     . LEU C 3 27 ? -7.254  8.776   -0.059  1.00 0.00 ? 27 LEU P HG     5  
ATOM 9106  H HD11   . LEU C 3 27 ? -5.778  8.424   1.426   1.00 0.00 ? 27 LEU P HD11   5  
ATOM 9107  H HD12   . LEU C 3 27 ? -5.897  9.871   2.457   1.00 0.00 ? 27 LEU P HD12   5  
ATOM 9108  H HD13   . LEU C 3 27 ? -5.418  9.977   0.712   1.00 0.00 ? 27 LEU P HD13   5  
ATOM 9109  H HD21   . LEU C 3 27 ? -7.979  7.269   1.616   1.00 0.00 ? 27 LEU P HD21   5  
ATOM 9110  H HD22   . LEU C 3 27 ? -9.296  8.378   1.278   1.00 0.00 ? 27 LEU P HD22   5  
ATOM 9111  H HD23   . LEU C 3 27 ? -8.242  8.752   2.652   1.00 0.00 ? 27 LEU P HD23   5  
ATOM 9112  N N      . THR C 3 28 ? -6.592  12.629  2.244   1.00 0.00 ? 28 THR P N      5  
ATOM 9113  C CA     . THR C 3 28 ? -5.867  13.407  3.273   1.00 0.00 ? 28 THR P CA     5  
ATOM 9114  C C      . THR C 3 28 ? -6.299  12.871  4.633   1.00 0.00 ? 28 THR P C      5  
ATOM 9115  O O      . THR C 3 28 ? -7.188  12.101  4.697   1.00 0.00 ? 28 THR P O      5  
ATOM 9116  C CB     . THR C 3 28 ? -6.419  14.881  3.249   1.00 0.00 ? 28 THR P CB     5  
ATOM 9117  O OG1    . THR C 3 28 ? -7.767  14.941  3.620   1.00 0.00 ? 28 THR P OG1    5  
ATOM 9118  C CG2    . THR C 3 28 ? -6.290  15.488  1.862   1.00 0.00 ? 28 THR P CG2    5  
ATOM 9119  H H      . THR C 3 28 ? -7.510  12.342  2.550   1.00 0.00 ? 28 THR P H      5  
ATOM 9120  H HA     . THR C 3 28 ? -4.798  13.366  3.061   1.00 0.00 ? 28 THR P HA     5  
ATOM 9121  H HB     . THR C 3 28 ? -5.834  15.460  3.964   1.00 0.00 ? 28 THR P HB     5  
ATOM 9122  H HG1    . THR C 3 28 ? -8.040  15.859  3.558   1.00 0.00 ? 28 THR P HG1    5  
ATOM 9123  H HG21   . THR C 3 28 ? -6.493  16.559  1.881   1.00 0.00 ? 28 THR P HG21   5  
ATOM 9124  H HG22   . THR C 3 28 ? -6.933  15.045  1.102   1.00 0.00 ? 28 THR P HG22   5  
ATOM 9125  H HG23   . THR C 3 28 ? -5.222  15.389  1.674   1.00 0.00 ? 28 THR P HG23   5  
ATOM 9126  N N      . ALA C 3 29 ? -5.620  13.209  5.710   1.00 0.00 ? 29 ALA P N      5  
ATOM 9127  C CA     . ALA C 3 29 ? -5.903  12.714  7.079   1.00 0.00 ? 29 ALA P CA     5  
ATOM 9128  C C      . ALA C 3 29 ? -7.296  12.807  7.631   1.00 0.00 ? 29 ALA P C      5  
ATOM 9129  O O      . ALA C 3 29 ? -7.685  11.728  8.145   1.00 0.00 ? 29 ALA P O      5  
ATOM 9130  C CB     . ALA C 3 29 ? -4.920  13.493  7.966   1.00 0.00 ? 29 ALA P CB     5  
ATOM 9131  H H      . ALA C 3 29 ? -4.788  13.777  5.652   1.00 0.00 ? 29 ALA P H      5  
ATOM 9132  H HA     . ALA C 3 29 ? -5.574  11.675  7.043   1.00 0.00 ? 29 ALA P HA     5  
ATOM 9133  H HB1    . ALA C 3 29 ? -5.203  14.546  7.978   1.00 0.00 ? 29 ALA P HB1    5  
ATOM 9134  H HB2    . ALA C 3 29 ? -4.973  13.045  8.958   1.00 0.00 ? 29 ALA P HB2    5  
ATOM 9135  H HB3    . ALA C 3 29 ? -3.955  13.439  7.461   1.00 0.00 ? 29 ALA P HB3    5  
ATOM 9136  N N      . PRO C 3 30 ? -8.077  13.924  7.491   1.00 0.00 ? 30 PRO P N      5  
ATOM 9137  C CA     . PRO C 3 30 ? -9.556  13.899  7.828   1.00 0.00 ? 30 PRO P CA     5  
ATOM 9138  C C      . PRO C 3 30 ? -10.346 12.925  6.957   1.00 0.00 ? 30 PRO P C      5  
ATOM 9139  O O      . PRO C 3 30 ? -11.267 12.285  7.422   1.00 0.00 ? 30 PRO P O      5  
ATOM 9140  C CB     . PRO C 3 30 ? -9.972  15.285  7.585   1.00 0.00 ? 30 PRO P CB     5  
ATOM 9141  C CG     . PRO C 3 30 ? -9.020  15.866  6.595   1.00 0.00 ? 30 PRO P CG     5  
ATOM 9142  C CD     . PRO C 3 30 ? -7.776  15.112  6.797   1.00 0.00 ? 30 PRO P CD     5  
ATOM 9143  H HA     . PRO C 3 30 ? -9.645  13.710  8.897   1.00 0.00 ? 30 PRO P HA     5  
ATOM 9144  H HB2    . PRO C 3 30 ? -10.996 15.359  7.219   1.00 0.00 ? 30 PRO P HB2    5  
ATOM 9145  H HB3    . PRO C 3 30 ? -9.831  15.876  8.490   1.00 0.00 ? 30 PRO P HB3    5  
ATOM 9146  H HG2    . PRO C 3 30 ? -9.375  15.659  5.585   1.00 0.00 ? 30 PRO P HG2    5  
ATOM 9147  H HG3    . PRO C 3 30 ? -8.867  16.943  6.668   1.00 0.00 ? 30 PRO P HG3    5  
ATOM 9148  H HD2    . PRO C 3 30 ? -7.162  14.953  5.909   1.00 0.00 ? 30 PRO P HD2    5  
ATOM 9149  H HD3    . PRO C 3 30 ? -7.127  15.650  7.490   1.00 0.00 ? 30 PRO P HD3    5  
ATOM 9150  N N      . ARG C 3 31 ? -10.080 12.756  5.650   1.00 0.00 ? 31 ARG P N      5  
ATOM 9151  C CA     . ARG C 3 31 ? -10.707 11.869  4.719   1.00 0.00 ? 31 ARG P CA     5  
ATOM 9152  C C      . ARG C 3 31 ? -10.391 10.486  5.140   1.00 0.00 ? 31 ARG P C      5  
ATOM 9153  O O      . ARG C 3 31 ? -11.282 9.671   5.506   1.00 0.00 ? 31 ARG P O      5  
ATOM 9154  C CB     . ARG C 3 31 ? -10.219 12.146  3.270   1.00 0.00 ? 31 ARG P CB     5  
ATOM 9155  C CG     . ARG C 3 31 ? -10.972 13.112  2.478   1.00 0.00 ? 31 ARG P CG     5  
ATOM 9156  C CD     . ARG C 3 31 ? -11.011 14.522  3.086   1.00 0.00 ? 31 ARG P CD     5  
ATOM 9157  N NE     . ARG C 3 31 ? -11.815 15.500  2.322   1.00 0.00 ? 31 ARG P NE     5  
ATOM 9158  C CZ     . ARG C 3 31 ? -11.462 16.013  1.155   1.00 0.00 ? 31 ARG P CZ     5  
ATOM 9159  N NH1    . ARG C 3 31 ? -10.204 15.988  0.786   1.00 0.00 ? 31 ARG P NH1    5  
ATOM 9160  N NH2    . ARG C 3 31 ? -12.349 16.683  0.487   1.00 0.00 ? 31 ARG P NH2    5  
ATOM 9161  H H      . ARG C 3 31 ? -9.307  13.283  5.271   1.00 0.00 ? 31 ARG P H      5  
ATOM 9162  H HA     . ARG C 3 31 ? -11.781 12.001  4.854   1.00 0.00 ? 31 ARG P HA     5  
ATOM 9163  H HB2    . ARG C 3 31 ? -9.155  12.382  3.293   1.00 0.00 ? 31 ARG P HB2    5  
ATOM 9164  H HB3    . ARG C 3 31 ? -10.219 11.234  2.673   1.00 0.00 ? 31 ARG P HB3    5  
ATOM 9165  H HG2    . ARG C 3 31 ? -10.536 13.175  1.481   1.00 0.00 ? 31 ARG P HG2    5  
ATOM 9166  H HG3    . ARG C 3 31 ? -11.996 12.795  2.272   1.00 0.00 ? 31 ARG P HG3    5  
ATOM 9167  H HD2    . ARG C 3 31 ? -11.424 14.524  4.095   1.00 0.00 ? 31 ARG P HD2    5  
ATOM 9168  H HD3    . ARG C 3 31 ? -10.010 14.932  3.221   1.00 0.00 ? 31 ARG P HD3    5  
ATOM 9169  H HE     . ARG C 3 31 ? -12.799 15.579  2.534   1.00 0.00 ? 31 ARG P HE     5  
ATOM 9170  H HH11   . ARG C 3 31 ? -9.540  15.736  1.504   1.00 0.00 ? 31 ARG P HH11   5  
ATOM 9171  H HH12   . ARG C 3 31 ? -9.945  16.454  -0.072  1.00 0.00 ? 31 ARG P HH12   5  
ATOM 9172  H HH21   . ARG C 3 31 ? -13.314 16.436  0.657   1.00 0.00 ? 31 ARG P HH21   5  
ATOM 9173  H HH22   . ARG C 3 31 ? -12.124 17.131  -0.388  1.00 0.00 ? 31 ARG P HH22   5  
ATOM 9174  N N      . LEU C 3 32 ? -9.095  10.126  5.136   1.00 0.00 ? 32 LEU P N      5  
ATOM 9175  C CA     . LEU C 3 32 ? -8.514  8.899   5.426   1.00 0.00 ? 32 LEU P CA     5  
ATOM 9176  C C      . LEU C 3 32 ? -9.091  8.306   6.745   1.00 0.00 ? 32 LEU P C      5  
ATOM 9177  O O      . LEU C 3 32 ? -9.431  7.161   6.814   1.00 0.00 ? 32 LEU P O      5  
ATOM 9178  C CB     . LEU C 3 32 ? -6.978  9.154   5.387   1.00 0.00 ? 32 LEU P CB     5  
ATOM 9179  C CG     . LEU C 3 32 ? -6.159  7.859   5.617   1.00 0.00 ? 32 LEU P CG     5  
ATOM 9180  C CD1    . LEU C 3 32 ? -5.650  7.390   4.294   1.00 0.00 ? 32 LEU P CD1    5  
ATOM 9181  C CD2    . LEU C 3 32 ? -4.983  8.296   6.526   1.00 0.00 ? 32 LEU P CD2    5  
ATOM 9182  H H      . LEU C 3 32 ? -8.422  10.777  4.758   1.00 0.00 ? 32 LEU P H      5  
ATOM 9183  H HA     . LEU C 3 32 ? -8.868  8.272   4.607   1.00 0.00 ? 32 LEU P HA     5  
ATOM 9184  H HB2    . LEU C 3 32 ? -6.635  9.586   4.448   1.00 0.00 ? 32 LEU P HB2    5  
ATOM 9185  H HB3    . LEU C 3 32 ? -6.873  9.913   6.163   1.00 0.00 ? 32 LEU P HB3    5  
ATOM 9186  H HG     . LEU C 3 32 ? -6.852  7.112   6.001   1.00 0.00 ? 32 LEU P HG     5  
ATOM 9187  H HD11   . LEU C 3 32 ? -6.471  7.058   3.658   1.00 0.00 ? 32 LEU P HD11   5  
ATOM 9188  H HD12   . LEU C 3 32 ? -4.891  6.620   4.433   1.00 0.00 ? 32 LEU P HD12   5  
ATOM 9189  H HD13   . LEU C 3 32 ? -5.089  8.170   3.783   1.00 0.00 ? 32 LEU P HD13   5  
ATOM 9190  H HD21   . LEU C 3 32 ? -4.228  7.524   6.674   1.00 0.00 ? 32 LEU P HD21   5  
ATOM 9191  H HD22   . LEU C 3 32 ? -5.245  8.514   7.562   1.00 0.00 ? 32 LEU P HD22   5  
ATOM 9192  H HD23   . LEU C 3 32 ? -4.584  9.196   6.060   1.00 0.00 ? 32 LEU P HD23   5  
ATOM 9193  N N      . ALA C 3 33 ? -9.168  9.117   7.792   1.00 0.00 ? 33 ALA P N      5  
ATOM 9194  C CA     . ALA C 3 33 ? -9.779  8.877   9.051   1.00 0.00 ? 33 ALA P CA     5  
ATOM 9195  C C      . ALA C 3 33 ? -11.294 8.570   9.041   1.00 0.00 ? 33 ALA P C      5  
ATOM 9196  O O      . ALA C 3 33 ? -11.634 7.459   9.487   1.00 0.00 ? 33 ALA P O      5  
ATOM 9197  C CB     . ALA C 3 33 ? -9.378  9.966   9.999   1.00 0.00 ? 33 ALA P CB     5  
ATOM 9198  H H      . ALA C 3 33 ? -8.844  10.064  7.654   1.00 0.00 ? 33 ALA P H      5  
ATOM 9199  H HA     . ALA C 3 33 ? -9.232  8.030   9.464   1.00 0.00 ? 33 ALA P HA     5  
ATOM 9200  H HB1    . ALA C 3 33 ? -9.781  9.735   10.985  1.00 0.00 ? 33 ALA P HB1    5  
ATOM 9201  H HB2    . ALA C 3 33 ? -8.299  10.022  10.143  1.00 0.00 ? 33 ALA P HB2    5  
ATOM 9202  H HB3    . ALA C 3 33 ? -9.790  10.935  9.718   1.00 0.00 ? 33 ALA P HB3    5  
ATOM 9203  N N      . ASP C 3 34 ? -12.114 9.410   8.426   1.00 0.00 ? 34 ASP P N      5  
ATOM 9204  C CA     . ASP C 3 34 ? -13.597 9.229   8.362   1.00 0.00 ? 34 ASP P CA     5  
ATOM 9205  C C      . ASP C 3 34 ? -14.075 8.015   7.585   1.00 0.00 ? 34 ASP P C      5  
ATOM 9206  O O      . ASP C 3 34 ? -14.785 7.132   8.081   1.00 0.00 ? 34 ASP P O      5  
ATOM 9207  C CB     . ASP C 3 34 ? -14.265 10.496  7.758   1.00 0.00 ? 34 ASP P CB     5  
ATOM 9208  C CG     . ASP C 3 34 ? -15.779 10.415  7.706   1.00 0.00 ? 34 ASP P CG     5  
ATOM 9209  O OD1    . ASP C 3 34 ? -16.410 10.679  8.747   1.00 0.00 ? 34 ASP P OD1    5  
ATOM 9210  O OD2    . ASP C 3 34 ? -16.265 10.090  6.585   1.00 0.00 ? 34 ASP P OD2    5  
ATOM 9211  H H      . ASP C 3 34 ? -11.668 10.214  8.006   1.00 0.00 ? 34 ASP P H      5  
ATOM 9212  H HA     . ASP C 3 34 ? -13.895 9.117   9.404   1.00 0.00 ? 34 ASP P HA     5  
ATOM 9213  H HB2    . ASP C 3 34 ? -13.929 11.375  8.306   1.00 0.00 ? 34 ASP P HB2    5  
ATOM 9214  H HB3    . ASP C 3 34 ? -13.944 10.609  6.722   1.00 0.00 ? 34 ASP P HB3    5  
ATOM 9215  N N      . LEU C 3 35 ? -13.583 7.850   6.343   1.00 0.00 ? 35 LEU P N      5  
ATOM 9216  C CA     . LEU C 3 35 ? -13.641 6.614   5.692   1.00 0.00 ? 35 LEU P CA     5  
ATOM 9217  C C      . LEU C 3 35 ? -12.972 5.449   6.452   1.00 0.00 ? 35 LEU P C      5  
ATOM 9218  O O      . LEU C 3 35 ? -13.602 4.369   6.541   1.00 0.00 ? 35 LEU P O      5  
ATOM 9219  C CB     . LEU C 3 35 ? -13.163 6.857   4.287   1.00 0.00 ? 35 LEU P CB     5  
ATOM 9220  C CG     . LEU C 3 35 ? -14.000 6.509   3.051   1.00 0.00 ? 35 LEU P CG     5  
ATOM 9221  C CD1    . LEU C 3 35 ? -15.497 6.697   3.126   1.00 0.00 ? 35 LEU P CD1    5  
ATOM 9222  C CD2    . LEU C 3 35 ? -13.447 7.195   1.812   1.00 0.00 ? 35 LEU P CD2    5  
ATOM 9223  H H      . LEU C 3 35 ? -13.104 8.565   5.814   1.00 0.00 ? 35 LEU P H      5  
ATOM 9224  H HA     . LEU C 3 35 ? -14.694 6.333   5.676   1.00 0.00 ? 35 LEU P HA     5  
ATOM 9225  H HB2    . LEU C 3 35 ? -12.814 7.888   4.228   1.00 0.00 ? 35 LEU P HB2    5  
ATOM 9226  H HB3    . LEU C 3 35 ? -12.322 6.167   4.211   1.00 0.00 ? 35 LEU P HB3    5  
ATOM 9227  H HG     . LEU C 3 35 ? -13.856 5.439   2.903   1.00 0.00 ? 35 LEU P HG     5  
ATOM 9228  H HD11   . LEU C 3 35 ? -15.771 7.740   3.284   1.00 0.00 ? 35 LEU P HD11   5  
ATOM 9229  H HD12   . LEU C 3 35 ? -15.996 6.139   3.918   1.00 0.00 ? 35 LEU P HD12   5  
ATOM 9230  H HD13   . LEU C 3 35 ? -15.918 6.329   2.190   1.00 0.00 ? 35 LEU P HD13   5  
ATOM 9231  H HD21   . LEU C 3 35 ? -12.363 7.088   1.854   1.00 0.00 ? 35 LEU P HD21   5  
ATOM 9232  H HD22   . LEU C 3 35 ? -13.811 8.221   1.771   1.00 0.00 ? 35 LEU P HD22   5  
ATOM 9233  H HD23   . LEU C 3 35 ? -13.836 6.729   0.906   1.00 0.00 ? 35 LEU P HD23   5  
ATOM 9234  N N      . SER C 3 36 ? -11.745 5.551   7.048   1.00 0.00 ? 36 SER P N      5  
ATOM 9235  C CA     . SER C 3 36 ? -11.196 4.399   7.768   1.00 0.00 ? 36 SER P CA     5  
ATOM 9236  C C      . SER C 3 36 ? -12.217 3.794   8.811   1.00 0.00 ? 36 SER P C      5  
ATOM 9237  O O      . SER C 3 36 ? -12.545 2.598   8.718   1.00 0.00 ? 36 SER P O      5  
ATOM 9238  C CB     . SER C 3 36 ? -9.867  4.616   8.438   1.00 0.00 ? 36 SER P CB     5  
ATOM 9239  O OG     . SER C 3 36 ? -9.884  5.439   9.530   1.00 0.00 ? 36 SER P OG     5  
ATOM 9240  H H      . SER C 3 36 ? -11.274 6.441   7.111   1.00 0.00 ? 36 SER P H      5  
ATOM 9241  H HA     . SER C 3 36 ? -10.985 3.671   6.986   1.00 0.00 ? 36 SER P HA     5  
ATOM 9242  H HB2    . SER C 3 36 ? -9.483  3.659   8.792   1.00 0.00 ? 36 SER P HB2    5  
ATOM 9243  H HB3    . SER C 3 36 ? -9.133  4.953   7.705   1.00 0.00 ? 36 SER P HB3    5  
ATOM 9244  H HG     . SER C 3 36 ? -10.373 6.214   9.246   1.00 0.00 ? 36 SER P HG     5  
ATOM 9245  N N      . ALA C 3 37 ? -12.716 4.656   9.628   1.00 0.00 ? 37 ALA P N      5  
ATOM 9246  C CA     . ALA C 3 37 ? -13.570 4.316   10.686  1.00 0.00 ? 37 ALA P CA     5  
ATOM 9247  C C      . ALA C 3 37 ? -15.036 3.883   10.239  1.00 0.00 ? 37 ALA P C      5  
ATOM 9248  O O      . ALA C 3 37 ? -15.647 3.103   10.971  1.00 0.00 ? 37 ALA P O      5  
ATOM 9249  C CB     . ALA C 3 37 ? -13.625 5.509   11.638  1.00 0.00 ? 37 ALA P CB     5  
ATOM 9250  H H      . ALA C 3 37 ? -12.370 5.597   9.500   1.00 0.00 ? 37 ALA P H      5  
ATOM 9251  H HA     . ALA C 3 37 ? -13.170 3.450   11.213  1.00 0.00 ? 37 ALA P HA     5  
ATOM 9252  H HB1    . ALA C 3 37 ? -14.246 5.262   12.500  1.00 0.00 ? 37 ALA P HB1    5  
ATOM 9253  H HB2    . ALA C 3 37 ? -12.619 5.721   12.001  1.00 0.00 ? 37 ALA P HB2    5  
ATOM 9254  H HB3    . ALA C 3 37 ? -13.974 6.397   11.113  1.00 0.00 ? 37 ALA P HB3    5  
ATOM 9255  N N      . LYS C 3 38 ? -15.615 4.373   9.178   1.00 0.00 ? 38 LYS P N      5  
ATOM 9256  C CA     . LYS C 3 38 ? -16.874 3.915   8.558   1.00 0.00 ? 38 LYS P CA     5  
ATOM 9257  C C      . LYS C 3 38 ? -16.779 2.677   7.717   1.00 0.00 ? 38 LYS P C      5  
ATOM 9258  O O      . LYS C 3 38 ? -17.655 1.800   7.796   1.00 0.00 ? 38 LYS P O      5  
ATOM 9259  C CB     . LYS C 3 38 ? -17.649 5.124   7.878   1.00 0.00 ? 38 LYS P CB     5  
ATOM 9260  C CG     . LYS C 3 38 ? -19.207 5.084   8.273   1.00 0.00 ? 38 LYS P CG     5  
ATOM 9261  C CD     . LYS C 3 38 ? -20.054 6.164   7.574   1.00 0.00 ? 38 LYS P CD     5  
ATOM 9262  C CE     . LYS C 3 38 ? -19.827 6.068   6.011   1.00 0.00 ? 38 LYS P CE     5  
ATOM 9263  N NZ     . LYS C 3 38 ? -21.077 6.519   5.291   1.00 0.00 ? 38 LYS P NZ     5  
ATOM 9264  H H      . LYS C 3 38 ? -15.047 4.935   8.562   1.00 0.00 ? 38 LYS P H      5  
ATOM 9265  H HA     . LYS C 3 38 ? -17.547 3.670   9.381   1.00 0.00 ? 38 LYS P HA     5  
ATOM 9266  H HB2    . LYS C 3 38 ? -17.250 6.104   8.141   1.00 0.00 ? 38 LYS P HB2    5  
ATOM 9267  H HB3    . LYS C 3 38 ? -17.456 4.895   6.830   1.00 0.00 ? 38 LYS P HB3    5  
ATOM 9268  H HG2    . LYS C 3 38 ? -19.514 4.060   8.060   1.00 0.00 ? 38 LYS P HG2    5  
ATOM 9269  H HG3    . LYS C 3 38 ? -19.341 5.116   9.354   1.00 0.00 ? 38 LYS P HG3    5  
ATOM 9270  H HD2    . LYS C 3 38 ? -21.072 6.013   7.933   1.00 0.00 ? 38 LYS P HD2    5  
ATOM 9271  H HD3    . LYS C 3 38 ? -19.736 7.171   7.844   1.00 0.00 ? 38 LYS P HD3    5  
ATOM 9272  H HE2    . LYS C 3 38 ? -18.891 6.546   5.722   1.00 0.00 ? 38 LYS P HE2    5  
ATOM 9273  H HE3    . LYS C 3 38 ? -19.604 5.033   5.753   1.00 0.00 ? 38 LYS P HE3    5  
ATOM 9274  H HZ1    . LYS C 3 38 ? -21.279 7.486   5.502   1.00 0.00 ? 38 LYS P HZ1    5  
ATOM 9275  H HZ2    . LYS C 3 38 ? -21.862 5.946   5.561   1.00 0.00 ? 38 LYS P HZ2    5  
ATOM 9276  H HZ3    . LYS C 3 38 ? -21.022 6.514   4.282   1.00 0.00 ? 38 LYS P HZ3    5  
ATOM 9277  N N      . LEU C 3 39 ? -15.831 2.583   6.763   1.00 0.00 ? 39 LEU P N      5  
ATOM 9278  C CA     . LEU C 3 39 ? -15.659 1.354   6.010   1.00 0.00 ? 39 LEU P CA     5  
ATOM 9279  C C      . LEU C 3 39 ? -15.227 0.123   6.902   1.00 0.00 ? 39 LEU P C      5  
ATOM 9280  O O      . LEU C 3 39 ? -15.314 -1.015  6.494   1.00 0.00 ? 39 LEU P O      5  
ATOM 9281  C CB     . LEU C 3 39 ? -14.419 1.469   4.974   1.00 0.00 ? 39 LEU P CB     5  
ATOM 9282  C CG     . LEU C 3 39 ? -14.362 2.460   3.807   1.00 0.00 ? 39 LEU P CG     5  
ATOM 9283  C CD1    . LEU C 3 39 ? -15.332 3.599   3.986   1.00 0.00 ? 39 LEU P CD1    5  
ATOM 9284  C CD2    . LEU C 3 39 ? -12.918 2.882   3.648   1.00 0.00 ? 39 LEU P CD2    5  
ATOM 9285  H H      . LEU C 3 39 ? -15.222 3.349   6.514   1.00 0.00 ? 39 LEU P H      5  
ATOM 9286  H HA     . LEU C 3 39 ? -16.591 1.156   5.482   1.00 0.00 ? 39 LEU P HA     5  
ATOM 9287  H HB2    . LEU C 3 39 ? -13.513 1.604   5.565   1.00 0.00 ? 39 LEU P HB2    5  
ATOM 9288  H HB3    . LEU C 3 39 ? -14.119 0.508   4.557   1.00 0.00 ? 39 LEU P HB3    5  
ATOM 9289  H HG     . LEU C 3 39 ? -14.692 1.939   2.907   1.00 0.00 ? 39 LEU P HG     5  
ATOM 9290  H HD11   . LEU C 3 39 ? -15.468 3.942   2.960   1.00 0.00 ? 39 LEU P HD11   5  
ATOM 9291  H HD12   . LEU C 3 39 ? -14.960 4.359   4.674   1.00 0.00 ? 39 LEU P HD12   5  
ATOM 9292  H HD13   . LEU C 3 39 ? -16.253 3.203   4.414   1.00 0.00 ? 39 LEU P HD13   5  
ATOM 9293  H HD21   . LEU C 3 39 ? -12.303 2.016   3.403   1.00 0.00 ? 39 LEU P HD21   5  
ATOM 9294  H HD22   . LEU C 3 39 ? -12.585 3.312   4.593   1.00 0.00 ? 39 LEU P HD22   5  
ATOM 9295  H HD23   . LEU C 3 39 ? -12.735 3.642   2.889   1.00 0.00 ? 39 LEU P HD23   5  
ATOM 9296  N N      . ALA C 3 40 ? -14.652 0.433   8.056   1.00 0.00 ? 40 ALA P N      5  
ATOM 9297  C CA     . ALA C 3 40 ? -14.247 -0.405  9.200   1.00 0.00 ? 40 ALA P CA     5  
ATOM 9298  C C      . ALA C 3 40 ? -12.896 -1.192  8.994   1.00 0.00 ? 40 ALA P C      5  
ATOM 9299  O O      . ALA C 3 40 ? -12.800 -2.370  9.300   1.00 0.00 ? 40 ALA P O      5  
ATOM 9300  C CB     . ALA C 3 40 ? -15.482 -1.301  9.595   1.00 0.00 ? 40 ALA P CB     5  
ATOM 9301  H H      . ALA C 3 40 ? -14.418 1.415   8.086   1.00 0.00 ? 40 ALA P H      5  
ATOM 9302  H HA     . ALA C 3 40 ? -14.011 0.347   9.954   1.00 0.00 ? 40 ALA P HA     5  
ATOM 9303  H HB1    . ALA C 3 40 ? -16.369 -0.679  9.470   1.00 0.00 ? 40 ALA P HB1    5  
ATOM 9304  H HB2    . ALA C 3 40 ? -15.532 -2.082  8.836   1.00 0.00 ? 40 ALA P HB2    5  
ATOM 9305  H HB3    . ALA C 3 40 ? -15.382 -1.802  10.558  1.00 0.00 ? 40 ALA P HB3    5  
ATOM 9306  N N      . LEU C 3 41 ? -11.865 -0.468  8.591   1.00 0.00 ? 41 LEU P N      5  
ATOM 9307  C CA     . LEU C 3 41 ? -10.502 -0.941  8.412   1.00 0.00 ? 41 LEU P CA     5  
ATOM 9308  C C      . LEU C 3 41 ? -9.387  0.075   8.764   1.00 0.00 ? 41 LEU P C      5  
ATOM 9309  O O      . LEU C 3 41 ? -9.717  1.190   9.248   1.00 0.00 ? 41 LEU P O      5  
ATOM 9310  C CB     . LEU C 3 41 ? -10.295 -1.493  6.980   1.00 0.00 ? 41 LEU P CB     5  
ATOM 9311  C CG     . LEU C 3 41 ? -10.875 -0.727  5.776   1.00 0.00 ? 41 LEU P CG     5  
ATOM 9312  C CD1    . LEU C 3 41 ? -10.342 0.657   5.648   1.00 0.00 ? 41 LEU P CD1    5  
ATOM 9313  C CD2    . LEU C 3 41 ? -10.642 -1.435  4.453   1.00 0.00 ? 41 LEU P CD2    5  
ATOM 9314  H H      . LEU C 3 41 ? -11.983 0.530   8.492   1.00 0.00 ? 41 LEU P H      5  
ATOM 9315  H HA     . LEU C 3 41 ? -10.332 -1.827  9.026   1.00 0.00 ? 41 LEU P HA     5  
ATOM 9316  H HB2    . LEU C 3 41 ? -9.222  -1.596  6.824   1.00 0.00 ? 41 LEU P HB2    5  
ATOM 9317  H HB3    . LEU C 3 41 ? -10.585 -2.544  6.940   1.00 0.00 ? 41 LEU P HB3    5  
ATOM 9318  H HG     . LEU C 3 41 ? -11.954 -0.617  5.883   1.00 0.00 ? 41 LEU P HG     5  
ATOM 9319  H HD11   . LEU C 3 41 ? -9.276  0.575   5.430   1.00 0.00 ? 41 LEU P HD11   5  
ATOM 9320  H HD12   . LEU C 3 41 ? -10.588 1.280   6.507   1.00 0.00 ? 41 LEU P HD12   5  
ATOM 9321  H HD13   . LEU C 3 41 ? -10.812 1.135   4.788   1.00 0.00 ? 41 LEU P HD13   5  
ATOM 9322  H HD21   . LEU C 3 41 ? -11.210 -0.960  3.654   1.00 0.00 ? 41 LEU P HD21   5  
ATOM 9323  H HD22   . LEU C 3 41 ? -11.019 -2.458  4.489   1.00 0.00 ? 41 LEU P HD22   5  
ATOM 9324  H HD23   . LEU C 3 41 ? -9.603  -1.411  4.125   1.00 0.00 ? 41 LEU P HD23   5  
ATOM 9325  N N      . GLY C 3 42 ? -8.103  -0.241  8.545   1.00 0.00 ? 42 GLY P N      5  
ATOM 9326  C CA     . GLY C 3 42 ? -6.943  0.610   8.744   1.00 0.00 ? 42 GLY P CA     5  
ATOM 9327  C C      . GLY C 3 42 ? -6.922  1.883   7.875   1.00 0.00 ? 42 GLY P C      5  
ATOM 9328  O O      . GLY C 3 42 ? -7.122  1.750   6.682   1.00 0.00 ? 42 GLY P O      5  
ATOM 9329  H H      . GLY C 3 42 ? -8.021  -1.236  8.391   1.00 0.00 ? 42 GLY P H      5  
ATOM 9330  H HA2    . GLY C 3 42 ? -6.864  0.934   9.781   1.00 0.00 ? 42 GLY P HA2    5  
ATOM 9331  H HA3    . GLY C 3 42 ? -6.060  0.006   8.533   1.00 0.00 ? 42 GLY P HA3    5  
ATOM 9332  N N      . THR C 3 43 ? -6.599  3.101   8.395   1.00 0.00 ? 43 THR P N      5  
ATOM 9333  C CA     . THR C 3 43 ? -6.344  4.359   7.714   1.00 0.00 ? 43 THR P CA     5  
ATOM 9334  C C      . THR C 3 43 ? -5.475  4.116   6.511   1.00 0.00 ? 43 THR P C      5  
ATOM 9335  O O      . THR C 3 43 ? -5.848  4.471   5.399   1.00 0.00 ? 43 THR P O      5  
ATOM 9336  C CB     . THR C 3 43 ? -5.688  5.417   8.606   1.00 0.00 ? 43 THR P CB     5  
ATOM 9337  O OG1    . THR C 3 43 ? -4.678  4.874   9.426   1.00 0.00 ? 43 THR P OG1    5  
ATOM 9338  C CG2    . THR C 3 43 ? -6.665  6.160   9.553   1.00 0.00 ? 43 THR P CG2    5  
ATOM 9339  H H      . THR C 3 43 ? -6.502  3.136   9.400   1.00 0.00 ? 43 THR P H      5  
ATOM 9340  H HA     . THR C 3 43 ? -7.275  4.780   7.334   1.00 0.00 ? 43 THR P HA     5  
ATOM 9341  H HB     . THR C 3 43 ? -5.128  6.103   7.972   1.00 0.00 ? 43 THR P HB     5  
ATOM 9342  H HG1    . THR C 3 43 ? -5.107  4.303   10.067  1.00 0.00 ? 43 THR P HG1    5  
ATOM 9343  H HG21   . THR C 3 43 ? -7.318  6.688   8.859   1.00 0.00 ? 43 THR P HG21   5  
ATOM 9344  H HG22   . THR C 3 43 ? -6.097  6.878   10.144  1.00 0.00 ? 43 THR P HG22   5  
ATOM 9345  H HG23   . THR C 3 43 ? -7.231  5.415   10.112  1.00 0.00 ? 43 THR P HG23   5  
ATOM 9346  N N      . ALA C 3 44 ? -4.365  3.397   6.693   1.00 0.00 ? 44 ALA P N      5  
ATOM 9347  C CA     . ALA C 3 44 ? -3.422  3.070   5.571   1.00 0.00 ? 44 ALA P CA     5  
ATOM 9348  C C      . ALA C 3 44 ? -4.129  2.494   4.342   1.00 0.00 ? 44 ALA P C      5  
ATOM 9349  O O      . ALA C 3 44 ? -3.842  2.862   3.224   1.00 0.00 ? 44 ALA P O      5  
ATOM 9350  C CB     . ALA C 3 44 ? -2.399  2.017   6.123   1.00 0.00 ? 44 ALA P CB     5  
ATOM 9351  H H      . ALA C 3 44 ? -4.095  3.153   7.635   1.00 0.00 ? 44 ALA P H      5  
ATOM 9352  H HA     . ALA C 3 44 ? -2.898  4.014   5.416   1.00 0.00 ? 44 ALA P HA     5  
ATOM 9353  H HB1    . ALA C 3 44 ? -1.539  1.799   5.490   1.00 0.00 ? 44 ALA P HB1    5  
ATOM 9354  H HB2    . ALA C 3 44 ? -1.947  2.484   6.998   1.00 0.00 ? 44 ALA P HB2    5  
ATOM 9355  H HB3    . ALA C 3 44 ? -2.815  1.039   6.365   1.00 0.00 ? 44 ALA P HB3    5  
ATOM 9356  N N      . GLN C 3 45 ? -5.119  1.581   4.572   1.00 0.00 ? 45 GLN P N      5  
ATOM 9357  C CA     . GLN C 3 45 ? -5.822  0.923   3.469   1.00 0.00 ? 45 GLN P CA     5  
ATOM 9358  C C      . GLN C 3 45 ? -6.631  1.916   2.588   1.00 0.00 ? 45 GLN P C      5  
ATOM 9359  O O      . GLN C 3 45 ? -6.718  1.689   1.371   1.00 0.00 ? 45 GLN P O      5  
ATOM 9360  C CB     . GLN C 3 45 ? -6.744  -0.135  3.994   1.00 0.00 ? 45 GLN P CB     5  
ATOM 9361  C CG     . GLN C 3 45 ? -6.150  -1.527  4.245   1.00 0.00 ? 45 GLN P CG     5  
ATOM 9362  C CD     . GLN C 3 45 ? -5.328  -1.680  5.457   1.00 0.00 ? 45 GLN P CD     5  
ATOM 9363  O OE1    . GLN C 3 45 ? -4.140  -1.456  5.452   1.00 0.00 ? 45 GLN P OE1    5  
ATOM 9364  N NE2    . GLN C 3 45 ? -5.869  -2.010  6.620   1.00 0.00 ? 45 GLN P NE2    5  
ATOM 9365  H H      . GLN C 3 45 ? -5.415  1.342   5.509   1.00 0.00 ? 45 GLN P H      5  
ATOM 9366  H HA     . GLN C 3 45 ? -5.075  0.544   2.771   1.00 0.00 ? 45 GLN P HA     5  
ATOM 9367  H HB2    . GLN C 3 45 ? -7.224  0.211   4.908   1.00 0.00 ? 45 GLN P HB2    5  
ATOM 9368  H HB3    . GLN C 3 45 ? -7.497  -0.403  3.253   1.00 0.00 ? 45 GLN P HB3    5  
ATOM 9369  H HG2    . GLN C 3 45 ? -6.984  -2.227  4.304   1.00 0.00 ? 45 GLN P HG2    5  
ATOM 9370  H HG3    . GLN C 3 45 ? -5.437  -1.792  3.464   1.00 0.00 ? 45 GLN P HG3    5  
ATOM 9371  H HE21   . GLN C 3 45 ? -6.833  -2.204  6.853   1.00 0.00 ? 45 GLN P HE21   5  
