data_1ZRC
# 
_entry.id   1ZRC 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZRC         
NDB   PD0670       
RCSB  RCSB033029   
WWPDB D_1000033029 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1ZRD '4 CRYSTAL STRUCTURES OF CAP-DNA WITH ALL BASE-PAIR SUBSTITUTIONS AT POSITION 6, CAP-[6A;17T]ICAP38 DNA' unspecified 
PDB 1ZRE '4 CRYSTAL STRUCTURES OF CAP-DNA WITH ALL BASE-PAIR SUBSTITUTIONS AT POSITION 6, CAP-[6G;17C]ICAP38 DNA' unspecified 
PDB 1ZRF '4 CRYSTAL STRUCTURES OF CAP-DNA WITH ALL BASE-PAIR SUBSTITUTIONS AT POSITION 6, CAP-[6C;17G]ICAP38 DNA' unspecified 
# 
_pdbx_database_status.entry_id                        1ZRC 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berman, H.M.' 1 
'Napoli, A.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            357 
_citation.page_first                173 
_citation.page_last                 183 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16427082 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.051 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Napoli, A.A.'  1 
primary 'Lawson, C.L.'  2 
primary 'Ebright, R.H.' 3 
primary 'Berman, H.M.'  4 
# 
_cell.entry_id           1ZRC 
_cell.length_a           61.550 
_cell.length_b           75.552 
_cell.length_c           180.898 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZRC 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*TP*GP*AP*T)-3'"             5249.446  2  ? ? ? ? 
2 polymer     syn "5'-D(*CP*TP*AP*GP*AP*TP*CP*AP*CP*AP*TP*TP*TP*TP*TP*CP*GP*AP*AP*AP*T)-3'" 6396.171  2  ? ? ? ? 
3 polymer     man 'Catabolite gene activator'                                               23541.242 2  ? ? ? ? 
4 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                                    329.206   2  ? ? ? ? 
5 water       nat water                                                                     18.015    39 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'cAMP receptor protein, cAMP-regulatory protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DT)(DC)(DG)(DA)(DA)(DA)(DA)(DA)(DT)(DG)(DT)(DG)(DA)(DT)' ATTTCGAAAAATGTGAT W,Y ? 
2 polydeoxyribonucleotide no no 
;(DC)(DT)(DA)(DG)(DA)(DT)(DC)(DA)(DC)(DA)(DT)(DT)(DT)(DT)(DT)(DC)(DG)(DA)(DA)(DA)
(DT)
;
CTAGATCACATTTTTCGAAAT X,Z ? 
3 'polypeptide(L)'        no no 
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DT  n 
1 4   DT  n 
1 5   DC  n 
1 6   DG  n 
1 7   DA  n 
1 8   DA  n 
1 9   DA  n 
1 10  DA  n 
1 11  DA  n 
1 12  DT  n 
1 13  DG  n 
1 14  DT  n 
1 15  DG  n 
1 16  DA  n 
1 17  DT  n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DA  n 
2 19  DA  n 
2 20  DA  n 
2 21  DT  n 
3 1   VAL n 
3 2   LEU n 
3 3   GLY n 
3 4   LYS n 
3 5   PRO n 
3 6   GLN n 
3 7   THR n 
3 8   ASP n 
3 9   PRO n 
3 10  THR n 
3 11  LEU n 
3 12  GLU n 
3 13  TRP n 
3 14  PHE n 
3 15  LEU n 
3 16  SER n 
3 17  HIS n 
3 18  CYS n 
3 19  HIS n 
3 20  ILE n 
3 21  HIS n 
3 22  LYS n 
3 23  TYR n 
3 24  PRO n 
3 25  SER n 
3 26  LYS n 
3 27  SER n 
3 28  THR n 
3 29  LEU n 
3 30  ILE n 
3 31  HIS n 
3 32  GLN n 
3 33  GLY n 
3 34  GLU n 
3 35  LYS n 
3 36  ALA n 
3 37  GLU n 
3 38  THR n 
3 39  LEU n 
3 40  TYR n 
3 41  TYR n 
3 42  ILE n 
3 43  VAL n 
3 44  LYS n 
3 45  GLY n 
3 46  SER n 
3 47  VAL n 
3 48  ALA n 
3 49  VAL n 
3 50  LEU n 
3 51  ILE n 
3 52  LYS n 
3 53  ASP n 
3 54  GLU n 
3 55  GLU n 
3 56  GLY n 
3 57  LYS n 
3 58  GLU n 
3 59  MET n 
3 60  ILE n 
3 61  LEU n 
3 62  SER n 
3 63  TYR n 
3 64  LEU n 
3 65  ASN n 
3 66  GLN n 
3 67  GLY n 
3 68  ASP n 
3 69  PHE n 
3 70  ILE n 
3 71  GLY n 
3 72  GLU n 
3 73  LEU n 
3 74  GLY n 
3 75  LEU n 
3 76  PHE n 
3 77  GLU n 
3 78  GLU n 
3 79  GLY n 
3 80  GLN n 
3 81  GLU n 
3 82  ARG n 
3 83  SER n 
3 84  ALA n 
3 85  TRP n 
3 86  VAL n 
3 87  ARG n 
3 88  ALA n 
3 89  LYS n 
3 90  THR n 
3 91  ALA n 
3 92  CYS n 
3 93  GLU n 
3 94  VAL n 
3 95  ALA n 
3 96  GLU n 
3 97  ILE n 
3 98  SER n 
3 99  TYR n 
3 100 LYS n 
3 101 LYS n 
3 102 PHE n 
3 103 ARG n 
3 104 GLN n 
3 105 LEU n 
3 106 ILE n 
3 107 GLN n 
3 108 VAL n 
3 109 ASN n 
3 110 PRO n 
3 111 ASP n 
3 112 ILE n 
3 113 LEU n 
3 114 MET n 
3 115 ARG n 
3 116 LEU n 
3 117 SER n 
3 118 ALA n 
3 119 GLN n 
3 120 MET n 
3 121 ALA n 
3 122 ARG n 
3 123 ARG n 
3 124 LEU n 
3 125 GLN n 
3 126 VAL n 
3 127 THR n 
3 128 SER n 
3 129 GLU n 
3 130 LYS n 
3 131 VAL n 
3 132 GLY n 
3 133 ASN n 
3 134 LEU n 
3 135 ALA n 
3 136 PHE n 
3 137 LEU n 
3 138 ASP n 
3 139 VAL n 
3 140 THR n 
3 141 GLY n 
3 142 ARG n 
3 143 ILE n 
3 144 ALA n 
3 145 GLN n 
3 146 THR n 
3 147 LEU n 
3 148 LEU n 
3 149 ASN n 
3 150 LEU n 
3 151 ALA n 
3 152 LYS n 
3 153 GLN n 
3 154 PRO n 
3 155 ASP n 
3 156 ALA n 
3 157 MET n 
3 158 THR n 
3 159 HIS n 
3 160 PRO n 
3 161 ASP n 
3 162 GLY n 
3 163 MET n 
3 164 GLN n 
3 165 ILE n 
3 166 LYS n 
3 167 ILE n 
3 168 THR n 
3 169 ARG n 
3 170 GLN n 
3 171 GLU n 
3 172 ILE n 
3 173 GLY n 
3 174 GLN n 
3 175 ILE n 
3 176 VAL n 
3 177 GLY n 
3 178 CYS n 
3 179 SER n 
3 180 ARG n 
3 181 GLU n 
3 182 THR n 
3 183 VAL n 
3 184 GLY n 
3 185 ARG n 
3 186 ILE n 
3 187 LEU n 
3 188 LYS n 
3 189 MET n 
3 190 LEU n 
3 191 GLU n 
3 192 ASP n 
3 193 GLN n 
3 194 ASN n 
3 195 LEU n 
3 196 ILE n 
3 197 SER n 
3 198 ALA n 
3 199 HIS n 
3 200 GLY n 
3 201 LYS n 
3 202 THR n 
3 203 ILE n 
3 204 VAL n 
3 205 VAL n 
3 206 TYR n 
3 207 GLY n 
3 208 THR n 
3 209 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'crp, cap, csm' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pAKCRP1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CRP_ECOLI P0ACJ8 3 2 ? ? 
2 PDB 1ZRC      1ZRC   1 ? ? ? 
3 PDB 1ZRC      1ZRC   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZRC A 1 ? 209 ? P0ACJ8 2  ? 210 ? 1  209 
2 1 1ZRC B 1 ? 209 ? P0ACJ8 2  ? 210 ? 1  209 
3 2 1ZRC W 1 ? 17  ? 1ZRC   -8 ? 9   ? -8 9   
4 3 1ZRC X 1 ? 21  ? 1ZRC   13 ? -8  ? 13 -8  
5 2 1ZRC Y 1 ? 17  ? 1ZRC   -8 ? 9   ? -8 9   
6 3 1ZRC Z 1 ? 21  ? 1ZRC   13 ? -8  ? 13 -8  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1ZRC 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      3.16 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   60.78 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'2mM cAMP, 0.1M MES, 0.2M NaCl, 0.05M MgCl2, 5% PEG 8000, 15% Dioxane, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 cAMP       ? ? ? 
1 2  1 MES        ? ? ? 
1 3  1 NaCl       ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 'PEG 8000' ? ? ? 
1 6  1 Dioxane    ? ? ? 
1 7  1 H2O        ? ? ? 
1 8  2 cAMP       ? ? ? 
1 9  2 MES        ? ? ? 
1 10 2 NaCl       ? ? ? 
1 11 2 MgCl2      ? ? ? 
1 12 2 'PEG 8000' ? ? ? 
1 13 2 H2O        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           108 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-04-24 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
# 
_reflns.entry_id                     1ZRC 
_reflns.d_resolution_low             47.13 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   21454 
_reflns.percent_possible_obs         99.800 
_reflns.pdbx_Rmerge_I_obs            0.084 
_reflns.pdbx_chi_squared             1.989 
_reflns.pdbx_redundancy              14.000 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   21593 
_reflns.R_free_details               ? 
_reflns.B_iso_Wilson_estimate        38.3 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_low 
_reflns_shell.d_res_high 
_reflns_shell.number_measured_obs 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.number_unique_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.percent_possible_all 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.90  2.80 2080 98.800  0.881 1.636 12.900 ? ? ? ? ? ? ? 1  
3.02  2.90 2109 100.000 0.732 1.689 14.200 ? ? ? ? ? ? ? 2  
3.15  3.02 2144 100.000 0.463 1.791 14.400 ? ? ? ? ? ? ? 3  
3.32  3.15 2115 100.000 0.285 1.871 14.500 ? ? ? ? ? ? ? 4  
3.53  3.32 2132 100.000 0.183 1.948 14.500 ? ? ? ? ? ? ? 5  
3.80  3.53 2165 100.000 0.12  2.071 14.400 ? ? ? ? ? ? ? 6  
4.18  3.80 2144 100.000 0.08  2.288 14.300 ? ? ? ? ? ? ? 7  
4.79  4.18 2187 100.000 0.067 2.513 14.100 ? ? ? ? ? ? ? 8  
6.03  4.79 2199 100.000 0.058 2.274 13.900 ? ? ? ? ? ? ? 9  
50.00 6.03 2318 99.000  0.032 1.750 13.200 ? ? ? ? ? ? ? 10 
# 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             47.13 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    95.00 
_refine.ls_number_reflns_obs                     20395 
_refine.ls_R_factor_R_work                       0.235 
_refine.ls_R_factor_R_free                       0.29 
_refine.ls_percent_reflns_R_free                 9.900 
_refine.ls_number_reflns_R_free                  2021 
_refine.occupancy_min                            1.00 
_refine.occupancy_max                            1.00 
_refine.B_iso_mean                               75.335 
_refine.solvent_model_param_bsol                 48.9256 
_refine.aniso_B[1][1]                            -23.55 
_refine.aniso_B[2][2]                            6.43 
_refine.aniso_B[3][3]                            17.13 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.entry_id                                 1ZRC 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     21476 
_refine.ls_R_factor_all                          0.287 
_refine.ls_R_factor_obs                          0.287 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB ID 1O3Q' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_param_ksol                 0.339399 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZRC 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_obs    0.40 
_refine_analyze.Luzzati_sigma_a_obs             0.47 
_refine_analyze.Luzzati_coordinate_error_free   0.51 
_refine_analyze.Luzzati_sigma_a_free            0.56 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3162 
_refine_hist.pdbx_number_atoms_nucleic_acid   1546 
_refine_hist.pdbx_number_atoms_ligand         44 
_refine_hist.number_atoms_solvent             39 
_refine_hist.number_atoms_total               4791 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        47.13 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.3   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 22.2  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.04  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
2.80 2.93  1953 83.6 0.401 0.44  0.029 229 10.5 8 . 'X-RAY DIFFRACTION' . . 
2.93 3.08  2137 90.3 0.372 0.415 0.026 250 10.5 8 . 'X-RAY DIFFRACTION' . . 
3.08 3.27  2244 93.6 0.304 0.362 0.024 236 9.5  8 . 'X-RAY DIFFRACTION' . . 
3.27 3.53  2297 96.6 0.26  0.334 0.021 253 9.9  8 . 'X-RAY DIFFRACTION' . . 
3.53 3.88  2371 98.0 0.234 0.283 0.018 252 9.6  8 . 'X-RAY DIFFRACTION' . . 
3.88 4.44  2399 98.8 0.202 0.263 0.016 270 10.1 8 . 'X-RAY DIFFRACTION' . . 
4.44 5.60  2423 99.0 0.209 0.26  0.016 266 9.9  8 . 'X-RAY DIFFRACTION' . . 
5.60 47.13 2550 98.6 0.212 0.259 0.016 265 9.4  8 . 'X-RAY DIFFRACTION' . . 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param protein.top      'X-RAY DIFFRACTION' 
2 carbohydrate.param           carbohydrate.top 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:dna-rna_rep.param dna-rna.top      'X-RAY DIFFRACTION' 
4 cmp.par                      cmp_top.top      'X-RAY DIFFRACTION' 
5 CNS_TOPPAR:water_rep.param   water.top        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZRC 
_struct.title                     '4 Crystal structures of CAP-DNA with all base-pair substitutions at position 6, CAP-ICAP38 DNA' 
_struct.pdbx_descriptor           'Catabolite gene activator/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZRC 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, CAP, CAP-DNA, CATABOLITE GENE ACTIVATOR PROTEIN, CAMP RECEPTOR PROTEIN, CRP, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO E 9   ? HIS E 17  ? PRO A 9   HIS A 17  1 ? 9  
HELX_P HELX_P2  2  TYR E 99  ? GLN E 107 ? TYR A 99  GLN A 107 1 ? 9  
HELX_P HELX_P3  3  PRO E 110 ? LEU E 137 ? PRO A 110 LEU A 137 1 ? 28 
HELX_P HELX_P4  4  ASP E 138 ? ALA E 151 ? ASP A 138 ALA A 151 1 ? 14 
HELX_P HELX_P5  5  THR E 168 ? GLY E 177 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P6  6  SER E 179 ? GLN E 193 ? SER A 179 GLN A 193 1 ? 15 
HELX_P HELX_P7  7  PRO F 9   ? HIS F 17  ? PRO B 9   HIS B 17  1 ? 9  
HELX_P HELX_P8  8  SER F 98  ? VAL F 108 ? SER B 98  VAL B 108 1 ? 11 
HELX_P HELX_P9  9  PRO F 110 ? LEU F 137 ? PRO B 110 LEU B 137 1 ? 28 
HELX_P HELX_P10 10 ASP F 138 ? ALA F 151 ? ASP B 138 ALA B 151 1 ? 14 
HELX_P HELX_P11 11 THR F 168 ? GLY F 177 ? THR B 168 GLY B 177 1 ? 10 
HELX_P HELX_P12 12 SER F 179 ? GLN F 193 ? SER B 179 GLN B 193 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DA 1  N1 ? ? ? 1_555 B DT 21 N3 ? ? W DA -8 X DT -8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DA 1  N6 ? ? ? 1_555 B DT 21 O4 ? ? W DA -8 X DT -8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DT 2  N3 ? ? ? 1_555 B DA 20 N1 ? ? W DT -7 X DA -7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4  hydrog ? ? A DT 2  O4 ? ? ? 1_555 B DA 20 N6 ? ? W DT -7 X DA -7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DT 3  N3 ? ? ? 1_555 B DA 19 N1 ? ? W DT -6 X DA -6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DT 3  O4 ? ? ? 1_555 B DA 19 N6 ? ? W DT -6 X DA -6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 18 N1 ? ? W DT -5 X DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 18 N6 ? ? W DT -5 X DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DC 5  N3 ? ? ? 1_555 B DG 17 N1 ? ? W DC -4 X DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DC 5  N4 ? ? ? 1_555 B DG 17 O6 ? ? W DC -4 X DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG 17 N2 ? ? W DC -4 X DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 16 N3 ? ? W DG -3 X DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 16 O2 ? ? W DG -3 X DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 16 N4 ? ? W DG -3 X DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 15 N3 ? ? W DA -2 X DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 15 O4 ? ? W DA -2 X DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 14 N3 ? ? W DA -1 X DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 14 O4 ? ? W DA -1 X DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 13 N3 ? ? W DA 1  X DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 13 O4 ? ? W DA 1  X DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 12 N3 ? ? W DA 2  X DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 12 O4 ? ? W DA 2  X DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 11 N3 ? ? W DA 3  X DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 11 O4 ? ? W DA 3  X DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 10 N1 ? ? W DT 4  X DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 10 N6 ? ? W DT 4  X DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 9  N3 ? ? W DG 5  X DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 9  O2 ? ? W DG 5  X DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 9  N4 ? ? W DG 5  X DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 14 N3 ? ? ? 1_555 B DA 8  N1 ? ? W DT 6  X DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 14 O4 ? ? ? 1_555 B DA 8  N6 ? ? W DT 6  X DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 7  N3 ? ? W DG 7  X DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 7  O2 ? ? W DG 7  X DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 7  N4 ? ? W DG 7  X DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 6  N3 ? ? W DA 8  X DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 6  O4 ? ? W DA 8  X DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? A DT 17 N3 ? ? ? 1_555 B DA 5  N1 ? ? W DT 9  X DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? A DT 17 O4 ? ? ? 1_555 B DA 5  N6 ? ? W DT 9  X DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? B DC 1  N3 ? ? ? 1_555 D DG 4  N1 ? ? X DC 13 Z DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? B DC 1  N4 ? ? ? 1_555 D DG 4  O6 ? ? X DC 13 Z DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? B DC 1  O2 ? ? ? 1_555 D DG 4  N2 ? ? X DC 13 Z DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? B DT 2  N3 ? ? ? 1_555 D DA 3  N1 ? ? X DT 12 Z DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? B DT 2  O4 ? ? ? 1_555 D DA 3  N6 ? ? X DT 12 Z DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? B DA 3  N1 ? ? ? 1_555 D DT 2  N3 ? ? X DA 11 Z DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? B DA 3  N6 ? ? ? 1_555 D DT 2  O4 ? ? X DA 11 Z DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? B DG 4  N1 ? ? ? 1_555 D DC 1  N3 ? ? X DG 10 Z DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? B DG 4  N2 ? ? ? 1_555 D DC 1  O2 ? ? X DG 10 Z DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? B DG 4  O6 ? ? ? 1_555 D DC 1  N4 ? ? X DG 10 Z DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? C DA 1  N1 ? ? ? 1_555 D DT 21 N3 ? ? Y DA -8 Z DT -8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? C DA 1  N6 ? ? ? 1_555 D DT 21 O4 ? ? Y DA -8 Z DT -8 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? C DT 2  N3 ? ? ? 1_555 D DA 20 N1 ? ? Y DT -7 Z DA -7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? C DT 2  O4 ? ? ? 1_555 D DA 20 N6 ? ? Y DT -7 Z DA -7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 19 N1 ? ? Y DT -6 Z DA -6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 19 N6 ? ? Y DT -6 Z DA -6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 18 N1 ? ? Y DT -5 Z DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 18 N6 ? ? Y DT -5 Z DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? C DC 5  N3 ? ? ? 1_555 D DG 17 N1 ? ? Y DC -4 Z DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? C DC 5  N4 ? ? ? 1_555 D DG 17 O6 ? ? Y DC -4 Z DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? C DC 5  O2 ? ? ? 1_555 D DG 17 N2 ? ? Y DC -4 Z DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 16 N3 ? ? Y DG -3 Z DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 16 O2 ? ? Y DG -3 Z DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 16 N4 ? ? Y DG -3 Z DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 15 N3 ? ? Y DA -2 Z DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 15 O4 ? ? Y DA -2 Z DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 14 N3 ? ? Y DA -1 Z DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 14 O4 ? ? Y DA -1 Z DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 12 O4 ? ? Y DA 1  Z DT 2  1_555 ? ? ? ? ? ? 'DA-DT PAIR' ? ? 
hydrog68 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 13 N3 ? ? Y DA 1  Z DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 13 O4 ? ? Y DA 1  Z DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 12 N3 ? ? Y DA 2  Z DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 12 O4 ? ? Y DA 2  Z DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 11 N3 ? ? Y DA 3  Z DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 11 O4 ? ? Y DA 3  Z DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 10 N1 ? ? Y DT 4  Z DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 10 N6 ? ? Y DT 4  Z DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC 9  N3 ? ? Y DG 5  Z DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77 hydrog ? ? C DG 13 N2 ? ? ? 1_555 D DC 9  O2 ? ? Y DG 5  Z DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78 hydrog ? ? C DG 13 O6 ? ? ? 1_555 D DC 9  N4 ? ? Y DG 5  Z DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79 hydrog ? ? C DT 14 N3 ? ? ? 1_555 D DA 8  N1 ? ? Y DT 6  Z DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80 hydrog ? ? C DT 14 O4 ? ? ? 1_555 D DA 8  N6 ? ? Y DT 6  Z DA 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81 hydrog ? ? C DG 15 N1 ? ? ? 1_555 D DC 7  N3 ? ? Y DG 7  Z DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82 hydrog ? ? C DG 15 N2 ? ? ? 1_555 D DC 7  O2 ? ? Y DG 7  Z DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83 hydrog ? ? C DG 15 O6 ? ? ? 1_555 D DC 7  N4 ? ? Y DG 7  Z DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84 hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT 6  N3 ? ? Y DA 8  Z DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85 hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT 6  O4 ? ? Y DA 8  Z DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 5  N1 ? ? Y DT 9  Z DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 5  N6 ? ? Y DT 9  Z DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 3 ? 
F ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS E 19  ? TYR E 23  ? HIS A 19  TYR A 23  
A 2 CYS E 92  ? SER E 98  ? CYS A 92  SER A 98  
A 3 THR E 38  ? LYS E 44  ? THR A 38  LYS A 44  
A 4 PHE E 69  ? ILE E 70  ? PHE A 69  ILE A 70  
B 1 THR E 28  ? ILE E 30  ? THR A 28  ILE A 30  
B 2 TRP E 85  ? ALA E 88  ? TRP A 85  ALA A 88  
B 3 SER E 46  ? LYS E 52  ? SER A 46  LYS A 52  
B 4 GLU E 58  ? ASN E 65  ? GLU A 58  ASN A 65  
C 1 MET E 157 ? HIS E 159 ? MET A 157 HIS A 159 
C 2 GLY E 162 ? LYS E 166 ? GLY A 162 LYS A 166 
C 3 THR E 202 ? TYR E 206 ? THR A 202 TYR A 206 
C 4 ILE E 196 ? HIS E 199 ? ILE A 196 HIS A 199 
D 1 THR F 28  ? ILE F 30  ? THR B 28  ILE B 30  
D 2 TRP F 85  ? ALA F 88  ? TRP B 85  ALA B 88  
D 3 VAL F 47  ? LYS F 52  ? VAL B 47  LYS B 52  
D 4 GLU F 58  ? LEU F 64  ? GLU B 58  LEU B 64  
E 1 PHE F 69  ? ILE F 70  ? PHE B 69  ILE B 70  
E 2 TYR F 40  ? LYS F 44  ? TYR B 40  LYS B 44  
E 3 GLU F 93  ? ALA F 95  ? GLU B 93  ALA B 95  
F 1 GLY F 162 ? LYS F 166 ? GLY B 162 LYS B 166 
F 2 THR F 202 ? TYR F 206 ? THR B 202 TYR B 206 
F 3 ILE F 196 ? HIS F 199 ? ILE B 196 HIS B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N HIS E 21  ? N HIS A 21  O VAL E 94  ? O VAL A 94  
A 2 3 O GLU E 93  ? O GLU A 93  N LYS E 44  ? N LYS A 44  
A 3 4 N TYR E 40  ? N TYR A 40  O ILE E 70  ? O ILE A 70  
B 1 2 N LEU E 29  ? N LEU A 29  O VAL E 86  ? O VAL A 86  
B 2 3 O TRP E 85  ? O TRP A 85  N LEU E 50  ? N LEU A 50  
B 3 4 N VAL E 47  ? N VAL A 47  O LEU E 64  ? O LEU A 64  
C 1 2 N HIS E 159 ? N HIS A 159 O GLY E 162 ? O GLY A 162 
C 2 3 N MET E 163 ? N MET A 163 O VAL E 205 ? O VAL A 205 
C 3 4 O THR E 202 ? O THR A 202 N HIS E 199 ? N HIS A 199 
D 1 2 N LEU F 29  ? N LEU B 29  O VAL F 86  ? O VAL B 86  
D 2 3 O ARG F 87  ? O ARG B 87  N ALA F 48  ? N ALA B 48  
D 3 4 N VAL F 49  ? N VAL B 49  O SER F 62  ? O SER B 62  
E 1 2 O ILE F 70  ? O ILE B 70  N TYR F 40  ? N TYR B 40  
E 2 3 N LYS F 44  ? N LYS B 44  O GLU F 93  ? O GLU B 93  
F 1 2 N ILE F 165 ? N ILE B 165 O ILE F 203 ? O ILE B 203 
F 2 3 O VAL F 204 ? O VAL B 204 N SER F 197 ? N SER B 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CMP A 210' 
AC2 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE CMP B 210' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 VAL E 49  ? VAL A 49  . ? 1_555 ? 
2  AC1 11 LEU E 61  ? LEU A 61  . ? 1_555 ? 
3  AC1 11 ILE E 70  ? ILE A 70  . ? 1_555 ? 
4  AC1 11 GLY E 71  ? GLY A 71  . ? 1_555 ? 
5  AC1 11 GLU E 72  ? GLU A 72  . ? 1_555 ? 
6  AC1 11 LEU E 73  ? LEU A 73  . ? 1_555 ? 
7  AC1 11 ARG E 82  ? ARG A 82  . ? 1_555 ? 
8  AC1 11 SER E 83  ? SER A 83  . ? 1_555 ? 
9  AC1 11 ALA E 84  ? ALA A 84  . ? 1_555 ? 
10 AC1 11 THR E 127 ? THR A 127 . ? 1_555 ? 
11 AC1 11 SER F 128 ? SER B 128 . ? 1_555 ? 
12 AC2 11 SER E 128 ? SER A 128 . ? 1_555 ? 
13 AC2 11 VAL F 49  ? VAL B 49  . ? 1_555 ? 
14 AC2 11 LEU F 61  ? LEU B 61  . ? 1_555 ? 
15 AC2 11 ILE F 70  ? ILE B 70  . ? 1_555 ? 
16 AC2 11 GLY F 71  ? GLY B 71  . ? 1_555 ? 
17 AC2 11 GLU F 72  ? GLU B 72  . ? 1_555 ? 
18 AC2 11 ARG F 82  ? ARG B 82  . ? 1_555 ? 
19 AC2 11 SER F 83  ? SER B 83  . ? 1_555 ? 
20 AC2 11 ALA F 84  ? ALA B 84  . ? 1_555 ? 
21 AC2 11 ARG F 123 ? ARG B 123 . ? 1_555 ? 
22 AC2 11 THR F 127 ? THR B 127 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1ZRC 
_atom_sites.fract_transf_matrix[1][1]   0.016247 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013236 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005528 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DA  A 1 1   ? 24.920 -0.916  60.955  1.00 128.83 ? -8  DA  W "O5'" 1 
ATOM   2    C "C5'" . DA  A 1 1   ? 23.718 -0.143  61.013  1.00 128.64 ? -8  DA  W "C5'" 1 
ATOM   3    C "C4'" . DA  A 1 1   ? 23.931 1.234   61.597  1.00 129.00 ? -8  DA  W "C4'" 1 
ATOM   4    O "O4'" . DA  A 1 1   ? 24.270 1.095   63.000  1.00 128.76 ? -8  DA  W "O4'" 1 
ATOM   5    C "C3'" . DA  A 1 1   ? 25.121 1.952   60.966  1.00 129.76 ? -8  DA  W "C3'" 1 
ATOM   6    O "O3'" . DA  A 1 1   ? 24.953 3.371   60.998  1.00 131.97 ? -8  DA  W "O3'" 1 
ATOM   7    C "C2'" . DA  A 1 1   ? 26.282 1.514   61.836  1.00 129.30 ? -8  DA  W "C2'" 1 
ATOM   8    C "C1'" . DA  A 1 1   ? 25.642 1.412   63.213  1.00 128.10 ? -8  DA  W "C1'" 1 
ATOM   9    N N9    . DA  A 1 1   ? 26.231 0.373   64.060  1.00 126.89 ? -8  DA  W N9    1 
ATOM   10   C C8    . DA  A 1 1   ? 26.229 -0.989  63.874  1.00 125.95 ? -8  DA  W C8    1 
ATOM   11   N N7    . DA  A 1 1   ? 26.900 -1.650  64.787  1.00 125.48 ? -8  DA  W N7    1 
ATOM   12   C C5    . DA  A 1 1   ? 27.364 -0.659  65.641  1.00 125.72 ? -8  DA  W C5    1 
ATOM   13   C C6    . DA  A 1 1   ? 28.150 -0.703  66.808  1.00 126.23 ? -8  DA  W C6    1 
ATOM   14   N N6    . DA  A 1 1   ? 28.633 -1.832  67.344  1.00 125.77 ? -8  DA  W N6    1 
ATOM   15   N N1    . DA  A 1 1   ? 28.430 0.472   67.418  1.00 126.84 ? -8  DA  W N1    1 
ATOM   16   C C2    . DA  A 1 1   ? 27.952 1.605   66.884  1.00 126.44 ? -8  DA  W C2    1 
ATOM   17   N N3    . DA  A 1 1   ? 27.209 1.774   65.794  1.00 126.15 ? -8  DA  W N3    1 
ATOM   18   C C4    . DA  A 1 1   ? 26.948 0.591   65.212  1.00 126.09 ? -8  DA  W C4    1 
ATOM   19   P P     . DT  A 1 2   ? 25.853 4.296   60.038  1.00 133.43 ? -7  DT  W P     1 
ATOM   20   O OP1   . DT  A 1 2   ? 24.964 4.832   58.975  1.00 133.14 ? -7  DT  W OP1   1 
ATOM   21   O OP2   . DT  A 1 2   ? 27.062 3.518   59.660  1.00 132.83 ? -7  DT  W OP2   1 
ATOM   22   O "O5'" . DT  A 1 2   ? 26.304 5.504   60.979  1.00 134.12 ? -7  DT  W "O5'" 1 
ATOM   23   C "C5'" . DT  A 1 2   ? 26.896 5.252   62.255  1.00 134.37 ? -7  DT  W "C5'" 1 
ATOM   24   C "C4'" . DT  A 1 2   ? 28.285 5.843   62.312  1.00 134.37 ? -7  DT  W "C4'" 1 
ATOM   25   O "O4'" . DT  A 1 2   ? 29.062 4.989   63.184  1.00 134.49 ? -7  DT  W "O4'" 1 
ATOM   26   C "C3'" . DT  A 1 2   ? 28.977 5.787   60.949  1.00 134.55 ? -7  DT  W "C3'" 1 
ATOM   27   O "O3'" . DT  A 1 2   ? 30.016 6.773   60.757  1.00 134.38 ? -7  DT  W "O3'" 1 
ATOM   28   C "C2'" . DT  A 1 2   ? 29.599 4.407   60.958  1.00 135.07 ? -7  DT  W "C2'" 1 
ATOM   29   C "C1'" . DT  A 1 2   ? 29.985 4.227   62.421  1.00 135.34 ? -7  DT  W "C1'" 1 
ATOM   30   N N1    . DT  A 1 2   ? 29.927 2.828   62.889  1.00 135.67 ? -7  DT  W N1    1 
ATOM   31   C C2    . DT  A 1 2   ? 30.234 2.558   64.202  1.00 135.48 ? -7  DT  W C2    1 
ATOM   32   O O2    . DT  A 1 2   ? 30.520 3.424   65.015  1.00 134.69 ? -7  DT  W O2    1 
ATOM   33   N N3    . DT  A 1 2   ? 30.195 1.223   64.531  1.00 135.69 ? -7  DT  W N3    1 
ATOM   34   C C4    . DT  A 1 2   ? 29.884 0.161   63.697  1.00 135.72 ? -7  DT  W C4    1 
ATOM   35   O O4    . DT  A 1 2   ? 29.897 -0.989  64.131  1.00 136.35 ? -7  DT  W O4    1 
ATOM   36   C C5    . DT  A 1 2   ? 29.559 0.522   62.340  1.00 135.58 ? -7  DT  W C5    1 
ATOM   37   C C7    . DT  A 1 2   ? 29.205 -0.557  61.367  1.00 135.67 ? -7  DT  W C7    1 
ATOM   38   C C6    . DT  A 1 2   ? 29.591 1.817   62.010  1.00 135.64 ? -7  DT  W C6    1 
ATOM   39   P P     . DT  A 1 3   ? 30.286 7.915   61.860  1.00 134.42 ? -6  DT  W P     1 
ATOM   40   O OP1   . DT  A 1 3   ? 28.994 8.328   62.469  1.00 134.64 ? -6  DT  W OP1   1 
ATOM   41   O OP2   . DT  A 1 3   ? 31.162 8.947   61.249  1.00 133.48 ? -6  DT  W OP2   1 
ATOM   42   O "O5'" . DT  A 1 3   ? 31.153 7.144   62.954  1.00 134.10 ? -6  DT  W "O5'" 1 
ATOM   43   C "C5'" . DT  A 1 3   ? 31.083 7.507   64.328  1.00 133.44 ? -6  DT  W "C5'" 1 
ATOM   44   C "C4'" . DT  A 1 3   ? 32.467 7.556   64.936  1.00 132.47 ? -6  DT  W "C4'" 1 
ATOM   45   O "O4'" . DT  A 1 3   ? 32.957 6.206   65.160  1.00 132.50 ? -6  DT  W "O4'" 1 
ATOM   46   C "C3'" . DT  A 1 3   ? 33.486 8.199   63.995  1.00 131.39 ? -6  DT  W "C3'" 1 
ATOM   47   O "O3'" . DT  A 1 3   ? 34.501 8.873   64.746  1.00 129.80 ? -6  DT  W "O3'" 1 
ATOM   48   C "C2'" . DT  A 1 3   ? 34.020 7.013   63.210  1.00 131.59 ? -6  DT  W "C2'" 1 
ATOM   49   C "C1'" . DT  A 1 3   ? 34.033 5.921   64.270  1.00 131.64 ? -6  DT  W "C1'" 1 
ATOM   50   N N1    . DT  A 1 3   ? 33.910 4.520   63.799  1.00 130.67 ? -6  DT  W N1    1 
ATOM   51   C C2    . DT  A 1 3   ? 34.499 3.531   64.556  1.00 130.32 ? -6  DT  W C2    1 
ATOM   52   O O2    . DT  A 1 3   ? 35.094 3.749   65.594  1.00 129.92 ? -6  DT  W O2    1 
ATOM   53   N N3    . DT  A 1 3   ? 34.366 2.264   64.049  1.00 130.43 ? -6  DT  W N3    1 
ATOM   54   C C4    . DT  A 1 3   ? 33.719 1.894   62.888  1.00 130.36 ? -6  DT  W C4    1 
ATOM   55   O O4    . DT  A 1 3   ? 33.681 0.710   62.557  1.00 130.38 ? -6  DT  W O4    1 
ATOM   56   C C5    . DT  A 1 3   ? 33.126 2.976   62.146  1.00 130.46 ? -6  DT  W C5    1 
ATOM   57   C C7    . DT  A 1 3   ? 32.416 2.666   60.866  1.00 130.95 ? -6  DT  W C7    1 
ATOM   58   C C6    . DT  A 1 3   ? 33.241 4.218   62.634  1.00 130.40 ? -6  DT  W C6    1 
ATOM   59   P P     . DT  A 1 4   ? 35.902 9.236   64.051  1.00 129.79 ? -5  DT  W P     1 
ATOM   60   O OP1   . DT  A 1 4   ? 36.407 10.477  64.692  1.00 128.91 ? -5  DT  W OP1   1 
ATOM   61   O OP2   . DT  A 1 4   ? 35.741 9.184   62.574  1.00 130.04 ? -5  DT  W OP2   1 
ATOM   62   O "O5'" . DT  A 1 4   ? 36.843 8.036   64.503  1.00 128.86 ? -5  DT  W "O5'" 1 
ATOM   63   C "C5'" . DT  A 1 4   ? 36.881 7.647   65.870  1.00 127.23 ? -5  DT  W "C5'" 1 
ATOM   64   C "C4'" . DT  A 1 4   ? 38.154 6.897   66.188  1.00 125.84 ? -5  DT  W "C4'" 1 
ATOM   65   O "O4'" . DT  A 1 4   ? 38.014 5.507   65.801  1.00 125.11 ? -5  DT  W "O4'" 1 
ATOM   66   C "C3'" . DT  A 1 4   ? 39.367 7.410   65.412  1.00 124.60 ? -5  DT  W "C3'" 1 
ATOM   67   O "O3'" . DT  A 1 4   ? 40.558 7.250   66.197  1.00 123.88 ? -5  DT  W "O3'" 1 
ATOM   68   C "C2'" . DT  A 1 4   ? 39.343 6.559   64.153  1.00 124.16 ? -5  DT  W "C2'" 1 
ATOM   69   C "C1'" . DT  A 1 4   ? 38.846 5.219   64.684  1.00 123.55 ? -5  DT  W "C1'" 1 
ATOM   70   N N1    . DT  A 1 4   ? 38.089 4.365   63.743  1.00 121.54 ? -5  DT  W N1    1 
ATOM   71   C C2    . DT  A 1 4   ? 38.240 3.003   63.856  1.00 120.69 ? -5  DT  W C2    1 
ATOM   72   O O2    . DT  A 1 4   ? 38.950 2.479   64.692  1.00 121.21 ? -5  DT  W O2    1 
ATOM   73   N N3    . DT  A 1 4   ? 37.526 2.269   62.947  1.00 119.62 ? -5  DT  W N3    1 
ATOM   74   C C4    . DT  A 1 4   ? 36.697 2.748   61.960  1.00 119.38 ? -5  DT  W C4    1 
ATOM   75   O O4    . DT  A 1 4   ? 36.124 1.965   61.215  1.00 119.12 ? -5  DT  W O4    1 
ATOM   76   C C5    . DT  A 1 4   ? 36.580 4.184   61.898  1.00 120.02 ? -5  DT  W C5    1 
ATOM   77   C C7    . DT  A 1 4   ? 35.706 4.796   60.850  1.00 120.10 ? -5  DT  W C7    1 
ATOM   78   C C6    . DT  A 1 4   ? 37.269 4.912   62.785  1.00 120.82 ? -5  DT  W C6    1 
ATOM   79   P P     . DC  A 1 5   ? 41.993 7.182   65.477  1.00 123.84 ? -4  DC  W P     1 
ATOM   80   O OP1   . DC  A 1 5   ? 43.036 7.418   66.514  1.00 122.84 ? -4  DC  W OP1   1 
ATOM   81   O OP2   . DC  A 1 5   ? 41.966 8.034   64.264  1.00 124.36 ? -4  DC  W OP2   1 
ATOM   82   O "O5'" . DC  A 1 5   ? 42.085 5.660   65.018  1.00 122.93 ? -4  DC  W "O5'" 1 
ATOM   83   C "C5'" . DC  A 1 5   ? 42.135 4.620   65.990  1.00 120.47 ? -4  DC  W "C5'" 1 
ATOM   84   C "C4'" . DC  A 1 5   ? 43.240 3.650   65.649  1.00 118.80 ? -4  DC  W "C4'" 1 
ATOM   85   O "O4'" . DC  A 1 5   ? 42.760 2.680   64.696  1.00 118.77 ? -4  DC  W "O4'" 1 
ATOM   86   C "C3'" . DC  A 1 5   ? 44.428 4.319   64.974  1.00 117.74 ? -4  DC  W "C3'" 1 
ATOM   87   O "O3'" . DC  A 1 5   ? 45.609 3.580   65.273  1.00 116.44 ? -4  DC  W "O3'" 1 
ATOM   88   C "C2'" . DC  A 1 5   ? 44.055 4.255   63.504  1.00 118.01 ? -4  DC  W "C2'" 1 
ATOM   89   C "C1'" . DC  A 1 5   ? 43.319 2.925   63.411  1.00 118.35 ? -4  DC  W "C1'" 1 
ATOM   90   N N1    . DC  A 1 5   ? 42.211 2.870   62.448  1.00 118.72 ? -4  DC  W N1    1 
ATOM   91   C C2    . DC  A 1 5   ? 41.717 1.616   62.092  1.00 119.04 ? -4  DC  W C2    1 
ATOM   92   O O2    . DC  A 1 5   ? 42.260 0.606   62.565  1.00 119.03 ? -4  DC  W O2    1 
ATOM   93   N N3    . DC  A 1 5   ? 40.665 1.532   61.249  1.00 119.16 ? -4  DC  W N3    1 
ATOM   94   C C4    . DC  A 1 5   ? 40.114 2.643   60.759  1.00 118.89 ? -4  DC  W C4    1 
ATOM   95   N N4    . DC  A 1 5   ? 39.070 2.505   59.937  1.00 119.37 ? -4  DC  W N4    1 
ATOM   96   C C5    . DC  A 1 5   ? 40.610 3.940   61.090  1.00 118.26 ? -4  DC  W C5    1 
ATOM   97   C C6    . DC  A 1 5   ? 41.653 4.006   61.927  1.00 118.13 ? -4  DC  W C6    1 
ATOM   98   P P     . DG  A 1 6   ? 47.025 4.071   64.706  1.00 115.69 ? -3  DG  W P     1 
ATOM   99   O OP1   . DG  A 1 6   ? 47.936 4.221   65.867  1.00 115.88 ? -3  DG  W OP1   1 
ATOM   100  O OP2   . DG  A 1 6   ? 46.818 5.216   63.785  1.00 115.97 ? -3  DG  W OP2   1 
ATOM   101  O "O5'" . DG  A 1 6   ? 47.504 2.813   63.859  1.00 114.43 ? -3  DG  W "O5'" 1 
ATOM   102  C "C5'" . DG  A 1 6   ? 47.394 1.501   64.403  1.00 111.16 ? -3  DG  W "C5'" 1 
ATOM   103  C "C4'" . DG  A 1 6   ? 47.813 0.472   63.382  1.00 109.23 ? -3  DG  W "C4'" 1 
ATOM   104  O "O4'" . DG  A 1 6   ? 46.766 0.304   62.396  1.00 108.27 ? -3  DG  W "O4'" 1 
ATOM   105  C "C3'" . DG  A 1 6   ? 49.036 0.917   62.590  1.00 107.86 ? -3  DG  W "C3'" 1 
ATOM   106  O "O3'" . DG  A 1 6   ? 49.789 -0.221  62.183  1.00 106.92 ? -3  DG  W "O3'" 1 
ATOM   107  C "C2'" . DG  A 1 6   ? 48.432 1.666   61.415  1.00 107.30 ? -3  DG  W "C2'" 1 
ATOM   108  C "C1'" . DG  A 1 6   ? 47.167 0.859   61.146  1.00 107.43 ? -3  DG  W "C1'" 1 
ATOM   109  N N9    . DG  A 1 6   ? 46.027 1.589   60.591  1.00 106.41 ? -3  DG  W N9    1 
ATOM   110  C C8    . DG  A 1 6   ? 45.805 2.947   60.609  1.00 105.64 ? -3  DG  W C8    1 
ATOM   111  N N7    . DG  A 1 6   ? 44.675 3.290   60.049  1.00 104.51 ? -3  DG  W N7    1 
ATOM   112  C C5    . DG  A 1 6   ? 44.121 2.089   59.631  1.00 104.10 ? -3  DG  W C5    1 
ATOM   113  C C6    . DG  A 1 6   ? 42.899 1.826   58.963  1.00 103.80 ? -3  DG  W C6    1 
ATOM   114  O O6    . DG  A 1 6   ? 42.027 2.629   58.595  1.00 102.90 ? -3  DG  W O6    1 
ATOM   115  N N1    . DG  A 1 6   ? 42.730 0.464   58.731  1.00 104.62 ? -3  DG  W N1    1 
ATOM   116  C C2    . DG  A 1 6   ? 43.622 -0.519  59.095  1.00 104.99 ? -3  DG  W C2    1 
ATOM   117  N N2    . DG  A 1 6   ? 43.279 -1.781  58.786  1.00 105.39 ? -3  DG  W N2    1 
ATOM   118  N N3    . DG  A 1 6   ? 44.763 -0.284  59.715  1.00 104.42 ? -3  DG  W N3    1 
ATOM   119  C C4    . DG  A 1 6   ? 44.946 1.030   59.952  1.00 104.96 ? -3  DG  W C4    1 
ATOM   120  P P     . DA  A 1 7   ? 51.110 -0.015  61.306  1.00 107.79 ? -2  DA  W P     1 
ATOM   121  O OP1   . DA  A 1 7   ? 51.978 -1.214  61.462  1.00 108.09 ? -2  DA  W OP1   1 
ATOM   122  O OP2   . DA  A 1 7   ? 51.655 1.336   61.602  1.00 107.81 ? -2  DA  W OP2   1 
ATOM   123  O "O5'" . DA  A 1 7   ? 50.550 -0.009  59.821  1.00 106.95 ? -2  DA  W "O5'" 1 
ATOM   124  C "C5'" . DA  A 1 7   ? 51.010 -0.956  58.867  1.00 103.99 ? -2  DA  W "C5'" 1 
ATOM   125  C "C4'" . DA  A 1 7   ? 50.178 -2.215  58.934  1.00 101.45 ? -2  DA  W "C4'" 1 
ATOM   126  O "O4'" . DA  A 1 7   ? 48.786 -1.855  59.100  1.00 100.67 ? -2  DA  W "O4'" 1 
ATOM   127  C "C3'" . DA  A 1 7   ? 50.240 -3.007  57.641  1.00 100.35 ? -2  DA  W "C3'" 1 
ATOM   128  O "O3'" . DA  A 1 7   ? 50.080 -4.402  57.860  1.00 99.99  ? -2  DA  W "O3'" 1 
ATOM   129  C "C2'" . DA  A 1 7   ? 49.110 -2.414  56.830  1.00 99.95  ? -2  DA  W "C2'" 1 
ATOM   130  C "C1'" . DA  A 1 7   ? 48.071 -2.044  57.881  1.00 99.82  ? -2  DA  W "C1'" 1 
ATOM   131  N N9    . DA  A 1 7   ? 47.420 -0.771  57.564  1.00 98.71  ? -2  DA  W N9    1 
ATOM   132  C C8    . DA  A 1 7   ? 47.895 0.475   57.884  1.00 97.54  ? -2  DA  W C8    1 
ATOM   133  N N7    . DA  A 1 7   ? 47.142 1.455   57.458  1.00 96.68  ? -2  DA  W N7    1 
ATOM   134  C C5    . DA  A 1 7   ? 46.092 0.816   56.820  1.00 96.14  ? -2  DA  W C5    1 
ATOM   135  C C6    . DA  A 1 7   ? 44.963 1.307   56.160  1.00 95.27  ? -2  DA  W C6    1 
ATOM   136  N N6    . DA  A 1 7   ? 44.697 2.608   56.031  1.00 94.82  ? -2  DA  W N6    1 
ATOM   137  N N1    . DA  A 1 7   ? 44.106 0.412   55.630  1.00 95.19  ? -2  DA  W N1    1 
ATOM   138  C C2    . DA  A 1 7   ? 44.384 -0.891  55.761  1.00 95.65  ? -2  DA  W C2    1 
ATOM   139  N N3    . DA  A 1 7   ? 45.417 -1.478  56.360  1.00 96.15  ? -2  DA  W N3    1 
ATOM   140  C C4    . DA  A 1 7   ? 46.246 -0.557  56.878  1.00 97.13  ? -2  DA  W C4    1 
ATOM   141  P P     . DA  A 1 8   ? 50.439 -5.419  56.675  1.00 100.05 ? -1  DA  W P     1 
ATOM   142  O OP1   . DA  A 1 8   ? 50.251 -6.800  57.186  1.00 99.29  ? -1  DA  W OP1   1 
ATOM   143  O OP2   . DA  A 1 8   ? 51.746 -5.019  56.084  1.00 99.20  ? -1  DA  W OP2   1 
ATOM   144  O "O5'" . DA  A 1 8   ? 49.302 -5.120  55.604  1.00 99.74  ? -1  DA  W "O5'" 1 
ATOM   145  C "C5'" . DA  A 1 8   ? 47.945 -5.463  55.874  1.00 97.45  ? -1  DA  W "C5'" 1 
ATOM   146  C "C4'" . DA  A 1 8   ? 47.152 -5.498  54.590  1.00 95.41  ? -1  DA  W "C4'" 1 
ATOM   147  O "O4'" . DA  A 1 8   ? 46.601 -4.181  54.323  1.00 94.21  ? -1  DA  W "O4'" 1 
ATOM   148  C "C3'" . DA  A 1 8   ? 48.056 -5.812  53.394  1.00 94.24  ? -1  DA  W "C3'" 1 
ATOM   149  O "O3'" . DA  A 1 8   ? 47.330 -6.536  52.392  1.00 93.59  ? -1  DA  W "O3'" 1 
ATOM   150  C "C2'" . DA  A 1 8   ? 48.502 -4.433  52.938  1.00 93.41  ? -1  DA  W "C2'" 1 
ATOM   151  C "C1'" . DA  A 1 8   ? 47.251 -3.608  53.193  1.00 93.92  ? -1  DA  W "C1'" 1 
ATOM   152  N N9    . DA  A 1 8   ? 47.452 -2.175  53.429  1.00 93.05  ? -1  DA  W N9    1 
ATOM   153  C C8    . DA  A 1 8   ? 48.519 -1.544  54.017  1.00 92.47  ? -1  DA  W C8    1 
ATOM   154  N N7    . DA  A 1 8   ? 48.411 -0.239  54.051  1.00 91.18  ? -1  DA  W N7    1 
ATOM   155  C C5    . DA  A 1 8   ? 47.188 0.009   53.446  1.00 91.60  ? -1  DA  W C5    1 
ATOM   156  C C6    . DA  A 1 8   ? 46.493 1.201   53.169  1.00 91.16  ? -1  DA  W C6    1 
ATOM   157  N N6    . DA  A 1 8   ? 46.949 2.412   53.482  1.00 89.25  ? -1  DA  W N6    1 
ATOM   158  N N1    . DA  A 1 8   ? 45.296 1.101   52.551  1.00 91.46  ? -1  DA  W N1    1 
ATOM   159  C C2    . DA  A 1 8   ? 44.837 -0.117  52.238  1.00 92.13  ? -1  DA  W C2    1 
ATOM   160  N N3    . DA  A 1 8   ? 45.395 -1.309  52.445  1.00 92.73  ? -1  DA  W N3    1 
ATOM   161  C C4    . DA  A 1 8   ? 46.584 -1.174  53.062  1.00 92.53  ? -1  DA  W C4    1 
ATOM   162  P P     . DA  A 1 9   ? 47.912 -6.660  50.894  1.00 92.57  ? 1   DA  W P     1 
ATOM   163  O OP1   . DA  A 1 9   ? 48.029 -8.110  50.589  1.00 90.86  ? 1   DA  W OP1   1 
ATOM   164  O OP2   . DA  A 1 9   ? 49.089 -5.768  50.705  1.00 92.16  ? 1   DA  W OP2   1 
ATOM   165  O "O5'" . DA  A 1 9   ? 46.715 -6.071  50.028  1.00 90.43  ? 1   DA  W "O5'" 1 
ATOM   166  C "C5'" . DA  A 1 9   ? 45.393 -6.081  50.558  1.00 85.88  ? 1   DA  W "C5'" 1 
ATOM   167  C "C4'" . DA  A 1 9   ? 44.455 -5.282  49.685  1.00 83.42  ? 1   DA  W "C4'" 1 
ATOM   168  O "O4'" . DA  A 1 9   ? 44.628 -3.859  49.910  1.00 82.44  ? 1   DA  W "O4'" 1 
ATOM   169  C "C3'" . DA  A 1 9   ? 44.732 -5.487  48.199  1.00 81.18  ? 1   DA  W "C3'" 1 
ATOM   170  O "O3'" . DA  A 1 9   ? 43.502 -5.320  47.495  1.00 79.67  ? 1   DA  W "O3'" 1 
ATOM   171  C "C2'" . DA  A 1 9   ? 45.737 -4.393  47.891  1.00 80.90  ? 1   DA  W "C2'" 1 
ATOM   172  C "C1'" . DA  A 1 9   ? 45.222 -3.261  48.766  1.00 81.73  ? 1   DA  W "C1'" 1 
ATOM   173  N N9    . DA  A 1 9   ? 46.201 -2.271  49.212  1.00 82.03  ? 1   DA  W N9    1 
ATOM   174  C C8    . DA  A 1 9   ? 47.472 -2.465  49.692  1.00 82.16  ? 1   DA  W C8    1 
ATOM   175  N N7    . DA  A 1 9   ? 48.096 -1.352  50.006  1.00 82.05  ? 1   DA  W N7    1 
ATOM   176  C C5    . DA  A 1 9   ? 47.170 -0.357  49.713  1.00 82.37  ? 1   DA  W C5    1 
ATOM   177  C C6    . DA  A 1 9   ? 47.214 1.050   49.827  1.00 81.12  ? 1   DA  W C6    1 
ATOM   178  N N6    . DA  A 1 9   ? 48.268 1.728   50.283  1.00 78.97  ? 1   DA  W N6    1 
ATOM   179  N N1    . DA  A 1 9   ? 46.118 1.745   49.448  1.00 80.97  ? 1   DA  W N1    1 
ATOM   180  C C2    . DA  A 1 9   ? 45.058 1.070   48.986  1.00 80.81  ? 1   DA  W C2    1 
ATOM   181  N N3    . DA  A 1 9   ? 44.895 -0.241  48.833  1.00 82.25  ? 1   DA  W N3    1 
ATOM   182  C C4    . DA  A 1 9   ? 46.000 -0.908  49.221  1.00 82.73  ? 1   DA  W C4    1 
ATOM   183  P P     . DA  A 1 10  ? 43.456 -5.463  45.896  1.00 78.66  ? 2   DA  W P     1 
ATOM   184  O OP1   . DA  A 1 10  ? 42.473 -6.536  45.599  1.00 75.88  ? 2   DA  W OP1   1 
ATOM   185  O OP2   . DA  A 1 10  ? 44.828 -5.509  45.298  1.00 75.23  ? 2   DA  W OP2   1 
ATOM   186  O "O5'" . DA  A 1 10  ? 42.812 -4.077  45.471  1.00 77.85  ? 2   DA  W "O5'" 1 
ATOM   187  C "C5'" . DA  A 1 10  ? 43.326 -2.879  46.018  1.00 73.48  ? 2   DA  W "C5'" 1 
ATOM   188  C "C4'" . DA  A 1 10  ? 42.631 -1.688  45.417  1.00 70.48  ? 2   DA  W "C4'" 1 
ATOM   189  O "O4'" . DA  A 1 10  ? 43.330 -0.525  45.914  1.00 70.39  ? 2   DA  W "O4'" 1 
ATOM   190  C "C3'" . DA  A 1 10  ? 42.727 -1.603  43.895  1.00 68.03  ? 2   DA  W "C3'" 1 
ATOM   191  O "O3'" . DA  A 1 10  ? 41.569 -0.924  43.367  1.00 64.37  ? 2   DA  W "O3'" 1 
ATOM   192  C "C2'" . DA  A 1 10  ? 44.041 -0.877  43.683  1.00 67.29  ? 2   DA  W "C2'" 1 
ATOM   193  C "C1'" . DA  A 1 10  ? 44.125 0.051   44.891  1.00 68.65  ? 2   DA  W "C1'" 1 
ATOM   194  N N9    . DA  A 1 10  ? 45.482 0.175   45.417  1.00 68.93  ? 2   DA  W N9    1 
ATOM   195  C C8    . DA  A 1 10  ? 46.419 -0.814  45.541  1.00 69.23  ? 2   DA  W C8    1 
ATOM   196  N N7    . DA  A 1 10  ? 47.567 -0.399  46.003  1.00 69.13  ? 2   DA  W N7    1 
ATOM   197  C C5    . DA  A 1 10  ? 47.372 0.954   46.209  1.00 69.33  ? 2   DA  W C5    1 
ATOM   198  C C6    . DA  A 1 10  ? 48.215 1.964   46.686  1.00 70.73  ? 2   DA  W C6    1 
ATOM   199  N N6    . DA  A 1 10  ? 49.482 1.762   47.060  1.00 70.13  ? 2   DA  W N6    1 
ATOM   200  N N1    . DA  A 1 10  ? 47.708 3.210   46.770  1.00 71.41  ? 2   DA  W N1    1 
ATOM   201  C C2    . DA  A 1 10  ? 46.441 3.415   46.396  1.00 71.41  ? 2   DA  W C2    1 
ATOM   202  N N3    . DA  A 1 10  ? 45.552 2.548   45.933  1.00 70.55  ? 2   DA  W N3    1 
ATOM   203  C C4    . DA  A 1 10  ? 46.088 1.320   45.862  1.00 69.73  ? 2   DA  W C4    1 
ATOM   204  P P     . DA  A 1 11  ? 41.625 -0.227  41.919  1.00 60.32  ? 3   DA  W P     1 
ATOM   205  O OP1   . DA  A 1 11  ? 40.221 -0.100  41.480  1.00 59.90  ? 3   DA  W OP1   1 
ATOM   206  O OP2   . DA  A 1 11  ? 42.638 -0.856  41.021  1.00 61.39  ? 3   DA  W OP2   1 
ATOM   207  O "O5'" . DA  A 1 11  ? 42.171 1.231   42.229  1.00 60.11  ? 3   DA  W "O5'" 1 
ATOM   208  C "C5'" . DA  A 1 11  ? 41.440 2.097   43.068  1.00 54.52  ? 3   DA  W "C5'" 1 
ATOM   209  C "C4'" . DA  A 1 11  ? 41.928 3.514   42.914  1.00 51.94  ? 3   DA  W "C4'" 1 
ATOM   210  O "O4'" . DA  A 1 11  ? 43.294 3.614   43.386  1.00 52.87  ? 3   DA  W "O4'" 1 
ATOM   211  C "C3'" . DA  A 1 11  ? 41.990 3.982   41.461  1.00 50.87  ? 3   DA  W "C3'" 1 
ATOM   212  O "O3'" . DA  A 1 11  ? 41.830 5.399   41.500  1.00 49.94  ? 3   DA  W "O3'" 1 
ATOM   213  C "C2'" . DA  A 1 11  ? 43.399 3.594   41.030  1.00 48.65  ? 3   DA  W "C2'" 1 
ATOM   214  C "C1'" . DA  A 1 11  ? 44.175 3.879   42.298  1.00 51.61  ? 3   DA  W "C1'" 1 
ATOM   215  N N9    . DA  A 1 11  ? 45.440 3.183   42.545  1.00 54.37  ? 3   DA  W N9    1 
ATOM   216  C C8    . DA  A 1 11  ? 45.738 1.847   42.433  1.00 55.33  ? 3   DA  W C8    1 
ATOM   217  N N7    . DA  A 1 11  ? 46.976 1.552   42.758  1.00 54.38  ? 3   DA  W N7    1 
ATOM   218  C C5    . DA  A 1 11  ? 47.532 2.775   43.100  1.00 54.69  ? 3   DA  W C5    1 
ATOM   219  C C6    . DA  A 1 11  ? 48.822 3.141   43.521  1.00 55.66  ? 3   DA  W C6    1 
ATOM   220  N N6    . DA  A 1 11  ? 49.822 2.273   43.685  1.00 56.44  ? 3   DA  W N6    1 
ATOM   221  N N1    . DA  A 1 11  ? 49.056 4.446   43.772  1.00 55.92  ? 3   DA  W N1    1 
ATOM   222  C C2    . DA  A 1 11  ? 48.052 5.316   43.610  1.00 57.54  ? 3   DA  W C2    1 
ATOM   223  N N3    . DA  A 1 11  ? 46.796 5.095   43.219  1.00 57.19  ? 3   DA  W N3    1 
ATOM   224  C C4    . DA  A 1 11  ? 46.600 3.788   42.975  1.00 55.11  ? 3   DA  W C4    1 
ATOM   225  P P     . DT  A 1 12  ? 41.617 6.237   40.153  1.00 46.93  ? 4   DT  W P     1 
ATOM   226  O OP1   . DT  A 1 12  ? 40.328 6.953   40.323  1.00 47.43  ? 4   DT  W OP1   1 
ATOM   227  O OP2   . DT  A 1 12  ? 41.857 5.419   38.936  1.00 47.84  ? 4   DT  W OP2   1 
ATOM   228  O "O5'" . DT  A 1 12  ? 42.765 7.318   40.246  1.00 43.74  ? 4   DT  W "O5'" 1 
ATOM   229  C "C5'" . DT  A 1 12  ? 43.995 6.989   40.819  1.00 42.21  ? 4   DT  W "C5'" 1 
ATOM   230  C "C4'" . DT  A 1 12  ? 44.867 8.213   40.875  1.00 44.45  ? 4   DT  W "C4'" 1 
ATOM   231  O "O4'" . DT  A 1 12  ? 46.150 7.765   41.350  1.00 48.19  ? 4   DT  W "O4'" 1 
ATOM   232  C "C3'" . DT  A 1 12  ? 45.140 8.850   39.519  1.00 47.93  ? 4   DT  W "C3'" 1 
ATOM   233  O "O3'" . DT  A 1 12  ? 45.385 10.251  39.671  1.00 52.74  ? 4   DT  W "O3'" 1 
ATOM   234  C "C2'" . DT  A 1 12  ? 46.353 8.085   39.026  1.00 47.15  ? 4   DT  W "C2'" 1 
ATOM   235  C "C1'" . DT  A 1 12  ? 47.106 7.765   40.304  1.00 48.46  ? 4   DT  W "C1'" 1 
ATOM   236  N N1    . DT  A 1 12  ? 47.769 6.446   40.324  1.00 50.42  ? 4   DT  W N1    1 
ATOM   237  C C2    . DT  A 1 12  ? 49.085 6.400   40.709  1.00 53.34  ? 4   DT  W C2    1 
ATOM   238  O O2    . DT  A 1 12  ? 49.721 7.392   41.017  1.00 53.92  ? 4   DT  W O2    1 
ATOM   239  N N3    . DT  A 1 12  ? 49.635 5.143   40.717  1.00 57.12  ? 4   DT  W N3    1 
ATOM   240  C C4    . DT  A 1 12  ? 49.011 3.956   40.374  1.00 56.60  ? 4   DT  W C4    1 
ATOM   241  O O4    . DT  A 1 12  ? 49.629 2.901   40.430  1.00 57.15  ? 4   DT  W O4    1 
ATOM   242  C C5    . DT  A 1 12  ? 47.637 4.078   39.972  1.00 55.07  ? 4   DT  W C5    1 
ATOM   243  C C7    . DT  A 1 12  ? 46.894 2.844   39.572  1.00 53.13  ? 4   DT  W C7    1 
ATOM   244  C C6    . DT  A 1 12  ? 47.088 5.301   39.972  1.00 52.60  ? 4   DT  W C6    1 
ATOM   245  P P     . DG  A 1 13  ? 45.375 11.222  38.382  1.00 56.48  ? 5   DG  W P     1 
ATOM   246  O OP1   . DG  A 1 13  ? 44.495 12.378  38.697  1.00 54.21  ? 5   DG  W OP1   1 
ATOM   247  O OP2   . DG  A 1 13  ? 45.139 10.439  37.131  1.00 56.44  ? 5   DG  W OP2   1 
ATOM   248  O "O5'" . DG  A 1 13  ? 46.866 11.759  38.366  1.00 55.21  ? 5   DG  W "O5'" 1 
ATOM   249  C "C5'" . DG  A 1 13  ? 47.468 12.166  39.582  1.00 58.26  ? 5   DG  W "C5'" 1 
ATOM   250  C "C4'" . DG  A 1 13  ? 48.924 12.498  39.375  1.00 59.30  ? 5   DG  W "C4'" 1 
ATOM   251  O "O4'" . DG  A 1 13  ? 49.701 11.285  39.259  1.00 59.14  ? 5   DG  W "O4'" 1 
ATOM   252  C "C3'" . DG  A 1 13  ? 49.220 13.285  38.112  1.00 60.41  ? 5   DG  W "C3'" 1 
ATOM   253  O "O3'" . DG  A 1 13  ? 50.345 14.118  38.407  1.00 64.71  ? 5   DG  W "O3'" 1 
ATOM   254  C "C2'" . DG  A 1 13  ? 49.464 12.180  37.089  1.00 60.62  ? 5   DG  W "C2'" 1 
ATOM   255  C "C1'" . DG  A 1 13  ? 50.136 11.083  37.920  1.00 60.76  ? 5   DG  W "C1'" 1 
ATOM   256  N N9    . DG  A 1 13  ? 49.848 9.683   37.594  1.00 62.98  ? 5   DG  W N9    1 
ATOM   257  C C8    . DG  A 1 13  ? 48.660 9.142   37.155  1.00 63.50  ? 5   DG  W C8    1 
ATOM   258  N N7    . DG  A 1 13  ? 48.676 7.835   37.103  1.00 62.55  ? 5   DG  W N7    1 
ATOM   259  C C5    . DG  A 1 13  ? 49.962 7.492   37.496  1.00 63.66  ? 5   DG  W C5    1 
ATOM   260  C C6    . DG  A 1 13  ? 50.574 6.220   37.648  1.00 62.85  ? 5   DG  W C6    1 
ATOM   261  O O6    . DG  A 1 13  ? 50.084 5.096   37.483  1.00 61.87  ? 5   DG  W O6    1 
ATOM   262  N N1    . DG  A 1 13  ? 51.895 6.339   38.048  1.00 63.98  ? 5   DG  W N1    1 
ATOM   263  C C2    . DG  A 1 13  ? 52.547 7.521   38.284  1.00 65.49  ? 5   DG  W C2    1 
ATOM   264  N N2    . DG  A 1 13  ? 53.827 7.429   38.675  1.00 68.51  ? 5   DG  W N2    1 
ATOM   265  N N3    . DG  A 1 13  ? 51.994 8.708   38.153  1.00 65.78  ? 5   DG  W N3    1 
ATOM   266  C C4    . DG  A 1 13  ? 50.709 8.623   37.765  1.00 63.95  ? 5   DG  W C4    1 
ATOM   267  P P     . DT  A 1 14  ? 50.770 15.313  37.418  1.00 67.77  ? 6   DT  W P     1 
ATOM   268  O OP1   . DT  A 1 14  ? 50.984 16.494  38.287  1.00 68.37  ? 6   DT  W OP1   1 
ATOM   269  O OP2   . DT  A 1 14  ? 49.889 15.427  36.220  1.00 64.88  ? 6   DT  W OP2   1 
ATOM   270  O "O5'" . DT  A 1 14  ? 52.194 14.806  36.940  1.00 68.01  ? 6   DT  W "O5'" 1 
ATOM   271  C "C5'" . DT  A 1 14  ? 52.503 13.428  37.021  1.00 69.48  ? 6   DT  W "C5'" 1 
ATOM   272  C "C4'" . DT  A 1 14  ? 53.867 13.174  36.444  1.00 71.77  ? 6   DT  W "C4'" 1 
ATOM   273  O "O4'" . DT  A 1 14  ? 53.991 11.747  36.270  1.00 72.66  ? 6   DT  W "O4'" 1 
ATOM   274  C "C3'" . DT  A 1 14  ? 54.021 13.769  35.055  1.00 73.39  ? 6   DT  W "C3'" 1 
ATOM   275  O "O3'" . DT  A 1 14  ? 55.381 14.137  34.821  1.00 78.37  ? 6   DT  W "O3'" 1 
ATOM   276  C "C2'" . DT  A 1 14  ? 53.512 12.661  34.153  1.00 73.78  ? 6   DT  W "C2'" 1 
ATOM   277  C "C1'" . DT  A 1 14  ? 53.919 11.397  34.898  1.00 72.68  ? 6   DT  W "C1'" 1 
ATOM   278  N N1    . DT  A 1 14  ? 52.966 10.270  34.785  1.00 72.85  ? 6   DT  W N1    1 
ATOM   279  C C2    . DT  A 1 14  ? 53.344 9.065   35.325  1.00 72.12  ? 6   DT  W C2    1 
ATOM   280  O O2    . DT  A 1 14  ? 54.408 8.893   35.881  1.00 72.42  ? 6   DT  W O2    1 
ATOM   281  N N3    . DT  A 1 14  ? 52.424 8.063   35.185  1.00 71.84  ? 6   DT  W N3    1 
ATOM   282  C C4    . DT  A 1 14  ? 51.195 8.144   34.569  1.00 70.89  ? 6   DT  W C4    1 
ATOM   283  O O4    . DT  A 1 14  ? 50.484 7.157   34.512  1.00 73.43  ? 6   DT  W O4    1 
ATOM   284  C C5    . DT  A 1 14  ? 50.856 9.431   34.030  1.00 69.73  ? 6   DT  W C5    1 
ATOM   285  C C7    . DT  A 1 14  ? 49.536 9.605   33.351  1.00 68.51  ? 6   DT  W C7    1 
ATOM   286  C C6    . DT  A 1 14  ? 51.744 10.421  34.162  1.00 71.10  ? 6   DT  W C6    1 
ATOM   287  P P     . DG  A 1 15  ? 55.711 15.566  34.160  1.00 81.83  ? 7   DG  W P     1 
ATOM   288  O OP1   . DG  A 1 15  ? 56.973 16.068  34.762  1.00 80.38  ? 7   DG  W OP1   1 
ATOM   289  O OP2   . DG  A 1 15  ? 54.486 16.410  34.195  1.00 79.52  ? 7   DG  W OP2   1 
ATOM   290  O "O5'" . DG  A 1 15  ? 55.979 15.204  32.637  1.00 82.85  ? 7   DG  W "O5'" 1 
ATOM   291  C "C5'" . DG  A 1 15  ? 57.038 14.333  32.271  1.00 84.19  ? 7   DG  W "C5'" 1 
ATOM   292  C "C4'" . DG  A 1 15  ? 56.949 14.003  30.801  1.00 85.59  ? 7   DG  W "C4'" 1 
ATOM   293  O "O4'" . DG  A 1 15  ? 56.122 12.828  30.615  1.00 86.92  ? 7   DG  W "O4'" 1 
ATOM   294  C "C3'" . DG  A 1 15  ? 56.230 15.130  30.049  1.00 85.71  ? 7   DG  W "C3'" 1 
ATOM   295  O "O3'" . DG  A 1 15  ? 56.597 15.097  28.671  1.00 86.67  ? 7   DG  W "O3'" 1 
ATOM   296  C "C2'" . DG  A 1 15  ? 54.775 14.706  30.141  1.00 85.79  ? 7   DG  W "C2'" 1 
ATOM   297  C "C1'" . DG  A 1 15  ? 54.932 13.210  29.949  1.00 86.20  ? 7   DG  W "C1'" 1 
ATOM   298  N N9    . DG  A 1 15  ? 53.840 12.323  30.336  1.00 85.30  ? 7   DG  W N9    1 
ATOM   299  C C8    . DG  A 1 15  ? 52.647 12.685  30.909  1.00 84.73  ? 7   DG  W C8    1 
ATOM   300  N N7    . DG  A 1 15  ? 51.823 11.685  31.048  1.00 84.65  ? 7   DG  W N7    1 
ATOM   301  C C5    . DG  A 1 15  ? 52.519 10.590  30.554  1.00 85.34  ? 7   DG  W C5    1 
ATOM   302  C C6    . DG  A 1 15  ? 52.126 9.229   30.435  1.00 85.81  ? 7   DG  W C6    1 
ATOM   303  O O6    . DG  A 1 15  ? 51.046 8.709   30.739  1.00 85.76  ? 7   DG  W O6    1 
ATOM   304  N N1    . DG  A 1 15  ? 53.141 8.447   29.893  1.00 85.32  ? 7   DG  W N1    1 
ATOM   305  C C2    . DG  A 1 15  ? 54.373 8.906   29.507  1.00 84.76  ? 7   DG  W C2    1 
ATOM   306  N N2    . DG  A 1 15  ? 55.209 7.971   29.011  1.00 83.97  ? 7   DG  W N2    1 
ATOM   307  N N3    . DG  A 1 15  ? 54.752 10.180  29.600  1.00 84.31  ? 7   DG  W N3    1 
ATOM   308  C C4    . DG  A 1 15  ? 53.777 10.960  30.131  1.00 84.91  ? 7   DG  W C4    1 
ATOM   309  P P     . DA  A 1 16  ? 57.768 16.038  28.126  1.00 87.59  ? 8   DA  W P     1 
ATOM   310  O OP1   . DA  A 1 16  ? 58.577 16.459  29.294  1.00 87.28  ? 8   DA  W OP1   1 
ATOM   311  O OP2   . DA  A 1 16  ? 57.181 17.062  27.224  1.00 86.96  ? 8   DA  W OP2   1 
ATOM   312  O "O5'" . DA  A 1 16  ? 58.639 15.026  27.265  1.00 88.44  ? 8   DA  W "O5'" 1 
ATOM   313  C "C5'" . DA  A 1 16  ? 59.465 14.068  27.918  1.00 91.54  ? 8   DA  W "C5'" 1 
ATOM   314  C "C4'" . DA  A 1 16  ? 59.621 12.824  27.074  1.00 93.59  ? 8   DA  W "C4'" 1 
ATOM   315  O "O4'" . DA  A 1 16  ? 58.436 11.995  27.158  1.00 94.76  ? 8   DA  W "O4'" 1 
ATOM   316  C "C3'" . DA  A 1 16  ? 59.781 13.132  25.589  1.00 94.24  ? 8   DA  W "C3'" 1 
ATOM   317  O "O3'" . DA  A 1 16  ? 60.544 12.076  25.011  1.00 94.65  ? 8   DA  W "O3'" 1 
ATOM   318  C "C2'" . DA  A 1 16  ? 58.345 13.140  25.089  1.00 94.51  ? 8   DA  W "C2'" 1 
ATOM   319  C "C1'" . DA  A 1 16  ? 57.735 12.015  25.917  1.00 95.61  ? 8   DA  W "C1'" 1 
ATOM   320  N N9    . DA  A 1 16  ? 56.295 12.071  26.195  1.00 96.07  ? 8   DA  W N9    1 
ATOM   321  C C8    . DA  A 1 16  ? 55.508 13.169  26.442  1.00 96.19  ? 8   DA  W C8    1 
ATOM   322  N N7    . DA  A 1 16  ? 54.250 12.878  26.677  1.00 95.74  ? 8   DA  W N7    1 
ATOM   323  C C5    . DA  A 1 16  ? 54.201 11.496  26.574  1.00 95.88  ? 8   DA  W C5    1 
ATOM   324  C C6    . DA  A 1 16  ? 53.147 10.569  26.715  1.00 96.42  ? 8   DA  W C6    1 
ATOM   325  N N6    . DA  A 1 16  ? 51.888 10.912  27.010  1.00 94.38  ? 8   DA  W N6    1 
ATOM   326  N N1    . DA  A 1 16  ? 53.436 9.259   26.541  1.00 97.07  ? 8   DA  W N1    1 
ATOM   327  C C2    . DA  A 1 16  ? 54.701 8.914   26.247  1.00 96.01  ? 8   DA  W C2    1 
ATOM   328  N N3    . DA  A 1 16  ? 55.772 9.690   26.093  1.00 95.45  ? 8   DA  W N3    1 
ATOM   329  C C4    . DA  A 1 16  ? 55.452 10.984  26.271  1.00 95.79  ? 8   DA  W C4    1 
ATOM   330  P P     . DT  A 1 17  ? 60.906 12.107  23.452  1.00 96.12  ? 9   DT  W P     1 
ATOM   331  O OP1   . DT  A 1 17  ? 62.389 12.136  23.361  1.00 96.89  ? 9   DT  W OP1   1 
ATOM   332  O OP2   . DT  A 1 17  ? 60.102 13.175  22.785  1.00 94.82  ? 9   DT  W OP2   1 
ATOM   333  O "O5'" . DT  A 1 17  ? 60.413 10.676  22.950  1.00 94.52  ? 9   DT  W "O5'" 1 
ATOM   334  C "C5'" . DT  A 1 17  ? 59.129 10.189  23.325  1.00 92.59  ? 9   DT  W "C5'" 1 
ATOM   335  C "C4'" . DT  A 1 17  ? 58.763 8.972   22.512  1.00 91.43  ? 9   DT  W "C4'" 1 
ATOM   336  O "O4'" . DT  A 1 17  ? 57.385 8.655   22.821  1.00 92.12  ? 9   DT  W "O4'" 1 
ATOM   337  C "C3'" . DT  A 1 17  ? 58.792 9.212   21.004  1.00 91.29  ? 9   DT  W "C3'" 1 
ATOM   338  O "O3'" . DT  A 1 17  ? 58.858 7.970   20.289  1.00 90.19  ? 9   DT  W "O3'" 1 
ATOM   339  C "C2'" . DT  A 1 17  ? 57.409 9.772   20.736  1.00 91.84  ? 9   DT  W "C2'" 1 
ATOM   340  C "C1'" . DT  A 1 17  ? 56.540 9.004   21.727  1.00 91.83  ? 9   DT  W "C1'" 1 
ATOM   341  N N1    . DT  A 1 17  ? 55.399 9.780   22.261  1.00 91.57  ? 9   DT  W N1    1 
ATOM   342  C C2    . DT  A 1 17  ? 54.330 9.096   22.798  1.00 91.29  ? 9   DT  W C2    1 
ATOM   343  O O2    . DT  A 1 17  ? 54.270 7.880   22.850  1.00 91.43  ? 9   DT  W O2    1 
ATOM   344  N N3    . DT  A 1 17  ? 53.324 9.897   23.276  1.00 90.62  ? 9   DT  W N3    1 
ATOM   345  C C4    . DT  A 1 17  ? 53.280 11.277  23.275  1.00 90.67  ? 9   DT  W C4    1 
ATOM   346  O O4    . DT  A 1 17  ? 52.313 11.858  23.751  1.00 91.81  ? 9   DT  W O4    1 
ATOM   347  C C5    . DT  A 1 17  ? 54.424 11.929  22.694  1.00 91.00  ? 9   DT  W C5    1 
ATOM   348  C C7    . DT  A 1 17  ? 54.458 13.423  22.646  1.00 90.42  ? 9   DT  W C7    1 
ATOM   349  C C6    . DT  A 1 17  ? 55.413 11.160  22.221  1.00 91.71  ? 9   DT  W C6    1 
ATOM   350  O "O5'" . DC  B 2 1   ? 50.706 16.989  9.373   1.00 102.36 ? 13  DC  X "O5'" 1 
ATOM   351  C "C5'" . DC  B 2 1   ? 49.842 18.047  8.966   1.00 100.32 ? 13  DC  X "C5'" 1 
ATOM   352  C "C4'" . DC  B 2 1   ? 48.521 17.990  9.695   1.00 99.69  ? 13  DC  X "C4'" 1 
