data_1ZQX
# 
_entry.id   1ZQX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZQX         
WWPDB D_1000177526 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
_pdbx_database_related.details 
PDB 1zqu unspecified . 
PDB 1zqv unspecified . 
PDB 1zqw unspecified . 
PDB 1zqy unspecified . 
PDB 1zqz unspecified . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZQX 
_pdbx_database_status.recvd_initial_deposition_date   1996-04-19 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pelletier, H.' 1 
'Sawaya, M.R.'  2 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
'Characterization of the metal ion binding helix-hairpin-helix motifs in human DNA polymerase beta by X-ray structural analysis.' 
Biochemistry      35  12778 12787 1996 BICHAW US 0006-2960 0033 ? 8841120 10.1021/bi960790i 
1       'Crystal Structures of Human DNA Polymerase Beta Complexed with Nicked and Gapped DNA Substrates' 'To be Published' ?   ? 
?     ?    ?      ?  ?         0353 ? ?       ?                 
2       'The Role of Thumb Movement and Template Bending in Polymerase Fidelity' 'To be Published' ?   ?     ?     ?    ?      ?  
?         0353 ? ?       ?                 
3       
;Crystal Structures of Human DNA Polymerase Beta Complexed with DNA; Implications for Catalytic Mechanism, Processivity, and Fidelity
;
Biochemistry      35  12742 ?     1996 BICHAW US 0006-2960 0033 ? ?       ?                 
4       'A Structural Basis for Metal Ion Mutagenicity and Nucleotide Selectivity in Human DNA Polymerase Beta' Biochemistry      
35  12762 ?     1996 BICHAW US 0006-2960 0033 ? ?       ?                 
5       'Characterization of the Metal Ion-Binding HHH Motifs in Human DNA Polymerase Beta by X-Ray Structural Analysis' 
Biochemistry      35  12778 ?     1996 BICHAW US 0006-2960 0033 ? ?       ?                 
6       'Polymerase Structures and Mechanism' Science           266 2025  ?     1994 SCIEAS US 0036-8075 0038 ? ?       ? 
7       'Structures of Ternary Complexes of Rat DNA Polymerase Beta, a DNA Template-Primer, and ddCTP' Science           264 1891  
?     1994 SCIEAS US 0036-8075 0038 ? ?       ?                 
8       'Crystal Structure of Rat DNA Polymerase Beta: Evidence for a Common Polymerase Mechanism' Science           264 1930  ? 
1994 SCIEAS US 0036-8075 0038 ? ?       ?                 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Pelletier, H.' 1  
primary 'Sawaya, M.R.'  2  
1       'Sawaya, M.R.'  3  
1       'Rawson, T.'    4  
1       'Wilson, S.H.'  5  
1       'Kraut, J.'     6  
1       'Pelletier, H.' 7  
2       'Pelletier, H.' 8  
3       'Pelletier, H.' 9  
3       'Sawaya, M.R.'  10 
3       'Wolfle, W.'    11 
3       'Wilson, S.H.'  12 
3       'Kraut, J.'     13 
4       'Pelletier, H.' 14 
4       'Sawaya, M.R.'  15 
4       'Wolfle, W.'    16 
4       'Wilson, S.H.'  17 
4       'Kraut, J.'     18 
5       'Pelletier, H.' 19 
5       'Sawaya, M.R.'  20 
6       'Pelletier, H.' 21 
7       'Pelletier, H.' 22 
7       'Sawaya, M.R.'  23 
7       'Kumar, A.'     24 
7       'Wilson, S.H.'  25 
7       'Kraut, J.'     26 
8       'Sawaya, M.R.'  27 
8       'Pelletier, H.' 28 
8       'Kumar, A.'     29 
8       'Wilson, S.H.'  30 
8       'Kraut, J.'     31 
# 
_cell.entry_id           1ZQX 
_cell.length_a           120.789 
_cell.length_b           63.188 
_cell.length_c           38.588 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZQX 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'DNA POLYMERASE BETA' 28774.527 1   2.7.7.7 ? 'C-TERMINAL 31-KD DOMAIN (RESIDUES 88 - 335)' 
'SOAKED IN THE PRESENCE OF KCL (150 MILLIMOLAR)' 
2 water   nat water                 18.015    102 ?       ? ?                                             ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;IRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVK
KLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDE
NEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRY
REPKDRSE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;IRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDIVLNEVK
KLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDE
NEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFDYIQWRY
REPKDRSE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ILE n 
1 2   ARG n 
1 3   GLN n 
1 4   ASP n 
1 5   ASP n 
1 6   THR n 
1 7   SER n 
1 8   SER n 
1 9   SER n 
1 10  ILE n 
1 11  ASN n 
1 12  PHE n 
1 13  LEU n 
1 14  THR n 
1 15  ARG n 
1 16  VAL n 
1 17  THR n 
1 18  GLY n 
1 19  ILE n 
1 20  GLY n 
1 21  PRO n 
1 22  SER n 
1 23  ALA n 
1 24  ALA n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  VAL n 
1 29  ASP n 
1 30  GLU n 
1 31  GLY n 
1 32  ILE n 
1 33  LYS n 
1 34  THR n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  LEU n 
1 39  ARG n 
1 40  LYS n 
1 41  ASN n 
1 42  GLU n 
1 43  ASP n 
1 44  LYS n 
1 45  LEU n 
1 46  ASN n 
1 47  HIS n 
1 48  HIS n 
1 49  GLN n 
1 50  ARG n 
1 51  ILE n 
1 52  GLY n 
1 53  LEU n 
1 54  LYS n 
1 55  TYR n 
1 56  PHE n 
1 57  GLU n 
1 58  ASP n 
1 59  PHE n 
1 60  GLU n 
1 61  LYS n 
1 62  ARG n 
1 63  ILE n 
1 64  PRO n 
1 65  ARG n 
1 66  GLU n 
1 67  GLU n 
1 68  MET n 
1 69  LEU n 
1 70  GLN n 
1 71  MET n 
1 72  GLN n 
1 73  ASP n 
1 74  ILE n 
1 75  VAL n 
1 76  LEU n 
1 77  ASN n 
1 78  GLU n 
1 79  VAL n 
1 80  LYS n 
1 81  LYS n 
1 82  LEU n 
1 83  ASP n 
1 84  PRO n 
1 85  GLU n 
1 86  TYR n 
1 87  ILE n 
1 88  ALA n 
1 89  THR n 
1 90  VAL n 
1 91  CYS n 
1 92  GLY n 
1 93  SER n 
1 94  PHE n 
1 95  ARG n 
1 96  ARG n 
1 97  GLY n 
1 98  ALA n 
1 99  GLU n 
1 100 SER n 
1 101 SER n 
1 102 GLY n 
1 103 ASP n 
1 104 MET n 
1 105 ASP n 
1 106 VAL n 
1 107 LEU n 
1 108 LEU n 
1 109 THR n 
1 110 HIS n 
1 111 PRO n 
1 112 ASN n 
1 113 PHE n 
1 114 THR n 
1 115 SER n 
1 116 GLU n 
1 117 SER n 
1 118 SER n 
1 119 LYS n 
1 120 GLN n 
1 121 PRO n 
1 122 LYS n 
1 123 LEU n 
1 124 LEU n 
1 125 HIS n 
1 126 ARG n 
1 127 VAL n 
1 128 VAL n 
1 129 GLU n 
1 130 GLN n 
1 131 LEU n 
1 132 GLN n 
1 133 LYS n 
1 134 VAL n 
1 135 ARG n 
1 136 PHE n 
1 137 ILE n 
1 138 THR n 
1 139 ASP n 
1 140 THR n 
1 141 LEU n 
1 142 SER n 
1 143 LYS n 
1 144 GLY n 
1 145 GLU n 
1 146 THR n 
1 147 LYS n 
1 148 PHE n 
1 149 MET n 
1 150 GLY n 
1 151 VAL n 
1 152 CYS n 
1 153 GLN n 
1 154 LEU n 
1 155 PRO n 
1 156 SER n 
1 157 GLU n 
1 158 ASN n 
1 159 ASP n 
1 160 GLU n 
1 161 ASN n 
1 162 GLU n 
1 163 TYR n 
1 164 PRO n 
1 165 HIS n 
1 166 ARG n 
1 167 ARG n 
1 168 ILE n 
1 169 ASP n 
1 170 ILE n 
1 171 ARG n 
1 172 LEU n 
1 173 ILE n 
1 174 PRO n 
1 175 LYS n 
1 176 ASP n 
1 177 GLN n 
1 178 TYR n 
1 179 TYR n 
1 180 CYS n 
1 181 GLY n 
1 182 VAL n 
1 183 LEU n 
1 184 TYR n 
1 185 PHE n 
1 186 THR n 
1 187 GLY n 
1 188 SER n 
1 189 ASP n 
1 190 ILE n 
1 191 PHE n 
1 192 ASN n 
1 193 LYS n 
1 194 ASN n 
1 195 MET n 
1 196 ARG n 
1 197 ALA n 
1 198 HIS n 
1 199 ALA n 
1 200 LEU n 
1 201 GLU n 
1 202 LYS n 
1 203 GLY n 
1 204 PHE n 
1 205 THR n 
1 206 ILE n 
1 207 ASN n 
1 208 GLU n 
1 209 TYR n 
1 210 THR n 
1 211 ILE n 
1 212 ARG n 
1 213 PRO n 
1 214 LEU n 
1 215 GLY n 
1 216 VAL n 
1 217 THR n 
1 218 GLY n 
1 219 VAL n 
1 220 ALA n 
1 221 GLY n 
1 222 GLU n 
1 223 PRO n 
1 224 LEU n 
1 225 PRO n 
1 226 VAL n 
1 227 ASP n 
1 228 SER n 
1 229 GLU n 
1 230 GLN n 
1 231 ASP n 
1 232 ILE n 
1 233 PHE n 
1 234 ASP n 
1 235 TYR n 
1 236 ILE n 
1 237 GLN n 
1 238 TRP n 
1 239 ARG n 
1 240 TYR n 
1 241 ARG n 
1 242 GLU n 
1 243 PRO n 
1 244 LYS n 
1 245 ASP n 
1 246 ARG n 
1 247 SER n 
1 248 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'Norway rat' 
_entity_src_gen.gene_src_genus                     Rattus 
_entity_src_gen.pdbx_gene_src_gene                 POL 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Rattus norvegicus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10116 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 POL 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPOB_RAT 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P06766 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;SKRKAPQETLNGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGK
LRKLEKIRQDDTSSSINFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFEKRIPREEMLQMQDI
VLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQPKLLHRVVEQLQKVRFITDTLSKGETKFMGVCQL
PSENDENEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEQDIFD
YIQWRYREPKDRSE
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZQX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 248 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P06766 
_struct_ref_seq.db_align_beg                  87 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  334 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       88 
_struct_ref_seq.pdbx_auth_seq_align_end       335 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          1ZQX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.3 
_exptl_crystal.density_percent_sol   47. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
;THIS ENTRY DESCRIBES THE STRUCTURE THAT RESULTED WHEN A CRYSTAL OF THE C-TERMINAL 31-KD DOMAIN OF RAT DNA POL BETA (SEE ENTRY 1BPB AND REFERENCE 9) HAD BEEN SOAKED IN THE FOLLOWING SOLUTION FOR 24 HOURS: PEG 3350, 16% TRIS-HCL, 100 MILLIMOLAR, PH 7.5 KCL, 150 MILLIMOLAR SEE REFERENCE 3 FOR DETAILS CONCERNING EXPERIMENTAL PROCEDURES, RESULTS, AND DISCUSSION FOR THIS STRUCTURE.
;
# 
_diffrn.id                     1 
_diffrn.ambient_temp           298 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'AREA DETECTOR' 
_diffrn_detector.type                   'XUONG-HAMLIN MULTIWIRE' 
_diffrn_detector.pdbx_collection_date   1996-01-11 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'GRAPHITE(002)' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RUH2R' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ZQX 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             20. 
_reflns.d_resolution_high            2.5 
_reflns.number_obs                   9991 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.0740000 
_reflns.pdbx_netI_over_sigmaI        9.1 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.5 
_reflns_shell.d_res_low              2.6 
_reflns_shell.percent_possible_all   85.0 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.2100000 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        1.5 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZQX 
_refine.ls_number_reflns_obs                     9991 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20. 
_refine.ls_d_res_high                            2.5 
_refine.ls_percent_reflns_obs                    92.0 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    'MOEWS AND KRETSINGER (STANDARD TNT)' 
_refine.solvent_model_param_ksol                 0.861 
_refine.solvent_model_param_bsol                 80.78 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  ? 
_refine.pdbx_starting_model                      1ZQU 
_refine.pdbx_method_to_determine_struct          'DIFFERENCE FOURIER' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'STANDARD TNT' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1935 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             102 
_refine_hist.number_atoms_total               2037 
_refine_hist.d_res_high                       2.5 
_refine_hist.d_res_low                        20. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d           0.016 ? 0.020 1977 'X-RAY DIFFRACTION' ? 
t_angle_deg        2.7   ? 3.0   2655 'X-RAY DIFFRACTION' ? 
t_dihedral_angle_d 22.4  ? ?     1190 'X-RAY DIFFRACTION' ? 
t_incorr_chiral_ct 0     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_pseud_angle      ?     ? ?     ?    'X-RAY DIFFRACTION' ? 
t_trig_c_planes    0.019 ? 0.020 54   'X-RAY DIFFRACTION' ? 
t_gen_planes       0.007 ? 0.020 287  'X-RAY DIFFRACTION' ? 
t_it               4.6   ? 6.0   1977 'X-RAY DIFFRACTION' ? 
t_nbd              0.022 ? 0.020 69   'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    1ZQX 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.2260000 
_pdbx_refine.free_R_factor_no_cutoff                     ? 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     ? 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            ? 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    ? 
_pdbx_refine.free_R_factor_4sig_cutoff                   ? 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  1ZQX 
_struct.title                     
'DNA POLYMERASE BETA (POL B) (E.C.2.7.7.7), 31-KD DOMAIN; SOAKED IN THE PRESENCE OF KCL (150 MILLIMOLAR)' 
_struct.pdbx_descriptor           'DNA POLYMERASE BETA' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZQX 
_struct_keywords.pdbx_keywords   NUCLEOTIDYLTRANSFERASE 
_struct_keywords.text            'DNA-DIRECTED DNA POLYMERASE, DNA REPLICATION, DNA REPAIR, NUCLEOTIDYLTRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  F ASP A 5   ? ARG A 15  ? ASP A 92  ARG A 102 1 ? 11 
HELX_P HELX_P2  G PRO A 21  ? GLY A 31  ? PRO A 108 GLY A 118 1 ? 11 
HELX_P HELX_P3  H LEU A 35  ? LYS A 44  ? LEU A 122 LYS A 131 1 ? 10 
HELX_P HELX_P4  I HIS A 47  ? GLU A 60  ? HIS A 134 GLU A 147 1 ? 14 
HELX_P HELX_P5  J ARG A 65  ? LEU A 82  ? ARG A 152 LEU A 169 1 ? 18 
HELX_P HELX_P6  K GLY A 92  ? GLY A 97  ? GLY A 179 GLY A 184 1 ? 6  
HELX_P HELX_P7  L PRO A 121 ? LYS A 133 ? PRO A 208 LYS A 220 5 ? 13 
HELX_P HELX_P8  M LYS A 175 ? THR A 186 ? LYS A 262 THR A 273 5 ? 12 
HELX_P HELX_P9  N ASP A 189 ? GLU A 201 ? ASP A 276 GLU A 288 1 ? 13 
HELX_P HELX_P10 O GLU A 229 ? ILE A 236 ? GLU A 316 ILE A 323 1 ? 8  
HELX_P HELX_P11 P PRO A 243 ? ASP A 245 ? PRO A 330 ASP A 332 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           187 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            274 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    188 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     275 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 5 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 87  ? CYS A 91  ? ILE A 174 CYS A 178 
A 2 MET A 104 ? THR A 109 ? MET A 191 THR A 196 
A 3 ARG A 166 ? ARG A 171 ? ARG A 253 ARG A 258 
A 4 LYS A 147 ? CYS A 152 ? LYS A 234 CYS A 239 
A 5 ILE A 137 ? THR A 140 ? ILE A 224 THR A 227 
B 1 PHE A 204 ? ASN A 207 ? PHE A 291 ASN A 294 
B 2 THR A 210 ? PRO A 213 ? THR A 297 PRO A 300 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O ILE A 87  ? O ILE A 174 N THR A 109 ? N THR A 196 
A 2 3 O MET A 104 ? O MET A 191 N ASP A 169 ? N ASP A 256 
A 3 4 O ARG A 166 ? O ARG A 253 N CYS A 152 ? N CYS A 239 
A 4 5 O VAL A 151 ? O VAL A 238 N ASP A 139 ? N ASP A 226 
B 1 2 O THR A 205 ? O THR A 292 N ARG A 212 ? N ARG A 299 
# 
_database_PDB_matrix.entry_id          1ZQX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZQX 
_atom_sites.fract_transf_matrix[1][1]   0.008279 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015826 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.025915 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 4   ? 23.981 46.696 9.376   1.00 98.79  ? 91  ASP A N   1 
ATOM   2    C CA  . ASP A 1 4   ? 24.346 47.681 10.377  1.00 99.52  ? 91  ASP A CA  1 
ATOM   3    C C   . ASP A 1 4   ? 23.843 47.281 11.756  1.00 100.00 ? 91  ASP A C   1 
ATOM   4    O O   . ASP A 1 4   ? 23.503 46.118 11.957  1.00 100.00 ? 91  ASP A O   1 
ATOM   5    C CB  . ASP A 1 4   ? 23.904 49.083 9.976   1.00 100.00 ? 91  ASP A CB  1 
ATOM   6    N N   . ASP A 1 5   ? 23.804 48.238 12.708  1.00 100.00 ? 92  ASP A N   1 
ATOM   7    C CA  . ASP A 1 5   ? 23.344 47.986 14.084  1.00 99.99  ? 92  ASP A CA  1 
ATOM   8    C C   . ASP A 1 5   ? 21.899 47.542 14.128  1.00 99.44  ? 92  ASP A C   1 
ATOM   9    O O   . ASP A 1 5   ? 21.317 47.257 15.172  1.00 98.64  ? 92  ASP A O   1 
ATOM   10   C CB  . ASP A 1 5   ? 23.578 49.173 15.009  1.00 100.00 ? 92  ASP A CB  1 
ATOM   11   N N   . THR A 1 6   ? 21.331 47.506 12.949  1.00 100.00 ? 93  THR A N   1 
ATOM   12   C CA  . THR A 1 6   ? 19.973 47.109 12.773  1.00 99.71  ? 93  THR A CA  1 
ATOM   13   C C   . THR A 1 6   ? 19.897 45.678 12.270  1.00 99.47  ? 93  THR A C   1 
ATOM   14   O O   . THR A 1 6   ? 18.965 44.945 12.608  1.00 100.00 ? 93  THR A O   1 
ATOM   15   C CB  . THR A 1 6   ? 19.309 48.088 11.827  1.00 100.00 ? 93  THR A CB  1 
ATOM   16   O OG1 . THR A 1 6   ? 17.940 48.137 12.130  1.00 100.00 ? 93  THR A OG1 1 
ATOM   17   C CG2 . THR A 1 6   ? 19.536 47.608 10.398  1.00 100.00 ? 93  THR A CG2 1 
ATOM   18   N N   . SER A 1 7   ? 20.924 45.298 11.457  1.00 98.37  ? 94  SER A N   1 
ATOM   19   C CA  . SER A 1 7   ? 21.090 43.953 10.878  1.00 94.36  ? 94  SER A CA  1 
ATOM   20   C C   . SER A 1 7   ? 21.410 43.130 12.089  1.00 86.61  ? 94  SER A C   1 
ATOM   21   O O   . SER A 1 7   ? 21.236 41.912 12.182  1.00 85.27  ? 94  SER A O   1 
ATOM   22   C CB  . SER A 1 7   ? 22.228 43.863 9.860   1.00 96.15  ? 94  SER A CB  1 
ATOM   23   O OG  . SER A 1 7   ? 22.287 42.557 9.297   1.00 97.57  ? 94  SER A OG  1 
ATOM   24   N N   . SER A 1 8   ? 21.897 43.928 13.019  1.00 80.89  ? 95  SER A N   1 
ATOM   25   C CA  . SER A 1 8   ? 22.271 43.556 14.326  1.00 76.85  ? 95  SER A CA  1 
ATOM   26   C C   . SER A 1 8   ? 20.987 43.009 14.920  1.00 78.24  ? 95  SER A C   1 
ATOM   27   O O   . SER A 1 8   ? 21.014 42.040 15.663  1.00 82.82  ? 95  SER A O   1 
ATOM   28   C CB  . SER A 1 8   ? 22.728 44.821 15.052  1.00 71.94  ? 95  SER A CB  1 
ATOM   29   O OG  . SER A 1 8   ? 23.177 44.557 16.357  1.00 68.90  ? 95  SER A OG  1 
ATOM   30   N N   . SER A 1 9   ? 19.853 43.636 14.550  1.00 73.80  ? 96  SER A N   1 
ATOM   31   C CA  . SER A 1 9   ? 18.532 43.213 15.021  1.00 68.78  ? 96  SER A CA  1 
ATOM   32   C C   . SER A 1 9   ? 18.016 41.910 14.438  1.00 60.77  ? 96  SER A C   1 
ATOM   33   O O   . SER A 1 9   ? 17.486 41.092 15.185  1.00 55.88  ? 96  SER A O   1 
ATOM   34   C CB  . SER A 1 9   ? 17.451 44.280 15.129  1.00 70.42  ? 96  SER A CB  1 
ATOM   35   O OG  . SER A 1 9   ? 17.550 44.931 16.384  1.00 71.74  ? 96  SER A OG  1 
ATOM   36   N N   . ILE A 1 10  ? 18.156 41.702 13.123  1.00 59.34  ? 97  ILE A N   1 
ATOM   37   C CA  . ILE A 1 10  ? 17.695 40.445 12.572  1.00 59.01  ? 97  ILE A CA  1 
ATOM   38   C C   . ILE A 1 10  ? 18.522 39.372 13.245  1.00 61.30  ? 97  ILE A C   1 
ATOM   39   O O   . ILE A 1 10  ? 18.060 38.254 13.477  1.00 62.97  ? 97  ILE A O   1 
ATOM   40   C CB  . ILE A 1 10  ? 17.859 40.276 11.045  1.00 59.77  ? 97  ILE A CB  1 
ATOM   41   C CG1 . ILE A 1 10  ? 16.681 40.807 10.197  1.00 63.70  ? 97  ILE A CG1 1 
ATOM   42   C CG2 . ILE A 1 10  ? 18.274 38.835 10.730  1.00 51.91  ? 97  ILE A CG2 1 
ATOM   43   C CD1 . ILE A 1 10  ? 16.708 40.422 8.711   1.00 64.20  ? 97  ILE A CD1 1 
ATOM   44   N N   . ASN A 1 11  ? 19.771 39.720 13.565  1.00 62.87  ? 98  ASN A N   1 
ATOM   45   C CA  . ASN A 1 11  ? 20.625 38.740 14.214  1.00 64.85  ? 98  ASN A CA  1 
ATOM   46   C C   . ASN A 1 11  ? 20.108 38.247 15.526  1.00 64.26  ? 98  ASN A C   1 
ATOM   47   O O   . ASN A 1 11  ? 20.156 37.064 15.835  1.00 66.68  ? 98  ASN A O   1 
ATOM   48   C CB  . ASN A 1 11  ? 22.149 38.972 14.200  1.00 65.95  ? 98  ASN A CB  1 
ATOM   49   C CG  . ASN A 1 11  ? 22.740 38.507 12.899  1.00 68.89  ? 98  ASN A CG  1 
ATOM   50   O OD1 . ASN A 1 11  ? 22.011 38.009 12.029  1.00 66.99  ? 98  ASN A OD1 1 
ATOM   51   N ND2 . ASN A 1 11  ? 24.052 38.652 12.761  1.00 72.22  ? 98  ASN A ND2 1 
ATOM   52   N N   . PHE A 1 12  ? 19.598 39.144 16.302  1.00 62.29  ? 99  PHE A N   1 
ATOM   53   C CA  . PHE A 1 12  ? 19.071 38.798 17.598  1.00 64.31  ? 99  PHE A CA  1 
ATOM   54   C C   . PHE A 1 12  ? 17.780 37.942 17.622  1.00 56.76  ? 99  PHE A C   1 
ATOM   55   O O   . PHE A 1 12  ? 17.687 36.914 18.292  1.00 51.73  ? 99  PHE A O   1 
ATOM   56   C CB  . PHE A 1 12  ? 18.834 40.126 18.291  1.00 70.86  ? 99  PHE A CB  1 
ATOM   57   C CG  . PHE A 1 12  ? 18.343 39.910 19.656  1.00 77.68  ? 99  PHE A CG  1 
ATOM   58   C CD1 . PHE A 1 12  ? 16.977 39.691 19.894  1.00 81.45  ? 99  PHE A CD1 1 
ATOM   59   C CD2 . PHE A 1 12  ? 19.236 39.917 20.729  1.00 79.80  ? 99  PHE A CD2 1 
ATOM   60   C CE1 . PHE A 1 12  ? 16.509 39.475 21.196  1.00 82.92  ? 99  PHE A CE1 1 
ATOM   61   C CE2 . PHE A 1 12  ? 18.781 39.712 22.027  1.00 80.25  ? 99  PHE A CE2 1 
ATOM   62   C CZ  . PHE A 1 12  ? 17.423 39.493 22.249  1.00 81.82  ? 99  PHE A CZ  1 
ATOM   63   N N   . LEU A 1 13  ? 16.773 38.407 16.898  1.00 54.02  ? 100 LEU A N   1 
ATOM   64   C CA  . LEU A 1 13  ? 15.501 37.745 16.795  1.00 54.03  ? 100 LEU A CA  1 
ATOM   65   C C   . LEU A 1 13  ? 15.716 36.310 16.388  1.00 51.20  ? 100 LEU A C   1 
ATOM   66   O O   . LEU A 1 13  ? 15.138 35.389 16.949  1.00 47.96  ? 100 LEU A O   1 
ATOM   67   C CB  . LEU A 1 13  ? 14.720 38.393 15.642  1.00 60.25  ? 100 LEU A CB  1 
ATOM   68   C CG  . LEU A 1 13  ? 13.888 39.624 16.006  1.00 60.96  ? 100 LEU A CG  1 
ATOM   69   C CD1 . LEU A 1 13  ? 14.404 40.227 17.292  1.00 55.38  ? 100 LEU A CD1 1 
ATOM   70   C CD2 . LEU A 1 13  ? 14.007 40.658 14.878  1.00 65.60  ? 100 LEU A CD2 1 
ATOM   71   N N   . THR A 1 14  ? 16.547 36.134 15.385  1.00 50.90  ? 101 THR A N   1 
ATOM   72   C CA  . THR A 1 14  ? 16.843 34.825 14.866  1.00 52.64  ? 101 THR A CA  1 
ATOM   73   C C   . THR A 1 14  ? 17.306 33.849 15.956  1.00 50.03  ? 101 THR A C   1 
ATOM   74   O O   . THR A 1 14  ? 17.288 32.627 15.743  1.00 50.27  ? 101 THR A O   1 
ATOM   75   C CB  . THR A 1 14  ? 17.800 34.904 13.661  1.00 57.41  ? 101 THR A CB  1 
ATOM   76   O OG1 . THR A 1 14  ? 17.599 33.811 12.790  1.00 59.18  ? 101 THR A OG1 1 
ATOM   77   C CG2 . THR A 1 14  ? 19.224 34.886 14.202  1.00 60.01  ? 101 THR A CG2 1 
ATOM   78   N N   . ARG A 1 15  ? 17.700 34.393 17.127  1.00 46.47  ? 102 ARG A N   1 
ATOM   79   C CA  . ARG A 1 15  ? 18.134 33.580 18.268  1.00 44.10  ? 102 ARG A CA  1 
ATOM   80   C C   . ARG A 1 15  ? 16.989 32.927 18.937  1.00 49.97  ? 102 ARG A C   1 
ATOM   81   O O   . ARG A 1 15  ? 17.183 32.097 19.809  1.00 56.26  ? 102 ARG A O   1 
ATOM   82   C CB  . ARG A 1 15  ? 18.914 34.328 19.346  1.00 40.40  ? 102 ARG A CB  1 
ATOM   83   C CG  . ARG A 1 15  ? 20.380 34.376 18.995  1.00 40.10  ? 102 ARG A CG  1 
ATOM   84   C CD  . ARG A 1 15  ? 21.140 35.424 19.764  1.00 35.60  ? 102 ARG A CD  1 
ATOM   85   N NE  . ARG A 1 15  ? 21.050 35.281 21.211  1.00 33.03  ? 102 ARG A NE  1 
ATOM   86   C CZ  . ARG A 1 15  ? 21.516 36.236 21.980  1.00 30.67  ? 102 ARG A CZ  1 
ATOM   87   N NH1 . ARG A 1 15  ? 22.043 37.321 21.414  1.00 37.05  ? 102 ARG A NH1 1 
ATOM   88   N NH2 . ARG A 1 15  ? 21.443 36.126 23.289  1.00 23.69  ? 102 ARG A NH2 1 
ATOM   89   N N   . VAL A 1 16  ? 15.806 33.332 18.520  1.00 48.15  ? 103 VAL A N   1 
ATOM   90   C CA  . VAL A 1 16  ? 14.571 32.805 19.052  1.00 42.84  ? 103 VAL A CA  1 
ATOM   91   C C   . VAL A 1 16  ? 14.096 31.577 18.347  1.00 37.71  ? 103 VAL A C   1 
ATOM   92   O O   . VAL A 1 16  ? 13.873 31.603 17.115  1.00 37.29  ? 103 VAL A O   1 
ATOM   93   C CB  . VAL A 1 16  ? 13.457 33.833 18.938  1.00 48.26  ? 103 VAL A CB  1 
ATOM   94   C CG1 . VAL A 1 16  ? 12.219 33.343 19.688  1.00 46.56  ? 103 VAL A CG1 1 
ATOM   95   C CG2 . VAL A 1 16  ? 13.906 35.201 19.440  1.00 51.70  ? 103 VAL A CG2 1 
ATOM   96   N N   . THR A 1 17  ? 13.906 30.497 19.093  1.00 33.64  ? 104 THR A N   1 
ATOM   97   C CA  . THR A 1 17  ? 13.417 29.325 18.409  1.00 44.22  ? 104 THR A CA  1 
ATOM   98   C C   . THR A 1 17  ? 12.029 29.655 17.925  1.00 41.66  ? 104 THR A C   1 
ATOM   99   O O   . THR A 1 17  ? 11.153 29.988 18.718  1.00 45.13  ? 104 THR A O   1 
ATOM   100  C CB  . THR A 1 17  ? 13.451 28.018 19.195  1.00 52.20  ? 104 THR A CB  1 
ATOM   101  O OG1 . THR A 1 17  ? 12.799 26.999 18.437  1.00 52.39  ? 104 THR A OG1 1 
ATOM   102  C CG2 . THR A 1 17  ? 12.783 28.216 20.544  1.00 55.00  ? 104 THR A CG2 1 
ATOM   103  N N   . GLY A 1 18  ? 11.900 29.584 16.615  1.00 38.20  ? 105 GLY A N   1 
ATOM   104  C CA  . GLY A 1 18  ? 10.691 29.865 15.884  1.00 42.03  ? 105 GLY A CA  1 
ATOM   105  C C   . GLY A 1 18  ? 11.081 30.918 14.877  1.00 47.98  ? 105 GLY A C   1 
ATOM   106  O O   . GLY A 1 18  ? 10.712 30.873 13.699  1.00 50.88  ? 105 GLY A O   1 
ATOM   107  N N   . ILE A 1 19  ? 11.873 31.897 15.344  1.00 50.55  ? 106 ILE A N   1 
ATOM   108  C CA  . ILE A 1 19  ? 12.304 32.984 14.461  1.00 49.73  ? 106 ILE A CA  1 
ATOM   109  C C   . ILE A 1 19  ? 13.321 32.686 13.367  1.00 52.78  ? 106 ILE A C   1 
ATOM   110  O O   . ILE A 1 19  ? 14.529 32.686 13.615  1.00 51.02  ? 106 ILE A O   1 
ATOM   111  C CB  . ILE A 1 19  ? 12.584 34.351 15.096  1.00 47.89  ? 106 ILE A CB  1 
ATOM   112  C CG1 . ILE A 1 19  ? 11.341 34.922 15.715  1.00 46.96  ? 106 ILE A CG1 1 
ATOM   113  C CG2 . ILE A 1 19  ? 13.045 35.323 14.028  1.00 49.39  ? 106 ILE A CG2 1 
ATOM   114  C CD1 . ILE A 1 19  ? 11.144 34.464 17.136  1.00 46.09  ? 106 ILE A CD1 1 
ATOM   115  N N   . GLY A 1 20  ? 12.804 32.477 12.146  1.00 58.36  ? 107 GLY A N   1 
ATOM   116  C CA  . GLY A 1 20  ? 13.618 32.231 10.971  1.00 64.43  ? 107 GLY A CA  1 
ATOM   117  C C   . GLY A 1 20  ? 14.009 33.595 10.358  1.00 70.84  ? 107 GLY A C   1 
ATOM   118  O O   . GLY A 1 20  ? 13.614 34.649 10.859  1.00 68.98  ? 107 GLY A O   1 
ATOM   119  N N   . PRO A 1 21  ? 14.793 33.597 9.278   1.00 78.16  ? 108 PRO A N   1 
ATOM   120  C CA  . PRO A 1 21  ? 15.174 34.850 8.663   1.00 80.07  ? 108 PRO A CA  1 
ATOM   121  C C   . PRO A 1 21  ? 14.003 35.615 8.087   1.00 78.12  ? 108 PRO A C   1 
ATOM   122  O O   . PRO A 1 21  ? 13.718 36.724 8.519   1.00 78.58  ? 108 PRO A O   1 
ATOM   123  C CB  . PRO A 1 21  ? 16.212 34.500 7.604   1.00 83.25  ? 108 PRO A CB  1 
ATOM   124  C CG  . PRO A 1 21  ? 16.856 33.211 8.106   1.00 83.38  ? 108 PRO A CG  1 
ATOM   125  C CD  . PRO A 1 21  ? 15.909 32.622 9.143   1.00 81.56  ? 108 PRO A CD  1 
ATOM   126  N N   . SER A 1 22  ? 13.326 35.011 7.132   1.00 78.93  ? 109 SER A N   1 
ATOM   127  C CA  . SER A 1 22  ? 12.173 35.633 6.509   1.00 82.77  ? 109 SER A CA  1 
ATOM   128  C C   . SER A 1 22  ? 11.180 36.023 7.589   1.00 78.41  ? 109 SER A C   1 
ATOM   129  O O   . SER A 1 22  ? 10.502 37.057 7.537   1.00 79.08  ? 109 SER A O   1 
ATOM   130  C CB  . SER A 1 22  ? 11.525 34.611 5.594   1.00 87.13  ? 109 SER A CB  1 
ATOM   131  N N   . ALA A 1 23  ? 11.132 35.139 8.566   1.00 70.62  ? 110 ALA A N   1 
ATOM   132  C CA  . ALA A 1 23  ? 10.279 35.291 9.699   1.00 63.36  ? 110 ALA A CA  1 
ATOM   133  C C   . ALA A 1 23  ? 10.808 36.437 10.542  1.00 56.40  ? 110 ALA A C   1 