ATOM 9372  H HE22   . GLN C 3 45 ? -5.169  -2.222  7.317   1.00 0.00 ? 45 GLN P HE22   5  
ATOM 9373  N N      . VAL C 3 46 ? -7.190  2.975   3.174   1.00 0.00 ? 46 VAL P N      5  
ATOM 9374  C CA     . VAL C 3 46 ? -7.959  3.986   2.397   1.00 0.00 ? 46 VAL P CA     5  
ATOM 9375  C C      . VAL C 3 46 ? -6.872  4.647   1.444   1.00 0.00 ? 46 VAL P C      5  
ATOM 9376  O O      . VAL C 3 46 ? -7.088  4.766   0.234   1.00 0.00 ? 46 VAL P O      5  
ATOM 9377  C CB     . VAL C 3 46 ? -8.689  5.011   3.334   1.00 0.00 ? 46 VAL P CB     5  
ATOM 9378  C CG1    . VAL C 3 46 ? -9.870  5.663   2.557   1.00 0.00 ? 46 VAL P CG1    5  
ATOM 9379  C CG2    . VAL C 3 46 ? -9.254  4.369   4.638   1.00 0.00 ? 46 VAL P CG2    5  
ATOM 9380  H H      . VAL C 3 46 ? -7.135  3.061   4.178   1.00 0.00 ? 46 VAL P H      5  
ATOM 9381  H HA     . VAL C 3 46 ? -8.721  3.483   1.802   1.00 0.00 ? 46 VAL P HA     5  
ATOM 9382  H HB     . VAL C 3 46 ? -8.057  5.815   3.710   1.00 0.00 ? 46 VAL P HB     5  
ATOM 9383  H HG11   . VAL C 3 46 ? -10.080 6.614   3.044   1.00 0.00 ? 46 VAL P HG11   5  
ATOM 9384  H HG12   . VAL C 3 46 ? -9.521  5.709   1.525   1.00 0.00 ? 46 VAL P HG12   5  
ATOM 9385  H HG13   . VAL C 3 46 ? -10.816 5.135   2.676   1.00 0.00 ? 46 VAL P HG13   5  
ATOM 9386  H HG21   . VAL C 3 46 ? -9.713  5.107   5.295   1.00 0.00 ? 46 VAL P HG21   5  
ATOM 9387  H HG22   . VAL C 3 46 ? -10.055 3.716   4.293   1.00 0.00 ? 46 VAL P HG22   5  
ATOM 9388  H HG23   . VAL C 3 46 ? -8.409  3.884   5.127   1.00 0.00 ? 46 VAL P HG23   5  
ATOM 9389  N N      . LYS C 3 47 ? -5.730  5.153   1.960   1.00 0.00 ? 47 LYS P N      5  
ATOM 9390  C CA     . LYS C 3 47 ? -4.620  5.696   1.153   1.00 0.00 ? 47 LYS P CA     5  
ATOM 9391  C C      . LYS C 3 47 ? -4.174  4.823   0.045   1.00 0.00 ? 47 LYS P C      5  
ATOM 9392  O O      . LYS C 3 47 ? -4.109  5.308   -1.103  1.00 0.00 ? 47 LYS P O      5  
ATOM 9393  C CB     . LYS C 3 47 ? -3.469  5.926   2.146   1.00 0.00 ? 47 LYS P CB     5  
ATOM 9394  C CG     . LYS C 3 47 ? -2.942  7.432   2.213   1.00 0.00 ? 47 LYS P CG     5  
ATOM 9395  C CD     . LYS C 3 47 ? -2.238  7.800   3.542   1.00 0.00 ? 47 LYS P CD     5  
ATOM 9396  C CE     . LYS C 3 47 ? -1.804  6.624   4.443   1.00 0.00 ? 47 LYS P CE     5  
ATOM 9397  N NZ     . LYS C 3 47 ? -0.878  7.121   5.497   1.00 0.00 ? 47 LYS P NZ     5  
ATOM 9398  H H      . LYS C 3 47 ? -5.617  5.180   2.963   1.00 0.00 ? 47 LYS P H      5  
ATOM 9399  H HA     . LYS C 3 47 ? -4.927  6.693   0.836   1.00 0.00 ? 47 LYS P HA     5  
ATOM 9400  H HB2    . LYS C 3 47 ? -3.745  5.471   3.098   1.00 0.00 ? 47 LYS P HB2    5  
ATOM 9401  H HB3    . LYS C 3 47 ? -2.627  5.321   1.810   1.00 0.00 ? 47 LYS P HB3    5  
ATOM 9402  H HG2    . LYS C 3 47 ? -2.118  7.480   1.501   1.00 0.00 ? 47 LYS P HG2    5  
ATOM 9403  H HG3    . LYS C 3 47 ? -3.650  8.191   1.881   1.00 0.00 ? 47 LYS P HG3    5  
ATOM 9404  H HD2    . LYS C 3 47 ? -1.429  8.431   3.173   1.00 0.00 ? 47 LYS P HD2    5  
ATOM 9405  H HD3    . LYS C 3 47 ? -3.014  8.328   4.094   1.00 0.00 ? 47 LYS P HD3    5  
ATOM 9406  H HE2    . LYS C 3 47 ? -2.729  6.325   4.935   1.00 0.00 ? 47 LYS P HE2    5  
ATOM 9407  H HE3    . LYS C 3 47 ? -1.379  5.838   3.819   1.00 0.00 ? 47 LYS P HE3    5  
ATOM 9408  H HZ1    . LYS C 3 47 ? 0.053   6.922   5.161   1.00 0.00 ? 47 LYS P HZ1    5  
ATOM 9409  H HZ2    . LYS C 3 47 ? -0.843  6.651   6.390   1.00 0.00 ? 47 LYS P HZ2    5  
ATOM 9410  H HZ3    . LYS C 3 47 ? -0.907  8.125   5.605   1.00 0.00 ? 47 LYS P HZ3    5  
ATOM 9411  N N      . ILE C 3 48 ? -3.942  3.544   0.281   1.00 0.00 ? 48 ILE P N      5  
ATOM 9412  C CA     . ILE C 3 48 ? -3.526  2.591   -0.752  1.00 0.00 ? 48 ILE P CA     5  
ATOM 9413  C C      . ILE C 3 48 ? -4.630  2.430   -1.878  1.00 0.00 ? 48 ILE P C      5  
ATOM 9414  O O      . ILE C 3 48 ? -4.290  2.338   -3.038  1.00 0.00 ? 48 ILE P O      5  
ATOM 9415  C CB     . ILE C 3 48 ? -3.321  1.228   -0.056  1.00 0.00 ? 48 ILE P CB     5  
ATOM 9416  C CG1    . ILE C 3 48 ? -2.082  1.284   0.806   1.00 0.00 ? 48 ILE P CG1    5  
ATOM 9417  C CG2    . ILE C 3 48 ? -3.157  0.147   -1.176  1.00 0.00 ? 48 ILE P CG2    5  
ATOM 9418  C CD1    . ILE C 3 48 ? -1.852  0.069   1.717   1.00 0.00 ? 48 ILE P CD1    5  
ATOM 9419  H H      . ILE C 3 48 ? -3.847  3.308   1.259   1.00 0.00 ? 48 ILE P H      5  
ATOM 9420  H HA     . ILE C 3 48 ? -2.622  2.975   -1.224  1.00 0.00 ? 48 ILE P HA     5  
ATOM 9421  H HB     . ILE C 3 48 ? -4.120  0.965   0.637   1.00 0.00 ? 48 ILE P HB     5  
ATOM 9422  H HG12   . ILE C 3 48 ? -1.245  1.269   0.109   1.00 0.00 ? 48 ILE P HG12   5  
ATOM 9423  H HG13   . ILE C 3 48 ? -2.050  2.220   1.364   1.00 0.00 ? 48 ILE P HG13   5  
ATOM 9424  H HG21   . ILE C 3 48 ? -2.841  -0.832  -0.817  1.00 0.00 ? 48 ILE P HG21   5  
ATOM 9425  H HG22   . ILE C 3 48 ? -4.134  -0.031  -1.625  1.00 0.00 ? 48 ILE P HG22   5  
ATOM 9426  H HG23   . ILE C 3 48 ? -2.440  0.412   -1.953  1.00 0.00 ? 48 ILE P HG23   5  
ATOM 9427  H HD11   . ILE C 3 48 ? -0.980  0.262   2.342   1.00 0.00 ? 48 ILE P HD11   5  
ATOM 9428  H HD12   . ILE C 3 48 ? -2.717  0.001   2.377   1.00 0.00 ? 48 ILE P HD12   5  
ATOM 9429  H HD13   . ILE C 3 48 ? -1.793  -0.748  0.998   1.00 0.00 ? 48 ILE P HD13   5  
ATOM 9430  N N      . TRP C 3 49 ? -5.907  2.480   -1.485  1.00 0.00 ? 49 TRP P N      5  
ATOM 9431  C CA     . TRP C 3 49 ? -7.008  2.462   -2.486  1.00 0.00 ? 49 TRP P CA     5  
ATOM 9432  C C      . TRP C 3 49 ? -6.906  3.574   -3.520  1.00 0.00 ? 49 TRP P C      5  
ATOM 9433  O O      . TRP C 3 49 ? -6.883  3.321   -4.749  1.00 0.00 ? 49 TRP P O      5  
ATOM 9434  C CB     . TRP C 3 49 ? -8.391  2.408   -1.785  1.00 0.00 ? 49 TRP P CB     5  
ATOM 9435  C CG     . TRP C 3 49 ? -9.608  2.371   -2.673  1.00 0.00 ? 49 TRP P CG     5  
ATOM 9436  C CD1    . TRP C 3 49 ? -9.832  1.285   -3.363  1.00 0.00 ? 49 TRP P CD1    5  
ATOM 9437  C CD2    . TRP C 3 49 ? -10.599 3.319   -3.140  1.00 0.00 ? 49 TRP P CD2    5  
ATOM 9438  N NE1    . TRP C 3 49 ? -10.930 1.405   -4.206  1.00 0.00 ? 49 TRP P NE1    5  
ATOM 9439  C CE2    . TRP C 3 49 ? -11.496 2.696   -4.079  1.00 0.00 ? 49 TRP P CE2    5  
ATOM 9440  C CE3    . TRP C 3 49 ? -10.820 4.654   -2.855  1.00 0.00 ? 49 TRP P CE3    5  
ATOM 9441  C CZ2    . TRP C 3 49 ? -12.659 3.284   -4.565  1.00 0.00 ? 49 TRP P CZ2    5  
ATOM 9442  C CZ3    . TRP C 3 49 ? -11.930 5.321   -3.396  1.00 0.00 ? 49 TRP P CZ3    5  
ATOM 9443  C CH2    . TRP C 3 49 ? -12.834 4.656   -4.259  1.00 0.00 ? 49 TRP P CH2    5  
ATOM 9444  H H      . TRP C 3 49 ? -6.012  2.577   -0.486  1.00 0.00 ? 49 TRP P H      5  
ATOM 9445  H HA     . TRP C 3 49 ? -6.920  1.564   -3.099  1.00 0.00 ? 49 TRP P HA     5  
ATOM 9446  H HB2    . TRP C 3 49 ? -8.483  1.604   -1.055  1.00 0.00 ? 49 TRP P HB2    5  
ATOM 9447  H HB3    . TRP C 3 49 ? -8.471  3.368   -1.273  1.00 0.00 ? 49 TRP P HB3    5  
ATOM 9448  H HD1    . TRP C 3 49 ? -9.177  0.427   -3.322  1.00 0.00 ? 49 TRP P HD1    5  
ATOM 9449  H HE1    . TRP C 3 49 ? -11.197 0.718   -4.896  1.00 0.00 ? 49 TRP P HE1    5  
ATOM 9450  H HE3    . TRP C 3 49 ? -10.070 5.192   -2.295  1.00 0.00 ? 49 TRP P HE3    5  
ATOM 9451  H HZ2    . TRP C 3 49 ? -13.330 2.719   -5.195  1.00 0.00 ? 49 TRP P HZ2    5  
ATOM 9452  H HZ3    . TRP C 3 49 ? -12.079 6.354   -3.120  1.00 0.00 ? 49 TRP P HZ3    5  
ATOM 9453  H HH2    . TRP C 3 49 ? -13.741 5.165   -4.547  1.00 0.00 ? 49 TRP P HH2    5  
ATOM 9454  N N      . PHE C 3 50 ? -6.843  4.811   -3.115  1.00 0.00 ? 50 PHE P N      5  
ATOM 9455  C CA     . PHE C 3 50 ? -6.755  5.950   -3.901  1.00 0.00 ? 50 PHE P CA     5  
ATOM 9456  C C      . PHE C 3 50 ? -5.574  5.870   -4.856  1.00 0.00 ? 50 PHE P C      5  
ATOM 9457  O O      . PHE C 3 50 ? -5.726  5.870   -6.047  1.00 0.00 ? 50 PHE P O      5  
ATOM 9458  C CB     . PHE C 3 50 ? -6.921  7.303   -3.155  1.00 0.00 ? 50 PHE P CB     5  
ATOM 9459  C CG     . PHE C 3 50 ? -8.378  7.589   -2.683  1.00 0.00 ? 50 PHE P CG     5  
ATOM 9460  C CD1    . PHE C 3 50 ? -9.299  8.210   -3.561  1.00 0.00 ? 50 PHE P CD1    5  
ATOM 9461  C CD2    . PHE C 3 50 ? -8.817  7.234   -1.444  1.00 0.00 ? 50 PHE P CD2    5  
ATOM 9462  C CE1    . PHE C 3 50 ? -10.551 8.625   -3.124  1.00 0.00 ? 50 PHE P CE1    5  
ATOM 9463  C CE2    . PHE C 3 50 ? -10.162 7.376   -1.091  1.00 0.00 ? 50 PHE P CE2    5  
ATOM 9464  C CZ     . PHE C 3 50 ? -10.969 8.244   -1.856  1.00 0.00 ? 50 PHE P CZ     5  
ATOM 9465  H H      . PHE C 3 50 ? -6.861  4.902   -2.108  1.00 0.00 ? 50 PHE P H      5  
ATOM 9466  H HA     . PHE C 3 50 ? -7.641  5.969   -4.535  1.00 0.00 ? 50 PHE P HA     5  
ATOM 9467  H HB2    . PHE C 3 50 ? -6.282  7.286   -2.272  1.00 0.00 ? 50 PHE P HB2    5  
ATOM 9468  H HB3    . PHE C 3 50 ? -6.613  8.088   -3.846  1.00 0.00 ? 50 PHE P HB3    5  
ATOM 9469  H HD1    . PHE C 3 50 ? -8.985  8.465   -4.562  1.00 0.00 ? 50 PHE P HD1    5  
ATOM 9470  H HD2    . PHE C 3 50 ? -8.203  6.747   -0.700  1.00 0.00 ? 50 PHE P HD2    5  
ATOM 9471  H HE1    . PHE C 3 50 ? -11.168 9.248   -3.755  1.00 0.00 ? 50 PHE P HE1    5  
ATOM 9472  H HE2    . PHE C 3 50 ? -10.451 7.060   -0.099  1.00 0.00 ? 50 PHE P HE2    5  
ATOM 9473  H HZ     . PHE C 3 50 ? -11.866 8.691   -1.453  1.00 0.00 ? 50 PHE P HZ     5  
ATOM 9474  N N      . LYS C 3 51 ? -4.415  5.624   -4.226  1.00 0.00 ? 51 LYS P N      5  
ATOM 9475  C CA     . LYS C 3 51 ? -3.115  5.449   -4.873  1.00 0.00 ? 51 LYS P CA     5  
ATOM 9476  C C      . LYS C 3 51 ? -3.173  4.397   -5.985  1.00 0.00 ? 51 LYS P C      5  
ATOM 9477  O O      . LYS C 3 51 ? -2.833  4.629   -7.115  1.00 0.00 ? 51 LYS P O      5  
ATOM 9478  C CB     . LYS C 3 51 ? -2.044  5.121   -3.782  1.00 0.00 ? 51 LYS P CB     5  
ATOM 9479  C CG     . LYS C 3 51 ? -1.446  6.399   -3.085  1.00 0.00 ? 51 LYS P CG     5  
ATOM 9480  C CD     . LYS C 3 51 ? -0.649  5.987   -1.841  1.00 0.00 ? 51 LYS P CD     5  
ATOM 9481  C CE     . LYS C 3 51 ? 0.350   4.777   -2.045  1.00 0.00 ? 51 LYS P CE     5  
ATOM 9482  N NZ     . LYS C 3 51 ? 1.611   4.900   -1.197  1.00 0.00 ? 51 LYS P NZ     5  
ATOM 9483  H H      . LYS C 3 51 ? -4.386  5.465   -3.229  1.00 0.00 ? 51 LYS P H      5  
ATOM 9484  H HA     . LYS C 3 51 ? -2.846  6.351   -5.423  1.00 0.00 ? 51 LYS P HA     5  
ATOM 9485  H HB2    . LYS C 3 51 ? -2.380  4.386   -3.050  1.00 0.00 ? 51 LYS P HB2    5  
ATOM 9486  H HB3    . LYS C 3 51 ? -1.197  4.749   -4.358  1.00 0.00 ? 51 LYS P HB3    5  
ATOM 9487  H HG2    . LYS C 3 51 ? -0.837  6.893   -3.842  1.00 0.00 ? 51 LYS P HG2    5  
ATOM 9488  H HG3    . LYS C 3 51 ? -2.245  7.046   -2.723  1.00 0.00 ? 51 LYS P HG3    5  
ATOM 9489  H HD2    . LYS C 3 51 ? -0.172  6.886   -1.448  1.00 0.00 ? 51 LYS P HD2    5  
ATOM 9490  H HD3    . LYS C 3 51 ? -1.358  5.739   -1.053  1.00 0.00 ? 51 LYS P HD3    5  
ATOM 9491  H HE2    . LYS C 3 51 ? -0.174  3.837   -1.871  1.00 0.00 ? 51 LYS P HE2    5  
ATOM 9492  H HE3    . LYS C 3 51 ? 0.620   4.770   -3.101  1.00 0.00 ? 51 LYS P HE3    5  
ATOM 9493  H HZ1    . LYS C 3 51 ? 1.541   4.771   -0.197  1.00 0.00 ? 51 LYS P HZ1    5  
ATOM 9494  H HZ2    . LYS C 3 51 ? 2.028   5.813   -1.305  1.00 0.00 ? 51 LYS P HZ2    5  
ATOM 9495  H HZ3    . LYS C 3 51 ? 2.313   4.257   -1.536  1.00 0.00 ? 51 LYS P HZ3    5  
ATOM 9496  N N      . ASN C 3 52 ? -3.683  3.207   -5.743  1.00 0.00 ? 52 ASN P N      5  
ATOM 9497  C CA     . ASN C 3 52 ? -3.832  2.190   -6.744  1.00 0.00 ? 52 ASN P CA     5  
ATOM 9498  C C      . ASN C 3 52 ? -4.904  2.578   -7.846  1.00 0.00 ? 52 ASN P C      5  
ATOM 9499  O O      . ASN C 3 52 ? -4.739  2.206   -9.006  1.00 0.00 ? 52 ASN P O      5  
ATOM 9500  C CB     . ASN C 3 52 ? -4.214  0.894   -5.997  1.00 0.00 ? 52 ASN P CB     5  
ATOM 9501  C CG     . ASN C 3 52 ? -5.634  0.614   -5.713  1.00 0.00 ? 52 ASN P CG     5  
ATOM 9502  O OD1    . ASN C 3 52 ? -6.536  0.804   -6.487  1.00 0.00 ? 52 ASN P OD1    5  
ATOM 9503  N ND2    . ASN C 3 52 ? -5.844  0.047   -4.471  1.00 0.00 ? 52 ASN P ND2    5  
ATOM 9504  H H      . ASN C 3 52 ? -3.909  2.998   -4.781  1.00 0.00 ? 52 ASN P H      5  
ATOM 9505  H HA     . ASN C 3 52 ? -2.841  2.046   -7.172  1.00 0.00 ? 52 ASN P HA     5  
ATOM 9506  H HB2    . ASN C 3 52 ? -3.869  0.023   -6.555  1.00 0.00 ? 52 ASN P HB2    5  
ATOM 9507  H HB3    . ASN C 3 52 ? -3.647  0.697   -5.088  1.00 0.00 ? 52 ASN P HB3    5  
ATOM 9508  H HD21   . ASN C 3 52 ? -5.014  -0.152  -3.930  1.00 0.00 ? 52 ASN P HD21   5  
ATOM 9509  H HD22   . ASN C 3 52 ? -6.728  -0.351  -4.189  1.00 0.00 ? 52 ASN P HD22   5  
ATOM 9510  N N      . ARG C 3 53 ? -5.995  3.281   -7.604  1.00 0.00 ? 53 ARG P N      5  
ATOM 9511  C CA     . ARG C 3 53 ? -6.888  3.833   -8.691  1.00 0.00 ? 53 ARG P CA     5  
ATOM 9512  C C      . ARG C 3 53 ? -6.105  4.666   -9.705  1.00 0.00 ? 53 ARG P C      5  
ATOM 9513  O O      . ARG C 3 53 ? -6.251  4.422   -10.914 1.00 0.00 ? 53 ARG P O      5  
ATOM 9514  C CB     . ARG C 3 53 ? -7.990  4.664   -8.011  1.00 0.00 ? 53 ARG P CB     5  
ATOM 9515  C CG     . ARG C 3 53 ? -9.329  4.804   -8.715  1.00 0.00 ? 53 ARG P CG     5  
ATOM 9516  C CD     . ARG C 3 53 ? -10.419 5.591   -7.937  1.00 0.00 ? 53 ARG P CD     5  
ATOM 9517  N NE     . ARG C 3 53 ? -11.693 5.616   -8.664  1.00 0.00 ? 53 ARG P NE     5  
ATOM 9518  C CZ     . ARG C 3 53 ? -12.813 5.007   -8.308  1.00 0.00 ? 53 ARG P CZ     5  
ATOM 9519  N NH1    . ARG C 3 53 ? -12.884 4.006   -7.514  1.00 0.00 ? 53 ARG P NH1    5  
ATOM 9520  N NH2    . ARG C 3 53 ? -13.979 5.339   -8.756  1.00 0.00 ? 53 ARG P NH2    5  
ATOM 9521  H H      . ARG C 3 53 ? -6.239  3.399   -6.631  1.00 0.00 ? 53 ARG P H      5  
ATOM 9522  H HA     . ARG C 3 53 ? -7.308  2.961   -9.194  1.00 0.00 ? 53 ARG P HA     5  
ATOM 9523  H HB2    . ARG C 3 53 ? -8.158  4.347   -6.981  1.00 0.00 ? 53 ARG P HB2    5  
ATOM 9524  H HB3    . ARG C 3 53 ? -7.674  5.702   -7.911  1.00 0.00 ? 53 ARG P HB3    5  
ATOM 9525  H HG2    . ARG C 3 53 ? -9.078  5.082   -9.739  1.00 0.00 ? 53 ARG P HG2    5  
ATOM 9526  H HG3    . ARG C 3 53 ? -9.733  3.793   -8.741  1.00 0.00 ? 53 ARG P HG3    5  
ATOM 9527  H HD2    . ARG C 3 53 ? -10.605 5.052   -7.008  1.00 0.00 ? 53 ARG P HD2    5  
ATOM 9528  H HD3    . ARG C 3 53 ? -10.089 6.617   -7.779  1.00 0.00 ? 53 ARG P HD3    5  
ATOM 9529  H HE     . ARG C 3 53 ? -11.825 6.408   -9.277  1.00 0.00 ? 53 ARG P HE     5  
ATOM 9530  H HH11   . ARG C 3 53 ? -12.097 3.372   -7.511  1.00 0.00 ? 53 ARG P HH11   5  
ATOM 9531  H HH12   . ARG C 3 53 ? -13.784 3.563   -7.399  1.00 0.00 ? 53 ARG P HH12   5  
ATOM 9532  H HH21   . ARG C 3 53 ? -14.038 6.026   -9.494  1.00 0.00 ? 53 ARG P HH21   5  
ATOM 9533  H HH22   . ARG C 3 53 ? -14.720 4.712   -8.478  1.00 0.00 ? 53 ARG P HH22   5  
ATOM 9534  N N      . ARG C 3 54 ? -5.244  5.600   -9.217  1.00 0.00 ? 54 ARG P N      5  
ATOM 9535  C CA     . ARG C 3 54 ? -4.455  6.457   -10.062 1.00 0.00 ? 54 ARG P CA     5  
ATOM 9536  C C      . ARG C 3 54 ? -3.416  5.722   -10.860 1.00 0.00 ? 54 ARG P C      5  
ATOM 9537  O O      . ARG C 3 54 ? -3.333  5.924   -12.082 1.00 0.00 ? 54 ARG P O      5  
ATOM 9538  C CB     . ARG C 3 54 ? -3.959  7.679   -9.326  1.00 0.00 ? 54 ARG P CB     5  
ATOM 9539  C CG     . ARG C 3 54 ? -4.934  8.271   -8.248  1.00 0.00 ? 54 ARG P CG     5  
ATOM 9540  C CD     . ARG C 3 54 ? -5.940  9.051   -9.094  1.00 0.00 ? 54 ARG P CD     5  
ATOM 9541  N NE     . ARG C 3 54 ? -7.259  9.177   -8.420  1.00 0.00 ? 54 ARG P NE     5  
ATOM 9542  C CZ     . ARG C 3 54 ? -8.395  8.790   -8.973  1.00 0.00 ? 54 ARG P CZ     5  
ATOM 9543  N NH1    . ARG C 3 54 ? -8.501  8.145   -10.097 1.00 0.00 ? 54 ARG P NH1    5  
ATOM 9544  N NH2    . ARG C 3 54 ? -9.478  9.087   -8.399  1.00 0.00 ? 54 ARG P NH2    5  
ATOM 9545  H H      . ARG C 3 54 ? -5.295  5.918   -8.259  1.00 0.00 ? 54 ARG P H      5  
ATOM 9546  H HA     . ARG C 3 54 ? -5.208  6.771   -10.786 1.00 0.00 ? 54 ARG P HA     5  
ATOM 9547  H HB2    . ARG C 3 54 ? -3.050  7.331   -8.836  1.00 0.00 ? 54 ARG P HB2    5  
ATOM 9548  H HB3    . ARG C 3 54 ? -3.650  8.417   -10.067 1.00 0.00 ? 54 ARG P HB3    5  
ATOM 9549  H HG2    . ARG C 3 54 ? -5.521  7.551   -7.677  1.00 0.00 ? 54 ARG P HG2    5  
ATOM 9550  H HG3    . ARG C 3 54 ? -4.576  9.002   -7.522  1.00 0.00 ? 54 ARG P HG3    5  
ATOM 9551  H HD2    . ARG C 3 54 ? -5.544  10.019  -9.400  1.00 0.00 ? 54 ARG P HD2    5  
ATOM 9552  H HD3    . ARG C 3 54 ? -6.091  8.353   -9.919  1.00 0.00 ? 54 ARG P HD3    5  
ATOM 9553  H HE     . ARG C 3 54 ? -7.218  9.838   -7.657  1.00 0.00 ? 54 ARG P HE     5  
ATOM 9554  H HH11   . ARG C 3 54 ? -7.687  8.047   -10.687 1.00 0.00 ? 54 ARG P HH11   5  
ATOM 9555  H HH12   . ARG C 3 54 ? -9.367  7.669   -10.310 1.00 0.00 ? 54 ARG P HH12   5  
ATOM 9556  H HH21   . ARG C 3 54 ? -9.498  9.721   -7.613  1.00 0.00 ? 54 ARG P HH21   5  
ATOM 9557  H HH22   . ARG C 3 54 ? -10.309 8.756   -8.868  1.00 0.00 ? 54 ARG P HH22   5  
ATOM 9558  N N      . ARG C 3 55 ? -2.586  4.832   -10.273 1.00 0.00 ? 55 ARG P N      5  
ATOM 9559  C CA     . ARG C 3 55 ? -1.631  4.010   -11.062 1.00 0.00 ? 55 ARG P CA     5  
ATOM 9560  C C      . ARG C 3 55 ? -2.458  3.213   -12.136 1.00 0.00 ? 55 ARG P C      5  
ATOM 9561  O O      . ARG C 3 55 ? -2.196  3.377   -13.344 1.00 0.00 ? 55 ARG P O      5  
ATOM 9562  C CB     . ARG C 3 55 ? -0.798  3.064   -10.170 1.00 0.00 ? 55 ARG P CB     5  
ATOM 9563  C CG     . ARG C 3 55 ? 0.330   3.891   -9.513  1.00 0.00 ? 55 ARG P CG     5  
ATOM 9564  C CD     . ARG C 3 55 ? 1.225   4.694   -10.472 1.00 0.00 ? 55 ARG P CD     5  
ATOM 9565  N NE     . ARG C 3 55 ? 1.841   3.885   -11.408 1.00 0.00 ? 55 ARG P NE     5  
ATOM 9566  C CZ     . ARG C 3 55 ? 2.842   2.974   -11.292 1.00 0.00 ? 55 ARG P CZ     5  
ATOM 9567  N NH1    . ARG C 3 55 ? 3.471   2.789   -10.177 1.00 0.00 ? 55 ARG P NH1    5  
ATOM 9568  N NH2    . ARG C 3 55 ? 3.220   2.273   -12.386 1.00 0.00 ? 55 ARG P NH2    5  
ATOM 9569  H H      . ARG C 3 55 ? -2.775  4.629   -9.301  1.00 0.00 ? 55 ARG P H      5  
ATOM 9570  H HA     . ARG C 3 55 ? -0.930  4.561   -11.690 1.00 0.00 ? 55 ARG P HA     5  
ATOM 9571  H HB2    . ARG C 3 55 ? -1.514  2.563   -9.518  1.00 0.00 ? 55 ARG P HB2    5  
ATOM 9572  H HB3    . ARG C 3 55 ? -0.346  2.304   -10.808 1.00 0.00 ? 55 ARG P HB3    5  
ATOM 9573  H HG2    . ARG C 3 55 ? -0.184  4.559   -8.823  1.00 0.00 ? 55 ARG P HG2    5  
ATOM 9574  H HG3    . ARG C 3 55 ? 0.937   3.323   -8.808  1.00 0.00 ? 55 ARG P HG3    5  
ATOM 9575  H HD2    . ARG C 3 55 ? 0.693   5.448   -11.050 1.00 0.00 ? 55 ARG P HD2    5  
ATOM 9576  H HD3    . ARG C 3 55 ? 2.070   5.124   -9.933  1.00 0.00 ? 55 ARG P HD3    5  
ATOM 9577  H HE     . ARG C 3 55 ? 1.450   3.873   -12.338 1.00 0.00 ? 55 ARG P HE     5  
ATOM 9578  H HH11   . ARG C 3 55 ? 3.445   3.510   -9.469  1.00 0.00 ? 55 ARG P HH11   5  
ATOM 9579  H HH12   . ARG C 3 55 ? 4.139   2.032   -10.165 1.00 0.00 ? 55 ARG P HH12   5  
ATOM 9580  H HH21   . ARG C 3 55 ? 2.871   2.518   -13.301 1.00 0.00 ? 55 ARG P HH21   5  
ATOM 9581  H HH22   . ARG C 3 55 ? 3.952   1.586   -12.279 1.00 0.00 ? 55 ARG P HH22   5  
ATOM 9582  N N      . ARG C 3 56 ? -3.467  2.490   -11.742 1.00 0.00 ? 56 ARG P N      5  
ATOM 9583  C CA     . ARG C 3 56 ? -4.230  1.636   -12.731 1.00 0.00 ? 56 ARG P CA     5  
ATOM 9584  C C      . ARG C 3 56 ? -4.757  2.483   -13.850 1.00 0.00 ? 56 ARG P C      5  
ATOM 9585  O O      . ARG C 3 56 ? -4.568  2.098   -15.023 1.00 0.00 ? 56 ARG P O      5  
ATOM 9586  C CB     . ARG C 3 56 ? -5.420  0.994   -11.940 1.00 0.00 ? 56 ARG P CB     5  
ATOM 9587  C CG     . ARG C 3 56 ? -6.246  0.124   -12.890 1.00 0.00 ? 56 ARG P CG     5  
ATOM 9588  C CD     . ARG C 3 56 ? -7.389  -0.556  -12.067 1.00 0.00 ? 56 ARG P CD     5  
ATOM 9589  N NE     . ARG C 3 56 ? -8.316  0.422   -11.481 1.00 0.00 ? 56 ARG P NE     5  
ATOM 9590  C CZ     . ARG C 3 56 ? -8.388  0.685   -10.191 1.00 0.00 ? 56 ARG P CZ     5  
ATOM 9591  N NH1    . ARG C 3 56 ? -7.457  0.382   -9.351  1.00 0.00 ? 56 ARG P NH1    5  
ATOM 9592  N NH2    . ARG C 3 56 ? -9.364  1.386   -9.731  1.00 0.00 ? 56 ARG P NH2    5  
ATOM 9593  H H      . ARG C 3 56 ? -3.638  2.364   -10.754 1.00 0.00 ? 56 ARG P H      5  
ATOM 9594  H HA     . ARG C 3 56 ? -3.628  0.798   -13.082 1.00 0.00 ? 56 ARG P HA     5  
ATOM 9595  H HB2    . ARG C 3 56 ? -5.133  0.532   -10.995 1.00 0.00 ? 56 ARG P HB2    5  
ATOM 9596  H HB3    . ARG C 3 56 ? -6.135  1.753   -11.621 1.00 0.00 ? 56 ARG P HB3    5  
ATOM 9597  H HG2    . ARG C 3 56 ? -6.615  0.768   -13.689 1.00 0.00 ? 56 ARG P HG2    5  
ATOM 9598  H HG3    . ARG C 3 56 ? -5.641  -0.692  -13.287 1.00 0.00 ? 56 ARG P HG3    5  
ATOM 9599  H HD2    . ARG C 3 56 ? -7.910  -1.199  -12.777 1.00 0.00 ? 56 ARG P HD2    5  
ATOM 9600  H HD3    . ARG C 3 56 ? -7.074  -1.274  -11.309 1.00 0.00 ? 56 ARG P HD3    5  
ATOM 9601  H HE     . ARG C 3 56 ? -9.059  0.771   -12.071 1.00 0.00 ? 56 ARG P HE     5  
ATOM 9602  H HH11   . ARG C 3 56 ? -6.605  -0.062  -9.661  1.00 0.00 ? 56 ARG P HH11   5  
ATOM 9603  H HH12   . ARG C 3 56 ? -7.519  0.639   -8.377  1.00 0.00 ? 56 ARG P HH12   5  
ATOM 9604  H HH21   . ARG C 3 56 ? -10.165 1.740   -10.234 1.00 0.00 ? 56 ARG P HH21   5  
ATOM 9605  H HH22   . ARG C 3 56 ? -9.448  1.401   -8.725  1.00 0.00 ? 56 ARG P HH22   5  
ATOM 9606  N N      . HIS C 3 57 ? -5.447  3.631   -13.568 1.00 0.00 ? 57 HIS P N      5  
ATOM 9607  C CA     . HIS C 3 57 ? -6.126  4.494   -14.520 1.00 0.00 ? 57 HIS P CA     5  
ATOM 9608  C C      . HIS C 3 57 ? -5.014  5.132   -15.466 1.00 0.00 ? 57 HIS P C      5  
ATOM 9609  O O      . HIS C 3 57 ? -5.106  5.012   -16.675 1.00 0.00 ? 57 HIS P O      5  
ATOM 9610  C CB     . HIS C 3 57 ? -6.811  5.660   -13.762 1.00 0.00 ? 57 HIS P CB     5  
ATOM 9611  C CG     . HIS C 3 57 ? -8.261  5.384   -13.373 1.00 0.00 ? 57 HIS P CG     5  
ATOM 9612  N ND1    . HIS C 3 57 ? -9.396  6.217   -13.565 1.00 0.00 ? 57 HIS P ND1    5  
ATOM 9613  C CD2    . HIS C 3 57 ? -8.759  4.275   -12.643 1.00 0.00 ? 57 HIS P CD2    5  
ATOM 9614  C CE1    . HIS C 3 57 ? -10.372 5.728   -12.849 1.00 0.00 ? 57 HIS P CE1    5  
ATOM 9615  N NE2    . HIS C 3 57 ? -10.054 4.556   -12.287 1.00 0.00 ? 57 HIS P NE2    5  
ATOM 9616  H H      . HIS C 3 57 ? -5.775  3.824   -12.633 1.00 0.00 ? 57 HIS P H      5  
ATOM 9617  H HA     . HIS C 3 57 ? -6.832  3.886   -15.086 1.00 0.00 ? 57 HIS P HA     5  
ATOM 9618  H HB2    . HIS C 3 57 ? -6.224  6.019   -12.917 1.00 0.00 ? 57 HIS P HB2    5  
ATOM 9619  H HB3    . HIS C 3 57 ? -6.977  6.455   -14.489 1.00 0.00 ? 57 HIS P HB3    5  
ATOM 9620  H HD1    . HIS C 3 57 ? -9.469  7.112   -14.026 1.00 0.00 ? 57 HIS P HD1    5  
ATOM 9621  H HD2    . HIS C 3 57 ? -8.112  3.482   -12.298 1.00 0.00 ? 57 HIS P HD2    5  
ATOM 9622  H HE1    . HIS C 3 57 ? -11.362 6.153   -12.765 1.00 0.00 ? 57 HIS P HE1    5  
ATOM 9623  N N      . LYS C 3 58 ? -3.876  5.726   -14.942 1.00 0.00 ? 58 LYS P N      5  
ATOM 9624  C CA     . LYS C 3 58 ? -2.699  6.275   -15.695 1.00 0.00 ? 58 LYS P CA     5  
ATOM 9625  C C      . LYS C 3 58 ? -2.011  5.315   -16.715 1.00 0.00 ? 58 LYS P C      5  
ATOM 9626  O O      . LYS C 3 58 ? -1.801  5.606   -17.883 1.00 0.00 ? 58 LYS P O      5  
ATOM 9627  C CB     . LYS C 3 58 ? -1.709  7.189   -14.955 1.00 0.00 ? 58 LYS P CB     5  
ATOM 9628  C CG     . LYS C 3 58 ? -0.615  6.419   -14.103 1.00 0.00 ? 58 LYS P CG     5  
ATOM 9629  C CD     . LYS C 3 58 ? 0.196   7.445   -13.328 1.00 0.00 ? 58 LYS P CD     5  
ATOM 9630  C CE     . LYS C 3 58 ? -0.534  7.882   -12.118 1.00 0.00 ? 58 LYS P CE     5  
ATOM 9631  N NZ     . LYS C 3 58 ? -0.613  9.416   -12.116 1.00 0.00 ? 58 LYS P NZ     5  
ATOM 9632  H H      . LYS C 3 58 ? -3.896  5.848   -13.940 1.00 0.00 ? 58 LYS P H      5  
ATOM 9633  H HA     . LYS C 3 58 ? -3.160  6.974   -16.394 1.00 0.00 ? 58 LYS P HA     5  
ATOM 9634  H HB2    . LYS C 3 58 ? -1.236  7.825   -15.702 1.00 0.00 ? 58 LYS P HB2    5  
ATOM 9635  H HB3    . LYS C 3 58 ? -2.306  7.893   -14.376 1.00 0.00 ? 58 LYS P HB3    5  
ATOM 9636  H HG2    . LYS C 3 58 ? -1.084  5.679   -13.455 1.00 0.00 ? 58 LYS P HG2    5  
ATOM 9637  H HG3    . LYS C 3 58 ? 0.026   5.967   -14.860 1.00 0.00 ? 58 LYS P HG3    5  