ATOM   353  O "O4'" . DC  B 2 1   ? 47.918 16.696  9.448   1.00 98.82  ? 13  DC  X "O4'" 1 
ATOM   354  C "C3'" . DC  B 2 1   ? 48.692 18.070  11.209  1.00 98.99  ? 13  DC  X "C3'" 1 
ATOM   355  O "O3'" . DC  B 2 1   ? 47.548 18.659  11.829  1.00 97.94  ? 13  DC  X "O3'" 1 
ATOM   356  C "C2'" . DC  B 2 1   ? 48.871 16.622  11.612  1.00 98.48  ? 13  DC  X "C2'" 1 
ATOM   357  C "C1'" . DC  B 2 1   ? 47.970 15.896  10.624  1.00 98.03  ? 13  DC  X "C1'" 1 
ATOM   358  N N1    . DC  B 2 1   ? 48.466 14.566  10.252  1.00 96.66  ? 13  DC  X N1    1 
ATOM   359  C C2    . DC  B 2 1   ? 47.577 13.494  10.262  1.00 96.62  ? 13  DC  X C2    1 
ATOM   360  O O2    . DC  B 2 1   ? 46.385 13.707  10.529  1.00 96.34  ? 13  DC  X O2    1 
ATOM   361  N N3    . DC  B 2 1   ? 48.034 12.255  9.979   1.00 96.73  ? 13  DC  X N3    1 
ATOM   362  C C4    . DC  B 2 1   ? 49.322 12.072  9.682   1.00 96.45  ? 13  DC  X C4    1 
ATOM   363  N N4    . DC  B 2 1   ? 49.732 10.826  9.419   1.00 96.25  ? 13  DC  X N4    1 
ATOM   364  C C5    . DC  B 2 1   ? 50.245 13.155  9.641   1.00 95.71  ? 13  DC  X C5    1 
ATOM   365  C C6    . DC  B 2 1   ? 49.778 14.372  9.926   1.00 95.40  ? 13  DC  X C6    1 
ATOM   366  P P     . DT  B 2 2   ? 47.541 18.883  13.421  1.00 97.91  ? 12  DT  X P     1 
ATOM   367  O OP1   . DT  B 2 2   ? 46.624 20.024  13.699  1.00 97.38  ? 12  DT  X OP1   1 
ATOM   368  O OP2   . DT  B 2 2   ? 48.947 18.932  13.909  1.00 96.19  ? 12  DT  X OP2   1 
ATOM   369  O "O5'" . DT  B 2 2   ? 46.883 17.540  13.974  1.00 95.96  ? 12  DT  X "O5'" 1 
ATOM   370  C "C5'" . DT  B 2 2   ? 45.546 17.186  13.624  1.00 90.73  ? 12  DT  X "C5'" 1 
ATOM   371  C "C4'" . DT  B 2 2   ? 44.992 16.187  14.612  1.00 86.07  ? 12  DT  X "C4'" 1 
ATOM   372  O "O4'" . DT  B 2 2   ? 45.534 14.873  14.339  1.00 85.79  ? 12  DT  X "O4'" 1 
ATOM   373  C "C3'" . DT  B 2 2   ? 45.444 16.517  16.034  1.00 83.31  ? 12  DT  X "C3'" 1 
ATOM   374  O "O3'" . DT  B 2 2   ? 44.499 15.989  16.963  1.00 80.18  ? 12  DT  X "O3'" 1 
ATOM   375  C "C2'" . DT  B 2 2   ? 46.751 15.758  16.156  1.00 83.23  ? 12  DT  X "C2'" 1 
ATOM   376  C "C1'" . DT  B 2 2   ? 46.410 14.497  15.390  1.00 85.03  ? 12  DT  X "C1'" 1 
ATOM   377  N N1    . DT  B 2 2   ? 47.522 13.715  14.831  1.00 85.71  ? 12  DT  X N1    1 
ATOM   378  C C2    . DT  B 2 2   ? 47.394 12.347  14.853  1.00 86.71  ? 12  DT  X C2    1 
ATOM   379  O O2    . DT  B 2 2   ? 46.404 11.778  15.276  1.00 86.26  ? 12  DT  X O2    1 
ATOM   380  N N3    . DT  B 2 2   ? 48.471 11.664  14.358  1.00 87.65  ? 12  DT  X N3    1 
ATOM   381  C C4    . DT  B 2 2   ? 49.634 12.200  13.855  1.00 87.13  ? 12  DT  X C4    1 
ATOM   382  O O4    . DT  B 2 2   ? 50.522 11.460  13.463  1.00 88.99  ? 12  DT  X O4    1 
ATOM   383  C C5    . DT  B 2 2   ? 49.698 13.639  13.846  1.00 86.91  ? 12  DT  X C5    1 
ATOM   384  C C7    . DT  B 2 2   ? 50.925 14.304  13.310  1.00 86.70  ? 12  DT  X C7    1 
ATOM   385  C C6    . DT  B 2 2   ? 48.649 14.319  14.325  1.00 86.70  ? 12  DT  X C6    1 
ATOM   386  P P     . DA  B 2 3   ? 43.820 16.951  18.050  1.00 76.23  ? 11  DA  X P     1 
ATOM   387  O OP1   . DA  B 2 3   ? 43.565 18.283  17.452  1.00 76.76  ? 11  DA  X OP1   1 
ATOM   388  O OP2   . DA  B 2 3   ? 44.556 16.842  19.335  1.00 71.93  ? 11  DA  X OP2   1 
ATOM   389  O "O5'" . DA  B 2 3   ? 42.404 16.284  18.242  1.00 74.76  ? 11  DA  X "O5'" 1 
ATOM   390  C "C5'" . DA  B 2 3   ? 42.092 15.668  19.463  1.00 72.69  ? 11  DA  X "C5'" 1 
ATOM   391  C "C4'" . DA  B 2 3   ? 41.666 14.247  19.222  1.00 68.53  ? 11  DA  X "C4'" 1 
ATOM   392  O "O4'" . DA  B 2 3   ? 42.739 13.556  18.545  1.00 66.80  ? 11  DA  X "O4'" 1 
ATOM   393  C "C3'" . DA  B 2 3   ? 41.497 13.531  20.546  1.00 65.94  ? 11  DA  X "C3'" 1 
ATOM   394  O "O3'" . DA  B 2 3   ? 40.483 12.558  20.477  1.00 60.00  ? 11  DA  X "O3'" 1 
ATOM   395  C "C2'" . DA  B 2 3   ? 42.873 12.963  20.826  1.00 67.67  ? 11  DA  X "C2'" 1 
ATOM   396  C "C1'" . DA  B 2 3   ? 43.385 12.646  19.435  1.00 69.46  ? 11  DA  X "C1'" 1 
ATOM   397  N N9    . DA  B 2 3   ? 44.824 12.844  19.278  1.00 71.53  ? 11  DA  X N9    1 
ATOM   398  C C8    . DA  B 2 3   ? 45.514 14.023  19.406  1.00 73.48  ? 11  DA  X C8    1 
ATOM   399  N N7    . DA  B 2 3   ? 46.789 13.924  19.117  1.00 73.26  ? 11  DA  X N7    1 
ATOM   400  C C5    . DA  B 2 3   ? 46.952 12.587  18.794  1.00 71.94  ? 11  DA  X C5    1 
ATOM   401  C C6    . DA  B 2 3   ? 48.065 11.856  18.383  1.00 71.70  ? 11  DA  X C6    1 
ATOM   402  N N6    . DA  B 2 3   ? 49.273 12.392  18.216  1.00 71.83  ? 11  DA  X N6    1 
ATOM   403  N N1    . DA  B 2 3   ? 47.898 10.540  18.146  1.00 70.11  ? 11  DA  X N1    1 
ATOM   404  C C2    . DA  B 2 3   ? 46.683 10.009  18.316  1.00 69.59  ? 11  DA  X C2    1 
ATOM   405  N N3    . DA  B 2 3   ? 45.556 10.594  18.695  1.00 69.79  ? 11  DA  X N3    1 
ATOM   406  C C4    . DA  B 2 3   ? 45.758 11.903  18.917  1.00 71.50  ? 11  DA  X C4    1 
ATOM   407  P P     . DG  B 2 4   ? 39.781 12.110  21.825  1.00 56.71  ? 10  DG  X P     1 
ATOM   408  O OP1   . DG  B 2 4   ? 38.344 11.834  21.606  1.00 60.91  ? 10  DG  X OP1   1 
ATOM   409  O OP2   . DG  B 2 4   ? 40.201 13.079  22.867  1.00 55.31  ? 10  DG  X OP2   1 
ATOM   410  O "O5'" . DG  B 2 4   ? 40.468 10.724  22.124  1.00 56.96  ? 10  DG  X "O5'" 1 
ATOM   411  C "C5'" . DG  B 2 4   ? 41.470 10.631  23.096  1.00 56.89  ? 10  DG  X "C5'" 1 
ATOM   412  C "C4'" . DG  B 2 4   ? 42.277 9.397   22.836  1.00 55.03  ? 10  DG  X "C4'" 1 
ATOM   413  O "O4'" . DG  B 2 4   ? 43.446 9.755   22.054  1.00 57.10  ? 10  DG  X "O4'" 1 
ATOM   414  C "C3'" . DG  B 2 4   ? 42.823 8.892   24.156  1.00 54.89  ? 10  DG  X "C3'" 1 
ATOM   415  O "O3'" . DG  B 2 4   ? 43.017 7.519   24.003  1.00 54.27  ? 10  DG  X "O3'" 1 
ATOM   416  C "C2'" . DG  B 2 4   ? 44.152 9.602   24.287  1.00 56.14  ? 10  DG  X "C2'" 1 
ATOM   417  C "C1'" . DG  B 2 4   ? 44.608 9.589   22.848  1.00 57.18  ? 10  DG  X "C1'" 1 
ATOM   418  N N9    . DG  B 2 4   ? 45.610 10.576  22.461  1.00 59.28  ? 10  DG  X N9    1 
ATOM   419  C C8    . DG  B 2 4   ? 45.550 11.945  22.575  1.00 60.04  ? 10  DG  X C8    1 
ATOM   420  N N7    . DG  B 2 4   ? 46.648 12.540  22.185  1.00 59.92  ? 10  DG  X N7    1 
ATOM   421  C C5    . DG  B 2 4   ? 47.476 11.502  21.782  1.00 60.67  ? 10  DG  X C5    1 
ATOM   422  C C6    . DG  B 2 4   ? 48.793 11.525  21.272  1.00 59.83  ? 10  DG  X C6    1 
ATOM   423  O O6    . DG  B 2 4   ? 49.521 12.498  21.072  1.00 60.04  ? 10  DG  X O6    1 
ATOM   424  N N1    . DG  B 2 4   ? 49.250 10.247  20.981  1.00 60.24  ? 10  DG  X N1    1 
ATOM   425  C C2    . DG  B 2 4   ? 48.532 9.087   21.160  1.00 60.31  ? 10  DG  X C2    1 
ATOM   426  N N2    . DG  B 2 4   ? 49.140 7.946   20.810  1.00 60.01  ? 10  DG  X N2    1 
ATOM   427  N N3    . DG  B 2 4   ? 47.308 9.049   21.645  1.00 59.81  ? 10  DG  X N3    1 
ATOM   428  C C4    . DG  B 2 4   ? 46.843 10.285  21.932  1.00 60.76  ? 10  DG  X C4    1 
ATOM   429  P P     . DA  B 2 5   ? 42.797 6.556   25.239  1.00 54.56  ? 9   DA  X P     1 
ATOM   430  O OP1   . DA  B 2 5   ? 41.356 6.236   25.374  1.00 54.72  ? 9   DA  X OP1   1 
ATOM   431  O OP2   . DA  B 2 5   ? 43.542 7.091   26.399  1.00 57.50  ? 9   DA  X OP2   1 
ATOM   432  O "O5'" . DA  B 2 5   ? 43.570 5.285   24.709  1.00 59.03  ? 9   DA  X "O5'" 1 
ATOM   433  C "C5'" . DA  B 2 5   ? 43.954 5.215   23.341  1.00 57.15  ? 9   DA  X "C5'" 1 
ATOM   434  C "C4'" . DA  B 2 5   ? 45.156 4.323   23.210  1.00 56.76  ? 9   DA  X "C4'" 1 
ATOM   435  O "O4'" . DA  B 2 5   ? 46.337 5.137   23.050  1.00 55.89  ? 9   DA  X "O4'" 1 
ATOM   436  C "C3'" . DA  B 2 5   ? 45.365 3.550   24.499  1.00 57.01  ? 9   DA  X "C3'" 1 
ATOM   437  O "O3'" . DA  B 2 5   ? 45.954 2.295   24.213  1.00 60.18  ? 9   DA  X "O3'" 1 
ATOM   438  C "C2'" . DA  B 2 5   ? 46.254 4.476   25.306  1.00 57.91  ? 9   DA  X "C2'" 1 
ATOM   439  C "C1'" . DA  B 2 5   ? 47.122 5.121   24.232  1.00 57.36  ? 9   DA  X "C1'" 1 
ATOM   440  N N9    . DA  B 2 5   ? 47.519 6.503   24.496  1.00 57.49  ? 9   DA  X N9    1 
ATOM   441  C C8    . DA  B 2 5   ? 46.785 7.480   25.115  1.00 60.21  ? 9   DA  X C8    1 
ATOM   442  N N7    . DA  B 2 5   ? 47.378 8.651   25.138  1.00 60.77  ? 9   DA  X N7    1 
ATOM   443  C C5    . DA  B 2 5   ? 48.586 8.422   24.505  1.00 59.09  ? 9   DA  X C5    1 
ATOM   444  C C6    . DA  B 2 5   ? 49.660 9.261   24.200  1.00 58.97  ? 9   DA  X C6    1 
ATOM   445  N N6    . DA  B 2 5   ? 49.693 10.560  24.487  1.00 58.17  ? 9   DA  X N6    1 
ATOM   446  N N1    . DA  B 2 5   ? 50.719 8.715   23.573  1.00 60.21  ? 9   DA  X N1    1 
ATOM   447  C C2    . DA  B 2 5   ? 50.684 7.418   23.270  1.00 59.08  ? 9   DA  X C2    1 
ATOM   448  N N3    . DA  B 2 5   ? 49.729 6.530   23.494  1.00 59.48  ? 9   DA  X N3    1 
ATOM   449  C C4    . DA  B 2 5   ? 48.694 7.100   24.122  1.00 57.89  ? 9   DA  X C4    1 
ATOM   450  P P     . DT  B 2 6   ? 46.208 1.263   25.398  1.00 62.56  ? 8   DT  X P     1 
ATOM   451  O OP1   . DT  B 2 6   ? 45.695 -0.057  24.970  1.00 64.93  ? 8   DT  X OP1   1 
ATOM   452  O OP2   . DT  B 2 6   ? 45.715 1.876   26.659  1.00 63.97  ? 8   DT  X OP2   1 
ATOM   453  O "O5'" . DT  B 2 6   ? 47.789 1.198   25.449  1.00 63.35  ? 8   DT  X "O5'" 1 
ATOM   454  C "C5'" . DT  B 2 6   ? 48.551 2.346   25.120  1.00 64.18  ? 8   DT  X "C5'" 1 
ATOM   455  C "C4'" . DT  B 2 6   ? 50.014 1.997   25.107  1.00 64.57  ? 8   DT  X "C4'" 1 
ATOM   456  O "O4'" . DT  B 2 6   ? 50.734 3.248   25.034  1.00 64.73  ? 8   DT  X "O4'" 1 
ATOM   457  C "C3'" . DT  B 2 6   ? 50.448 1.351   26.415  1.00 65.52  ? 8   DT  X "C3'" 1 
ATOM   458  O "O3'" . DT  B 2 6   ? 51.492 0.401   26.224  1.00 68.18  ? 8   DT  X "O3'" 1 
ATOM   459  C "C2'" . DT  B 2 6   ? 50.816 2.535   27.286  1.00 64.92  ? 8   DT  X "C2'" 1 
ATOM   460  C "C1'" . DT  B 2 6   ? 51.336 3.559   26.286  1.00 63.63  ? 8   DT  X "C1'" 1 
ATOM   461  N N1    . DT  B 2 6   ? 50.950 4.943   26.619  1.00 60.99  ? 8   DT  X N1    1 
ATOM   462  C C2    . DT  B 2 6   ? 51.716 5.966   26.119  1.00 60.10  ? 8   DT  X C2    1 
ATOM   463  O O2    . DT  B 2 6   ? 52.699 5.777   25.419  1.00 60.73  ? 8   DT  X O2    1 
ATOM   464  N N3    . DT  B 2 6   ? 51.289 7.227   26.469  1.00 59.59  ? 8   DT  X N3    1 
ATOM   465  C C4    . DT  B 2 6   ? 50.201 7.548   27.260  1.00 59.68  ? 8   DT  X C4    1 
ATOM   466  O O4    . DT  B 2 6   ? 49.947 8.718   27.502  1.00 58.73  ? 8   DT  X O4    1 
ATOM   467  C C5    . DT  B 2 6   ? 49.440 6.422   27.752  1.00 60.95  ? 8   DT  X C5    1 
ATOM   468  C C7    . DT  B 2 6   ? 48.245 6.675   28.616  1.00 59.08  ? 8   DT  X C7    1 
ATOM   469  C C6    . DT  B 2 6   ? 49.846 5.192   27.410  1.00 60.65  ? 8   DT  X C6    1 
ATOM   470  P P     . DC  B 2 7   ? 51.774 -0.702  27.363  1.00 70.07  ? 7   DC  X P     1 
ATOM   471  O OP1   . DC  B 2 7   ? 52.221 -1.968  26.728  1.00 71.82  ? 7   DC  X OP1   1 
ATOM   472  O OP2   . DC  B 2 7   ? 50.628 -0.726  28.305  1.00 69.04  ? 7   DC  X OP2   1 
ATOM   473  O "O5'" . DC  B 2 7   ? 53.022 -0.076  28.115  1.00 70.61  ? 7   DC  X "O5'" 1 
ATOM   474  C "C5'" . DC  B 2 7   ? 54.102 0.502   27.385  1.00 69.88  ? 7   DC  X "C5'" 1 
ATOM   475  C "C4'" . DC  B 2 7   ? 55.212 0.846   28.344  1.00 70.02  ? 7   DC  X "C4'" 1 
ATOM   476  O "O4'" . DC  B 2 7   ? 55.025 2.229   28.745  1.00 68.40  ? 7   DC  X "O4'" 1 
ATOM   477  C "C3'" . DC  B 2 7   ? 54.995 0.014   29.607  1.00 70.80  ? 7   DC  X "C3'" 1 
ATOM   478  O "O3'" . DC  B 2 7   ? 56.152 -0.424  30.301  1.00 73.31  ? 7   DC  X "O3'" 1 
ATOM   479  C "C2'" . DC  B 2 7   ? 54.121 0.898   30.464  1.00 69.90  ? 7   DC  X "C2'" 1 
ATOM   480  C "C1'" . DC  B 2 7   ? 54.597 2.296   30.101  1.00 67.49  ? 7   DC  X "C1'" 1 
ATOM   481  N N1    . DC  B 2 7   ? 53.506 3.281   30.216  1.00 65.11  ? 7   DC  X N1    1 
ATOM   482  C C2    . DC  B 2 7   ? 53.677 4.598   29.753  1.00 63.48  ? 7   DC  X C2    1 
ATOM   483  O O2    . DC  B 2 7   ? 54.744 4.928   29.217  1.00 58.88  ? 7   DC  X O2    1 
ATOM   484  N N3    . DC  B 2 7   ? 52.656 5.478   29.911  1.00 64.97  ? 7   DC  X N3    1 
ATOM   485  C C4    . DC  B 2 7   ? 51.512 5.088   30.498  1.00 65.68  ? 7   DC  X C4    1 
ATOM   486  N N4    . DC  B 2 7   ? 50.531 5.982   30.645  1.00 66.44  ? 7   DC  X N4    1 
ATOM   487  C C5    . DC  B 2 7   ? 51.321 3.761   30.963  1.00 65.46  ? 7   DC  X C5    1 
ATOM   488  C C6    . DC  B 2 7   ? 52.327 2.903   30.801  1.00 65.55  ? 7   DC  X C6    1 
ATOM   489  P P     . DA  B 2 8   ? 55.970 -1.464  31.525  1.00 76.64  ? 6   DA  X P     1 
ATOM   490  O OP1   . DA  B 2 8   ? 56.730 -2.697  31.207  1.00 76.78  ? 6   DA  X OP1   1 
ATOM   491  O OP2   . DA  B 2 8   ? 54.532 -1.578  31.875  1.00 74.28  ? 6   DA  X OP2   1 
ATOM   492  O "O5'" . DA  B 2 8   ? 56.706 -0.707  32.713  1.00 77.81  ? 6   DA  X "O5'" 1 
ATOM   493  C "C5'" . DA  B 2 8   ? 57.873 0.065   32.448  1.00 81.29  ? 6   DA  X "C5'" 1 
ATOM   494  C "C4'" . DA  B 2 8   ? 58.391 0.671   33.727  1.00 84.31  ? 6   DA  X "C4'" 1 
ATOM   495  O "O4'" . DA  B 2 8   ? 57.526 1.768   34.095  1.00 85.11  ? 6   DA  X "O4'" 1 
ATOM   496  C "C3'" . DA  B 2 8   ? 58.323 -0.314  34.892  1.00 86.56  ? 6   DA  X "C3'" 1 
ATOM   497  O "O3'" . DA  B 2 8   ? 59.376 -0.066  35.836  1.00 87.16  ? 6   DA  X "O3'" 1 
ATOM   498  C "C2'" . DA  B 2 8   ? 56.930 -0.082  35.451  1.00 86.35  ? 6   DA  X "C2'" 1 
ATOM   499  C "C1'" . DA  B 2 8   ? 56.737 1.415   35.228  1.00 87.22  ? 6   DA  X "C1'" 1 
ATOM   500  N N9    . DA  B 2 8   ? 55.362 1.850   34.967  1.00 88.32  ? 6   DA  X N9    1 
ATOM   501  C C8    . DA  B 2 8   ? 54.265 1.100   34.600  1.00 87.20  ? 6   DA  X C8    1 
ATOM   502  N N7    . DA  B 2 8   ? 53.174 1.807   34.437  1.00 86.68  ? 6   DA  X N7    1 
ATOM   503  C C5    . DA  B 2 8   ? 53.576 3.107   34.716  1.00 88.41  ? 6   DA  X C5    1 
ATOM   504  C C6    . DA  B 2 8   ? 52.888 4.330   34.720  1.00 89.01  ? 6   DA  X C6    1 
ATOM   505  N N6    . DA  B 2 8   ? 51.594 4.450   34.420  1.00 89.71  ? 6   DA  X N6    1 
ATOM   506  N N1    . DA  B 2 8   ? 53.584 5.443   35.045  1.00 89.52  ? 6   DA  X N1    1 
ATOM   507  C C2    . DA  B 2 8   ? 54.881 5.324   35.340  1.00 88.99  ? 6   DA  X C2    1 
ATOM   508  N N3    . DA  B 2 8   ? 55.638 4.235   35.370  1.00 89.35  ? 6   DA  X N3    1 
ATOM   509  C C4    . DA  B 2 8   ? 54.918 3.147   35.045  1.00 88.72  ? 6   DA  X C4    1 
ATOM   510  P P     . DC  B 2 9   ? 59.529 -1.007  37.132  1.00 86.56  ? 5   DC  X P     1 
ATOM   511  O OP1   . DC  B 2 9   ? 60.932 -1.483  37.181  1.00 87.25  ? 5   DC  X OP1   1 
ATOM   512  O OP2   . DC  B 2 9   ? 58.405 -1.986  37.189  1.00 83.70  ? 5   DC  X OP2   1 
ATOM   513  O "O5'" . DC  B 2 9   ? 59.337 0.037   38.306  1.00 87.84  ? 5   DC  X "O5'" 1 
ATOM   514  C "C5'" . DC  B 2 9   ? 58.381 1.060   38.150  1.00 89.23  ? 5   DC  X "C5'" 1 
ATOM   515  C "C4'" . DC  B 2 9   ? 58.626 2.183   39.121  1.00 89.24  ? 5   DC  X "C4'" 1 
ATOM   516  O "O4'" . DC  B 2 9   ? 57.573 3.141   38.906  1.00 90.95  ? 5   DC  X "O4'" 1 
ATOM   517  C "C3'" . DC  B 2 9   ? 58.545 1.810   40.596  1.00 88.82  ? 5   DC  X "C3'" 1 
ATOM   518  O "O3'" . DC  B 2 9   ? 59.287 2.801   41.317  1.00 86.92  ? 5   DC  X "O3'" 1 
ATOM   519  C "C2'" . DC  B 2 9   ? 57.055 1.914   40.868  1.00 89.35  ? 5   DC  X "C2'" 1 
ATOM   520  C "C1'" . DC  B 2 9   ? 56.618 3.060   39.955  1.00 91.11  ? 5   DC  X "C1'" 1 
ATOM   521  N N1    . DC  B 2 9   ? 55.306 2.867   39.312  1.00 91.63  ? 5   DC  X N1    1 
ATOM   522  C C2    . DC  B 2 9   ? 54.720 3.963   38.691  1.00 91.43  ? 5   DC  X C2    1 
ATOM   523  O O2    . DC  B 2 9   ? 55.320 5.049   38.718  1.00 91.18  ? 5   DC  X O2    1 
ATOM   524  N N3    . DC  B 2 9   ? 53.521 3.816   38.077  1.00 91.47  ? 5   DC  X N3    1 
ATOM   525  C C4    . DC  B 2 9   ? 52.914 2.627   38.076  1.00 90.18  ? 5   DC  X C4    1 
ATOM   526  N N4    . DC  B 2 9   ? 51.730 2.534   37.462  1.00 88.05  ? 5   DC  X N4    1 
ATOM   527  C C5    . DC  B 2 9   ? 53.492 1.486   38.706  1.00 89.48  ? 5   DC  X C5    1 
ATOM   528  C C6    . DC  B 2 9   ? 54.678 1.649   39.308  1.00 90.21  ? 5   DC  X C6    1 
ATOM   529  P P     . DA  B 2 10  ? 59.736 2.554   42.844  1.00 84.29  ? 4   DA  X P     1 
ATOM   530  O OP1   . DA  B 2 10  ? 61.159 2.148   42.782  1.00 84.42  ? 4   DA  X OP1   1 
ATOM   531  O OP2   . DA  B 2 10  ? 58.760 1.714   43.593  1.00 82.65  ? 4   DA  X OP2   1 
ATOM   532  O "O5'" . DA  B 2 10  ? 59.678 4.032   43.425  1.00 83.12  ? 4   DA  X "O5'" 1 
ATOM   533  C "C5'" . DA  B 2 10  ? 60.079 5.129   42.604  1.00 81.91  ? 4   DA  X "C5'" 1 
ATOM   534  C "C4'" . DA  B 2 10  ? 59.261 6.364   42.910  1.00 81.10  ? 4   DA  X "C4'" 1 
ATOM   535  O "O4'" . DA  B 2 10  ? 57.893 6.180   42.456  1.00 81.36  ? 4   DA  X "O4'" 1 
ATOM   536  C "C3'" . DA  B 2 10  ? 59.149 6.613   44.413  1.00 79.38  ? 4   DA  X "C3'" 1 
ATOM   537  O "O3'" . DA  B 2 10  ? 59.047 8.013   44.681  1.00 76.47  ? 4   DA  X "O3'" 1 
ATOM   538  C "C2'" . DA  B 2 10  ? 57.894 5.847   44.796  1.00 79.86  ? 4   DA  X "C2'" 1 
ATOM   539  C "C1'" . DA  B 2 10  ? 57.016 6.071   43.575  1.00 81.15  ? 4   DA  X "C1'" 1 
ATOM   540  N N9    . DA  B 2 10  ? 56.003 5.049   43.297  1.00 81.45  ? 4   DA  X N9    1 
ATOM   541  C C8    . DA  B 2 10  ? 56.050 3.715   43.605  1.00 82.56  ? 4   DA  X C8    1 
ATOM   542  N N7    . DA  B 2 10  ? 54.979 3.048   43.245  1.00 82.16  ? 4   DA  X N7    1 
ATOM   543  C C5    . DA  B 2 10  ? 54.173 4.008   42.651  1.00 80.87  ? 4   DA  X C5    1 
ATOM   544  C C6    . DA  B 2 10  ? 52.907 3.934   42.053  1.00 80.05  ? 4   DA  X C6    1 
ATOM   545  N N6    . DA  B 2 10  ? 52.202 2.806   41.952  1.00 78.43  ? 4   DA  X N6    1 
ATOM   546  N N1    . DA  B 2 10  ? 52.382 5.071   41.555  1.00 79.88  ? 4   DA  X N1    1 
ATOM   547  C C2    . DA  B 2 10  ? 53.091 6.201   41.655  1.00 79.69  ? 4   DA  X C2    1 
ATOM   548  N N3    . DA  B 2 10  ? 54.291 6.398   42.191  1.00 80.72  ? 4   DA  X N3    1 
ATOM   549  C C4    . DA  B 2 10  ? 54.788 5.246   42.677  1.00 81.55  ? 4   DA  X C4    1 
ATOM   550  P P     . DT  B 2 11  ? 58.495 8.512   46.102  1.00 75.50  ? 3   DT  X P     1 
ATOM   551  O OP1   . DT  B 2 11  ? 58.935 9.918   46.250  1.00 75.84  ? 3   DT  X OP1   1 
ATOM   552  O OP2   . DT  B 2 11  ? 58.818 7.520   47.155  1.00 74.46  ? 3   DT  X OP2   1 
ATOM   553  O "O5'" . DT  B 2 11  ? 56.920 8.492   45.908  1.00 77.03  ? 3   DT  X "O5'" 1 
ATOM   554  C "C5'" . DT  B 2 11  ? 56.350 8.938   44.688  1.00 78.75  ? 3   DT  X "C5'" 1 
ATOM   555  C "C4'" . DT  B 2 11  ? 55.039 9.632   44.952  1.00 79.69  ? 3   DT  X "C4'" 1 
ATOM   556  O "O4'" . DT  B 2 11  ? 53.944 8.727   44.669  1.00 81.74  ? 3   DT  X "O4'" 1 
ATOM   557  C "C3'" . DT  B 2 11  ? 54.880 10.001  46.422  1.00 79.75  ? 3   DT  X "C3'" 1 
ATOM   558  O "O3'" . DT  B 2 11  ? 54.151 11.223  46.517  1.00 80.21  ? 3   DT  X "O3'" 1 
ATOM   559  C "C2'" . DT  B 2 11  ? 54.193 8.781   47.017  1.00 79.36  ? 3   DT  X "C2'" 1 
ATOM   560  C "C1'" . DT  B 2 11  ? 53.291 8.338   45.875  1.00 80.83  ? 3   DT  X "C1'" 1 
ATOM   561  N N1    . DT  B 2 11  ? 52.956 6.893   45.776  1.00 81.67  ? 3   DT  X N1    1 
ATOM   562  C C2    . DT  B 2 11  ? 51.704 6.559   45.287  1.00 81.88  ? 3   DT  X C2    1 
ATOM   563  O O2    . DT  B 2 11  ? 50.878 7.388   44.934  1.00 82.09  ? 3   DT  X O2    1 
ATOM   564  N N3    . DT  B 2 11  ? 51.450 5.210   45.229  1.00 82.17  ? 3   DT  X N3    1 
ATOM   565  C C4    . DT  B 2 11  ? 52.298 4.183   45.600  1.00 82.61  ? 3   DT  X C4    1 
ATOM   566  O O4    . DT  B 2 11  ? 51.930 3.013   45.497  1.00 81.72  ? 3   DT  X O4    1 
ATOM   567  C C5    . DT  B 2 11  ? 53.588 4.598   46.098  1.00 82.10  ? 3   DT  X C5    1 
ATOM   568  C C7    . DT  B 2 11  ? 54.561 3.546   46.525  1.00 81.00  ? 3   DT  X C7    1 
ATOM   569  C C6    . DT  B 2 11  ? 53.854 5.915   46.158  1.00 81.68  ? 3   DT  X C6    1 
ATOM   570  P P     . DT  B 2 12  ? 53.291 11.545  47.825  1.00 81.42  ? 2   DT  X P     1 
ATOM   571  O OP1   . DT  B 2 12  ? 52.961 12.998  47.802  1.00 79.51  ? 2   DT  X OP1   1 
ATOM   572  O OP2   . DT  B 2 12  ? 53.875 10.935  49.050  1.00 81.14  ? 2   DT  X OP2   1 
ATOM   573  O "O5'" . DT  B 2 12  ? 51.966 10.742  47.536  1.00 79.55  ? 2   DT  X "O5'" 1 
ATOM   574  C "C5'" . DT  B 2 12  ? 50.772 11.150  48.124  1.00 76.13  ? 2   DT  X "C5'" 1 
ATOM   575  C "C4'" . DT  B 2 12  ? 49.668 11.090  47.107  1.00 71.58  ? 2   DT  X "C4'" 1 
ATOM   576  O "O4'" . DT  B 2 12  ? 49.693 9.779   46.504  1.00 72.01  ? 2   DT  X "O4'" 1 
ATOM   577  C "C3'" . DT  B 2 12  ? 48.324 11.204  47.791  1.00 69.71  ? 2   DT  X "C3'" 1 
ATOM   578  O "O3'" . DT  B 2 12  ? 47.381 11.846  46.946  1.00 64.09  ? 2   DT  X "O3'" 1 
ATOM   579  C "C2'" . DT  B 2 12  ? 48.001 9.765   48.144  1.00 70.07  ? 2   DT  X "C2'" 1 
ATOM   580  C "C1'" . DT  B 2 12  ? 48.620 8.991   46.994  1.00 70.74  ? 2   DT  X "C1'" 1 
ATOM   581  N N1    . DT  B 2 12  ? 49.180 7.705   47.407  1.00 70.78  ? 2   DT  X N1    1 
ATOM   582  C C2    . DT  B 2 12  ? 48.440 6.585   47.167  1.00 71.62  ? 2   DT  X C2    1 
ATOM   583  O O2    . DT  B 2 12  ? 47.347 6.620   46.647  1.00 72.46  ? 2   DT  X O2    1 
ATOM   584  N N3    . DT  B 2 12  ? 49.026 5.414   47.567  1.00 73.33  ? 2   DT  X N3    1 
ATOM   585  C C4    . DT  B 2 12  ? 50.254 5.260   48.171  1.00 73.11  ? 2   DT  X C4    1 
ATOM   586  O O4    . DT  B 2 12  ? 50.651 4.139   48.464  1.00 74.64  ? 2   DT  X O4    1 
ATOM   587  C C5    . DT  B 2 12  ? 50.981 6.484   48.402  1.00 72.50  ? 2   DT  X C5    1 
ATOM   588  C C7    . DT  B 2 12  ? 52.323 6.418   49.055  1.00 72.87  ? 2   DT  X C7    1 
ATOM   589  C C6    . DT  B 2 12  ? 50.415 7.634   48.015  1.00 72.04  ? 2   DT  X C6    1 
ATOM   590  P P     . DT  B 2 13  ? 46.149 12.606  47.612  1.00 62.23  ? 1   DT  X P     1 
ATOM   591  O OP1   . DT  B 2 13  ? 45.936 13.888  46.901  1.00 62.04  ? 1   DT  X OP1   1 
ATOM   592  O OP2   . DT  B 2 13  ? 46.422 12.595  49.074  1.00 62.10  ? 1   DT  X OP2   1 
ATOM   593  O "O5'" . DT  B 2 13  ? 44.941 11.614  47.342  1.00 59.36  ? 1   DT  X "O5'" 1 
ATOM   594  C "C5'" . DT  B 2 13  ? 45.194 10.227  47.375  1.00 56.13  ? 1   DT  X "C5'" 1 
ATOM   595  C "C4'" . DT  B 2 13  ? 43.934 9.440   47.154  1.00 55.04  ? 1   DT  X "C4'" 1 
ATOM   596  O "O4'" . DT  B 2 13  ? 44.341 8.055   47.218  1.00 57.20  ? 1   DT  X "O4'" 1 
ATOM   597  C "C3'" . DT  B 2 13  ? 42.888 9.607   48.250  1.00 52.11  ? 1   DT  X "C3'" 1 
ATOM   598  O "O3'" . DT  B 2 13  ? 41.588 9.409   47.699  1.00 49.57  ? 1   DT  X "O3'" 1 
ATOM   599  C "C2'" . DT  B 2 13  ? 43.295 8.557   49.269  1.00 54.33  ? 1   DT  X "C2'" 1 
ATOM   600  C "C1'" . DT  B 2 13  ? 43.876 7.443   48.408  1.00 57.06  ? 1   DT  X "C1'" 1 
ATOM   601  N N1    . DT  B 2 13  ? 45.014 6.704   48.987  1.00 59.34  ? 1   DT  X N1    1 
ATOM   602  C C2    . DT  B 2 13  ? 44.944 5.323   49.032  1.00 60.76  ? 1   DT  X C2    1 
ATOM   603  O O2    . DT  B 2 13  ? 43.974 4.686   48.634  1.00 63.61  ? 1   DT  X O2    1 
ATOM   604  N N3    . DT  B 2 13  ? 46.053 4.711   49.563  1.00 59.61  ? 1   DT  X N3    1 
ATOM   605  C C4    . DT  B 2 13  ? 47.193 5.323   50.043  1.00 59.60  ? 1   DT  X C4    1 
ATOM   606  O O4    . DT  B 2 13  ? 48.114 4.644   50.480  1.00 59.72  ? 1   DT  X O4    1 
ATOM   607  C C5    . DT  B 2 13  ? 47.194 6.765   49.977  1.00 59.84  ? 1   DT  X C5    1 
ATOM   608  C C7    . DT  B 2 13  ? 48.388 7.507   50.483  1.00 59.51  ? 1   DT  X C7    1 
ATOM   609  C C6    . DT  B 2 13  ? 46.119 7.378   49.458  1.00 59.95  ? 1   DT  X C6    1 
ATOM   610  P P     . DT  B 2 14  ? 40.340 9.131   48.664  1.00 50.15  ? -1  DT  X P     1 
ATOM   611  O OP1   . DT  B 2 14  ? 39.099 9.517   47.951  1.00 50.24  ? -1  DT  X OP1   1 
ATOM   612  O OP2   . DT  B 2 14  ? 40.626 9.727   49.978  1.00 52.49  ? -1  DT  X OP2   1 
ATOM   613  O "O5'" . DT  B 2 14  ? 40.362 7.544   48.792  1.00 55.38  ? -1  DT  X "O5'" 1 
ATOM   614  C "C5'" . DT  B 2 14  ? 40.610 6.748   47.637  1.00 58.42  ? -1  DT  X "C5'" 1 
ATOM   615  C "C4'" . DT  B 2 14  ? 40.120 5.331   47.830  1.00 62.03  ? -1  DT  X "C4'" 1 
ATOM   616  O "O4'" . DT  B 2 14  ? 41.154 4.526   48.456  1.00 61.20  ? -1  DT  X "O4'" 1 
ATOM   617  C "C3'" . DT  B 2 14  ? 38.902 5.206   48.747  1.00 62.12  ? -1  DT  X "C3'" 1 
ATOM   618  O "O3'" . DT  B 2 14  ? 38.110 4.086   48.311  1.00 64.51  ? -1  DT  X "O3'" 1 
ATOM   619  C "C2'" . DT  B 2 14  ? 39.542 5.017   50.113  1.00 62.47  ? -1  DT  X "C2'" 1 
ATOM   620  C "C1'" . DT  B 2 14  ? 40.771 4.177   49.777  1.00 62.25  ? -1  DT  X "C1'" 1 
ATOM   621  N N1    . DT  B 2 14  ? 41.955 4.325   50.638  1.00 63.43  ? -1  DT  X N1    1 
ATOM   622  C C2    . DT  B 2 14  ? 42.674 3.188   50.930  1.00 64.04  ? -1  DT  X C2    1 
ATOM   623  O O2    . DT  B 2 14  ? 42.340 2.075   50.561  1.00 63.85  ? -1  DT  X O2    1 
ATOM   624  N N3    . DT  B 2 14  ? 43.807 3.403   51.674  1.00 65.53  ? -1  DT  X N3    1 
ATOM   625  C C4    . DT  B 2 14  ? 44.279 4.617   52.144  1.00 65.70  ? -1  DT  X C4    1 
ATOM   626  O O4    . DT  B 2 14  ? 45.335 4.670   52.768  1.00 66.54  ? -1  DT  X O4    1 
ATOM   627  C C5    . DT  B 2 14  ? 43.459 5.757   51.832  1.00 64.35  ? -1  DT  X C5    1 
ATOM   628  C C7    . DT  B 2 14  ? 43.887 7.101   52.324  1.00 62.78  ? -1  DT  X C7    1 
ATOM   629  C C6    . DT  B 2 14  ? 42.348 5.559   51.108  1.00 64.04  ? -1  DT  X C6    1 
ATOM   630  P P     . DT  B 2 15  ? 36.918 3.507   49.228  1.00 65.00  ? -2  DT  X P     1 
ATOM   631  O OP1   . DT  B 2 15  ? 35.784 3.301   48.298  1.00 64.27  ? -2  DT  X OP1   1 
ATOM   632  O OP2   . DT  B 2 15  ? 36.713 4.311   50.461  1.00 64.22  ? -2  DT  X OP2   1 
ATOM   633  O "O5'" . DT  B 2 15  ? 37.483 2.075   49.645  1.00 68.31  ? -2  DT  X "O5'" 1 
ATOM   634  C "C5'" . DT  B 2 15  ? 38.390 1.393   48.780  1.00 73.02  ? -2  DT  X "C5'" 1 
ATOM   635  C "C4'" . DT  B 2 15  ? 38.801 0.056   49.355  1.00 77.59  ? -2  DT  X "C4'" 1 
ATOM   636  O "O4'" . DT  B 2 15  ? 39.935 0.188   50.252  1.00 78.37  ? -2  DT  X "O4'" 1 
ATOM   637  C "C3'" . DT  B 2 15  ? 37.712 -0.591  50.202  1.00 80.65  ? -2  DT  X "C3'" 1 
ATOM   638  O "O3'" . DT  B 2 15  ? 37.843 -2.008  50.098  1.00 85.00  ? -2  DT  X "O3'" 1 
ATOM   639  C "C2'" . DT  B 2 15  ? 38.014 -0.077  51.601  1.00 78.70  ? -2  DT  X "C2'" 1 
ATOM   640  C "C1'" . DT  B 2 15  ? 39.535 -0.073  51.593  1.00 78.49  ? -2  DT  X "C1'" 1 
ATOM   641  N N1    . DT  B 2 15  ? 40.226 0.886   52.476  1.00 79.33  ? -2  DT  X N1    1 
ATOM   642  C C2    . DT  B 2 15  ? 41.342 0.448   53.168  1.00 79.87  ? -2  DT  X C2    1 
ATOM   643  O O2    . DT  B 2 15  ? 41.761 -0.700  53.112  1.00 81.72  ? -2  DT  X O2    1 
ATOM   644  N N3    . DT  B 2 15  ? 41.957 1.412   53.930  1.00 78.98  ? -2  DT  X N3    1 
ATOM   645  C C4    . DT  B 2 15  ? 41.578 2.734   54.063  1.00 78.80  ? -2  DT  X C4    1 
ATOM   646  O O4    . DT  B 2 15  ? 42.236 3.493   54.764  1.00 77.11  ? -2  DT  X O4    1 
ATOM   647  C C5    . DT  B 2 15  ? 40.396 3.113   53.330  1.00 78.98  ? -2  DT  X C5    1 
ATOM   648  C C7    . DT  B 2 15  ? 39.909 4.520   53.426  1.00 80.11  ? -2  DT  X C7    1 
ATOM   649  C C6    . DT  B 2 15  ? 39.784 2.183   52.587  1.00 79.69  ? -2  DT  X C6    1 
ATOM   650  P P     . DC  B 2 16  ? 36.886 -2.962  50.953  1.00 88.06  ? -3  DC  X P     1 
ATOM   651  O OP1   . DC  B 2 16  ? 36.580 -4.094  50.041  1.00 87.08  ? -3  DC  X OP1   1 
ATOM   652  O OP2   . DC  B 2 16  ? 35.773 -2.176  51.557  1.00 84.71  ? -3  DC  X OP2   1 
ATOM   653  O "O5'" . DC  B 2 16  ? 37.855 -3.446  52.122  1.00 92.65  ? -3  DC  X "O5'" 1 
ATOM   654  C "C5'" . DC  B 2 16  ? 39.240 -3.701  51.857  1.00 99.07  ? -3  DC  X "C5'" 1 
ATOM   655  C "C4'" . DC  B 2 16  ? 39.900 -4.372  53.041  1.00 103.45 ? -3  DC  X "C4'" 1 
ATOM   656  O "O4'" . DC  B 2 16  ? 40.403 -3.379  53.970  1.00 103.17 ? -3  DC  X "O4'" 1 
ATOM   657  C "C3'" . DC  B 2 16  ? 38.899 -5.204  53.845  1.00 106.68 ? -3  DC  X "C3'" 1 
ATOM   658  O "O3'" . DC  B 2 16  ? 39.578 -6.285  54.500  1.00 111.67 ? -3  DC  X "O3'" 1 
ATOM   659  C "C2'" . DC  B 2 16  ? 38.363 -4.200  54.852  1.00 105.68 ? -3  DC  X "C2'" 1 
ATOM   660  C "C1'" . DC  B 2 16  ? 39.628 -3.416  55.164  1.00 104.69 ? -3  DC  X "C1'" 1 
ATOM   661  N N1    . DC  B 2 16  ? 39.503 -2.050  55.700  1.00 104.17 ? -3  DC  X N1    1 
ATOM   662  C C2    . DC  B 2 16  ? 40.592 -1.532  56.412  1.00 104.01 ? -3  DC  X C2    1 
ATOM   663  O O2    . DC  B 2 16  ? 41.599 -2.246  56.562  1.00 103.53 ? -3  DC  X O2    1 
ATOM   664  N N3    . DC  B 2 16  ? 40.523 -0.279  56.915  1.00 103.55 ? -3  DC  X N3    1 
ATOM   665  C C4    . DC  B 2 16  ? 39.421 0.452   56.733  1.00 103.38 ? -3  DC  X C4    1 
ATOM   666  N N4    . DC  B 2 16  ? 39.408 1.689   57.243  1.00 102.85 ? -3  DC  X N4    1 
ATOM   667  C C5    . DC  B 2 16  ? 38.288 -0.053  56.019  1.00 102.91 ? -3  DC  X C5    1 
ATOM   668  C C6    . DC  B 2 16  ? 38.372 -1.299  55.524  1.00 103.29 ? -3  DC  X C6    1 
ATOM   669  P P     . DG  B 2 17  ? 38.733 -7.434  55.249  1.00 115.04 ? -4  DG  X P     1 
ATOM   670  O OP1   . DG  B 2 17  ? 39.300 -8.716  54.754  1.00 114.38 ? -4  DG  X OP1   1 
ATOM   671  O OP2   . DG  B 2 17  ? 37.270 -7.177  55.138  1.00 113.85 ? -4  DG  X OP2   1 
ATOM   672  O "O5'" . DG  B 2 17  ? 39.138 -7.267  56.780  1.00 116.61 ? -4  DG  X "O5'" 1 
ATOM   673  C "C5'" . DG  B 2 17  ? 40.460 -7.571  57.212  1.00 120.18 ? -4  DG  X "C5'" 1 
ATOM   674  C "C4'" . DG  B 2 17  ? 40.516 -7.679  58.718  1.00 122.36 ? -4  DG  X "C4'" 1 
ATOM   675  O "O4'" . DG  B 2 17  ? 40.416 -6.349  59.289  1.00 122.55 ? -4  DG  X "O4'" 1 
ATOM   676  C "C3'" . DG  B 2 17  ? 39.331 -8.459  59.297  1.00 123.87 ? -4  DG  X "C3'" 1 
ATOM   677  O "O3'" . DG  B 2 17  ? 39.732 -9.164  60.489  1.00 125.56 ? -4  DG  X "O3'" 1 
ATOM   678  C "C2'" . DG  B 2 17  ? 38.295 -7.372  59.527  1.00 123.78 ? -4  DG  X "C2'" 1 
ATOM   679  C "C1'" . DG  B 2 17  ? 39.162 -6.196  59.950  1.00 122.77 ? -4  DG  X "C1'" 1 
ATOM   680  N N9    . DG  B 2 17  ? 38.633 -4.863  59.661  1.00 121.72 ? -4  DG  X N9    1 
ATOM   681  C C8    . DG  B 2 17  ? 37.433 -4.553  59.064  1.00 121.28 ? -4  DG  X C8    1 
ATOM   682  N N7    . DG  B 2 17  ? 37.222 -3.266  58.978  1.00 120.85 ? -4  DG  X N7    1 
ATOM   683  C C5    . DG  B 2 17  ? 38.355 -2.693  59.543  1.00 119.69 ? -4  DG  X C5    1 
ATOM   684  C C6    . DG  B 2 17  ? 38.700 -1.328  59.731  1.00 118.72 ? -4  DG  X C6    1 
ATOM   685  O O6    . DG  B 2 17  ? 38.053 -0.319  59.425  1.00 118.05 ? -4  DG  X O6    1 
ATOM   686  N N1    . DG  B 2 17  ? 39.940 -1.196  60.346  1.00 118.31 ? -4  DG  X N1    1 
ATOM   687  C C2    . DG  B 2 17  ? 40.746 -2.238  60.730  1.00 118.60 ? -4  DG  X C2    1 
ATOM   688  N N2    . DG  B 2 17  ? 41.909 -1.907  61.307  1.00 118.11 ? -4  DG  X N2    1 
ATOM   689  N N3    . DG  B 2 17  ? 40.438 -3.511  60.560  1.00 119.32 ? -4  DG  X N3    1 
ATOM   690  C C4    . DG  B 2 17  ? 39.237 -3.664  59.965  1.00 120.30 ? -4  DG  X C4    1 
ATOM   691  P P     . DA  B 2 18  ? 38.689 -9.396  61.700  1.00 126.81 ? -5  DA  X P     1 
ATOM   692  O OP1   . DA  B 2 18  ? 39.003 -10.728 62.270  1.00 126.83 ? -5  DA  X OP1   1 
ATOM   693  O OP2   . DA  B 2 18  ? 37.292 -9.094  61.284  1.00 126.22 ? -5  DA  X OP2   1 
ATOM   694  O "O5'" . DA  B 2 18  ? 39.155 -8.309  62.768  1.00 127.54 ? -5  DA  X "O5'" 1 
ATOM   695  C "C5'" . DA  B 2 18  ? 40.545 -8.069  62.980  1.00 128.81 ? -5  DA  X "C5'" 1 
ATOM   696  C "C4'" . DA  B 2 18  ? 40.761 -7.092  64.113  1.00 131.15 ? -5  DA  X "C4'" 1 
ATOM   697  O "O4'" . DA  B 2 18  ? 40.327 -5.767  63.715  1.00 131.22 ? -5  DA  X "O4'" 1 
ATOM   698  C "C3'" . DA  B 2 18  ? 39.914 -7.432  65.341  1.00 132.66 ? -5  DA  X "C3'" 1 
ATOM   699  O "O3'" . DA  B 2 18  ? 40.571 -6.948  66.520  1.00 135.44 ? -5  DA  X "O3'" 1 
ATOM   700  C "C2'" . DA  B 2 18  ? 38.626 -6.669  65.085  1.00 131.85 ? -5  DA  X "C2'" 1 
ATOM   701  C "C1'" . DA  B 2 18  ? 39.167 -5.400  64.454  1.00 131.01 ? -5  DA  X "C1'" 1 
ATOM   702  N N9    . DA  B 2 18  ? 38.271 -4.627  63.593  1.00 130.49 ? -5  DA  X N9    1 
ATOM   703  C C8    . DA  B 2 18  ? 37.328 -5.054  62.689  1.00 130.35 ? -5  DA  X C8    1 
ATOM   704  N N7    . DA  B 2 18  ? 36.687 -4.075  62.094  1.00 129.77 ? -5  DA  X N7    1 
ATOM   705  C C5    . DA  B 2 18  ? 37.247 -2.928  62.641  1.00 129.74 ? -5  DA  X C5    1 
ATOM   706  C C6    . DA  B 2 18  ? 37.006 -1.557  62.430  1.00 129.96 ? -5  DA  X C6    1 
ATOM   707  N N6    . DA  B 2 18  ? 36.101 -1.082  61.571  1.00 130.19 ? -5  DA  X N6    1 
ATOM   708  N N1    . DA  B 2 18  ? 37.741 -0.674  63.142  1.00 129.79 ? -5  DA  X N1    1 
ATOM   709  C C2    . DA  B 2 18  ? 38.653 -1.145  64.000  1.00 129.21 ? -5  DA  X C2    1 
ATOM   710  N N3    . DA  B 2 18  ? 38.971 -2.404  64.284  1.00 129.08 ? -5  DA  X N3    1 
ATOM   711  C C4    . DA  B 2 18  ? 38.224 -3.255  63.563  1.00 129.67 ? -5  DA  X C4    1 
ATOM   712  P P     . DA  B 2 19  ? 39.902 -7.179  67.965  1.00 137.21 ? -6  DA  X P     1 
ATOM   713  O OP1   . DA  B 2 19  ? 40.939 -7.821  68.817  1.00 136.78 ? -6  DA  X OP1   1 
ATOM   714  O OP2   . DA  B 2 19  ? 38.583 -7.840  67.783  1.00 137.15 ? -6  DA  X OP2   1 
ATOM   715  O "O5'" . DA  B 2 19  ? 39.666 -5.704  68.521  1.00 137.62 ? -6  DA  X "O5'" 1 
ATOM   716  C "C5'" . DA  B 2 19  ? 40.776 -4.896  68.906  1.00 138.81 ? -6  DA  X "C5'" 1 
ATOM   717  C "C4'" . DA  B 2 19  ? 40.314 -3.611  69.557  1.00 139.82 ? -6  DA  X "C4'" 1 
ATOM   718  O "O4'" . DA  B 2 19  ? 39.604 -2.805  68.580  1.00 140.73 ? -6  DA  X "O4'" 1 
ATOM   719  C "C3'" . DA  B 2 19  ? 39.307 -3.842  70.687  1.00 140.26 ? -6  DA  X "C3'" 1 
ATOM   720  O "O3'" . DA  B 2 19  ? 39.432 -2.804  71.679  1.00 139.96 ? -6  DA  X "O3'" 1 
ATOM   721  C "C2'" . DA  B 2 19  ? 37.972 -3.811  69.964  1.00 140.59 ? -6  DA  X "C2'" 1 
ATOM   722  C "C1'" . DA  B 2 19  ? 38.224 -2.736  68.923  1.00 141.13 ? -6  DA  X "C1'" 1 
ATOM   723  N N9    . DA  B 2 19  ? 37.411 -2.791  67.705  1.00 141.64 ? -6  DA  X N9    1 
ATOM   724  C C8    . DA  B 2 19  ? 36.976 -3.885  66.995  1.00 142.03 ? -6  DA  X C8    1 
ATOM   725  N N7    . DA  B 2 19  ? 36.197 -3.583  65.980  1.00 141.97 ? -6  DA  X N7    1 
ATOM   726  C C5    . DA  B 2 19  ? 36.127 -2.195  66.015  1.00 141.66 ? -6  DA  X C5    1 
ATOM   727  C C6    . DA  B 2 19  ? 35.450 -1.254  65.208  1.00 141.36 ? -6  DA  X C6    1 
ATOM   728  N N6    . DA  B 2 19  ? 34.677 -1.581  64.170  1.00 141.09 ? -6  DA  X N6    1 
ATOM   729  N N1    . DA  B 2 19  ? 35.596 0.054   65.513  1.00 141.23 ? -6  DA  X N1    1 
ATOM   730  C C2    . DA  B 2 19  ? 36.366 0.386   66.558  1.00 141.64 ? -6  DA  X C2    1 
ATOM   731  N N3    . DA  B 2 19  ? 37.046 -0.401  67.392  1.00 141.62 ? -6  DA  X N3    1 
ATOM   732  C C4    . DA  B 2 19  ? 36.882 -1.695  67.062  1.00 141.77 ? -6  DA  X C4    1 
ATOM   733  P P     . DA  B 2 20  ? 38.150 -2.341  72.542  1.00 139.46 ? -7  DA  X P     1 
ATOM   734  O OP1   . DA  B 2 20  ? 38.675 -1.652  73.749  1.00 139.12 ? -7  DA  X OP1   1 
ATOM   735  O OP2   . DA  B 2 20  ? 37.197 -3.470  72.699  1.00 139.42 ? -7  DA  X OP2   1 
ATOM   736  O "O5'" . DA  B 2 20  ? 37.463 -1.237  71.626  1.00 139.06 ? -7  DA  X "O5'" 1 
ATOM   737  C "C5'" . DA  B 2 20  ? 38.216 -0.119  71.167  1.00 138.71 ? -7  DA  X "C5'" 1 
ATOM   738  C "C4'" . DA  B 2 20  ? 37.370 1.132   71.188  1.00 138.57 ? -7  DA  X "C4'" 1 
ATOM   739  O "O4'" . DA  B 2 20  ? 36.458 1.124   70.065  1.00 138.04 ? -7  DA  X "O4'" 1 
ATOM   740  C "C3'" . DA  B 2 20  ? 36.478 1.211   72.422  1.00 138.63 ? -7  DA  X "C3'" 1 
ATOM   741  O "O3'" . DA  B 2 20  ? 36.232 2.583   72.738  1.00 139.58 ? -7  DA  X "O3'" 1 
ATOM   742  C "C2'" . DA  B 2 20  ? 35.217 0.493   71.972  1.00 137.98 ? -7  DA  X "C2'" 1 
ATOM   743  C "C1'" . DA  B 2 20  ? 35.125 0.917   70.515  1.00 137.08 ? -7  DA  X "C1'" 1 
ATOM   744  N N9    . DA  B 2 20  ? 34.479 -0.019  69.595  1.00 135.80 ? -7  DA  X N9    1 
ATOM   745  C C8    . DA  B 2 20  ? 34.536 -1.391  69.562  1.00 135.33 ? -7  DA  X C8    1 
ATOM   746  N N7    . DA  B 2 20  ? 33.854 -1.924  68.575  1.00 134.62 ? -7  DA  X N7    1 
ATOM   747  C C5    . DA  B 2 20  ? 33.309 -0.830  67.918  1.00 134.91 ? -7  DA  X C5    1 
ATOM   748  C C6    . DA  B 2 20  ? 32.484 -0.716  66.785  1.00 134.87 ? -7  DA  X C6    1 
ATOM   749  N N6    . DA  B 2 20  ? 32.044 -1.758  66.072  1.00 134.18 ? -7  DA  X N6    1 
ATOM   750  N N1    . DA  B 2 20  ? 32.121 0.527   66.400  1.00 134.99 ? -7  DA  X N1    1 
ATOM   751  C C2    . DA  B 2 20  ? 32.558 1.574   67.107  1.00 134.72 ? -7  DA  X C2    1 
ATOM   752  N N3    . DA  B 2 20  ? 33.334 1.596   68.183  1.00 134.75 ? -7  DA  X N3    1 
ATOM   753  C C4    . DA  B 2 20  ? 33.680 0.348   68.541  1.00 135.11 ? -7  DA  X C4    1 
ATOM   754  P P     . DT  B 2 21  ? 35.144 2.962   73.855  1.00 140.69 ? -8  DT  X P     1 
ATOM   755  O OP1   . DT  B 2 21  ? 35.723 4.060   74.675  1.00 139.86 ? -8  DT  X OP1   1 
ATOM   756  O OP2   . DT  B 2 21  ? 34.684 1.712   74.517  1.00 140.90 ? -8  DT  X OP2   1 
ATOM   757  O "O5'" . DT  B 2 21  ? 33.931 3.543   73.003  1.00 140.15 ? -8  DT  X "O5'" 1 
ATOM   758  C "C5'" . DT  B 2 21  ? 34.080 4.747   72.256  1.00 139.58 ? -8  DT  X "C5'" 1 
ATOM   759  C "C4'" . DT  B 2 21  ? 32.727 5.347   71.952  1.00 139.38 ? -8  DT  X "C4'" 1 
ATOM   760  O "O4'" . DT  B 2 21  ? 32.068 4.538   70.948  1.00 138.81 ? -8  DT  X "O4'" 1 
ATOM   761  C "C3'" . DT  B 2 21  ? 31.792 5.335   73.161  1.00 139.08 ? -8  DT  X "C3'" 1 
ATOM   762  O "O3'" . DT  B 2 21  ? 30.761 6.320   73.012  1.00 138.75 ? -8  DT  X "O3'" 1 
ATOM   763  C "C2'" . DT  B 2 21  ? 31.132 3.972   73.046  1.00 138.60 ? -8  DT  X "C2'" 1 
ATOM   764  C "C1'" . DT  B 2 21  ? 30.990 3.824   71.535  1.00 138.34 ? -8  DT  X "C1'" 1 
ATOM   765  N N1    . DT  B 2 21  ? 30.993 2.446   70.999  1.00 137.74 ? -8  DT  X N1    1 
ATOM   766  C C2    . DT  B 2 21  ? 30.371 2.235   69.789  1.00 137.44 ? -8  DT  X C2    1 
ATOM   767  O O2    . DT  B 2 21  ? 29.857 3.128   69.139  1.00 137.51 ? -8  DT  X O2    1 
ATOM   768  N N3    . DT  B 2 21  ? 30.372 0.933   69.364  1.00 137.01 ? -8  DT  X N3    1 
ATOM   769  C C4    . DT  B 2 21  ? 30.920 -0.155  70.007  1.00 136.85 ? -8  DT  X C4    1 
ATOM   770  O O4    . DT  B 2 21  ? 30.830 -1.272  69.498  1.00 136.42 ? -8  DT  X O4    1 
ATOM   771  C C5    . DT  B 2 21  ? 31.571 0.138   71.266  1.00 136.98 ? -8  DT  X C5    1 
ATOM   772  C C7    . DT  B 2 21  ? 32.198 -0.979  72.037  1.00 137.31 ? -8  DT  X C7    1 
ATOM   773  C C6    . DT  B 2 21  ? 31.579 1.409   71.691  1.00 137.35 ? -8  DT  X C6    1 
ATOM   774  O "O5'" . DA  C 1 1   ? 2.139  0.518   -18.940 1.00 135.67 ? -8  DA  Y "O5'" 1 
ATOM   775  C "C5'" . DA  C 1 1   ? 2.213  -0.435  -17.883 1.00 135.81 ? -8  DA  Y "C5'" 1 
ATOM   776  C "C4'" . DA  C 1 1   ? 2.990  -1.660  -18.301 1.00 136.20 ? -8  DA  Y "C4'" 1 
ATOM   777  O "O4'" . DA  C 1 1   ? 3.384  -1.493  -19.688 1.00 136.34 ? -8  DA  Y "O4'" 1 
ATOM   778  C "C3'" . DA  C 1 1   ? 4.297  -1.808  -17.527 1.00 136.61 ? -8  DA  Y "C3'" 1 
ATOM   779  O "O3'" . DA  C 1 1   ? 4.674  -3.181  -17.397 1.00 137.13 ? -8  DA  Y "O3'" 1 
ATOM   780  C "C2'" . DA  C 1 1   ? 5.283  -1.016  -18.365 1.00 136.97 ? -8  DA  Y "C2'" 1 
ATOM   781  C "C1'" . DA  C 1 1   ? 4.790  -1.260  -19.784 1.00 136.85 ? -8  DA  Y "C1'" 1 
ATOM   782  N N9    . DA  C 1 1   ? 5.014  -0.126  -20.688 1.00 136.42 ? -8  DA  Y N9    1 
ATOM   783  C C8    . DA  C 1 1   ? 4.518  1.153   -20.573 1.00 136.35 ? -8  DA  Y C8    1 
ATOM   784  N N7    . DA  C 1 1   ? 4.927  1.967   -21.516 1.00 135.95 ? -8  DA  Y N7    1 
ATOM   785  C C5    . DA  C 1 1   ? 5.741  1.173   -22.314 1.00 136.09 ? -8  DA  Y C5    1 
ATOM   786  C C6    . DA  C 1 1   ? 6.483  1.447   -23.483 1.00 136.14 ? -8  DA  Y C6    1 
ATOM   787  N N6    . DA  C 1 1   ? 6.526  2.647   -24.071 1.00 135.67 ? -8  DA  Y N6    1 
ATOM   788  N N1    . DA  C 1 1   ? 7.187  0.432   -24.031 1.00 135.96 ? -8  DA  Y N1    1 
ATOM   789  C C2    . DA  C 1 1   ? 7.144  -0.772  -23.438 1.00 135.67 ? -8  DA  Y C2    1 
ATOM   790  N N3    . DA  C 1 1   ? 6.487  -1.152  -22.341 1.00 135.53 ? -8  DA  Y N3    1 
ATOM   791  C C4    . DA  C 1 1   ? 5.797  -0.122  -21.820 1.00 135.89 ? -8  DA  Y C4    1 
ATOM   792  P P     . DT  C 1 2   ? 6.159  -3.555  -16.912 1.00 137.58 ? -7  DT  Y P     1 
ATOM   793  O OP1   . DT  C 1 2   ? 6.143  -4.972  -16.476 1.00 137.47 ? -7  DT  Y OP1   1 
ATOM   794  O OP2   . DT  C 1 2   ? 6.642  -2.509  -15.979 1.00 137.68 ? -7  DT  Y OP2   1 
ATOM   795  O "O5'" . DT  C 1 2   ? 7.016  -3.458  -18.248 1.00 137.83 ? -7  DT  Y "O5'" 1 
ATOM   796  C "C5'" . DT  C 1 2   ? 6.900  -4.462  -19.248 1.00 138.74 ? -7  DT  Y "C5'" 1 
ATOM   797  C "C4'" . DT  C 1 2   ? 8.267  -4.846  -19.759 1.00 139.75 ? -7  DT  Y "C4'" 1 
ATOM   798  O "O4'" . DT  C 1 2   ? 8.711  -3.852  -20.717 1.00 139.83 ? -7  DT  Y "O4'" 1 
ATOM   799  C "C3'" . DT  C 1 2   ? 9.322  -4.837  -18.654 1.00 140.70 ? -7  DT  Y "C3'" 1 
ATOM   800  O "O3'" . DT  C 1 2   ? 10.325 -5.831  -18.905 1.00 142.43 ? -7  DT  Y "O3'" 1 
ATOM   801  C "C2'" . DT  C 1 2   ? 9.839  -3.409  -18.689 1.00 140.17 ? -7  DT  Y "C2'" 1 
ATOM   802  C "C1'" . DT  C 1 2   ? 9.775  -3.077  -20.174 1.00 139.59 ? -7  DT  Y "C1'" 1 
ATOM   803  N N1    . DT  C 1 2   ? 9.535  -1.652  -20.506 1.00 139.28 ? -7  DT  Y N1    1 
ATOM   804  C C2    . DT  C 1 2   ? 10.125 -1.140  -21.647 1.00 139.02 ? -7  DT  Y C2    1 
ATOM   805  O O2    . DT  C 1 2   ? 10.816 -1.804  -22.398 1.00 138.68 ? -7  DT  Y O2    1 
ATOM   806  N N3    . DT  C 1 2   ? 9.875  0.191   -21.876 1.00 138.95 ? -7  DT  Y N3    1 
ATOM   807  C C4    . DT  C 1 2   ? 9.110  1.040   -21.102 1.00 138.64 ? -7  DT  Y C4    1 
ATOM   808  O O4    . DT  C 1 2   ? 8.977  2.214   -21.435 1.00 138.59 ? -7  DT  Y O4    1 
ATOM   809  C C5    . DT  C 1 2   ? 8.516  0.438   -19.926 1.00 138.45 ? -7  DT  Y C5    1 
ATOM   810  C C7    . DT  C 1 2   ? 7.670  1.284   -19.028 1.00 137.99 ? -7  DT  Y C7    1 
ATOM   811  C C6    . DT  C 1 2   ? 8.753  -0.860  -19.692 1.00 138.77 ? -7  DT  Y C6    1 
ATOM   812  P P     . DT  C 1 3   ? 11.831 -5.612  -18.382 1.00 143.64 ? -6  DT  Y P     1 
ATOM   813  O OP1   . DT  C 1 3   ? 12.437 -6.961  -18.231 1.00 143.51 ? -6  DT  Y OP1   1 
ATOM   814  O OP2   . DT  C 1 3   ? 11.822 -4.679  -17.224 1.00 143.24 ? -6  DT  Y OP2   1 
ATOM   815  O "O5'" . DT  C 1 3   ? 12.522 -4.903  -19.629 1.00 143.25 ? -6  DT  Y "O5'" 1 
ATOM   816  C "C5'" . DT  C 1 3   ? 12.135 -5.278  -20.948 1.00 143.26 ? -6  DT  Y "C5'" 1 
ATOM   817  C "C4'" . DT  C 1 3   ? 13.075 -4.700  -21.978 1.00 143.43 ? -6  DT  Y "C4'" 1 
ATOM   818  O "O4'" . DT  C 1 3   ? 12.835 -3.280  -22.126 1.00 143.31 ? -6  DT  Y "O4'" 1 
ATOM   819  C "C3'" . DT  C 1 3   ? 14.539 -4.814  -21.563 1.00 143.58 ? -6  DT  Y "C3'" 1 
ATOM   820  O "O3'" . DT  C 1 3   ? 15.344 -4.895  -22.740 1.00 144.19 ? -6  DT  Y "O3'" 1 
ATOM   821  C "C2'" . DT  C 1 3   ? 14.775 -3.522  -20.802 1.00 143.48 ? -6  DT  Y "C2'" 1 
ATOM   822  C "C1'" . DT  C 1 3   ? 13.939 -2.547  -21.613 1.00 143.34 ? -6  DT  Y "C1'" 1 
ATOM   823  N N1    . DT  C 1 3   ? 13.434 -1.333  -20.934 1.00 143.09 ? -6  DT  Y N1    1 
ATOM   824  C C2    . DT  C 1 3   ? 13.690 -0.125  -21.546 1.00 142.82 ? -6  DT  Y C2    1 
ATOM   825  O O2    . DT  C 1 3   ? 14.311 -0.028  -22.594 1.00 142.41 ? -6  DT  Y O2    1 
ATOM   826  N N3    . DT  C 1 3   ? 13.194 0.972   -20.883 1.00 142.41 ? -6  DT  Y N3    1 
ATOM   827  C C4    . DT  C 1 3   ? 12.483 0.981   -19.699 1.00 142.19 ? -6  DT  Y C4    1 
ATOM   828  O O4    . DT  C 1 3   ? 12.099 2.048   -19.226 1.00 142.19 ? -6  DT  Y O4    1 
ATOM   829  C C5    . DT  C 1 3   ? 12.251 -0.320  -19.108 1.00 142.19 ? -6  DT  Y C5    1 
ATOM   830  C C7    . DT  C 1 3   ? 11.488 -0.406  -17.823 1.00 141.56 ? -6  DT  Y C7    1 
ATOM   831  C C6    . DT  C 1 3   ? 12.734 -1.399  -19.746 1.00 142.73 ? -6  DT  Y C6    1 
ATOM   832  P P     . DT  C 1 4   ? 16.940 -4.810  -22.626 1.00 144.82 ? -5  DT  Y P     1 
ATOM   833  O OP1   . DT  C 1 4   ? 17.493 -5.830  -23.554 1.00 144.41 ? -5  DT  Y OP1   1 
ATOM   834  O OP2   . DT  C 1 4   ? 17.310 -4.847  -21.189 1.00 144.76 ? -5  DT  Y OP2   1 
ATOM   835  O "O5'" . DT  C 1 4   ? 17.276 -3.367  -23.213 1.00 145.75 ? -5  DT  Y "O5'" 1 
ATOM   836  C "C5'" . DT  C 1 4   ? 16.912 -3.035  -24.552 1.00 147.24 ? -5  DT  Y "C5'" 1 
ATOM   837  C "C4'" . DT  C 1 4   ? 17.715 -1.856  -25.054 1.00 148.24 ? -5  DT  Y "C4'" 1 
ATOM   838  O "O4'" . DT  C 1 4   ? 17.229 -0.639  -24.431 1.00 148.26 ? -5  DT  Y "O4'" 1 
ATOM   839  C "C3'" . DT  C 1 4   ? 19.193 -1.937  -24.674 1.00 148.92 ? -5  DT  Y "C3'" 1 
ATOM   840  O "O3'" . DT  C 1 4   ? 20.004 -1.282  -25.662 1.00 150.52 ? -5  DT  Y "O3'" 1 
ATOM   841  C "C2'" . DT  C 1 4   ? 19.230 -1.238  -23.328 1.00 149.01 ? -5  DT  Y "C2'" 1 
ATOM   842  C "C1'" . DT  C 1 4   ? 18.193 -0.140  -23.512 1.00 148.33 ? -5  DT  Y "C1'" 1 
ATOM   843  N N1    . DT  C 1 4   ? 17.495 0.287   -22.283 1.00 148.11 ? -5  DT  Y N1    1 
ATOM   844  C C2    . DT  C 1 4   ? 17.012 1.575   -22.229 1.00 148.14 ? -5  DT  Y C2    1 
ATOM   845  O O2    . DT  C 1 4   ? 17.114 2.362   -23.156 1.00 148.21 ? -5  DT  Y O2    1 
ATOM   846  N N3    . DT  C 1 4   ? 16.401 1.909   -21.043 1.00 148.10 ? -5  DT  Y N3    1 
ATOM   847  C C4    . DT  C 1 4   ? 16.229 1.098   -19.934 1.00 147.89 ? -5  DT  Y C4    1 
ATOM   848  O O4    . DT  C 1 4   ? 15.661 1.533   -18.936 1.00 147.71 ? -5  DT  Y O4    1 
ATOM   849  C C5    . DT  C 1 4   ? 16.754 -0.241  -20.064 1.00 147.91 ? -5  DT  Y C5    1 
ATOM   850  C C7    . DT  C 1 4   ? 16.615 -1.189  -18.914 1.00 147.50 ? -5  DT  Y C7    1 
ATOM   851  C C6    . DT  C 1 4   ? 17.349 -0.576  -21.217 1.00 148.04 ? -5  DT  Y C6    1 
ATOM   852  P P     . DC  C 1 5   ? 21.335 -0.489  -25.216 1.00 151.70 ? -4  DC  Y P     1 
ATOM   853  O OP1   . DC  C 1 5   ? 22.155 -0.256  -26.434 1.00 151.30 ? -4  DC  Y OP1   1 
ATOM   854  O OP2   . DC  C 1 5   ? 21.948 -1.162  -24.041 1.00 151.83 ? -4  DC  Y OP2   1 
ATOM   855  O "O5'" . DC  C 1 5   ? 20.771 0.924   -24.749 1.00 151.03 ? -4  DC  Y "O5'" 1 
ATOM   856  C "C5'" . DC  C 1 5   ? 20.320 1.872   -25.707 1.00 150.82 ? -4  DC  Y "C5'" 1 
ATOM   857  C "C4'" . DC  C 1 5   ? 20.992 3.201   -25.464 1.00 150.94 ? -4  DC  Y "C4'" 1 
ATOM   858  O "O4'" . DC  C 1 5   ? 20.494 3.739   -24.219 1.00 151.34 ? -4  DC  Y "O4'" 1 
ATOM   859  C "C3'" . DC  C 1 5   ? 22.499 3.064   -25.269 1.00 151.07 ? -4  DC  Y "C3'" 1 
ATOM   860  O "O3'" . DC  C 1 5   ? 23.151 4.273   -25.661 1.00 151.00 ? -4  DC  Y "O3'" 1 
ATOM   861  C "C2'" . DC  C 1 5   ? 22.623 2.816   -23.777 1.00 151.12 ? -4  DC  Y "C2'" 1 
ATOM   862  C "C1'" . DC  C 1 5   ? 21.495 3.667   -23.210 1.00 151.45 ? -4  DC  Y "C1'" 1 
ATOM   863  N N1    . DC  C 1 5   ? 20.870 3.123   -21.993 1.00 151.74 ? -4  DC  Y N1    1 
ATOM   864  C C2    . DC  C 1 5   ? 20.238 4.006   -21.105 1.00 151.75 ? -4  DC  Y C2    1 
ATOM   865  O O2    . DC  C 1 5   ? 20.224 5.220   -21.368 1.00 151.51 ? -4  DC  Y O2    1 
ATOM   866  N N3    . DC  C 1 5   ? 19.659 3.514   -19.985 1.00 151.77 ? -4  DC  Y N3    1 
ATOM   867  C C4    . DC  C 1 5   ? 19.694 2.202   -19.738 1.00 151.88 ? -4  DC  Y C4    1 
ATOM   868  N N4    . DC  C 1 5   ? 19.108 1.761   -18.623 1.00 151.97 ? -4  DC  Y N4    1 
ATOM   869  C C5    . DC  C 1 5   ? 20.331 1.283   -20.623 1.00 151.63 ? -4  DC  Y C5    1 
ATOM   870  C C6    . DC  C 1 5   ? 20.900 1.782   -21.727 1.00 151.60 ? -4  DC  Y C6    1 
ATOM   871  P P     . DG  C 1 6   ? 24.749 4.408   -25.525 1.00 151.08 ? -3  DG  Y P     1 
ATOM   872  O OP1   . DG  C 1 6   ? 25.310 4.424   -26.901 1.00 150.99 ? -3  DG  Y OP1   1 
ATOM   873  O OP2   . DG  C 1 6   ? 25.252 3.410   -24.545 1.00 151.25 ? -3  DG  Y OP2   1 
ATOM   874  O "O5'" . DG  C 1 6   ? 24.926 5.865   -24.901 1.00 150.03 ? -3  DG  Y "O5'" 1 
ATOM   875  C "C5'" . DG  C 1 6   ? 24.036 6.920   -25.272 1.00 147.53 ? -3  DG  Y "C5'" 1 
ATOM   876  C "C4'" . DG  C 1 6   ? 24.087 8.048   -24.267 1.00 146.01 ? -3  DG  Y "C4'" 1 
ATOM   877  O "O4'" . DG  C 1 6   ? 23.578 7.591   -22.989 1.00 145.31 ? -3  DG  Y "O4'" 1 
ATOM   878  C "C3'" . DG  C 1 6   ? 25.512 8.516   -23.980 1.00 145.19 ? -3  DG  Y "C3'" 1 
ATOM   879  O "O3'" . DG  C 1 6   ? 25.488 9.891   -23.581 1.00 144.45 ? -3  DG  Y "O3'" 1 
ATOM   880  C "C2'" . DG  C 1 6   ? 25.939 7.619   -22.832 1.00 144.78 ? -3  DG  Y "C2'" 1 
ATOM   881  C "C1'" . DG  C 1 6   ? 24.643 7.504   -22.045 1.00 144.36 ? -3  DG  Y "C1'" 1 
ATOM   882  N N9    . DG  C 1 6   ? 24.456 6.300   -21.240 1.00 143.28 ? -3  DG  Y N9    1 
ATOM   883  C C8    . DG  C 1 6   ? 25.082 5.083   -21.376 1.00 142.56 ? -3  DG  Y C8    1 
ATOM   884  N N7    . DG  C 1 6   ? 24.689 4.204   -20.493 1.00 142.12 ? -3  DG  Y N7    1 
ATOM   885  C C5    . DG  C 1 6   ? 23.748 4.882   -19.727 1.00 142.08 ? -3  DG  Y C5    1 
ATOM   886  C C6    . DG  C 1 6   ? 22.970 4.449   -18.614 1.00 141.61 ? -3  DG  Y C6    1 
ATOM   887  O O6    . DG  C 1 6   ? 22.954 3.339   -18.064 1.00 141.00 ? -3  DG  Y O6    1 
ATOM   888  N N1    . DG  C 1 6   ? 22.144 5.465   -18.143 1.00 141.39 ? -3  DG  Y N1    1 
ATOM   889  C C2    . DG  C 1 6   ? 22.072 6.733   -18.668 1.00 141.53 ? -3  DG  Y C2    1 
ATOM   890  N N2    . DG  C 1 6   ? 21.216 7.574   -18.073 1.00 141.61 ? -3  DG  Y N2    1 
ATOM   891  N N3    . DG  C 1 6   ? 22.786 7.147   -19.699 1.00 141.71 ? -3  DG  Y N3    1 
ATOM   892  C C4    . DG  C 1 6   ? 23.596 6.178   -20.176 1.00 142.50 ? -3  DG  Y C4    1 
ATOM   893  P P     . DA  C 1 7   ? 26.846 10.745  -23.582 1.00 143.57 ? -2  DA  Y P     1 
ATOM   894  O OP1   . DA  C 1 7   ? 26.518 12.116  -24.054 1.00 143.77 ? -2  DA  Y OP1   1 
ATOM   895  O OP2   . DA  C 1 7   ? 27.884 9.950   -24.285 1.00 143.31 ? -2  DA  Y OP2   1 
ATOM   896  O "O5'" . DA  C 1 7   ? 27.239 10.837  -22.044 1.00 142.72 ? -2  DA  Y "O5'" 1 
ATOM   897  C "C5'" . DA  C 1 7   ? 27.263 12.088  -21.360 1.00 140.45 ? -2  DA  Y "C5'" 1 
ATOM   898  C "C4'" . DA  C 1 7   ? 25.882 12.425  -20.851 1.00 138.82 ? -2  DA  Y "C4'" 1 
ATOM   899  O "O4'" . DA  C 1 7   ? 25.230 11.213  -20.415 1.00 138.37 ? -2  DA  Y "O4'" 1 
ATOM   900  C "C3'" . DA  C 1 7   ? 25.907 13.330  -19.624 1.00 138.30 ? -2  DA  Y "C3'" 1 
ATOM   901  O "O3'" . DA  C 1 7   ? 24.686 14.072  -19.553 1.00 137.59 ? -2  DA  Y "O3'" 1 
ATOM   902  C "C2'" . DA  C 1 7   ? 26.004 12.334  -18.482 1.00 137.77 ? -2  DA  Y "C2'" 1 
ATOM   903  C "C1'" . DA  C 1 7   ? 25.147 11.185  -18.993 1.00 137.57 ? -2  DA  Y "C1'" 1 
ATOM   904  N N9    . DA  C 1 7   ? 25.534 9.844   -18.550 1.00 136.17 ? -2  DA  Y N9    1 
ATOM   905  C C8    . DA  C 1 7   ? 26.549 9.060   -19.043 1.00 135.53 ? -2  DA  Y C8    1 
ATOM   906  N N7    . DA  C 1 7   ? 26.618 7.876   -18.489 1.00 134.55 ? -2  DA  Y N7    1 
ATOM   907  C C5    . DA  C 1 7   ? 25.589 7.883   -17.560 1.00 134.67 ? -2  DA  Y C5    1 
ATOM   908  C C6    . DA  C 1 7   ? 25.138 6.918   -16.653 1.00 134.50 ? -2  DA  Y C6    1 
ATOM   909  N N6    . DA  C 1 7   ? 25.692 5.710   -16.537 1.00 134.38 ? -2  DA  Y N6    1 
ATOM   910  N N1    . DA  C 1 7   ? 24.090 7.238   -15.861 1.00 134.39 ? -2  DA  Y N1    1 
ATOM   911  C C2    . DA  C 1 7   ? 23.542 8.454   -15.985 1.00 134.38 ? -2  DA  Y C2    1 
ATOM   912  N N3    . DA  C 1 7   ? 23.877 9.448   -16.803 1.00 134.63 ? -2  DA  Y N3    1 
ATOM   913  C C4    . DA  C 1 7   ? 24.921 9.093   -17.575 1.00 135.12 ? -2  DA  Y C4    1 
ATOM   914  P P     . DA  C 1 8   ? 24.502 15.195  -18.419 1.00 136.91 ? -1  DA  Y P     1 
ATOM   915  O OP1   . DA  C 1 8   ? 23.151 15.794  -18.574 1.00 137.14 ? -1  DA  Y OP1   1 
ATOM   916  O OP2   . DA  C 1 8   ? 25.704 16.074  -18.424 1.00 136.37 ? -1  DA  Y OP2   1 
ATOM   917  O "O5'" . DA  C 1 8   ? 24.507 14.375  -17.058 1.00 133.54 ? -1  DA  Y "O5'" 1 
ATOM   918  C "C5'" . DA  C 1 8   ? 25.246 14.853  -15.948 1.00 128.99 ? -1  DA  Y "C5'" 1 
ATOM   919  C "C4'" . DA  C 1 8   ? 24.549 14.492  -14.661 1.00 125.32 ? -1  DA  Y "C4'" 1 
ATOM   920  O "O4'" . DA  C 1 8   ? 24.474 13.045  -14.591 1.00 123.22 ? -1  DA  Y "O4'" 1 
ATOM   921  C "C3'" . DA  C 1 8   ? 25.368 14.917  -13.448 1.00 123.74 ? -1  DA  Y "C3'" 1 
ATOM   922  O "O3'" . DA  C 1 8   ? 24.550 15.253  -12.327 1.00 122.10 ? -1  DA  Y "O3'" 1 
ATOM   923  C "C2'" . DA  C 1 8   ? 26.260 13.719  -13.198 1.00 122.73 ? -1  DA  Y "C2'" 1 
ATOM   924  C "C1'" . DA  C 1 8   ? 25.389 12.545  -13.620 1.00 121.38 ? -1  DA  Y "C1'" 1 
ATOM   925  N N9    . DA  C 1 8   ? 26.181 11.487  -14.246 1.00 119.39 ? -1  DA  Y N9    1 
ATOM   926  C C8    . DA  C 1 8   ? 27.202 11.636  -15.158 1.00 118.35 ? -1  DA  Y C8    1 
ATOM   927  N N7    . DA  C 1 8   ? 27.775 10.508  -15.503 1.00 116.51 ? -1  DA  Y N7    1 
ATOM   928  C C5    . DA  C 1 8   ? 27.077 9.550   -14.783 1.00 116.78 ? -1  DA  Y C5    1 
ATOM   929  C C6    . DA  C 1 8   ? 27.202 8.158   -14.704 1.00 116.31 ? -1  DA  Y C6    1 
ATOM   930  N N6    . DA  C 1 8   ? 28.116 7.459   -15.384 1.00 115.29 ? -1  DA  Y N6    1 
ATOM   931  N N1    . DA  C 1 8   ? 26.347 7.496   -13.893 1.00 115.98 ? -1  DA  Y N1    1 
ATOM   932  C C2    . DA  C 1 8   ? 25.434 8.200   -13.209 1.00 116.08 ? -1  DA  Y C2    1 
ATOM   933  N N3    . DA  C 1 8   ? 25.220 9.512   -13.197 1.00 116.43 ? -1  DA  Y N3    1 
ATOM   934  C C4    . DA  C 1 8   ? 26.084 10.138  -14.014 1.00 117.66 ? -1  DA  Y C4    1 
ATOM   935  P P     . DA  C 1 9   ? 25.240 15.510  -10.898 1.00 120.93 ? 1   DA  Y P     1 
ATOM   936  O OP1   . DA  C 1 9   ? 24.435 16.527  -10.166 1.00 120.96 ? 1   DA  Y OP1   1 
ATOM   937  O OP2   . DA  C 1 9   ? 26.699 15.733  -11.099 1.00 120.18 ? 1   DA  Y OP2   1 
ATOM   938  O "O5'" . DA  C 1 9   ? 25.037 14.115  -10.169 1.00 116.37 ? 1   DA  Y "O5'" 1 
ATOM   939  C "C5'" . DA  C 1 9   ? 23.752 13.510  -10.138 1.00 110.01 ? 1   DA  Y "C5'" 1 
ATOM   940  C "C4'" . DA  C 1 9   ? 23.753 12.361  -9.164  1.00 105.54 ? 1   DA  Y "C4'" 1 
ATOM   941  O "O4'" . DA  C 1 9   ? 24.577 11.304  -9.713  1.00 103.45 ? 1   DA  Y "O4'" 1 
ATOM   942  C "C3'" . DA  C 1 9   ? 24.416 12.745  -7.848  1.00 103.61 ? 1   DA  Y "C3'" 1 
ATOM   943  O "O3'" . DA  C 1 9   ? 23.831 12.006  -6.771  1.00 103.78 ? 1   DA  Y "O3'" 1 
ATOM   944  C "C2'" . DA  C 1 9   ? 25.881 12.420  -8.097  1.00 101.54 ? 1   DA  Y "C2'" 1 
ATOM   945  C "C1'" . DA  C 1 9   ? 25.795 11.192  -8.988  1.00 99.28  ? 1   DA  Y "C1'" 1 
ATOM   946  N N9    . DA  C 1 9   ? 26.887 11.007  -9.953  1.00 95.06  ? 1   DA  Y N9    1 
ATOM   947  C C8    . DA  C 1 9   ? 27.615 11.952  -10.636 1.00 92.65  ? 1   DA  Y C8    1 
ATOM   948  N N7    . DA  C 1 9   ? 28.535 11.442  -11.424 1.00 89.77  ? 1   DA  Y N7    1 
ATOM   949  C C5    . DA  C 1 9   ? 28.400 10.072  -11.251 1.00 89.85  ? 1   DA  Y C5    1 
ATOM   950  C C6    . DA  C 1 9   ? 29.084 8.969   -11.806 1.00 89.31  ? 1   DA  Y C6    1 
ATOM   951  N N6    . DA  C 1 9   ? 30.076 9.073   -12.689 1.00 87.41  ? 1   DA  Y N6    1 
ATOM   952  N N1    . DA  C 1 9   ? 28.704 7.733   -11.412 1.00 89.60  ? 1   DA  Y N1    1 
ATOM   953  C C2    . DA  C 1 9   ? 27.709 7.621   -10.528 1.00 90.70  ? 1   DA  Y C2    1 
ATOM   954  N N3    . DA  C 1 9   ? 26.991 8.575   -9.940  1.00 91.58  ? 1   DA  Y N3    1 
ATOM   955  C C4    . DA  C 1 9   ? 27.391 9.791   -10.348 1.00 91.92  ? 1   DA  Y C4    1 
ATOM   956  P P     . DA  C 1 10  ? 24.641 11.822  -5.395  1.00 103.92 ? 2   DA  Y P     1 
ATOM   957  O OP1   . DA  C 1 10  ? 23.655 11.508  -4.323  1.00 102.95 ? 2   DA  Y OP1   1 
ATOM   958  O OP2   . DA  C 1 10  ? 25.558 12.980  -5.233  1.00 104.26 ? 2   DA  Y OP2   1 
ATOM   959  O "O5'" . DA  C 1 10  ? 25.503 10.512  -5.668  1.00 101.12 ? 2   DA  Y "O5'" 1 
ATOM   960  C "C5'" . DA  C 1 10  ? 24.868 9.348   -6.183  1.00 97.27  ? 2   DA  Y "C5'" 1 
ATOM   961  C "C4'" . DA  C 1 10  ? 25.610 8.104   -5.760  1.00 94.50  ? 2   DA  Y "C4'" 1 
ATOM   962  O "O4'" . DA  C 1 10  ? 26.707 7.868   -6.677  1.00 92.09  ? 2   DA  Y "O4'" 1 
ATOM   963  C "C3'" . DA  C 1 10  ? 26.251 8.231   -4.382  1.00 93.85  ? 2   DA  Y "C3'" 1 
ATOM   964  O "O3'" . DA  C 1 10  ? 26.241 6.958   -3.715  1.00 95.07  ? 2   DA  Y "O3'" 1 
ATOM   965  C "C2'" . DA  C 1 10  ? 27.631 8.787   -4.702  1.00 91.77  ? 2   DA  Y "C2'" 1 