ATOM   134  O O   . ALA A 1 23  ? 10.064 37.237 11.088  1.00 51.18  ? 110 ALA A O   1 
ATOM   135  C CB  . ALA A 1 23  ? 10.262 33.978 10.462  1.00 61.56  ? 110 ALA A CB  1 
ATOM   136  N N   . ALA A 1 24  ? 12.121 36.516 10.623  1.00 58.09  ? 111 ALA A N   1 
ATOM   137  C CA  . ALA A 1 24  ? 12.749 37.570 11.386  1.00 63.62  ? 111 ALA A CA  1 
ATOM   138  C C   . ALA A 1 24  ? 12.690 38.903 10.681  1.00 68.01  ? 111 ALA A C   1 
ATOM   139  O O   . ALA A 1 24  ? 12.524 39.943 11.305  1.00 64.41  ? 111 ALA A O   1 
ATOM   140  C CB  . ALA A 1 24  ? 14.200 37.253 11.678  1.00 66.08  ? 111 ALA A CB  1 
ATOM   141  N N   . ARG A 1 25  ? 12.841 38.855 9.363   1.00 74.64  ? 112 ARG A N   1 
ATOM   142  C CA  . ARG A 1 25  ? 12.817 40.042 8.543   1.00 78.78  ? 112 ARG A CA  1 
ATOM   143  C C   . ARG A 1 25  ? 11.519 40.833 8.711   1.00 77.40  ? 112 ARG A C   1 
ATOM   144  O O   . ARG A 1 25  ? 11.546 41.999 9.095   1.00 75.58  ? 112 ARG A O   1 
ATOM   145  C CB  . ARG A 1 25  ? 13.123 39.741 7.068   1.00 85.12  ? 112 ARG A CB  1 
ATOM   146  C CG  . ARG A 1 25  ? 14.521 39.147 6.815   1.00 90.77  ? 112 ARG A CG  1 
ATOM   147  C CD  . ARG A 1 25  ? 14.939 39.076 5.325   1.00 96.33  ? 112 ARG A CD  1 
ATOM   148  N NE  . ARG A 1 25  ? 16.411 39.063 5.116   1.00 100.00 ? 112 ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 25  ? 17.102 39.075 3.946   1.00 100.00 ? 112 ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 25  ? 16.524 39.099 2.744   1.00 100.00 ? 112 ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 25  ? 18.438 39.064 3.994   1.00 100.00 ? 112 ARG A NH2 1 
ATOM   152  N N   . LYS A 1 26  ? 10.378 40.195 8.437   1.00 77.85  ? 113 LYS A N   1 
ATOM   153  C CA  . LYS A 1 26  ? 9.099  40.879 8.564   1.00 78.57  ? 113 LYS A CA  1 
ATOM   154  C C   . LYS A 1 26  ? 8.898  41.560 9.895   1.00 73.99  ? 113 LYS A C   1 
ATOM   155  O O   . LYS A 1 26  ? 8.407  42.673 9.972   1.00 75.28  ? 113 LYS A O   1 
ATOM   156  C CB  . LYS A 1 26  ? 7.909  40.020 8.199   1.00 84.88  ? 113 LYS A CB  1 
ATOM   157  C CG  . LYS A 1 26  ? 8.015  38.639 8.807   1.00 90.53  ? 113 LYS A CG  1 
ATOM   158  C CD  . LYS A 1 26  ? 6.785  37.787 8.554   1.00 93.96  ? 113 LYS A CD  1 
ATOM   159  C CE  . LYS A 1 26  ? 6.952  36.336 8.990   1.00 95.03  ? 113 LYS A CE  1 
ATOM   160  N NZ  . LYS A 1 26  ? 7.158  36.141 10.436  1.00 94.74  ? 113 LYS A NZ  1 
ATOM   161  N N   . LEU A 1 27  ? 9.270  40.904 10.961  1.00 70.26  ? 114 LEU A N   1 
ATOM   162  C CA  . LEU A 1 27  ? 9.088  41.553 12.221  1.00 70.11  ? 114 LEU A CA  1 
ATOM   163  C C   . LEU A 1 27  ? 9.970  42.765 12.298  1.00 69.15  ? 114 LEU A C   1 
ATOM   164  O O   . LEU A 1 27  ? 9.860  43.558 13.211  1.00 60.94  ? 114 LEU A O   1 
ATOM   165  C CB  . LEU A 1 27  ? 9.379  40.650 13.413  1.00 73.05  ? 114 LEU A CB  1 
ATOM   166  C CG  . LEU A 1 27  ? 8.351  39.563 13.625  1.00 79.37  ? 114 LEU A CG  1 
ATOM   167  C CD1 . LEU A 1 27  ? 8.106  38.777 12.340  1.00 82.72  ? 114 LEU A CD1 1 
ATOM   168  C CD2 . LEU A 1 27  ? 8.874  38.624 14.702  1.00 82.11  ? 114 LEU A CD2 1 
ATOM   169  N N   . VAL A 1 28  ? 10.891 42.919 11.367  1.00 79.22  ? 115 VAL A N   1 
ATOM   170  C CA  . VAL A 1 28  ? 11.710 44.104 11.490  1.00 87.52  ? 115 VAL A CA  1 
ATOM   171  C C   . VAL A 1 28  ? 10.993 45.229 10.777  1.00 91.92  ? 115 VAL A C   1 
ATOM   172  O O   . VAL A 1 28  ? 11.127 46.398 11.135  1.00 93.42  ? 115 VAL A O   1 
ATOM   173  C CB  . VAL A 1 28  ? 13.163 43.958 11.029  1.00 88.48  ? 115 VAL A CB  1 
ATOM   174  C CG1 . VAL A 1 28  ? 14.076 44.797 11.918  1.00 86.53  ? 115 VAL A CG1 1 
ATOM   175  C CG2 . VAL A 1 28  ? 13.613 42.505 10.978  1.00 89.99  ? 115 VAL A CG2 1 
ATOM   176  N N   . ASP A 1 29  ? 10.225 44.828 9.752   1.00 92.83  ? 116 ASP A N   1 
ATOM   177  C CA  . ASP A 1 29  ? 9.444  45.741 8.943   1.00 91.89  ? 116 ASP A CA  1 
ATOM   178  C C   . ASP A 1 29  ? 8.229  46.291 9.653   1.00 86.62  ? 116 ASP A C   1 
ATOM   179  O O   . ASP A 1 29  ? 7.561  47.222 9.192   1.00 86.76  ? 116 ASP A O   1 
ATOM   180  C CB  . ASP A 1 29  ? 9.331  45.401 7.445   1.00 95.96  ? 116 ASP A CB  1 
ATOM   181  C CG  . ASP A 1 29  ? 10.503 45.962 6.680   1.00 98.98  ? 116 ASP A CG  1 
ATOM   182  O OD1 . ASP A 1 29  ? 10.736 47.156 6.623   1.00 99.40  ? 116 ASP A OD1 1 
ATOM   183  O OD2 . ASP A 1 29  ? 11.336 45.041 6.243   1.00 100.00 ? 116 ASP A OD2 1 
ATOM   184  N N   . GLU A 1 30  ? 7.994  45.669 10.804  1.00 83.33  ? 117 GLU A N   1 
ATOM   185  C CA  . GLU A 1 30  ? 6.923  45.990 11.717  1.00 80.91  ? 117 GLU A CA  1 
ATOM   186  C C   . GLU A 1 30  ? 7.495  46.841 12.862  1.00 75.21  ? 117 GLU A C   1 
ATOM   187  O O   . GLU A 1 30  ? 6.775  47.326 13.728  1.00 76.20  ? 117 GLU A O   1 
ATOM   188  C CB  . GLU A 1 30  ? 6.293  44.710 12.298  1.00 85.33  ? 117 GLU A CB  1 
ATOM   189  C CG  . GLU A 1 30  ? 6.044  43.586 11.262  1.00 89.99  ? 117 GLU A CG  1 
ATOM   190  C CD  . GLU A 1 30  ? 4.738  43.637 10.507  1.00 92.95  ? 117 GLU A CD  1 
ATOM   191  O OE1 . GLU A 1 30  ? 3.692  43.583 11.303  1.00 93.62  ? 117 GLU A OE1 1 
ATOM   192  O OE2 . GLU A 1 30  ? 4.667  43.507 9.291   1.00 94.05  ? 117 GLU A OE2 1 
ATOM   193  N N   . GLY A 1 31  ? 8.806  47.036 12.889  1.00 70.85  ? 118 GLY A N   1 
ATOM   194  C CA  . GLY A 1 31  ? 9.382  47.833 13.956  1.00 72.32  ? 118 GLY A CA  1 
ATOM   195  C C   . GLY A 1 31  ? 9.703  47.054 15.229  1.00 76.32  ? 118 GLY A C   1 
ATOM   196  O O   . GLY A 1 31  ? 9.903  47.650 16.285  1.00 75.41  ? 118 GLY A O   1 
ATOM   197  N N   . ILE A 1 32  ? 9.730  45.712 15.125  1.00 79.33  ? 119 ILE A N   1 
ATOM   198  C CA  . ILE A 1 32  ? 10.040 44.796 16.229  1.00 77.44  ? 119 ILE A CA  1 
ATOM   199  C C   . ILE A 1 32  ? 11.533 44.447 16.142  1.00 76.93  ? 119 ILE A C   1 
ATOM   200  O O   . ILE A 1 32  ? 11.972 43.784 15.201  1.00 80.32  ? 119 ILE A O   1 
ATOM   201  C CB  . ILE A 1 32  ? 9.165  43.547 16.185  1.00 76.29  ? 119 ILE A CB  1 
ATOM   202  N N   . LYS A 1 33  ? 12.319 44.876 17.130  1.00 71.45  ? 120 LYS A N   1 
ATOM   203  C CA  . LYS A 1 33  ? 13.750 44.631 17.112  1.00 68.63  ? 120 LYS A CA  1 
ATOM   204  C C   . LYS A 1 33  ? 14.309 43.973 18.346  1.00 69.30  ? 120 LYS A C   1 
ATOM   205  O O   . LYS A 1 33  ? 14.899 42.906 18.289  1.00 70.28  ? 120 LYS A O   1 
ATOM   206  C CB  . LYS A 1 33  ? 14.475 45.952 16.965  1.00 66.85  ? 120 LYS A CB  1 
ATOM   207  C CG  . LYS A 1 33  ? 14.207 46.678 15.659  1.00 67.18  ? 120 LYS A CG  1 
ATOM   208  C CD  . LYS A 1 33  ? 14.865 48.043 15.652  1.00 69.12  ? 120 LYS A CD  1 
ATOM   209  C CE  . LYS A 1 33  ? 14.576 48.858 14.415  1.00 73.12  ? 120 LYS A CE  1 
ATOM   210  N NZ  . LYS A 1 33  ? 14.875 50.289 14.618  1.00 75.66  ? 120 LYS A NZ  1 
ATOM   211  N N   . THR A 1 34  ? 14.153 44.619 19.478  1.00 70.03  ? 121 THR A N   1 
ATOM   212  C CA  . THR A 1 34  ? 14.675 44.025 20.682  1.00 71.01  ? 121 THR A CA  1 
ATOM   213  C C   . THR A 1 34  ? 13.756 42.905 21.080  1.00 70.39  ? 121 THR A C   1 
ATOM   214  O O   . THR A 1 34  ? 12.961 42.426 20.269  1.00 68.28  ? 121 THR A O   1 
ATOM   215  C CB  . THR A 1 34  ? 14.671 45.003 21.854  1.00 73.21  ? 121 THR A CB  1 
ATOM   216  O OG1 . THR A 1 34  ? 13.373 45.007 22.400  1.00 73.01  ? 121 THR A OG1 1 
ATOM   217  C CG2 . THR A 1 34  ? 15.004 46.401 21.356  1.00 75.13  ? 121 THR A CG2 1 
ATOM   218  N N   . LEU A 1 35  ? 13.877 42.502 22.356  1.00 73.00  ? 122 LEU A N   1 
ATOM   219  C CA  . LEU A 1 35  ? 13.036 41.443 22.888  1.00 78.04  ? 122 LEU A CA  1 
ATOM   220  C C   . LEU A 1 35  ? 11.820 41.929 23.641  1.00 77.17  ? 122 LEU A C   1 
ATOM   221  O O   . LEU A 1 35  ? 10.732 41.327 23.593  1.00 77.16  ? 122 LEU A O   1 
ATOM   222  C CB  . LEU A 1 35  ? 13.715 40.229 23.525  1.00 82.27  ? 122 LEU A CB  1 
ATOM   223  C CG  . LEU A 1 35  ? 14.492 40.482 24.798  1.00 85.08  ? 122 LEU A CG  1 
ATOM   224  C CD1 . LEU A 1 35  ? 13.616 41.120 25.877  1.00 86.80  ? 122 LEU A CD1 1 
ATOM   225  C CD2 . LEU A 1 35  ? 14.937 39.111 25.281  1.00 86.06  ? 122 LEU A CD2 1 
ATOM   226  N N   . GLU A 1 36  ? 12.020 43.029 24.341  1.00 73.49  ? 123 GLU A N   1 
ATOM   227  C CA  . GLU A 1 36  ? 10.907 43.559 25.045  1.00 70.96  ? 123 GLU A CA  1 
ATOM   228  C C   . GLU A 1 36  ? 9.932  43.973 23.952  1.00 65.70  ? 123 GLU A C   1 
ATOM   229  O O   . GLU A 1 36  ? 8.744  44.068 24.217  1.00 64.49  ? 123 GLU A O   1 
ATOM   230  C CB  . GLU A 1 36  ? 11.283 44.664 26.017  1.00 74.60  ? 123 GLU A CB  1 
ATOM   231  N N   . ASP A 1 37  ? 10.463 44.189 22.708  1.00 61.88  ? 124 ASP A N   1 
ATOM   232  C CA  . ASP A 1 37  ? 9.627  44.537 21.567  1.00 62.23  ? 124 ASP A CA  1 
ATOM   233  C C   . ASP A 1 37  ? 8.710  43.346 21.458  1.00 58.34  ? 124 ASP A C   1 
ATOM   234  O O   . ASP A 1 37  ? 7.486  43.447 21.547  1.00 58.47  ? 124 ASP A O   1 
ATOM   235  C CB  . ASP A 1 37  ? 10.362 44.646 20.178  1.00 68.53  ? 124 ASP A CB  1 
ATOM   236  C CG  . ASP A 1 37  ? 10.867 46.004 19.705  1.00 73.33  ? 124 ASP A CG  1 
ATOM   237  O OD1 . ASP A 1 37  ? 11.108 46.834 20.701  1.00 74.30  ? 124 ASP A OD1 1 
ATOM   238  O OD2 . ASP A 1 37  ? 11.043 46.290 18.513  1.00 71.81  ? 124 ASP A OD2 1 
ATOM   239  N N   . LEU A 1 38  ? 9.374  42.198 21.304  1.00 52.85  ? 125 LEU A N   1 
ATOM   240  C CA  . LEU A 1 38  ? 8.737  40.909 21.186  1.00 49.71  ? 125 LEU A CA  1 
ATOM   241  C C   . LEU A 1 38  ? 7.666  40.630 22.201  1.00 48.98  ? 125 LEU A C   1 
ATOM   242  O O   . LEU A 1 38  ? 6.561  40.233 21.858  1.00 48.86  ? 125 LEU A O   1 
ATOM   243  C CB  . LEU A 1 38  ? 9.735  39.756 21.288  1.00 48.32  ? 125 LEU A CB  1 
ATOM   244  C CG  . LEU A 1 38  ? 10.470 39.450 20.000  1.00 48.74  ? 125 LEU A CG  1 
ATOM   245  C CD1 . LEU A 1 38  ? 11.410 38.297 20.284  1.00 48.03  ? 125 LEU A CD1 1 
ATOM   246  C CD2 . LEU A 1 38  ? 9.482  39.062 18.887  1.00 48.77  ? 125 LEU A CD2 1 
ATOM   247  N N   . ARG A 1 39  ? 7.988  40.819 23.459  1.00 48.66  ? 126 ARG A N   1 
ATOM   248  C CA  . ARG A 1 39  ? 7.021  40.570 24.510  1.00 53.25  ? 126 ARG A CA  1 
ATOM   249  C C   . ARG A 1 39  ? 5.760  41.420 24.409  1.00 58.57  ? 126 ARG A C   1 
ATOM   250  O O   . ARG A 1 39  ? 4.672  40.962 24.767  1.00 63.19  ? 126 ARG A O   1 
ATOM   251  C CB  . ARG A 1 39  ? 7.707  40.708 25.831  1.00 57.42  ? 126 ARG A CB  1 
ATOM   252  C CG  . ARG A 1 39  ? 9.007  39.961 25.722  1.00 67.56  ? 126 ARG A CG  1 
ATOM   253  C CD  . ARG A 1 39  ? 9.865  39.992 26.973  1.00 78.94  ? 126 ARG A CD  1 
ATOM   254  N NE  . ARG A 1 39  ? 10.757 38.836 26.973  1.00 88.27  ? 126 ARG A NE  1 
ATOM   255  C CZ  . ARG A 1 39  ? 11.861 38.680 27.699  1.00 91.37  ? 126 ARG A CZ  1 
ATOM   256  N NH1 . ARG A 1 39  ? 12.319 39.608 28.540  1.00 90.56  ? 126 ARG A NH1 1 
ATOM   257  N NH2 . ARG A 1 39  ? 12.539 37.538 27.558  1.00 91.62  ? 126 ARG A NH2 1 
ATOM   258  N N   . LYS A 1 40  ? 5.909  42.653 23.941  1.00 58.52  ? 127 LYS A N   1 
ATOM   259  C CA  . LYS A 1 40  ? 4.784  43.537 23.782  1.00 60.34  ? 127 LYS A CA  1 
ATOM   260  C C   . LYS A 1 40  ? 4.191  43.210 22.457  1.00 54.84  ? 127 LYS A C   1 
ATOM   261  O O   . LYS A 1 40  ? 3.386  43.969 21.933  1.00 55.82  ? 127 LYS A O   1 
ATOM   262  C CB  . LYS A 1 40  ? 5.182  45.012 23.632  1.00 69.87  ? 127 LYS A CB  1 
ATOM   263  C CG  . LYS A 1 40  ? 6.144  45.467 24.689  1.00 79.57  ? 127 LYS A CG  1 
ATOM   264  C CD  . LYS A 1 40  ? 5.759  44.830 26.005  1.00 88.38  ? 127 LYS A CD  1 
ATOM   265  C CE  . LYS A 1 40  ? 6.851  44.833 27.048  1.00 93.92  ? 127 LYS A CE  1 
ATOM   266  N NZ  . LYS A 1 40  ? 6.522  43.913 28.144  1.00 96.76  ? 127 LYS A NZ  1 
ATOM   267  N N   . ASN A 1 41  ? 4.602  42.104 21.868  1.00 51.07  ? 128 ASN A N   1 
ATOM   268  C CA  . ASN A 1 41  ? 4.060  41.817 20.565  1.00 48.43  ? 128 ASN A CA  1 
ATOM   269  C C   . ASN A 1 41  ? 3.751  40.364 20.253  1.00 43.24  ? 128 ASN A C   1 
ATOM   270  O O   . ASN A 1 41  ? 3.751  39.969 19.069  1.00 34.56  ? 128 ASN A O   1 
ATOM   271  C CB  . ASN A 1 41  ? 4.843  42.553 19.446  1.00 55.43  ? 128 ASN A CB  1 
ATOM   272  C CG  . ASN A 1 41  ? 4.548  44.046 19.401  1.00 60.54  ? 128 ASN A CG  1 
ATOM   273  O OD1 . ASN A 1 41  ? 3.655  44.500 18.672  1.00 63.41  ? 128 ASN A OD1 1 
ATOM   274  N ND2 . ASN A 1 41  ? 5.128  44.779 20.341  1.00 60.07  ? 128 ASN A ND2 1 
ATOM   275  N N   . GLU A 1 42  ? 3.474  39.609 21.331  1.00 44.57  ? 129 GLU A N   1 
ATOM   276  C CA  . GLU A 1 42  ? 3.130  38.200 21.236  1.00 46.85  ? 129 GLU A CA  1 
ATOM   277  C C   . GLU A 1 42  ? 2.151  37.963 20.116  1.00 42.47  ? 129 GLU A C   1 
ATOM   278  O O   . GLU A 1 42  ? 2.392  37.091 19.317  1.00 42.61  ? 129 GLU A O   1 
ATOM   279  C CB  . GLU A 1 42  ? 2.526  37.669 22.545  1.00 48.44  ? 129 GLU A CB  1 
ATOM   280  C CG  . GLU A 1 42  ? 3.527  37.663 23.714  1.00 48.28  ? 129 GLU A CG  1 
ATOM   281  C CD  . GLU A 1 42  ? 2.959  37.047 24.955  1.00 47.29  ? 129 GLU A CD  1 
ATOM   282  O OE1 . GLU A 1 42  ? 1.793  37.543 25.267  1.00 49.90  ? 129 GLU A OE1 1 
ATOM   283  O OE2 . GLU A 1 42  ? 3.561  36.260 25.655  1.00 44.24  ? 129 GLU A OE2 1 
ATOM   284  N N   . ASP A 1 43  ? 1.075  38.759 20.026  1.00 38.01  ? 130 ASP A N   1 
ATOM   285  C CA  . ASP A 1 43  ? 0.110  38.575 18.956  1.00 33.63  ? 130 ASP A CA  1 
ATOM   286  C C   . ASP A 1 43  ? 0.688  38.484 17.560  1.00 36.00  ? 130 ASP A C   1 
ATOM   287  O O   . ASP A 1 43  ? -0.022 38.060 16.650  1.00 41.15  ? 130 ASP A O   1 
ATOM   288  C CB  . ASP A 1 43  ? -1.093 39.517 19.000  1.00 33.66  ? 130 ASP A CB  1 
ATOM   289  C CG  . ASP A 1 43  ? -0.644 40.936 18.975  1.00 33.36  ? 130 ASP A CG  1 
ATOM   290  O OD1 . ASP A 1 43  ? 0.046  41.259 20.062  1.00 32.19  ? 130 ASP A OD1 1 
ATOM   291  O OD2 . ASP A 1 43  ? -0.900 41.687 18.044  1.00 26.83  ? 130 ASP A OD2 1 
ATOM   292  N N   . LYS A 1 44  ? 1.933  38.867 17.311  1.00 37.64  ? 131 LYS A N   1 
ATOM   293  C CA  . LYS A 1 44  ? 2.342  38.704 15.934  1.00 43.34  ? 131 LYS A CA  1 
ATOM   294  C C   . LYS A 1 44  ? 3.047  37.392 15.646  1.00 42.82  ? 131 LYS A C   1 
ATOM   295  O O   . LYS A 1 44  ? 3.210  36.985 14.477  1.00 46.47  ? 131 LYS A O   1 
ATOM   296  C CB  . LYS A 1 44  ? 2.808  39.946 15.171  1.00 48.74  ? 131 LYS A CB  1 
ATOM   297  N N   . LEU A 1 45  ? 3.432  36.760 16.768  1.00 32.42  ? 132 LEU A N   1 
ATOM   298  C CA  . LEU A 1 45  ? 4.134  35.498 16.903  1.00 32.68  ? 132 LEU A CA  1 
ATOM   299  C C   . LEU A 1 45  ? 3.293  34.248 16.887  1.00 35.71  ? 132 LEU A C   1 
ATOM   300  O O   . LEU A 1 45  ? 2.238  34.220 17.523  1.00 36.70  ? 132 LEU A O   1 
ATOM   301  C CB  . LEU A 1 45  ? 4.750  35.455 18.305  1.00 29.98  ? 132 LEU A CB  1 
ATOM   302  C CG  . LEU A 1 45  ? 5.812  36.517 18.594  1.00 28.91  ? 132 LEU A CG  1 
ATOM   303  C CD1 . LEU A 1 45  ? 6.252  36.379 20.020  1.00 29.54  ? 132 LEU A CD1 1 
ATOM   304  C CD2 . LEU A 1 45  ? 7.030  36.279 17.724  1.00 28.90  ? 132 LEU A CD2 1 
ATOM   305  N N   . ASN A 1 46  ? 3.761  33.186 16.196  1.00 38.50  ? 133 ASN A N   1 
ATOM   306  C CA  . ASN A 1 46  ? 3.004  31.938 16.212  1.00 36.63  ? 133 ASN A CA  1 
ATOM   307  C C   . ASN A 1 46  ? 3.204  31.312 17.573  1.00 32.76  ? 133 ASN A C   1 
ATOM   308  O O   . ASN A 1 46  ? 3.893  31.897 18.428  1.00 30.11  ? 133 ASN A O   1 
ATOM   309  C CB  . ASN A 1 46  ? 3.266  30.944 15.058  1.00 38.98  ? 133 ASN A CB  1 
ATOM   310  C CG  . ASN A 1 46  ? 4.718  30.536 14.902  1.00 38.57  ? 133 ASN A CG  1 
ATOM   311  O OD1 . ASN A 1 46  ? 5.207  30.281 13.778  1.00 34.24  ? 133 ASN A OD1 1 
ATOM   312  N ND2 . ASN A 1 46  ? 5.430  30.545 16.024  1.00 34.41  ? 133 ASN A ND2 1 
ATOM   313  N N   . HIS A 1 47  ? 2.602  30.147 17.812  1.00 32.56  ? 134 HIS A N   1 
ATOM   314  C CA  . HIS A 1 47  ? 2.697  29.459 19.122  1.00 29.87  ? 134 HIS A CA  1 
ATOM   315  C C   . HIS A 1 47  ? 4.080  29.031 19.485  1.00 29.06  ? 134 HIS A C   1 
ATOM   316  O O   . HIS A 1 47  ? 4.469  29.130 20.656  1.00 29.48  ? 134 HIS A O   1 
ATOM   317  C CB  . HIS A 1 47  ? 1.884  28.195 19.094  1.00 31.13  ? 134 HIS A CB  1 
ATOM   318  C CG  . HIS A 1 47  ? 1.882  27.455 20.399  1.00 32.65  ? 134 HIS A CG  1 
ATOM   319  N ND1 . HIS A 1 47  ? 1.212  27.957 21.496  1.00 33.60  ? 134 HIS A ND1 1 
ATOM   320  C CD2 . HIS A 1 47  ? 2.437  26.275 20.736  1.00 33.30  ? 134 HIS A CD2 1 
ATOM   321  C CE1 . HIS A 1 47  ? 1.388  27.073 22.471  1.00 31.72  ? 134 HIS A CE1 1 
ATOM   322  N NE2 . HIS A 1 47  ? 2.115  26.052 22.055  1.00 32.19  ? 134 HIS A NE2 1 
ATOM   323  N N   . HIS A 1 48  ? 4.777  28.533 18.463  1.00 25.93  ? 135 HIS A N   1 
ATOM   324  C CA  . HIS A 1 48  ? 6.113  28.044 18.563  1.00 25.17  ? 135 HIS A CA  1 
ATOM   325  C C   . HIS A 1 48  ? 7.027  29.177 18.965  1.00 26.26  ? 135 HIS A C   1 
ATOM   326  O O   . HIS A 1 48  ? 7.651  29.126 20.050  1.00 26.11  ? 135 HIS A O   1 
ATOM   327  C CB  . HIS A 1 48  ? 6.491  27.263 17.277  1.00 34.18  ? 135 HIS A CB  1 
ATOM   328  C CG  . HIS A 1 48  ? 7.881  26.715 17.189  1.00 43.84  ? 135 HIS A CG  1 
ATOM   329  N ND1 . HIS A 1 48  ? 8.625  26.503 18.332  1.00 49.19  ? 135 HIS A ND1 1 
ATOM   330  C CD2 . HIS A 1 48  ? 8.619  26.299 16.122  1.00 49.08  ? 135 HIS A CD2 1 
ATOM   331  C CE1 . HIS A 1 48  ? 9.789  26.003 17.954  1.00 51.80  ? 135 HIS A CE1 1 
ATOM   332  N NE2 . HIS A 1 48  ? 9.824  25.863 16.634  1.00 53.41  ? 135 HIS A NE2 1 
ATOM   333  N N   . GLN A 1 49  ? 7.083  30.220 18.125  1.00 27.79  ? 136 GLN A N   1 
ATOM   334  C CA  . GLN A 1 49  ? 7.905  31.393 18.389  1.00 26.30  ? 136 GLN A CA  1 
ATOM   335  C C   . GLN A 1 49  ? 7.543  31.906 19.721  1.00 31.38  ? 136 GLN A C   1 
ATOM   336  O O   . GLN A 1 49  ? 8.389  32.383 20.481  1.00 36.09  ? 136 GLN A O   1 
ATOM   337  C CB  . GLN A 1 49  ? 7.674  32.503 17.360  1.00 26.41  ? 136 GLN A CB  1 
ATOM   338  C CG  . GLN A 1 49  ? 7.868  31.994 15.931  1.00 31.36  ? 136 GLN A CG  1 
ATOM   339  C CD  . GLN A 1 49  ? 7.363  32.945 14.894  1.00 35.75  ? 136 GLN A CD  1 
ATOM   340  O OE1 . GLN A 1 49  ? 7.784  32.852 13.732  1.00 39.22  ? 136 GLN A OE1 1 
ATOM   341  N NE2 . GLN A 1 49  ? 6.372  33.735 15.263  1.00 39.50  ? 136 GLN A NE2 1 
ATOM   342  N N   . ARG A 1 50  ? 6.261  31.802 20.024  1.00 33.50  ? 137 ARG A N   1 
ATOM   343  C CA  . ARG A 1 50  ? 5.845  32.276 21.297  1.00 35.26  ? 137 ARG A CA  1 
ATOM   344  C C   . ARG A 1 50  ? 6.602  31.639 22.481  1.00 33.90  ? 137 ARG A C   1 
ATOM   345  O O   . ARG A 1 50  ? 7.257  32.372 23.238  1.00 28.13  ? 137 ARG A O   1 
ATOM   346  C CB  . ARG A 1 50  ? 4.333  32.377 21.485  1.00 42.17  ? 137 ARG A CB  1 
ATOM   347  C CG  . ARG A 1 50  ? 4.064  33.302 22.668  1.00 44.72  ? 137 ARG A CG  1 
ATOM   348  C CD  . ARG A 1 50  ? 2.614  33.418 23.100  1.00 46.40  ? 137 ARG A CD  1 
ATOM   349  N NE  . ARG A 1 50  ? 2.266  32.551 24.218  1.00 49.00  ? 137 ARG A NE  1 
ATOM   350  C CZ  . ARG A 1 50  ? 1.760  31.327 24.106  1.00 49.25  ? 137 ARG A CZ  1 
ATOM   351  N NH1 . ARG A 1 50  ? 1.530  30.766 22.923  1.00 52.78  ? 137 ARG A NH1 1 
ATOM   352  N NH2 . ARG A 1 50  ? 1.482  30.648 25.218  1.00 46.81  ? 137 ARG A NH2 1 
ATOM   353  N N   . ILE A 1 51  ? 6.526  30.276 22.608  1.00 33.26  ? 138 ILE A N   1 
ATOM   354  C CA  . ILE A 1 51  ? 7.174  29.452 23.654  1.00 31.26  ? 138 ILE A CA  1 
ATOM   355  C C   . ILE A 1 51  ? 8.665  29.723 23.738  1.00 24.16  ? 138 ILE A C   1 
ATOM   356  O O   . ILE A 1 51  ? 9.177  29.981 24.815  1.00 17.17  ? 138 ILE A O   1 
ATOM   357  C CB  . ILE A 1 51  ? 6.915  27.953 23.437  1.00 33.98  ? 138 ILE A CB  1 
ATOM   358  C CG1 . ILE A 1 51  ? 5.441  27.773 23.162  1.00 38.05  ? 138 ILE A CG1 1 
ATOM   359  C CG2 . ILE A 1 51  ? 7.231  27.131 24.682  1.00 30.38  ? 138 ILE A CG2 1 
ATOM   360  C CD1 . ILE A 1 51  ? 4.610  28.354 24.293  1.00 36.92  ? 138 ILE A CD1 1 
ATOM   361  N N   . GLY A 1 52  ? 9.351  29.676 22.572  1.00 26.67  ? 139 GLY A N   1 
ATOM   362  C CA  . GLY A 1 52  ? 10.779 29.932 22.543  1.00 33.91  ? 139 GLY A CA  1 
ATOM   363  C C   . GLY A 1 52  ? 11.091 31.293 23.173  1.00 36.70  ? 139 GLY A C   1 
ATOM   364  O O   . GLY A 1 52  ? 12.092 31.445 23.892  1.00 33.39  ? 139 GLY A O   1 
ATOM   365  N N   . LEU A 1 53  ? 10.225 32.292 22.891  1.00 34.11  ? 140 LEU A N   1 
ATOM   366  C CA  . LEU A 1 53  ? 10.429 33.609 23.483  1.00 33.71  ? 140 LEU A CA  1 
ATOM   367  C C   . LEU A 1 53  ? 10.316 33.492 24.980  1.00 30.77  ? 140 LEU A C   1 
ATOM   368  O O   . LEU A 1 53  ? 11.082 34.034 25.766  1.00 31.47  ? 140 LEU A O   1 
ATOM   369  C CB  . LEU A 1 53  ? 9.420  34.715 23.016  1.00 37.02  ? 140 LEU A CB  1 
ATOM   370  C CG  . LEU A 1 53  ? 9.517  35.995 23.891  1.00 36.46  ? 140 LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 53  ? 10.695 36.893 23.514  1.00 36.88  ? 140 LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 53  ? 8.201  36.786 23.912  1.00 36.56  ? 140 LEU A CD2 1 
ATOM   373  N N   . LYS A 1 54  ? 9.328  32.739 25.367  1.00 35.16  ? 141 LYS A N   1 
ATOM   374  C CA  . LYS A 1 54  ? 9.092  32.545 26.788  1.00 33.89  ? 141 LYS A CA  1 
ATOM   375  C C   . LYS A 1 54  ? 10.201 31.862 27.517  1.00 31.81  ? 141 LYS A C   1 
ATOM   376  O O   . LYS A 1 54  ? 10.289 31.975 28.742  1.00 28.89  ? 141 LYS A O   1 
ATOM   377  C CB  . LYS A 1 54  ? 7.795  31.836 26.932  1.00 34.77  ? 141 LYS A CB  1 
ATOM   378  C CG  . LYS A 1 54  ? 7.444  31.492 28.342  1.00 32.98  ? 141 LYS A CG  1 
ATOM   379  C CD  . LYS A 1 54  ? 6.391  30.406 28.232  1.00 40.28  ? 141 LYS A CD  1 
ATOM   380  C CE  . LYS A 1 54  ? 5.692  30.089 29.518  1.00 47.90  ? 141 LYS A CE  1 
ATOM   381  N NZ  . LYS A 1 54  ? 6.626  29.991 30.644  1.00 53.15  ? 141 LYS A NZ  1 
ATOM   382  N N   . TYR A 1 55  ? 11.073 31.148 26.797  1.00 35.07  ? 142 TYR A N   1 
ATOM   383  C CA  . TYR A 1 55  ? 12.146 30.479 27.518  1.00 40.46  ? 142 TYR A CA  1 
ATOM   384  C C   . TYR A 1 55  ? 13.492 30.812 26.939  1.00 42.58  ? 142 TYR A C   1 
ATOM   385  O O   . TYR A 1 55  ? 14.429 29.995 27.052  1.00 45.61  ? 142 TYR A O   1 
ATOM   386  C CB  . TYR A 1 55  ? 12.023 28.957 27.544  1.00 37.62  ? 142 TYR A CB  1 
ATOM   387  C CG  . TYR A 1 55  ? 10.851 28.411 28.322  1.00 35.29  ? 142 TYR A CG  1 
ATOM   388  C CD1 . TYR A 1 55  ? 10.851 28.400 29.720  1.00 28.22  ? 142 TYR A CD1 1 
ATOM   389  C CD2 . TYR A 1 55  ? 9.759  27.873 27.643  1.00 35.90  ? 142 TYR A CD2 1 
ATOM   390  C CE1 . TYR A 1 55  ? 9.768  27.877 30.413  1.00 26.77  ? 142 TYR A CE1 1 
ATOM   391  C CE2 . TYR A 1 55  ? 8.663  27.346 28.324  1.00 31.63  ? 142 TYR A CE2 1 
ATOM   392  C CZ  . TYR A 1 55  ? 8.671  27.352 29.725  1.00 28.42  ? 142 TYR A CZ  1 
ATOM   393  O OH  . TYR A 1 55  ? 7.605  26.833 30.385  1.00 25.97  ? 142 TYR A OH  1 
ATOM   394  N N   . PHE A 1 56  ? 13.520 31.995 26.345  1.00 37.17  ? 143 PHE A N   1 
ATOM   395  C CA  . PHE A 1 56  ? 14.660 32.566 25.697  1.00 34.28  ? 143 PHE A CA  1 
ATOM   396  C C   . PHE A 1 56  ? 15.917 32.241 26.444  1.00 32.17  ? 143 PHE A C   1 
ATOM   397  O O   . PHE A 1 56  ? 16.823 31.543 25.957  1.00 37.31  ? 143 PHE A O   1 
ATOM   398  C CB  . PHE A 1 56  ? 14.547 34.092 25.523  1.00 31.62  ? 143 PHE A CB  1 
ATOM   399  C CG  . PHE A 1 56  ? 15.759 34.600 24.779  1.00 31.32  ? 143 PHE A CG  1 
ATOM   400  C CD1 . PHE A 1 56  ? 15.856 34.404 23.406  1.00 27.84  ? 143 PHE A CD1 1 
ATOM   401  C CD2 . PHE A 1 56  ? 16.795 35.229 25.455  1.00 34.43  ? 143 PHE A CD2 1 
ATOM   402  C CE1 . PHE A 1 56  ? 16.968 34.834 22.682  1.00 33.32  ? 143 PHE A CE1 1 
ATOM   403  C CE2 . PHE A 1 56  ? 17.923 35.677 24.762  1.00 35.88  ? 143 PHE A CE2 1 
ATOM   404  C CZ  . PHE A 1 56  ? 18.004 35.478 23.378  1.00 36.05  ? 143 PHE A CZ  1 
ATOM   405  N N   . GLU A 1 57  ? 15.920 32.691 27.651  1.00 28.46  ? 144 GLU A N   1 
ATOM   406  C CA  . GLU A 1 57  ? 17.034 32.476 28.501  1.00 32.37  ? 144 GLU A CA  1 
ATOM   407  C C   . GLU A 1 57  ? 17.469 31.048 28.667  1.00 41.24  ? 144 GLU A C   1 
ATOM   408  O O   . GLU A 1 57  ? 18.515 30.665 28.143  1.00 49.03  ? 144 GLU A O   1 
ATOM   409  C CB  . GLU A 1 57  ? 16.887 33.145 29.845  1.00 35.52  ? 144 GLU A CB  1 
ATOM   410  C CG  . GLU A 1 57  ? 16.888 34.670 29.710  1.00 50.87  ? 144 GLU A CG  1 
ATOM   411  C CD  . GLU A 1 57  ? 15.566 35.254 29.315  1.00 64.92  ? 144 GLU A CD  1 
ATOM   412  O OE1 . GLU A 1 57  ? 14.966 34.644 28.325  1.00 72.13  ? 144 GLU A OE1 1 
ATOM   413  O OE2 . GLU A 1 57  ? 15.116 36.220 29.888  1.00 67.18  ? 144 GLU A OE2 1 
ATOM   414  N N   . ASP A 1 58  ? 16.634 30.294 29.398  1.00 38.58  ? 145 ASP A N   1 
ATOM   415  C CA  . ASP A 1 58  ? 16.831 28.889 29.716  1.00 31.68  ? 145 ASP A CA  1 
ATOM   416  C C   . ASP A 1 58  ? 17.427 28.137 28.556  1.00 26.21  ? 145 ASP A C   1 
ATOM   417  O O   . ASP A 1 58  ? 18.352 27.358 28.712  1.00 31.22  ? 145 ASP A O   1 
ATOM   418  C CB  . ASP A 1 58  ? 15.510 28.235 30.165  1.00 31.30  ? 145 ASP A CB  1 
ATOM   419  C CG  . ASP A 1 58  ? 15.225 28.345 31.645  1.00 34.27  ? 145 ASP A CG  1 
ATOM   420  O OD1 . ASP A 1 58  ? 16.092 29.088 32.302  1.00 43.25  ? 145 ASP A OD1 1 
ATOM   421  O OD2 . ASP A 1 58  ? 14.320 27.764 32.192  1.00 28.74  ? 145 ASP A OD2 1 
ATOM   422  N N   . PHE A 1 59  ? 16.856 28.413 27.396  1.00 21.71  ? 146 PHE A N   1 
ATOM   423  C CA  . PHE A 1 59  ? 17.258 27.821 26.179  1.00 23.93  ? 146 PHE A CA  1 
ATOM   424  C C   . PHE A 1 59  ? 18.684 28.188 25.855  1.00 28.17  ? 146 PHE A C   1 
ATOM   425  O O   . PHE A 1 59  ? 19.303 27.529 25.046  1.00 30.75  ? 146 PHE A O   1 
ATOM   426  C CB  . PHE A 1 59  ? 16.231 28.242 25.093  1.00 27.34  ? 146 PHE A CB  1 
ATOM   427  C CG  . PHE A 1 59  ? 14.967 27.406 25.036  1.00 30.52  ? 146 PHE A CG  1 
ATOM   428  C CD1 . PHE A 1 59  ? 14.691 26.405 25.988  1.00 30.17  ? 146 PHE A CD1 1 
ATOM   429  C CD2 . PHE A 1 59  ? 13.994 27.647 24.055  1.00 33.60  ? 146 PHE A CD2 1 
ATOM   430  C CE1 . PHE A 1 59  ? 13.509 25.648 25.922  1.00 27.86  ? 146 PHE A CE1 1 
ATOM   431  C CE2 . PHE A 1 59  ? 12.817 26.914 23.983  1.00 29.99  ? 146 PHE A CE2 1 
ATOM   432  C CZ  . PHE A 1 59  ? 12.573 25.912 24.916  1.00 23.49  ? 146 PHE A CZ  1 
ATOM   433  N N   . GLU A 1 60  ? 19.204 29.232 26.498  1.00 33.04  ? 147 GLU A N   1 
ATOM   434  C CA  . GLU A 1 60  ? 20.591 29.652 26.259  1.00 39.15  ? 147 GLU A CA  1 
ATOM   435  C C   . GLU A 1 60  ? 21.666 28.859 27.016  1.00 36.17  ? 147 GLU A C   1 
ATOM   436  O O   . GLU A 1 60  ? 22.853 28.910 26.730  1.00 35.34  ? 147 GLU A O   1 
ATOM   437  C CB  . GLU A 1 60  ? 20.865 31.120 25.847  1.00 43.77  ? 147 GLU A CB  1 
ATOM   438  C CG  . GLU A 1 60  ? 20.550 31.398 24.348  1.00 47.81  ? 147 GLU A CG  1 