ATOM 9638  H HD2    . LYS C 3 58 ? 1.127   7.074   -12.900 1.00 0.00 ? 58 LYS P HD2    5  
ATOM 9639  H HD3    . LYS C 3 58 ? 0.381   8.200   -14.092 1.00 0.00 ? 58 LYS P HD3    5  
ATOM 9640  H HE2    . LYS C 3 58 ? -1.485  7.351   -12.078 1.00 0.00 ? 58 LYS P HE2    5  
ATOM 9641  H HE3    . LYS C 3 58 ? -0.016  7.589   -11.206 1.00 0.00 ? 58 LYS P HE3    5  
ATOM 9642  H HZ1    . LYS C 3 58 ? 0.329   9.765   -12.222 1.00 0.00 ? 58 LYS P HZ1    5  
ATOM 9643  H HZ2    . LYS C 3 58 ? -0.989  9.828   -11.273 1.00 0.00 ? 58 LYS P HZ2    5  
ATOM 9644  H HZ3    . LYS C 3 58 ? -1.124  9.873   -12.858 1.00 0.00 ? 58 LYS P HZ3    5  
ATOM 9645  N N      . ILE C 3 59 ? -1.988  4.093   -16.257 1.00 0.00 ? 59 ILE P N      5  
ATOM 9646  C CA     . ILE C 3 59 ? -1.497  2.879   -17.007 1.00 0.00 ? 59 ILE P CA     5  
ATOM 9647  C C      . ILE C 3 59 ? -2.471  2.467   -18.128 1.00 0.00 ? 59 ILE P C      5  
ATOM 9648  O O      . ILE C 3 59 ? -2.086  2.482   -19.312 1.00 0.00 ? 59 ILE P O      5  
ATOM 9649  C CB     . ILE C 3 59 ? -1.338  1.728   -15.966 1.00 0.00 ? 59 ILE P CB     5  
ATOM 9650  C CG1    . ILE C 3 59 ? -0.049  2.042   -15.078 1.00 0.00 ? 59 ILE P CG1    5  
ATOM 9651  C CG2    . ILE C 3 59 ? -1.017  0.338   -16.573 1.00 0.00 ? 59 ILE P CG2    5  
ATOM 9652  C CD1    . ILE C 3 59 ? 0.049   1.223   -13.777 1.00 0.00 ? 59 ILE P CD1    5  
ATOM 9653  H H      . ILE C 3 59 ? -2.127  4.068   -15.257 1.00 0.00 ? 59 ILE P H      5  
ATOM 9654  H HA     . ILE C 3 59 ? -0.531  3.168   -17.422 1.00 0.00 ? 59 ILE P HA     5  
ATOM 9655  H HB     . ILE C 3 59 ? -2.219  1.666   -15.328 1.00 0.00 ? 59 ILE P HB     5  
ATOM 9656  H HG12   . ILE C 3 59 ? 0.891   1.790   -15.568 1.00 0.00 ? 59 ILE P HG12   5  
ATOM 9657  H HG13   . ILE C 3 59 ? 0.001   3.110   -14.866 1.00 0.00 ? 59 ILE P HG13   5  
ATOM 9658  H HG21   . ILE C 3 59 ? -1.958  -0.084  -16.924 1.00 0.00 ? 59 ILE P HG21   5  
ATOM 9659  H HG22   . ILE C 3 59 ? -0.217  0.345   -17.313 1.00 0.00 ? 59 ILE P HG22   5  
ATOM 9660  H HG23   . ILE C 3 59 ? -0.757  -0.347  -15.766 1.00 0.00 ? 59 ILE P HG23   5  
ATOM 9661  H HD11   . ILE C 3 59 ? 0.673   1.813   -13.106 1.00 0.00 ? 59 ILE P HD11   5  
ATOM 9662  H HD12   . ILE C 3 59 ? -0.918  1.201   -13.275 1.00 0.00 ? 59 ILE P HD12   5  
ATOM 9663  H HD13   . ILE C 3 59 ? 0.457   0.234   -13.985 1.00 0.00 ? 59 ILE P HD13   5  
ATOM 9664  N N      . GLN C 3 60 ? -3.799  2.370   -17.882 1.00 0.00 ? 60 GLN P N      5  
ATOM 9665  C CA     . GLN C 3 60 ? -4.844  2.310   -18.868 1.00 0.00 ? 60 GLN P CA     5  
ATOM 9666  C C      . GLN C 3 60 ? -4.902  3.461   -19.976 1.00 0.00 ? 60 GLN P C      5  
ATOM 9667  O O      . GLN C 3 60 ? -5.221  3.206   -21.142 1.00 0.00 ? 60 GLN P O      5  
ATOM 9668  C CB     . GLN C 3 60 ? -6.220  2.145   -18.147 1.00 0.00 ? 60 GLN P CB     5  
ATOM 9669  C CG     . GLN C 3 60 ? -6.395  0.727   -17.455 1.00 0.00 ? 60 GLN P CG     5  
ATOM 9670  C CD     . GLN C 3 60 ? -7.576  0.546   -16.515 1.00 0.00 ? 60 GLN P CD     5  
ATOM 9671  O OE1    . GLN C 3 60 ? -8.483  1.400   -16.252 1.00 0.00 ? 60 GLN P OE1    5  
ATOM 9672  N NE2    . GLN C 3 60 ? -7.654  -0.613  -15.889 1.00 0.00 ? 60 GLN P NE2    5  
ATOM 9673  H H      . GLN C 3 60 ? -4.146  2.506   -16.943 1.00 0.00 ? 60 GLN P H      5  
ATOM 9674  H HA     . GLN C 3 60 ? -4.708  1.369   -19.403 1.00 0.00 ? 60 GLN P HA     5  
ATOM 9675  H HB2    . GLN C 3 60 ? -6.277  2.991   -17.462 1.00 0.00 ? 60 GLN P HB2    5  
ATOM 9676  H HB3    . GLN C 3 60 ? -7.063  2.212   -18.834 1.00 0.00 ? 60 GLN P HB3    5  
ATOM 9677  H HG2    . GLN C 3 60 ? -6.494  -0.087  -18.172 1.00 0.00 ? 60 GLN P HG2    5  
ATOM 9678  H HG3    . GLN C 3 60 ? -5.515  0.310   -16.967 1.00 0.00 ? 60 GLN P HG3    5  
ATOM 9679  H HE21   . GLN C 3 60 ? -6.920  -1.305  -15.839 1.00 0.00 ? 60 GLN P HE21   5  
ATOM 9680  H HE22   . GLN C 3 60 ? -8.549  -0.795  -15.458 1.00 0.00 ? 60 GLN P HE22   5  
ATOM 9681  N N      . SER C 3 61 ? -4.538  4.623   -19.590 1.00 0.00 ? 61 SER P N      5  
ATOM 9682  C CA     . SER C 3 61 ? -4.390  5.813   -20.461 1.00 0.00 ? 61 SER P CA     5  
ATOM 9683  C C      . SER C 3 61 ? -3.184  5.737   -21.406 1.00 0.00 ? 61 SER P C      5  
ATOM 9684  O O      . SER C 3 61 ? -3.245  5.954   -22.635 1.00 0.00 ? 61 SER P O      5  
ATOM 9685  C CB     . SER C 3 61 ? -4.256  7.110   -19.639 1.00 0.00 ? 61 SER P CB     5  
ATOM 9686  O OG     . SER C 3 61 ? -5.145  7.127   -18.581 1.00 0.00 ? 61 SER P OG     5  
ATOM 9687  H H      . SER C 3 61 ? -4.335  4.768   -18.611 1.00 0.00 ? 61 SER P H      5  
ATOM 9688  H HA     . SER C 3 61 ? -5.182  5.950   -21.197 1.00 0.00 ? 61 SER P HA     5  
ATOM 9689  H HB2    . SER C 3 61 ? -3.227  7.278   -19.319 1.00 0.00 ? 61 SER P HB2    5  
ATOM 9690  H HB3    . SER C 3 61 ? -4.503  7.936   -20.306 1.00 0.00 ? 61 SER P HB3    5  
ATOM 9691  H HG     . SER C 3 61 ? -4.918  7.886   -18.040 1.00 0.00 ? 61 SER P HG     5  
ATOM 9692  N N      . ASP C 3 62 ? -2.063  5.377   -20.834 1.00 0.00 ? 62 ASP P N      5  
ATOM 9693  C CA     . ASP C 3 62 ? -0.917  5.101   -21.637 1.00 0.00 ? 62 ASP P CA     5  
ATOM 9694  C C      . ASP C 3 62 ? -0.996  3.927   -22.542 1.00 0.00 ? 62 ASP P C      5  
ATOM 9695  O O      . ASP C 3 62 ? -0.386  3.914   -23.566 1.00 0.00 ? 62 ASP P O      5  
ATOM 9696  C CB     . ASP C 3 62 ? 0.260   4.841   -20.756 1.00 0.00 ? 62 ASP P CB     5  
ATOM 9697  C CG     . ASP C 3 62 ? 1.556   5.354   -21.447 1.00 0.00 ? 62 ASP P CG     5  
ATOM 9698  O OD1    . ASP C 3 62 ? 1.878   6.545   -21.331 1.00 0.00 ? 62 ASP P OD1    5  
ATOM 9699  O OD2    . ASP C 3 62 ? 2.430   4.529   -21.804 1.00 0.00 ? 62 ASP P OD2    5  
ATOM 9700  H H      . ASP C 3 62 ? -2.077  5.120   -19.858 1.00 0.00 ? 62 ASP P H      5  
ATOM 9701  H HA     . ASP C 3 62 ? -0.643  5.970   -22.235 1.00 0.00 ? 62 ASP P HA     5  
ATOM 9702  H HB2    . ASP C 3 62 ? 0.137   5.252   -19.753 1.00 0.00 ? 62 ASP P HB2    5  
ATOM 9703  H HB3    . ASP C 3 62 ? 0.390   3.780   -20.539 1.00 0.00 ? 62 ASP P HB3    5  
ATOM 9704  N N      . GLN C 3 63 ? -1.851  2.858   -22.201 1.00 0.00 ? 63 GLN P N      5  
ATOM 9705  C CA     . GLN C 3 63 ? -2.064  1.636   -22.961 1.00 0.00 ? 63 GLN P CA     5  
ATOM 9706  C C      . GLN C 3 63 ? -3.147  1.764   -23.976 1.00 0.00 ? 63 GLN P C      5  
ATOM 9707  O O      . GLN C 3 63 ? -3.170  1.023   -24.956 1.00 0.00 ? 63 GLN P O      5  
ATOM 9708  C CB     . GLN C 3 63 ? -2.373  0.480   -22.016 1.00 0.00 ? 63 GLN P CB     5  
ATOM 9709  C CG     . GLN C 3 63 ? -1.101  0.037   -21.346 1.00 0.00 ? 63 GLN P CG     5  
ATOM 9710  C CD     . GLN C 3 63 ? -1.434  -1.093  -20.404 1.00 0.00 ? 63 GLN P CD     5  
ATOM 9711  O OE1    . GLN C 3 63 ? -1.895  -0.876  -19.315 1.00 0.00 ? 63 GLN P OE1    5  
ATOM 9712  N NE2    . GLN C 3 63 ? -1.130  -2.277  -20.837 1.00 0.00 ? 63 GLN P NE2    5  
ATOM 9713  H H      . GLN C 3 63 ? -2.227  2.873   -21.264 1.00 0.00 ? 63 GLN P H      5  
ATOM 9714  H HA     . GLN C 3 63 ? -1.159  1.538   -23.560 1.00 0.00 ? 63 GLN P HA     5  
ATOM 9715  H HB2    . GLN C 3 63 ? -3.097  0.787   -21.261 1.00 0.00 ? 63 GLN P HB2    5  
ATOM 9716  H HB3    . GLN C 3 63 ? -2.710  -0.403  -22.557 1.00 0.00 ? 63 GLN P HB3    5  
ATOM 9717  H HG2    . GLN C 3 63 ? -0.318  -0.177  -22.074 1.00 0.00 ? 63 GLN P HG2    5  
ATOM 9718  H HG3    . GLN C 3 63 ? -0.721  0.788   -20.653 1.00 0.00 ? 63 GLN P HG3    5  
ATOM 9719  H HE21   . GLN C 3 63 ? -0.722  -2.387  -21.754 1.00 0.00 ? 63 GLN P HE21   5  
ATOM 9720  H HE22   . GLN C 3 63 ? -1.299  -3.108  -20.288 1.00 0.00 ? 63 GLN P HE22   5  
ATOM 9721  N N      . HIS C 3 64 ? -4.074  2.689   -23.726 1.00 0.00 ? 64 HIS P N      5  
ATOM 9722  C CA     . HIS C 3 64 ? -5.144  3.109   -24.717 1.00 0.00 ? 64 HIS P CA     5  
ATOM 9723  C C      . HIS C 3 64 ? -6.042  1.927   -25.269 1.00 0.00 ? 64 HIS P C      5  
ATOM 9724  O O      . HIS C 3 64 ? -6.479  1.950   -26.441 1.00 0.00 ? 64 HIS P O      5  
ATOM 9725  C CB     . HIS C 3 64 ? -4.607  4.149   -25.663 1.00 0.00 ? 64 HIS P CB     5  
ATOM 9726  C CG     . HIS C 3 64 ? -5.674  4.771   -26.612 1.00 0.00 ? 64 HIS P CG     5  
ATOM 9727  N ND1    . HIS C 3 64 ? -7.040  4.802   -26.360 1.00 0.00 ? 64 HIS P ND1    5  
ATOM 9728  C CD2    . HIS C 3 64 ? -5.488  5.443   -27.791 1.00 0.00 ? 64 HIS P CD2    5  
ATOM 9729  C CE1    . HIS C 3 64 ? -7.645  5.476   -27.361 1.00 0.00 ? 64 HIS P CE1    5  
ATOM 9730  N NE2    . HIS C 3 64 ? -6.717  5.837   -28.267 1.00 0.00 ? 64 HIS P NE2    5  
ATOM 9731  H H      . HIS C 3 64 ? -4.034  3.280   -22.909 1.00 0.00 ? 64 HIS P H      5  
ATOM 9732  H HA     . HIS C 3 64 ? -5.944  3.593   -24.156 1.00 0.00 ? 64 HIS P HA     5  
ATOM 9733  H HB2    . HIS C 3 64 ? -4.131  4.927   -25.065 1.00 0.00 ? 64 HIS P HB2    5  
ATOM 9734  H HB3    . HIS C 3 64 ? -3.877  3.577   -26.235 1.00 0.00 ? 64 HIS P HB3    5  
ATOM 9735  H HD1    . HIS C 3 64 ? -7.529  4.517   -25.524 1.00 0.00 ? 64 HIS P HD1    5  
ATOM 9736  H HD2    . HIS C 3 64 ? -4.541  5.504   -28.306 1.00 0.00 ? 64 HIS P HD2    5  
ATOM 9737  H HE1    . HIS C 3 64 ? -8.713  5.635   -27.408 1.00 0.00 ? 64 HIS P HE1    5  
ATOM 9738  N N      . LYS C 3 65 ? -6.117  0.826   -24.492 1.00 0.00 ? 65 LYS P N      5  
ATOM 9739  C CA     . LYS C 3 65 ? -6.793  -0.461  -24.865 1.00 0.00 ? 65 LYS P CA     5  
ATOM 9740  C C      . LYS C 3 65 ? -8.293  -0.392  -24.547 1.00 0.00 ? 65 LYS P C      5  
ATOM 9741  O O      . LYS C 3 65 ? -8.939  -1.410  -24.448 1.00 0.00 ? 65 LYS P O      5  
ATOM 9742  C CB     . LYS C 3 65 ? -5.999  -1.681  -24.229 1.00 0.00 ? 65 LYS P CB     5  
ATOM 9743  C CG     . LYS C 3 65 ? -5.838  -1.725  -22.643 1.00 0.00 ? 65 LYS P CG     5  
ATOM 9744  C CD     . LYS C 3 65 ? -4.950  -2.902  -22.337 1.00 0.00 ? 65 LYS P CD     5  
ATOM 9745  C CE     . LYS C 3 65 ? -4.725  -3.153  -20.851 1.00 0.00 ? 65 LYS P CE     5  
ATOM 9746  N NZ     . LYS C 3 65 ? -5.868  -3.910  -20.355 1.00 0.00 ? 65 LYS P NZ     5  
ATOM 9747  H H      . LYS C 3 65 ? -5.905  1.027   -23.526 1.00 0.00 ? 65 LYS P H      5  
ATOM 9748  H HA     . LYS C 3 65 ? -6.687  -0.653  -25.933 1.00 0.00 ? 65 LYS P HA     5  
ATOM 9749  H HB2    . LYS C 3 65 ? -6.526  -2.544  -24.635 1.00 0.00 ? 65 LYS P HB2    5  
ATOM 9750  H HB3    . LYS C 3 65 ? -5.041  -1.615  -24.744 1.00 0.00 ? 65 LYS P HB3    5  
ATOM 9751  H HG2    . LYS C 3 65 ? -5.353  -0.828  -22.260 1.00 0.00 ? 65 LYS P HG2    5  
ATOM 9752  H HG3    . LYS C 3 65 ? -6.844  -1.895  -22.260 1.00 0.00 ? 65 LYS P HG3    5  
ATOM 9753  H HD2    . LYS C 3 65 ? -5.382  -3.753  -22.862 1.00 0.00 ? 65 LYS P HD2    5  
ATOM 9754  H HD3    . LYS C 3 65 ? -3.968  -2.675  -22.754 1.00 0.00 ? 65 LYS P HD3    5  
ATOM 9755  H HE2    . LYS C 3 65 ? -3.850  -3.788  -20.714 1.00 0.00 ? 65 LYS P HE2    5  
ATOM 9756  H HE3    . LYS C 3 65 ? -4.462  -2.254  -20.293 1.00 0.00 ? 65 LYS P HE3    5  
ATOM 9757  H HZ1    . LYS C 3 65 ? -5.864  -4.821  -20.790 1.00 0.00 ? 65 LYS P HZ1    5  
ATOM 9758  H HZ2    . LYS C 3 65 ? -6.700  -3.440  -20.683 1.00 0.00 ? 65 LYS P HZ2    5  
ATOM 9759  H HZ3    . LYS C 3 65 ? -5.831  -3.935  -19.346 1.00 0.00 ? 65 LYS P HZ3    5  
ATOM 9760  N N      . ASP C 3 66 ? -8.797  0.835   -24.467 1.00 0.00 ? 66 ASP P N      5  
ATOM 9761  C CA     . ASP C 3 66 ? -10.188 1.154   -24.307 1.00 0.00 ? 66 ASP P CA     5  
ATOM 9762  C C      . ASP C 3 66 ? -11.038 1.156   -25.640 1.00 0.00 ? 66 ASP P C      5  
ATOM 9763  O O      . ASP C 3 66 ? -10.435 1.222   -26.754 1.00 0.00 ? 66 ASP P O      5  
ATOM 9764  C CB     . ASP C 3 66 ? -10.410 2.471   -23.617 1.00 0.00 ? 66 ASP P CB     5  
ATOM 9765  C CG     . ASP C 3 66 ? -9.659  3.646   -24.272 1.00 0.00 ? 66 ASP P CG     5  
ATOM 9766  O OD1    . ASP C 3 66 ? -8.443  3.843   -23.909 1.00 0.00 ? 66 ASP P OD1    5  
ATOM 9767  O OD2    . ASP C 3 66 ? -10.184 4.407   -25.160 1.00 0.00 ? 66 ASP P OD2    5  
ATOM 9768  H H      . ASP C 3 66 ? -8.211  1.539   -24.894 1.00 0.00 ? 66 ASP P H      5  
ATOM 9769  H HA     . ASP C 3 66 ? -10.625 0.391   -23.663 1.00 0.00 ? 66 ASP P HA     5  
ATOM 9770  H HB2    . ASP C 3 66 ? -11.460 2.763   -23.639 1.00 0.00 ? 66 ASP P HB2    5  
ATOM 9771  H HB3    . ASP C 3 66 ? -10.081 2.379   -22.582 1.00 0.00 ? 66 ASP P HB3    5  
ATOM 9772  N N      . GLN C 3 67 ? -12.339 1.156   -25.547 1.00 0.00 ? 67 GLN P N      5  
ATOM 9773  C CA     . GLN C 3 67 ? -13.282 1.395   -26.652 1.00 0.00 ? 67 GLN P CA     5  
ATOM 9774  C C      . GLN C 3 67 ? -14.550 2.104   -26.066 1.00 0.00 ? 67 GLN P C      5  
ATOM 9775  O O      . GLN C 3 67 ? -15.008 1.719   -24.950 1.00 0.00 ? 67 GLN P O      5  
ATOM 9776  C CB     . GLN C 3 67 ? -13.686 0.039   -27.254 1.00 0.00 ? 67 GLN P CB     5  
ATOM 9777  C CG     . GLN C 3 67 ? -14.864 -0.017  -28.328 1.00 0.00 ? 67 GLN P CG     5  
ATOM 9778  C CD     . GLN C 3 67 ? -16.141 -0.494  -27.677 1.00 0.00 ? 67 GLN P CD     5  
ATOM 9779  O OE1    . GLN C 3 67 ? -16.218 -1.562  -27.046 1.00 0.00 ? 67 GLN P OE1    5  
ATOM 9780  N NE2    . GLN C 3 67 ? -17.207 0.252   -27.742 1.00 0.00 ? 67 GLN P NE2    5  
ATOM 9781  H H      . GLN C 3 67 ? -12.686 0.979   -24.615 1.00 0.00 ? 67 GLN P H      5  
ATOM 9782  H HA     . GLN C 3 67 ? -12.868 2.089   -27.384 1.00 0.00 ? 67 GLN P HA     5  
ATOM 9783  H HB2    . GLN C 3 67 ? -12.806 -0.323  -27.786 1.00 0.00 ? 67 GLN P HB2    5  
ATOM 9784  H HB3    . GLN C 3 67 ? -13.987 -0.574  -26.404 1.00 0.00 ? 67 GLN P HB3    5  
ATOM 9785  H HG2    . GLN C 3 67 ? -14.937 0.939   -28.847 1.00 0.00 ? 67 GLN P HG2    5  
ATOM 9786  H HG3    . GLN C 3 67 ? -14.680 -0.744  -29.118 1.00 0.00 ? 67 GLN P HG3    5  
ATOM 9787  H HE21   . GLN C 3 67 ? -17.164 1.105   -28.281 1.00 0.00 ? 67 GLN P HE21   5  
ATOM 9788  H HE22   . GLN C 3 67 ? -17.993 0.036   -27.144 1.00 0.00 ? 67 GLN P HE22   5  
ATOM 9789  N N      . SER C 3 68 ? -15.219 2.993   -26.810 1.00 0.00 ? 68 SER P N      5  
ATOM 9790  C CA     . SER C 3 68 ? -16.605 3.532   -26.632 1.00 0.00 ? 68 SER P CA     5  
ATOM 9791  C C      . SER C 3 68 ? -17.315 3.845   -27.995 1.00 0.00 ? 68 SER P C      5  
ATOM 9792  O O      . SER C 3 68 ? -17.473 2.850   -28.778 1.00 0.00 ? 68 SER P O      5  
ATOM 9793  C CB     . SER C 3 68 ? -16.596 4.897   -25.820 1.00 0.00 ? 68 SER P CB     5  
ATOM 9794  O OG     . SER C 3 68 ? -15.802 4.705   -24.619 1.00 0.00 ? 68 SER P OG     5  
ATOM 9795  O OXT    . SER C 3 68 ? -17.614 5.017   -28.275 1.00 0.00 ? 68 SER P OXT    5  
ATOM 9796  H H      . SER C 3 68 ? -14.730 3.244   -27.656 1.00 0.00 ? 68 SER P H      5  
ATOM 9797  H HA     . SER C 3 68 ? -17.319 2.836   -26.189 1.00 0.00 ? 68 SER P HA     5  
ATOM 9798  H HB2    . SER C 3 68 ? -16.242 5.780   -26.350 1.00 0.00 ? 68 SER P HB2    5  
ATOM 9799  H HB3    . SER C 3 68 ? -17.645 5.079   -25.590 1.00 0.00 ? 68 SER P HB3    5  
ATOM 9800  H HG     . SER C 3 68 ? -14.949 4.438   -24.970 1.00 0.00 ? 68 SER P HG     5  
ATOM 9801  O "O5'"  . DG  A 1 1  ? 7.621   -21.241 -10.938 1.00 0.00 ? 69 DG  A "O5'"  6  
ATOM 9802  C "C5'"  . DG  A 1 1  ? 7.898   -21.631 -12.266 1.00 0.00 ? 69 DG  A "C5'"  6  
ATOM 9803  C "C4'"  . DG  A 1 1  ? 7.287   -20.680 -13.346 1.00 0.00 ? 69 DG  A "C4'"  6  
ATOM 9804  O "O4'"  . DG  A 1 1  ? 5.891   -20.697 -13.293 1.00 0.00 ? 69 DG  A "O4'"  6  
ATOM 9805  C "C3'"  . DG  A 1 1  ? 7.811   -19.242 -13.236 1.00 0.00 ? 69 DG  A "C3'"  6  
ATOM 9806  O "O3'"  . DG  A 1 1  ? 7.863   -18.857 -14.561 1.00 0.00 ? 69 DG  A "O3'"  6  
ATOM 9807  C "C2'"  . DG  A 1 1  ? 6.614   -18.626 -12.440 1.00 0.00 ? 69 DG  A "C2'"  6  
ATOM 9808  C "C1'"  . DG  A 1 1  ? 5.418   -19.523 -12.763 1.00 0.00 ? 69 DG  A "C1'"  6  
ATOM 9809  N N9     . DG  A 1 1  ? 4.591   -19.836 -11.566 1.00 0.00 ? 69 DG  A N9     6  
ATOM 9810  C C8     . DG  A 1 1  ? 5.006   -20.070 -10.284 1.00 0.00 ? 69 DG  A C8     6  
ATOM 9811  N N7     . DG  A 1 1  ? 4.041   -20.625 -9.573  1.00 0.00 ? 69 DG  A N7     6  
ATOM 9812  C C5     . DG  A 1 1  ? 2.891   -20.744 -10.395 1.00 0.00 ? 69 DG  A C5     6  
ATOM 9813  C C6     . DG  A 1 1  ? 1.590   -21.272 -10.111 1.00 0.00 ? 69 DG  A C6     6  
ATOM 9814  O O6     . DG  A 1 1  ? 1.118   -21.786 -9.145  1.00 0.00 ? 69 DG  A O6     6  
ATOM 9815  N N1     . DG  A 1 1  ? 0.841   -21.105 -11.299 1.00 0.00 ? 69 DG  A N1     6  
ATOM 9816  C C2     . DG  A 1 1  ? 1.199   -20.548 -12.461 1.00 0.00 ? 69 DG  A C2     6  
ATOM 9817  N N2     . DG  A 1 1  ? 0.352   -20.498 -13.459 1.00 0.00 ? 69 DG  A N2     6  
ATOM 9818  N N3     . DG  A 1 1  ? 2.455   -20.085 -12.641 1.00 0.00 ? 69 DG  A N3     6  
ATOM 9819  C C4     . DG  A 1 1  ? 3.263   -20.238 -11.625 1.00 0.00 ? 69 DG  A C4     6  
ATOM 9820  H "H5'"  . DG  A 1 1  ? 7.625   -22.670 -12.442 1.00 0.00 ? 69 DG  A "H5'"  6  
ATOM 9821  H "H5''" . DG  A 1 1  ? 8.979   -21.552 -12.388 1.00 0.00 ? 69 DG  A "H5''" 6  
ATOM 9822  H "H4'"  . DG  A 1 1  ? 7.475   -21.127 -14.323 1.00 0.00 ? 69 DG  A "H4'"  6  
ATOM 9823  H "H3'"  . DG  A 1 1  ? 8.735   -19.123 -12.669 1.00 0.00 ? 69 DG  A "H3'"  6  
ATOM 9824  H "H2'"  . DG  A 1 1  ? 6.904   -18.507 -11.396 1.00 0.00 ? 69 DG  A "H2'"  6  
ATOM 9825  H "H2''" . DG  A 1 1  ? 6.442   -17.607 -12.786 1.00 0.00 ? 69 DG  A "H2''" 6  
ATOM 9826  H "H1'"  . DG  A 1 1  ? 4.847   -18.976 -13.513 1.00 0.00 ? 69 DG  A "H1'"  6  
ATOM 9827  H H8     . DG  A 1 1  ? 6.046   -19.964 -10.011 1.00 0.00 ? 69 DG  A H8     6  
ATOM 9828  H H1     . DG  A 1 1  ? -0.157  -21.181 -11.160 1.00 0.00 ? 69 DG  A H1     6  
ATOM 9829  H H21    . DG  A 1 1  ? 0.673   -20.162 -14.356 1.00 0.00 ? 69 DG  A H21    6  
ATOM 9830  H H22    . DG  A 1 1  ? -0.598  -20.816 -13.336 1.00 0.00 ? 69 DG  A H22    6  
ATOM 9831  H "HO5'" . DG  A 1 1  ? 8.409   -20.820 -10.586 1.00 0.00 ? 69 DG  A "HO5'" 6  
ATOM 9832  P P      . DC  A 1 2  ? 8.179   -17.362 -15.096 1.00 0.00 ? 70 DC  A P      6  
ATOM 9833  O OP1    . DC  A 1 2  ? 8.924   -17.433 -16.362 1.00 0.00 ? 70 DC  A OP1    6  
ATOM 9834  O OP2    . DC  A 1 2  ? 8.573   -16.545 -13.967 1.00 0.00 ? 70 DC  A OP2    6  
ATOM 9835  O "O5'"  . DC  A 1 2  ? 6.684   -16.904 -15.410 1.00 0.00 ? 70 DC  A "O5'"  6  
ATOM 9836  C "C5'"  . DC  A 1 2  ? 5.969   -17.499 -16.463 1.00 0.00 ? 70 DC  A "C5'"  6  
ATOM 9837  C "C4'"  . DC  A 1 2  ? 4.446   -17.164 -16.639 1.00 0.00 ? 70 DC  A "C4'"  6  
ATOM 9838  O "O4'"  . DC  A 1 2  ? 3.758   -17.483 -15.403 1.00 0.00 ? 70 DC  A "O4'"  6  
ATOM 9839  C "C3'"  . DC  A 1 2  ? 4.268   -15.611 -16.849 1.00 0.00 ? 70 DC  A "C3'"  6  
ATOM 9840  O "O3'"  . DC  A 1 2  ? 3.281   -15.560 -17.828 1.00 0.00 ? 70 DC  A "O3'"  6  
ATOM 9841  C "C2'"  . DC  A 1 2  ? 3.500   -15.212 -15.545 1.00 0.00 ? 70 DC  A "C2'"  6  
ATOM 9842  C "C1'"  . DC  A 1 2  ? 2.778   -16.494 -15.043 1.00 0.00 ? 70 DC  A "C1'"  6  
ATOM 9843  N N1     . DC  A 1 2  ? 2.638   -16.546 -13.573 1.00 0.00 ? 70 DC  A N1     6  
ATOM 9844  C C2     . DC  A 1 2  ? 1.358   -16.847 -13.123 1.00 0.00 ? 70 DC  A C2     6  
ATOM 9845  O O2     . DC  A 1 2  ? 0.364   -16.918 -13.859 1.00 0.00 ? 70 DC  A O2     6  
ATOM 9846  N N3     . DC  A 1 2  ? 1.195   -16.975 -11.786 1.00 0.00 ? 70 DC  A N3     6  
ATOM 9847  C C4     . DC  A 1 2  ? 2.307   -16.976 -11.006 1.00 0.00 ? 70 DC  A C4     6  
ATOM 9848  N N4     . DC  A 1 2  ? 2.033   -17.003 -9.754  1.00 0.00 ? 70 DC  A N4     6  
ATOM 9849  C C5     . DC  A 1 2  ? 3.669   -16.789 -11.432 1.00 0.00 ? 70 DC  A C5     6  
ATOM 9850  C C6     . DC  A 1 2  ? 3.789   -16.666 -12.772 1.00 0.00 ? 70 DC  A C6     6  
ATOM 9851  H "H5'"  . DC  A 1 2  ? 6.144   -18.573 -16.400 1.00 0.00 ? 70 DC  A "H5'"  6  
ATOM 9852  H "H5''" . DC  A 1 2  ? 6.448   -17.204 -17.397 1.00 0.00 ? 70 DC  A "H5''" 6  
ATOM 9853  H "H4'"  . DC  A 1 2  ? 4.022   -17.658 -17.512 1.00 0.00 ? 70 DC  A "H4'"  6  
ATOM 9854  H "H3'"  . DC  A 1 2  ? 5.115   -15.049 -17.242 1.00 0.00 ? 70 DC  A "H3'"  6  
ATOM 9855  H "H2'"  . DC  A 1 2  ? 4.224   -14.797 -14.843 1.00 0.00 ? 70 DC  A "H2'"  6  
ATOM 9856  H "H2''" . DC  A 1 2  ? 2.716   -14.482 -15.744 1.00 0.00 ? 70 DC  A "H2''" 6  
ATOM 9857  H "H1'"  . DC  A 1 2  ? 1.894   -16.629 -15.664 1.00 0.00 ? 70 DC  A "H1'"  6  
ATOM 9858  H H41    . DC  A 1 2  ? 2.742   -17.133 -9.047  1.00 0.00 ? 70 DC  A H41    6  
ATOM 9859  H H42    . DC  A 1 2  ? 1.049   -16.883 -9.558  1.00 0.00 ? 70 DC  A H42    6  
ATOM 9860  H H5     . DC  A 1 2  ? 4.511   -16.825 -10.755 1.00 0.00 ? 70 DC  A H5     6  
ATOM 9861  H H6     . DC  A 1 2  ? 4.750   -16.440 -13.213 1.00 0.00 ? 70 DC  A H6     6  
ATOM 9862  P P      . DT  A 1 3  ? 2.911   -14.246 -18.713 1.00 0.00 ? 71 DT  A P      6  
ATOM 9863  O OP1    . DT  A 1 3  ? 2.389   -14.655 -19.963 1.00 0.00 ? 71 DT  A OP1    6  
ATOM 9864  O OP2    . DT  A 1 3  ? 4.096   -13.414 -18.680 1.00 0.00 ? 71 DT  A OP2    6  
ATOM 9865  O "O5'"  . DT  A 1 3  ? 1.654   -13.478 -18.048 1.00 0.00 ? 71 DT  A "O5'"  6  
ATOM 9866  C "C5'"  . DT  A 1 3  ? 0.343   -14.049 -18.021 1.00 0.00 ? 71 DT  A "C5'"  6  
ATOM 9867  C "C4'"  . DT  A 1 3  ? -0.501  -13.640 -16.802 1.00 0.00 ? 71 DT  A "C4'"  6  
ATOM 9868  O "O4'"  . DT  A 1 3  ? 0.062   -14.171 -15.580 1.00 0.00 ? 71 DT  A "O4'"  6  
ATOM 9869  C "C3'"  . DT  A 1 3  ? -0.625  -12.092 -16.600 1.00 0.00 ? 71 DT  A "C3'"  6  
ATOM 9870  O "O3'"  . DT  A 1 3  ? -1.811  -11.581 -17.258 1.00 0.00 ? 71 DT  A "O3'"  6  
ATOM 9871  C "C2'"  . DT  A 1 3  ? -0.694  -12.096 -15.057 1.00 0.00 ? 71 DT  A "C2'"  6  
ATOM 9872  C "C1'"  . DT  A 1 3  ? -0.597  -13.457 -14.569 1.00 0.00 ? 71 DT  A "C1'"  6  
ATOM 9873  N N1     . DT  A 1 3  ? 0.138   -13.503 -13.267 1.00 0.00 ? 71 DT  A N1     6  
ATOM 9874  C C2     . DT  A 1 3  ? -0.551  -13.689 -12.100 1.00 0.00 ? 71 DT  A C2     6  
ATOM 9875  O O2     . DT  A 1 3  ? -1.746  -13.754 -12.063 1.00 0.00 ? 71 DT  A O2     6  
ATOM 9876  N N3     . DT  A 1 3  ? 0.232   -13.946 -10.980 1.00 0.00 ? 71 DT  A N3     6  
ATOM 9877  C C4     . DT  A 1 3  ? 1.585   -13.713 -10.841 1.00 0.00 ? 71 DT  A C4     6  
ATOM 9878  O O4     . DT  A 1 3  ? 2.133   -13.903 -9.718  1.00 0.00 ? 71 DT  A O4     6  
ATOM 9879  C C5     . DT  A 1 3  ? 2.207   -13.407 -12.128 1.00 0.00 ? 71 DT  A C5     6  
ATOM 9880  C C7     . DT  A 1 3  ? 3.729   -13.178 -12.216 1.00 0.00 ? 71 DT  A C7     6  
ATOM 9881  C C6     . DT  A 1 3  ? 1.542   -13.366 -13.278 1.00 0.00 ? 71 DT  A C6     6  
ATOM 9882  H "H5'"  . DT  A 1 3  ? 0.398   -15.133 -18.108 1.00 0.00 ? 71 DT  A "H5'"  6  
ATOM 9883  H "H5''" . DT  A 1 3  ? -0.269  -13.715 -18.859 1.00 0.00 ? 71 DT  A "H5''" 6  
ATOM 9884  H "H4'"  . DT  A 1 3  ? -1.501  -14.066 -16.891 1.00 0.00 ? 71 DT  A "H4'"  6  
ATOM 9885  H "H3'"  . DT  A 1 3  ? 0.254   -11.580 -16.993 1.00 0.00 ? 71 DT  A "H3'"  6  
ATOM 9886  H "H2'"  . DT  A 1 3  ? 0.086   -11.423 -14.700 1.00 0.00 ? 71 DT  A "H2'"  6  
ATOM 9887  H "H2''" . DT  A 1 3  ? -1.672  -11.812 -14.665 1.00 0.00 ? 71 DT  A "H2''" 6  
ATOM 9888  H "H1'"  . DT  A 1 3  ? -1.616  -13.773 -14.344 1.00 0.00 ? 71 DT  A "H1'"  6  
ATOM 9889  H H3     . DT  A 1 3  ? -0.227  -14.314 -10.161 1.00 0.00 ? 71 DT  A H3     6  
ATOM 9890  H H71    . DT  A 1 3  ? 3.940   -12.141 -11.954 1.00 0.00 ? 71 DT  A H71    6  
ATOM 9891  H H72    . DT  A 1 3  ? 4.307   -13.852 -11.583 1.00 0.00 ? 71 DT  A H72    6  
ATOM 9892  H H73    . DT  A 1 3  ? 4.149   -13.363 -13.205 1.00 0.00 ? 71 DT  A H73    6  
ATOM 9893  H H6     . DT  A 1 3  ? 2.007   -13.206 -14.238 1.00 0.00 ? 71 DT  A H6     6  
ATOM 9894  P P      . DC  A 1 4  ? -2.087  -10.013 -17.130 1.00 0.00 ? 72 DC  A P      6  
ATOM 9895  O OP1    . DC  A 1 4  ? -3.079  -9.738  -18.154 1.00 0.00 ? 72 DC  A OP1    6  
ATOM 9896  O OP2    . DC  A 1 4  ? -0.772  -9.271  -17.172 1.00 0.00 ? 72 DC  A OP2    6  
ATOM 9897  O "O5'"  . DC  A 1 4  ? -2.692  -9.809  -15.723 1.00 0.00 ? 72 DC  A "O5'"  6  
ATOM 9898  C "C5'"  . DC  A 1 4  ? -3.986  -10.137 -15.585 1.00 0.00 ? 72 DC  A "C5'"  6  
ATOM 9899  C "C4'"  . DC  A 1 4  ? -4.552  -9.750  -14.220 1.00 0.00 ? 72 DC  A "C4'"  6  
ATOM 9900  O "O4'"  . DC  A 1 4  ? -3.958  -10.438 -13.168 1.00 0.00 ? 72 DC  A "O4'"  6  
ATOM 9901  C "C3'"  . DC  A 1 4  ? -4.695  -8.301  -13.910 1.00 0.00 ? 72 DC  A "C3'"  6  
ATOM 9902  O "O3'"  . DC  A 1 4  ? -5.869  -8.019  -13.202 1.00 0.00 ? 72 DC  A "O3'"  6  
ATOM 9903  C "C2'"  . DC  A 1 4  ? -3.489  -8.052  -13.040 1.00 0.00 ? 72 DC  A "C2'"  6  
ATOM 9904  C "C1'"  . DC  A 1 4  ? -3.374  -9.481  -12.332 1.00 0.00 ? 72 DC  A "C1'"  6  