ATOM   966  C "C1'" . DA  C 1 10  ? 27.954 8.121   -6.039  1.00 89.80  ? 2   DA  Y "C1'" 1 
ATOM   967  N N9    . DA  C 1 10  ? 28.799 8.887   -6.968  1.00 86.43  ? 2   DA  Y N9    1 
ATOM   968  C C8    . DA  C 1 10  ? 28.875 10.252  -7.132  1.00 85.00  ? 2   DA  Y C8    1 
ATOM   969  N N7    . DA  C 1 10  ? 29.754 10.629  -8.032  1.00 82.04  ? 2   DA  Y N7    1 
ATOM   970  C C5    . DA  C 1 10  ? 30.287 9.434   -8.497  1.00 81.58  ? 2   DA  Y C5    1 
ATOM   971  C C6    . DA  C 1 10  ? 31.268 9.147   -9.465  1.00 81.55  ? 2   DA  Y C6    1 
ATOM   972  N N6    . DA  C 1 10  ? 31.914 10.081  -10.170 1.00 80.26  ? 2   DA  Y N6    1 
ATOM   973  N N1    . DA  C 1 10  ? 31.564 7.847   -9.691  1.00 81.09  ? 2   DA  Y N1    1 
ATOM   974  C C2    . DA  C 1 10  ? 30.913 6.913   -8.995  1.00 80.02  ? 2   DA  Y C2    1 
ATOM   975  N N3    . DA  C 1 10  ? 29.975 7.057   -8.067  1.00 80.76  ? 2   DA  Y N3    1 
ATOM   976  C C4    . DA  C 1 10  ? 29.705 8.355   -7.858  1.00 82.37  ? 2   DA  Y C4    1 
ATOM   977  P P     . DA  C 1 11  ? 27.259 6.673   -2.503  1.00 96.19  ? 3   DA  Y P     1 
ATOM   978  O OP1   . DA  C 1 11  ? 26.701 5.584   -1.650  1.00 93.73  ? 3   DA  Y OP1   1 
ATOM   979  O OP2   . DA  C 1 11  ? 27.635 7.976   -1.887  1.00 95.94  ? 3   DA  Y OP2   1 
ATOM   980  O "O5'" . DA  C 1 11  ? 28.512 6.064   -3.269  1.00 94.14  ? 3   DA  Y "O5'" 1 
ATOM   981  C "C5'" . DA  C 1 11  ? 28.290 5.092   -4.276  1.00 88.87  ? 3   DA  Y "C5'" 1 
ATOM   982  C "C4'" . DA  C 1 11  ? 29.578 4.413   -4.669  1.00 85.41  ? 3   DA  Y "C4'" 1 
ATOM   983  O "O4'" . DA  C 1 11  ? 30.356 5.284   -5.524  1.00 83.81  ? 3   DA  Y "O4'" 1 
ATOM   984  C "C3'" . DA  C 1 11  ? 30.476 4.132   -3.469  1.00 83.86  ? 3   DA  Y "C3'" 1 
ATOM   985  O "O3'" . DA  C 1 11  ? 31.249 2.969   -3.772  1.00 83.95  ? 3   DA  Y "O3'" 1 
ATOM   986  C "C2'" . DA  C 1 11  ? 31.324 5.394   -3.380  1.00 81.97  ? 3   DA  Y "C2'" 1 
ATOM   987  C "C1'" . DA  C 1 11  ? 31.531 5.694   -4.853  1.00 79.88  ? 3   DA  Y "C1'" 1 
ATOM   988  N N9    . DA  C 1 11  ? 31.896 7.040   -5.308  1.00 77.18  ? 3   DA  Y N9    1 
ATOM   989  C C8    . DA  C 1 11  ? 31.459 8.278   -4.897  1.00 76.31  ? 3   DA  Y C8    1 
ATOM   990  N N7    . DA  C 1 11  ? 32.040 9.280   -5.525  1.00 73.11  ? 3   DA  Y N7    1 
ATOM   991  C C5    . DA  C 1 11  ? 32.910 8.659   -6.413  1.00 73.04  ? 3   DA  Y C5    1 
ATOM   992  C C6    . DA  C 1 11  ? 33.821 9.164   -7.364  1.00 72.14  ? 3   DA  Y C6    1 
ATOM   993  N N6    . DA  C 1 11  ? 34.021 10.466  -7.588  1.00 72.33  ? 3   DA  Y N6    1 
ATOM   994  N N1    . DA  C 1 11  ? 34.533 8.271   -8.089  1.00 70.47  ? 3   DA  Y N1    1 
ATOM   995  C C2    . DA  C 1 11  ? 34.338 6.967   -7.865  1.00 70.60  ? 3   DA  Y C2    1 
ATOM   996  N N3    . DA  C 1 11  ? 33.519 6.371   -7.004  1.00 71.75  ? 3   DA  Y N3    1 
ATOM   997  C C4    . DA  C 1 11  ? 32.826 7.282   -6.297  1.00 74.54  ? 3   DA  Y C4    1 
ATOM   998  P P     . DT  C 1 12  ? 31.868 2.090   -2.589  1.00 84.41  ? 4   DT  Y P     1 
ATOM   999  O OP1   . DT  C 1 12  ? 31.648 0.650   -2.891  1.00 81.33  ? 4   DT  Y OP1   1 
ATOM   1000 O OP2   . DT  C 1 12  ? 31.396 2.669   -1.302  1.00 85.07  ? 4   DT  Y OP2   1 
ATOM   1001 O "O5'" . DT  C 1 12  ? 33.417 2.384   -2.716  1.00 84.33  ? 4   DT  Y "O5'" 1 
ATOM   1002 C "C5'" . DT  C 1 12  ? 33.852 3.510   -3.449  1.00 84.73  ? 4   DT  Y "C5'" 1 
ATOM   1003 C "C4'" . DT  C 1 12  ? 34.909 3.097   -4.439  1.00 84.70  ? 4   DT  Y "C4'" 1 
ATOM   1004 O "O4'" . DT  C 1 12  ? 35.183 4.239   -5.273  1.00 84.09  ? 4   DT  Y "O4'" 1 
ATOM   1005 C "C3'" . DT  C 1 12  ? 36.232 2.757   -3.763  1.00 86.03  ? 4   DT  Y "C3'" 1 
ATOM   1006 O "O3'" . DT  C 1 12  ? 36.968 1.817   -4.548  1.00 88.51  ? 4   DT  Y "O3'" 1 
ATOM   1007 C "C2'" . DT  C 1 12  ? 36.915 4.106   -3.679  1.00 83.78  ? 4   DT  Y "C2'" 1 
ATOM   1008 C "C1'" . DT  C 1 12  ? 36.448 4.785   -4.954  1.00 82.62  ? 4   DT  Y "C1'" 1 
ATOM   1009 N N1    . DT  C 1 12  ? 36.285 6.238   -4.863  1.00 81.39  ? 4   DT  Y N1    1 
ATOM   1010 C C2    . DT  C 1 12  ? 37.062 6.997   -5.695  1.00 82.55  ? 4   DT  Y C2    1 
ATOM   1011 O O2    . DT  C 1 12  ? 37.864 6.508   -6.479  1.00 83.39  ? 4   DT  Y O2    1 
ATOM   1012 N N3    . DT  C 1 12  ? 36.870 8.352   -5.581  1.00 81.91  ? 4   DT  Y N3    1 
ATOM   1013 C C4    . DT  C 1 12  ? 35.999 9.000   -4.733  1.00 80.69  ? 4   DT  Y C4    1 
ATOM   1014 O O4    . DT  C 1 12  ? 35.939 10.225  -4.743  1.00 81.94  ? 4   DT  Y O4    1 
ATOM   1015 C C5    . DT  C 1 12  ? 35.213 8.139   -3.884  1.00 80.06  ? 4   DT  Y C5    1 
ATOM   1016 C C7    . DT  C 1 12  ? 34.242 8.757   -2.931  1.00 79.22  ? 4   DT  Y C7    1 
ATOM   1017 C C6    . DT  C 1 12  ? 35.392 6.814   -3.989  1.00 80.07  ? 4   DT  Y C6    1 
ATOM   1018 P P     . DG  C 1 13  ? 38.314 1.164   -3.959  1.00 91.47  ? 5   DG  Y P     1 
ATOM   1019 O OP1   . DG  C 1 13  ? 38.365 -0.250  -4.432  1.00 90.90  ? 5   DG  Y OP1   1 
ATOM   1020 O OP2   . DG  C 1 13  ? 38.416 1.463   -2.504  1.00 89.78  ? 5   DG  Y OP2   1 
ATOM   1021 O "O5'" . DG  C 1 13  ? 39.474 1.958   -4.700  1.00 92.08  ? 5   DG  Y "O5'" 1 
ATOM   1022 C "C5'" . DG  C 1 13  ? 39.729 1.744   -6.083  1.00 93.08  ? 5   DG  Y "C5'" 1 
ATOM   1023 C "C4'" . DG  C 1 13  ? 40.977 2.484   -6.504  1.00 93.74  ? 5   DG  Y "C4'" 1 
ATOM   1024 O "O4'" . DG  C 1 13  ? 40.770 3.907   -6.345  1.00 92.96  ? 5   DG  Y "O4'" 1 
ATOM   1025 C "C3'" . DG  C 1 13  ? 42.176 2.156   -5.617  1.00 94.02  ? 5   DG  Y "C3'" 1 
ATOM   1026 O "O3'" . DG  C 1 13  ? 43.369 2.394   -6.386  1.00 96.28  ? 5   DG  Y "O3'" 1 
ATOM   1027 C "C2'" . DG  C 1 13  ? 42.029 3.169   -4.495  1.00 92.94  ? 5   DG  Y "C2'" 1 
ATOM   1028 C "C1'" . DG  C 1 13  ? 41.551 4.389   -5.260  1.00 91.97  ? 5   DG  Y "C1'" 1 
ATOM   1029 N N9    . DG  C 1 13  ? 40.758 5.373   -4.536  1.00 90.99  ? 5   DG  Y N9    1 
ATOM   1030 C C8    . DG  C 1 13  ? 39.713 5.145   -3.676  1.00 90.78  ? 5   DG  Y C8    1 
ATOM   1031 N N7    . DG  C 1 13  ? 39.153 6.245   -3.247  1.00 89.43  ? 5   DG  Y N7    1 
ATOM   1032 C C5    . DG  C 1 13  ? 39.889 7.257   -3.846  1.00 89.01  ? 5   DG  Y C5    1 
ATOM   1033 C C6    . DG  C 1 13  ? 39.749 8.666   -3.766  1.00 89.60  ? 5   DG  Y C6    1 
ATOM   1034 O O6    . DG  C 1 13  ? 38.913 9.325   -3.129  1.00 90.26  ? 5   DG  Y O6    1 
ATOM   1035 N N1    . DG  C 1 13  ? 40.711 9.317   -4.534  1.00 89.04  ? 5   DG  Y N1    1 
ATOM   1036 C C2    . DG  C 1 13  ? 41.678 8.694   -5.285  1.00 88.76  ? 5   DG  Y C2    1 
ATOM   1037 N N2    . DG  C 1 13  ? 42.508 9.492   -5.967  1.00 88.00  ? 5   DG  Y N2    1 
ATOM   1038 N N3    . DG  C 1 13  ? 41.818 7.382   -5.364  1.00 88.64  ? 5   DG  Y N3    1 
ATOM   1039 C C4    . DG  C 1 13  ? 40.895 6.732   -4.628  1.00 89.50  ? 5   DG  Y C4    1 
ATOM   1040 P P     . DT  C 1 14  ? 44.802 1.899   -5.845  1.00 97.75  ? 6   DT  Y P     1 
ATOM   1041 O OP1   . DT  C 1 14  ? 45.807 2.208   -6.900  1.00 96.95  ? 6   DT  Y OP1   1 
ATOM   1042 O OP2   . DT  C 1 14  ? 44.666 0.502   -5.342  1.00 96.48  ? 6   DT  Y OP2   1 
ATOM   1043 O "O5'" . DT  C 1 14  ? 45.097 2.884   -4.632  1.00 97.44  ? 6   DT  Y "O5'" 1 
ATOM   1044 C "C5'" . DT  C 1 14  ? 44.541 4.192   -4.619  1.00 96.73  ? 6   DT  Y "C5'" 1 
ATOM   1045 C "C4'" . DT  C 1 14  ? 45.603 5.210   -4.926  1.00 97.24  ? 6   DT  Y "C4'" 1 
ATOM   1046 O "O4'" . DT  C 1 14  ? 44.999 6.524   -4.816  1.00 96.47  ? 6   DT  Y "O4'" 1 
ATOM   1047 C "C3'" . DT  C 1 14  ? 46.706 5.177   -3.883  1.00 98.46  ? 6   DT  Y "C3'" 1 
ATOM   1048 O "O3'" . DT  C 1 14  ? 47.956 5.540   -4.454  1.00 102.28 ? 6   DT  Y "O3'" 1 
ATOM   1049 C "C2'" . DT  C 1 14  ? 46.208 6.142   -2.826  1.00 96.69  ? 6   DT  Y "C2'" 1 
ATOM   1050 C "C1'" . DT  C 1 14  ? 45.439 7.185   -3.632  1.00 93.84  ? 6   DT  Y "C1'" 1 
ATOM   1051 N N1    . DT  C 1 14  ? 44.237 7.669   -2.911  1.00 89.40  ? 6   DT  Y N1    1 
ATOM   1052 C C2    . DT  C 1 14  ? 43.968 9.024   -2.861  1.00 86.94  ? 6   DT  Y C2    1 
ATOM   1053 O O2    . DT  C 1 14  ? 44.654 9.866   -3.410  1.00 85.37  ? 6   DT  Y O2    1 
ATOM   1054 N N3    . DT  C 1 14  ? 42.853 9.357   -2.131  1.00 84.80  ? 6   DT  Y N3    1 
ATOM   1055 C C4    . DT  C 1 14  ? 42.003 8.493   -1.462  1.00 84.59  ? 6   DT  Y C4    1 
ATOM   1056 O O4    . DT  C 1 14  ? 41.044 8.938   -0.835  1.00 82.71  ? 6   DT  Y O4    1 
ATOM   1057 C C5    . DT  C 1 14  ? 42.340 7.091   -1.568  1.00 85.10  ? 6   DT  Y C5    1 
ATOM   1058 C C7    . DT  C 1 14  ? 41.480 6.082   -0.877  1.00 83.55  ? 6   DT  Y C7    1 
ATOM   1059 C C6    . DT  C 1 14  ? 43.418 6.755   -2.283  1.00 86.60  ? 6   DT  Y C6    1 
ATOM   1060 P P     . DG  C 1 15  ? 49.311 5.133   -3.705  1.00 105.02 ? 7   DG  Y P     1 
ATOM   1061 O OP1   . DG  C 1 15  ? 50.218 4.524   -4.713  1.00 105.71 ? 7   DG  Y OP1   1 
ATOM   1062 O OP2   . DG  C 1 15  ? 48.958 4.367   -2.483  1.00 105.40 ? 7   DG  Y OP2   1 
ATOM   1063 O "O5'" . DG  C 1 15  ? 49.889 6.552   -3.285  1.00 104.12 ? 7   DG  Y "O5'" 1 
ATOM   1064 C "C5'" . DG  C 1 15  ? 49.867 7.625   -4.218  1.00 103.95 ? 7   DG  Y "C5'" 1 
ATOM   1065 C "C4'" . DG  C 1 15  ? 50.308 8.905   -3.555  1.00 104.12 ? 7   DG  Y "C4'" 1 
ATOM   1066 O "O4'" . DG  C 1 15  ? 49.182 9.526   -2.886  1.00 103.25 ? 7   DG  Y "O4'" 1 
ATOM   1067 C "C3'" . DG  C 1 15  ? 51.331 8.634   -2.459  1.00 105.04 ? 7   DG  Y "C3'" 1 
ATOM   1068 O "O3'" . DG  C 1 15  ? 52.228 9.740   -2.375  1.00 108.93 ? 7   DG  Y "O3'" 1 
ATOM   1069 C "C2'" . DG  C 1 15  ? 50.463 8.437   -1.229  1.00 103.07 ? 7   DG  Y "C2'" 1 
ATOM   1070 C "C1'" . DG  C 1 15  ? 49.337 9.433   -1.474  1.00 101.47 ? 7   DG  Y "C1'" 1 
ATOM   1071 N N9    . DG  C 1 15  ? 48.038 9.111   -0.878  1.00 98.59  ? 7   DG  Y N9    1 
ATOM   1072 C C8    . DG  C 1 15  ? 47.532 7.865   -0.598  1.00 97.14  ? 7   DG  Y C8    1 
ATOM   1073 N N7    . DG  C 1 15  ? 46.342 7.902   -0.057  1.00 95.55  ? 7   DG  Y N7    1 
ATOM   1074 C C5    . DG  C 1 15  ? 46.044 9.254   0.027   1.00 95.51  ? 7   DG  Y C5    1 
ATOM   1075 C C6    . DG  C 1 15  ? 44.889 9.914   0.532   1.00 94.80  ? 7   DG  Y C6    1 
ATOM   1076 O O6    . DG  C 1 15  ? 43.867 9.420   1.018   1.00 92.61  ? 7   DG  Y O6    1 
ATOM   1077 N N1    . DG  C 1 15  ? 45.006 11.296  0.430   1.00 95.28  ? 7   DG  Y N1    1 
ATOM   1078 C C2    . DG  C 1 15  ? 46.088 11.961  -0.093  1.00 95.84  ? 7   DG  Y C2    1 
ATOM   1079 N N2    . DG  C 1 15  ? 46.013 13.301  -0.108  1.00 95.65  ? 7   DG  Y N2    1 
ATOM   1080 N N3    . DG  C 1 15  ? 47.166 11.359  -0.566  1.00 96.39  ? 7   DG  Y N3    1 
ATOM   1081 C C4    . DG  C 1 15  ? 47.077 10.016  -0.476  1.00 96.63  ? 7   DG  Y C4    1 
ATOM   1082 P P     . DA  C 1 16  ? 53.099 9.974   -1.047  1.00 111.68 ? 8   DA  Y P     1 
ATOM   1083 O OP1   . DA  C 1 16  ? 54.468 10.354  -1.484  1.00 110.80 ? 8   DA  Y OP1   1 
ATOM   1084 O OP2   . DA  C 1 16  ? 52.917 8.829   -0.114  1.00 110.83 ? 8   DA  Y OP2   1 
ATOM   1085 O "O5'" . DA  C 1 16  ? 52.411 11.270  -0.439  1.00 111.80 ? 8   DA  Y "O5'" 1 
ATOM   1086 C "C5'" . DA  C 1 16  ? 51.948 12.292  -1.314  1.00 113.94 ? 8   DA  Y "C5'" 1 
ATOM   1087 C "C4'" . DA  C 1 16  ? 51.485 13.490  -0.523  1.00 115.51 ? 8   DA  Y "C4'" 1 
ATOM   1088 O "O4'" . DA  C 1 16  ? 50.193 13.199  0.067   1.00 116.30 ? 8   DA  Y "O4'" 1 
ATOM   1089 C "C3'" . DA  C 1 16  ? 52.413 13.774  0.656   1.00 115.91 ? 8   DA  Y "C3'" 1 
ATOM   1090 O "O3'" . DA  C 1 16  ? 52.421 15.176  0.948   1.00 116.46 ? 8   DA  Y "O3'" 1 
ATOM   1091 C "C2'" . DA  C 1 16  ? 51.811 12.937  1.772   1.00 115.56 ? 8   DA  Y "C2'" 1 
ATOM   1092 C "C1'" . DA  C 1 16  ? 50.322 13.056  1.481   1.00 115.95 ? 8   DA  Y "C1'" 1 
ATOM   1093 N N9    . DA  C 1 16  ? 49.471 11.945  1.921   1.00 115.27 ? 8   DA  Y N9    1 
ATOM   1094 C C8    . DA  C 1 16  ? 49.736 10.597  1.904   1.00 114.80 ? 8   DA  Y C8    1 
ATOM   1095 N N7    . DA  C 1 16  ? 48.760 9.859   2.379   1.00 114.32 ? 8   DA  Y N7    1 
ATOM   1096 C C5    . DA  C 1 16  ? 47.785 10.782  2.733   1.00 114.20 ? 8   DA  Y C5    1 
ATOM   1097 C C6    . DA  C 1 16  ? 46.501 10.639  3.299   1.00 113.65 ? 8   DA  Y C6    1 
ATOM   1098 N N6    . DA  C 1 16  ? 45.956 9.463   3.621   1.00 113.14 ? 8   DA  Y N6    1 
ATOM   1099 N N1    . DA  C 1 16  ? 45.787 11.763  3.526   1.00 113.36 ? 8   DA  Y N1    1 
ATOM   1100 C C2    . DA  C 1 16  ? 46.330 12.943  3.204   1.00 113.40 ? 8   DA  Y C2    1 
ATOM   1101 N N3    . DA  C 1 16  ? 47.520 13.207  2.670   1.00 113.94 ? 8   DA  Y N3    1 
ATOM   1102 C C4    . DA  C 1 16  ? 48.208 12.070  2.456   1.00 114.46 ? 8   DA  Y C4    1 
ATOM   1103 P P     . DT  C 1 17  ? 52.948 15.693  2.374   1.00 116.66 ? 9   DT  Y P     1 
ATOM   1104 O OP1   . DT  C 1 17  ? 53.367 17.109  2.190   1.00 116.70 ? 9   DT  Y OP1   1 
ATOM   1105 O OP2   . DT  C 1 17  ? 53.917 14.708  2.923   1.00 115.97 ? 9   DT  Y OP2   1 
ATOM   1106 O "O5'" . DT  C 1 17  ? 51.631 15.665  3.275   1.00 116.12 ? 9   DT  Y "O5'" 1 
ATOM   1107 C "C5'" . DT  C 1 17  ? 50.430 16.294  2.819   1.00 114.42 ? 9   DT  Y "C5'" 1 
ATOM   1108 C "C4'" . DT  C 1 17  ? 49.605 16.785  3.988   1.00 112.79 ? 9   DT  Y "C4'" 1 
ATOM   1109 O "O4'" . DT  C 1 17  ? 48.773 15.714  4.496   1.00 111.94 ? 9   DT  Y "O4'" 1 
ATOM   1110 C "C3'" . DT  C 1 17  ? 50.468 17.219  5.173   1.00 112.04 ? 9   DT  Y "C3'" 1 
ATOM   1111 O "O3'" . DT  C 1 17  ? 49.704 18.119  5.979   1.00 111.33 ? 9   DT  Y "O3'" 1 
ATOM   1112 C "C2'" . DT  C 1 17  ? 50.631 15.921  5.949   1.00 110.77 ? 9   DT  Y "C2'" 1 
ATOM   1113 C "C1'" . DT  C 1 17  ? 49.255 15.294  5.767   1.00 110.00 ? 9   DT  Y "C1'" 1 
ATOM   1114 N N1    . DT  C 1 17  ? 49.134 13.824  5.853   1.00 107.29 ? 9   DT  Y N1    1 
ATOM   1115 C C2    . DT  C 1 17  ? 47.971 13.344  6.402   1.00 106.54 ? 9   DT  Y C2    1 
ATOM   1116 O O2    . DT  C 1 17  ? 47.081 14.071  6.808   1.00 106.46 ? 9   DT  Y O2    1 
ATOM   1117 N N3    . DT  C 1 17  ? 47.882 11.979  6.460   1.00 105.60 ? 9   DT  Y N3    1 
ATOM   1118 C C4    . DT  C 1 17  ? 48.818 11.063  6.036   1.00 105.09 ? 9   DT  Y C4    1 
ATOM   1119 O O4    . DT  C 1 17  ? 48.587 9.857   6.155   1.00 104.60 ? 9   DT  Y O4    1 
ATOM   1120 C C5    . DT  C 1 17  ? 50.023 11.634  5.472   1.00 105.24 ? 9   DT  Y C5    1 
ATOM   1121 C C7    . DT  C 1 17  ? 51.101 10.716  4.988   1.00 105.77 ? 9   DT  Y C7    1 
ATOM   1122 C C6    . DT  C 1 17  ? 50.120 12.971  5.410   1.00 105.62 ? 9   DT  Y C6    1 
ATOM   1123 O "O5'" . DC  D 2 1   ? 56.565 7.913   16.831  1.00 83.18  ? 13  DC  Z "O5'" 1 
ATOM   1124 C "C5'" . DC  D 2 1   ? 57.345 7.173   17.765  1.00 83.07  ? 13  DC  Z "C5'" 1 
ATOM   1125 C "C4'" . DC  D 2 1   ? 56.469 6.297   18.628  1.00 83.82  ? 13  DC  Z "C4'" 1 
ATOM   1126 O "O4'" . DC  D 2 1   ? 55.683 7.116   19.522  1.00 84.86  ? 13  DC  Z "O4'" 1 
ATOM   1127 C "C3'" . DC  D 2 1   ? 55.444 5.515   17.813  1.00 83.04  ? 13  DC  Z "C3'" 1 
ATOM   1128 O "O3'" . DC  D 2 1   ? 55.066 4.364   18.565  1.00 82.18  ? 13  DC  Z "O3'" 1 
ATOM   1129 C "C2'" . DC  D 2 1   ? 54.271 6.472   17.739  1.00 83.13  ? 13  DC  Z "C2'" 1 
ATOM   1130 C "C1'" . DC  D 2 1   ? 54.316 7.096   19.121  1.00 85.72  ? 13  DC  Z "C1'" 1 
ATOM   1131 N N1    . DC  D 2 1   ? 53.784 8.461   19.244  1.00 87.26  ? 13  DC  Z N1    1 
ATOM   1132 C C2    . DC  D 2 1   ? 52.565 8.654   19.908  1.00 87.24  ? 13  DC  Z C2    1 
ATOM   1133 O O2    . DC  D 2 1   ? 51.945 7.663   20.331  1.00 86.64  ? 13  DC  Z O2    1 
ATOM   1134 N N3    . DC  D 2 1   ? 52.096 9.909   20.071  1.00 86.65  ? 13  DC  Z N3    1 
ATOM   1135 C C4    . DC  D 2 1   ? 52.787 10.944  19.596  1.00 87.66  ? 13  DC  Z C4    1 
ATOM   1136 N N4    . DC  D 2 1   ? 52.294 12.166  19.790  1.00 89.02  ? 13  DC  Z N4    1 
ATOM   1137 C C5    . DC  D 2 1   ? 54.016 10.775  18.899  1.00 88.74  ? 13  DC  Z C5    1 
ATOM   1138 C C6    . DC  D 2 1   ? 54.473 9.528   18.744  1.00 88.33  ? 13  DC  Z C6    1 
ATOM   1139 P P     . DT  D 2 2   ? 54.367 3.131   17.826  1.00 82.33  ? 12  DT  Z P     1 
ATOM   1140 O OP1   . DT  D 2 2   ? 54.090 2.100   18.868  1.00 78.23  ? 12  DT  Z OP1   1 
ATOM   1141 O OP2   . DT  D 2 2   ? 55.197 2.790   16.637  1.00 81.05  ? 12  DT  Z OP2   1 
ATOM   1142 O "O5'" . DT  D 2 2   ? 52.983 3.728   17.308  1.00 80.38  ? 12  DT  Z "O5'" 1 
ATOM   1143 C "C5'" . DT  D 2 2   ? 51.746 3.184   17.759  1.00 75.61  ? 12  DT  Z "C5'" 1 
ATOM   1144 C "C4'" . DT  D 2 2   ? 50.641 3.480   16.773  1.00 71.54  ? 12  DT  Z "C4'" 1 
ATOM   1145 O "O4'" . DT  D 2 2   ? 50.244 4.867   16.865  1.00 70.27  ? 12  DT  Z "O4'" 1 
ATOM   1146 C "C3'" . DT  D 2 2   ? 51.138 3.309   15.337  1.00 70.09  ? 12  DT  Z "C3'" 1 
ATOM   1147 O "O3'" . DT  D 2 2   ? 50.023 3.029   14.491  1.00 68.23  ? 12  DT  Z "O3'" 1 
ATOM   1148 C "C2'" . DT  D 2 2   ? 51.668 4.689   14.998  1.00 68.61  ? 12  DT  Z "C2'" 1 
ATOM   1149 C "C1'" . DT  D 2 2   ? 50.608 5.527   15.669  1.00 68.86  ? 12  DT  Z "C1'" 1 
ATOM   1150 N N1    . DT  D 2 2   ? 50.860 6.937   15.953  1.00 68.03  ? 12  DT  Z N1    1 
ATOM   1151 C C2    . DT  D 2 2   ? 49.818 7.653   16.484  1.00 67.89  ? 12  DT  Z C2    1 
ATOM   1152 O O2    . DT  D 2 2   ? 48.739 7.157   16.753  1.00 65.04  ? 12  DT  Z O2    1 
ATOM   1153 N N3    . DT  D 2 2   ? 50.083 8.979   16.690  1.00 69.15  ? 12  DT  Z N3    1 
ATOM   1154 C C4    . DT  D 2 2   ? 51.264 9.640   16.433  1.00 70.01  ? 12  DT  Z C4    1 
ATOM   1155 O O4    . DT  D 2 2   ? 51.356 10.831  16.672  1.00 71.80  ? 12  DT  Z O4    1 
ATOM   1156 C C5    . DT  D 2 2   ? 52.322 8.828   15.890  1.00 70.26  ? 12  DT  Z C5    1 
ATOM   1157 C C7    . DT  D 2 2   ? 53.640 9.465   15.586  1.00 69.25  ? 12  DT  Z C7    1 
ATOM   1158 C C6    . DT  D 2 2   ? 52.071 7.529   15.680  1.00 70.45  ? 12  DT  Z C6    1 
ATOM   1159 P P     . DA  D 2 3   ? 49.659 1.514   14.129  1.00 69.47  ? 11  DA  Z P     1 
ATOM   1160 O OP1   . DA  D 2 3   ? 50.684 0.584   14.657  1.00 70.31  ? 11  DA  Z OP1   1 
ATOM   1161 O OP2   . DA  D 2 3   ? 49.313 1.496   12.687  1.00 67.61  ? 11  DA  Z OP2   1 
ATOM   1162 O "O5'" . DA  D 2 3   ? 48.362 1.219   14.993  1.00 69.31  ? 11  DA  Z "O5'" 1 
ATOM   1163 C "C5'" . DA  D 2 3   ? 47.124 1.010   14.345  1.00 67.57  ? 11  DA  Z "C5'" 1 
ATOM   1164 C "C4'" . DA  D 2 3   ? 46.053 1.868   14.968  1.00 63.73  ? 11  DA  Z "C4'" 1 
ATOM   1165 O "O4'" . DA  D 2 3   ? 46.553 3.209   15.171  1.00 61.54  ? 11  DA  Z "O4'" 1 
ATOM   1166 C "C3'" . DA  D 2 3   ? 44.896 2.016   13.998  1.00 63.27  ? 11  DA  Z "C3'" 1 
ATOM   1167 O "O3'" . DA  D 2 3   ? 43.694 2.224   14.726  1.00 62.86  ? 11  DA  Z "O3'" 1 
ATOM   1168 C "C2'" . DA  D 2 3   ? 45.295 3.232   13.186  1.00 61.77  ? 11  DA  Z "C2'" 1 
ATOM   1169 C "C1'" . DA  D 2 3   ? 45.952 4.095   14.242  1.00 61.36  ? 11  DA  Z "C1'" 1 
ATOM   1170 N N9    . DA  D 2 3   ? 46.984 5.006   13.751  1.00 61.92  ? 11  DA  Z N9    1 
ATOM   1171 C C8    . DA  D 2 3   ? 48.149 4.714   13.081  1.00 60.84  ? 11  DA  Z C8    1 
ATOM   1172 N N7    . DA  D 2 3   ? 48.874 5.775   12.799  1.00 61.00  ? 11  DA  Z N7    1 
ATOM   1173 C C5    . DA  D 2 3   ? 48.136 6.832   13.315  1.00 60.02  ? 11  DA  Z C5    1 
ATOM   1174 C C6    . DA  D 2 3   ? 48.361 8.222   13.349  1.00 59.87  ? 11  DA  Z C6    1 
ATOM   1175 N N6    . DA  D 2 3   ? 49.434 8.814   12.832  1.00 59.94  ? 11  DA  Z N6    1 
ATOM   1176 N N1    . DA  D 2 3   ? 47.426 8.996   13.941  1.00 59.77  ? 11  DA  Z N1    1 
ATOM   1177 C C2    . DA  D 2 3   ? 46.344 8.406   14.457  1.00 60.31  ? 11  DA  Z C2    1 
ATOM   1178 N N3    . DA  D 2 3   ? 46.019 7.113   14.490  1.00 59.38  ? 11  DA  Z N3    1 
ATOM   1179 C C4    . DA  D 2 3   ? 46.967 6.373   13.897  1.00 60.66  ? 11  DA  Z C4    1 
ATOM   1180 P P     . DG  D 2 4   ? 42.312 1.724   14.107  1.00 64.75  ? 10  DG  Z P     1 
ATOM   1181 O OP1   . DG  D 2 4   ? 41.444 1.230   15.219  1.00 65.46  ? 10  DG  Z OP1   1 
ATOM   1182 O OP2   . DG  D 2 4   ? 42.665 0.815   12.978  1.00 64.02  ? 10  DG  Z OP2   1 
ATOM   1183 O "O5'" . DG  D 2 4   ? 41.698 3.059   13.525  1.00 58.86  ? 10  DG  Z "O5'" 1 
ATOM   1184 C "C5'" . DG  D 2 4   ? 42.558 4.097   13.186  1.00 58.71  ? 10  DG  Z "C5'" 1 
ATOM   1185 C "C4'" . DG  D 2 4   ? 41.793 5.381   13.071  1.00 62.05  ? 10  DG  Z "C4'" 1 
ATOM   1186 O "O4'" . DG  D 2 4   ? 42.767 6.434   12.957  1.00 64.49  ? 10  DG  Z "O4'" 1 
ATOM   1187 C "C3'" . DG  D 2 4   ? 40.943 5.467   11.813  1.00 63.28  ? 10  DG  Z "C3'" 1 
ATOM   1188 O "O3'" . DG  D 2 4   ? 39.857 6.351   12.081  1.00 63.97  ? 10  DG  Z "O3'" 1 
ATOM   1189 C "C2'" . DG  D 2 4   ? 41.921 6.016   10.792  1.00 63.77  ? 10  DG  Z "C2'" 1 
ATOM   1190 C "C1'" . DG  D 2 4   ? 42.797 6.935   11.634  1.00 64.43  ? 10  DG  Z "C1'" 1 
ATOM   1191 N N9    . DG  D 2 4   ? 44.197 7.005   11.224  1.00 64.46  ? 10  DG  Z N9    1 
ATOM   1192 C C8    . DG  D 2 4   ? 45.002 5.980   10.782  1.00 64.67  ? 10  DG  Z C8    1 
ATOM   1193 N N7    . DG  D 2 4   ? 46.197 6.381   10.440  1.00 63.50  ? 10  DG  Z N7    1 
ATOM   1194 C C5    . DG  D 2 4   ? 46.181 7.747   10.683  1.00 64.16  ? 10  DG  Z C5    1 
ATOM   1195 C C6    . DG  D 2 4   ? 47.188 8.730   10.496  1.00 66.83  ? 10  DG  Z C6    1 
ATOM   1196 O O6    . DG  D 2 4   ? 48.349 8.586   10.067  1.00 68.95  ? 10  DG  Z O6    1 
ATOM   1197 N N1    . DG  D 2 4   ? 46.737 9.996   10.869  1.00 66.47  ? 10  DG  Z N1    1 
ATOM   1198 C C2    . DG  D 2 4   ? 45.486 10.276  11.365  1.00 64.15  ? 10  DG  Z C2    1 
ATOM   1199 N N2    . DG  D 2 4   ? 45.239 11.551  11.674  1.00 65.11  ? 10  DG  Z N2    1 
ATOM   1200 N N3    . DG  D 2 4   ? 44.549 9.372   11.545  1.00 63.11  ? 10  DG  Z N3    1 
ATOM   1201 C C4    . DG  D 2 4   ? 44.959 8.140   11.182  1.00 63.63  ? 10  DG  Z C4    1 
ATOM   1202 P P     . DA  D 2 5   ? 38.891 6.825   10.899  1.00 63.06  ? 9   DA  Z P     1 
ATOM   1203 O OP1   . DA  D 2 5   ? 37.501 6.662   11.378  1.00 64.00  ? 9   DA  Z OP1   1 
ATOM   1204 O OP2   . DA  D 2 5   ? 39.304 6.192   9.627   1.00 64.99  ? 9   DA  Z OP2   1 
ATOM   1205 O "O5'" . DA  D 2 5   ? 39.195 8.377   10.842  1.00 63.65  ? 9   DA  Z "O5'" 1 
ATOM   1206 C "C5'" . DA  D 2 5   ? 39.309 9.109   12.050  1.00 66.48  ? 9   DA  Z "C5'" 1 
ATOM   1207 C "C4'" . DA  D 2 5   ? 39.498 10.574  11.751  1.00 67.98  ? 9   DA  Z "C4'" 1 
ATOM   1208 O "O4'" . DA  D 2 5   ? 40.825 10.796  11.221  1.00 68.41  ? 9   DA  Z "O4'" 1 
ATOM   1209 C "C3'" . DA  D 2 5   ? 38.547 11.064  10.674  1.00 69.65  ? 9   DA  Z "C3'" 1 
ATOM   1210 O "O3'" . DA  D 2 5   ? 38.260 12.441  10.915  1.00 72.25  ? 9   DA  Z "O3'" 1 
ATOM   1211 C "C2'" . DA  D 2 5   ? 39.328 10.803  9.396   1.00 70.59  ? 9   DA  Z "C2'" 1 
ATOM   1212 C "C1'" . DA  D 2 5   ? 40.770 11.072  9.824   1.00 69.99  ? 9   DA  Z "C1'" 1 
ATOM   1213 N N9    . DA  D 2 5   ? 41.807 10.257  9.174   1.00 69.47  ? 9   DA  Z N9    1 
ATOM   1214 C C8    . DA  D 2 5   ? 41.799 8.896   8.963   1.00 69.82  ? 9   DA  Z C8    1 
ATOM   1215 N N7    . DA  D 2 5   ? 42.911 8.433   8.436   1.00 68.77  ? 9   DA  Z N7    1 
ATOM   1216 C C5    . DA  D 2 5   ? 43.698 9.563   8.270   1.00 68.28  ? 9   DA  Z C5    1 
ATOM   1217 C C6    . DA  D 2 5   ? 45.007 9.745   7.770   1.00 67.43  ? 9   DA  Z C6    1 
ATOM   1218 N N6    . DA  D 2 5   ? 45.786 8.750   7.335   1.00 65.16  ? 9   DA  Z N6    1 
ATOM   1219 N N1    . DA  D 2 5   ? 45.496 11.004  7.739   1.00 67.79  ? 9   DA  Z N1    1 
ATOM   1220 C C2    . DA  D 2 5   ? 44.721 12.006  8.184   1.00 68.66  ? 9   DA  Z C2    1 
ATOM   1221 N N3    . DA  D 2 5   ? 43.482 11.963  8.680   1.00 69.20  ? 9   DA  Z N3    1 
ATOM   1222 C C4    . DA  D 2 5   ? 43.022 10.699  8.699   1.00 68.75  ? 9   DA  Z C4    1 
ATOM   1223 P P     . DT  D 2 6   ? 37.074 13.155  10.116  1.00 74.27  ? 8   DT  Z P     1 
ATOM   1224 O OP1   . DT  D 2 6   ? 36.302 14.006  11.055  1.00 74.99  ? 8   DT  Z OP1   1 
ATOM   1225 O OP2   . DT  D 2 6   ? 36.373 12.118  9.306   1.00 73.93  ? 8   DT  Z OP2   1 
ATOM   1226 O "O5'" . DT  D 2 6   ? 37.895 14.116  9.164   1.00 75.32  ? 8   DT  Z "O5'" 1 
ATOM   1227 C "C5'" . DT  D 2 6   ? 39.248 13.813  8.870   1.00 76.28  ? 8   DT  Z "C5'" 1 
ATOM   1228 C "C4'" . DT  D 2 6   ? 39.925 15.014  8.270   1.00 77.62  ? 8   DT  Z "C4'" 1 
ATOM   1229 O "O4'" . DT  D 2 6   ? 41.206 14.570  7.763   1.00 77.52  ? 8   DT  Z "O4'" 1 
ATOM   1230 C "C3'" . DT  D 2 6   ? 39.166 15.537  7.061   1.00 79.02  ? 8   DT  Z "C3'" 1 
ATOM   1231 O "O3'" . DT  D 2 6   ? 39.325 16.947  6.939   1.00 82.63  ? 8   DT  Z "O3'" 1 
ATOM   1232 C "C2'" . DT  D 2 6   ? 39.743 14.730  5.912   1.00 77.81  ? 8   DT  Z "C2'" 1 
ATOM   1233 C "C1'" . DT  D 2 6   ? 41.190 14.499  6.340   1.00 76.23  ? 8   DT  Z "C1'" 1 
ATOM   1234 N N1    . DT  D 2 6   ? 41.719 13.165  5.957   1.00 73.98  ? 8   DT  Z N1    1 
ATOM   1235 C C2    . DT  D 2 6   ? 43.009 13.080  5.474   1.00 71.65  ? 8   DT  Z C2    1 
ATOM   1236 O O2    . DT  D 2 6   ? 43.737 14.050  5.345   1.00 72.46  ? 8   DT  Z O2    1 
ATOM   1237 N N3    . DT  D 2 6   ? 43.415 11.810  5.148   1.00 68.96  ? 8   DT  Z N3    1 
ATOM   1238 C C4    . DT  D 2 6   ? 42.680 10.641  5.254   1.00 69.17  ? 8   DT  Z C4    1 
ATOM   1239 O O4    . DT  D 2 6   ? 43.184 9.564   4.927   1.00 68.65  ? 8   DT  Z O4    1 
ATOM   1240 C C5    . DT  D 2 6   ? 41.336 10.803  5.760   1.00 69.53  ? 8   DT  Z C5    1 
ATOM   1241 C C7    . DT  D 2 6   ? 40.462 9.597   5.896   1.00 67.83  ? 8   DT  Z C7    1 
ATOM   1242 C C6    . DT  D 2 6   ? 40.930 12.039  6.086   1.00 71.52  ? 8   DT  Z C6    1 
ATOM   1243 P P     . DC  D 2 7   ? 38.602 17.719  5.736   1.00 86.14  ? 7   DC  Z P     1 
ATOM   1244 O OP1   . DC  D 2 7   ? 38.323 19.103  6.201   1.00 85.48  ? 7   DC  Z OP1   1 
ATOM   1245 O OP2   . DC  D 2 7   ? 37.488 16.867  5.235   1.00 83.65  ? 7   DC  Z OP2   1 
ATOM   1246 O "O5'" . DC  D 2 7   ? 39.746 17.767  4.631   1.00 87.40  ? 7   DC  Z "O5'" 1 
ATOM   1247 C "C5'" . DC  D 2 7   ? 41.111 17.921  5.018   1.00 89.20  ? 7   DC  Z "C5'" 1 
ATOM   1248 C "C4'" . DC  D 2 7   ? 41.977 18.188  3.808   1.00 91.55  ? 7   DC  Z "C4'" 1 
ATOM   1249 O "O4'" . DC  D 2 7   ? 42.619 16.961  3.373   1.00 90.34  ? 7   DC  Z "O4'" 1 
ATOM   1250 C "C3'" . DC  D 2 7   ? 41.155 18.656  2.608   1.00 92.98  ? 7   DC  Z "C3'" 1 
ATOM   1251 O "O3'" . DC  D 2 7   ? 41.937 19.526  1.788   1.00 97.40  ? 7   DC  Z "O3'" 1 
ATOM   1252 C "C2'" . DC  D 2 7   ? 40.807 17.354  1.906   1.00 90.97  ? 7   DC  Z "C2'" 1 
ATOM   1253 C "C1'" . DC  D 2 7   ? 42.069 16.533  2.133   1.00 88.80  ? 7   DC  Z "C1'" 1 
ATOM   1254 N N1    . DC  D 2 7   ? 41.909 15.070  2.174   1.00 86.19  ? 7   DC  Z N1    1 
ATOM   1255 C C2    . DC  D 2 7   ? 42.887 14.275  1.569   1.00 85.97  ? 7   DC  Z C2    1 
ATOM   1256 O O2    . DC  D 2 7   ? 43.859 14.825  1.034   1.00 86.95  ? 7   DC  Z O2    1 
ATOM   1257 N N3    . DC  D 2 7   ? 42.750 12.931  1.577   1.00 85.29  ? 7   DC  Z N3    1 
ATOM   1258 C C4    . DC  D 2 7   ? 41.684 12.376  2.157   1.00 85.24  ? 7   DC  Z C4    1 
ATOM   1259 N N4    . DC  D 2 7   ? 41.581 11.044  2.128   1.00 85.40  ? 7   DC  Z N4    1 
ATOM   1260 C C5    . DC  D 2 7   ? 40.677 13.160  2.789   1.00 85.26  ? 7   DC  Z C5    1 
ATOM   1261 C C6    . DC  D 2 7   ? 40.830 14.492  2.776   1.00 85.82  ? 7   DC  Z C6    1 
ATOM   1262 P P     . DA  D 2 8   ? 41.221 20.426  0.669   1.00 100.50 ? 6   DA  Z P     1 
ATOM   1263 O OP1   . DA  D 2 8   ? 41.818 21.785  0.762   1.00 99.14  ? 6   DA  Z OP1   1 
ATOM   1264 O OP2   . DA  D 2 8   ? 39.744 20.256  0.760   1.00 99.31  ? 6   DA  Z OP2   1 
ATOM   1265 O "O5'" . DA  D 2 8   ? 41.727 19.767  -0.684  1.00 101.56 ? 6   DA  Z "O5'" 1 
ATOM   1266 C "C5'" . DA  D 2 8   ? 43.118 19.689  -0.957  1.00 103.76 ? 6   DA  Z "C5'" 1 
ATOM   1267 C "C4'" . DA  D 2 8   ? 43.355 19.051  -2.305  1.00 106.01 ? 6   DA  Z "C4'" 1 
ATOM   1268 O "O4'" . DA  D 2 8   ? 43.213 17.609  -2.199  1.00 106.05 ? 6   DA  Z "O4'" 1 
ATOM   1269 C "C3'" . DA  D 2 8   ? 42.302 19.489  -3.322  1.00 106.80 ? 6   DA  Z "C3'" 1 
ATOM   1270 O "O3'" . DA  D 2 8   ? 42.868 19.489  -4.636  1.00 109.36 ? 6   DA  Z "O3'" 1 
ATOM   1271 C "C2'" . DA  D 2 8   ? 41.215 18.439  -3.153  1.00 106.06 ? 6   DA  Z "C2'" 1 
ATOM   1272 C "C1'" . DA  D 2 8   ? 42.044 17.188  -2.889  1.00 104.79 ? 6   DA  Z "C1'" 1 
ATOM   1273 N N9    . DA  D 2 8   ? 41.422 16.090  -2.142  1.00 102.31 ? 6   DA  Z N9    1 
ATOM   1274 C C8    . DA  D 2 8   ? 40.390 16.122  -1.234  1.00 101.21 ? 6   DA  Z C8    1 
ATOM   1275 N N7    . DA  D 2 8   ? 40.045 14.938  -0.785  1.00 99.45  ? 6   DA  Z N7    1 
ATOM   1276 C C5    . DA  D 2 8   ? 40.915 14.069  -1.433  1.00 99.15  ? 6   DA  Z C5    1 
ATOM   1277 C C6    . DA  D 2 8   ? 41.064 12.669  -1.395  1.00 98.38  ? 6   DA  Z C6    1 
ATOM   1278 N N6    . DA  D 2 8   ? 40.311 11.861  -0.648  1.00 97.83  ? 6   DA  Z N6    1 
ATOM   1279 N N1    . DA  D 2 8   ? 42.030 12.118  -2.164  1.00 98.40  ? 6   DA  Z N1    1 
ATOM   1280 C C2    . DA  D 2 8   ? 42.786 12.925  -2.916  1.00 99.11  ? 6   DA  Z C2    1 
ATOM   1281 N N3    . DA  D 2 8   ? 42.741 14.249  -3.038  1.00 99.96  ? 6   DA  Z N3    1 
ATOM   1282 C C4    . DA  D 2 8   ? 41.773 14.766  -2.262  1.00 100.40 ? 6   DA  Z C4    1 
ATOM   1283 P P     . DC  D 2 9   ? 42.149 20.309  -5.817  1.00 112.22 ? 5   DC  Z P     1 
ATOM   1284 O OP1   . DC  D 2 9   ? 43.197 21.148  -6.457  1.00 111.91 ? 5   DC  Z OP1   1 
ATOM   1285 O OP2   . DC  D 2 9   ? 40.910 20.949  -5.293  1.00 110.33 ? 5   DC  Z OP2   1 
ATOM   1286 O "O5'" . DC  D 2 9   ? 41.745 19.154  -6.832  1.00 111.78 ? 5   DC  Z "O5'" 1 
ATOM   1287 C "C5'" . DC  D 2 9   ? 41.605 17.826  -6.356  1.00 112.62 ? 5   DC  Z "C5'" 1 
ATOM   1288 C "C4'" . DC  D 2 9   ? 42.435 16.877  -7.184  1.00 113.61 ? 5   DC  Z "C4'" 1 
ATOM   1289 O "O4'" . DC  D 2 9   ? 42.495 15.621  -6.474  1.00 113.15 ? 5   DC  Z "O4'" 1 
ATOM   1290 C "C3'" . DC  D 2 9   ? 41.797 16.557  -8.531  1.00 115.24 ? 5   DC  Z "C3'" 1 
ATOM   1291 O "O3'" . DC  D 2 9   ? 42.793 16.155  -9.478  1.00 118.52 ? 5   DC  Z "O3'" 1 
ATOM   1292 C "C2'" . DC  D 2 9   ? 40.889 15.395  -8.192  1.00 114.24 ? 5   DC  Z "C2'" 1 
ATOM   1293 C "C1'" . DC  D 2 9   ? 41.684 14.655  -7.126  1.00 113.28 ? 5   DC  Z "C1'" 1 
ATOM   1294 N N1    . DC  D 2 9   ? 40.838 14.011  -6.109  1.00 112.42 ? 5   DC  Z N1    1 
ATOM   1295 C C2    . DC  D 2 9   ? 40.901 12.627  -5.973  1.00 111.51 ? 5   DC  Z C2    1 
ATOM   1296 O O2    . DC  D 2 9   ? 41.689 11.993  -6.693  1.00 111.24 ? 5   DC  Z O2    1 
ATOM   1297 N N3    . DC  D 2 9   ? 40.105 12.014  -5.069  1.00 110.66 ? 5   DC  Z N3    1 
ATOM   1298 C C4    . DC  D 2 9   ? 39.272 12.735  -4.318  1.00 110.41 ? 5   DC  Z C4    1 
ATOM   1299 N N4    . DC  D 2 9   ? 38.499 12.085  -3.451  1.00 109.89 ? 5   DC  Z N4    1 
ATOM   1300 C C5    . DC  D 2 9   ? 39.196 14.153  -4.424  1.00 110.57 ? 5   DC  Z C5    1 
ATOM   1301 C C6    . DC  D 2 9   ? 39.993 14.746  -5.323  1.00 111.70 ? 5   DC  Z C6    1 
ATOM   1302 P P     . DA  D 2 10  ? 42.410 16.031  -11.038 1.00 120.25 ? 4   DA  Z P     1 
ATOM   1303 O OP1   . DA  D 2 10  ? 43.482 16.751  -11.777 1.00 120.29 ? 4   DA  Z OP1   1 
ATOM   1304 O OP2   . DA  D 2 10  ? 40.986 16.423  -11.227 1.00 119.60 ? 4   DA  Z OP2   1 
ATOM   1305 O "O5'" . DA  D 2 10  ? 42.545 14.476  -11.361 1.00 119.29 ? 4   DA  Z "O5'" 1 
ATOM   1306 C "C5'" . DA  D 2 10  ? 43.821 13.840  -11.340 1.00 118.69 ? 4   DA  Z "C5'" 1 
ATOM   1307 C "C4'" . DA  D 2 10  ? 43.686 12.374  -11.681 1.00 118.27 ? 4   DA  Z "C4'" 1 
ATOM   1308 O "O4'" . DA  D 2 10  ? 42.904 11.724  -10.645 1.00 117.76 ? 4   DA  Z "O4'" 1 
ATOM   1309 C "C3'" . DA  D 2 10  ? 42.906 12.142  -12.974 1.00 118.06 ? 4   DA  Z "C3'" 1 
ATOM   1310 O "O3'" . DA  D 2 10  ? 43.348 10.946  -13.629 1.00 117.29 ? 4   DA  Z "O3'" 1 
ATOM   1311 C "C2'" . DA  D 2 10  ? 41.470 12.056  -12.494 1.00 117.40 ? 4   DA  Z "C2'" 1 
ATOM   1312 C "C1'" . DA  D 2 10  ? 41.619 11.369  -11.145 1.00 116.97 ? 4   DA  Z "C1'" 1 
ATOM   1313 N N9    . DA  D 2 10  ? 40.611 11.767  -10.161 1.00 115.90 ? 4   DA  Z N9    1 
ATOM   1314 C C8    . DA  D 2 10  ? 40.049 13.009  -10.004 1.00 115.69 ? 4   DA  Z C8    1 
ATOM   1315 N N7    . DA  D 2 10  ? 39.121 13.058  -9.076  1.00 115.34 ? 4   DA  Z N7    1 
ATOM   1316 C C5    . DA  D 2 10  ? 39.078 11.763  -8.578  1.00 114.61 ? 4   DA  Z C5    1 
ATOM   1317 C C6    . DA  D 2 10  ? 38.294 11.158  -7.576  1.00 113.39 ? 4   DA  Z C6    1 
ATOM   1318 N N6    . DA  D 2 10  ? 37.366 11.806  -6.866  1.00 112.32 ? 4   DA  Z N6    1 
ATOM   1319 N N1    . DA  D 2 10  ? 38.500 9.848   -7.326  1.00 112.98 ? 4   DA  Z N1    1 
ATOM   1320 C C2    . DA  D 2 10  ? 39.433 9.198   -8.036  1.00 113.48 ? 4   DA  Z C2    1 
ATOM   1321 N N3    . DA  D 2 10  ? 40.232 9.654   -9.000  1.00 114.70 ? 4   DA  Z N3    1 
ATOM   1322 C C4    . DA  D 2 10  ? 40.002 10.959  -9.228  1.00 115.17 ? 4   DA  Z C4    1 
ATOM   1323 P P     . DT  D 2 11  ? 42.412 10.251  -14.738 1.00 117.27 ? 3   DT  Z P     1 
ATOM   1324 O OP1   . DT  D 2 11  ? 43.308 9.474   -15.636 1.00 116.22 ? 3   DT  Z OP1   1 
ATOM   1325 O OP2   . DT  D 2 11  ? 41.498 11.274  -15.318 1.00 116.60 ? 3   DT  Z OP2   1 
ATOM   1326 O "O5'" . DT  D 2 11  ? 41.546 9.230   -13.875 1.00 115.42 ? 3   DT  Z "O5'" 1 
ATOM   1327 C "C5'" . DT  D 2 11  ? 42.158 8.519   -12.803 1.00 112.89 ? 3   DT  Z "C5'" 1 
ATOM   1328 C "C4'" . DT  D 2 11  ? 41.409 7.241   -12.502 1.00 111.10 ? 3   DT  Z "C4'" 1 
ATOM   1329 O "O4'" . DT  D 2 11  ? 40.348 7.498   -11.550 1.00 109.59 ? 3   DT  Z "O4'" 1 
ATOM   1330 C "C3'" . DT  D 2 11  ? 40.714 6.654   -13.728 1.00 109.92 ? 3   DT  Z "C3'" 1 
ATOM   1331 O "O3'" . DT  D 2 11  ? 40.646 5.227   -13.591 1.00 110.19 ? 3   DT  Z "O3'" 1 
ATOM   1332 C "C2'" . DT  D 2 11  ? 39.344 7.314   -13.681 1.00 108.73 ? 3   DT  Z "C2'" 1 
ATOM   1333 C "C1'" . DT  D 2 11  ? 39.083 7.362   -12.180 1.00 107.32 ? 3   DT  Z "C1'" 1 
ATOM   1334 N N1    . DT  D 2 11  ? 38.183 8.408   -11.649 1.00 104.87 ? 3   DT  Z N1    1 
ATOM   1335 C C2    . DT  D 2 11  ? 37.246 8.016   -10.712 1.00 103.61 ? 3   DT  Z C2    1 
ATOM   1336 O O2    . DT  D 2 11  ? 37.129 6.866   -10.328 1.00 101.81 ? 3   DT  Z O2    1 
ATOM   1337 N N3    . DT  D 2 11  ? 36.445 9.023   -10.239 1.00 103.10 ? 3   DT  Z N3    1 
ATOM   1338 C C4    . DT  D 2 11  ? 36.482 10.353  -10.600 1.00 103.73 ? 3   DT  Z C4    1 
ATOM   1339 O O4    . DT  D 2 11  ? 35.698 11.147  -10.082 1.00 103.39 ? 3   DT  Z O4    1 
ATOM   1340 C C5    . DT  D 2 11  ? 37.482 10.697  -11.593 1.00 104.06 ? 3   DT  Z C5    1 
ATOM   1341 C C7    . DT  D 2 11  ? 37.588 12.118  -12.049 1.00 104.39 ? 3   DT  Z C7    1 
ATOM   1342 C C6    . DT  D 2 11  ? 38.274 9.719   -12.061 1.00 103.83 ? 3   DT  Z C6    1 
ATOM   1343 P P     . DT  D 2 12  ? 40.067 4.331   -14.793 1.00 110.52 ? 2   DT  Z P     1 
ATOM   1344 O OP1   . DT  D 2 12  ? 40.202 2.899   -14.405 1.00 108.98 ? 2   DT  Z OP1   1 
ATOM   1345 O OP2   . DT  D 2 12  ? 40.667 4.805   -16.064 1.00 110.61 ? 2   DT  Z OP2   1 
ATOM   1346 O "O5'" . DT  D 2 12  ? 38.521 4.706   -14.806 1.00 109.24 ? 2   DT  Z "O5'" 1 
ATOM   1347 C "C5'" . DT  D 2 12  ? 37.531 3.689   -14.784 1.00 107.37 ? 2   DT  Z "C5'" 1 
ATOM   1348 C "C4'" . DT  D 2 12  ? 37.409 3.109   -13.393 1.00 105.10 ? 2   DT  Z "C4'" 1 
ATOM   1349 O "O4'" . DT  D 2 12  ? 37.078 4.166   -12.461 1.00 103.61 ? 2   DT  Z "O4'" 1 
ATOM   1350 C "C3'" . DT  D 2 12  ? 36.262 2.117   -13.290 1.00 104.44 ? 2   DT  Z "C3'" 1 
ATOM   1351 O "O3'" . DT  D 2 12  ? 36.540 1.120   -12.315 1.00 105.17 ? 2   DT  Z "O3'" 1 
ATOM   1352 C "C2'" . DT  D 2 12  ? 35.080 2.992   -12.921 1.00 103.31 ? 2   DT  Z "C2'" 1 
ATOM   1353 C "C1'" . DT  D 2 12  ? 35.717 4.056   -12.046 1.00 102.55 ? 2   DT  Z "C1'" 1 
ATOM   1354 N N1    . DT  D 2 12  ? 35.102 5.393   -12.168 1.00 101.20 ? 2   DT  Z N1    1 
ATOM   1355 C C2    . DT  D 2 12  ? 33.956 5.665   -11.456 1.00 100.61 ? 2   DT  Z C2    1 
ATOM   1356 O O2    . DT  D 2 12  ? 33.398 4.846   -10.750 1.00 100.60 ? 2   DT  Z O2    1 
ATOM   1357 N N3    . DT  D 2 12  ? 33.481 6.945   -11.603 1.00 99.87  ? 2   DT  Z N3    1 
ATOM   1358 C C4    . DT  D 2 12  ? 34.025 7.952   -12.374 1.00 99.43  ? 2   DT  Z C4    1 
ATOM   1359 O O4    . DT  D 2 12  ? 33.501 9.054   -12.396 1.00 99.40  ? 2   DT  Z O4    1 
ATOM   1360 C C5    . DT  D 2 12  ? 35.211 7.595   -13.105 1.00 99.78  ? 2   DT  Z C5    1 
ATOM   1361 C C7    . DT  D 2 12  ? 35.864 8.625   -13.972 1.00 99.47  ? 2   DT  Z C7    1 
ATOM   1362 C C6    . DT  D 2 12  ? 35.683 6.349   -12.972 1.00 100.79 ? 2   DT  Z C6    1 
ATOM   1363 P P     . DT  D 2 13  ? 35.566 -0.150  -12.199 1.00 107.96 ? 1   DT  Z P     1 
ATOM   1364 O OP1   . DT  D 2 13  ? 36.129 -1.061  -11.163 1.00 107.35 ? 1   DT  Z OP1   1 
ATOM   1365 O OP2   . DT  D 2 13  ? 35.275 -0.676  -13.564 1.00 106.66 ? 1   DT  Z OP2   1 
ATOM   1366 O "O5'" . DT  D 2 13  ? 34.228 0.492   -11.630 1.00 105.68 ? 1   DT  Z "O5'" 1 
ATOM   1367 C "C5'" . DT  D 2 13  ? 32.978 -0.137  -11.836 1.00 103.04 ? 1   DT  Z "C5'" 1 
ATOM   1368 C "C4'" . DT  D 2 13  ? 32.115 0.033   -10.611 1.00 101.18 ? 1   DT  Z "C4'" 1 
ATOM   1369 O "O4'" . DT  D 2 13  ? 31.944 1.451   -10.363 1.00 99.62  ? 1   DT  Z "O4'" 1 
ATOM   1370 C "C3'" . DT  D 2 13  ? 30.710 -0.511  -10.817 1.00 100.52 ? 1   DT  Z "C3'" 1 
ATOM   1371 O "O3'" . DT  D 2 13  ? 30.183 -0.995  -9.584  1.00 100.15 ? 1   DT  Z "O3'" 1 
ATOM   1372 C "C2'" . DT  D 2 13  ? 29.967 0.682   -11.392 1.00 100.14 ? 1   DT  Z "C2'" 1 
ATOM   1373 C "C1'" . DT  D 2 13  ? 30.618 1.861   -10.683 1.00 99.60  ? 1   DT  Z "C1'" 1 
ATOM   1374 N N1    . DT  D 2 13  ? 30.717 3.094   -11.495 1.00 99.39  ? 1   DT  Z N1    1 
ATOM   1375 C C2    . DT  D 2 13  ? 29.977 4.202   -11.123 1.00 99.77  ? 1   DT  Z C2    1 
ATOM   1376 O O2    . DT  D 2 13  ? 29.222 4.214   -10.164 1.00 100.51 ? 1   DT  Z O2    1 
ATOM   1377 N N3    . DT  D 2 13  ? 30.157 5.307   -11.923 1.00 98.98  ? 1   DT  Z N3    1 
ATOM   1378 C C4    . DT  D 2 13  ? 30.978 5.411   -13.028 1.00 99.09  ? 1   DT  Z C4    1 
ATOM   1379 O O4    . DT  D 2 13  ? 31.043 6.471   -13.646 1.00 98.19  ? 1   DT  Z O4    1 
ATOM   1380 C C5    . DT  D 2 13  ? 31.714 4.211   -13.365 1.00 99.30  ? 1   DT  Z C5    1 
ATOM   1381 C C7    . DT  D 2 13  ? 32.626 4.230   -14.549 1.00 99.07  ? 1   DT  Z C7    1 
ATOM   1382 C C6    . DT  D 2 13  ? 31.546 3.128   -12.593 1.00 99.26  ? 1   DT  Z C6    1 
ATOM   1383 P P     . DT  D 2 14  ? 28.938 -2.005  -9.596  1.00 102.50 ? -1  DT  Z P     1 
ATOM   1384 O OP1   . DT  D 2 14  ? 29.115 -2.979  -8.489  1.00 103.02 ? -1  DT  Z OP1   1 
ATOM   1385 O OP2   . DT  D 2 14  ? 28.741 -2.502  -10.977 1.00 102.36 ? -1  DT  Z OP2   1 
ATOM   1386 O "O5'" . DT  D 2 14  ? 27.734 -1.040  -9.236  1.00 101.95 ? -1  DT  Z "O5'" 1 
ATOM   1387 C "C5'" . DT  D 2 14  ? 27.884 0.351   -9.440  1.00 103.43 ? -1  DT  Z "C5'" 1 
ATOM   1388 C "C4'" . DT  D 2 14  ? 26.788 1.113   -8.746  1.00 105.55 ? -1  DT  Z "C4'" 1 
ATOM   1389 O "O4'" . DT  D 2 14  ? 26.875 2.475   -9.219  1.00 106.18 ? -1  DT  Z "O4'" 1 
ATOM   1390 C "C3'" . DT  D 2 14  ? 25.390 0.645   -9.116  1.00 106.57 ? -1  DT  Z "C3'" 1 
ATOM   1391 O "O3'" . DT  D 2 14  ? 24.493 0.917   -8.041  1.00 108.09 ? -1  DT  Z "O3'" 1 
ATOM   1392 C "C2'" . DT  D 2 14  ? 25.087 1.443   -10.369 1.00 106.86 ? -1  DT  Z "C2'" 1 
ATOM   1393 C "C1'" . DT  D 2 14  ? 25.827 2.756   -10.144 1.00 106.39 ? -1  DT  Z "C1'" 1 
ATOM   1394 N N1    . DT  D 2 14  ? 26.468 3.266   -11.377 1.00 106.80 ? -1  DT  Z N1    1 
ATOM   1395 C C2    . DT  D 2 14  ? 26.436 4.621   -11.635 1.00 106.73 ? -1  DT  Z C2    1 
ATOM   1396 O O2    . DT  D 2 14  ? 25.874 5.426   -10.909 1.00 107.15 ? -1  DT  Z O2    1 
ATOM   1397 N N3    . DT  D 2 14  ? 27.093 4.998   -12.783 1.00 106.12 ? -1  DT  Z N3    1 
ATOM   1398 C C4    . DT  D 2 14  ? 27.758 4.176   -13.676 1.00 105.64 ? -1  DT  Z C4    1 
ATOM   1399 O O4    . DT  D 2 14  ? 28.314 4.657   -14.656 1.00 105.59 ? -1  DT  Z O4    1 
ATOM   1400 C C5    . DT  D 2 14  ? 27.737 2.771   -13.352 1.00 105.34 ? -1  DT  Z C5    1 
ATOM   1401 C C7    . DT  D 2 14  ? 28.425 1.809   -14.266 1.00 104.77 ? -1  DT  Z C7    1 
ATOM   1402 C C6    . DT  D 2 14  ? 27.100 2.391   -12.238 1.00 106.10 ? -1  DT  Z C6    1 
ATOM   1403 P P     . DT  D 2 15  ? 22.923 1.042   -8.331  1.00 109.38 ? -2  DT  Z P     1 
ATOM   1404 O OP1   . DT  D 2 15  ? 22.223 0.905   -7.031  1.00 110.65 ? -2  DT  Z OP1   1 
ATOM   1405 O OP2   . DT  D 2 15  ? 22.572 0.131   -9.450  1.00 109.73 ? -2  DT  Z OP2   1 
ATOM   1406 O "O5'" . DT  D 2 15  ? 22.771 2.552   -8.815  1.00 109.02 ? -2  DT  Z "O5'" 1 
ATOM   1407 C "C5'" . DT  D 2 15  ? 23.291 3.616   -8.024  1.00 108.96 ? -2  DT  Z "C5'" 1 
ATOM   1408 C "C4'" . DT  D 2 15  ? 22.545 4.901   -8.303  1.00 110.11 ? -2  DT  Z "C4'" 1 
ATOM   1409 O "O4'" . DT  D 2 15  ? 22.964 5.449   -9.577  1.00 109.89 ? -2  DT  Z "O4'" 1 
ATOM   1410 C "C3'" . DT  D 2 15  ? 21.037 4.696   -8.433  1.00 110.26 ? -2  DT  Z "C3'" 1 
ATOM   1411 O "O3'" . DT  D 2 15  ? 20.353 5.894   -8.049  1.00 111.54 ? -2  DT  Z "O3'" 1 
ATOM   1412 C "C2'" . DT  D 2 15  ? 20.868 4.405   -9.913  1.00 109.68 ? -2  DT  Z "C2'" 1 
ATOM   1413 C "C1'" . DT  D 2 15  ? 21.914 5.324   -10.529 1.00 109.49 ? -2  DT  Z "C1'" 1 
ATOM   1414 N N1    . DT  D 2 15  ? 22.503 4.873   -11.796 1.00 108.42 ? -2  DT  Z N1    1 
ATOM   1415 C C2    . DT  D 2 15  ? 22.723 5.819   -12.767 1.00 107.85 ? -2  DT  Z C2    1 
ATOM   1416 O O2    . DT  D 2 15  ? 22.435 6.997   -12.622 1.00 107.29 ? -2  DT  Z O2    1 
ATOM   1417 N N3    . DT  D 2 15  ? 23.293 5.333   -13.919 1.00 107.76 ? -2  DT  Z N3    1 
ATOM   1418 C C4    . DT  D 2 15  ? 23.652 4.021   -14.183 1.00 108.03 ? -2  DT  Z C4    1 
ATOM   1419 O O4    . DT  D 2 15  ? 24.159 3.726   -15.261 1.00 108.51 ? -2  DT  Z O4    1 
ATOM   1420 C C5    . DT  D 2 15  ? 23.384 3.083   -13.120 1.00 107.65 ? -2  DT  Z C5    1 
ATOM   1421 C C7    . DT  D 2 15  ? 23.738 1.643   -13.319 1.00 106.79 ? -2  DT  Z C7    1 
ATOM   1422 C C6    . DT  D 2 15  ? 22.829 3.549   -11.995 1.00 108.02 ? -2  DT  Z C6    1 
ATOM   1423 P P     . DC  D 2 16  ? 18.759 5.879   -7.848  1.00 112.69 ? -3  DC  Z P     1 
ATOM   1424 O OP1   . DC  D 2 16  ? 18.459 6.620   -6.592  1.00 112.61 ? -3  DC  Z OP1   1 
ATOM   1425 O OP2   . DC  D 2 16  ? 18.275 4.483   -8.012  1.00 112.29 ? -3  DC  Z OP2   1 
ATOM   1426 O "O5'" . DC  D 2 16  ? 18.227 6.744   -9.074  1.00 113.14 ? -3  DC  Z "O5'" 1 
ATOM   1427 C "C5'" . DC  D 2 16  ? 18.839 6.624   -10.353 1.00 113.52 ? -3  DC  Z "C5'" 1 
ATOM   1428 C "C4'" . DC  D 2 16  ? 18.265 7.633   -11.318 1.00 114.20 ? -3  DC  Z "C4'" 1 
ATOM   1429 O "O4'" . DC  D 2 16  ? 18.977 7.484   -12.568 1.00 113.86 ? -3  DC  Z "O4'" 1 
ATOM   1430 C "C3'" . DC  D 2 16  ? 16.796 7.403   -11.658 1.00 114.78 ? -3  DC  Z "C3'" 1 
ATOM   1431 O "O3'" . DC  D 2 16  ? 16.181 8.644   -12.030 1.00 117.01 ? -3  DC  Z "O3'" 1 
ATOM   1432 C "C2'" . DC  D 2 16  ? 16.877 6.429   -12.818 1.00 114.01 ? -3  DC  Z "C2'" 1 
ATOM   1433 C "C1'" . DC  D 2 16  ? 18.152 6.857   -13.540 1.00 112.65 ? -3  DC  Z "C1'" 1 
ATOM   1434 N N1    . DC  D 2 16  ? 18.920 5.740   -14.118 1.00 111.41 ? -3  DC  Z N1    1 
ATOM   1435 C C2    . DC  D 2 16  ? 19.808 6.000   -15.167 1.00 111.04 ? -3  DC  Z C2    1 
ATOM   1436 O O2    . DC  D 2 16  ? 19.939 7.162   -15.567 1.00 110.82 ? -3  DC  Z O2    1 
ATOM   1437 N N3    . DC  D 2 16  ? 20.501 4.977   -15.717 1.00 111.09 ? -3  DC  Z N3    1 
ATOM   1438 C C4    . DC  D 2 16  ? 20.339 3.736   -15.254 1.00 110.92 ? -3  DC  Z C4    1 
ATOM   1439 N N4    . DC  D 2 16  ? 21.042 2.756   -15.833 1.00 110.36 ? -3  DC  Z N4    1 
ATOM   1440 C C5    . DC  D 2 16  ? 19.449 3.443   -14.179 1.00 110.82 ? -3  DC  Z C5    1 
ATOM   1441 C C6    . DC  D 2 16  ? 18.767 4.466   -13.645 1.00 110.80 ? -3  DC  Z C6    1 
ATOM   1442 P P     . DG  D 2 17  ? 14.573 8.760   -12.114 1.00 119.65 ? -4  DG  Z P     1 
ATOM   1443 O OP1   . DG  D 2 17  ? 14.105 9.598   -10.978 1.00 118.96 ? -4  DG  Z OP1   1 
ATOM   1444 O OP2   . DG  D 2 17  ? 13.971 7.415   -12.333 1.00 119.61 ? -4  DG  Z OP2   1 
ATOM   1445 O "O5'" . DG  D 2 17  ? 14.353 9.614   -13.435 1.00 118.63 ? -4  DG  Z "O5'" 1 
ATOM   1446 C "C5'" . DG  D 2 17  ? 15.136 10.775  -13.672 1.00 117.83 ? -4  DG  Z "C5'" 1 
ATOM   1447 C "C4'" . DG  D 2 17  ? 15.278 11.015  -15.154 1.00 117.28 ? -4  DG  Z "C4'" 1 
ATOM   1448 O "O4'" . DG  D 2 17  ? 16.057 9.941   -15.742 1.00 115.24 ? -4  DG  Z "O4'" 1 
ATOM   1449 C "C3'" . DG  D 2 17  ? 13.918 10.944  -15.844 1.00 118.30 ? -4  DG  Z "C3'" 1 
ATOM   1450 O "O3'" . DG  D 2 17  ? 13.925 11.755  -17.019 1.00 121.88 ? -4  DG  Z "O3'" 1 
ATOM   1451 C "C2'" . DG  D 2 17  ? 13.794 9.474   -16.194 1.00 116.23 ? -4  DG  Z "C2'" 1 
ATOM   1452 C "C1'" . DG  D 2 17  ? 15.223 9.136   -16.561 1.00 113.52 ? -4  DG  Z "C1'" 1 
ATOM   1453 N N9    . DG  D 2 17  ? 15.599 7.736   -16.402 1.00 110.50 ? -4  DG  Z N9    1 
ATOM   1454 C C8    . DG  D 2 17  ? 15.042 6.819   -15.546 1.00 109.72 ? -4  DG  Z C8    1 
ATOM   1455 N N7    . DG  D 2 17  ? 15.544 5.621   -15.684 1.00 108.83 ? -4  DG  Z N7    1 
ATOM   1456 C C5    . DG  D 2 17  ? 16.501 5.761   -16.680 1.00 107.57 ? -4  DG  Z C5    1 
ATOM   1457 C C6    . DG  D 2 17  ? 17.368 4.801   -17.266 1.00 106.70 ? -4  DG  Z C6    1 
ATOM   1458 O O6    . DG  D 2 17  ? 17.464 3.595   -17.016 1.00 105.98 ? -4  DG  Z O6    1 
ATOM   1459 N N1    . DG  D 2 17  ? 18.177 5.372   -18.241 1.00 106.14 ? -4  DG  Z N1    1 
ATOM   1460 C C2    . DG  D 2 17  ? 18.154 6.691   -18.610 1.00 106.03 ? -4  DG  Z C2    1 
ATOM   1461 N N2    . DG  D 2 17  ? 19.010 7.047   -19.578 1.00 106.05 ? -4  DG  Z N2    1 
ATOM   1462 N N3    . DG  D 2 17  ? 17.351 7.595   -18.075 1.00 106.61 ? -4  DG  Z N3    1 
ATOM   1463 C C4    . DG  D 2 17  ? 16.557 7.063   -17.123 1.00 108.24 ? -4  DG  Z C4    1 
ATOM   1464 P P     . DA  D 2 18  ? 12.627 11.804  -17.965 1.00 124.57 ? -5  DA  Z P     1 
ATOM   1465 O OP1   . DA  D 2 18  ? 11.954 13.109  -17.718 1.00 123.55 ? -5  DA  Z OP1   1 
ATOM   1466 O OP2   . DA  D 2 18  ? 11.858 10.539  -17.805 1.00 123.95 ? -5  DA  Z OP2   1 
ATOM   1467 O "O5'" . DA  D 2 18  ? 13.253 11.811  -19.430 1.00 125.90 ? -5  DA  Z "O5'" 1 
ATOM   1468 C "C5'" . DA  D 2 18  ? 14.520 12.422  -19.675 1.00 128.20 ? -5  DA  Z "C5'" 1 
ATOM   1469 C "C4'" . DA  D 2 18  ? 15.134 11.879  -20.945 1.00 130.17 ? -5  DA  Z "C4'" 1 
ATOM   1470 O "O4'" . DA  D 2 18  ? 15.549 10.505  -20.736 1.00 130.15 ? -5  DA  Z "O4'" 1 
ATOM   1471 C "C3'" . DA  D 2 18  ? 14.128 11.818  -22.093 1.00 132.16 ? -5  DA  Z "C3'" 1 
ATOM   1472 O "O3'" . DA  D 2 18  ? 14.808 11.964  -23.346 1.00 135.25 ? -5  DA  Z "O3'" 1 
ATOM   1473 C "C2'" . DA  D 2 18  ? 13.512 10.438  -21.932 1.00 131.18 ? -5  DA  Z "C2'" 1 
ATOM   1474 C "C1'" . DA  D 2 18  ? 14.709 9.619   -21.471 1.00 129.86 ? -5  DA  Z "C1'" 1 
ATOM   1475 N N9    . DA  D 2 18  ? 14.417 8.446   -20.641 1.00 128.88 ? -5  DA  Z N9    1 
ATOM   1476 C C8    . DA  D 2 18  ? 13.490 8.317   -19.634 1.00 128.17 ? -5  DA  Z C8    1 
ATOM   1477 N N7    . DA  D 2 18  ? 13.465 7.123   -19.086 1.00 127.56 ? -5  DA  Z N7    1 
ATOM   1478 C C5    . DA  D 2 18  ? 14.443 6.417   -19.777 1.00 127.38 ? -5  DA  Z C5    1 
ATOM   1479 C C6    . DA  D 2 18  ? 14.909 5.087   -19.674 1.00 126.55 ? -5  DA  Z C6    1 
ATOM   1480 N N6    . DA  D 2 18  ? 14.428 4.199   -18.801 1.00 125.71 ? -5  DA  Z N6    1 
ATOM   1481 N N1    . DA  D 2 18  ? 15.898 4.700   -20.513 1.00 125.89 ? -5  DA  Z N1    1 
ATOM   1482 C C2    . DA  D 2 18  ? 16.378 5.589   -21.391 1.00 126.33 ? -5  DA  Z C2    1 
ATOM   1483 N N3    . DA  D 2 18  ? 16.024 6.861   -21.585 1.00 127.38 ? -5  DA  Z N3    1 
ATOM   1484 C C4    . DA  D 2 18  ? 15.040 7.219   -20.736 1.00 128.06 ? -5  DA  Z C4    1 
ATOM   1485 P P     . DA  D 2 19  ? 13.969 11.960  -24.720 1.00 137.50 ? -6  DA  Z P     1 
ATOM   1486 O OP1   . DA  D 2 19  ? 14.562 13.009  -25.587 1.00 137.17 ? -6  DA  Z OP1   1 
ATOM   1487 O OP2   . DA  D 2 19  ? 12.516 12.006  -24.398 1.00 137.23 ? -6  DA  Z OP2   1 
ATOM   1488 O "O5'" . DA  D 2 19  ? 14.315 10.541  -25.362 1.00 138.77 ? -6  DA  Z "O5'" 1 
ATOM   1489 C "C5'" . DA  D 2 19  ? 15.673 10.170  -25.592 1.00 140.19 ? -6  DA  Z "C5'" 1 
ATOM   1490 C "C4'" . DA  D 2 19  ? 15.765 8.844   -26.314 1.00 141.64 ? -6  DA  Z "C4'" 1 
ATOM   1491 O "O4'" . DA  D 2 19  ? 15.447 7.755   -25.408 1.00 142.36 ? -6  DA  Z "O4'" 1 
ATOM   1492 C "C3'" . DA  D 2 19  ? 14.756 8.718   -27.456 1.00 142.47 ? -6  DA  Z "C3'" 1 
ATOM   1493 O "O3'" . DA  D 2 19  ? 15.291 7.841   -28.457 1.00 142.78 ? -6  DA  Z "O3'" 1 
ATOM   1494 C "C2'" . DA  D 2 19  ? 13.544 8.113   -26.768 1.00 142.53 ? -6  DA  Z "C2'" 1 
ATOM   1495 C "C1'" . DA  D 2 19  ? 14.209 7.161   -25.786 1.00 142.65 ? -6  DA  Z "C1'" 1 
ATOM   1496 N N9    . DA  D 2 19  ? 13.457 6.800   -24.581 1.00 142.66 ? -6  DA  Z N9    1 
ATOM   1497 C C8    . DA  D 2 19  ? 12.493 7.520   -23.913 1.00 142.64 ? -6  DA  Z C8    1 
ATOM   1498 N N7    . DA  D 2 19  ? 11.976 6.885   -22.886 1.00 142.48 ? -6  DA  Z N7    1 
ATOM   1499 C C5    . DA  D 2 19  ? 12.651 5.671   -22.869 1.00 142.27 ? -6  DA  Z C5    1 
ATOM   1500 C C6    . DA  D 2 19  ? 12.563 4.546   -22.022 1.00 141.95 ? -6  DA  Z C6    1 
ATOM   1501 N N6    . DA  D 2 19  ? 11.723 4.457   -20.987 1.00 141.30 ? -6  DA  Z N6    1 
ATOM   1502 N N1    . DA  D 2 19  ? 13.381 3.500   -22.282 1.00 141.98 ? -6  DA  Z N1    1 
ATOM   1503 C C2    . DA  D 2 19  ? 14.225 3.587   -23.321 1.00 141.98 ? -6  DA  Z C2    1 
ATOM   1504 N N3    . DA  D 2 19  ? 14.399 4.585   -24.186 1.00 141.93 ? -6  DA  Z N3    1 
ATOM   1505 C C4    . DA  D 2 19  ? 13.572 5.609   -23.902 1.00 142.41 ? -6  DA  Z C4    1 
ATOM   1506 P P     . DA  D 2 20  ? 14.393 7.409   -29.720 1.00 142.68 ? -7  DA  Z P     1 
ATOM   1507 O OP1   . DA  D 2 20  ? 14.990 8.050   -30.920 1.00 142.44 ? -7  DA  Z OP1   1 
ATOM   1508 O OP2   . DA  D 2 20  ? 12.953 7.614   -29.417 1.00 142.78 ? -7  DA  Z OP2   1 
ATOM   1509 O "O5'" . DA  D 2 20  ? 14.660 5.844   -29.823 1.00 141.76 ? -7  DA  Z "O5'" 1 
ATOM   1510 C "C5'" . DA  D 2 20  ? 15.969 5.323   -29.611 1.00 140.10 ? -7  DA  Z "C5'" 1 
ATOM   1511 C "C4'" . DA  D 2 20  ? 15.916 3.825   -29.432 1.00 138.72 ? -7  DA  Z "C4'" 1 
ATOM   1512 O "O4'" . DA  D 2 20  ? 15.310 3.505   -28.152 1.00 138.00 ? -7  DA  Z "O4'" 1 
ATOM   1513 C "C3'" . DA  D 2 20  ? 15.002 3.188   -30.474 1.00 138.45 ? -7  DA  Z "C3'" 1 
ATOM   1514 O "O3'" . DA  D 2 20  ? 15.429 1.853   -30.739 1.00 139.65 ? -7  DA  Z "O3'" 1 
ATOM   1515 C "C2'" . DA  D 2 20  ? 13.644 3.208   -29.796 1.00 137.54 ? -7  DA  Z "C2'" 1 
ATOM   1516 C "C1'" . DA  D 2 20  ? 14.030 2.917   -28.357 1.00 136.86 ? -7  DA  Z "C1'" 1 
ATOM   1517 N N9    . DA  D 2 20  ? 13.106 3.393   -27.325 1.00 135.48 ? -7  DA  Z N9    1 
ATOM   1518 C C8    . DA  D 2 20  ? 12.536 4.634   -27.181 1.00 134.95 ? -7  DA  Z C8    1 
ATOM   1519 N N7    . DA  D 2 20  ? 11.705 4.721   -26.168 1.00 134.07 ? -7  DA  Z N7    1 
ATOM   1520 C C5    . DA  D 2 20  ? 11.737 3.454   -25.599 1.00 134.01 ? -7  DA  Z C5    1 
ATOM   1521 C C6    . DA  D 2 20  ? 11.071 2.892   -24.488 1.00 133.84 ? -7  DA  Z C6    1 
ATOM   1522 N N6    . DA  D 2 20  ? 10.204 3.558   -23.724 1.00 133.75 ? -7  DA  Z N6    1 
ATOM   1523 N N1    . DA  D 2 20  ? 11.331 1.601   -24.187 1.00 133.85 ? -7  DA  Z N1    1 
ATOM   1524 C C2    . DA  D 2 20  ? 12.200 0.929   -24.956 1.00 133.64 ? -7  DA  Z C2    1 
ATOM   1525 N N3    . DA  D 2 20  ? 12.884 1.345   -26.023 1.00 133.64 ? -7  DA  Z N3    1 
ATOM   1526 C C4    . DA  D 2 20  ? 12.604 2.630   -26.295 1.00 134.39 ? -7  DA  Z C4    1 
ATOM   1527 P P     . DT  D 2 21  ? 14.408 0.813   -31.410 1.00 140.44 ? -8  DT  Z P     1 
ATOM   1528 O OP1   . DT  D 2 21  ? 15.226 -0.284  -31.994 1.00 140.10 ? -8  DT  Z OP1   1 
ATOM   1529 O OP2   . DT  D 2 21  ? 13.480 1.584   -32.279 1.00 140.13 ? -8  DT  Z OP2   1 
ATOM   1530 O "O5'" . DT  D 2 21  ? 13.582 0.229   -30.175 1.00 139.46 ? -8  DT  Z "O5'" 1 
ATOM   1531 C "C5'" . DT  D 2 21  ? 14.248 -0.482  -29.132 1.00 138.48 ? -8  DT  Z "C5'" 1 
ATOM   1532 C "C4'" . DT  D 2 21  ? 13.409 -1.642  -28.643 1.00 137.80 ? -8  DT  Z "C4'" 1 
ATOM   1533 O "O4'" . DT  D 2 21  ? 12.427 -1.179  -27.684 1.00 137.84 ? -8  DT  Z "O4'" 1 
ATOM   1534 C "C3'" . DT  D 2 21  ? 12.598 -2.310  -29.752 1.00 137.43 ? -8  DT  Z "C3'" 1 
ATOM   1535 O "O3'" . DT  D 2 21  ? 12.236 -3.635  -29.339 1.00 136.70 ? -8  DT  Z "O3'" 1 
ATOM   1536 C "C2'" . DT  D 2 21  ? 11.310 -1.503  -29.741 1.00 137.18 ? -8  DT  Z "C2'" 1 
ATOM   1537 C "C1'" . DT  D 2 21  ? 11.127 -1.266  -28.249 1.00 136.77 ? -8  DT  Z "C1'" 1 
ATOM   1538 N N1    . DT  D 2 21  ? 10.342 -0.091  -27.815 1.00 135.96 ? -8  DT  Z N1    1 
ATOM   1539 C C2    . DT  D 2 21  ? 9.488  -0.279  -26.750 1.00 135.56 ? -8  DT  Z C2    1 
ATOM   1540 O O2    . DT  D 2 21  ? 9.368  -1.351  -26.179 1.00 135.84 ? -8  DT  Z O2    1 
ATOM   1541 N N3    . DT  D 2 21  ? 8.778  0.835   -26.376 1.00 135.02 ? -8  DT  Z N3    1 
ATOM   1542 C C4    . DT  D 2 21  ? 8.834  2.089   -26.947 1.00 134.50 ? -8  DT  Z C4    1 
ATOM   1543 O O4    . DT  D 2 21  ? 8.133  2.994   -26.499 1.00 133.42 ? -8  DT  Z O4    1 
ATOM   1544 C C5    . DT  D 2 21  ? 9.751  2.217   -28.065 1.00 134.59 ? -8  DT  Z C5    1 
ATOM   1545 C C7    . DT  D 2 21  ? 9.878  3.539   -28.752 1.00 134.63 ? -8  DT  Z C7    1 
ATOM   1546 C C6    . DT  D 2 21  ? 10.450 1.134   -28.436 1.00 135.20 ? -8  DT  Z C6    1 
ATOM   1547 N N     . ASP E 3 8   ? 3.065  -3.245  44.937  1.00 97.24  ? 8   ASP A N     1 
ATOM   1548 C CA    . ASP E 3 8   ? 1.784  -3.565  44.237  1.00 98.04  ? 8   ASP A CA    1 
ATOM   1549 C C     . ASP E 3 8   ? 1.473  -5.066  44.201  1.00 97.98  ? 8   ASP A C     1 
ATOM   1550 O O     . ASP E 3 8   ? 2.374  -5.902  44.165  1.00 97.46  ? 8   ASP A O     1 
ATOM   1551 C CB    . ASP E 3 8   ? 1.801  -3.015  42.803  1.00 98.27  ? 8   ASP A CB    1 
ATOM   1552 C CG    . ASP E 3 8   ? 2.842  -3.691  41.920  1.00 97.75  ? 8   ASP A CG    1 
ATOM   1553 O OD1   . ASP E 3 8   ? 4.052  -3.484  42.155  1.00 96.51  ? 8   ASP A OD1   1 
ATOM   1554 O OD2   . ASP E 3 8   ? 2.444  -4.429  40.990  1.00 97.67  ? 8   ASP A OD2   1 
ATOM   1555 N N     . PRO E 3 9   ? 0.178  -5.417  44.187  1.00 98.62  ? 9   PRO A N     1 
ATOM   1556 C CA    . PRO E 3 9   ? -0.311 -6.798  44.159  1.00 98.74  ? 9   PRO A CA    1 
ATOM   1557 C C     . PRO E 3 9   ? 0.410  -7.768  43.216  1.00 98.70  ? 9   PRO A C     1 
ATOM   1558 O O     . PRO E 3 9   ? 0.405  -8.980  43.458  1.00 98.92  ? 9   PRO A O     1 
ATOM   1559 C CB    . PRO E 3 9   ? -1.786 -6.631  43.793  1.00 99.02  ? 9   PRO A CB    1 
ATOM   1560 C CG    . PRO E 3 9   ? -2.141 -5.339  44.446  1.00 98.93  ? 9   PRO A CG    1 
ATOM   1561 C CD    . PRO E 3 9   ? -0.950 -4.468  44.104  1.00 99.52  ? 9   PRO A CD    1 
ATOM   1562 N N     . THR E 3 10  ? 1.021  -7.261  42.146  1.00 97.66  ? 10  THR A N     1 
ATOM   1563 C CA    . THR E 3 10  ? 1.706  -8.162  41.220  1.00 96.86  ? 10  THR A CA    1 
ATOM   1564 C C     . THR E 3 10  ? 3.174  -8.390  41.557  1.00 96.19  ? 10  THR A C     1 
ATOM   1565 O O     . THR E 3 10  ? 3.598  -9.531  41.729  1.00 96.88  ? 10  THR A O     1 
ATOM   1566 C CB    . THR E 3 10  ? 1.597  -7.685  39.768  1.00 95.91  ? 10  THR A CB    1 
ATOM   1567 O OG1   . THR E 3 10  ? 0.221  -7.651  39.387  1.00 95.42  ? 10  THR A OG1   1 
ATOM   1568 C CG2   . THR E 3 10  ? 2.323  -8.650  38.843  1.00 95.63  ? 10  THR A CG2   1 
ATOM   1569 N N     . LEU E 3 11  ? 3.960  -7.324  41.638  1.00 94.83  ? 11  LEU A N     1 
ATOM   1570 C CA    . LEU E 3 11  ? 5.361  -7.496  41.984  1.00 93.05  ? 11  LEU A CA    1 
ATOM   1571 C C     . LEU E 3 11  ? 5.381  -7.756  43.476  1.00 92.46  ? 11  LEU A C     1 
ATOM   1572 O O     . LEU E 3 11  ? 6.102  -7.104  44.233  1.00 93.38  ? 11  LEU A O     1 
ATOM   1573 C CB    . LEU E 3 11  ? 6.181  -6.248  41.645  1.00 92.36  ? 11  LEU A CB    1 
ATOM   1574 C CG    . LEU E 3 11  ? 7.314  -6.486  40.639  1.00 91.32  ? 11  LEU A CG    1 
ATOM   1575 C CD1   . LEU E 3 11  ? 6.726  -6.988  39.325  1.00 89.04  ? 11  LEU A CD1   1 
ATOM   1576 C CD2   . LEU E 3 11  ? 8.102  -5.200  40.425  1.00 90.68  ? 11  LEU A CD2   1 
ATOM   1577 N N     . GLU E 3 12  ? 4.550  -8.709  43.883  1.00 91.04  ? 12  GLU A N     1 
ATOM   1578 C CA    . GLU E 3 12  ? 4.424  -9.119  45.274  1.00 90.14  ? 12  GLU A CA    1 