ATOM   439  C CD  . GLU A 1 60  ? 20.910 32.779 23.816  1.00 52.35  ? 147 GLU A CD  1 
ATOM   440  O OE1 . GLU A 1 60  ? 20.965 33.712 24.748  1.00 52.93  ? 147 GLU A OE1 1 
ATOM   441  O OE2 . GLU A 1 60  ? 21.069 33.009 22.632  1.00 55.55  ? 147 GLU A OE2 1 
ATOM   442  N N   . LYS A 1 61  ? 21.179 28.094 28.001  1.00 28.14  ? 148 LYS A N   1 
ATOM   443  C CA  . LYS A 1 61  ? 21.992 27.266 28.841  1.00 29.27  ? 148 LYS A CA  1 
ATOM   444  C C   . LYS A 1 61  ? 22.157 25.789 28.444  1.00 30.80  ? 148 LYS A C   1 
ATOM   445  O O   . LYS A 1 61  ? 21.202 25.092 28.062  1.00 29.90  ? 148 LYS A O   1 
ATOM   446  C CB  . LYS A 1 61  ? 21.389 27.287 30.181  1.00 31.82  ? 148 LYS A CB  1 
ATOM   447  C CG  . LYS A 1 61  ? 20.991 28.681 30.500  1.00 33.39  ? 148 LYS A CG  1 
ATOM   448  C CD  . LYS A 1 61  ? 20.544 28.716 31.945  1.00 39.20  ? 148 LYS A CD  1 
ATOM   449  C CE  . LYS A 1 61  ? 19.931 30.037 32.331  1.00 46.56  ? 148 LYS A CE  1 
ATOM   450  N NZ  . LYS A 1 61  ? 19.676 30.095 33.775  1.00 48.95  ? 148 LYS A NZ  1 
ATOM   451  N N   . ARG A 1 62  ? 23.409 25.336 28.605  1.00 28.42  ? 149 ARG A N   1 
ATOM   452  C CA  . ARG A 1 62  ? 23.858 23.988 28.336  1.00 26.01  ? 149 ARG A CA  1 
ATOM   453  C C   . ARG A 1 62  ? 23.315 23.028 29.375  1.00 24.57  ? 149 ARG A C   1 
ATOM   454  O O   . ARG A 1 62  ? 23.130 23.457 30.508  1.00 28.34  ? 149 ARG A O   1 
ATOM   455  C CB  . ARG A 1 62  ? 25.390 23.912 28.407  1.00 26.51  ? 149 ARG A CB  1 
ATOM   456  C CG  . ARG A 1 62  ? 26.110 24.630 27.280  1.00 33.95  ? 149 ARG A CG  1 
ATOM   457  C CD  . ARG A 1 62  ? 25.773 24.136 25.862  1.00 42.79  ? 149 ARG A CD  1 
ATOM   458  N NE  . ARG A 1 62  ? 26.139 22.751 25.542  1.00 53.71  ? 149 ARG A NE  1 
ATOM   459  C CZ  . ARG A 1 62  ? 25.996 22.266 24.312  1.00 61.67  ? 149 ARG A CZ  1 
ATOM   460  N NH1 . ARG A 1 62  ? 25.524 23.028 23.330  1.00 60.85  ? 149 ARG A NH1 1 
ATOM   461  N NH2 . ARG A 1 62  ? 26.328 20.998 24.053  1.00 67.11  ? 149 ARG A NH2 1 
ATOM   462  N N   . ILE A 1 63  ? 23.070 21.753 28.979  1.00 20.29  ? 150 ILE A N   1 
ATOM   463  C CA  . ILE A 1 63  ? 22.589 20.728 29.881  1.00 19.82  ? 150 ILE A CA  1 
ATOM   464  C C   . ILE A 1 63  ? 23.801 19.789 30.232  1.00 24.90  ? 150 ILE A C   1 
ATOM   465  O O   . ILE A 1 63  ? 24.435 19.175 29.350  1.00 23.72  ? 150 ILE A O   1 
ATOM   466  C CB  . ILE A 1 63  ? 21.353 19.932 29.432  1.00 20.30  ? 150 ILE A CB  1 
ATOM   467  C CG1 . ILE A 1 63  ? 20.310 20.751 28.664  1.00 30.55  ? 150 ILE A CG1 1 
ATOM   468  C CG2 . ILE A 1 63  ? 20.640 19.382 30.660  1.00 16.04  ? 150 ILE A CG2 1 
ATOM   469  C CD1 . ILE A 1 63  ? 19.417 19.872 27.776  1.00 29.32  ? 150 ILE A CD1 1 
ATOM   470  N N   . PRO A 1 64  ? 24.102 19.708 31.510  1.00 17.37  ? 151 PRO A N   1 
ATOM   471  C CA  . PRO A 1 64  ? 25.153 18.937 32.146  1.00 18.04  ? 151 PRO A CA  1 
ATOM   472  C C   . PRO A 1 64  ? 24.744 17.493 32.361  1.00 26.61  ? 151 PRO A C   1 
ATOM   473  O O   . PRO A 1 64  ? 23.639 17.260 32.840  1.00 30.84  ? 151 PRO A O   1 
ATOM   474  C CB  . PRO A 1 64  ? 25.260 19.585 33.541  1.00 17.09  ? 151 PRO A CB  1 
ATOM   475  C CG  . PRO A 1 64  ? 23.990 20.406 33.765  1.00 15.18  ? 151 PRO A CG  1 
ATOM   476  C CD  . PRO A 1 64  ? 23.272 20.502 32.435  1.00 14.29  ? 151 PRO A CD  1 
ATOM   477  N N   . ARG A 1 65  ? 25.642 16.552 32.034  1.00 31.48  ? 152 ARG A N   1 
ATOM   478  C CA  . ARG A 1 65  ? 25.376 15.127 32.146  1.00 26.93  ? 152 ARG A CA  1 
ATOM   479  C C   . ARG A 1 65  ? 24.495 14.552 33.223  1.00 26.13  ? 152 ARG A C   1 
ATOM   480  O O   . ARG A 1 65  ? 23.661 13.656 32.977  1.00 29.29  ? 152 ARG A O   1 
ATOM   481  C CB  . ARG A 1 65  ? 26.184 14.121 31.350  1.00 28.08  ? 152 ARG A CB  1 
ATOM   482  C CG  . ARG A 1 65  ? 27.276 13.392 32.089  1.00 29.98  ? 152 ARG A CG  1 
ATOM   483  C CD  . ARG A 1 65  ? 27.390 11.991 31.502  1.00 33.90  ? 152 ARG A CD  1 
ATOM   484  N NE  . ARG A 1 65  ? 27.335 12.021 30.038  1.00 37.70  ? 152 ARG A NE  1 
ATOM   485  C CZ  . ARG A 1 65  ? 27.199 10.942 29.270  1.00 32.34  ? 152 ARG A CZ  1 
ATOM   486  N NH1 . ARG A 1 65  ? 27.086 9.723  29.818  1.00 31.55  ? 152 ARG A NH1 1 
ATOM   487  N NH2 . ARG A 1 65  ? 27.156 11.073 27.951  1.00 29.27  ? 152 ARG A NH2 1 
ATOM   488  N N   . GLU A 1 66  ? 24.690 15.073 34.406  1.00 26.33  ? 153 GLU A N   1 
ATOM   489  C CA  . GLU A 1 66  ? 23.938 14.670 35.564  1.00 37.28  ? 153 GLU A CA  1 
ATOM   490  C C   . GLU A 1 66  ? 22.463 14.867 35.315  1.00 36.56  ? 153 GLU A C   1 
ATOM   491  O O   . GLU A 1 66  ? 21.635 14.032 35.656  1.00 41.71  ? 153 GLU A O   1 
ATOM   492  C CB  . GLU A 1 66  ? 24.387 15.471 36.795  1.00 52.90  ? 153 GLU A CB  1 
ATOM   493  C CG  . GLU A 1 66  ? 25.882 15.296 37.095  1.00 70.42  ? 153 GLU A CG  1 
ATOM   494  C CD  . GLU A 1 66  ? 26.216 13.956 37.692  1.00 85.29  ? 153 GLU A CD  1 
ATOM   495  O OE1 . GLU A 1 66  ? 25.520 12.959 37.559  1.00 90.90  ? 153 GLU A OE1 1 
ATOM   496  O OE2 . GLU A 1 66  ? 27.281 14.003 38.462  1.00 88.59  ? 153 GLU A OE2 1 
ATOM   497  N N   . GLU A 1 67  ? 22.108 15.997 34.709  1.00 30.68  ? 154 GLU A N   1 
ATOM   498  C CA  . GLU A 1 67  ? 20.730 16.270 34.424  1.00 30.97  ? 154 GLU A CA  1 
ATOM   499  C C   . GLU A 1 67  ? 20.213 15.370 33.323  1.00 31.16  ? 154 GLU A C   1 
ATOM   500  O O   . GLU A 1 67  ? 19.194 14.722 33.503  1.00 34.70  ? 154 GLU A O   1 
ATOM   501  C CB  . GLU A 1 67  ? 20.427 17.746 34.136  1.00 37.09  ? 154 GLU A CB  1 
ATOM   502  C CG  . GLU A 1 67  ? 20.204 18.512 35.456  1.00 44.96  ? 154 GLU A CG  1 
ATOM   503  C CD  . GLU A 1 67  ? 20.304 20.014 35.400  1.00 45.29  ? 154 GLU A CD  1 
ATOM   504  O OE1 . GLU A 1 67  ? 19.514 20.588 34.528  1.00 41.62  ? 154 GLU A OE1 1 
ATOM   505  O OE2 . GLU A 1 67  ? 20.904 20.636 36.243  1.00 45.87  ? 154 GLU A OE2 1 
ATOM   506  N N   . MET A 1 68  ? 20.919 15.307 32.206  1.00 24.28  ? 155 MET A N   1 
ATOM   507  C CA  . MET A 1 68  ? 20.527 14.472 31.076  1.00 28.70  ? 155 MET A CA  1 
ATOM   508  C C   . MET A 1 68  ? 20.233 13.057 31.473  1.00 27.43  ? 155 MET A C   1 
ATOM   509  O O   . MET A 1 68  ? 19.418 12.359 30.870  1.00 27.39  ? 155 MET A O   1 
ATOM   510  C CB  . MET A 1 68  ? 21.706 14.346 30.128  1.00 29.33  ? 155 MET A CB  1 
ATOM   511  C CG  . MET A 1 68  ? 21.787 15.529 29.243  1.00 32.23  ? 155 MET A CG  1 
ATOM   512  S SD  . MET A 1 68  ? 20.159 15.764 28.590  1.00 31.80  ? 155 MET A SD  1 
ATOM   513  C CE  . MET A 1 68  ? 20.592 16.018 26.875  1.00 23.72  ? 155 MET A CE  1 
ATOM   514  N N   . LEU A 1 69  ? 20.978 12.666 32.457  1.00 27.80  ? 156 LEU A N   1 
ATOM   515  C CA  . LEU A 1 69  ? 20.887 11.365 32.982  1.00 34.51  ? 156 LEU A CA  1 
ATOM   516  C C   . LEU A 1 69  ? 19.586 11.094 33.651  1.00 32.88  ? 156 LEU A C   1 
ATOM   517  O O   . LEU A 1 69  ? 18.942 10.090 33.406  1.00 34.28  ? 156 LEU A O   1 
ATOM   518  C CB  . LEU A 1 69  ? 22.121 11.061 33.848  1.00 37.56  ? 156 LEU A CB  1 
ATOM   519  C CG  . LEU A 1 69  ? 23.025 10.031 33.182  1.00 34.46  ? 156 LEU A CG  1 
ATOM   520  C CD1 . LEU A 1 69  ? 23.145 10.239 31.670  1.00 33.55  ? 156 LEU A CD1 1 
ATOM   521  C CD2 . LEU A 1 69  ? 24.382 10.121 33.835  1.00 26.68  ? 156 LEU A CD2 1 
ATOM   522  N N   . GLN A 1 70  ? 19.217 12.025 34.476  1.00 31.93  ? 157 GLN A N   1 
ATOM   523  C CA  . GLN A 1 70  ? 17.972 11.891 35.145  1.00 37.74  ? 157 GLN A CA  1 
ATOM   524  C C   . GLN A 1 70  ? 16.885 12.112 34.146  1.00 33.52  ? 157 GLN A C   1 
ATOM   525  O O   . GLN A 1 70  ? 15.772 11.628 34.293  1.00 35.64  ? 157 GLN A O   1 
ATOM   526  C CB  . GLN A 1 70  ? 17.813 12.931 36.240  1.00 44.55  ? 157 GLN A CB  1 
ATOM   527  C CG  . GLN A 1 70  ? 18.948 12.857 37.250  1.00 51.76  ? 157 GLN A CG  1 
ATOM   528  C CD  . GLN A 1 70  ? 18.859 14.026 38.186  1.00 60.39  ? 157 GLN A CD  1 
ATOM   529  O OE1 . GLN A 1 70  ? 19.874 14.604 38.581  1.00 58.62  ? 157 GLN A OE1 1 
ATOM   530  N NE2 . GLN A 1 70  ? 17.625 14.397 38.520  1.00 66.15  ? 157 GLN A NE2 1 
ATOM   531  N N   . MET A 1 71  ? 17.196 12.876 33.118  1.00 32.37  ? 158 MET A N   1 
ATOM   532  C CA  . MET A 1 71  ? 16.156 13.050 32.187  1.00 29.27  ? 158 MET A CA  1 
ATOM   533  C C   . MET A 1 71  ? 15.958 11.774 31.521  1.00 29.90  ? 158 MET A C   1 
ATOM   534  O O   . MET A 1 71  ? 14.828 11.323 31.378  1.00 34.17  ? 158 MET A O   1 
ATOM   535  C CB  . MET A 1 71  ? 16.129 14.327 31.333  1.00 28.68  ? 158 MET A CB  1 
ATOM   536  C CG  . MET A 1 71  ? 17.478 14.956 31.254  1.00 33.27  ? 158 MET A CG  1 
ATOM   537  S SD  . MET A 1 71  ? 17.299 16.754 31.239  1.00 25.17  ? 158 MET A SD  1 
ATOM   538  C CE  . MET A 1 71  ? 16.735 16.954 29.509  1.00 18.92  ? 158 MET A CE  1 
ATOM   539  N N   . GLN A 1 72  ? 17.054 11.154 31.167  1.00 31.63  ? 159 GLN A N   1 
ATOM   540  C CA  . GLN A 1 72  ? 16.932 9.899  30.509  1.00 32.45  ? 159 GLN A CA  1 
ATOM   541  C C   . GLN A 1 72  ? 16.119 8.861  31.233  1.00 28.82  ? 159 GLN A C   1 
ATOM   542  O O   . GLN A 1 72  ? 15.377 8.111  30.619  1.00 32.20  ? 159 GLN A O   1 
ATOM   543  C CB  . GLN A 1 72  ? 18.229 9.293  30.083  1.00 33.52  ? 159 GLN A CB  1 
ATOM   544  C CG  . GLN A 1 72  ? 18.030 7.867  29.591  1.00 31.81  ? 159 GLN A CG  1 
ATOM   545  C CD  . GLN A 1 72  ? 19.405 7.355  29.470  1.00 34.23  ? 159 GLN A CD  1 
ATOM   546  O OE1 . GLN A 1 72  ? 19.910 7.064  28.374  1.00 36.20  ? 159 GLN A OE1 1 
ATOM   547  N NE2 . GLN A 1 72  ? 20.103 7.536  30.572  1.00 30.97  ? 159 GLN A NE2 1 
ATOM   548  N N   . ASP A 1 73  ? 16.267 8.809  32.518  1.00 29.91  ? 160 ASP A N   1 
ATOM   549  C CA  . ASP A 1 73  ? 15.532 7.847  33.289  1.00 33.26  ? 160 ASP A CA  1 
ATOM   550  C C   . ASP A 1 73  ? 14.029 8.062  33.327  1.00 33.10  ? 160 ASP A C   1 
ATOM   551  O O   . ASP A 1 73  ? 13.214 7.133  33.258  1.00 36.67  ? 160 ASP A O   1 
ATOM   552  C CB  . ASP A 1 73  ? 16.013 7.967  34.700  1.00 39.32  ? 160 ASP A CB  1 
ATOM   553  C CG  . ASP A 1 73  ? 17.209 7.152  34.972  1.00 49.96  ? 160 ASP A CG  1 
ATOM   554  O OD1 . ASP A 1 73  ? 17.554 6.327  34.015  1.00 49.95  ? 160 ASP A OD1 1 
ATOM   555  O OD2 . ASP A 1 73  ? 17.647 7.111  36.098  1.00 58.25  ? 160 ASP A OD2 1 
ATOM   556  N N   . ILE A 1 74  ? 13.627 9.300  33.485  1.00 29.32  ? 161 ILE A N   1 
ATOM   557  C CA  . ILE A 1 74  ? 12.222 9.555  33.526  1.00 31.22  ? 161 ILE A CA  1 
ATOM   558  C C   . ILE A 1 74  ? 11.628 9.141  32.173  1.00 28.86  ? 161 ILE A C   1 
ATOM   559  O O   . ILE A 1 74  ? 10.620 8.452  32.085  1.00 28.90  ? 161 ILE A O   1 
ATOM   560  C CB  . ILE A 1 74  ? 11.950 11.021 33.787  1.00 32.63  ? 161 ILE A CB  1 
ATOM   561  C CG1 . ILE A 1 74  ? 12.053 11.328 35.272  1.00 32.92  ? 161 ILE A CG1 1 
ATOM   562  C CG2 . ILE A 1 74  ? 10.565 11.343 33.216  1.00 29.58  ? 161 ILE A CG2 1 
ATOM   563  C CD1 . ILE A 1 74  ? 12.298 12.808 35.605  1.00 33.73  ? 161 ILE A CD1 1 
ATOM   564  N N   . VAL A 1 75  ? 12.269 9.549  31.107  1.00 21.40  ? 162 VAL A N   1 
ATOM   565  C CA  . VAL A 1 75  ? 11.731 9.161  29.863  1.00 21.05  ? 162 VAL A CA  1 
ATOM   566  C C   . VAL A 1 75  ? 11.725 7.649  29.639  1.00 28.03  ? 162 VAL A C   1 
ATOM   567  O O   . VAL A 1 75  ? 10.763 7.068  29.156  1.00 29.06  ? 162 VAL A O   1 
ATOM   568  C CB  . VAL A 1 75  ? 12.433 9.853  28.740  1.00 26.09  ? 162 VAL A CB  1 
ATOM   569  C CG1 . VAL A 1 75  ? 11.926 9.260  27.434  1.00 25.08  ? 162 VAL A CG1 1 
ATOM   570  C CG2 . VAL A 1 75  ? 12.123 11.330 28.826  1.00 31.89  ? 162 VAL A CG2 1 
ATOM   571  N N   . LEU A 1 76  ? 12.803 6.996  29.989  1.00 27.17  ? 163 LEU A N   1 
ATOM   572  C CA  . LEU A 1 76  ? 12.805 5.584  29.763  1.00 25.44  ? 163 LEU A CA  1 
ATOM   573  C C   . LEU A 1 76  ? 11.765 4.850  30.578  1.00 33.41  ? 163 LEU A C   1 
ATOM   574  O O   . LEU A 1 76  ? 11.010 3.962  30.115  1.00 34.21  ? 163 LEU A O   1 
ATOM   575  C CB  . LEU A 1 76  ? 14.202 4.974  29.853  1.00 20.04  ? 163 LEU A CB  1 
ATOM   576  C CG  . LEU A 1 76  ? 15.167 5.523  28.793  1.00 26.70  ? 163 LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 76  ? 16.546 4.929  28.984  1.00 28.17  ? 163 LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 76  ? 14.696 5.216  27.364  1.00 27.04  ? 163 LEU A CD2 1 
ATOM   579  N N   . ASN A 1 77  ? 11.695 5.215  31.826  1.00 35.39  ? 164 ASN A N   1 
ATOM   580  C CA  . ASN A 1 77  ? 10.787 4.561  32.684  1.00 39.85  ? 164 ASN A CA  1 
ATOM   581  C C   . ASN A 1 77  ? 9.316  4.755  32.390  1.00 40.65  ? 164 ASN A C   1 
ATOM   582  O O   . ASN A 1 77  ? 8.520  3.840  32.556  1.00 41.37  ? 164 ASN A O   1 
ATOM   583  C CB  . ASN A 1 77  ? 11.161 4.764  34.151  1.00 51.68  ? 164 ASN A CB  1 
ATOM   584  C CG  . ASN A 1 77  ? 10.205 5.642  34.877  1.00 68.35  ? 164 ASN A CG  1 
ATOM   585  O OD1 . ASN A 1 77  ? 9.746  6.687  34.386  1.00 78.17  ? 164 ASN A OD1 1 
ATOM   586  N ND2 . ASN A 1 77  ? 9.755  5.113  36.003  1.00 70.19  ? 164 ASN A ND2 1 
ATOM   587  N N   . GLU A 1 78  ? 8.918  5.923  31.976  1.00 39.36  ? 165 GLU A N   1 
ATOM   588  C CA  . GLU A 1 78  ? 7.516  6.118  31.707  1.00 30.24  ? 165 GLU A CA  1 
ATOM   589  C C   . GLU A 1 78  ? 7.061  5.353  30.502  1.00 26.71  ? 165 GLU A C   1 
ATOM   590  O O   . GLU A 1 78  ? 5.953  4.786  30.487  1.00 34.05  ? 165 GLU A O   1 
ATOM   591  C CB  . GLU A 1 78  ? 7.250  7.607  31.526  1.00 26.96  ? 165 GLU A CB  1 
ATOM   592  C CG  . GLU A 1 78  ? 7.525  8.330  32.833  1.00 23.07  ? 165 GLU A CG  1 
ATOM   593  C CD  . GLU A 1 78  ? 6.593  7.822  33.855  1.00 26.88  ? 165 GLU A CD  1 
ATOM   594  O OE1 . GLU A 1 78  ? 5.466  7.420  33.348  1.00 33.57  ? 165 GLU A OE1 1 
ATOM   595  O OE2 . GLU A 1 78  ? 6.881  7.709  35.013  1.00 30.16  ? 165 GLU A OE2 1 
ATOM   596  N N   . VAL A 1 79  ? 7.911  5.355  29.498  1.00 20.52  ? 166 VAL A N   1 
ATOM   597  C CA  . VAL A 1 79  ? 7.645  4.657  28.262  1.00 26.09  ? 166 VAL A CA  1 
ATOM   598  C C   . VAL A 1 79  ? 7.458  3.190  28.607  1.00 32.06  ? 166 VAL A C   1 
ATOM   599  O O   . VAL A 1 79  ? 6.566  2.525  28.134  1.00 27.84  ? 166 VAL A O   1 
ATOM   600  C CB  . VAL A 1 79  ? 8.779  4.865  27.213  1.00 27.29  ? 166 VAL A CB  1 
ATOM   601  C CG1 . VAL A 1 79  ? 8.917  3.748  26.183  1.00 21.55  ? 166 VAL A CG1 1 
ATOM   602  C CG2 . VAL A 1 79  ? 8.815  6.259  26.563  1.00 32.72  ? 166 VAL A CG2 1 
ATOM   603  N N   . LYS A 1 80  ? 8.329  2.677  29.475  1.00 41.72  ? 167 LYS A N   1 
ATOM   604  C CA  . LYS A 1 80  ? 8.200  1.276  29.818  1.00 46.69  ? 167 LYS A CA  1 
ATOM   605  C C   . LYS A 1 80  ? 6.824  0.878  30.398  1.00 44.55  ? 167 LYS A C   1 
ATOM   606  O O   . LYS A 1 80  ? 6.249  -0.148 30.049  1.00 50.52  ? 167 LYS A O   1 
ATOM   607  C CB  . LYS A 1 80  ? 9.380  0.702  30.580  1.00 51.79  ? 167 LYS A CB  1 
ATOM   608  C CG  . LYS A 1 80  ? 9.658  -0.756 30.252  1.00 62.37  ? 167 LYS A CG  1 
ATOM   609  C CD  . LYS A 1 80  ? 10.931 -1.240 30.937  1.00 73.24  ? 167 LYS A CD  1 
ATOM   610  C CE  . LYS A 1 80  ? 11.454 -2.587 30.471  1.00 82.43  ? 167 LYS A CE  1 
ATOM   611  N NZ  . LYS A 1 80  ? 12.761 -2.900 31.081  1.00 87.56  ? 167 LYS A NZ  1 
ATOM   612  N N   . LYS A 1 81  ? 6.268  1.694  31.271  1.00 33.91  ? 168 LYS A N   1 
ATOM   613  C CA  . LYS A 1 81  ? 4.993  1.356  31.826  1.00 33.12  ? 168 LYS A CA  1 
ATOM   614  C C   . LYS A 1 81  ? 3.811  1.428  30.852  1.00 33.17  ? 168 LYS A C   1 
ATOM   615  O O   . LYS A 1 81  ? 2.701  0.957  31.132  1.00 39.63  ? 168 LYS A O   1 
ATOM   616  C CB  . LYS A 1 81  ? 4.743  2.169  33.066  1.00 36.43  ? 168 LYS A CB  1 
ATOM   617  C CG  . LYS A 1 81  ? 5.876  2.019  34.055  1.00 44.42  ? 168 LYS A CG  1 
ATOM   618  C CD  . LYS A 1 81  ? 5.652  2.841  35.311  1.00 54.91  ? 168 LYS A CD  1 
ATOM   619  C CE  . LYS A 1 81  ? 5.581  4.348  35.063  1.00 65.22  ? 168 LYS A CE  1 
ATOM   620  N NZ  . LYS A 1 81  ? 4.444  4.778  34.224  1.00 72.90  ? 168 LYS A NZ  1 
ATOM   621  N N   . LEU A 1 82  ? 4.031  2.023  29.725  1.00 27.97  ? 169 LEU A N   1 
ATOM   622  C CA  . LEU A 1 82  ? 2.992  2.120  28.760  1.00 25.58  ? 169 LEU A CA  1 
ATOM   623  C C   . LEU A 1 82  ? 2.889  0.834  27.965  1.00 29.44  ? 169 LEU A C   1 
ATOM   624  O O   . LEU A 1 82  ? 1.796  0.306  27.675  1.00 29.21  ? 169 LEU A O   1 
ATOM   625  C CB  . LEU A 1 82  ? 3.320  3.332  27.875  1.00 21.28  ? 169 LEU A CB  1 
ATOM   626  C CG  . LEU A 1 82  ? 3.072  4.589  28.686  1.00 29.52  ? 169 LEU A CG  1 
ATOM   627  C CD1 . LEU A 1 82  ? 3.491  5.881  27.985  1.00 26.57  ? 169 LEU A CD1 1 
ATOM   628  C CD2 . LEU A 1 82  ? 1.585  4.662  28.997  1.00 33.73  ? 169 LEU A CD2 1 
ATOM   629  N N   . ASP A 1 83  ? 4.083  0.356  27.651  1.00 26.51  ? 170 ASP A N   1 
ATOM   630  C CA  . ASP A 1 83  ? 4.317  -0.823 26.869  1.00 25.49  ? 170 ASP A CA  1 
ATOM   631  C C   . ASP A 1 83  ? 5.797  -1.017 26.639  1.00 31.34  ? 170 ASP A C   1 
ATOM   632  O O   . ASP A 1 83  ? 6.507  -0.282 25.923  1.00 31.33  ? 170 ASP A O   1 
ATOM   633  C CB  . ASP A 1 83  ? 3.616  -0.580 25.554  1.00 18.89  ? 170 ASP A CB  1 
ATOM   634  C CG  . ASP A 1 83  ? 3.547  -1.658 24.542  1.00 20.99  ? 170 ASP A CG  1 
ATOM   635  O OD1 . ASP A 1 83  ? 4.204  -2.757 24.838  1.00 24.97  ? 170 ASP A OD1 1 
ATOM   636  O OD2 . ASP A 1 83  ? 2.906  -1.475 23.517  1.00 23.58  ? 170 ASP A OD2 1 
ATOM   637  N N   . PRO A 1 84  ? 6.215  -2.053 27.260  1.00 37.03  ? 171 PRO A N   1 
ATOM   638  C CA  . PRO A 1 84  ? 7.561  -2.519 27.280  1.00 34.59  ? 171 PRO A CA  1 
ATOM   639  C C   . PRO A 1 84  ? 8.023  -2.944 25.932  1.00 31.72  ? 171 PRO A C   1 
ATOM   640  O O   . PRO A 1 84  ? 9.160  -3.379 25.816  1.00 37.90  ? 171 PRO A O   1 
ATOM   641  C CB  . PRO A 1 84  ? 7.521  -3.760 28.142  1.00 36.78  ? 171 PRO A CB  1 
ATOM   642  C CG  . PRO A 1 84  ? 6.087  -3.907 28.612  1.00 39.81  ? 171 PRO A CG  1 
ATOM   643  C CD  . PRO A 1 84  ? 5.284  -3.108 27.616  1.00 40.15  ? 171 PRO A CD  1 
ATOM   644  N N   . GLU A 1 85  ? 7.164  -2.842 24.927  1.00 20.86  ? 172 GLU A N   1 
ATOM   645  C CA  . GLU A 1 85  ? 7.581  -3.243 23.616  1.00 24.53  ? 172 GLU A CA  1 
ATOM   646  C C   . GLU A 1 85  ? 8.169  -2.073 22.834  1.00 22.99  ? 172 GLU A C   1 
ATOM   647  O O   . GLU A 1 85  ? 8.715  -2.279 21.741  1.00 26.03  ? 172 GLU A O   1 
ATOM   648  C CB  . GLU A 1 85  ? 6.456  -3.895 22.807  1.00 34.10  ? 172 GLU A CB  1 
ATOM   649  C CG  . GLU A 1 85  ? 7.022  -4.821 21.735  1.00 46.77  ? 172 GLU A CG  1 
ATOM   650  C CD  . GLU A 1 85  ? 7.480  -6.117 22.340  1.00 57.07  ? 172 GLU A CD  1 
ATOM   651  O OE1 . GLU A 1 85  ? 6.750  -6.463 23.379  1.00 57.55  ? 172 GLU A OE1 1 
ATOM   652  O OE2 . GLU A 1 85  ? 8.419  -6.776 21.893  1.00 63.04  ? 172 GLU A OE2 1 
ATOM   653  N N   . TYR A 1 86  ? 8.004  -0.876 23.402  1.00 21.34  ? 173 TYR A N   1 
ATOM   654  C CA  . TYR A 1 86  ? 8.509  0.384  22.877  1.00 21.38  ? 173 TYR A CA  1 
ATOM   655  C C   . TYR A 1 86  ? 10.020 0.457  23.145  1.00 19.52  ? 173 TYR A C   1 
ATOM   656  O O   . TYR A 1 86  ? 10.451 0.096  24.231  1.00 13.74  ? 173 TYR A O   1 
ATOM   657  C CB  . TYR A 1 86  ? 8.003  1.594  23.724  1.00 20.17  ? 173 TYR A CB  1 
ATOM   658  C CG  . TYR A 1 86  ? 6.709  2.323  23.464  1.00 16.90  ? 173 TYR A CG  1 
ATOM   659  C CD1 . TYR A 1 86  ? 6.532  2.982  22.257  1.00 17.19  ? 173 TYR A CD1 1 
ATOM   660  C CD2 . TYR A 1 86  ? 5.707  2.412  24.425  1.00 16.81  ? 173 TYR A CD2 1 
ATOM   661  C CE1 . TYR A 1 86  ? 5.355  3.698  21.984  1.00 19.19  ? 173 TYR A CE1 1 
ATOM   662  C CE2 . TYR A 1 86  ? 4.533  3.119  24.185  1.00 17.54  ? 173 TYR A CE2 1 
ATOM   663  C CZ  . TYR A 1 86  ? 4.342  3.766  22.947  1.00 15.37  ? 173 TYR A CZ  1 
ATOM   664  O OH  . TYR A 1 86  ? 3.217  4.455  22.704  1.00 24.23  ? 173 TYR A OH  1 
ATOM   665  N N   . ILE A 1 87  ? 10.798 0.910  22.218  1.00 15.60  ? 174 ILE A N   1 
ATOM   666  C CA  . ILE A 1 87  ? 12.241 1.083  22.385  1.00 20.78  ? 174 ILE A CA  1 
ATOM   667  C C   . ILE A 1 87  ? 12.411 2.590  22.267  1.00 25.51  ? 174 ILE A C   1 
ATOM   668  O O   . ILE A 1 87  ? 11.781 3.211  21.380  1.00 29.08  ? 174 ILE A O   1 
ATOM   669  C CB  . ILE A 1 87  ? 13.073 0.391  21.331  1.00 24.28  ? 174 ILE A CB  1 
ATOM   670  C CG1 . ILE A 1 87  ? 12.912 -1.111 21.330  1.00 25.69  ? 174 ILE A CG1 1 
ATOM   671  C CG2 . ILE A 1 87  ? 14.528 0.812  21.265  1.00 22.44  ? 174 ILE A CG2 1 
ATOM   672  C CD1 . ILE A 1 87  ? 13.100 -1.506 19.863  1.00 21.12  ? 174 ILE A CD1 1 
ATOM   673  N N   . ALA A 1 88  ? 13.241 3.103  23.159  1.00 22.25  ? 175 ALA A N   1 
ATOM   674  C CA  . ALA A 1 88  ? 13.582 4.498  23.290  1.00 25.11  ? 175 ALA A CA  1 
ATOM   675  C C   . ALA A 1 88  ? 15.092 4.681  23.441  1.00 24.62  ? 175 ALA A C   1 
ATOM   676  O O   . ALA A 1 88  ? 15.749 3.998  24.235  1.00 22.71  ? 175 ALA A O   1 
ATOM   677  C CB  . ALA A 1 88  ? 12.885 4.996  24.555  1.00 28.64  ? 175 ALA A CB  1 
ATOM   678  N N   . THR A 1 89  ? 15.650 5.599  22.710  1.00 30.63  ? 176 THR A N   1 
ATOM   679  C CA  . THR A 1 89  ? 17.067 5.785  22.849  1.00 31.38  ? 176 THR A CA  1 
ATOM   680  C C   . THR A 1 89  ? 17.418 7.247  22.734  1.00 25.85  ? 176 THR A C   1 
ATOM   681  O O   . THR A 1 89  ? 16.973 7.955  21.822  1.00 22.37  ? 176 THR A O   1 
ATOM   682  C CB  . THR A 1 89  ? 17.816 5.002  21.763  1.00 27.52  ? 176 THR A CB  1 
ATOM   683  O OG1 . THR A 1 89  ? 17.334 3.675  21.692  1.00 28.87  ? 176 THR A OG1 1 
ATOM   684  C CG2 . THR A 1 89  ? 19.292 5.004  22.048  1.00 19.73  ? 176 THR A CG2 1 
ATOM   685  N N   . VAL A 1 90  ? 18.211 7.701  23.689  1.00 23.91  ? 177 VAL A N   1 
ATOM   686  C CA  . VAL A 1 90  ? 18.625 9.094  23.677  1.00 23.37  ? 177 VAL A CA  1 
ATOM   687  C C   . VAL A 1 90  ? 19.855 9.325  22.845  1.00 23.08  ? 177 VAL A C   1 
ATOM   688  O O   . VAL A 1 90  ? 20.955 9.000  23.230  1.00 30.52  ? 177 VAL A O   1 
ATOM   689  C CB  . VAL A 1 90  ? 18.919 9.701  25.009  1.00 20.23  ? 177 VAL A CB  1 
ATOM   690  C CG1 . VAL A 1 90  ? 19.104 11.187 24.743  1.00 17.15  ? 177 VAL A CG1 1 
ATOM   691  C CG2 . VAL A 1 90  ? 17.747 9.459  25.933  1.00 15.67  ? 177 VAL A CG2 1 
ATOM   692  N N   . CYS A 1 91  ? 19.666 9.921  21.729  1.00 27.20  ? 178 CYS A N   1 
ATOM   693  C CA  . CYS A 1 91  ? 20.819 10.156 20.918  1.00 25.72  ? 178 CYS A CA  1 
ATOM   694  C C   . CYS A 1 91  ? 21.614 11.393 21.329  1.00 25.89  ? 178 CYS A C   1 
ATOM   695  O O   . CYS A 1 91  ? 21.794 11.659 22.531  1.00 19.41  ? 178 CYS A O   1 
ATOM   696  C CB  . CYS A 1 91  ? 20.498 9.846  19.477  1.00 25.79  ? 178 CYS A CB  1 
ATOM   697  S SG  . CYS A 1 91  ? 19.664 8.227  19.514  1.00 35.41  ? 178 CYS A SG  1 
ATOM   698  N N   . GLY A 1 92  ? 22.117 12.162 20.375  1.00 27.04  ? 179 GLY A N   1 
ATOM   699  C CA  . GLY A 1 92  ? 22.872 13.341 20.734  1.00 28.14  ? 179 GLY A CA  1 
ATOM   700  C C   . GLY A 1 92  ? 24.239 12.958 21.280  1.00 32.35  ? 179 GLY A C   1 
ATOM   701  O O   . GLY A 1 92  ? 24.465 11.821 21.705  1.00 29.51  ? 179 GLY A O   1 
ATOM   702  N N   . SER A 1 93  ? 25.149 13.924 21.261  1.00 37.27  ? 180 SER A N   1 
ATOM   703  C CA  . SER A 1 93  ? 26.517 13.781 21.740  1.00 36.32  ? 180 SER A CA  1 
ATOM   704  C C   . SER A 1 93  ? 26.559 13.121 23.090  1.00 33.34  ? 180 SER A C   1 
ATOM   705  O O   . SER A 1 93  ? 27.553 12.492 23.505  1.00 33.38  ? 180 SER A O   1 
ATOM   706  C CB  . SER A 1 93  ? 27.044 15.181 21.923  1.00 35.09  ? 180 SER A CB  1 
ATOM   707  O OG  . SER A 1 93  ? 26.062 15.874 22.654  1.00 31.55  ? 180 SER A OG  1 
ATOM   708  N N   . PHE A 1 94  ? 25.440 13.309 23.772  1.00 30.55  ? 181 PHE A N   1 
ATOM   709  C CA  . PHE A 1 94  ? 25.192 12.787 25.076  1.00 25.78  ? 181 PHE A CA  1 
ATOM   710  C C   . PHE A 1 94  ? 25.385 11.280 25.074  1.00 24.61  ? 181 PHE A C   1 
ATOM   711  O O   . PHE A 1 94  ? 26.034 10.801 25.976  1.00 21.23  ? 181 PHE A O   1 
ATOM   712  C CB  . PHE A 1 94  ? 23.758 13.140 25.557  1.00 24.80  ? 181 PHE A CB  1 
ATOM   713  C CG  . PHE A 1 94  ? 23.289 12.160 26.599  1.00 14.29  ? 181 PHE A CG  1 
ATOM   714  C CD1 . PHE A 1 94  ? 23.568 12.357 27.943  1.00 12.52  ? 181 PHE A CD1 1 
ATOM   715  C CD2 . PHE A 1 94  ? 22.577 11.017 26.235  1.00 17.95  ? 181 PHE A CD2 1 
ATOM   716  C CE1 . PHE A 1 94  ? 23.152 11.458 28.916  1.00 9.44   ? 181 PHE A CE1 1 
ATOM   717  C CE2 . PHE A 1 94  ? 22.141 10.081 27.197  1.00 16.44  ? 181 PHE A CE2 1 
ATOM   718  C CZ  . PHE A 1 94  ? 22.441 10.325 28.534  1.00 10.18  ? 181 PHE A CZ  1 
ATOM   719  N N   . ARG A 1 95  ? 24.831 10.557 24.058  1.00 21.62  ? 182 ARG A N   1 
ATOM   720  C CA  . ARG A 1 95  ? 25.013 9.099  23.992  1.00 22.95  ? 182 ARG A CA  1 
ATOM   721  C C   . ARG A 1 95  ? 26.508 8.877  23.813  1.00 31.12  ? 182 ARG A C   1 
ATOM   722  O O   . ARG A 1 95  ? 27.084 7.886  24.228  1.00 33.87  ? 182 ARG A O   1 
ATOM   723  C CB  . ARG A 1 95  ? 24.293 8.486  22.755  1.00 15.05  ? 182 ARG A CB  1 
ATOM   724  C CG  . ARG A 1 95  ? 23.791 7.018  22.871  1.00 25.00  ? 182 ARG A CG  1 
ATOM   725  C CD  . ARG A 1 95  ? 23.425 6.397  21.488  1.00 31.32  ? 182 ARG A CD  1 
ATOM   726  N NE  . ARG A 1 95  ? 23.524 4.916  21.438  1.00 25.87  ? 182 ARG A NE  1 
ATOM   727  C CZ  . ARG A 1 95  ? 23.758 4.183  20.324  1.00 22.82  ? 182 ARG A CZ  1 
ATOM   728  N NH1 . ARG A 1 95  ? 23.924 4.701  19.107  1.00 14.44  ? 182 ARG A NH1 1 
ATOM   729  N NH2 . ARG A 1 95  ? 23.829 2.855  20.439  1.00 19.72  ? 182 ARG A NH2 1 
ATOM   730  N N   . ARG A 1 96  ? 27.156 9.840  23.182  1.00 29.82  ? 183 ARG A N   1 
ATOM   731  C CA  . ARG A 1 96  ? 28.559 9.706  22.961  1.00 24.64  ? 183 ARG A CA  1 
ATOM   732  C C   . ARG A 1 96  ? 29.446 9.922  24.155  1.00 28.60  ? 183 ARG A C   1 
ATOM   733  O O   . ARG A 1 96  ? 30.659 9.878  24.071  1.00 33.89  ? 183 ARG A O   1 
ATOM   734  C CB  . ARG A 1 96  ? 29.074 10.381 21.710  1.00 21.79  ? 183 ARG A CB  1 
ATOM   735  C CG  . ARG A 1 96  ? 28.688 9.700  20.391  1.00 30.13  ? 183 ARG A CG  1 
ATOM   736  C CD  . ARG A 1 96  ? 29.631 10.212 19.326  1.00 41.35  ? 183 ARG A CD  1 
ATOM   737  N NE  . ARG A 1 96  ? 29.866 11.622 19.595  1.00 48.32  ? 183 ARG A NE  1 
ATOM   738  C CZ  . ARG A 1 96  ? 29.176 12.611 19.053  1.00 52.27  ? 183 ARG A CZ  1 
ATOM   739  N NH1 . ARG A 1 96  ? 28.199 12.405 18.168  1.00 54.43  ? 183 ARG A NH1 1 
ATOM   740  N NH2 . ARG A 1 96  ? 29.500 13.849 19.411  1.00 51.41  ? 183 ARG A NH2 1 
ATOM   741  N N   . GLY A 1 97  ? 28.856 10.145 25.321  1.00 22.75  ? 184 GLY A N   1 
ATOM   742  C CA  . GLY A 1 97  ? 29.690 10.340 26.444  1.00 16.74  ? 184 GLY A CA  1 
ATOM   743  C C   . GLY A 1 97  ? 29.821 11.798 26.774  1.00 25.74  ? 184 GLY A C   1 