ATOM 9905  N N1     . DC  A 1 4  ? -1.962  -9.765  -11.962 1.00 0.00 ? 72 DC  A N1     6  
ATOM 9906  C C2     . DC  A 1 4  ? -1.710  -10.217 -10.666 1.00 0.00 ? 72 DC  A C2     6  
ATOM 9907  O O2     . DC  A 1 4  ? -2.615  -10.479 -9.812  1.00 0.00 ? 72 DC  A O2     6  
ATOM 9908  N N3     . DC  A 1 4  ? -0.462  -10.518 -10.274 1.00 0.00 ? 72 DC  A N3     6  
ATOM 9909  C C4     . DC  A 1 4  ? 0.547   -10.313 -11.094 1.00 0.00 ? 72 DC  A C4     6  
ATOM 9910  N N4     . DC  A 1 4  ? 1.743   -10.407 -10.633 1.00 0.00 ? 72 DC  A N4     6  
ATOM 9911  C C5     . DC  A 1 4  ? 0.383   -9.806  -12.435 1.00 0.00 ? 72 DC  A C5     6  
ATOM 9912  C C6     . DC  A 1 4  ? -0.878  -9.532  -12.811 1.00 0.00 ? 72 DC  A C6     6  
ATOM 9913  H "H5'"  . DC  A 1 4  ? -4.134  -11.207 -15.739 1.00 0.00 ? 72 DC  A "H5'"  6  
ATOM 9914  H "H5''" . DC  A 1 4  ? -4.650  -9.684  -16.321 1.00 0.00 ? 72 DC  A "H5''" 6  
ATOM 9915  H "H4'"  . DC  A 1 4  ? -5.554  -10.179 -14.214 1.00 0.00 ? 72 DC  A "H4'"  6  
ATOM 9916  H "H3'"  . DC  A 1 4  ? -4.545  -7.783  -14.858 1.00 0.00 ? 72 DC  A "H3'"  6  
ATOM 9917  H "H2'"  . DC  A 1 4  ? -2.628  -7.762  -13.644 1.00 0.00 ? 72 DC  A "H2'"  6  
ATOM 9918  H "H2''" . DC  A 1 4  ? -3.768  -7.276  -12.327 1.00 0.00 ? 72 DC  A "H2''" 6  
ATOM 9919  H "H1'"  . DC  A 1 4  ? -3.964  -9.312  -11.431 1.00 0.00 ? 72 DC  A "H1'"  6  
ATOM 9920  H H41    . DC  A 1 4  ? 2.512   -10.068 -11.192 1.00 0.00 ? 72 DC  A H41    6  
ATOM 9921  H H42    . DC  A 1 4  ? 1.823   -10.596 -9.643  1.00 0.00 ? 72 DC  A H42    6  
ATOM 9922  H H5     . DC  A 1 4  ? 1.221   -9.764  -13.116 1.00 0.00 ? 72 DC  A H5     6  
ATOM 9923  H H6     . DC  A 1 4  ? -1.008  -9.309  -13.860 1.00 0.00 ? 72 DC  A H6     6  
ATOM 9924  P P      . DT  A 1 5  ? -6.430  -6.476  -13.209 1.00 0.00 ? 73 DT  A P      6  
ATOM 9925  O OP1    . DT  A 1 5  ? -7.898  -6.407  -12.968 1.00 0.00 ? 73 DT  A OP1    6  
ATOM 9926  O OP2    . DT  A 1 5  ? -5.959  -5.601  -14.294 1.00 0.00 ? 73 DT  A OP2    6  
ATOM 9927  O "O5'"  . DT  A 1 5  ? -5.698  -5.914  -11.906 1.00 0.00 ? 73 DT  A "O5'"  6  
ATOM 9928  C "C5'"  . DT  A 1 5  ? -5.823  -6.571  -10.648 1.00 0.00 ? 73 DT  A "C5'"  6  
ATOM 9929  C "C4'"  . DT  A 1 5  ? -4.906  -5.960  -9.603  1.00 0.00 ? 73 DT  A "C4'"  6  
ATOM 9930  O "O4'"  . DT  A 1 5  ? -3.581  -6.501  -9.713  1.00 0.00 ? 73 DT  A "O4'"  6  
ATOM 9931  C "C3'"  . DT  A 1 5  ? -4.763  -4.453  -9.768  1.00 0.00 ? 73 DT  A "C3'"  6  
ATOM 9932  O "O3'"  . DT  A 1 5  ? -4.528  -3.770  -8.476  1.00 0.00 ? 73 DT  A "O3'"  6  
ATOM 9933  C "C2'"  . DT  A 1 5  ? -3.427  -4.357  -10.565 1.00 0.00 ? 73 DT  A "C2'"  6  
ATOM 9934  C "C1'"  . DT  A 1 5  ? -2.668  -5.482  -9.845  1.00 0.00 ? 73 DT  A "C1'"  6  
ATOM 9935  N N1     . DT  A 1 5  ? -1.372  -5.980  -10.337 1.00 0.00 ? 73 DT  A N1     6  
ATOM 9936  C C2     . DT  A 1 5  ? -0.512  -6.601  -9.443  1.00 0.00 ? 73 DT  A C2     6  
ATOM 9937  O O2     . DT  A 1 5  ? -0.851  -6.826  -8.301  1.00 0.00 ? 73 DT  A O2     6  
ATOM 9938  N N3     . DT  A 1 5  ? 0.695   -7.114  -9.892  1.00 0.00 ? 73 DT  A N3     6  
ATOM 9939  C C4     . DT  A 1 5  ? 1.154   -6.910  -11.162 1.00 0.00 ? 73 DT  A C4     6  
ATOM 9940  O O4     . DT  A 1 5  ? 2.332   -7.295  -11.386 1.00 0.00 ? 73 DT  A O4     6  
ATOM 9941  C C5     . DT  A 1 5  ? 0.220   -6.238  -12.097 1.00 0.00 ? 73 DT  A C5     6  
ATOM 9942  C C7     . DT  A 1 5  ? 0.514   -5.881  -13.564 1.00 0.00 ? 73 DT  A C7     6  
ATOM 9943  C C6     . DT  A 1 5  ? -0.970  -5.821  -11.662 1.00 0.00 ? 73 DT  A C6     6  
ATOM 9944  H "H5'"  . DT  A 1 5  ? -5.567  -7.625  -10.756 1.00 0.00 ? 73 DT  A "H5'"  6  
ATOM 9945  H "H5''" . DT  A 1 5  ? -6.783  -6.362  -10.175 1.00 0.00 ? 73 DT  A "H5''" 6  
ATOM 9946  H "H4'"  . DT  A 1 5  ? -5.275  -6.184  -8.602  1.00 0.00 ? 73 DT  A "H4'"  6  
ATOM 9947  H "H3'"  . DT  A 1 5  ? -5.610  -4.024  -10.304 1.00 0.00 ? 73 DT  A "H3'"  6  
ATOM 9948  H "H2'"  . DT  A 1 5  ? -3.655  -4.532  -11.617 1.00 0.00 ? 73 DT  A "H2'"  6  
ATOM 9949  H "H2''" . DT  A 1 5  ? -2.899  -3.408  -10.479 1.00 0.00 ? 73 DT  A "H2''" 6  
ATOM 9950  H "H1'"  . DT  A 1 5  ? -2.545  -5.186  -8.803  1.00 0.00 ? 73 DT  A "H1'"  6  
ATOM 9951  H H3     . DT  A 1 5  ? 1.391   -7.365  -9.205  1.00 0.00 ? 73 DT  A H3     6  
ATOM 9952  H H71    . DT  A 1 5  ? -0.408  -5.482  -13.984 1.00 0.00 ? 73 DT  A H71    6  
ATOM 9953  H H72    . DT  A 1 5  ? 1.347   -5.186  -13.670 1.00 0.00 ? 73 DT  A H72    6  
ATOM 9954  H H73    . DT  A 1 5  ? 0.721   -6.798  -14.117 1.00 0.00 ? 73 DT  A H73    6  
ATOM 9955  H H6     . DT  A 1 5  ? -1.604  -5.254  -12.328 1.00 0.00 ? 73 DT  A H6     6  
ATOM 9956  P P      . DA  A 1 6  ? -5.741  -3.471  -7.568  1.00 0.00 ? 74 DA  A P      6  
ATOM 9957  O OP1    . DA  A 1 6  ? -6.906  -4.222  -8.044  1.00 0.00 ? 74 DA  A OP1    6  
ATOM 9958  O OP2    . DA  A 1 6  ? -5.754  -2.019  -7.526  1.00 0.00 ? 74 DA  A OP2    6  
ATOM 9959  O "O5'"  . DA  A 1 6  ? -5.276  -3.997  -6.171  1.00 0.00 ? 74 DA  A "O5'"  6  
ATOM 9960  C "C5'"  . DA  A 1 6  ? -5.332  -5.367  -5.761  1.00 0.00 ? 74 DA  A "C5'"  6  
ATOM 9961  C "C4'"  . DA  A 1 6  ? -4.581  -5.821  -4.502  1.00 0.00 ? 74 DA  A "C4'"  6  
ATOM 9962  O "O4'"  . DA  A 1 6  ? -3.145  -6.087  -4.797  1.00 0.00 ? 74 DA  A "O4'"  6  
ATOM 9963  C "C3'"  . DA  A 1 6  ? -4.647  -4.914  -3.262  1.00 0.00 ? 74 DA  A "C3'"  6  
ATOM 9964  O "O3'"  . DA  A 1 6  ? -4.351  -5.860  -2.239  1.00 0.00 ? 74 DA  A "O3'"  6  
ATOM 9965  C "C2'"  . DA  A 1 6  ? -3.474  -3.919  -3.621  1.00 0.00 ? 74 DA  A "C2'"  6  
ATOM 9966  C "C1'"  . DA  A 1 6  ? -2.429  -4.913  -4.184  1.00 0.00 ? 74 DA  A "C1'"  6  
ATOM 9967  N N9     . DA  A 1 6  ? -1.652  -4.437  -5.311  1.00 0.00 ? 74 DA  A N9     6  
ATOM 9968  C C8     . DA  A 1 6  ? -1.982  -3.618  -6.400  1.00 0.00 ? 74 DA  A C8     6  
ATOM 9969  N N7     . DA  A 1 6  ? -1.013  -3.513  -7.304  1.00 0.00 ? 74 DA  A N7     6  
ATOM 9970  C C5     . DA  A 1 6  ? 0.025   -4.218  -6.777  1.00 0.00 ? 74 DA  A C5     6  
ATOM 9971  C C6     . DA  A 1 6  ? 1.316   -4.599  -7.192  1.00 0.00 ? 74 DA  A C6     6  
ATOM 9972  N N6     . DA  A 1 6  ? 2.013   -4.116  -8.243  1.00 0.00 ? 74 DA  A N6     6  
ATOM 9973  N N1     . DA  A 1 6  ? 2.111   -5.292  -6.409  1.00 0.00 ? 74 DA  A N1     6  
ATOM 9974  C C2     . DA  A 1 6  ? 1.662   -5.750  -5.241  1.00 0.00 ? 74 DA  A C2     6  
ATOM 9975  N N3     . DA  A 1 6  ? 0.422   -5.589  -4.749  1.00 0.00 ? 74 DA  A N3     6  
ATOM 9976  C C4     . DA  A 1 6  ? -0.372  -4.866  -5.608  1.00 0.00 ? 74 DA  A C4     6  
ATOM 9977  H "H5'"  . DA  A 1 6  ? -4.867  -6.002  -6.515  1.00 0.00 ? 74 DA  A "H5'"  6  
ATOM 9978  H "H5''" . DA  A 1 6  ? -6.372  -5.685  -5.677  1.00 0.00 ? 74 DA  A "H5''" 6  
ATOM 9979  H "H4'"  . DA  A 1 6  ? -5.046  -6.776  -4.262  1.00 0.00 ? 74 DA  A "H4'"  6  
ATOM 9980  H "H3'"  . DA  A 1 6  ? -5.588  -4.375  -3.154  1.00 0.00 ? 74 DA  A "H3'"  6  
ATOM 9981  H "H2'"  . DA  A 1 6  ? -3.741  -3.231  -4.423  1.00 0.00 ? 74 DA  A "H2'"  6  
ATOM 9982  H "H2''" . DA  A 1 6  ? -3.073  -3.341  -2.789  1.00 0.00 ? 74 DA  A "H2''" 6  
ATOM 9983  H "H1'"  . DA  A 1 6  ? -1.738  -5.256  -3.413  1.00 0.00 ? 74 DA  A "H1'"  6  
ATOM 9984  H H8     . DA  A 1 6  ? -2.923  -3.098  -6.505  1.00 0.00 ? 74 DA  A H8     6  
ATOM 9985  H H61    . DA  A 1 6  ? 2.973   -4.412  -8.347  1.00 0.00 ? 74 DA  A H61    6  
ATOM 9986  H H62    . DA  A 1 6  ? 1.656   -3.370  -8.822  1.00 0.00 ? 74 DA  A H62    6  
ATOM 9987  H H2     . DA  A 1 6  ? 2.414   -6.296  -4.688  1.00 0.00 ? 74 DA  A H2     6  
ATOM 9988  P P      . DA  A 1 7  ? -3.925  -5.388  -0.765  1.00 0.00 ? 75 DA  A P      6  
ATOM 9989  O OP1    . DA  A 1 7  ? -3.945  -6.558  0.150   1.00 0.00 ? 75 DA  A OP1    6  
ATOM 9990  O OP2    . DA  A 1 7  ? -4.716  -4.268  -0.293  1.00 0.00 ? 75 DA  A OP2    6  
ATOM 9991  O "O5'"  . DA  A 1 7  ? -2.323  -4.924  -0.860  1.00 0.00 ? 75 DA  A "O5'"  6  
ATOM 9992  C "C5'"  . DA  A 1 7  ? -1.352  -5.741  -0.378  1.00 0.00 ? 75 DA  A "C5'"  6  
ATOM 9993  C "C4'"  . DA  A 1 7  ? 0.037   -5.086  -0.380  1.00 0.00 ? 75 DA  A "C4'"  6  
ATOM 9994  O "O4'"  . DA  A 1 7  ? 0.616   -4.682  -1.617  1.00 0.00 ? 75 DA  A "O4'"  6  
ATOM 9995  C "C3'"  . DA  A 1 7  ? 0.213   -3.955  0.620   1.00 0.00 ? 75 DA  A "C3'"  6  
ATOM 9996  O "O3'"  . DA  A 1 7  ? 1.045   -4.463  1.634   1.00 0.00 ? 75 DA  A "O3'"  6  
ATOM 9997  C "C2'"  . DA  A 1 7  ? 0.816   -2.848  -0.202  1.00 0.00 ? 75 DA  A "C2'"  6  
ATOM 9998  C "C1'"  . DA  A 1 7  ? 1.343   -3.567  -1.460  1.00 0.00 ? 75 DA  A "C1'"  6  
ATOM 9999  N N9     . DA  A 1 7  ? 1.220   -2.821  -2.738  1.00 0.00 ? 75 DA  A N9     6  
ATOM 10000 C C8     . DA  A 1 7  ? 0.208   -2.189  -3.307  1.00 0.00 ? 75 DA  A C8     6  
ATOM 10001 N N7     . DA  A 1 7  ? 0.482   -1.674  -4.481  1.00 0.00 ? 75 DA  A N7     6  
ATOM 10002 C C5     . DA  A 1 7  ? 1.792   -1.990  -4.698  1.00 0.00 ? 75 DA  A C5     6  
ATOM 10003 C C6     . DA  A 1 7  ? 2.617   -1.898  -5.848  1.00 0.00 ? 75 DA  A C6     6  
ATOM 10004 N N6     . DA  A 1 7  ? 2.326   -1.335  -6.968  1.00 0.00 ? 75 DA  A N6     6  
ATOM 10005 N N1     . DA  A 1 7  ? 3.839   -2.486  -5.877  1.00 0.00 ? 75 DA  A N1     6  
ATOM 10006 C C2     . DA  A 1 7  ? 4.216   -3.116  -4.688  1.00 0.00 ? 75 DA  A C2     6  
ATOM 10007 N N3     . DA  A 1 7  ? 3.456   -3.301  -3.617  1.00 0.00 ? 75 DA  A N3     6  
ATOM 10008 C C4     . DA  A 1 7  ? 2.192   -2.762  -3.704  1.00 0.00 ? 75 DA  A C4     6  
ATOM 10009 H "H5'"  . DA  A 1 7  ? -1.236  -6.644  -0.976  1.00 0.00 ? 75 DA  A "H5'"  6  
ATOM 10010 H "H5''" . DA  A 1 7  ? -1.606  -5.914  0.668   1.00 0.00 ? 75 DA  A "H5''" 6  
ATOM 10011 H "H4'"  . DA  A 1 7  ? 0.643   -5.949  -0.105  1.00 0.00 ? 75 DA  A "H4'"  6  
ATOM 10012 H "H3'"  . DA  A 1 7  ? -0.696  -3.593  1.100   1.00 0.00 ? 75 DA  A "H3'"  6  
ATOM 10013 H "H2'"  . DA  A 1 7  ? 0.040   -2.135  -0.481  1.00 0.00 ? 75 DA  A "H2'"  6  
ATOM 10014 H "H2''" . DA  A 1 7  ? 1.663   -2.342  0.260   1.00 0.00 ? 75 DA  A "H2''" 6  
ATOM 10015 H "H1'"  . DA  A 1 7  ? 2.386   -3.767  -1.210  1.00 0.00 ? 75 DA  A "H1'"  6  
ATOM 10016 H H8     . DA  A 1 7  ? -0.764  -2.035  -2.862  1.00 0.00 ? 75 DA  A H8     6  
ATOM 10017 H H61    . DA  A 1 7  ? 3.024   -1.357  -7.697  1.00 0.00 ? 75 DA  A H61    6  
ATOM 10018 H H62    . DA  A 1 7  ? 1.417   -0.909  -7.085  1.00 0.00 ? 75 DA  A H62    6  
ATOM 10019 H H2     . DA  A 1 7  ? 5.115   -3.696  -4.835  1.00 0.00 ? 75 DA  A H2     6  
ATOM 10020 P P      . DT  A 1 8  ? 1.700   -3.585  2.766   1.00 0.00 ? 76 DT  A P      6  
ATOM 10021 O OP1    . DT  A 1 8  ? 1.997   -4.641  3.745   1.00 0.00 ? 76 DT  A OP1    6  
ATOM 10022 O OP2    . DT  A 1 8  ? 0.889   -2.413  3.125   1.00 0.00 ? 76 DT  A OP2    6  
ATOM 10023 O "O5'"  . DT  A 1 8  ? 3.071   -3.052  2.256   1.00 0.00 ? 76 DT  A "O5'"  6  
ATOM 10024 C "C5'"  . DT  A 1 8  ? 4.186   -3.873  2.024   1.00 0.00 ? 76 DT  A "C5'"  6  
ATOM 10025 C "C4'"  . DT  A 1 8  ? 5.232   -3.151  1.231   1.00 0.00 ? 76 DT  A "C4'"  6  
ATOM 10026 O "O4'"  . DT  A 1 8  ? 4.708   -2.720  -0.051  1.00 0.00 ? 76 DT  A "O4'"  6  
ATOM 10027 C "C3'"  . DT  A 1 8  ? 5.708   -1.839  1.885   1.00 0.00 ? 76 DT  A "C3'"  6  
ATOM 10028 O "O3'"  . DT  A 1 8  ? 6.935   -2.056  2.526   1.00 0.00 ? 76 DT  A "O3'"  6  
ATOM 10029 C "C2'"  . DT  A 1 8  ? 5.867   -0.807  0.771   1.00 0.00 ? 76 DT  A "C2'"  6  
ATOM 10030 C "C1'"  . DT  A 1 8  ? 5.471   -1.564  -0.538  1.00 0.00 ? 76 DT  A "C1'"  6  
ATOM 10031 N N1     . DT  A 1 8  ? 4.678   -0.681  -1.384  1.00 0.00 ? 76 DT  A N1     6  
ATOM 10032 C C2     . DT  A 1 8  ? 5.143   -0.328  -2.637  1.00 0.00 ? 76 DT  A C2     6  
ATOM 10033 O O2     . DT  A 1 8  ? 6.290   -0.625  -3.002  1.00 0.00 ? 76 DT  A O2     6  
ATOM 10034 N N3     . DT  A 1 8  ? 4.317   0.321   -3.478  1.00 0.00 ? 76 DT  A N3     6  
ATOM 10035 C C4     . DT  A 1 8  ? 3.075   0.812   -3.125  1.00 0.00 ? 76 DT  A C4     6  
ATOM 10036 O O4     . DT  A 1 8  ? 2.315   1.452   -3.935  1.00 0.00 ? 76 DT  A O4     6  
ATOM 10037 C C5     . DT  A 1 8  ? 2.630   0.457   -1.802  1.00 0.00 ? 76 DT  A C5     6  
ATOM 10038 C C7     . DT  A 1 8  ? 1.301   1.002   -1.340  1.00 0.00 ? 76 DT  A C7     6  
ATOM 10039 C C6     . DT  A 1 8  ? 3.419   -0.249  -0.909  1.00 0.00 ? 76 DT  A C6     6  
ATOM 10040 H "H5'"  . DT  A 1 8  ? 3.930   -4.735  1.406   1.00 0.00 ? 76 DT  A "H5'"  6  
ATOM 10041 H "H5''" . DT  A 1 8  ? 4.610   -4.256  2.952   1.00 0.00 ? 76 DT  A "H5''" 6  
ATOM 10042 H "H4'"  . DT  A 1 8  ? 6.092   -3.806  1.097   1.00 0.00 ? 76 DT  A "H4'"  6  
ATOM 10043 H "H3'"  . DT  A 1 8  ? 4.989   -1.556  2.652   1.00 0.00 ? 76 DT  A "H3'"  6  
ATOM 10044 H "H2'"  . DT  A 1 8  ? 5.306   0.089   1.035   1.00 0.00 ? 76 DT  A "H2'"  6  
ATOM 10045 H "H2''" . DT  A 1 8  ? 6.893   -0.499  0.565   1.00 0.00 ? 76 DT  A "H2''" 6  
ATOM 10046 H "H1'"  . DT  A 1 8  ? 6.427   -1.852  -0.975  1.00 0.00 ? 76 DT  A "H1'"  6  
ATOM 10047 H H3     . DT  A 1 8  ? 4.716   0.663   -4.341  1.00 0.00 ? 76 DT  A H3     6  
ATOM 10048 H H71    . DT  A 1 8  ? 0.924   0.381   -0.527  1.00 0.00 ? 76 DT  A H71    6  
ATOM 10049 H H72    . DT  A 1 8  ? 1.519   2.015   -1.002  1.00 0.00 ? 76 DT  A H72    6  
ATOM 10050 H H73    . DT  A 1 8  ? 0.606   0.972   -2.179  1.00 0.00 ? 76 DT  A H73    6  
ATOM 10051 H H6     . DT  A 1 8  ? 3.225   -0.378  0.145   1.00 0.00 ? 76 DT  A H6     6  
ATOM 10052 P P      . DC  A 1 9  ? 7.545   -1.040  3.570   1.00 0.00 ? 77 DC  A P      6  
ATOM 10053 O OP1    . DC  A 1 9  ? 8.325   -1.816  4.552   1.00 0.00 ? 77 DC  A OP1    6  
ATOM 10054 O OP2    . DC  A 1 9  ? 6.543   -0.174  4.155   1.00 0.00 ? 77 DC  A OP2    6  
ATOM 10055 O "O5'"  . DC  A 1 9  ? 8.547   -0.197  2.591   1.00 0.00 ? 77 DC  A "O5'"  6  
ATOM 10056 C "C5'"  . DC  A 1 9  ? 9.591   -0.842  1.866   1.00 0.00 ? 77 DC  A "C5'"  6  
ATOM 10057 C "C4'"  . DC  A 1 9  ? 10.551  0.061   1.061   1.00 0.00 ? 77 DC  A "C4'"  6  
ATOM 10058 O "O4'"  . DC  A 1 9  ? 9.788   0.560   -0.041  1.00 0.00 ? 77 DC  A "O4'"  6  
ATOM 10059 C "C3'"  . DC  A 1 9  ? 10.961  1.327   1.870   1.00 0.00 ? 77 DC  A "C3'"  6  
ATOM 10060 O "O3'"  . DC  A 1 9  ? 12.330  1.590   1.550   1.00 0.00 ? 77 DC  A "O3'"  6  
ATOM 10061 C "C2'"  . DC  A 1 9  ? 9.942   2.353   1.374   1.00 0.00 ? 77 DC  A "C2'"  6  
ATOM 10062 C "C1'"  . DC  A 1 9  ? 9.674   1.962   -0.116  1.00 0.00 ? 77 DC  A "C1'"  6  
ATOM 10063 N N1     . DC  A 1 9  ? 8.407   2.419   -0.754  1.00 0.00 ? 77 DC  A N1     6  
ATOM 10064 C C2     . DC  A 1 9  ? 8.295   2.645   -2.119  1.00 0.00 ? 77 DC  A C2     6  
ATOM 10065 O O2     . DC  A 1 9  ? 9.234   2.517   -2.882  1.00 0.00 ? 77 DC  A O2     6  
ATOM 10066 N N3     . DC  A 1 9  ? 7.165   3.131   -2.672  1.00 0.00 ? 77 DC  A N3     6  
ATOM 10067 C C4     . DC  A 1 9  ? 6.123   3.165   -1.883  1.00 0.00 ? 77 DC  A C4     6  
ATOM 10068 N N4     . DC  A 1 9  ? 5.083   3.581   -2.469  1.00 0.00 ? 77 DC  A N4     6  
ATOM 10069 C C5     . DC  A 1 9  ? 6.099   2.772   -0.505  1.00 0.00 ? 77 DC  A C5     6  
ATOM 10070 C C6     . DC  A 1 9  ? 7.301   2.439   -0.002  1.00 0.00 ? 77 DC  A C6     6  
ATOM 10071 H "H5'"  . DC  A 1 9  ? 9.029   -1.462  1.169   1.00 0.00 ? 77 DC  A "H5'"  6  
ATOM 10072 H "H5''" . DC  A 1 9  ? 10.157  -1.441  2.581   1.00 0.00 ? 77 DC  A "H5''" 6  
ATOM 10073 H "H4'"  . DC  A 1 9  ? 11.396  -0.492  0.649   1.00 0.00 ? 77 DC  A "H4'"  6  
ATOM 10074 H "H3'"  . DC  A 1 9  ? 10.801  1.130   2.930   1.00 0.00 ? 77 DC  A "H3'"  6  
ATOM 10075 H "H2'"  . DC  A 1 9  ? 9.076   2.150   2.004   1.00 0.00 ? 77 DC  A "H2'"  6  
ATOM 10076 H "H2''" . DC  A 1 9  ? 10.220  3.402   1.481   1.00 0.00 ? 77 DC  A "H2''" 6  
ATOM 10077 H "H1'"  . DC  A 1 9  ? 10.536  2.311   -0.685  1.00 0.00 ? 77 DC  A "H1'"  6  
ATOM 10078 H H41    . DC  A 1 9  ? 4.192   3.770   -2.033  1.00 0.00 ? 77 DC  A H41    6  
ATOM 10079 H H42    . DC  A 1 9  ? 5.129   3.777   -3.459  1.00 0.00 ? 77 DC  A H42    6  
ATOM 10080 H H5     . DC  A 1 9  ? 5.220   2.879   0.115   1.00 0.00 ? 77 DC  A H5     6  
ATOM 10081 H H6     . DC  A 1 9  ? 7.384   2.155   1.037   1.00 0.00 ? 77 DC  A H6     6  
ATOM 10082 P P      . DC  A 1 10 ? 13.137  2.839   2.111   1.00 0.00 ? 78 DC  A P      6  
ATOM 10083 O OP1    . DC  A 1 10 ? 14.571  2.501   2.275   1.00 0.00 ? 78 DC  A OP1    6  
ATOM 10084 O OP2    . DC  A 1 10 ? 12.355  3.473   3.211   1.00 0.00 ? 78 DC  A OP2    6  
ATOM 10085 O "O5'"  . DC  A 1 10 ? 13.061  3.859   0.950   1.00 0.00 ? 78 DC  A "O5'"  6  
ATOM 10086 C "C5'"  . DC  A 1 10 ? 13.737  3.672   -0.306  1.00 0.00 ? 78 DC  A "C5'"  6  
ATOM 10087 C "C4'"  . DC  A 1 10 ? 13.752  4.829   -1.361  1.00 0.00 ? 78 DC  A "C4'"  6  
ATOM 10088 O "O4'"  . DC  A 1 10 ? 12.447  5.085   -1.858  1.00 0.00 ? 78 DC  A "O4'"  6  
ATOM 10089 C "C3'"  . DC  A 1 10 ? 14.308  6.069   -0.810  1.00 0.00 ? 78 DC  A "C3'"  6  
ATOM 10090 O "O3'"  . DC  A 1 10 ? 15.423  6.462   -1.667  1.00 0.00 ? 78 DC  A "O3'"  6  
ATOM 10091 C "C2'"  . DC  A 1 10 ? 13.121  7.044   -0.716  1.00 0.00 ? 78 DC  A "C2'"  6  
ATOM 10092 C "C1'"  . DC  A 1 10 ? 12.046  6.370   -1.627  1.00 0.00 ? 78 DC  A "C1'"  6  
ATOM 10093 N N1     . DC  A 1 10 ? 10.632  6.247   -1.134  1.00 0.00 ? 78 DC  A N1     6  
ATOM 10094 C C2     . DC  A 1 10 ? 9.552   6.408   -1.871  1.00 0.00 ? 78 DC  A C2     6  
ATOM 10095 O O2     . DC  A 1 10 ? 9.718   6.865   -2.985  1.00 0.00 ? 78 DC  A O2     6  
ATOM 10096 N N3     . DC  A 1 10 ? 8.248   6.209   -1.466  1.00 0.00 ? 78 DC  A N3     6  
ATOM 10097 C C4     . DC  A 1 10 ? 8.171   5.864   -0.188  1.00 0.00 ? 78 DC  A C4     6  
ATOM 10098 N N4     . DC  A 1 10 ? 6.885   5.711   0.121   1.00 0.00 ? 78 DC  A N4     6  
ATOM 10099 C C5     . DC  A 1 10 ? 9.229   5.716   0.723   1.00 0.00 ? 78 DC  A C5     6  
ATOM 10100 C C6     . DC  A 1 10 ? 10.428  5.928   0.207   1.00 0.00 ? 78 DC  A C6     6  
ATOM 10101 H "H5'"  . DC  A 1 10 ? 13.309  2.809   -0.819  1.00 0.00 ? 78 DC  A "H5'"  6  
ATOM 10102 H "H5''" . DC  A 1 10 ? 14.728  3.281   -0.075  1.00 0.00 ? 78 DC  A "H5''" 6  
ATOM 10103 H "H4'"  . DC  A 1 10 ? 14.416  4.623   -2.201  1.00 0.00 ? 78 DC  A "H4'"  6  
ATOM 10104 H "H3'"  . DC  A 1 10 ? 14.623  5.857   0.212   1.00 0.00 ? 78 DC  A "H3'"  6  
ATOM 10105 H "H2'"  . DC  A 1 10 ? 12.823  7.229   0.315   1.00 0.00 ? 78 DC  A "H2'"  6  
ATOM 10106 H "H2''" . DC  A 1 10 ? 13.320  8.050   -1.088  1.00 0.00 ? 78 DC  A "H2''" 6  
ATOM 10107 H "H1'"  . DC  A 1 10 ? 11.951  6.857   -2.597  1.00 0.00 ? 78 DC  A "H1'"  6  
ATOM 10108 H H41    . DC  A 1 10 ? 6.742   5.374   1.062   1.00 0.00 ? 78 DC  A H41    6  
ATOM 10109 H H42    . DC  A 1 10 ? 6.255   5.865   -0.653  1.00 0.00 ? 78 DC  A H42    6  
ATOM 10110 H H5     . DC  A 1 10 ? 9.099   5.450   1.762   1.00 0.00 ? 78 DC  A H5     6  
ATOM 10111 H H6     . DC  A 1 10 ? 11.239  5.858   0.918   1.00 0.00 ? 78 DC  A H6     6  
ATOM 10112 P P      . DC  A 1 11 ? 16.181  7.855   -1.580  1.00 0.00 ? 79 DC  A P      6  
ATOM 10113 O OP1    . DC  A 1 11 ? 17.384  7.610   -2.380  1.00 0.00 ? 79 DC  A OP1    6  
ATOM 10114 O OP2    . DC  A 1 11 ? 16.291  8.218   -0.135  1.00 0.00 ? 79 DC  A OP2    6  
ATOM 10115 O "O5'"  . DC  A 1 11 ? 15.331  8.954   -2.335  1.00 0.00 ? 79 DC  A "O5'"  6  
ATOM 10116 C "C5'"  . DC  A 1 11 ? 15.036  8.722   -3.749  1.00 0.00 ? 79 DC  A "C5'"  6  
ATOM 10117 C "C4'"  . DC  A 1 11 ? 13.707  9.445   -4.200  1.00 0.00 ? 79 DC  A "C4'"  6  
ATOM 10118 O "O4'"  . DC  A 1 11 ? 12.469  9.029   -3.562  1.00 0.00 ? 79 DC  A "O4'"  6  
ATOM 10119 C "C3'"  . DC  A 1 11 ? 13.855  10.987  -3.790  1.00 0.00 ? 79 DC  A "C3'"  6  
ATOM 10120 O "O3'"  . DC  A 1 11 ? 13.500  11.621  -5.004  1.00 0.00 ? 79 DC  A "O3'"  6  
ATOM 10121 C "C2'"  . DC  A 1 11 ? 12.843  11.125  -2.651  1.00 0.00 ? 79 DC  A "C2'"  6  
ATOM 10122 C "C1'"  . DC  A 1 11 ? 11.778  10.208  -3.196  1.00 0.00 ? 79 DC  A "C1'"  6  
ATOM 10123 N N1     . DC  A 1 11 ? 10.685  9.961   -2.229  1.00 0.00 ? 79 DC  A N1     6  
ATOM 10124 C C2     . DC  A 1 11 ? 9.328   10.088  -2.662  1.00 0.00 ? 79 DC  A C2     6  
ATOM 10125 O O2     . DC  A 1 11 ? 9.005   10.498  -3.818  1.00 0.00 ? 79 DC  A O2     6  
ATOM 10126 N N3     . DC  A 1 11 ? 8.278   9.859   -1.821  1.00 0.00 ? 79 DC  A N3     6  
ATOM 10127 C C4     . DC  A 1 11 ? 8.530   9.499   -0.579  1.00 0.00 ? 79 DC  A C4     6  
ATOM 10128 N N4     . DC  A 1 11 ? 7.509   9.219   0.161   1.00 0.00 ? 79 DC  A N4     6  
ATOM 10129 C C5     . DC  A 1 11 ? 9.878   9.379   -0.037  1.00 0.00 ? 79 DC  A C5     6  
ATOM 10130 C C6     . DC  A 1 11 ? 10.862  9.668   -0.914  1.00 0.00 ? 79 DC  A C6     6  
ATOM 10131 H "H5'"  . DC  A 1 11 ? 14.906  7.646   -3.870  1.00 0.00 ? 79 DC  A "H5'"  6  
ATOM 10132 H "H5''" . DC  A 1 11 ? 15.833  9.169   -4.342  1.00 0.00 ? 79 DC  A "H5''" 6  
ATOM 10133 H "H4'"  . DC  A 1 11 ? 13.702  9.434   -5.291  1.00 0.00 ? 79 DC  A "H4'"  6  
ATOM 10134 H "H3'"  . DC  A 1 11 ? 14.892  11.264  -3.598  1.00 0.00 ? 79 DC  A "H3'"  6  
ATOM 10135 H "H2'"  . DC  A 1 11 ? 13.395  10.813  -1.764  1.00 0.00 ? 79 DC  A "H2'"  6  
ATOM 10136 H "H2''" . DC  A 1 11 ? 12.582  12.169  -2.476  1.00 0.00 ? 79 DC  A "H2''" 6  
ATOM 10137 H "H1'"  . DC  A 1 11 ? 11.302  10.748  -4.016  1.00 0.00 ? 79 DC  A "H1'"  6  
ATOM 10138 H H41    . DC  A 1 11 ? 7.613   8.938   1.127   1.00 0.00 ? 79 DC  A H41    6  
ATOM 10139 H H42    . DC  A 1 11 ? 6.636   9.309   -0.339  1.00 0.00 ? 79 DC  A H42    6  
ATOM 10140 H H5     . DC  A 1 11 ? 10.102  9.142   0.992   1.00 0.00 ? 79 DC  A H5     6  
ATOM 10141 H H6     . DC  A 1 11 ? 11.896  9.561   -0.622  1.00 0.00 ? 79 DC  A H6     6  
ATOM 10142 P P      . DC  A 1 12 ? 13.747  13.217  -5.163  1.00 0.00 ? 80 DC  A P      6  
ATOM 10143 O OP1    . DC  A 1 12 ? 14.604  13.503  -6.335  1.00 0.00 ? 80 DC  A OP1    6  
ATOM 10144 O OP2    . DC  A 1 12 ? 14.151  13.815  -3.840  1.00 0.00 ? 80 DC  A OP2    6  
ATOM 10145 O "O5'"  . DC  A 1 12 ? 12.222  13.762  -5.447  1.00 0.00 ? 80 DC  A "O5'"  6  
ATOM 10146 C "C5'"  . DC  A 1 12 ? 11.484  13.203  -6.525  1.00 0.00 ? 80 DC  A "C5'"  6  
ATOM 10147 C "C4'"  . DC  A 1 12 ? 10.037  13.708  -6.545  1.00 0.00 ? 80 DC  A "C4'"  6  
ATOM 10148 O "O4'"  . DC  A 1 12 ? 9.221   13.306  -5.411  1.00 0.00 ? 80 DC  A "O4'"  6  
ATOM 10149 C "C3'"  . DC  A 1 12 ? 9.909   15.232  -6.655  1.00 0.00 ? 80 DC  A "C3'"  6  
ATOM 10150 O "O3'"  . DC  A 1 12 ? 8.752   15.612  -7.338  1.00 0.00 ? 80 DC  A "O3'"  6  
ATOM 10151 C "C2'"  . DC  A 1 12 ? 9.720   15.538  -5.137  1.00 0.00 ? 80 DC  A "C2'"  6  
ATOM 10152 C "C1'"  . DC  A 1 12 ? 8.780   14.445  -4.631  1.00 0.00 ? 80 DC  A "C1'"  6  
ATOM 10153 N N1     . DC  A 1 12 ? 8.909   14.067  -3.206  1.00 0.00 ? 80 DC  A N1     6  
ATOM 10154 C C2     . DC  A 1 12 ? 7.729   13.947  -2.422  1.00 0.00 ? 80 DC  A C2     6  
ATOM 10155 O O2     . DC  A 1 12 ? 6.693   14.361  -2.839  1.00 0.00 ? 80 DC  A O2     6  
ATOM 10156 N N3     . DC  A 1 12 ? 7.766   13.441  -1.183  1.00 0.00 ? 80 DC  A N3     6  
ATOM 10157 C C4     . DC  A 1 12 ? 8.883   13.198  -0.624  1.00 0.00 ? 80 DC  A C4     6  
ATOM 10158 N N4     . DC  A 1 12 ? 8.796   12.623  0.523   1.00 0.00 ? 80 DC  A N4     6  
ATOM 10159 C C5     . DC  A 1 12 ? 10.136  13.476  -1.331  1.00 0.00 ? 80 DC  A C5     6  
ATOM 10160 C C6     . DC  A 1 12 ? 10.112  13.945  -2.605  1.00 0.00 ? 80 DC  A C6     6  
ATOM 10161 H "H5'"  . DC  A 1 12 ? 11.492  12.119  -6.635  1.00 0.00 ? 80 DC  A "H5'"  6  
ATOM 10162 H "H5''" . DC  A 1 12 ? 11.960  13.502  -7.459  1.00 0.00 ? 80 DC  A "H5''" 6  
ATOM 10163 H "H4'"  . DC  A 1 12 ? 9.541   13.263  -7.407  1.00 0.00 ? 80 DC  A "H4'"  6  
ATOM 10164 H "H3'"  . DC  A 1 12 ? 10.851  15.590  -7.073  1.00 0.00 ? 80 DC  A "H3'"  6  
ATOM 10165 H "H2'"  . DC  A 1 12 ? 10.723  15.565  -4.712  1.00 0.00 ? 80 DC  A "H2'"  6  
ATOM 10166 H "H2''" . DC  A 1 12 ? 9.384   16.567  -5.003  1.00 0.00 ? 80 DC  A "H2''" 6  
ATOM 10167 H "H1'"  . DC  A 1 12 ? 7.767   14.777  -4.858  1.00 0.00 ? 80 DC  A "H1'"  6  
ATOM 10168 H H41    . DC  A 1 12 ? 9.638   12.369  1.021   1.00 0.00 ? 80 DC  A H41    6  
ATOM 10169 H H42    . DC  A 1 12 ? 7.839   12.419  0.773   1.00 0.00 ? 80 DC  A H42    6  
ATOM 10170 H H5     . DC  A 1 12 ? 11.045  13.310  -0.770  1.00 0.00 ? 80 DC  A H5     6  
ATOM 10171 H H6     . DC  A 1 12 ? 10.969  14.221  -3.202  1.00 0.00 ? 80 DC  A H6     6  