ATOM   1579 C C     . GLU E 3 12  ? 4.023  -10.587 45.288  1.00 87.28  ? 12  GLU A C     1 
ATOM   1580 O O     . GLU E 3 12  ? 4.500  -11.377 46.101  1.00 86.17  ? 12  GLU A O     1 
ATOM   1581 C CB    . GLU E 3 12  ? 3.363  -8.283  45.988  1.00 92.28  ? 12  GLU A CB    1 
ATOM   1582 C CG    . GLU E 3 12  ? 3.183  -8.691  47.428  1.00 94.96  ? 12  GLU A CG    1 
ATOM   1583 C CD    . GLU E 3 12  ? 4.513  -8.980  48.088  1.00 96.81  ? 12  GLU A CD    1 
ATOM   1584 O OE1   . GLU E 3 12  ? 5.358  -8.059  48.149  1.00 97.30  ? 12  GLU A OE1   1 
ATOM   1585 O OE2   . GLU E 3 12  ? 4.718  -10.131 48.533  1.00 97.79  ? 12  GLU A OE2   1 
ATOM   1586 N N     . TRP E 3 13  ? 3.116  -10.930 44.385  1.00 84.32  ? 13  TRP A N     1 
ATOM   1587 C CA    . TRP E 3 13  ? 2.670  -12.298 44.239  1.00 81.82  ? 13  TRP A CA    1 
ATOM   1588 C C     . TRP E 3 13  ? 3.781  -12.935 43.416  1.00 80.24  ? 13  TRP A C     1 
ATOM   1589 O O     . TRP E 3 13  ? 3.856  -14.155 43.277  1.00 81.01  ? 13  TRP A O     1 
ATOM   1590 C CB    . TRP E 3 13  ? 1.347  -12.335 43.479  1.00 81.39  ? 13  TRP A CB    1 
ATOM   1591 C CG    . TRP E 3 13  ? 1.193  -13.529 42.592  1.00 80.89  ? 13  TRP A CG    1 
ATOM   1592 C CD1   . TRP E 3 13  ? 0.877  -14.802 42.970  1.00 80.74  ? 13  TRP A CD1   1 
ATOM   1593 C CD2   . TRP E 3 13  ? 1.360  -13.560 41.172  1.00 80.00  ? 13  TRP A CD2   1 
ATOM   1594 N NE1   . TRP E 3 13  ? 0.832  -15.625 41.870  1.00 80.07  ? 13  TRP A NE1   1 
ATOM   1595 C CE2   . TRP E 3 13  ? 1.123  -14.888 40.753  1.00 79.73  ? 13  TRP A CE2   1 
ATOM   1596 C CE3   . TRP E 3 13  ? 1.686  -12.593 40.212  1.00 80.17  ? 13  TRP A CE3   1 
ATOM   1597 C CZ2   . TRP E 3 13  ? 1.200  -15.277 39.412  1.00 80.62  ? 13  TRP A CZ2   1 
ATOM   1598 C CZ3   . TRP E 3 13  ? 1.765  -12.978 38.873  1.00 81.40  ? 13  TRP A CZ3   1 
ATOM   1599 C CH2   . TRP E 3 13  ? 1.521  -14.311 38.488  1.00 81.89  ? 13  TRP A CH2   1 
ATOM   1600 N N     . PHE E 3 14  ? 4.638  -12.079 42.864  1.00 77.80  ? 14  PHE A N     1 
ATOM   1601 C CA    . PHE E 3 14  ? 5.773  -12.511 42.059  1.00 74.73  ? 14  PHE A CA    1 
ATOM   1602 C C     . PHE E 3 14  ? 6.899  -12.933 42.985  1.00 73.84  ? 14  PHE A C     1 
ATOM   1603 O O     . PHE E 3 14  ? 7.401  -14.049 42.903  1.00 73.99  ? 14  PHE A O     1 
ATOM   1604 C CB    . PHE E 3 14  ? 6.273  -11.374 41.175  1.00 73.11  ? 14  PHE A CB    1 
ATOM   1605 C CG    . PHE E 3 14  ? 7.636  -11.620 40.590  1.00 70.77  ? 14  PHE A CG    1 
ATOM   1606 C CD1   . PHE E 3 14  ? 7.808  -12.509 39.537  1.00 69.58  ? 14  PHE A CD1   1 
ATOM   1607 C CD2   . PHE E 3 14  ? 8.751  -10.967 41.106  1.00 68.87  ? 14  PHE A CD2   1 
ATOM   1608 C CE1   . PHE E 3 14  ? 9.071  -12.744 39.003  1.00 70.03  ? 14  PHE A CE1   1 
ATOM   1609 C CE2   . PHE E 3 14  ? 10.012 -11.192 40.584  1.00 67.80  ? 14  PHE A CE2   1 
ATOM   1610 C CZ    . PHE E 3 14  ? 10.176 -12.083 39.528  1.00 69.97  ? 14  PHE A CZ    1 
ATOM   1611 N N     . LEU E 3 15  ? 7.307  -12.031 43.866  1.00 72.52  ? 15  LEU A N     1 
ATOM   1612 C CA    . LEU E 3 15  ? 8.371  -12.356 44.800  1.00 72.57  ? 15  LEU A CA    1 
ATOM   1613 C C     . LEU E 3 15  ? 7.999  -13.595 45.611  1.00 72.34  ? 15  LEU A C     1 
ATOM   1614 O O     . LEU E 3 15  ? 8.866  -14.284 46.149  1.00 72.50  ? 15  LEU A O     1 
ATOM   1615 C CB    . LEU E 3 15  ? 8.627  -11.179 45.740  1.00 71.93  ? 15  LEU A CB    1 
ATOM   1616 C CG    . LEU E 3 15  ? 8.921  -9.855  45.038  1.00 72.91  ? 15  LEU A CG    1 
ATOM   1617 C CD1   . LEU E 3 15  ? 9.301  -8.809  46.066  1.00 73.08  ? 15  LEU A CD1   1 
ATOM   1618 C CD2   . LEU E 3 15  ? 10.049 -10.046 44.043  1.00 72.93  ? 15  LEU A CD2   1 
ATOM   1619 N N     . SER E 3 16  ? 6.701  -13.872 45.689  1.00 72.04  ? 16  SER A N     1 
ATOM   1620 C CA    . SER E 3 16  ? 6.206  -15.016 46.437  1.00 70.68  ? 16  SER A CA    1 
ATOM   1621 C C     . SER E 3 16  ? 6.707  -16.304 45.804  1.00 70.41  ? 16  SER A C     1 
ATOM   1622 O O     . SER E 3 16  ? 7.030  -17.258 46.503  1.00 71.95  ? 16  SER A O     1 
ATOM   1623 C CB    . SER E 3 16  ? 4.681  -15.012 46.455  1.00 70.80  ? 16  SER A CB    1 
ATOM   1624 O OG    . SER E 3 16  ? 4.162  -15.276 45.165  1.00 70.53  ? 16  SER A OG    1 
ATOM   1625 N N     . HIS E 3 17  ? 6.771  -16.333 44.480  1.00 69.47  ? 17  HIS A N     1 
ATOM   1626 C CA    . HIS E 3 17  ? 7.245  -17.517 43.786  1.00 69.30  ? 17  HIS A CA    1 
ATOM   1627 C C     . HIS E 3 17  ? 8.731  -17.395 43.484  1.00 67.06  ? 17  HIS A C     1 
ATOM   1628 O O     . HIS E 3 17  ? 9.243  -18.029 42.568  1.00 66.94  ? 17  HIS A O     1 
ATOM   1629 C CB    . HIS E 3 17  ? 6.472  -17.717 42.482  1.00 73.36  ? 17  HIS A CB    1 
ATOM   1630 C CG    . HIS E 3 17  ? 4.996  -17.887 42.672  1.00 78.77  ? 17  HIS A CG    1 
ATOM   1631 N ND1   . HIS E 3 17  ? 4.453  -18.507 43.779  1.00 80.93  ? 17  HIS A ND1   1 
ATOM   1632 C CD2   . HIS E 3 17  ? 3.951  -17.553 41.878  1.00 79.98  ? 17  HIS A CD2   1 
ATOM   1633 C CE1   . HIS E 3 17  ? 3.137  -18.546 43.659  1.00 80.84  ? 17  HIS A CE1   1 
ATOM   1634 N NE2   . HIS E 3 17  ? 2.807  -17.974 42.515  1.00 82.04  ? 17  HIS A NE2   1 
ATOM   1635 N N     . CYS E 3 18  ? 9.424  -16.570 44.255  1.00 65.46  ? 18  CYS A N     1 
ATOM   1636 C CA    . CYS E 3 18  ? 10.856 -16.369 44.053  1.00 64.84  ? 18  CYS A CA    1 
ATOM   1637 C C     . CYS E 3 18  ? 11.654 -16.788 45.284  1.00 64.78  ? 18  CYS A C     1 
ATOM   1638 O O     . CYS E 3 18  ? 11.208 -16.622 46.419  1.00 65.10  ? 18  CYS A O     1 
ATOM   1639 C CB    . CYS E 3 18  ? 11.161 -14.889 43.735  1.00 63.57  ? 18  CYS A CB    1 
ATOM   1640 S SG    . CYS E 3 18  ? 10.946 -14.363 42.008  1.00 60.91  ? 18  CYS A SG    1 
ATOM   1641 N N     . HIS E 3 19  ? 12.835 -17.338 45.047  1.00 64.58  ? 19  HIS A N     1 
ATOM   1642 C CA    . HIS E 3 19  ? 13.724 -17.764 46.120  1.00 65.83  ? 19  HIS A CA    1 
ATOM   1643 C C     . HIS E 3 19  ? 14.630 -16.555 46.314  1.00 64.02  ? 19  HIS A C     1 
ATOM   1644 O O     . HIS E 3 19  ? 15.323 -16.153 45.380  1.00 65.05  ? 19  HIS A O     1 
ATOM   1645 C CB    . HIS E 3 19  ? 14.529 -18.993 45.657  1.00 69.15  ? 19  HIS A CB    1 
ATOM   1646 C CG    . HIS E 3 19  ? 15.506 -19.513 46.669  1.00 74.40  ? 19  HIS A CG    1 
ATOM   1647 N ND1   . HIS E 3 19  ? 16.098 -20.755 46.558  1.00 76.51  ? 19  HIS A ND1   1 
ATOM   1648 C CD2   . HIS E 3 19  ? 16.005 -18.960 47.803  1.00 75.59  ? 19  HIS A CD2   1 
ATOM   1649 C CE1   . HIS E 3 19  ? 16.916 -20.946 47.580  1.00 77.01  ? 19  HIS A CE1   1 
ATOM   1650 N NE2   . HIS E 3 19  ? 16.879 -19.871 48.350  1.00 76.08  ? 19  HIS A NE2   1 
ATOM   1651 N N     . ILE E 3 20  ? 14.621 -15.957 47.499  1.00 60.54  ? 20  ILE A N     1 
ATOM   1652 C CA    . ILE E 3 20  ? 15.458 -14.783 47.729  1.00 59.32  ? 20  ILE A CA    1 
ATOM   1653 C C     . ILE E 3 20  ? 16.879 -15.119 48.192  1.00 57.16  ? 20  ILE A C     1 
ATOM   1654 O O     . ILE E 3 20  ? 17.069 -15.995 49.023  1.00 58.88  ? 20  ILE A O     1 
ATOM   1655 C CB    . ILE E 3 20  ? 14.797 -13.837 48.745  1.00 59.59  ? 20  ILE A CB    1 
ATOM   1656 C CG1   . ILE E 3 20  ? 15.737 -12.679 49.064  1.00 59.54  ? 20  ILE A CG1   1 
ATOM   1657 C CG2   . ILE E 3 20  ? 14.455 -14.596 50.009  1.00 62.14  ? 20  ILE A CG2   1 
ATOM   1658 C CD1   . ILE E 3 20  ? 15.159 -11.700 50.052  1.00 61.07  ? 20  ILE A CD1   1 
ATOM   1659 N N     . HIS E 3 21  ? 17.871 -14.419 47.645  1.00 55.08  ? 21  HIS A N     1 
ATOM   1660 C CA    . HIS E 3 21  ? 19.282 -14.638 47.992  1.00 52.50  ? 21  HIS A CA    1 
ATOM   1661 C C     . HIS E 3 21  ? 19.981 -13.318 48.269  1.00 51.05  ? 21  HIS A C     1 
ATOM   1662 O O     . HIS E 3 21  ? 19.550 -12.273 47.796  1.00 50.59  ? 21  HIS A O     1 
ATOM   1663 C CB    . HIS E 3 21  ? 20.021 -15.326 46.847  1.00 53.19  ? 21  HIS A CB    1 
ATOM   1664 C CG    . HIS E 3 21  ? 19.675 -16.771 46.676  1.00 54.75  ? 21  HIS A CG    1 
ATOM   1665 N ND1   . HIS E 3 21  ? 20.419 -17.787 47.240  1.00 54.20  ? 21  HIS A ND1   1 
ATOM   1666 C CD2   . HIS E 3 21  ? 18.671 -17.373 45.991  1.00 54.86  ? 21  HIS A CD2   1 
ATOM   1667 C CE1   . HIS E 3 21  ? 19.890 -18.951 46.907  1.00 55.00  ? 21  HIS A CE1   1 
ATOM   1668 N NE2   . HIS E 3 21  ? 18.829 -18.729 46.150  1.00 54.95  ? 21  HIS A NE2   1 
ATOM   1669 N N     . LYS E 3 22  ? 21.070 -13.367 49.024  1.00 49.50  ? 22  LYS A N     1 
ATOM   1670 C CA    . LYS E 3 22  ? 21.814 -12.159 49.342  1.00 48.77  ? 22  LYS A CA    1 
ATOM   1671 C C     . LYS E 3 22  ? 23.251 -12.284 48.884  1.00 47.78  ? 22  LYS A C     1 
ATOM   1672 O O     . LYS E 3 22  ? 23.909 -13.269 49.195  1.00 48.74  ? 22  LYS A O     1 
ATOM   1673 C CB    . LYS E 3 22  ? 21.800 -11.898 50.850  1.00 49.27  ? 22  LYS A CB    1 
ATOM   1674 C CG    . LYS E 3 22  ? 20.436 -11.579 51.430  1.00 52.61  ? 22  LYS A CG    1 
ATOM   1675 C CD    . LYS E 3 22  ? 20.526 -11.335 52.937  1.00 55.83  ? 22  LYS A CD    1 
ATOM   1676 C CE    . LYS E 3 22  ? 19.275 -10.630 53.471  1.00 58.12  ? 22  LYS A CE    1 
ATOM   1677 N NZ    . LYS E 3 22  ? 18.009 -11.349 53.114  1.00 58.89  ? 22  LYS A NZ    1 
ATOM   1678 N N     . TYR E 3 23  ? 23.732 -11.291 48.141  1.00 47.55  ? 23  TYR A N     1 
ATOM   1679 C CA    . TYR E 3 23  ? 25.119 -11.278 47.668  1.00 47.67  ? 23  TYR A CA    1 
ATOM   1680 C C     . TYR E 3 23  ? 25.867 -10.142 48.346  1.00 49.29  ? 23  TYR A C     1 
ATOM   1681 O O     . TYR E 3 23  ? 25.369 -9.029  48.464  1.00 50.29  ? 23  TYR A O     1 
ATOM   1682 C CB    . TYR E 3 23  ? 25.193 -11.074 46.155  1.00 45.06  ? 23  TYR A CB    1 
ATOM   1683 C CG    . TYR E 3 23  ? 24.494 -12.140 45.365  1.00 42.47  ? 23  TYR A CG    1 
ATOM   1684 C CD1   . TYR E 3 23  ? 23.119 -12.083 45.139  1.00 41.28  ? 23  TYR A CD1   1 
ATOM   1685 C CD2   . TYR E 3 23  ? 25.192 -13.249 44.917  1.00 42.95  ? 23  TYR A CD2   1 
ATOM   1686 C CE1   . TYR E 3 23  ? 22.454 -13.114 44.492  1.00 42.81  ? 23  TYR A CE1   1 
ATOM   1687 C CE2   . TYR E 3 23  ? 24.548 -14.286 44.272  1.00 45.78  ? 23  TYR A CE2   1 
ATOM   1688 C CZ    . TYR E 3 23  ? 23.176 -14.223 44.061  1.00 45.88  ? 23  TYR A CZ    1 
ATOM   1689 O OH    . TYR E 3 23  ? 22.554 -15.285 43.439  1.00 44.44  ? 23  TYR A OH    1 
ATOM   1690 N N     . PRO E 3 24  ? 27.083 -10.402 48.801  1.00 50.43  ? 24  PRO A N     1 
ATOM   1691 C CA    . PRO E 3 24  ? 27.789 -9.302  49.447  1.00 52.26  ? 24  PRO A CA    1 
ATOM   1692 C C     . PRO E 3 24  ? 28.384 -8.395  48.364  1.00 53.98  ? 24  PRO A C     1 
ATOM   1693 O O     . PRO E 3 24  ? 28.511 -8.791  47.208  1.00 55.65  ? 24  PRO A O     1 
ATOM   1694 C CB    . PRO E 3 24  ? 28.864 -10.025 50.235  1.00 52.35  ? 24  PRO A CB    1 
ATOM   1695 C CG    . PRO E 3 24  ? 29.283 -11.100 49.245  1.00 51.93  ? 24  PRO A CG    1 
ATOM   1696 C CD    . PRO E 3 24  ? 27.943 -11.591 48.677  1.00 51.01  ? 24  PRO A CD    1 
ATOM   1697 N N     . SER E 3 25  ? 28.751 -7.180  48.733  1.00 54.36  ? 25  SER A N     1 
ATOM   1698 C CA    . SER E 3 25  ? 29.348 -6.265  47.782  1.00 53.45  ? 25  SER A CA    1 
ATOM   1699 C C     . SER E 3 25  ? 30.520 -6.905  47.017  1.00 51.46  ? 25  SER A C     1 
ATOM   1700 O O     . SER E 3 25  ? 31.209 -7.759  47.542  1.00 51.41  ? 25  SER A O     1 
ATOM   1701 C CB    . SER E 3 25  ? 29.825 -5.031  48.534  1.00 54.25  ? 25  SER A CB    1 
ATOM   1702 O OG    . SER E 3 25  ? 30.860 -4.393  47.820  1.00 59.03  ? 25  SER A OG    1 
ATOM   1703 N N     . LYS E 3 26  ? 30.720 -6.480  45.772  1.00 51.21  ? 26  LYS A N     1 
ATOM   1704 C CA    . LYS E 3 26  ? 31.797 -6.959  44.903  1.00 50.28  ? 26  LYS A CA    1 
ATOM   1705 C C     . LYS E 3 26  ? 31.735 -8.419  44.472  1.00 49.96  ? 26  LYS A C     1 
ATOM   1706 O O     . LYS E 3 26  ? 32.558 -8.865  43.670  1.00 50.34  ? 26  LYS A O     1 
ATOM   1707 C CB    . LYS E 3 26  ? 33.148 -6.696  45.550  1.00 52.13  ? 26  LYS A CB    1 
ATOM   1708 C CG    . LYS E 3 26  ? 33.382 -5.243  45.879  1.00 57.39  ? 26  LYS A CG    1 
ATOM   1709 C CD    . LYS E 3 26  ? 34.699 -5.028  46.622  1.00 61.27  ? 26  LYS A CD    1 
ATOM   1710 C CE    . LYS E 3 26  ? 34.557 -3.903  47.674  1.00 66.75  ? 26  LYS A CE    1 
ATOM   1711 N NZ    . LYS E 3 26  ? 33.938 -2.631  47.136  1.00 66.20  ? 26  LYS A NZ    1 
ATOM   1712 N N     . SER E 3 27  ? 30.768 -9.165  44.993  1.00 48.86  ? 27  SER A N     1 
ATOM   1713 C CA    . SER E 3 27  ? 30.626 -10.573 44.640  1.00 46.48  ? 27  SER A CA    1 
ATOM   1714 C C     . SER E 3 27  ? 30.007 -10.677 43.260  1.00 46.87  ? 27  SER A C     1 
ATOM   1715 O O     . SER E 3 27  ? 29.391 -9.728  42.784  1.00 48.01  ? 27  SER A O     1 
ATOM   1716 C CB    . SER E 3 27  ? 29.733 -11.279 45.651  1.00 45.69  ? 27  SER A CB    1 
ATOM   1717 O OG    . SER E 3 27  ? 28.400 -10.809 45.563  1.00 43.80  ? 27  SER A OG    1 
ATOM   1718 N N     . THR E 3 28  ? 30.160 -11.835 42.628  1.00 46.85  ? 28  THR A N     1 
ATOM   1719 C CA    . THR E 3 28  ? 29.622 -12.070 41.291  1.00 46.68  ? 28  THR A CA    1 
ATOM   1720 C C     . THR E 3 28  ? 28.296 -12.829 41.250  1.00 46.15  ? 28  THR A C     1 
ATOM   1721 O O     . THR E 3 28  ? 28.175 -13.917 41.790  1.00 46.07  ? 28  THR A O     1 
ATOM   1722 C CB    . THR E 3 28  ? 30.614 -12.847 40.473  1.00 46.87  ? 28  THR A CB    1 
ATOM   1723 O OG1   . THR E 3 28  ? 31.801 -12.066 40.336  1.00 50.27  ? 28  THR A OG1   1 
ATOM   1724 C CG2   . THR E 3 28  ? 30.045 -13.166 39.113  1.00 47.27  ? 28  THR A CG2   1 
ATOM   1725 N N     . LEU E 3 29  ? 27.310 -12.263 40.575  1.00 46.46  ? 29  LEU A N     1 
ATOM   1726 C CA    . LEU E 3 29  ? 26.001 -12.896 40.479  1.00 47.08  ? 29  LEU A CA    1 
ATOM   1727 C C     . LEU E 3 29  ? 25.772 -13.656 39.185  1.00 47.20  ? 29  LEU A C     1 
ATOM   1728 O O     . LEU E 3 29  ? 24.977 -14.594 39.163  1.00 47.65  ? 29  LEU A O     1 
ATOM   1729 C CB    . LEU E 3 29  ? 24.879 -11.862 40.613  1.00 46.10  ? 29  LEU A CB    1 
ATOM   1730 C CG    . LEU E 3 29  ? 24.663 -11.238 41.986  1.00 46.82  ? 29  LEU A CG    1 
ATOM   1731 C CD1   . LEU E 3 29  ? 25.838 -10.337 42.379  1.00 45.01  ? 29  LEU A CD1   1 
ATOM   1732 C CD2   . LEU E 3 29  ? 23.377 -10.452 41.927  1.00 48.53  ? 29  LEU A CD2   1 
ATOM   1733 N N     . ILE E 3 30  ? 26.452 -13.258 38.112  1.00 46.80  ? 30  ILE A N     1 
ATOM   1734 C CA    . ILE E 3 30  ? 26.258 -13.914 36.827  1.00 45.94  ? 30  ILE A CA    1 
ATOM   1735 C C     . ILE E 3 30  ? 27.507 -13.977 35.968  1.00 48.27  ? 30  ILE A C     1 
ATOM   1736 O O     . ILE E 3 30  ? 27.992 -12.948 35.522  1.00 49.55  ? 30  ILE A O     1 
ATOM   1737 C CB    . ILE E 3 30  ? 25.129 -13.209 36.055  1.00 41.54  ? 30  ILE A CB    1 
ATOM   1738 C CG1   . ILE E 3 30  ? 23.830 -13.419 36.811  1.00 38.18  ? 30  ILE A CG1   1 
ATOM   1739 C CG2   . ILE E 3 30  ? 25.001 -13.759 34.649  1.00 39.52  ? 30  ILE A CG2   1 
ATOM   1740 C CD1   . ILE E 3 30  ? 22.670 -12.685 36.256  1.00 40.83  ? 30  ILE A CD1   1 
ATOM   1741 N N     . HIS E 3 31  ? 28.002 -15.197 35.731  1.00 51.68  ? 31  HIS A N     1 
ATOM   1742 C CA    . HIS E 3 31  ? 29.205 -15.447 34.922  1.00 54.40  ? 31  HIS A CA    1 
ATOM   1743 C C     . HIS E 3 31  ? 28.899 -15.483 33.427  1.00 52.87  ? 31  HIS A C     1 
ATOM   1744 O O     . HIS E 3 31  ? 28.195 -16.364 32.957  1.00 52.94  ? 31  HIS A O     1 
ATOM   1745 C CB    . HIS E 3 31  ? 29.852 -16.791 35.303  1.00 58.58  ? 31  HIS A CB    1 
ATOM   1746 C CG    . HIS E 3 31  ? 30.254 -16.899 36.745  1.00 64.51  ? 31  HIS A CG    1 
ATOM   1747 N ND1   . HIS E 3 31  ? 31.555 -16.729 37.172  1.00 67.12  ? 31  HIS A ND1   1 
ATOM   1748 C CD2   . HIS E 3 31  ? 29.523 -17.160 37.860  1.00 66.97  ? 31  HIS A CD2   1 
ATOM   1749 C CE1   . HIS E 3 31  ? 31.607 -16.880 38.487  1.00 69.19  ? 31  HIS A CE1   1 
ATOM   1750 N NE2   . HIS E 3 31  ? 30.388 -17.142 38.930  1.00 67.68  ? 31  HIS A NE2   1 
ATOM   1751 N N     . GLN E 3 32  ? 29.445 -14.529 32.687  1.00 52.63  ? 32  GLN A N     1 
ATOM   1752 C CA    . GLN E 3 32  ? 29.261 -14.448 31.241  1.00 52.09  ? 32  GLN A CA    1 
ATOM   1753 C C     . GLN E 3 32  ? 29.645 -15.774 30.611  1.00 50.48  ? 32  GLN A C     1 
ATOM   1754 O O     . GLN E 3 32  ? 30.674 -16.338 30.936  1.00 48.82  ? 32  GLN A O     1 
ATOM   1755 C CB    . GLN E 3 32  ? 30.141 -13.321 30.683  1.00 53.62  ? 32  GLN A CB    1 
ATOM   1756 C CG    . GLN E 3 32  ? 30.353 -13.319 29.188  1.00 57.31  ? 32  GLN A CG    1 
ATOM   1757 C CD    . GLN E 3 32  ? 31.064 -12.049 28.723  1.00 63.00  ? 32  GLN A CD    1 
ATOM   1758 O OE1   . GLN E 3 32  ? 32.116 -11.665 29.251  1.00 65.08  ? 32  GLN A OE1   1 
ATOM   1759 N NE2   . GLN E 3 32  ? 30.490 -11.390 27.726  1.00 66.18  ? 32  GLN A NE2   1 
ATOM   1760 N N     . GLY E 3 33  ? 28.808 -16.278 29.717  1.00 51.29  ? 33  GLY A N     1 
ATOM   1761 C CA    . GLY E 3 33  ? 29.106 -17.544 29.077  1.00 51.36  ? 33  GLY A CA    1 
ATOM   1762 C C     . GLY E 3 33  ? 28.410 -18.745 29.693  1.00 51.61  ? 33  GLY A C     1 
ATOM   1763 O O     . GLY E 3 33  ? 28.236 -19.755 29.041  1.00 50.96  ? 33  GLY A O     1 
ATOM   1764 N N     . GLU E 3 34  ? 28.021 -18.662 30.951  1.00 53.36  ? 34  GLU A N     1 
ATOM   1765 C CA    . GLU E 3 34  ? 27.344 -19.787 31.552  1.00 56.61  ? 34  GLU A CA    1 
ATOM   1766 C C     . GLU E 3 34  ? 25.921 -19.929 31.009  1.00 57.88  ? 34  GLU A C     1 
ATOM   1767 O O     . GLU E 3 34  ? 25.342 -18.992 30.465  1.00 57.61  ? 34  GLU A O     1 
ATOM   1768 C CB    . GLU E 3 34  ? 27.336 -19.642 33.073  1.00 58.95  ? 34  GLU A CB    1 
ATOM   1769 C CG    . GLU E 3 34  ? 28.720 -19.820 33.687  1.00 64.51  ? 34  GLU A CG    1 
ATOM   1770 C CD    . GLU E 3 34  ? 28.740 -19.688 35.214  1.00 68.85  ? 34  GLU A CD    1 
ATOM   1771 O OE1   . GLU E 3 34  ? 29.806 -19.961 35.823  1.00 71.64  ? 34  GLU A OE1   1 
ATOM   1772 O OE2   . GLU E 3 34  ? 27.707 -19.307 35.811  1.00 69.70  ? 34  GLU A OE2   1 
ATOM   1773 N N     . LYS E 3 35  ? 25.375 -21.129 31.133  1.00 59.76  ? 35  LYS A N     1 
ATOM   1774 C CA    . LYS E 3 35  ? 24.026 -21.409 30.677  1.00 61.56  ? 35  LYS A CA    1 
ATOM   1775 C C     . LYS E 3 35  ? 23.035 -20.517 31.417  1.00 61.32  ? 35  LYS A C     1 
ATOM   1776 O O     . LYS E 3 35  ? 23.149 -20.319 32.622  1.00 62.09  ? 35  LYS A O     1 
ATOM   1777 C CB    . LYS E 3 35  ? 23.694 -22.890 30.918  1.00 62.90  ? 35  LYS A CB    1 
ATOM   1778 C CG    . LYS E 3 35  ? 24.341 -23.818 29.910  1.00 66.19  ? 35  LYS A CG    1 
ATOM   1779 C CD    . LYS E 3 35  ? 23.841 -23.512 28.494  1.00 69.77  ? 35  LYS A CD    1 
ATOM   1780 C CE    . LYS E 3 35  ? 24.873 -23.915 27.427  1.00 73.27  ? 35  LYS A CE    1 
ATOM   1781 N NZ    . LYS E 3 35  ? 24.486 -23.479 26.042  1.00 74.28  ? 35  LYS A NZ    1 
ATOM   1782 N N     . ALA E 3 36  ? 22.063 -19.972 30.700  1.00 60.62  ? 36  ALA A N     1 
ATOM   1783 C CA    . ALA E 3 36  ? 21.079 -19.110 31.331  1.00 60.75  ? 36  ALA A CA    1 
ATOM   1784 C C     . ALA E 3 36  ? 19.801 -19.897 31.588  1.00 61.87  ? 36  ALA A C     1 
ATOM   1785 O O     . ALA E 3 36  ? 19.243 -20.485 30.661  1.00 64.30  ? 36  ALA A O     1 
ATOM   1786 C CB    . ALA E 3 36  ? 20.793 -17.918 30.434  1.00 58.07  ? 36  ALA A CB    1 
ATOM   1787 N N     . GLU E 3 37  ? 19.335 -19.920 32.834  1.00 61.00  ? 37  GLU A N     1 
ATOM   1788 C CA    . GLU E 3 37  ? 18.108 -20.649 33.164  1.00 60.66  ? 37  GLU A CA    1 
ATOM   1789 C C     . GLU E 3 37  ? 17.381 -20.010 34.351  1.00 59.02  ? 37  GLU A C     1 
ATOM   1790 O O     . GLU E 3 37  ? 16.239 -20.349 34.672  1.00 58.11  ? 37  GLU A O     1 
ATOM   1791 C CB    . GLU E 3 37  ? 18.447 -22.115 33.450  1.00 62.95  ? 37  GLU A CB    1 
ATOM   1792 C CG    . GLU E 3 37  ? 19.177 -22.770 32.275  1.00 69.16  ? 37  GLU A CG    1 
ATOM   1793 C CD    . GLU E 3 37  ? 19.834 -24.101 32.609  1.00 73.00  ? 37  GLU A CD    1 
ATOM   1794 O OE1   . GLU E 3 37  ? 20.755 -24.508 31.857  1.00 74.24  ? 37  GLU A OE1   1 
ATOM   1795 O OE2   . GLU E 3 37  ? 19.428 -24.741 33.608  1.00 75.37  ? 37  GLU A OE2   1 
ATOM   1796 N N     . THR E 3 38  ? 18.047 -19.053 34.985  1.00 57.01  ? 38  THR A N     1 
ATOM   1797 C CA    . THR E 3 38  ? 17.476 -18.355 36.122  1.00 52.89  ? 38  THR A CA    1 
ATOM   1798 C C     . THR E 3 38  ? 17.246 -16.902 35.742  1.00 50.36  ? 38  THR A C     1 
ATOM   1799 O O     . THR E 3 38  ? 17.930 -16.378 34.866  1.00 50.47  ? 38  THR A O     1 
ATOM   1800 C CB    . THR E 3 38  ? 18.425 -18.426 37.309  1.00 51.94  ? 38  THR A CB    1 
ATOM   1801 O OG1   . THR E 3 38  ? 18.795 -19.787 37.510  1.00 52.15  ? 38  THR A OG1   1 
ATOM   1802 C CG2   . THR E 3 38  ? 17.754 -17.914 38.576  1.00 52.61  ? 38  THR A CG2   1 
ATOM   1803 N N     . LEU E 3 39  ? 16.273 -16.277 36.400  1.00 46.79  ? 39  LEU A N     1 
ATOM   1804 C CA    . LEU E 3 39  ? 15.911 -14.880 36.184  1.00 44.15  ? 39  LEU A CA    1 
ATOM   1805 C C     . LEU E 3 39  ? 16.022 -14.137 37.511  1.00 44.30  ? 39  LEU A C     1 
ATOM   1806 O O     . LEU E 3 39  ? 15.557 -14.633 38.533  1.00 43.38  ? 39  LEU A O     1 
ATOM   1807 C CB    . LEU E 3 39  ? 14.471 -14.788 35.683  1.00 41.38  ? 39  LEU A CB    1 
ATOM   1808 C CG    . LEU E 3 39  ? 13.859 -13.389 35.661  1.00 37.85  ? 39  LEU A CG    1 
ATOM   1809 C CD1   . LEU E 3 39  ? 14.611 -12.524 34.654  1.00 40.58  ? 39  LEU A CD1   1 
ATOM   1810 C CD2   . LEU E 3 39  ? 12.402 -13.465 35.295  1.00 32.39  ? 39  LEU A CD2   1 
ATOM   1811 N N     . TYR E 3 40  ? 16.610 -12.943 37.498  1.00 45.63  ? 40  TYR A N     1 
ATOM   1812 C CA    . TYR E 3 40  ? 16.775 -12.162 38.729  1.00 45.83  ? 40  TYR A CA    1 
ATOM   1813 C C     . TYR E 3 40  ? 15.956 -10.877 38.759  1.00 46.39  ? 40  TYR A C     1 
ATOM   1814 O O     . TYR E 3 40  ? 15.571 -10.356 37.714  1.00 46.81  ? 40  TYR A O     1 
ATOM   1815 C CB    . TYR E 3 40  ? 18.239 -11.789 38.930  1.00 44.11  ? 40  TYR A CB    1 
ATOM   1816 C CG    . TYR E 3 40  ? 19.189 -12.959 38.873  1.00 46.21  ? 40  TYR A CG    1 
ATOM   1817 C CD1   . TYR E 3 40  ? 19.484 -13.583 37.665  1.00 45.66  ? 40  TYR A CD1   1 
ATOM   1818 C CD2   . TYR E 3 40  ? 19.805 -13.441 40.032  1.00 46.47  ? 40  TYR A CD2   1 
ATOM   1819 C CE1   . TYR E 3 40  ? 20.362 -14.647 37.614  1.00 45.68  ? 40  TYR A CE1   1 
ATOM   1820 C CE2   . TYR E 3 40  ? 20.683 -14.505 39.989  1.00 43.60  ? 40  TYR A CE2   1 
ATOM   1821 C CZ    . TYR E 3 40  ? 20.956 -15.101 38.781  1.00 45.17  ? 40  TYR A CZ    1 
ATOM   1822 O OH    . TYR E 3 40  ? 21.825 -16.159 38.727  1.00 47.92  ? 40  TYR A OH    1 
ATOM   1823 N N     . TYR E 3 41  ? 15.702 -10.384 39.975  1.00 45.88  ? 41  TYR A N     1 
ATOM   1824 C CA    . TYR E 3 41  ? 14.969 -9.138  40.234  1.00 43.62  ? 41  TYR A CA    1 
ATOM   1825 C C     . TYR E 3 41  ? 15.616 -8.570  41.489  1.00 42.51  ? 41  TYR A C     1 
ATOM   1826 O O     . TYR E 3 41  ? 15.654 -9.244  42.499  1.00 43.62  ? 41  TYR A O     1 
ATOM   1827 C CB    . TYR E 3 41  ? 13.494 -9.415  40.489  1.00 43.70  ? 41  TYR A CB    1 
ATOM   1828 C CG    . TYR E 3 41  ? 12.725 -8.201  40.963  1.00 49.59  ? 41  TYR A CG    1 
ATOM   1829 C CD1   . TYR E 3 41  ? 12.802 -7.778  42.288  1.00 49.88  ? 41  TYR A CD1   1 
ATOM   1830 C CD2   . TYR E 3 41  ? 11.941 -7.442  40.075  1.00 51.78  ? 41  TYR A CD2   1 
ATOM   1831 C CE1   . TYR E 3 41  ? 12.127 -6.638  42.719  1.00 51.24  ? 41  TYR A CE1   1 
ATOM   1832 C CE2   . TYR E 3 41  ? 11.259 -6.291  40.507  1.00 49.41  ? 41  TYR A CE2   1 
ATOM   1833 C CZ    . TYR E 3 41  ? 11.360 -5.901  41.829  1.00 50.34  ? 41  TYR A CZ    1 
ATOM   1834 O OH    . TYR E 3 41  ? 10.700 -4.782  42.285  1.00 50.92  ? 41  TYR A OH    1 
ATOM   1835 N N     . ILE E 3 42  ? 16.127 -7.344  41.434  1.00 41.73  ? 42  ILE A N     1 
ATOM   1836 C CA    . ILE E 3 42  ? 16.810 -6.745  42.585  1.00 41.31  ? 42  ILE A CA    1 
ATOM   1837 C C     . ILE E 3 42  ? 15.932 -6.084  43.665  1.00 44.47  ? 42  ILE A C     1 
ATOM   1838 O O     . ILE E 3 42  ? 15.568 -4.916  43.545  1.00 46.92  ? 42  ILE A O     1 
ATOM   1839 C CB    . ILE E 3 42  ? 17.835 -5.687  42.127  1.00 37.10  ? 42  ILE A CB    1 
ATOM   1840 C CG1   . ILE E 3 42  ? 18.862 -6.312  41.198  1.00 35.64  ? 42  ILE A CG1   1 
ATOM   1841 C CG2   . ILE E 3 42  ? 18.535 -5.100  43.329  1.00 35.53  ? 42  ILE A CG2   1 
ATOM   1842 C CD1   . ILE E 3 42  ? 19.840 -5.320  40.613  1.00 34.55  ? 42  ILE A CD1   1 
ATOM   1843 N N     . VAL E 3 43  ? 15.625 -6.810  44.738  1.00 45.52  ? 43  VAL A N     1 
ATOM   1844 C CA    . VAL E 3 43  ? 14.806 -6.247  45.803  1.00 44.48  ? 43  VAL A CA    1 
ATOM   1845 C C     . VAL E 3 43  ? 15.545 -5.144  46.542  1.00 44.99  ? 43  VAL A C     1 
ATOM   1846 O O     . VAL E 3 43  ? 14.915 -4.238  47.077  1.00 45.65  ? 43  VAL A O     1 
ATOM   1847 C CB    . VAL E 3 43  ? 14.359 -7.320  46.817  1.00 44.26  ? 43  VAL A CB    1 
ATOM   1848 C CG1   . VAL E 3 43  ? 13.529 -6.672  47.913  1.00 40.42  ? 43  VAL A CG1   1 
ATOM   1849 C CG2   . VAL E 3 43  ? 13.538 -8.409  46.098  1.00 42.05  ? 43  VAL A CG2   1 
ATOM   1850 N N     . LYS E 3 44  ? 16.873 -5.212  46.585  1.00 45.31  ? 44  LYS A N     1 
ATOM   1851 C CA    . LYS E 3 44  ? 17.639 -4.158  47.254  1.00 46.67  ? 44  LYS A CA    1 
ATOM   1852 C C     . LYS E 3 44  ? 19.128 -4.211  46.977  1.00 45.94  ? 44  LYS A C     1 
ATOM   1853 O O     . LYS E 3 44  ? 19.723 -5.289  46.975  1.00 48.08  ? 44  LYS A O     1 
ATOM   1854 C CB    . LYS E 3 44  ? 17.417 -4.186  48.762  1.00 48.34  ? 44  LYS A CB    1 
ATOM   1855 C CG    . LYS E 3 44  ? 18.332 -3.240  49.525  1.00 53.48  ? 44  LYS A CG    1 
ATOM   1856 C CD    . LYS E 3 44  ? 18.120 -3.371  51.032  1.00 59.87  ? 44  LYS A CD    1 
ATOM   1857 C CE    . LYS E 3 44  ? 19.212 -2.651  51.832  1.00 62.30  ? 44  LYS A CE    1 
ATOM   1858 N NZ    . LYS E 3 44  ? 19.194 -3.032  53.286  1.00 62.79  ? 44  LYS A NZ    1 
ATOM   1859 N N     . GLY E 3 45  ? 19.720 -3.035  46.762  1.00 43.70  ? 45  GLY A N     1 
ATOM   1860 C CA    . GLY E 3 45  ? 21.140 -2.931  46.472  1.00 41.66  ? 45  GLY A CA    1 
ATOM   1861 C C     . GLY E 3 45  ? 21.326 -2.573  45.012  1.00 41.16  ? 45  GLY A C     1 
ATOM   1862 O O     . GLY E 3 45  ? 20.351 -2.261  44.328  1.00 41.72  ? 45  GLY A O     1 
ATOM   1863 N N     . SER E 3 46  ? 22.555 -2.613  44.511  1.00 39.33  ? 46  SER A N     1 
ATOM   1864 C CA    . SER E 3 46  ? 22.759 -2.281  43.112  1.00 38.79  ? 46  SER A CA    1 
ATOM   1865 C C     . SER E 3 46  ? 23.863 -3.120  42.461  1.00 38.32  ? 46  SER A C     1 
ATOM   1866 O O     . SER E 3 46  ? 24.832 -3.503  43.104  1.00 37.50  ? 46  SER A O     1 
ATOM   1867 C CB    . SER E 3 46  ? 23.088 -0.795  42.988  1.00 40.28  ? 46  SER A CB    1 
ATOM   1868 O OG    . SER E 3 46  ? 24.445 -0.554  43.324  1.00 42.75  ? 46  SER A OG    1 
ATOM   1869 N N     . VAL E 3 47  ? 23.729 -3.390  41.171  1.00 38.83  ? 47  VAL A N     1 
ATOM   1870 C CA    . VAL E 3 47  ? 24.733 -4.193  40.476  1.00 38.39  ? 47  VAL A CA    1 
ATOM   1871 C C     . VAL E 3 47  ? 25.343 -3.461  39.286  1.00 38.66  ? 47  VAL A C     1 
ATOM   1872 O O     . VAL E 3 47  ? 24.886 -2.394  38.893  1.00 38.53  ? 47  VAL A O     1 
ATOM   1873 C CB    . VAL E 3 47  ? 24.110 -5.516  39.957  1.00 35.95  ? 47  VAL A CB    1 
ATOM   1874 C CG1   . VAL E 3 47  ? 23.364 -6.227  41.085  1.00 32.44  ? 47  VAL A CG1   1 
ATOM   1875 C CG2   . VAL E 3 47  ? 23.152 -5.217  38.837  1.00 32.30  ? 47  VAL A CG2   1 
ATOM   1876 N N     . ALA E 3 48  ? 26.371 -4.072  38.710  1.00 39.70  ? 48  ALA A N     1 
ATOM   1877 C CA    . ALA E 3 48  ? 27.066 -3.547  37.537  1.00 38.22  ? 48  ALA A CA    1 
ATOM   1878 C C     . ALA E 3 48  ? 27.110 -4.643  36.467  1.00 38.55  ? 48  ALA A C     1 
ATOM   1879 O O     . ALA E 3 48  ? 27.573 -5.752  36.726  1.00 39.08  ? 48  ALA A O     1 
ATOM   1880 C CB    . ALA E 3 48  ? 28.464 -3.153  37.905  1.00 36.78  ? 48  ALA A CB    1 
ATOM   1881 N N     . VAL E 3 49  ? 26.613 -4.326  35.275  1.00 38.25  ? 49  VAL A N     1 
ATOM   1882 C CA    . VAL E 3 49  ? 26.595 -5.246  34.147  1.00 36.64  ? 49  VAL A CA    1 
ATOM   1883 C C     . VAL E 3 49  ? 27.810 -4.945  33.283  1.00 38.05  ? 49  VAL A C     1 
ATOM   1884 O O     . VAL E 3 49  ? 27.867 -3.886  32.666  1.00 40.41  ? 49  VAL A O     1 
ATOM   1885 C CB    . VAL E 3 49  ? 25.333 -5.024  33.296  1.00 35.66  ? 49  VAL A CB    1 
ATOM   1886 C CG1   . VAL E 3 49  ? 25.397 -5.844  32.019  1.00 34.91  ? 49  VAL A CG1   1 
ATOM   1887 C CG2   . VAL E 3 49  ? 24.095 -5.392  34.101  1.00 34.41  ? 49  VAL A CG2   1 
ATOM   1888 N N     . LEU E 3 50  ? 28.781 -5.849  33.227  1.00 37.20  ? 50  LEU A N     1 
ATOM   1889 C CA    . LEU E 3 50  ? 29.952 -5.576  32.403  1.00 37.66  ? 50  LEU A CA    1 
ATOM   1890 C C     . LEU E 3 50  ? 30.421 -6.712  31.516  1.00 39.00  ? 50  LEU A C     1 
ATOM   1891 O O     . LEU E 3 50  ? 30.113 -7.884  31.758  1.00 40.19  ? 50  LEU A O     1 
ATOM   1892 C CB    . LEU E 3 50  ? 31.107 -5.110  33.281  1.00 39.79  ? 50  LEU A CB    1 
ATOM   1893 C CG    . LEU E 3 50  ? 31.499 -5.959  34.490  1.00 38.28  ? 50  LEU A CG    1 
ATOM   1894 C CD1   . LEU E 3 50  ? 32.235 -7.188  34.020  1.00 40.68  ? 50  LEU A CD1   1 
ATOM   1895 C CD2   . LEU E 3 50  ? 32.401 -5.158  35.394  1.00 37.82  ? 50  LEU A CD2   1 
ATOM   1896 N N     . ILE E 3 51  ? 31.166 -6.357  30.476  1.00 39.40  ? 51  ILE A N     1 
ATOM   1897 C CA    . ILE E 3 51  ? 31.692 -7.346  29.553  1.00 43.43  ? 51  ILE A CA    1 
ATOM   1898 C C     . ILE E 3 51  ? 33.200 -7.215  29.482  1.00 47.17  ? 51  ILE A C     1 
ATOM   1899 O O     . ILE E 3 51  ? 33.728 -6.107  29.553  1.00 48.31  ? 51  ILE A O     1 
ATOM   1900 C CB    . ILE E 3 51  ? 31.112 -7.176  28.161  1.00 41.15  ? 51  ILE A CB    1 
ATOM   1901 C CG1   . ILE E 3 51  ? 31.302 -5.744  27.704  1.00 42.14  ? 51  ILE A CG1   1 
ATOM   1902 C CG2   . ILE E 3 51  ? 29.655 -7.566  28.158  1.00 38.38  ? 51  ILE A CG2   1 
ATOM   1903 C CD1   . ILE E 3 51  ? 30.526 -5.427  26.457  1.00 43.47  ? 51  ILE A CD1   1 
ATOM   1904 N N     . LYS E 3 52  ? 33.883 -8.356  29.353  1.00 51.26  ? 52  LYS A N     1 
ATOM   1905 C CA    . LYS E 3 52  ? 35.347 -8.411  29.296  1.00 53.96  ? 52  LYS A CA    1 
ATOM   1906 C C     . LYS E 3 52  ? 35.837 -8.805  27.902  1.00 57.92  ? 52  LYS A C     1 
ATOM   1907 O O     . LYS E 3 52  ? 35.083 -9.360  27.106  1.00 58.39  ? 52  LYS A O     1 
ATOM   1908 C CB    . LYS E 3 52  ? 35.873 -9.459  30.289  1.00 50.50  ? 52  LYS A CB    1 
ATOM   1909 C CG    . LYS E 3 52  ? 35.632 -9.196  31.759  1.00 48.42  ? 52  LYS A CG    1 
ATOM   1910 C CD    . LYS E 3 52  ? 35.777 -10.504 32.524  1.00 49.17  ? 52  LYS A CD    1 
ATOM   1911 C CE    . LYS E 3 52  ? 35.946 -10.321 34.038  1.00 51.76  ? 52  LYS A CE    1 
ATOM   1912 N NZ    . LYS E 3 52  ? 37.308 -9.819  34.473  1.00 52.23  ? 52  LYS A NZ    1 
ATOM   1913 N N     . ASP E 3 53  ? 37.101 -8.511  27.608  1.00 62.54  ? 53  ASP A N     1 
ATOM   1914 C CA    . ASP E 3 53  ? 37.694 -8.915  26.333  1.00 66.67  ? 53  ASP A CA    1 
ATOM   1915 C C     . ASP E 3 53  ? 38.714 -10.024 26.653  1.00 68.41  ? 53  ASP A C     1 
ATOM   1916 O O     . ASP E 3 53  ? 38.975 -10.313 27.826  1.00 66.09  ? 53  ASP A O     1 
ATOM   1917 C CB    . ASP E 3 53  ? 38.374 -7.732  25.641  1.00 67.32  ? 53  ASP A CB    1 
ATOM   1918 C CG    . ASP E 3 53  ? 39.641 -7.293  26.340  1.00 70.98  ? 53  ASP A CG    1 
ATOM   1919 O OD1   . ASP E 3 53  ? 40.084 -6.154  26.079  1.00 72.85  ? 53  ASP A OD1   1 
ATOM   1920 O OD2   . ASP E 3 53  ? 40.204 -8.078  27.138  1.00 71.35  ? 53  ASP A OD2   1 
ATOM   1921 N N     . GLU E 3 54  ? 39.283 -10.640 25.620  1.00 71.72  ? 54  GLU A N     1 
ATOM   1922 C CA    . GLU E 3 54  ? 40.249 -11.726 25.807  1.00 74.82  ? 54  GLU A CA    1 
ATOM   1923 C C     . GLU E 3 54  ? 41.360 -11.392 26.796  1.00 75.56  ? 54  GLU A C     1 
ATOM   1924 O O     . GLU E 3 54  ? 41.904 -12.285 27.448  1.00 76.23  ? 54  GLU A O     1 
ATOM   1925 C CB    . GLU E 3 54  ? 40.881 -12.114 24.468  1.00 77.06  ? 54  GLU A CB    1 
ATOM   1926 C CG    . GLU E 3 54  ? 41.489 -10.943 23.713  1.00 81.92  ? 54  GLU A CG    1 
ATOM   1927 C CD    . GLU E 3 54  ? 40.429 -10.000 23.154  1.00 84.79  ? 54  GLU A CD    1 
ATOM   1928 O OE1   . GLU E 3 54  ? 39.683 -10.426 22.240  1.00 85.62  ? 54  GLU A OE1   1 
ATOM   1929 O OE2   . GLU E 3 54  ? 40.339 -8.842  23.632  1.00 85.47  ? 54  GLU A OE2   1 
ATOM   1930 N N     . GLU E 3 55  ? 41.683 -10.108 26.912  1.00 75.25  ? 55  GLU A N     1 
ATOM   1931 C CA    . GLU E 3 55  ? 42.745 -9.653  27.799  1.00 74.69  ? 55  GLU A CA    1 
ATOM   1932 C C     . GLU E 3 55  ? 42.299 -9.367  29.232  1.00 73.58  ? 55  GLU A C     1 
ATOM   1933 O O     . GLU E 3 55  ? 43.129 -9.243  30.133  1.00 73.59  ? 55  GLU A O     1 
ATOM   1934 C CB    . GLU E 3 55  ? 43.381 -8.402  27.203  1.00 77.67  ? 55  GLU A CB    1 
ATOM   1935 C CG    . GLU E 3 55  ? 43.858 -8.603  25.775  1.00 82.87  ? 55  GLU A CG    1 
ATOM   1936 C CD    . GLU E 3 55  ? 44.440 -7.344  25.163  1.00 85.60  ? 55  GLU A CD    1 
ATOM   1937 O OE1   . GLU E 3 55  ? 45.338 -6.734  25.787  1.00 86.15  ? 55  GLU A OE1   1 
ATOM   1938 O OE2   . GLU E 3 55  ? 43.999 -6.972  24.052  1.00 87.72  ? 55  GLU A OE2   1 
ATOM   1939 N N     . GLY E 3 56  ? 40.991 -9.258  29.443  1.00 72.08  ? 56  GLY A N     1 
ATOM   1940 C CA    . GLY E 3 56  ? 40.484 -8.970  30.773  1.00 69.09  ? 56  GLY A CA    1 
ATOM   1941 C C     . GLY E 3 56  ? 39.918 -7.557  30.871  1.00 67.53  ? 56  GLY A C     1 
ATOM   1942 O O     . GLY E 3 56  ? 39.119 -7.269  31.766  1.00 68.20  ? 56  GLY A O     1 
ATOM   1943 N N     . LYS E 3 57  ? 40.335 -6.672  29.965  1.00 63.46  ? 57  LYS A N     1 
ATOM   1944 C CA    . LYS E 3 57  ? 39.840 -5.310  29.967  1.00 62.07  ? 57  LYS A CA    1 
ATOM   1945 C C     . LYS E 3 57  ? 38.326 -5.336  30.155  1.00 60.31  ? 57  LYS A C     1 
ATOM   1946 O O     . LYS E 3 57  ? 37.622 -6.067  29.458  1.00 61.76  ? 57  LYS A O     1 
ATOM   1947 C CB    . LYS E 3 57  ? 40.187 -4.631  28.646  1.00 64.15  ? 57  LYS A CB    1 
ATOM   1948 C CG    . LYS E 3 57  ? 41.606 -4.049  28.567  1.00 67.94  ? 57  LYS A CG    1 
ATOM   1949 C CD    . LYS E 3 57  ? 41.954 -3.598  27.132  1.00 70.80  ? 57  LYS A CD    1 
ATOM   1950 C CE    . LYS E 3 57  ? 40.848 -2.713  26.514  1.00 73.10  ? 57  LYS A CE    1 
ATOM   1951 N NZ    . LYS E 3 57  ? 40.864 -2.684  25.007  1.00 73.03  ? 57  LYS A NZ    1 
ATOM   1952 N N     . GLU E 3 58  ? 37.821 -4.544  31.094  1.00 57.73  ? 58  GLU A N     1 
ATOM   1953 C CA    . GLU E 3 58  ? 36.385 -4.509  31.361  1.00 54.23  ? 58  GLU A CA    1 
ATOM   1954 C C     . GLU E 3 58  ? 35.705 -3.254  30.825  1.00 52.90  ? 58  GLU A C     1 
ATOM   1955 O O     . GLU E 3 58  ? 36.257 -2.154  30.881  1.00 52.15  ? 58  GLU A O     1 
ATOM   1956 C CB    . GLU E 3 58  ? 36.114 -4.589  32.863  1.00 53.54  ? 58  GLU A CB    1 
ATOM   1957 C CG    . GLU E 3 58  ? 36.924 -5.629  33.612  1.00 54.95  ? 58  GLU A CG    1 
ATOM   1958 C CD    . GLU E 3 58  ? 36.402 -5.860  35.028  1.00 58.31  ? 58  GLU A CD    1 
ATOM   1959 O OE1   . GLU E 3 58  ? 35.888 -4.890  35.650  1.00 59.37  ? 58  GLU A OE1   1 
ATOM   1960 O OE2   . GLU E 3 58  ? 36.513 -7.009  35.524  1.00 58.17  ? 58  GLU A OE2   1 
ATOM   1961 N N     . MET E 3 59  ? 34.493 -3.431  30.315  1.00 52.15  ? 59  MET A N     1 
ATOM   1962 C CA    . MET E 3 59  ? 33.695 -2.327  29.795  1.00 51.69  ? 59  MET A CA    1 
ATOM   1963 C C     . MET E 3 59  ? 32.373 -2.374  30.542  1.00 50.16  ? 59  MET A C     1 
ATOM   1964 O O     . MET E 3 59  ? 31.746 -3.415  30.602  1.00 51.64  ? 59  MET A O     1 
ATOM   1965 C CB    . MET E 3 59  ? 33.443 -2.523  28.313  1.00 54.44  ? 59  MET A CB    1 
ATOM   1966 C CG    . MET E 3 59  ? 33.387 -1.241  27.535  1.00 56.66  ? 59  MET A CG    1 
ATOM   1967 S SD    . MET E 3 59  ? 31.913 -0.350  27.869  1.00 61.33  ? 59  MET A SD    1 
ATOM   1968 C CE    . MET E 3 59  ? 32.018 0.909   26.591  1.00 61.14  ? 59  MET A CE    1 
ATOM   1969 N N     . ILE E 3 60  ? 31.951 -1.264  31.133  1.00 48.08  ? 60  ILE A N     1 
ATOM   1970 C CA    . ILE E 3 60  ? 30.696 -1.254  31.865  1.00 45.34  ? 60  ILE A CA    1 
ATOM   1971 C C     . ILE E 3 60  ? 29.538 -0.895  30.953  1.00 46.70  ? 60  ILE A C     1 
ATOM   1972 O O     . ILE E 3 60  ? 29.510 0.184   30.356  1.00 49.66  ? 60  ILE A O     1 
ATOM   1973 C CB    . ILE E 3 60  ? 30.729 -0.254  33.022  1.00 42.68  ? 60  ILE A CB    1 
ATOM   1974 C CG1   . ILE E 3 60  ? 31.688 -0.745  34.088  1.00 39.89  ? 60  ILE A CG1   1 
ATOM   1975 C CG2   . ILE E 3 60  ? 29.351 -0.089  33.614  1.00 40.71  ? 60  ILE A CG2   1 
ATOM   1976 C CD1   . ILE E 3 60  ? 31.597 0.052   35.352  1.00 40.92  ? 60  ILE A CD1   1 
ATOM   1977 N N     . LEU E 3 61  ? 28.576 -1.799  30.849  1.00 44.20  ? 61  LEU A N     1 
ATOM   1978 C CA    . LEU E 3 61  ? 27.424 -1.563  30.009  1.00 42.09  ? 61  LEU A CA    1 
ATOM   1979 C C     . LEU E 3 61  ? 26.347 -0.807  30.739  1.00 41.95  ? 61  LEU A C     1 
ATOM   1980 O O     . LEU E 3 61  ? 25.578 -0.063  30.122  1.00 43.86  ? 61  LEU A O     1 
ATOM   1981 C CB    . LEU E 3 61  ? 26.835 -2.881  29.536  1.00 42.39  ? 61  LEU A CB    1 
ATOM   1982 C CG    . LEU E 3 61  ? 27.498 -3.545  28.338  1.00 42.18  ? 61  LEU A CG    1 
ATOM   1983 C CD1   . LEU E 3 61  ? 26.724 -4.813  27.999  1.00 40.81  ? 61  LEU A CD1   1 
ATOM   1984 C CD2   . LEU E 3 61  ? 27.498 -2.586  27.155  1.00 39.33  ? 61  LEU A CD2   1 
ATOM   1985 N N     . SER E 3 62  ? 26.275 -1.000  32.053  1.00 41.02  ? 62  SER A N     1 
ATOM   1986 C CA    . SER E 3 62  ? 25.232 -0.344  32.835  1.00 38.59  ? 62  SER A CA    1 
ATOM   1987 C C     . SER E 3 62  ? 25.267 -0.674  34.309  1.00 38.36  ? 62  SER A C     1 
ATOM   1988 O O     . SER E 3 62  ? 26.001 -1.551  34.748  1.00 38.17  ? 62  SER A O     1 
ATOM   1989 C CB    . SER E 3 62  ? 23.862 -0.749  32.289  1.00 35.66  ? 62  SER A CB    1 
ATOM   1990 O OG    . SER E 3 62  ? 22.796 -0.301  33.110  1.00 35.14  ? 62  SER A OG    1 
ATOM   1991 N N     . TYR E 3 63  ? 24.477 0.075   35.067  1.00 38.76  ? 63  TYR A N     1 
ATOM   1992 C CA    . TYR E 3 63  ? 24.305 -0.160  36.490  1.00 39.66  ? 63  TYR A CA    1 
ATOM   1993 C C     . TYR E 3 63  ? 22.824 -0.519  36.586  1.00 39.96  ? 63  TYR A C     1 
ATOM   1994 O O     . TYR E 3 63  ? 22.011 0.009   35.834  1.00 41.38  ? 63  TYR A O     1 
ATOM   1995 C CB    . TYR E 3 63  ? 24.560 1.105   37.315  1.00 40.51  ? 63  TYR A CB    1 
ATOM   1996 C CG    . TYR E 3 63  ? 26.011 1.525   37.443  1.00 43.13  ? 63  TYR A CG    1 
ATOM   1997 C CD1   . TYR E 3 63  ? 27.000 0.600   37.773  1.00 42.58  ? 63  TYR A CD1   1 
ATOM   1998 C CD2   . TYR E 3 63  ? 26.388 2.858   37.258  1.00 44.32  ? 63  TYR A CD2   1 
ATOM   1999 C CE1   . TYR E 3 63  ? 28.322 0.983   37.911  1.00 45.22  ? 63  TYR A CE1   1 
ATOM   2000 C CE2   . TYR E 3 63  ? 27.708 3.257   37.395  1.00 45.36  ? 63  TYR A CE2   1 
ATOM   2001 C CZ    . TYR E 3 63  ? 28.678 2.316   37.721  1.00 46.77  ? 63  TYR A CZ    1 
ATOM   2002 O OH    . TYR E 3 63  ? 30.005 2.702   37.851  1.00 46.67  ? 63  TYR A OH    1 
ATOM   2003 N N     . LEU E 3 64  ? 22.464 -1.435  37.471  1.00 40.19  ? 64  LEU A N     1 
ATOM   2004 C CA    . LEU E 3 64  ? 21.053 -1.778  37.632  1.00 39.86  ? 64  LEU A CA    1 
ATOM   2005 C C     . LEU E 3 64  ? 20.770 -1.667  39.111  1.00 40.27  ? 64  LEU A C     1 
ATOM   2006 O O     . LEU E 3 64  ? 21.678 -1.863  39.931  1.00 40.01  ? 64  LEU A O     1 
ATOM   2007 C CB    . LEU E 3 64  ? 20.771 -3.192  37.133  1.00 40.16  ? 64  LEU A CB    1 
ATOM   2008 C CG    . LEU E 3 64  ? 20.996 -3.414  35.636  1.00 36.98  ? 64  LEU A CG    1 
ATOM   2009 C CD1   . LEU E 3 64  ? 20.793 -4.877  35.320  1.00 36.40  ? 64  LEU A CD1   1 
ATOM   2010 C CD2   . LEU E 3 64  ? 20.032 -2.561  34.832  1.00 36.06  ? 64  LEU A CD2   1 
ATOM   2011 N N     . ASN E 3 65  ? 19.527 -1.352  39.461  1.00 40.27  ? 65  ASN A N     1 
ATOM   2012 C CA    . ASN E 3 65  ? 19.186 -1.177  40.864  1.00 40.98  ? 65  ASN A CA    1 
ATOM   2013 C C     . ASN E 3 65  ? 17.875 -1.774  41.272  1.00 40.93  ? 65  ASN A C     1 
ATOM   2014 O O     . ASN E 3 65  ? 17.192 -2.439  40.495  1.00 41.01  ? 65  ASN A O     1 
ATOM   2015 C CB    . ASN E 3 65  ? 19.123 0.308   41.206  1.00 41.41  ? 65  ASN A CB    1 
ATOM   2016 C CG    . ASN E 3 65  ? 20.269 1.075   40.638  1.00 42.33  ? 65  ASN A CG    1 
ATOM   2017 O OD1   . ASN E 3 65  ? 21.336 1.141   41.247  1.00 45.78  ? 65  ASN A OD1   1 
ATOM   2018 N ND2   . ASN E 3 65  ? 20.076 1.648   39.446  1.00 39.33  ? 65  ASN A ND2   1 
ATOM   2019 N N     . GLN E 3 66  ? 17.544 -1.489  42.525  1.00 42.89  ? 66  GLN A N     1 
ATOM   2020 C CA    . GLN E 3 66  ? 16.314 -1.906  43.175  1.00 44.06  ? 66  GLN A CA    1 
ATOM   2021 C C     . GLN E 3 66  ? 15.215 -1.748  42.141  1.00 43.02  ? 66  GLN A C     1 
ATOM   2022 O O     . GLN E 3 66  ? 15.072 -0.676  41.554  1.00 45.43  ? 66  GLN A O     1 
ATOM   2023 C CB    . GLN E 3 66  ? 16.085 -0.973  44.354  1.00 47.88  ? 66  GLN A CB    1 
ATOM   2024 C CG    . GLN E 3 66  ? 15.021 -1.363  45.346  1.00 53.12  ? 66  GLN A CG    1 
ATOM   2025 C CD    . GLN E 3 66  ? 14.923 -0.319  46.446  1.00 57.10  ? 66  GLN A CD    1 
ATOM   2026 O OE1   . GLN E 3 66  ? 14.650 0.856   46.172  1.00 59.37  ? 66  GLN A OE1   1 
ATOM   2027 N NE2   . GLN E 3 66  ? 15.163 -0.729  47.690  1.00 58.56  ? 66  GLN A NE2   1 
ATOM   2028 N N     . GLY E 3 67  ? 14.466 -2.814  41.889  1.00 39.46  ? 67  GLY A N     1 
ATOM   2029 C CA    . GLY E 3 67  ? 13.409 -2.745  40.902  1.00 39.27  ? 67  GLY A CA    1 
ATOM   2030 C C     . GLY E 3 67  ? 13.771 -3.335  39.547  1.00 40.83  ? 67  GLY A C     1 
ATOM   2031 O O     . GLY E 3 67  ? 12.898 -3.853  38.841  1.00 38.47  ? 67  GLY A O     1 
ATOM   2032 N N     . ASP E 3 68  ? 15.050 -3.267  39.177  1.00 41.53  ? 68  ASP A N     1 
ATOM   2033 C CA    . ASP E 3 68  ? 15.504 -3.806  37.892  1.00 45.50  ? 68  ASP A CA    1 
ATOM   2034 C C     . ASP E 3 68  ? 15.661 -5.335  37.790  1.00 46.47  ? 68  ASP A C     1 
ATOM   2035 O O     . ASP E 3 68  ? 16.105 -6.007  38.729  1.00 48.34  ? 68  ASP A O     1 
ATOM   2036 C CB    . ASP E 3 68  ? 16.844 -3.181  37.492  1.00 48.69  ? 68  ASP A CB    1 
ATOM   2037 C CG    . ASP E 3 68  ? 16.702 -1.767  36.966  1.00 52.00  ? 68  ASP A CG    1 
ATOM   2038 O OD1   . ASP E 3 68  ? 15.725 -1.510  36.216  1.00 53.75  ? 68  ASP A OD1   1 
ATOM   2039 O OD2   . ASP E 3 68  ? 17.579 -0.925  37.289  1.00 52.64  ? 68  ASP A OD2   1 
ATOM   2040 N N     . PHE E 3 69  ? 15.320 -5.880  36.631  1.00 45.64  ? 69  PHE A N     1 
ATOM   2041 C CA    . PHE E 3 69  ? 15.468 -7.310  36.402  1.00 46.36  ? 69  PHE A CA    1 
ATOM   2042 C C     . PHE E 3 69  ? 16.882 -7.614  35.890  1.00 46.33  ? 69  PHE A C     1 
ATOM   2043 O O     . PHE E 3 69  ? 17.552 -6.746  35.334  1.00 47.38  ? 69  PHE A O     1 
ATOM   2044 C CB    . PHE E 3 69  ? 14.452 -7.789  35.361  1.00 46.52  ? 69  PHE A CB    1 
ATOM   2045 C CG    . PHE E 3 69  ? 13.098 -8.134  35.930  1.00 49.53  ? 69  PHE A CG    1 
ATOM   2046 C CD1   . PHE E 3 69  ? 11.943 -7.510  35.450  1.00 50.18  ? 69  PHE A CD1   1 
ATOM   2047 C CD2   . PHE E 3 69  ? 12.967 -9.128  36.901  1.00 48.70  ? 69  PHE A CD2   1 
ATOM   2048 C CE1   . PHE E 3 69  ? 10.677 -7.882  35.925  1.00 51.51  ? 69  PHE A CE1   1 
ATOM   2049 C CE2   . PHE E 3 69  ? 11.711 -9.506  37.381  1.00 49.68  ? 69  PHE A CE2   1 
ATOM   2050 C CZ    . PHE E 3 69  ? 10.564 -8.885  36.892  1.00 51.09  ? 69  PHE A CZ    1 
ATOM   2051 N N     . ILE E 3 70  ? 17.351 -8.837  36.103  1.00 46.42  ? 70  ILE A N     1 
ATOM   2052 C CA    . ILE E 3 70  ? 18.653 -9.229  35.584  1.00 45.32  ? 70  ILE A CA    1 
ATOM   2053 C C     . ILE E 3 70  ? 18.547 -10.643 35.024  1.00 45.49  ? 70  ILE A C     1 
ATOM   2054 O O     . ILE E 3 70  ? 17.859 -11.485 35.587  1.00 44.63  ? 70  ILE A O     1 
ATOM   2055 C CB    . ILE E 3 70  ? 19.752 -9.260  36.651  1.00 43.60  ? 70  ILE A CB    1 
ATOM   2056 C CG1   . ILE E 3 70  ? 19.558 -8.166  37.677  1.00 43.15  ? 70  ILE A CG1   1 
ATOM   2057 C CG2   . ILE E 3 70  ? 21.092 -9.013  35.992  1.00 43.38  ? 70  ILE A CG2   1 
ATOM   2058 C CD1   . ILE E 3 70  ? 20.570 -8.269  38.804  1.00 43.94  ? 70  ILE A CD1   1 
ATOM   2059 N N     . GLY E 3 71  ? 19.233 -10.891 33.915  1.00 47.16  ? 71  GLY A N     1 
ATOM   2060 C CA    . GLY E 3 71  ? 19.236 -12.205 33.306  1.00 48.56  ? 71  GLY A CA    1 
ATOM   2061 C C     . GLY E 3 71  ? 17.983 -12.541 32.533  1.00 51.02  ? 71  GLY A C     1 
ATOM   2062 O O     . GLY E 3 71  ? 17.558 -13.693 32.523  1.00 52.32  ? 71  GLY A O     1 
ATOM   2063 N N     . GLU E 3 72  ? 17.379 -11.549 31.886  1.00 51.53  ? 72  GLU A N     1 
ATOM   2064 C CA    . GLU E 3 72  ? 16.171 -11.796 31.120  1.00 51.39  ? 72  GLU A CA    1 
ATOM   2065 C C     . GLU E 3 72  ? 16.548 -12.241 29.725  1.00 52.71  ? 72  GLU A C     1 
ATOM   2066 O O     . GLU E 3 72  ? 15.854 -13.037 29.095  1.00 54.89  ? 72  GLU A O     1 
ATOM   2067 C CB    . GLU E 3 72  ? 15.325 -10.533 30.996  1.00 50.57  ? 72  GLU A CB    1 
ATOM   2068 C CG    . GLU E 3 72  ? 15.798 -9.345  31.816  1.00 53.08  ? 72  GLU A CG    1 
ATOM   2069 C CD    . GLU E 3 72  ? 17.104 -8.705  31.326  1.00 50.98  ? 72  GLU A CD    1 
ATOM   2070 O OE1   . GLU E 3 72  ? 17.211 -8.362  30.125  1.00 47.39  ? 72  GLU A OE1   1 
ATOM   2071 O OE2   . GLU E 3 72  ? 18.013 -8.526  32.169  1.00 48.89  ? 72  GLU A OE2   1 
ATOM   2072 N N     . LEU E 3 73  ? 17.662 -11.730 29.235  1.00 53.21  ? 73  LEU A N     1 
ATOM   2073 C CA    . LEU E 3 73  ? 18.080 -12.054 27.885  1.00 53.97  ? 73  LEU A CA    1 
ATOM   2074 C C     . LEU E 3 73  ? 18.201 -13.530 27.542  1.00 54.82  ? 73  LEU A C     1 
ATOM   2075 O O     . LEU E 3 73  ? 18.381 -13.872 26.383  1.00 55.14  ? 73  LEU A O     1 
ATOM   2076 C CB    . LEU E 3 73  ? 19.383 -11.333 27.580  1.00 52.63  ? 73  LEU A CB    1 
ATOM   2077 C CG    . LEU E 3 73  ? 19.246 -9.833  27.804  1.00 49.53  ? 73  LEU A CG    1 
ATOM   2078 C CD1   . LEU E 3 73  ? 20.472 -9.160  27.263  1.00 50.36  ? 73  LEU A CD1   1 
ATOM   2079 C CD2   . LEU E 3 73  ? 17.996 -9.302  27.116  1.00 46.88  ? 73  LEU A CD2   1 
ATOM   2080 N N     . GLY E 3 74  ? 18.094 -14.402 28.537  1.00 56.64  ? 74  GLY A N     1 
ATOM   2081 C CA    . GLY E 3 74  ? 18.198 -15.825 28.266  1.00 59.48  ? 74  GLY A CA    1 
ATOM   2082 C C     . GLY E 3 74  ? 16.857 -16.538 28.259  1.00 61.11  ? 74  GLY A C     1 
ATOM   2083 O O     . GLY E 3 74  ? 16.710 -17.605 27.679  1.00 62.10  ? 74  GLY A O     1 
ATOM   2084 N N     . LEU E 3 75  ? 15.874 -15.936 28.908  1.00 62.54  ? 75  LEU A N     1 
ATOM   2085 C CA    . LEU E 3 75  ? 14.533 -16.493 29.008  1.00 63.28  ? 75  LEU A CA    1 
ATOM   2086 C C     . LEU E 3 75  ? 13.768 -16.628 27.699  1.00 65.05  ? 75  LEU A C     1 
ATOM   2087 O O     . LEU E 3 75  ? 12.790 -17.361 27.636  1.00 64.87  ? 75  LEU A O     1 
ATOM   2088 C CB    . LEU E 3 75  ? 13.709 -15.629 29.964  1.00 61.63  ? 75  LEU A CB    1 
ATOM   2089 C CG    . LEU E 3 75  ? 12.188 -15.675 29.854  1.00 60.93  ? 75  LEU A CG    1 
ATOM   2090 C CD1   . LEU E 3 75  ? 11.704 -17.055 30.244  1.00 60.90  ? 75  LEU A CD1   1 
ATOM   2091 C CD2   . LEU E 3 75  ? 11.565 -14.613 30.744  1.00 59.53  ? 75  LEU A CD2   1 
ATOM   2092 N N     . PHE E 3 76  ? 14.194 -15.949 26.643  1.00 67.97  ? 76  PHE A N     1 
ATOM   2093 C CA    . PHE E 3 76  ? 13.407 -16.025 25.419  1.00 70.90  ? 76  PHE A CA    1 
ATOM   2094 C C     . PHE E 3 76  ? 13.705 -17.089 24.388  1.00 72.66  ? 76  PHE A C     1 
ATOM   2095 O O     . PHE E 3 76  ? 13.037 -17.155 23.364  1.00 71.70  ? 76  PHE A O     1 
ATOM   2096 C CB    . PHE E 3 76  ? 13.351 -14.649 24.762  1.00 69.57  ? 76  PHE A CB    1 
ATOM   2097 C CG    . PHE E 3 76  ? 12.560 -13.660 25.556  1.00 69.32  ? 76  PHE A CG    1 
ATOM   2098 C CD1   . PHE E 3 76  ? 13.165 -12.904 26.556  1.00 71.23  ? 76  PHE A CD1   1 
ATOM   2099 C CD2   . PHE E 3 76  ? 11.189 -13.543 25.367  1.00 69.05  ? 76  PHE A CD2   1 
ATOM   2100 C CE1   . PHE E 3 76  ? 12.410 -12.043 27.362  1.00 70.60  ? 76  PHE A CE1   1 
ATOM   2101 C CE2   . PHE E 3 76  ? 10.427 -12.693 26.162  1.00 69.82  ? 76  PHE A CE2   1 
ATOM   2102 C CZ    . PHE E 3 76  ? 11.038 -11.941 27.163  1.00 69.84  ? 76  PHE A CZ    1 
ATOM   2103 N N     . GLU E 3 77  ? 14.684 -17.936 24.665  1.00 76.06  ? 77  GLU A N     1 
ATOM   2104 C CA    . GLU E 3 77  ? 15.036 -19.006 23.744  1.00 79.49  ? 77  GLU A CA    1 
ATOM   2105 C C     . GLU E 3 77  ? 16.117 -19.913 24.293  1.00 81.20  ? 77  GLU A C     1 
ATOM   2106 O O     . GLU E 3 77  ? 17.095 -19.461 24.889  1.00 81.51  ? 77  GLU A O     1 
ATOM   2107 C CB    . GLU E 3 77  ? 15.502 -18.452 22.405  1.00 79.56  ? 77  GLU A CB    1 
ATOM   2108 C CG    . GLU E 3 77  ? 16.018 -19.536 21.488  1.00 82.01  ? 77  GLU A CG    1 
ATOM   2109 C CD    . GLU E 3 77  ? 16.420 -19.007 20.133  1.00 85.15  ? 77  GLU A CD    1 
ATOM   2110 O OE1   . GLU E 3 77  ? 17.312 -18.130 20.078  1.00 85.87  ? 77  GLU A OE1   1 
ATOM   2111 O OE2   . GLU E 3 77  ? 15.841 -19.468 19.121  1.00 86.20  ? 77  GLU A OE2   1 
ATOM   2112 N N     . GLU E 3 78  ? 15.934 -21.204 24.062  1.00 83.02  ? 78  GLU A N     1 
ATOM   2113 C CA    . GLU E 3 78  ? 16.866 -22.215 24.527  1.00 84.60  ? 78  GLU A CA    1 
ATOM   2114 C C     . GLU E 3 78  ? 18.258 -22.068 23.912  1.00 83.62  ? 78  GLU A C     1 
ATOM   2115 O O     . GLU E 3 78  ? 18.416 -21.552 22.797  1.00 83.61  ? 78  GLU A O     1 
ATOM   2116 C CB    . GLU E 3 78  ? 16.305 -23.603 24.198  1.00 88.16  ? 78  GLU A CB    1 
ATOM   2117 C CG    . GLU E 3 78  ? 14.916 -23.857 24.759  1.00 91.65  ? 78  GLU A CG    1 
ATOM   2118 C CD    . GLU E 3 78  ? 14.877 -23.748 26.278  1.00 94.86  ? 78  GLU A CD    1 
ATOM   2119 O OE1   . GLU E 3 78  ? 15.627 -24.500 26.944  1.00 95.15  ? 78  GLU A OE1   1 
ATOM   2120 O OE2   . GLU E 3 78  ? 14.099 -22.914 26.805  1.00 96.80  ? 78  GLU A OE2   1 
ATOM   2121 N N     . GLY E 3 79  ? 19.263 -22.525 24.652  1.00 82.00  ? 79  GLY A N     1 
ATOM   2122 C CA    . GLY E 3 79  ? 20.631 -22.475 24.163  1.00 80.15  ? 79  GLY A CA    1 
ATOM   2123 C C     . GLY E 3 79  ? 21.370 -21.177 24.392  1.00 77.85  ? 79  GLY A C     1 
ATOM   2124 O O     . GLY E 3 79  ? 22.481 -21.001 23.892  1.00 77.77  ? 79  GLY A O     1 
ATOM   2125 N N     . GLN E 3 80  ? 20.764 -20.282 25.164  1.00 75.53  ? 80  GLN A N     1 
ATOM   2126 C CA    . GLN E 3 80  ? 21.351 -18.979 25.453  1.00 72.73  ? 80  GLN A CA    1 
ATOM   2127 C C     . GLN E 3 80  ? 22.323 -18.979 26.624  1.00 69.26  ? 80  GLN A C     1 
ATOM   2128 O O     . GLN E 3 80  ? 22.062 -19.560 27.672  1.00 69.11  ? 80  GLN A O     1 
ATOM   2129 C CB    . GLN E 3 80  ? 20.235 -17.966 25.734  1.00 75.10  ? 80  GLN A CB    1 
ATOM   2130 C CG    . GLN E 3 80  ? 19.318 -17.709 24.552  1.00 76.97  ? 80  GLN A CG    1 
ATOM   2131 C CD    . GLN E 3 80  ? 20.045 -17.039 23.409  1.00 77.58  ? 80  GLN A CD    1 
ATOM   2132 O OE1   . GLN E 3 80  ? 20.255 -15.825 23.421  1.00 77.62  ? 80  GLN A OE1   1 
ATOM   2133 N NE2   . GLN E 3 80  ? 20.454 -17.832 22.420  1.00 77.12  ? 80  GLN A NE2   1 
ATOM   2134 N N     . GLU E 3 81  ? 23.456 -18.327 26.446  1.00 65.61  ? 81  GLU A N     1 
ATOM   2135 C CA    . GLU E 3 81  ? 24.406 -18.248 27.534  1.00 64.53  ? 81  GLU A CA    1 
ATOM   2136 C C     . GLU E 3 81  ? 24.424 -16.785 27.967  1.00 61.58  ? 81  GLU A C     1 
ATOM   2137 O O     . GLU E 3 81  ? 24.189 -15.888 27.142  1.00 60.94  ? 81  GLU A O     1 
ATOM   2138 C CB    . GLU E 3 81  ? 25.798 -18.733 27.085  1.00 68.10  ? 81  GLU A CB    1 
ATOM   2139 C CG    . GLU E 3 81  ? 25.965 -20.271 27.171  1.00 72.96  ? 81  GLU A CG    1 
ATOM   2140 C CD    . GLU E 3 81  ? 27.320 -20.791 26.665  1.00 76.23  ? 81  GLU A CD    1 
ATOM   2141 O OE1   . GLU E 3 81  ? 27.593 -22.005 26.859  1.00 76.20  ? 81  GLU A OE1   1 
ATOM   2142 O OE2   . GLU E 3 81  ? 28.102 -19.998 26.076  1.00 77.67  ? 81  GLU A OE2   1 
ATOM   2143 N N     . ARG E 3 82  ? 24.666 -16.551 29.257  1.00 55.84  ? 82  ARG A N     1 
ATOM   2144 C CA    . ARG E 3 82  ? 24.701 -15.204 29.803  1.00 49.41  ? 82  ARG A CA    1 
ATOM   2145 C C     . ARG E 3 82  ? 25.525 -14.298 28.909  1.00 48.14  ? 82  ARG A C     1 
ATOM   2146 O O     . ARG E 3 82  ? 26.627 -14.653 28.504  1.00 47.04  ? 82  ARG A O     1 
ATOM   2147 C CB    . ARG E 3 82  ? 25.303 -15.229 31.191  1.00 48.85  ? 82  ARG A CB    1 
ATOM   2148 C CG    . ARG E 3 82  ? 24.576 -16.129 32.181  1.00 46.74  ? 82  ARG A CG    1 
ATOM   2149 C CD    . ARG E 3 82  ? 23.135 -15.747 32.319  1.00 44.34  ? 82  ARG A CD    1 
ATOM   2150 N NE    . ARG E 3 82  ? 22.515 -16.387 33.468  1.00 43.46  ? 82  ARG A NE    1 
ATOM   2151 C CZ    . ARG E 3 82  ? 21.216 -16.317 33.740  1.00 44.30  ? 82  ARG A CZ    1 
ATOM   2152 N NH1   . ARG E 3 82  ? 20.414 -15.642 32.930  1.00 43.39  ? 82  ARG A NH1   1 
ATOM   2153 N NH2   . ARG E 3 82  ? 20.721 -16.892 34.834  1.00 44.88  ? 82  ARG A NH2   1 
ATOM   2154 N N     . SER E 3 83  ? 24.989 -13.120 28.611  1.00 46.44  ? 83  SER A N     1 
ATOM   2155 C CA    . SER E 3 83  ? 25.660 -12.164 27.737  1.00 44.61  ? 83  SER A CA    1 
ATOM   2156 C C     . SER E 3 83  ? 26.681 -11.241 28.402  1.00 44.19  ? 83  SER A C     1 
ATOM   2157 O O     . SER E 3 83  ? 27.323 -10.451 27.709  1.00 42.55  ? 83  SER A O     1 
ATOM   2158 C CB    . SER E 3 83  ? 24.621 -11.301 27.059  1.00 44.48  ? 83  SER A CB    1 
ATOM   2159 O OG    . SER E 3 83  ? 23.932 -10.560 28.046  1.00 49.21  ? 83  SER A OG    1 
ATOM   2160 N N     . ALA E 3 84  ? 26.826 -11.327 29.724  1.00 43.07  ? 84  ALA A N     1 
ATOM   2161 C CA    . ALA E 3 84  ? 27.764 -10.475 30.448  1.00 43.31  ? 84  ALA A CA    1 
ATOM   2162 C C     . ALA E 3 84  ? 27.880 -10.858 31.911  1.00 45.02  ? 84  ALA A C     1 
ATOM   2163 O O     . ALA E 3 84  ? 27.154 -11.728 32.405  1.00 44.97  ? 84  ALA A O     1 
ATOM   2164 C CB    . ALA E 3 84  ? 27.329 -9.048  30.359  1.00 42.77  ? 84  ALA A CB    1 
ATOM   2165 N N     . TRP E 3 85  ? 28.808 -10.208 32.602  1.00 45.40  ? 85  TRP A N     1 
ATOM   2166 C CA    . TRP E 3 85  ? 29.000 -10.462 34.016  1.00 47.66  ? 85  TRP A CA    1 
ATOM   2167 C C     . TRP E 3 85  ? 28.119 -9.471  34.744  1.00 48.71  ? 85  TRP A C     1 
ATOM   2168 O O     . TRP E 3 85  ? 27.769 -8.425  34.181  1.00 49.09  ? 85  TRP A O     1 
ATOM   2169 C CB    . TRP E 3 85  ? 30.447 -10.206 34.431  1.00 50.79  ? 85  TRP A CB    1 
ATOM   2170 C CG    . TRP E 3 85  ? 31.436 -11.145 33.859  1.00 56.04  ? 85  TRP A CG    1 
ATOM   2171 C CD1   . TRP E 3 85  ? 31.909 -11.167 32.579  1.00 58.54  ? 85  TRP A CD1   1 
ATOM   2172 C CD2   . TRP E 3 85  ? 32.069 -12.224 34.543  1.00 58.79  ? 85  TRP A CD2   1 
ATOM   2173 N NE1   . TRP E 3 85  ? 32.804 -12.202 32.420  1.00 59.55  ? 85  TRP A NE1   1 
ATOM   2174 C CE2   . TRP E 3 85  ? 32.920 -12.868 33.613  1.00 59.93  ? 85  TRP A CE2   1 
ATOM   2175 C CE3   . TRP E 3 85  ? 32.003 -12.714 35.853  1.00 60.05  ? 85  TRP A CE3   1 
ATOM   2176 C CZ2   . TRP E 3 85  ? 33.700 -13.981 33.953  1.00 60.05  ? 85  TRP A CZ2   1 
ATOM   2177 C CZ3   . TRP E 3 85  ? 32.782 -13.825 36.192  1.00 63.31  ? 85  TRP A CZ3   1 
ATOM   2178 C CH2   . TRP E 3 85  ? 33.618 -14.445 35.240  1.00 61.25  ? 85  TRP A CH2   1 
ATOM   2179 N N     . VAL E 3 86  ? 27.748 -9.791  35.978  1.00 47.40  ? 86  VAL A N     1 
ATOM   2180 C CA    . VAL E 3 86  ? 26.947 -8.868  36.770  1.00 48.11  ? 86  VAL A CA    1 
ATOM   2181 C C     . VAL E 3 86  ? 27.503 -8.935  38.180  1.00 50.12  ? 86  VAL A C     1 
ATOM   2182 O O     . VAL E 3 86  ? 27.223 -9.873  38.923  1.00 52.54  ? 86  VAL A O     1 
ATOM   2183 C CB    . VAL E 3 86  ? 25.441 -9.240  36.779  1.00 48.21  ? 86  VAL A CB    1 
ATOM   2184 C CG1   . VAL E 3 86  ? 24.644 -8.210  37.595  1.00 45.24  ? 86  VAL A CG1   1 
ATOM   2185 C CG2   . VAL E 3 86  ? 24.903 -9.283  35.361  1.00 46.05  ? 86  VAL A CG2   1 
ATOM   2186 N N     . ARG E 3 87  ? 28.299 -7.937  38.543  1.00 49.88  ? 87  ARG A N     1 
ATOM   2187 C CA    . ARG E 3 87  ? 28.921 -7.902  39.856  1.00 50.55  ? 87  ARG A CA    1 
ATOM   2188 C C     . ARG E 3 87  ? 28.236 -6.895  40.757  1.00 50.07  ? 87  ARG A C     1 
ATOM   2189 O O     . ARG E 3 87  ? 27.961 -5.780  40.344  1.00 51.04  ? 87  ARG A O     1 
ATOM   2190 C CB    . ARG E 3 87  ? 30.390 -7.540  39.693  1.00 53.25  ? 87  ARG A CB    1 
ATOM   2191 C CG    . ARG E 3 87  ? 31.249 -7.894  40.882  1.00 56.79  ? 87  ARG A CG    1 