ATOM   744  O O   . GLY A 1 97  ? 30.339 12.109 27.841  1.00 21.31  ? 184 GLY A O   1 
ATOM   745  N N   . ALA A 1 98  ? 29.331 12.676 25.874  1.00 30.68  ? 185 ALA A N   1 
ATOM   746  C CA  . ALA A 1 98  ? 29.368 14.144 26.066  1.00 29.17  ? 185 ALA A CA  1 
ATOM   747  C C   . ALA A 1 98  ? 29.130 14.572 27.522  1.00 27.71  ? 185 ALA A C   1 
ATOM   748  O O   . ALA A 1 98  ? 28.307 13.998 28.252  1.00 25.20  ? 185 ALA A O   1 
ATOM   749  C CB  . ALA A 1 98  ? 28.429 14.869 25.116  1.00 31.25  ? 185 ALA A CB  1 
ATOM   750  N N   . GLU A 1 99  ? 29.891 15.571 27.916  1.00 29.42  ? 186 GLU A N   1 
ATOM   751  C CA  . GLU A 1 99  ? 29.870 16.132 29.250  1.00 33.56  ? 186 GLU A CA  1 
ATOM   752  C C   . GLU A 1 99  ? 28.709 17.073 29.540  1.00 31.07  ? 186 GLU A C   1 
ATOM   753  O O   . GLU A 1 99  ? 28.286 17.257 30.693  1.00 31.77  ? 186 GLU A O   1 
ATOM   754  C CB  . GLU A 1 99  ? 31.210 16.852 29.467  1.00 46.56  ? 186 GLU A CB  1 
ATOM   755  C CG  . GLU A 1 99  ? 31.570 16.778 30.937  1.00 61.41  ? 186 GLU A CG  1 
ATOM   756  C CD  . GLU A 1 99  ? 31.560 15.347 31.345  1.00 74.05  ? 186 GLU A CD  1 
ATOM   757  O OE1 . GLU A 1 99  ? 31.981 14.571 30.384  1.00 80.95  ? 186 GLU A OE1 1 
ATOM   758  O OE2 . GLU A 1 99  ? 31.264 14.959 32.455  1.00 76.78  ? 186 GLU A OE2 1 
ATOM   759  N N   . SER A 1 100 ? 28.205 17.684 28.467  1.00 29.70  ? 187 SER A N   1 
ATOM   760  C CA  . SER A 1 100 ? 27.107 18.625 28.510  1.00 30.21  ? 187 SER A CA  1 
ATOM   761  C C   . SER A 1 100 ? 26.374 18.471 27.203  1.00 27.24  ? 187 SER A C   1 
ATOM   762  O O   . SER A 1 100 ? 26.960 17.996 26.239  1.00 25.94  ? 187 SER A O   1 
ATOM   763  C CB  . SER A 1 100 ? 27.636 20.046 28.634  1.00 32.62  ? 187 SER A CB  1 
ATOM   764  O OG  . SER A 1 100 ? 28.054 20.505 27.354  1.00 38.35  ? 187 SER A OG  1 
ATOM   765  N N   . SER A 1 101 ? 25.100 18.880 27.168  1.00 29.57  ? 188 SER A N   1 
ATOM   766  C CA  . SER A 1 101 ? 24.276 18.774 25.959  1.00 22.74  ? 188 SER A CA  1 
ATOM   767  C C   . SER A 1 101 ? 23.488 20.018 25.813  1.00 19.37  ? 188 SER A C   1 
ATOM   768  O O   . SER A 1 101 ? 23.482 20.845 26.722  1.00 19.17  ? 188 SER A O   1 
ATOM   769  C CB  . SER A 1 101 ? 23.286 17.637 26.055  1.00 29.21  ? 188 SER A CB  1 
ATOM   770  O OG  . SER A 1 101 ? 23.987 16.416 26.058  1.00 32.97  ? 188 SER A OG  1 
ATOM   771  N N   . GLY A 1 102 ? 22.814 20.187 24.701  1.00 25.62  ? 189 GLY A N   1 
ATOM   772  C CA  . GLY A 1 102 ? 22.040 21.389 24.552  1.00 29.93  ? 189 GLY A CA  1 
ATOM   773  C C   . GLY A 1 102 ? 20.553 21.126 24.566  1.00 38.31  ? 189 GLY A C   1 
ATOM   774  O O   . GLY A 1 102 ? 19.753 22.036 24.753  1.00 41.36  ? 189 GLY A O   1 
ATOM   775  N N   . ASP A 1 103 ? 20.210 19.875 24.351  1.00 35.38  ? 190 ASP A N   1 
ATOM   776  C CA  . ASP A 1 103 ? 18.839 19.484 24.307  1.00 33.02  ? 190 ASP A CA  1 
ATOM   777  C C   . ASP A 1 103 ? 18.769 17.994 24.340  1.00 31.86  ? 190 ASP A C   1 
ATOM   778  O O   . ASP A 1 103 ? 19.810 17.357 24.323  1.00 30.42  ? 190 ASP A O   1 
ATOM   779  C CB  . ASP A 1 103 ? 18.260 19.925 22.956  1.00 37.13  ? 190 ASP A CB  1 
ATOM   780  C CG  . ASP A 1 103 ? 18.966 19.363 21.746  1.00 42.92  ? 190 ASP A CG  1 
ATOM   781  O OD1 . ASP A 1 103 ? 19.347 18.204 21.631  1.00 49.46  ? 190 ASP A OD1 1 
ATOM   782  O OD2 . ASP A 1 103 ? 19.093 20.246 20.798  1.00 44.71  ? 190 ASP A OD2 1 
ATOM   783  N N   . MET A 1 104 ? 17.555 17.459 24.392  1.00 30.70  ? 191 MET A N   1 
ATOM   784  C CA  . MET A 1 104 ? 17.349 16.037 24.433  1.00 21.86  ? 191 MET A CA  1 
ATOM   785  C C   . MET A 1 104 ? 16.760 15.440 23.196  1.00 21.97  ? 191 MET A C   1 
ATOM   786  O O   . MET A 1 104 ? 15.681 15.753 22.717  1.00 28.31  ? 191 MET A O   1 
ATOM   787  C CB  . MET A 1 104 ? 16.636 15.578 25.705  1.00 21.75  ? 191 MET A CB  1 
ATOM   788  C CG  . MET A 1 104 ? 16.349 14.087 25.744  1.00 21.61  ? 191 MET A CG  1 
ATOM   789  S SD  . MET A 1 104 ? 15.710 13.538 27.350  1.00 32.73  ? 191 MET A SD  1 
ATOM   790  C CE  . MET A 1 104 ? 17.226 13.406 28.321  1.00 36.84  ? 191 MET A CE  1 
ATOM   791  N N   . ASP A 1 105 ? 17.501 14.537 22.644  1.00 22.42  ? 192 ASP A N   1 
ATOM   792  C CA  . ASP A 1 105 ? 17.011 13.941 21.493  1.00 26.59  ? 192 ASP A CA  1 
ATOM   793  C C   . ASP A 1 105 ? 16.612 12.503 21.777  1.00 28.76  ? 192 ASP A C   1 
ATOM   794  O O   . ASP A 1 105 ? 17.459 11.673 22.108  1.00 29.13  ? 192 ASP A O   1 
ATOM   795  C CB  . ASP A 1 105 ? 18.069 14.122 20.422  1.00 33.32  ? 192 ASP A CB  1 
ATOM   796  C CG  . ASP A 1 105 ? 17.494 14.017 19.061  1.00 44.31  ? 192 ASP A CG  1 
ATOM   797  O OD1 . ASP A 1 105 ? 16.183 14.028 19.060  1.00 45.46  ? 192 ASP A OD1 1 
ATOM   798  O OD2 . ASP A 1 105 ? 18.196 13.916 18.070  1.00 53.69  ? 192 ASP A OD2 1 
ATOM   799  N N   . VAL A 1 106 ? 15.312 12.198 21.676  1.00 23.70  ? 193 VAL A N   1 
ATOM   800  C CA  . VAL A 1 106 ? 14.858 10.862 21.942  1.00 18.04  ? 193 VAL A CA  1 
ATOM   801  C C   . VAL A 1 106 ? 14.325 10.209 20.692  1.00 24.96  ? 193 VAL A C   1 
ATOM   802  O O   . VAL A 1 106 ? 13.543 10.821 19.965  1.00 29.80  ? 193 VAL A O   1 
ATOM   803  C CB  . VAL A 1 106 ? 13.798 10.781 23.006  1.00 17.90  ? 193 VAL A CB  1 
ATOM   804  C CG1 . VAL A 1 106 ? 13.420 9.332  23.220  1.00 17.65  ? 193 VAL A CG1 1 
ATOM   805  C CG2 . VAL A 1 106 ? 14.294 11.403 24.307  1.00 14.51  ? 193 VAL A CG2 1 
ATOM   806  N N   . LEU A 1 107 ? 14.764 8.997  20.464  1.00 23.01  ? 194 LEU A N   1 
ATOM   807  C CA  . LEU A 1 107 ? 14.345 8.228  19.326  1.00 27.14  ? 194 LEU A CA  1 
ATOM   808  C C   . LEU A 1 107 ? 13.419 7.079  19.826  1.00 26.10  ? 194 LEU A C   1 
ATOM   809  O O   . LEU A 1 107 ? 13.810 6.268  20.640  1.00 31.73  ? 194 LEU A O   1 
ATOM   810  C CB  . LEU A 1 107 ? 15.476 7.914  18.330  1.00 26.61  ? 194 LEU A CB  1 
ATOM   811  C CG  . LEU A 1 107 ? 15.808 9.092  17.414  1.00 27.66  ? 194 LEU A CG  1 
ATOM   812  C CD1 . LEU A 1 107 ? 16.302 10.320 18.190  1.00 29.69  ? 194 LEU A CD1 1 
ATOM   813  C CD2 . LEU A 1 107 ? 16.865 8.659  16.405  1.00 29.01  ? 194 LEU A CD2 1 
ATOM   814  N N   . LEU A 1 108 ? 12.206 7.045  19.380  1.00 25.06  ? 195 LEU A N   1 
ATOM   815  C CA  . LEU A 1 108 ? 11.273 6.046  19.842  1.00 18.42  ? 195 LEU A CA  1 
ATOM   816  C C   . LEU A 1 108 ? 10.758 5.121  18.744  1.00 18.59  ? 195 LEU A C   1 
ATOM   817  O O   . LEU A 1 108 ? 10.424 5.524  17.639  1.00 20.04  ? 195 LEU A O   1 
ATOM   818  C CB  . LEU A 1 108 ? 10.148 6.853  20.447  1.00 14.05  ? 195 LEU A CB  1 
ATOM   819  C CG  . LEU A 1 108 ? 8.962  6.029  20.825  1.00 15.26  ? 195 LEU A CG  1 
ATOM   820  C CD1 . LEU A 1 108 ? 9.228  5.285  22.133  1.00 6.44   ? 195 LEU A CD1 1 
ATOM   821  C CD2 . LEU A 1 108 ? 7.670  6.883  20.868  1.00 16.49  ? 195 LEU A CD2 1 
ATOM   822  N N   . THR A 1 109 ? 10.649 3.829  19.044  1.00 15.28  ? 196 THR A N   1 
ATOM   823  C CA  . THR A 1 109 ? 10.150 2.943  18.005  1.00 15.21  ? 196 THR A CA  1 
ATOM   824  C C   . THR A 1 109 ? 9.294  1.820  18.543  1.00 16.13  ? 196 THR A C   1 
ATOM   825  O O   . THR A 1 109 ? 9.268  1.569  19.765  1.00 19.01  ? 196 THR A O   1 
ATOM   826  C CB  . THR A 1 109 ? 11.258 2.411  17.133  1.00 20.06  ? 196 THR A CB  1 
ATOM   827  O OG1 . THR A 1 109 ? 10.662 2.034  15.879  1.00 24.62  ? 196 THR A OG1 1 
ATOM   828  C CG2 . THR A 1 109 ? 11.844 1.172  17.851  1.00 22.06  ? 196 THR A CG2 1 
ATOM   829  N N   . HIS A 1 110 ? 8.571  1.155  17.657  1.00 18.72  ? 197 HIS A N   1 
ATOM   830  C CA  . HIS A 1 110 ? 7.700  0.064  18.077  1.00 25.37  ? 197 HIS A CA  1 
ATOM   831  C C   . HIS A 1 110 ? 7.516  -0.928 16.953  1.00 27.12  ? 197 HIS A C   1 
ATOM   832  O O   . HIS A 1 110 ? 7.420  -0.558 15.756  1.00 31.36  ? 197 HIS A O   1 
ATOM   833  C CB  . HIS A 1 110 ? 6.354  0.644  18.576  1.00 21.01  ? 197 HIS A CB  1 
ATOM   834  C CG  . HIS A 1 110 ? 5.527  -0.256 19.405  1.00 23.33  ? 197 HIS A CG  1 
ATOM   835  N ND1 . HIS A 1 110 ? 4.912  -1.417 18.879  1.00 28.53  ? 197 HIS A ND1 1 
ATOM   836  C CD2 . HIS A 1 110 ? 5.161  -0.162 20.706  1.00 21.01  ? 197 HIS A CD2 1 
ATOM   837  C CE1 . HIS A 1 110 ? 4.217  -1.981 19.885  1.00 23.44  ? 197 HIS A CE1 1 
ATOM   838  N NE2 . HIS A 1 110 ? 4.353  -1.240 20.997  1.00 19.71  ? 197 HIS A NE2 1 
ATOM   839  N N   . PRO A 1 111 ? 7.491  -2.190 17.330  1.00 21.81  ? 198 PRO A N   1 
ATOM   840  C CA  . PRO A 1 111 ? 7.359  -3.245 16.361  1.00 21.77  ? 198 PRO A CA  1 
ATOM   841  C C   . PRO A 1 111 ? 6.081  -3.161 15.546  1.00 27.16  ? 198 PRO A C   1 
ATOM   842  O O   . PRO A 1 111 ? 5.983  -3.704 14.448  1.00 27.44  ? 198 PRO A O   1 
ATOM   843  C CB  . PRO A 1 111 ? 7.458  -4.554 17.117  1.00 19.03  ? 198 PRO A CB  1 
ATOM   844  C CG  . PRO A 1 111 ? 7.725  -4.223 18.588  1.00 25.86  ? 198 PRO A CG  1 
ATOM   845  C CD  . PRO A 1 111 ? 7.571  -2.694 18.711  1.00 20.69  ? 198 PRO A CD  1 
ATOM   846  N N   . ASN A 1 112 ? 5.106  -2.475 16.103  1.00 27.91  ? 199 ASN A N   1 
ATOM   847  C CA  . ASN A 1 112 ? 3.830  -2.349 15.410  1.00 27.63  ? 199 ASN A CA  1 
ATOM   848  C C   . ASN A 1 112 ? 3.820  -1.356 14.324  1.00 28.65  ? 199 ASN A C   1 
ATOM   849  O O   . ASN A 1 112 ? 2.855  -1.284 13.550  1.00 33.05  ? 199 ASN A O   1 
ATOM   850  C CB  . ASN A 1 112 ? 2.749  -1.865 16.369  1.00 29.69  ? 199 ASN A CB  1 
ATOM   851  C CG  . ASN A 1 112 ? 2.210  -2.961 17.206  1.00 32.74  ? 199 ASN A CG  1 
ATOM   852  O OD1 . ASN A 1 112 ? 2.430  -4.138 16.874  1.00 36.28  ? 199 ASN A OD1 1 
ATOM   853  N ND2 . ASN A 1 112 ? 1.488  -2.555 18.260  1.00 30.59  ? 199 ASN A ND2 1 
ATOM   854  N N   . PHE A 1 113 ? 4.888  -0.590 14.291  1.00 26.40  ? 200 PHE A N   1 
ATOM   855  C CA  . PHE A 1 113 ? 5.037  0.474  13.348  1.00 26.46  ? 200 PHE A CA  1 
ATOM   856  C C   . PHE A 1 113 ? 6.290  0.320  12.508  1.00 27.01  ? 200 PHE A C   1 
ATOM   857  O O   . PHE A 1 113 ? 7.402  0.476  13.013  1.00 29.48  ? 200 PHE A O   1 
ATOM   858  C CB  . PHE A 1 113 ? 5.054  1.770  14.206  1.00 28.24  ? 200 PHE A CB  1 
ATOM   859  C CG  . PHE A 1 113 ? 5.223  2.967  13.369  1.00 36.63  ? 200 PHE A CG  1 
ATOM   860  C CD1 . PHE A 1 113 ? 4.329  3.169  12.306  1.00 42.19  ? 200 PHE A CD1 1 
ATOM   861  C CD2 . PHE A 1 113 ? 6.240  3.909  13.590  1.00 40.57  ? 200 PHE A CD2 1 
ATOM   862  C CE1 . PHE A 1 113 ? 4.445  4.291  11.464  1.00 40.19  ? 200 PHE A CE1 1 
ATOM   863  C CE2 . PHE A 1 113 ? 6.365  5.029  12.762  1.00 41.85  ? 200 PHE A CE2 1 
ATOM   864  C CZ  . PHE A 1 113 ? 5.467  5.225  11.704  1.00 36.89  ? 200 PHE A CZ  1 
ATOM   865  N N   . THR A 1 114 ? 6.065  0.037  11.218  1.00 25.35  ? 201 THR A N   1 
ATOM   866  C CA  . THR A 1 114 ? 7.082  -0.158 10.231  1.00 28.22  ? 201 THR A CA  1 
ATOM   867  C C   . THR A 1 114 ? 6.754  0.730  9.076   1.00 34.78  ? 201 THR A C   1 
ATOM   868  O O   . THR A 1 114 ? 5.621  1.210  8.994   1.00 37.21  ? 201 THR A O   1 
ATOM   869  C CB  . THR A 1 114 ? 7.092  -1.595 9.713   1.00 31.19  ? 201 THR A CB  1 
ATOM   870  O OG1 . THR A 1 114 ? 5.867  -1.852 9.055   1.00 33.87  ? 201 THR A OG1 1 
ATOM   871  C CG2 . THR A 1 114 ? 7.213  -2.531 10.900  1.00 33.72  ? 201 THR A CG2 1 
ATOM   872  N N   . SER A 1 115 ? 7.775  0.913  8.228   1.00 36.26  ? 202 SER A N   1 
ATOM   873  C CA  . SER A 1 115 ? 7.728  1.717  7.051   1.00 41.32  ? 202 SER A CA  1 
ATOM   874  C C   . SER A 1 115 ? 6.660  1.223  6.084   1.00 49.38  ? 202 SER A C   1 
ATOM   875  O O   . SER A 1 115 ? 6.388  1.782  5.014   1.00 52.11  ? 202 SER A O   1 
ATOM   876  C CB  . SER A 1 115 ? 9.118  1.943  6.439   1.00 39.24  ? 202 SER A CB  1 
ATOM   877  O OG  . SER A 1 115 ? 9.571  0.792  5.747   1.00 37.53  ? 202 SER A OG  1 
ATOM   878  N N   . GLU A 1 116 ? 6.024  0.143  6.438   1.00 55.26  ? 203 GLU A N   1 
ATOM   879  C CA  . GLU A 1 116 ? 5.008  -0.287 5.543   1.00 66.15  ? 203 GLU A CA  1 
ATOM   880  C C   . GLU A 1 116 ? 3.715  0.305  6.057   1.00 65.05  ? 203 GLU A C   1 
ATOM   881  O O   . GLU A 1 116 ? 2.896  0.756  5.273   1.00 64.81  ? 203 GLU A O   1 
ATOM   882  C CB  . GLU A 1 116 ? 5.014  -1.794 5.199   1.00 78.05  ? 203 GLU A CB  1 
ATOM   883  C CG  . GLU A 1 116 ? 4.704  -1.992 3.692   1.00 88.74  ? 203 GLU A CG  1 
ATOM   884  C CD  . GLU A 1 116 ? 5.264  -3.245 3.060   1.00 96.53  ? 203 GLU A CD  1 
ATOM   885  O OE1 . GLU A 1 116 ? 5.828  -4.063 3.912   1.00 99.26  ? 203 GLU A OE1 1 
ATOM   886  O OE2 . GLU A 1 116 ? 5.222  -3.455 1.860   1.00 98.80  ? 203 GLU A OE2 1 
ATOM   887  N N   . SER A 1 117 ? 3.566  0.346  7.392   1.00 68.20  ? 204 SER A N   1 
ATOM   888  C CA  . SER A 1 117 ? 2.367  0.920  7.990   1.00 71.17  ? 204 SER A CA  1 
ATOM   889  C C   . SER A 1 117 ? 2.222  2.339  7.574   1.00 74.82  ? 204 SER A C   1 
ATOM   890  O O   . SER A 1 117 ? 1.489  2.695  6.670   1.00 73.04  ? 204 SER A O   1 
ATOM   891  C CB  . SER A 1 117 ? 2.421  0.971  9.501   1.00 71.80  ? 204 SER A CB  1 
ATOM   892  O OG  . SER A 1 117 ? 2.443  -0.311 10.070  1.00 72.40  ? 204 SER A OG  1 
ATOM   893  N N   . SER A 1 118 ? 2.961  3.161  8.278   1.00 84.19  ? 205 SER A N   1 
ATOM   894  C CA  . SER A 1 118 ? 2.937  4.567  7.999   1.00 91.58  ? 205 SER A CA  1 
ATOM   895  C C   . SER A 1 118 ? 1.555  5.181  8.289   1.00 89.52  ? 205 SER A C   1 
ATOM   896  O O   . SER A 1 118 ? 0.799  5.390  7.329   1.00 92.08  ? 205 SER A O   1 
ATOM   897  C CB  . SER A 1 118 ? 3.355  4.789  6.544   1.00 96.81  ? 205 SER A CB  1 
ATOM   898  O OG  . SER A 1 118 ? 4.580  4.116  6.260   1.00 99.16  ? 205 SER A OG  1 
ATOM   899  N N   . LYS A 1 119 ? 1.283  5.472  9.610   1.00 82.59  ? 206 LYS A N   1 
ATOM   900  C CA  . LYS A 1 119 ? 0.032  6.077  10.128  1.00 75.72  ? 206 LYS A CA  1 
ATOM   901  C C   . LYS A 1 119 ? -0.289 5.819  11.639  1.00 60.77  ? 206 LYS A C   1 
ATOM   902  O O   . LYS A 1 119 ? -1.441 5.549  11.999  1.00 60.26  ? 206 LYS A O   1 
ATOM   903  C CB  . LYS A 1 119 ? -1.128 5.588  9.285   1.00 84.55  ? 206 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 119 ? -1.045 4.083  9.308   1.00 90.97  ? 206 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 119 ? -1.107 3.391  7.970   1.00 94.06  ? 206 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 119 ? -0.758 1.927  8.164   1.00 97.47  ? 206 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 119 ? -0.820 1.150  6.929   1.00 100.00 ? 206 LYS A NZ  1 
ATOM   908  N N   . GLN A 1 120 ? 0.630  5.891  12.589  1.00 47.96  ? 207 GLN A N   1 
ATOM   909  C CA  . GLN A 1 120 ? 0.112  5.609  13.937  1.00 42.16  ? 207 GLN A CA  1 
ATOM   910  C C   . GLN A 1 120 ? 0.437  6.650  15.014  1.00 43.79  ? 207 GLN A C   1 
ATOM   911  O O   . GLN A 1 120 ? 1.087  6.360  16.030  1.00 47.21  ? 207 GLN A O   1 
ATOM   912  C CB  . GLN A 1 120 ? 0.439  4.188  14.461  1.00 36.89  ? 207 GLN A CB  1 
ATOM   913  C CG  . GLN A 1 120 ? 0.613  3.146  13.344  1.00 32.80  ? 207 GLN A CG  1 
ATOM   914  C CD  . GLN A 1 120 ? 0.975  1.800  13.893  1.00 26.85  ? 207 GLN A CD  1 
ATOM   915  O OE1 . GLN A 1 120 ? 0.801  1.570  15.098  1.00 27.65  ? 207 GLN A OE1 1 
ATOM   916  N NE2 . GLN A 1 120 ? 1.724  1.002  13.144  1.00 26.15  ? 207 GLN A NE2 1 
ATOM   917  N N   . PRO A 1 121 ? -0.037 7.867  14.775  1.00 45.66  ? 208 PRO A N   1 
ATOM   918  C CA  . PRO A 1 121 ? 0.153  9.009  15.649  1.00 41.79  ? 208 PRO A CA  1 
ATOM   919  C C   . PRO A 1 121 ? -0.049 8.677  17.117  1.00 33.24  ? 208 PRO A C   1 
ATOM   920  O O   . PRO A 1 121 ? 0.669  9.155  18.001  1.00 33.75  ? 208 PRO A O   1 
ATOM   921  C CB  . PRO A 1 121 ? -0.826 10.099 15.158  1.00 45.99  ? 208 PRO A CB  1 
ATOM   922  C CG  . PRO A 1 121 ? -1.461 9.581  13.873  1.00 48.01  ? 208 PRO A CG  1 
ATOM   923  C CD  . PRO A 1 121 ? -1.034 8.131  13.699  1.00 49.52  ? 208 PRO A CD  1 
ATOM   924  N N   . LYS A 1 122 ? -1.028 7.835  17.389  1.00 29.34  ? 209 LYS A N   1 
ATOM   925  C CA  . LYS A 1 122 ? -1.325 7.416  18.743  1.00 31.05  ? 209 LYS A CA  1 
ATOM   926  C C   . LYS A 1 122 ? -0.081 6.919  19.501  1.00 23.82  ? 209 LYS A C   1 
ATOM   927  O O   . LYS A 1 122 ? 0.082  7.167  20.690  1.00 24.61  ? 209 LYS A O   1 
ATOM   928  C CB  . LYS A 1 122 ? -2.333 6.309  18.634  1.00 42.89  ? 209 LYS A CB  1 
ATOM   929  C CG  . LYS A 1 122 ? -3.626 6.830  18.079  1.00 47.50  ? 209 LYS A CG  1 
ATOM   930  C CD  . LYS A 1 122 ? -4.373 7.600  19.141  1.00 49.63  ? 209 LYS A CD  1 
ATOM   931  C CE  . LYS A 1 122 ? -5.765 7.986  18.704  1.00 52.01  ? 209 LYS A CE  1 
ATOM   932  N NZ  . LYS A 1 122 ? -6.484 8.689  19.769  1.00 54.49  ? 209 LYS A NZ  1 
ATOM   933  N N   . LEU A 1 123 ? 0.796  6.222  18.781  1.00 24.17  ? 210 LEU A N   1 
ATOM   934  C CA  . LEU A 1 123 ? 2.033  5.672  19.297  1.00 29.34  ? 210 LEU A CA  1 
ATOM   935  C C   . LEU A 1 123 ? 2.910  6.742  19.931  1.00 29.24  ? 210 LEU A C   1 
ATOM   936  O O   . LEU A 1 123 ? 3.461  6.583  21.051  1.00 29.04  ? 210 LEU A O   1 
ATOM   937  C CB  . LEU A 1 123 ? 2.793  4.919  18.192  1.00 32.91  ? 210 LEU A CB  1 
ATOM   938  C CG  . LEU A 1 123 ? 2.309  3.478  17.996  1.00 30.74  ? 210 LEU A CG  1 
ATOM   939  C CD1 . LEU A 1 123 ? 3.192  2.735  16.978  1.00 32.29  ? 210 LEU A CD1 1 
ATOM   940  C CD2 . LEU A 1 123 ? 2.380  2.772  19.342  1.00 24.06  ? 210 LEU A CD2 1 
ATOM   941  N N   . LEU A 1 124 ? 3.054  7.837  19.193  1.00 21.88  ? 211 LEU A N   1 
ATOM   942  C CA  . LEU A 1 124 ? 3.859  8.937  19.695  1.00 19.12  ? 211 LEU A CA  1 
ATOM   943  C C   . LEU A 1 124 ? 3.064  9.736  20.694  1.00 20.69  ? 211 LEU A C   1 
ATOM   944  O O   . LEU A 1 124 ? 3.540  9.955  21.803  1.00 17.66  ? 211 LEU A O   1 
ATOM   945  C CB  . LEU A 1 124 ? 4.400  9.914  18.636  1.00 20.72  ? 211 LEU A CB  1 
ATOM   946  C CG  . LEU A 1 124 ? 4.966  11.187 19.282  1.00 22.10  ? 211 LEU A CG  1 
ATOM   947  C CD1 . LEU A 1 124 ? 6.094  10.850 20.232  1.00 22.96  ? 211 LEU A CD1 1 
ATOM   948  C CD2 . LEU A 1 124 ? 5.543  12.132 18.224  1.00 19.66  ? 211 LEU A CD2 1 
ATOM   949  N N   . HIS A 1 125 ? 1.834  10.142 20.307  1.00 25.97  ? 212 HIS A N   1 
ATOM   950  C CA  . HIS A 1 125 ? 0.994  10.955 21.197  1.00 21.96  ? 212 HIS A CA  1 
ATOM   951  C C   . HIS A 1 125 ? 0.815  10.411 22.565  1.00 24.01  ? 212 HIS A C   1 
ATOM   952  O O   . HIS A 1 125 ? 0.879  11.147 23.566  1.00 30.65  ? 212 HIS A O   1 
ATOM   953  C CB  . HIS A 1 125 ? -0.304 11.587 20.668  1.00 27.49  ? 212 HIS A CB  1 
ATOM   954  C CG  . HIS A 1 125 ? -0.066 12.284 19.387  1.00 37.34  ? 212 HIS A CG  1 
ATOM   955  N ND1 . HIS A 1 125 ? -1.050 12.390 18.426  1.00 41.22  ? 212 HIS A ND1 1 
ATOM   956  C CD2 . HIS A 1 125 ? 1.069  12.858 18.908  1.00 35.27  ? 212 HIS A CD2 1 
ATOM   957  C CE1 . HIS A 1 125 ? -0.506 13.044 17.398  1.00 42.58  ? 212 HIS A CE1 1 
ATOM   958  N NE2 . HIS A 1 125 ? 0.774  13.335 17.655  1.00 38.08  ? 212 HIS A NE2 1 
ATOM   959  N N   . ARG A 1 126 ? 0.585  9.132  22.669  1.00 22.39  ? 213 ARG A N   1 
ATOM   960  C CA  . ARG A 1 126 ? 0.399  8.521  23.951  1.00 21.85  ? 213 ARG A CA  1 
ATOM   961  C C   . ARG A 1 126 ? 1.547  8.784  24.891  1.00 26.51  ? 213 ARG A C   1 
ATOM   962  O O   . ARG A 1 126 ? 1.353  9.042  26.075  1.00 26.94  ? 213 ARG A O   1 
ATOM   963  C CB  . ARG A 1 126 ? 0.299  7.029  23.671  1.00 25.75  ? 213 ARG A CB  1 
ATOM   964  C CG  . ARG A 1 126 ? -0.093 6.210  24.906  1.00 24.17  ? 213 ARG A CG  1 
ATOM   965  C CD  . ARG A 1 126 ? -0.066 4.701  24.666  1.00 26.54  ? 213 ARG A CD  1 
ATOM   966  N NE  . ARG A 1 126 ? -0.502 4.044  25.888  1.00 26.82  ? 213 ARG A NE  1 
ATOM   967  C CZ  . ARG A 1 126 ? -0.480 2.761  26.211  1.00 32.60  ? 213 ARG A CZ  1 
ATOM   968  N NH1 . ARG A 1 126 ? -0.024 1.777  25.420  1.00 35.12  ? 213 ARG A NH1 1 
ATOM   969  N NH2 . ARG A 1 126 ? -0.945 2.429  27.409  1.00 27.49  ? 213 ARG A NH2 1 
ATOM   970  N N   . VAL A 1 127 ? 2.756  8.727  24.413  1.00 30.06  ? 214 VAL A N   1 
ATOM   971  C CA  . VAL A 1 127 ? 3.894  8.957  25.304  1.00 32.27  ? 214 VAL A CA  1 
ATOM   972  C C   . VAL A 1 127 ? 4.032  10.383 25.793  1.00 29.17  ? 214 VAL A C   1 
ATOM   973  O O   . VAL A 1 127 ? 4.392  10.662 26.952  1.00 22.92  ? 214 VAL A O   1 
ATOM   974  C CB  . VAL A 1 127 ? 5.111  8.630  24.506  1.00 36.35  ? 214 VAL A CB  1 
ATOM   975  C CG1 . VAL A 1 127 ? 6.362  8.755  25.377  1.00 31.26  ? 214 VAL A CG1 1 
ATOM   976  C CG2 . VAL A 1 127 ? 4.903  7.259  23.850  1.00 36.12  ? 214 VAL A CG2 1 
ATOM   977  N N   . VAL A 1 128 ? 3.755  11.294 24.859  1.00 25.33  ? 215 VAL A N   1 
ATOM   978  C CA  . VAL A 1 128 ? 3.815  12.714 25.090  1.00 21.48  ? 215 VAL A CA  1 
ATOM   979  C C   . VAL A 1 128 ? 2.847  12.944 26.232  1.00 22.54  ? 215 VAL A C   1 
ATOM   980  O O   . VAL A 1 128 ? 3.170  13.520 27.293  1.00 22.03  ? 215 VAL A O   1 
ATOM   981  C CB  . VAL A 1 128 ? 3.392  13.399 23.764  1.00 18.27  ? 215 VAL A CB  1 
ATOM   982  C CG1 . VAL A 1 128 ? 3.127  14.882 23.907  1.00 19.32  ? 215 VAL A CG1 1 
ATOM   983  C CG2 . VAL A 1 128 ? 4.370  13.137 22.620  1.00 15.88  ? 215 VAL A CG2 1 
ATOM   984  N N   . GLU A 1 129 ? 1.669  12.420 25.989  1.00 24.36  ? 216 GLU A N   1 
ATOM   985  C CA  . GLU A 1 129 ? 0.587  12.527 26.942  1.00 32.06  ? 216 GLU A CA  1 
ATOM   986  C C   . GLU A 1 129 ? 1.015  12.087 28.330  1.00 31.71  ? 216 GLU A C   1 
ATOM   987  O O   . GLU A 1 129 ? 0.793  12.781 29.321  1.00 29.28  ? 216 GLU A O   1 
ATOM   988  C CB  . GLU A 1 129 ? -0.754 11.933 26.441  1.00 42.51  ? 216 GLU A CB  1 
ATOM   989  C CG  . GLU A 1 129 ? -1.291 12.682 25.190  1.00 52.44  ? 216 GLU A CG  1 
ATOM   990  C CD  . GLU A 1 129 ? -2.643 12.235 24.666  1.00 61.03  ? 216 GLU A CD  1 
ATOM   991  O OE1 . GLU A 1 129 ? -3.466 11.884 25.628  1.00 61.54  ? 216 GLU A OE1 1 
ATOM   992  O OE2 . GLU A 1 129 ? -2.952 12.272 23.472  1.00 64.40  ? 216 GLU A OE2 1 
ATOM   993  N N   . GLN A 1 130 ? 1.675  10.922 28.398  1.00 29.50  ? 217 GLN A N   1 
ATOM   994  C CA  . GLN A 1 130 ? 2.120  10.415 29.675  1.00 23.72  ? 217 GLN A CA  1 
ATOM   995  C C   . GLN A 1 130 ? 3.163  11.309 30.293  1.00 28.15  ? 217 GLN A C   1 
ATOM   996  O O   . GLN A 1 130 ? 3.135  11.528 31.508  1.00 26.80  ? 217 GLN A O   1 
ATOM   997  C CB  . GLN A 1 130 ? 2.522  8.928  29.576  1.00 26.13  ? 217 GLN A CB  1 
ATOM   998  C CG  . GLN A 1 130 ? 3.175  8.359  30.858  1.00 22.93  ? 217 GLN A CG  1 
ATOM   999  C CD  . GLN A 1 130 ? 2.208  8.323  32.014  1.00 25.83  ? 217 GLN A CD  1 
ATOM   1000 O OE1 . GLN A 1 130 ? 2.582  8.314  33.187  1.00 22.62  ? 217 GLN A OE1 1 
ATOM   1001 N NE2 . GLN A 1 130 ? 0.942  8.190  31.676  1.00 28.90  ? 217 GLN A NE2 1 
ATOM   1002 N N   . LEU A 1 131 ? 4.089  11.860 29.505  1.00 33.46  ? 218 LEU A N   1 
ATOM   1003 C CA  . LEU A 1 131 ? 5.104  12.727 30.098  1.00 30.04  ? 218 LEU A CA  1 
ATOM   1004 C C   . LEU A 1 131 ? 4.462  14.024 30.531  1.00 28.56  ? 218 LEU A C   1 
ATOM   1005 O O   . LEU A 1 131 ? 4.922  14.687 31.459  1.00 22.79  ? 218 LEU A O   1 
ATOM   1006 C CB  . LEU A 1 131 ? 6.311  12.971 29.179  1.00 28.20  ? 218 LEU A CB  1 
ATOM   1007 C CG  . LEU A 1 131 ? 6.987  11.703 28.652  1.00 25.80  ? 218 LEU A CG  1 
ATOM   1008 C CD1 . LEU A 1 131 ? 7.933  12.027 27.491  1.00 27.88  ? 218 LEU A CD1 1 
ATOM   1009 C CD2 . LEU A 1 131 ? 7.731  10.936 29.752  1.00 19.35  ? 218 LEU A CD2 1 
ATOM   1010 N N   . GLN A 1 132 ? 3.389  14.388 29.861  1.00 28.90  ? 219 GLN A N   1 
ATOM   1011 C CA  . GLN A 1 132 ? 2.788  15.629 30.287  1.00 30.97  ? 219 GLN A CA  1 
ATOM   1012 C C   . GLN A 1 132 ? 2.061  15.396 31.560  1.00 29.90  ? 219 GLN A C   1 
ATOM   1013 O O   . GLN A 1 132 ? 1.980  16.226 32.442  1.00 35.69  ? 219 GLN A O   1 
ATOM   1014 C CB  . GLN A 1 132 ? 1.857  16.261 29.264  1.00 31.04  ? 219 GLN A CB  1 
ATOM   1015 C CG  . GLN A 1 132 ? 2.389  16.243 27.832  1.00 37.23  ? 219 GLN A CG  1 
ATOM   1016 C CD  . GLN A 1 132 ? 1.521  17.160 27.013  1.00 45.51  ? 219 GLN A CD  1 
ATOM   1017 O OE1 . GLN A 1 132 ? 0.973  16.773 25.968  1.00 46.44  ? 219 GLN A OE1 1 
ATOM   1018 N NE2 . GLN A 1 132 ? 1.315  18.345 27.562  1.00 47.24  ? 219 GLN A NE2 1 
ATOM   1019 N N   . LYS A 1 133 ? 1.523  14.226 31.646  1.00 27.53  ? 220 LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 0.810  13.919 32.833  1.00 26.04  ? 220 LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 1.758  13.908 34.014  1.00 30.06  ? 220 LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 1.423  14.369 35.089  1.00 35.59  ? 220 LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? -0.047 12.690 32.608  1.00 26.20  ? 220 LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? -0.301 11.848 33.829  1.00 26.12  ? 220 LYS A CG  1 
ATOM   1025 N N   . VAL A 1 134 ? 2.961  13.387 33.832  1.00 32.64  ? 221 VAL A N   1 
ATOM   1026 C CA  . VAL A 1 134 ? 3.888  13.374 34.937  1.00 38.41  ? 221 VAL A CA  1 
ATOM   1027 C C   . VAL A 1 134 ? 4.495  14.712 35.165  1.00 44.61  ? 221 VAL A C   1 
ATOM   1028 O O   . VAL A 1 134 ? 5.266  14.890 36.092  1.00 42.92  ? 221 VAL A O   1 
ATOM   1029 C CB  . VAL A 1 134 ? 5.013  12.395 34.789  1.00 33.96  ? 221 VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 134 ? 4.447  11.013 34.930  1.00 29.90  ? 221 VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 134 ? 5.675  12.602 33.428  1.00 36.44  ? 221 VAL A CG2 1 
ATOM   1032 N N   . ARG A 1 135 ? 4.188  15.651 34.334  1.00 49.66  ? 222 ARG A N   1 
ATOM   1033 C CA  . ARG A 1 135 ? 4.774  16.948 34.561  1.00 51.63  ? 222 ARG A CA  1 
ATOM   1034 C C   . ARG A 1 135 ? 6.213  17.150 34.126  1.00 42.13  ? 222 ARG A C   1 
ATOM   1035 O O   . ARG A 1 135 ? 6.827  18.126 34.515  1.00 35.83  ? 222 ARG A O   1 
ATOM   1036 C CB  . ARG A 1 135 ? 4.409  17.553 35.893  1.00 58.74  ? 222 ARG A CB  1 
ATOM   1037 C CG  . ARG A 1 135 ? 2.901  17.496 36.066  1.00 69.27  ? 222 ARG A CG  1 
ATOM   1038 C CD  . ARG A 1 135 ? 2.338  18.343 37.193  1.00 81.67  ? 222 ARG A CD  1 
ATOM   1039 N NE  . ARG A 1 135 ? 0.960  17.942 37.479  1.00 91.78  ? 222 ARG A NE  1 
ATOM   1040 C CZ  . ARG A 1 135 ? 0.126  18.538 38.330  1.00 97.10  ? 222 ARG A CZ  1 
ATOM   1041 N NH1 . ARG A 1 135 ? 0.466  19.618 39.027  1.00 99.15  ? 222 ARG A NH1 1 
ATOM   1042 N NH2 . ARG A 1 135 ? -1.098 18.032 38.480  1.00 97.67  ? 222 ARG A NH2 1 
ATOM   1043 N N   . PHE A 1 136 ? 6.736  16.209 33.313  1.00 35.96  ? 223 PHE A N   1 
ATOM   1044 C CA  . PHE A 1 136 ? 8.065  16.329 32.797  1.00 33.03  ? 223 PHE A CA  1 
ATOM   1045 C C   . PHE A 1 136 ? 7.910  17.286 31.647  1.00 33.90  ? 223 PHE A C   1 
ATOM   1046 O O   . PHE A 1 136 ? 8.479  18.378 31.642  1.00 36.59  ? 223 PHE A O   1 
ATOM   1047 C CB  . PHE A 1 136 ? 8.654  14.986 32.347  1.00 33.32  ? 223 PHE A CB  1 