ATOM 10172 P P      . DG  A 1 13 ? 8.460   17.076  -7.731  1.00 0.00 ? 81 DG  A P      6  
ATOM 10173 O OP1    . DG  A 1 13 ? 7.410   16.938  -8.781  1.00 0.00 ? 81 DG  A OP1    6  
ATOM 10174 O OP2    . DG  A 1 13 ? 9.707   17.815  -8.013  1.00 0.00 ? 81 DG  A OP2    6  
ATOM 10175 O "O5'"  . DG  A 1 13 ? 7.698   17.827  -6.474  1.00 0.00 ? 81 DG  A "O5'"  6  
ATOM 10176 C "C5'"  . DG  A 1 13 ? 6.302   18.156  -6.543  1.00 0.00 ? 81 DG  A "C5'"  6  
ATOM 10177 C "C4'"  . DG  A 1 13 ? 5.954   18.918  -5.342  1.00 0.00 ? 81 DG  A "C4'"  6  
ATOM 10178 O "O4'"  . DG  A 1 13 ? 5.893   18.187  -4.118  1.00 0.00 ? 81 DG  A "O4'"  6  
ATOM 10179 C "C3'"  . DG  A 1 13 ? 6.985   20.038  -5.033  1.00 0.00 ? 81 DG  A "C3'"  6  
ATOM 10180 O "O3'"  . DG  A 1 13 ? 6.294   21.138  -4.497  1.00 0.00 ? 81 DG  A "O3'"  6  
ATOM 10181 C "C2'"  . DG  A 1 13 ? 7.918   19.433  -3.972  1.00 0.00 ? 81 DG  A "C2'"  6  
ATOM 10182 C "C1'"  . DG  A 1 13 ? 6.854   18.700  -3.133  1.00 0.00 ? 81 DG  A "C1'"  6  
ATOM 10183 N N9     . DG  A 1 13 ? 7.287   17.730  -2.159  1.00 0.00 ? 81 DG  A N9     6  
ATOM 10184 C C8     . DG  A 1 13 ? 8.554   17.344  -1.850  1.00 0.00 ? 81 DG  A C8     6  
ATOM 10185 N N7     . DG  A 1 13 ? 8.707   16.795  -0.616  1.00 0.00 ? 81 DG  A N7     6  
ATOM 10186 C C5     . DG  A 1 13 ? 7.398   16.641  -0.253  1.00 0.00 ? 81 DG  A C5     6  
ATOM 10187 C C6     . DG  A 1 13 ? 6.799   16.076  0.899   1.00 0.00 ? 81 DG  A C6     6  
ATOM 10188 O O6     . DG  A 1 13 ? 7.452   15.570  1.807   1.00 0.00 ? 81 DG  A O6     6  
ATOM 10189 N N1     . DG  A 1 13 ? 5.451   16.191  1.048   1.00 0.00 ? 81 DG  A N1     6  
ATOM 10190 C C2     . DG  A 1 13 ? 4.698   16.853  0.189   1.00 0.00 ? 81 DG  A C2     6  
ATOM 10191 N N2     . DG  A 1 13 ? 3.401   16.884  0.552   1.00 0.00 ? 81 DG  A N2     6  
ATOM 10192 N N3     . DG  A 1 13 ? 5.155   17.521  -0.871  1.00 0.00 ? 81 DG  A N3     6  
ATOM 10193 C C4     . DG  A 1 13 ? 6.537   17.377  -1.056  1.00 0.00 ? 81 DG  A C4     6  
ATOM 10194 H "H5'"  . DG  A 1 13 ? 5.757   17.223  -6.683  1.00 0.00 ? 81 DG  A "H5'"  6  
ATOM 10195 H "H5''" . DG  A 1 13 ? 6.131   18.881  -7.340  1.00 0.00 ? 81 DG  A "H5''" 6  
ATOM 10196 H "H4'"  . DG  A 1 13 ? 4.943   19.324  -5.399  1.00 0.00 ? 81 DG  A "H4'"  6  
ATOM 10197 H "H3'"  . DG  A 1 13 ? 7.627   20.246  -5.890  1.00 0.00 ? 81 DG  A "H3'"  6  
ATOM 10198 H "HO3'" . DG  A 1 13 ? 6.872   21.900  -4.572  1.00 0.00 ? 81 DG  A "HO3'" 6  
ATOM 10199 H "H2'"  . DG  A 1 13 ? 8.654   18.776  -4.436  1.00 0.00 ? 81 DG  A "H2'"  6  
ATOM 10200 H "H2''" . DG  A 1 13 ? 8.398   20.150  -3.307  1.00 0.00 ? 81 DG  A "H2''" 6  
ATOM 10201 H "H1'"  . DG  A 1 13 ? 6.292   19.422  -2.542  1.00 0.00 ? 81 DG  A "H1'"  6  
ATOM 10202 H H8     . DG  A 1 13 ? 9.365   17.580  -2.524  1.00 0.00 ? 81 DG  A H8     6  
ATOM 10203 H H1     . DG  A 1 13 ? 5.099   15.757  1.889   1.00 0.00 ? 81 DG  A H1     6  
ATOM 10204 H H21    . DG  A 1 13 ? 2.784   17.378  -0.076  1.00 0.00 ? 81 DG  A H21    6  
ATOM 10205 H H22    . DG  A 1 13 ? 3.006   16.360  1.320   1.00 0.00 ? 81 DG  A H22    6  
ATOM 10206 O "O5'"  . DC  B 2 1  ? 1.898   13.149  8.076   1.00 0.00 ? 82 DC  B "O5'"  6  
ATOM 10207 C "C5'"  . DC  B 2 1  ? 1.357   14.413  8.246   1.00 0.00 ? 82 DC  B "C5'"  6  
ATOM 10208 C "C4'"  . DC  B 2 1  ? 0.560   14.879  6.992   1.00 0.00 ? 82 DC  B "C4'"  6  
ATOM 10209 O "O4'"  . DC  B 2 1  ? 1.435   15.233  5.975   1.00 0.00 ? 82 DC  B "O4'"  6  
ATOM 10210 C "C3'"  . DC  B 2 1  ? -0.337  13.836  6.378   1.00 0.00 ? 82 DC  B "C3'"  6  
ATOM 10211 O "O3'"  . DC  B 2 1  ? -1.446  14.433  5.748   1.00 0.00 ? 82 DC  B "O3'"  6  
ATOM 10212 C "C2'"  . DC  B 2 1  ? 0.566   13.075  5.379   1.00 0.00 ? 82 DC  B "C2'"  6  
ATOM 10213 C "C1'"  . DC  B 2 1  ? 1.507   14.236  4.973   1.00 0.00 ? 82 DC  B "C1'"  6  
ATOM 10214 N N1     . DC  B 2 1  ? 2.957   14.056  4.674   1.00 0.00 ? 82 DC  B N1     6  
ATOM 10215 C C2     . DC  B 2 1  ? 3.616   14.891  3.753   1.00 0.00 ? 82 DC  B C2     6  
ATOM 10216 O O2     . DC  B 2 1  ? 3.027   15.848  3.261   1.00 0.00 ? 82 DC  B O2     6  
ATOM 10217 N N3     . DC  B 2 1  ? 4.921   14.667  3.373   1.00 0.00 ? 82 DC  B N3     6  
ATOM 10218 C C4     . DC  B 2 1  ? 5.543   13.786  4.089   1.00 0.00 ? 82 DC  B C4     6  
ATOM 10219 N N4     . DC  B 2 1  ? 6.812   13.927  3.957   1.00 0.00 ? 82 DC  B N4     6  
ATOM 10220 C C5     . DC  B 2 1  ? 4.951   12.954  5.128   1.00 0.00 ? 82 DC  B C5     6  
ATOM 10221 C C6     . DC  B 2 1  ? 3.656   13.038  5.321   1.00 0.00 ? 82 DC  B C6     6  
ATOM 10222 H "H5'"  . DC  B 2 1  ? 2.153   15.139  8.410   1.00 0.00 ? 82 DC  B "H5'"  6  
ATOM 10223 H "H5''" . DC  B 2 1  ? 0.609   14.471  9.037   1.00 0.00 ? 82 DC  B "H5''" 6  
ATOM 10224 H "H4'"  . DC  B 2 1  ? 0.014   15.791  7.233   1.00 0.00 ? 82 DC  B "H4'"  6  
ATOM 10225 H "H3'"  . DC  B 2 1  ? -0.677  13.157  7.160   1.00 0.00 ? 82 DC  B "H3'"  6  
ATOM 10226 H "H2'"  . DC  B 2 1  ? 1.083   12.299  5.946   1.00 0.00 ? 82 DC  B "H2'"  6  
ATOM 10227 H "H2''" . DC  B 2 1  ? -0.038  12.673  4.566   1.00 0.00 ? 82 DC  B "H2''" 6  
ATOM 10228 H "H1'"  . DC  B 2 1  ? 1.056   14.776  4.140   1.00 0.00 ? 82 DC  B "H1'"  6  
ATOM 10229 H H41    . DC  B 2 1  ? 7.395   13.295  4.487   1.00 0.00 ? 82 DC  B H41    6  
ATOM 10230 H H42    . DC  B 2 1  ? 7.140   14.519  3.207   1.00 0.00 ? 82 DC  B H42    6  
ATOM 10231 H H5     . DC  B 2 1  ? 5.496   12.225  5.711   1.00 0.00 ? 82 DC  B H5     6  
ATOM 10232 H H6     . DC  B 2 1  ? 3.137   12.504  6.104   1.00 0.00 ? 82 DC  B H6     6  
ATOM 10233 H "HO5'" . DC  B 2 1  ? 2.225   12.782  8.900   1.00 0.00 ? 82 DC  B "HO5'" 6  
ATOM 10234 P P      . DG  B 2 2  ? -2.768  13.636  5.375   1.00 0.00 ? 83 DG  B P      6  
ATOM 10235 O OP1    . DG  B 2 2  ? -3.792  14.730  5.405   1.00 0.00 ? 83 DG  B OP1    6  
ATOM 10236 O OP2    . DG  B 2 2  ? -2.879  12.484  6.278   1.00 0.00 ? 83 DG  B OP2    6  
ATOM 10237 O "O5'"  . DG  B 2 2  ? -2.481  13.139  3.844   1.00 0.00 ? 83 DG  B "O5'"  6  
ATOM 10238 C "C5'"  . DG  B 2 2  ? -2.632  14.048  2.748   1.00 0.00 ? 83 DG  B "C5'"  6  
ATOM 10239 C "C4'"  . DG  B 2 2  ? -1.836  13.550  1.500   1.00 0.00 ? 83 DG  B "C4'"  6  
ATOM 10240 O "O4'"  . DG  B 2 2  ? -0.403  13.578  1.668   1.00 0.00 ? 83 DG  B "O4'"  6  
ATOM 10241 C "C3'"  . DG  B 2 2  ? -2.146  12.139  0.948   1.00 0.00 ? 83 DG  B "C3'"  6  
ATOM 10242 O "O3'"  . DG  B 2 2  ? -2.210  12.224  -0.495  1.00 0.00 ? 83 DG  B "O3'"  6  
ATOM 10243 C "C2'"  . DG  B 2 2  ? -0.969  11.337  1.431   1.00 0.00 ? 83 DG  B "C2'"  6  
ATOM 10244 C "C1'"  . DG  B 2 2  ? 0.032   12.371  1.106   1.00 0.00 ? 83 DG  B "C1'"  6  
ATOM 10245 N N9     . DG  B 2 2  ? 1.433   12.036  1.452   1.00 0.00 ? 83 DG  B N9     6  
ATOM 10246 C C8     . DG  B 2 2  ? 1.914   11.270  2.433   1.00 0.00 ? 83 DG  B C8     6  
ATOM 10247 N N7     . DG  B 2 2  ? 3.233   11.181  2.480   1.00 0.00 ? 83 DG  B N7     6  
ATOM 10248 C C5     . DG  B 2 2  ? 3.614   11.935  1.421   1.00 0.00 ? 83 DG  B C5     6  
ATOM 10249 C C6     . DG  B 2 2  ? 4.948   12.162  0.943   1.00 0.00 ? 83 DG  B C6     6  
ATOM 10250 O O6     . DG  B 2 2  ? 6.037   11.803  1.423   1.00 0.00 ? 83 DG  B O6     6  
ATOM 10251 N N1     . DG  B 2 2  ? 4.964   12.899  -0.179  1.00 0.00 ? 83 DG  B N1     6  
ATOM 10252 C C2     . DG  B 2 2  ? 3.850   13.418  -0.757  1.00 0.00 ? 83 DG  B C2     6  
ATOM 10253 N N2     . DG  B 2 2  ? 4.081   14.086  -1.881  1.00 0.00 ? 83 DG  B N2     6  
ATOM 10254 N N3     . DG  B 2 2  ? 2.631   13.337  -0.301  1.00 0.00 ? 83 DG  B N3     6  
ATOM 10255 C C4     . DG  B 2 2  ? 2.560   12.516  0.803   1.00 0.00 ? 83 DG  B C4     6  
ATOM 10256 H "H5'"  . DG  B 2 2  ? -2.267  15.059  2.924   1.00 0.00 ? 83 DG  B "H5'"  6  
ATOM 10257 H "H5''" . DG  B 2 2  ? -3.678  14.173  2.467   1.00 0.00 ? 83 DG  B "H5''" 6  
ATOM 10258 H "H4'"  . DG  B 2 2  ? -1.999  14.201  0.640   1.00 0.00 ? 83 DG  B "H4'"  6  
ATOM 10259 H "H3'"  . DG  B 2 2  ? -3.124  11.825  1.314   1.00 0.00 ? 83 DG  B "H3'"  6  
ATOM 10260 H "H2'"  . DG  B 2 2  ? -0.951  11.131  2.501   1.00 0.00 ? 83 DG  B "H2'"  6  
ATOM 10261 H "H2''" . DG  B 2 2  ? -0.816  10.446  0.823   1.00 0.00 ? 83 DG  B "H2''" 6  
ATOM 10262 H "H1'"  . DG  B 2 2  ? -0.024  12.324  0.019   1.00 0.00 ? 83 DG  B "H1'"  6  
ATOM 10263 H H8     . DG  B 2 2  ? 1.180   10.781  3.058   1.00 0.00 ? 83 DG  B H8     6  
ATOM 10264 H H1     . DG  B 2 2  ? 5.856   13.135  -0.589  1.00 0.00 ? 83 DG  B H1     6  
ATOM 10265 H H21    . DG  B 2 2  ? 3.293   14.393  -2.433  1.00 0.00 ? 83 DG  B H21    6  
ATOM 10266 H H22    . DG  B 2 2  ? 5.037   14.209  -2.185  1.00 0.00 ? 83 DG  B H22    6  
ATOM 10267 P P      . DG  B 2 3  ? -2.788  11.089  -1.483  1.00 0.00 ? 84 DG  B P      6  
ATOM 10268 O OP1    . DG  B 2 3  ? -4.219  11.384  -1.662  1.00 0.00 ? 84 DG  B OP1    6  
ATOM 10269 O OP2    . DG  B 2 3  ? -2.405  9.740   -1.029  1.00 0.00 ? 84 DG  B OP2    6  
ATOM 10270 O "O5'"  . DG  B 2 3  ? -1.996  11.366  -2.837  1.00 0.00 ? 84 DG  B "O5'"  6  
ATOM 10271 C "C5'"  . DG  B 2 3  ? -2.317  12.540  -3.612  1.00 0.00 ? 84 DG  B "C5'"  6  
ATOM 10272 C "C4'"  . DG  B 2 3  ? -1.222  12.640  -4.713  1.00 0.00 ? 84 DG  B "C4'"  6  
ATOM 10273 O "O4'"  . DG  B 2 3  ? 0.000   12.596  -4.047  1.00 0.00 ? 84 DG  B "O4'"  6  
ATOM 10274 C "C3'"  . DG  B 2 3  ? -1.154  11.465  -5.736  1.00 0.00 ? 84 DG  B "C3'"  6  
ATOM 10275 O "O3'"  . DG  B 2 3  ? -0.791  12.051  -7.006  1.00 0.00 ? 84 DG  B "O3'"  6  
ATOM 10276 C "C2'"  . DG  B 2 3  ? -0.088  10.533  -5.179  1.00 0.00 ? 84 DG  B "C2'"  6  
ATOM 10277 C "C1'"  . DG  B 2 3  ? 0.811   11.543  -4.516  1.00 0.00 ? 84 DG  B "C1'"  6  
ATOM 10278 N N9     . DG  B 2 3  ? 1.546   10.899  -3.406  1.00 0.00 ? 84 DG  B N9     6  
ATOM 10279 C C8     . DG  B 2 3  ? 0.948   10.291  -2.305  1.00 0.00 ? 84 DG  B C8     6  
ATOM 10280 N N7     . DG  B 2 3  ? 1.824   9.768   -1.450  1.00 0.00 ? 84 DG  B N7     6  
ATOM 10281 C C5     . DG  B 2 3  ? 3.045   10.205  -1.912  1.00 0.00 ? 84 DG  B C5     6  
ATOM 10282 C C6     . DG  B 2 3  ? 4.361   9.970   -1.447  1.00 0.00 ? 84 DG  B C6     6  
ATOM 10283 O O6     . DG  B 2 3  ? 4.823   9.269   -0.486  1.00 0.00 ? 84 DG  B O6     6  
ATOM 10284 N N1     . DG  B 2 3  ? 5.413   10.487  -2.252  1.00 0.00 ? 84 DG  B N1     6  
ATOM 10285 C C2     . DG  B 2 3  ? 5.217   11.096  -3.517  1.00 0.00 ? 84 DG  B C2     6  
ATOM 10286 N N2     . DG  B 2 3  ? 6.250   11.343  -4.307  1.00 0.00 ? 84 DG  B N2     6  
ATOM 10287 N N3     . DG  B 2 3  ? 3.948   11.336  -3.944  1.00 0.00 ? 84 DG  B N3     6  
ATOM 10288 C C4     . DG  B 2 3  ? 2.928   10.807  -3.131  1.00 0.00 ? 84 DG  B C4     6  
ATOM 10289 H "H5'"  . DG  B 2 3  ? -2.165  13.470  -3.063  1.00 0.00 ? 84 DG  B "H5'"  6  
ATOM 10290 H "H5''" . DG  B 2 3  ? -3.298  12.660  -4.072  1.00 0.00 ? 84 DG  B "H5''" 6  
ATOM 10291 H "H4'"  . DG  B 2 3  ? -1.359  13.600  -5.212  1.00 0.00 ? 84 DG  B "H4'"  6  
ATOM 10292 H "H3'"  . DG  B 2 3  ? -2.136  10.990  -5.766  1.00 0.00 ? 84 DG  B "H3'"  6  
ATOM 10293 H "H2'"  . DG  B 2 3  ? -0.694  9.906   -4.524  1.00 0.00 ? 84 DG  B "H2'"  6  
ATOM 10294 H "H2''" . DG  B 2 3  ? 0.434   9.873   -5.872  1.00 0.00 ? 84 DG  B "H2''" 6  
ATOM 10295 H "H1'"  . DG  B 2 3  ? 1.555   11.871  -5.242  1.00 0.00 ? 84 DG  B "H1'"  6  
ATOM 10296 H H8     . DG  B 2 3  ? -0.122  10.148  -2.288  1.00 0.00 ? 84 DG  B H8     6  
ATOM 10297 H H1     . DG  B 2 3  ? 6.368   10.355  -1.950  1.00 0.00 ? 84 DG  B H1     6  
ATOM 10298 H H21    . DG  B 2 3  ? 6.040   11.569  -5.269  1.00 0.00 ? 84 DG  B H21    6  
ATOM 10299 H H22    . DG  B 2 3  ? 7.162   11.031  -4.005  1.00 0.00 ? 84 DG  B H22    6  
ATOM 10300 P P      . DG  B 2 4  ? -1.053  11.317  -8.373  1.00 0.00 ? 85 DG  B P      6  
ATOM 10301 O OP1    . DG  B 2 4  ? -1.065  12.321  -9.463  1.00 0.00 ? 85 DG  B OP1    6  
ATOM 10302 O OP2    . DG  B 2 4  ? -2.232  10.434  -8.243  1.00 0.00 ? 85 DG  B OP2    6  
ATOM 10303 O "O5'"  . DG  B 2 4  ? 0.199   10.400  -8.545  1.00 0.00 ? 85 DG  B "O5'"  6  
ATOM 10304 C "C5'"  . DG  B 2 4  ? 1.535   10.916  -8.836  1.00 0.00 ? 85 DG  B "C5'"  6  
ATOM 10305 C "C4'"  . DG  B 2 4  ? 2.680   9.858   -8.748  1.00 0.00 ? 85 DG  B "C4'"  6  
ATOM 10306 O "O4'"  . DG  B 2 4  ? 3.002   9.628   -7.386  1.00 0.00 ? 85 DG  B "O4'"  6  
ATOM 10307 C "C3'"  . DG  B 2 4  ? 2.093   8.495   -9.255  1.00 0.00 ? 85 DG  B "C3'"  6  
ATOM 10308 O "O3'"  . DG  B 2 4  ? 2.983   7.772   -10.094 1.00 0.00 ? 85 DG  B "O3'"  6  
ATOM 10309 C "C2'"  . DG  B 2 4  ? 1.991   7.682   -7.996  1.00 0.00 ? 85 DG  B "C2'"  6  
ATOM 10310 C "C1'"  . DG  B 2 4  ? 3.111   8.279   -7.147  1.00 0.00 ? 85 DG  B "C1'"  6  
ATOM 10311 N N9     . DG  B 2 4  ? 3.187   7.934   -5.756  1.00 0.00 ? 85 DG  B N9     6  
ATOM 10312 C C8     . DG  B 2 4  ? 2.172   7.522   -4.932  1.00 0.00 ? 85 DG  B C8     6  
ATOM 10313 N N7     . DG  B 2 4  ? 2.566   7.103   -3.753  1.00 0.00 ? 85 DG  B N7     6  
ATOM 10314 C C5     . DG  B 2 4  ? 3.966   7.207   -3.823  1.00 0.00 ? 85 DG  B C5     6  
ATOM 10315 C C6     . DG  B 2 4  ? 5.002   6.950   -2.895  1.00 0.00 ? 85 DG  B C6     6  
ATOM 10316 O O6     . DG  B 2 4  ? 4.915   6.476   -1.746  1.00 0.00 ? 85 DG  B O6     6  
ATOM 10317 N N1     . DG  B 2 4  ? 6.249   7.193   -3.293  1.00 0.00 ? 85 DG  B N1     6  
ATOM 10318 C C2     . DG  B 2 4  ? 6.527   7.684   -4.496  1.00 0.00 ? 85 DG  B C2     6  
ATOM 10319 N N2     . DG  B 2 4  ? 7.788   7.639   -4.805  1.00 0.00 ? 85 DG  B N2     6  
ATOM 10320 N N3     . DG  B 2 4  ? 5.626   7.971   -5.467  1.00 0.00 ? 85 DG  B N3     6  
ATOM 10321 C C4     . DG  B 2 4  ? 4.328   7.711   -5.055  1.00 0.00 ? 85 DG  B C4     6  
ATOM 10322 H "H5'"  . DG  B 2 4  ? 1.855   11.732  -8.188  1.00 0.00 ? 85 DG  B "H5'"  6  
ATOM 10323 H "H5''" . DG  B 2 4  ? 1.545   11.312  -9.852  1.00 0.00 ? 85 DG  B "H5''" 6  
ATOM 10324 H "H4'"  . DG  B 2 4  ? 3.594   10.088  -9.294  1.00 0.00 ? 85 DG  B "H4'"  6  
ATOM 10325 H "H3'"  . DG  B 2 4  ? 1.099   8.559   -9.698  1.00 0.00 ? 85 DG  B "H3'"  6  
ATOM 10326 H "H2'"  . DG  B 2 4  ? 1.054   7.946   -7.505  1.00 0.00 ? 85 DG  B "H2'"  6  
ATOM 10327 H "H2''" . DG  B 2 4  ? 2.086   6.597   -8.045  1.00 0.00 ? 85 DG  B "H2''" 6  
ATOM 10328 H "H1'"  . DG  B 2 4  ? 4.076   7.891   -7.473  1.00 0.00 ? 85 DG  B "H1'"  6  
ATOM 10329 H H8     . DG  B 2 4  ? 1.136   7.603   -5.227  1.00 0.00 ? 85 DG  B H8     6  
ATOM 10330 H H1     . DG  B 2 4  ? 7.002   6.855   -2.710  1.00 0.00 ? 85 DG  B H1     6  
ATOM 10331 H H21    . DG  B 2 4  ? 7.917   8.148   -5.668  1.00 0.00 ? 85 DG  B H21    6  
ATOM 10332 H H22    . DG  B 2 4  ? 8.452   7.105   -4.262  1.00 0.00 ? 85 DG  B H22    6  
ATOM 10333 P P      . DG  B 2 5  ? 3.321   8.155   -11.558 1.00 0.00 ? 86 DG  B P      6  
ATOM 10334 O OP1    . DG  B 2 5  ? 3.098   9.622   -11.655 1.00 0.00 ? 86 DG  B OP1    6  
ATOM 10335 O OP2    . DG  B 2 5  ? 2.625   7.235   -12.473 1.00 0.00 ? 86 DG  B OP2    6  
ATOM 10336 O "O5'"  . DG  B 2 5  ? 4.898   7.787   -11.702 1.00 0.00 ? 86 DG  B "O5'"  6  
ATOM 10337 C "C5'"  . DG  B 2 5  ? 6.036   8.632   -11.464 1.00 0.00 ? 86 DG  B "C5'"  6  
ATOM 10338 C "C4'"  . DG  B 2 5  ? 7.399   7.911   -11.151 1.00 0.00 ? 86 DG  B "C4'"  6  
ATOM 10339 O "O4'"  . DG  B 2 5  ? 7.484   7.361   -9.855  1.00 0.00 ? 86 DG  B "O4'"  6  
ATOM 10340 C "C3'"  . DG  B 2 5  ? 7.656   6.673   -12.101 1.00 0.00 ? 86 DG  B "C3'"  6  
ATOM 10341 O "O3'"  . DG  B 2 5  ? 9.021   6.490   -12.252 1.00 0.00 ? 86 DG  B "O3'"  6  
ATOM 10342 C "C2'"  . DG  B 2 5  ? 6.936   5.562   -11.407 1.00 0.00 ? 86 DG  B "C2'"  6  
ATOM 10343 C "C1'"  . DG  B 2 5  ? 7.322   5.964   -9.997  1.00 0.00 ? 86 DG  B "C1'"  6  
ATOM 10344 N N9     . DG  B 2 5  ? 6.386   5.444   -8.954  1.00 0.00 ? 86 DG  B N9     6  
ATOM 10345 C C8     . DG  B 2 5  ? 5.060   5.613   -9.007  1.00 0.00 ? 86 DG  B C8     6  
ATOM 10346 N N7     . DG  B 2 5  ? 4.472   5.334   -7.877  1.00 0.00 ? 86 DG  B N7     6  
ATOM 10347 C C5     . DG  B 2 5  ? 5.540   4.994   -7.049  1.00 0.00 ? 86 DG  B C5     6  
ATOM 10348 C C6     . DG  B 2 5  ? 5.518   4.741   -5.674  1.00 0.00 ? 86 DG  B C6     6  
ATOM 10349 O O6     . DG  B 2 5  ? 4.580   4.522   -4.958  1.00 0.00 ? 86 DG  B O6     6  
ATOM 10350 N N1     . DG  B 2 5  ? 6.758   4.451   -5.148  1.00 0.00 ? 86 DG  B N1     6  
ATOM 10351 C C2     . DG  B 2 5  ? 7.917   4.628   -5.851  1.00 0.00 ? 86 DG  B C2     6  
ATOM 10352 N N2     . DG  B 2 5  ? 9.027   4.175   -5.258  1.00 0.00 ? 86 DG  B N2     6  
ATOM 10353 N N3     . DG  B 2 5  ? 8.026   4.944   -7.119  1.00 0.00 ? 86 DG  B N3     6  
ATOM 10354 C C4     . DG  B 2 5  ? 6.744   5.038   -7.720  1.00 0.00 ? 86 DG  B C4     6  
ATOM 10355 H "H5'"  . DG  B 2 5  ? 5.874   9.307   -10.623 1.00 0.00 ? 86 DG  B "H5'"  6  
ATOM 10356 H "H5''" . DG  B 2 5  ? 6.230   9.244   -12.345 1.00 0.00 ? 86 DG  B "H5''" 6  
ATOM 10357 H "H4'"  . DG  B 2 5  ? 8.245   8.587   -11.276 1.00 0.00 ? 86 DG  B "H4'"  6  
ATOM 10358 H "H3'"  . DG  B 2 5  ? 7.238   6.850   -13.092 1.00 0.00 ? 86 DG  B "H3'"  6  
ATOM 10359 H "H2'"  . DG  B 2 5  ? 5.885   5.598   -11.694 1.00 0.00 ? 86 DG  B "H2'"  6  
ATOM 10360 H "H2''" . DG  B 2 5  ? 7.320   4.589   -11.716 1.00 0.00 ? 86 DG  B "H2''" 6  
ATOM 10361 H "H1'"  . DG  B 2 5  ? 8.307   5.527   -9.834  1.00 0.00 ? 86 DG  B "H1'"  6  
ATOM 10362 H H8     . DG  B 2 5  ? 4.580   5.916   -9.926  1.00 0.00 ? 86 DG  B H8     6  
ATOM 10363 H H1     . DG  B 2 5  ? 6.773   4.199   -4.170  1.00 0.00 ? 86 DG  B H1     6  
ATOM 10364 H H21    . DG  B 2 5  ? 9.873   4.003   -5.782  1.00 0.00 ? 86 DG  B H21    6  
ATOM 10365 H H22    . DG  B 2 5  ? 8.810   3.588   -4.466  1.00 0.00 ? 86 DG  B H22    6  
ATOM 10366 P P      . DA  B 2 6  ? 9.522   5.415   -13.375 1.00 0.00 ? 87 DA  B P      6  
ATOM 10367 O OP1    . DA  B 2 6  ? 10.838  5.878   -13.732 1.00 0.00 ? 87 DA  B OP1    6  
ATOM 10368 O OP2    . DA  B 2 6  ? 8.513   5.289   -14.373 1.00 0.00 ? 87 DA  B OP2    6  
ATOM 10369 O "O5'"  . DA  B 2 6  ? 9.735   4.086   -12.530 1.00 0.00 ? 87 DA  B "O5'"  6  
ATOM 10370 C "C5'"  . DA  B 2 6  ? 10.721  3.843   -11.569 1.00 0.00 ? 87 DA  B "C5'"  6  
ATOM 10371 C "C4'"  . DA  B 2 6  ? 10.350  2.663   -10.672 1.00 0.00 ? 87 DA  B "C4'"  6  
ATOM 10372 O "O4'"  . DA  B 2 6  ? 9.307   3.011   -9.799  1.00 0.00 ? 87 DA  B "O4'"  6  
ATOM 10373 C "C3'"  . DA  B 2 6  ? 9.952   1.405   -11.474 1.00 0.00 ? 87 DA  B "C3'"  6  
ATOM 10374 O "O3'"  . DA  B 2 6  ? 10.435  0.238   -10.931 1.00 0.00 ? 87 DA  B "O3'"  6  
ATOM 10375 C "C2'"  . DA  B 2 6  ? 8.469   1.315   -11.267 1.00 0.00 ? 87 DA  B "C2'"  6  
ATOM 10376 C "C1'"  . DA  B 2 6  ? 8.555   1.840   -9.796  1.00 0.00 ? 87 DA  B "C1'"  6  
ATOM 10377 N N9     . DA  B 2 6  ? 7.212   2.055   -9.321  1.00 0.00 ? 87 DA  B N9     6  
ATOM 10378 C C8     . DA  B 2 6  ? 5.993   2.404   -9.901  1.00 0.00 ? 87 DA  B C8     6  
ATOM 10379 N N7     . DA  B 2 6  ? 4.994   2.412   -9.108  1.00 0.00 ? 87 DA  B N7     6  
ATOM 10380 C C5     . DA  B 2 6  ? 5.476   1.949   -7.972  1.00 0.00 ? 87 DA  B C5     6  
ATOM 10381 C C6     . DA  B 2 6  ? 4.934   1.640   -6.757  1.00 0.00 ? 87 DA  B C6     6  
ATOM 10382 N N6     . DA  B 2 6  ? 3.679   1.758   -6.404  1.00 0.00 ? 87 DA  B N6     6  
ATOM 10383 N N1     . DA  B 2 6  ? 5.710   1.184   -5.753  1.00 0.00 ? 87 DA  B N1     6  
ATOM 10384 C C2     . DA  B 2 6  ? 7.010   1.150   -5.985  1.00 0.00 ? 87 DA  B C2     6  
ATOM 10385 N N3     . DA  B 2 6  ? 7.625   1.440   -7.062  1.00 0.00 ? 87 DA  B N3     6  
ATOM 10386 C C4     . DA  B 2 6  ? 6.830   1.750   -8.077  1.00 0.00 ? 87 DA  B C4     6  
ATOM 10387 H "H5'"  . DA  B 2 6  ? 10.765  4.690   -10.884 1.00 0.00 ? 87 DA  B "H5'"  6  
ATOM 10388 H "H5''" . DA  B 2 6  ? 11.714  3.703   -11.995 1.00 0.00 ? 87 DA  B "H5''" 6  
ATOM 10389 H "H4'"  . DA  B 2 6  ? 11.250  2.375   -10.129 1.00 0.00 ? 87 DA  B "H4'"  6  
ATOM 10390 H "H3'"  . DA  B 2 6  ? 10.326  1.530   -12.490 1.00 0.00 ? 87 DA  B "H3'"  6  
ATOM 10391 H "H2'"  . DA  B 2 6  ? 7.959   2.074   -11.861 1.00 0.00 ? 87 DA  B "H2'"  6  
ATOM 10392 H "H2''" . DA  B 2 6  ? 8.124   0.296   -11.446 1.00 0.00 ? 87 DA  B "H2''" 6  
ATOM 10393 H "H1'"  . DA  B 2 6  ? 9.112   1.146   -9.165  1.00 0.00 ? 87 DA  B "H1'"  6  
ATOM 10394 H H8     . DA  B 2 6  ? 6.033   2.749   -10.924 1.00 0.00 ? 87 DA  B H8     6  
ATOM 10395 H H61    . DA  B 2 6  ? 3.401   1.520   -5.463  1.00 0.00 ? 87 DA  B H61    6  
ATOM 10396 H H62    . DA  B 2 6  ? 3.071   2.272   -7.025  1.00 0.00 ? 87 DA  B H62    6  
ATOM 10397 H H2     . DA  B 2 6  ? 7.605   1.044   -5.089  1.00 0.00 ? 87 DA  B H2     6  
ATOM 10398 P P      . DT  B 2 7  ? 11.931  -0.350  -11.311 1.00 0.00 ? 88 DT  B P      6  
ATOM 10399 O OP1    . DT  B 2 7  ? 12.865  0.773   -11.146 1.00 0.00 ? 88 DT  B OP1    6  
ATOM 10400 O OP2    . DT  B 2 7  ? 11.810  -1.127  -12.572 1.00 0.00 ? 88 DT  B OP2    6  
ATOM 10401 O "O5'"  . DT  B 2 7  ? 11.865  -1.316  -10.063 1.00 0.00 ? 88 DT  B "O5'"  6  
ATOM 10402 C "C5'"  . DT  B 2 7  ? 12.453  -0.949  -8.835  1.00 0.00 ? 88 DT  B "C5'"  6  
ATOM 10403 C "C4'"  . DT  B 2 7  ? 11.827  -1.831  -7.739  1.00 0.00 ? 88 DT  B "C4'"  6  
ATOM 10404 O "O4'"  . DT  B 2 7  ? 10.423  -1.563  -7.445  1.00 0.00 ? 88 DT  B "O4'"  6  
ATOM 10405 C "C3'"  . DT  B 2 7  ? 11.966  -3.339  -8.036  1.00 0.00 ? 88 DT  B "C3'"  6  
ATOM 10406 O "O3'"  . DT  B 2 7  ? 12.556  -3.968  -6.863  1.00 0.00 ? 88 DT  B "O3'"  6  
ATOM 10407 C "C2'"  . DT  B 2 7  ? 10.510  -3.817  -8.351  1.00 0.00 ? 88 DT  B "C2'"  6  
ATOM 10408 C "C1'"  . DT  B 2 7  ? 9.629   -2.771  -7.598  1.00 0.00 ? 88 DT  B "C1'"  6  
ATOM 10409 N N1     . DT  B 2 7  ? 8.269   -2.425  -8.069  1.00 0.00 ? 88 DT  B N1     6  
ATOM 10410 C C2     . DT  B 2 7  ? 7.300   -2.225  -7.046  1.00 0.00 ? 88 DT  B C2     6  
ATOM 10411 O O2     . DT  B 2 7  ? 7.568   -2.420  -5.854  1.00 0.00 ? 88 DT  B O2     6  
ATOM 10412 N N3     . DT  B 2 7  ? 6.061   -1.873  -7.477  1.00 0.00 ? 88 DT  B N3     6  
ATOM 10413 C C4     . DT  B 2 7  ? 5.667   -1.694  -8.754  1.00 0.00 ? 88 DT  B C4     6  
ATOM 10414 O O4     . DT  B 2 7  ? 4.500   -1.432  -8.974  1.00 0.00 ? 88 DT  B O4     6  
ATOM 10415 C C5     . DT  B 2 7  ? 6.726   -1.859  -9.771  1.00 0.00 ? 88 DT  B C5     6  
ATOM 10416 C C7     . DT  B 2 7  ? 6.413   -1.830  -11.270 1.00 0.00 ? 88 DT  B C7     6  
ATOM 10417 C C6     . DT  B 2 7  ? 8.003   -2.243  -9.413  1.00 0.00 ? 88 DT  B C6     6  
ATOM 10418 H "H5'"  . DT  B 2 7  ? 12.234  0.108   -8.683  1.00 0.00 ? 88 DT  B "H5'"  6  
ATOM 10419 H "H5''" . DT  B 2 7  ? 13.535  -1.068  -8.906  1.00 0.00 ? 88 DT  B "H5''" 6  
ATOM 10420 H "H4'"  . DT  B 2 7  ? 12.325  -1.696  -6.779  1.00 0.00 ? 88 DT  B "H4'"  6  
ATOM 10421 H "H3'"  . DT  B 2 7  ? 12.685  -3.517  -8.835  1.00 0.00 ? 88 DT  B "H3'"  6  
ATOM 10422 H "H2'"  . DT  B 2 7  ? 10.354  -3.865  -9.428  1.00 0.00 ? 88 DT  B "H2'"  6  
ATOM 10423 H "H2''" . DT  B 2 7  ? 10.334  -4.794  -7.898  1.00 0.00 ? 88 DT  B "H2''" 6  
ATOM 10424 H "H1'"  . DT  B 2 7  ? 9.527   -3.165  -6.587  1.00 0.00 ? 88 DT  B "H1'"  6  
ATOM 10425 H H3     . DT  B 2 7  ? 5.264   -1.889  -6.856  1.00 0.00 ? 88 DT  B H3     6  
ATOM 10426 H H71    . DT  B 2 7  ? 6.108   -0.825  -11.561 1.00 0.00 ? 88 DT  B H71    6  
ATOM 10427 H H72    . DT  B 2 7  ? 7.305   -2.177  -11.792 1.00 0.00 ? 88 DT  B H72    6  
ATOM 10428 H H73    . DT  B 2 7  ? 5.589   -2.500  -11.516 1.00 0.00 ? 88 DT  B H73    6  
ATOM 10429 H H6     . DT  B 2 7  ? 8.839   -2.204  -10.096 1.00 0.00 ? 88 DT  B H6     6  
ATOM 10430 P P      . DT  B 2 8  ? 12.680  -5.528  -6.559  1.00 0.00 ? 89 DT  B P      6  
ATOM 10431 O OP1    . DT  B 2 8  ? 13.822  -5.697  -5.633  1.00 0.00 ? 89 DT  B OP1    6  
ATOM 10432 O OP2    . DT  B 2 8  ? 12.756  -6.174  -7.851  1.00 0.00 ? 89 DT  B OP2    6  
ATOM 10433 O "O5'"  . DT  B 2 8  ? 11.339  -5.866  -5.789  1.00 0.00 ? 89 DT  B "O5'"  6  
ATOM 10434 C "C5'"  . DT  B 2 8  ? 11.041  -5.202  -4.566  1.00 0.00 ? 89 DT  B "C5'"  6  
ATOM 10435 C "C4'"  . DT  B 2 8  ? 9.789   -5.685  -3.865  1.00 0.00 ? 89 DT  B "C4'"  6  
ATOM 10436 O "O4'"  . DT  B 2 8  ? 8.600   -5.339  -4.625  1.00 0.00 ? 89 DT  B "O4'"  6  
ATOM 10437 C "C3'"  . DT  B 2 8  ? 9.712   -7.203  -3.721  1.00 0.00 ? 89 DT  B "C3'"  6  