ATOM   2192 C CD    . ARG E 3 87  ? 32.665 -7.460  40.624  1.00 58.59  ? 87  ARG A CD    1 
ATOM   2193 N NE    . ARG E 3 87  ? 33.116 -7.855  39.292  1.00 59.48  ? 87  ARG A NE    1 
ATOM   2194 C CZ    . ARG E 3 87  ? 33.728 -7.024  38.461  1.00 59.34  ? 87  ARG A CZ    1 
ATOM   2195 N NH1   . ARG E 3 87  ? 33.940 -5.771  38.839  1.00 58.36  ? 87  ARG A NH1   1 
ATOM   2196 N NH2   . ARG E 3 87  ? 34.142 -7.445  37.273  1.00 59.28  ? 87  ARG A NH2   1 
ATOM   2197 N N     . ALA E 3 88  ? 27.973 -7.279  41.995  1.00 50.14  ? 88  ALA A N     1 
ATOM   2198 C CA    . ALA E 3 88  ? 27.292 -6.389  42.929  1.00 51.67  ? 88  ALA A CA    1 
ATOM   2199 C C     . ALA E 3 88  ? 28.045 -5.091  43.285  1.00 52.60  ? 88  ALA A C     1 
ATOM   2200 O O     . ALA E 3 88  ? 29.206 -5.126  43.677  1.00 52.65  ? 88  ALA A O     1 
ATOM   2201 C CB    . ALA E 3 88  ? 26.959 -7.158  44.196  1.00 48.25  ? 88  ALA A CB    1 
ATOM   2202 N N     . LYS E 3 89  ? 27.382 -3.946  43.139  1.00 54.55  ? 89  LYS A N     1 
ATOM   2203 C CA    . LYS E 3 89  ? 27.997 -2.663  43.494  1.00 56.15  ? 89  LYS A CA    1 
ATOM   2204 C C     . LYS E 3 89  ? 27.929 -2.508  45.009  1.00 56.29  ? 89  LYS A C     1 
ATOM   2205 O O     . LYS E 3 89  ? 28.823 -1.950  45.623  1.00 58.15  ? 89  LYS A O     1 
ATOM   2206 C CB    . LYS E 3 89  ? 27.262 -1.479  42.850  1.00 57.36  ? 89  LYS A CB    1 
ATOM   2207 C CG    . LYS E 3 89  ? 27.860 -0.969  41.543  1.00 58.94  ? 89  LYS A CG    1 
ATOM   2208 C CD    . LYS E 3 89  ? 27.526 0.521   41.324  1.00 61.10  ? 89  LYS A CD    1 
ATOM   2209 C CE    . LYS E 3 89  ? 26.019 0.817   41.471  1.00 61.04  ? 89  LYS A CE    1 
ATOM   2210 N NZ    . LYS E 3 89  ? 25.657 2.268   41.280  1.00 60.04  ? 89  LYS A NZ    1 
ATOM   2211 N N     . THR E 3 90  ? 26.847 -2.996  45.598  1.00 56.07  ? 90  THR A N     1 
ATOM   2212 C CA    . THR E 3 90  ? 26.639 -2.934  47.043  1.00 57.02  ? 90  THR A CA    1 
ATOM   2213 C C     . THR E 3 90  ? 26.066 -4.272  47.498  1.00 56.56  ? 90  THR A C     1 
ATOM   2214 O O     . THR E 3 90  ? 25.701 -5.108  46.669  1.00 57.37  ? 90  THR A O     1 
ATOM   2215 C CB    . THR E 3 90  ? 25.599 -1.867  47.410  1.00 57.42  ? 90  THR A CB    1 
ATOM   2216 O OG1   . THR E 3 90  ? 24.348 -2.189  46.779  1.00 56.42  ? 90  THR A OG1   1 
ATOM   2217 C CG2   . THR E 3 90  ? 26.056 -0.503  46.956  1.00 56.02  ? 90  THR A CG2   1 
ATOM   2218 N N     . ALA E 3 91  ? 25.978 -4.487  48.801  1.00 54.06  ? 91  ALA A N     1 
ATOM   2219 C CA    . ALA E 3 91  ? 25.387 -5.730  49.266  1.00 54.07  ? 91  ALA A CA    1 
ATOM   2220 C C     . ALA E 3 91  ? 24.017 -5.755  48.594  1.00 52.99  ? 91  ALA A C     1 
ATOM   2221 O O     . ALA E 3 91  ? 23.343 -4.738  48.551  1.00 54.15  ? 91  ALA A O     1 
ATOM   2222 C CB    . ALA E 3 91  ? 25.222 -5.710  50.779  1.00 55.15  ? 91  ALA A CB    1 
ATOM   2223 N N     . CYS E 3 92  ? 23.603 -6.895  48.058  1.00 51.20  ? 92  CYS A N     1 
ATOM   2224 C CA    . CYS E 3 92  ? 22.316 -6.963  47.394  1.00 48.47  ? 92  CYS A CA    1 
ATOM   2225 C C     . CYS E 3 92  ? 21.389 -8.009  47.946  1.00 47.25  ? 92  CYS A C     1 
ATOM   2226 O O     . CYS E 3 92  ? 21.805 -8.966  48.578  1.00 49.37  ? 92  CYS A O     1 
ATOM   2227 C CB    . CYS E 3 92  ? 22.508 -7.247  45.918  1.00 50.22  ? 92  CYS A CB    1 
ATOM   2228 S SG    . CYS E 3 92  ? 23.264 -5.914  45.055  1.00 52.30  ? 92  CYS A SG    1 
ATOM   2229 N N     . GLU E 3 93  ? 20.111 -7.807  47.711  1.00 44.43  ? 93  GLU A N     1 
ATOM   2230 C CA    . GLU E 3 93  ? 19.122 -8.761  48.130  1.00 44.77  ? 93  GLU A CA    1 
ATOM   2231 C C     . GLU E 3 93  ? 18.456 -9.043  46.782  1.00 44.81  ? 93  GLU A C     1 
ATOM   2232 O O     . GLU E 3 93  ? 17.820 -8.177  46.179  1.00 45.93  ? 93  GLU A O     1 
ATOM   2233 C CB    . GLU E 3 93  ? 18.159 -8.135  49.133  1.00 45.12  ? 93  GLU A CB    1 
ATOM   2234 C CG    . GLU E 3 93  ? 17.223 -9.151  49.740  1.00 49.06  ? 93  GLU A CG    1 
ATOM   2235 C CD    . GLU E 3 93  ? 16.379 -8.589  50.863  1.00 52.60  ? 93  GLU A CD    1 
ATOM   2236 O OE1   . GLU E 3 93  ? 16.934 -7.884  51.749  1.00 54.79  ? 93  GLU A OE1   1 
ATOM   2237 O OE2   . GLU E 3 93  ? 15.159 -8.869  50.863  1.00 53.34  ? 93  GLU A OE2   1 
ATOM   2238 N N     . VAL E 3 94  ? 18.621 -10.258 46.298  1.00 43.19  ? 94  VAL A N     1 
ATOM   2239 C CA    . VAL E 3 94  ? 18.109 -10.591 44.993  1.00 41.47  ? 94  VAL A CA    1 
ATOM   2240 C C     . VAL E 3 94  ? 17.113 -11.735 44.946  1.00 42.79  ? 94  VAL A C     1 
ATOM   2241 O O     . VAL E 3 94  ? 17.372 -12.826 45.449  1.00 42.49  ? 94  VAL A O     1 
ATOM   2242 C CB    . VAL E 3 94  ? 19.293 -10.897 44.080  1.00 39.45  ? 94  VAL A CB    1 
ATOM   2243 C CG1   . VAL E 3 94  ? 18.820 -11.204 42.684  1.00 38.85  ? 94  VAL A CG1   1 
ATOM   2244 C CG2   . VAL E 3 94  ? 20.257 -9.707  44.102  1.00 38.37  ? 94  VAL A CG2   1 
ATOM   2245 N N     . ALA E 3 95  ? 15.965 -11.462 44.336  1.00 43.53  ? 95  ALA A N     1 
ATOM   2246 C CA    . ALA E 3 95  ? 14.912 -12.445 44.169  1.00 44.38  ? 95  ALA A CA    1 
ATOM   2247 C C     . ALA E 3 95  ? 15.321 -13.251 42.939  1.00 46.22  ? 95  ALA A C     1 
ATOM   2248 O O     . ALA E 3 95  ? 15.824 -12.682 41.949  1.00 45.20  ? 95  ALA A O     1 
ATOM   2249 C CB    . ALA E 3 95  ? 13.583 -11.753 43.936  1.00 43.74  ? 95  ALA A CB    1 
ATOM   2250 N N     . GLU E 3 96  ? 15.122 -14.568 43.016  1.00 46.61  ? 96  GLU A N     1 
ATOM   2251 C CA    . GLU E 3 96  ? 15.486 -15.479 41.939  1.00 47.72  ? 96  GLU A CA    1 
ATOM   2252 C C     . GLU E 3 96  ? 14.382 -16.496 41.690  1.00 48.20  ? 96  GLU A C     1 
ATOM   2253 O O     . GLU E 3 96  ? 13.664 -16.897 42.609  1.00 48.67  ? 96  GLU A O     1 
ATOM   2254 C CB    . GLU E 3 96  ? 16.794 -16.202 42.283  1.00 49.31  ? 96  GLU A CB    1 
ATOM   2255 C CG    . GLU E 3 96  ? 18.047 -15.313 42.240  1.00 54.29  ? 96  GLU A CG    1 
ATOM   2256 C CD    . GLU E 3 96  ? 19.308 -15.978 42.830  1.00 57.48  ? 96  GLU A CD    1 
ATOM   2257 O OE1   . GLU E 3 96  ? 19.579 -17.165 42.516  1.00 56.90  ? 96  GLU A OE1   1 
ATOM   2258 O OE2   . GLU E 3 96  ? 20.036 -15.299 43.599  1.00 57.41  ? 96  GLU A OE2   1 
ATOM   2259 N N     . ILE E 3 97  ? 14.252 -16.902 40.434  1.00 48.55  ? 97  ILE A N     1 
ATOM   2260 C CA    . ILE E 3 97  ? 13.248 -17.867 40.014  1.00 48.24  ? 97  ILE A CA    1 
ATOM   2261 C C     . ILE E 3 97  ? 13.741 -18.469 38.703  1.00 48.15  ? 97  ILE A C     1 
ATOM   2262 O O     . ILE E 3 97  ? 14.536 -17.851 38.003  1.00 47.32  ? 97  ILE A O     1 
ATOM   2263 C CB    . ILE E 3 97  ? 11.872 -17.179 39.844  1.00 49.07  ? 97  ILE A CB    1 
ATOM   2264 C CG1   . ILE E 3 97  ? 10.934 -18.055 39.015  1.00 50.86  ? 97  ILE A CG1   1 
ATOM   2265 C CG2   . ILE E 3 97  ? 12.053 -15.814 39.229  1.00 50.21  ? 97  ILE A CG2   1 
ATOM   2266 C CD1   . ILE E 3 97  ? 9.490  -17.574 39.012  1.00 50.45  ? 97  ILE A CD1   1 
ATOM   2267 N N     . SER E 3 98  ? 13.314 -19.690 38.389  1.00 49.85  ? 98  SER A N     1 
ATOM   2268 C CA    . SER E 3 98  ? 13.767 -20.341 37.158  1.00 50.71  ? 98  SER A CA    1 
ATOM   2269 C C     . SER E 3 98  ? 12.952 -19.847 35.991  1.00 51.18  ? 98  SER A C     1 
ATOM   2270 O O     . SER E 3 98  ? 11.822 -19.389 36.162  1.00 50.91  ? 98  SER A O     1 
ATOM   2271 C CB    . SER E 3 98  ? 13.596 -21.852 37.237  1.00 49.40  ? 98  SER A CB    1 
ATOM   2272 O OG    . SER E 3 98  ? 12.315 -22.216 36.752  1.00 51.29  ? 98  SER A OG    1 
ATOM   2273 N N     . TYR E 3 99  ? 13.518 -19.944 34.801  1.00 52.21  ? 99  TYR A N     1 
ATOM   2274 C CA    . TYR E 3 99  ? 12.787 -19.513 33.631  1.00 56.17  ? 99  TYR A CA    1 
ATOM   2275 C C     . TYR E 3 99  ? 11.475 -20.280 33.535  1.00 60.00  ? 99  TYR A C     1 
ATOM   2276 O O     . TYR E 3 99  ? 10.401 -19.688 33.377  1.00 60.63  ? 99  TYR A O     1 
ATOM   2277 C CB    . TYR E 3 99  ? 13.607 -19.761 32.375  1.00 54.41  ? 99  TYR A CB    1 
ATOM   2278 C CG    . TYR E 3 99  ? 14.756 -18.811 32.195  1.00 54.36  ? 99  TYR A CG    1 
ATOM   2279 C CD1   . TYR E 3 99  ? 14.864 -17.654 32.967  1.00 55.04  ? 99  TYR A CD1   1 
ATOM   2280 C CD2   . TYR E 3 99  ? 15.691 -19.022 31.193  1.00 55.10  ? 99  TYR A CD2   1 
ATOM   2281 C CE1   . TYR E 3 99  ? 15.873 -16.731 32.730  1.00 55.55  ? 99  TYR A CE1   1 
ATOM   2282 C CE2   . TYR E 3 99  ? 16.700 -18.112 30.948  1.00 55.74  ? 99  TYR A CE2   1 
ATOM   2283 C CZ    . TYR E 3 99  ? 16.785 -16.968 31.711  1.00 56.04  ? 99  TYR A CZ    1 
ATOM   2284 O OH    . TYR E 3 99  ? 17.762 -16.049 31.417  1.00 57.42  ? 99  TYR A OH    1 
ATOM   2285 N N     . LYS E 3 100 ? 11.570 -21.601 33.647  1.00 64.21  ? 100 LYS A N     1 
ATOM   2286 C CA    . LYS E 3 100 ? 10.404 -22.464 33.549  1.00 67.71  ? 100 LYS A CA    1 
ATOM   2287 C C     . LYS E 3 100 ? 9.351  -22.061 34.564  1.00 68.58  ? 100 LYS A C     1 
ATOM   2288 O O     . LYS E 3 100 ? 8.174  -21.935 34.231  1.00 68.12  ? 100 LYS A O     1 
ATOM   2289 C CB    . LYS E 3 100 ? 10.816 -23.929 33.744  1.00 71.35  ? 100 LYS A CB    1 
ATOM   2290 C CG    . LYS E 3 100 ? 9.830  -24.932 33.134  1.00 75.94  ? 100 LYS A CG    1 
ATOM   2291 C CD    . LYS E 3 100 ? 10.542 -26.160 32.539  1.00 77.22  ? 100 LYS A CD    1 
ATOM   2292 C CE    . LYS E 3 100 ? 9.557  -27.108 31.810  1.00 78.77  ? 100 LYS A CE    1 
ATOM   2293 N NZ    . LYS E 3 100 ? 8.923  -26.547 30.566  1.00 77.63  ? 100 LYS A NZ    1 
ATOM   2294 N N     . LYS E 3 101 ? 9.784  -21.845 35.800  1.00 70.26  ? 101 LYS A N     1 
ATOM   2295 C CA    . LYS E 3 101 ? 8.881  -21.438 36.868  1.00 72.82  ? 101 LYS A CA    1 
ATOM   2296 C C     . LYS E 3 101 ? 8.334  -20.026 36.601  1.00 72.95  ? 101 LYS A C     1 
ATOM   2297 O O     . LYS E 3 101 ? 7.348  -19.609 37.220  1.00 73.64  ? 101 LYS A O     1 
ATOM   2298 C CB    . LYS E 3 101 ? 9.631  -21.481 38.211  1.00 75.95  ? 101 LYS A CB    1 
ATOM   2299 C CG    . LYS E 3 101 ? 8.865  -20.957 39.439  1.00 79.27  ? 101 LYS A CG    1 
ATOM   2300 C CD    . LYS E 3 101 ? 7.698  -21.854 39.834  1.00 82.84  ? 101 LYS A CD    1 
ATOM   2301 C CE    . LYS E 3 101 ? 7.006  -21.346 41.105  1.00 85.59  ? 101 LYS A CE    1 
ATOM   2302 N NZ    . LYS E 3 101 ? 7.888  -21.326 42.318  1.00 85.57  ? 101 LYS A NZ    1 
ATOM   2303 N N     . PHE E 3 102 ? 8.969  -19.302 35.673  1.00 72.18  ? 102 PHE A N     1 
ATOM   2304 C CA    . PHE E 3 102 ? 8.563  -17.932 35.322  1.00 70.66  ? 102 PHE A CA    1 
ATOM   2305 C C     . PHE E 3 102 ? 7.558  -17.885 34.174  1.00 71.42  ? 102 PHE A C     1 
ATOM   2306 O O     . PHE E 3 102 ? 6.619  -17.081 34.195  1.00 71.44  ? 102 PHE A O     1 
ATOM   2307 C CB    . PHE E 3 102 ? 9.791  -17.098 34.949  1.00 67.55  ? 102 PHE A CB    1 
ATOM   2308 C CG    . PHE E 3 102 ? 9.504  -15.628 34.742  1.00 62.44  ? 102 PHE A CG    1 
ATOM   2309 C CD1   . PHE E 3 102 ? 9.203  -14.804 35.821  1.00 59.32  ? 102 PHE A CD1   1 
ATOM   2310 C CD2   . PHE E 3 102 ? 9.578  -15.064 33.467  1.00 57.90  ? 102 PHE A CD2   1 
ATOM   2311 C CE1   . PHE E 3 102 ? 8.984  -13.442 35.631  1.00 56.94  ? 102 PHE A CE1   1 
ATOM   2312 C CE2   . PHE E 3 102 ? 9.361  -13.717 33.274  1.00 54.37  ? 102 PHE A CE2   1 
ATOM   2313 C CZ    . PHE E 3 102 ? 9.064  -12.900 34.352  1.00 55.51  ? 102 PHE A CZ    1 
ATOM   2314 N N     . ARG E 3 103 ? 7.762  -18.727 33.164  1.00 72.11  ? 103 ARG A N     1 
ATOM   2315 C CA    . ARG E 3 103 ? 6.839  -18.763 32.042  1.00 73.47  ? 103 ARG A CA    1 
ATOM   2316 C C     . ARG E 3 103 ? 5.482  -19.263 32.559  1.00 75.35  ? 103 ARG A C     1 
ATOM   2317 O O     . ARG E 3 103 ? 4.430  -18.989 31.967  1.00 75.28  ? 103 ARG A O     1 
ATOM   2318 C CB    . ARG E 3 103 ? 7.371  -19.674 30.937  1.00 72.19  ? 103 ARG A CB    1 
ATOM   2319 C CG    . ARG E 3 103 ? 8.766  -19.316 30.457  1.00 72.32  ? 103 ARG A CG    1 
ATOM   2320 C CD    . ARG E 3 103 ? 8.986  -19.798 29.032  1.00 73.29  ? 103 ARG A CD    1 
ATOM   2321 N NE    . ARG E 3 103 ? 10.388 -19.811 28.619  1.00 73.61  ? 103 ARG A NE    1 
ATOM   2322 C CZ    . ARG E 3 103 ? 11.335 -20.547 29.199  1.00 76.37  ? 103 ARG A CZ    1 
ATOM   2323 N NH1   . ARG E 3 103 ? 11.035 -21.331 30.230  1.00 77.04  ? 103 ARG A NH1   1 
ATOM   2324 N NH2   . ARG E 3 103 ? 12.582 -20.518 28.739  1.00 76.49  ? 103 ARG A NH2   1 
ATOM   2325 N N     . GLN E 3 104 ? 5.513  -19.995 33.670  1.00 76.55  ? 104 GLN A N     1 
ATOM   2326 C CA    . GLN E 3 104 ? 4.287  -20.487 34.287  1.00 78.56  ? 104 GLN A CA    1 
ATOM   2327 C C     . GLN E 3 104 ? 3.512  -19.265 34.739  1.00 79.39  ? 104 GLN A C     1 
ATOM   2328 O O     . GLN E 3 104 ? 2.287  -19.217 34.655  1.00 79.66  ? 104 GLN A O     1 
ATOM   2329 C CB    . GLN E 3 104 ? 4.586  -21.319 35.528  1.00 79.15  ? 104 GLN A CB    1 
ATOM   2330 C CG    . GLN E 3 104 ? 4.803  -22.794 35.311  1.00 80.36  ? 104 GLN A CG    1 
ATOM   2331 C CD    . GLN E 3 104 ? 5.098  -23.498 36.626  1.00 82.13  ? 104 GLN A CD    1 
ATOM   2332 O OE1   . GLN E 3 104 ? 4.356  -23.339 37.606  1.00 82.34  ? 104 GLN A OE1   1 
ATOM   2333 N NE2   . GLN E 3 104 ? 6.186  -24.274 36.660  1.00 81.59  ? 104 GLN A NE2   1 
ATOM   2334 N N     . LEU E 3 105 ? 4.246  -18.278 35.236  1.00 80.06  ? 105 LEU A N     1 
ATOM   2335 C CA    . LEU E 3 105 ? 3.641  -17.053 35.721  1.00 80.44  ? 105 LEU A CA    1 
ATOM   2336 C C     . LEU E 3 105 ? 3.128  -16.153 34.608  1.00 80.06  ? 105 LEU A C     1 
ATOM   2337 O O     . LEU E 3 105 ? 2.088  -15.517 34.756  1.00 79.74  ? 105 LEU A O     1 
ATOM   2338 C CB    . LEU E 3 105 ? 4.642  -16.300 36.585  1.00 81.64  ? 105 LEU A CB    1 
ATOM   2339 C CG    . LEU E 3 105 ? 5.214  -17.170 37.702  1.00 82.54  ? 105 LEU A CG    1 
ATOM   2340 C CD1   . LEU E 3 105 ? 6.068  -16.315 38.611  1.00 83.99  ? 105 LEU A CD1   1 
ATOM   2341 C CD2   . LEU E 3 105 ? 4.084  -17.815 38.490  1.00 83.95  ? 105 LEU A CD2   1 
ATOM   2342 N N     . ILE E 3 106 ? 3.841  -16.084 33.491  1.00 79.98  ? 106 ILE A N     1 
ATOM   2343 C CA    . ILE E 3 106 ? 3.355  -15.233 32.418  1.00 81.54  ? 106 ILE A CA    1 
ATOM   2344 C C     . ILE E 3 106 ? 1.973  -15.713 32.008  1.00 82.28  ? 106 ILE A C     1 
ATOM   2345 O O     . ILE E 3 106 ? 1.046  -14.913 31.827  1.00 82.26  ? 106 ILE A O     1 
ATOM   2346 C CB    . ILE E 3 106 ? 4.262  -15.264 31.176  1.00 81.27  ? 106 ILE A CB    1 
ATOM   2347 C CG1   . ILE E 3 106 ? 5.664  -14.758 31.523  1.00 80.94  ? 106 ILE A CG1   1 
ATOM   2348 C CG2   . ILE E 3 106 ? 3.670  -14.368 30.101  1.00 81.13  ? 106 ILE A CG2   1 
ATOM   2349 C CD1   . ILE E 3 106 ? 6.546  -14.545 30.304  1.00 80.08  ? 106 ILE A CD1   1 
ATOM   2350 N N     . GLN E 3 107 ? 1.847  -17.033 31.881  1.00 82.94  ? 107 GLN A N     1 
ATOM   2351 C CA    . GLN E 3 107 ? 0.595  -17.675 31.488  1.00 82.65  ? 107 GLN A CA    1 
ATOM   2352 C C     . GLN E 3 107 ? -0.516 -17.544 32.523  1.00 80.98  ? 107 GLN A C     1 
ATOM   2353 O O     . GLN E 3 107 ? -1.553 -18.178 32.377  1.00 81.59  ? 107 GLN A O     1 
ATOM   2354 C CB    . GLN E 3 107 ? 0.815  -19.163 31.223  1.00 84.48  ? 107 GLN A CB    1 
ATOM   2355 C CG    . GLN E 3 107 ? 2.001  -19.496 30.341  1.00 88.28  ? 107 GLN A CG    1 
ATOM   2356 C CD    . GLN E 3 107 ? 2.136  -20.998 30.124  1.00 91.49  ? 107 GLN A CD    1 
ATOM   2357 O OE1   . GLN E 3 107 ? 1.232  -21.638 29.580  1.00 93.19  ? 107 GLN A OE1   1 
ATOM   2358 N NE2   . GLN E 3 107 ? 3.263  -21.571 30.555  1.00 92.09  ? 107 GLN A NE2   1 
ATOM   2359 N N     . VAL E 3 108 ? -0.301 -16.759 33.574  1.00 79.17  ? 108 VAL A N     1 
ATOM   2360 C CA    . VAL E 3 108 ? -1.329 -16.577 34.594  1.00 77.82  ? 108 VAL A CA    1 
ATOM   2361 C C     . VAL E 3 108 ? -1.333 -15.153 35.128  1.00 77.32  ? 108 VAL A C     1 
ATOM   2362 O O     . VAL E 3 108 ? -1.782 -14.902 36.245  1.00 77.55  ? 108 VAL A O     1 
ATOM   2363 C CB    . VAL E 3 108 ? -1.163 -17.564 35.770  1.00 78.00  ? 108 VAL A CB    1 
ATOM   2364 C CG1   . VAL E 3 108 ? -1.391 -19.000 35.292  1.00 78.15  ? 108 VAL A CG1   1 
ATOM   2365 C CG2   . VAL E 3 108 ? 0.220  -17.422 36.370  1.00 80.72  ? 108 VAL A CG2   1 
ATOM   2366 N N     . ASN E 3 109 ? -0.786 -14.250 34.313  1.00 75.84  ? 109 ASN A N     1 
ATOM   2367 C CA    . ASN E 3 109 ? -0.714 -12.763 34.520  1.00 74.48  ? 109 ASN A CA    1 
ATOM   2368 C C     . ASN E 3 109 ? 0.493  -12.219 33.774  1.00 73.88  ? 109 ASN A C     1 
ATOM   2369 O O     . ASN E 3 109 ? 1.444  -11.773 34.501  1.00 73.14  ? 109 ASN A O     1 
ATOM   2370 C CB    . ASN E 3 109 ? -0.588 -12.446 36.013  1.00 75.28  ? 109 ASN A CB    1 
ATOM   2371 C CG    . ASN E 3 109 ? -0.809 -10.968 36.245  1.00 76.53  ? 109 ASN A CG    1 
ATOM   2372 O OD1   . ASN E 3 109 ? -0.814 -10.119 35.260  1.00 77.15  ? 109 ASN A OD1   1 
ATOM   2373 N ND2   . ASN E 3 109 ? -1.175 -10.597 37.395  1.00 75.74  ? 109 ASN A ND2   1 
ATOM   2374 N N     . PRO E 3 110 ? 0.416  -12.098 32.445  1.00 73.44  ? 110 PRO A N     1 
ATOM   2375 C CA    . PRO E 3 110 ? 1.453  -11.600 31.552  1.00 72.08  ? 110 PRO A CA    1 
ATOM   2376 C C     . PRO E 3 110 ? 1.806  -10.166 31.879  1.00 70.97  ? 110 PRO A C     1 
ATOM   2377 O O     . PRO E 3 110 ? 2.625  -9.562  31.204  1.00 71.48  ? 110 PRO A O     1 
ATOM   2378 C CB    . PRO E 3 110 ? 0.802  -11.722 30.187  1.00 72.32  ? 110 PRO A CB    1 
ATOM   2379 C CG    . PRO E 3 110 ? -0.596 -11.344 30.495  1.00 73.34  ? 110 PRO A CG    1 
ATOM   2380 C CD    . PRO E 3 110 ? -0.868 -12.173 31.729  1.00 73.55  ? 110 PRO A CD    1 
ATOM   2381 N N     . ASP E 3 111 ? 1.172  -9.598  32.894  1.00 70.72  ? 111 ASP A N     1 
ATOM   2382 C CA    . ASP E 3 111 ? 1.505  -8.226  33.243  1.00 69.73  ? 111 ASP A CA    1 
ATOM   2383 C C     . ASP E 3 111 ? 2.928  -8.267  33.769  1.00 67.90  ? 111 ASP A C     1 
ATOM   2384 O O     . ASP E 3 111 ? 3.726  -7.346  33.550  1.00 67.09  ? 111 ASP A O     1 
ATOM   2385 C CB    . ASP E 3 111 ? 0.574  -7.680  34.321  1.00 71.77  ? 111 ASP A CB    1 
ATOM   2386 C CG    . ASP E 3 111 ? 1.035  -6.331  34.853  1.00 74.37  ? 111 ASP A CG    1 
ATOM   2387 O OD1   . ASP E 3 111 ? 1.195  -5.393  34.040  1.00 76.68  ? 111 ASP A OD1   1 
ATOM   2388 O OD2   . ASP E 3 111 ? 1.240  -6.205  36.080  1.00 74.77  ? 111 ASP A OD2   1 
ATOM   2389 N N     . ILE E 3 112 ? 3.240  -9.359  34.460  1.00 65.26  ? 112 ILE A N     1 
ATOM   2390 C CA    . ILE E 3 112 ? 4.565  -9.537  35.016  1.00 61.35  ? 112 ILE A CA    1 
ATOM   2391 C C     . ILE E 3 112 ? 5.553  -9.478  33.863  1.00 60.02  ? 112 ILE A C     1 
ATOM   2392 O O     . ILE E 3 112 ? 6.714  -9.126  34.048  1.00 60.65  ? 112 ILE A O     1 
ATOM   2393 C CB    . ILE E 3 112 ? 4.686  -10.888 35.721  1.00 60.62  ? 112 ILE A CB    1 
ATOM   2394 C CG1   . ILE E 3 112 ? 5.997  -10.941 36.498  1.00 60.95  ? 112 ILE A CG1   1 
ATOM   2395 C CG2   . ILE E 3 112 ? 4.638  -12.017 34.705  1.00 59.23  ? 112 ILE A CG2   1 
ATOM   2396 C CD1   . ILE E 3 112 ? 6.073  -9.933  37.625  1.00 61.62  ? 112 ILE A CD1   1 
ATOM   2397 N N     . LEU E 3 113 ? 5.071  -9.809  32.667  1.00 57.70  ? 113 LEU A N     1 
ATOM   2398 C CA    . LEU E 3 113 ? 5.893  -9.809  31.456  1.00 55.98  ? 113 LEU A CA    1 
ATOM   2399 C C     . LEU E 3 113 ? 6.072  -8.391  30.901  1.00 56.14  ? 113 LEU A C     1 
ATOM   2400 O O     . LEU E 3 113 ? 7.173  -7.993  30.509  1.00 55.43  ? 113 LEU A O     1 
ATOM   2401 C CB    . LEU E 3 113 ? 5.236  -10.684 30.392  1.00 52.36  ? 113 LEU A CB    1 
ATOM   2402 C CG    . LEU E 3 113 ? 6.108  -11.248 29.277  1.00 52.13  ? 113 LEU A CG    1 
ATOM   2403 C CD1   . LEU E 3 113 ? 5.192  -11.795 28.202  1.00 51.28  ? 113 LEU A CD1   1 
ATOM   2404 C CD2   . LEU E 3 113 ? 7.033  -10.201 28.705  1.00 48.54  ? 113 LEU A CD2   1 
ATOM   2405 N N     . MET E 3 114 ? 4.976  -7.640  30.865  1.00 56.68  ? 114 MET A N     1 
ATOM   2406 C CA    . MET E 3 114 ? 4.989  -6.273  30.368  1.00 56.76  ? 114 MET A CA    1 
ATOM   2407 C C     . MET E 3 114 ? 6.018  -5.493  31.169  1.00 56.66  ? 114 MET A C     1 
ATOM   2408 O O     . MET E 3 114 ? 6.795  -4.713  30.619  1.00 56.74  ? 114 MET A O     1 
ATOM   2409 C CB    . MET E 3 114 ? 3.611  -5.634  30.558  1.00 58.99  ? 114 MET A CB    1 
ATOM   2410 C CG    . MET E 3 114 ? 3.332  -4.404  29.696  1.00 59.70  ? 114 MET A CG    1 
ATOM   2411 S SD    . MET E 3 114 ? 2.658  -4.900  28.098  1.00 64.17  ? 114 MET A SD    1 
ATOM   2412 C CE    . MET E 3 114 ? 1.191  -5.869  28.664  1.00 59.65  ? 114 MET A CE    1 
ATOM   2413 N N     . ARG E 3 115 ? 6.021  -5.710  32.478  1.00 56.28  ? 115 ARG A N     1 
ATOM   2414 C CA    . ARG E 3 115 ? 6.957  -5.015  33.347  1.00 56.44  ? 115 ARG A CA    1 
ATOM   2415 C C     . ARG E 3 115 ? 8.404  -5.316  32.969  1.00 54.43  ? 115 ARG A C     1 
ATOM   2416 O O     . ARG E 3 115 ? 9.240  -4.423  32.919  1.00 54.69  ? 115 ARG A O     1 
ATOM   2417 C CB    . ARG E 3 115 ? 6.705  -5.398  34.804  1.00 58.27  ? 115 ARG A CB    1 
ATOM   2418 C CG    . ARG E 3 115 ? 7.395  -4.475  35.798  1.00 61.99  ? 115 ARG A CG    1 
ATOM   2419 C CD    . ARG E 3 115 ? 6.516  -4.305  37.023  1.00 67.20  ? 115 ARG A CD    1 
ATOM   2420 N NE    . ARG E 3 115 ? 5.101  -4.338  36.644  1.00 70.37  ? 115 ARG A NE    1 
ATOM   2421 C CZ    . ARG E 3 115 ? 4.092  -4.190  37.496  1.00 72.39  ? 115 ARG A CZ    1 
ATOM   2422 N NH1   . ARG E 3 115 ? 4.337  -3.989  38.787  1.00 73.41  ? 115 ARG A NH1   1 
ATOM   2423 N NH2   . ARG E 3 115 ? 2.839  -4.258  37.061  1.00 71.81  ? 115 ARG A NH2   1 
ATOM   2424 N N     . LEU E 3 116 ? 8.695  -6.579  32.703  1.00 53.56  ? 116 LEU A N     1 
ATOM   2425 C CA    . LEU E 3 116 ? 10.040 -6.984  32.322  1.00 53.15  ? 116 LEU A CA    1 
ATOM   2426 C C     . LEU E 3 116 ? 10.340 -6.365  30.963  1.00 52.69  ? 116 LEU A C     1 
ATOM   2427 O O     . LEU E 3 116 ? 11.384 -5.732  30.759  1.00 50.75  ? 116 LEU A O     1 
ATOM   2428 C CB    . LEU E 3 116 ? 10.103 -8.517  32.242  1.00 55.27  ? 116 LEU A CB    1 
ATOM   2429 C CG    . LEU E 3 116 ? 11.342 -9.309  31.802  1.00 55.38  ? 116 LEU A CG    1 
ATOM   2430 C CD1   . LEU E 3 116 ? 11.653 -9.063  30.329  1.00 56.40  ? 116 LEU A CD1   1 
ATOM   2431 C CD2   . LEU E 3 116 ? 12.511 -8.919  32.673  1.00 57.04  ? 116 LEU A CD2   1 
ATOM   2432 N N     . SER E 3 117 ? 9.409  -6.545  30.031  1.00 51.78  ? 117 SER A N     1 
ATOM   2433 C CA    . SER E 3 117 ? 9.585  -6.008  28.695  1.00 51.80  ? 117 SER A CA    1 
ATOM   2434 C C     . SER E 3 117 ? 9.855  -4.501  28.688  1.00 52.06  ? 117 SER A C     1 
ATOM   2435 O O     . SER E 3 117 ? 10.768 -4.035  28.001  1.00 54.31  ? 117 SER A O     1 
ATOM   2436 C CB    . SER E 3 117 ? 8.371  -6.335  27.844  1.00 49.97  ? 117 SER A CB    1 
ATOM   2437 O OG    . SER E 3 117 ? 8.285  -7.730  27.668  1.00 48.05  ? 117 SER A OG    1 
ATOM   2438 N N     . ALA E 3 118 ? 9.078  -3.741  29.450  1.00 49.45  ? 118 ALA A N     1 
ATOM   2439 C CA    . ALA E 3 118 ? 9.285  -2.306  29.502  1.00 47.99  ? 118 ALA A CA    1 
ATOM   2440 C C     . ALA E 3 118 ? 10.759 -2.064  29.797  1.00 48.16  ? 118 ALA A C     1 
ATOM   2441 O O     . ALA E 3 118 ? 11.440 -1.264  29.132  1.00 48.21  ? 118 ALA A O     1 
ATOM   2442 C CB    . ALA E 3 118 ? 8.432  -1.705  30.591  1.00 47.35  ? 118 ALA A CB    1 
ATOM   2443 N N     . GLN E 3 119 ? 11.255 -2.781  30.795  1.00 47.09  ? 119 GLN A N     1 
ATOM   2444 C CA    . GLN E 3 119 ? 12.642 -2.648  31.190  1.00 46.00  ? 119 GLN A CA    1 
ATOM   2445 C C     . GLN E 3 119 ? 13.609 -2.994  30.074  1.00 44.36  ? 119 GLN A C     1 
ATOM   2446 O O     . GLN E 3 119 ? 14.736 -2.507  30.050  1.00 43.29  ? 119 GLN A O     1 
ATOM   2447 C CB    . GLN E 3 119 ? 12.924 -3.498  32.426  1.00 45.47  ? 119 GLN A CB    1 
ATOM   2448 C CG    . GLN E 3 119 ? 12.597 -2.778  33.703  1.00 46.99  ? 119 GLN A CG    1 
ATOM   2449 C CD    . GLN E 3 119 ? 12.962 -3.579  34.915  1.00 49.68  ? 119 GLN A CD    1 
ATOM   2450 O OE1   . GLN E 3 119 ? 13.933 -4.327  34.894  1.00 53.93  ? 119 GLN A OE1   1 
ATOM   2451 N NE2   . GLN E 3 119 ? 12.203 -3.416  35.994  1.00 49.58  ? 119 GLN A NE2   1 
ATOM   2452 N N     . MET E 3 120 ? 13.188 -3.840  29.148  1.00 43.22  ? 120 MET A N     1 
ATOM   2453 C CA    . MET E 3 120 ? 14.083 -4.156  28.057  1.00 43.03  ? 120 MET A CA    1 
ATOM   2454 C C     . MET E 3 120 ? 14.056 -2.965  27.122  1.00 42.01  ? 120 MET A C     1 
ATOM   2455 O O     . MET E 3 120 ? 15.097 -2.431  26.747  1.00 40.90  ? 120 MET A O     1 
ATOM   2456 C CB    . MET E 3 120 ? 13.626 -5.407  27.333  1.00 45.35  ? 120 MET A CB    1 
ATOM   2457 C CG    . MET E 3 120 ? 13.711 -6.649  28.192  1.00 49.84  ? 120 MET A CG    1 
ATOM   2458 S SD    . MET E 3 120 ? 13.898 -8.121  27.196  1.00 52.83  ? 120 MET A SD    1 
ATOM   2459 C CE    . MET E 3 120 ? 12.194 -8.602  27.031  1.00 52.97  ? 120 MET A CE    1 
ATOM   2460 N N     . ALA E 3 121 ? 12.852 -2.534  26.772  1.00 41.13  ? 121 ALA A N     1 
ATOM   2461 C CA    . ALA E 3 121 ? 12.687 -1.399  25.886  1.00 41.97  ? 121 ALA A CA    1 
ATOM   2462 C C     . ALA E 3 121 ? 13.609 -0.257  26.313  1.00 43.35  ? 121 ALA A C     1 
ATOM   2463 O O     . ALA E 3 121 ? 14.240 0.417   25.480  1.00 41.55  ? 121 ALA A O     1 
ATOM   2464 C CB    . ALA E 3 121 ? 11.236 -0.944  25.896  1.00 41.26  ? 121 ALA A CB    1 
ATOM   2465 N N     . ARG E 3 122 ? 13.692 -0.047  27.622  1.00 44.15  ? 122 ARG A N     1 
ATOM   2466 C CA    . ARG E 3 122 ? 14.532 1.010   28.144  1.00 44.46  ? 122 ARG A CA    1 
ATOM   2467 C C     . ARG E 3 122 ? 16.014 0.698   27.903  1.00 43.84  ? 122 ARG A C     1 
ATOM   2468 O O     . ARG E 3 122 ? 16.754 1.512   27.350  1.00 43.41  ? 122 ARG A O     1 
ATOM   2469 C CB    . ARG E 3 122 ? 14.240 1.182   29.633  1.00 47.62  ? 122 ARG A CB    1 
ATOM   2470 C CG    . ARG E 3 122 ? 15.164 2.140   30.353  1.00 52.70  ? 122 ARG A CG    1 
ATOM   2471 C CD    . ARG E 3 122 ? 15.157 3.481   29.688  1.00 55.73  ? 122 ARG A CD    1 
ATOM   2472 N NE    . ARG E 3 122 ? 13.790 3.930   29.480  1.00 63.49  ? 122 ARG A NE    1 
ATOM   2473 C CZ    . ARG E 3 122 ? 13.467 5.107   28.956  1.00 66.72  ? 122 ARG A CZ    1 
ATOM   2474 N NH1   . ARG E 3 122 ? 14.429 5.957   28.586  1.00 65.50  ? 122 ARG A NH1   1 
ATOM   2475 N NH2   . ARG E 3 122 ? 12.183 5.431   28.803  1.00 66.97  ? 122 ARG A NH2   1 
ATOM   2476 N N     . ARG E 3 123 ? 16.446 -0.490  28.308  1.00 43.32  ? 123 ARG A N     1 
ATOM   2477 C CA    . ARG E 3 123 ? 17.840 -0.879  28.144  1.00 42.36  ? 123 ARG A CA    1 
ATOM   2478 C C     . ARG E 3 123 ? 18.313 -0.781  26.710  1.00 41.93  ? 123 ARG A C     1 
ATOM   2479 O O     . ARG E 3 123 ? 19.467 -0.422  26.445  1.00 40.77  ? 123 ARG A O     1 
ATOM   2480 C CB    . ARG E 3 123 ? 18.042 -2.290  28.677  1.00 41.52  ? 123 ARG A CB    1 
ATOM   2481 C CG    . ARG E 3 123 ? 18.008 -2.283  30.169  1.00 44.40  ? 123 ARG A CG    1 
ATOM   2482 C CD    . ARG E 3 123 ? 17.765 -3.628  30.761  1.00 47.44  ? 123 ARG A CD    1 
ATOM   2483 N NE    . ARG E 3 123 ? 17.408 -3.495  32.169  1.00 47.15  ? 123 ARG A NE    1 
ATOM   2484 C CZ    . ARG E 3 123 ? 17.295 -4.521  32.999  1.00 46.68  ? 123 ARG A CZ    1 
ATOM   2485 N NH1   . ARG E 3 123 ? 17.513 -5.753  32.558  1.00 43.82  ? 123 ARG A NH1   1 
ATOM   2486 N NH2   . ARG E 3 123 ? 16.972 -4.308  34.265  1.00 47.61  ? 123 ARG A NH2   1 
ATOM   2487 N N     . LEU E 3 124 ? 17.412 -1.088  25.785  1.00 40.67  ? 124 LEU A N     1 
ATOM   2488 C CA    . LEU E 3 124 ? 17.758 -1.036  24.392  1.00 40.14  ? 124 LEU A CA    1 
ATOM   2489 C C     . LEU E 3 124 ? 18.011 0.411   24.022  1.00 40.42  ? 124 LEU A C     1 
ATOM   2490 O O     . LEU E 3 124 ? 19.068 0.726   23.473  1.00 39.13  ? 124 LEU A O     1 
ATOM   2491 C CB    . LEU E 3 124 ? 16.641 -1.645  23.543  1.00 40.20  ? 124 LEU A CB    1 
ATOM   2492 C CG    . LEU E 3 124 ? 16.989 -1.918  22.077  1.00 41.27  ? 124 LEU A CG    1 
ATOM   2493 C CD1   . LEU E 3 124 ? 18.472 -2.243  21.946  1.00 42.85  ? 124 LEU A CD1   1 
ATOM   2494 C CD2   . LEU E 3 124 ? 16.158 -3.071  21.558  1.00 39.91  ? 124 LEU A CD2   1 
ATOM   2495 N N     . GLN E 3 125 ? 17.054 1.290   24.341  1.00 41.78  ? 125 GLN A N     1 
ATOM   2496 C CA    . GLN E 3 125 ? 17.182 2.727   24.031  1.00 42.55  ? 125 GLN A CA    1 
ATOM   2497 C C     . GLN E 3 125 ? 18.506 3.193   24.584  1.00 40.92  ? 125 GLN A C     1 
ATOM   2498 O O     . GLN E 3 125 ? 19.386 3.678   23.860  1.00 41.10  ? 125 GLN A O     1 
ATOM   2499 C CB    . GLN E 3 125 ? 16.064 3.565   24.689  1.00 44.92  ? 125 GLN A CB    1 
ATOM   2500 C CG    . GLN E 3 125 ? 14.696 3.539   23.983  1.00 52.83  ? 125 GLN A CG    1 
ATOM   2501 C CD    . GLN E 3 125 ? 13.544 4.067   24.871  1.00 57.23  ? 125 GLN A CD    1 
ATOM   2502 O OE1   . GLN E 3 125 ? 12.412 4.268   24.403  1.00 59.01  ? 125 GLN A OE1   1 
ATOM   2503 N NE2   . GLN E 3 125 ? 13.835 4.283   26.154  1.00 56.91  ? 125 GLN A NE2   1 
ATOM   2504 N N     . VAL E 3 126 ? 18.644 3.017   25.886  1.00 38.90  ? 126 VAL A N     1 
ATOM   2505 C CA    . VAL E 3 126 ? 19.843 3.436   26.561  1.00 36.65  ? 126 VAL A CA    1 
ATOM   2506 C C     . VAL E 3 126 ? 21.101 2.872   25.924  1.00 37.99  ? 126 VAL A C     1 
ATOM   2507 O O     . VAL E 3 126 ? 22.031 3.624   25.625  1.00 40.33  ? 126 VAL A O     1 
ATOM   2508 C CB    . VAL E 3 126 ? 19.783 3.052   28.050  1.00 33.22  ? 126 VAL A CB    1 
ATOM   2509 C CG1   . VAL E 3 126 ? 21.041 3.530   28.771  1.00 25.80  ? 126 VAL A CG1   1 
ATOM   2510 C CG2   . VAL E 3 126 ? 18.535 3.658   28.676  1.00 25.80  ? 126 VAL A CG2   1 
ATOM   2511 N N     . THR E 3 127 ? 21.140 1.565   25.678  1.00 38.53  ? 127 THR A N     1 
ATOM   2512 C CA    . THR E 3 127 ? 22.352 1.001   25.109  1.00 37.97  ? 127 THR A CA    1 
ATOM   2513 C C     . THR E 3 127 ? 22.625 1.503   23.723  1.00 38.34  ? 127 THR A C     1 
ATOM   2514 O O     . THR E 3 127 ? 23.780 1.637   23.330  1.00 37.32  ? 127 THR A O     1 
ATOM   2515 C CB    . THR E 3 127 ? 22.333 -0.510  25.136  1.00 36.98  ? 127 THR A CB    1 
ATOM   2516 O OG1   . THR E 3 127 ? 22.353 -0.933  26.505  1.00 38.39  ? 127 THR A OG1   1 
ATOM   2517 C CG2   . THR E 3 127 ? 23.571 -1.072  24.450  1.00 36.30  ? 127 THR A CG2   1 
ATOM   2518 N N     . SER E 3 128 ? 21.566 1.804   22.983  1.00 39.88  ? 128 SER A N     1 
ATOM   2519 C CA    . SER E 3 128 ? 21.745 2.333   21.646  1.00 41.41  ? 128 SER A CA    1 
ATOM   2520 C C     . SER E 3 128 ? 22.374 3.713   21.824  1.00 43.73  ? 128 SER A C     1 
ATOM   2521 O O     . SER E 3 128 ? 23.301 4.095   21.093  1.00 44.11  ? 128 SER A O     1 
ATOM   2522 C CB    . SER E 3 128 ? 20.406 2.436   20.928  1.00 40.27  ? 128 SER A CB    1 
ATOM   2523 O OG    . SER E 3 128 ? 19.792 1.162   20.811  1.00 40.37  ? 128 SER A OG    1 
ATOM   2524 N N     . GLU E 3 129 ? 21.892 4.447   22.823  1.00 44.57  ? 129 GLU A N     1 
ATOM   2525 C CA    . GLU E 3 129 ? 22.426 5.769   23.098  1.00 46.88  ? 129 GLU A CA    1 
ATOM   2526 C C     . GLU E 3 129 ? 23.946 5.675   23.236  1.00 48.05  ? 129 GLU A C     1 
ATOM   2527 O O     . GLU E 3 129 ? 24.679 6.454   22.632  1.00 47.43  ? 129 GLU A O     1 
ATOM   2528 C CB    . GLU E 3 129 ? 21.833 6.317   24.386  1.00 50.09  ? 129 GLU A CB    1 
ATOM   2529 C CG    . GLU E 3 129 ? 21.364 7.750   24.292  1.00 59.49  ? 129 GLU A CG    1 
ATOM   2530 C CD    . GLU E 3 129 ? 21.136 8.383   25.665  1.00 66.44  ? 129 GLU A CD    1 
ATOM   2531 O OE1   . GLU E 3 129 ? 20.438 7.758   26.509  1.00 70.00  ? 129 GLU A OE1   1 
ATOM   2532 O OE2   . GLU E 3 129 ? 21.655 9.509   25.895  1.00 68.96  ? 129 GLU A OE2   1 
ATOM   2533 N N     . LYS E 3 130 ? 24.425 4.713   24.025  1.00 49.11  ? 130 LYS A N     1 
ATOM   2534 C CA    . LYS E 3 130 ? 25.868 4.560   24.222  1.00 47.92  ? 130 LYS A CA    1 
ATOM   2535 C C     . LYS E 3 130 ? 26.571 4.341   22.897  1.00 45.53  ? 130 LYS A C     1 
ATOM   2536 O O     . LYS E 3 130 ? 27.662 4.865   22.686  1.00 46.94  ? 130 LYS A O     1 
ATOM   2537 C CB    . LYS E 3 130 ? 26.192 3.388   25.174  1.00 50.20  ? 130 LYS A CB    1 
ATOM   2538 C CG    . LYS E 3 130 ? 26.335 3.763   26.663  1.00 54.51  ? 130 LYS A CG    1 
ATOM   2539 C CD    . LYS E 3 130 ? 25.449 2.863   27.566  1.00 56.68  ? 130 LYS A CD    1 
ATOM   2540 C CE    . LYS E 3 130 ? 25.513 3.225   29.059  1.00 56.57  ? 130 LYS A CE    1 
ATOM   2541 N NZ    . LYS E 3 130 ? 26.785 2.809   29.718  1.00 59.72  ? 130 LYS A NZ    1 
ATOM   2542 N N     . VAL E 3 131 ? 25.955 3.580   21.995  1.00 43.35  ? 131 VAL A N     1 
ATOM   2543 C CA    . VAL E 3 131 ? 26.592 3.316   20.711  1.00 40.72  ? 131 VAL A CA    1 
ATOM   2544 C C     . VAL E 3 131 ? 26.890 4.614   19.994  1.00 41.19  ? 131 VAL A C     1 
ATOM   2545 O O     . VAL E 3 131 ? 27.967 4.783   19.424  1.00 40.65  ? 131 VAL A O     1 
ATOM   2546 C CB    . VAL E 3 131 ? 25.727 2.448   19.790  1.00 39.59  ? 131 VAL A CB    1 
ATOM   2547 C CG1   . VAL E 3 131 ? 26.345 2.422   18.385  1.00 36.88  ? 131 VAL A CG1   1 
ATOM   2548 C CG2   . VAL E 3 131 ? 25.638 1.032   20.345  1.00 37.19  ? 131 VAL A CG2   1 
ATOM   2549 N N     . GLY E 3 132 ? 25.926 5.525   20.026  1.00 40.69  ? 132 GLY A N     1 
ATOM   2550 C CA    . GLY E 3 132 ? 26.115 6.808   19.390  1.00 40.67  ? 132 GLY A CA    1 
ATOM   2551 C C     . GLY E 3 132 ? 27.221 7.568   20.091  1.00 42.26  ? 132 GLY A C     1 
ATOM   2552 O O     . GLY E 3 132 ? 28.145 8.050   19.443  1.00 42.16  ? 132 GLY A O     1 
ATOM   2553 N N     . ASN E 3 133 ? 27.134 7.680   21.413  1.00 43.65  ? 133 ASN A N     1 
ATOM   2554 C CA    . ASN E 3 133 ? 28.157 8.384   22.163  1.00 45.41  ? 133 ASN A CA    1 
ATOM   2555 C C     . ASN E 3 133 ? 29.538 7.908   21.732  1.00 47.03  ? 133 ASN A C     1 
ATOM   2556 O O     . ASN E 3 133 ? 30.410 8.725   21.389  1.00 47.31  ? 133 ASN A O     1 
ATOM   2557 C CB    . ASN E 3 133 ? 28.014 8.140   23.659  1.00 46.45  ? 133 ASN A CB    1 
ATOM   2558 C CG    . ASN E 3 133 ? 26.790 8.780   24.237  1.00 48.20  ? 133 ASN A CG    1 
ATOM   2559 O OD1   . ASN E 3 133 ? 26.419 9.890   23.868  1.00 47.42  ? 133 ASN A OD1   1 
ATOM   2560 N ND2   . ASN E 3 133 ? 26.158 8.087   25.174  1.00 52.93  ? 133 ASN A ND2   1 
ATOM   2561 N N     . LEU E 3 134 ? 29.740 6.591   21.762  1.00 45.45  ? 134 LEU A N     1 
ATOM   2562 C CA    . LEU E 3 134 ? 31.025 6.032   21.385  1.00 47.39  ? 134 LEU A CA    1 
ATOM   2563 C C     . LEU E 3 134 ? 31.400 6.412   19.963  1.00 50.87  ? 134 LEU A C     1 
ATOM   2564 O O     . LEU E 3 134 ? 32.560 6.707   19.677  1.00 52.41  ? 134 LEU A O     1 
ATOM   2565 C CB    . LEU E 3 134 ? 30.997 4.520   21.510  1.00 45.50  ? 134 LEU A CB    1 
ATOM   2566 C CG    . LEU E 3 134 ? 31.130 4.017   22.946  1.00 45.59  ? 134 LEU A CG    1 
ATOM   2567 C CD1   . LEU E 3 134 ? 30.553 2.614   23.076  1.00 40.28  ? 134 LEU A CD1   1 
ATOM   2568 C CD2   . LEU E 3 134 ? 32.618 4.076   23.357  1.00 43.19  ? 134 LEU A CD2   1 
ATOM   2569 N N     . ALA E 3 135 ? 30.410 6.435   19.078  1.00 51.50  ? 135 ALA A N     1 
ATOM   2570 C CA    . ALA E 3 135 ? 30.653 6.750   17.680  1.00 51.22  ? 135 ALA A CA    1 
ATOM   2571 C C     . ALA E 3 135 ? 30.794 8.224   17.311  1.00 52.77  ? 135 ALA A C     1 
ATOM   2572 O O     . ALA E 3 135 ? 31.577 8.553   16.423  1.00 55.45  ? 135 ALA A O     1 
ATOM   2573 C CB    . ALA E 3 135 ? 29.565 6.123   16.828  1.00 51.06  ? 135 ALA A CB    1 
ATOM   2574 N N     . PHE E 3 136 ? 30.059 9.116   17.972  1.00 51.92  ? 136 PHE A N     1 
ATOM   2575 C CA    . PHE E 3 136 ? 30.117 10.530  17.606  1.00 51.16  ? 136 PHE A CA    1 
ATOM   2576 C C     . PHE E 3 136 ? 30.856 11.486  18.542  1.00 51.69  ? 136 PHE A C     1 
ATOM   2577 O O     . PHE E 3 136 ? 31.368 12.512  18.095  1.00 53.80  ? 136 PHE A O     1 
ATOM   2578 C CB    . PHE E 3 136 ? 28.698 11.079  17.387  1.00 51.61  ? 136 PHE A CB    1 
ATOM   2579 C CG    . PHE E 3 136 ? 27.857 10.280  16.415  1.00 52.20  ? 136 PHE A CG    1 
ATOM   2580 C CD1   . PHE E 3 136 ? 28.336 9.959   15.144  1.00 52.06  ? 136 PHE A CD1   1 
ATOM   2581 C CD2   . PHE E 3 136 ? 26.575 9.865   16.768  1.00 51.82  ? 136 PHE A CD2   1 
ATOM   2582 C CE1   . PHE E 3 136 ? 27.553 9.238   14.244  1.00 51.39  ? 136 PHE A CE1   1 
ATOM   2583 C CE2   . PHE E 3 136 ? 25.782 9.141   15.870  1.00 51.20  ? 136 PHE A CE2   1 
ATOM   2584 C CZ    . PHE E 3 136 ? 26.273 8.826   14.607  1.00 51.51  ? 136 PHE A CZ    1 
ATOM   2585 N N     . LEU E 3 137 ? 30.904 11.180  19.833  1.00 51.26  ? 137 LEU A N     1 
ATOM   2586 C CA    . LEU E 3 137 ? 31.577 12.066  20.779  1.00 49.14  ? 137 LEU A CA    1 
ATOM   2587 C C     . LEU E 3 137 ? 33.020 11.696  21.052  1.00 48.46  ? 137 LEU A C     1 
ATOM   2588 O O     . LEU E 3 137 ? 33.388 10.516  21.076  1.00 46.68  ? 137 LEU A O     1 
ATOM   2589 C CB    . LEU E 3 137 ? 30.832 12.087  22.114  1.00 49.67  ? 137 LEU A CB    1 
ATOM   2590 C CG    . LEU E 3 137 ? 29.376 12.544  22.136  1.00 49.11  ? 137 LEU A CG    1 
ATOM   2591 C CD1   . LEU E 3 137 ? 28.944 12.838  23.582  1.00 47.88  ? 137 LEU A CD1   1 
ATOM   2592 C CD2   . LEU E 3 137 ? 29.235 13.789  21.274  1.00 48.86  ? 137 LEU A CD2   1 
ATOM   2593 N N     . ASP E 3 138 ? 33.846 12.716  21.256  1.00 49.08  ? 138 ASP A N     1 
ATOM   2594 C CA    . ASP E 3 138 ? 35.244 12.474  21.584  1.00 48.51  ? 138 ASP A CA    1 
ATOM   2595 C C     . ASP E 3 138 ? 35.242 12.067  23.058  1.00 47.34  ? 138 ASP A C     1 
ATOM   2596 O O     . ASP E 3 138 ? 34.177 12.005  23.693  1.00 47.20  ? 138 ASP A O     1 
ATOM   2597 C CB    . ASP E 3 138 ? 36.095 13.728  21.336  1.00 49.97  ? 138 ASP A CB    1 
ATOM   2598 C CG    . ASP E 3 138 ? 35.584 14.949  22.070  1.00 55.56  ? 138 ASP A CG    1 
ATOM   2599 O OD1   . ASP E 3 138 ? 35.935 16.081  21.646  1.00 56.86  ? 138 ASP A OD1   1 
ATOM   2600 O OD2   . ASP E 3 138 ? 34.846 14.788  23.073  1.00 57.82  ? 138 ASP A OD2   1 
ATOM   2601 N N     . VAL E 3 139 ? 36.405 11.772  23.617  1.00 45.06  ? 139 VAL A N     1 
ATOM   2602 C CA    . VAL E 3 139 ? 36.427 11.355  25.010  1.00 43.45  ? 139 VAL A CA    1 
ATOM   2603 C C     . VAL E 3 139 ? 35.836 12.401  25.963  1.00 42.52  ? 139 VAL A C     1 
ATOM   2604 O O     . VAL E 3 139 ? 34.969 12.081  26.798  1.00 42.29  ? 139 VAL A O     1 
ATOM   2605 C CB    . VAL E 3 139 ? 37.834 11.027  25.446  1.00 43.20  ? 139 VAL A CB    1 
ATOM   2606 C CG1   . VAL E 3 139 ? 37.803 10.018  26.588  1.00 44.79  ? 139 VAL A CG1   1 
ATOM   2607 C CG2   . VAL E 3 139 ? 38.589 10.493  24.284  1.00 43.04  ? 139 VAL A CG2   1 
ATOM   2608 N N     . THR E 3 140 ? 36.288 13.648  25.837  1.00 39.38  ? 140 THR A N     1 
ATOM   2609 C CA    . THR E 3 140 ? 35.779 14.687  26.709  1.00 37.04  ? 140 THR A CA    1 
ATOM   2610 C C     . THR E 3 140 ? 34.257 14.673  26.699  1.00 37.47  ? 140 THR A C     1 
ATOM   2611 O O     . THR E 3 140 ? 33.616 14.672  27.750  1.00 37.15  ? 140 THR A O     1 
ATOM   2612 C CB    . THR E 3 140 ? 36.328 16.053  26.306  1.00 35.67  ? 140 THR A CB    1 
ATOM   2613 O OG1   . THR E 3 140 ? 37.756 16.030  26.420  1.00 37.80  ? 140 THR A OG1   1 
ATOM   2614 C CG2   . THR E 3 140 ? 35.820 17.119  27.217  1.00 29.17  ? 140 THR A CG2   1 
ATOM   2615 N N     . GLY E 3 141 ? 33.666 14.615  25.519  1.00 37.15  ? 141 GLY A N     1 
ATOM   2616 C CA    . GLY E 3 141 ? 32.217 14.584  25.472  1.00 38.37  ? 141 GLY A CA    1 
ATOM   2617 C C     . GLY E 3 141 ? 31.629 13.389  26.195  1.00 39.51  ? 141 GLY A C     1 
ATOM   2618 O O     . GLY E 3 141 ? 30.674 13.512  26.959  1.00 40.12  ? 141 GLY A O     1 
ATOM   2619 N N     . ARG E 3 142 ? 32.200 12.216  25.956  1.00 41.19  ? 142 ARG A N     1 
ATOM   2620 C CA    . ARG E 3 142 ? 31.707 11.015  26.607  1.00 40.65  ? 142 ARG A CA    1 
ATOM   2621 C C     . ARG E 3 142 ? 31.877 11.142  28.118  1.00 40.02  ? 142 ARG A C     1 
ATOM   2622 O O     . ARG E 3 142 ? 30.934 10.873  28.868  1.00 39.67  ? 142 ARG A O     1 
ATOM   2623 C CB    . ARG E 3 142 ? 32.434 9.778   26.065  1.00 43.25  ? 142 ARG A CB    1 
ATOM   2624 C CG    . ARG E 3 142 ? 32.330 9.626   24.535  1.00 41.92  ? 142 ARG A CG    1 
ATOM   2625 C CD    . ARG E 3 142 ? 32.319 8.165   24.106  1.00 40.82  ? 142 ARG A CD    1 
ATOM   2626 N NE    . ARG E 3 142 ? 33.597 7.487   24.315  1.00 43.04  ? 142 ARG A NE    1 
ATOM   2627 C CZ    . ARG E 3 142 ? 34.733 7.808   23.697  1.00 42.97  ? 142 ARG A CZ    1 
ATOM   2628 N NH1   . ARG E 3 142 ? 34.759 8.809   22.829  1.00 45.52  ? 142 ARG A NH1   1 
ATOM   2629 N NH2   . ARG E 3 142 ? 35.834 7.105   23.916  1.00 40.39  ? 142 ARG A NH2   1 
ATOM   2630 N N     . ILE E 3 143 ? 33.055 11.564  28.578  1.00 38.15  ? 143 ILE A N     1 
ATOM   2631 C CA    . ILE E 3 143 ? 33.245 11.730  30.022  1.00 37.86  ? 143 ILE A CA    1 
ATOM   2632 C C     . ILE E 3 143 ? 32.242 12.741  30.613  1.00 39.67  ? 143 ILE A C     1 
ATOM   2633 O O     . ILE E 3 143 ? 31.562 12.455  31.615  1.00 40.00  ? 143 ILE A O     1 
ATOM   2634 C CB    . ILE E 3 143 ? 34.665 12.181  30.358  1.00 35.40  ? 143 ILE A CB    1 
ATOM   2635 C CG1   . ILE E 3 143 ? 35.646 11.053  30.015  1.00 37.09  ? 143 ILE A CG1   1 
ATOM   2636 C CG2   . ILE E 3 143 ? 34.756 12.554  31.824  1.00 30.67  ? 143 ILE A CG2   1 
ATOM   2637 C CD1   . ILE E 3 143 ? 37.084 11.302  30.468  1.00 36.98  ? 143 ILE A CD1   1 
ATOM   2638 N N     . ALA E 3 144 ? 32.143 13.914  29.990  1.00 40.29  ? 144 ALA A N     1 
ATOM   2639 C CA    . ALA E 3 144 ? 31.196 14.948  30.427  1.00 41.89  ? 144 ALA A CA    1 
ATOM   2640 C C     . ALA E 3 144 ? 29.832 14.304  30.609  1.00 42.63  ? 144 ALA A C     1 
ATOM   2641 O O     . ALA E 3 144 ? 29.189 14.413  31.658  1.00 41.60  ? 144 ALA A O     1 
ATOM   2642 C CB    . ALA E 3 144 ? 31.092 16.023  29.375  1.00 42.25  ? 144 ALA A CB    1 
ATOM   2643 N N     . GLN E 3 145 ? 29.415 13.637  29.543  1.00 43.38  ? 145 GLN A N     1 
ATOM   2644 C CA    . GLN E 3 145 ? 28.158 12.922  29.472  1.00 45.74  ? 145 GLN A CA    1 
ATOM   2645 C C     . GLN E 3 145 ? 28.002 11.899  30.620  1.00 46.07  ? 145 GLN A C     1 
ATOM   2646 O O     . GLN E 3 145 ? 26.976 11.863  31.304  1.00 45.24  ? 145 GLN A O     1 
ATOM   2647 C CB    . GLN E 3 145 ? 28.107 12.228  28.114  1.00 47.55  ? 145 GLN A CB    1 
ATOM   2648 C CG    . GLN E 3 145 ? 26.857 11.472  27.831  1.00 52.30  ? 145 GLN A CG    1 
ATOM   2649 C CD    . GLN E 3 145 ? 25.657 12.363  27.804  1.00 55.92  ? 145 GLN A CD    1 
ATOM   2650 O OE1   . GLN E 3 145 ? 25.376 13.071  28.777  1.00 59.41  ? 145 GLN A OE1   1 
ATOM   2651 N NE2   . GLN E 3 145 ? 24.923 12.337  26.691  1.00 59.36  ? 145 GLN A NE2   1 
ATOM   2652 N N     . THR E 3 146 ? 29.020 11.072  30.836  1.00 46.38  ? 146 THR A N     1 
ATOM   2653 C CA    . THR E 3 146 ? 28.945 10.071  31.892  1.00 47.12  ? 146 THR A CA    1 
ATOM   2654 C C     . THR E 3 146 ? 28.821 10.691  33.283  1.00 48.08  ? 146 THR A C     1 
ATOM   2655 O O     . THR E 3 146 ? 28.061 10.195  34.124  1.00 48.40  ? 146 THR A O     1 
ATOM   2656 C CB    . THR E 3 146 ? 30.163 9.141   31.864  1.00 46.54  ? 146 THR A CB    1 
ATOM   2657 O OG1   . THR E 3 146 ? 30.094 8.318   30.695  1.00 46.10  ? 146 THR A OG1   1 
ATOM   2658 C CG2   . THR E 3 146 ? 30.194 8.264   33.111  1.00 43.28  ? 146 THR A CG2   1 
ATOM   2659 N N     . LEU E 3 147 ? 29.570 11.761  33.537  1.00 46.72  ? 147 LEU A N     1 
ATOM   2660 C CA    . LEU E 3 147 ? 29.485 12.415  34.837  1.00 45.83  ? 147 LEU A CA    1 
ATOM   2661 C C     . LEU E 3 147 ? 28.041 12.885  35.070  1.00 47.36  ? 147 LEU A C     1 
ATOM   2662 O O     . LEU E 3 147 ? 27.477 12.678  36.142  1.00 46.70  ? 147 LEU A O     1 
ATOM   2663 C CB    . LEU E 3 147 ? 30.456 13.600  34.901  1.00 42.62  ? 147 LEU A CB    1 
ATOM   2664 C CG    . LEU E 3 147 ? 31.947 13.273  34.789  1.00 40.06  ? 147 LEU A CG    1 
ATOM   2665 C CD1   . LEU E 3 147 ? 32.759 14.548  34.787  1.00 40.47  ? 147 LEU A CD1   1 
ATOM   2666 C CD2   . LEU E 3 147 ? 32.374 12.423  35.956  1.00 40.62  ? 147 LEU A CD2   1 
ATOM   2667 N N     . LEU E 3 148 ? 27.444 13.498  34.046  1.00 49.67  ? 148 LEU A N     1 
ATOM   2668 C CA    . LEU E 3 148 ? 26.077 13.999  34.124  1.00 51.32  ? 148 LEU A CA    1 
ATOM   2669 C C     . LEU E 3 148 ? 25.102 12.862  34.435  1.00 54.60  ? 148 LEU A C     1 
ATOM   2670 O O     . LEU E 3 148 ? 24.173 13.030  35.241  1.00 56.04  ? 148 LEU A O     1 
ATOM   2671 C CB    . LEU E 3 148 ? 25.704 14.684  32.814  1.00 50.11  ? 148 LEU A CB    1 
ATOM   2672 C CG    . LEU E 3 148 ? 25.258 16.147  32.925  1.00 50.73  ? 148 LEU A CG    1 
ATOM   2673 C CD1   . LEU E 3 148 ? 26.230 16.960  33.767  1.00 50.07  ? 148 LEU A CD1   1 
ATOM   2674 C CD2   . LEU E 3 148 ? 25.164 16.728  31.529  1.00 50.96  ? 148 LEU A CD2   1 
ATOM   2675 N N     . ASN E 3 149 ? 25.311 11.711  33.797  1.00 55.58  ? 149 ASN A N     1 
ATOM   2676 C CA    . ASN E 3 149 ? 24.478 10.539  34.053  1.00 56.64  ? 149 ASN A CA    1 
ATOM   2677 C C     . ASN E 3 149 ? 24.739 10.118  35.499  1.00 56.75  ? 149 ASN A C     1 
ATOM   2678 O O     . ASN E 3 149 ? 23.844 10.170  36.339  1.00 58.49  ? 149 ASN A O     1 
ATOM   2679 C CB    . ASN E 3 149 ? 24.865 9.369   33.145  1.00 57.93  ? 149 ASN A CB    1 
ATOM   2680 C CG    . ASN E 3 149 ? 24.485 9.592   31.704  1.00 61.18  ? 149 ASN A CG    1 
ATOM   2681 O OD1   . ASN E 3 149 ? 25.086 9.007   30.794  1.00 61.20  ? 149 ASN A OD1   1 
ATOM   2682 N ND2   . ASN E 3 149 ? 23.474 10.424  31.480  1.00 62.85  ? 149 ASN A ND2   1 
ATOM   2683 N N     . LEU E 3 150 ? 25.978 9.712   35.781  1.00 54.35  ? 150 LEU A N     1 
ATOM   2684 C CA    . LEU E 3 150 ? 26.362 9.256   37.117  1.00 51.72  ? 150 LEU A CA    1 
ATOM   2685 C C     . LEU E 3 150 ? 25.771 10.102  38.210  1.00 51.75  ? 150 LEU A C     1 
ATOM   2686 O O     . LEU E 3 150 ? 25.450 9.598   39.279  1.00 51.70  ? 150 LEU A O     1 
ATOM   2687 C CB    . LEU E 3 150 ? 27.883 9.240   37.263  1.00 48.49  ? 150 LEU A CB    1 
ATOM   2688 C CG    . LEU E 3 150 ? 28.547 8.044   36.594  1.00 45.19  ? 150 LEU A CG    1 
ATOM   2689 C CD1   . LEU E 3 150 ? 30.060 8.150   36.676  1.00 41.62  ? 150 LEU A CD1   1 
ATOM   2690 C CD2   . LEU E 3 150 ? 28.032 6.773   37.282  1.00 43.20  ? 150 LEU A CD2   1 
ATOM   2691 N N     . ALA E 3 151 ? 25.622 11.391  37.933  1.00 52.28  ? 151 ALA A N     1 
ATOM   2692 C CA    . ALA E 3 151 ? 25.074 12.311  38.904  1.00 53.70  ? 151 ALA A CA    1 
ATOM   2693 C C     . ALA E 3 151 ? 23.590 12.053  39.122  1.00 56.09  ? 151 ALA A C     1 
ATOM   2694 O O     . ALA E 3 151 ? 23.036 12.426  40.157  1.00 56.69  ? 151 ALA A O     1 
ATOM   2695 C CB    . ALA E 3 151 ? 25.298 13.729  38.444  1.00 51.92  ? 151 ALA A CB    1 
ATOM   2696 N N     . LYS E 3 152 ? 22.956 11.414  38.141  1.00 58.74  ? 152 LYS A N     1 
ATOM   2697 C CA    . LYS E 3 152 ? 21.524 11.089  38.188  1.00 60.71  ? 152 LYS A CA    1 
ATOM   2698 C C     . LYS E 3 152 ? 21.249 9.761   38.899  1.00 60.81  ? 152 LYS A C     1 
ATOM   2699 O O     . LYS E 3 152 ? 20.156 9.558   39.424  1.00 61.08  ? 152 LYS A O     1 
ATOM   2700 C CB    . LYS E 3 152 ? 20.931 10.994  36.770  1.00 62.57  ? 152 LYS A CB    1 
ATOM   2701 C CG    . LYS E 3 152 ? 20.970 12.260  35.920  1.00 63.73  ? 152 LYS A CG    1 
ATOM   2702 C CD    . LYS E 3 152 ? 20.243 13.423  36.579  1.00 65.14  ? 152 LYS A CD    1 
ATOM   2703 C CE    . LYS E 3 152 ? 19.769 14.418  35.526  1.00 66.12  ? 152 LYS A CE    1 
ATOM   2704 N NZ    . LYS E 3 152 ? 20.853 14.761  34.550  1.00 68.72  ? 152 LYS A NZ    1 
ATOM   2705 N N     . GLN E 3 153 ? 22.224 8.854   38.894  1.00 60.10  ? 153 GLN A N     1 
ATOM   2706 C CA    . GLN E 3 153 ? 22.051 7.561   39.554  1.00 61.32  ? 153 GLN A CA    1 
ATOM   2707 C C     . GLN E 3 153 ? 21.586 7.762   40.997  1.00 62.11  ? 153 GLN A C     1 
ATOM   2708 O O     . GLN E 3 153 ? 21.927 8.759   41.629  1.00 62.39  ? 153 GLN A O     1 
ATOM   2709 C CB    . GLN E 3 153 ? 23.363 6.767   39.544  1.00 60.01  ? 153 GLN A CB    1 
ATOM   2710 C CG    . GLN E 3 153 ? 23.720 6.135   38.202  1.00 58.39  ? 153 GLN A CG    1 
ATOM   2711 C CD    . GLN E 3 153 ? 22.932 4.863   37.922  1.00 58.33  ? 153 GLN A CD    1 
ATOM   2712 O OE1   . GLN E 3 153 ? 22.900 3.954   38.748  1.00 61.06  ? 153 GLN A OE1   1 
ATOM   2713 N NE2   . GLN E 3 153 ? 22.302 4.791   36.756  1.00 55.07  ? 153 GLN A NE2   1 
ATOM   2714 N N     . PRO E 3 154 ? 20.792 6.818   41.531  1.00 62.41  ? 154 PRO A N     1 
ATOM   2715 C CA    . PRO E 3 154 ? 20.277 6.891   42.903  1.00 61.88  ? 154 PRO A CA    1 
ATOM   2716 C C     . PRO E 3 154 ? 21.345 6.884   44.003  1.00 61.77  ? 154 PRO A C     1 
ATOM   2717 O O     . PRO E 3 154 ? 21.130 7.430   45.084  1.00 61.00  ? 154 PRO A O     1 
ATOM   2718 C CB    . PRO E 3 154 ? 19.353 5.682   42.982  1.00 61.32  ? 154 PRO A CB    1 
ATOM   2719 C CG    . PRO E 3 154 ? 19.991 4.712   42.044  1.00 61.24  ? 154 PRO A CG    1 
ATOM   2720 C CD    . PRO E 3 154 ? 20.330 5.585   40.870  1.00 61.92  ? 154 PRO A CD    1 
ATOM   2721 N N     . ASP E 3 155 ? 22.493 6.275   43.729  1.00 62.08  ? 155 ASP A N     1 
ATOM   2722 C CA    . ASP E 3 155 ? 23.563 6.222   44.716  1.00 63.19  ? 155 ASP A CA    1 
ATOM   2723 C C     . ASP E 3 155 ? 24.337 7.547   44.798  1.00 63.41  ? 155 ASP A C     1 
ATOM   2724 O O     . ASP E 3 155 ? 25.387 7.638   45.445  1.00 63.79  ? 155 ASP A O     1 
ATOM   2725 C CB    . ASP E 3 155 ? 24.518 5.054   44.400  1.00 65.28  ? 155 ASP A CB    1 
ATOM   2726 C CG    . ASP E 3 155 ? 25.104 5.131   43.000  1.00 67.89  ? 155 ASP A CG    1 
ATOM   2727 O OD1   . ASP E 3 155 ? 24.317 5.170   42.026  1.00 70.78  ? 155 ASP A OD1   1 
ATOM   2728 O OD2   . ASP E 3 155 ? 26.353 5.149   42.875  1.00 68.77  ? 155 ASP A OD2   1 
ATOM   2729 N N     . ALA E 3 156 ? 23.810 8.578   44.149  1.00 62.31  ? 156 ALA A N     1 
ATOM   2730 C CA    . ALA E 3 156 ? 24.453 9.883   44.156  1.00 61.22  ? 156 ALA A CA    1 
ATOM   2731 C C     . ALA E 3 156 ? 23.947 10.697  45.323  1.00 60.23  ? 156 ALA A C     1 
ATOM   2732 O O     . ALA E 3 156 ? 22.751 10.745  45.565  1.00 59.19  ? 156 ALA A O     1 
ATOM   2733 C CB    . ALA E 3 156 ? 24.167 10.619  42.850  1.00 62.33  ? 156 ALA A CB    1 
ATOM   2734 N N     . MET E 3 157 ? 24.859 11.329  46.051  1.00 61.32  ? 157 MET A N     1 
ATOM   2735 C CA    . MET E 3 157 ? 24.469 12.157  47.187  1.00 63.27  ? 157 MET A CA    1 
ATOM   2736 C C     . MET E 3 157 ? 24.249 13.564  46.696  1.00 62.78  ? 157 MET A C     1 
ATOM   2737 O O     . MET E 3 157 ? 24.719 13.932  45.619  1.00 63.54  ? 157 MET A O     1 
ATOM   2738 C CB    . MET E 3 157 ? 25.553 12.186  48.258  1.00 66.17  ? 157 MET A CB    1 
ATOM   2739 C CG    . MET E 3 157 ? 25.762 10.881  48.988  1.00 70.70  ? 157 MET A CG    1 
ATOM   2740 S SD    . MET E 3 157 ? 27.420 10.872  49.672  1.00 78.23  ? 157 MET A SD    1 
ATOM   2741 C CE    . MET E 3 157 ? 28.441 10.654  48.108  1.00 72.30  ? 157 MET A CE    1 
ATOM   2742 N N     . THR E 3 158 ? 23.530 14.352  47.486  1.00 62.34  ? 158 THR A N     1 
ATOM   2743 C CA    . THR E 3 158 ? 23.267 15.733  47.124  1.00 60.65  ? 158 THR A CA    1 
ATOM   2744 C C     . THR E 3 158 ? 24.265 16.608  47.850  1.00 58.28  ? 158 THR A C     1 
ATOM   2745 O O     . THR E 3 158 ? 24.502 16.446  49.034  1.00 59.30  ? 158 THR A O     1 
ATOM   2746 C CB    . THR E 3 158 ? 21.861 16.155  47.501  1.00 61.47  ? 158 THR A CB    1 
ATOM   2747 O OG1   . THR E 3 158 ? 21.681 17.524  47.124  1.00 64.78  ? 158 THR A OG1   1 
ATOM   2748 C CG2   . THR E 3 158 ? 21.637 15.995  48.999  1.00 61.05  ? 158 THR A CG2   1 
ATOM   2749 N N     . HIS E 3 159 ? 24.852 17.536  47.119  1.00 57.70  ? 159 HIS A N     1 
ATOM   2750 C CA    . HIS E 3 159 ? 25.873 18.434  47.648  1.00 55.91  ? 159 HIS A CA    1 
ATOM   2751 C C     . HIS E 3 159 ? 25.357 19.859  47.565  1.00 55.22  ? 159 HIS A C     1 
ATOM   2752 O O     . HIS E 3 159 ? 24.444 20.156  46.791  1.00 55.66  ? 159 HIS A O     1 
ATOM   2753 C CB    . HIS E 3 159 ? 27.122 18.283  46.786  1.00 55.51  ? 159 HIS A CB    1 
ATOM   2754 C CG    . HIS E 3 159 ? 28.251 19.183  47.161  1.00 54.93  ? 159 HIS A CG    1 
ATOM   2755 N ND1   . HIS E 3 159 ? 29.218 18.820  48.072  1.00 55.32  ? 159 HIS A ND1   1 
ATOM   2756 C CD2   . HIS E 3 159 ? 28.620 20.395  46.681  1.00 54.99  ? 159 HIS A CD2   1 
ATOM   2757 C CE1   . HIS E 3 159 ? 30.140 19.765  48.131  1.00 54.80  ? 159 HIS A CE1   1 
ATOM   2758 N NE2   . HIS E 3 159 ? 29.801 20.731  47.296  1.00 54.55  ? 159 HIS A NE2   1 
ATOM   2759 N N     . PRO E 3 160 ? 25.914 20.758  48.378  1.00 54.27  ? 160 PRO A N     1 
ATOM   2760 C CA    . PRO E 3 160 ? 25.442 22.141  48.316  1.00 53.27  ? 160 PRO A CA    1 
ATOM   2761 C C     . PRO E 3 160 ? 25.630 22.807  46.954  1.00 53.37  ? 160 PRO A C     1 
ATOM   2762 O O     . PRO E 3 160 ? 24.794 23.600  46.540  1.00 53.98  ? 160 PRO A O     1 
ATOM   2763 C CB    . PRO E 3 160 ? 26.236 22.838  49.422  1.00 53.88  ? 160 PRO A CB    1 
ATOM   2764 C CG    . PRO E 3 160 ? 27.362 21.859  49.783  1.00 54.74  ? 160 PRO A CG    1 
ATOM   2765 C CD    . PRO E 3 160 ? 26.731 20.526  49.582  1.00 54.45  ? 160 PRO A CD    1 
ATOM   2766 N N     . ASP E 3 161 ? 26.705 22.479  46.246  1.00 53.30  ? 161 ASP A N     1 
ATOM   2767 C CA    . ASP E 3 161 ? 26.958 23.097  44.947  1.00 53.82  ? 161 ASP A CA    1 
ATOM   2768 C C     . ASP E 3 161 ? 26.490 22.247  43.760  1.00 54.84  ? 161 ASP A C     1 
ATOM   2769 O O     . ASP E 3 161 ? 26.718 22.591  42.591  1.00 52.69  ? 161 ASP A O     1 
ATOM   2770 C CB    . ASP E 3 161 ? 28.446 23.408  44.821  1.00 54.16  ? 161 ASP A CB    1 
ATOM   2771 C CG    . ASP E 3 161 ? 28.969 24.239  45.986  1.00 56.98  ? 161 ASP A CG    1 
ATOM   2772 O OD1   . ASP E 3 161 ? 28.517 25.395  46.170  1.00 59.26  ? 161 ASP A OD1   1 
ATOM   2773 O OD2   . ASP E 3 161 ? 29.840 23.740  46.725  1.00 58.90  ? 161 ASP A OD2   1 
ATOM   2774 N N     . GLY E 3 162 ? 25.827 21.133  44.064  1.00 56.02  ? 162 GLY A N     1 
ATOM   2775 C CA    . GLY E 3 162 ? 25.343 20.251  43.012  1.00 56.79  ? 162 GLY A CA    1 
ATOM   2776 C C     . GLY E 3 162 ? 25.106 18.830  43.490  1.00 56.14  ? 162 GLY A C     1 
ATOM   2777 O O     . GLY E 3 162 ? 24.542 18.614  44.565  1.00 55.94  ? 162 GLY A O     1 
ATOM   2778 N N     . MET E 3 163 ? 25.519 17.858  42.682  1.00 55.48  ? 163 MET A N     1 
ATOM   2779 C CA    . MET E 3 163 ? 25.361 16.453  43.042  1.00 55.13  ? 163 MET A CA    1 
ATOM   2780 C C     . MET E 3 163 ? 26.755 15.844  43.252  1.00 53.47  ? 163 MET A C     1 
ATOM   2781 O O     . MET E 3 163 ? 27.674 16.075  42.454  1.00 52.35  ? 163 MET A O     1 
ATOM   2782 C CB    . MET E 3 163 ? 24.601 15.711  41.944  1.00 56.46  ? 163 MET A CB    1 
ATOM   2783 C CG    . MET E 3 163 ? 23.656 14.657  42.492  1.00 61.80  ? 163 MET A CG    1 
ATOM   2784 S SD    . MET E 3 163 ? 22.372 15.391  43.537  1.00 62.01  ? 163 MET A SD    1 
ATOM   2785 C CE    . MET E 3 163 ? 21.311 16.053  42.219  1.00 62.60  ? 163 MET A CE    1 
ATOM   2786 N N     . GLN E 3 164 ? 26.916 15.083  44.333  1.00 50.67  ? 164 GLN A N     1 
ATOM   2787 C CA    . GLN E 3 164 ? 28.216 14.487  44.657  1.00 49.36  ? 164 GLN A CA    1 
ATOM   2788 C C     . GLN E 3 164 ? 28.290 13.007  44.309  1.00 46.20  ? 164 GLN A C     1 
ATOM   2789 O O     . GLN E 3 164 ? 27.348 12.257  44.578  1.00 45.98  ? 164 GLN A O     1 
ATOM   2790 C CB    . GLN E 3 164 ? 28.500 14.668  46.149  1.00 50.14  ? 164 GLN A CB    1 
ATOM   2791 C CG    . GLN E 3 164 ? 29.959 14.636  46.514  1.00 53.83  ? 164 GLN A CG    1 
ATOM   2792 C CD    . GLN E 3 164 ? 30.173 14.528  48.005  1.00 55.93  ? 164 GLN A CD    1 
ATOM   2793 O OE1   . GLN E 3 164 ? 29.856 13.505  48.599  1.00 61.38  ? 164 GLN A OE1   1 
ATOM   2794 N NE2   . GLN E 3 164 ? 30.709 15.579  48.620  1.00 56.43  ? 164 GLN A NE2   1 
ATOM   2795 N N     . ILE E 3 165 ? 29.395 12.577  43.707  1.00 42.82  ? 165 ILE A N     1 
ATOM   2796 C CA    . ILE E 3 165 ? 29.522 11.161  43.361  1.00 42.09  ? 165 ILE A CA    1 
ATOM   2797 C C     . ILE E 3 165 ? 30.874 10.543  43.690  1.00 43.42  ? 165 ILE A C     1 
ATOM   2798 O O     . ILE E 3 165 ? 31.864 11.236  43.907  1.00 43.59  ? 165 ILE A O     1 
ATOM   2799 C CB    . ILE E 3 165 ? 29.227 10.903  41.882  1.00 38.99  ? 165 ILE A CB    1 
ATOM   2800 C CG1   . ILE E 3 165 ? 30.309 11.539  41.019  1.00 37.99  ? 165 ILE A CG1   1 
ATOM   2801 C CG2   . ILE E 3 165 ? 27.852 11.445  41.536  1.00 36.72  ? 165 ILE A CG2   1 
ATOM   2802 C CD1   . ILE E 3 165 ? 30.099 11.316  39.526  1.00 39.15  ? 165 ILE A CD1   1 
ATOM   2803 N N     . LYS E 3 166 ? 30.900 9.218   43.755  1.00 44.77  ? 166 LYS A N     1 
ATOM   2804 C CA    . LYS E 3 166 ? 32.131 8.495   44.053  1.00 43.89  ? 166 LYS A CA    1 