ATOM   1048 C CG  . PHE A 1 136 ? 10.047 15.044 31.720  1.00 30.23  ? 223 PHE A CG  1 
ATOM   1049 C CD1 . PHE A 1 136 ? 11.167 15.364 32.485  1.00 25.55  ? 223 PHE A CD1 1 
ATOM   1050 C CD2 . PHE A 1 136 ? 10.228 14.748 30.373  1.00 30.04  ? 223 PHE A CD2 1 
ATOM   1051 C CE1 . PHE A 1 136 ? 12.443 15.417 31.928  1.00 23.55  ? 223 PHE A CE1 1 
ATOM   1052 C CE2 . PHE A 1 136 ? 11.499 14.789 29.802  1.00 27.83  ? 223 PHE A CE2 1 
ATOM   1053 C CZ  . PHE A 1 136 ? 12.607 15.125 30.580  1.00 25.27  ? 223 PHE A CZ  1 
ATOM   1054 N N   . ILE A 1 137 ? 7.086  16.906 30.646  1.00 30.79  ? 224 ILE A N   1 
ATOM   1055 C CA  . ILE A 1 137 ? 6.843  17.796 29.517  1.00 24.47  ? 224 ILE A CA  1 
ATOM   1056 C C   . ILE A 1 137 ? 5.950  18.913 30.018  1.00 27.30  ? 224 ILE A C   1 
ATOM   1057 O O   . ILE A 1 137 ? 4.905  18.668 30.631  1.00 30.62  ? 224 ILE A O   1 
ATOM   1058 C CB  . ILE A 1 137 ? 6.328  17.126 28.260  1.00 23.81  ? 224 ILE A CB  1 
ATOM   1059 C CG1 . ILE A 1 137 ? 7.342  16.111 27.771  1.00 18.29  ? 224 ILE A CG1 1 
ATOM   1060 C CG2 . ILE A 1 137 ? 6.039  18.160 27.154  1.00 21.03  ? 224 ILE A CG2 1 
ATOM   1061 C CD1 . ILE A 1 137 ? 6.813  15.306 26.586  1.00 18.58  ? 224 ILE A CD1 1 
ATOM   1062 N N   . THR A 1 138 ? 6.391  20.127 29.777  1.00 27.58  ? 225 THR A N   1 
ATOM   1063 C CA  . THR A 1 138 ? 5.739  21.365 30.150  1.00 22.43  ? 225 THR A CA  1 
ATOM   1064 C C   . THR A 1 138 ? 5.149  22.170 29.003  1.00 19.32  ? 225 THR A C   1 
ATOM   1065 O O   . THR A 1 138 ? 4.291  22.977 29.252  1.00 25.57  ? 225 THR A O   1 
ATOM   1066 C CB  . THR A 1 138 ? 6.752  22.309 30.771  1.00 28.93  ? 225 THR A CB  1 
ATOM   1067 O OG1 . THR A 1 138 ? 7.663  22.746 29.758  1.00 31.16  ? 225 THR A OG1 1 
ATOM   1068 C CG2 . THR A 1 138 ? 7.494  21.581 31.886  1.00 28.62  ? 225 THR A CG2 1 
ATOM   1069 N N   . ASP A 1 139 ? 5.577  21.991 27.732  1.00 20.49  ? 226 ASP A N   1 
ATOM   1070 C CA  . ASP A 1 139 ? 4.965  22.780 26.662  1.00 26.92  ? 226 ASP A CA  1 
ATOM   1071 C C   . ASP A 1 139 ? 5.260  22.189 25.327  1.00 26.13  ? 226 ASP A C   1 
ATOM   1072 O O   . ASP A 1 139 ? 6.136  21.357 25.178  1.00 29.57  ? 226 ASP A O   1 
ATOM   1073 C CB  . ASP A 1 139 ? 5.254  24.317 26.547  1.00 37.21  ? 226 ASP A CB  1 
ATOM   1074 C CG  . ASP A 1 139 ? 5.320  25.136 27.828  1.00 39.80  ? 226 ASP A CG  1 
ATOM   1075 O OD1 . ASP A 1 139 ? 5.974  24.813 28.791  1.00 35.43  ? 226 ASP A OD1 1 
ATOM   1076 O OD2 . ASP A 1 139 ? 4.488  26.167 27.863  1.00 42.11  ? 226 ASP A OD2 1 
ATOM   1077 N N   . THR A 1 140 ? 4.519  22.690 24.345  1.00 22.58  ? 227 THR A N   1 
ATOM   1078 C CA  . THR A 1 140 ? 4.720  22.159 23.028  1.00 23.46  ? 227 THR A CA  1 
ATOM   1079 C C   . THR A 1 140 ? 5.009  23.236 22.036  1.00 22.94  ? 227 THR A C   1 
ATOM   1080 O O   . THR A 1 140 ? 4.346  24.257 21.950  1.00 28.80  ? 227 THR A O   1 
ATOM   1081 C CB  . THR A 1 140 ? 3.417  21.417 22.562  1.00 21.34  ? 227 THR A CB  1 
ATOM   1082 O OG1 . THR A 1 140 ? 3.027  20.438 23.471  1.00 20.75  ? 227 THR A OG1 1 
ATOM   1083 C CG2 . THR A 1 140 ? 3.520  20.852 21.152  1.00 21.81  ? 227 THR A CG2 1 
ATOM   1084 N N   . LEU A 1 141 ? 6.031  23.002 21.280  1.00 17.74  ? 228 LEU A N   1 
ATOM   1085 C CA  . LEU A 1 141 ? 6.328  23.950 20.300  1.00 21.75  ? 228 LEU A CA  1 
ATOM   1086 C C   . LEU A 1 141 ? 5.448  23.542 19.132  1.00 30.32  ? 228 LEU A C   1 
ATOM   1087 O O   . LEU A 1 141 ? 4.598  24.316 18.668  1.00 33.82  ? 228 LEU A O   1 
ATOM   1088 C CB  . LEU A 1 141 ? 7.823  23.986 20.008  1.00 27.18  ? 228 LEU A CB  1 
ATOM   1089 C CG  . LEU A 1 141 ? 8.703  24.263 21.255  1.00 28.58  ? 228 LEU A CG  1 
ATOM   1090 C CD1 . LEU A 1 141 ? 10.122 23.872 20.902  1.00 34.32  ? 228 LEU A CD1 1 
ATOM   1091 C CD2 . LEU A 1 141 ? 8.683  25.733 21.652  1.00 21.37  ? 228 LEU A CD2 1 
ATOM   1092 N N   . SER A 1 142 ? 5.606  22.287 18.695  1.00 32.77  ? 229 SER A N   1 
ATOM   1093 C CA  . SER A 1 142 ? 4.839  21.683 17.607  1.00 42.21  ? 229 SER A CA  1 
ATOM   1094 C C   . SER A 1 142 ? 4.670  20.208 17.907  1.00 43.62  ? 229 SER A C   1 
ATOM   1095 O O   . SER A 1 142 ? 5.383  19.647 18.724  1.00 46.18  ? 229 SER A O   1 
ATOM   1096 C CB  . SER A 1 142 ? 5.341  21.959 16.193  1.00 52.09  ? 229 SER A CB  1 
ATOM   1097 O OG  . SER A 1 142 ? 6.532  21.239 15.920  1.00 59.27  ? 229 SER A OG  1 
ATOM   1098 N N   . LYS A 1 143 ? 3.722  19.597 17.254  1.00 42.75  ? 230 LYS A N   1 
ATOM   1099 C CA  . LYS A 1 143 ? 3.465  18.216 17.499  1.00 40.93  ? 230 LYS A CA  1 
ATOM   1100 C C   . LYS A 1 143 ? 2.775  17.603 16.337  1.00 39.65  ? 230 LYS A C   1 
ATOM   1101 O O   . LYS A 1 143 ? 1.593  17.858 16.127  1.00 40.37  ? 230 LYS A O   1 
ATOM   1102 C CB  . LYS A 1 143 ? 2.551  18.194 18.693  1.00 44.67  ? 230 LYS A CB  1 
ATOM   1103 C CG  . LYS A 1 143 ? 1.682  16.984 18.811  1.00 48.79  ? 230 LYS A CG  1 
ATOM   1104 C CD  . LYS A 1 143 ? 0.984  17.017 20.161  1.00 56.19  ? 230 LYS A CD  1 
ATOM   1105 C CE  . LYS A 1 143 ? -0.015 15.900 20.306  1.00 60.70  ? 230 LYS A CE  1 
ATOM   1106 N NZ  . LYS A 1 143 ? -0.429 15.722 21.694  1.00 62.34  ? 230 LYS A NZ  1 
ATOM   1107 N N   . GLY A 1 144 ? 3.563  16.802 15.614  1.00 42.25  ? 231 GLY A N   1 
ATOM   1108 C CA  . GLY A 1 144 ? 3.196  16.065 14.401  1.00 42.47  ? 231 GLY A CA  1 
ATOM   1109 C C   . GLY A 1 144 ? 2.774  14.613 14.651  1.00 40.96  ? 231 GLY A C   1 
ATOM   1110 O O   . GLY A 1 144 ? 2.600  14.178 15.790  1.00 40.44  ? 231 GLY A O   1 
ATOM   1111 N N   . GLU A 1 145 ? 2.597  13.886 13.555  1.00 41.19  ? 232 GLU A N   1 
ATOM   1112 C CA  . GLU A 1 145 ? 2.211  12.488 13.621  1.00 43.75  ? 232 GLU A CA  1 
ATOM   1113 C C   . GLU A 1 145 ? 3.414  11.693 14.024  1.00 36.46  ? 232 GLU A C   1 
ATOM   1114 O O   . GLU A 1 145 ? 3.351  10.746 14.795  1.00 34.82  ? 232 GLU A O   1 
ATOM   1115 C CB  . GLU A 1 145 ? 1.573  11.938 12.300  1.00 51.68  ? 232 GLU A CB  1 
ATOM   1116 C CG  . GLU A 1 145 ? 2.421  12.077 11.018  1.00 63.35  ? 232 GLU A CG  1 
ATOM   1117 C CD  . GLU A 1 145 ? 1.599  11.895 9.767   1.00 74.43  ? 232 GLU A CD  1 
ATOM   1118 O OE1 . GLU A 1 145 ? 0.315  11.995 9.998   1.00 79.10  ? 232 GLU A OE1 1 
ATOM   1119 O OE2 . GLU A 1 145 ? 2.078  11.754 8.651   1.00 76.17  ? 232 GLU A OE2 1 
ATOM   1120 N N   . THR A 1 146 ? 4.524  12.122 13.478  1.00 32.87  ? 233 THR A N   1 
ATOM   1121 C CA  . THR A 1 146 ? 5.737  11.445 13.762  1.00 34.27  ? 233 THR A CA  1 
ATOM   1122 C C   . THR A 1 146 ? 6.737  12.216 14.537  1.00 34.63  ? 233 THR A C   1 
ATOM   1123 O O   . THR A 1 146 ? 7.752  11.642 14.884  1.00 28.77  ? 233 THR A O   1 
ATOM   1124 C CB  . THR A 1 146 ? 6.407  10.887 12.510  1.00 40.51  ? 233 THR A CB  1 
ATOM   1125 O OG1 . THR A 1 146 ? 6.860  11.937 11.679  1.00 45.00  ? 233 THR A OG1 1 
ATOM   1126 C CG2 . THR A 1 146 ? 5.423  9.992  11.763  1.00 40.38  ? 233 THR A CG2 1 
ATOM   1127 N N   . LYS A 1 147 ? 6.486  13.511 14.797  1.00 31.69  ? 234 LYS A N   1 
ATOM   1128 C CA  . LYS A 1 147 ? 7.474  14.251 15.545  1.00 25.74  ? 234 LYS A CA  1 
ATOM   1129 C C   . LYS A 1 147 ? 6.916  15.274 16.452  1.00 21.60  ? 234 LYS A C   1 
ATOM   1130 O O   . LYS A 1 147 ? 6.085  16.067 16.044  1.00 26.26  ? 234 LYS A O   1 
ATOM   1131 C CB  . LYS A 1 147 ? 8.591  14.891 14.734  1.00 32.64  ? 234 LYS A CB  1 
ATOM   1132 C CG  . LYS A 1 147 ? 9.485  15.767 15.619  1.00 42.70  ? 234 LYS A CG  1 
ATOM   1133 C CD  . LYS A 1 147 ? 10.748 16.332 14.962  1.00 48.30  ? 234 LYS A CD  1 
ATOM   1134 C CE  . LYS A 1 147 ? 10.477 17.272 13.790  1.00 54.78  ? 234 LYS A CE  1 
ATOM   1135 N NZ  . LYS A 1 147 ? 11.681 17.957 13.280  1.00 60.91  ? 234 LYS A NZ  1 
ATOM   1136 N N   . PHE A 1 148 ? 7.448  15.221 17.705  1.00 14.83  ? 235 PHE A N   1 
ATOM   1137 C CA  . PHE A 1 148 ? 7.120  16.100 18.781  1.00 15.31  ? 235 PHE A CA  1 
ATOM   1138 C C   . PHE A 1 148 ? 8.233  16.992 19.227  1.00 27.84  ? 235 PHE A C   1 
ATOM   1139 O O   . PHE A 1 148 ? 9.193  16.457 19.775  1.00 29.21  ? 235 PHE A O   1 
ATOM   1140 C CB  . PHE A 1 148 ? 6.975  15.295 20.046  1.00 14.08  ? 235 PHE A CB  1 
ATOM   1141 C CG  . PHE A 1 148 ? 6.599  16.157 21.216  1.00 21.39  ? 235 PHE A CG  1 
ATOM   1142 C CD1 . PHE A 1 148 ? 5.325  16.782 21.195  1.00 23.84  ? 235 PHE A CD1 1 
ATOM   1143 C CD2 . PHE A 1 148 ? 7.396  16.374 22.334  1.00 21.61  ? 235 PHE A CD2 1 
ATOM   1144 C CE1 . PHE A 1 148 ? 4.884  17.604 22.275  1.00 16.51  ? 235 PHE A CE1 1 
ATOM   1145 C CE2 . PHE A 1 148 ? 6.968  17.159 23.368  1.00 19.28  ? 235 PHE A CE2 1 
ATOM   1146 C CZ  . PHE A 1 148 ? 5.750  17.780 23.358  1.00 17.71  ? 235 PHE A CZ  1 
ATOM   1147 N N   . MET A 1 149 ? 8.123  18.323 19.066  1.00 30.97  ? 236 MET A N   1 
ATOM   1148 C CA  . MET A 1 149 ? 9.175  19.196 19.579  1.00 21.80  ? 236 MET A CA  1 
ATOM   1149 C C   . MET A 1 149 ? 8.560  19.968 20.753  1.00 18.46  ? 236 MET A C   1 
ATOM   1150 O O   . MET A 1 149 ? 7.475  20.535 20.651  1.00 18.99  ? 236 MET A O   1 
ATOM   1151 C CB  . MET A 1 149 ? 9.767  20.157 18.574  1.00 18.18  ? 236 MET A CB  1 
ATOM   1152 C CG  . MET A 1 149 ? 9.855  19.582 17.212  1.00 29.84  ? 236 MET A CG  1 
ATOM   1153 S SD  . MET A 1 149 ? 10.331 20.887 16.072  1.00 46.18  ? 236 MET A SD  1 
ATOM   1154 C CE  . MET A 1 149 ? 12.064 21.026 16.580  1.00 48.23  ? 236 MET A CE  1 
ATOM   1155 N N   . GLY A 1 150 ? 9.264  20.011 21.896  1.00 16.31  ? 237 GLY A N   1 
ATOM   1156 C CA  . GLY A 1 150 ? 8.772  20.695 23.040  1.00 16.46  ? 237 GLY A CA  1 
ATOM   1157 C C   . GLY A 1 150 ? 9.754  21.024 24.140  1.00 20.98  ? 237 GLY A C   1 
ATOM   1158 O O   . GLY A 1 150 ? 10.965 20.969 23.983  1.00 26.66  ? 237 GLY A O   1 
ATOM   1159 N N   . VAL A 1 151 ? 9.149  21.357 25.255  1.00 13.70  ? 238 VAL A N   1 
ATOM   1160 C CA  . VAL A 1 151 ? 9.812  21.751 26.442  1.00 18.36  ? 238 VAL A CA  1 
ATOM   1161 C C   . VAL A 1 151 ? 9.446  20.806 27.570  1.00 27.62  ? 238 VAL A C   1 
ATOM   1162 O O   . VAL A 1 151 ? 8.361  20.247 27.609  1.00 35.41  ? 238 VAL A O   1 
ATOM   1163 C CB  . VAL A 1 151 ? 9.296  23.109 26.888  1.00 9.47   ? 238 VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 151 ? 10.120 23.693 27.971  1.00 5.68   ? 238 VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 151 ? 9.099  24.043 25.692  1.00 10.79  ? 238 VAL A CG2 1 
ATOM   1166 N N   . CYS A 1 152 ? 10.396 20.702 28.493  1.00 23.94  ? 239 CYS A N   1 
ATOM   1167 C CA  . CYS A 1 152 ? 10.323 19.898 29.653  1.00 27.35  ? 239 CYS A CA  1 
ATOM   1168 C C   . CYS A 1 152 ? 11.181 20.492 30.724  1.00 28.19  ? 239 CYS A C   1 
ATOM   1169 O O   . CYS A 1 152 ? 11.947 21.439 30.515  1.00 39.82  ? 239 CYS A O   1 
ATOM   1170 C CB  . CYS A 1 152 ? 10.818 18.437 29.417  1.00 31.99  ? 239 CYS A CB  1 
ATOM   1171 S SG  . CYS A 1 152 ? 12.602 18.223 29.013  1.00 30.49  ? 239 CYS A SG  1 
ATOM   1172 N N   . GLN A 1 153 ? 11.058 19.884 31.870  1.00 22.16  ? 240 GLN A N   1 
ATOM   1173 C CA  . GLN A 1 153 ? 11.791 20.285 33.051  1.00 23.78  ? 240 GLN A CA  1 
ATOM   1174 C C   . GLN A 1 153 ? 11.840 19.192 34.109  1.00 21.38  ? 240 GLN A C   1 
ATOM   1175 O O   . GLN A 1 153 ? 10.901 18.401 34.276  1.00 16.26  ? 240 GLN A O   1 
ATOM   1176 C CB  . GLN A 1 153 ? 11.321 21.659 33.578  1.00 28.54  ? 240 GLN A CB  1 
ATOM   1177 C CG  . GLN A 1 153 ? 11.495 21.923 35.086  1.00 30.66  ? 240 GLN A CG  1 
ATOM   1178 C CD  . GLN A 1 153 ? 11.053 23.327 35.446  1.00 42.48  ? 240 GLN A CD  1 
ATOM   1179 O OE1 . GLN A 1 153 ? 10.172 23.524 36.295  1.00 45.23  ? 240 GLN A OE1 1 
ATOM   1180 N NE2 . GLN A 1 153 ? 11.676 24.312 34.806  1.00 47.13  ? 240 GLN A NE2 1 
ATOM   1181 N N   . LEU A 1 154 ? 12.986 19.160 34.799  1.00 27.01  ? 241 LEU A N   1 
ATOM   1182 C CA  . LEU A 1 154 ? 13.194 18.198 35.854  1.00 33.76  ? 241 LEU A CA  1 
ATOM   1183 C C   . LEU A 1 154 ? 12.397 18.665 37.017  1.00 42.08  ? 241 LEU A C   1 
ATOM   1184 O O   . LEU A 1 154 ? 12.344 19.856 37.320  1.00 41.59  ? 241 LEU A O   1 
ATOM   1185 C CB  . LEU A 1 154 ? 14.652 17.931 36.292  1.00 36.66  ? 241 LEU A CB  1 
ATOM   1186 C CG  . LEU A 1 154 ? 15.416 16.978 35.369  1.00 33.51  ? 241 LEU A CG  1 
ATOM   1187 C CD1 . LEU A 1 154 ? 16.855 16.810 35.841  1.00 25.23  ? 241 LEU A CD1 1 
ATOM   1188 C CD2 . LEU A 1 154 ? 14.732 15.619 35.369  1.00 37.77  ? 241 LEU A CD2 1 
ATOM   1189 N N   . PRO A 1 155 ? 11.786 17.689 37.641  1.00 51.17  ? 242 PRO A N   1 
ATOM   1190 C CA  . PRO A 1 155 ? 10.957 17.891 38.785  1.00 54.04  ? 242 PRO A CA  1 
ATOM   1191 C C   . PRO A 1 155 ? 11.671 18.500 39.913  1.00 61.58  ? 242 PRO A C   1 
ATOM   1192 O O   . PRO A 1 155 ? 12.512 17.846 40.525  1.00 62.00  ? 242 PRO A O   1 
ATOM   1193 C CB  . PRO A 1 155 ? 10.604 16.510 39.303  1.00 52.09  ? 242 PRO A CB  1 
ATOM   1194 C CG  . PRO A 1 155 ? 10.983 15.533 38.208  1.00 53.10  ? 242 PRO A CG  1 
ATOM   1195 C CD  . PRO A 1 155 ? 11.578 16.342 37.068  1.00 52.59  ? 242 PRO A CD  1 
ATOM   1196 N N   . SER A 1 156 ? 11.311 19.729 40.212  1.00 71.44  ? 243 SER A N   1 
ATOM   1197 C CA  . SER A 1 156 ? 11.933 20.364 41.331  1.00 76.74  ? 243 SER A CA  1 
ATOM   1198 C C   . SER A 1 156 ? 11.346 19.729 42.579  1.00 81.96  ? 243 SER A C   1 
ATOM   1199 O O   . SER A 1 156 ? 10.228 19.187 42.571  1.00 82.69  ? 243 SER A O   1 
ATOM   1200 C CB  . SER A 1 156 ? 11.727 21.878 41.335  1.00 75.25  ? 243 SER A CB  1 
ATOM   1201 N N   . GLU A 1 157 ? 12.132 19.778 43.629  1.00 87.88  ? 244 GLU A N   1 
ATOM   1202 C CA  . GLU A 1 157 ? 11.750 19.257 44.914  1.00 93.94  ? 244 GLU A CA  1 
ATOM   1203 C C   . GLU A 1 157 ? 11.639 20.399 45.920  1.00 98.71  ? 244 GLU A C   1 
ATOM   1204 O O   . GLU A 1 157 ? 11.121 20.226 47.021  1.00 100.00 ? 244 GLU A O   1 
ATOM   1205 C CB  . GLU A 1 157 ? 12.668 18.144 45.369  1.00 94.42  ? 244 GLU A CB  1 
ATOM   1206 N N   . ASN A 1 158 ? 12.150 21.580 45.501  1.00 100.00 ? 245 ASN A N   1 
ATOM   1207 C CA  . ASN A 1 158 ? 12.156 22.824 46.279  1.00 99.15  ? 245 ASN A CA  1 
ATOM   1208 C C   . ASN A 1 158 ? 10.827 23.556 46.126  1.00 97.64  ? 245 ASN A C   1 
ATOM   1209 O O   . ASN A 1 158 ? 10.758 24.785 46.170  1.00 98.00  ? 245 ASN A O   1 
ATOM   1210 C CB  . ASN A 1 158 ? 13.339 23.726 45.922  1.00 99.50  ? 245 ASN A CB  1 
ATOM   1211 N N   . GLU A 1 162 ? 15.273 25.496 41.172  1.00 72.10  ? 249 GLU A N   1 
ATOM   1212 C CA  . GLU A 1 162 ? 14.563 24.967 40.017  1.00 69.56  ? 249 GLU A CA  1 
ATOM   1213 C C   . GLU A 1 162 ? 15.407 24.923 38.754  1.00 61.84  ? 249 GLU A C   1 
ATOM   1214 O O   . GLU A 1 162 ? 16.282 25.750 38.521  1.00 64.26  ? 249 GLU A O   1 
ATOM   1215 C CB  . GLU A 1 162 ? 13.127 25.524 39.796  1.00 73.70  ? 249 GLU A CB  1 
ATOM   1216 C CG  . GLU A 1 162 ? 13.008 27.037 39.504  1.00 81.74  ? 249 GLU A CG  1 
ATOM   1217 C CD  . GLU A 1 162 ? 11.582 27.489 39.284  1.00 89.17  ? 249 GLU A CD  1 
ATOM   1218 O OE1 . GLU A 1 162 ? 11.153 27.307 38.055  1.00 91.89  ? 249 GLU A OE1 1 
ATOM   1219 O OE2 . GLU A 1 162 ? 10.943 28.084 40.128  1.00 91.46  ? 249 GLU A OE2 1 
ATOM   1220 N N   . TYR A 1 163 ? 15.133 23.923 37.960  1.00 50.24  ? 250 TYR A N   1 
ATOM   1221 C CA  . TYR A 1 163 ? 15.816 23.721 36.727  1.00 43.75  ? 250 TYR A CA  1 
ATOM   1222 C C   . TYR A 1 163 ? 15.268 24.565 35.647  1.00 38.00  ? 250 TYR A C   1 
ATOM   1223 O O   . TYR A 1 163 ? 14.117 24.983 35.699  1.00 46.34  ? 250 TYR A O   1 
ATOM   1224 C CB  . TYR A 1 163 ? 15.601 22.294 36.241  1.00 45.47  ? 250 TYR A CB  1 
ATOM   1225 C CG  . TYR A 1 163 ? 16.336 21.380 37.131  1.00 42.96  ? 250 TYR A CG  1 
ATOM   1226 C CD1 . TYR A 1 163 ? 15.789 21.006 38.350  1.00 41.61  ? 250 TYR A CD1 1 
ATOM   1227 C CD2 . TYR A 1 163 ? 17.598 20.912 36.770  1.00 43.39  ? 250 TYR A CD2 1 
ATOM   1228 C CE1 . TYR A 1 163 ? 16.470 20.161 39.205  1.00 39.79  ? 250 TYR A CE1 1 
ATOM   1229 C CE2 . TYR A 1 163 ? 18.304 20.051 37.620  1.00 44.28  ? 250 TYR A CE2 1 
ATOM   1230 C CZ  . TYR A 1 163 ? 17.723 19.687 38.838  1.00 42.39  ? 250 TYR A CZ  1 
ATOM   1231 O OH  . TYR A 1 163 ? 18.426 18.853 39.657  1.00 44.38  ? 250 TYR A OH  1 
ATOM   1232 N N   . PRO A 1 164 ? 16.109 24.773 34.676  1.00 28.41  ? 251 PRO A N   1 
ATOM   1233 C CA  . PRO A 1 164 ? 15.740 25.529 33.545  1.00 27.20  ? 251 PRO A CA  1 
ATOM   1234 C C   . PRO A 1 164 ? 14.931 24.568 32.765  1.00 24.75  ? 251 PRO A C   1 
ATOM   1235 O O   . PRO A 1 164 ? 15.027 23.381 32.985  1.00 23.90  ? 251 PRO A O   1 
ATOM   1236 C CB  . PRO A 1 164 ? 17.023 25.772 32.756  1.00 21.22  ? 251 PRO A CB  1 
ATOM   1237 C CG  . PRO A 1 164 ? 18.189 25.381 33.662  1.00 22.52  ? 251 PRO A CG  1 
ATOM   1238 C CD  . PRO A 1 164 ? 17.574 24.760 34.894  1.00 20.93  ? 251 PRO A CD  1 
ATOM   1239 N N   . HIS A 1 165 ? 14.144 25.093 31.898  1.00 19.83  ? 252 HIS A N   1 
ATOM   1240 C CA  . HIS A 1 165 ? 13.381 24.267 31.102  1.00 22.92  ? 252 HIS A CA  1 
ATOM   1241 C C   . HIS A 1 165 ? 14.298 23.909 30.028  1.00 25.97  ? 252 HIS A C   1 
ATOM   1242 O O   . HIS A 1 165 ? 15.181 24.697 29.737  1.00 33.60  ? 252 HIS A O   1 
ATOM   1243 C CB  . HIS A 1 165 ? 12.278 25.117 30.512  1.00 28.30  ? 252 HIS A CB  1 
ATOM   1244 C CG  . HIS A 1 165 ? 11.191 25.289 31.488  1.00 33.31  ? 252 HIS A CG  1 
ATOM   1245 N ND1 . HIS A 1 165 ? 11.277 26.161 32.554  1.00 29.26  ? 252 HIS A ND1 1 
ATOM   1246 C CD2 . HIS A 1 165 ? 9.993  24.654 31.542  1.00 38.81  ? 252 HIS A CD2 1 
ATOM   1247 C CE1 . HIS A 1 165 ? 10.142 26.046 33.226  1.00 32.96  ? 252 HIS A CE1 1 
ATOM   1248 N NE2 . HIS A 1 165 ? 9.351  25.156 32.653  1.00 39.13  ? 252 HIS A NE2 1 
ATOM   1249 N N   . ARG A 1 166 ? 14.072 22.744 29.433  1.00 23.98  ? 253 ARG A N   1 
ATOM   1250 C CA  . ARG A 1 166 ? 14.887 22.269 28.344  1.00 25.28  ? 253 ARG A CA  1 
ATOM   1251 C C   . ARG A 1 166 ? 14.060 21.811 27.155  1.00 21.62  ? 253 ARG A C   1 
ATOM   1252 O O   . ARG A 1 166 ? 12.910 21.467 27.337  1.00 30.04  ? 253 ARG A O   1 
ATOM   1253 C CB  . ARG A 1 166 ? 15.804 21.123 28.697  1.00 32.50  ? 253 ARG A CB  1 
ATOM   1254 C CG  . ARG A 1 166 ? 17.097 21.548 29.314  1.00 36.99  ? 253 ARG A CG  1 
ATOM   1255 C CD  . ARG A 1 166 ? 16.786 22.084 30.669  1.00 37.16  ? 253 ARG A CD  1 
ATOM   1256 N NE  . ARG A 1 166 ? 17.925 22.088 31.567  1.00 32.94  ? 253 ARG A NE  1 
ATOM   1257 C CZ  . ARG A 1 166 ? 19.009 22.827 31.480  1.00 28.58  ? 253 ARG A CZ  1 
ATOM   1258 N NH1 . ARG A 1 166 ? 19.231 23.677 30.487  1.00 25.30  ? 253 ARG A NH1 1 
ATOM   1259 N NH2 . ARG A 1 166 ? 19.912 22.676 32.443  1.00 29.45  ? 253 ARG A NH2 1 
ATOM   1260 N N   . ARG A 1 167 ? 14.700 21.789 26.005  1.00 21.62  ? 254 ARG A N   1 
ATOM   1261 C CA  . ARG A 1 167 ? 14.178 21.386 24.690  1.00 22.23  ? 254 ARG A CA  1 
ATOM   1262 C C   . ARG A 1 167 ? 14.227 19.915 24.495  1.00 30.18  ? 254 ARG A C   1 
ATOM   1263 O O   . ARG A 1 167 ? 15.240 19.258 24.754  1.00 28.76  ? 254 ARG A O   1 
ATOM   1264 C CB  . ARG A 1 167 ? 15.134 21.942 23.681  1.00 24.08  ? 254 ARG A CB  1 
ATOM   1265 C CG  . ARG A 1 167 ? 14.792 23.403 23.470  1.00 29.56  ? 254 ARG A CG  1 
ATOM   1266 C CD  . ARG A 1 167 ? 13.514 23.495 22.642  1.00 25.46  ? 254 ARG A CD  1 
ATOM   1267 N NE  . ARG A 1 167 ? 13.638 22.869 21.325  1.00 15.71  ? 254 ARG A NE  1 
ATOM   1268 C CZ  . ARG A 1 167 ? 13.094 21.722 20.963  1.00 19.69  ? 254 ARG A CZ  1 
ATOM   1269 N NH1 . ARG A 1 167 ? 12.329 21.003 21.808  1.00 22.50  ? 254 ARG A NH1 1 
ATOM   1270 N NH2 . ARG A 1 167 ? 13.290 21.274 19.722  1.00 15.73  ? 254 ARG A NH2 1 
ATOM   1271 N N   . ILE A 1 168 ? 13.137 19.391 24.013  1.00 30.37  ? 255 ILE A N   1 
ATOM   1272 C CA  . ILE A 1 168 ? 13.141 17.994 23.822  1.00 25.58  ? 255 ILE A CA  1 
ATOM   1273 C C   . ILE A 1 168 ? 12.487 17.597 22.573  1.00 24.83  ? 255 ILE A C   1 
ATOM   1274 O O   . ILE A 1 168 ? 11.495 18.140 22.109  1.00 30.44  ? 255 ILE A O   1 
ATOM   1275 C CB  . ILE A 1 168 ? 12.601 17.246 24.993  1.00 28.74  ? 255 ILE A CB  1 
ATOM   1276 C CG1 . ILE A 1 168 ? 12.477 15.772 24.630  1.00 30.31  ? 255 ILE A CG1 1 
ATOM   1277 C CG2 . ILE A 1 168 ? 11.252 17.809 25.367  1.00 28.99  ? 255 ILE A CG2 1 
ATOM   1278 C CD1 . ILE A 1 168 ? 11.976 14.958 25.814  1.00 27.92  ? 255 ILE A CD1 1 
ATOM   1279 N N   . ASP A 1 169 ? 13.055 16.611 21.969  1.00 21.59  ? 256 ASP A N   1 
ATOM   1280 C CA  . ASP A 1 169 ? 12.439 16.200 20.755  1.00 24.98  ? 256 ASP A CA  1 
ATOM   1281 C C   . ASP A 1 169 ? 12.269 14.739 20.818  1.00 28.45  ? 256 ASP A C   1 
ATOM   1282 O O   . ASP A 1 169 ? 13.125 14.023 21.349  1.00 23.79  ? 256 ASP A O   1 
ATOM   1283 C CB  . ASP A 1 169 ? 13.215 16.552 19.487  1.00 25.15  ? 256 ASP A CB  1 
ATOM   1284 C CG  . ASP A 1 169 ? 13.248 18.014 19.146  1.00 30.54  ? 256 ASP A CG  1 
ATOM   1285 O OD1 . ASP A 1 169 ? 12.741 18.773 20.041  1.00 31.20  ? 256 ASP A OD1 1 
ATOM   1286 O OD2 . ASP A 1 169 ? 13.708 18.472 18.132  1.00 36.78  ? 256 ASP A OD2 1 
ATOM   1287 N N   . ILE A 1 170 ? 11.137 14.345 20.230  1.00 30.03  ? 257 ILE A N   1 
ATOM   1288 C CA  . ILE A 1 170 ? 10.748 12.957 20.139  1.00 23.93  ? 257 ILE A CA  1 
ATOM   1289 C C   . ILE A 1 170 ? 10.279 12.649 18.748  1.00 28.14  ? 257 ILE A C   1 
ATOM   1290 O O   . ILE A 1 170 ? 9.343  13.240 18.206  1.00 34.69  ? 257 ILE A O   1 
ATOM   1291 C CB  . ILE A 1 170 ? 9.746  12.503 21.172  1.00 17.29  ? 257 ILE A CB  1 
ATOM   1292 C CG1 . ILE A 1 170 ? 10.146 13.034 22.525  1.00 16.88  ? 257 ILE A CG1 1 
ATOM   1293 C CG2 . ILE A 1 170 ? 9.872  11.004 21.261  1.00 17.80  ? 257 ILE A CG2 1 
ATOM   1294 C CD1 . ILE A 1 170 ? 9.284  12.412 23.623  1.00 17.83  ? 257 ILE A CD1 1 
ATOM   1295 N N   . ARG A 1 171 ? 10.990 11.705 18.157  1.00 26.31  ? 258 ARG A N   1 
ATOM   1296 C CA  . ARG A 1 171 ? 10.696 11.253 16.811  1.00 28.05  ? 258 ARG A CA  1 
ATOM   1297 C C   . ARG A 1 171 ? 10.208 9.765  16.787  1.00 27.01  ? 258 ARG A C   1 
ATOM   1298 O O   . ARG A 1 171 ? 10.740 8.887  17.460  1.00 21.98  ? 258 ARG A O   1 
ATOM   1299 C CB  . ARG A 1 171 ? 11.929 11.527 15.973  1.00 33.53  ? 258 ARG A CB  1 
ATOM   1300 C CG  . ARG A 1 171 ? 12.536 12.899 16.269  1.00 46.48  ? 258 ARG A CG  1 
ATOM   1301 C CD  . ARG A 1 171 ? 13.999 12.902 15.878  1.00 59.08  ? 258 ARG A CD  1 
ATOM   1302 N NE  . ARG A 1 171 ? 14.474 14.142 15.287  1.00 72.46  ? 258 ARG A NE  1 
ATOM   1303 C CZ  . ARG A 1 171 ? 14.456 14.458 13.976  1.00 82.06  ? 258 ARG A CZ  1 
ATOM   1304 N NH1 . ARG A 1 171 ? 13.979 13.654 13.005  1.00 82.50  ? 258 ARG A NH1 1 
ATOM   1305 N NH2 . ARG A 1 171 ? 14.952 15.648 13.640  1.00 86.15  ? 258 ARG A NH2 1 
ATOM   1306 N N   . LEU A 1 172 ? 9.172  9.483  16.026  1.00 26.50  ? 259 LEU A N   1 
ATOM   1307 C CA  . LEU A 1 172 ? 8.658  8.135  15.919  1.00 20.00  ? 259 LEU A CA  1 
ATOM   1308 C C   . LEU A 1 172 ? 9.259  7.642  14.604  1.00 18.70  ? 259 LEU A C   1 
ATOM   1309 O O   . LEU A 1 172 ? 9.063  8.256  13.560  1.00 16.26  ? 259 LEU A O   1 
ATOM   1310 C CB  . LEU A 1 172 ? 7.108  8.108  15.884  1.00 21.25  ? 259 LEU A CB  1 
ATOM   1311 C CG  . LEU A 1 172 ? 6.404  6.743  15.754  1.00 21.02  ? 259 LEU A CG  1 
ATOM   1312 C CD1 . LEU A 1 172 ? 6.583  5.932  17.034  1.00 20.13  ? 259 LEU A CD1 1 
ATOM   1313 C CD2 . LEU A 1 172 ? 4.918  6.965  15.506  1.00 21.61  ? 259 LEU A CD2 1 
ATOM   1314 N N   . ILE A 1 173 ? 10.037 6.552  14.679  1.00 18.21  ? 260 ILE A N   1 
ATOM   1315 C CA  . ILE A 1 173 ? 10.664 6.008  13.500  1.00 17.49  ? 260 ILE A CA  1 
ATOM   1316 C C   . ILE A 1 173 ? 10.176 4.623  13.236  1.00 15.41  ? 260 ILE A C   1 
ATOM   1317 O O   . ILE A 1 173 ? 10.069 3.906  14.247  1.00 13.89  ? 260 ILE A O   1 
ATOM   1318 C CB  . ILE A 1 173 ? 12.116 5.726  13.745  1.00 25.82  ? 260 ILE A CB  1 
ATOM   1319 C CG1 . ILE A 1 173 ? 12.851 6.918  14.301  1.00 26.54  ? 260 ILE A CG1 1 
ATOM   1320 C CG2 . ILE A 1 173 ? 12.659 5.350  12.362  1.00 30.56  ? 260 ILE A CG2 1 
ATOM   1321 C CD1 . ILE A 1 173 ? 12.774 8.083  13.335  1.00 23.00  ? 260 ILE A CD1 1 
ATOM   1322 N N   . PRO A 1 174 ? 9.969  4.201  11.978  1.00 12.69  ? 261 PRO A N   1 
ATOM   1323 C CA  . PRO A 1 174 ? 9.549  2.825  11.808  1.00 22.83  ? 261 PRO A CA  1 
ATOM   1324 C C   . PRO A 1 174 ? 10.602 1.945  12.368  1.00 26.20  ? 261 PRO A C   1 
ATOM   1325 O O   . PRO A 1 174 ? 11.765 2.345  12.498  1.00 26.19  ? 261 PRO A O   1 
ATOM   1326 C CB  . PRO A 1 174 ? 9.456  2.579  10.294  1.00 20.65  ? 261 PRO A CB  1 
ATOM   1327 C CG  . PRO A 1 174 ? 9.244  3.938  9.657   1.00 19.02  ? 261 PRO A CG  1 
ATOM   1328 C CD  . PRO A 1 174 ? 9.534  4.962  10.753  1.00 12.94  ? 261 PRO A CD  1 
ATOM   1329 N N   . LYS A 1 175 ? 10.202 0.756  12.725  1.00 29.39  ? 262 LYS A N   1 
ATOM   1330 C CA  . LYS A 1 175 ? 11.116 -0.188 13.312  1.00 30.71  ? 262 LYS A CA  1 
ATOM   1331 C C   . LYS A 1 175 ? 12.166 -0.740 12.383  1.00 26.83  ? 262 LYS A C   1 
ATOM   1332 O O   . LYS A 1 175 ? 13.277 -1.075 12.779  1.00 27.11  ? 262 LYS A O   1 
ATOM   1333 C CB  . LYS A 1 175 ? 10.401 -1.295 14.011  1.00 37.77  ? 262 LYS A CB  1 
ATOM   1334 C CG  . LYS A 1 175 ? 11.383 -2.365 14.375  1.00 41.13  ? 262 LYS A CG  1 
ATOM   1335 C CD  . LYS A 1 175 ? 11.179 -2.772 15.817  1.00 46.06  ? 262 LYS A CD  1 
ATOM   1336 C CE  . LYS A 1 175 ? 12.061 -3.912 16.249  1.00 47.66  ? 262 LYS A CE  1 
ATOM   1337 N NZ  . LYS A 1 175 ? 11.730 -4.312 17.615  1.00 49.08  ? 262 LYS A NZ  1 
ATOM   1338 N N   . ASP A 1 176 ? 11.800 -0.853 11.134  1.00 24.04  ? 263 ASP A N   1 
ATOM   1339 C CA  . ASP A 1 176 ? 12.745 -1.371 10.181  1.00 21.26  ? 263 ASP A CA  1 
ATOM   1340 C C   . ASP A 1 176 ? 13.766 -0.332 9.723   1.00 19.33  ? 263 ASP A C   1 
ATOM   1341 O O   . ASP A 1 176 ? 14.615 -0.661 8.901   1.00 22.33  ? 263 ASP A O   1 
ATOM   1342 C CB  . ASP A 1 176 ? 12.019 -1.939 8.971   1.00 22.90  ? 263 ASP A CB  1 
ATOM   1343 C CG  . ASP A 1 176 ? 11.057 -0.896 8.417   1.00 29.26  ? 263 ASP A CG  1 
ATOM   1344 O OD1 . ASP A 1 176 ? 10.169 -0.545 9.311   1.00 26.62  ? 263 ASP A OD1 1 
ATOM   1345 O OD2 . ASP A 1 176 ? 11.104 -0.425 7.283   1.00 31.70  ? 263 ASP A OD2 1 
ATOM   1346 N N   . GLN A 1 177 ? 13.677 0.903  10.253  1.00 17.33  ? 264 GLN A N   1 
ATOM   1347 C CA  . GLN A 1 177 ? 14.541 2.062  9.924   1.00 17.93  ? 264 GLN A CA  1 
ATOM   1348 C C   . GLN A 1 177 ? 15.213 2.726  11.114  1.00 16.97  ? 264 GLN A C   1 
ATOM   1349 O O   . GLN A 1 177 ? 16.009 3.670  11.026  1.00 21.12  ? 264 GLN A O   1 
ATOM   1350 C CB  . GLN A 1 177 ? 13.710 3.142  9.238   1.00 16.38  ? 264 GLN A CB  1 
ATOM   1351 C CG  . GLN A 1 177 ? 13.315 2.635  7.867   1.00 23.00  ? 264 GLN A CG  1 
ATOM   1352 C CD  . GLN A 1 177 ? 12.615 3.640  7.032   1.00 38.18  ? 264 GLN A CD  1 
ATOM   1353 O OE1 . GLN A 1 177 ? 11.831 4.442  7.555   1.00 44.27  ? 264 GLN A OE1 1 