ATOM 10438 O "O3'"  . DT  B 2 8  ? 9.168   -7.393  -2.372  1.00 0.00 ? 89 DT  B "O3'"  6  
ATOM 10439 C "C2'"  . DT  B 2 8  ? 8.693   -7.592  -4.815  1.00 0.00 ? 89 DT  B "C2'"  6  
ATOM 10440 C "C1'"  . DT  B 2 8  ? 7.739   -6.437  -4.668  1.00 0.00 ? 89 DT  B "C1'"  6  
ATOM 10441 N N1     . DT  B 2 8  ? 6.994   -6.040  -5.886  1.00 0.00 ? 89 DT  B N1     6  
ATOM 10442 C C2     . DT  B 2 8  ? 5.625   -6.034  -5.875  1.00 0.00 ? 89 DT  B C2     6  
ATOM 10443 O O2     . DT  B 2 8  ? 5.005   -6.528  -4.938  1.00 0.00 ? 89 DT  B O2     6  
ATOM 10444 N N3     . DT  B 2 8  ? 4.899   -5.707  -6.962  1.00 0.00 ? 89 DT  B N3     6  
ATOM 10445 C C4     . DT  B 2 8  ? 5.418   -5.251  -8.121  1.00 0.00 ? 89 DT  B C4     6  
ATOM 10446 O O4     . DT  B 2 8  ? 4.645   -4.757  -8.973  1.00 0.00 ? 89 DT  B O4     6  
ATOM 10447 C C5     . DT  B 2 8  ? 6.844   -5.551  -8.248  1.00 0.00 ? 89 DT  B C5     6  
ATOM 10448 C C7     . DT  B 2 8  ? 7.497   -5.611  -9.649  1.00 0.00 ? 89 DT  B C7     6  
ATOM 10449 C C6     . DT  B 2 8  ? 7.574   -5.916  -7.150  1.00 0.00 ? 89 DT  B C6     6  
ATOM 10450 H "H5'"  . DT  B 2 8  ? 10.899  -4.154  -4.830  1.00 0.00 ? 89 DT  B "H5'"  6  
ATOM 10451 H "H5''" . DT  B 2 8  ? 11.917  -5.231  -3.917  1.00 0.00 ? 89 DT  B "H5''" 6  
ATOM 10452 H "H4'"  . DT  B 2 8  ? 9.796   -5.205  -2.886  1.00 0.00 ? 89 DT  B "H4'"  6  
ATOM 10453 H "H3'"  . DT  B 2 8  ? 10.669  -7.704  -3.869  1.00 0.00 ? 89 DT  B "H3'"  6  
ATOM 10454 H "H2'"  . DT  B 2 8  ? 9.219   -7.580  -5.769  1.00 0.00 ? 89 DT  B "H2'"  6  
ATOM 10455 H "H2''" . DT  B 2 8  ? 8.281   -8.593  -4.690  1.00 0.00 ? 89 DT  B "H2''" 6  
ATOM 10456 H "H1'"  . DT  B 2 8  ? 7.117   -6.581  -3.785  1.00 0.00 ? 89 DT  B "H1'"  6  
ATOM 10457 H H3     . DT  B 2 8  ? 3.957   -5.383  -6.798  1.00 0.00 ? 89 DT  B H3     6  
ATOM 10458 H H71    . DT  B 2 8  ? 7.042   -6.327  -10.335 1.00 0.00 ? 89 DT  B H71    6  
ATOM 10459 H H72    . DT  B 2 8  ? 7.502   -4.663  -10.187 1.00 0.00 ? 89 DT  B H72    6  
ATOM 10460 H H73    . DT  B 2 8  ? 8.505   -6.024  -9.678  1.00 0.00 ? 89 DT  B H73    6  
ATOM 10461 H H6     . DT  B 2 8  ? 8.603   -6.214  -7.279  1.00 0.00 ? 89 DT  B H6     6  
ATOM 10462 P P      . DA  B 2 9  ? 8.769   -8.794  -1.667  1.00 0.00 ? 90 DA  B P      6  
ATOM 10463 O OP1    . DA  B 2 9  ? 8.776   -8.665  -0.240  1.00 0.00 ? 90 DA  B OP1    6  
ATOM 10464 O OP2    . DA  B 2 9  ? 9.507   -9.850  -2.332  1.00 0.00 ? 90 DA  B OP2    6  
ATOM 10465 O "O5'"  . DA  B 2 9  ? 7.138   -8.961  -2.041  1.00 0.00 ? 90 DA  B "O5'"  6  
ATOM 10466 C "C5'"  . DA  B 2 9  ? 6.111   -8.316  -1.317  1.00 0.00 ? 90 DA  B "C5'"  6  
ATOM 10467 C "C4'"  . DA  B 2 9  ? 4.699   -8.889  -1.511  1.00 0.00 ? 90 DA  B "C4'"  6  
ATOM 10468 O "O4'"  . DA  B 2 9  ? 4.405   -8.720  -2.928  1.00 0.00 ? 90 DA  B "O4'"  6  
ATOM 10469 C "C3'"  . DA  B 2 9  ? 4.750   -10.474 -1.360  1.00 0.00 ? 90 DA  B "C3'"  6  
ATOM 10470 O "O3'"  . DA  B 2 9  ? 3.532   -11.084 -0.927  1.00 0.00 ? 90 DA  B "O3'"  6  
ATOM 10471 C "C2'"  . DA  B 2 9  ? 5.120   -10.934 -2.809  1.00 0.00 ? 90 DA  B "C2'"  6  
ATOM 10472 C "C1'"  . DA  B 2 9  ? 4.284   -9.908  -3.621  1.00 0.00 ? 90 DA  B "C1'"  6  
ATOM 10473 N N9     . DA  B 2 9  ? 4.623   -9.663  -5.011  1.00 0.00 ? 90 DA  B N9     6  
ATOM 10474 C C8     . DA  B 2 9  ? 5.801   -9.883  -5.659  1.00 0.00 ? 90 DA  B C8     6  
ATOM 10475 N N7     . DA  B 2 9  ? 5.774   -9.628  -6.932  1.00 0.00 ? 90 DA  B N7     6  
ATOM 10476 C C5     . DA  B 2 9  ? 4.404   -9.200  -7.142  1.00 0.00 ? 90 DA  B C5     6  
ATOM 10477 C C6     . DA  B 2 9  ? 3.683   -8.720  -8.243  1.00 0.00 ? 90 DA  B C6     6  
ATOM 10478 N N6     . DA  B 2 9  ? 4.166   -8.377  -9.440  1.00 0.00 ? 90 DA  B N6     6  
ATOM 10479 N N1     . DA  B 2 9  ? 2.463   -8.332  -8.059  1.00 0.00 ? 90 DA  B N1     6  
ATOM 10480 C C2     . DA  B 2 9  ? 1.842   -8.513  -6.853  1.00 0.00 ? 90 DA  B C2     6  
ATOM 10481 N N3     . DA  B 2 9  ? 2.384   -9.102  -5.795  1.00 0.00 ? 90 DA  B N3     6  
ATOM 10482 C C4     . DA  B 2 9  ? 3.733   -9.322  -5.958  1.00 0.00 ? 90 DA  B C4     6  
ATOM 10483 H "H5'"  . DA  B 2 9  ? 6.056   -7.315  -1.745  1.00 0.00 ? 90 DA  B "H5'"  6  
ATOM 10484 H "H5''" . DA  B 2 9  ? 6.367   -8.306  -0.258  1.00 0.00 ? 90 DA  B "H5''" 6  
ATOM 10485 H "H4'"  . DA  B 2 9  ? 4.033   -8.281  -0.899  1.00 0.00 ? 90 DA  B "H4'"  6  
ATOM 10486 H "H3'"  . DA  B 2 9  ? 5.542   -10.714 -0.651  1.00 0.00 ? 90 DA  B "H3'"  6  
ATOM 10487 H "H2'"  . DA  B 2 9  ? 6.169   -10.748 -3.037  1.00 0.00 ? 90 DA  B "H2'"  6  
ATOM 10488 H "H2''" . DA  B 2 9  ? 4.885   -11.973 -3.039  1.00 0.00 ? 90 DA  B "H2''" 6  
ATOM 10489 H "H1'"  . DA  B 2 9  ? 3.237   -10.210 -3.622  1.00 0.00 ? 90 DA  B "H1'"  6  
ATOM 10490 H H8     . DA  B 2 9  ? 6.690   -10.259 -5.175  1.00 0.00 ? 90 DA  B H8     6  
ATOM 10491 H H61    . DA  B 2 9  ? 3.511   -7.929  -10.064 1.00 0.00 ? 90 DA  B H61    6  
ATOM 10492 H H62    . DA  B 2 9  ? 5.086   -8.675  -9.731  1.00 0.00 ? 90 DA  B H62    6  
ATOM 10493 H H2     . DA  B 2 9  ? 0.818   -8.192  -6.727  1.00 0.00 ? 90 DA  B H2     6  
ATOM 10494 P P      . DG  B 2 10 ? 3.618   -12.352 0.036   1.00 0.00 ? 91 DG  B P      6  
ATOM 10495 O OP1    . DG  B 2 10 ? 3.669   -11.851 1.443   1.00 0.00 ? 91 DG  B OP1    6  
ATOM 10496 O OP2    . DG  B 2 10 ? 4.747   -13.182 -0.468  1.00 0.00 ? 91 DG  B OP2    6  
ATOM 10497 O "O5'"  . DG  B 2 10 ? 2.331   -13.228 -0.261  1.00 0.00 ? 91 DG  B "O5'"  6  
ATOM 10498 C "C5'"  . DG  B 2 10 ? 1.029   -12.772 0.216   1.00 0.00 ? 91 DG  B "C5'"  6  
ATOM 10499 C "C4'"  . DG  B 2 10 ? 0.000   -13.229 -0.800  1.00 0.00 ? 91 DG  B "C4'"  6  
ATOM 10500 O "O4'"  . DG  B 2 10 ? 0.240   -12.784 -2.083  1.00 0.00 ? 91 DG  B "O4'"  6  
ATOM 10501 C "C3'"  . DG  B 2 10 ? -0.216  -14.774 -0.879  1.00 0.00 ? 91 DG  B "C3'"  6  
ATOM 10502 O "O3'"  . DG  B 2 10 ? -1.480  -15.144 -1.226  1.00 0.00 ? 91 DG  B "O3'"  6  
ATOM 10503 C "C2'"  . DG  B 2 10 ? 0.590   -15.094 -2.113  1.00 0.00 ? 91 DG  B "C2'"  6  
ATOM 10504 C "C1'"  . DG  B 2 10 ? 0.325   -13.830 -3.022  1.00 0.00 ? 91 DG  B "C1'"  6  
ATOM 10505 N N9     . DG  B 2 10 ? 1.242   -13.360 -4.047  1.00 0.00 ? 91 DG  B N9     6  
ATOM 10506 C C8     . DG  B 2 10 ? 2.575   -13.323 -4.119  1.00 0.00 ? 91 DG  B C8     6  
ATOM 10507 N N7     . DG  B 2 10 ? 3.133   -12.798 -5.188  1.00 0.00 ? 91 DG  B N7     6  
ATOM 10508 C C5     . DG  B 2 10 ? 1.984   -12.384 -5.867  1.00 0.00 ? 91 DG  B C5     6  
ATOM 10509 C C6     . DG  B 2 10 ? 1.785   -11.855 -7.195  1.00 0.00 ? 91 DG  B C6     6  
ATOM 10510 O O6     . DG  B 2 10 ? 2.670   -11.518 -7.989  1.00 0.00 ? 91 DG  B O6     6  
ATOM 10511 N N1     . DG  B 2 10 ? 0.458   -11.536 -7.466  1.00 0.00 ? 91 DG  B N1     6  
ATOM 10512 C C2     . DG  B 2 10 ? -0.564  -11.786 -6.594  1.00 0.00 ? 91 DG  B C2     6  
ATOM 10513 N N2     . DG  B 2 10 ? -1.748  -11.547 -7.036  1.00 0.00 ? 91 DG  B N2     6  
ATOM 10514 N N3     . DG  B 2 10 ? -0.495  -12.251 -5.416  1.00 0.00 ? 91 DG  B N3     6  
ATOM 10515 C C4     . DG  B 2 10 ? 0.808   -12.594 -5.113  1.00 0.00 ? 91 DG  B C4     6  
ATOM 10516 H "H5'"  . DG  B 2 10 ? 1.076   -11.684 0.187   1.00 0.00 ? 91 DG  B "H5'"  6  
ATOM 10517 H "H5''" . DG  B 2 10 ? 0.798   -13.020 1.251   1.00 0.00 ? 91 DG  B "H5''" 6  
ATOM 10518 H "H4'"  . DG  B 2 10 ? -1.017  -12.919 -0.559  1.00 0.00 ? 91 DG  B "H4'"  6  
ATOM 10519 H "H3'"  . DG  B 2 10 ? 0.198   -15.225 0.024   1.00 0.00 ? 91 DG  B "H3'"  6  
ATOM 10520 H "H2'"  . DG  B 2 10 ? 1.649   -15.086 -1.853  1.00 0.00 ? 91 DG  B "H2'"  6  
ATOM 10521 H "H2''" . DG  B 2 10 ? 0.227   -15.970 -2.653  1.00 0.00 ? 91 DG  B "H2''" 6  
ATOM 10522 H "H1'"  . DG  B 2 10 ? -0.558  -13.979 -3.642  1.00 0.00 ? 91 DG  B "H1'"  6  
ATOM 10523 H H8     . DG  B 2 10 ? 3.232   -13.694 -3.346  1.00 0.00 ? 91 DG  B H8     6  
ATOM 10524 H H1     . DG  B 2 10 ? 0.259   -11.110 -8.360  1.00 0.00 ? 91 DG  B H1     6  
ATOM 10525 H H21    . DG  B 2 10 ? -2.471  -11.957 -6.464  1.00 0.00 ? 91 DG  B H21    6  
ATOM 10526 H H22    . DG  B 2 10 ? -1.813  -11.364 -8.028  1.00 0.00 ? 91 DG  B H22    6  
ATOM 10527 P P      . DA  B 2 11 ? -2.271  -16.369 -0.738  1.00 0.00 ? 92 DA  B P      6  
ATOM 10528 O OP1    . DA  B 2 11 ? -2.636  -16.117 0.648   1.00 0.00 ? 92 DA  B OP1    6  
ATOM 10529 O OP2    . DA  B 2 11 ? -1.570  -17.601 -1.118  1.00 0.00 ? 92 DA  B OP2    6  
ATOM 10530 O "O5'"  . DA  B 2 11 ? -3.629  -16.349 -1.611  1.00 0.00 ? 92 DA  B "O5'"  6  
ATOM 10531 C "C5'"  . DA  B 2 11 ? -4.656  -15.397 -1.468  1.00 0.00 ? 92 DA  B "C5'"  6  
ATOM 10532 C "C4'"  . DA  B 2 11 ? -5.482  -15.159 -2.756  1.00 0.00 ? 92 DA  B "C4'"  6  
ATOM 10533 O "O4'"  . DA  B 2 11 ? -4.605  -14.693 -3.770  1.00 0.00 ? 92 DA  B "O4'"  6  
ATOM 10534 C "C3'"  . DA  B 2 11 ? -6.186  -16.407 -3.278  1.00 0.00 ? 92 DA  B "C3'"  6  
ATOM 10535 O "O3'"  . DA  B 2 11 ? -7.375  -15.934 -3.910  1.00 0.00 ? 92 DA  B "O3'"  6  
ATOM 10536 C "C2'"  . DA  B 2 11 ? -5.121  -17.027 -4.117  1.00 0.00 ? 92 DA  B "C2'"  6  
ATOM 10537 C "C1'"  . DA  B 2 11 ? -4.487  -15.793 -4.739  1.00 0.00 ? 92 DA  B "C1'"  6  
ATOM 10538 N N9     . DA  B 2 11 ? -3.061  -16.051 -5.226  1.00 0.00 ? 92 DA  B N9     6  
ATOM 10539 C C8     . DA  B 2 11 ? -2.093  -16.791 -4.632  1.00 0.00 ? 92 DA  B C8     6  
ATOM 10540 N N7     . DA  B 2 11 ? -0.972  -16.709 -5.275  1.00 0.00 ? 92 DA  B N7     6  
ATOM 10541 C C5     . DA  B 2 11 ? -1.223  -15.871 -6.366  1.00 0.00 ? 92 DA  B C5     6  
ATOM 10542 C C6     . DA  B 2 11 ? -0.427  -15.385 -7.442  1.00 0.00 ? 92 DA  B C6     6  
ATOM 10543 N N6     . DA  B 2 11 ? 0.875   -15.445 -7.424  1.00 0.00 ? 92 DA  B N6     6  
ATOM 10544 N N1     . DA  B 2 11 ? -0.996  -14.620 -8.397  1.00 0.00 ? 92 DA  B N1     6  
ATOM 10545 C C2     . DA  B 2 11 ? -2.339  -14.456 -8.376  1.00 0.00 ? 92 DA  B C2     6  
ATOM 10546 N N3     . DA  B 2 11 ? -3.201  -14.851 -7.356  1.00 0.00 ? 92 DA  B N3     6  
ATOM 10547 C C4     . DA  B 2 11 ? -2.531  -15.635 -6.404  1.00 0.00 ? 92 DA  B C4     6  
ATOM 10548 H "H5'"  . DA  B 2 11 ? -4.368  -14.442 -1.029  1.00 0.00 ? 92 DA  B "H5'"  6  
ATOM 10549 H "H5''" . DA  B 2 11 ? -5.351  -15.878 -0.778  1.00 0.00 ? 92 DA  B "H5''" 6  
ATOM 10550 H "H4'"  . DA  B 2 11 ? -6.234  -14.374 -2.672  1.00 0.00 ? 92 DA  B "H4'"  6  
ATOM 10551 H "H3'"  . DA  B 2 11 ? -6.467  -17.036 -2.433  1.00 0.00 ? 92 DA  B "H3'"  6  
ATOM 10552 H "H2'"  . DA  B 2 11 ? -4.514  -17.577 -3.397  1.00 0.00 ? 92 DA  B "H2'"  6  
ATOM 10553 H "H2''" . DA  B 2 11 ? -5.604  -17.682 -4.843  1.00 0.00 ? 92 DA  B "H2''" 6  
ATOM 10554 H "H1'"  . DA  B 2 11 ? -5.140  -15.638 -5.599  1.00 0.00 ? 92 DA  B "H1'"  6  
ATOM 10555 H H8     . DA  B 2 11 ? -2.282  -17.356 -3.732  1.00 0.00 ? 92 DA  B H8     6  
ATOM 10556 H H61    . DA  B 2 11 ? 1.376   -15.156 -8.252  1.00 0.00 ? 92 DA  B H61    6  
ATOM 10557 H H62    . DA  B 2 11 ? 1.298   -15.917 -6.637  1.00 0.00 ? 92 DA  B H62    6  
ATOM 10558 H H2     . DA  B 2 11 ? -2.727  -13.738 -9.081  1.00 0.00 ? 92 DA  B H2     6  
ATOM 10559 P P      . DG  B 2 12 ? -8.610  -16.955 -4.228  1.00 0.00 ? 93 DG  B P      6  
ATOM 10560 O OP1    . DG  B 2 12 ? -9.848  -16.163 -4.293  1.00 0.00 ? 93 DG  B OP1    6  
ATOM 10561 O OP2    . DG  B 2 12 ? -8.574  -18.138 -3.381  1.00 0.00 ? 93 DG  B OP2    6  
ATOM 10562 O "O5'"  . DG  B 2 12 ? -8.274  -17.291 -5.776  1.00 0.00 ? 93 DG  B "O5'"  6  
ATOM 10563 C "C5'"  . DG  B 2 12 ? -8.587  -16.285 -6.775  1.00 0.00 ? 93 DG  B "C5'"  6  
ATOM 10564 C "C4'"  . DG  B 2 12 ? -7.970  -16.736 -8.074  1.00 0.00 ? 93 DG  B "C4'"  6  
ATOM 10565 O "O4'"  . DG  B 2 12 ? -6.549  -16.776 -8.137  1.00 0.00 ? 93 DG  B "O4'"  6  
ATOM 10566 C "C3'"  . DG  B 2 12 ? -8.440  -18.220 -8.438  1.00 0.00 ? 93 DG  B "C3'"  6  
ATOM 10567 O "O3'"  . DG  B 2 12 ? -9.220  -18.173 -9.703  1.00 0.00 ? 93 DG  B "O3'"  6  
ATOM 10568 C "C2'"  . DG  B 2 12 ? -7.087  -18.965 -8.388  1.00 0.00 ? 93 DG  B "C2'"  6  
ATOM 10569 C "C1'"  . DG  B 2 12 ? -6.106  -17.877 -8.854  1.00 0.00 ? 93 DG  B "C1'"  6  
ATOM 10570 N N9     . DG  B 2 12 ? -4.710  -18.062 -8.526  1.00 0.00 ? 93 DG  B N9     6  
ATOM 10571 C C8     . DG  B 2 12 ? -4.256  -18.697 -7.377  1.00 0.00 ? 93 DG  B C8     6  
ATOM 10572 N N7     . DG  B 2 12 ? -2.964  -18.842 -7.291  1.00 0.00 ? 93 DG  B N7     6  
ATOM 10573 C C5     . DG  B 2 12 ? -2.488  -18.441 -8.520  1.00 0.00 ? 93 DG  B C5     6  
ATOM 10574 C C6     . DG  B 2 12 ? -1.166  -18.500 -9.111  1.00 0.00 ? 93 DG  B C6     6  
ATOM 10575 O O6     . DG  B 2 12 ? -0.126  -19.021 -8.667  1.00 0.00 ? 93 DG  B O6     6  
ATOM 10576 N N1     . DG  B 2 12 ? -1.086  -17.835 -10.286 1.00 0.00 ? 93 DG  B N1     6  
ATOM 10577 C C2     . DG  B 2 12 ? -2.099  -17.237 -10.908 1.00 0.00 ? 93 DG  B C2     6  
ATOM 10578 N N2     . DG  B 2 12 ? -1.823  -16.663 -12.065 1.00 0.00 ? 93 DG  B N2     6  
ATOM 10579 N N3     . DG  B 2 12 ? -3.373  -17.205 -10.459 1.00 0.00 ? 93 DG  B N3     6  
ATOM 10580 C C4     . DG  B 2 12 ? -3.518  -17.836 -9.271  1.00 0.00 ? 93 DG  B C4     6  
ATOM 10581 H "H5'"  . DG  B 2 12 ? -8.107  -15.318 -6.626  1.00 0.00 ? 93 DG  B "H5'"  6  
ATOM 10582 H "H5''" . DG  B 2 12 ? -9.654  -16.234 -6.990  1.00 0.00 ? 93 DG  B "H5''" 6  
ATOM 10583 H "H4'"  . DG  B 2 12 ? -8.347  -16.122 -8.891  1.00 0.00 ? 93 DG  B "H4'"  6  
ATOM 10584 H "H3'"  . DG  B 2 12 ? -8.993  -18.707 -7.634  1.00 0.00 ? 93 DG  B "H3'"  6  
ATOM 10585 H "H2'"  . DG  B 2 12 ? -6.965  -19.208 -7.333  1.00 0.00 ? 93 DG  B "H2'"  6  
ATOM 10586 H "H2''" . DG  B 2 12 ? -7.053  -19.820 -9.064  1.00 0.00 ? 93 DG  B "H2''" 6  
ATOM 10587 H "H1'"  . DG  B 2 12 ? -6.222  -17.703 -9.924  1.00 0.00 ? 93 DG  B "H1'"  6  
ATOM 10588 H H8     . DG  B 2 12 ? -5.031  -18.982 -6.681  1.00 0.00 ? 93 DG  B H8     6  
ATOM 10589 H H1     . DG  B 2 12 ? -0.332  -18.056 -10.920 1.00 0.00 ? 93 DG  B H1     6  
ATOM 10590 H H21    . DG  B 2 12 ? -2.414  -15.966 -12.496 1.00 0.00 ? 93 DG  B H21    6  
ATOM 10591 H H22    . DG  B 2 12 ? -0.929  -16.919 -12.460 1.00 0.00 ? 93 DG  B H22    6  
ATOM 10592 P P      . DC  B 2 13 ? -9.719  -19.450 -10.423 1.00 0.00 ? 94 DC  B P      6  
ATOM 10593 O OP1    . DC  B 2 13 ? -10.805 -19.086 -11.385 1.00 0.00 ? 94 DC  B OP1    6  
ATOM 10594 O OP2    . DC  B 2 13 ? -10.095 -20.482 -9.402  1.00 0.00 ? 94 DC  B OP2    6  
ATOM 10595 O "O5'"  . DC  B 2 13 ? -8.455  -19.918 -11.252 1.00 0.00 ? 94 DC  B "O5'"  6  
ATOM 10596 C "C5'"  . DC  B 2 13 ? -8.195  -19.289 -12.528 1.00 0.00 ? 94 DC  B "C5'"  6  
ATOM 10597 C "C4'"  . DC  B 2 13 ? -7.199  -20.141 -13.277 1.00 0.00 ? 94 DC  B "C4'"  6  
ATOM 10598 O "O4'"  . DC  B 2 13 ? -5.916  -19.930 -12.723 1.00 0.00 ? 94 DC  B "O4'"  6  
ATOM 10599 C "C3'"  . DC  B 2 13 ? -7.480  -21.653 -13.304 1.00 0.00 ? 94 DC  B "C3'"  6  
ATOM 10600 O "O3'"  . DC  B 2 13 ? -7.667  -22.022 -14.642 1.00 0.00 ? 94 DC  B "O3'"  6  
ATOM 10601 C "C2'"  . DC  B 2 13 ? -6.235  -22.373 -12.781 1.00 0.00 ? 94 DC  B "C2'"  6  
ATOM 10602 C "C1'"  . DC  B 2 13 ? -5.220  -21.199 -12.804 1.00 0.00 ? 94 DC  B "C1'"  6  
ATOM 10603 N N1     . DC  B 2 13 ? -4.243  -21.354 -11.698 1.00 0.00 ? 94 DC  B N1     6  
ATOM 10604 C C2     . DC  B 2 13 ? -2.877  -21.397 -11.843 1.00 0.00 ? 94 DC  B C2     6  
ATOM 10605 O O2     . DC  B 2 13 ? -2.372  -21.223 -12.921 1.00 0.00 ? 94 DC  B O2     6  
ATOM 10606 N N3     . DC  B 2 13 ? -2.060  -21.434 -10.728 1.00 0.00 ? 94 DC  B N3     6  
ATOM 10607 C C4     . DC  B 2 13 ? -2.591  -21.607 -9.535  1.00 0.00 ? 94 DC  B C4     6  
ATOM 10608 N N4     . DC  B 2 13 ? -1.665  -21.885 -8.641  1.00 0.00 ? 94 DC  B N4     6  
ATOM 10609 C C5     . DC  B 2 13 ? -3.961  -21.602 -9.296  1.00 0.00 ? 94 DC  B C5     6  
ATOM 10610 C C6     . DC  B 2 13 ? -4.735  -21.392 -10.389 1.00 0.00 ? 94 DC  B C6     6  
ATOM 10611 H "H5'"  . DC  B 2 13 ? -7.851  -18.266 -12.378 1.00 0.00 ? 94 DC  B "H5'"  6  
ATOM 10612 H "H5''" . DC  B 2 13 ? -9.159  -19.241 -13.035 1.00 0.00 ? 94 DC  B "H5''" 6  
ATOM 10613 H "H4'"  . DC  B 2 13 ? -7.209  -19.711 -14.279 1.00 0.00 ? 94 DC  B "H4'"  6  
ATOM 10614 H "H3'"  . DC  B 2 13 ? -8.339  -21.919 -12.689 1.00 0.00 ? 94 DC  B "H3'"  6  
ATOM 10615 H "HO3'" . DC  B 2 13 ? -8.616  -22.128 -14.744 1.00 0.00 ? 94 DC  B "HO3'" 6  
ATOM 10616 H "H2'"  . DC  B 2 13 ? -6.353  -22.742 -11.762 1.00 0.00 ? 94 DC  B "H2'"  6  
ATOM 10617 H "H2''" . DC  B 2 13 ? -6.025  -23.200 -13.460 1.00 0.00 ? 94 DC  B "H2''" 6  
ATOM 10618 H "H1'"  . DC  B 2 13 ? -4.617  -21.356 -13.697 1.00 0.00 ? 94 DC  B "H1'"  6  
ATOM 10619 H H41    . DC  B 2 13 ? -2.043  -22.123 -7.735  1.00 0.00 ? 94 DC  B H41    6  
ATOM 10620 H H42    . DC  B 2 13 ? -0.667  -21.775 -8.751  1.00 0.00 ? 94 DC  B H42    6  
ATOM 10621 H H5     . DC  B 2 13 ? -4.328  -21.537 -8.282  1.00 0.00 ? 94 DC  B H5     6  
ATOM 10622 H H6     . DC  B 2 13 ? -5.792  -21.255 -10.215 1.00 0.00 ? 94 DC  B H6     6  
ATOM 10623 N N      . GLY C 3 1  ? -0.833  -4.985  5.338   1.00 0.00 ? 1  GLY P N      6  
ATOM 10624 C CA     . GLY C 3 1  ? -0.996  -5.448  3.913   1.00 0.00 ? 1  GLY P CA     6  
ATOM 10625 C C      . GLY C 3 1  ? -1.929  -6.631  3.886   1.00 0.00 ? 1  GLY P C      6  
ATOM 10626 O O      . GLY C 3 1  ? -1.483  -7.774  4.066   1.00 0.00 ? 1  GLY P O      6  
ATOM 10627 H H1     . GLY C 3 1  ? -0.519  -5.790  5.861   1.00 0.00 ? 1  GLY P H1     6  
ATOM 10628 H H2     . GLY C 3 1  ? -1.718  -4.730  5.753   1.00 0.00 ? 1  GLY P H2     6  
ATOM 10629 H H3     . GLY C 3 1  ? -0.198  -4.203  5.414   1.00 0.00 ? 1  GLY P H3     6  
ATOM 10630 H HA2    . GLY C 3 1  ? -1.290  -4.623  3.264   1.00 0.00 ? 1  GLY P HA2    6  
ATOM 10631 H HA3    . GLY C 3 1  ? -0.039  -5.803  3.530   1.00 0.00 ? 1  GLY P HA3    6  
ATOM 10632 N N      . PRO C 3 2  ? -3.291  -6.478  3.566   1.00 0.00 ? 2  PRO P N      6  
ATOM 10633 C CA     . PRO C 3 2  ? -4.277  -7.499  3.565   1.00 0.00 ? 2  PRO P CA     6  
ATOM 10634 C C      . PRO C 3 2  ? -3.871  -8.870  2.953   1.00 0.00 ? 2  PRO P C      6  
ATOM 10635 O O      . PRO C 3 2  ? -4.073  -9.959  3.417   1.00 0.00 ? 2  PRO P O      6  
ATOM 10636 C CB     . PRO C 3 2  ? -5.600  -6.935  2.945   1.00 0.00 ? 2  PRO P CB     6  
ATOM 10637 C CG     . PRO C 3 2  ? -5.375  -5.424  3.150   1.00 0.00 ? 2  PRO P CG     6  
ATOM 10638 C CD     . PRO C 3 2  ? -3.917  -5.170  3.370   1.00 0.00 ? 2  PRO P CD     6  
ATOM 10639 H HA     . PRO C 3 2  ? -4.405  -7.682  4.632   1.00 0.00 ? 2  PRO P HA     6  
ATOM 10640 H HB2    . PRO C 3 2  ? -5.539  -7.039  1.862   1.00 0.00 ? 2  PRO P HB2    6  
ATOM 10641 H HB3    . PRO C 3 2  ? -6.517  -7.317  3.393   1.00 0.00 ? 2  PRO P HB3    6  
ATOM 10642 H HG2    . PRO C 3 2  ? -5.732  -4.895  2.266   1.00 0.00 ? 2  PRO P HG2    6  
ATOM 10643 H HG3    . PRO C 3 2  ? -6.023  -5.257  4.010   1.00 0.00 ? 2  PRO P HG3    6  
ATOM 10644 H HD2    . PRO C 3 2  ? -3.483  -4.619  2.535   1.00 0.00 ? 2  PRO P HD2    6  
ATOM 10645 H HD3    . PRO C 3 2  ? -3.812  -4.562  4.269   1.00 0.00 ? 2  PRO P HD3    6  
ATOM 10646 N N      . ARG C 3 3  ? -3.126  -8.773  1.811   1.00 0.00 ? 3  ARG P N      6  
ATOM 10647 C CA     . ARG C 3 3  ? -2.586  -9.951  1.135   1.00 0.00 ? 3  ARG P CA     6  
ATOM 10648 C C      . ARG C 3 3  ? -1.623  -10.842 1.944   1.00 0.00 ? 3  ARG P C      6  
ATOM 10649 O O      . ARG C 3 3  ? -1.469  -12.063 1.646   1.00 0.00 ? 3  ARG P O      6  
ATOM 10650 C CB     . ARG C 3 3  ? -1.808  -9.538  -0.127  1.00 0.00 ? 3  ARG P CB     6  
ATOM 10651 C CG     . ARG C 3 3  ? -2.615  -9.549  -1.402  1.00 0.00 ? 3  ARG P CG     6  
ATOM 10652 C CD     . ARG C 3 3  ? -1.732  -9.972  -2.524  1.00 0.00 ? 3  ARG P CD     6  
ATOM 10653 N NE     . ARG C 3 3  ? -0.731  -8.946  -2.947  1.00 0.00 ? 3  ARG P NE     6  
ATOM 10654 C CZ     . ARG C 3 3  ? 0.572   -8.892  -2.699  1.00 0.00 ? 3  ARG P CZ     6  
ATOM 10655 N NH1    . ARG C 3 3  ? 1.223   -9.839  -2.061  1.00 0.00 ? 3  ARG P NH1    6  
ATOM 10656 N NH2    . ARG C 3 3  ? 1.200   -7.833  -2.999  1.00 0.00 ? 3  ARG P NH2    6  
ATOM 10657 H H      . ARG C 3 3  ? -3.127  -7.887  1.327   1.00 0.00 ? 3  ARG P H      6  
ATOM 10658 H HA     . ARG C 3 3  ? -3.359  -10.612 0.740   1.00 0.00 ? 3  ARG P HA     6  
ATOM 10659 H HB2    . ARG C 3 3  ? -1.259  -8.603  -0.021  1.00 0.00 ? 3  ARG P HB2    6  
ATOM 10660 H HB3    . ARG C 3 3  ? -1.015  -10.282 -0.193  1.00 0.00 ? 3  ARG P HB3    6  
ATOM 10661 H HG2    . ARG C 3 3  ? -3.416  -10.289 -1.394  1.00 0.00 ? 3  ARG P HG2    6  
ATOM 10662 H HG3    . ARG C 3 3  ? -3.109  -8.603  -1.619  1.00 0.00 ? 3  ARG P HG3    6  
ATOM 10663 H HD2    . ARG C 3 3  ? -1.129  -10.802 -2.151  1.00 0.00 ? 3  ARG P HD2    6  
ATOM 10664 H HD3    . ARG C 3 3  ? -2.384  -10.353 -3.310  1.00 0.00 ? 3  ARG P HD3    6  
ATOM 10665 H HE     . ARG C 3 3  ? -1.034  -8.411  -3.749  1.00 0.00 ? 3  ARG P HE     6  
ATOM 10666 H HH11   . ARG C 3 3  ? 0.634   -10.608 -1.779  1.00 0.00 ? 3  ARG P HH11   6  
ATOM 10667 H HH12   . ARG C 3 3  ? 2.171   -9.735  -1.730  1.00 0.00 ? 3  ARG P HH12   6  
ATOM 10668 H HH21   . ARG C 3 3  ? 0.666   -7.120  -3.472  1.00 0.00 ? 3  ARG P HH21   6  
ATOM 10669 H HH22   . ARG C 3 3  ? 2.168   -7.639  -2.781  1.00 0.00 ? 3  ARG P HH22   6  
ATOM 10670 N N      . ARG C 3 4  ? -0.911  -10.247 2.887   1.00 0.00 ? 4  ARG P N      6  
ATOM 10671 C CA     . ARG C 3 4  ? 0.272   -10.830 3.485   1.00 0.00 ? 4  ARG P CA     6  
ATOM 10672 C C      . ARG C 3 4  ? 0.003   -11.205 4.998   1.00 0.00 ? 4  ARG P C      6  
ATOM 10673 O O      . ARG C 3 4  ? 0.672   -12.082 5.542   1.00 0.00 ? 4  ARG P O      6  
ATOM 10674 C CB     . ARG C 3 4  ? 1.540   -9.922  3.426   1.00 0.00 ? 4  ARG P CB     6  
ATOM 10675 C CG     . ARG C 3 4  ? 1.718   -9.196  2.053   1.00 0.00 ? 4  ARG P CG     6  
ATOM 10676 C CD     . ARG C 3 4  ? 2.951   -8.253  1.915   1.00 0.00 ? 4  ARG P CD     6  
ATOM 10677 N NE     . ARG C 3 4  ? 2.973   -7.281  2.986   1.00 0.00 ? 4  ARG P NE     6  
ATOM 10678 C CZ     . ARG C 3 4  ? 3.536   -7.463  4.246   1.00 0.00 ? 4  ARG P CZ     6  
ATOM 10679 N NH1    . ARG C 3 4  ? 4.075   -8.579  4.665   1.00 0.00 ? 4  ARG P NH1    6  
ATOM 10680 N NH2    . ARG C 3 4  ? 3.550   -6.508  5.123   1.00 0.00 ? 4  ARG P NH2    6  
ATOM 10681 H H      . ARG C 3 4  ? -1.155  -9.270  2.956   1.00 0.00 ? 4  ARG P H      6  
ATOM 10682 H HA     . ARG C 3 4  ? 0.428   -11.743 2.909   1.00 0.00 ? 4  ARG P HA     6  
ATOM 10683 H HB2    . ARG C 3 4  ? 1.391   -9.210  4.238   1.00 0.00 ? 4  ARG P HB2    6  
ATOM 10684 H HB3    . ARG C 3 4  ? 2.391   -10.586 3.577   1.00 0.00 ? 4  ARG P HB3    6  
ATOM 10685 H HG2    . ARG C 3 4  ? 1.736   -9.944  1.260   1.00 0.00 ? 4  ARG P HG2    6  
ATOM 10686 H HG3    . ARG C 3 4  ? 0.773   -8.704  1.822   1.00 0.00 ? 4  ARG P HG3    6  
ATOM 10687 H HD2    . ARG C 3 4  ? 3.789   -8.951  1.913   1.00 0.00 ? 4  ARG P HD2    6  
ATOM 10688 H HD3    . ARG C 3 4  ? 2.891   -7.791  0.929   1.00 0.00 ? 4  ARG P HD3    6  
ATOM 10689 H HE     . ARG C 3 4  ? 2.697   -6.321  2.838   1.00 0.00 ? 4  ARG P HE     6  
ATOM 10690 H HH11   . ARG C 3 4  ? 4.154   -9.382  4.057   1.00 0.00 ? 4  ARG P HH11   6  
ATOM 10691 H HH12   . ARG C 3 4  ? 3.979   -8.751  5.655   1.00 0.00 ? 4  ARG P HH12   6  
ATOM 10692 H HH21   . ARG C 3 4  ? 3.231   -5.612  4.782   1.00 0.00 ? 4  ARG P HH21   6  
ATOM 10693 H HH22   . ARG C 3 4  ? 4.089   -6.608  5.970   1.00 0.00 ? 4  ARG P HH22   6  
ATOM 10694 N N      . THR C 3 5  ? -0.882  -10.492 5.653   1.00 0.00 ? 5  THR P N      6  
ATOM 10695 C CA     . THR C 3 5  ? -1.235  -10.644 7.041   1.00 0.00 ? 5  THR P CA     6  
ATOM 10696 C C      . THR C 3 5  ? -2.624  -10.170 7.400   1.00 0.00 ? 5  THR P C      6  
ATOM 10697 O O      . THR C 3 5  ? -3.452  -10.009 6.468   1.00 0.00 ? 5  THR P O      6  
ATOM 10698 C CB     . THR C 3 5  ? -0.100  -9.945  7.791   1.00 0.00 ? 5  THR P CB     6  
ATOM 10699 O OG1    . THR C 3 5  ? 0.019   -10.337 9.153   1.00 0.00 ? 5  THR P OG1    6  
ATOM 10700 C CG2    . THR C 3 5  ? -0.104  -8.461  7.579   1.00 0.00 ? 5  THR P CG2    6  
ATOM 10701 H H      . THR C 3 5  ? -1.396  -9.812  5.111   1.00 0.00 ? 5  THR P H      6  
ATOM 10702 H HA     . THR C 3 5  ? -1.121  -11.685 7.344   1.00 0.00 ? 5  THR P HA     6  
ATOM 10703 H HB     . THR C 3 5  ? 0.847   -10.242 7.341   1.00 0.00 ? 5  THR P HB     6  
ATOM 10704 H HG1    . THR C 3 5  ? 0.874   -10.003 9.436   1.00 0.00 ? 5  THR P HG1    6  