ATOM   2805 C C     . LYS E 3 166 ? 32.394 7.517   42.932  1.00 41.79  ? 166 LYS A C     1 
ATOM   2806 O O     . LYS E 3 166 ? 31.557 6.680   42.623  1.00 44.66  ? 166 LYS A O     1 
ATOM   2807 C CB    . LYS E 3 166 ? 32.001 7.719   45.359  1.00 45.06  ? 166 LYS A CB    1 
ATOM   2808 C CG    . LYS E 3 166 ? 31.661 8.558   46.552  1.00 49.78  ? 166 LYS A CG    1 
ATOM   2809 C CD    . LYS E 3 166 ? 32.847 9.391   46.981  1.00 55.50  ? 166 LYS A CD    1 
ATOM   2810 C CE    . LYS E 3 166 ? 32.535 10.119  48.283  1.00 58.95  ? 166 LYS A CE    1 
ATOM   2811 N NZ    . LYS E 3 166 ? 32.133 9.176   49.371  1.00 59.06  ? 166 LYS A NZ    1 
ATOM   2812 N N     . ILE E 3 167 ? 33.550 7.634   42.311  1.00 39.93  ? 167 ILE A N     1 
ATOM   2813 C CA    . ILE E 3 167 ? 33.920 6.737   41.239  1.00 39.69  ? 167 ILE A CA    1 
ATOM   2814 C C     . ILE E 3 167 ? 35.379 7.005   40.986  1.00 39.34  ? 167 ILE A C     1 
ATOM   2815 O O     . ILE E 3 167 ? 35.869 8.081   41.307  1.00 38.41  ? 167 ILE A O     1 
ATOM   2816 C CB    . ILE E 3 167 ? 33.079 6.968   39.943  1.00 39.42  ? 167 ILE A CB    1 
ATOM   2817 C CG1   . ILE E 3 167 ? 33.423 5.893   38.909  1.00 41.30  ? 167 ILE A CG1   1 
ATOM   2818 C CG2   . ILE E 3 167 ? 33.360 8.320   39.356  1.00 38.32  ? 167 ILE A CG2   1 
ATOM   2819 C CD1   . ILE E 3 167 ? 32.419 5.768   37.787  1.00 44.34  ? 167 ILE A CD1   1 
ATOM   2820 N N     . THR E 3 168 ? 36.075 6.005   40.462  1.00 40.94  ? 168 THR A N     1 
ATOM   2821 C CA    . THR E 3 168 ? 37.496 6.115   40.172  1.00 42.30  ? 168 THR A CA    1 
ATOM   2822 C C     . THR E 3 168 ? 37.659 6.445   38.711  1.00 41.11  ? 168 THR A C     1 
ATOM   2823 O O     . THR E 3 168 ? 36.731 6.267   37.930  1.00 41.30  ? 168 THR A O     1 
ATOM   2824 C CB    . THR E 3 168 ? 38.231 4.790   40.458  1.00 45.13  ? 168 THR A CB    1 
ATOM   2825 O OG1   . THR E 3 168 ? 37.735 3.762   39.577  1.00 47.78  ? 168 THR A OG1   1 
ATOM   2826 C CG2   . THR E 3 168 ? 38.018 4.384   41.919  1.00 43.33  ? 168 THR A CG2   1 
ATOM   2827 N N     . ARG E 3 169 ? 38.831 6.938   38.336  1.00 41.23  ? 169 ARG A N     1 
ATOM   2828 C CA    . ARG E 3 169 ? 39.048 7.264   36.936  1.00 41.73  ? 169 ARG A CA    1 
ATOM   2829 C C     . ARG E 3 169 ? 39.009 5.954   36.195  1.00 41.34  ? 169 ARG A C     1 
ATOM   2830 O O     . ARG E 3 169 ? 38.518 5.883   35.073  1.00 40.49  ? 169 ARG A O     1 
ATOM   2831 C CB    . ARG E 3 169 ? 40.401 7.944   36.712  1.00 39.98  ? 169 ARG A CB    1 
ATOM   2832 C CG    . ARG E 3 169 ? 40.534 9.263   37.427  1.00 43.11  ? 169 ARG A CG    1 
ATOM   2833 C CD    . ARG E 3 169 ? 41.145 9.037   38.772  1.00 44.53  ? 169 ARG A CD    1 
ATOM   2834 N NE    . ARG E 3 169 ? 40.485 9.747   39.860  1.00 44.71  ? 169 ARG A NE    1 
ATOM   2835 C CZ    . ARG E 3 169 ? 40.455 11.064  39.950  1.00 42.40  ? 169 ARG A CZ    1 
ATOM   2836 N NH1   . ARG E 3 169 ? 41.037 11.773  39.003  1.00 42.51  ? 169 ARG A NH1   1 
ATOM   2837 N NH2   . ARG E 3 169 ? 39.895 11.657  40.993  1.00 39.79  ? 169 ARG A NH2   1 
ATOM   2838 N N     . GLN E 3 170 ? 39.521 4.918   36.853  1.00 41.53  ? 170 GLN A N     1 
ATOM   2839 C CA    . GLN E 3 170 ? 39.573 3.596   36.276  1.00 41.79  ? 170 GLN A CA    1 
ATOM   2840 C C     . GLN E 3 170 ? 38.163 3.214   35.855  1.00 41.04  ? 170 GLN A C     1 
ATOM   2841 O O     . GLN E 3 170 ? 37.915 2.824   34.706  1.00 39.50  ? 170 GLN A O     1 
ATOM   2842 C CB    . GLN E 3 170 ? 40.111 2.619   37.318  1.00 46.16  ? 170 GLN A CB    1 
ATOM   2843 C CG    . GLN E 3 170 ? 41.063 1.540   36.788  1.00 51.62  ? 170 GLN A CG    1 
ATOM   2844 C CD    . GLN E 3 170 ? 42.207 1.236   37.768  1.00 53.92  ? 170 GLN A CD    1 
ATOM   2845 O OE1   . GLN E 3 170 ? 41.985 0.721   38.868  1.00 56.04  ? 170 GLN A OE1   1 
ATOM   2846 N NE2   . GLN E 3 170 ? 43.435 1.566   37.367  1.00 53.75  ? 170 GLN A NE2   1 
ATOM   2847 N N     . GLU E 3 171 ? 37.226 3.359   36.776  1.00 40.58  ? 171 GLU A N     1 
ATOM   2848 C CA    . GLU E 3 171 ? 35.872 2.995   36.455  1.00 43.88  ? 171 GLU A CA    1 
ATOM   2849 C C     . GLU E 3 171 ? 35.271 3.861   35.349  1.00 44.82  ? 171 GLU A C     1 
ATOM   2850 O O     . GLU E 3 171 ? 34.644 3.339   34.428  1.00 47.32  ? 171 GLU A O     1 
ATOM   2851 C CB    . GLU E 3 171 ? 35.009 3.023   37.707  1.00 45.70  ? 171 GLU A CB    1 
ATOM   2852 C CG    . GLU E 3 171 ? 34.343 1.686   37.957  1.00 49.36  ? 171 GLU A CG    1 
ATOM   2853 C CD    . GLU E 3 171 ? 33.242 1.774   38.986  1.00 51.53  ? 171 GLU A CD    1 
ATOM   2854 O OE1   . GLU E 3 171 ? 33.569 2.068   40.162  1.00 53.35  ? 171 GLU A OE1   1 
ATOM   2855 O OE2   . GLU E 3 171 ? 32.061 1.561   38.613  1.00 48.14  ? 171 GLU A OE2   1 
ATOM   2856 N N     . ILE E 3 172 ? 35.450 5.178   35.428  1.00 43.44  ? 172 ILE A N     1 
ATOM   2857 C CA    . ILE E 3 172 ? 34.931 6.058   34.385  1.00 39.32  ? 172 ILE A CA    1 
ATOM   2858 C C     . ILE E 3 172 ? 35.513 5.577   33.066  1.00 37.68  ? 172 ILE A C     1 
ATOM   2859 O O     . ILE E 3 172 ? 34.825 5.501   32.063  1.00 37.05  ? 172 ILE A O     1 
ATOM   2860 C CB    . ILE E 3 172 ? 35.367 7.520   34.613  1.00 38.78  ? 172 ILE A CB    1 
ATOM   2861 C CG1   . ILE E 3 172 ? 34.559 8.118   35.751  1.00 35.03  ? 172 ILE A CG1   1 
ATOM   2862 C CG2   . ILE E 3 172 ? 35.199 8.354   33.321  1.00 36.00  ? 172 ILE A CG2   1 
ATOM   2863 C CD1   . ILE E 3 172 ? 35.107 9.437   36.202  1.00 36.19  ? 172 ILE A CD1   1 
ATOM   2864 N N     . GLY E 3 173 ? 36.791 5.247   33.081  1.00 37.39  ? 173 GLY A N     1 
ATOM   2865 C CA    . GLY E 3 173 ? 37.424 4.775   31.874  1.00 41.09  ? 173 GLY A CA    1 
ATOM   2866 C C     . GLY E 3 173 ? 36.757 3.505   31.376  1.00 44.31  ? 173 GLY A C     1 
ATOM   2867 O O     . GLY E 3 173 ? 36.822 3.182   30.177  1.00 45.20  ? 173 GLY A O     1 
ATOM   2868 N N     . GLN E 3 174 ? 36.110 2.777   32.279  1.00 43.43  ? 174 GLN A N     1 
ATOM   2869 C CA    . GLN E 3 174 ? 35.457 1.548   31.877  1.00 46.11  ? 174 GLN A CA    1 
ATOM   2870 C C     . GLN E 3 174 ? 33.999 1.776   31.525  1.00 48.01  ? 174 GLN A C     1 
ATOM   2871 O O     . GLN E 3 174 ? 33.227 0.833   31.330  1.00 51.18  ? 174 GLN A O     1 
ATOM   2872 C CB    . GLN E 3 174 ? 35.587 0.496   32.971  1.00 47.70  ? 174 GLN A CB    1 
ATOM   2873 C CG    . GLN E 3 174 ? 37.028 0.118   33.243  1.00 48.30  ? 174 GLN A CG    1 
ATOM   2874 C CD    . GLN E 3 174 ? 37.170 -0.877  34.362  1.00 47.09  ? 174 GLN A CD    1 
ATOM   2875 O OE1   . GLN E 3 174 ? 36.717 -0.642  35.479  1.00 46.04  ? 174 GLN A OE1   1 
ATOM   2876 N NE2   . GLN E 3 174 ? 37.805 -2.003  34.067  1.00 50.08  ? 174 GLN A NE2   1 
ATOM   2877 N N     . ILE E 3 175 ? 33.615 3.039   31.453  1.00 47.01  ? 175 ILE A N     1 
ATOM   2878 C CA    . ILE E 3 175 ? 32.266 3.367   31.072  1.00 45.69  ? 175 ILE A CA    1 
ATOM   2879 C C     . ILE E 3 175 ? 32.381 4.025   29.709  1.00 45.65  ? 175 ILE A C     1 
ATOM   2880 O O     . ILE E 3 175 ? 31.634 3.686   28.797  1.00 47.54  ? 175 ILE A O     1 
ATOM   2881 C CB    . ILE E 3 175 ? 31.606 4.330   32.087  1.00 47.65  ? 175 ILE A CB    1 
ATOM   2882 C CG1   . ILE E 3 175 ? 31.382 3.581   33.410  1.00 46.62  ? 175 ILE A CG1   1 
ATOM   2883 C CG2   . ILE E 3 175 ? 30.288 4.911   31.513  1.00 45.35  ? 175 ILE A CG2   1 
ATOM   2884 C CD1   . ILE E 3 175 ? 30.521 4.330   34.423  1.00 46.83  ? 175 ILE A CD1   1 
ATOM   2885 N N     . VAL E 3 176 ? 33.350 4.927   29.563  1.00 43.77  ? 176 VAL A N     1 
ATOM   2886 C CA    . VAL E 3 176 ? 33.552 5.651   28.312  1.00 44.04  ? 176 VAL A CA    1 
ATOM   2887 C C     . VAL E 3 176 ? 34.519 4.964   27.370  1.00 44.64  ? 176 VAL A C     1 
ATOM   2888 O O     . VAL E 3 176 ? 34.707 5.386   26.227  1.00 44.94  ? 176 VAL A O     1 
ATOM   2889 C CB    . VAL E 3 176 ? 34.098 7.050   28.570  1.00 43.88  ? 176 VAL A CB    1 
ATOM   2890 C CG1   . VAL E 3 176 ? 33.208 7.784   29.554  1.00 45.93  ? 176 VAL A CG1   1 
ATOM   2891 C CG2   . VAL E 3 176 ? 35.508 6.950   29.099  1.00 43.53  ? 176 VAL A CG2   1 
ATOM   2892 N N     . GLY E 3 177 ? 35.161 3.915   27.856  1.00 46.32  ? 177 GLY A N     1 
ATOM   2893 C CA    . GLY E 3 177 ? 36.098 3.199   27.015  1.00 46.03  ? 177 GLY A CA    1 
ATOM   2894 C C     . GLY E 3 177 ? 37.280 4.036   26.580  1.00 46.57  ? 177 GLY A C     1 
ATOM   2895 O O     . GLY E 3 177 ? 37.443 4.333   25.400  1.00 47.88  ? 177 GLY A O     1 
ATOM   2896 N N     . CYS E 3 178 ? 38.096 4.435   27.546  1.00 46.41  ? 178 CYS A N     1 
ATOM   2897 C CA    . CYS E 3 178 ? 39.307 5.205   27.274  1.00 47.25  ? 178 CYS A CA    1 
ATOM   2898 C C     . CYS E 3 178 ? 40.230 4.810   28.423  1.00 46.77  ? 178 CYS A C     1 
ATOM   2899 O O     . CYS E 3 178 ? 39.785 4.117   29.340  1.00 45.89  ? 178 CYS A O     1 
ATOM   2900 C CB    . CYS E 3 178 ? 39.035 6.728   27.276  1.00 45.56  ? 178 CYS A CB    1 
ATOM   2901 S SG    . CYS E 3 178 ? 38.843 7.509   28.904  1.00 42.83  ? 178 CYS A SG    1 
ATOM   2902 N N     . SER E 3 179 ? 41.491 5.228   28.381  1.00 45.48  ? 179 SER A N     1 
ATOM   2903 C CA    . SER E 3 179 ? 42.420 4.875   29.456  1.00 48.21  ? 179 SER A CA    1 
ATOM   2904 C C     . SER E 3 179 ? 42.137 5.626   30.755  1.00 48.62  ? 179 SER A C     1 
ATOM   2905 O O     . SER E 3 179 ? 41.440 6.639   30.759  1.00 49.70  ? 179 SER A O     1 
ATOM   2906 C CB    . SER E 3 179 ? 43.864 5.158   29.029  1.00 48.31  ? 179 SER A CB    1 
ATOM   2907 O OG    . SER E 3 179 ? 44.074 6.551   28.849  1.00 51.62  ? 179 SER A OG    1 
ATOM   2908 N N     . ARG E 3 180 ? 42.695 5.133   31.858  1.00 49.19  ? 180 ARG A N     1 
ATOM   2909 C CA    . ARG E 3 180 ? 42.507 5.779   33.155  1.00 48.38  ? 180 ARG A CA    1 
ATOM   2910 C C     . ARG E 3 180 ? 43.375 7.019   33.182  1.00 48.08  ? 180 ARG A C     1 
ATOM   2911 O O     . ARG E 3 180 ? 43.058 7.990   33.867  1.00 48.44  ? 180 ARG A O     1 
ATOM   2912 C CB    . ARG E 3 180 ? 42.924 4.861   34.307  1.00 47.86  ? 180 ARG A CB    1 
ATOM   2913 C CG    . ARG E 3 180 ? 44.418 4.578   34.348  1.00 52.06  ? 180 ARG A CG    1 
ATOM   2914 C CD    . ARG E 3 180 ? 44.805 3.816   35.621  1.00 57.21  ? 180 ARG A CD    1 
ATOM   2915 N NE    . ARG E 3 180 ? 46.190 3.353   35.603  1.00 56.26  ? 180 ARG A NE    1 
ATOM   2916 C CZ    . ARG E 3 180 ? 47.242 4.158   35.586  1.00 56.44  ? 180 ARG A CZ    1 
ATOM   2917 N NH1   . ARG E 3 180 ? 47.083 5.472   35.594  1.00 54.66  ? 180 ARG A NH1   1 
ATOM   2918 N NH2   . ARG E 3 180 ? 48.455 3.638   35.526  1.00 58.76  ? 180 ARG A NH2   1 
ATOM   2919 N N     . GLU E 3 181 ? 44.485 6.984   32.453  1.00 48.11  ? 181 GLU A N     1 
ATOM   2920 C CA    . GLU E 3 181 ? 45.358 8.140   32.424  1.00 48.48  ? 181 GLU A CA    1 
ATOM   2921 C C     . GLU E 3 181 ? 44.571 9.256   31.793  1.00 48.84  ? 181 GLU A C     1 
ATOM   2922 O O     . GLU E 3 181 ? 44.443 10.340  32.362  1.00 50.65  ? 181 GLU A O     1 
ATOM   2923 C CB    . GLU E 3 181 ? 46.605 7.898   31.584  1.00 50.79  ? 181 GLU A CB    1 
ATOM   2924 C CG    . GLU E 3 181 ? 47.667 7.030   32.226  1.00 56.13  ? 181 GLU A CG    1 
ATOM   2925 C CD    . GLU E 3 181 ? 47.503 5.544   31.939  1.00 58.94  ? 181 GLU A CD    1 
ATOM   2926 O OE1   . GLU E 3 181 ? 48.502 4.814   32.138  1.00 61.21  ? 181 GLU A OE1   1 
ATOM   2927 O OE2   . GLU E 3 181 ? 46.398 5.106   31.529  1.00 58.39  ? 181 GLU A OE2   1 
ATOM   2928 N N     . THR E 3 182 ? 44.017 8.984   30.618  1.00 47.14  ? 182 THR A N     1 
ATOM   2929 C CA    . THR E 3 182 ? 43.262 9.998   29.913  1.00 45.97  ? 182 THR A CA    1 
ATOM   2930 C C     . THR E 3 182 ? 42.113 10.566  30.739  1.00 44.78  ? 182 THR A C     1 
ATOM   2931 O O     . THR E 3 182 ? 41.909 11.778  30.794  1.00 44.50  ? 182 THR A O     1 
ATOM   2932 C CB    . THR E 3 182 ? 42.776 9.448   28.565  1.00 45.87  ? 182 THR A CB    1 
ATOM   2933 O OG1   . THR E 3 182 ? 43.862 9.519   27.622  1.00 49.40  ? 182 THR A OG1   1 
ATOM   2934 C CG2   . THR E 3 182 ? 41.593 10.257  28.034  1.00 46.66  ? 182 THR A CG2   1 
ATOM   2935 N N     . VAL E 3 183 ? 41.362 9.696   31.388  1.00 43.61  ? 183 VAL A N     1 
ATOM   2936 C CA    . VAL E 3 183 ? 40.275 10.160  32.214  1.00 43.66  ? 183 VAL A CA    1 
ATOM   2937 C C     . VAL E 3 183 ? 40.857 11.228  33.131  1.00 45.36  ? 183 VAL A C     1 
ATOM   2938 O O     . VAL E 3 183 ? 40.352 12.359  33.202  1.00 46.73  ? 183 VAL A O     1 
ATOM   2939 C CB    . VAL E 3 183 ? 39.730 9.022   33.059  1.00 42.29  ? 183 VAL A CB    1 
ATOM   2940 C CG1   . VAL E 3 183 ? 38.552 9.487   33.866  1.00 40.51  ? 183 VAL A CG1   1 
ATOM   2941 C CG2   . VAL E 3 183 ? 39.345 7.877   32.159  1.00 45.36  ? 183 VAL A CG2   1 
ATOM   2942 N N     . GLY E 3 184 ? 41.943 10.860  33.808  1.00 44.46  ? 184 GLY A N     1 
ATOM   2943 C CA    . GLY E 3 184 ? 42.608 11.763  34.728  1.00 43.53  ? 184 GLY A CA    1 
ATOM   2944 C C     . GLY E 3 184 ? 42.925 13.143  34.170  1.00 44.01  ? 184 GLY A C     1 
ATOM   2945 O O     . GLY E 3 184 ? 42.688 14.154  34.830  1.00 43.10  ? 184 GLY A O     1 
ATOM   2946 N N     . ARG E 3 185 ? 43.469 13.202  32.963  1.00 43.56  ? 185 ARG A N     1 
ATOM   2947 C CA    . ARG E 3 185 ? 43.802 14.485  32.396  1.00 44.27  ? 185 ARG A CA    1 
ATOM   2948 C C     . ARG E 3 185 ? 42.511 15.216  32.129  1.00 46.34  ? 185 ARG A C     1 
ATOM   2949 O O     . ARG E 3 185 ? 42.381 16.408  32.441  1.00 48.98  ? 185 ARG A O     1 
ATOM   2950 C CB    . ARG E 3 185 ? 44.564 14.331  31.086  1.00 46.61  ? 185 ARG A CB    1 
ATOM   2951 C CG    . ARG E 3 185 ? 45.707 13.338  31.133  1.00 52.62  ? 185 ARG A CG    1 
ATOM   2952 C CD    . ARG E 3 185 ? 46.563 13.400  29.874  1.00 56.85  ? 185 ARG A CD    1 
ATOM   2953 N NE    . ARG E 3 185 ? 47.641 12.409  29.901  1.00 63.41  ? 185 ARG A NE    1 
ATOM   2954 C CZ    . ARG E 3 185 ? 47.464 11.097  29.750  1.00 66.07  ? 185 ARG A CZ    1 
ATOM   2955 N NH1   . ARG E 3 185 ? 46.243 10.600  29.553  1.00 65.54  ? 185 ARG A NH1   1 
ATOM   2956 N NH2   . ARG E 3 185 ? 48.510 10.277  29.811  1.00 66.64  ? 185 ARG A NH2   1 
ATOM   2957 N N     . ILE E 3 186 ? 41.534 14.512  31.569  1.00 44.88  ? 186 ILE A N     1 
ATOM   2958 C CA    . ILE E 3 186 ? 40.298 15.186  31.244  1.00 43.70  ? 186 ILE A CA    1 
ATOM   2959 C C     . ILE E 3 186 ? 39.622 15.728  32.480  1.00 43.42  ? 186 ILE A C     1 
ATOM   2960 O O     . ILE E 3 186 ? 39.128 16.856  32.463  1.00 44.65  ? 186 ILE A O     1 
ATOM   2961 C CB    . ILE E 3 186 ? 39.360 14.277  30.396  1.00 44.44  ? 186 ILE A CB    1 
ATOM   2962 C CG1   . ILE E 3 186 ? 39.891 14.242  28.954  1.00 44.22  ? 186 ILE A CG1   1 
ATOM   2963 C CG2   . ILE E 3 186 ? 37.919 14.802  30.403  1.00 40.95  ? 186 ILE A CG2   1 
ATOM   2964 C CD1   . ILE E 3 186 ? 39.006 13.524  27.955  1.00 46.53  ? 186 ILE A CD1   1 
ATOM   2965 N N     . LEU E 3 187 ? 39.635 14.952  33.560  1.00 43.11  ? 187 LEU A N     1 
ATOM   2966 C CA    . LEU E 3 187 ? 39.015 15.372  34.821  1.00 41.73  ? 187 LEU A CA    1 
ATOM   2967 C C     . LEU E 3 187 ? 39.617 16.720  35.237  1.00 41.28  ? 187 LEU A C     1 
ATOM   2968 O O     . LEU E 3 187 ? 38.910 17.653  35.602  1.00 40.55  ? 187 LEU A O     1 
ATOM   2969 C CB    . LEU E 3 187 ? 39.273 14.306  35.897  1.00 38.99  ? 187 LEU A CB    1 
ATOM   2970 C CG    . LEU E 3 187 ? 38.084 13.643  36.622  1.00 39.39  ? 187 LEU A CG    1 
ATOM   2971 C CD1   . LEU E 3 187 ? 36.961 13.317  35.646  1.00 38.09  ? 187 LEU A CD1   1 
ATOM   2972 C CD2   . LEU E 3 187 ? 38.555 12.371  37.342  1.00 34.56  ? 187 LEU A CD2   1 
ATOM   2973 N N     . LYS E 3 188 ? 40.932 16.821  35.138  1.00 41.87  ? 188 LYS A N     1 
ATOM   2974 C CA    . LYS E 3 188 ? 41.637 18.034  35.501  1.00 44.89  ? 188 LYS A CA    1 
ATOM   2975 C C     . LYS E 3 188 ? 41.209 19.246  34.639  1.00 45.39  ? 188 LYS A C     1 
ATOM   2976 O O     . LYS E 3 188 ? 41.137 20.379  35.129  1.00 44.08  ? 188 LYS A O     1 
ATOM   2977 C CB    . LYS E 3 188 ? 43.148 17.756  35.429  1.00 47.06  ? 188 LYS A CB    1 
ATOM   2978 C CG    . LYS E 3 188 ? 44.043 18.978  35.313  1.00 56.65  ? 188 LYS A CG    1 
ATOM   2979 C CD    . LYS E 3 188 ? 43.853 19.956  36.465  1.00 62.38  ? 188 LYS A CD    1 
ATOM   2980 C CE    . LYS E 3 188 ? 44.646 21.246  36.243  1.00 64.31  ? 188 LYS A CE    1 
ATOM   2981 N NZ    . LYS E 3 188 ? 44.357 22.226  37.339  1.00 66.52  ? 188 LYS A NZ    1 
ATOM   2982 N N     . MET E 3 189 ? 40.896 19.022  33.369  1.00 45.98  ? 189 MET A N     1 
ATOM   2983 C CA    . MET E 3 189 ? 40.465 20.140  32.533  1.00 46.80  ? 189 MET A CA    1 
ATOM   2984 C C     . MET E 3 189 ? 39.026 20.560  32.853  1.00 46.85  ? 189 MET A C     1 
ATOM   2985 O O     . MET E 3 189 ? 38.707 21.749  32.841  1.00 47.07  ? 189 MET A O     1 
ATOM   2986 C CB    . MET E 3 189 ? 40.594 19.801  31.043  1.00 46.46  ? 189 MET A CB    1 
ATOM   2987 C CG    . MET E 3 189 ? 42.015 19.490  30.606  1.00 49.19  ? 189 MET A CG    1 
ATOM   2988 S SD    . MET E 3 189 ? 42.194 19.121  28.842  1.00 50.90  ? 189 MET A SD    1 
ATOM   2989 C CE    . MET E 3 189 ? 40.482 18.565  28.408  1.00 51.89  ? 189 MET A CE    1 
ATOM   2990 N N     . LEU E 3 190 ? 38.150 19.602  33.133  1.00 45.06  ? 190 LEU A N     1 
ATOM   2991 C CA    . LEU E 3 190 ? 36.785 19.972  33.458  1.00 45.87  ? 190 LEU A CA    1 
ATOM   2992 C C     . LEU E 3 190 ? 36.801 20.815  34.749  1.00 47.96  ? 190 LEU A C     1 
ATOM   2993 O O     . LEU E 3 190 ? 35.938 21.673  34.971  1.00 47.50  ? 190 LEU A O     1 
ATOM   2994 C CB    . LEU E 3 190 ? 35.908 18.718  33.634  1.00 43.86  ? 190 LEU A CB    1 
ATOM   2995 C CG    . LEU E 3 190 ? 35.633 17.830  32.411  1.00 43.16  ? 190 LEU A CG    1 
ATOM   2996 C CD1   . LEU E 3 190 ? 34.759 16.644  32.804  1.00 40.89  ? 190 LEU A CD1   1 
ATOM   2997 C CD2   . LEU E 3 190 ? 34.944 18.631  31.332  1.00 42.18  ? 190 LEU A CD2   1 
ATOM   2998 N N     . GLU E 3 191 ? 37.788 20.582  35.607  1.00 49.69  ? 191 GLU A N     1 
ATOM   2999 C CA    . GLU E 3 191 ? 37.852 21.367  36.822  1.00 51.17  ? 191 GLU A CA    1 
ATOM   3000 C C     . GLU E 3 191 ? 38.398 22.752  36.492  1.00 50.58  ? 191 GLU A C     1 
ATOM   3001 O O     . GLU E 3 191 ? 37.965 23.740  37.068  1.00 51.47  ? 191 GLU A O     1 
ATOM   3002 C CB    . GLU E 3 191 ? 38.719 20.694  37.879  1.00 52.89  ? 191 GLU A CB    1 
ATOM   3003 C CG    . GLU E 3 191 ? 38.542 21.314  39.258  1.00 55.80  ? 191 GLU A CG    1 
ATOM   3004 C CD    . GLU E 3 191 ? 39.306 20.573  40.333  1.00 58.57  ? 191 GLU A CD    1 
ATOM   3005 O OE1   . GLU E 3 191 ? 39.205 19.327  40.376  1.00 61.81  ? 191 GLU A OE1   1 
ATOM   3006 O OE2   . GLU E 3 191 ? 39.998 21.225  41.142  1.00 59.12  ? 191 GLU A OE2   1 
ATOM   3007 N N     . ASP E 3 192 ? 39.342 22.833  35.563  1.00 50.48  ? 192 ASP A N     1 
ATOM   3008 C CA    . ASP E 3 192 ? 39.874 24.135  35.168  1.00 51.20  ? 192 ASP A CA    1 
ATOM   3009 C C     . ASP E 3 192 ? 38.756 25.021  34.626  1.00 51.60  ? 192 ASP A C     1 
ATOM   3010 O O     . ASP E 3 192 ? 38.865 26.253  34.650  1.00 53.26  ? 192 ASP A O     1 
ATOM   3011 C CB    . ASP E 3 192 ? 40.930 23.980  34.089  1.00 53.13  ? 192 ASP A CB    1 
ATOM   3012 C CG    . ASP E 3 192 ? 42.310 23.834  34.655  1.00 57.61  ? 192 ASP A CG    1 
ATOM   3013 O OD1   . ASP E 3 192 ? 43.241 23.550  33.861  1.00 59.69  ? 192 ASP A OD1   1 
ATOM   3014 O OD2   . ASP E 3 192 ? 42.461 24.012  35.892  1.00 57.30  ? 192 ASP A OD2   1 
ATOM   3015 N N     . GLN E 3 193 ? 37.688 24.393  34.136  1.00 48.22  ? 193 GLN A N     1 
ATOM   3016 C CA    . GLN E 3 193 ? 36.552 25.117  33.594  1.00 46.79  ? 193 GLN A CA    1 
ATOM   3017 C C     . GLN E 3 193 ? 35.413 25.167  34.594  1.00 46.56  ? 193 GLN A C     1 
ATOM   3018 O O     . GLN E 3 193 ? 34.244 25.279  34.219  1.00 44.62  ? 193 GLN A O     1 
ATOM   3019 C CB    . GLN E 3 193 ? 36.072 24.452  32.315  1.00 46.58  ? 193 GLN A CB    1 
ATOM   3020 C CG    . GLN E 3 193 ? 37.204 24.146  31.371  1.00 48.49  ? 193 GLN A CG    1 
ATOM   3021 C CD    . GLN E 3 193 ? 36.792 23.258  30.204  1.00 48.69  ? 193 GLN A CD    1 
ATOM   3022 O OE1   . GLN E 3 193 ? 37.636 22.593  29.614  1.00 49.85  ? 193 GLN A OE1   1 
ATOM   3023 N NE2   . GLN E 3 193 ? 35.500 23.255  29.860  1.00 47.24  ? 193 GLN A NE2   1 
ATOM   3024 N N     . ASN E 3 194 ? 35.767 25.083  35.870  1.00 47.29  ? 194 ASN A N     1 
ATOM   3025 C CA    . ASN E 3 194 ? 34.789 25.120  36.952  1.00 48.94  ? 194 ASN A CA    1 
ATOM   3026 C C     . ASN E 3 194 ? 33.555 24.290  36.691  1.00 47.77  ? 194 ASN A C     1 
ATOM   3027 O O     . ASN E 3 194 ? 32.462 24.705  37.050  1.00 50.12  ? 194 ASN A O     1 
ATOM   3028 C CB    . ASN E 3 194 ? 34.345 26.557  37.238  1.00 49.31  ? 194 ASN A CB    1 
ATOM   3029 C CG    . ASN E 3 194 ? 35.493 27.437  37.649  1.00 53.91  ? 194 ASN A CG    1 
ATOM   3030 O OD1   . ASN E 3 194 ? 36.344 27.033  38.444  1.00 55.79  ? 194 ASN A OD1   1 
ATOM   3031 N ND2   . ASN E 3 194 ? 35.530 28.649  37.115  1.00 55.54  ? 194 ASN A ND2   1 
ATOM   3032 N N     . LEU E 3 195 ? 33.705 23.123  36.080  1.00 46.27  ? 195 LEU A N     1 
ATOM   3033 C CA    . LEU E 3 195 ? 32.530 22.304  35.813  1.00 44.05  ? 195 LEU A CA    1 
ATOM   3034 C C     . LEU E 3 195 ? 32.320 21.312  36.924  1.00 44.24  ? 195 LEU A C     1 
ATOM   3035 O O     . LEU E 3 195 ? 31.181 21.020  37.306  1.00 44.85  ? 195 LEU A O     1 
ATOM   3036 C CB    . LEU E 3 195 ? 32.679 21.566  34.502  1.00 42.43  ? 195 LEU A CB    1 
ATOM   3037 C CG    . LEU E 3 195 ? 32.843 22.551  33.349  1.00 43.75  ? 195 LEU A CG    1 
ATOM   3038 C CD1   . LEU E 3 195 ? 33.063 21.787  32.038  1.00 43.02  ? 195 LEU A CD1   1 
ATOM   3039 C CD2   . LEU E 3 195 ? 31.605 23.437  33.274  1.00 40.76  ? 195 LEU A CD2   1 
ATOM   3040 N N     . ILE E 3 196 ? 33.427 20.817  37.461  1.00 42.25  ? 196 ILE A N     1 
ATOM   3041 C CA    . ILE E 3 196 ? 33.375 19.840  38.523  1.00 40.95  ? 196 ILE A CA    1 
ATOM   3042 C C     . ILE E 3 196 ? 34.554 20.046  39.439  1.00 43.94  ? 196 ILE A C     1 
ATOM   3043 O O     . ILE E 3 196 ? 35.575 20.606  39.034  1.00 47.81  ? 196 ILE A O     1 
ATOM   3044 C CB    . ILE E 3 196 ? 33.436 18.411  37.937  1.00 39.28  ? 196 ILE A CB    1 
ATOM   3045 C CG1   . ILE E 3 196 ? 34.554 18.311  36.900  1.00 38.31  ? 196 ILE A CG1   1 
ATOM   3046 C CG2   . ILE E 3 196 ? 32.141 18.064  37.237  1.00 38.57  ? 196 ILE A CG2   1 
ATOM   3047 C CD1   . ILE E 3 196 ? 35.786 17.613  37.394  1.00 34.26  ? 196 ILE A CD1   1 
ATOM   3048 N N     . SER E 3 197 ? 34.411 19.616  40.685  1.00 45.30  ? 197 SER A N     1 
ATOM   3049 C CA    . SER E 3 197 ? 35.496 19.708  41.656  1.00 44.04  ? 197 SER A CA    1 
ATOM   3050 C C     . SER E 3 197 ? 35.863 18.267  41.949  1.00 44.42  ? 197 SER A C     1 
ATOM   3051 O O     . SER E 3 197 ? 35.051 17.505  42.508  1.00 43.52  ? 197 SER A O     1 
ATOM   3052 C CB    . SER E 3 197 ? 35.035 20.393  42.938  1.00 45.21  ? 197 SER A CB    1 
ATOM   3053 O OG    . SER E 3 197 ? 35.991 20.209  43.970  1.00 46.28  ? 197 SER A OG    1 
ATOM   3054 N N     . ALA E 3 198 ? 37.073 17.889  41.548  1.00 43.60  ? 198 ALA A N     1 
ATOM   3055 C CA    . ALA E 3 198 ? 37.549 16.522  41.738  1.00 44.41  ? 198 ALA A CA    1 
ATOM   3056 C C     . ALA E 3 198 ? 38.559 16.392  42.865  1.00 45.15  ? 198 ALA A C     1 
ATOM   3057 O O     . ALA E 3 198 ? 39.593 17.057  42.854  1.00 45.51  ? 198 ALA A O     1 
ATOM   3058 C CB    . ALA E 3 198 ? 38.161 15.994  40.435  1.00 42.45  ? 198 ALA A CB    1 
ATOM   3059 N N     . HIS E 3 199 ? 38.243 15.534  43.833  1.00 45.95  ? 199 HIS A N     1 
ATOM   3060 C CA    . HIS E 3 199 ? 39.118 15.250  44.968  1.00 45.65  ? 199 HIS A CA    1 
ATOM   3061 C C     . HIS E 3 199 ? 39.094 13.769  45.274  1.00 46.09  ? 199 HIS A C     1 
ATOM   3062 O O     . HIS E 3 199 ? 38.218 13.307  46.009  1.00 45.31  ? 199 HIS A O     1 
ATOM   3063 C CB    . HIS E 3 199 ? 38.681 15.986  46.223  1.00 46.94  ? 199 HIS A CB    1 
ATOM   3064 C CG    . HIS E 3 199 ? 39.087 17.424  46.256  1.00 50.16  ? 199 HIS A CG    1 
ATOM   3065 N ND1   . HIS E 3 199 ? 38.308 18.431  45.727  1.00 51.88  ? 199 HIS A ND1   1 
ATOM   3066 C CD2   . HIS E 3 199 ? 40.192 18.024  46.757  1.00 49.33  ? 199 HIS A CD2   1 
ATOM   3067 C CE1   . HIS E 3 199 ? 38.917 19.591  45.905  1.00 52.09  ? 199 HIS A CE1   1 
ATOM   3068 N NE2   . HIS E 3 199 ? 40.061 19.371  46.527  1.00 50.28  ? 199 HIS A NE2   1 
ATOM   3069 N N     . GLY E 3 200 ? 40.052 13.030  44.714  1.00 45.68  ? 200 GLY A N     1 
ATOM   3070 C CA    . GLY E 3 200 ? 40.118 11.602  44.960  1.00 45.61  ? 200 GLY A CA    1 
ATOM   3071 C C     . GLY E 3 200 ? 38.956 10.933  44.271  1.00 46.92  ? 200 GLY A C     1 
ATOM   3072 O O     . GLY E 3 200 ? 38.758 11.152  43.077  1.00 47.87  ? 200 GLY A O     1 
ATOM   3073 N N     . LYS E 3 201 ? 38.193 10.123  45.002  1.00 46.18  ? 201 LYS A N     1 
ATOM   3074 C CA    . LYS E 3 201 ? 37.040 9.446   44.418  1.00 47.08  ? 201 LYS A CA    1 
ATOM   3075 C C     . LYS E 3 201 ? 35.823 10.323  44.539  1.00 46.12  ? 201 LYS A C     1 
ATOM   3076 O O     . LYS E 3 201 ? 34.756 9.991   44.039  1.00 47.72  ? 201 LYS A O     1 
ATOM   3077 C CB    . LYS E 3 201 ? 36.746 8.119   45.127  1.00 48.74  ? 201 LYS A CB    1 
ATOM   3078 C CG    . LYS E 3 201 ? 37.577 6.957   44.640  1.00 53.05  ? 201 LYS A CG    1 
ATOM   3079 C CD    . LYS E 3 201 ? 37.221 5.661   45.353  1.00 56.41  ? 201 LYS A CD    1 
ATOM   3080 C CE    . LYS E 3 201 ? 35.756 5.274   45.167  1.00 58.14  ? 201 LYS A CE    1 
ATOM   3081 N NZ    . LYS E 3 201 ? 35.491 3.914   45.755  1.00 60.02  ? 201 LYS A NZ    1 
ATOM   3082 N N     . THR E 3 202 ? 35.966 11.439  45.231  1.00 44.82  ? 202 THR A N     1 
ATOM   3083 C CA    . THR E 3 202 ? 34.826 12.319  45.400  1.00 42.77  ? 202 THR A CA    1 
ATOM   3084 C C     . THR E 3 202 ? 34.874 13.333  44.285  1.00 40.35  ? 202 THR A C     1 
ATOM   3085 O O     . THR E 3 202 ? 35.880 13.993  44.088  1.00 41.52  ? 202 THR A O     1 
ATOM   3086 C CB    . THR E 3 202 ? 34.859 13.020  46.762  1.00 42.70  ? 202 THR A CB    1 
ATOM   3087 O OG1   . THR E 3 202 ? 34.876 12.028  47.795  1.00 42.33  ? 202 THR A OG1   1 
ATOM   3088 C CG2   . THR E 3 202 ? 33.630 13.906  46.939  1.00 44.79  ? 202 THR A CG2   1 
ATOM   3089 N N     . ILE E 3 203 ? 33.783 13.420  43.541  1.00 36.53  ? 203 ILE A N     1 
ATOM   3090 C CA    . ILE E 3 203 ? 33.676 14.325  42.429  1.00 35.67  ? 203 ILE A CA    1 
ATOM   3091 C C     . ILE E 3 203 ? 32.355 15.037  42.574  1.00 38.96  ? 203 ILE A C     1 
ATOM   3092 O O     . ILE E 3 203 ? 31.307 14.381  42.611  1.00 41.14  ? 203 ILE A O     1 
ATOM   3093 C CB    . ILE E 3 203 ? 33.608 13.581  41.098  1.00 32.19  ? 203 ILE A CB    1 
ATOM   3094 C CG1   . ILE E 3 203 ? 34.938 12.911  40.785  1.00 30.55  ? 203 ILE A CG1   1 
ATOM   3095 C CG2   . ILE E 3 203 ? 33.202 14.543  39.993  1.00 32.26  ? 203 ILE A CG2   1 
ATOM   3096 C CD1   . ILE E 3 203 ? 34.974 12.235  39.392  1.00 27.69  ? 203 ILE A CD1   1 
ATOM   3097 N N     . VAL E 3 204 ? 32.378 16.364  42.648  1.00 40.38  ? 204 VAL A N     1 
ATOM   3098 C CA    . VAL E 3 204 ? 31.121 17.088  42.743  1.00 41.10  ? 204 VAL A CA    1 
ATOM   3099 C C     . VAL E 3 204 ? 30.787 17.656  41.373  1.00 41.76  ? 204 VAL A C     1 
ATOM   3100 O O     . VAL E 3 204 ? 31.607 18.318  40.747  1.00 42.74  ? 204 VAL A O     1 
ATOM   3101 C CB    . VAL E 3 204 ? 31.191 18.251  43.728  1.00 41.76  ? 204 VAL A CB    1 
ATOM   3102 C CG1   . VAL E 3 204 ? 29.783 18.758  43.990  1.00 41.55  ? 204 VAL A CG1   1 
ATOM   3103 C CG2   . VAL E 3 204 ? 31.865 17.822  45.008  1.00 40.94  ? 204 VAL A CG2   1 
ATOM   3104 N N     . VAL E 3 205 ? 29.584 17.385  40.897  1.00 43.08  ? 205 VAL A N     1 
ATOM   3105 C CA    . VAL E 3 205 ? 29.168 17.902  39.609  1.00 42.54  ? 205 VAL A CA    1 
ATOM   3106 C C     . VAL E 3 205 ? 28.302 19.105  39.895  1.00 45.18  ? 205 VAL A C     1 
ATOM   3107 O O     . VAL E 3 205 ? 27.202 18.980  40.455  1.00 46.55  ? 205 VAL A O     1 
ATOM   3108 C CB    . VAL E 3 205 ? 28.368 16.881  38.843  1.00 39.50  ? 205 VAL A CB    1 
ATOM   3109 C CG1   . VAL E 3 205 ? 27.929 17.460  37.527  1.00 39.78  ? 205 VAL A CG1   1 
ATOM   3110 C CG2   . VAL E 3 205 ? 29.211 15.674  38.614  1.00 38.44  ? 205 VAL A CG2   1 
ATOM   3111 N N     . TYR E 3 206 ? 28.823 20.273  39.534  1.00 46.76  ? 206 TYR A N     1 
ATOM   3112 C CA    . TYR E 3 206 ? 28.134 21.539  39.744  1.00 47.43  ? 206 TYR A CA    1 
ATOM   3113 C C     . TYR E 3 206 ? 26.805 21.607  39.010  1.00 50.74  ? 206 TYR A C     1 
ATOM   3114 O O     . TYR E 3 206 ? 26.717 21.271  37.822  1.00 48.22  ? 206 TYR A O     1 
ATOM   3115 C CB    . TYR E 3 206 ? 29.049 22.698  39.331  1.00 40.98  ? 206 TYR A CB    1 
ATOM   3116 C CG    . TYR E 3 206 ? 30.214 22.854  40.282  1.00 36.19  ? 206 TYR A CG    1 
ATOM   3117 C CD1   . TYR E 3 206 ? 29.996 22.864  41.670  1.00 33.87  ? 206 TYR A CD1   1 
ATOM   3118 C CD2   . TYR E 3 206 ? 31.527 22.933  39.818  1.00 31.35  ? 206 TYR A CD2   1 
ATOM   3119 C CE1   . TYR E 3 206 ? 31.056 22.938  42.574  1.00 30.14  ? 206 TYR A CE1   1 
ATOM   3120 C CE2   . TYR E 3 206 ? 32.597 23.006  40.716  1.00 30.14  ? 206 TYR A CE2   1 
ATOM   3121 C CZ    . TYR E 3 206 ? 32.353 23.002  42.101  1.00 29.53  ? 206 TYR A CZ    1 
ATOM   3122 O OH    . TYR E 3 206 ? 33.388 23.017  43.020  1.00 25.22  ? 206 TYR A OH    1 
ATOM   3123 N N     . GLY E 3 207 ? 25.776 22.020  39.751  1.00 55.36  ? 207 GLY A N     1 
ATOM   3124 C CA    . GLY E 3 207 ? 24.437 22.133  39.203  1.00 61.22  ? 207 GLY A CA    1 
ATOM   3125 C C     . GLY E 3 207 ? 24.394 22.962  37.929  1.00 65.41  ? 207 GLY A C     1 
ATOM   3126 O O     . GLY E 3 207 ? 24.521 24.208  38.032  1.00 67.65  ? 207 GLY A O     1 
ATOM   3127 N N     . ASP F 3 8   ? 2.980  -19.051 10.970  1.00 117.01 ? 8   ASP B N     1 
ATOM   3128 C CA    . ASP F 3 8   ? 2.396  -19.790 12.128  1.00 117.95 ? 8   ASP B CA    1 
ATOM   3129 C C     . ASP F 3 8   ? 0.967  -19.301 12.399  1.00 118.07 ? 8   ASP B C     1 
ATOM   3130 O O     . ASP F 3 8   ? 0.433  -18.480 11.652  1.00 118.18 ? 8   ASP B O     1 
ATOM   3131 C CB    . ASP F 3 8   ? 3.258  -19.573 13.378  1.00 118.25 ? 8   ASP B CB    1 
ATOM   3132 C CG    . ASP F 3 8   ? 2.902  -18.292 14.119  1.00 118.30 ? 8   ASP B CG    1 
ATOM   3133 O OD1   . ASP F 3 8   ? 3.109  -17.197 13.556  1.00 118.15 ? 8   ASP B OD1   1 
ATOM   3134 O OD2   . ASP F 3 8   ? 2.407  -18.386 15.263  1.00 117.29 ? 8   ASP B OD2   1 
ATOM   3135 N N     . PRO F 3 9   ? 0.326  -19.812 13.469  1.00 118.02 ? 9   PRO B N     1 
ATOM   3136 C CA    . PRO F 3 9   ? -1.042 -19.401 13.810  1.00 117.45 ? 9   PRO B CA    1 
ATOM   3137 C C     . PRO F 3 9   ? -1.151 -17.967 14.335  1.00 116.69 ? 9   PRO B C     1 
ATOM   3138 O O     . PRO F 3 9   ? -1.716 -17.094 13.675  1.00 116.80 ? 9   PRO B O     1 
ATOM   3139 C CB    . PRO F 3 9   ? -1.455 -20.423 14.870  1.00 117.53 ? 9   PRO B CB    1 
ATOM   3140 C CG    . PRO F 3 9   ? -0.671 -21.638 14.493  1.00 117.97 ? 9   PRO B CG    1 
ATOM   3141 C CD    . PRO F 3 9   ? 0.683  -21.047 14.191  1.00 118.10 ? 9   PRO B CD    1 
ATOM   3142 N N     . THR F 3 10  ? -0.609 -17.738 15.527  1.00 115.44 ? 10  THR B N     1 
ATOM   3143 C CA    . THR F 3 10  ? -0.652 -16.426 16.168  1.00 114.26 ? 10  THR B CA    1 
ATOM   3144 C C     . THR F 3 10  ? -0.271 -15.251 15.267  1.00 113.13 ? 10  THR B C     1 
ATOM   3145 O O     . THR F 3 10  ? -1.107 -14.394 14.979  1.00 112.88 ? 10  THR B O     1 
ATOM   3146 C CB    . THR F 3 10  ? 0.255  -16.399 17.409  1.00 114.53 ? 10  THR B CB    1 
ATOM   3147 O OG1   . THR F 3 10  ? -0.118 -17.467 18.285  1.00 114.76 ? 10  THR B OG1   1 
ATOM   3148 C CG2   . THR F 3 10  ? 0.116  -15.073 18.151  1.00 114.35 ? 10  THR B CG2   1 
ATOM   3149 N N     . LEU F 3 11  ? 0.985  -15.205 14.829  1.00 111.92 ? 11  LEU B N     1 
ATOM   3150 C CA    . LEU F 3 11  ? 1.446  -14.112 13.976  1.00 110.77 ? 11  LEU B CA    1 
ATOM   3151 C C     . LEU F 3 11  ? 0.500  -13.863 12.807  1.00 109.97 ? 11  LEU B C     1 
ATOM   3152 O O     . LEU F 3 11  ? 0.474  -12.770 12.242  1.00 109.57 ? 11  LEU B O     1 
ATOM   3153 C CB    . LEU F 3 11  ? 2.867  -14.385 13.467  1.00 110.20 ? 11  LEU B CB    1 
ATOM   3154 C CG    . LEU F 3 11  ? 3.949  -13.433 13.998  1.00 109.75 ? 11  LEU B CG    1 
ATOM   3155 C CD1   . LEU F 3 11  ? 3.902  -13.381 15.517  1.00 109.31 ? 11  LEU B CD1   1 
ATOM   3156 C CD2   . LEU F 3 11  ? 5.317  -13.890 13.517  1.00 109.22 ? 11  LEU B CD2   1 
ATOM   3157 N N     . GLU F 3 12  ? -0.274 -14.878 12.440  1.00 109.46 ? 12  GLU B N     1 
ATOM   3158 C CA    . GLU F 3 12  ? -1.240 -14.719 11.362  1.00 108.80 ? 12  GLU B CA    1 
ATOM   3159 C C     . GLU F 3 12  ? -2.339 -13.840 11.943  1.00 107.13 ? 12  GLU B C     1 
ATOM   3160 O O     . GLU F 3 12  ? -2.676 -12.793 11.389  1.00 107.20 ? 12  GLU B O     1 
ATOM   3161 C CB    . GLU F 3 12  ? -1.833 -16.070 10.949  1.00 110.27 ? 12  GLU B CB    1 
ATOM   3162 C CG    . GLU F 3 12  ? -2.759 -15.987 9.742   1.00 112.54 ? 12  GLU B CG    1 
ATOM   3163 C CD    . GLU F 3 12  ? -3.859 -14.946 9.911   1.00 113.62 ? 12  GLU B CD    1 
ATOM   3164 O OE1   . GLU F 3 12  ? -4.744 -15.145 10.774  1.00 113.93 ? 12  GLU B OE1   1 
ATOM   3165 O OE2   . GLU F 3 12  ? -3.831 -13.924 9.187   1.00 113.43 ? 12  GLU B OE2   1 
ATOM   3166 N N     . TRP F 3 13  ? -2.893 -14.287 13.068  1.00 104.82 ? 13  TRP B N     1 
ATOM   3167 C CA    . TRP F 3 13  ? -3.948 -13.561 13.764  1.00 102.66 ? 13  TRP B CA    1 
ATOM   3168 C C     . TRP F 3 13  ? -3.580 -12.092 13.913  1.00 101.43 ? 13  TRP B C     1 
ATOM   3169 O O     . TRP F 3 13  ? -4.395 -11.214 13.642  1.00 101.78 ? 13  TRP B O     1 
ATOM   3170 C CB    . TRP F 3 13  ? -4.190 -14.182 15.146  1.00 102.38 ? 13  TRP B CB    1 
ATOM   3171 C CG    . TRP F 3 13  ? -4.988 -13.316 16.079  1.00 101.21 ? 13  TRP B CG    1 
ATOM   3172 C CD1   . TRP F 3 13  ? -6.171 -12.689 15.809  1.00 101.12 ? 13  TRP B CD1   1 
ATOM   3173 C CD2   . TRP F 3 13  ? -4.656 -12.980 17.432  1.00 100.79 ? 13  TRP B CD2   1 
ATOM   3174 N NE1   . TRP F 3 13  ? -6.595 -11.980 16.908  1.00 101.07 ? 13  TRP B NE1   1 
ATOM   3175 C CE2   . TRP F 3 13  ? -5.684 -12.140 17.919  1.00 100.87 ? 13  TRP B CE2   1 
ATOM   3176 C CE3   . TRP F 3 13  ? -3.587 -13.305 18.280  1.00 100.21 ? 13  TRP B CE3   1 
ATOM   3177 C CZ2   . TRP F 3 13  ? -5.675 -11.620 19.221  1.00 100.34 ? 13  TRP B CZ2   1 
ATOM   3178 C CZ3   . TRP F 3 13  ? -3.579 -12.787 19.576  1.00 99.82  ? 13  TRP B CZ3   1 
ATOM   3179 C CH2   . TRP F 3 13  ? -4.618 -11.953 20.031  1.00 99.99  ? 13  TRP B CH2   1 
ATOM   3180 N N     . PHE F 3 14  ? -2.350 -11.834 14.344  1.00 99.53  ? 14  PHE B N     1 
ATOM   3181 C CA    . PHE F 3 14  ? -1.868 -10.472 14.523  1.00 98.10  ? 14  PHE B CA    1 
ATOM   3182 C C     . PHE F 3 14  ? -2.083 -9.625  13.262  1.00 97.18  ? 14  PHE B C     1 
ATOM   3183 O O     . PHE F 3 14  ? -2.797 -8.616  13.280  1.00 95.98  ? 14  PHE B O     1 
ATOM   3184 C CB    . PHE F 3 14  ? -0.377 -10.493 14.887  1.00 97.85  ? 14  PHE B CB    1 
ATOM   3185 C CG    . PHE F 3 14  ? 0.276  -9.139  14.851  1.00 97.42  ? 14  PHE B CG    1 
ATOM   3186 C CD1   . PHE F 3 14  ? -0.043 -8.172  15.793  1.00 97.64  ? 14  PHE B CD1   1 
ATOM   3187 C CD2   . PHE F 3 14  ? 1.180  -8.818  13.847  1.00 97.32  ? 14  PHE B CD2   1 
ATOM   3188 C CE1   . PHE F 3 14  ? 0.529  -6.902  15.734  1.00 97.99  ? 14  PHE B CE1   1 
ATOM   3189 C CE2   . PHE F 3 14  ? 1.755  -7.555  13.780  1.00 97.77  ? 14  PHE B CE2   1 
ATOM   3190 C CZ    . PHE F 3 14  ? 1.428  -6.595  14.726  1.00 98.15  ? 14  PHE B CZ    1 
ATOM   3191 N N     . LEU F 3 15  ? -1.455 -10.050 12.170  1.00 96.54  ? 15  LEU B N     1 
ATOM   3192 C CA    . LEU F 3 15  ? -1.542 -9.353  10.889  1.00 95.43  ? 15  LEU B CA    1 
ATOM   3193 C C     . LEU F 3 15  ? -2.980 -8.949  10.574  1.00 94.07  ? 15  LEU B C     1 
ATOM   3194 O O     . LEU F 3 15  ? -3.232 -7.907  9.963   1.00 93.14  ? 15  LEU B O     1 
ATOM   3195 C CB    . LEU F 3 15  ? -0.992 -10.257 9.777   1.00 95.35  ? 15  LEU B CB    1 
ATOM   3196 C CG    . LEU F 3 15  ? 0.403  -10.846 10.032  1.00 95.16  ? 15  LEU B CG    1 
ATOM   3197 C CD1   . LEU F 3 15  ? 0.708  -11.935 9.023   1.00 94.82  ? 15  LEU B CD1   1 
ATOM   3198 C CD2   . LEU F 3 15  ? 1.441  -9.749  9.964   1.00 95.54  ? 15  LEU B CD2   1 
ATOM   3199 N N     . SER F 3 16  ? -3.917 -9.783  11.009  1.00 93.03  ? 16  SER B N     1 
ATOM   3200 C CA    . SER F 3 16  ? -5.338 -9.555  10.781  1.00 91.76  ? 16  SER B CA    1 
ATOM   3201 C C     . SER F 3 16  ? -5.784 -8.165  11.218  1.00 90.67  ? 16  SER B C     1 
ATOM   3202 O O     . SER F 3 16  ? -6.526 -7.485  10.504  1.00 90.80  ? 16  SER B O     1 
ATOM   3203 C CB    . SER F 3 16  ? -6.154 -10.610 11.533  1.00 91.73  ? 16  SER B CB    1 
ATOM   3204 O OG    . SER F 3 16  ? -5.690 -11.917 11.235  1.00 92.07  ? 16  SER B OG    1 
ATOM   3205 N N     . HIS F 3 17  ? -5.324 -7.743  12.390  1.00 88.98  ? 17  HIS B N     1 
ATOM   3206 C CA    . HIS F 3 17  ? -5.702 -6.446  12.920  1.00 88.02  ? 17  HIS B CA    1 
ATOM   3207 C C     . HIS F 3 17  ? -4.742 -5.348  12.485  1.00 87.50  ? 17  HIS B C     1 
ATOM   3208 O O     . HIS F 3 17  ? -4.854 -4.203  12.922  1.00 86.68  ? 17  HIS B O     1 
ATOM   3209 C CB    . HIS F 3 17  ? -5.772 -6.522  14.445  1.00 87.91  ? 17  HIS B CB    1 
ATOM   3210 C CG    . HIS F 3 17  ? -6.638 -7.635  14.949  1.00 89.27  ? 17  HIS B CG    1 
ATOM   3211 N ND1   . HIS F 3 17  ? -6.463 -8.948  14.562  1.00 89.82  ? 17  HIS B ND1   1 
ATOM   3212 C CD2   . HIS F 3 17  ? -7.675 -7.637  15.822  1.00 89.13  ? 17  HIS B CD2   1 
ATOM   3213 C CE1   . HIS F 3 17  ? -7.353 -9.709  15.174  1.00 89.77  ? 17  HIS B CE1   1 
ATOM   3214 N NE2   . HIS F 3 17  ? -8.100 -8.939  15.945  1.00 89.82  ? 17  HIS B NE2   1 
ATOM   3215 N N     . CYS F 3 18  ? -3.799 -5.693  11.616  1.00 87.69  ? 18  CYS B N     1 
ATOM   3216 C CA    . CYS F 3 18  ? -2.835 -4.706  11.143  1.00 88.19  ? 18  CYS B CA    1 
ATOM   3217 C C     . CYS F 3 18  ? -3.222 -4.072  9.795   1.00 89.90  ? 18  CYS B C     1 
ATOM   3218 O O     . CYS F 3 18  ? -3.543 -4.759  8.817   1.00 89.88  ? 18  CYS B O     1 
ATOM   3219 C CB    . CYS F 3 18  ? -1.420 -5.322  11.066  1.00 86.59  ? 18  CYS B CB    1 
ATOM   3220 S SG    . CYS F 3 18  ? -0.485 -5.420  12.647  1.00 79.87  ? 18  CYS B SG    1 
ATOM   3221 N N     . HIS F 3 19  ? -3.194 -2.744  9.772   1.00 91.33  ? 19  HIS B N     1 
ATOM   3222 C CA    . HIS F 3 19  ? -3.515 -1.958  8.589   1.00 92.69  ? 19  HIS B CA    1 
ATOM   3223 C C     . HIS F 3 19  ? -2.300 -1.986  7.660   1.00 92.27  ? 19  HIS B C     1 
ATOM   3224 O O     . HIS F 3 19  ? -1.603 -0.982  7.508   1.00 92.25  ? 19  HIS B O     1 
ATOM   3225 C CB    . HIS F 3 19  ? -3.812 -0.518  9.016   1.00 96.42  ? 19  HIS B CB    1 
ATOM   3226 C CG    . HIS F 3 19  ? -4.981 0.102   8.314   1.00 100.76 ? 19  HIS B CG    1 
ATOM   3227 N ND1   . HIS F 3 19  ? -4.926 0.534   7.006   1.00 102.60 ? 19  HIS B ND1   1 
ATOM   3228 C CD2   . HIS F 3 19  ? -6.238 0.372   8.747   1.00 101.81 ? 19  HIS B CD2   1 
ATOM   3229 C CE1   . HIS F 3 19  ? -6.096 1.044   6.663   1.00 103.44 ? 19  HIS B CE1   1 
ATOM   3230 N NE2   . HIS F 3 19  ? -6.910 0.957   7.701   1.00 103.72 ? 19  HIS B NE2   1 
ATOM   3231 N N     . ILE F 3 20  ? -2.053 -3.143  7.052   1.00 91.17  ? 20  ILE B N     1 
ATOM   3232 C CA    . ILE F 3 20  ? -0.928 -3.342  6.139   1.00 90.43  ? 20  ILE B CA    1 
ATOM   3233 C C     . ILE F 3 20  ? -0.699 -2.201  5.139   1.00 89.75  ? 20  ILE B C     1 
ATOM   3234 O O     . ILE F 3 20  ? -1.646 -1.647  4.593   1.00 89.21  ? 20  ILE B O     1 
ATOM   3235 C CB    . ILE F 3 20  ? -1.114 -4.647  5.354   1.00 91.13  ? 20  ILE B CB    1 
ATOM   3236 C CG1   . ILE F 3 20  ? 0.047  -4.839  4.383   1.00 91.39  ? 20  ILE B CG1   1 
ATOM   3237 C CG2   . ILE F 3 20  ? -2.452 -4.624  4.620   1.00 91.90  ? 20  ILE B CG2   1 
ATOM   3238 C CD1   . ILE F 3 20  ? 1.378  -5.012  5.065   1.00 92.37  ? 20  ILE B CD1   1 
ATOM   3239 N N     . HIS F 3 21  ? 0.566  -1.865  4.900   1.00 89.76  ? 21  HIS B N     1 
ATOM   3240 C CA    . HIS F 3 21  ? 0.932  -0.790  3.974   1.00 90.37  ? 21  HIS B CA    1 
ATOM   3241 C C     . HIS F 3 21  ? 2.044  -1.170  3.011   1.00 90.11  ? 21  HIS B C     1 
ATOM   3242 O O     . HIS F 3 21  ? 2.451  -2.329  2.923   1.00 90.18  ? 21  HIS B O     1 
ATOM   3243 C CB    . HIS F 3 21  ? 1.383  0.455   4.736   1.00 91.95  ? 21  HIS B CB    1 
ATOM   3244 C CG    . HIS F 3 21  ? 0.258  1.273   5.278   1.00 94.65  ? 21  HIS B CG    1 
ATOM   3245 N ND1   . HIS F 3 21  ? -1.031 0.794   5.378   1.00 96.24  ? 21  HIS B ND1   1 
ATOM   3246 C CD2   . HIS F 3 21  ? 0.234  2.529   5.785   1.00 95.59  ? 21  HIS B CD2   1 
ATOM   3247 C CE1   . HIS F 3 21  ? -1.800 1.718   5.924   1.00 96.97  ? 21  HIS B CE1   1 
ATOM   3248 N NE2   . HIS F 3 21  ? -1.057 2.780   6.181   1.00 97.35  ? 21  HIS B NE2   1 
ATOM   3249 N N     . LYS F 3 22  ? 2.535  -0.164  2.295   1.00 89.23  ? 22  LYS B N     1 
ATOM   3250 C CA    . LYS F 3 22  ? 3.603  -0.349  1.323   1.00 88.58  ? 22  LYS B CA    1 
ATOM   3251 C C     . LYS F 3 22  ? 4.551  0.836   1.359   1.00 86.99  ? 22  LYS B C     1 
ATOM   3252 O O     . LYS F 3 22  ? 4.130  1.989   1.315   1.00 86.84  ? 22  LYS B O     1 
ATOM   3253 C CB    . LYS F 3 22  ? 3.026  -0.508  -0.090  1.00 89.31  ? 22  LYS B CB    1 
ATOM   3254 C CG    . LYS F 3 22  ? 2.681  -1.942  -0.477  1.00 90.50  ? 22  LYS B CG    1 
ATOM   3255 C CD    . LYS F 3 22  ? 3.932  -2.750  -0.804  1.00 92.18  ? 22  LYS B CD    1 
ATOM   3256 C CE    . LYS F 3 22  ? 4.633  -2.213  -2.053  1.00 93.55  ? 22  LYS B CE    1 
ATOM   3257 N NZ    . LYS F 3 22  ? 5.960  -2.860  -2.294  1.00 93.29  ? 22  LYS B NZ    1 
ATOM   3258 N N     . TYR F 3 23  ? 5.837  0.536   1.448   1.00 85.19  ? 23  TYR B N     1 
ATOM   3259 C CA    . TYR F 3 23  ? 6.853  1.564   1.492   1.00 84.19  ? 23  TYR B CA    1 
ATOM   3260 C C     . TYR F 3 23  ? 7.929  1.284   0.447   1.00 84.02  ? 23  TYR B C     1 
ATOM   3261 O O     . TYR F 3 23  ? 8.439  0.167   0.341   1.00 83.36  ? 23  TYR B O     1 
ATOM   3262 C CB    . TYR F 3 23  ? 7.506  1.623   2.878   1.00 83.74  ? 23  TYR B CB    1 
ATOM   3263 C CG    . TYR F 3 23  ? 6.723  2.337   3.970   1.00 82.83  ? 23  TYR B CG    1 
ATOM   3264 C CD1   . TYR F 3 23  ? 5.713  1.685   4.681   1.00 82.39  ? 23  TYR B CD1   1 
ATOM   3265 C CD2   . TYR F 3 23  ? 7.041  3.652   4.334   1.00 82.16  ? 23  TYR B CD2   1 
ATOM   3266 C CE1   . TYR F 3 23  ? 5.043  2.323   5.736   1.00 82.30  ? 23  TYR B CE1   1 
ATOM   3267 C CE2   . TYR F 3 23  ? 6.380  4.299   5.383   1.00 81.30  ? 23  TYR B CE2   1 
ATOM   3268 C CZ    . TYR F 3 23  ? 5.385  3.629   6.082   1.00 81.85  ? 23  TYR B CZ    1 
ATOM   3269 O OH    . TYR F 3 23  ? 4.742  4.257   7.131   1.00 80.79  ? 23  TYR B OH    1 
ATOM   3270 N N     . PRO F 3 24  ? 8.285  2.303   -0.345  1.00 83.95  ? 24  PRO B N     1 
ATOM   3271 C CA    . PRO F 3 24  ? 9.312  2.143   -1.375  1.00 84.13  ? 24  PRO B CA    1 
ATOM   3272 C C     . PRO F 3 24  ? 10.692 2.235   -0.733  1.00 84.30  ? 24  PRO B C     1 
ATOM   3273 O O     . PRO F 3 24  ? 10.821 2.695   0.400   1.00 85.60  ? 24  PRO B O     1 
ATOM   3274 C CB    . PRO F 3 24  ? 9.038  3.317   -2.302  1.00 83.97  ? 24  PRO B CB    1 
ATOM   3275 C CG    . PRO F 3 24  ? 8.641  4.387   -1.339  1.00 84.22  ? 24  PRO B CG    1 
ATOM   3276 C CD    . PRO F 3 24  ? 7.690  3.650   -0.407  1.00 84.01  ? 24  PRO B CD    1 
ATOM   3277 N N     . SER F 3 25  ? 11.721 1.801   -1.449  1.00 83.66  ? 25  SER B N     1 
ATOM   3278 C CA    . SER F 3 25  ? 13.076 1.875   -0.921  1.00 82.16  ? 25  SER B CA    1 
ATOM   3279 C C     . SER F 3 25  ? 13.428 3.339   -0.662  1.00 81.82  ? 25  SER B C     1 
ATOM   3280 O O     . SER F 3 25  ? 12.701 4.239   -1.083  1.00 82.48  ? 25  SER B O     1 
ATOM   3281 C CB    . SER F 3 25  ? 14.058 1.272   -1.917  1.00 82.13  ? 25  SER B CB    1 
ATOM   3282 O OG    . SER F 3 25  ? 15.390 1.515   -1.509  1.00 82.18  ? 25  SER B OG    1 
ATOM   3283 N N     . LYS F 3 26  ? 14.540 3.574   0.029   1.00 80.96  ? 26  LYS B N     1 
ATOM   3284 C CA    . LYS F 3 26  ? 14.988 4.930   0.353   1.00 79.91  ? 26  LYS B CA    1 
ATOM   3285 C C     . LYS F 3 26  ? 13.985 5.738   1.176   1.00 78.60  ? 26  LYS B C     1 
ATOM   3286 O O     . LYS F 3 26  ? 14.308 6.830   1.646   1.00 78.35  ? 26  LYS B O     1 
ATOM   3287 C CB    . LYS F 3 26  ? 15.317 5.720   -0.918  1.00 80.14  ? 26  LYS B CB    1 
ATOM   3288 C CG    . LYS F 3 26  ? 16.739 5.561   -1.435  1.00 81.88  ? 26  LYS B CG    1 
ATOM   3289 C CD    . LYS F 3 26  ? 17.066 6.704   -2.401  1.00 83.86  ? 26  LYS B CD    1 
ATOM   3290 C CE    . LYS F 3 26  ? 18.447 6.578   -3.041  1.00 84.30  ? 26  LYS B CE    1 
ATOM   3291 N NZ    . LYS F 3 26  ? 18.530 5.457   -4.026  1.00 84.76  ? 26  LYS B NZ    1 
ATOM   3292 N N     . SER F 3 27  ? 12.770 5.222   1.343   1.00 76.88  ? 27  SER B N     1 
ATOM   3293 C CA    . SER F 3 27  ? 11.761 5.941   2.113   1.00 74.82  ? 27  SER B CA    1 
ATOM   3294 C C     . SER F 3 27  ? 11.946 5.617   3.587   1.00 74.08  ? 27  SER B C     1 
ATOM   3295 O O     . SER F 3 27  ? 12.301 4.489   3.944   1.00 74.84  ? 27  SER B O     1 
ATOM   3296 C CB    . SER F 3 27  ? 10.348 5.550   1.670   1.00 74.00  ? 27  SER B CB    1 
ATOM   3297 O OG    . SER F 3 27  ? 9.987  4.271   2.156   1.00 73.42  ? 27  SER B OG    1 
ATOM   3298 N N     . THR F 3 28  ? 11.707 6.613   4.435   1.00 71.46  ? 28  THR B N     1 
ATOM   3299 C CA    . THR F 3 28  ? 11.853 6.447   5.872   1.00 68.43  ? 28  THR B CA    1 
ATOM   3300 C C     . THR F 3 28  ? 10.513 6.078   6.509   1.00 66.80  ? 28  THR B C     1 
ATOM   3301 O O     . THR F 3 28  ? 9.482  6.643   6.169   1.00 66.87  ? 28  THR B O     1 
ATOM   3302 C CB    . THR F 3 28  ? 12.372 7.755   6.522   1.00 68.80  ? 28  THR B CB    1 
ATOM   3303 O OG1   . THR F 3 28  ? 11.264 8.539   6.975   1.00 69.72  ? 28  THR B OG1   1 
ATOM   3304 C CG2   . THR F 3 28  ? 13.155 8.585   5.512   1.00 66.86  ? 28  THR B CG2   1 
ATOM   3305 N N     . LEU F 3 29  ? 10.520 5.121   7.427   1.00 65.55  ? 29  LEU B N     1 
ATOM   3306 C CA    . LEU F 3 29  ? 9.289  4.728   8.107   1.00 63.87  ? 29  LEU B CA    1 
ATOM   3307 C C     . LEU F 3 29  ? 9.149  5.467   9.431   1.00 64.22  ? 29  LEU B C     1 
ATOM   3308 O O     . LEU F 3 29  ? 8.049  5.867   9.814   1.00 64.56  ? 29  LEU B O     1 
ATOM   3309 C CB    . LEU F 3 29  ? 9.266  3.227   8.384   1.00 61.24  ? 29  LEU B CB    1 
ATOM   3310 C CG    . LEU F 3 29  ? 9.075  2.296   7.196   1.00 60.72  ? 29  LEU B CG    1 
ATOM   3311 C CD1   . LEU F 3 29  ? 10.254 2.420   6.237   1.00 60.15  ? 29  LEU B CD1   1 
ATOM   3312 C CD2   . LEU F 3 29  ? 8.923  0.877   7.708   1.00 59.35  ? 29  LEU B CD2   1 
ATOM   3313 N N     . ILE F 3 30  ? 10.265 5.637   10.134  1.00 64.07  ? 30  ILE B N     1 
ATOM   3314 C CA    . ILE F 3 30  ? 10.248 6.317   11.418  1.00 64.20  ? 30  ILE B CA    1 
ATOM   3315 C C     . ILE F 3 30  ? 11.177 7.517   11.419  1.00 65.43  ? 30  ILE B C     1 
ATOM   3316 O O     . ILE F 3 30  ? 12.277 7.461   10.864  1.00 65.95  ? 30  ILE B O     1 
ATOM   3317 C CB    . ILE F 3 30  ? 10.680 5.372   12.566  1.00 63.27  ? 30  ILE B CB    1 
ATOM   3318 C CG1   . ILE F 3 30  ? 9.583  4.352   12.884  1.00 62.47  ? 30  ILE B CG1   1 
ATOM   3319 C CG2   . ILE F 3 30  ? 10.965 6.174   13.804  1.00 63.83  ? 30  ILE B CG2   1 
ATOM   3320 C CD1   . ILE F 3 30  ? 9.539  3.163   11.968  1.00 61.92  ? 30  ILE B CD1   1 
ATOM   3321 N N     . HIS F 3 31  ? 10.722 8.600   12.040  1.00 66.01  ? 31  HIS B N     1 
ATOM   3322 C CA    . HIS F 3 31  ? 11.505 9.824   12.146  1.00 67.52  ? 31  HIS B CA    1 
ATOM   3323 C C     . HIS F 3 31  ? 11.914 9.971   13.593  1.00 67.19  ? 31  HIS B C     1 
ATOM   3324 O O     . HIS F 3 31  ? 11.072 10.166  14.475  1.00 68.06  ? 31  HIS B O     1 
ATOM   3325 C CB    . HIS F 3 31  ? 10.681 11.053  11.758  1.00 71.67  ? 31  HIS B CB    1 
ATOM   3326 C CG    . HIS F 3 31  ? 10.486 11.222  10.283  1.00 76.61  ? 31  HIS B CG    1 
ATOM   3327 N ND1   . HIS F 3 31  ? 11.366 11.934  9.493   1.00 77.25  ? 31  HIS B ND1   1 
ATOM   3328 C CD2   . HIS F 3 31  ? 9.515  10.766  9.453   1.00 76.44  ? 31  HIS B CD2   1 
ATOM   3329 C CE1   . HIS F 3 31  ? 10.943 11.910  8.240   1.00 77.38  ? 31  HIS B CE1   1 
ATOM   3330 N NE2   . HIS F 3 31  ? 9.823  11.208  8.189   1.00 77.01  ? 31  HIS B NE2   1 
ATOM   3331 N N     . GLN F 3 32  ? 13.212 9.884   13.837  1.00 65.56  ? 32  GLN B N     1 
ATOM   3332 C CA    . GLN F 3 32  ? 13.727 10.018  15.183  1.00 63.88  ? 32  GLN B CA    1 
ATOM   3333 C C     . GLN F 3 32  ? 13.163 11.302  15.801  1.00 62.02  ? 32  GLN B C     1 
ATOM   3334 O O     . GLN F 3 32  ? 13.175 12.349  15.168  1.00 61.82  ? 32  GLN B O     1 
ATOM   3335 C CB    . GLN F 3 32  ? 15.256 10.084  15.132  1.00 63.36  ? 32  GLN B CB    1 
ATOM   3336 C CG    . GLN F 3 32  ? 15.951 9.726   16.438  1.00 64.50  ? 32  GLN B CG    1 
ATOM   3337 C CD    . GLN F 3 32  ? 16.895 10.814  16.919  1.00 65.48  ? 32  GLN B CD    1 
ATOM   3338 O OE1   . GLN F 3 32  ? 16.465 11.926  17.218  1.00 66.25  ? 32  GLN B OE1   1 
ATOM   3339 N NE2   . GLN F 3 32  ? 18.188 10.498  16.995  1.00 65.35  ? 32  GLN B NE2   1 
ATOM   3340 N N     . GLY F 3 33  ? 12.639 11.216  17.017  1.00 59.68  ? 33  GLY B N     1 
ATOM   3341 C CA    . GLY F 3 33  ? 12.139 12.412  17.668  1.00 58.90  ? 33  GLY B CA    1 
ATOM   3342 C C     . GLY F 3 33  ? 10.645 12.645  17.701  1.00 59.27  ? 33  GLY B C     1 
ATOM   3343 O O     . GLY F 3 33  ? 10.158 13.421  18.522  1.00 57.26  ? 33  GLY B O     1 
ATOM   3344 N N     . GLU F 3 34  ? 9.915  11.996  16.805  1.00 59.92  ? 34  GLU B N     1 
ATOM   3345 C CA    . GLU F 3 34  ? 8.471  12.144  16.774  1.00 60.73  ? 34  GLU B CA    1 
ATOM   3346 C C     . GLU F 3 34  ? 7.787  11.285  17.835  1.00 61.06  ? 34  GLU B C     1 
ATOM   3347 O O     . GLU F 3 34  ? 8.381  10.356  18.388  1.00 59.73  ? 34  GLU B O     1 
ATOM   3348 C CB    . GLU F 3 34  ? 7.946  11.753  15.406  1.00 62.48  ? 34  GLU B CB    1 
ATOM   3349 C CG    . GLU F 3 34  ? 8.411  12.660  14.296  1.00 67.21  ? 34  GLU B CG    1 
ATOM   3350 C CD    . GLU F 3 34  ? 7.706  12.358  12.985  1.00 70.31  ? 34  GLU B CD    1 
ATOM   3351 O OE1   . GLU F 3 34  ? 8.037  11.329  12.345  1.00 70.94  ? 34  GLU B OE1   1 
ATOM   3352 O OE2   . GLU F 3 34  ? 6.805  13.146  12.606  1.00 70.67  ? 34  GLU B OE2   1 
ATOM   3353 N N     . LYS F 3 35  ? 6.531  11.606  18.122  1.00 61.67  ? 35  LYS B N     1 
ATOM   3354 C CA    . LYS F 3 35  ? 5.769  10.845  19.094  1.00 62.22  ? 35  LYS B CA    1 
ATOM   3355 C C     . LYS F 3 35  ? 5.579  9.445   18.517  1.00 62.73  ? 35  LYS B C     1 
ATOM   3356 O O     . LYS F 3 35  ? 5.318  9.279   17.324  1.00 62.91  ? 35  LYS B O     1 
ATOM   3357 C CB    . LYS F 3 35  ? 4.399  11.490  19.333  1.00 63.77  ? 35  LYS B CB    1 
ATOM   3358 C CG    . LYS F 3 35  ? 4.404  12.755  20.184  1.00 67.55  ? 35  LYS B CG    1 
ATOM   3359 C CD    . LYS F 3 35  ? 4.606  12.435  21.662  1.00 72.52  ? 35  LYS B CD    1 
ATOM   3360 C CE    . LYS F 3 35  ? 4.839  13.701  22.497  1.00 74.25  ? 35  LYS B CE    1 
ATOM   3361 N NZ    . LYS F 3 35  ? 5.116  13.413  23.948  1.00 73.89  ? 35  LYS B NZ    1 
ATOM   3362 N N     . ALA F 3 36  ? 5.733  8.430   19.352  1.00 62.51  ? 36  ALA B N     1 
ATOM   3363 C CA    . ALA F 3 36  ? 5.536  7.074   18.877  1.00 61.75  ? 36  ALA B CA    1 
ATOM   3364 C C     . ALA F 3 36  ? 4.183  6.632   19.397  1.00 61.20  ? 36  ALA B C     1 
ATOM   3365 O O     . ALA F 3 36  ? 3.889  6.780   20.588  1.00 58.82  ? 36  ALA B O     1 
ATOM   3366 C CB    . ALA F 3 36  ? 6.625  6.163   19.394  1.00 61.82  ? 36  ALA B CB    1 
ATOM   3367 N N     . GLU F 3 37  ? 3.355  6.117   18.490  1.00 61.16  ? 37  GLU B N     1 
ATOM   3368 C CA    . GLU F 3 37  ? 2.022  5.650   18.842  1.00 61.16  ? 37  GLU B CA    1 
ATOM   3369 C C     . GLU F 3 37  ? 1.667  4.470   17.961  1.00 59.75  ? 37  GLU B C     1 
ATOM   3370 O O     . GLU F 3 37  ? 0.590  3.894   18.084  1.00 59.58  ? 37  GLU B O     1 
ATOM   3371 C CB    . GLU F 3 37  ? 1.010  6.769   18.629  1.00 64.18  ? 37  GLU B CB    1 
ATOM   3372 C CG    . GLU F 3 37  ? 1.484  8.117   19.148  1.00 70.03  ? 37  GLU B CG    1 
ATOM   3373 C CD    . GLU F 3 37  ? 0.527  9.256   18.824  1.00 74.53  ? 37  GLU B CD    1 
ATOM   3374 O OE1   . GLU F 3 37  ? 0.921  10.429  19.048  1.00 76.47  ? 37  GLU B OE1   1 
ATOM   3375 O OE2   . GLU F 3 37  ? -0.611 8.984   18.353  1.00 76.16  ? 37  GLU B OE2   1 
ATOM   3376 N N     . THR F 3 38  ? 2.602  4.104   17.090  1.00 58.86  ? 38  THR B N     1 
ATOM   3377 C CA    . THR F 3 38  ? 2.409  3.019   16.137  1.00 56.88  ? 38  THR B CA    1 
ATOM   3378 C C     . THR F 3 38  ? 3.472  1.928   16.251  1.00 56.49  ? 38  THR B C     1 
ATOM   3379 O O     . THR F 3 38  ? 4.637  2.201   16.509  1.00 56.30  ? 38  THR B O     1 
ATOM   3380 C CB    . THR F 3 38  ? 2.446  3.578   14.699  1.00 56.20  ? 38  THR B CB    1 
ATOM   3381 O OG1   . THR F 3 38  ? 1.628  4.744   14.636  1.00 54.20  ? 38  THR B OG1   1 
ATOM   3382 C CG2   . THR F 3 38  ? 1.938  2.557   13.692  1.00 55.65  ? 38  THR B CG2   1 
ATOM   3383 N N     . LEU F 3 39  ? 3.053  0.688   16.042  1.00 56.26  ? 39  LEU B N     1 
ATOM   3384 C CA    . LEU F 3 39  ? 3.951  -0.455  16.089  1.00 55.41  ? 39  LEU B CA    1 
ATOM   3385 C C     . LEU F 3 39  ? 3.932  -1.067  14.704  1.00 57.56  ? 39  LEU B C     1 
ATOM   3386 O O     . LEU F 3 39  ? 2.861  -1.348  14.157  1.00 58.44  ? 39  LEU B O     1 
ATOM   3387 C CB    . LEU F 3 39  ? 3.454  -1.498  17.083  1.00 52.32  ? 39  LEU B CB    1 
ATOM   3388 C CG    . LEU F 3 39  ? 4.052  -2.877  16.819  1.00 48.48  ? 39  LEU B CG    1 
ATOM   3389 C CD1   . LEU F 3 39  ? 5.551  -2.768  17.004  1.00 48.95  ? 39  LEU B CD1   1 
ATOM   3390 C CD2   . LEU F 3 39  ? 3.473  -3.925  17.747  1.00 46.86  ? 39  LEU B CD2   1 
ATOM   3391 N N     . TYR F 3 40  ? 5.112  -1.290  14.141  1.00 58.55  ? 40  TYR B N     1 
ATOM   3392 C CA    . TYR F 3 40  ? 5.200  -1.858  12.813  1.00 58.73  ? 40  TYR B CA    1 
ATOM   3393 C C     . TYR F 3 40  ? 5.607  -3.321  12.808  1.00 59.73  ? 40  TYR B C     1 
ATOM   3394 O O     . TYR F 3 40  ? 5.985  -3.890  13.836  1.00 58.74  ? 40  TYR B O     1 
ATOM   3395 C CB    . TYR F 3 40  ? 6.180  -1.047  11.973  1.00 61.02  ? 40  TYR B CB    1 
ATOM   3396 C CG    . TYR F 3 40  ? 5.814  0.422   11.845  1.00 63.63  ? 40  TYR B CG    1 
ATOM   3397 C CD1   . TYR F 3 40  ? 5.898  1.281   12.938  1.00 64.55  ? 40  TYR B CD1   1 
ATOM   3398 C CD2   . TYR F 3 40  ? 5.372  0.946   10.630  1.00 64.79  ? 40  TYR B CD2   1 
ATOM   3399 C CE1   . TYR F 3 40  ? 5.550  2.625   12.829  1.00 66.96  ? 40  TYR B CE1   1 
ATOM   3400 C CE2   . TYR F 3 40  ? 5.021  2.286   10.508  1.00 66.94  ? 40  TYR B CE2   1 
ATOM   3401 C CZ    . TYR F 3 40  ? 5.110  3.121   11.611  1.00 68.00  ? 40  TYR B CZ    1 
ATOM   3402 O OH    . TYR F 3 40  ? 4.757  4.447   11.493  1.00 68.50  ? 40  TYR B OH    1 
ATOM   3403 N N     . TYR F 3 41  ? 5.497  -3.925  11.630  1.00 61.10  ? 41  TYR B N     1 
ATOM   3404 C CA    . TYR F 3 41  ? 5.862  -5.318  11.407  1.00 62.09  ? 41  TYR B CA    1 
ATOM   3405 C C     . TYR F 3 41  ? 6.149  -5.462  9.927   1.00 62.72  ? 41  TYR B C     1 
ATOM   3406 O O     . TYR F 3 41  ? 5.276  -5.238  9.098   1.00 63.91  ? 41  TYR B O     1 
ATOM   3407 C CB    . TYR F 3 41  ? 4.729  -6.258  11.803  1.00 62.44  ? 41  TYR B CB    1 
ATOM   3408 C CG    . TYR F 3 41  ? 5.058  -7.719  11.597  1.00 62.40  ? 41  TYR B CG    1 
ATOM   3409 C CD1   . TYR F 3 41  ? 5.170  -8.262  10.313  1.00 61.70  ? 41  TYR B CD1   1 
ATOM   3410 C CD2   . TYR F 3 41  ? 5.260  -8.562  12.690  1.00 63.52  ? 41  TYR B CD2   1 
ATOM   3411 C CE1   . TYR F 3 41  ? 5.474  -9.612  10.126  1.00 61.59  ? 41  TYR B CE1   1 
ATOM   3412 C CE2   . TYR F 3 41  ? 5.565  -9.914  12.516  1.00 63.11  ? 41  TYR B CE2   1 
ATOM   3413 C CZ    . TYR F 3 41  ? 5.669  -10.431 11.234  1.00 62.57  ? 41  TYR B CZ    1 
ATOM   3414 O OH    . TYR F 3 41  ? 5.955  -11.769 11.080  1.00 61.96  ? 41  TYR B OH    1 
ATOM   3415 N N     . ILE F 3 42  ? 7.382  -5.831  9.610   1.00 64.09  ? 42  ILE B N     1 
ATOM   3416 C CA    . ILE F 3 42  ? 7.832  -5.997  8.235   1.00 65.29  ? 42  ILE B CA    1 
ATOM   3417 C C     . ILE F 3 42  ? 7.376  -7.317  7.637   1.00 66.76  ? 42  ILE B C     1 