ATOM   1354 N NE2 . GLN A 1 177 ? 12.889 3.589  5.711   1.00 41.58  ? 264 GLN A NE2 1 
ATOM   1355 N N   . TYR A 1 178 ? 14.828 2.171  12.265  1.00 15.22  ? 265 TYR A N   1 
ATOM   1356 C CA  . TYR A 1 178 ? 15.275 2.558  13.555  1.00 17.95  ? 265 TYR A CA  1 
ATOM   1357 C C   . TYR A 1 178 ? 16.786 2.614  13.776  1.00 32.29  ? 265 TYR A C   1 
ATOM   1358 O O   . TYR A 1 178 ? 17.305 3.690  14.017  1.00 36.94  ? 265 TYR A O   1 
ATOM   1359 C CB  . TYR A 1 178 ? 14.643 1.613  14.579  1.00 7.63   ? 265 TYR A CB  1 
ATOM   1360 C CG  . TYR A 1 178 ? 14.825 2.186  16.002  1.00 15.82  ? 265 TYR A CG  1 
ATOM   1361 C CD1 . TYR A 1 178 ? 14.211 3.389  16.297  1.00 14.28  ? 265 TYR A CD1 1 
ATOM   1362 C CD2 . TYR A 1 178 ? 15.533 1.524  16.968  1.00 14.29  ? 265 TYR A CD2 1 
ATOM   1363 C CE1 . TYR A 1 178 ? 14.328 3.952  17.568  1.00 8.52   ? 265 TYR A CE1 1 
ATOM   1364 C CE2 . TYR A 1 178 ? 15.674 2.032  18.260  1.00 14.94  ? 265 TYR A CE2 1 
ATOM   1365 C CZ  . TYR A 1 178 ? 15.064 3.282  18.570  1.00 15.69  ? 265 TYR A CZ  1 
ATOM   1366 O OH  . TYR A 1 178 ? 15.182 3.813  19.804  1.00 21.09  ? 265 TYR A OH  1 
ATOM   1367 N N   . TYR A 1 179 ? 17.520 1.472  13.732  1.00 34.26  ? 266 TYR A N   1 
ATOM   1368 C CA  . TYR A 1 179 ? 18.990 1.498  13.970  1.00 31.64  ? 266 TYR A CA  1 
ATOM   1369 C C   . TYR A 1 179 ? 19.789 2.492  13.181  1.00 26.75  ? 266 TYR A C   1 
ATOM   1370 O O   . TYR A 1 179 ? 20.689 3.129  13.709  1.00 23.74  ? 266 TYR A O   1 
ATOM   1371 C CB  . TYR A 1 179 ? 19.680 0.106  14.077  1.00 26.87  ? 266 TYR A CB  1 
ATOM   1372 C CG  . TYR A 1 179 ? 19.026 -0.467 15.255  1.00 24.77  ? 266 TYR A CG  1 
ATOM   1373 C CD1 . TYR A 1 179 ? 19.298 0.103  16.493  1.00 24.50  ? 266 TYR A CD1 1 
ATOM   1374 C CD2 . TYR A 1 179 ? 18.063 -1.479 15.146  1.00 26.63  ? 266 TYR A CD2 1 
ATOM   1375 C CE1 . TYR A 1 179 ? 18.673 -0.347 17.641  1.00 26.23  ? 266 TYR A CE1 1 
ATOM   1376 C CE2 . TYR A 1 179 ? 17.418 -1.956 16.310  1.00 28.58  ? 266 TYR A CE2 1 
ATOM   1377 C CZ  . TYR A 1 179 ? 17.735 -1.373 17.551  1.00 30.69  ? 266 TYR A CZ  1 
ATOM   1378 O OH  . TYR A 1 179 ? 17.126 -1.823 18.680  1.00 31.12  ? 266 TYR A OH  1 
ATOM   1379 N N   . CYS A 1 180 ? 19.435 2.608  11.903  1.00 25.48  ? 267 CYS A N   1 
ATOM   1380 C CA  . CYS A 1 180 ? 20.072 3.521  10.982  1.00 26.79  ? 267 CYS A CA  1 
ATOM   1381 C C   . CYS A 1 180 ? 19.982 4.929  11.452  1.00 25.26  ? 267 CYS A C   1 
ATOM   1382 O O   . CYS A 1 180 ? 20.926 5.717  11.277  1.00 25.82  ? 267 CYS A O   1 
ATOM   1383 C CB  . CYS A 1 180 ? 19.466 3.409  9.604   1.00 27.22  ? 267 CYS A CB  1 
ATOM   1384 S SG  . CYS A 1 180 ? 20.230 2.092  8.677   1.00 32.55  ? 267 CYS A SG  1 
ATOM   1385 N N   . GLY A 1 181 ? 18.801 5.182  12.007  1.00 22.27  ? 268 GLY A N   1 
ATOM   1386 C CA  . GLY A 1 181 ? 18.369 6.434  12.586  1.00 19.41  ? 268 GLY A CA  1 
ATOM   1387 C C   . GLY A 1 181 ? 19.125 6.711  13.892  1.00 21.34  ? 268 GLY A C   1 
ATOM   1388 O O   . GLY A 1 181 ? 19.621 7.787  14.186  1.00 28.55  ? 268 GLY A O   1 
ATOM   1389 N N   . VAL A 1 182 ? 19.233 5.709  14.716  1.00 18.35  ? 269 VAL A N   1 
ATOM   1390 C CA  . VAL A 1 182 ? 19.972 5.949  15.943  1.00 22.64  ? 269 VAL A CA  1 
ATOM   1391 C C   . VAL A 1 182 ? 21.435 6.207  15.622  1.00 30.48  ? 269 VAL A C   1 
ATOM   1392 O O   . VAL A 1 182 ? 22.130 7.002  16.279  1.00 25.58  ? 269 VAL A O   1 
ATOM   1393 C CB  . VAL A 1 182 ? 19.918 4.704  16.760  1.00 18.61  ? 269 VAL A CB  1 
ATOM   1394 C CG1 . VAL A 1 182 ? 21.027 4.793  17.798  1.00 17.96  ? 269 VAL A CG1 1 
ATOM   1395 C CG2 . VAL A 1 182 ? 18.548 4.615  17.403  1.00 23.04  ? 269 VAL A CG2 1 
ATOM   1396 N N   . LEU A 1 183 ? 21.901 5.483  14.600  1.00 29.42  ? 270 LEU A N   1 
ATOM   1397 C CA  . LEU A 1 183 ? 23.273 5.612  14.200  1.00 25.02  ? 270 LEU A CA  1 
ATOM   1398 C C   . LEU A 1 183 ? 23.511 7.071  13.821  1.00 24.81  ? 270 LEU A C   1 
ATOM   1399 O O   . LEU A 1 183 ? 24.305 7.778  14.460  1.00 24.69  ? 270 LEU A O   1 
ATOM   1400 C CB  . LEU A 1 183 ? 23.658 4.660  13.058  1.00 18.96  ? 270 LEU A CB  1 
ATOM   1401 C CG  . LEU A 1 183 ? 25.137 4.735  12.827  1.00 22.80  ? 270 LEU A CG  1 
ATOM   1402 C CD1 . LEU A 1 183 ? 25.880 3.902  13.862  1.00 26.89  ? 270 LEU A CD1 1 
ATOM   1403 C CD2 . LEU A 1 183 ? 25.500 4.324  11.411  1.00 25.13  ? 270 LEU A CD2 1 
ATOM   1404 N N   . TYR A 1 184 ? 22.756 7.478  12.804  1.00 28.01  ? 271 TYR A N   1 
ATOM   1405 C CA  . TYR A 1 184 ? 22.766 8.807  12.245  1.00 34.40  ? 271 TYR A CA  1 
ATOM   1406 C C   . TYR A 1 184 ? 22.657 9.879  13.344  1.00 34.18  ? 271 TYR A C   1 
ATOM   1407 O O   . TYR A 1 184 ? 23.532 10.738 13.474  1.00 37.10  ? 271 TYR A O   1 
ATOM   1408 C CB  . TYR A 1 184 ? 21.625 8.957  11.214  1.00 41.51  ? 271 TYR A CB  1 
ATOM   1409 C CG  . TYR A 1 184 ? 21.680 10.306 10.565  1.00 50.10  ? 271 TYR A CG  1 
ATOM   1410 C CD1 . TYR A 1 184 ? 21.064 11.422 11.145  1.00 53.67  ? 271 TYR A CD1 1 
ATOM   1411 C CD2 . TYR A 1 184 ? 22.390 10.485 9.372   1.00 55.06  ? 271 TYR A CD2 1 
ATOM   1412 C CE1 . TYR A 1 184 ? 21.136 12.677 10.551  1.00 56.81  ? 271 TYR A CE1 1 
ATOM   1413 C CE2 . TYR A 1 184 ? 22.473 11.739 8.766   1.00 56.07  ? 271 TYR A CE2 1 
ATOM   1414 C CZ  . TYR A 1 184 ? 21.841 12.829 9.364   1.00 59.23  ? 271 TYR A CZ  1 
ATOM   1415 O OH  . TYR A 1 184 ? 21.915 14.066 8.781   1.00 64.93  ? 271 TYR A OH  1 
ATOM   1416 N N   . PHE A 1 185 ? 21.569 9.803  14.138  1.00 26.57  ? 272 PHE A N   1 
ATOM   1417 C CA  . PHE A 1 185 ? 21.366 10.737 15.204  1.00 22.22  ? 272 PHE A CA  1 
ATOM   1418 C C   . PHE A 1 185 ? 22.403 10.670 16.296  1.00 23.82  ? 272 PHE A C   1 
ATOM   1419 O O   . PHE A 1 185 ? 22.478 11.524 17.161  1.00 25.64  ? 272 PHE A O   1 
ATOM   1420 C CB  . PHE A 1 185 ? 19.928 10.970 15.701  1.00 24.41  ? 272 PHE A CB  1 
ATOM   1421 C CG  . PHE A 1 185 ? 19.032 11.405 14.568  1.00 30.28  ? 272 PHE A CG  1 
ATOM   1422 C CD1 . PHE A 1 185 ? 18.359 10.473 13.802  1.00 31.09  ? 272 PHE A CD1 1 
ATOM   1423 C CD2 . PHE A 1 185 ? 18.865 12.753 14.264  1.00 33.58  ? 272 PHE A CD2 1 
ATOM   1424 C CE1 . PHE A 1 185 ? 17.532 10.832 12.760  1.00 34.42  ? 272 PHE A CE1 1 
ATOM   1425 C CE2 . PHE A 1 185 ? 18.027 13.142 13.212  1.00 34.94  ? 272 PHE A CE2 1 
ATOM   1426 C CZ  . PHE A 1 185 ? 17.355 12.173 12.460  1.00 36.46  ? 272 PHE A CZ  1 
ATOM   1427 N N   . THR A 1 186 ? 23.242 9.641  16.272  1.00 21.96  ? 273 THR A N   1 
ATOM   1428 C CA  . THR A 1 186 ? 24.267 9.592  17.290  1.00 22.84  ? 273 THR A CA  1 
ATOM   1429 C C   . THR A 1 186 ? 25.489 10.393 16.874  1.00 26.04  ? 273 THR A C   1 
ATOM   1430 O O   . THR A 1 186 ? 26.178 10.962 17.697  1.00 27.36  ? 273 THR A O   1 
ATOM   1431 C CB  . THR A 1 186 ? 24.581 8.182  17.821  1.00 23.83  ? 273 THR A CB  1 
ATOM   1432 O OG1 . THR A 1 186 ? 23.474 7.702  18.534  1.00 23.51  ? 273 THR A OG1 1 
ATOM   1433 C CG2 . THR A 1 186 ? 25.779 8.233  18.776  1.00 24.31  ? 273 THR A CG2 1 
ATOM   1434 N N   . GLY A 1 187 ? 25.756 10.447 15.546  1.00 27.35  ? 274 GLY A N   1 
ATOM   1435 C CA  . GLY A 1 187 ? 26.892 11.164 14.986  1.00 29.55  ? 274 GLY A CA  1 
ATOM   1436 C C   . GLY A 1 187 ? 28.154 10.576 15.558  1.00 29.47  ? 274 GLY A C   1 
ATOM   1437 O O   . GLY A 1 187 ? 28.159 9.433  15.953  1.00 27.15  ? 274 GLY A O   1 
ATOM   1438 N N   . SER A 1 188 ? 29.229 11.364 15.611  1.00 30.62  ? 275 SER A N   1 
ATOM   1439 C CA  . SER A 1 188 ? 29.248 12.747 15.149  1.00 31.91  ? 275 SER A CA  1 
ATOM   1440 C C   . SER A 1 188 ? 29.147 12.827 13.648  1.00 35.41  ? 275 SER A C   1 
ATOM   1441 O O   . SER A 1 188 ? 29.071 11.796 12.933  1.00 35.68  ? 275 SER A O   1 
ATOM   1442 C CB  . SER A 1 188 ? 30.559 13.362 15.513  1.00 33.55  ? 275 SER A CB  1 
ATOM   1443 O OG  . SER A 1 188 ? 31.496 12.807 14.626  1.00 36.62  ? 275 SER A OG  1 
ATOM   1444 N N   . ASP A 1 189 ? 29.162 14.069 13.176  1.00 37.26  ? 276 ASP A N   1 
ATOM   1445 C CA  . ASP A 1 189 ? 29.073 14.318 11.751  1.00 43.44  ? 276 ASP A CA  1 
ATOM   1446 C C   . ASP A 1 189 ? 30.208 13.748 10.996  1.00 32.71  ? 276 ASP A C   1 
ATOM   1447 O O   . ASP A 1 189 ? 29.985 13.250 9.926   1.00 35.22  ? 276 ASP A O   1 
ATOM   1448 C CB  . ASP A 1 189 ? 28.858 15.782 11.313  1.00 61.42  ? 276 ASP A CB  1 
ATOM   1449 C CG  . ASP A 1 189 ? 27.481 16.344 11.545  1.00 75.66  ? 276 ASP A CG  1 
ATOM   1450 O OD1 . ASP A 1 189 ? 26.684 16.270 10.501  1.00 83.09  ? 276 ASP A OD1 1 
ATOM   1451 O OD2 . ASP A 1 189 ? 27.217 17.000 12.524  1.00 77.84  ? 276 ASP A OD2 1 
ATOM   1452 N N   . ILE A 1 190 ? 31.415 13.834 11.523  1.00 29.04  ? 277 ILE A N   1 
ATOM   1453 C CA  . ILE A 1 190 ? 32.535 13.289 10.799  1.00 38.39  ? 277 ILE A CA  1 
ATOM   1454 C C   . ILE A 1 190 ? 32.456 11.818 10.725  1.00 33.74  ? 277 ILE A C   1 
ATOM   1455 O O   . ILE A 1 190 ? 32.801 11.154 9.746   1.00 32.94  ? 277 ILE A O   1 
ATOM   1456 C CB  . ILE A 1 190 ? 33.856 13.604 11.431  1.00 50.44  ? 277 ILE A CB  1 
ATOM   1457 C CG1 . ILE A 1 190 ? 33.673 13.634 12.920  1.00 59.30  ? 277 ILE A CG1 1 
ATOM   1458 C CG2 . ILE A 1 190 ? 34.316 14.967 10.969  1.00 52.80  ? 277 ILE A CG2 1 
ATOM   1459 C CD1 . ILE A 1 190 ? 33.147 14.992 13.375  1.00 64.00  ? 277 ILE A CD1 1 
ATOM   1460 N N   . PHE A 1 191 ? 32.015 11.324 11.839  1.00 35.37  ? 278 PHE A N   1 
ATOM   1461 C CA  . PHE A 1 191 ? 31.888 9.920  11.919  1.00 30.35  ? 278 PHE A CA  1 
ATOM   1462 C C   . PHE A 1 191 ? 30.932 9.420  10.874  1.00 27.29  ? 278 PHE A C   1 
ATOM   1463 O O   . PHE A 1 191 ? 31.158 8.389  10.272  1.00 30.19  ? 278 PHE A O   1 
ATOM   1464 C CB  . PHE A 1 191 ? 31.484 9.489  13.310  1.00 27.00  ? 278 PHE A CB  1 
ATOM   1465 C CG  . PHE A 1 191 ? 31.325 7.998  13.330  1.00 35.75  ? 278 PHE A CG  1 
ATOM   1466 C CD1 . PHE A 1 191 ? 32.443 7.175  13.389  1.00 36.15  ? 278 PHE A CD1 1 
ATOM   1467 C CD2 . PHE A 1 191 ? 30.052 7.430  13.295  1.00 36.46  ? 278 PHE A CD2 1 
ATOM   1468 C CE1 . PHE A 1 191 ? 32.311 5.789  13.415  1.00 33.57  ? 278 PHE A CE1 1 
ATOM   1469 C CE2 . PHE A 1 191 ? 29.892 6.043  13.323  1.00 38.85  ? 278 PHE A CE2 1 
ATOM   1470 C CZ  . PHE A 1 191 ? 31.028 5.231  13.384  1.00 37.15  ? 278 PHE A CZ  1 
ATOM   1471 N N   . ASN A 1 192 ? 29.845 10.175 10.675  1.00 25.96  ? 279 ASN A N   1 
ATOM   1472 C CA  . ASN A 1 192 ? 28.883 9.766  9.702   1.00 27.55  ? 279 ASN A CA  1 
ATOM   1473 C C   . ASN A 1 192 ? 29.413 9.828  8.334   1.00 30.42  ? 279 ASN A C   1 
ATOM   1474 O O   . ASN A 1 192 ? 29.115 8.939  7.553   1.00 33.92  ? 279 ASN A O   1 
ATOM   1475 C CB  . ASN A 1 192 ? 27.527 10.422 9.869   1.00 30.30  ? 279 ASN A CB  1 
ATOM   1476 C CG  . ASN A 1 192 ? 26.924 9.873  11.130  1.00 36.01  ? 279 ASN A CG  1 
ATOM   1477 O OD1 . ASN A 1 192 ? 26.630 10.625 12.062  1.00 39.27  ? 279 ASN A OD1 1 
ATOM   1478 N ND2 . ASN A 1 192 ? 26.710 8.548  11.144  1.00 38.46  ? 279 ASN A ND2 1 
ATOM   1479 N N   . LYS A 1 193 ? 30.213 10.884 8.096   1.00 28.31  ? 280 LYS A N   1 
ATOM   1480 C CA  . LYS A 1 193 ? 30.844 11.127 6.835   1.00 33.08  ? 280 LYS A CA  1 
ATOM   1481 C C   . LYS A 1 193 ? 31.834 10.021 6.605   1.00 34.10  ? 280 LYS A C   1 
ATOM   1482 O O   . LYS A 1 193 ? 31.742 9.331  5.605   1.00 35.37  ? 280 LYS A O   1 
ATOM   1483 C CB  . LYS A 1 193 ? 31.475 12.514 6.783   1.00 34.97  ? 280 LYS A CB  1 
ATOM   1484 N N   . ASN A 1 194 ? 32.754 9.816  7.533   1.00 38.02  ? 281 ASN A N   1 
ATOM   1485 C CA  . ASN A 1 194 ? 33.732 8.744  7.348   1.00 47.49  ? 281 ASN A CA  1 
ATOM   1486 C C   . ASN A 1 194 ? 33.137 7.360  7.111   1.00 45.30  ? 281 ASN A C   1 
ATOM   1487 O O   . ASN A 1 194 ? 33.621 6.586  6.275   1.00 49.90  ? 281 ASN A O   1 
ATOM   1488 C CB  . ASN A 1 194 ? 34.775 8.675  8.463   1.00 49.67  ? 281 ASN A CB  1 
ATOM   1489 C CG  . ASN A 1 194 ? 35.620 9.919  8.514   1.00 46.86  ? 281 ASN A CG  1 
ATOM   1490 O OD1 . ASN A 1 194 ? 36.129 10.241 9.567   1.00 45.30  ? 281 ASN A OD1 1 
ATOM   1491 N ND2 . ASN A 1 194 ? 35.823 10.587 7.388   1.00 45.73  ? 281 ASN A ND2 1 
ATOM   1492 N N   . MET A 1 195 ? 32.116 7.042  7.868   1.00 39.95  ? 282 MET A N   1 
ATOM   1493 C CA  . MET A 1 195 ? 31.494 5.759  7.690   1.00 42.39  ? 282 MET A CA  1 
ATOM   1494 C C   . MET A 1 195 ? 30.719 5.674  6.384   1.00 42.97  ? 282 MET A C   1 
ATOM   1495 O O   . MET A 1 195 ? 30.742 4.632  5.764   1.00 45.70  ? 282 MET A O   1 
ATOM   1496 C CB  . MET A 1 195 ? 30.701 5.226  8.908   1.00 44.10  ? 282 MET A CB  1 
ATOM   1497 C CG  . MET A 1 195 ? 29.642 4.241  8.460   1.00 45.94  ? 282 MET A CG  1 
ATOM   1498 S SD  . MET A 1 195 ? 29.044 3.209  9.813   1.00 46.28  ? 282 MET A SD  1 
ATOM   1499 C CE  . MET A 1 195 ? 28.653 4.479  11.033  1.00 45.53  ? 282 MET A CE  1 
ATOM   1500 N N   . ARG A 1 196 ? 30.025 6.751  5.933   1.00 41.00  ? 283 ARG A N   1 
ATOM   1501 C CA  . ARG A 1 196 ? 29.322 6.585  4.659   1.00 43.84  ? 283 ARG A CA  1 
ATOM   1502 C C   . ARG A 1 196 ? 30.357 6.350  3.561   1.00 41.36  ? 283 ARG A C   1 
ATOM   1503 O O   . ARG A 1 196 ? 30.098 5.592  2.626   1.00 41.14  ? 283 ARG A O   1 
ATOM   1504 C CB  . ARG A 1 196 ? 28.405 7.737  4.201   1.00 51.92  ? 283 ARG A CB  1 
ATOM   1505 C CG  . ARG A 1 196 ? 27.599 8.429  5.289   1.00 62.04  ? 283 ARG A CG  1 
ATOM   1506 C CD  . ARG A 1 196 ? 26.285 7.785  5.734   1.00 75.38  ? 283 ARG A CD  1 
ATOM   1507 N NE  . ARG A 1 196 ? 25.101 8.358  5.076   1.00 87.20  ? 283 ARG A NE  1 
ATOM   1508 C CZ  . ARG A 1 196 ? 24.440 9.451  5.509   1.00 93.77  ? 283 ARG A CZ  1 
ATOM   1509 N NH1 . ARG A 1 196 ? 24.807 10.134 6.590   1.00 93.27  ? 283 ARG A NH1 1 
ATOM   1510 N NH2 . ARG A 1 196 ? 23.381 9.880  4.826   1.00 97.76  ? 283 ARG A NH2 1 
ATOM   1511 N N   . ALA A 1 197 ? 31.527 7.035  3.693   1.00 37.54  ? 284 ALA A N   1 
ATOM   1512 C CA  . ALA A 1 197 ? 32.604 6.911  2.722   1.00 34.57  ? 284 ALA A CA  1 
ATOM   1513 C C   . ALA A 1 197 ? 33.104 5.510  2.671   1.00 33.96  ? 284 ALA A C   1 
ATOM   1514 O O   . ALA A 1 197 ? 33.178 4.958  1.587   1.00 38.17  ? 284 ALA A O   1 
ATOM   1515 C CB  . ALA A 1 197 ? 33.728 7.918  2.859   1.00 34.12  ? 284 ALA A CB  1 
ATOM   1516 N N   . HIS A 1 198 ? 33.417 4.918  3.832   1.00 34.25  ? 285 HIS A N   1 
ATOM   1517 C CA  . HIS A 1 198 ? 33.855 3.564  3.841   1.00 36.20  ? 285 HIS A CA  1 
ATOM   1518 C C   . HIS A 1 198 ? 32.778 2.691  3.159   1.00 30.85  ? 285 HIS A C   1 
ATOM   1519 O O   . HIS A 1 198 ? 33.089 2.033  2.184   1.00 32.06  ? 285 HIS A O   1 
ATOM   1520 C CB  . HIS A 1 198 ? 34.145 3.111  5.283   1.00 43.59  ? 285 HIS A CB  1 
ATOM   1521 C CG  . HIS A 1 198 ? 34.502 1.672  5.431   1.00 51.70  ? 285 HIS A CG  1 
ATOM   1522 N ND1 . HIS A 1 198 ? 35.542 1.104  4.714   1.00 55.46  ? 285 HIS A ND1 1 
ATOM   1523 C CD2 . HIS A 1 198 ? 33.971 0.711  6.240   1.00 55.84  ? 285 HIS A CD2 1 
ATOM   1524 C CE1 . HIS A 1 198 ? 35.610 -0.174 5.080   1.00 57.47  ? 285 HIS A CE1 1 
ATOM   1525 N NE2 . HIS A 1 198 ? 34.684 -0.442 5.994   1.00 56.34  ? 285 HIS A NE2 1 
ATOM   1526 N N   . ALA A 1 199 ? 31.526 2.719  3.650   1.00 23.84  ? 286 ALA A N   1 
ATOM   1527 C CA  . ALA A 1 199 ? 30.426 1.933  3.087   1.00 25.32  ? 286 ALA A CA  1 
ATOM   1528 C C   . ALA A 1 199 ? 30.399 1.891  1.563   1.00 28.41  ? 286 ALA A C   1 
ATOM   1529 O O   . ALA A 1 199 ? 30.086 0.873  0.921   1.00 29.99  ? 286 ALA A O   1 
ATOM   1530 C CB  . ALA A 1 199 ? 29.089 2.379  3.632   1.00 24.36  ? 286 ALA A CB  1 
ATOM   1531 N N   . LEU A 1 200 ? 30.738 3.008  0.983   1.00 29.33  ? 287 LEU A N   1 
ATOM   1532 C CA  . LEU A 1 200 ? 30.767 3.135  -0.432  1.00 39.01  ? 287 LEU A CA  1 
ATOM   1533 C C   . LEU A 1 200 ? 31.867 2.258  -0.978  1.00 43.79  ? 287 LEU A C   1 
ATOM   1534 O O   . LEU A 1 200 ? 31.656 1.528  -1.931  1.00 45.95  ? 287 LEU A O   1 
ATOM   1535 C CB  . LEU A 1 200 ? 30.909 4.622  -0.748  1.00 45.86  ? 287 LEU A CB  1 
ATOM   1536 C CG  . LEU A 1 200 ? 30.625 4.928  -2.194  1.00 52.74  ? 287 LEU A CG  1 
ATOM   1537 C CD1 . LEU A 1 200 ? 29.576 3.953  -2.699  1.00 54.71  ? 287 LEU A CD1 1 
ATOM   1538 C CD2 . LEU A 1 200 ? 30.086 6.356  -2.287  1.00 52.88  ? 287 LEU A CD2 1 
ATOM   1539 N N   . GLU A 1 201 ? 33.038 2.314  -0.350  1.00 51.74  ? 288 GLU A N   1 
ATOM   1540 C CA  . GLU A 1 201 ? 34.139 1.483  -0.794  1.00 62.51  ? 288 GLU A CA  1 
ATOM   1541 C C   . GLU A 1 201 ? 33.735 0.047  -0.712  1.00 63.37  ? 288 GLU A C   1 
ATOM   1542 O O   . GLU A 1 201 ? 34.240 -0.786 -1.457  1.00 68.93  ? 288 GLU A O   1 
ATOM   1543 C CB  . GLU A 1 201 ? 35.408 1.662  0.057   1.00 73.73  ? 288 GLU A CB  1 
ATOM   1544 C CG  . GLU A 1 201 ? 36.211 2.927  -0.267  1.00 85.90  ? 288 GLU A CG  1 
ATOM   1545 C CD  . GLU A 1 201 ? 35.423 4.210  -0.224  1.00 96.12  ? 288 GLU A CD  1 
ATOM   1546 O OE1 . GLU A 1 201 ? 34.381 4.223  -1.023  1.00 99.64  ? 288 GLU A OE1 1 
ATOM   1547 O OE2 . GLU A 1 201 ? 35.817 5.200  0.364   1.00 99.23  ? 288 GLU A OE2 1 
ATOM   1548 N N   . LYS A 1 202 ? 32.829 -0.225 0.217   1.00 57.87  ? 289 LYS A N   1 
ATOM   1549 C CA  . LYS A 1 202 ? 32.354 -1.565 0.409   1.00 54.89  ? 289 LYS A CA  1 
ATOM   1550 C C   . LYS A 1 202 ? 31.202 -2.058 -0.445  1.00 53.91  ? 289 LYS A C   1 
ATOM   1551 O O   . LYS A 1 202 ? 30.813 -3.247 -0.341  1.00 53.36  ? 289 LYS A O   1 
ATOM   1552 C CB  . LYS A 1 202 ? 32.396 -2.072 1.818   1.00 54.74  ? 289 LYS A CB  1 
ATOM   1553 C CG  . LYS A 1 202 ? 33.837 -2.240 2.189   1.00 57.34  ? 289 LYS A CG  1 
ATOM   1554 C CD  . LYS A 1 202 ? 34.101 -3.360 3.165   1.00 62.81  ? 289 LYS A CD  1 
ATOM   1555 C CE  . LYS A 1 202 ? 35.543 -3.821 3.034   1.00 67.86  ? 289 LYS A CE  1 
ATOM   1556 N NZ  . LYS A 1 202 ? 36.085 -4.428 4.251   1.00 69.10  ? 289 LYS A NZ  1 
ATOM   1557 N N   . GLY A 1 203 ? 30.695 -1.124 -1.283  1.00 51.67  ? 290 GLY A N   1 
ATOM   1558 C CA  . GLY A 1 203 ? 29.584 -1.330 -2.212  1.00 51.34  ? 290 GLY A CA  1 
ATOM   1559 C C   . GLY A 1 203 ? 28.258 -1.160 -1.511  1.00 49.54  ? 290 GLY A C   1 
ATOM   1560 O O   . GLY A 1 203 ? 27.341 -1.962 -1.650  1.00 51.22  ? 290 GLY A O   1 
ATOM   1561 N N   . PHE A 1 204 ? 28.176 -0.088 -0.732  1.00 43.74  ? 291 PHE A N   1 
ATOM   1562 C CA  . PHE A 1 204 ? 26.990 0.160  0.016   1.00 40.53  ? 291 PHE A CA  1 
ATOM   1563 C C   . PHE A 1 204 ? 26.679 1.604  0.300   1.00 41.49  ? 291 PHE A C   1 
ATOM   1564 O O   . PHE A 1 204 ? 27.513 2.428  0.632   1.00 42.66  ? 291 PHE A O   1 
ATOM   1565 C CB  . PHE A 1 204 ? 27.175 -0.448 1.407   1.00 41.28  ? 291 PHE A CB  1 
ATOM   1566 C CG  . PHE A 1 204 ? 27.090 -1.955 1.512   1.00 41.98  ? 291 PHE A CG  1 
ATOM   1567 C CD1 . PHE A 1 204 ? 25.835 -2.555 1.576   1.00 43.98  ? 291 PHE A CD1 1 
ATOM   1568 C CD2 . PHE A 1 204 ? 28.217 -2.759 1.555   1.00 38.18  ? 291 PHE A CD2 1 
ATOM   1569 C CE1 . PHE A 1 204 ? 25.706 -3.947 1.677   1.00 47.04  ? 291 PHE A CE1 1 
ATOM   1570 C CE2 . PHE A 1 204 ? 28.118 -4.129 1.653   1.00 38.78  ? 291 PHE A CE2 1 
ATOM   1571 C CZ  . PHE A 1 204 ? 26.868 -4.728 1.713   1.00 44.61  ? 291 PHE A CZ  1 
ATOM   1572 N N   . THR A 1 205 ? 25.409 1.901  0.175   1.00 43.45  ? 292 THR A N   1 
ATOM   1573 C CA  . THR A 1 205 ? 24.956 3.228  0.458   1.00 38.43  ? 292 THR A CA  1 
ATOM   1574 C C   . THR A 1 205 ? 24.059 3.243  1.661   1.00 31.30  ? 292 THR A C   1 
ATOM   1575 O O   . THR A 1 205 ? 23.047 2.555  1.726   1.00 32.09  ? 292 THR A O   1 
ATOM   1576 C CB  . THR A 1 205 ? 24.259 3.935  -0.683  1.00 45.85  ? 292 THR A CB  1 
ATOM   1577 O OG1 . THR A 1 205 ? 23.727 5.144  -0.145  1.00 48.85  ? 292 THR A OG1 1 
ATOM   1578 C CG2 . THR A 1 205 ? 23.133 3.064  -1.228  1.00 46.28  ? 292 THR A CG2 1 
ATOM   1579 N N   . ILE A 1 206 ? 24.489 4.065  2.580   1.00 33.32  ? 293 ILE A N   1 
ATOM   1580 C CA  . ILE A 1 206 ? 23.890 4.334  3.865   1.00 35.59  ? 293 ILE A CA  1 
ATOM   1581 C C   . ILE A 1 206 ? 23.415 5.760  4.068   1.00 35.63  ? 293 ILE A C   1 
ATOM   1582 O O   . ILE A 1 206 ? 24.138 6.702  3.780   1.00 34.82  ? 293 ILE A O   1 
ATOM   1583 C CB  . ILE A 1 206 ? 25.044 4.206  4.793   1.00 38.83  ? 293 ILE A CB  1 
ATOM   1584 C CG1 . ILE A 1 206 ? 25.635 2.849  4.552   1.00 44.96  ? 293 ILE A CG1 1 
ATOM   1585 C CG2 . ILE A 1 206 ? 24.634 4.353  6.244   1.00 38.72  ? 293 ILE A CG2 1 
ATOM   1586 C CD1 . ILE A 1 206 ? 26.672 2.541  5.602   1.00 46.32  ? 293 ILE A CD1 1 
ATOM   1587 N N   . ASN A 1 207 ? 22.227 5.926  4.630   1.00 28.76  ? 294 ASN A N   1 
ATOM   1588 C CA  . ASN A 1 207 ? 21.697 7.234  4.922   1.00 28.16  ? 294 ASN A CA  1 
ATOM   1589 C C   . ASN A 1 207 ? 21.027 7.057  6.246   1.00 33.91  ? 294 ASN A C   1 
ATOM   1590 O O   . ASN A 1 207 ? 21.177 5.978  6.820   1.00 39.35  ? 294 ASN A O   1 
ATOM   1591 C CB  . ASN A 1 207 ? 20.727 7.831  3.877   1.00 29.19  ? 294 ASN A CB  1 
ATOM   1592 C CG  . ASN A 1 207 ? 19.475 7.013  3.637   1.00 33.96  ? 294 ASN A CG  1 
ATOM   1593 O OD1 . ASN A 1 207 ? 19.160 6.700  2.484   1.00 35.60  ? 294 ASN A OD1 1 
ATOM   1594 N ND2 . ASN A 1 207 ? 18.771 6.639  4.692   1.00 34.44  ? 294 ASN A ND2 1 
ATOM   1595 N N   . GLU A 1 208 ? 20.293 8.074  6.731   1.00 32.94  ? 295 GLU A N   1 
ATOM   1596 C CA  . GLU A 1 208 ? 19.609 7.970  8.026   1.00 34.84  ? 295 GLU A CA  1 
ATOM   1597 C C   . GLU A 1 208 ? 18.475 6.994  8.105   1.00 30.17  ? 295 GLU A C   1 
ATOM   1598 O O   . GLU A 1 208 ? 17.956 6.847  9.174   1.00 30.05  ? 295 GLU A O   1 
ATOM   1599 C CB  . GLU A 1 208 ? 19.167 9.276  8.708   1.00 43.39  ? 295 GLU A CB  1 
ATOM   1600 C CG  . GLU A 1 208 ? 18.302 10.142 7.778   1.00 56.24  ? 295 GLU A CG  1 
ATOM   1601 C CD  . GLU A 1 208 ? 19.035 10.538 6.524   1.00 65.58  ? 295 GLU A CD  1 
ATOM   1602 O OE1 . GLU A 1 208 ? 19.911 11.483 6.718   1.00 70.42  ? 295 GLU A OE1 1 
ATOM   1603 O OE2 . GLU A 1 208 ? 18.815 10.048 5.439   1.00 65.88  ? 295 GLU A OE2 1 
ATOM   1604 N N   . TYR A 1 209 ? 18.040 6.324  6.992   1.00 29.61  ? 296 TYR A N   1 
ATOM   1605 C CA  . TYR A 1 209 ? 16.940 5.375  7.119   1.00 34.67  ? 296 TYR A CA  1 
ATOM   1606 C C   . TYR A 1 209 ? 17.396 3.936  6.946   1.00 35.95  ? 296 TYR A C   1 
ATOM   1607 O O   . TYR A 1 209 ? 17.043 3.081  7.784   1.00 34.62  ? 296 TYR A O   1 
ATOM   1608 C CB  . TYR A 1 209 ? 15.776 5.600  6.135   1.00 41.99  ? 296 TYR A CB  1 
ATOM   1609 C CG  . TYR A 1 209 ? 15.460 7.042  6.049   1.00 49.84  ? 296 TYR A CG  1 
ATOM   1610 C CD1 . TYR A 1 209 ? 14.836 7.679  7.116   1.00 52.96  ? 296 TYR A CD1 1 
ATOM   1611 C CD2 . TYR A 1 209 ? 15.837 7.781  4.924   1.00 54.36  ? 296 TYR A CD2 1 
ATOM   1612 C CE1 . TYR A 1 209 ? 14.561 9.037  7.065   1.00 56.58  ? 296 TYR A CE1 1 
ATOM   1613 C CE2 . TYR A 1 209 ? 15.563 9.143  4.854   1.00 56.94  ? 296 TYR A CE2 1 
ATOM   1614 C CZ  . TYR A 1 209 ? 14.928 9.756  5.930   1.00 60.32  ? 296 TYR A CZ  1 
ATOM   1615 O OH  . TYR A 1 209 ? 14.655 11.101 5.878   1.00 66.55  ? 296 TYR A OH  1 
ATOM   1616 N N   . THR A 1 210 ? 18.175 3.728  5.853   1.00 35.48  ? 297 THR A N   1 
ATOM   1617 C CA  . THR A 1 210 ? 18.690 2.414  5.437   1.00 35.34  ? 297 THR A CA  1 
ATOM   1618 C C   . THR A 1 210 ? 20.021 2.298  4.762   1.00 34.48  ? 297 THR A C   1 
ATOM   1619 O O   . THR A 1 210 ? 20.595 3.256  4.274   1.00 35.41  ? 297 THR A O   1 
ATOM   1620 C CB  . THR A 1 210 ? 17.841 2.173  4.187   1.00 27.86  ? 297 THR A CB  1 
ATOM   1621 O OG1 . THR A 1 210 ? 18.125 3.234  3.279   1.00 25.63  ? 297 THR A OG1 1 
ATOM   1622 C CG2 . THR A 1 210 ? 16.408 2.245  4.574   1.00 24.59  ? 297 THR A CG2 1 
ATOM   1623 N N   . ILE A 1 211 ? 20.423 1.046  4.718   1.00 33.17  ? 298 ILE A N   1 
ATOM   1624 C CA  . ILE A 1 211 ? 21.635 0.598  4.053   1.00 34.24  ? 298 ILE A CA  1 
ATOM   1625 C C   . ILE A 1 211 ? 21.227 -0.222 2.826   1.00 32.35  ? 298 ILE A C   1 
ATOM   1626 O O   . ILE A 1 211 ? 20.389 -1.099 2.910   1.00 34.90  ? 298 ILE A O   1 
ATOM   1627 C CB  . ILE A 1 211 ? 22.502 -0.169 4.983   1.00 36.73  ? 298 ILE A CB  1 
ATOM   1628 C CG1 . ILE A 1 211 ? 23.664 -0.629 4.130   1.00 34.65  ? 298 ILE A CG1 1 
ATOM   1629 C CG2 . ILE A 1 211 ? 21.647 -1.347 5.436   1.00 38.45  ? 298 ILE A CG2 1 
ATOM   1630 C CD1 . ILE A 1 211 ? 24.965 -0.717 4.908   1.00 32.52  ? 298 ILE A CD1 1 
ATOM   1631 N N   A ARG A 1 212 ? 21.855 0.081  1.692   0.50 31.41  ? 299 ARG A N   1 
ATOM   1632 N N   B ARG A 1 212 ? 21.884 0.053  1.716   0.50 28.05  ? 299 ARG A N   1 
ATOM   1633 C CA  A ARG A 1 212 ? 21.509 -0.609 0.469   0.50 32.89  ? 299 ARG A CA  1 
ATOM   1634 C CA  B ARG A 1 212 ? 21.563 -0.657 0.508   0.50 26.47  ? 299 ARG A CA  1 
ATOM   1635 C C   A ARG A 1 212 ? 22.709 -0.890 -0.411  0.50 37.30  ? 299 ARG A C   1 
ATOM   1636 C C   B ARG A 1 212 ? 22.778 -0.946 -0.326  0.50 33.68  ? 299 ARG A C   1 
ATOM   1637 O O   A ARG A 1 212 ? 23.577 -0.043 -0.587  0.50 39.52  ? 299 ARG A O   1 
ATOM   1638 O O   B ARG A 1 212 ? 23.708 -0.150 -0.398  0.50 35.40  ? 299 ARG A O   1 
ATOM   1639 C CB  A ARG A 1 212 ? 20.587 0.353  -0.276  0.50 32.58  ? 299 ARG A CB  1 
ATOM   1640 C CB  B ARG A 1 212 ? 20.723 0.254  -0.380  0.50 21.90  ? 299 ARG A CB  1 
ATOM   1641 C CG  A ARG A 1 212 ? 19.528 0.941  0.657   0.50 33.45  ? 299 ARG A CG  1 
ATOM   1642 C CG  B ARG A 1 212 ? 19.354 0.613  0.152   0.50 19.25  ? 299 ARG A CG  1 
ATOM   1643 C CD  A ARG A 1 212 ? 18.726 2.111  0.067   0.50 34.41  ? 299 ARG A CD  1 
ATOM   1644 C CD  B ARG A 1 212 ? 18.622 1.586  -0.764  0.50 19.81  ? 299 ARG A CD  1 
ATOM   1645 N NE  A ARG A 1 212 ? 19.346 3.468  -0.025  0.50 31.66  ? 299 ARG A NE  1 
ATOM   1646 N NE  B ARG A 1 212 ? 19.211 2.948  -0.856  0.50 17.29  ? 299 ARG A NE  1 
ATOM   1647 C CZ  A ARG A 1 212 ? 20.125 4.146  0.842   0.50 27.73  ? 299 ARG A CZ  1 
ATOM   1648 C CZ  B ARG A 1 212 ? 18.662 3.900  -1.630  0.50 10.55  ? 299 ARG A CZ  1 
ATOM   1649 N NH1 A ARG A 1 212 ? 20.474 3.704  2.040   0.50 21.91  ? 299 ARG A NH1 1 
ATOM   1650 N NH1 B ARG A 1 212 ? 17.568 3.689  -2.362  0.50 8.60   ? 299 ARG A NH1 1 
ATOM   1651 N NH2 A ARG A 1 212 ? 20.555 5.361  0.505   0.50 29.73  ? 299 ARG A NH2 1 
ATOM   1652 N NH2 B ARG A 1 212 ? 19.212 5.106  -1.693  0.50 5.38   ? 299 ARG A NH2 1 
ATOM   1653 N N   . PRO A 1 213 ? 22.747 -2.089 -0.964  1.00 37.48  ? 300 PRO A N   1 
ATOM   1654 C CA  . PRO A 1 213 ? 23.825 -2.477 -1.813  1.00 43.73  ? 300 PRO A CA  1 
ATOM   1655 C C   . PRO A 1 213 ? 23.729 -1.621 -3.051  1.00 51.55  ? 300 PRO A C   1 
ATOM   1656 O O   . PRO A 1 213 ? 22.640 -1.153 -3.390  1.00 52.24  ? 300 PRO A O   1 
ATOM   1657 C CB  . PRO A 1 213 ? 23.497 -3.921 -2.182  1.00 44.11  ? 300 PRO A CB  1 
ATOM   1658 C CG  . PRO A 1 213 ? 21.989 -4.053 -2.083  1.00 39.84  ? 300 PRO A CG  1 