ATOM 10705 H HG21   . THR C 3 5  ? -0.640  -7.912  8.353   1.00 0.00 ? 5  THR P HG21   6  
ATOM 10706 H HG22   . THR C 3 5  ? -0.466  -8.257  6.571   1.00 0.00 ? 5  THR P HG22   6  
ATOM 10707 H HG23   . THR C 3 5  ? 0.960   -8.230  7.628   1.00 0.00 ? 5  THR P HG23   6  
ATOM 10708 N N      . ARG C 3 6  ? -2.893  -9.832  8.715   1.00 0.00 ? 6  ARG P N      6  
ATOM 10709 C CA     . ARG C 3 6  ? -4.239  -9.391  9.238   1.00 0.00 ? 6  ARG P CA     6  
ATOM 10710 C C      . ARG C 3 6  ? -4.875  -8.272  8.446   1.00 0.00 ? 6  ARG P C      6  
ATOM 10711 O O      . ARG C 3 6  ? -4.098  -7.421  7.972   1.00 0.00 ? 6  ARG P O      6  
ATOM 10712 C CB     . ARG C 3 6  ? -4.053  -9.108  10.709  1.00 0.00 ? 6  ARG P CB     6  
ATOM 10713 C CG     . ARG C 3 6  ? -3.135  -7.971  11.067  1.00 0.00 ? 6  ARG P CG     6  
ATOM 10714 C CD     . ARG C 3 6  ? -3.291  -7.567  12.632  1.00 0.00 ? 6  ARG P CD     6  
ATOM 10715 N NE     . ARG C 3 6  ? -2.562  -8.434  13.490  1.00 0.00 ? 6  ARG P NE     6  
ATOM 10716 C CZ     . ARG C 3 6  ? -1.247  -8.465  13.698  1.00 0.00 ? 6  ARG P CZ     6  
ATOM 10717 N NH1    . ARG C 3 6  ? -0.361  -7.686  13.132  1.00 0.00 ? 6  ARG P NH1    6  
ATOM 10718 N NH2    . ARG C 3 6  ? -0.779  -9.354  14.488  1.00 0.00 ? 6  ARG P NH2    6  
ATOM 10719 H H      . ARG C 3 6  ? -2.230  -10.094 9.432   1.00 0.00 ? 6  ARG P H      6  
ATOM 10720 H HA     . ARG C 3 6  ? -4.825  -10.307 9.157   1.00 0.00 ? 6  ARG P HA     6  
ATOM 10721 H HB2    . ARG C 3 6  ? -5.062  -9.035  11.117  1.00 0.00 ? 6  ARG P HB2    6  
ATOM 10722 H HB3    . ARG C 3 6  ? -3.609  -10.045 11.045  1.00 0.00 ? 6  ARG P HB3    6  
ATOM 10723 H HG2    . ARG C 3 6  ? -2.075  -8.186  10.923  1.00 0.00 ? 6  ARG P HG2    6  
ATOM 10724 H HG3    . ARG C 3 6  ? -3.395  -7.137  10.415  1.00 0.00 ? 6  ARG P HG3    6  
ATOM 10725 H HD2    . ARG C 3 6  ? -2.819  -6.584  12.652  1.00 0.00 ? 6  ARG P HD2    6  
ATOM 10726 H HD3    . ARG C 3 6  ? -4.341  -7.535  12.922  1.00 0.00 ? 6  ARG P HD3    6  
ATOM 10727 H HE     . ARG C 3 6  ? -3.084  -9.042  14.104  1.00 0.00 ? 6  ARG P HE     6  
ATOM 10728 H HH11   . ARG C 3 6  ? -0.605  -7.026  12.407  1.00 0.00 ? 6  ARG P HH11   6  
ATOM 10729 H HH12   . ARG C 3 6  ? 0.586   -7.858  13.437  1.00 0.00 ? 6  ARG P HH12   6  
ATOM 10730 H HH21   . ARG C 3 6  ? -1.363  -10.119 14.793  1.00 0.00 ? 6  ARG P HH21   6  
ATOM 10731 H HH22   . ARG C 3 6  ? 0.219   -9.405  14.631  1.00 0.00 ? 6  ARG P HH22   6  
ATOM 10732 N N      . THR C 3 7  ? -6.186  -8.294  8.273   1.00 0.00 ? 7  THR P N      6  
ATOM 10733 C CA     . THR C 3 7  ? -7.107  -7.491  7.365   1.00 0.00 ? 7  THR P CA     6  
ATOM 10734 C C      . THR C 3 7  ? -7.496  -8.305  6.149   1.00 0.00 ? 7  THR P C      6  
ATOM 10735 O O      . THR C 3 7  ? -6.662  -9.001  5.542   1.00 0.00 ? 7  THR P O      6  
ATOM 10736 C CB     . THR C 3 7  ? -6.557  -6.164  6.884   1.00 0.00 ? 7  THR P CB     6  
ATOM 10737 O OG1    . THR C 3 7  ? -6.179  -5.340  8.013   1.00 0.00 ? 7  THR P OG1    6  
ATOM 10738 C CG2    . THR C 3 7  ? -7.675  -5.414  6.141   1.00 0.00 ? 7  THR P CG2    6  
ATOM 10739 H H      . THR C 3 7  ? -6.686  -9.041  8.734   1.00 0.00 ? 7  THR P H      6  
ATOM 10740 H HA     . THR C 3 7  ? -8.035  -7.381  7.927   1.00 0.00 ? 7  THR P HA     6  
ATOM 10741 H HB     . THR C 3 7  ? -5.719  -6.481  6.264   1.00 0.00 ? 7  THR P HB     6  
ATOM 10742 H HG1    . THR C 3 7  ? -5.474  -5.829  8.445   1.00 0.00 ? 7  THR P HG1    6  
ATOM 10743 H HG21   . THR C 3 7  ? -7.174  -4.484  5.869   1.00 0.00 ? 7  THR P HG21   6  
ATOM 10744 H HG22   . THR C 3 7  ? -8.547  -5.315  6.786   1.00 0.00 ? 7  THR P HG22   6  
ATOM 10745 H HG23   . THR C 3 7  ? -7.890  -5.822  5.153   1.00 0.00 ? 7  THR P HG23   6  
ATOM 10746 N N      . THR C 3 8  ? -8.690  -8.139  5.623   1.00 0.00 ? 8  THR P N      6  
ATOM 10747 C CA     . THR C 3 8  ? -9.116  -8.733  4.294   1.00 0.00 ? 8  THR P CA     6  
ATOM 10748 C C      . THR C 3 8  ? -10.233 -7.841  3.761   1.00 0.00 ? 8  THR P C      6  
ATOM 10749 O O      . THR C 3 8  ? -11.289 -7.870  4.428   1.00 0.00 ? 8  THR P O      6  
ATOM 10750 C CB     . THR C 3 8  ? -9.685  -10.113 4.517   1.00 0.00 ? 8  THR P CB     6  
ATOM 10751 O OG1    . THR C 3 8  ? -8.634  -11.017 4.827   1.00 0.00 ? 8  THR P OG1    6  
ATOM 10752 C CG2    . THR C 3 8  ? -10.409 -10.779 3.393   1.00 0.00 ? 8  THR P CG2    6  
ATOM 10753 H H      . THR C 3 8  ? -9.505  -7.816  6.123   1.00 0.00 ? 8  THR P H      6  
ATOM 10754 H HA     . THR C 3 8  ? -8.320  -8.741  3.551   1.00 0.00 ? 8  THR P HA     6  
ATOM 10755 H HB     . THR C 3 8  ? -10.420 -10.165 5.320   1.00 0.00 ? 8  THR P HB     6  
ATOM 10756 H HG1    . THR C 3 8  ? -8.511  -11.075 5.778   1.00 0.00 ? 8  THR P HG1    6  
ATOM 10757 H HG21   . THR C 3 8  ? -10.774 -11.801 3.494   1.00 0.00 ? 8  THR P HG21   6  
ATOM 10758 H HG22   . THR C 3 8  ? -9.713  -10.740 2.555   1.00 0.00 ? 8  THR P HG22   6  
ATOM 10759 H HG23   . THR C 3 8  ? -11.267 -10.190 3.069   1.00 0.00 ? 8  THR P HG23   6  
ATOM 10760 N N      . PHE C 3 9  ? -10.035 -7.062  2.715   1.00 0.00 ? 9  PHE P N      6  
ATOM 10761 C CA     . PHE C 3 9  ? -11.132 -6.211  2.259   1.00 0.00 ? 9  PHE P CA     6  
ATOM 10762 C C      . PHE C 3 9  ? -12.409 -6.942  1.772   1.00 0.00 ? 9  PHE P C      6  
ATOM 10763 O O      . PHE C 3 9  ? -12.252 -8.100  1.233   1.00 0.00 ? 9  PHE P O      6  
ATOM 10764 C CB     . PHE C 3 9  ? -10.728 -5.274  1.122   1.00 0.00 ? 9  PHE P CB     6  
ATOM 10765 C CG     . PHE C 3 9  ? -9.808  -4.041  1.297   1.00 0.00 ? 9  PHE P CG     6  
ATOM 10766 C CD1    . PHE C 3 9  ? -8.745  -4.094  2.212   1.00 0.00 ? 9  PHE P CD1    6  
ATOM 10767 C CD2    . PHE C 3 9  ? -9.944  -2.896  0.520   1.00 0.00 ? 9  PHE P CD2    6  
ATOM 10768 C CE1    . PHE C 3 9  ? -7.858  -3.039  2.385   1.00 0.00 ? 9  PHE P CE1    6  
ATOM 10769 C CE2    . PHE C 3 9  ? -9.129  -1.775  0.740   1.00 0.00 ? 9  PHE P CE2    6  
ATOM 10770 C CZ     . PHE C 3 9  ? -8.026  -1.893  1.567   1.00 0.00 ? 9  PHE P CZ     6  
ATOM 10771 H H      . PHE C 3 9  ? -9.149  -7.006  2.234   1.00 0.00 ? 9  PHE P H      6  
ATOM 10772 H HA     . PHE C 3 9  ? -11.457 -5.563  3.072   1.00 0.00 ? 9  PHE P HA     6  
ATOM 10773 H HB2    . PHE C 3 9  ? -10.314 -5.890  0.323   1.00 0.00 ? 9  PHE P HB2    6  
ATOM 10774 H HB3    . PHE C 3 9  ? -11.678 -4.845  0.803   1.00 0.00 ? 9  PHE P HB3    6  
ATOM 10775 H HD1    . PHE C 3 9  ? -8.618  -5.001  2.783   1.00 0.00 ? 9  PHE P HD1    6  
ATOM 10776 H HD2    . PHE C 3 9  ? -10.725 -2.950  -0.224  1.00 0.00 ? 9  PHE P HD2    6  
ATOM 10777 H HE1    . PHE C 3 9  ? -7.045  -3.195  3.079   1.00 0.00 ? 9  PHE P HE1    6  
ATOM 10778 H HE2    . PHE C 3 9  ? -9.227  -0.968  0.028   1.00 0.00 ? 9  PHE P HE2    6  
ATOM 10779 H HZ     . PHE C 3 9  ? -7.369  -1.041  1.493   1.00 0.00 ? 9  PHE P HZ     6  
ATOM 10780 N N      . THR C 3 10 ? -13.587 -6.323  1.929   1.00 0.00 ? 10 THR P N      6  
ATOM 10781 C CA     . THR C 3 10 ? -14.832 -6.876  1.376   1.00 0.00 ? 10 THR P CA     6  
ATOM 10782 C C      . THR C 3 10 ? -15.480 -5.852  0.364   1.00 0.00 ? 10 THR P C      6  
ATOM 10783 O O      . THR C 3 10 ? -15.143 -4.672  0.397   1.00 0.00 ? 10 THR P O      6  
ATOM 10784 C CB     . THR C 3 10 ? -15.802 -7.150  2.517   1.00 0.00 ? 10 THR P CB     6  
ATOM 10785 O OG1    . THR C 3 10 ? -16.179 -5.942  3.085   1.00 0.00 ? 10 THR P OG1    6  
ATOM 10786 C CG2    . THR C 3 10 ? -15.311 -8.177  3.560   1.00 0.00 ? 10 THR P CG2    6  
ATOM 10787 H H      . THR C 3 10 ? -13.623 -5.472  2.471   1.00 0.00 ? 10 THR P H      6  
ATOM 10788 H HA     . THR C 3 10 ? -14.684 -7.821  0.855   1.00 0.00 ? 10 THR P HA     6  
ATOM 10789 H HB     . THR C 3 10 ? -16.591 -7.523  1.863   1.00 0.00 ? 10 THR P HB     6  
ATOM 10790 H HG1    . THR C 3 10 ? -16.736 -6.125  3.844   1.00 0.00 ? 10 THR P HG1    6  
ATOM 10791 H HG21   . THR C 3 10 ? -16.221 -8.568  4.013   1.00 0.00 ? 10 THR P HG21   6  
ATOM 10792 H HG22   . THR C 3 10 ? -14.764 -7.671  4.356   1.00 0.00 ? 10 THR P HG22   6  
ATOM 10793 H HG23   . THR C 3 10 ? -14.678 -8.912  3.062   1.00 0.00 ? 10 THR P HG23   6  
ATOM 10794 N N      . SER C 3 11 ? -16.520 -6.292  -0.369  1.00 0.00 ? 11 SER P N      6  
ATOM 10795 C CA     . SER C 3 11 ? -17.228 -5.437  -1.279  1.00 0.00 ? 11 SER P CA     6  
ATOM 10796 C C      . SER C 3 11 ? -17.881 -4.259  -0.527  1.00 0.00 ? 11 SER P C      6  
ATOM 10797 O O      . SER C 3 11 ? -17.817 -3.160  -1.087  1.00 0.00 ? 11 SER P O      6  
ATOM 10798 C CB     . SER C 3 11 ? -18.305 -6.219  -2.103  1.00 0.00 ? 11 SER P CB     6  
ATOM 10799 O OG     . SER C 3 11 ? -17.682 -7.175  -2.944  1.00 0.00 ? 11 SER P OG     6  
ATOM 10800 H H      . SER C 3 11 ? -16.580 -7.274  -0.596  1.00 0.00 ? 11 SER P H      6  
ATOM 10801 H HA     . SER C 3 11 ? -16.580 -4.919  -1.985  1.00 0.00 ? 11 SER P HA     6  
ATOM 10802 H HB2    . SER C 3 11 ? -19.022 -6.590  -1.371  1.00 0.00 ? 11 SER P HB2    6  
ATOM 10803 H HB3    . SER C 3 11 ? -18.887 -5.491  -2.668  1.00 0.00 ? 11 SER P HB3    6  
ATOM 10804 H HG     . SER C 3 11 ? -17.391 -6.683  -3.715  1.00 0.00 ? 11 SER P HG     6  
ATOM 10805 N N      . SER C 3 12 ? -18.445 -4.512  0.639   1.00 0.00 ? 12 SER P N      6  
ATOM 10806 C CA     . SER C 3 12 ? -18.900 -3.435  1.614   1.00 0.00 ? 12 SER P CA     6  
ATOM 10807 C C      . SER C 3 12 ? -17.890 -2.385  1.898   1.00 0.00 ? 12 SER P C      6  
ATOM 10808 O O      . SER C 3 12 ? -18.238 -1.210  2.028   1.00 0.00 ? 12 SER P O      6  
ATOM 10809 C CB     . SER C 3 12 ? -19.276 -4.093  2.878   1.00 0.00 ? 12 SER P CB     6  
ATOM 10810 O OG     . SER C 3 12 ? -19.968 -3.138  3.679   1.00 0.00 ? 12 SER P OG     6  
ATOM 10811 H H      . SER C 3 12 ? -18.608 -5.453  0.967   1.00 0.00 ? 12 SER P H      6  
ATOM 10812 H HA     . SER C 3 12 ? -19.740 -2.874  1.202   1.00 0.00 ? 12 SER P HA     6  
ATOM 10813 H HB2    . SER C 3 12 ? -19.961 -4.926  2.721   1.00 0.00 ? 12 SER P HB2    6  
ATOM 10814 H HB3    . SER C 3 12 ? -18.397 -4.424  3.431   1.00 0.00 ? 12 SER P HB3    6  
ATOM 10815 H HG     . SER C 3 12 ? -19.748 -3.307  4.598   1.00 0.00 ? 12 SER P HG     6  
ATOM 10816 N N      . GLN C 3 13 ? -16.687 -2.830  2.238   1.00 0.00 ? 13 GLN P N      6  
ATOM 10817 C CA     . GLN C 3 13 ? -15.584 -1.872  2.445   1.00 0.00 ? 13 GLN P CA     6  
ATOM 10818 C C      . GLN C 3 13 ? -15.280 -1.075  1.126   1.00 0.00 ? 13 GLN P C      6  
ATOM 10819 O O      . GLN C 3 13 ? -15.397 0.160   1.229   1.00 0.00 ? 13 GLN P O      6  
ATOM 10820 C CB     . GLN C 3 13 ? -14.364 -2.574  2.978   1.00 0.00 ? 13 GLN P CB     6  
ATOM 10821 C CG     . GLN C 3 13 ? -14.675 -3.197  4.304   1.00 0.00 ? 13 GLN P CG     6  
ATOM 10822 C CD     . GLN C 3 13 ? -13.514 -3.884  5.024   1.00 0.00 ? 13 GLN P CD     6  
ATOM 10823 O OE1    . GLN C 3 13 ? -13.020 -4.905  4.532   1.00 0.00 ? 13 GLN P OE1    6  
ATOM 10824 N NE2    . GLN C 3 13 ? -12.979 -3.244  5.999   1.00 0.00 ? 13 GLN P NE2    6  
ATOM 10825 H H      . GLN C 3 13 ? -16.425 -3.804  2.174   1.00 0.00 ? 13 GLN P H      6  
ATOM 10826 H HA     . GLN C 3 13 ? -15.758 -1.172  3.262   1.00 0.00 ? 13 GLN P HA     6  
ATOM 10827 H HB2    . GLN C 3 13 ? -13.922 -3.305  2.299   1.00 0.00 ? 13 GLN P HB2    6  
ATOM 10828 H HB3    . GLN C 3 13 ? -13.543 -1.889  3.189   1.00 0.00 ? 13 GLN P HB3    6  
ATOM 10829 H HG2    . GLN C 3 13 ? -14.996 -2.363  4.929   1.00 0.00 ? 13 GLN P HG2    6  
ATOM 10830 H HG3    . GLN C 3 13 ? -15.395 -4.015  4.351   1.00 0.00 ? 13 GLN P HG3    6  
ATOM 10831 H HE21   . GLN C 3 13 ? -13.400 -2.370  6.281   1.00 0.00 ? 13 GLN P HE21   6  
ATOM 10832 H HE22   . GLN C 3 13 ? -12.296 -3.784  6.511   1.00 0.00 ? 13 GLN P HE22   6  
ATOM 10833 N N      . ILE C 3 14 ? -15.174 -1.772  0.024   1.00 0.00 ? 14 ILE P N      6  
ATOM 10834 C CA     . ILE C 3 14 ? -14.956 -0.989  -1.211  1.00 0.00 ? 14 ILE P CA     6  
ATOM 10835 C C      . ILE C 3 14 ? -16.154 -0.067  -1.532  1.00 0.00 ? 14 ILE P C      6  
ATOM 10836 O O      . ILE C 3 14 ? -15.937 0.928   -2.107  1.00 0.00 ? 14 ILE P O      6  
ATOM 10837 C CB     . ILE C 3 14 ? -14.565 -1.860  -2.397  1.00 0.00 ? 14 ILE P CB     6  
ATOM 10838 C CG1    . ILE C 3 14 ? -13.252 -2.490  -2.001  1.00 0.00 ? 14 ILE P CG1    6  
ATOM 10839 C CG2    . ILE C 3 14 ? -14.449 -1.179  -3.736  1.00 0.00 ? 14 ILE P CG2    6  
ATOM 10840 C CD1    . ILE C 3 14 ? -13.071 -3.751  -2.903  1.00 0.00 ? 14 ILE P CD1    6  
ATOM 10841 H H      . ILE C 3 14 ? -15.159 -2.781  -0.025  1.00 0.00 ? 14 ILE P H      6  
ATOM 10842 H HA     . ILE C 3 14 ? -14.033 -0.466  -0.960  1.00 0.00 ? 14 ILE P HA     6  
ATOM 10843 H HB     . ILE C 3 14 ? -15.364 -2.599  -2.431  1.00 0.00 ? 14 ILE P HB     6  
ATOM 10844 H HG12   . ILE C 3 14 ? -12.426 -1.784  -2.092  1.00 0.00 ? 14 ILE P HG12   6  
ATOM 10845 H HG13   . ILE C 3 14 ? -13.234 -2.828  -0.965  1.00 0.00 ? 14 ILE P HG13   6  
ATOM 10846 H HG21   . ILE C 3 14 ? -15.426 -0.764  -3.978  1.00 0.00 ? 14 ILE P HG21   6  
ATOM 10847 H HG22   . ILE C 3 14 ? -13.838 -0.291  -3.574  1.00 0.00 ? 14 ILE P HG22   6  
ATOM 10848 H HG23   . ILE C 3 14 ? -14.143 -1.870  -4.521  1.00 0.00 ? 14 ILE P HG23   6  
ATOM 10849 H HD11   . ILE C 3 14 ? -12.321 -4.364  -2.401  1.00 0.00 ? 14 ILE P HD11   6  
ATOM 10850 H HD12   . ILE C 3 14 ? -14.015 -4.291  -2.963  1.00 0.00 ? 14 ILE P HD12   6  
ATOM 10851 H HD13   . ILE C 3 14 ? -12.884 -3.390  -3.913  1.00 0.00 ? 14 ILE P HD13   6  
ATOM 10852 N N      . ALA C 3 15 ? -17.349 -0.467  -1.089  1.00 0.00 ? 15 ALA P N      6  
ATOM 10853 C CA     . ALA C 3 15 ? -18.598 0.306   -1.248  1.00 0.00 ? 15 ALA P CA     6  
ATOM 10854 C C      . ALA C 3 15 ? -18.556 1.588   -0.365  1.00 0.00 ? 15 ALA P C      6  
ATOM 10855 O O      . ALA C 3 15 ? -18.873 2.656   -0.907  1.00 0.00 ? 15 ALA P O      6  
ATOM 10856 C CB     . ALA C 3 15 ? -19.855 -0.479  -0.842  1.00 0.00 ? 15 ALA P CB     6  
ATOM 10857 H H      . ALA C 3 15 ? -17.332 -1.419  -0.751  1.00 0.00 ? 15 ALA P H      6  
ATOM 10858 H HA     . ALA C 3 15 ? -18.635 0.689   -2.269  1.00 0.00 ? 15 ALA P HA     6  
ATOM 10859 H HB1    . ALA C 3 15 ? -20.788 -0.008  -1.147  1.00 0.00 ? 15 ALA P HB1    6  
ATOM 10860 H HB2    . ALA C 3 15 ? -19.806 -1.464  -1.307  1.00 0.00 ? 15 ALA P HB2    6  
ATOM 10861 H HB3    . ALA C 3 15 ? -19.780 -0.736  0.215   1.00 0.00 ? 15 ALA P HB3    6  
ATOM 10862 N N      . GLU C 3 16 ? -18.117 1.471   0.890   1.00 0.00 ? 16 GLU P N      6  
ATOM 10863 C CA     . GLU C 3 16 ? -17.790 2.624   1.768   1.00 0.00 ? 16 GLU P CA     6  
ATOM 10864 C C      . GLU C 3 16 ? -16.743 3.498   1.007   1.00 0.00 ? 16 GLU P C      6  
ATOM 10865 O O      . GLU C 3 16 ? -16.955 4.703   0.894   1.00 0.00 ? 16 GLU P O      6  
ATOM 10866 C CB     . GLU C 3 16 ? -17.142 2.180   3.081   1.00 0.00 ? 16 GLU P CB     6  
ATOM 10867 C CG     . GLU C 3 16 ? -17.827 1.374   4.181   1.00 0.00 ? 16 GLU P CG     6  
ATOM 10868 C CD     . GLU C 3 16 ? -19.173 2.096   4.562   1.00 0.00 ? 16 GLU P CD     6  
ATOM 10869 O OE1    . GLU C 3 16 ? -19.102 3.219   5.148   1.00 0.00 ? 16 GLU P OE1    6  
ATOM 10870 O OE2    . GLU C 3 16 ? -20.297 1.515   4.405   1.00 0.00 ? 16 GLU P OE2    6  
ATOM 10871 H H      . GLU C 3 16 ? -17.682 0.598   1.152   1.00 0.00 ? 16 GLU P H      6  
ATOM 10872 H HA     . GLU C 3 16 ? -18.639 3.297   1.883   1.00 0.00 ? 16 GLU P HA     6  
ATOM 10873 H HB2    . GLU C 3 16 ? -16.457 1.416   2.713   1.00 0.00 ? 16 GLU P HB2    6  
ATOM 10874 H HB3    . GLU C 3 16 ? -16.634 2.979   3.621   1.00 0.00 ? 16 GLU P HB3    6  
ATOM 10875 H HG2    . GLU C 3 16 ? -18.061 0.416   3.717   1.00 0.00 ? 16 GLU P HG2    6  
ATOM 10876 H HG3    . GLU C 3 16 ? -17.122 1.315   5.012   1.00 0.00 ? 16 GLU P HG3    6  
ATOM 10877 N N      . LEU C 3 17 ? -15.576 2.904   0.578   1.00 0.00 ? 17 LEU P N      6  
ATOM 10878 C CA     . LEU C 3 17 ? -14.479 3.642   0.073   1.00 0.00 ? 17 LEU P CA     6  
ATOM 10879 C C      . LEU C 3 17 ? -14.865 4.366   -1.170  1.00 0.00 ? 17 LEU P C      6  
ATOM 10880 O O      . LEU C 3 17 ? -14.601 5.543   -1.306  1.00 0.00 ? 17 LEU P O      6  
ATOM 10881 C CB     . LEU C 3 17 ? -13.295 2.786   -0.244  1.00 0.00 ? 17 LEU P CB     6  
ATOM 10882 C CG     . LEU C 3 17 ? -12.436 2.540   0.991   1.00 0.00 ? 17 LEU P CG     6  
ATOM 10883 C CD1    . LEU C 3 17 ? -11.649 1.165   1.048   1.00 0.00 ? 17 LEU P CD1    6  
ATOM 10884 C CD2    . LEU C 3 17 ? -11.449 3.675   1.352   1.00 0.00 ? 17 LEU P CD2    6  
ATOM 10885 H H      . LEU C 3 17 ? -15.542 1.925   0.823   1.00 0.00 ? 17 LEU P H      6  
ATOM 10886 H HA     . LEU C 3 17 ? -14.268 4.359   0.867   1.00 0.00 ? 17 LEU P HA     6  
ATOM 10887 H HB2    . LEU C 3 17 ? -13.798 1.900   -0.630  1.00 0.00 ? 17 LEU P HB2    6  
ATOM 10888 H HB3    . LEU C 3 17 ? -12.695 3.225   -1.042  1.00 0.00 ? 17 LEU P HB3    6  
ATOM 10889 H HG     . LEU C 3 17 ? -13.240 2.480   1.725   1.00 0.00 ? 17 LEU P HG     6  
ATOM 10890 H HD11   . LEU C 3 17 ? -10.892 1.141   0.263   1.00 0.00 ? 17 LEU P HD11   6  
ATOM 10891 H HD12   . LEU C 3 17 ? -12.364 0.344   1.095   1.00 0.00 ? 17 LEU P HD12   6  
ATOM 10892 H HD13   . LEU C 3 17 ? -11.111 1.234   1.993   1.00 0.00 ? 17 LEU P HD13   6  
ATOM 10893 H HD21   . LEU C 3 17 ? -10.784 3.317   2.139   1.00 0.00 ? 17 LEU P HD21   6  
ATOM 10894 H HD22   . LEU C 3 17 ? -12.153 4.427   1.705   1.00 0.00 ? 17 LEU P HD22   6  
ATOM 10895 H HD23   . LEU C 3 17 ? -10.945 4.056   0.464   1.00 0.00 ? 17 LEU P HD23   6  
ATOM 10896 N N      . GLU C 3 18 ? -15.664 3.727   -2.081  1.00 0.00 ? 18 GLU P N      6  
ATOM 10897 C CA     . GLU C 3 18 ? -16.279 4.414   -3.278  1.00 0.00 ? 18 GLU P CA     6  
ATOM 10898 C C      . GLU C 3 18 ? -17.305 5.482   -2.916  1.00 0.00 ? 18 GLU P C      6  
ATOM 10899 O O      . GLU C 3 18 ? -17.236 6.553   -3.538  1.00 0.00 ? 18 GLU P O      6  
ATOM 10900 C CB     . GLU C 3 18 ? -17.001 3.374   -4.195  1.00 0.00 ? 18 GLU P CB     6  
ATOM 10901 C CG     . GLU C 3 18 ? -15.947 2.684   -5.133  1.00 0.00 ? 18 GLU P CG     6  
ATOM 10902 C CD     . GLU C 3 18 ? -16.513 1.562   -6.044  1.00 0.00 ? 18 GLU P CD     6  
ATOM 10903 O OE1    . GLU C 3 18 ? -17.700 1.268   -6.005  1.00 0.00 ? 18 GLU P OE1    6  
ATOM 10904 O OE2    . GLU C 3 18 ? -15.726 0.979   -6.852  1.00 0.00 ? 18 GLU P OE2    6  
ATOM 10905 H H      . GLU C 3 18 ? -15.723 2.722   -2.000  1.00 0.00 ? 18 GLU P H      6  
ATOM 10906 H HA     . GLU C 3 18 ? -15.557 4.984   -3.863  1.00 0.00 ? 18 GLU P HA     6  
ATOM 10907 H HB2    . GLU C 3 18 ? -17.611 2.659   -3.643  1.00 0.00 ? 18 GLU P HB2    6  
ATOM 10908 H HB3    . GLU C 3 18 ? -17.703 3.881   -4.856  1.00 0.00 ? 18 GLU P HB3    6  
ATOM 10909 H HG2    . GLU C 3 18 ? -15.424 3.468   -5.681  1.00 0.00 ? 18 GLU P HG2    6  
ATOM 10910 H HG3    . GLU C 3 18 ? -15.195 2.182   -4.525  1.00 0.00 ? 18 GLU P HG3    6  
ATOM 10911 N N      . GLN C 3 19 ? -18.245 5.221   -2.007  1.00 0.00 ? 19 GLN P N      6  
ATOM 10912 C CA     . GLN C 3 19 ? -19.325 6.235   -1.739  1.00 0.00 ? 19 GLN P CA     6  
ATOM 10913 C C      . GLN C 3 19 ? -18.794 7.492   -1.110  1.00 0.00 ? 19 GLN P C      6  
ATOM 10914 O O      . GLN C 3 19 ? -19.082 8.579   -1.591  1.00 0.00 ? 19 GLN P O      6  
ATOM 10915 C CB     . GLN C 3 19 ? -20.334 5.534   -0.788  1.00 0.00 ? 19 GLN P CB     6  
ATOM 10916 C CG     . GLN C 3 19 ? -21.197 4.536   -1.611  1.00 0.00 ? 19 GLN P CG     6  
ATOM 10917 C CD     . GLN C 3 19 ? -22.113 5.033   -2.657  1.00 0.00 ? 19 GLN P CD     6  
ATOM 10918 O OE1    . GLN C 3 19 ? -23.003 5.786   -2.334  1.00 0.00 ? 19 GLN P OE1    6  
ATOM 10919 N NE2    . GLN C 3 19 ? -21.852 4.810   -3.954  1.00 0.00 ? 19 GLN P NE2    6  
ATOM 10920 H H      . GLN C 3 19 ? -18.203 4.303   -1.588  1.00 0.00 ? 19 GLN P H      6  
ATOM 10921 H HA     . GLN C 3 19 ? -19.785 6.510   -2.688  1.00 0.00 ? 19 GLN P HA     6  
ATOM 10922 H HB2    . GLN C 3 19 ? -19.850 5.068   0.071   1.00 0.00 ? 19 GLN P HB2    6  
ATOM 10923 H HB3    . GLN C 3 19 ? -21.017 6.340   -0.521  1.00 0.00 ? 19 GLN P HB3    6  
ATOM 10924 H HG2    . GLN C 3 19 ? -20.611 3.749   -2.087  1.00 0.00 ? 19 GLN P HG2    6  
ATOM 10925 H HG3    . GLN C 3 19 ? -21.802 4.021   -0.866  1.00 0.00 ? 19 GLN P HG3    6  
ATOM 10926 H HE21   . GLN C 3 19 ? -21.177 4.147   -4.309  1.00 0.00 ? 19 GLN P HE21   6  
ATOM 10927 H HE22   . GLN C 3 19 ? -22.497 5.166   -4.645  1.00 0.00 ? 19 GLN P HE22   6  
ATOM 10928 N N      . HIS C 3 20 ? -17.934 7.414   -0.122  1.00 0.00 ? 20 HIS P N      6  
ATOM 10929 C CA     . HIS C 3 20 ? -17.161 8.575   0.410   1.00 0.00 ? 20 HIS P CA     6  
ATOM 10930 C C      . HIS C 3 20 ? -16.115 9.172   -0.639  1.00 0.00 ? 20 HIS P C      6  
ATOM 10931 O O      . HIS C 3 20 ? -15.778 10.360  -0.672  1.00 0.00 ? 20 HIS P O      6  
ATOM 10932 C CB     . HIS C 3 20 ? -16.696 8.241   1.733   1.00 0.00 ? 20 HIS P CB     6  
ATOM 10933 C CG     . HIS C 3 20 ? -17.862 7.885   2.562   1.00 0.00 ? 20 HIS P CG     6  
ATOM 10934 N ND1    . HIS C 3 20 ? -18.956 8.660   2.744   1.00 0.00 ? 20 HIS P ND1    6  
ATOM 10935 C CD2    . HIS C 3 20 ? -18.187 6.651   3.126   1.00 0.00 ? 20 HIS P CD2    6  
ATOM 10936 C CE1    . HIS C 3 20 ? -20.019 7.992   3.267   1.00 0.00 ? 20 HIS P CE1    6  
ATOM 10937 N NE2    . HIS C 3 20 ? -19.612 6.698   3.469   1.00 0.00 ? 20 HIS P NE2    6  
ATOM 10938 H H      . HIS C 3 20 ? -17.559 6.510   0.127   1.00 0.00 ? 20 HIS P H      6  
ATOM 10939 H HA     . HIS C 3 20 ? -17.884 9.378   0.560   1.00 0.00 ? 20 HIS P HA     6  
ATOM 10940 H HB2    . HIS C 3 20 ? -16.061 7.357   1.662   1.00 0.00 ? 20 HIS P HB2    6  
ATOM 10941 H HB3    . HIS C 3 20 ? -16.201 9.074   2.233   1.00 0.00 ? 20 HIS P HB3    6  
ATOM 10942 H HD1    . HIS C 3 20 ? -19.055 9.568   2.313   1.00 0.00 ? 20 HIS P HD1    6  
ATOM 10943 H HD2    . HIS C 3 20 ? -17.555 5.775   3.125   1.00 0.00 ? 20 HIS P HD2    6  
ATOM 10944 H HE1    . HIS C 3 20 ? -21.038 8.349   3.304   1.00 0.00 ? 20 HIS P HE1    6  
ATOM 10945 N N      . PHE C 3 21 ? -15.569 8.314   -1.506  1.00 0.00 ? 21 PHE P N      6  
ATOM 10946 C CA     . PHE C 3 21 ? -14.822 8.810   -2.637  1.00 0.00 ? 21 PHE P CA     6  
ATOM 10947 C C      . PHE C 3 21 ? -15.595 9.665   -3.631  1.00 0.00 ? 21 PHE P C      6  
ATOM 10948 O O      . PHE C 3 21 ? -14.992 10.566  -4.229  1.00 0.00 ? 21 PHE P O      6  
ATOM 10949 C CB     . PHE C 3 21 ? -14.099 7.669   -3.349  1.00 0.00 ? 21 PHE P CB     6  
ATOM 10950 C CG     . PHE C 3 21 ? -13.796 7.826   -4.838  1.00 0.00 ? 21 PHE P CG     6  
ATOM 10951 C CD1    . PHE C 3 21 ? -14.916 7.682   -5.678  1.00 0.00 ? 21 PHE P CD1    6  
ATOM 10952 C CD2    . PHE C 3 21 ? -12.539 8.042   -5.418  1.00 0.00 ? 21 PHE P CD2    6  
ATOM 10953 C CE1    . PHE C 3 21 ? -14.876 7.906   -7.036  1.00 0.00 ? 21 PHE P CE1    6  
ATOM 10954 C CE2    . PHE C 3 21 ? -12.463 8.149   -6.850  1.00 0.00 ? 21 PHE P CE2    6  
ATOM 10955 C CZ     . PHE C 3 21 ? -13.623 8.033   -7.661  1.00 0.00 ? 21 PHE P CZ     6  
ATOM 10956 H H      . PHE C 3 21 ? -15.674 7.346   -1.236  1.00 0.00 ? 21 PHE P H      6  
ATOM 10957 H HA     . PHE C 3 21 ? -14.131 9.541   -2.219  1.00 0.00 ? 21 PHE P HA     6  
ATOM 10958 H HB2    . PHE C 3 21 ? -13.295 7.455   -2.645  1.00 0.00 ? 21 PHE P HB2    6  
ATOM 10959 H HB3    . PHE C 3 21 ? -14.744 6.799   -3.227  1.00 0.00 ? 21 PHE P HB3    6  
ATOM 10960 H HD1    . PHE C 3 21 ? -15.795 7.375   -5.131  1.00 0.00 ? 21 PHE P HD1    6  
ATOM 10961 H HD2    . PHE C 3 21 ? -11.683 7.999   -4.761  1.00 0.00 ? 21 PHE P HD2    6  
ATOM 10962 H HE1    . PHE C 3 21 ? -15.793 7.947   -7.606  1.00 0.00 ? 21 PHE P HE1    6  
ATOM 10963 H HE2    . PHE C 3 21 ? -11.505 8.160   -7.350  1.00 0.00 ? 21 PHE P HE2    6  
ATOM 10964 H HZ     . PHE C 3 21 ? -13.537 8.120   -8.734  1.00 0.00 ? 21 PHE P HZ     6  
ATOM 10965 N N      . LEU C 3 22 ? -16.899 9.447   -3.731  1.00 0.00 ? 22 LEU P N      6  
ATOM 10966 C CA     . LEU C 3 22 ? -17.741 10.352  -4.586  1.00 0.00 ? 22 LEU P CA     6  
ATOM 10967 C C      . LEU C 3 22 ? -17.535 11.781  -4.134  1.00 0.00 ? 22 LEU P C      6  
ATOM 10968 O O      . LEU C 3 22 ? -17.631 12.718  -4.907  1.00 0.00 ? 22 LEU P O      6  
ATOM 10969 C CB     . LEU C 3 22 ? -19.238 9.944   -4.592  1.00 0.00 ? 22 LEU P CB     6  
ATOM 10970 C CG     . LEU C 3 22 ? -19.587 8.546   -5.073  1.00 0.00 ? 22 LEU P CG     6  
ATOM 10971 C CD1    . LEU C 3 22 ? -21.087 8.312   -4.987  1.00 0.00 ? 22 LEU P CD1    6  