ATOM   3418 O O     . ILE F 3 42  ? 7.972  -8.365  7.910   1.00 67.40  ? 42  ILE B O     1 
ATOM   3419 C CB    . ILE F 3 42  ? 9.372  -5.911  8.163   1.00 64.76  ? 42  ILE B CB    1 
ATOM   3420 C CG1   . ILE F 3 42  ? 9.806  -4.462  8.360   1.00 63.06  ? 42  ILE B CG1   1 
ATOM   3421 C CG2   . ILE F 3 42  ? 9.882  -6.464  6.842   1.00 63.97  ? 42  ILE B CG2   1 
ATOM   3422 C CD1   . ILE F 3 42  ? 11.273 -4.304  8.494   1.00 63.17  ? 42  ILE B CD1   1 
ATOM   3423 N N     . VAL F 3 43  ? 6.322  -7.253  6.819   1.00 67.84  ? 43  VAL B N     1 
ATOM   3424 C CA    . VAL F 3 43  ? 5.773  -8.437  6.162   1.00 68.54  ? 43  VAL B CA    1 
ATOM   3425 C C     . VAL F 3 43  ? 6.750  -8.868  5.082   1.00 69.11  ? 43  VAL B C     1 
ATOM   3426 O O     . VAL F 3 43  ? 7.022  -10.057 4.917   1.00 67.47  ? 43  VAL B O     1 
ATOM   3427 C CB    . VAL F 3 43  ? 4.413  -8.147  5.503   1.00 69.03  ? 43  VAL B CB    1 
ATOM   3428 C CG1   . VAL F 3 43  ? 3.804  -9.440  5.003   1.00 68.79  ? 43  VAL B CG1   1 
ATOM   3429 C CG2   . VAL F 3 43  ? 3.481  -7.477  6.491   1.00 69.54  ? 43  VAL B CG2   1 
ATOM   3430 N N     . LYS F 3 44  ? 7.266  -7.887  4.346   1.00 70.06  ? 44  LYS B N     1 
ATOM   3431 C CA    . LYS F 3 44  ? 8.238  -8.143  3.297   1.00 71.72  ? 44  LYS B CA    1 
ATOM   3432 C C     . LYS F 3 44  ? 9.101  -6.917  3.070   1.00 71.68  ? 44  LYS B C     1 
ATOM   3433 O O     . LYS F 3 44  ? 8.621  -5.777  3.098   1.00 69.69  ? 44  LYS B O     1 
ATOM   3434 C CB    . LYS F 3 44  ? 7.561  -8.526  1.975   1.00 75.71  ? 44  LYS B CB    1 
ATOM   3435 C CG    . LYS F 3 44  ? 8.578  -8.807  0.868   1.00 77.67  ? 44  LYS B CG    1 
ATOM   3436 C CD    . LYS F 3 44  ? 7.952  -9.272  -0.436  1.00 80.75  ? 44  LYS B CD    1 
ATOM   3437 C CE    . LYS F 3 44  ? 9.050  -9.625  -1.452  1.00 82.28  ? 44  LYS B CE    1 
ATOM   3438 N NZ    . LYS F 3 44  ? 8.527  -10.013 -2.799  1.00 83.34  ? 44  LYS B NZ    1 
ATOM   3439 N N     . GLY F 3 45  ? 10.383 -7.171  2.829   1.00 71.62  ? 45  GLY B N     1 
ATOM   3440 C CA    . GLY F 3 45  ? 11.329 -6.098  2.607   1.00 70.90  ? 45  GLY B CA    1 
ATOM   3441 C C     . GLY F 3 45  ? 12.359 -6.083  3.720   1.00 70.81  ? 45  GLY B C     1 
ATOM   3442 O O     . GLY F 3 45  ? 12.430 -7.001  4.544   1.00 69.34  ? 45  GLY B O     1 
ATOM   3443 N N     . SER F 3 46  ? 13.161 -5.029  3.746   1.00 70.83  ? 46  SER B N     1 
ATOM   3444 C CA    . SER F 3 46  ? 14.190 -4.892  4.763   1.00 70.71  ? 46  SER B CA    1 
ATOM   3445 C C     . SER F 3 46  ? 14.443 -3.416  5.018   1.00 68.43  ? 46  SER B C     1 
ATOM   3446 O O     . SER F 3 46  ? 14.324 -2.585  4.110   1.00 67.99  ? 46  SER B O     1 
ATOM   3447 C CB    . SER F 3 46  ? 15.486 -5.571  4.301   1.00 72.83  ? 46  SER B CB    1 
ATOM   3448 O OG    . SER F 3 46  ? 16.027 -4.908  3.167   1.00 75.10  ? 46  SER B OG    1 
ATOM   3449 N N     . VAL F 3 47  ? 14.788 -3.094  6.259   1.00 65.73  ? 47  VAL B N     1 
ATOM   3450 C CA    . VAL F 3 47  ? 15.054 -1.713  6.631   1.00 63.53  ? 47  VAL B CA    1 
ATOM   3451 C C     . VAL F 3 47  ? 16.356 -1.621  7.398   1.00 62.19  ? 47  VAL B C     1 
ATOM   3452 O O     . VAL F 3 47  ? 16.926 -2.631  7.827   1.00 61.59  ? 47  VAL B O     1 
ATOM   3453 C CB    . VAL F 3 47  ? 13.931 -1.135  7.538   1.00 63.69  ? 47  VAL B CB    1 
ATOM   3454 C CG1   . VAL F 3 47  ? 12.672 -0.835  6.724   1.00 61.89  ? 47  VAL B CG1   1 
ATOM   3455 C CG2   . VAL F 3 47  ? 13.622 -2.123  8.655   1.00 61.03  ? 47  VAL B CG2   1 
ATOM   3456 N N     . ALA F 3 48  ? 16.817 -0.393  7.573   1.00 60.13  ? 48  ALA B N     1 
ATOM   3457 C CA    . ALA F 3 48  ? 18.035 -0.138  8.315   1.00 57.64  ? 48  ALA B CA    1 
ATOM   3458 C C     . ALA F 3 48  ? 17.650 0.827   9.422   1.00 57.25  ? 48  ALA B C     1 
ATOM   3459 O O     . ALA F 3 48  ? 16.981 1.825   9.166   1.00 57.57  ? 48  ALA B O     1 
ATOM   3460 C CB    . ALA F 3 48  ? 19.081 0.487   7.408   1.00 54.58  ? 48  ALA B CB    1 
ATOM   3461 N N     . VAL F 3 49  ? 18.020 0.509   10.658  1.00 57.16  ? 49  VAL B N     1 
ATOM   3462 C CA    . VAL F 3 49  ? 17.736 1.401   11.781  1.00 56.92  ? 49  VAL B CA    1 
ATOM   3463 C C     . VAL F 3 49  ? 19.016 2.220   11.890  1.00 56.14  ? 49  VAL B C     1 
ATOM   3464 O O     . VAL F 3 49  ? 20.103 1.652   11.966  1.00 57.83  ? 49  VAL B O     1 
ATOM   3465 C CB    . VAL F 3 49  ? 17.514 0.617   13.094  1.00 58.13  ? 49  VAL B CB    1 
ATOM   3466 C CG1   . VAL F 3 49  ? 17.107 1.566   14.208  1.00 58.45  ? 49  VAL B CG1   1 
ATOM   3467 C CG2   . VAL F 3 49  ? 16.440 -0.449  12.894  1.00 59.58  ? 49  VAL B CG2   1 
ATOM   3468 N N     . LEU F 3 50  ? 18.913 3.540   11.885  1.00 54.20  ? 50  LEU B N     1 
ATOM   3469 C CA    . LEU F 3 50  ? 20.123 4.341   11.948  1.00 54.45  ? 50  LEU B CA    1 
ATOM   3470 C C     . LEU F 3 50  ? 19.972 5.627   12.752  1.00 55.04  ? 50  LEU B C     1 
ATOM   3471 O O     . LEU F 3 50  ? 18.869 6.134   12.924  1.00 55.14  ? 50  LEU B O     1 
ATOM   3472 C CB    . LEU F 3 50  ? 20.576 4.648   10.528  1.00 54.51  ? 50  LEU B CB    1 
ATOM   3473 C CG    . LEU F 3 50  ? 19.598 5.480   9.703   1.00 53.96  ? 50  LEU B CG    1 
ATOM   3474 C CD1   . LEU F 3 50  ? 19.803 6.954   10.025  1.00 54.15  ? 50  LEU B CD1   1 
ATOM   3475 C CD2   . LEU F 3 50  ? 19.830 5.235   8.232   1.00 54.22  ? 50  LEU B CD2   1 
ATOM   3476 N N     . ILE F 3 51  ? 21.090 6.152   13.241  1.00 55.56  ? 51  ILE B N     1 
ATOM   3477 C CA    . ILE F 3 51  ? 21.069 7.369   14.046  1.00 57.72  ? 51  ILE B CA    1 
ATOM   3478 C C     . ILE F 3 51  ? 22.034 8.371   13.449  1.00 60.14  ? 51  ILE B C     1 
ATOM   3479 O O     . ILE F 3 51  ? 22.975 7.979   12.768  1.00 62.13  ? 51  ILE B O     1 
ATOM   3480 C CB    . ILE F 3 51  ? 21.486 7.081   15.505  1.00 55.96  ? 51  ILE B CB    1 
ATOM   3481 C CG1   . ILE F 3 51  ? 22.829 6.354   15.511  1.00 56.22  ? 51  ILE B CG1   1 
ATOM   3482 C CG2   . ILE F 3 51  ? 20.426 6.252   16.205  1.00 52.75  ? 51  ILE B CG2   1 
ATOM   3483 C CD1   . ILE F 3 51  ? 23.315 5.956   16.884  1.00 56.79  ? 51  ILE B CD1   1 
ATOM   3484 N N     . LYS F 3 52  ? 21.811 9.656   13.707  1.00 62.06  ? 52  LYS B N     1 
ATOM   3485 C CA    . LYS F 3 52  ? 22.675 10.686  13.157  1.00 65.25  ? 52  LYS B CA    1 
ATOM   3486 C C     . LYS F 3 52  ? 23.342 11.520  14.233  1.00 68.51  ? 52  LYS B C     1 
ATOM   3487 O O     . LYS F 3 52  ? 22.821 11.674  15.329  1.00 68.83  ? 52  LYS B O     1 
ATOM   3488 C CB    . LYS F 3 52  ? 21.869 11.602  12.243  1.00 65.96  ? 52  LYS B CB    1 
ATOM   3489 C CG    . LYS F 3 52  ? 21.067 10.867  11.179  1.00 68.64  ? 52  LYS B CG    1 
ATOM   3490 C CD    . LYS F 3 52  ? 20.070 11.805  10.499  1.00 71.54  ? 52  LYS B CD    1 
ATOM   3491 C CE    . LYS F 3 52  ? 19.094 11.032  9.599   1.00 74.25  ? 52  LYS B CE    1 
ATOM   3492 N NZ    . LYS F 3 52  ? 17.929 11.862  9.128   1.00 74.23  ? 52  LYS B NZ    1 
ATOM   3493 N N     . ASP F 3 53  ? 24.510 12.060  13.914  1.00 73.02  ? 53  ASP B N     1 
ATOM   3494 C CA    . ASP F 3 53  ? 25.229 12.897  14.858  1.00 77.25  ? 53  ASP B CA    1 
ATOM   3495 C C     . ASP F 3 53  ? 24.627 14.287  14.743  1.00 79.68  ? 53  ASP B C     1 
ATOM   3496 O O     . ASP F 3 53  ? 23.609 14.468  14.071  1.00 80.41  ? 53  ASP B O     1 
ATOM   3497 C CB    . ASP F 3 53  ? 26.723 12.942  14.519  1.00 79.30  ? 53  ASP B CB    1 
ATOM   3498 C CG    . ASP F 3 53  ? 27.003 13.611  13.182  1.00 80.97  ? 53  ASP B CG    1 
ATOM   3499 O OD1   . ASP F 3 53  ? 28.189 13.713  12.804  1.00 81.12  ? 53  ASP B OD1   1 
ATOM   3500 O OD2   . ASP F 3 53  ? 26.042 14.035  12.506  1.00 82.87  ? 53  ASP B OD2   1 
ATOM   3501 N N     . GLU F 3 54  ? 25.266 15.266  15.376  1.00 82.69  ? 54  GLU B N     1 
ATOM   3502 C CA    . GLU F 3 54  ? 24.778 16.644  15.359  1.00 85.01  ? 54  GLU B CA    1 
ATOM   3503 C C     . GLU F 3 54  ? 24.809 17.255  13.966  1.00 85.04  ? 54  GLU B C     1 
ATOM   3504 O O     . GLU F 3 54  ? 23.986 18.114  13.649  1.00 85.48  ? 54  GLU B O     1 
ATOM   3505 C CB    . GLU F 3 54  ? 25.603 17.523  16.318  1.00 87.50  ? 54  GLU B CB    1 
ATOM   3506 C CG    . GLU F 3 54  ? 27.090 17.688  15.939  1.00 91.65  ? 54  GLU B CG    1 
ATOM   3507 C CD    . GLU F 3 54  ? 27.936 16.433  16.197  1.00 94.90  ? 54  GLU B CD    1 
ATOM   3508 O OE1   . GLU F 3 54  ? 28.203 16.120  17.384  1.00 95.57  ? 54  GLU B OE1   1 
ATOM   3509 O OE2   . GLU F 3 54  ? 28.331 15.758  15.214  1.00 94.59  ? 54  GLU B OE2   1 
ATOM   3510 N N     . GLU F 3 55  ? 25.741 16.796  13.133  1.00 84.88  ? 55  GLU B N     1 
ATOM   3511 C CA    . GLU F 3 55  ? 25.898 17.330  11.783  1.00 84.90  ? 55  GLU B CA    1 
ATOM   3512 C C     . GLU F 3 55  ? 25.546 16.405  10.621  1.00 83.32  ? 55  GLU B C     1 
ATOM   3513 O O     . GLU F 3 55  ? 26.082 16.575  9.528   1.00 83.81  ? 55  GLU B O     1 
ATOM   3514 C CB    . GLU F 3 55  ? 27.335 17.816  11.588  1.00 87.72  ? 55  GLU B CB    1 
ATOM   3515 C CG    . GLU F 3 55  ? 27.744 18.960  12.505  1.00 92.33  ? 55  GLU B CG    1 
ATOM   3516 C CD    . GLU F 3 55  ? 29.219 18.898  12.894  1.00 95.57  ? 55  GLU B CD    1 
ATOM   3517 O OE1   . GLU F 3 55  ? 30.082 18.861  11.983  1.00 95.74  ? 55  GLU B OE1   1 
ATOM   3518 O OE2   . GLU F 3 55  ? 29.511 18.884  14.117  1.00 97.23  ? 55  GLU B OE2   1 
ATOM   3519 N N     . GLY F 3 56  ? 24.672 15.426  10.833  1.00 81.07  ? 56  GLY B N     1 
ATOM   3520 C CA    . GLY F 3 56  ? 24.309 14.558  9.725   1.00 78.10  ? 56  GLY B CA    1 
ATOM   3521 C C     . GLY F 3 56  ? 24.889 13.157  9.653   1.00 76.72  ? 56  GLY B C     1 
ATOM   3522 O O     . GLY F 3 56  ? 24.218 12.253  9.157   1.00 76.81  ? 56  GLY B O     1 
ATOM   3523 N N     . LYS F 3 57  ? 26.122 12.959  10.114  1.00 75.38  ? 57  LYS B N     1 
ATOM   3524 C CA    . LYS F 3 57  ? 26.738 11.627  10.081  1.00 74.68  ? 57  LYS B CA    1 
ATOM   3525 C C     . LYS F 3 57  ? 25.742 10.540  10.488  1.00 73.61  ? 57  LYS B C     1 
ATOM   3526 O O     . LYS F 3 57  ? 24.939 10.732  11.398  1.00 73.79  ? 57  LYS B O     1 
ATOM   3527 C CB    . LYS F 3 57  ? 27.944 11.559  11.024  1.00 75.48  ? 57  LYS B CB    1 
ATOM   3528 C CG    . LYS F 3 57  ? 29.242 12.123  10.470  1.00 75.91  ? 57  LYS B CG    1 
ATOM   3529 C CD    . LYS F 3 57  ? 30.286 11.021  10.321  1.00 76.82  ? 57  LYS B CD    1 
ATOM   3530 C CE    . LYS F 3 57  ? 30.723 10.458  11.668  1.00 77.37  ? 57  LYS B CE    1 
ATOM   3531 N NZ    . LYS F 3 57  ? 31.621 9.271   11.534  1.00 76.80  ? 57  LYS B NZ    1 
ATOM   3532 N N     . GLU F 3 58  ? 25.802 9.393   9.824   1.00 71.80  ? 58  GLU B N     1 
ATOM   3533 C CA    . GLU F 3 58  ? 24.900 8.300   10.148  1.00 69.46  ? 58  GLU B CA    1 
ATOM   3534 C C     . GLU F 3 58  ? 25.631 7.100   10.755  1.00 68.22  ? 58  GLU B C     1 
ATOM   3535 O O     . GLU F 3 58  ? 26.824 6.900   10.542  1.00 68.64  ? 58  GLU B O     1 
ATOM   3536 C CB    . GLU F 3 58  ? 24.138 7.875   8.897   1.00 70.04  ? 58  GLU B CB    1 
ATOM   3537 C CG    . GLU F 3 58  ? 23.521 9.041   8.137   1.00 70.79  ? 58  GLU B CG    1 
ATOM   3538 C CD    . GLU F 3 58  ? 22.426 8.599   7.177   1.00 71.85  ? 58  GLU B CD    1 
ATOM   3539 O OE1   . GLU F 3 58  ? 22.542 7.487   6.603   1.00 70.96  ? 58  GLU B OE1   1 
ATOM   3540 O OE2   . GLU F 3 58  ? 21.455 9.371   6.994   1.00 71.53  ? 58  GLU B OE2   1 
ATOM   3541 N N     . MET F 3 59  ? 24.900 6.302   11.516  1.00 66.47  ? 59  MET B N     1 
ATOM   3542 C CA    . MET F 3 59  ? 25.456 5.125   12.170  1.00 64.43  ? 59  MET B CA    1 
ATOM   3543 C C     . MET F 3 59  ? 24.383 4.056   12.030  1.00 63.08  ? 59  MET B C     1 
ATOM   3544 O O     . MET F 3 59  ? 23.265 4.235   12.509  1.00 64.91  ? 59  MET B O     1 
ATOM   3545 C CB    . MET F 3 59  ? 25.693 5.437   13.651  1.00 63.85  ? 59  MET B CB    1 
ATOM   3546 C CG    . MET F 3 59  ? 27.077 5.121   14.184  1.00 64.69  ? 59  MET B CG    1 
ATOM   3547 S SD    . MET F 3 59  ? 27.379 3.370   14.555  1.00 67.25  ? 59  MET B SD    1 
ATOM   3548 C CE    . MET F 3 59  ? 29.097 3.417   14.904  1.00 61.98  ? 59  MET B CE    1 
ATOM   3549 N N     . ILE F 3 60  ? 24.692 2.960   11.357  1.00 60.03  ? 60  ILE B N     1 
ATOM   3550 C CA    . ILE F 3 60  ? 23.697 1.907   11.205  1.00 57.67  ? 60  ILE B CA    1 
ATOM   3551 C C     . ILE F 3 60  ? 23.703 1.063   12.478  1.00 57.01  ? 60  ILE B C     1 
ATOM   3552 O O     . ILE F 3 60  ? 24.663 0.334   12.734  1.00 58.08  ? 60  ILE B O     1 
ATOM   3553 C CB    . ILE F 3 60  ? 24.001 0.998   9.972   1.00 56.90  ? 60  ILE B CB    1 
ATOM   3554 C CG1   . ILE F 3 60  ? 23.600 1.698   8.672   1.00 55.30  ? 60  ILE B CG1   1 
ATOM   3555 C CG2   . ILE F 3 60  ? 23.207 -0.293  10.066  1.00 56.53  ? 60  ILE B CG2   1 
ATOM   3556 C CD1   . ILE F 3 60  ? 24.184 3.065   8.497   1.00 56.82  ? 60  ILE B CD1   1 
ATOM   3557 N N     . LEU F 3 61  ? 22.650 1.170   13.285  1.00 54.33  ? 61  LEU B N     1 
ATOM   3558 C CA    . LEU F 3 61  ? 22.588 0.395   14.517  1.00 52.12  ? 61  LEU B CA    1 
ATOM   3559 C C     . LEU F 3 61  ? 22.324 -1.038  14.171  1.00 51.49  ? 61  LEU B C     1 
ATOM   3560 O O     . LEU F 3 61  ? 22.944 -1.956  14.699  1.00 50.68  ? 61  LEU B O     1 
ATOM   3561 C CB    . LEU F 3 61  ? 21.451 0.848   15.417  1.00 50.96  ? 61  LEU B CB    1 
ATOM   3562 C CG    . LEU F 3 61  ? 21.387 2.275   15.926  1.00 51.44  ? 61  LEU B CG    1 
ATOM   3563 C CD1   . LEU F 3 61  ? 20.372 2.314   17.058  1.00 52.69  ? 61  LEU B CD1   1 
ATOM   3564 C CD2   . LEU F 3 61  ? 22.728 2.707   16.428  1.00 51.61  ? 61  LEU B CD2   1 
ATOM   3565 N N     . SER F 3 62  ? 21.383 -1.225  13.267  1.00 52.65  ? 62  SER B N     1 
ATOM   3566 C CA    . SER F 3 62  ? 21.007 -2.562  12.887  1.00 53.66  ? 62  SER B CA    1 
ATOM   3567 C C     . SER F 3 62  ? 20.175 -2.618  11.629  1.00 53.60  ? 62  SER B C     1 
ATOM   3568 O O     . SER F 3 62  ? 19.544 -1.646  11.230  1.00 54.10  ? 62  SER B O     1 
ATOM   3569 C CB    . SER F 3 62  ? 20.221 -3.200  14.034  1.00 53.89  ? 62  SER B CB    1 
ATOM   3570 O OG    . SER F 3 62  ? 19.426 -4.280  13.575  1.00 55.09  ? 62  SER B OG    1 
ATOM   3571 N N     . TYR F 3 63  ? 20.209 -3.774  10.991  1.00 54.44  ? 63  TYR B N     1 
ATOM   3572 C CA    . TYR F 3 63  ? 19.401 -4.002  9.823   1.00 55.52  ? 63  TYR B CA    1 
ATOM   3573 C C     . TYR F 3 63  ? 18.263 -4.823  10.422  1.00 57.09  ? 63  TYR B C     1 
ATOM   3574 O O     . TYR F 3 63  ? 18.503 -5.674  11.278  1.00 55.94  ? 63  TYR B O     1 
ATOM   3575 C CB    . TYR F 3 63  ? 20.161 -4.838  8.773   1.00 54.42  ? 63  TYR B CB    1 
ATOM   3576 C CG    . TYR F 3 63  ? 21.131 -4.051  7.907   1.00 54.39  ? 63  TYR B CG    1 
ATOM   3577 C CD1   . TYR F 3 63  ? 20.779 -2.798  7.395   1.00 53.86  ? 63  TYR B CD1   1 
ATOM   3578 C CD2   . TYR F 3 63  ? 22.394 -4.563  7.583   1.00 54.64  ? 63  TYR B CD2   1 
ATOM   3579 C CE1   . TYR F 3 63  ? 21.657 -2.070  6.586   1.00 52.90  ? 63  TYR B CE1   1 
ATOM   3580 C CE2   . TYR F 3 63  ? 23.284 -3.842  6.771   1.00 53.96  ? 63  TYR B CE2   1 
ATOM   3581 C CZ    . TYR F 3 63  ? 22.905 -2.593  6.277   1.00 54.92  ? 63  TYR B CZ    1 
ATOM   3582 O OH    . TYR F 3 63  ? 23.766 -1.858  5.482   1.00 54.55  ? 63  TYR B OH    1 
ATOM   3583 N N     . LEU F 3 64  ? 17.030 -4.543  10.023  1.00 59.16  ? 64  LEU B N     1 
ATOM   3584 C CA    . LEU F 3 64  ? 15.896 -5.329  10.508  1.00 63.33  ? 64  LEU B CA    1 
ATOM   3585 C C     . LEU F 3 64  ? 15.178 -5.826  9.272   1.00 65.66  ? 64  LEU B C     1 
ATOM   3586 O O     . LEU F 3 64  ? 14.780 -5.035  8.418   1.00 67.07  ? 64  LEU B O     1 
ATOM   3587 C CB    . LEU F 3 64  ? 14.948 -4.484  11.363  1.00 63.38  ? 64  LEU B CB    1 
ATOM   3588 C CG    . LEU F 3 64  ? 15.403 -4.181  12.795  1.00 62.28  ? 64  LEU B CG    1 
ATOM   3589 C CD1   . LEU F 3 64  ? 14.431 -3.206  13.437  1.00 61.78  ? 64  LEU B CD1   1 
ATOM   3590 C CD2   . LEU F 3 64  ? 15.485 -5.474  13.596  1.00 61.41  ? 64  LEU B CD2   1 
ATOM   3591 N N     . ASN F 3 65  ? 15.020 -7.136  9.161   1.00 68.33  ? 65  ASN B N     1 
ATOM   3592 C CA    . ASN F 3 65  ? 14.375 -7.687  7.980   1.00 71.42  ? 65  ASN B CA    1 
ATOM   3593 C C     . ASN F 3 65  ? 12.911 -8.062  8.180   1.00 72.37  ? 65  ASN B C     1 
ATOM   3594 O O     . ASN F 3 65  ? 12.182 -7.424  8.948   1.00 72.20  ? 65  ASN B O     1 
ATOM   3595 C CB    . ASN F 3 65  ? 15.165 -8.903  7.479   1.00 73.29  ? 65  ASN B CB    1 
ATOM   3596 C CG    . ASN F 3 65  ? 16.661 -8.646  7.439   1.00 75.62  ? 65  ASN B CG    1 
ATOM   3597 O OD1   . ASN F 3 65  ? 17.335 -8.694  8.475   1.00 76.86  ? 65  ASN B OD1   1 
ATOM   3598 N ND2   . ASN F 3 65  ? 17.187 -8.349  6.248   1.00 76.57  ? 65  ASN B ND2   1 
ATOM   3599 N N     . GLN F 3 66  ? 12.494 -9.102  7.465   1.00 73.01  ? 66  GLN B N     1 
ATOM   3600 C CA    . GLN F 3 66  ? 11.130 -9.601  7.515   1.00 73.51  ? 66  GLN B CA    1 
ATOM   3601 C C     . GLN F 3 66  ? 10.932 -10.360 8.812   1.00 72.64  ? 66  GLN B C     1 
ATOM   3602 O O     . GLN F 3 66  ? 11.854 -11.026 9.282   1.00 73.68  ? 66  GLN B O     1 
ATOM   3603 C CB    . GLN F 3 66  ? 10.889 -10.529 6.336   1.00 74.47  ? 66  GLN B CB    1 
ATOM   3604 C CG    . GLN F 3 66  ? 9.462  -10.960 6.169   1.00 78.23  ? 66  GLN B CG    1 
ATOM   3605 C CD    . GLN F 3 66  ? 9.309  -11.928 5.016   1.00 81.90  ? 66  GLN B CD    1 
ATOM   3606 O OE1   . GLN F 3 66  ? 9.876  -13.026 5.036   1.00 83.39  ? 66  GLN B OE1   1 
ATOM   3607 N NE2   . GLN F 3 66  ? 8.553  -11.526 3.994   1.00 82.35  ? 66  GLN B NE2   1 
ATOM   3608 N N     . GLY F 3 67  ? 9.734  -10.259 9.384   1.00 70.42  ? 67  GLY B N     1 
ATOM   3609 C CA    . GLY F 3 67  ? 9.451  -10.945 10.631  1.00 67.71  ? 67  GLY B CA    1 
ATOM   3610 C C     . GLY F 3 67  ? 9.855  -10.142 11.855  1.00 66.85  ? 67  GLY B C     1 
ATOM   3611 O O     . GLY F 3 67  ? 9.571  -10.542 12.982  1.00 66.52  ? 67  GLY B O     1 
ATOM   3612 N N     . ASP F 3 68  ? 10.525 -9.012  11.637  1.00 65.44  ? 68  ASP B N     1 
ATOM   3613 C CA    . ASP F 3 68  ? 10.965 -8.150  12.735  1.00 63.88  ? 68  ASP B CA    1 
ATOM   3614 C C     . ASP F 3 68  ? 9.906  -7.097  13.033  1.00 61.38  ? 68  ASP B C     1 
ATOM   3615 O O     . ASP F 3 68  ? 9.182  -6.693  12.138  1.00 62.02  ? 68  ASP B O     1 
ATOM   3616 C CB    . ASP F 3 68  ? 12.280 -7.415  12.383  1.00 63.42  ? 68  ASP B CB    1 
ATOM   3617 C CG    . ASP F 3 68  ? 13.468 -8.355  12.194  1.00 64.05  ? 68  ASP B CG    1 
ATOM   3618 O OD1   . ASP F 3 68  ? 13.520 -9.407  12.874  1.00 63.83  ? 68  ASP B OD1   1 
ATOM   3619 O OD2   . ASP F 3 68  ? 14.363 -8.026  11.376  1.00 62.37  ? 68  ASP B OD2   1 
ATOM   3620 N N     . PHE F 3 69  ? 9.808  -6.655  14.283  1.00 58.87  ? 69  PHE B N     1 
ATOM   3621 C CA    . PHE F 3 69  ? 8.858  -5.599  14.614  1.00 57.81  ? 69  PHE B CA    1 
ATOM   3622 C C     . PHE F 3 69  ? 9.636  -4.289  14.522  1.00 56.64  ? 69  PHE B C     1 
ATOM   3623 O O     . PHE F 3 69  ? 10.857 -4.297  14.560  1.00 56.97  ? 69  PHE B O     1 
ATOM   3624 C CB    . PHE F 3 69  ? 8.316  -5.746  16.045  1.00 57.83  ? 69  PHE B CB    1 
ATOM   3625 C CG    . PHE F 3 69  ? 7.257  -6.806  16.205  1.00 56.29  ? 69  PHE B CG    1 
ATOM   3626 C CD1   . PHE F 3 69  ? 7.599  -8.140  16.370  1.00 55.36  ? 69  PHE B CD1   1 
ATOM   3627 C CD2   . PHE F 3 69  ? 5.911  -6.461  16.216  1.00 56.54  ? 69  PHE B CD2   1 
ATOM   3628 C CE1   . PHE F 3 69  ? 6.611  -9.113  16.547  1.00 55.68  ? 69  PHE B CE1   1 
ATOM   3629 C CE2   . PHE F 3 69  ? 4.919  -7.428  16.389  1.00 55.25  ? 69  PHE B CE2   1 
ATOM   3630 C CZ    . PHE F 3 69  ? 5.271  -8.753  16.556  1.00 55.23  ? 69  PHE B CZ    1 
ATOM   3631 N N     . ILE F 3 70  ? 8.940  -3.168  14.393  1.00 55.56  ? 70  ILE B N     1 
ATOM   3632 C CA    . ILE F 3 70  ? 9.610  -1.875  14.342  1.00 54.19  ? 70  ILE B CA    1 
ATOM   3633 C C     . ILE F 3 70  ? 8.870  -0.890  15.225  1.00 52.72  ? 70  ILE B C     1 
ATOM   3634 O O     . ILE F 3 70  ? 7.676  -1.023  15.440  1.00 52.07  ? 70  ILE B O     1 
ATOM   3635 C CB    . ILE F 3 70  ? 9.623  -1.275  12.935  1.00 55.77  ? 70  ILE B CB    1 
ATOM   3636 C CG1   . ILE F 3 70  ? 10.254 -2.243  11.947  1.00 55.29  ? 70  ILE B CG1   1 
ATOM   3637 C CG2   . ILE F 3 70  ? 10.410 0.042   12.939  1.00 56.13  ? 70  ILE B CG2   1 
ATOM   3638 C CD1   . ILE F 3 70  ? 10.439 -1.603  10.589  1.00 56.00  ? 70  ILE B CD1   1 
ATOM   3639 N N     . GLY F 3 71  ? 9.587  0.106   15.725  1.00 53.49  ? 71  GLY B N     1 
ATOM   3640 C CA    . GLY F 3 71  ? 8.981  1.119   16.566  1.00 52.92  ? 71  GLY B CA    1 
ATOM   3641 C C     . GLY F 3 71  ? 8.303  0.590   17.812  1.00 53.25  ? 71  GLY B C     1 
ATOM   3642 O O     . GLY F 3 71  ? 7.208  1.049   18.157  1.00 52.53  ? 71  GLY B O     1 
ATOM   3643 N N     . GLU F 3 72  ? 8.941  -0.361  18.498  1.00 52.76  ? 72  GLU B N     1 
ATOM   3644 C CA    . GLU F 3 72  ? 8.346  -0.920  19.708  1.00 53.11  ? 72  GLU B CA    1 
ATOM   3645 C C     . GLU F 3 72  ? 8.833  -0.336  21.026  1.00 53.50  ? 72  GLU B C     1 
ATOM   3646 O O     . GLU F 3 72  ? 8.180  -0.513  22.053  1.00 54.26  ? 72  GLU B O     1 
ATOM   3647 C CB    . GLU F 3 72  ? 8.516  -2.436  19.757  1.00 50.96  ? 72  GLU B CB    1 
ATOM   3648 C CG    . GLU F 3 72  ? 9.491  -3.001  18.774  1.00 55.34  ? 72  GLU B CG    1 
ATOM   3649 C CD    . GLU F 3 72  ? 10.930 -2.680  19.101  1.00 58.14  ? 72  GLU B CD    1 
ATOM   3650 O OE1   . GLU F 3 72  ? 11.376 -3.007  20.226  1.00 60.06  ? 72  GLU B OE1   1 
ATOM   3651 O OE2   . GLU F 3 72  ? 11.618 -2.117  18.225  1.00 56.91  ? 72  GLU B OE2   1 
ATOM   3652 N N     . LEU F 3 73  ? 9.956  0.367   21.017  1.00 53.00  ? 73  LEU B N     1 
ATOM   3653 C CA    . LEU F 3 73  ? 10.460 0.909   22.265  1.00 54.32  ? 73  LEU B CA    1 
ATOM   3654 C C     . LEU F 3 73  ? 9.550  1.987   22.811  1.00 55.60  ? 73  LEU B C     1 
ATOM   3655 O O     . LEU F 3 73  ? 9.681  2.396   23.969  1.00 56.21  ? 73  LEU B O     1 
ATOM   3656 C CB    . LEU F 3 73  ? 11.859 1.469   22.075  1.00 54.84  ? 73  LEU B CB    1 
ATOM   3657 C CG    . LEU F 3 73  ? 12.874 0.461   21.547  1.00 55.90  ? 73  LEU B CG    1 
ATOM   3658 C CD1   . LEU F 3 73  ? 14.224 1.152   21.499  1.00 55.92  ? 73  LEU B CD1   1 
ATOM   3659 C CD2   . LEU F 3 73  ? 12.919 -0.798  22.434  1.00 53.16  ? 73  LEU B CD2   1 
ATOM   3660 N N     . GLY F 3 74  ? 8.621  2.440   21.978  1.00 55.99  ? 74  GLY B N     1 
ATOM   3661 C CA    . GLY F 3 74  ? 7.709  3.476   22.409  1.00 55.77  ? 74  GLY B CA    1 
ATOM   3662 C C     . GLY F 3 74  ? 6.461  2.898   23.031  1.00 56.92  ? 74  GLY B C     1 
ATOM   3663 O O     . GLY F 3 74  ? 5.704  3.603   23.697  1.00 59.13  ? 74  GLY B O     1 
ATOM   3664 N N     . LEU F 3 75  ? 6.264  1.601   22.836  1.00 56.72  ? 75  LEU B N     1 
ATOM   3665 C CA    . LEU F 3 75  ? 5.084  0.900   23.332  1.00 57.36  ? 75  LEU B CA    1 
ATOM   3666 C C     . LEU F 3 75  ? 4.868  0.804   24.830  1.00 58.97  ? 75  LEU B C     1 
ATOM   3667 O O     . LEU F 3 75  ? 3.729  0.725   25.282  1.00 60.69  ? 75  LEU B O     1 
ATOM   3668 C CB    . LEU F 3 75  ? 5.075  -0.520  22.782  1.00 57.58  ? 75  LEU B CB    1 
ATOM   3669 C CG    . LEU F 3 75  ? 3.986  -1.483  23.257  1.00 56.64  ? 75  LEU B CG    1 
ATOM   3670 C CD1   . LEU F 3 75  ? 2.639  -1.094  22.640  1.00 57.25  ? 75  LEU B CD1   1 
ATOM   3671 C CD2   . LEU F 3 75  ? 4.360  -2.889  22.841  1.00 54.74  ? 75  LEU B CD2   1 
ATOM   3672 N N     . PHE F 3 76  ? 5.941  0.806   25.608  1.00 60.26  ? 76  PHE B N     1 
ATOM   3673 C CA    . PHE F 3 76  ? 5.783  0.627   27.039  1.00 61.08  ? 76  PHE B CA    1 
ATOM   3674 C C     . PHE F 3 76  ? 5.635  1.837   27.934  1.00 62.38  ? 76  PHE B C     1 
ATOM   3675 O O     . PHE F 3 76  ? 5.019  1.735   28.981  1.00 63.58  ? 76  PHE B O     1 
ATOM   3676 C CB    . PHE F 3 76  ? 6.903  -0.268  27.556  1.00 59.97  ? 76  PHE B CB    1 
ATOM   3677 C CG    . PHE F 3 76  ? 6.986  -1.577  26.847  1.00 58.13  ? 76  PHE B CG    1 
ATOM   3678 C CD1   . PHE F 3 76  ? 7.642  -1.681  25.630  1.00 58.80  ? 76  PHE B CD1   1 
ATOM   3679 C CD2   . PHE F 3 76  ? 6.376  -2.706  27.377  1.00 58.41  ? 76  PHE B CD2   1 
ATOM   3680 C CE1   . PHE F 3 76  ? 7.690  -2.903  24.946  1.00 58.80  ? 76  PHE B CE1   1 
ATOM   3681 C CE2   . PHE F 3 76  ? 6.417  -3.926  26.706  1.00 56.91  ? 76  PHE B CE2   1 
ATOM   3682 C CZ    . PHE F 3 76  ? 7.075  -4.025  25.489  1.00 57.37  ? 76  PHE B CZ    1 
ATOM   3683 N N     . GLU F 3 77  ? 6.200  2.976   27.565  1.00 65.37  ? 77  GLU B N     1 
ATOM   3684 C CA    . GLU F 3 77  ? 6.036  4.146   28.416  1.00 68.42  ? 77  GLU B CA    1 
ATOM   3685 C C     . GLU F 3 77  ? 5.235  5.233   27.703  1.00 68.86  ? 77  GLU B C     1 
ATOM   3686 O O     . GLU F 3 77  ? 4.814  5.052   26.555  1.00 68.67  ? 77  GLU B O     1 
ATOM   3687 C CB    . GLU F 3 77  ? 7.394  4.680   28.871  1.00 70.84  ? 77  GLU B CB    1 
ATOM   3688 C CG    . GLU F 3 77  ? 7.289  5.662   30.031  1.00 74.92  ? 77  GLU B CG    1 
ATOM   3689 C CD    . GLU F 3 77  ? 8.591  5.822   30.811  1.00 77.55  ? 77  GLU B CD    1 
ATOM   3690 O OE1   . GLU F 3 77  ? 9.658  6.028   30.185  1.00 78.70  ? 77  GLU B OE1   1 
ATOM   3691 O OE2   . GLU F 3 77  ? 8.540  5.752   32.061  1.00 78.67  ? 77  GLU B OE2   1 
ATOM   3692 N N     . GLU F 3 78  ? 5.014  6.354   28.380  1.00 69.53  ? 78  GLU B N     1 
ATOM   3693 C CA    . GLU F 3 78  ? 4.234  7.433   27.792  1.00 70.63  ? 78  GLU B CA    1 
ATOM   3694 C C     . GLU F 3 78  ? 5.037  8.664   27.458  1.00 69.97  ? 78  GLU B C     1 
ATOM   3695 O O     . GLU F 3 78  ? 6.060  8.950   28.087  1.00 69.11  ? 78  GLU B O     1 
ATOM   3696 C CB    . GLU F 3 78  ? 3.080  7.829   28.715  1.00 73.20  ? 78  GLU B CB    1 
ATOM   3697 C CG    . GLU F 3 78  ? 2.168  6.672   29.098  1.00 79.87  ? 78  GLU B CG    1 
ATOM   3698 C CD    . GLU F 3 78  ? 2.019  5.639   27.979  1.00 83.85  ? 78  GLU B CD    1 
ATOM   3699 O OE1   . GLU F 3 78  ? 1.751  6.041   26.820  1.00 86.29  ? 78  GLU B OE1   1 
ATOM   3700 O OE2   . GLU F 3 78  ? 2.169  4.423   28.266  1.00 84.94  ? 78  GLU B OE2   1 
ATOM   3701 N N     . GLY F 3 79  ? 4.541  9.393   26.460  1.00 69.93  ? 79  GLY B N     1 
ATOM   3702 C CA    . GLY F 3 79  ? 5.184  10.612  26.010  1.00 69.19  ? 79  GLY B CA    1 
ATOM   3703 C C     . GLY F 3 79  ? 6.570  10.349  25.473  1.00 68.84  ? 79  GLY B C     1 
ATOM   3704 O O     . GLY F 3 79  ? 7.458  11.187  25.611  1.00 69.45  ? 79  GLY B O     1 
ATOM   3705 N N     . GLN F 3 80  ? 6.757  9.182   24.864  1.00 67.51  ? 80  GLN B N     1 
ATOM   3706 C CA    . GLN F 3 80  ? 8.055  8.823   24.321  1.00 67.03  ? 80  GLN B CA    1 
ATOM   3707 C C     . GLN F 3 80  ? 8.252  9.176   22.849  1.00 66.37  ? 80  GLN B C     1 
ATOM   3708 O O     . GLN F 3 80  ? 7.296  9.269   22.079  1.00 67.05  ? 80  GLN B O     1 
ATOM   3709 C CB    . GLN F 3 80  ? 8.321  7.338   24.553  1.00 67.25  ? 80  GLN B CB    1 
ATOM   3710 C CG    . GLN F 3 80  ? 8.719  7.044   25.982  1.00 68.02  ? 80  GLN B CG    1 
ATOM   3711 C CD    . GLN F 3 80  ? 9.654  5.871   26.088  1.00 67.86  ? 80  GLN B CD    1 
ATOM   3712 O OE1   . GLN F 3 80  ? 9.219  4.722   26.171  1.00 69.10  ? 80  GLN B OE1   1 
ATOM   3713 N NE2   . GLN F 3 80  ? 10.955 6.149   26.071  1.00 67.41  ? 80  GLN B NE2   1 
ATOM   3714 N N     . GLU F 3 81  ? 9.508  9.377   22.469  1.00 65.16  ? 81  GLU B N     1 
ATOM   3715 C CA    . GLU F 3 81  ? 9.845  9.738   21.102  1.00 64.55  ? 81  GLU B CA    1 
ATOM   3716 C C     . GLU F 3 81  ? 10.591 8.632   20.416  1.00 63.28  ? 81  GLU B C     1 
ATOM   3717 O O     . GLU F 3 81  ? 11.275 7.855   21.068  1.00 63.96  ? 81  GLU B O     1 
ATOM   3718 C CB    . GLU F 3 81  ? 10.725 10.975  21.088  1.00 65.82  ? 81  GLU B CB    1 
ATOM   3719 C CG    . GLU F 3 81  ? 10.054 12.214  21.602  1.00 68.85  ? 81  GLU B CG    1 
ATOM   3720 C CD    . GLU F 3 81  ? 10.958 13.414  21.509  1.00 70.51  ? 81  GLU B CD    1 
ATOM   3721 O OE1   . GLU F 3 81  ? 10.460 14.542  21.713  1.00 72.45  ? 81  GLU B OE1   1 
ATOM   3722 O OE2   . GLU F 3 81  ? 12.166 13.225  21.238  1.00 69.85  ? 81  GLU B OE2   1 
ATOM   3723 N N     . ARG F 3 82  ? 10.467 8.567   19.095  1.00 62.01  ? 82  ARG B N     1 
ATOM   3724 C CA    . ARG F 3 82  ? 11.169 7.548   18.322  1.00 60.43  ? 82  ARG B CA    1 
ATOM   3725 C C     . ARG F 3 82  ? 12.648 7.674   18.683  1.00 60.60  ? 82  ARG B C     1 
ATOM   3726 O O     . ARG F 3 82  ? 13.176 8.788   18.782  1.00 61.37  ? 82  ARG B O     1 
ATOM   3727 C CB    . ARG F 3 82  ? 10.958 7.795   16.830  1.00 58.46  ? 82  ARG B CB    1 
ATOM   3728 C CG    . ARG F 3 82  ? 9.514  7.672   16.389  1.00 55.44  ? 82  ARG B CG    1 
ATOM   3729 C CD    . ARG F 3 82  ? 8.985  6.292   16.674  1.00 52.66  ? 82  ARG B CD    1 
ATOM   3730 N NE    . ARG F 3 82  ? 7.659  6.088   16.114  1.00 52.02  ? 82  ARG B NE    1 
ATOM   3731 C CZ    . ARG F 3 82  ? 6.954  4.974   16.276  1.00 53.26  ? 82  ARG B CZ    1 
ATOM   3732 N NH1   . ARG F 3 82  ? 7.457  3.975   16.987  1.00 53.64  ? 82  ARG B NH1   1 
ATOM   3733 N NH2   . ARG F 3 82  ? 5.754  4.845   15.720  1.00 55.02  ? 82  ARG B NH2   1 
ATOM   3734 N N     . SER F 3 83  ? 13.319 6.543   18.880  1.00 58.98  ? 83  SER B N     1 
ATOM   3735 C CA    . SER F 3 83  ? 14.724 6.566   19.275  1.00 56.78  ? 83  SER B CA    1 
ATOM   3736 C C     . SER F 3 83  ? 15.735 6.600   18.130  1.00 56.21  ? 83  SER B C     1 
ATOM   3737 O O     . SER F 3 83  ? 16.921 6.822   18.350  1.00 55.50  ? 83  SER B O     1 
ATOM   3738 C CB    . SER F 3 83  ? 15.010 5.373   20.181  1.00 55.93  ? 83  SER B CB    1 
ATOM   3739 O OG    . SER F 3 83  ? 14.555 4.173   19.577  1.00 58.19  ? 83  SER B OG    1 
ATOM   3740 N N     . ALA F 3 84  ? 15.275 6.393   16.908  1.00 55.76  ? 84  ALA B N     1 
ATOM   3741 C CA    . ALA F 3 84  ? 16.188 6.406   15.783  1.00 56.69  ? 84  ALA B CA    1 
ATOM   3742 C C     . ALA F 3 84  ? 15.419 6.457   14.484  1.00 57.47  ? 84  ALA B C     1 
ATOM   3743 O O     . ALA F 3 84  ? 14.209 6.289   14.471  1.00 56.89  ? 84  ALA B O     1 
ATOM   3744 C CB    . ALA F 3 84  ? 17.051 5.173   15.814  1.00 56.20  ? 84  ALA B CB    1 
ATOM   3745 N N     . TRP F 3 85  ? 16.127 6.693   13.387  1.00 58.64  ? 85  TRP B N     1 
ATOM   3746 C CA    . TRP F 3 85  ? 15.492 6.743   12.088  1.00 60.08  ? 85  TRP B CA    1 
ATOM   3747 C C     . TRP F 3 85  ? 15.388 5.330   11.569  1.00 60.91  ? 85  TRP B C     1 
ATOM   3748 O O     . TRP F 3 85  ? 16.239 4.495   11.861  1.00 62.11  ? 85  TRP B O     1 
ATOM   3749 C CB    . TRP F 3 85  ? 16.326 7.558   11.113  1.00 60.46  ? 85  TRP B CB    1 
ATOM   3750 C CG    . TRP F 3 85  ? 16.617 8.906   11.586  1.00 62.76  ? 85  TRP B CG    1 
ATOM   3751 C CD1   . TRP F 3 85  ? 17.566 9.274   12.499  1.00 64.72  ? 85  TRP B CD1   1 
ATOM   3752 C CD2   . TRP F 3 85  ? 15.951 10.096  11.193  1.00 64.17  ? 85  TRP B CD2   1 
ATOM   3753 N NE1   . TRP F 3 85  ? 17.532 10.635  12.698  1.00 65.57  ? 85  TRP B NE1   1 
ATOM   3754 C CE2   . TRP F 3 85  ? 16.547 11.165  11.907  1.00 65.93  ? 85  TRP B CE2   1 
ATOM   3755 C CE3   . TRP F 3 85  ? 14.907 10.371  10.307  1.00 65.96  ? 85  TRP B CE3   1 
ATOM   3756 C CZ2   . TRP F 3 85  ? 16.127 12.493  11.759  1.00 67.65  ? 85  TRP B CZ2   1 
ATOM   3757 C CZ3   . TRP F 3 85  ? 14.485 11.697  10.160  1.00 68.65  ? 85  TRP B CZ3   1 
ATOM   3758 C CH2   . TRP F 3 85  ? 15.098 12.740  10.883  1.00 67.70  ? 85  TRP B CH2   1 
ATOM   3759 N N     . VAL F 3 86  ? 14.340 5.045   10.816  1.00 61.98  ? 86  VAL B N     1 
ATOM   3760 C CA    . VAL F 3 86  ? 14.209 3.720   10.250  1.00 64.97  ? 86  VAL B CA    1 
ATOM   3761 C C     . VAL F 3 86  ? 13.876 3.915   8.785   1.00 67.23  ? 86  VAL B C     1 
ATOM   3762 O O     . VAL F 3 86  ? 12.775 4.337   8.438   1.00 69.52  ? 86  VAL B O     1 
ATOM   3763 C CB    . VAL F 3 86  ? 13.107 2.908   10.932  1.00 64.48  ? 86  VAL B CB    1 
ATOM   3764 C CG1   . VAL F 3 86  ? 13.262 1.438   10.581  1.00 64.36  ? 86  VAL B CG1   1 
ATOM   3765 C CG2   . VAL F 3 86  ? 13.179 3.098   12.417  1.00 63.84  ? 86  VAL B CG2   1 
ATOM   3766 N N     . ARG F 3 87  ? 14.856 3.631   7.936   1.00 68.74  ? 87  ARG B N     1 
ATOM   3767 C CA    . ARG F 3 87  ? 14.725 3.771   6.494   1.00 69.08  ? 87  ARG B CA    1 
ATOM   3768 C C     . ARG F 3 87  ? 14.615 2.384   5.878   1.00 69.69  ? 87  ARG B C     1 
ATOM   3769 O O     . ARG F 3 87  ? 15.049 1.393   6.472   1.00 69.44  ? 87  ARG B O     1 
ATOM   3770 C CB    . ARG F 3 87  ? 15.951 4.489   5.951   1.00 69.49  ? 87  ARG B CB    1 
ATOM   3771 C CG    . ARG F 3 87  ? 15.900 4.828   4.488   1.00 72.13  ? 87  ARG B CG    1 
ATOM   3772 C CD    . ARG F 3 87  ? 17.242 5.382   4.071   1.00 72.76  ? 87  ARG B CD    1 
ATOM   3773 N NE    . ARG F 3 87  ? 17.714 6.395   5.012   1.00 73.23  ? 87  ARG B NE    1 
ATOM   3774 C CZ    . ARG F 3 87  ? 18.997 6.574   5.307   1.00 74.68  ? 87  ARG B CZ    1 
ATOM   3775 N NH1   . ARG F 3 87  ? 19.916 5.806   4.735   1.00 76.15  ? 87  ARG B NH1   1 
ATOM   3776 N NH2   . ARG F 3 87  ? 19.368 7.514   6.165   1.00 73.96  ? 87  ARG B NH2   1 
ATOM   3777 N N     . ALA F 3 88  ? 14.035 2.305   4.689   1.00 70.72  ? 88  ALA B N     1 
ATOM   3778 C CA    . ALA F 3 88  ? 13.883 1.013   4.037   1.00 72.73  ? 88  ALA B CA    1 
ATOM   3779 C C     . ALA F 3 88  ? 14.938 0.759   2.955   1.00 73.58  ? 88  ALA B C     1 
ATOM   3780 O O     . ALA F 3 88  ? 15.184 1.605   2.091   1.00 72.34  ? 88  ALA B O     1 
ATOM   3781 C CB    . ALA F 3 88  ? 12.480 0.895   3.444   1.00 72.63  ? 88  ALA B CB    1 
ATOM   3782 N N     . LYS F 3 89  ? 15.580 -0.402  3.025   1.00 74.84  ? 89  LYS B N     1 
ATOM   3783 C CA    . LYS F 3 89  ? 16.567 -0.760  2.020   1.00 76.74  ? 89  LYS B CA    1 
ATOM   3784 C C     . LYS F 3 89  ? 15.766 -1.095  0.767   1.00 78.22  ? 89  LYS B C     1 
ATOM   3785 O O     . LYS F 3 89  ? 15.549 -0.238  -0.084  1.00 79.43  ? 89  LYS B O     1 
ATOM   3786 C CB    . LYS F 3 89  ? 17.384 -1.976  2.458   1.00 76.27  ? 89  LYS B CB    1 
ATOM   3787 C CG    . LYS F 3 89  ? 18.364 -1.705  3.589   1.00 75.90  ? 89  LYS B CG    1 
ATOM   3788 C CD    . LYS F 3 89  ? 19.377 -2.842  3.717   1.00 76.00  ? 89  LYS B CD    1 
ATOM   3789 C CE    . LYS F 3 89  ? 18.689 -4.197  3.920   1.00 76.06  ? 89  LYS B CE    1 
ATOM   3790 N NZ    . LYS F 3 89  ? 19.640 -5.345  4.018   1.00 75.36  ? 89  LYS B NZ    1 
ATOM   3791 N N     . THR F 3 90  ? 15.314 -2.341  0.663   1.00 79.08  ? 90  THR B N     1 
ATOM   3792 C CA    . THR F 3 90  ? 14.509 -2.761  -0.482  1.00 78.89  ? 90  THR B CA    1 
ATOM   3793 C C     . THR F 3 90  ? 13.131 -2.120  -0.338  1.00 79.07  ? 90  THR B C     1 
ATOM   3794 O O     . THR F 3 90  ? 12.947 -1.209  0.464   1.00 78.45  ? 90  THR B O     1 
ATOM   3795 C CB    . THR F 3 90  ? 14.327 -4.299  -0.514  1.00 79.02  ? 90  THR B CB    1 
ATOM   3796 O OG1   . THR F 3 90  ? 13.509 -4.705  0.594   1.00 79.01  ? 90  THR B OG1   1 
ATOM   3797 C CG2   . THR F 3 90  ? 15.682 -5.009  -0.433  1.00 77.39  ? 90  THR B CG2   1 
ATOM   3798 N N     . ALA F 3 91  ? 12.168 -2.587  -1.125  1.00 80.44  ? 91  ALA B N     1 
ATOM   3799 C CA    . ALA F 3 91  ? 10.808 -2.072  -1.044  1.00 80.96  ? 91  ALA B CA    1 
ATOM   3800 C C     . ALA F 3 91  ? 10.183 -2.858  0.095   1.00 81.76  ? 91  ALA B C     1 
ATOM   3801 O O     . ALA F 3 91  ? 10.435 -4.056  0.235   1.00 82.15  ? 91  ALA B O     1 
ATOM   3802 C CB    . ALA F 3 91  ? 10.072 -2.332  -2.331  1.00 81.24  ? 91  ALA B CB    1 
ATOM   3803 N N     . CYS F 3 92  ? 9.366  -2.204  0.910   1.00 82.40  ? 92  CYS B N     1 
ATOM   3804 C CA    . CYS F 3 92  ? 8.785  -2.899  2.047   1.00 82.87  ? 92  CYS B CA    1 
ATOM   3805 C C     . CYS F 3 92  ? 7.275  -2.965  2.126   1.00 82.82  ? 92  CYS B C     1 
ATOM   3806 O O     . CYS F 3 92  ? 6.560  -2.050  1.722   1.00 82.68  ? 92  CYS B O     1 
ATOM   3807 C CB    . CYS F 3 92  ? 9.314  -2.285  3.337   1.00 83.27  ? 92  CYS B CB    1 
ATOM   3808 S SG    . CYS F 3 92  ? 11.086 -2.018  3.294   1.00 86.08  ? 92  CYS B SG    1 
ATOM   3809 N N     . GLU F 3 93  ? 6.815  -4.087  2.662   1.00 83.17  ? 93  GLU B N     1 
ATOM   3810 C CA    . GLU F 3 93  ? 5.407  -4.355  2.878   1.00 82.69  ? 93  GLU B CA    1 
ATOM   3811 C C     . GLU F 3 93  ? 5.353  -4.377  4.408   1.00 80.96  ? 93  GLU B C     1 
ATOM   3812 O O     . GLU F 3 93  ? 5.682  -5.382  5.046   1.00 79.51  ? 93  GLU B O     1 
ATOM   3813 C CB    . GLU F 3 93  ? 5.047  -5.715  2.275   1.00 85.21  ? 93  GLU B CB    1 
ATOM   3814 C CG    . GLU F 3 93  ? 3.560  -5.950  2.085   1.00 88.39  ? 93  GLU B CG    1 
ATOM   3815 C CD    . GLU F 3 93  ? 3.239  -6.553  0.728   1.00 90.96  ? 93  GLU B CD    1 
ATOM   3816 O OE1   . GLU F 3 93  ? 3.462  -5.860  -0.294  1.00 91.95  ? 93  GLU B OE1   1 
ATOM   3817 O OE2   . GLU F 3 93  ? 2.769  -7.714  0.682   1.00 91.44  ? 93  GLU B OE2   1 
ATOM   3818 N N     . VAL F 3 94  ? 4.961  -3.245  4.984   1.00 79.22  ? 94  VAL B N     1 
ATOM   3819 C CA    . VAL F 3 94  ? 4.921  -3.092  6.431   1.00 77.28  ? 94  VAL B CA    1 
ATOM   3820 C C     . VAL F 3 94  ? 3.542  -3.032  7.077   1.00 75.89  ? 94  VAL B C     1 
ATOM   3821 O O     . VAL F 3 94  ? 2.748  -2.130  6.806   1.00 75.12  ? 94  VAL B O     1 
ATOM   3822 C CB    . VAL F 3 94  ? 5.679  -1.818  6.849   1.00 77.29  ? 94  VAL B CB    1 
ATOM   3823 C CG1   . VAL F 3 94  ? 6.010  -1.872  8.329   1.00 77.06  ? 94  VAL B CG1   1 
ATOM   3824 C CG2   . VAL F 3 94  ? 6.937  -1.666  6.011   1.00 78.45  ? 94  VAL B CG2   1 
ATOM   3825 N N     . ALA F 3 95  ? 3.275  -3.989  7.957   1.00 74.28  ? 95  ALA B N     1 
ATOM   3826 C CA    . ALA F 3 95  ? 2.011  -4.024  8.678   1.00 73.61  ? 95  ALA B CA    1 
ATOM   3827 C C     . ALA F 3 95  ? 2.065  -3.027  9.844   1.00 72.69  ? 95  ALA B C     1 
ATOM   3828 O O     . ALA F 3 95  ? 2.954  -3.109  10.690  1.00 72.48  ? 95  ALA B O     1 
ATOM   3829 C CB    . ALA F 3 95  ? 1.751  -5.439  9.207   1.00 71.99  ? 95  ALA B CB    1 
ATOM   3830 N N     . GLU F 3 96  ? 1.126  -2.084  9.879   1.00 71.62  ? 96  GLU B N     1 
ATOM   3831 C CA    . GLU F 3 96  ? 1.067  -1.101  10.964  1.00 71.25  ? 96  GLU B CA    1 
ATOM   3832 C C     . GLU F 3 96  ? -0.051 -1.452  11.952  1.00 69.54  ? 96  GLU B C     1 
ATOM   3833 O O     . GLU F 3 96  ? -0.851 -2.358  11.703  1.00 69.29  ? 96  GLU B O     1 
ATOM   3834 C CB    . GLU F 3 96  ? 0.851  0.315   10.408  1.00 71.99  ? 96  GLU B CB    1 
ATOM   3835 C CG    . GLU F 3 96  ? 2.084  0.877   9.711   1.00 75.97  ? 96  GLU B CG    1 
ATOM   3836 C CD    . GLU F 3 96  ? 1.915  2.316   9.227   1.00 79.14  ? 96  GLU B CD    1 
ATOM   3837 O OE1   . GLU F 3 96  ? 1.406  3.154   10.010  1.00 80.95  ? 96  GLU B OE1   1 
ATOM   3838 O OE2   . GLU F 3 96  ? 2.309  2.610   8.068   1.00 78.97  ? 96  GLU B OE2   1 
ATOM   3839 N N     . ILE F 3 97  ? -0.081 -0.747  13.080  1.00 66.99  ? 97  ILE B N     1 
ATOM   3840 C CA    . ILE F 3 97  ? -1.091 -0.954  14.126  1.00 63.59  ? 97  ILE B CA    1 
ATOM   3841 C C     . ILE F 3 97  ? -0.776 -0.056  15.308  1.00 62.56  ? 97  ILE B C     1 
ATOM   3842 O O     . ILE F 3 97  ? 0.383  0.073   15.708  1.00 62.93  ? 97  ILE B O     1 
ATOM   3843 C CB    . ILE F 3 97  ? -1.137 -2.403  14.643  1.00 62.20  ? 97  ILE B CB    1 
ATOM   3844 C CG1   . ILE F 3 97  ? -2.277 -2.538  15.658  1.00 62.92  ? 97  ILE B CG1   1 
ATOM   3845 C CG2   . ILE F 3 97  ? 0.170  -2.767  15.317  1.00 61.54  ? 97  ILE B CG2   1 
ATOM   3846 C CD1   . ILE F 3 97  ? -2.591 -3.972  16.093  1.00 61.07  ? 97  ILE B CD1   1 
ATOM   3847 N N     . SER F 3 98  ? -1.809 0.561   15.867  1.00 60.42  ? 98  SER B N     1 
ATOM   3848 C CA    . SER F 3 98  ? -1.624 1.468   16.991  1.00 59.24  ? 98  SER B CA    1 
ATOM   3849 C C     . SER F 3 98  ? -1.285 0.745   18.283  1.00 57.73  ? 98  SER B C     1 
ATOM   3850 O O     . SER F 3 98  ? -1.742 -0.378  18.533  1.00 56.45  ? 98  SER B O     1 
ATOM   3851 C CB    . SER F 3 98  ? -2.890 2.294   17.241  1.00 61.40  ? 98  SER B CB    1 
ATOM   3852 O OG    . SER F 3 98  ? -3.762 1.630   18.156  1.00 61.16  ? 98  SER B OG    1 
ATOM   3853 N N     . TYR F 3 99  ? -0.492 1.413   19.111  1.00 55.38  ? 99  TYR B N     1 
ATOM   3854 C CA    . TYR F 3 99  ? -0.131 0.856   20.389  1.00 53.90  ? 99  TYR B CA    1 
ATOM   3855 C C     . TYR F 3 99  ? -1.433 0.473   21.090  1.00 56.28  ? 99  TYR B C     1 
ATOM   3856 O O     . TYR F 3 99  ? -1.592 -0.664  21.539  1.00 56.82  ? 99  TYR B O     1 
ATOM   3857 C CB    . TYR F 3 99  ? 0.613  1.886   21.226  1.00 49.77  ? 99  TYR B CB    1 
ATOM   3858 C CG    . TYR F 3 99  ? 2.040  2.175   20.810  1.00 47.32  ? 99  TYR B CG    1 
ATOM   3859 C CD1   . TYR F 3 99  ? 2.792  1.250   20.081  1.00 47.32  ? 99  TYR B CD1   1 
ATOM   3860 C CD2   . TYR F 3 99  ? 2.668  3.344   21.229  1.00 45.65  ? 99  TYR B CD2   1 
ATOM   3861 C CE1   . TYR F 3 99  ? 4.135  1.488   19.787  1.00 46.58  ? 99  TYR B CE1   1 
ATOM   3862 C CE2   . TYR F 3 99  ? 4.001  3.590   20.949  1.00 44.94  ? 99  TYR B CE2   1 
ATOM   3863 C CZ    . TYR F 3 99  ? 4.737  2.664   20.232  1.00 46.67  ? 99  TYR B CZ    1 
ATOM   3864 O OH    . TYR F 3 99  ? 6.082  2.912   20.000  1.00 46.95  ? 99  TYR B OH    1 
ATOM   3865 N N     . LYS F 3 100 ? -2.374 1.416   21.156  1.00 57.88  ? 100 LYS B N     1 
ATOM   3866 C CA    . LYS F 3 100 ? -3.653 1.165   21.814  1.00 59.04  ? 100 LYS B CA    1 
ATOM   3867 C C     . LYS F 3 100 ? -4.323 -0.109  21.329  1.00 60.16  ? 100 LYS B C     1 
ATOM   3868 O O     . LYS F 3 100 ? -4.716 -0.956  22.133  1.00 59.73  ? 100 LYS B O     1 
ATOM   3869 C CB    . LYS F 3 100 ? -4.610 2.346   21.629  1.00 59.02  ? 100 LYS B CB    1 
ATOM   3870 C CG    . LYS F 3 100 ? -4.885 3.140   22.911  1.00 61.11  ? 100 LYS B CG    1 
ATOM   3871 C CD    . LYS F 3 100 ? -5.994 4.197   22.724  1.00 62.66  ? 100 LYS B CD    1 
ATOM   3872 C CE    . LYS F 3 100 ? -6.295 4.966   24.023  1.00 62.10  ? 100 LYS B CE    1 
ATOM   3873 N NZ    . LYS F 3 100 ? -5.187 5.910   24.422  1.00 60.60  ? 100 LYS B NZ    1 
ATOM   3874 N N     . LYS F 3 101 ? -4.456 -0.265  20.019  1.00 61.92  ? 101 LYS B N     1 
ATOM   3875 C CA    . LYS F 3 101 ? -5.104 -1.467  19.516  1.00 64.58  ? 101 LYS B CA    1 
ATOM   3876 C C     . LYS F 3 101 ? -4.216 -2.662  19.833  1.00 65.33  ? 101 LYS B C     1 
ATOM   3877 O O     . LYS F 3 101 ? -4.707 -3.729  20.209  1.00 65.43  ? 101 LYS B O     1 
ATOM   3878 C CB    . LYS F 3 101 ? -5.359 -1.354  18.006  1.00 66.66  ? 101 LYS B CB    1 
ATOM   3879 C CG    . LYS F 3 101 ? -5.851 -2.643  17.329  1.00 69.41  ? 101 LYS B CG    1 
ATOM   3880 C CD    . LYS F 3 101 ? -7.282 -3.023  17.713  1.00 72.53  ? 101 LYS B CD    1 
ATOM   3881 C CE    . LYS F 3 101 ? -7.726 -4.335  17.033  1.00 72.56  ? 101 LYS B CE    1 
ATOM   3882 N NZ    . LYS F 3 101 ? -7.669 -4.315  15.531  1.00 71.71  ? 101 LYS B NZ    1 
ATOM   3883 N N     . PHE F 3 102 ? -2.904 -2.473  19.704  1.00 64.99  ? 102 PHE B N     1 
ATOM   3884 C CA    . PHE F 3 102 ? -1.960 -3.547  19.981  1.00 64.21  ? 102 PHE B CA    1 
ATOM   3885 C C     . PHE F 3 102 ? -2.064 -4.007  21.429  1.00 65.26  ? 102 PHE B C     1 
ATOM   3886 O O     . PHE F 3 102 ? -2.245 -5.200  21.698  1.00 65.62  ? 102 PHE B O     1 
ATOM   3887 C CB    . PHE F 3 102 ? -0.520 -3.096  19.697  1.00 63.17  ? 102 PHE B CB    1 
ATOM   3888 C CG    . PHE F 3 102 ? 0.520  -4.178  19.939  1.00 61.55  ? 102 PHE B CG    1 
ATOM   3889 C CD1   . PHE F 3 102 ? 0.623  -5.272  19.085  1.00 60.07  ? 102 PHE B CD1   1 
ATOM   3890 C CD2   . PHE F 3 102 ? 1.369  -4.116  21.042  1.00 60.62  ? 102 PHE B CD2   1 
ATOM   3891 C CE1   . PHE F 3 102 ? 1.545  -6.278  19.325  1.00 57.94  ? 102 PHE B CE1   1 
ATOM   3892 C CE2   . PHE F 3 102 ? 2.287  -5.116  21.285  1.00 58.65  ? 102 PHE B CE2   1 
ATOM   3893 C CZ    . PHE F 3 102 ? 2.373  -6.199  20.424  1.00 58.74  ? 102 PHE B CZ    1 
ATOM   3894 N N     . ARG F 3 103 ? -1.951 -3.066  22.362  1.00 65.65  ? 103 ARG B N     1 
ATOM   3895 C CA    . ARG F 3 103 ? -2.019 -3.422  23.767  1.00 68.00  ? 103 ARG B CA    1 
ATOM   3896 C C     . ARG F 3 103 ? -3.172 -4.393  23.964  1.00 70.23  ? 103 ARG B C     1 
ATOM   3897 O O     . ARG F 3 103 ? -3.026 -5.418  24.629  1.00 71.00  ? 103 ARG B O     1 
ATOM   3898 C CB    . ARG F 3 103 ? -2.202 -2.175  24.646  1.00 68.67  ? 103 ARG B CB    1 
ATOM   3899 C CG    . ARG F 3 103 ? -1.047 -1.175  24.558  1.00 70.34  ? 103 ARG B CG    1 
ATOM   3900 C CD    . ARG F 3 103 ? -0.774 -0.445  25.874  1.00 70.35  ? 103 ARG B CD    1 
ATOM   3901 N NE    . ARG F 3 103 ? 0.339  0.503   25.750  1.00 72.51  ? 103 ARG B NE    1 
ATOM   3902 C CZ    . ARG F 3 103 ? 0.284  1.650   25.067  1.00 72.90  ? 103 ARG B CZ    1 
ATOM   3903 N NH1   . ARG F 3 103 ? -0.833 2.003   24.441  1.00 72.59  ? 103 ARG B NH1   1 
ATOM   3904 N NH2   . ARG F 3 103 ? 1.345  2.450   25.006  1.00 71.95  ? 103 ARG B NH2   1 
ATOM   3905 N N     . GLN F 3 104 ? -4.311 -4.086  23.353  1.00 71.72  ? 104 GLN B N     1 
ATOM   3906 C CA    . GLN F 3 104 ? -5.478 -4.944  23.473  1.00 72.22  ? 104 GLN B CA    1 
ATOM   3907 C C     . GLN F 3 104 ? -5.188 -6.334  22.932  1.00 72.68  ? 104 GLN B C     1 
ATOM   3908 O O     . GLN F 3 104 ? -5.435 -7.323  23.616  1.00 72.97  ? 104 GLN B O     1 
ATOM   3909 C CB    . GLN F 3 104 ? -6.665 -4.314  22.747  1.00 72.43  ? 104 GLN B CB    1 
ATOM   3910 C CG    . GLN F 3 104 ? -6.962 -2.916  23.269  1.00 74.90  ? 104 GLN B CG    1 
ATOM   3911 C CD    . GLN F 3 104 ? -8.136 -2.241  22.580  1.00 75.87  ? 104 GLN B CD    1 
ATOM   3912 O OE1   . GLN F 3 104 ? -8.204 -2.162  21.342  1.00 77.07  ? 104 GLN B OE1   1 
ATOM   3913 N NE2   . GLN F 3 104 ? -9.063 -1.733  23.382  1.00 74.09  ? 104 GLN B NE2   1 
ATOM   3914 N N     . LEU F 3 105 ? -4.649 -6.413  21.719  1.00 73.11  ? 105 LEU B N     1 
ATOM   3915 C CA    . LEU F 3 105 ? -4.341 -7.705  21.119  1.00 74.12  ? 105 LEU B CA    1 
ATOM   3916 C C     . LEU F 3 105 ? -3.629 -8.584  22.126  1.00 75.85  ? 105 LEU B C     1 
ATOM   3917 O O     . LEU F 3 105 ? -3.888 -9.784  22.210  1.00 76.85  ? 105 LEU B O     1 
ATOM   3918 C CB    . LEU F 3 105 ? -3.452 -7.535  19.900  1.00 73.59  ? 105 LEU B CB    1 
ATOM   3919 C CG    . LEU F 3 105 ? -3.944 -6.527  18.869  1.00 74.84  ? 105 LEU B CG    1 
ATOM   3920 C CD1   . LEU F 3 105 ? -3.209 -6.775  17.558  1.00 75.98  ? 105 LEU B CD1   1 
ATOM   3921 C CD2   . LEU F 3 105 ? -5.443 -6.674  18.663  1.00 75.20  ? 105 LEU B CD2   1 
ATOM   3922 N N     . ILE F 3 106 ? -2.732 -7.977  22.895  1.00 76.40  ? 106 ILE B N     1 
ATOM   3923 C CA    . ILE F 3 106 ? -1.988 -8.707  23.905  1.00 76.82  ? 106 ILE B CA    1 
ATOM   3924 C C     . ILE F 3 106 ? -2.946 -9.274  24.933  1.00 78.44  ? 106 ILE B C     1 
ATOM   3925 O O     . ILE F 3 106 ? -2.904 -10.460 25.229  1.00 79.46  ? 106 ILE B O     1 
ATOM   3926 C CB    . ILE F 3 106 ? -0.972 -7.792  24.620  1.00 76.73  ? 106 ILE B CB    1 
ATOM   3927 C CG1   . ILE F 3 106 ? 0.104  -7.341  23.621  1.00 75.47  ? 106 ILE B CG1   1 
ATOM   3928 C CG2   . ILE F 3 106 ? -0.368 -8.518  25.825  1.00 74.79  ? 106 ILE B CG2   1 
ATOM   3929 C CD1   . ILE F 3 106 ? 1.048  -6.297  24.162  1.00 73.87  ? 106 ILE B CD1   1 
ATOM   3930 N N     . GLN F 3 107 ? -3.815 -8.425  25.468  1.00 80.90  ? 107 GLN B N     1 
ATOM   3931 C CA    . GLN F 3 107 ? -4.784 -8.848  26.476  1.00 83.99  ? 107 GLN B CA    1 
ATOM   3932 C C     . GLN F 3 107 ? -5.353 -10.237 26.225  1.00 83.98  ? 107 GLN B C     1 
ATOM   3933 O O     . GLN F 3 107 ? -5.278 -11.114 27.085  1.00 84.57  ? 107 GLN B O     1 
ATOM   3934 C CB    . GLN F 3 107 ? -5.962 -7.876  26.549  1.00 87.56  ? 107 GLN B CB    1 
ATOM   3935 C CG    . GLN F 3 107 ? -5.640 -6.474  27.035  1.00 92.29  ? 107 GLN B CG    1 
ATOM   3936 C CD    . GLN F 3 107 ? -6.904 -5.655  27.295  1.00 94.81  ? 107 GLN B CD    1 
ATOM   3937 O OE1   . GLN F 3 107 ? -7.716 -6.007  28.163  1.00 95.90  ? 107 GLN B OE1   1 
ATOM   3938 N NE2   . GLN F 3 107 ? -7.078 -4.562  26.543  1.00 94.52  ? 107 GLN B NE2   1 
ATOM   3939 N N     . VAL F 3 108 ? -5.925 -10.430 25.042  1.00 84.07  ? 108 VAL B N     1 
ATOM   3940 C CA    . VAL F 3 108 ? -6.542 -11.705 24.696  1.00 84.78  ? 108 VAL B CA    1 
ATOM   3941 C C     . VAL F 3 108 ? -5.575 -12.789 24.203  1.00 85.80  ? 108 VAL B C     1 
ATOM   3942 O O     . VAL F 3 108 ? -6.016 -13.808 23.664  1.00 86.29  ? 108 VAL B O     1 
ATOM   3943 C CB    . VAL F 3 108 ? -7.667 -11.503 23.636  1.00 83.58  ? 108 VAL B CB    1 
ATOM   3944 C CG1   . VAL F 3 108 ? -8.545 -10.325 24.038  1.00 82.25  ? 108 VAL B CG1   1 
ATOM   3945 C CG2   . VAL F 3 108 ? -7.073 -11.289 22.254  1.00 82.23  ? 108 VAL B CG2   1 
ATOM   3946 N N     . ASN F 3 109 ? -4.272 -12.572 24.393  1.00 85.31  ? 109 ASN B N     1 
ATOM   3947 C CA    . ASN F 3 109 ? -3.253 -13.535 23.974  1.00 85.13  ? 109 ASN B CA    1 
ATOM   3948 C C     . ASN F 3 109 ? -1.842 -12.994 24.124  1.00 84.55  ? 109 ASN B C     1 
ATOM   3949 O O     . ASN F 3 109 ? -1.250 -12.497 23.162  1.00 85.23  ? 109 ASN B O     1 
ATOM   3950 C CB    . ASN F 3 109 ? -3.451 -13.956 22.521  1.00 86.43  ? 109 ASN B CB    1 
ATOM   3951 C CG    . ASN F 3 109 ? -2.198 -14.582 21.928  1.00 88.18  ? 109 ASN B CG    1 
ATOM   3952 O OD1   . ASN F 3 109 ? -2.332 -15.183 20.749  1.00 88.54  ? 109 ASN B OD1   1 
ATOM   3953 N ND2   . ASN F 3 109 ? -1.120 -14.526 22.529  1.00 87.92  ? 109 ASN B ND2   1 
ATOM   3954 N N     . PRO F 3 110 ? -1.266 -13.109 25.328  1.00 83.28  ? 110 PRO B N     1 
ATOM   3955 C CA    . PRO F 3 110 ? 0.090  -12.615 25.578  1.00 81.25  ? 110 PRO B CA    1 
ATOM   3956 C C     . PRO F 3 110 ? 1.210  -13.248 24.761  1.00 79.64  ? 110 PRO B C     1 
ATOM   3957 O O     . PRO F 3 110 ? 2.345  -12.789 24.823  1.00 79.18  ? 110 PRO B O     1 
ATOM   3958 C CB    . PRO F 3 110 ? 0.266  -12.831 27.080  1.00 81.19  ? 110 PRO B CB    1 
ATOM   3959 C CG    . PRO F 3 110 ? -0.608 -14.004 27.355  1.00 83.22  ? 110 PRO B CG    1 
ATOM   3960 C CD    . PRO F 3 110 ? -1.844 -13.691 26.549  1.00 83.22  ? 110 PRO B CD    1 
ATOM   3961 N N     . ASP F 3 111 ? 0.912  -14.285 23.986  1.00 78.37  ? 111 ASP B N     1 
ATOM   3962 C CA    . ASP F 3 111 ? 1.967  -14.907 23.190  1.00 77.58  ? 111 ASP B CA    1 
ATOM   3963 C C     . ASP F 3 111 ? 2.583  -13.978 22.136  1.00 75.75  ? 111 ASP B C     1 
ATOM   3964 O O     . ASP F 3 111 ? 3.760  -14.120 21.781  1.00 74.30  ? 111 ASP B O     1 
ATOM   3965 C CB    . ASP F 3 111 ? 1.470  -16.183 22.512  1.00 78.94  ? 111 ASP B CB    1 
ATOM   3966 C CG    . ASP F 3 111 ? 2.427  -16.672 21.434  1.00 81.11  ? 111 ASP B CG    1 
ATOM   3967 O OD1   . ASP F 3 111 ? 2.171  -16.394 20.240  1.00 82.74  ? 111 ASP B OD1   1 
ATOM   3968 O OD2   . ASP F 3 111 ? 3.446  -17.314 21.777  1.00 80.95  ? 111 ASP B OD2   1 
ATOM   3969 N N     . ILE F 3 112 ? 1.792  -13.040 21.626  1.00 74.40  ? 112 ILE B N     1 
ATOM   3970 C CA    . ILE F 3 112 ? 2.297  -12.096 20.629  1.00 72.16  ? 112 ILE B CA    1 
ATOM   3971 C C     . ILE F 3 112 ? 3.303  -11.186 21.327  1.00 70.57  ? 112 ILE B C     1 
ATOM   3972 O O     . ILE F 3 112 ? 4.347  -10.861 20.778  1.00 69.77  ? 112 ILE B O     1 
ATOM   3973 C CB    . ILE F 3 112 ? 1.155  -11.230 20.029  1.00 71.77  ? 112 ILE B CB    1 
ATOM   3974 C CG1   . ILE F 3 112 ? 1.712  -10.249 18.992  1.00 70.75  ? 112 ILE B CG1   1 
ATOM   3975 C CG2   . ILE F 3 112 ? 0.442  -10.470 21.133  1.00 71.86  ? 112 ILE B CG2   1 
ATOM   3976 C CD1   . ILE F 3 112 ? 2.184  -10.907 17.702  1.00 71.20  ? 112 ILE B CD1   1 
ATOM   3977 N N     . LEU F 3 113 ? 2.984  -10.794 22.554  1.00 69.31  ? 113 LEU B N     1 
ATOM   3978 C CA    . LEU F 3 113 ? 3.854  -9.926  23.333  1.00 69.13  ? 113 LEU B CA    1 
ATOM   3979 C C     . LEU F 3 113 ? 5.143  -10.661 23.672  1.00 69.20  ? 113 LEU B C     1 
ATOM   3980 O O     . LEU F 3 113 ? 6.186  -10.052 23.876  1.00 69.12  ? 113 LEU B O     1 
ATOM   3981 C CB    . LEU F 3 113 ? 3.136  -9.489  24.610  1.00 68.46  ? 113 LEU B CB    1 
ATOM   3982 C CG    . LEU F 3 113 ? 3.849  -8.524  25.555  1.00 67.67  ? 113 LEU B CG    1 
ATOM   3983 C CD1   . LEU F 3 113 ? 4.874  -9.257  26.368  1.00 68.10  ? 113 LEU B CD1   1 
ATOM   3984 C CD2   . LEU F 3 113 ? 4.487  -7.415  24.751  1.00 67.91  ? 113 LEU B CD2   1 
ATOM   3985 N N     . MET F 3 114 ? 5.060  -11.980 23.747  1.00 69.17  ? 114 MET B N     1 
ATOM   3986 C CA    . MET F 3 114 ? 6.235  -12.777 24.033  1.00 68.00  ? 114 MET B CA    1 
ATOM   3987 C C     . MET F 3 114 ? 7.135  -12.630 22.807  1.00 66.22  ? 114 MET B C     1 
ATOM   3988 O O     . MET F 3 114 ? 8.291  -12.241 22.928  1.00 67.21  ? 114 MET B O     1 
ATOM   3989 C CB    . MET F 3 114 ? 5.844  -14.245 24.239  1.00 69.45  ? 114 MET B CB    1 
ATOM   3990 C CG    . MET F 3 114 ? 6.966  -15.145 24.750  1.00 71.87  ? 114 MET B CG    1 
ATOM   3991 S SD    . MET F 3 114 ? 7.173  -15.127 26.545  1.00 76.16  ? 114 MET B SD    1 
ATOM   3992 C CE    . MET F 3 114 ? 6.024  -16.437 27.023  1.00 74.36  ? 114 MET B CE    1 
ATOM   3993 N N     . ARG F 3 115 ? 6.596  -12.921 21.626  1.00 63.54  ? 115 ARG B N     1 
ATOM   3994 C CA    . ARG F 3 115 ? 7.363  -12.814 20.389  1.00 61.95  ? 115 ARG B CA    1 
ATOM   3995 C C     . ARG F 3 115 ? 8.149  -11.501 20.316  1.00 59.22  ? 115 ARG B C     1 
ATOM   3996 O O     . ARG F 3 115 ? 9.351  -11.504 20.072  1.00 59.08  ? 115 ARG B O     1 
ATOM   3997 C CB    . ARG F 3 115 ? 6.436  -12.900 19.168  1.00 64.64  ? 115 ARG B CB    1 
ATOM   3998 C CG    . ARG F 3 115 ? 5.515  -14.101 19.146  1.00 68.34  ? 115 ARG B CG    1 
ATOM   3999 C CD    . ARG F 3 115 ? 6.294  -15.406 19.061  1.00 72.00  ? 115 ARG B CD    1 
ATOM   4000 N NE    . ARG F 3 115 ? 5.417  -16.573 19.188  1.00 75.03  ? 115 ARG B NE    1 
ATOM   4001 C CZ    . ARG F 3 115 ? 4.577  -16.993 18.244  1.00 76.45  ? 115 ARG B CZ    1 
ATOM   4002 N NH1   . ARG F 3 115 ? 4.498  -16.349 17.085  1.00 76.38  ? 115 ARG B NH1   1 
ATOM   4003 N NH2   . ARG F 3 115 ? 3.802  -18.051 18.469  1.00 76.43  ? 115 ARG B NH2   1 
ATOM   4004 N N     . LEU F 3 116 ? 7.458  -10.382 20.517  1.00 55.88  ? 116 LEU B N     1 
ATOM   4005 C CA    . LEU F 3 116 ? 8.075  -9.063  20.461  1.00 51.84  ? 116 LEU B CA    1 
ATOM   4006 C C     . LEU F 3 116 ? 9.255  -9.000  21.399  1.00 51.56  ? 116 LEU B C     1 
ATOM   4007 O O     . LEU F 3 116 ? 10.357 -8.614  21.005  1.00 50.53  ? 116 LEU B O     1 
ATOM   4008 C CB    . LEU F 3 116 ? 7.072  -7.983  20.861  1.00 50.08  ? 116 LEU B CB    1 
ATOM   4009 C CG    . LEU F 3 116 ? 7.622  -6.555  20.871  1.00 49.56  ? 116 LEU B CG    1 
ATOM   4010 C CD1   . LEU F 3 116 ? 7.845  -6.080  19.440  1.00 51.33  ? 116 LEU B CD1   1 
ATOM   4011 C CD2   . LEU F 3 116 ? 6.665  -5.634  21.567  1.00 47.59  ? 116 LEU B CD2   1 
ATOM   4012 N N     . SER F 3 117 ? 9.008  -9.378  22.648  1.00 51.66  ? 117 SER B N     1 
ATOM   4013 C CA    . SER F 3 117 ? 10.031 -9.382  23.688  1.00 51.62  ? 117 SER B CA    1 
ATOM   4014 C C     . SER F 3 117 ? 11.243 -10.239 23.334  1.00 51.56  ? 117 SER B C     1 
ATOM   4015 O O     . SER F 3 117 ? 12.381 -9.890  23.663  1.00 52.98  ? 117 SER B O     1 
ATOM   4016 C CB    . SER F 3 117 ? 9.420  -9.851  24.999  1.00 50.00  ? 117 SER B CB    1 
ATOM   4017 O OG    . SER F 3 117 ? 8.428  -8.930  25.412  1.00 53.08  ? 117 SER B OG    1 
ATOM   4018 N N     . ALA F 3 118 ? 11.002 -11.361 22.666  1.00 50.55  ? 118 ALA B N     1 
ATOM   4019 C CA    . ALA F 3 118 ? 12.091 -12.227 22.249  1.00 48.97  ? 118 ALA B CA    1 
ATOM   4020 C C     . ALA F 3 118 ? 12.947 -11.391 21.306  1.00 48.63  ? 118 ALA B C     1 
ATOM   4021 O O     . ALA F 3 118 ? 14.173 -11.347 21.420  1.00 49.97  ? 118 ALA B O     1 
ATOM   4022 C CB    . ALA F 3 118 ? 11.546 -13.448 21.528  1.00 45.28  ? 118 ALA B CB    1 
ATOM   4023 N N     . GLN F 3 119 ? 12.286 -10.706 20.385  1.00 47.82  ? 119 GLN B N     1 
ATOM   4024 C CA    . GLN F 3 119 ? 12.992 -9.878  19.436  1.00 48.72  ? 119 GLN B CA    1 
ATOM   4025 C C     . GLN F 3 119 ? 13.684 -8.718  20.113  1.00 48.91  ? 119 GLN B C     1 
ATOM   4026 O O     . GLN F 3 119 ? 14.664 -8.197  19.600  1.00 51.19  ? 119 GLN B O     1 
ATOM   4027 C CB    . GLN F 3 119 ? 12.040 -9.342  18.383  1.00 50.23  ? 119 GLN B CB    1 
ATOM   4028 C CG    . GLN F 3 119 ? 11.648 -10.343 17.337  1.00 52.87  ? 119 GLN B CG    1 
ATOM   4029 C CD    . GLN F 3 119 ? 10.938 -9.677  16.192  1.00 56.04  ? 119 GLN B CD    1 
ATOM   4030 O OE1   . GLN F 3 119 ? 11.378 -8.631  15.713  1.00 58.84  ? 119 GLN B OE1   1 