ATOM   1659 C CD  . PRO A 1 213 ? 21.553 -2.961 -1.124  1.00 37.90  ? 300 PRO A CD  1 
ATOM   1660 N N   . LEU A 1 214 ? 24.879 -1.404 -3.709  1.00 58.63  ? 301 LEU A N   1 
ATOM   1661 C CA  . LEU A 1 214 ? 24.973 -0.617 -4.929  1.00 64.81  ? 301 LEU A CA  1 
ATOM   1662 C C   . LEU A 1 214 ? 24.772 -1.377 -6.230  1.00 72.87  ? 301 LEU A C   1 
ATOM   1663 O O   . LEU A 1 214 ? 23.921 -2.248 -6.360  1.00 72.66  ? 301 LEU A O   1 
ATOM   1664 C CB  . LEU A 1 214 ? 26.123 0.370  -4.996  1.00 66.53  ? 301 LEU A CB  1 
ATOM   1665 C CG  . LEU A 1 214 ? 25.742 1.605  -4.221  1.00 71.87  ? 301 LEU A CG  1 
ATOM   1666 C CD1 . LEU A 1 214 ? 25.493 1.208  -2.778  1.00 75.54  ? 301 LEU A CD1 1 
ATOM   1667 C CD2 . LEU A 1 214 ? 26.854 2.636  -4.330  1.00 73.19  ? 301 LEU A CD2 1 
ATOM   1668 N N   . GLY A 1 215 ? 25.544 -1.047 -7.244  1.00 80.89  ? 302 GLY A N   1 
ATOM   1669 C CA  . GLY A 1 215 ? 25.342 -1.781 -8.465  1.00 86.73  ? 302 GLY A CA  1 
ATOM   1670 C C   . GLY A 1 215 ? 26.021 -1.114 -9.611  1.00 93.31  ? 302 GLY A C   1 
ATOM   1671 O O   . GLY A 1 215 ? 26.712 -0.109 -9.447  1.00 92.88  ? 302 GLY A O   1 
ATOM   1672 N N   . VAL A 1 216 ? 25.816 -1.705 -10.773 1.00 98.27  ? 303 VAL A N   1 
ATOM   1673 C CA  . VAL A 1 216 ? 26.402 -1.169 -11.968 1.00 100.00 ? 303 VAL A CA  1 
ATOM   1674 C C   . VAL A 1 216 ? 25.846 0.229  -12.204 1.00 100.00 ? 303 VAL A C   1 
ATOM   1675 O O   . VAL A 1 216 ? 24.666 0.502  -11.938 1.00 98.94  ? 303 VAL A O   1 
ATOM   1676 C CB  . VAL A 1 216 ? 26.208 -2.111 -13.154 1.00 100.00 ? 303 VAL A CB  1 
ATOM   1677 N N   . THR A 1 217 ? 26.722 1.111  -12.693 1.00 100.00 ? 304 THR A N   1 
ATOM   1678 C CA  . THR A 1 217 ? 26.379 2.499  -12.976 1.00 100.00 ? 304 THR A CA  1 
ATOM   1679 C C   . THR A 1 217 ? 26.233 3.314  -11.697 1.00 100.00 ? 304 THR A C   1 
ATOM   1680 O O   . THR A 1 217 ? 26.291 4.548  -11.723 1.00 100.00 ? 304 THR A O   1 
ATOM   1681 C CB  . THR A 1 217 ? 25.095 2.570  -13.782 1.00 99.54  ? 304 THR A CB  1 
ATOM   1682 N N   . GLY A 1 218 ? 26.054 2.573  -10.600 1.00 100.00 ? 305 GLY A N   1 
ATOM   1683 C CA  . GLY A 1 218 ? 25.884 3.062  -9.243  1.00 99.36  ? 305 GLY A CA  1 
ATOM   1684 C C   . GLY A 1 218 ? 24.445 3.191  -8.796  1.00 99.84  ? 305 GLY A C   1 
ATOM   1685 O O   . GLY A 1 218 ? 24.081 2.663  -7.751  1.00 99.69  ? 305 GLY A O   1 
ATOM   1686 N N   . VAL A 1 219 ? 23.633 3.894  -9.577  1.00 99.09  ? 306 VAL A N   1 
ATOM   1687 C CA  . VAL A 1 219 ? 22.239 4.077  -9.215  1.00 92.99  ? 306 VAL A CA  1 
ATOM   1688 C C   . VAL A 1 219 ? 21.561 2.752  -8.919  1.00 82.62  ? 306 VAL A C   1 
ATOM   1689 O O   . VAL A 1 219 ? 20.881 2.202  -9.795  1.00 80.33  ? 306 VAL A O   1 
ATOM   1690 C CB  . VAL A 1 219 ? 21.502 4.804  -10.318 1.00 95.25  ? 306 VAL A CB  1 
ATOM   1691 N N   . ALA A 1 220 ? 21.760 2.294  -7.654  1.00 74.26  ? 307 ALA A N   1 
ATOM   1692 C CA  . ALA A 1 220 ? 21.222 1.027  -7.139  1.00 66.98  ? 307 ALA A CA  1 
ATOM   1693 C C   . ALA A 1 220 ? 20.604 1.022  -5.695  1.00 60.91  ? 307 ALA A C   1 
ATOM   1694 O O   . ALA A 1 220 ? 20.629 2.014  -4.961  1.00 52.80  ? 307 ALA A O   1 
ATOM   1695 C CB  . ALA A 1 220 ? 22.146 -0.155 -7.444  1.00 63.33  ? 307 ALA A CB  1 
ATOM   1696 N N   . GLY A 1 221 ? 20.007 -0.124 -5.300  1.00 60.21  ? 308 GLY A N   1 
ATOM   1697 C CA  . GLY A 1 221 ? 19.396 -0.204 -3.986  1.00 59.56  ? 308 GLY A CA  1 
ATOM   1698 C C   . GLY A 1 221 ? 18.637 -1.493 -3.653  1.00 60.27  ? 308 GLY A C   1 
ATOM   1699 O O   . GLY A 1 221 ? 18.650 -2.488 -4.389  1.00 63.53  ? 308 GLY A O   1 
ATOM   1700 N N   . GLU A 1 222 ? 18.004 -1.414 -2.477  1.00 55.98  ? 309 GLU A N   1 
ATOM   1701 C CA  . GLU A 1 222 ? 17.175 -2.428 -1.831  1.00 53.78  ? 309 GLU A CA  1 
ATOM   1702 C C   . GLU A 1 222 ? 17.690 -2.756 -0.435  1.00 45.52  ? 309 GLU A C   1 
ATOM   1703 O O   . GLU A 1 222 ? 18.562 -3.603 -0.225  1.00 45.45  ? 309 GLU A O   1 
ATOM   1704 C CB  . GLU A 1 222 ? 16.665 -3.585 -2.698  1.00 64.77  ? 309 GLU A CB  1 
ATOM   1705 C CG  . GLU A 1 222 ? 15.327 -4.151 -2.159  1.00 75.23  ? 309 GLU A CG  1 
ATOM   1706 C CD  . GLU A 1 222 ? 14.558 -4.969 -3.154  1.00 83.67  ? 309 GLU A CD  1 
ATOM   1707 O OE1 . GLU A 1 222 ? 14.841 -4.642 -4.394  1.00 88.50  ? 309 GLU A OE1 1 
ATOM   1708 O OE2 . GLU A 1 222 ? 13.739 -5.814 -2.831  1.00 84.14  ? 309 GLU A OE2 1 
ATOM   1709 N N   . PRO A 1 223 ? 17.106 -2.042 0.510   1.00 39.48  ? 310 PRO A N   1 
ATOM   1710 C CA  . PRO A 1 223 ? 17.401 -2.092 1.912   1.00 38.31  ? 310 PRO A CA  1 
ATOM   1711 C C   . PRO A 1 223 ? 17.517 -3.436 2.597   1.00 37.20  ? 310 PRO A C   1 
ATOM   1712 O O   . PRO A 1 223 ? 16.619 -4.268 2.599   1.00 38.61  ? 310 PRO A O   1 
ATOM   1713 C CB  . PRO A 1 223 ? 16.331 -1.261 2.610   1.00 39.00  ? 310 PRO A CB  1 
ATOM   1714 C CG  . PRO A 1 223 ? 15.194 -1.086 1.611   1.00 36.87  ? 310 PRO A CG  1 
ATOM   1715 C CD  . PRO A 1 223 ? 15.749 -1.496 0.260   1.00 38.92  ? 310 PRO A CD  1 
ATOM   1716 N N   . LEU A 1 224 ? 18.681 -3.569 3.198   1.00 36.01  ? 311 LEU A N   1 
ATOM   1717 C CA  . LEU A 1 224 ? 19.107 -4.705 3.971   1.00 35.53  ? 311 LEU A CA  1 
ATOM   1718 C C   . LEU A 1 224 ? 18.483 -4.619 5.354   1.00 36.34  ? 311 LEU A C   1 
ATOM   1719 O O   . LEU A 1 224 ? 18.388 -3.527 5.905   1.00 40.38  ? 311 LEU A O   1 
ATOM   1720 C CB  . LEU A 1 224 ? 20.630 -4.604 4.130   1.00 32.54  ? 311 LEU A CB  1 
ATOM   1721 C CG  . LEU A 1 224 ? 21.437 -5.281 3.042   1.00 27.08  ? 311 LEU A CG  1 
ATOM   1722 C CD1 . LEU A 1 224 ? 20.556 -5.572 1.825   1.00 34.81  ? 311 LEU A CD1 1 
ATOM   1723 C CD2 . LEU A 1 224 ? 22.588 -4.358 2.659   1.00 19.89  ? 311 LEU A CD2 1 
ATOM   1724 N N   . PRO A 1 225 ? 18.078 -5.761 5.910   1.00 31.91  ? 312 PRO A N   1 
ATOM   1725 C CA  . PRO A 1 225 ? 17.492 -5.805 7.246   1.00 26.24  ? 312 PRO A CA  1 
ATOM   1726 C C   . PRO A 1 225 ? 18.521 -5.509 8.296   1.00 25.41  ? 312 PRO A C   1 
ATOM   1727 O O   . PRO A 1 225 ? 19.570 -6.133 8.348   1.00 26.68  ? 312 PRO A O   1 
ATOM   1728 C CB  . PRO A 1 225 ? 17.054 -7.250 7.490   1.00 24.76  ? 312 PRO A CB  1 
ATOM   1729 C CG  . PRO A 1 225 ? 17.280 -7.996 6.187   1.00 23.13  ? 312 PRO A CG  1 
ATOM   1730 C CD  . PRO A 1 225 ? 17.984 -7.071 5.213   1.00 23.94  ? 312 PRO A CD  1 
ATOM   1731 N N   . VAL A 1 226 ? 18.185 -4.556 9.170   1.00 19.31  ? 313 VAL A N   1 
ATOM   1732 C CA  . VAL A 1 226 ? 19.019 -4.111 10.238  1.00 18.54  ? 313 VAL A CA  1 
ATOM   1733 C C   . VAL A 1 226 ? 18.240 -4.178 11.537  1.00 28.98  ? 313 VAL A C   1 
ATOM   1734 O O   . VAL A 1 226 ? 17.230 -3.473 11.715  1.00 40.31  ? 313 VAL A O   1 
ATOM   1735 C CB  . VAL A 1 226 ? 19.365 -2.649 9.997   1.00 15.08  ? 313 VAL A CB  1 
ATOM   1736 C CG1 . VAL A 1 226 ? 20.123 -2.088 11.201  1.00 17.67  ? 313 VAL A CG1 1 
ATOM   1737 C CG2 . VAL A 1 226 ? 20.161 -2.466 8.725   1.00 15.20  ? 313 VAL A CG2 1 
ATOM   1738 N N   . ASP A 1 227 ? 18.690 -5.028 12.435  1.00 27.55  ? 314 ASP A N   1 
ATOM   1739 C CA  . ASP A 1 227 ? 18.075 -5.240 13.719  1.00 26.47  ? 314 ASP A CA  1 
ATOM   1740 C C   . ASP A 1 227 ? 18.882 -4.677 14.866  1.00 21.77  ? 314 ASP A C   1 
ATOM   1741 O O   . ASP A 1 227 ? 18.569 -4.887 16.029  1.00 22.90  ? 314 ASP A O   1 
ATOM   1742 C CB  . ASP A 1 227 ? 17.854 -6.736 13.921  1.00 42.12  ? 314 ASP A CB  1 
ATOM   1743 C CG  . ASP A 1 227 ? 17.122 -7.322 12.751  1.00 52.20  ? 314 ASP A CG  1 
ATOM   1744 O OD1 . ASP A 1 227 ? 15.891 -6.874 12.649  1.00 58.71  ? 314 ASP A OD1 1 
ATOM   1745 O OD2 . ASP A 1 227 ? 17.596 -8.190 12.044  1.00 52.45  ? 314 ASP A OD2 1 
ATOM   1746 N N   . SER A 1 228 ? 19.933 -3.967 14.525  1.00 23.26  ? 315 SER A N   1 
ATOM   1747 C CA  . SER A 1 228 ? 20.775 -3.358 15.534  1.00 20.95  ? 315 SER A CA  1 
ATOM   1748 C C   . SER A 1 228 ? 21.793 -2.497 14.812  1.00 20.32  ? 315 SER A C   1 
ATOM   1749 O O   . SER A 1 228 ? 21.841 -2.519 13.573  1.00 20.06  ? 315 SER A O   1 
ATOM   1750 C CB  . SER A 1 228 ? 21.438 -4.395 16.402  1.00 23.01  ? 315 SER A CB  1 
ATOM   1751 O OG  . SER A 1 228 ? 22.437 -5.042 15.651  1.00 24.95  ? 315 SER A OG  1 
ATOM   1752 N N   . GLU A 1 229 ? 22.578 -1.771 15.582  1.00 20.63  ? 316 GLU A N   1 
ATOM   1753 C CA  . GLU A 1 229 ? 23.601 -0.920 15.028  1.00 24.29  ? 316 GLU A CA  1 
ATOM   1754 C C   . GLU A 1 229 ? 24.721 -1.746 14.457  1.00 26.11  ? 316 GLU A C   1 
ATOM   1755 O O   . GLU A 1 229 ? 25.322 -1.386 13.453  1.00 26.31  ? 316 GLU A O   1 
ATOM   1756 C CB  . GLU A 1 229 ? 24.208 0.034  16.111  1.00 22.06  ? 316 GLU A CB  1 
ATOM   1757 C CG  . GLU A 1 229 ? 23.585 1.434  16.153  1.00 20.32  ? 316 GLU A CG  1 
ATOM   1758 C CD  . GLU A 1 229 ? 24.280 2.358  17.112  1.00 20.34  ? 316 GLU A CD  1 
ATOM   1759 O OE1 . GLU A 1 229 ? 24.581 1.786  18.240  1.00 27.93  ? 316 GLU A OE1 1 
ATOM   1760 O OE2 . GLU A 1 229 ? 24.555 3.523  16.877  1.00 27.84  ? 316 GLU A OE2 1 
ATOM   1761 N N   . GLN A 1 230 ? 24.977 -2.858 15.143  1.00 24.67  ? 317 GLN A N   1 
ATOM   1762 C CA  . GLN A 1 230 ? 26.034 -3.796 14.772  1.00 30.27  ? 317 GLN A CA  1 
ATOM   1763 C C   . GLN A 1 230 ? 25.915 -4.332 13.388  1.00 27.10  ? 317 GLN A C   1 
ATOM   1764 O O   . GLN A 1 230 ? 26.906 -4.465 12.683  1.00 26.46  ? 317 GLN A O   1 
ATOM   1765 C CB  . GLN A 1 230 ? 26.236 -4.926 15.789  1.00 38.08  ? 317 GLN A CB  1 
ATOM   1766 C CG  . GLN A 1 230 ? 26.372 -4.389 17.218  1.00 47.73  ? 317 GLN A CG  1 
ATOM   1767 C CD  . GLN A 1 230 ? 25.079 -3.853 17.814  1.00 53.04  ? 317 GLN A CD  1 
ATOM   1768 O OE1 . GLN A 1 230 ? 25.027 -3.576 19.006  1.00 53.70  ? 317 GLN A OE1 1 
ATOM   1769 N NE2 . GLN A 1 230 ? 24.049 -3.726 17.003  1.00 54.73  ? 317 GLN A NE2 1 
ATOM   1770 N N   . ASP A 1 231 ? 24.696 -4.630 13.051  1.00 20.90  ? 318 ASP A N   1 
ATOM   1771 C CA  . ASP A 1 231 ? 24.393 -5.127 11.775  1.00 20.52  ? 318 ASP A CA  1 
ATOM   1772 C C   . ASP A 1 231 ? 24.998 -4.209 10.686  1.00 25.78  ? 318 ASP A C   1 
ATOM   1773 O O   . ASP A 1 231 ? 25.612 -4.643 9.714   1.00 23.62  ? 318 ASP A O   1 
ATOM   1774 C CB  . ASP A 1 231 ? 22.861 -5.156 11.645  1.00 26.18  ? 318 ASP A CB  1 
ATOM   1775 C CG  . ASP A 1 231 ? 22.142 -6.302 12.308  1.00 33.04  ? 318 ASP A CG  1 
ATOM   1776 O OD1 . ASP A 1 231 ? 22.918 -7.167 12.898  1.00 35.99  ? 318 ASP A OD1 1 
ATOM   1777 O OD2 . ASP A 1 231 ? 20.926 -6.433 12.214  1.00 33.17  ? 318 ASP A OD2 1 
ATOM   1778 N N   . ILE A 1 232 ? 24.855 -2.889 10.904  1.00 28.19  ? 319 ILE A N   1 
ATOM   1779 C CA  . ILE A 1 232 ? 25.383 -1.915 9.974   1.00 28.43  ? 319 ILE A CA  1 
ATOM   1780 C C   . ILE A 1 232 ? 26.863 -2.049 9.781   1.00 24.78  ? 319 ILE A C   1 
ATOM   1781 O O   . ILE A 1 232 ? 27.370 -2.085 8.653   1.00 27.67  ? 319 ILE A O   1 
ATOM   1782 C CB  . ILE A 1 232 ? 24.974 -0.507 10.342  1.00 29.60  ? 319 ILE A CB  1 
ATOM   1783 C CG1 . ILE A 1 232 ? 23.477 -0.453 10.406  1.00 25.76  ? 319 ILE A CG1 1 
ATOM   1784 C CG2 . ILE A 1 232 ? 25.432 0.490  9.277   1.00 32.61  ? 319 ILE A CG2 1 
ATOM   1785 C CD1 . ILE A 1 232 ? 23.075 0.755  11.193  1.00 23.67  ? 319 ILE A CD1 1 
ATOM   1786 N N   . PHE A 1 233 ? 27.548 -2.140 10.913  1.00 22.72  ? 320 PHE A N   1 
ATOM   1787 C CA  . PHE A 1 233 ? 28.977 -2.327 10.914  1.00 26.28  ? 320 PHE A CA  1 
ATOM   1788 C C   . PHE A 1 233 ? 29.311 -3.648 10.214  1.00 30.08  ? 320 PHE A C   1 
ATOM   1789 O O   . PHE A 1 233 ? 30.209 -3.718 9.376   1.00 32.78  ? 320 PHE A O   1 
ATOM   1790 C CB  . PHE A 1 233 ? 29.518 -2.322 12.377  1.00 23.30  ? 320 PHE A CB  1 
ATOM   1791 C CG  . PHE A 1 233 ? 29.602 -0.942 13.001  1.00 25.60  ? 320 PHE A CG  1 
ATOM   1792 C CD1 . PHE A 1 233 ? 28.480 -0.281 13.512  1.00 28.96  ? 320 PHE A CD1 1 
ATOM   1793 C CD2 . PHE A 1 233 ? 30.831 -0.286 13.089  1.00 27.63  ? 320 PHE A CD2 1 
ATOM   1794 C CE1 . PHE A 1 233 ? 28.585 0.981  14.081  1.00 28.85  ? 320 PHE A CE1 1 
ATOM   1795 C CE2 . PHE A 1 233 ? 30.955 0.981  13.654  1.00 22.73  ? 320 PHE A CE2 1 
ATOM   1796 C CZ  . PHE A 1 233 ? 29.821 1.606  14.150  1.00 25.38  ? 320 PHE A CZ  1 
ATOM   1797 N N   . ASP A 1 234 ? 28.587 -4.704 10.535  1.00 29.02  ? 321 ASP A N   1 
ATOM   1798 C CA  . ASP A 1 234 ? 28.852 -5.998 9.889   1.00 32.09  ? 321 ASP A CA  1 
ATOM   1799 C C   . ASP A 1 234 ? 28.809 -5.942 8.382   1.00 31.77  ? 321 ASP A C   1 
ATOM   1800 O O   . ASP A 1 234 ? 29.731 -6.409 7.716   1.00 35.17  ? 321 ASP A O   1 
ATOM   1801 C CB  . ASP A 1 234 ? 27.916 -7.104 10.338  1.00 35.78  ? 321 ASP A CB  1 
ATOM   1802 C CG  . ASP A 1 234 ? 28.248 -7.643 11.679  1.00 46.78  ? 321 ASP A CG  1 
ATOM   1803 O OD1 . ASP A 1 234 ? 29.547 -7.744 11.872  1.00 56.80  ? 321 ASP A OD1 1 
ATOM   1804 O OD2 . ASP A 1 234 ? 27.398 -8.033 12.452  1.00 46.03  ? 321 ASP A OD2 1 
ATOM   1805 N N   . TYR A 1 235 ? 27.723 -5.375 7.841   1.00 30.00  ? 322 TYR A N   1 
ATOM   1806 C CA  . TYR A 1 235 ? 27.551 -5.276 6.423   1.00 27.89  ? 322 TYR A CA  1 
ATOM   1807 C C   . TYR A 1 235 ? 28.769 -4.702 5.781   1.00 30.94  ? 322 TYR A C   1 
ATOM   1808 O O   . TYR A 1 235 ? 29.213 -5.143 4.719   1.00 35.15  ? 322 TYR A O   1 
ATOM   1809 C CB  . TYR A 1 235 ? 26.352 -4.447 6.058   1.00 31.16  ? 322 TYR A CB  1 
ATOM   1810 C CG  . TYR A 1 235 ? 25.053 -5.167 6.225   1.00 33.50  ? 322 TYR A CG  1 
ATOM   1811 C CD1 . TYR A 1 235 ? 24.778 -6.291 5.444   1.00 36.12  ? 322 TYR A CD1 1 
ATOM   1812 C CD2 . TYR A 1 235 ? 24.098 -4.705 7.115   1.00 32.90  ? 322 TYR A CD2 1 
ATOM   1813 C CE1 . TYR A 1 235 ? 23.545 -6.959 5.571   1.00 38.63  ? 322 TYR A CE1 1 
ATOM   1814 C CE2 . TYR A 1 235 ? 22.886 -5.349 7.251   1.00 34.77  ? 322 TYR A CE2 1 
ATOM   1815 C CZ  . TYR A 1 235 ? 22.599 -6.476 6.487   1.00 35.02  ? 322 TYR A CZ  1 
ATOM   1816 O OH  . TYR A 1 235 ? 21.403 -7.114 6.617   1.00 33.04  ? 322 TYR A OH  1 
ATOM   1817 N N   . ILE A 1 236 ? 29.330 -3.715 6.409   1.00 33.61  ? 323 ILE A N   1 
ATOM   1818 C CA  . ILE A 1 236 ? 30.501 -3.136 5.819   1.00 37.73  ? 323 ILE A CA  1 
ATOM   1819 C C   . ILE A 1 236 ? 31.782 -3.629 6.438   1.00 42.74  ? 323 ILE A C   1 
ATOM   1820 O O   . ILE A 1 236 ? 32.800 -2.990 6.227   1.00 42.36  ? 323 ILE A O   1 
ATOM   1821 C CB  . ILE A 1 236 ? 30.464 -1.647 5.798   1.00 36.02  ? 323 ILE A CB  1 
ATOM   1822 C CG1 . ILE A 1 236 ? 30.637 -1.122 7.199   1.00 33.79  ? 323 ILE A CG1 1 
ATOM   1823 C CG2 . ILE A 1 236 ? 29.096 -1.228 5.321   1.00 40.34  ? 323 ILE A CG2 1 
ATOM   1824 C CD1 . ILE A 1 236 ? 30.773 0.377  7.133   1.00 34.78  ? 323 ILE A CD1 1 
ATOM   1825 N N   . GLN A 1 237 ? 31.688 -4.717 7.191   1.00 45.33  ? 324 GLN A N   1 
ATOM   1826 C CA  . GLN A 1 237 ? 32.816 -5.351 7.865   1.00 45.00  ? 324 GLN A CA  1 
ATOM   1827 C C   . GLN A 1 237 ? 33.841 -4.390 8.370   1.00 41.36  ? 324 GLN A C   1 
ATOM   1828 O O   . GLN A 1 237 ? 34.883 -4.176 7.776   1.00 41.58  ? 324 GLN A O   1 
ATOM   1829 C CB  . GLN A 1 237 ? 33.431 -6.410 6.960   1.00 45.12  ? 324 GLN A CB  1 
ATOM   1830 C CG  . GLN A 1 237 ? 33.728 -5.838 5.575   1.00 48.16  ? 324 GLN A CG  1 
ATOM   1831 C CD  . GLN A 1 237 ? 33.882 -6.921 4.544   1.00 51.70  ? 324 GLN A CD  1 
ATOM   1832 O OE1 . GLN A 1 237 ? 34.435 -6.684 3.465   1.00 56.67  ? 324 GLN A OE1 1 
ATOM   1833 N NE2 . GLN A 1 237 ? 33.268 -8.062 4.812   1.00 48.29  ? 324 GLN A NE2 1 
ATOM   1834 N N   . TRP A 1 238 ? 33.501 -3.849 9.509   1.00 37.10  ? 325 TRP A N   1 
ATOM   1835 C CA  . TRP A 1 238 ? 34.296 -2.885 10.210  1.00 38.28  ? 325 TRP A CA  1 
ATOM   1836 C C   . TRP A 1 238 ? 34.004 -3.241 11.658  1.00 35.06  ? 325 TRP A C   1 
ATOM   1837 O O   . TRP A 1 238 ? 32.845 -3.593 11.999  1.00 37.42  ? 325 TRP A O   1 
ATOM   1838 C CB  . TRP A 1 238 ? 33.678 -1.486 9.883   1.00 44.87  ? 325 TRP A CB  1 
ATOM   1839 C CG  . TRP A 1 238 ? 34.544 -0.332 9.392   1.00 51.16  ? 325 TRP A CG  1 
ATOM   1840 C CD1 . TRP A 1 238 ? 35.659 -0.446 8.636   1.00 53.55  ? 325 TRP A CD1 1 
ATOM   1841 C CD2 . TRP A 1 238 ? 34.336 1.095  9.554   1.00 53.91  ? 325 TRP A CD2 1 
ATOM   1842 N NE1 . TRP A 1 238 ? 36.178 0.784  8.320   1.00 52.73  ? 325 TRP A NE1 1 
ATOM   1843 C CE2 . TRP A 1 238 ? 35.382 1.750  8.864   1.00 55.34  ? 325 TRP A CE2 1 
ATOM   1844 C CE3 . TRP A 1 238 ? 33.374 1.882  10.195  1.00 52.49  ? 325 TRP A CE3 1 
ATOM   1845 C CZ2 . TRP A 1 238 ? 35.485 3.148  8.827   1.00 56.44  ? 325 TRP A CZ2 1 
ATOM   1846 C CZ3 . TRP A 1 238 ? 33.478 3.255  10.153  1.00 53.07  ? 325 TRP A CZ3 1 
ATOM   1847 C CH2 . TRP A 1 238 ? 34.521 3.886  9.479   1.00 55.46  ? 325 TRP A CH2 1 
ATOM   1848 N N   . ARG A 1 239 ? 35.047 -3.175 12.506  1.00 29.90  ? 326 ARG A N   1 
ATOM   1849 C CA  . ARG A 1 239 ? 34.859 -3.460 13.905  1.00 25.09  ? 326 ARG A CA  1 
ATOM   1850 C C   . ARG A 1 239 ? 33.787 -2.488 14.362  1.00 31.90  ? 326 ARG A C   1 
ATOM   1851 O O   . ARG A 1 239 ? 33.623 -1.405 13.766  1.00 32.32  ? 326 ARG A O   1 
ATOM   1852 C CB  . ARG A 1 239 ? 36.145 -3.371 14.715  1.00 19.37  ? 326 ARG A CB  1 
ATOM   1853 N N   . TYR A 1 240 ? 33.050 -2.938 15.371  1.00 28.22  ? 327 TYR A N   1 
ATOM   1854 C CA  . TYR A 1 240 ? 31.969 -2.225 15.981  1.00 27.21  ? 327 TYR A CA  1 
ATOM   1855 C C   . TYR A 1 240 ? 32.430 -1.074 16.872  1.00 34.47  ? 327 TYR A C   1 
ATOM   1856 O O   . TYR A 1 240 ? 33.085 -1.287 17.888  1.00 41.14  ? 327 TYR A O   1 
ATOM   1857 C CB  . TYR A 1 240 ? 30.958 -3.183 16.673  1.00 27.94  ? 327 TYR A CB  1 
ATOM   1858 C CG  . TYR A 1 240 ? 29.955 -2.339 17.362  1.00 27.32  ? 327 TYR A CG  1 
ATOM   1859 C CD1 . TYR A 1 240 ? 28.893 -1.785 16.623  1.00 31.69  ? 327 TYR A CD1 1 
ATOM   1860 C CD2 . TYR A 1 240 ? 30.072 -2.007 18.707  1.00 29.29  ? 327 TYR A CD2 1 
ATOM   1861 C CE1 . TYR A 1 240 ? 27.949 -0.928 17.251  1.00 32.32  ? 327 TYR A CE1 1 
ATOM   1862 C CE2 . TYR A 1 240 ? 29.165 -1.187 19.321  1.00 30.71  ? 327 TYR A CE2 1 
ATOM   1863 C CZ  . TYR A 1 240 ? 28.111 -0.644 18.615  1.00 32.71  ? 327 TYR A CZ  1 
ATOM   1864 O OH  . TYR A 1 240 ? 27.199 0.180  19.225  1.00 39.07  ? 327 TYR A OH  1 
ATOM   1865 N N   . ARG A 1 241 ? 32.124 0.167  16.507  1.00 38.04  ? 328 ARG A N   1 
ATOM   1866 C CA  . ARG A 1 241 ? 32.557 1.287  17.346  1.00 39.31  ? 328 ARG A CA  1 
ATOM   1867 C C   . ARG A 1 241 ? 31.476 1.751  18.284  1.00 37.74  ? 328 ARG A C   1 
ATOM   1868 O O   . ARG A 1 241 ? 30.392 2.183  17.852  1.00 41.17  ? 328 ARG A O   1 
ATOM   1869 C CB  . ARG A 1 241 ? 32.990 2.526  16.584  1.00 46.54  ? 328 ARG A CB  1 
ATOM   1870 C CG  . ARG A 1 241 ? 34.362 2.554  15.934  1.00 54.83  ? 328 ARG A CG  1 
ATOM   1871 C CD  . ARG A 1 241 ? 34.247 3.573  14.832  1.00 58.78  ? 328 ARG A CD  1 
ATOM   1872 N NE  . ARG A 1 241 ? 35.388 3.718  13.974  1.00 59.02  ? 328 ARG A NE  1 
ATOM   1873 C CZ  . ARG A 1 241 ? 36.127 4.776  14.091  1.00 59.23  ? 328 ARG A CZ  1 
ATOM   1874 N NH1 . ARG A 1 241 ? 35.804 5.690  14.999  1.00 56.89  ? 328 ARG A NH1 1 
ATOM   1875 N NH2 . ARG A 1 241 ? 37.194 4.941  13.303  1.00 61.60  ? 328 ARG A NH2 1 
ATOM   1876 N N   . GLU A 1 242 ? 31.773 1.683  19.560  1.00 34.52  ? 329 GLU A N   1 
ATOM   1877 C CA  . GLU A 1 242 ? 30.839 2.139  20.533  1.00 42.47  ? 329 GLU A CA  1 
ATOM   1878 C C   . GLU A 1 242 ? 30.804 3.616  20.381  1.00 44.63  ? 329 GLU A C   1 
ATOM   1879 O O   . GLU A 1 242 ? 31.840 4.196  20.140  1.00 51.53  ? 329 GLU A O   1 
ATOM   1880 C CB  . GLU A 1 242 ? 31.398 1.898  21.904  1.00 50.76  ? 329 GLU A CB  1 
ATOM   1881 C CG  . GLU A 1 242 ? 31.421 0.420  22.218  1.00 61.55  ? 329 GLU A CG  1 
ATOM   1882 C CD  . GLU A 1 242 ? 32.322 0.232  23.355  1.00 70.91  ? 329 GLU A CD  1 
ATOM   1883 O OE1 . GLU A 1 242 ? 33.387 0.986  23.241  1.00 74.89  ? 329 GLU A OE1 1 
ATOM   1884 O OE2 . GLU A 1 242 ? 32.020 -0.421 24.325  1.00 75.97  ? 329 GLU A OE2 1 
ATOM   1885 N N   . PRO A 1 243 ? 29.646 4.206  20.536  1.00 39.88  ? 330 PRO A N   1 
ATOM   1886 C CA  . PRO A 1 243 ? 29.435 5.646  20.399  1.00 37.20  ? 330 PRO A CA  1 
ATOM   1887 C C   . PRO A 1 243 ? 30.536 6.552  20.944  1.00 33.22  ? 330 PRO A C   1 
ATOM   1888 O O   . PRO A 1 243 ? 30.744 7.658  20.465  1.00 32.70  ? 330 PRO A O   1 
ATOM   1889 C CB  . PRO A 1 243 ? 28.141 5.942  21.169  1.00 34.01  ? 330 PRO A CB  1 
ATOM   1890 C CG  . PRO A 1 243 ? 27.674 4.646  21.825  1.00 33.26  ? 330 PRO A CG  1 
ATOM   1891 C CD  . PRO A 1 243 ? 28.660 3.564  21.431  1.00 35.65  ? 330 PRO A CD  1 
ATOM   1892 N N   . LYS A 1 244 ? 31.252 6.104  21.951  1.00 34.35  ? 331 LYS A N   1 
ATOM   1893 C CA  . LYS A 1 244 ? 32.270 6.982  22.469  1.00 32.98  ? 331 LYS A CA  1 
ATOM   1894 C C   . LYS A 1 244 ? 33.443 7.151  21.552  1.00 34.52  ? 331 LYS A C   1 
ATOM   1895 O O   . LYS A 1 244 ? 34.065 8.200  21.522  1.00 37.69  ? 331 LYS A O   1 
ATOM   1896 C CB  . LYS A 1 244 ? 32.685 6.605  23.873  1.00 38.10  ? 331 LYS A CB  1 
ATOM   1897 C CG  . LYS A 1 244 ? 33.757 5.539  23.878  1.00 45.11  ? 331 LYS A CG  1 
ATOM   1898 C CD  . LYS A 1 244 ? 33.688 4.669  25.124  1.00 48.29  ? 331 LYS A CD  1 
ATOM   1899 C CE  . LYS A 1 244 ? 34.943 3.819  25.350  1.00 49.93  ? 331 LYS A CE  1 
ATOM   1900 N NZ  . LYS A 1 244 ? 35.549 3.248  24.132  1.00 50.20  ? 331 LYS A NZ  1 
ATOM   1901 N N   . ASP A 1 245 ? 33.745 6.104  20.823  1.00 36.18  ? 332 ASP A N   1 
ATOM   1902 C CA  . ASP A 1 245 ? 34.840 6.121  19.886  1.00 38.51  ? 332 ASP A CA  1 
ATOM   1903 C C   . ASP A 1 245 ? 34.370 6.670  18.552  1.00 40.16  ? 332 ASP A C   1 
ATOM   1904 O O   . ASP A 1 245 ? 35.029 6.554  17.517  1.00 45.31  ? 332 ASP A O   1 
ATOM   1905 C CB  . ASP A 1 245 ? 35.418 4.698  19.788  1.00 44.44  ? 332 ASP A CB  1 
ATOM   1906 C CG  . ASP A 1 245 ? 35.565 4.082  21.162  1.00 48.52  ? 332 ASP A CG  1 
ATOM   1907 O OD1 . ASP A 1 245 ? 36.213 4.830  22.012  1.00 45.93  ? 332 ASP A OD1 1 
ATOM   1908 O OD2 . ASP A 1 245 ? 35.098 2.993  21.442  1.00 51.83  ? 332 ASP A OD2 1 
ATOM   1909 N N   . ARG A 1 246 ? 33.178 7.282  18.579  1.00 41.17  ? 333 ARG A N   1 
ATOM   1910 C CA  . ARG A 1 246 ? 32.582 7.851  17.371  1.00 43.48  ? 333 ARG A CA  1 
ATOM   1911 C C   . ARG A 1 246 ? 32.910 9.294  17.066  1.00 45.59  ? 333 ARG A C   1 
ATOM   1912 O O   . ARG A 1 246 ? 32.186 9.906  16.303  1.00 51.05  ? 333 ARG A O   1 
ATOM   1913 C CB  . ARG A 1 246 ? 31.099 7.569  17.219  1.00 39.01  ? 333 ARG A CB  1 
ATOM   1914 C CG  . ARG A 1 246 ? 30.845 6.091  17.332  1.00 37.68  ? 333 ARG A CG  1 
ATOM   1915 C CD  . ARG A 1 246 ? 29.459 5.691  16.921  1.00 36.76  ? 333 ARG A CD  1 
ATOM   1916 N NE  . ARG A 1 246 ? 29.144 4.377  17.438  1.00 34.68  ? 333 ARG A NE  1 
ATOM   1917 C CZ  . ARG A 1 246 ? 27.934 3.834  17.402  1.00 26.51  ? 333 ARG A CZ  1 
ATOM   1918 N NH1 . ARG A 1 246 ? 26.892 4.450  16.890  1.00 27.00  ? 333 ARG A NH1 1 
ATOM   1919 N NH2 . ARG A 1 246 ? 27.769 2.634  17.909  1.00 24.36  ? 333 ARG A NH2 1 
ATOM   1920 N N   . SER A 1 247 ? 33.966 9.841  17.636  1.00 43.95  ? 334 SER A N   1 
ATOM   1921 C CA  . SER A 1 247 ? 34.317 11.237 17.383  1.00 47.80  ? 334 SER A CA  1 
ATOM   1922 C C   . SER A 1 247 ? 34.569 11.618 15.942  1.00 44.15  ? 334 SER A C   1 
ATOM   1923 O O   . SER A 1 247 ? 34.185 12.720 15.550  1.00 45.47  ? 334 SER A O   1 
ATOM   1924 C CB  . SER A 1 247 ? 35.434 11.691 18.266  1.00 55.55  ? 334 SER A CB  1 
ATOM   1925 O OG  . SER A 1 247 ? 35.112 11.227 19.558  1.00 61.27  ? 334 SER A OG  1 
ATOM   1926 N N   . GLU A 1 248 ? 35.188 10.702 15.201  1.00 43.69  ? 335 GLU A N   1 
ATOM   1927 C CA  . GLU A 1 248 ? 35.523 10.835 13.802  1.00 48.52  ? 335 GLU A CA  1 
ATOM   1928 C C   . GLU A 1 248 ? 35.669 9.418  13.282  1.00 44.54  ? 335 GLU A C   1 
ATOM   1929 O O   . GLU A 1 248 ? 35.208 9.115  12.163  1.00 42.37  ? 335 GLU A O   1 
ATOM   1930 C CB  . GLU A 1 248 ? 36.835 11.608 13.565  1.00 57.63  ? 335 GLU A CB  1 
ATOM   1931 C CG  . GLU A 1 248 ? 38.074 10.729 13.830  1.00 69.81  ? 335 GLU A CG  1 
ATOM   1932 C CD  . GLU A 1 248 ? 39.378 11.376 13.440  1.00 79.49  ? 335 GLU A CD  1 
ATOM   1933 O OE1 . GLU A 1 248 ? 39.552 11.478 12.150  1.00 82.92  ? 335 GLU A OE1 1 
ATOM   1934 O OE2 . GLU A 1 248 ? 40.265 11.587 14.235  1.00 83.29  ? 335 GLU A OE2 1 
ATOM   1935 O OXT . GLU A 1 248 ? 36.161 8.575  14.060  1.00 45.22  ? 335 GLU A OXT 1 
HETATM 1936 O O   . HOH B 2 .   ? 20.262 13.892 22.950  1.00 36.44  ? 401 HOH A O   1 
HETATM 1937 O O   . HOH B 2 .   ? 18.614 24.524 28.461  1.00 36.95  ? 402 HOH A O   1 
HETATM 1938 O O   . HOH B 2 .   ? 22.700 5.777  9.717   1.00 17.03  ? 403 HOH A O   1 
HETATM 1939 O O   . HOH B 2 .   ? 15.294 20.615 34.005  1.00 16.61  ? 404 HOH A O   1 
HETATM 1940 O O   . HOH B 2 .   ? 31.088 -5.849 12.768  1.00 33.51  ? 405 HOH A O   1 
HETATM 1941 O O   . HOH B 2 .   ? 9.388  0.040  26.410  1.00 33.63  ? 406 HOH A O   1 
HETATM 1942 O O   . HOH B 2 .   ? 10.401 -4.844 21.247  1.00 34.60  ? 407 HOH A O   1 
HETATM 1943 O O   . HOH B 2 .   ? 1.852  22.171 15.913  1.00 38.14  ? 408 HOH A O   1 
HETATM 1944 O O   . HOH B 2 .   ? 20.958 16.023 21.356  1.00 51.39  ? 409 HOH A O   1 
HETATM 1945 O O   . HOH B 2 .   ? 25.007 7.714  8.739   1.00 57.19  ? 410 HOH A O   1 
HETATM 1946 O O   . HOH B 2 .   ? 17.585 23.287 26.068  1.00 30.24  ? 411 HOH A O   1 
HETATM 1947 O O   . HOH B 2 .   ? 18.546 -0.689 5.462   1.00 28.95  ? 412 HOH A O   1 
HETATM 1948 O O   . HOH B 2 .   ? 25.427 15.312 27.965  1.00 28.80  ? 413 HOH A O   1 
HETATM 1949 O O   . HOH B 2 .   ? 26.823 7.585  15.450  1.00 27.34  ? 414 HOH A O   1 
HETATM 1950 O O   . HOH B 2 .   ? 17.685 19.519 33.592  1.00 37.44  ? 415 HOH A O   1 
HETATM 1951 O O   . HOH B 2 .   ? 17.925 2.672  25.102  1.00 35.37  ? 416 HOH A O   1 
HETATM 1952 O O   . HOH B 2 .   ? 1.846  24.298 24.906  1.00 53.10  ? 417 HOH A O   1 
HETATM 1953 O O   . HOH B 2 .   ? 17.334 0.367  7.848   1.00 29.01  ? 418 HOH A O   1 
HETATM 1954 O O   . HOH B 2 .   ? 32.620 -6.186 15.968  1.00 41.57  ? 419 HOH A O   1 
HETATM 1955 O O   . HOH B 2 .   ? 20.448 34.489 27.790  1.00 36.49  ? 420 HOH A O   1 
HETATM 1956 O O   . HOH B 2 .   ? 15.804 30.489 14.848  1.00 53.11  ? 421 HOH A O   1 
HETATM 1957 O O   . HOH B 2 .   ? 21.440 24.646 24.607  1.00 61.16  ? 422 HOH A O   1 
HETATM 1958 O O   . HOH B 2 .   ? 1.996  19.336 31.886  1.00 48.58  ? 423 HOH A O   1 
HETATM 1959 O O   . HOH B 2 .   ? 18.728 5.544  25.643  1.00 42.55  ? 424 HOH A O   1 
HETATM 1960 O O   . HOH B 2 .   ? 24.889 -8.951 11.940  1.00 41.61  ? 425 HOH A O   1 
HETATM 1961 O O   . HOH B 2 .   ? 2.806  20.843 26.003  1.00 51.01  ? 426 HOH A O   1 
HETATM 1962 O O   . HOH B 2 .   ? 13.170 1.708  25.456  1.00 41.05  ? 427 HOH A O   1 
HETATM 1963 O O   . HOH B 2 .   ? 17.221 0.651  10.104  1.00 29.90  ? 428 HOH A O   1 
HETATM 1964 O O   . HOH B 2 .   ? 30.332 4.397  23.697  1.00 54.52  ? 429 HOH A O   1 