ATOM 10972 C CD2    . LEU C 3 22 ? -19.182 8.384   -6.511  1.00 0.00 ? 22 LEU P CD2    6  
ATOM 10973 H H      . LEU C 3 22 ? -17.289 8.693   -3.183  1.00 0.00 ? 22 LEU P H      6  
ATOM 10974 H HA     . LEU C 3 22 ? -17.367 10.205  -5.600  1.00 0.00 ? 22 LEU P HA     6  
ATOM 10975 H HB2    . LEU C 3 22 ? -19.585 10.137  -3.576  1.00 0.00 ? 22 LEU P HB2    6  
ATOM 10976 H HB3    . LEU C 3 22 ? -19.715 10.633  -5.288  1.00 0.00 ? 22 LEU P HB3    6  
ATOM 10977 H HG     . LEU C 3 22 ? -19.061 7.807   -4.469  1.00 0.00 ? 22 LEU P HG     6  
ATOM 10978 H HD11   . LEU C 3 22 ? -21.613 9.065   -5.574  1.00 0.00 ? 22 LEU P HD11   6  
ATOM 10979 H HD12   . LEU C 3 22 ? -21.369 8.263   -3.936  1.00 0.00 ? 22 LEU P HD12   6  
ATOM 10980 H HD13   . LEU C 3 22 ? -21.402 7.320   -5.312  1.00 0.00 ? 22 LEU P HD13   6  
ATOM 10981 H HD21   . LEU C 3 22 ? -18.097 8.318   -6.589  1.00 0.00 ? 22 LEU P HD21   6  
ATOM 10982 H HD22   . LEU C 3 22 ? -19.427 9.242   -7.135  1.00 0.00 ? 22 LEU P HD22   6  
ATOM 10983 H HD23   . LEU C 3 22 ? -19.605 7.457   -6.897  1.00 0.00 ? 22 LEU P HD23   6  
ATOM 10984 N N      . GLN C 3 23 ? -17.238 11.945  -2.860  1.00 0.00 ? 23 GLN P N      6  
ATOM 10985 C CA     . GLN C 3 23 ? -17.071 13.280  -2.163  1.00 0.00 ? 23 GLN P CA     6  
ATOM 10986 C C      . GLN C 3 23 ? -15.719 13.892  -2.272  1.00 0.00 ? 23 GLN P C      6  
ATOM 10987 O O      . GLN C 3 23 ? -15.572 15.062  -2.004  1.00 0.00 ? 23 GLN P O      6  
ATOM 10988 C CB     . GLN C 3 23 ? -17.502 13.151  -0.715  1.00 0.00 ? 23 GLN P CB     6  
ATOM 10989 C CG     . GLN C 3 23 ? -18.860 12.406  -0.529  1.00 0.00 ? 23 GLN P CG     6  
ATOM 10990 C CD     . GLN C 3 23 ? -19.990 12.844  -1.511  1.00 0.00 ? 23 GLN P CD     6  
ATOM 10991 O OE1    . GLN C 3 23 ? -20.031 14.043  -1.881  1.00 0.00 ? 23 GLN P OE1    6  
ATOM 10992 N NE2    . GLN C 3 23 ? -20.830 11.927  -1.911  1.00 0.00 ? 23 GLN P NE2    6  
ATOM 10993 H H      . GLN C 3 23 ? -17.040 11.116  -2.318  1.00 0.00 ? 23 GLN P H      6  
ATOM 10994 H HA     . GLN C 3 23 ? -17.665 14.018  -2.703  1.00 0.00 ? 23 GLN P HA     6  
ATOM 10995 H HB2    . GLN C 3 23 ? -16.797 12.516  -0.179  1.00 0.00 ? 23 GLN P HB2    6  
ATOM 10996 H HB3    . GLN C 3 23 ? -17.446 14.096  -0.175  1.00 0.00 ? 23 GLN P HB3    6  
ATOM 10997 H HG2    . GLN C 3 23 ? -18.677 11.340  -0.664  1.00 0.00 ? 23 GLN P HG2    6  
ATOM 10998 H HG3    . GLN C 3 23 ? -19.082 12.652  0.509   1.00 0.00 ? 23 GLN P HG3    6  
ATOM 10999 H HE21   . GLN C 3 23 ? -20.656 10.996  -1.562  1.00 0.00 ? 23 GLN P HE21   6  
ATOM 11000 H HE22   . GLN C 3 23 ? -21.656 12.172  -2.439  1.00 0.00 ? 23 GLN P HE22   6  
ATOM 11001 N N      . GLY C 3 24 ? -14.690 13.056  -2.697  1.00 0.00 ? 24 GLY P N      6  
ATOM 11002 C CA     . GLY C 3 24 ? -13.300 13.467  -2.989  1.00 0.00 ? 24 GLY P CA     6  
ATOM 11003 C C      . GLY C 3 24 ? -12.388 12.427  -3.634  1.00 0.00 ? 24 GLY P C      6  
ATOM 11004 O O      . GLY C 3 24 ? -12.276 11.364  -3.016  1.00 0.00 ? 24 GLY P O      6  
ATOM 11005 H H      . GLY C 3 24 ? -14.958 12.098  -2.873  1.00 0.00 ? 24 GLY P H      6  
ATOM 11006 H HA2    . GLY C 3 24 ? -13.326 14.408  -3.540  1.00 0.00 ? 24 GLY P HA2    6  
ATOM 11007 H HA3    . GLY C 3 24 ? -12.731 13.743  -2.102  1.00 0.00 ? 24 GLY P HA3    6  
ATOM 11008 N N      . ARG C 3 25 ? -11.674 12.782  -4.722  1.00 0.00 ? 25 ARG P N      6  
ATOM 11009 C CA     . ARG C 3 25 ? -10.873 11.874  -5.538  1.00 0.00 ? 25 ARG P CA     6  
ATOM 11010 C C      . ARG C 3 25 ? -9.540  11.511  -4.910  1.00 0.00 ? 25 ARG P C      6  
ATOM 11011 O O      . ARG C 3 25 ? -9.009  10.454  -5.255  1.00 0.00 ? 25 ARG P O      6  
ATOM 11012 C CB     . ARG C 3 25 ? -10.707 12.525  -6.907  1.00 0.00 ? 25 ARG P CB     6  
ATOM 11013 C CG     . ARG C 3 25 ? -11.869 12.503  -7.909  1.00 0.00 ? 25 ARG P CG     6  
ATOM 11014 C CD     . ARG C 3 25 ? -12.500 11.159  -7.989  1.00 0.00 ? 25 ARG P CD     6  
ATOM 11015 N NE     . ARG C 3 25 ? -13.452 11.009  -9.159  1.00 0.00 ? 25 ARG P NE     6  
ATOM 11016 C CZ     . ARG C 3 25 ? -14.787 10.974  -9.121  1.00 0.00 ? 25 ARG P CZ     6  
ATOM 11017 N NH1    . ARG C 3 25 ? -15.508 11.181  -8.073  1.00 0.00 ? 25 ARG P NH1    6  
ATOM 11018 N NH2    . ARG C 3 25 ? -15.421 10.773  -10.274 1.00 0.00 ? 25 ARG P NH2    6  
ATOM 11019 H H      . ARG C 3 25 ? -11.756 13.749  -5.002  1.00 0.00 ? 25 ARG P H      6  
ATOM 11020 H HA     . ARG C 3 25 ? -11.333 10.897  -5.682  1.00 0.00 ? 25 ARG P HA     6  
ATOM 11021 H HB2    . ARG C 3 25 ? -10.428 13.569  -6.763  1.00 0.00 ? 25 ARG P HB2    6  
ATOM 11022 H HB3    . ARG C 3 25 ? -9.840  12.043  -7.361  1.00 0.00 ? 25 ARG P HB3    6  
ATOM 11023 H HG2    . ARG C 3 25 ? -12.630 13.164  -7.494  1.00 0.00 ? 25 ARG P HG2    6  
ATOM 11024 H HG3    . ARG C 3 25 ? -11.570 12.734  -8.932  1.00 0.00 ? 25 ARG P HG3    6  
ATOM 11025 H HD2    . ARG C 3 25 ? -11.732 10.387  -7.979  1.00 0.00 ? 25 ARG P HD2    6  
ATOM 11026 H HD3    . ARG C 3 25 ? -12.939 10.976  -7.008  1.00 0.00 ? 25 ARG P HD3    6  
ATOM 11027 H HE     . ARG C 3 25 ? -13.045 10.937  -10.081 1.00 0.00 ? 25 ARG P HE     6  
ATOM 11028 H HH11   . ARG C 3 25 ? -15.090 11.353  -7.170  1.00 0.00 ? 25 ARG P HH11   6  
ATOM 11029 H HH12   . ARG C 3 25 ? -16.459 11.511  -8.156  1.00 0.00 ? 25 ARG P HH12   6  
ATOM 11030 H HH21   . ARG C 3 25 ? -14.875 10.782  -11.124 1.00 0.00 ? 25 ARG P HH21   6  
ATOM 11031 H HH22   . ARG C 3 25 ? -16.430 10.784  -10.275 1.00 0.00 ? 25 ARG P HH22   6  
ATOM 11032 N N      . TYR C 3 26 ? -9.091  12.286  -3.893  1.00 0.00 ? 26 TYR P N      6  
ATOM 11033 C CA     . TYR C 3 26 ? -7.880  11.964  -3.098  1.00 0.00 ? 26 TYR P CA     6  
ATOM 11034 C C      . TYR C 3 26 ? -8.128  11.980  -1.601  1.00 0.00 ? 26 TYR P C      6  
ATOM 11035 O O      . TYR C 3 26 ? -9.300  12.163  -1.208  1.00 0.00 ? 26 TYR P O      6  
ATOM 11036 C CB     . TYR C 3 26 ? -6.888  13.085  -3.414  1.00 0.00 ? 26 TYR P CB     6  
ATOM 11037 C CG     . TYR C 3 26 ? -6.696  13.491  -4.874  1.00 0.00 ? 26 TYR P CG     6  
ATOM 11038 C CD1    . TYR C 3 26 ? -5.638  12.981  -5.600  1.00 0.00 ? 26 TYR P CD1    6  
ATOM 11039 C CD2    . TYR C 3 26 ? -7.474  14.464  -5.485  1.00 0.00 ? 26 TYR P CD2    6  
ATOM 11040 C CE1    . TYR C 3 26 ? -5.458  13.430  -6.927  1.00 0.00 ? 26 TYR P CE1    6  
ATOM 11041 C CE2    . TYR C 3 26 ? -7.394  14.804  -6.838  1.00 0.00 ? 26 TYR P CE2    6  
ATOM 11042 C CZ     . TYR C 3 26 ? -6.310  14.342  -7.541  1.00 0.00 ? 26 TYR P CZ     6  
ATOM 11043 O OH     . TYR C 3 26 ? -6.116  14.633  -8.813  1.00 0.00 ? 26 TYR P OH     6  
ATOM 11044 H H      . TYR C 3 26 ? -9.584  13.157  -3.752  1.00 0.00 ? 26 TYR P H      6  
ATOM 11045 H HA     . TYR C 3 26 ? -7.453  10.971  -3.246  1.00 0.00 ? 26 TYR P HA     6  
ATOM 11046 H HB2    . TYR C 3 26 ? -7.135  14.003  -2.880  1.00 0.00 ? 26 TYR P HB2    6  
ATOM 11047 H HB3    . TYR C 3 26 ? -5.924  12.813  -2.986  1.00 0.00 ? 26 TYR P HB3    6  
ATOM 11048 H HD1    . TYR C 3 26 ? -5.018  12.179  -5.226  1.00 0.00 ? 26 TYR P HD1    6  
ATOM 11049 H HD2    . TYR C 3 26 ? -8.328  14.888  -4.978  1.00 0.00 ? 26 TYR P HD2    6  
ATOM 11050 H HE1    . TYR C 3 26 ? -4.694  12.968  -7.536  1.00 0.00 ? 26 TYR P HE1    6  
ATOM 11051 H HE2    . TYR C 3 26 ? -8.181  15.379  -7.303  1.00 0.00 ? 26 TYR P HE2    6  
ATOM 11052 H HH     . TYR C 3 26 ? -5.190  14.450  -8.984  1.00 0.00 ? 26 TYR P HH     6  
ATOM 11053 N N      . LEU C 3 27 ? -7.088  11.873  -0.783  1.00 0.00 ? 27 LEU P N      6  
ATOM 11054 C CA     . LEU C 3 27 ? -7.130  11.901  0.653   1.00 0.00 ? 27 LEU P CA     6  
ATOM 11055 C C      . LEU C 3 27 ? -6.611  13.135  1.396   1.00 0.00 ? 27 LEU P C      6  
ATOM 11056 O O      . LEU C 3 27 ? -5.774  13.879  0.919   1.00 0.00 ? 27 LEU P O      6  
ATOM 11057 C CB     . LEU C 3 27 ? -6.420  10.668  1.235   1.00 0.00 ? 27 LEU P CB     6  
ATOM 11058 C CG     . LEU C 3 27 ? -7.208  9.420   1.579   1.00 0.00 ? 27 LEU P CG     6  
ATOM 11059 C CD1    . LEU C 3 27 ? -6.319  8.655   2.546   1.00 0.00 ? 27 LEU P CD1    6  
ATOM 11060 C CD2    . LEU C 3 27 ? -8.530  9.618   2.377   1.00 0.00 ? 27 LEU P CD2    6  
ATOM 11061 H H      . LEU C 3 27 ? -6.200  11.683  -1.226  1.00 0.00 ? 27 LEU P H      6  
ATOM 11062 H HA     . LEU C 3 27 ? -8.189  11.921  0.910   1.00 0.00 ? 27 LEU P HA     6  
ATOM 11063 H HB2    . LEU C 3 27 ? -5.659  10.287  0.552   1.00 0.00 ? 27 LEU P HB2    6  
ATOM 11064 H HB3    . LEU C 3 27 ? -5.679  10.895  2.001   1.00 0.00 ? 27 LEU P HB3    6  
ATOM 11065 H HG     . LEU C 3 27 ? -7.372  8.791   0.704   1.00 0.00 ? 27 LEU P HG     6  
ATOM 11066 H HD11   . LEU C 3 27 ? -5.425  8.341   2.008   1.00 0.00 ? 27 LEU P HD11   6  
ATOM 11067 H HD12   . LEU C 3 27 ? -6.803  7.730   2.862   1.00 0.00 ? 27 LEU P HD12   6  
ATOM 11068 H HD13   . LEU C 3 27 ? -6.133  9.198   3.473   1.00 0.00 ? 27 LEU P HD13   6  
ATOM 11069 H HD21   . LEU C 3 27 ? -8.954  8.714   2.814   1.00 0.00 ? 27 LEU P HD21   6  
ATOM 11070 H HD22   . LEU C 3 27 ? -9.296  9.867   1.642   1.00 0.00 ? 27 LEU P HD22   6  
ATOM 11071 H HD23   . LEU C 3 27 ? -8.400  10.398  3.127   1.00 0.00 ? 27 LEU P HD23   6  
ATOM 11072 N N      . THR C 3 28 ? -7.135  13.249  2.654   1.00 0.00 ? 28 THR P N      6  
ATOM 11073 C CA     . THR C 3 28 ? -6.564  14.042  3.764   1.00 0.00 ? 28 THR P CA     6  
ATOM 11074 C C      . THR C 3 28 ? -6.922  13.406  5.088   1.00 0.00 ? 28 THR P C      6  
ATOM 11075 O O      . THR C 3 28 ? -7.758  12.458  5.045   1.00 0.00 ? 28 THR P O      6  
ATOM 11076 C CB     . THR C 3 28 ? -7.064  15.462  3.742   1.00 0.00 ? 28 THR P CB     6  
ATOM 11077 O OG1    . THR C 3 28 ? -8.416  15.467  4.060   1.00 0.00 ? 28 THR P OG1    6  
ATOM 11078 C CG2    . THR C 3 28 ? -6.885  16.299  2.422   1.00 0.00 ? 28 THR P CG2    6  
ATOM 11079 H H      . THR C 3 28 ? -7.901  12.658  2.944   1.00 0.00 ? 28 THR P H      6  
ATOM 11080 H HA     . THR C 3 28 ? -5.476  14.075  3.700   1.00 0.00 ? 28 THR P HA     6  
ATOM 11081 H HB     . THR C 3 28 ? -6.589  16.052  4.526   1.00 0.00 ? 28 THR P HB     6  
ATOM 11082 H HG1    . THR C 3 28 ? -8.639  16.364  4.320   1.00 0.00 ? 28 THR P HG1    6  
ATOM 11083 H HG21   . THR C 3 28 ? -7.382  17.262  2.536   1.00 0.00 ? 28 THR P HG21   6  
ATOM 11084 H HG22   . THR C 3 28 ? -7.300  15.827  1.532   1.00 0.00 ? 28 THR P HG22   6  
ATOM 11085 H HG23   . THR C 3 28 ? -5.864  16.552  2.135   1.00 0.00 ? 28 THR P HG23   6  
ATOM 11086 N N      . ALA C 3 29 ? -6.337  13.835  6.197   1.00 0.00 ? 29 ALA P N      6  
ATOM 11087 C CA     . ALA C 3 29 ? -6.659  13.166  7.444   1.00 0.00 ? 29 ALA P CA     6  
ATOM 11088 C C      . ALA C 3 29 ? -8.154  13.035  7.881   1.00 0.00 ? 29 ALA P C      6  
ATOM 11089 O O      . ALA C 3 29 ? -8.465  11.929  8.330   1.00 0.00 ? 29 ALA P O      6  
ATOM 11090 C CB     . ALA C 3 29 ? -5.903  13.811  8.594   1.00 0.00 ? 29 ALA P CB     6  
ATOM 11091 H H      . ALA C 3 29 ? -5.498  14.392  6.126   1.00 0.00 ? 29 ALA P H      6  
ATOM 11092 H HA     . ALA C 3 29 ? -6.245  12.158  7.444   1.00 0.00 ? 29 ALA P HA     6  
ATOM 11093 H HB1    . ALA C 3 29 ? -6.171  13.250  9.490   1.00 0.00 ? 29 ALA P HB1    6  
ATOM 11094 H HB2    . ALA C 3 29 ? -4.833  13.762  8.394   1.00 0.00 ? 29 ALA P HB2    6  
ATOM 11095 H HB3    . ALA C 3 29 ? -6.175  14.864  8.675   1.00 0.00 ? 29 ALA P HB3    6  
ATOM 11096 N N      . PRO C 3 30 ? -8.890  14.138  7.794   1.00 0.00 ? 30 PRO P N      6  
ATOM 11097 C CA     . PRO C 3 30 ? -10.355 14.037  8.005   1.00 0.00 ? 30 PRO P CA     6  
ATOM 11098 C C      . PRO C 3 30 ? -10.979 13.025  7.057   1.00 0.00 ? 30 PRO P C      6  
ATOM 11099 O O      . PRO C 3 30 ? -11.786 12.259  7.547   1.00 0.00 ? 30 PRO P O      6  
ATOM 11100 C CB     . PRO C 3 30 ? -10.876 15.513  7.795   1.00 0.00 ? 30 PRO P CB     6  
ATOM 11101 C CG     . PRO C 3 30 ? -9.790  16.314  7.143   1.00 0.00 ? 30 PRO P CG     6  
ATOM 11102 C CD     . PRO C 3 30 ? -8.571  15.487  7.415   1.00 0.00 ? 30 PRO P CD     6  
ATOM 11103 H HA     . PRO C 3 30 ? -10.570 13.703  9.020   1.00 0.00 ? 30 PRO P HA     6  
ATOM 11104 H HB2    . PRO C 3 30 ? -11.804 15.514  7.221   1.00 0.00 ? 30 PRO P HB2    6  
ATOM 11105 H HB3    . PRO C 3 30 ? -11.017 15.924  8.796   1.00 0.00 ? 30 PRO P HB3    6  
ATOM 11106 H HG2    . PRO C 3 30 ? -9.831  16.456  6.063   1.00 0.00 ? 30 PRO P HG2    6  
ATOM 11107 H HG3    . PRO C 3 30 ? -9.712  17.314  7.567   1.00 0.00 ? 30 PRO P HG3    6  
ATOM 11108 H HD2    . PRO C 3 30 ? -7.806  15.626  6.653   1.00 0.00 ? 30 PRO P HD2    6  
ATOM 11109 H HD3    . PRO C 3 30 ? -8.075  15.941  8.273   1.00 0.00 ? 30 PRO P HD3    6  
ATOM 11110 N N      . ARG C 3 31 ? -10.691 13.102  5.706   1.00 0.00 ? 31 ARG P N      6  
ATOM 11111 C CA     . ARG C 3 31 ? -11.158 12.071  4.749   1.00 0.00 ? 31 ARG P CA     6  
ATOM 11112 C C      . ARG C 3 31 ? -10.879 10.623  5.127   1.00 0.00 ? 31 ARG P C      6  
ATOM 11113 O O      . ARG C 3 31 ? -11.751 9.768   5.304   1.00 0.00 ? 31 ARG P O      6  
ATOM 11114 C CB     . ARG C 3 31 ? -10.538 12.306  3.389   1.00 0.00 ? 31 ARG P CB     6  
ATOM 11115 C CG     . ARG C 3 31 ? -11.260 13.226  2.405   1.00 0.00 ? 31 ARG P CG     6  
ATOM 11116 C CD     . ARG C 3 31 ? -11.577 14.661  2.857   1.00 0.00 ? 31 ARG P CD     6  
ATOM 11117 N NE     . ARG C 3 31 ? -10.915 15.638  1.969   1.00 0.00 ? 31 ARG P NE     6  
ATOM 11118 C CZ     . ARG C 3 31 ? -11.007 16.925  2.180   1.00 0.00 ? 31 ARG P CZ     6  
ATOM 11119 N NH1    . ARG C 3 31 ? -11.631 17.509  3.154   1.00 0.00 ? 31 ARG P NH1    6  
ATOM 11120 N NH2    . ARG C 3 31 ? -10.408 17.747  1.369   1.00 0.00 ? 31 ARG P NH2    6  
ATOM 11121 H H      . ARG C 3 31 ? -9.926  13.725  5.490   1.00 0.00 ? 31 ARG P H      6  
ATOM 11122 H HA     . ARG C 3 31 ? -12.232 12.148  4.586   1.00 0.00 ? 31 ARG P HA     6  
ATOM 11123 H HB2    . ARG C 3 31 ? -9.498  12.614  3.491   1.00 0.00 ? 31 ARG P HB2    6  
ATOM 11124 H HB3    . ARG C 3 31 ? -10.452 11.375  2.828   1.00 0.00 ? 31 ARG P HB3    6  
ATOM 11125 H HG2    . ARG C 3 31 ? -10.608 13.296  1.534   1.00 0.00 ? 31 ARG P HG2    6  
ATOM 11126 H HG3    . ARG C 3 31 ? -12.182 12.733  2.098   1.00 0.00 ? 31 ARG P HG3    6  
ATOM 11127 H HD2    . ARG C 3 31 ? -12.642 14.776  3.056   1.00 0.00 ? 31 ARG P HD2    6  
ATOM 11128 H HD3    . ARG C 3 31 ? -11.116 14.785  3.837   1.00 0.00 ? 31 ARG P HD3    6  
ATOM 11129 H HE     . ARG C 3 31 ? -10.370 15.358  1.166   1.00 0.00 ? 31 ARG P HE     6  
ATOM 11130 H HH11   . ARG C 3 31 ? -12.135 16.969  3.842   1.00 0.00 ? 31 ARG P HH11   6  
ATOM 11131 H HH12   . ARG C 3 31 ? -11.687 18.517  3.176   1.00 0.00 ? 31 ARG P HH12   6  
ATOM 11132 H HH21   . ARG C 3 31 ? -9.841  17.436  0.593   1.00 0.00 ? 31 ARG P HH21   6  
ATOM 11133 H HH22   . ARG C 3 31 ? -10.636 18.714  1.549   1.00 0.00 ? 31 ARG P HH22   6  
ATOM 11134 N N      . LEU C 3 32 ? -9.560  10.415  5.353   1.00 0.00 ? 32 LEU P N      6  
ATOM 11135 C CA     . LEU C 3 32 ? -8.887  9.181   5.764   1.00 0.00 ? 32 LEU P CA     6  
ATOM 11136 C C      . LEU C 3 32 ? -9.634  8.588   6.977   1.00 0.00 ? 32 LEU P C      6  
ATOM 11137 O O      . LEU C 3 32 ? -10.198 7.473   6.854   1.00 0.00 ? 32 LEU P O      6  
ATOM 11138 C CB     . LEU C 3 32 ? -7.388  9.445   6.050   1.00 0.00 ? 32 LEU P CB     6  
ATOM 11139 C CG     . LEU C 3 32 ? -6.549  8.189   6.084   1.00 0.00 ? 32 LEU P CG     6  
ATOM 11140 C CD1    . LEU C 3 32 ? -5.138  8.419   6.455   1.00 0.00 ? 32 LEU P CD1    6  
ATOM 11141 C CD2    . LEU C 3 32 ? -7.060  7.223   7.090   1.00 0.00 ? 32 LEU P CD2    6  
ATOM 11142 H H      . LEU C 3 32 ? -8.960  11.190  5.107   1.00 0.00 ? 32 LEU P H      6  
ATOM 11143 H HA     . LEU C 3 32 ? -8.962  8.418   4.989   1.00 0.00 ? 32 LEU P HA     6  
ATOM 11144 H HB2    . LEU C 3 32 ? -6.919  10.031  5.260   1.00 0.00 ? 32 LEU P HB2    6  
ATOM 11145 H HB3    . LEU C 3 32 ? -7.271  9.978   6.994   1.00 0.00 ? 32 LEU P HB3    6  
ATOM 11146 H HG     . LEU C 3 32 ? -6.564  7.672   5.124   1.00 0.00 ? 32 LEU P HG     6  
ATOM 11147 H HD11   . LEU C 3 32 ? -4.542  7.510   6.384   1.00 0.00 ? 32 LEU P HD11   6  
ATOM 11148 H HD12   . LEU C 3 32 ? -5.148  8.735   7.498   1.00 0.00 ? 32 LEU P HD12   6  
ATOM 11149 H HD13   . LEU C 3 32 ? -4.818  9.251   5.828   1.00 0.00 ? 32 LEU P HD13   6  
ATOM 11150 H HD21   . LEU C 3 32 ? -7.294  7.684   8.050   1.00 0.00 ? 32 LEU P HD21   6  
ATOM 11151 H HD22   . LEU C 3 32 ? -6.430  6.337   7.172   1.00 0.00 ? 32 LEU P HD22   6  
ATOM 11152 H HD23   . LEU C 3 32 ? -7.871  6.646   6.645   1.00 0.00 ? 32 LEU P HD23   6  
ATOM 11153 N N      . ALA C 3 33 ? -9.722  9.368   8.083   1.00 0.00 ? 33 ALA P N      6  
ATOM 11154 C CA     . ALA C 3 33 ? -10.236 8.934   9.354   1.00 0.00 ? 33 ALA P CA     6  
ATOM 11155 C C      . ALA C 3 33 ? -11.768 8.728   9.376   1.00 0.00 ? 33 ALA P C      6  
ATOM 11156 O O      . ALA C 3 33 ? -12.181 7.674   9.948   1.00 0.00 ? 33 ALA P O      6  
ATOM 11157 C CB     . ALA C 3 33 ? -9.806  9.939   10.445  1.00 0.00 ? 33 ALA P CB     6  
ATOM 11158 H H      . ALA C 3 33 ? -9.469  10.346  8.087   1.00 0.00 ? 33 ALA P H      6  
ATOM 11159 H HA     . ALA C 3 33 ? -9.827  7.945   9.561   1.00 0.00 ? 33 ALA P HA     6  
ATOM 11160 H HB1    . ALA C 3 33 ? -8.739  10.098  10.289  1.00 0.00 ? 33 ALA P HB1    6  
ATOM 11161 H HB2    . ALA C 3 33 ? -10.435 10.828  10.405  1.00 0.00 ? 33 ALA P HB2    6  
ATOM 11162 H HB3    . ALA C 3 33 ? -9.869  9.491   11.437  1.00 0.00 ? 33 ALA P HB3    6  
ATOM 11163 N N      . ASP C 3 34 ? -12.609 9.556   8.669   1.00 0.00 ? 34 ASP P N      6  
ATOM 11164 C CA     . ASP C 3 34 ? -14.020 9.394   8.487   1.00 0.00 ? 34 ASP P CA     6  
ATOM 11165 C C      . ASP C 3 34 ? -14.430 8.134   7.827   1.00 0.00 ? 34 ASP P C      6  
ATOM 11166 O O      . ASP C 3 34 ? -15.136 7.266   8.344   1.00 0.00 ? 34 ASP P O      6  
ATOM 11167 C CB     . ASP C 3 34 ? -14.520 10.592  7.737   1.00 0.00 ? 34 ASP P CB     6  
ATOM 11168 C CG     . ASP C 3 34 ? -15.984 10.874  8.072   1.00 0.00 ? 34 ASP P CG     6  
ATOM 11169 O OD1    . ASP C 3 34 ? -16.274 11.503  9.111   1.00 0.00 ? 34 ASP P OD1    6  
ATOM 11170 O OD2    . ASP C 3 34 ? -16.925 10.320  7.437   1.00 0.00 ? 34 ASP P OD2    6  
ATOM 11171 H H      . ASP C 3 34 ? -12.154 10.331  8.208   1.00 0.00 ? 34 ASP P H      6  
ATOM 11172 H HA     . ASP C 3 34 ? -14.453 9.254   9.477   1.00 0.00 ? 34 ASP P HA     6  
ATOM 11173 H HB2    . ASP C 3 34 ? -14.052 11.469  8.185   1.00 0.00 ? 34 ASP P HB2    6  
ATOM 11174 H HB3    . ASP C 3 34 ? -14.371 10.633  6.657   1.00 0.00 ? 34 ASP P HB3    6  
ATOM 11175 N N      . LEU C 3 35 ? -13.705 7.813   6.718   1.00 0.00 ? 35 LEU P N      6  
ATOM 11176 C CA     . LEU C 3 35 ? -13.909 6.513   6.088   1.00 0.00 ? 35 LEU P CA     6  
ATOM 11177 C C      . LEU C 3 35 ? -13.286 5.433   6.894   1.00 0.00 ? 35 LEU P C      6  
ATOM 11178 O O      . LEU C 3 35 ? -13.873 4.354   7.078   1.00 0.00 ? 35 LEU P O      6  
ATOM 11179 C CB     . LEU C 3 35 ? -13.270 6.646   4.684   1.00 0.00 ? 35 LEU P CB     6  
ATOM 11180 C CG     . LEU C 3 35 ? -13.874 5.925   3.517   1.00 0.00 ? 35 LEU P CG     6  
ATOM 11181 C CD1    . LEU C 3 35 ? -15.300 5.606   3.750   1.00 0.00 ? 35 LEU P CD1    6  
ATOM 11182 C CD2    . LEU C 3 35 ? -13.604 6.741   2.265   1.00 0.00 ? 35 LEU P CD2    6  
ATOM 11183 H H      . LEU C 3 35 ? -13.035 8.402   6.245   1.00 0.00 ? 35 LEU P H      6  
ATOM 11184 H HA     . LEU C 3 35 ? -14.991 6.375   6.091   1.00 0.00 ? 35 LEU P HA     6  
ATOM 11185 H HB2    . LEU C 3 35 ? -13.315 7.710   4.453   1.00 0.00 ? 35 LEU P HB2    6  
ATOM 11186 H HB3    . LEU C 3 35 ? -12.221 6.355   4.649   1.00 0.00 ? 35 LEU P HB3    6  
ATOM 11187 H HG     . LEU C 3 35 ? -13.237 5.068   3.295   1.00 0.00 ? 35 LEU P HG     6  
ATOM 11188 H HD11   . LEU C 3 35 ? -15.370 4.809   4.491   1.00 0.00 ? 35 LEU P HD11   6  
ATOM 11189 H HD12   . LEU C 3 35 ? -15.703 5.164   2.839   1.00 0.00 ? 35 LEU P HD12   6  
ATOM 11190 H HD13   . LEU C 3 35 ? -15.701 6.590   3.996   1.00 0.00 ? 35 LEU P HD13   6  
ATOM 11191 H HD21   . LEU C 3 35 ? -12.537 6.710   2.045   1.00 0.00 ? 35 LEU P HD21   6  
ATOM 11192 H HD22   . LEU C 3 35 ? -13.960 7.768   2.357   1.00 0.00 ? 35 LEU P HD22   6  
ATOM 11193 H HD23   . LEU C 3 35 ? -14.092 6.291   1.401   1.00 0.00 ? 35 LEU P HD23   6  
ATOM 11194 N N      . SER C 3 36 ? -12.098 5.562   7.480   1.00 0.00 ? 36 SER P N      6  
ATOM 11195 C CA     . SER C 3 36 ? -11.400 4.552   8.317   1.00 0.00 ? 36 SER P CA     6  
ATOM 11196 C C      . SER C 3 36 ? -12.214 4.075   9.473   1.00 0.00 ? 36 SER P C      6  
ATOM 11197 O O      . SER C 3 36 ? -12.261 2.872   9.656   1.00 0.00 ? 36 SER P O      6  
ATOM 11198 C CB     . SER C 3 36 ? -9.972  5.051   8.660   1.00 0.00 ? 36 SER P CB     6  
ATOM 11199 O OG     . SER C 3 36 ? -9.373  4.438   9.800   1.00 0.00 ? 36 SER P OG     6  
ATOM 11200 H H      . SER C 3 36 ? -11.630 6.454   7.408   1.00 0.00 ? 36 SER P H      6  
ATOM 11201 H HA     . SER C 3 36 ? -11.286 3.624   7.755   1.00 0.00 ? 36 SER P HA     6  
ATOM 11202 H HB2    . SER C 3 36 ? -9.367  4.845   7.777   1.00 0.00 ? 36 SER P HB2    6  
ATOM 11203 H HB3    . SER C 3 36 ? -9.976  6.129   8.826   1.00 0.00 ? 36 SER P HB3    6  
ATOM 11204 H HG     . SER C 3 36 ? -9.168  3.510   9.664   1.00 0.00 ? 36 SER P HG     6  
ATOM 11205 N N      . ALA C 3 37 ? -12.914 4.974   10.225  1.00 0.00 ? 37 ALA P N      6  
ATOM 11206 C CA     . ALA C 3 37 ? -13.857 4.557   11.269  1.00 0.00 ? 37 ALA P CA     6  
ATOM 11207 C C      . ALA C 3 37 ? -14.991 3.711   10.672  1.00 0.00 ? 37 ALA P C      6  
ATOM 11208 O O      . ALA C 3 37 ? -15.285 2.666   11.248  1.00 0.00 ? 37 ALA P O      6  
ATOM 11209 C CB     . ALA C 3 37 ? -14.544 5.790   11.841  1.00 0.00 ? 37 ALA P CB     6  
ATOM 11210 H H      . ALA C 3 37 ? -12.774 5.964   10.080  1.00 0.00 ? 37 ALA P H      6  
ATOM 11211 H HA     . ALA C 3 37 ? -13.311 4.046   12.061  1.00 0.00 ? 37 ALA P HA     6  
ATOM 11212 H HB1    . ALA C 3 37 ? -15.050 6.280   11.010  1.00 0.00 ? 37 ALA P HB1    6  
ATOM 11213 H HB2    . ALA C 3 37 ? -15.268 5.553   12.621  1.00 0.00 ? 37 ALA P HB2    6  
ATOM 11214 H HB3    . ALA C 3 37 ? -13.841 6.499   12.277  1.00 0.00 ? 37 ALA P HB3    6  
ATOM 11215 N N      . LYS C 3 38 ? -15.656 4.117   9.557   1.00 0.00 ? 38 LYS P N      6  
ATOM 11216 C CA     . LYS C 3 38 ? -16.755 3.550   8.774   1.00 0.00 ? 38 LYS P CA     6  
ATOM 11217 C C      . LYS C 3 38 ? -16.450 2.179   8.153   1.00 0.00 ? 38 LYS P C      6  
ATOM 11218 O O      . LYS C 3 38 ? -17.135 1.186   8.447   1.00 0.00 ? 38 LYS P O      6  
ATOM 11219 C CB     . LYS C 3 38 ? -17.284 4.508   7.745   1.00 0.00 ? 38 LYS P CB     6  
ATOM 11220 C CG     . LYS C 3 38 ? -18.394 5.554   8.234   1.00 0.00 ? 38 LYS P CG     6  
ATOM 11221 C CD     . LYS C 3 38 ? -19.092 6.449   7.197   1.00 0.00 ? 38 LYS P CD     6  
ATOM 11222 C CE     . LYS C 3 38 ? -18.460 7.825   7.222   1.00 0.00 ? 38 LYS P CE     6  
ATOM 11223 N NZ     . LYS C 3 38 ? -18.919 8.638   6.155   1.00 0.00 ? 38 LYS P NZ     6  
ATOM 11224 H H      . LYS C 3 38 ? -15.306 4.995   9.204   1.00 0.00 ? 38 LYS P H      6  
ATOM 11225 H HA     . LYS C 3 38 ? -17.605 3.370   9.432   1.00 0.00 ? 38 LYS P HA     6  
ATOM 11226 H HB2    . LYS C 3 38 ? -16.500 5.122   7.302   1.00 0.00 ? 38 LYS P HB2    6  
ATOM 11227 H HB3    . LYS C 3 38 ? -17.622 3.962   6.864   1.00 0.00 ? 38 LYS P HB3    6  
ATOM 11228 H HG2    . LYS C 3 38 ? -19.047 4.872   8.781   1.00 0.00 ? 38 LYS P HG2    6  
ATOM 11229 H HG3    . LYS C 3 38 ? -17.925 6.209   8.967   1.00 0.00 ? 38 LYS P HG3    6  
ATOM 11230 H HD2    . LYS C 3 38 ? -18.882 6.023   6.216   1.00 0.00 ? 38 LYS P HD2    6  
ATOM 11231 H HD3    . LYS C 3 38 ? -20.158 6.501   7.417   1.00 0.00 ? 38 LYS P HD3    6  
ATOM 11232 H HE2    . LYS C 3 38 ? -18.696 8.346   8.150   1.00 0.00 ? 38 LYS P HE2    6  
ATOM 11233 H HE3    . LYS C 3 38 ? -17.372 7.780   7.188   1.00 0.00 ? 38 LYS P HE3    6  
ATOM 11234 H HZ1    . LYS C 3 38 ? -18.495 9.545   6.289   1.00 0.00 ? 38 LYS P HZ1    6  
ATOM 11235 H HZ2    . LYS C 3 38 ? -19.922 8.754   6.127   1.00 0.00 ? 38 LYS P HZ2    6  
ATOM 11236 H HZ3    . LYS C 3 38 ? -18.619 8.211   5.290   1.00 0.00 ? 38 LYS P HZ3    6  
ATOM 11237 N N      . LEU C 3 39 ? -15.405 2.145   7.335   1.00 0.00 ? 39 LEU P N      6  
ATOM 11238 C CA     . LEU C 3 39 ? -14.729