HETATM 1965 O O   . HOH B 2 .   ? 35.500 0.707  14.100  1.00 37.79  ? 430 HOH A O   1 
HETATM 1966 O O   . HOH B 2 .   ? 15.753 -1.013 11.571  1.00 33.28  ? 433 HOH A O   1 
HETATM 1967 O O   . HOH B 2 .   ? 1.994  33.597 19.770  1.00 46.53  ? 434 HOH A O   1 
HETATM 1968 O O   . HOH B 2 .   ? 14.079 30.528 21.464  1.00 42.89  ? 435 HOH A O   1 
HETATM 1969 O O   . HOH B 2 .   ? 15.498 -3.288 8.544   1.00 32.24  ? 436 HOH A O   1 
HETATM 1970 O O   . HOH B 2 .   ? 0.322  29.326 15.904  1.00 41.36  ? 437 HOH A O   1 
HETATM 1971 O O   . HOH B 2 .   ? -0.792 3.851  20.428  1.00 48.89  ? 438 HOH A O   1 
HETATM 1972 O O   . HOH B 2 .   ? 15.327 38.827 30.235  1.00 95.99  ? 439 HOH A O   1 
HETATM 1973 O O   . HOH B 2 .   ? 32.408 16.712 26.700  1.00 46.07  ? 440 HOH A O   1 
HETATM 1974 O O   . HOH B 2 .   ? -0.002 -0.003 17.048  0.5  72.70  ? 441 HOH A O   1 
HETATM 1975 O O   . HOH B 2 .   ? 2.123  25.481 27.152  1.00 53.24  ? 442 HOH A O   1 
HETATM 1976 O O   . HOH B 2 .   ? 20.798 6.681  24.509  1.00 44.58  ? 443 HOH A O   1 
HETATM 1977 O O   . HOH B 2 .   ? 1.174  2.625  22.711  1.00 38.53  ? 444 HOH A O   1 
HETATM 1978 O O   . HOH B 2 .   ? 3.670  33.042 26.819  1.00 49.15  ? 445 HOH A O   1 
HETATM 1979 O O   . HOH B 2 .   ? 29.166 23.115 28.111  1.00 60.91  ? 447 HOH A O   1 
HETATM 1980 O O   . HOH B 2 .   ? -0.606 19.721 15.870  1.00 53.27  ? 448 HOH A O   1 
HETATM 1981 O O   . HOH B 2 .   ? 15.327 6.269  9.861   1.00 55.82  ? 449 HOH A O   1 
HETATM 1982 O O   . HOH B 2 .   ? -0.188 34.860 25.959  1.00 63.70  ? 450 HOH A O   1 
HETATM 1983 O O   . HOH B 2 .   ? 31.687 2.027  25.777  1.00 68.45  ? 451 HOH A O   1 
HETATM 1984 O O   . HOH B 2 .   ? 27.388 5.634  1.765   1.00 61.07  ? 454 HOH A O   1 
HETATM 1985 O O   . HOH B 2 .   ? 14.054 27.983 36.459  1.00 71.41  ? 455 HOH A O   1 
HETATM 1986 O O   . HOH B 2 .   ? 6.728  18.076 15.117  1.00 37.22  ? 456 HOH A O   1 
HETATM 1987 O O   . HOH B 2 .   ? 13.428 -4.863 1.750   1.00 77.80  ? 457 HOH A O   1 
HETATM 1988 O O   . HOH B 2 .   ? 22.365 38.665 19.033  1.00 70.23  ? 458 HOH A O   1 
HETATM 1989 O O   . HOH B 2 .   ? 16.524 1.274  -2.598  1.00 57.83  ? 459 HOH A O   1 
HETATM 1990 O O   . HOH B 2 .   ? 34.073 1.234  20.372  1.00 67.26  ? 460 HOH A O   1 
HETATM 1991 O O   . HOH B 2 .   ? 24.908 19.457 21.925  1.00 59.77  ? 461 HOH A O   1 
HETATM 1992 O O   . HOH B 2 .   ? 39.322 0.881  8.067   1.00 50.04  ? 462 HOH A O   1 
HETATM 1993 O O   . HOH B 2 .   ? 26.047 8.786  27.653  1.00 62.90  ? 463 HOH A O   1 
HETATM 1994 O O   . HOH B 2 .   ? -2.111 4.918  28.177  1.00 36.27  ? 464 HOH A O   1 
HETATM 1995 O O   . HOH B 2 .   ? 17.106 31.293 23.671  1.00 26.94  ? 465 HOH A O   1 
HETATM 1996 O O   . HOH B 2 .   ? 21.743 -1.437 17.850  1.00 54.68  ? 466 HOH A O   1 
HETATM 1997 O O   . HOH B 2 .   ? 38.623 7.128  13.962  1.00 56.50  ? 467 HOH A O   1 
HETATM 1998 O O   . HOH B 2 .   ? 0.061  31.706 20.766  0.5  100.00 ? 468 HOH A O   1 
HETATM 1999 O O   . HOH B 2 .   ? 24.526 13.155 13.338  1.00 72.06  ? 469 HOH A O   1 
HETATM 2000 O O   . HOH B 2 .   ? 36.987 6.110  10.985  1.00 88.27  ? 470 HOH A O   1 
HETATM 2001 O O   . HOH B 2 .   ? 4.417  34.067 13.452  1.00 59.12  ? 471 HOH A O   1 
HETATM 2002 O O   . HOH B 2 .   ? 6.306  34.472 25.289  1.00 64.41  ? 472 HOH A O   1 
HETATM 2003 O O   . HOH B 2 .   ? -2.797 6.603  15.223  1.00 42.99  ? 473 HOH A O   1 
HETATM 2004 O O   . HOH B 2 .   ? 25.482 14.063 16.209  1.00 61.57  ? 474 HOH A O   1 
HETATM 2005 O O   . HOH B 2 .   ? -3.466 2.537  29.628  1.00 91.38  ? 476 HOH A O   1 
HETATM 2006 O O   . HOH B 2 .   ? -0.220 -0.056 22.844  1.00 84.42  ? 477 HOH A O   1 
HETATM 2007 O O   . HOH B 2 .   ? 8.450  5.290  4.824   1.00 72.08  ? 478 HOH A O   1 
HETATM 2008 O O   . HOH B 2 .   ? 37.444 2.265  6.341   1.00 66.32  ? 479 HOH A O   1 
HETATM 2009 O O   . HOH B 2 .   ? 3.221  -5.308 25.421  1.00 58.98  ? 481 HOH A O   1 
HETATM 2010 O O   . HOH B 2 .   ? 14.306 -8.296 11.040  1.00 87.16  ? 482 HOH A O   1 
HETATM 2011 O O   . HOH B 2 .   ? 7.035  25.468 33.055  1.00 57.68  ? 483 HOH A O   1 
HETATM 2012 O O   . HOH B 2 .   ? -0.931 7.840  27.589  1.00 77.20  ? 484 HOH A O   1 
HETATM 2013 O O   . HOH B 2 .   ? -2.677 16.429 27.464  1.00 65.00  ? 485 HOH A O   1 
HETATM 2014 O O   . HOH B 2 .   ? 6.557  -7.951 26.669  1.00 53.49  ? 486 HOH A O   1 
HETATM 2015 O O   . HOH B 2 .   ? 3.387  -7.338 23.690  1.00 58.52  ? 487 HOH A O   1 
HETATM 2016 O O   . HOH B 2 .   ? 23.939 -7.555 17.497  1.00 75.50  ? 488 HOH A O   1 
HETATM 2017 O O   . HOH B 2 .   ? 16.354 5.225  1.588   1.00 83.87  ? 489 HOH A O   1 
HETATM 2018 O O   . HOH B 2 .   ? 8.090  28.916 13.649  1.00 50.30  ? 490 HOH A O   1 
HETATM 2019 O O   . HOH B 2 .   ? 5.330  14.342 38.312  1.00 68.34  ? 491 HOH A O   1 
HETATM 2020 O O   . HOH B 2 .   ? 24.183 16.437 20.433  1.00 46.44  ? 492 HOH A O   1 
HETATM 2021 O O   . HOH B 2 .   ? 13.268 -5.776 31.542  1.00 86.15  ? 494 HOH A O   1 
HETATM 2022 O O   . HOH B 2 .   ? 7.400  20.523 36.739  1.00 92.17  ? 496 HOH A O   1 
HETATM 2023 O O   . HOH B 2 .   ? 23.264 6.252  26.606  1.00 65.10  ? 497 HOH A O   1 
HETATM 2024 O O   . HOH B 2 .   ? 15.534 13.612 4.526   1.00 63.19  ? 498 HOH A O   1 
HETATM 2025 O O   . HOH B 2 .   ? 32.159 11.819 19.405  1.00 67.38  ? 499 HOH A O   1 
HETATM 2026 O O   . HOH B 2 .   ? 23.548 15.593 22.645  1.00 39.97  ? 501 HOH A O   1 
HETATM 2027 O O   . HOH B 2 .   ? 0.181  -0.991 30.250  1.00 87.62  ? 502 HOH A O   1 
HETATM 2028 O O   . HOH B 2 .   ? 12.458 28.384 34.125  1.00 62.54  ? 503 HOH A O   1 
HETATM 2029 O O   . HOH B 2 .   ? 12.401 0.682  5.312   1.00 61.82  ? 504 HOH A O   1 
HETATM 2030 O O   . HOH B 2 .   ? 8.828  17.670 36.304  1.00 61.17  ? 505 HOH A O   1 
HETATM 2031 O O   . HOH B 2 .   ? 16.260 1.315  26.460  1.00 45.72  ? 506 HOH A O   1 
HETATM 2032 O O   . HOH B 2 .   ? 8.479  20.466 39.681  1.00 64.79  ? 507 HOH A O   1 
HETATM 2033 O O   . HOH B 2 .   ? 15.104 24.055 18.291  1.00 55.74  ? 508 HOH A O   1 
HETATM 2034 O O   . HOH B 2 .   ? 31.266 10.400 3.344   1.00 67.05  ? 509 HOH A O   1 
HETATM 2035 O O   . HOH B 2 .   ? 3.735  7.395  35.678  1.00 55.96  ? 510 HOH A O   1 
HETATM 2036 O O   . HOH B 2 .   ? 24.088 -8.872 14.873  1.00 75.09  ? 511 HOH A O   1 
HETATM 2037 O O   . HOH B 2 .   ? 12.440 22.287 38.672  1.00 36.52  ? 512 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ILE 1   88  ?   ?   ?   A . n 
A 1 2   ARG 2   89  ?   ?   ?   A . n 
A 1 3   GLN 3   90  ?   ?   ?   A . n 
A 1 4   ASP 4   91  91  ASP ASP A . n 
A 1 5   ASP 5   92  92  ASP ASP A . n 
A 1 6   THR 6   93  93  THR THR A . n 
A 1 7   SER 7   94  94  SER SER A . n 
A 1 8   SER 8   95  95  SER SER A . n 
A 1 9   SER 9   96  96  SER SER A . n 
A 1 10  ILE 10  97  97  ILE ILE A . n 
A 1 11  ASN 11  98  98  ASN ASN A . n 
A 1 12  PHE 12  99  99  PHE PHE A . n 
A 1 13  LEU 13  100 100 LEU LEU A . n 
A 1 14  THR 14  101 101 THR THR A . n 
A 1 15  ARG 15  102 102 ARG ARG A . n 
A 1 16  VAL 16  103 103 VAL VAL A . n 
A 1 17  THR 17  104 104 THR THR A . n 
A 1 18  GLY 18  105 105 GLY GLY A . n 
A 1 19  ILE 19  106 106 ILE ILE A . n 
A 1 20  GLY 20  107 107 GLY GLY A . n 
A 1 21  PRO 21  108 108 PRO PRO A . n 
A 1 22  SER 22  109 109 SER SER A . n 
A 1 23  ALA 23  110 110 ALA ALA A . n 
A 1 24  ALA 24  111 111 ALA ALA A . n 
A 1 25  ARG 25  112 112 ARG ARG A . n 
A 1 26  LYS 26  113 113 LYS LYS A . n 
A 1 27  LEU 27  114 114 LEU LEU A . n 
A 1 28  VAL 28  115 115 VAL VAL A . n 
A 1 29  ASP 29  116 116 ASP ASP A . n 
A 1 30  GLU 30  117 117 GLU GLU A . n 
A 1 31  GLY 31  118 118 GLY GLY A . n 
A 1 32  ILE 32  119 119 ILE ILE A . n 
A 1 33  LYS 33  120 120 LYS LYS A . n 
A 1 34  THR 34  121 121 THR THR A . n 
A 1 35  LEU 35  122 122 LEU LEU A . n 
A 1 36  GLU 36  123 123 GLU GLU A . n 
A 1 37  ASP 37  124 124 ASP ASP A . n 
A 1 38  LEU 38  125 125 LEU LEU A . n 
A 1 39  ARG 39  126 126 ARG ARG A . n 
A 1 40  LYS 40  127 127 LYS LYS A . n 
A 1 41  ASN 41  128 128 ASN ASN A . n 
A 1 42  GLU 42  129 129 GLU GLU A . n 
A 1 43  ASP 43  130 130 ASP ASP A . n 
A 1 44  LYS 44  131 131 LYS LYS A . n 
A 1 45  LEU 45  132 132 LEU LEU A . n 
A 1 46  ASN 46  133 133 ASN ASN A . n 
A 1 47  HIS 47  134 134 HIS HIS A . n 
A 1 48  HIS 48  135 135 HIS HIS A . n 
A 1 49  GLN 49  136 136 GLN GLN A . n 
A 1 50  ARG 50  137 137 ARG ARG A . n 
A 1 51  ILE 51  138 138 ILE ILE A . n 
A 1 52  GLY 52  139 139 GLY GLY A . n 
A 1 53  LEU 53  140 140 LEU LEU A . n 
A 1 54  LYS 54  141 141 LYS LYS A . n 
A 1 55  TYR 55  142 142 TYR TYR A . n 
A 1 56  PHE 56  143 143 PHE PHE A . n 
A 1 57  GLU 57  144 144 GLU GLU A . n 
A 1 58  ASP 58  145 145 ASP ASP A . n 
A 1 59  PHE 59  146 146 PHE PHE A . n 
A 1 60  GLU 60  147 147 GLU GLU A . n 
A 1 61  LYS 61  148 148 LYS LYS A . n 
A 1 62  ARG 62  149 149 ARG ARG A . n 
A 1 63  ILE 63  150 150 ILE ILE A . n 
A 1 64  PRO 64  151 151 PRO PRO A . n 
A 1 65  ARG 65  152 152 ARG ARG A . n 
A 1 66  GLU 66  153 153 GLU GLU A . n 
A 1 67  GLU 67  154 154 GLU GLU A . n 
A 1 68  MET 68  155 155 MET MET A . n 
A 1 69  LEU 69  156 156 LEU LEU A . n 
A 1 70  GLN 70  157 157 GLN GLN A . n 
A 1 71  MET 71  158 158 MET MET A . n 
A 1 72  GLN 72  159 159 GLN GLN A . n 
A 1 73  ASP 73  160 160 ASP ASP A . n 
A 1 74  ILE 74  161 161 ILE ILE A . n 
A 1 75  VAL 75  162 162 VAL VAL A . n 
A 1 76  LEU 76  163 163 LEU LEU A . n 
A 1 77  ASN 77  164 164 ASN ASN A . n 
A 1 78  GLU 78  165 165 GLU GLU A . n 
A 1 79  VAL 79  166 166 VAL VAL A . n 
A 1 80  LYS 80  167 167 LYS LYS A . n 
A 1 81  LYS 81  168 168 LYS LYS A . n 
A 1 82  LEU 82  169 169 LEU LEU A . n 
A 1 83  ASP 83  170 170 ASP ASP A . n 
A 1 84  PRO 84  171 171 PRO PRO A . n 
A 1 85  GLU 85  172 172 GLU GLU A . n 
A 1 86  TYR 86  173 173 TYR TYR A . n 
A 1 87  ILE 87  174 174 ILE ILE A . n 
A 1 88  ALA 88  175 175 ALA ALA A . n 
A 1 89  THR 89  176 176 THR THR A . n 
A 1 90  VAL 90  177 177 VAL VAL A . n 
A 1 91  CYS 91  178 178 CYS CYS A . n 
A 1 92  GLY 92  179 179 GLY GLY A . n 
A 1 93  SER 93  180 180 SER SER A . n 
A 1 94  PHE 94  181 181 PHE PHE A . n 
A 1 95  ARG 95  182 182 ARG ARG A . n 
A 1 96  ARG 96  183 183 ARG ARG A . n 
A 1 97  GLY 97  184 184 GLY GLY A . n 
A 1 98  ALA 98  185 185 ALA ALA A . n 
A 1 99  GLU 99  186 186 GLU GLU A . n 
A 1 100 SER 100 187 187 SER SER A . n 
A 1 101 SER 101 188 188 SER SER A . n 
A 1 102 GLY 102 189 189 GLY GLY A . n 
A 1 103 ASP 103 190 190 ASP ASP A . n 
A 1 104 MET 104 191 191 MET MET A . n 
A 1 105 ASP 105 192 192 ASP ASP A . n 
A 1 106 VAL 106 193 193 VAL VAL A . n 
A 1 107 LEU 107 194 194 LEU LEU A . n 
A 1 108 LEU 108 195 195 LEU LEU A . n 
A 1 109 THR 109 196 196 THR THR A . n 
A 1 110 HIS 110 197 197 HIS HIS A . n 
A 1 111 PRO 111 198 198 PRO PRO A . n 
A 1 112 ASN 112 199 199 ASN ASN A . n 
A 1 113 PHE 113 200 200 PHE PHE A . n 
A 1 114 THR 114 201 201 THR THR A . n 
A 1 115 SER 115 202 202 SER SER A . n 
A 1 116 GLU 116 203 203 GLU GLU A . n 
A 1 117 SER 117 204 204 SER SER A . n 
A 1 118 SER 118 205 205 SER SER A . n 
A 1 119 LYS 119 206 206 LYS LYS A . n 
A 1 120 GLN 120 207 207 GLN GLN A . n 
A 1 121 PRO 121 208 208 PRO PRO A . n 
A 1 122 LYS 122 209 209 LYS LYS A . n 
A 1 123 LEU 123 210 210 LEU LEU A . n 
A 1 124 LEU 124 211 211 LEU LEU A . n 
A 1 125 HIS 125 212 212 HIS HIS A . n 
A 1 126 ARG 126 213 213 ARG ARG A . n 
A 1 127 VAL 127 214 214 VAL VAL A . n 
A 1 128 VAL 128 215 215 VAL VAL A . n 
A 1 129 GLU 129 216 216 GLU GLU A . n 
A 1 130 GLN 130 217 217 GLN GLN A . n 
A 1 131 LEU 131 218 218 LEU LEU A . n 
A 1 132 GLN 132 219 219 GLN GLN A . n 
A 1 133 LYS 133 220 220 LYS LYS A . n 
A 1 134 VAL 134 221 221 VAL VAL A . n 
A 1 135 ARG 135 222 222 ARG ARG A . n 
A 1 136 PHE 136 223 223 PHE PHE A . n 
A 1 137 ILE 137 224 224 ILE ILE A . n 
A 1 138 THR 138 225 225 THR THR A . n 
A 1 139 ASP 139 226 226 ASP ASP A . n 
A 1 140 THR 140 227 227 THR THR A . n 
A 1 141 LEU 141 228 228 LEU LEU A . n 
A 1 142 SER 142 229 229 SER SER A . n 
A 1 143 LYS 143 230 230 LYS LYS A . n 
A 1 144 GLY 144 231 231 GLY GLY A . n 
A 1 145 GLU 145 232 232 GLU GLU A . n 
A 1 146 THR 146 233 233 THR THR A . n 
A 1 147 LYS 147 234 234 LYS LYS A . n 
A 1 148 PHE 148 235 235 PHE PHE A . n 
A 1 149 MET 149 236 236 MET MET A . n 
A 1 150 GLY 150 237 237 GLY GLY A . n 
A 1 151 VAL 151 238 238 VAL VAL A . n 
A 1 152 CYS 152 239 239 CYS CYS A . n 
A 1 153 GLN 153 240 240 GLN GLN A . n 
A 1 154 LEU 154 241 241 LEU LEU A . n 
A 1 155 PRO 155 242 242 PRO PRO A . n 
A 1 156 SER 156 243 243 SER SER A . n 
A 1 157 GLU 157 244 244 GLU GLU A . n 
A 1 158 ASN 158 245 245 ASN ASN A . n 
A 1 159 ASP 159 246 ?   ?   ?   A . n 
A 1 160 GLU 160 247 ?   ?   ?   A . n 
A 1 161 ASN 161 248 ?   ?   ?   A . n 
A 1 162 GLU 162 249 249 GLU GLU A . n 
A 1 163 TYR 163 250 250 TYR TYR A . n 
A 1 164 PRO 164 251 251 PRO PRO A . n 
A 1 165 HIS 165 252 252 HIS HIS A . n 
A 1 166 ARG 166 253 253 ARG ARG A . n 
A 1 167 ARG 167 254 254 ARG ARG A . n 
A 1 168 ILE 168 255 255 ILE ILE A . n 
A 1 169 ASP 169 256 256 ASP ASP A . n 
A 1 170 ILE 170 257 257 ILE ILE A . n 
A 1 171 ARG 171 258 258 ARG ARG A . n 
A 1 172 LEU 172 259 259 LEU LEU A . n 
A 1 173 ILE 173 260 260 ILE ILE A . n 
A 1 174 PRO 174 261 261 PRO PRO A . n 
A 1 175 LYS 175 262 262 LYS LYS A . n 
A 1 176 ASP 176 263 263 ASP ASP A . n 
A 1 177 GLN 177 264 264 GLN GLN A . n 
A 1 178 TYR 178 265 265 TYR TYR A . n 
A 1 179 TYR 179 266 266 TYR TYR A . n 
A 1 180 CYS 180 267 267 CYS CYS A . n 
A 1 181 GLY 181 268 268 GLY GLY A . n 
A 1 182 VAL 182 269 269 VAL VAL A . n 
A 1 183 LEU 183 270 270 LEU LEU A . n 
A 1 184 TYR 184 271 271 TYR TYR A . n 
A 1 185 PHE 185 272 272 PHE PHE A . n 
A 1 186 THR 186 273 273 THR THR A . n 
A 1 187 GLY 187 274 274 GLY GLY A . n 
A 1 188 SER 188 275 275 SER SER A . n 
A 1 189 ASP 189 276 276 ASP ASP A . n 
A 1 190 ILE 190 277 277 ILE ILE A . n 
A 1 191 PHE 191 278 278 PHE PHE A . n 
A 1 192 ASN 192 279 279 ASN ASN A . n 
A 1 193 LYS 193 280 280 LYS LYS A . n 
A 1 194 ASN 194 281 281 ASN ASN A . n 
A 1 195 MET 195 282 282 MET MET A . n 
A 1 196 ARG 196 283 283 ARG ARG A . n 
A 1 197 ALA 197 284 284 ALA ALA A . n 
A 1 198 HIS 198 285 285 HIS HIS A . n 
A 1 199 ALA 199 286 286 ALA ALA A . n 
A 1 200 LEU 200 287 287 LEU LEU A . n 
A 1 201 GLU 201 288 288 GLU GLU A . n 
A 1 202 LYS 202 289 289 LYS LYS A . n 
A 1 203 GLY 203 290 290 GLY GLY A . n 
A 1 204 PHE 204 291 291 PHE PHE A . n 
A 1 205 THR 205 292 292 THR THR A . n 
A 1 206 ILE 206 293 293 ILE ILE A . n 
A 1 207 ASN 207 294 294 ASN ASN A . n 
A 1 208 GLU 208 295 295 GLU GLU A . n 
A 1 209 TYR 209 296 296 TYR TYR A . n 
A 1 210 THR 210 297 297 THR THR A . n 
A 1 211 ILE 211 298 298 ILE ILE A . n 
A 1 212 ARG 212 299 299 ARG ARG A . n 
A 1 213 PRO 213 300 300 PRO PRO A . n 
A 1 214 LEU 214 301 301 LEU LEU A . n 
A 1 215 GLY 215 302 302 GLY GLY A . n 
A 1 216 VAL 216 303 303 VAL VAL A . n 
A 1 217 THR 217 304 304 THR THR A . n 
A 1 218 GLY 218 305 305 GLY GLY A . n 
A 1 219 VAL 219 306 306 VAL VAL A . n 
A 1 220 ALA 220 307 307 ALA ALA A . n 
A 1 221 GLY 221 308 308 GLY GLY A . n 
A 1 222 GLU 222 309 309 GLU GLU A . n 
A 1 223 PRO 223 310 310 PRO PRO A . n 
A 1 224 LEU 224 311 311 LEU LEU A . n 
A 1 225 PRO 225 312 312 PRO PRO A . n 
A 1 226 VAL 226 313 313 VAL VAL A . n 
A 1 227 ASP 227 314 314 ASP ASP A . n 
A 1 228 SER 228 315 315 SER SER A . n 
A 1 229 GLU 229 316 316 GLU GLU A . n 
A 1 230 GLN 230 317 317 GLN GLN A . n 
A 1 231 ASP 231 318 318 ASP ASP A . n 
A 1 232 ILE 232 319 319 ILE ILE A . n 
A 1 233 PHE 233 320 320 PHE PHE A . n 
A 1 234 ASP 234 321 321 ASP ASP A . n 
A 1 235 TYR 235 322 322 TYR TYR A . n 
A 1 236 ILE 236 323 323 ILE ILE A . n 
A 1 237 GLN 237 324 324 GLN GLN A . n 
A 1 238 TRP 238 325 325 TRP TRP A . n 
A 1 239 ARG 239 326 326 ARG ARG A . n 
A 1 240 TYR 240 327 327 TYR TYR A . n 
A 1 241 ARG 241 328 328 ARG ARG A . n 
A 1 242 GLU 242 329 329 GLU GLU A . n 
A 1 243 PRO 243 330 330 PRO PRO A . n 
A 1 244 LYS 244 331 331 LYS LYS A . n 
A 1 245 ASP 245 332 332 ASP ASP A . n 
A 1 246 ARG 246 333 333 ARG ARG A . n 
A 1 247 SER 247 334 334 SER SER A . n 
A 1 248 GLU 248 335 335 GLU GLU A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 441 ? B HOH . 
2 1 A HOH 468 ? B HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-11-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Atomic model'              
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
TNT  refinement       5-D      ? 1 
SDMS 'data reduction' .        ? 2 
SDMS 'data scaling'   .        ? 3 
TNT  phasing          'V. 5-D' ? 4 
# 
_pdbx_entry_details.entry_id             1ZQX 
_pdbx_entry_details.compound_details     
;PLEASE NOTE THAT THIS ENTRY IS ONLY THE 31 KD DOMAIN
(RESIDUES 88 - 335) AND THE N-TERMINAL 8 KD DOMAIN IS NOT
PRESENT IN THIS STRUCTURE.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 477 ? ? 1_555 O A HOH 477 ? ? 2_555 0.45 
2 1 O A HOH 502 ? ? 1_555 O A HOH 502 ? ? 2_555 2.01 
# 
_pdbx_validate_rmsd_bond.id                        1 
_pdbx_validate_rmsd_bond.PDB_model_num             1 
_pdbx_validate_rmsd_bond.auth_atom_id_1            CD 
_pdbx_validate_rmsd_bond.auth_asym_id_1            A 
_pdbx_validate_rmsd_bond.auth_comp_id_1            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_1             147 
_pdbx_validate_rmsd_bond.PDB_ins_code_1            ? 
_pdbx_validate_rmsd_bond.label_alt_id_1            ? 
_pdbx_validate_rmsd_bond.auth_atom_id_2            OE1 
_pdbx_validate_rmsd_bond.auth_asym_id_2            A 
_pdbx_validate_rmsd_bond.auth_comp_id_2            GLU 
_pdbx_validate_rmsd_bond.auth_seq_id_2             147 
_pdbx_validate_rmsd_bond.PDB_ins_code_2            ? 
_pdbx_validate_rmsd_bond.label_alt_id_2            ? 
_pdbx_validate_rmsd_bond.bond_value                1.320 
_pdbx_validate_rmsd_bond.bond_target_value         1.252 
_pdbx_validate_rmsd_bond.bond_deviation            0.068 
_pdbx_validate_rmsd_bond.bond_standard_deviation   0.011 
_pdbx_validate_rmsd_bond.linker_flag               N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE A ARG 112 ? ? CZ A ARG 112 ? ? NH1 A ARG 112 ? ? 123.76 120.30 3.46   0.50 N 
2  1 CB A ASP 124 ? ? CG A ASP 124 ? ? OD1 A ASP 124 ? ? 112.77 118.30 -5.53  0.90 N 
3  1 CB A ASP 130 ? ? CG A ASP 130 ? ? OD1 A ASP 130 ? ? 112.02 118.30 -6.28  0.90 N 
4  1 C  A ILE 150 ? ? N  A PRO 151 ? ? CA  A PRO 151 ? ? 128.65 119.30 9.35   1.50 Y 
5  1 CB A CYS 178 ? ? CA A CYS 178 ? ? C   A CYS 178 ? ? 122.31 111.50 10.81  1.20 N 
6  1 NE A ARG 182 ? ? CZ A ARG 182 ? ? NH1 A ARG 182 ? ? 124.22 120.30 3.92   0.50 N 
7  1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD1 A ASP 190 ? ? 124.95 118.30 6.65   0.90 N 
8  1 CB A ASP 190 ? ? CG A ASP 190 ? ? OD2 A ASP 190 ? ? 112.14 118.30 -6.16  0.90 N 
9  1 CB A ASP 192 ? ? CG A ASP 192 ? ? OD1 A ASP 192 ? ? 112.85 118.30 -5.45  0.90 N 
10 1 NE A ARG 213 ? ? CZ A ARG 213 ? ? NH1 A ARG 213 ? ? 124.93 120.30 4.63   0.50 N 
11 1 NE A ARG 213 ? ? CZ A ARG 213 ? ? NH2 A ARG 213 ? ? 117.20 120.30 -3.10  0.50 N 
12 1 CB A PHE 235 ? ? CA A PHE 235 ? ? C   A PHE 235 ? ? 98.05  110.40 -12.35 2.00 N 
13 1 NE A ARG 253 ? ? CZ A ARG 253 ? ? NH2 A ARG 253 ? ? 116.64 120.30 -3.66  0.50 N 
14 1 CB A ASP 256 ? ? CG A ASP 256 ? ? OD2 A ASP 256 ? ? 124.75 118.30 6.45   0.90 N 
15 1 NE A ARG 258 ? ? CZ A ARG 258 ? ? NH1 A ARG 258 ? ? 124.42 120.30 4.12   0.50 N 
16 1 NE A ARG 258 ? ? CZ A ARG 258 ? ? NH2 A ARG 258 ? ? 116.71 120.30 -3.59  0.50 N 
17 1 CB A ASP 263 ? ? CG A ASP 263 ? ? OD1 A ASP 263 ? ? 111.34 118.30 -6.96  0.90 N 
18 1 CB A ASP 263 ? ? CG A ASP 263 ? ? OD2 A ASP 263 ? ? 125.03 118.30 6.73   0.90 N 
19 1 CA A TYR 266 ? ? CB A TYR 266 ? ? CG  A TYR 266 ? ? 101.96 113.40 -11.44 1.90 N 
20 1 NE A ARG 299 ? A CZ A ARG 299 ? A NH1 A ARG 299 ? A 124.49 120.30 4.19   0.50 N 
21 1 CB A ASP 314 ? ? CG A ASP 314 ? ? OD1 A ASP 314 ? ? 112.63 118.30 -5.67  0.90 N 
22 1 CB A ASP 321 ? ? CG A ASP 321 ? ? OD1 A ASP 321 ? ? 112.41 118.30 -5.89  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LYS A 120 ? ? -126.82 -60.07  
2  1 THR A 121 ? ? -75.37  -161.94 
3  1 ASN A 128 ? ? -141.95 26.84   
4  1 ASP A 130 ? ? -49.95  -15.51  
5  1 GLU A 144 ? ? -54.25  -71.57  
6  1 ASP A 170 ? ? 176.45  112.27  
7  1 CYS A 178 ? ? -81.87  -140.29 
8  1 ALA A 185 ? ? -37.16  140.23  
9  1 SER A 202 ? ? -59.59  -3.20   
10 1 SER A 204 ? ? -59.30  -81.29  
11 1 SER A 205 ? ? 64.99   80.39   
12 1 LYS A 206 ? ? 157.26  42.90   
13 1 SER A 275 ? ? -69.85  -179.91 
14 1 LEU A 301 ? ? -88.66  -140.75 
15 1 THR A 304 ? ? 73.73   -18.49  
16 1 VAL A 306 ? ? -52.30  83.11   
17 1 GLU A 309 ? ? 123.88  93.39   
18 1 GLN A 324 ? ? 35.47   80.84   
19 1 PRO A 330 ? ? -38.58  -28.88  
# 
_pdbx_validate_chiral.id              1 
_pdbx_validate_chiral.PDB_model_num   1 
_pdbx_validate_chiral.auth_atom_id    CA 
_pdbx_validate_chiral.label_alt_id    ? 
_pdbx_validate_chiral.auth_asym_id    A 
_pdbx_validate_chiral.auth_comp_id    ARG 
_pdbx_validate_chiral.auth_seq_id     152 
_pdbx_validate_chiral.PDB_ins_code    ? 
_pdbx_validate_chiral.details         PLANAR 
_pdbx_validate_chiral.omega           . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASP 91  ? CG  ? A ASP 4   CG  
2  1 Y 1 A ASP 91  ? OD1 ? A ASP 4   OD1 
3  1 Y 1 A ASP 91  ? OD2 ? A ASP 4   OD2 
4  1 Y 1 A ASP 92  ? CG  ? A ASP 5   CG  
5  1 Y 1 A ASP 92  ? OD1 ? A ASP 5   OD1 
6  1 Y 1 A ASP 92  ? OD2 ? A ASP 5   OD2 
7  1 Y 1 A SER 109 ? OG  ? A SER 22  OG  
8  1 Y 1 A ILE 119 ? CG1 ? A ILE 32  CG1 
9  1 Y 1 A ILE 119 ? CG2 ? A ILE 32  CG2 
10 1 Y 1 A ILE 119 ? CD1 ? A ILE 32  CD1 
11 1 Y 1 A GLU 123 ? CG  ? A GLU 36  CG  
12 1 Y 1 A GLU 123 ? CD  ? A GLU 36  CD  
13 1 Y 1 A GLU 123 ? OE1 ? A GLU 36  OE1 
14 1 Y 1 A GLU 123 ? OE2 ? A GLU 36  OE2 
15 1 Y 1 A LYS 131 ? CG  ? A LYS 44  CG  
16 1 Y 1 A LYS 131 ? CD  ? A LYS 44  CD  
17 1 Y 1 A LYS 131 ? CE  ? A LYS 44  CE  
18 1 Y 1 A LYS 131 ? NZ  ? A LYS 44  NZ  
19 1 Y 1 A LYS 220 ? CD  ? A LYS 133 CD  
20 1 Y 1 A LYS 220 ? CE  ? A LYS 133 CE  
21 1 Y 1 A LYS 220 ? NZ  ? A LYS 133 NZ  
22 1 Y 1 A SER 243 ? OG  ? A SER 156 OG  
23 1 Y 1 A GLU 244 ? CG  ? A GLU 157 CG  
24 1 Y 1 A GLU 244 ? CD  ? A GLU 157 CD  
25 1 Y 1 A GLU 244 ? OE1 ? A GLU 157 OE1 
26 1 Y 1 A GLU 244 ? OE2 ? A GLU 157 OE2 
27 1 Y 1 A ASN 245 ? CG  ? A ASN 158 CG  
28 1 Y 1 A ASN 245 ? OD1 ? A ASN 158 OD1 
29 1 Y 1 A ASN 245 ? ND2 ? A ASN 158 ND2 
30 1 Y 1 A LYS 280 ? CG  ? A LYS 193 CG  
31 1 Y 1 A LYS 280 ? CD  ? A LYS 193 CD  
32 1 Y 1 A LYS 280 ? CE  ? A LYS 193 CE  
33 1 Y 1 A LYS 280 ? NZ  ? A LYS 193 NZ  
34 1 Y 1 A VAL 303 ? CG1 ? A VAL 216 CG1 
35 1 Y 1 A VAL 303 ? CG2 ? A VAL 216 CG2 
36 1 Y 1 A THR 304 ? OG1 ? A THR 217 OG1 
37 1 Y 1 A THR 304 ? CG2 ? A THR 217 CG2 
38 1 Y 1 A VAL 306 ? CG1 ? A VAL 219 CG1 
39 1 Y 1 A VAL 306 ? CG2 ? A VAL 219 CG2 
40 1 Y 1 A ARG 326 ? CG  ? A ARG 239 CG  
41 1 Y 1 A ARG 326 ? CD  ? A ARG 239 CD  
42 1 Y 1 A ARG 326 ? NE  ? A ARG 239 NE  
43 1 Y 1 A ARG 326 ? CZ  ? A ARG 239 CZ  
44 1 Y 1 A ARG 326 ? NH1 ? A ARG 239 NH1 
45 1 Y 1 A ARG 326 ? NH2 ? A ARG 239 NH2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A ILE 88  ? A ILE 1   
2 1 Y 1 A ARG 89  ? A ARG 2   
3 1 Y 1 A GLN 90  ? A GLN 3   
4 1 Y 1 A ASP 246 ? A ASP 159 
5 1 Y 1 A GLU 247 ? A GLU 160 
6 1 Y 1 A ASN 248 ? A ASN 161 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   401 401 HOH HOH A . 
B 2 HOH 2   402 402 HOH HOH A . 
B 2 HOH 3   403 403 HOH HOH A . 
B 2 HOH 4   404 404 HOH HOH A . 
B 2 HOH 5   405 405 HOH HOH A . 
B 2 HOH 6   406 406 HOH HOH A . 
B 2 HOH 7   407 407 HOH HOH A . 
B 2 HOH 8   408 408 HOH HOH A . 
B 2 HOH 9   409 409 HOH HOH A . 
B 2 HOH 10  410 410 HOH HOH A . 
B 2 HOH 11  411 411 HOH HOH A . 
B 2 HOH 12  412 412 HOH HOH A . 
B 2 HOH 13  413 413 HOH HOH A . 
B 2 HOH 14  414 414 HOH HOH A . 
B 2 HOH 15  415 415 HOH HOH A . 
B 2 HOH 16  416 416 HOH HOH A . 
B 2 HOH 17  417 417 HOH HOH A . 
B 2 HOH 18  418 418 HOH HOH A . 
B 2 HOH 19  419 419 HOH HOH A . 
B 2 HOH 20  420 420 HOH HOH A . 
B 2 HOH 21  421 421 HOH HOH A . 
B 2 HOH 22  422 422 HOH HOH A . 
B 2 HOH 23  423 423 HOH HOH A . 
B 2 HOH 24  424 424 HOH HOH A . 
B 2 HOH 25  425 425 HOH HOH A . 
B 2 HOH 26  426 426 HOH HOH A . 
B 2 HOH 27  427 427 HOH HOH A . 
B 2 HOH 28  428 428 HOH HOH A . 
B 2 HOH 29  429 429 HOH HOH A . 
B 2 HOH 30  430 430 HOH HOH A . 
B 2 HOH 31  433 433 HOH HOH A . 
B 2 HOH 32  434 434 HOH HOH A . 
B 2 HOH 33  435 435 HOH HOH A . 
B 2 HOH 34  436 436 HOH HOH A . 
B 2 HOH 35  437 437 HOH HOH A . 
B 2 HOH 36  438 438 HOH HOH A . 
B 2 HOH 37  439 439 HOH HOH A . 
B 2 HOH 38  440 440 HOH HOH A . 
B 2 HOH 39  441 441 HOH HOH A . 
B 2 HOH 40  442 442 HOH HOH A . 
B 2 HOH 41  443 443 HOH HOH A . 
B 2 HOH 42  444 444 HOH HOH A . 
B 2 HOH 43  445 445 HOH HOH A . 
B 2 HOH 44  447 447 HOH HOH A . 
B 2 HOH 45  448 448 HOH HOH A . 
B 2 HOH 46  449 449 HOH HOH A . 
B 2 HOH 47  450 450 HOH HOH A . 
B 2 HOH 48  451 451 HOH HOH A . 
B 2 HOH 49  454 454 HOH HOH A . 
B 2 HOH 50  455 455 HOH HOH A . 
B 2 HOH 51  456 456 HOH HOH A . 
B 2 HOH 52  457 457 HOH HOH A . 
B 2 HOH 53  458 458 HOH HOH A . 
B 2 HOH 54  459 459 HOH HOH A . 
B 2 HOH 55  460 460 HOH HOH A . 
B 2 HOH 56  461 461 HOH HOH A . 
B 2 HOH 57  462 462 HOH HOH A . 
B 2 HOH 58  463 463 HOH HOH A . 
B 2 HOH 59  464 464 HOH HOH A . 
B 2 HOH 60  465 465 HOH HOH A . 
B 2 HOH 61  466 466 HOH HOH A . 
B 2 HOH 62  467 467 HOH HOH A . 
B 2 HOH 63  468 468 HOH HOH A . 
B 2 HOH 64  469 469 HOH HOH A . 
B 2 HOH 65  470 470 HOH HOH A . 
B 2 HOH 66  471 471 HOH HOH A . 
B 2 HOH 67  472 472 HOH HOH A . 
B 2 HOH 68  473 473 HOH HOH A . 
B 2 HOH 69  474 474 HOH HOH A . 
B 2 HOH 70  476 476 HOH HOH A . 
B 2 HOH 71  477 477 HOH HOH A . 
B 2 HOH 72  478 478 HOH HOH A . 
B 2 HOH 73  479 479 HOH HOH A . 
B 2 HOH 74  481 481 HOH HOH A . 
B 2 HOH 75  482 482 HOH HOH A . 
B 2 HOH 76  483 483 HOH HOH A . 
B 2 HOH 77  484 484 HOH HOH A . 
B 2 HOH 78  485 485 HOH HOH A . 
B 2 HOH 79  486 486 HOH HOH A . 
B 2 HOH 80  487 487 HOH HOH A . 
B 2 HOH 81  488 488 HOH HOH A . 
B 2 HOH 82  489 489 HOH HOH A . 
B 2 HOH 83  490 490 HOH HOH A . 
B 2 HOH 84  491 491 HOH HOH A . 
B 2 HOH 85  492 492 HOH HOH A . 
B 2 HOH 86  494 494 HOH HOH A . 
B 2 HOH 87  496 496 HOH HOH A . 
B 2 HOH 88  497 497 HOH HOH A . 
B 2 HOH 89  498 498 HOH HOH A . 
B 2 HOH 90  499 499 HOH HOH A . 
B 2 HOH 91  501 501 HOH HOH A . 
B 2 HOH 92  502 502 HOH HOH A . 
B 2 HOH 93  503 503 HOH HOH A . 
B 2 HOH 94  504 504 HOH HOH A . 
B 2 HOH 95  505 505 HOH HOH A . 
B 2 HOH 96  506 506 HOH HOH A . 
B 2 HOH 97  507 507 HOH HOH A . 
B 2 HOH 98  508 508 HOH HOH A . 
B 2 HOH 99  509 509 HOH HOH A . 
B 2 HOH 100 510 510 HOH HOH A . 
B 2 HOH 101 511 511 HOH HOH A . 
B 2 HOH 102 512 512 HOH HOH A . 
#