ATOM   4031 N NE2   . GLN F 3 119 ? 9.839  -10.270 15.738  1.00 57.49  ? 119 GLN B NE2   1 
ATOM   4032 N N     . MET F 3 120 ? 13.179 -8.287  21.257  1.00 48.51  ? 120 MET B N     1 
ATOM   4033 C CA    . MET F 3 120 ? 13.832 -7.181  21.929  1.00 47.66  ? 120 MET B CA    1 
ATOM   4034 C C     . MET F 3 120 ? 15.102 -7.728  22.530  1.00 47.24  ? 120 MET B C     1 
ATOM   4035 O O     . MET F 3 120 ? 16.173 -7.142  22.383  1.00 46.40  ? 120 MET B O     1 
ATOM   4036 C CB    . MET F 3 120 ? 12.925 -6.567  23.001  1.00 49.59  ? 120 MET B CB    1 
ATOM   4037 C CG    . MET F 3 120 ? 12.052 -5.417  22.473  1.00 51.30  ? 120 MET B CG    1 
ATOM   4038 S SD    . MET F 3 120 ? 11.131 -4.551  23.758  1.00 54.80  ? 120 MET B SD    1 
ATOM   4039 C CE    . MET F 3 120 ? 9.848  -5.752  24.096  1.00 54.99  ? 120 MET B CE    1 
ATOM   4040 N N     . ALA F 3 121 ? 14.987 -8.878  23.184  1.00 46.84  ? 121 ALA B N     1 
ATOM   4041 C CA    . ALA F 3 121 ? 16.142 -9.517  23.794  1.00 46.28  ? 121 ALA B CA    1 
ATOM   4042 C C     . ALA F 3 121 ? 17.315 -9.694  22.830  1.00 46.84  ? 121 ALA B C     1 
ATOM   4043 O O     . ALA F 3 121 ? 18.447 -9.387  23.178  1.00 48.27  ? 121 ALA B O     1 
ATOM   4044 C CB    . ALA F 3 121 ? 15.747 -10.847 24.345  1.00 44.96  ? 121 ALA B CB    1 
ATOM   4045 N N     . ARG F 3 122 ? 17.064 -10.193 21.625  1.00 47.29  ? 122 ARG B N     1 
ATOM   4046 C CA    . ARG F 3 122 ? 18.164 -10.388 20.690  1.00 48.19  ? 122 ARG B CA    1 
ATOM   4047 C C     . ARG F 3 122 ? 18.746 -9.036  20.292  1.00 47.63  ? 122 ARG B C     1 
ATOM   4048 O O     . ARG F 3 122 ? 19.954 -8.903  20.121  1.00 47.47  ? 122 ARG B O     1 
ATOM   4049 C CB    . ARG F 3 122 ? 17.690 -11.180 19.459  1.00 50.99  ? 122 ARG B CB    1 
ATOM   4050 C CG    . ARG F 3 122 ? 18.717 -11.329 18.324  1.00 53.06  ? 122 ARG B CG    1 
ATOM   4051 C CD    . ARG F 3 122 ? 19.883 -12.192 18.718  1.00 58.24  ? 122 ARG B CD    1 
ATOM   4052 N NE    . ARG F 3 122 ? 19.490 -13.589 18.882  1.00 66.58  ? 122 ARG B NE    1 
ATOM   4053 C CZ    . ARG F 3 122 ? 19.118 -14.400 17.884  1.00 69.75  ? 122 ARG B CZ    1 
ATOM   4054 N NH1   . ARG F 3 122 ? 19.081 -13.962 16.624  1.00 70.54  ? 122 ARG B NH1   1 
ATOM   4055 N NH2   . ARG F 3 122 ? 18.788 -15.663 18.147  1.00 69.48  ? 122 ARG B NH2   1 
ATOM   4056 N N     . ARG F 3 123 ? 17.897 -8.026  20.158  1.00 46.96  ? 123 ARG B N     1 
ATOM   4057 C CA    . ARG F 3 123 ? 18.385 -6.692  19.810  1.00 48.25  ? 123 ARG B CA    1 
ATOM   4058 C C     . ARG F 3 123 ? 19.241 -6.095  20.937  1.00 49.10  ? 123 ARG B C     1 
ATOM   4059 O O     . ARG F 3 123 ? 20.118 -5.261  20.698  1.00 51.52  ? 123 ARG B O     1 
ATOM   4060 C CB    . ARG F 3 123 ? 17.213 -5.768  19.500  1.00 48.26  ? 123 ARG B CB    1 
ATOM   4061 C CG    . ARG F 3 123 ? 16.375 -6.286  18.367  1.00 50.07  ? 123 ARG B CG    1 
ATOM   4062 C CD    . ARG F 3 123 ? 15.052 -5.574  18.241  1.00 52.03  ? 123 ARG B CD    1 
ATOM   4063 N NE    . ARG F 3 123 ? 14.262 -6.181  17.180  1.00 52.08  ? 123 ARG B NE    1 
ATOM   4064 C CZ    . ARG F 3 123 ? 13.337 -5.537  16.487  1.00 52.93  ? 123 ARG B CZ    1 
ATOM   4065 N NH1   . ARG F 3 123 ? 13.082 -4.262  16.753  1.00 52.62  ? 123 ARG B NH1   1 
ATOM   4066 N NH2   . ARG F 3 123 ? 12.689 -6.164  15.514  1.00 53.79  ? 123 ARG B NH2   1 
ATOM   4067 N N     . LEU F 3 124 ? 18.990 -6.516  22.171  1.00 48.08  ? 124 LEU B N     1 
ATOM   4068 C CA    . LEU F 3 124 ? 19.774 -6.017  23.284  1.00 47.44  ? 124 LEU B CA    1 
ATOM   4069 C C     . LEU F 3 124 ? 21.177 -6.633  23.199  1.00 47.46  ? 124 LEU B C     1 
ATOM   4070 O O     . LEU F 3 124 ? 22.184 -5.919  23.170  1.00 47.17  ? 124 LEU B O     1 
ATOM   4071 C CB    . LEU F 3 124 ? 19.106 -6.394  24.601  1.00 47.23  ? 124 LEU B CB    1 
ATOM   4072 C CG    . LEU F 3 124 ? 19.759 -5.768  25.830  1.00 48.19  ? 124 LEU B CG    1 
ATOM   4073 C CD1   . LEU F 3 124 ? 19.761 -4.252  25.695  1.00 47.90  ? 124 LEU B CD1   1 
ATOM   4074 C CD2   . LEU F 3 124 ? 19.011 -6.192  27.070  1.00 47.40  ? 124 LEU B CD2   1 
ATOM   4075 N N     . GLN F 3 125 ? 21.229 -7.964  23.145  1.00 47.39  ? 125 GLN B N     1 
ATOM   4076 C CA    . GLN F 3 125 ? 22.494 -8.698  23.047  1.00 45.79  ? 125 GLN B CA    1 
ATOM   4077 C C     . GLN F 3 125 ? 23.337 -8.099  21.943  1.00 42.21  ? 125 GLN B C     1 
ATOM   4078 O O     . GLN F 3 125 ? 24.448 -7.637  22.178  1.00 42.11  ? 125 GLN B O     1 
ATOM   4079 C CB    . GLN F 3 125 ? 22.242 -10.187 22.740  1.00 48.20  ? 125 GLN B CB    1 
ATOM   4080 C CG    . GLN F 3 125 ? 21.610 -10.977 23.894  1.00 53.83  ? 125 GLN B CG    1 
ATOM   4081 C CD    . GLN F 3 125 ? 20.954 -12.315 23.468  1.00 57.62  ? 125 GLN B CD    1 
ATOM   4082 O OE1   . GLN F 3 125 ? 20.523 -13.100 24.325  1.00 57.03  ? 125 GLN B OE1   1 
ATOM   4083 N NE2   . GLN F 3 125 ? 20.865 -12.565 22.155  1.00 56.98  ? 125 GLN B NE2   1 
ATOM   4084 N N     . VAL F 3 126 ? 22.787 -8.094  20.739  1.00 38.47  ? 126 VAL B N     1 
ATOM   4085 C CA    . VAL F 3 126 ? 23.495 -7.580  19.590  1.00 37.04  ? 126 VAL B CA    1 
ATOM   4086 C C     . VAL F 3 126 ? 24.007 -6.161  19.823  1.00 39.11  ? 126 VAL B C     1 
ATOM   4087 O O     . VAL F 3 126 ? 25.198 -5.900  19.677  1.00 38.57  ? 126 VAL B O     1 
ATOM   4088 C CB    . VAL F 3 126 ? 22.576 -7.631  18.328  1.00 37.93  ? 126 VAL B CB    1 
ATOM   4089 C CG1   . VAL F 3 126 ? 23.303 -7.055  17.084  1.00 32.62  ? 126 VAL B CG1   1 
ATOM   4090 C CG2   . VAL F 3 126 ? 22.128 -9.069  18.082  1.00 32.91  ? 126 VAL B CG2   1 
ATOM   4091 N N     . THR F 3 127 ? 23.120 -5.236  20.192  1.00 38.94  ? 127 THR B N     1 
ATOM   4092 C CA    . THR F 3 127 ? 23.555 -3.865  20.411  1.00 37.42  ? 127 THR B CA    1 
ATOM   4093 C C     . THR F 3 127 ? 24.642 -3.856  21.481  1.00 37.01  ? 127 THR B C     1 
ATOM   4094 O O     . THR F 3 127 ? 25.611 -3.111  21.374  1.00 36.10  ? 127 THR B O     1 
ATOM   4095 C CB    . THR F 3 127 ? 22.365 -2.959  20.812  1.00 37.59  ? 127 THR B CB    1 
ATOM   4096 O OG1   . THR F 3 127 ? 21.380 -3.020  19.781  1.00 39.48  ? 127 THR B OG1   1 
ATOM   4097 C CG2   . THR F 3 127 ? 22.789 -1.489  20.962  1.00 33.73  ? 127 THR B CG2   1 
ATOM   4098 N N     . SER F 3 128 ? 24.497 -4.692  22.500  1.00 36.77  ? 128 SER B N     1 
ATOM   4099 C CA    . SER F 3 128 ? 25.507 -4.754  23.548  1.00 39.76  ? 128 SER B CA    1 
ATOM   4100 C C     . SER F 3 128 ? 26.851 -5.199  22.983  1.00 41.97  ? 128 SER B C     1 
ATOM   4101 O O     . SER F 3 128 ? 27.891 -4.591  23.268  1.00 40.71  ? 128 SER B O     1 
ATOM   4102 C CB    . SER F 3 128 ? 25.086 -5.725  24.643  1.00 40.58  ? 128 SER B CB    1 
ATOM   4103 O OG    . SER F 3 128 ? 24.041 -5.193  25.430  1.00 42.94  ? 128 SER B OG    1 
ATOM   4104 N N     . GLU F 3 129 ? 26.822 -6.270  22.191  1.00 44.75  ? 129 GLU B N     1 
ATOM   4105 C CA    . GLU F 3 129 ? 28.027 -6.809  21.565  1.00 46.56  ? 129 GLU B CA    1 
ATOM   4106 C C     . GLU F 3 129 ? 28.608 -5.761  20.626  1.00 46.19  ? 129 GLU B C     1 
ATOM   4107 O O     . GLU F 3 129 ? 29.798 -5.765  20.353  1.00 48.88  ? 129 GLU B O     1 
ATOM   4108 C CB    . GLU F 3 129 ? 27.701 -8.098  20.797  1.00 49.74  ? 129 GLU B CB    1 
ATOM   4109 C CG    . GLU F 3 129 ? 28.843 -8.636  19.941  1.00 57.84  ? 129 GLU B CG    1 
ATOM   4110 C CD    . GLU F 3 129 ? 28.463 -9.893  19.151  1.00 62.83  ? 129 GLU B CD    1 
ATOM   4111 O OE1   . GLU F 3 129 ? 29.203 -10.255 18.199  1.00 65.14  ? 129 GLU B OE1   1 
ATOM   4112 O OE2   . GLU F 3 129 ? 27.433 -10.525 19.486  1.00 65.58  ? 129 GLU B OE2   1 
ATOM   4113 N N     . LYS F 3 130 ? 27.772 -4.856  20.136  1.00 46.00  ? 130 LYS B N     1 
ATOM   4114 C CA    . LYS F 3 130 ? 28.250 -3.797  19.259  1.00 46.89  ? 130 LYS B CA    1 
ATOM   4115 C C     . LYS F 3 130 ? 29.052 -2.806  20.111  1.00 48.14  ? 130 LYS B C     1 
ATOM   4116 O O     . LYS F 3 130 ? 30.025 -2.219  19.653  1.00 49.53  ? 130 LYS B O     1 
ATOM   4117 C CB    . LYS F 3 130 ? 27.064 -3.092  18.596  1.00 47.13  ? 130 LYS B CB    1 
ATOM   4118 C CG    . LYS F 3 130 ? 27.427 -2.059  17.531  1.00 48.40  ? 130 LYS B CG    1 
ATOM   4119 C CD    . LYS F 3 130 ? 26.198 -1.721  16.655  1.00 51.83  ? 130 LYS B CD    1 
ATOM   4120 C CE    . LYS F 3 130 ? 26.510 -0.718  15.526  1.00 54.70  ? 130 LYS B CE    1 
ATOM   4121 N NZ    . LYS F 3 130 ? 27.612 -1.155  14.613  1.00 55.38  ? 130 LYS B NZ    1 
ATOM   4122 N N     . VAL F 3 131 ? 28.644 -2.624  21.362  1.00 47.94  ? 131 VAL B N     1 
ATOM   4123 C CA    . VAL F 3 131 ? 29.335 -1.706  22.252  1.00 47.11  ? 131 VAL B CA    1 
ATOM   4124 C C     . VAL F 3 131 ? 30.714 -2.298  22.559  1.00 47.79  ? 131 VAL B C     1 
ATOM   4125 O O     . VAL F 3 131 ? 31.741 -1.592  22.555  1.00 46.01  ? 131 VAL B O     1 
ATOM   4126 C CB    . VAL F 3 131 ? 28.526 -1.497  23.558  1.00 45.31  ? 131 VAL B CB    1 
ATOM   4127 C CG1   . VAL F 3 131 ? 29.248 -0.559  24.491  1.00 43.70  ? 131 VAL B CG1   1 
ATOM   4128 C CG2   . VAL F 3 131 ? 27.179 -0.921  23.228  1.00 44.43  ? 131 VAL B CG2   1 
ATOM   4129 N N     . GLY F 3 132 ? 30.736 -3.600  22.812  1.00 47.47  ? 132 GLY B N     1 
ATOM   4130 C CA    . GLY F 3 132 ? 31.997 -4.255  23.090  1.00 49.75  ? 132 GLY B CA    1 
ATOM   4131 C C     . GLY F 3 132 ? 32.945 -3.940  21.949  1.00 52.17  ? 132 GLY B C     1 
ATOM   4132 O O     . GLY F 3 132 ? 34.015 -3.358  22.155  1.00 52.11  ? 132 GLY B O     1 
ATOM   4133 N N     . ASN F 3 133 ? 32.524 -4.307  20.739  1.00 51.53  ? 133 ASN B N     1 
ATOM   4134 C CA    . ASN F 3 133 ? 33.297 -4.085  19.522  1.00 50.15  ? 133 ASN B CA    1 
ATOM   4135 C C     . ASN F 3 133 ? 33.849 -2.669  19.399  1.00 48.73  ? 133 ASN B C     1 
ATOM   4136 O O     . ASN F 3 133 ? 35.018 -2.459  19.085  1.00 48.58  ? 133 ASN B O     1 
ATOM   4137 C CB    . ASN F 3 133 ? 32.423 -4.392  18.297  1.00 50.10  ? 133 ASN B CB    1 
ATOM   4138 C CG    . ASN F 3 133 ? 32.094 -5.884  18.159  1.00 49.85  ? 133 ASN B CG    1 
ATOM   4139 O OD1   . ASN F 3 133 ? 31.311 -6.279  17.282  1.00 46.35  ? 133 ASN B OD1   1 
ATOM   4140 N ND2   . ASN F 3 133 ? 32.694 -6.715  19.023  1.00 48.67  ? 133 ASN B ND2   1 
ATOM   4141 N N     . LEU F 3 134 ? 33.004 -1.689  19.640  1.00 49.02  ? 134 LEU B N     1 
ATOM   4142 C CA    . LEU F 3 134 ? 33.436 -0.308  19.528  1.00 51.23  ? 134 LEU B CA    1 
ATOM   4143 C C     . LEU F 3 134 ? 34.458 0.091   20.584  1.00 53.79  ? 134 LEU B C     1 
ATOM   4144 O O     . LEU F 3 134 ? 35.278 0.979   20.365  1.00 54.99  ? 134 LEU B O     1 
ATOM   4145 C CB    . LEU F 3 134 ? 32.219 0.621   19.604  1.00 48.14  ? 134 LEU B CB    1 
ATOM   4146 C CG    . LEU F 3 134 ? 31.502 0.809   18.270  1.00 43.21  ? 134 LEU B CG    1 
ATOM   4147 C CD1   . LEU F 3 134 ? 30.277 1.694   18.418  1.00 41.00  ? 134 LEU B CD1   1 
ATOM   4148 C CD2   . LEU F 3 134 ? 32.499 1.410   17.309  1.00 40.77  ? 134 LEU B CD2   1 
ATOM   4149 N N     . ALA F 3 135 ? 34.421 -0.581  21.724  1.00 55.81  ? 135 ALA B N     1 
ATOM   4150 C CA    . ALA F 3 135 ? 35.327 -0.251  22.808  1.00 57.30  ? 135 ALA B CA    1 
ATOM   4151 C C     . ALA F 3 135 ? 36.580 -1.116  22.881  1.00 57.81  ? 135 ALA B C     1 
ATOM   4152 O O     . ALA F 3 135 ? 37.640 -0.654  23.323  1.00 58.76  ? 135 ALA B O     1 
ATOM   4153 C CB    . ALA F 3 135 ? 34.567 -0.323  24.131  1.00 60.00  ? 135 ALA B CB    1 
ATOM   4154 N N     . PHE F 3 136 ? 36.451 -2.365  22.449  1.00 57.76  ? 136 PHE B N     1 
ATOM   4155 C CA    . PHE F 3 136 ? 37.550 -3.320  22.490  1.00 57.56  ? 136 PHE B CA    1 
ATOM   4156 C C     . PHE F 3 136 ? 38.324 -3.533  21.185  1.00 57.90  ? 136 PHE B C     1 
ATOM   4157 O O     . PHE F 3 136 ? 39.490 -3.940  21.218  1.00 59.64  ? 136 PHE B O     1 
ATOM   4158 C CB    . PHE F 3 136 ? 37.036 -4.680  22.966  1.00 56.02  ? 136 PHE B CB    1 
ATOM   4159 C CG    . PHE F 3 136 ? 36.385 -4.650  24.311  1.00 56.40  ? 136 PHE B CG    1 
ATOM   4160 C CD1   . PHE F 3 136 ? 36.858 -3.812  25.316  1.00 58.18  ? 136 PHE B CD1   1 
ATOM   4161 C CD2   . PHE F 3 136 ? 35.335 -5.508  24.602  1.00 56.47  ? 136 PHE B CD2   1 
ATOM   4162 C CE1   . PHE F 3 136 ? 36.293 -3.835  26.597  1.00 56.52  ? 136 PHE B CE1   1 
ATOM   4163 C CE2   . PHE F 3 136 ? 34.769 -5.534  25.880  1.00 56.98  ? 136 PHE B CE2   1 
ATOM   4164 C CZ    . PHE F 3 136 ? 35.255 -4.694  26.875  1.00 54.86  ? 136 PHE B CZ    1 
ATOM   4165 N N     . LEU F 3 137 ? 37.700 -3.272  20.042  1.00 56.02  ? 137 LEU B N     1 
ATOM   4166 C CA    . LEU F 3 137 ? 38.392 -3.504  18.793  1.00 54.96  ? 137 LEU B CA    1 
ATOM   4167 C C     . LEU F 3 137 ? 38.822 -2.271  18.029  1.00 56.59  ? 137 LEU B C     1 
ATOM   4168 O O     . LEU F 3 137 ? 38.303 -1.175  18.227  1.00 57.30  ? 137 LEU B O     1 
ATOM   4169 C CB    . LEU F 3 137 ? 37.537 -4.375  17.879  1.00 52.86  ? 137 LEU B CB    1 
ATOM   4170 C CG    . LEU F 3 137 ? 36.882 -5.605  18.510  1.00 53.29  ? 137 LEU B CG    1 
ATOM   4171 C CD1   . LEU F 3 137 ? 36.386 -6.535  17.404  1.00 52.16  ? 137 LEU B CD1   1 
ATOM   4172 C CD2   . LEU F 3 137 ? 37.868 -6.326  19.416  1.00 49.78  ? 137 LEU B CD2   1 
ATOM   4173 N N     . ASP F 3 138 ? 39.801 -2.483  17.157  1.00 58.82  ? 138 ASP B N     1 
ATOM   4174 C CA    . ASP F 3 138 ? 40.347 -1.459  16.275  1.00 59.34  ? 138 ASP B CA    1 
ATOM   4175 C C     . ASP F 3 138 ? 39.477 -1.553  15.019  1.00 59.32  ? 138 ASP B C     1 
ATOM   4176 O O     . ASP F 3 138 ? 38.642 -2.462  14.903  1.00 58.21  ? 138 ASP B O     1 
ATOM   4177 C CB    . ASP F 3 138 ? 41.802 -1.796  15.938  1.00 62.05  ? 138 ASP B CB    1 
ATOM   4178 C CG    . ASP F 3 138 ? 41.967 -3.213  15.387  1.00 64.48  ? 138 ASP B CG    1 
ATOM   4179 O OD1   . ASP F 3 138 ? 43.103 -3.729  15.380  1.00 67.25  ? 138 ASP B OD1   1 
ATOM   4180 O OD2   . ASP F 3 138 ? 40.967 -3.816  14.948  1.00 66.67  ? 138 ASP B OD2   1 
ATOM   4181 N N     . VAL F 3 139 ? 39.660 -0.645  14.072  1.00 57.79  ? 139 VAL B N     1 
ATOM   4182 C CA    . VAL F 3 139 ? 38.826 -0.718  12.888  1.00 56.70  ? 139 VAL B CA    1 
ATOM   4183 C C     . VAL F 3 139 ? 38.873 -2.118  12.291  1.00 55.80  ? 139 VAL B C     1 
ATOM   4184 O O     . VAL F 3 139 ? 37.851 -2.799  12.243  1.00 58.00  ? 139 VAL B O     1 
ATOM   4185 C CB    . VAL F 3 139 ? 39.217 0.348   11.846  1.00 56.25  ? 139 VAL B CB    1 
ATOM   4186 C CG1   . VAL F 3 139 ? 38.430 0.145   10.572  1.00 55.36  ? 139 VAL B CG1   1 
ATOM   4187 C CG2   . VAL F 3 139 ? 38.898 1.739   12.400  1.00 56.08  ? 139 VAL B CG2   1 
ATOM   4188 N N     . THR F 3 140 ? 40.043 -2.572  11.870  1.00 53.79  ? 140 THR B N     1 
ATOM   4189 C CA    . THR F 3 140 ? 40.149 -3.909  11.289  1.00 51.75  ? 140 THR B CA    1 
ATOM   4190 C C     . THR F 3 140 ? 39.240 -4.924  11.968  1.00 51.47  ? 140 THR B C     1 
ATOM   4191 O O     . THR F 3 140 ? 38.435 -5.570  11.308  1.00 51.78  ? 140 THR B O     1 
ATOM   4192 C CB    . THR F 3 140 ? 41.600 -4.436  11.340  1.00 50.30  ? 140 THR B CB    1 
ATOM   4193 O OG1   . THR F 3 140 ? 42.394 -3.708  10.401  1.00 50.39  ? 140 THR B OG1   1 
ATOM   4194 C CG2   . THR F 3 140 ? 41.657 -5.905  10.994  1.00 46.23  ? 140 THR B CG2   1 
ATOM   4195 N N     . GLY F 3 141 ? 39.364 -5.066  13.283  1.00 51.10  ? 141 GLY B N     1 
ATOM   4196 C CA    . GLY F 3 141 ? 38.533 -6.022  13.993  1.00 50.94  ? 141 GLY B CA    1 
ATOM   4197 C C     . GLY F 3 141 ? 37.058 -5.746  13.789  1.00 51.11  ? 141 GLY B C     1 
ATOM   4198 O O     . GLY F 3 141 ? 36.254 -6.655  13.590  1.00 52.00  ? 141 GLY B O     1 
ATOM   4199 N N     . ARG F 3 142 ? 36.700 -4.474  13.827  1.00 50.79  ? 142 ARG B N     1 
ATOM   4200 C CA    . ARG F 3 142 ? 35.315 -4.082  13.657  1.00 51.68  ? 142 ARG B CA    1 
ATOM   4201 C C     . ARG F 3 142 ? 34.834 -4.470  12.263  1.00 53.02  ? 142 ARG B C     1 
ATOM   4202 O O     . ARG F 3 142 ? 33.811 -5.145  12.113  1.00 55.02  ? 142 ARG B O     1 
ATOM   4203 C CB    . ARG F 3 142 ? 35.172 -2.566  13.889  1.00 50.57  ? 142 ARG B CB    1 
ATOM   4204 C CG    . ARG F 3 142 ? 35.711 -2.116  15.241  1.00 45.77  ? 142 ARG B CG    1 
ATOM   4205 C CD    . ARG F 3 142 ? 34.762 -1.181  15.943  1.00 43.27  ? 142 ARG B CD    1 
ATOM   4206 N NE    . ARG F 3 142 ? 34.825 0.175   15.416  1.00 41.36  ? 142 ARG B NE    1 
ATOM   4207 C CZ    . ARG F 3 142 ? 35.929 0.913   15.399  1.00 40.55  ? 142 ARG B CZ    1 
ATOM   4208 N NH1   . ARG F 3 142 ? 37.060 0.412   15.878  1.00 38.95  ? 142 ARG B NH1   1 
ATOM   4209 N NH2   . ARG F 3 142 ? 35.904 2.150   14.915  1.00 37.99  ? 142 ARG B NH2   1 
ATOM   4210 N N     . ILE F 3 143 ? 35.570 -4.031  11.246  1.00 52.89  ? 143 ILE B N     1 
ATOM   4211 C CA    . ILE F 3 143 ? 35.239 -4.343  9.867   1.00 51.46  ? 143 ILE B CA    1 
ATOM   4212 C C     . ILE F 3 143 ? 35.188 -5.869  9.712   1.00 52.70  ? 143 ILE B C     1 
ATOM   4213 O O     . ILE F 3 143 ? 34.277 -6.419  9.109   1.00 53.51  ? 143 ILE B O     1 
ATOM   4214 C CB    . ILE F 3 143 ? 36.282 -3.719  8.930   1.00 48.81  ? 143 ILE B CB    1 
ATOM   4215 C CG1   . ILE F 3 143 ? 36.179 -2.201  9.028   1.00 47.43  ? 143 ILE B CG1   1 
ATOM   4216 C CG2   . ILE F 3 143 ? 36.064 -4.166  7.500   1.00 47.15  ? 143 ILE B CG2   1 
ATOM   4217 C CD1   . ILE F 3 143 ? 37.044 -1.470  8.033   1.00 48.68  ? 143 ILE B CD1   1 
ATOM   4218 N N     . ALA F 3 144 ? 36.155 -6.561  10.282  1.00 53.38  ? 144 ALA B N     1 
ATOM   4219 C CA    . ALA F 3 144 ? 36.141 -8.010  10.202  1.00 56.21  ? 144 ALA B CA    1 
ATOM   4220 C C     . ALA F 3 144 ? 34.776 -8.484  10.677  1.00 57.77  ? 144 ALA B C     1 
ATOM   4221 O O     . ALA F 3 144 ? 33.955 -8.964  9.886   1.00 57.52  ? 144 ALA B O     1 
ATOM   4222 C CB    . ALA F 3 144 ? 37.236 -8.602  11.094  1.00 55.20  ? 144 ALA B CB    1 
ATOM   4223 N N     . GLN F 3 145 ? 34.549 -8.313  11.979  1.00 59.26  ? 145 GLN B N     1 
ATOM   4224 C CA    . GLN F 3 145 ? 33.316 -8.711  12.648  1.00 60.00  ? 145 GLN B CA    1 
ATOM   4225 C C     . GLN F 3 145 ? 32.033 -8.377  11.884  1.00 60.16  ? 145 GLN B C     1 
ATOM   4226 O O     . GLN F 3 145 ? 31.114 -9.199  11.812  1.00 60.14  ? 145 GLN B O     1 
ATOM   4227 C CB    . GLN F 3 145 ? 33.257 -8.075  14.031  1.00 60.46  ? 145 GLN B CB    1 
ATOM   4228 C CG    . GLN F 3 145 ? 32.268 -8.758  14.944  1.00 63.78  ? 145 GLN B CG    1 
ATOM   4229 C CD    . GLN F 3 145 ? 32.713 -10.160 15.319  1.00 65.66  ? 145 GLN B CD    1 
ATOM   4230 O OE1   . GLN F 3 145 ? 31.955 -10.923 15.930  1.00 66.92  ? 145 GLN B OE1   1 
ATOM   4231 N NE2   . GLN F 3 145 ? 33.953 -10.505 14.966  1.00 65.39  ? 145 GLN B NE2   1 
ATOM   4232 N N     . THR F 3 146 ? 31.956 -7.171  11.330  1.00 59.49  ? 146 THR B N     1 
ATOM   4233 C CA    . THR F 3 146 ? 30.775 -6.788  10.577  1.00 60.11  ? 146 THR B CA    1 
ATOM   4234 C C     . THR F 3 146 ? 30.609 -7.725  9.397   1.00 61.72  ? 146 THR B C     1 
ATOM   4235 O O     . THR F 3 146 ? 29.513 -8.214  9.136   1.00 61.26  ? 146 THR B O     1 
ATOM   4236 C CB    . THR F 3 146 ? 30.879 -5.349  10.048  1.00 59.57  ? 146 THR B CB    1 
ATOM   4237 O OG1   . THR F 3 146 ? 30.678 -4.437  11.128  1.00 61.56  ? 146 THR B OG1   1 
ATOM   4238 C CG2   . THR F 3 146 ? 29.833 -5.087  8.982   1.00 57.17  ? 146 THR B CG2   1 
ATOM   4239 N N     . LEU F 3 147 ? 31.705 -7.979  8.688   1.00 63.15  ? 147 LEU B N     1 
ATOM   4240 C CA    . LEU F 3 147 ? 31.653 -8.852  7.532   1.00 65.64  ? 147 LEU B CA    1 
ATOM   4241 C C     . LEU F 3 147 ? 30.993 -10.174 7.872   1.00 68.57  ? 147 LEU B C     1 
ATOM   4242 O O     . LEU F 3 147 ? 30.064 -10.592 7.178   1.00 70.47  ? 147 LEU B O     1 
ATOM   4243 C CB    . LEU F 3 147 ? 33.048 -9.103  6.977   1.00 65.14  ? 147 LEU B CB    1 
ATOM   4244 C CG    . LEU F 3 147 ? 33.792 -7.899  6.391   1.00 64.12  ? 147 LEU B CG    1 
ATOM   4245 C CD1   . LEU F 3 147 ? 35.141 -8.395  5.882   1.00 62.21  ? 147 LEU B CD1   1 
ATOM   4246 C CD2   . LEU F 3 147 ? 32.991 -7.234  5.277   1.00 59.90  ? 147 LEU B CD2   1 
ATOM   4247 N N     . LEU F 3 148 ? 31.457 -10.838 8.929   1.00 70.19  ? 148 LEU B N     1 
ATOM   4248 C CA    . LEU F 3 148 ? 30.857 -12.113 9.316   1.00 71.20  ? 148 LEU B CA    1 
ATOM   4249 C C     . LEU F 3 148 ? 29.358 -11.904 9.475   1.00 72.92  ? 148 LEU B C     1 
ATOM   4250 O O     . LEU F 3 148 ? 28.554 -12.649 8.911   1.00 74.43  ? 148 LEU B O     1 
ATOM   4251 C CB    . LEU F 3 148 ? 31.423 -12.627 10.642  1.00 70.84  ? 148 LEU B CB    1 
ATOM   4252 C CG    . LEU F 3 148 ? 32.922 -12.895 10.787  1.00 70.60  ? 148 LEU B CG    1 
ATOM   4253 C CD1   . LEU F 3 148 ? 33.409 -13.600 9.535   1.00 71.34  ? 148 LEU B CD1   1 
ATOM   4254 C CD2   . LEU F 3 148 ? 33.680 -11.591 11.002  1.00 69.57  ? 148 LEU B CD2   1 
ATOM   4255 N N     . ASN F 3 149 ? 28.991 -10.876 10.236  1.00 73.51  ? 149 ASN B N     1 
ATOM   4256 C CA    . ASN F 3 149 ? 27.589 -10.557 10.485  1.00 74.01  ? 149 ASN B CA    1 
ATOM   4257 C C     . ASN F 3 149 ? 26.798 -10.280 9.214   1.00 75.51  ? 149 ASN B C     1 
ATOM   4258 O O     . ASN F 3 149 ? 25.721 -10.843 9.021   1.00 76.72  ? 149 ASN B O     1 
ATOM   4259 C CB    . ASN F 3 149 ? 27.497 -9.369  11.435  1.00 73.51  ? 149 ASN B CB    1 
ATOM   4260 C CG    . ASN F 3 149 ? 27.803 -9.756  12.865  1.00 74.06  ? 149 ASN B CG    1 
ATOM   4261 O OD1   . ASN F 3 149 ? 28.389 -8.980  13.632  1.00 73.83  ? 149 ASN B OD1   1 
ATOM   4262 N ND2   . ASN F 3 149 ? 27.395 -10.963 13.240  1.00 73.21  ? 149 ASN B ND2   1 
ATOM   4263 N N     . LEU F 3 150 ? 27.317 -9.416  8.347   1.00 76.03  ? 150 LEU B N     1 
ATOM   4264 C CA    . LEU F 3 150 ? 26.619 -9.117  7.105   1.00 76.58  ? 150 LEU B CA    1 
ATOM   4265 C C     . LEU F 3 150 ? 26.359 -10.404 6.336   1.00 77.46  ? 150 LEU B C     1 
ATOM   4266 O O     . LEU F 3 150 ? 25.388 -10.509 5.585   1.00 77.24  ? 150 LEU B O     1 
ATOM   4267 C CB    . LEU F 3 150 ? 27.432 -8.146  6.258   1.00 75.77  ? 150 LEU B CB    1 
ATOM   4268 C CG    . LEU F 3 150 ? 27.450 -6.722  6.812   1.00 76.02  ? 150 LEU B CG    1 
ATOM   4269 C CD1   . LEU F 3 150 ? 28.215 -5.807  5.871   1.00 76.07  ? 150 LEU B CD1   1 
ATOM   4270 C CD2   . LEU F 3 150 ? 26.018 -6.226  6.974   1.00 76.95  ? 150 LEU B CD2   1 
ATOM   4271 N N     . ALA F 3 151 ? 27.226 -11.387 6.546   1.00 79.27  ? 151 ALA B N     1 
ATOM   4272 C CA    . ALA F 3 151 ? 27.091 -12.685 5.895   1.00 81.71  ? 151 ALA B CA    1 
ATOM   4273 C C     . ALA F 3 151 ? 26.085 -13.531 6.668   1.00 82.75  ? 151 ALA B C     1 
ATOM   4274 O O     . ALA F 3 151 ? 26.208 -14.756 6.751   1.00 83.30  ? 151 ALA B O     1 
ATOM   4275 C CB    . ALA F 3 151 ? 28.439 -13.391 5.846   1.00 82.59  ? 151 ALA B CB    1 
ATOM   4276 N N     . LYS F 3 152 ? 25.094 -12.866 7.246   1.00 83.14  ? 152 LYS B N     1 
ATOM   4277 C CA    . LYS F 3 152 ? 24.065 -13.553 8.005   1.00 83.19  ? 152 LYS B CA    1 
ATOM   4278 C C     . LYS F 3 152 ? 22.718 -12.961 7.637   1.00 82.85  ? 152 LYS B C     1 
ATOM   4279 O O     . LYS F 3 152 ? 21.689 -13.599 7.809   1.00 82.51  ? 152 LYS B O     1 
ATOM   4280 C CB    . LYS F 3 152 ? 24.319 -13.405 9.508   1.00 83.90  ? 152 LYS B CB    1 
ATOM   4281 C CG    . LYS F 3 152 ? 25.400 -14.325 10.066  1.00 84.87  ? 152 LYS B CG    1 
ATOM   4282 C CD    . LYS F 3 152 ? 24.908 -15.767 10.115  1.00 87.85  ? 152 LYS B CD    1 
ATOM   4283 C CE    . LYS F 3 152 ? 25.915 -16.728 10.765  1.00 88.91  ? 152 LYS B CE    1 
ATOM   4284 N NZ    . LYS F 3 152 ? 27.135 -16.986 9.937   1.00 90.13  ? 152 LYS B NZ    1 
ATOM   4285 N N     . GLN F 3 153 ? 22.716 -11.739 7.125   1.00 83.54  ? 153 GLN B N     1 
ATOM   4286 C CA    . GLN F 3 153 ? 21.457 -11.128 6.744   1.00 85.84  ? 153 GLN B CA    1 
ATOM   4287 C C     . GLN F 3 153 ? 20.830 -11.944 5.617   1.00 88.41  ? 153 GLN B C     1 
ATOM   4288 O O     . GLN F 3 153 ? 21.537 -12.555 4.820   1.00 89.70  ? 153 GLN B O     1 
ATOM   4289 C CB    . GLN F 3 153 ? 21.690 -9.683  6.312   1.00 84.76  ? 153 GLN B CB    1 
ATOM   4290 C CG    . GLN F 3 153 ? 22.232 -8.817  7.435   1.00 82.75  ? 153 GLN B CG    1 
ATOM   4291 C CD    . GLN F 3 153 ? 21.392 -8.913  8.698   1.00 80.99  ? 153 GLN B CD    1 
ATOM   4292 O OE1   . GLN F 3 153 ? 20.246 -8.477  8.725   1.00 79.11  ? 153 GLN B OE1   1 
ATOM   4293 N NE2   . GLN F 3 153 ? 21.964 -9.494  9.751   1.00 80.38  ? 153 GLN B NE2   1 
ATOM   4294 N N     . PRO F 3 154 ? 19.491 -11.975 5.540   1.00 90.36  ? 154 PRO B N     1 
ATOM   4295 C CA    . PRO F 3 154 ? 18.821 -12.743 4.485   1.00 91.44  ? 154 PRO B CA    1 
ATOM   4296 C C     . PRO F 3 154 ? 19.156 -12.295 3.065   1.00 92.97  ? 154 PRO B C     1 
ATOM   4297 O O     . PRO F 3 154 ? 19.162 -13.106 2.142   1.00 93.23  ? 154 PRO B O     1 
ATOM   4298 C CB    . PRO F 3 154 ? 17.344 -12.574 4.822   1.00 91.06  ? 154 PRO B CB    1 
ATOM   4299 C CG    . PRO F 3 154 ? 17.301 -11.222 5.455   1.00 91.35  ? 154 PRO B CG    1 
ATOM   4300 C CD    . PRO F 3 154 ? 18.507 -11.247 6.359   1.00 90.89  ? 154 PRO B CD    1 
ATOM   4301 N N     . ASP F 3 155 ? 19.446 -11.011 2.889   1.00 94.40  ? 155 ASP B N     1 
ATOM   4302 C CA    . ASP F 3 155 ? 19.785 -10.490 1.569   1.00 96.40  ? 155 ASP B CA    1 
ATOM   4303 C C     . ASP F 3 155 ? 21.167 -10.968 1.126   1.00 97.44  ? 155 ASP B C     1 
ATOM   4304 O O     . ASP F 3 155 ? 21.784 -10.387 0.229   1.00 96.65  ? 155 ASP B O     1 
ATOM   4305 C CB    . ASP F 3 155 ? 19.745 -8.959  1.586   1.00 98.08  ? 155 ASP B CB    1 
ATOM   4306 C CG    . ASP F 3 155 ? 20.708 -8.355  2.600   1.00 100.28 ? 155 ASP B CG    1 
ATOM   4307 O OD1   . ASP F 3 155 ? 21.934 -8.339  2.337   1.00 100.96 ? 155 ASP B OD1   1 
ATOM   4308 O OD2   . ASP F 3 155 ? 20.234 -7.901  3.667   1.00 101.31 ? 155 ASP B OD2   1 
ATOM   4309 N N     . ALA F 3 156 ? 21.639 -12.044 1.746   1.00 98.92  ? 156 ALA B N     1 
ATOM   4310 C CA    . ALA F 3 156 ? 22.956 -12.576 1.441   1.00 100.91 ? 156 ALA B CA    1 
ATOM   4311 C C     . ALA F 3 156 ? 22.939 -13.940 0.781   1.00 102.19 ? 156 ALA B C     1 
ATOM   4312 O O     . ALA F 3 156 ? 22.316 -14.880 1.276   1.00 101.43 ? 156 ALA B O     1 
ATOM   4313 C CB    . ALA F 3 156 ? 23.787 -12.633 2.709   1.00 101.12 ? 156 ALA B CB    1 
ATOM   4314 N N     . MET F 3 157 ? 23.654 -14.035 -0.337  1.00 104.81 ? 157 MET B N     1 
ATOM   4315 C CA    . MET F 3 157 ? 23.763 -15.273 -1.103  1.00 106.89 ? 157 MET B CA    1 
ATOM   4316 C C     . MET F 3 157 ? 24.783 -16.213 -0.470  1.00 107.79 ? 157 MET B C     1 
ATOM   4317 O O     . MET F 3 157 ? 25.490 -15.842 0.469   1.00 107.64 ? 157 MET B O     1 
ATOM   4318 C CB    . MET F 3 157 ? 24.171 -14.962 -2.547  1.00 106.75 ? 157 MET B CB    1 
ATOM   4319 C CG    . MET F 3 157 ? 23.156 -14.102 -3.283  1.00 107.64 ? 157 MET B CG    1 
ATOM   4320 S SD    . MET F 3 157 ? 23.886 -12.643 -4.045  1.00 109.16 ? 157 MET B SD    1 
ATOM   4321 C CE    . MET F 3 157 ? 24.121 -11.562 -2.602  1.00 109.31 ? 157 MET B CE    1 
ATOM   4322 N N     . THR F 3 158 ? 24.852 -17.433 -0.990  1.00 108.95 ? 158 THR B N     1 
ATOM   4323 C CA    . THR F 3 158 ? 25.782 -18.430 -0.473  1.00 109.73 ? 158 THR B CA    1 
ATOM   4324 C C     . THR F 3 158 ? 26.872 -18.745 -1.500  1.00 110.58 ? 158 THR B C     1 
ATOM   4325 O O     . THR F 3 158 ? 26.590 -19.086 -2.652  1.00 110.77 ? 158 THR B O     1 
ATOM   4326 C CB    . THR F 3 158 ? 25.035 -19.735 -0.082  1.00 109.20 ? 158 THR B CB    1 
ATOM   4327 O OG1   . THR F 3 158 ? 25.977 -20.707 0.384   1.00 108.56 ? 158 THR B OG1   1 
ATOM   4328 C CG2   . THR F 3 158 ? 24.263 -20.294 -1.273  1.00 108.14 ? 158 THR B CG2   1 
ATOM   4329 N N     . HIS F 3 159 ? 28.121 -18.615 -1.077  1.00 110.78 ? 159 HIS B N     1 
ATOM   4330 C CA    . HIS F 3 159 ? 29.244 -18.884 -1.957  1.00 111.44 ? 159 HIS B CA    1 
ATOM   4331 C C     . HIS F 3 159 ? 29.836 -20.242 -1.575  1.00 111.76 ? 159 HIS B C     1 
ATOM   4332 O O     . HIS F 3 159 ? 29.495 -20.803 -0.531  1.00 112.38 ? 159 HIS B O     1 
ATOM   4333 C CB    . HIS F 3 159 ? 30.299 -17.787 -1.798  1.00 111.85 ? 159 HIS B CB    1 
ATOM   4334 C CG    . HIS F 3 159 ? 31.010 -17.442 -3.069  1.00 111.93 ? 159 HIS B CG    1 
ATOM   4335 N ND1   . HIS F 3 159 ? 30.385 -16.809 -4.121  1.00 111.63 ? 159 HIS B ND1   1 
ATOM   4336 C CD2   . HIS F 3 159 ? 32.290 -17.646 -3.457  1.00 111.54 ? 159 HIS B CD2   1 
ATOM   4337 C CE1   . HIS F 3 159 ? 31.251 -16.636 -5.103  1.00 111.73 ? 159 HIS B CE1   1 
ATOM   4338 N NE2   . HIS F 3 159 ? 32.414 -17.136 -4.726  1.00 111.93 ? 159 HIS B NE2   1 
ATOM   4339 N N     . PRO F 3 160 ? 30.714 -20.799 -2.425  1.00 111.17 ? 160 PRO B N     1 
ATOM   4340 C CA    . PRO F 3 160 ? 31.320 -22.098 -2.113  1.00 110.12 ? 160 PRO B CA    1 
ATOM   4341 C C     . PRO F 3 160 ? 32.513 -22.011 -1.165  1.00 109.16 ? 160 PRO B C     1 
ATOM   4342 O O     . PRO F 3 160 ? 33.016 -23.026 -0.698  1.00 108.98 ? 160 PRO B O     1 
ATOM   4343 C CB    . PRO F 3 160 ? 31.708 -22.629 -3.488  1.00 110.47 ? 160 PRO B CB    1 
ATOM   4344 C CG    . PRO F 3 160 ? 32.036 -21.383 -4.242  1.00 111.26 ? 160 PRO B CG    1 
ATOM   4345 C CD    . PRO F 3 160 ? 30.905 -20.466 -3.849  1.00 111.19 ? 160 PRO B CD    1 
ATOM   4346 N N     . ASP F 3 161 ? 32.963 -20.795 -0.881  1.00 108.89 ? 161 ASP B N     1 
ATOM   4347 C CA    . ASP F 3 161 ? 34.099 -20.605 0.018   1.00 108.74 ? 161 ASP B CA    1 
ATOM   4348 C C     . ASP F 3 161 ? 33.637 -20.183 1.417   1.00 108.01 ? 161 ASP B C     1 
ATOM   4349 O O     . ASP F 3 161 ? 34.157 -20.657 2.430   1.00 107.58 ? 161 ASP B O     1 
ATOM   4350 C CB    . ASP F 3 161 ? 35.054 -19.564 -0.570  1.00 109.22 ? 161 ASP B CB    1 
ATOM   4351 C CG    . ASP F 3 161 ? 35.352 -19.816 -2.040  1.00 109.85 ? 161 ASP B CG    1 
ATOM   4352 O OD1   . ASP F 3 161 ? 34.441 -19.613 -2.875  1.00 109.77 ? 161 ASP B OD1   1 
ATOM   4353 O OD2   . ASP F 3 161 ? 36.494 -20.218 -2.360  1.00 109.71 ? 161 ASP B OD2   1 
ATOM   4354 N N     . GLY F 3 162 ? 32.652 -19.289 1.458   1.00 107.03 ? 162 GLY B N     1 
ATOM   4355 C CA    . GLY F 3 162 ? 32.107 -18.818 2.720   1.00 104.84 ? 162 GLY B CA    1 
ATOM   4356 C C     . GLY F 3 162 ? 30.691 -18.313 2.508   1.00 103.57 ? 162 GLY B C     1 
ATOM   4357 O O     . GLY F 3 162 ? 29.713 -19.027 2.748   1.00 103.30 ? 162 GLY B O     1 
ATOM   4358 N N     . MET F 3 163 ? 30.584 -17.070 2.054   1.00 101.95 ? 163 MET B N     1 
ATOM   4359 C CA    . MET F 3 163 ? 29.292 -16.457 1.781   1.00 100.06 ? 163 MET B CA    1 
ATOM   4360 C C     . MET F 3 163 ? 29.580 -15.251 0.885   1.00 99.17  ? 163 MET B C     1 
ATOM   4361 O O     . MET F 3 163 ? 30.740 -14.898 0.674   1.00 99.36  ? 163 MET B O     1 
ATOM   4362 C CB    . MET F 3 163 ? 28.611 -16.035 3.089   1.00 98.86  ? 163 MET B CB    1 
ATOM   4363 C CG    . MET F 3 163 ? 27.110 -15.764 2.964   1.00 98.57  ? 163 MET B CG    1 
ATOM   4364 S SD    . MET F 3 163 ? 26.061 -17.231 2.781   1.00 97.32  ? 163 MET B SD    1 
ATOM   4365 C CE    . MET F 3 163 ? 25.000 -17.076 4.232   1.00 96.19  ? 163 MET B CE    1 
ATOM   4366 N N     . GLN F 3 164 ? 28.539 -14.615 0.363   1.00 97.95  ? 164 GLN B N     1 
ATOM   4367 C CA    . GLN F 3 164 ? 28.731 -13.487 -0.539  1.00 96.54  ? 164 GLN B CA    1 
ATOM   4368 C C     . GLN F 3 164 ? 27.676 -12.403 -0.358  1.00 94.70  ? 164 GLN B C     1 
ATOM   4369 O O     . GLN F 3 164 ? 26.476 -12.685 -0.324  1.00 94.23  ? 164 GLN B O     1 
ATOM   4370 C CB    . GLN F 3 164 ? 28.697 -14.008 -1.974  1.00 98.76  ? 164 GLN B CB    1 
ATOM   4371 C CG    . GLN F 3 164 ? 28.735 -12.956 -3.062  1.00 101.35 ? 164 GLN B CG    1 
ATOM   4372 C CD    . GLN F 3 164 ? 28.406 -13.543 -4.424  1.00 102.52 ? 164 GLN B CD    1 
ATOM   4373 O OE1   . GLN F 3 164 ? 27.304 -14.057 -4.640  1.00 103.57 ? 164 GLN B OE1   1 
ATOM   4374 N NE2   . GLN F 3 164 ? 29.362 -13.477 -5.348  1.00 102.45 ? 164 GLN B NE2   1 
ATOM   4375 N N     . ILE F 3 165 ? 28.122 -11.157 -0.261  1.00 91.91  ? 165 ILE B N     1 
ATOM   4376 C CA    . ILE F 3 165 ? 27.189 -10.060 -0.081  1.00 89.73  ? 165 ILE B CA    1 
ATOM   4377 C C     . ILE F 3 165 ? 27.532 -8.849  -0.922  1.00 88.03  ? 165 ILE B C     1 
ATOM   4378 O O     . ILE F 3 165 ? 28.606 -8.770  -1.509  1.00 87.18  ? 165 ILE B O     1 
ATOM   4379 C CB    . ILE F 3 165 ? 27.117 -9.606  1.392   1.00 90.09  ? 165 ILE B CB    1 
ATOM   4380 C CG1   . ILE F 3 165 ? 28.498 -9.143  1.873   1.00 88.94  ? 165 ILE B CG1   1 
ATOM   4381 C CG2   . ILE F 3 165 ? 26.577 -10.737 2.255   1.00 90.04  ? 165 ILE B CG2   1 
ATOM   4382 C CD1   . ILE F 3 165 ? 29.470 -10.264 2.160   1.00 89.69  ? 165 ILE B CD1   1 
ATOM   4383 N N     . LYS F 3 166 ? 26.596 -7.907  -0.957  1.00 87.16  ? 166 LYS B N     1 
ATOM   4384 C CA    . LYS F 3 166 ? 26.734 -6.668  -1.714  1.00 86.78  ? 166 LYS B CA    1 
ATOM   4385 C C     . LYS F 3 166 ? 26.553 -5.462  -0.810  1.00 85.40  ? 166 LYS B C     1 
ATOM   4386 O O     . LYS F 3 166 ? 25.439 -5.178  -0.359  1.00 85.55  ? 166 LYS B O     1 
ATOM   4387 C CB    . LYS F 3 166 ? 25.676 -6.577  -2.819  1.00 88.10  ? 166 LYS B CB    1 
ATOM   4388 C CG    . LYS F 3 166 ? 25.841 -7.530  -3.982  1.00 89.27  ? 166 LYS B CG    1 
ATOM   4389 C CD    . LYS F 3 166 ? 24.766 -7.265  -5.020  1.00 90.15  ? 166 LYS B CD    1 
ATOM   4390 C CE    . LYS F 3 166 ? 24.817 -5.825  -5.511  1.00 90.90  ? 166 LYS B CE    1 
ATOM   4391 N NZ    . LYS F 3 166 ? 23.711 -5.534  -6.465  1.00 92.33  ? 166 LYS B NZ    1 
ATOM   4392 N N     . ILE F 3 167 ? 27.638 -4.739  -0.563  1.00 83.52  ? 167 ILE B N     1 
ATOM   4393 C CA    . ILE F 3 167 ? 27.562 -3.557  0.277   1.00 81.31  ? 167 ILE B CA    1 
ATOM   4394 C C     . ILE F 3 167 ? 28.667 -2.577  -0.061  1.00 79.27  ? 167 ILE B C     1 
ATOM   4395 O O     . ILE F 3 167 ? 29.834 -2.952  -0.155  1.00 77.71  ? 167 ILE B O     1 
ATOM   4396 C CB    . ILE F 3 167 ? 27.663 -3.933  1.757   1.00 81.74  ? 167 ILE B CB    1 
ATOM   4397 C CG1   . ILE F 3 167 ? 27.590 -2.667  2.614   1.00 82.21  ? 167 ILE B CG1   1 
ATOM   4398 C CG2   . ILE F 3 167 ? 28.945 -4.718  1.999   1.00 81.84  ? 167 ILE B CG2   1 
ATOM   4399 C CD1   . ILE F 3 167 ? 27.388 -2.928  4.091   1.00 83.73  ? 167 ILE B CD1   1 
ATOM   4400 N N     . THR F 3 168 ? 28.293 -1.320  -0.248  1.00 77.12  ? 168 THR B N     1 
ATOM   4401 C CA    . THR F 3 168 ? 29.268 -0.299  -0.575  1.00 78.11  ? 168 THR B CA    1 
ATOM   4402 C C     . THR F 3 168 ? 30.273 -0.182  0.570   1.00 79.42  ? 168 THR B C     1 
ATOM   4403 O O     . THR F 3 168 ? 29.975 -0.580  1.692   1.00 81.12  ? 168 THR B O     1 
ATOM   4404 C CB    . THR F 3 168 ? 28.588 1.056   -0.764  1.00 77.30  ? 168 THR B CB    1 
ATOM   4405 O OG1   . THR F 3 168 ? 28.338 1.652   0.513   1.00 78.09  ? 168 THR B OG1   1 
ATOM   4406 C CG2   . THR F 3 168 ? 27.271 0.882   -1.469  1.00 76.89  ? 168 THR B CG2   1 
ATOM   4407 N N     . ARG F 3 169 ? 31.466 0.338   0.292   1.00 79.84  ? 169 ARG B N     1 
ATOM   4408 C CA    . ARG F 3 169 ? 32.464 0.522   1.343   1.00 80.08  ? 169 ARG B CA    1 
ATOM   4409 C C     . ARG F 3 169 ? 31.961 1.654   2.226   1.00 80.01  ? 169 ARG B C     1 
ATOM   4410 O O     . ARG F 3 169 ? 32.391 1.818   3.363   1.00 79.87  ? 169 ARG B O     1 
ATOM   4411 C CB    . ARG F 3 169 ? 33.828 0.909   0.761   1.00 80.85  ? 169 ARG B CB    1 
ATOM   4412 C CG    . ARG F 3 169 ? 34.722 -0.264  0.385   1.00 82.99  ? 169 ARG B CG    1 
ATOM   4413 C CD    . ARG F 3 169 ? 34.404 -0.814  -0.986  1.00 85.45  ? 169 ARG B CD    1 
ATOM   4414 N NE    . ARG F 3 169 ? 35.193 -2.004  -1.299  1.00 88.28  ? 169 ARG B NE    1 
ATOM   4415 C CZ    . ARG F 3 169 ? 36.524 -2.071  -1.257  1.00 90.37  ? 169 ARG B CZ    1 
ATOM   4416 N NH1   . ARG F 3 169 ? 37.243 -1.009  -0.907  1.00 90.84  ? 169 ARG B NH1   1 
ATOM   4417 N NH2   . ARG F 3 169 ? 37.139 -3.207  -1.574  1.00 89.97  ? 169 ARG B NH2   1 
ATOM   4418 N N     . GLN F 3 170 ? 31.044 2.439   1.675   1.00 79.69  ? 170 GLN B N     1 
ATOM   4419 C CA    . GLN F 3 170 ? 30.456 3.556   2.387   1.00 79.23  ? 170 GLN B CA    1 
ATOM   4420 C C     . GLN F 3 170 ? 29.659 2.986   3.538   1.00 78.30  ? 170 GLN B C     1 
ATOM   4421 O O     . GLN F 3 170 ? 29.877 3.324   4.691   1.00 78.52  ? 170 GLN B O     1 
ATOM   4422 C CB    . GLN F 3 170 ? 29.515 4.324   1.470   1.00 80.44  ? 170 GLN B CB    1 
ATOM   4423 C CG    . GLN F 3 170 ? 29.241 5.727   1.930   1.00 81.56  ? 170 GLN B CG    1 
ATOM   4424 C CD    . GLN F 3 170 ? 30.482 6.583   1.849   1.00 84.01  ? 170 GLN B CD    1 
ATOM   4425 O OE1   . GLN F 3 170 ? 31.058 6.765   0.771   1.00 85.26  ? 170 GLN B OE1   1 
ATOM   4426 N NE2   . GLN F 3 170 ? 30.909 7.114   2.990   1.00 85.98  ? 170 GLN B NE2   1 
ATOM   4427 N N     . GLU F 3 171 ? 28.719 2.116   3.206   1.00 78.02  ? 171 GLU B N     1 
ATOM   4428 C CA    . GLU F 3 171 ? 27.880 1.488   4.211   1.00 78.76  ? 171 GLU B CA    1 
ATOM   4429 C C     . GLU F 3 171 ? 28.721 0.965   5.369   1.00 77.73  ? 171 GLU B C     1 
ATOM   4430 O O     . GLU F 3 171 ? 28.563 1.409   6.510   1.00 77.96  ? 171 GLU B O     1 
ATOM   4431 C CB    . GLU F 3 171 ? 27.083 0.340   3.587   1.00 79.94  ? 171 GLU B CB    1 
ATOM   4432 C CG    . GLU F 3 171 ? 25.894 0.788   2.760   1.00 81.54  ? 171 GLU B CG    1 
ATOM   4433 C CD    . GLU F 3 171 ? 24.665 1.026   3.607   1.00 82.49  ? 171 GLU B CD    1 
ATOM   4434 O OE1   . GLU F 3 171 ? 23.998 0.034   3.984   1.00 81.81  ? 171 GLU B OE1   1 
ATOM   4435 O OE2   . GLU F 3 171 ? 24.375 2.207   3.903   1.00 84.31  ? 171 GLU B OE2   1 
ATOM   4436 N N     . ILE F 3 172 ? 29.608 0.020   5.075   1.00 75.88  ? 172 ILE B N     1 
ATOM   4437 C CA    . ILE F 3 172 ? 30.468 -0.553  6.103   1.00 73.40  ? 172 ILE B CA    1 
ATOM   4438 C C     . ILE F 3 172 ? 31.076 0.534   6.983   1.00 71.27  ? 172 ILE B C     1 
ATOM   4439 O O     . ILE F 3 172 ? 31.099 0.413   8.207   1.00 71.23  ? 172 ILE B O     1 
ATOM   4440 C CB    . ILE F 3 172 ? 31.576 -1.397  5.476   1.00 72.81  ? 172 ILE B CB    1 
ATOM   4441 C CG1   . ILE F 3 172 ? 30.967 -2.688  4.928   1.00 72.44  ? 172 ILE B CG1   1 
ATOM   4442 C CG2   . ILE F 3 172 ? 32.651 -1.685  6.500   1.00 72.12  ? 172 ILE B CG2   1 
ATOM   4443 C CD1   . ILE F 3 172 ? 31.959 -3.587  4.214   1.00 74.23  ? 172 ILE B CD1   1 
ATOM   4444 N N     . GLY F 3 173 ? 31.558 1.600   6.363   1.00 69.28  ? 173 GLY B N     1 
ATOM   4445 C CA    . GLY F 3 173 ? 32.117 2.680   7.143   1.00 68.46  ? 173 GLY B CA    1 
ATOM   4446 C C     . GLY F 3 173 ? 31.088 3.176   8.148   1.00 68.66  ? 173 GLY B C     1 
ATOM   4447 O O     . GLY F 3 173 ? 31.436 3.605   9.246   1.00 69.99  ? 173 GLY B O     1 
ATOM   4448 N N     . GLN F 3 174 ? 29.812 3.094   7.785   1.00 66.75  ? 174 GLN B N     1 
ATOM   4449 C CA    . GLN F 3 174 ? 28.736 3.561   8.651   1.00 65.19  ? 174 GLN B CA    1 
ATOM   4450 C C     . GLN F 3 174 ? 28.274 2.551   9.696   1.00 64.05  ? 174 GLN B C     1 
ATOM   4451 O O     . GLN F 3 174 ? 27.571 2.907   10.645  1.00 62.94  ? 174 GLN B O     1 
ATOM   4452 C CB    . GLN F 3 174 ? 27.538 3.990   7.809   1.00 65.94  ? 174 GLN B CB    1 
ATOM   4453 C CG    . GLN F 3 174 ? 27.839 5.090   6.819   1.00 65.81  ? 174 GLN B CG    1 
ATOM   4454 C CD    . GLN F 3 174 ? 26.598 5.558   6.090   1.00 67.05  ? 174 GLN B CD    1 
ATOM   4455 O OE1   . GLN F 3 174 ? 25.914 4.771   5.422   1.00 66.70  ? 174 GLN B OE1   1 
ATOM   4456 N NE2   . GLN F 3 174 ? 26.294 6.848   6.216   1.00 67.13  ? 174 GLN B NE2   1 
ATOM   4457 N N     . ILE F 3 175 ? 28.656 1.296   9.526   1.00 62.19  ? 175 ILE B N     1 
ATOM   4458 C CA    . ILE F 3 175 ? 28.259 0.291   10.490  1.00 61.91  ? 175 ILE B CA    1 
ATOM   4459 C C     . ILE F 3 175 ? 29.322 0.114   11.567  1.00 61.56  ? 175 ILE B C     1 
ATOM   4460 O O     . ILE F 3 175 ? 28.993 -0.150  12.726  1.00 63.08  ? 175 ILE B O     1 
ATOM   4461 C CB    . ILE F 3 175 ? 27.996 -1.072  9.820   1.00 62.14  ? 175 ILE B CB    1 
ATOM   4462 C CG1   . ILE F 3 175 ? 26.849 -0.940  8.817   1.00 63.51  ? 175 ILE B CG1   1 
ATOM   4463 C CG2   . ILE F 3 175 ? 27.644 -2.118  10.878  1.00 61.49  ? 175 ILE B CG2   1 
ATOM   4464 C CD1   . ILE F 3 175 ? 26.498 -2.241  8.090   1.00 64.54  ? 175 ILE B CD1   1 
ATOM   4465 N N     . VAL F 3 176 ? 30.593 0.253   11.195  1.00 59.87  ? 176 VAL B N     1 
ATOM   4466 C CA    . VAL F 3 176 ? 31.679 0.093   12.164  1.00 56.79  ? 176 VAL B CA    1 
ATOM   4467 C C     . VAL F 3 176 ? 32.071 1.443   12.743  1.00 55.04  ? 176 VAL B C     1 
ATOM   4468 O O     . VAL F 3 176 ? 32.649 1.519   13.823  1.00 54.04  ? 176 VAL B O     1 
ATOM   4469 C CB    . VAL F 3 176 ? 32.936 -0.548  11.526  1.00 55.83  ? 176 VAL B CB    1 
ATOM   4470 C CG1   . VAL F 3 176 ? 32.600 -1.910  10.941  1.00 53.62  ? 176 VAL B CG1   1 
ATOM   4471 C CG2   . VAL F 3 176 ? 33.498 0.379   10.468  1.00 55.44  ? 176 VAL B CG2   1 
ATOM   4472 N N     . GLY F 3 177 ? 31.759 2.505   12.007  1.00 54.05  ? 177 GLY B N     1 
ATOM   4473 C CA    . GLY F 3 177 ? 32.073 3.848   12.459  1.00 52.16  ? 177 GLY B CA    1 
ATOM   4474 C C     . GLY F 3 177 ? 33.465 4.326   12.100  1.00 52.01  ? 177 GLY B C     1 
ATOM   4475 O O     . GLY F 3 177 ? 34.254 4.651   12.972  1.00 50.57  ? 177 GLY B O     1 
ATOM   4476 N N     . CYS F 3 178 ? 33.771 4.360   10.812  1.00 53.98  ? 178 CYS B N     1 
ATOM   4477 C CA    . CYS F 3 178 ? 35.070 4.825   10.346  1.00 56.30  ? 178 CYS B CA    1 
ATOM   4478 C C     . CYS F 3 178 ? 34.906 5.316   8.922   1.00 57.16  ? 178 CYS B C     1 
ATOM   4479 O O     . CYS F 3 178 ? 33.898 5.046   8.285   1.00 58.12  ? 178 CYS B O     1 
ATOM   4480 C CB    . CYS F 3 178 ? 36.088 3.697   10.374  1.00 56.95  ? 178 CYS B CB    1 
ATOM   4481 S SG    . CYS F 3 178 ? 35.690 2.393   9.228   1.00 59.50  ? 178 CYS B SG    1 
ATOM   4482 N N     . SER F 3 179 ? 35.909 6.019   8.420   1.00 58.75  ? 179 SER B N     1 
ATOM   4483 C CA    . SER F 3 179 ? 35.871 6.572   7.072   1.00 60.61  ? 179 SER B CA    1 
ATOM   4484 C C     . SER F 3 179 ? 35.833 5.580   5.900   1.00 61.98  ? 179 SER B C     1 
ATOM   4485 O O     . SER F 3 179 ? 36.262 4.422   6.017   1.00 61.42  ? 179 SER B O     1 
ATOM   4486 C CB    . SER F 3 179 ? 37.059 7.507   6.895   1.00 60.20  ? 179 SER B CB    1 
ATOM   4487 O OG    . SER F 3 179 ? 37.027 8.499   7.900   1.00 62.83  ? 179 SER B OG    1 
ATOM   4488 N N     . ARG F 3 180 ? 35.312 6.067   4.769   1.00 63.17  ? 180 ARG B N     1 
ATOM   4489 C CA    . ARG F 3 180 ? 35.209 5.290   3.531   1.00 63.64  ? 180 ARG B CA    1 
ATOM   4490 C C     . ARG F 3 180 ? 36.614 4.836   3.140   1.00 64.20  ? 180 ARG B C     1 
ATOM   4491 O O     . ARG F 3 180 ? 36.804 3.719   2.657   1.00 65.12  ? 180 ARG B O     1 
ATOM   4492 C CB    . ARG F 3 180 ? 34.627 6.157   2.413   1.00 62.84  ? 180 ARG B CB    1 
ATOM   4493 C CG    . ARG F 3 180 ? 35.396 7.456   2.221   1.00 63.14  ? 180 ARG B CG    1 
ATOM   4494 C CD    . ARG F 3 180 ? 34.976 8.227   0.982   1.00 62.81  ? 180 ARG B CD    1 
ATOM   4495 N NE    . ARG F 3 180 ? 36.121 8.537   0.119   1.00 62.72  ? 180 ARG B NE    1 
ATOM   4496 C CZ    . ARG F 3 180 ? 36.859 7.625   -0.513  1.00 61.84  ? 180 ARG B CZ    1 
ATOM   4497 N NH1   . ARG F 3 180 ? 36.585 6.330   -0.390  1.00 63.09  ? 180 ARG B NH1   1 
ATOM   4498 N NH2   . ARG F 3 180 ? 37.873 8.004   -1.270  1.00 61.02  ? 180 ARG B NH2   1 
ATOM   4499 N N     . GLU F 3 181 ? 37.594 5.715   3.351   1.00 63.74  ? 181 GLU B N     1 
ATOM   4500 C CA    . GLU F 3 181 ? 38.983 5.398   3.043   1.00 63.40  ? 181 GLU B CA    1 
ATOM   4501 C C     . GLU F 3 181 ? 39.395 4.188   3.863   1.00 62.18  ? 181 GLU B C     1 
ATOM   4502 O O     . GLU F 3 181 ? 39.588 3.094   3.332   1.00 62.93  ? 181 GLU B O     1 
ATOM   4503 C CB    . GLU F 3 181 ? 39.917 6.558   3.401   1.00 63.96  ? 181 GLU B CB    1 
ATOM   4504 C CG    . GLU F 3 181 ? 39.767 7.818   2.564   1.00 66.19  ? 181 GLU B CG    1 
ATOM   4505 C CD    . GLU F 3 181 ? 38.600 8.687   2.993   1.00 67.95  ? 181 GLU B CD    1 
ATOM   4506 O OE1   . GLU F 3 181 ? 38.621 9.896   2.679   1.00 68.63  ? 181 GLU B OE1   1 
ATOM   4507 O OE2   . GLU F 3 181 ? 37.662 8.168   3.637   1.00 68.43  ? 181 GLU B OE2   1 
ATOM   4508 N N     . THR F 3 182 ? 39.521 4.396   5.166   1.00 59.95  ? 182 THR B N     1 
ATOM   4509 C CA    . THR F 3 182 ? 39.926 3.331   6.056   1.00 58.40  ? 182 THR B CA    1 
ATOM   4510 C C     . THR F 3 182 ? 39.277 2.012   5.682   1.00 58.25  ? 182 THR B C     1 
ATOM   4511 O O     . THR F 3 182 ? 39.937 0.974   5.674   1.00 58.84  ? 182 THR B O     1 
ATOM   4512 C CB    . THR F 3 182 ? 39.589 3.671   7.524   1.00 58.43  ? 182 THR B CB    1 
ATOM   4513 O OG1   . THR F 3 182 ? 40.416 4.752   7.959   1.00 58.75  ? 182 THR B OG1   1 
ATOM   4514 C CG2   . THR F 3 182 ? 39.832 2.474   8.437   1.00 56.18  ? 182 THR B CG2   1 
ATOM   4515 N N     . VAL F 3 183 ? 37.993 2.034   5.358   1.00 57.77  ? 183 VAL B N     1 
ATOM   4516 C CA    . VAL F 3 183 ? 37.338 0.777   5.017   1.00 59.18  ? 183 VAL B CA    1 
ATOM   4517 C C     . VAL F 3 183 ? 37.997 0.080   3.827   1.00 59.37  ? 183 VAL B C     1 
ATOM   4518 O O     . VAL F 3 183 ? 38.162 -1.144  3.834   1.00 58.68  ? 183 VAL B O     1 
ATOM   4519 C CB    . VAL F 3 183 ? 35.840 0.978   4.737   1.00 58.95  ? 183 VAL B CB    1 
ATOM   4520 C CG1   . VAL F 3 183 ? 35.182 -0.359  4.447   1.00 57.62  ? 183 VAL B CG1   1 
ATOM   4521 C CG2   . VAL F 3 183 ? 35.186 1.624   5.949   1.00 59.60  ? 183 VAL B CG2   1 
ATOM   4522 N N     . GLY F 3 184 ? 38.378 0.860   2.818   1.00 58.53  ? 184 GLY B N     1 
ATOM   4523 C CA    . GLY F 3 184 ? 39.029 0.284   1.657   1.00 58.64  ? 184 GLY B CA    1 
ATOM   4524 C C     . GLY F 3 184 ? 40.445 -0.164  1.984   1.00 58.87  ? 184 GLY B C     1 
ATOM   4525 O O     . GLY F 3 184 ? 40.839 -1.304  1.697   1.00 57.42  ? 184 GLY B O     1 
ATOM   4526 N N     . ARG F 3 185 ? 41.220 0.734   2.586   1.00 58.71  ? 185 ARG B N     1 
ATOM   4527 C CA    . ARG F 3 185 ? 42.589 0.410   2.949   1.00 59.19  ? 185 ARG B CA    1 
ATOM   4528 C C     . ARG F 3 185 ? 42.625 -0.937  3.639   1.00 62.02  ? 185 ARG B C     1 
ATOM   4529 O O     . ARG F 3 185 ? 43.276 -1.873  3.169   1.00 63.70  ? 185 ARG B O     1 
ATOM   4530 C CB    . ARG F 3 185 ? 43.160 1.467   3.874   1.00 55.09  ? 185 ARG B CB    1 
ATOM   4531 C CG    . ARG F 3 185 ? 43.097 2.844   3.288   1.00 55.18  ? 185 ARG B CG    1 
ATOM   4532 C CD    . ARG F 3 185 ? 44.202 3.705   3.834   1.00 56.38  ? 185 ARG B CD    1 
ATOM   4533 N NE    . ARG F 3 185 ? 44.386 4.900   3.021   1.00 59.19  ? 185 ARG B NE    1 
ATOM   4534 C CZ    . ARG F 3 185 ? 43.759 6.049   3.226   1.00 60.04  ? 185 ARG B CZ    1 
ATOM   4535 N NH1   . ARG F 3 185 ? 42.902 6.176   4.229   1.00 61.24  ? 185 ARG B NH1   1 
ATOM   4536 N NH2   . ARG F 3 185 ? 43.985 7.071   2.415   1.00 61.91  ? 185 ARG B NH2   1 
ATOM   4537 N N     . ILE F 3 186 ? 41.904 -1.044  4.748   1.00 64.47  ? 186 ILE B N     1 
ATOM   4538 C CA    . ILE F 3 186 ? 41.868 -2.294  5.496   1.00 65.75  ? 186 ILE B CA    1 
ATOM   4539 C C     . ILE F 3 186 ? 41.244 -3.424  4.683   1.00 67.09  ? 186 ILE B C     1 
ATOM   4540 O O     . ILE F 3 186 ? 41.567 -4.596  4.886   1.00 67.24  ? 186 ILE B O     1 
ATOM   4541 C CB    . ILE F 3 186 ? 41.088 -2.134  6.810   1.00 64.78  ? 186 ILE B CB    1 
ATOM   4542 C CG1   . ILE F 3 186 ? 41.592 -0.895  7.550   1.00 63.48  ? 186 ILE B CG1   1 
ATOM   4543 C CG2   . ILE F 3 186 ? 41.264 -3.377  7.670   1.00 62.53  ? 186 ILE B CG2   1 
ATOM   4544 C CD1   . ILE F 3 186 ? 41.016 -0.733  8.923   1.00 64.62  ? 186 ILE B CD1   1 
ATOM   4545 N N     . LEU F 3 187 ? 40.353 -3.078  3.760   1.00 68.37  ? 187 LEU B N     1 
ATOM   4546 C CA    . LEU F 3 187 ? 39.709 -4.100  2.947   1.00 69.96  ? 187 LEU B CA    1 
ATOM   4547 C C     . LEU F 3 187 ? 40.759 -4.776  2.085   1.00 72.01  ? 187 LEU B C     1 
ATOM   4548 O O     . LEU F 3 187 ? 40.859 -6.006  2.066   1.00 70.83  ? 187 LEU B O     1 
ATOM   4549 C CB    . LEU F 3 187 ? 38.620 -3.474  2.081   1.00 68.98  ? 187 LEU B CB    1 
ATOM   4550 C CG    . LEU F 3 187 ? 37.236 -4.139  2.111   1.00 69.22  ? 187 LEU B CG    1 
ATOM   4551 C CD1   . LEU F 3 187 ? 37.034 -5.002  3.375   1.00 66.34  ? 187 LEU B CD1   1 
ATOM   4552 C CD2   . LEU F 3 187 ? 36.184 -3.026  2.013   1.00 66.72  ? 187 LEU B CD2   1 
ATOM   4553 N N     . LYS F 3 188 ? 41.547 -3.964  1.381   1.00 74.85  ? 188 LYS B N     1 
ATOM   4554 C CA    . LYS F 3 188 ? 42.617 -4.479  0.531   1.00 77.66  ? 188 LYS B CA    1 
ATOM   4555 C C     . LYS F 3 188 ? 43.528 -5.356  1.388   1.00 78.80  ? 188 LYS B C     1 
ATOM   4556 O O     . LYS F 3 188 ? 43.738 -6.531  1.085   1.00 79.26  ? 188 LYS B O     1 
ATOM   4557 C CB    . LYS F 3 188 ? 43.415 -3.324  -0.077  1.00 78.62  ? 188 LYS B CB    1 
ATOM   4558 C CG    . LYS F 3 188 ? 44.809 -3.690  -0.592  1.00 81.53  ? 188 LYS B CG    1 
ATOM   4559 C CD    . LYS F 3 188 ? 44.835 -4.231  -2.028  1.00 83.25  ? 188 LYS B CD    1 
ATOM   4560 C CE    . LYS F 3 188 ? 46.293 -4.367  -2.516  1.00 84.27  ? 188 LYS B CE    1 
ATOM   4561 N NZ    . LYS F 3 188 ? 46.443 -4.735  -3.960  1.00 84.65  ? 188 LYS B NZ    1 
ATOM   4562 N N     . MET F 3 189 ? 44.059 -4.789  2.466   1.00 79.64  ? 189 MET B N     1 
ATOM   4563 C CA    . MET F 3 189 ? 44.928 -5.553  3.349   1.00 81.29  ? 189 MET B CA    1 
ATOM   4564 C C     . MET F 3 189 ? 44.307 -6.927  3.597   1.00 83.49  ? 189 MET B C     1 
ATOM   4565 O O     . MET F 3 189 ? 45.006 -7.931  3.687   1.00 84.82  ? 189 MET B O     1 
ATOM   4566 C CB    . MET F 3 189 ? 45.116 -4.820  4.677   1.00 79.82  ? 189 MET B CB    1 
ATOM   4567 C CG    . MET F 3 189 ? 45.774 -3.452  4.552   1.00 78.18  ? 189 MET B CG    1 
ATOM   4568 S SD    . MET F 3 189 ? 46.025 -2.671  6.167   1.00 75.56  ? 189 MET B SD    1 
ATOM   4569 C CE    . MET F 3 189 ? 46.834 -4.035  7.060   1.00 74.13  ? 189 MET B CE    1 
ATOM   4570 N N     . LEU F 3 190 ? 42.984 -6.970  3.694   1.00 85.77  ? 190 LEU B N     1 
ATOM   4571 C CA    . LEU F 3 190 ? 42.286 -8.227  3.922   1.00 87.99  ? 190 LEU B CA    1 
ATOM   4572 C C     . LEU F 3 190 ? 42.444 -9.158  2.724   1.00 88.88  ? 190 LEU B C     1 
ATOM   4573 O O     . LEU F 3 190 ? 42.768 -10.339 2.880   1.00 89.24  ? 190 LEU B O     1 
ATOM   4574 C CB    . LEU F 3 190 ? 40.809 -7.956  4.193   1.00 89.09  ? 190 LEU B CB    1 
ATOM   4575 C CG    . LEU F 3 190 ? 40.518 -7.352  5.567   1.00 88.40  ? 190 LEU B CG    1 
ATOM   4576 C CD1   . LEU F 3 190 ? 39.080 -6.862  5.624   1.00 88.40  ? 190 LEU B CD1   1 
ATOM   4577 C CD2   . LEU F 3 190 ? 40.786 -8.400  6.635   1.00 87.67  ? 190 LEU B CD2   1 
ATOM   4578 N N     . GLU F 3 191 ? 42.200 -8.628  1.531   1.00 89.29  ? 191 GLU B N     1 
ATOM   4579 C CA    . GLU F 3 191 ? 42.361 -9.418  0.322   1.00 90.07  ? 191 GLU B CA    1 
ATOM   4580 C C     . GLU F 3 191 ? 43.810 -9.896  0.288   1.00 90.96  ? 191 GLU B C     1 
ATOM   4581 O O     . GLU F 3 191 ? 44.078 -11.083 0.098   1.00 91.10  ? 191 GLU B O     1 
ATOM   4582 C CB    . GLU F 3 191 ? 42.068 -8.568  -0.910  1.00 89.30  ? 191 GLU B CB    1 
ATOM   4583 C CG    . GLU F 3 191 ? 40.600 -8.318  -1.158  1.00 91.24  ? 191 GLU B CG    1 
ATOM   4584 C CD    . GLU F 3 191 ? 40.358 -7.276  -2.241  1.00 93.08  ? 191 GLU B CD    1 
ATOM   4585 O OE1   . GLU F 3 191 ? 40.458 -6.062  -1.943  1.00 92.95  ? 191 GLU B OE1   1 
ATOM   4586 O OE2   . GLU F 3 191 ? 40.074 -7.671  -3.395  1.00 94.07  ? 191 GLU B OE2   1 
ATOM   4587 N N     . ASP F 3 192 ? 44.738 -8.962  0.492   1.00 91.90  ? 192 ASP B N     1 
ATOM   4588 C CA    . ASP F 3 192 ? 46.169 -9.267  0.485   1.00 92.70  ? 192 ASP B CA    1 
ATOM   4589 C C     . ASP F 3 192 ? 46.462 -10.472 1.362   1.00 93.92  ? 192 ASP B C     1 
ATOM   4590 O O     . ASP F 3 192 ? 46.959 -11.489 0.881   1.00 94.82  ? 192 ASP B O     1 
ATOM   4591 C CB    . ASP F 3 192 ? 46.989 -8.070  0.990   1.00 91.17  ? 192 ASP B CB    1 
ATOM   4592 C CG    . ASP F 3 192 ? 47.028 -6.914  -0.003  1.00 90.12  ? 192 ASP B CG    1 
ATOM   4593 O OD1   . ASP F 3 192 ? 47.589 -5.855  0.347   1.00 88.26  ? 192 ASP B OD1   1 
ATOM   4594 O OD2   . ASP F 3 192 ? 46.506 -7.061  -1.130  1.00 89.52  ? 192 ASP B OD2   1 
ATOM   4595 N N     . GLN F 3 193 ? 46.144 -10.351 2.648   1.00 95.09  ? 193 GLN B N     1 
ATOM   4596 C CA    . GLN F 3 193 ? 46.373 -11.423 3.616   1.00 96.05  ? 193 GLN B CA    1 
ATOM   4597 C C     . GLN F 3 193 ? 45.375 -12.547 3.385   1.00 95.87  ? 193 GLN B C     1 
ATOM   4598 O O     . GLN F 3 193 ? 45.021 -13.286 4.304   1.00 94.36  ? 193 GLN B O     1 
ATOM   4599 C CB    . GLN F 3 193 ? 46.239 -10.869 5.036   1.00 97.41  ? 193 GLN B CB    1 
ATOM   4600 C CG    . GLN F 3 193 ? 47.190 -9.707  5.312   1.00 99.03  ? 193 GLN B CG    1 
ATOM   4601 C CD    . GLN F 3 193 ? 46.654 -8.733  6.346   1.00 100.64 ? 193 GLN B CD    1 
ATOM   4602 O OE1   . GLN F 3 193 ? 47.158 -7.612  6.479   1.00 101.06 ? 193 GLN B OE1   1 
ATOM   4603 N NE2   . GLN F 3 193 ? 45.630 -9.155  7.087   1.00 100.82 ? 193 GLN B NE2   1 
ATOM   4604 N N     . ASN F 3 194 ? 44.945 -12.658 2.131   1.00 96.72  ? 194 ASN B N     1 
ATOM   4605 C CA    . ASN F 3 194 ? 43.985 -13.657 1.688   1.00 97.56  ? 194 ASN B CA    1 
ATOM   4606 C C     . ASN F 3 194 ? 43.082 -14.137 2.814   1.00 98.14  ? 194 ASN B C     1 
ATOM   4607 O O     . ASN F 3 194 ? 43.383 -15.111 3.511   1.00 97.92  ? 194 ASN B O     1 
ATOM   4608 C CB    . ASN F 3 194 ? 44.697 -14.856 1.054   1.00 97.04  ? 194 ASN B CB    1 
ATOM   4609 C CG    . ASN F 3 194 ? 43.910 -15.444 -0.105  1.00 97.24  ? 194 ASN B CG    1 
ATOM   4610 O OD1   . ASN F 3 194 ? 43.945 -14.917 -1.218  1.00 96.36  ? 194 ASN B OD1   1 
ATOM   4611 N ND2   . ASN F 3 194 ? 43.175 -16.522 0.156   1.00 97.05  ? 194 ASN B ND2   1 
ATOM   4612 N N     . LEU F 3 195 ? 41.972 -13.432 2.986   1.00 98.26  ? 195 LEU B N     1 
ATOM   4613 C CA    . LEU F 3 195 ? 41.005 -13.765 4.012   1.00 98.15  ? 195 LEU B CA    1 
ATOM   4614 C C     . LEU F 3 195 ? 39.628 -13.476 3.458   1.00 98.78  ? 195 LEU B C     1 
ATOM   4615 O O     . LEU F 3 195 ? 38.623 -13.992 3.953   1.00 99.08  ? 195 LEU B O     1 
ATOM   4616 C CB    . LEU F 3 195 ? 41.262 -12.931 5.268   1.00 96.81  ? 195 LEU B CB    1 
ATOM   4617 C CG    . LEU F 3 195 ? 42.515 -13.318 6.058   1.00 96.54  ? 195 LEU B CG    1 
ATOM   4618 C CD1   . LEU F 3 195 ? 42.751 -12.331 7.192   1.00 95.65  ? 195 LEU B CD1   1 
ATOM   4619 C CD2   . LEU F 3 195 ? 42.350 -14.734 6.602   1.00 95.78  ? 195 LEU B CD2   1 
ATOM   4620 N N     . ILE F 3 196 ? 39.592 -12.652 2.416   1.00 99.13  ? 196 ILE B N     1 
ATOM   4621 C CA    . ILE F 3 196 ? 38.337 -12.288 1.781   1.00 100.75 ? 196 ILE B CA    1 
ATOM   4622 C C     . ILE F 3 196 ? 38.517 -12.150 0.279   1.00 101.58 ? 196 ILE B C     1 
ATOM   4623 O O     . ILE F 3 196 ? 39.619 -12.309 -0.241  1.00 101.77 ? 196 ILE B O     1 
ATOM   4624 C CB    . ILE F 3 196 ? 37.798 -10.946 2.321   1.00 101.31 ? 196 ILE B CB    1 
ATOM   4625 C CG1   . ILE F 3 196 ? 38.606 -9.783  1.739   1.00 101.78 ? 196 ILE B CG1   1 
ATOM   4626 C CG2   . ILE F 3 196 ? 37.881 -10.929 3.843   1.00 101.61 ? 196 ILE B CG2   1 
ATOM   4627 C CD1   . ILE F 3 196 ? 38.031 -8.416  2.049   1.00 101.42 ? 196 ILE B CD1   1 
ATOM   4628 N N     . SER F 3 197 ? 37.418 -11.854 -0.407  1.00 102.86 ? 197 SER B N     1 
ATOM   4629 C CA    . SER F 3 197 ? 37.425 -11.669 -1.849  1.00 104.06 ? 197 SER B CA    1 
ATOM   4630 C C     . SER F 3 197 ? 36.559 -10.467 -2.161  1.00 104.69 ? 197 SER B C     1 
ATOM   4631 O O     . SER F 3 197 ? 35.343 -10.499 -1.967  1.00 104.23 ? 197 SER B O     1 
ATOM   4632 C CB    . SER F 3 197 ? 36.857 -12.895 -2.561  1.00 104.47 ? 197 SER B CB    1 
ATOM   4633 O OG    . SER F 3 197 ? 36.794 -12.675 -3.962  1.00 105.53 ? 197 SER B OG    1 
ATOM   4634 N N     . ALA F 3 198 ? 37.185 -9.404  -2.644  1.00 106.10 ? 198 ALA B N     1 
ATOM   4635 C CA    . ALA F 3 198 ? 36.448 -8.191  -2.963  1.00 108.17 ? 198 ALA B CA    1 
ATOM   4636 C C     . ALA F 3 198 ? 36.561 -7.820  -4.435  1.00 109.21 ? 198 ALA B C     1 
ATOM   4637 O O     . ALA F 3 198 ? 37.332 -8.432  -5.181  1.00 110.07 ? 198 ALA B O     1 
ATOM   4638 C CB    . ALA F 3 198 ? 36.940 -7.035  -2.090  1.00 108.52 ? 198 ALA B CB    1 
ATOM   4639 N N     . HIS F 3 199 ? 35.768 -6.824  -4.840  1.00 109.39 ? 199 HIS B N     1 
ATOM   4640 C CA    . HIS F 3 199 ? 35.720 -6.314  -6.216  1.00 108.34 ? 199 HIS B CA    1 
ATOM   4641 C C     . HIS F 3 199 ? 34.520 -5.370  -6.404  1.00 107.52 ? 199 HIS B C     1 
ATOM   4642 O O     . HIS F 3 199 ? 33.368 -5.812  -6.461  1.00 106.48 ? 199 HIS B O     1 
ATOM   4643 C CB    . HIS F 3 199 ? 35.669 -7.479  -7.237  1.00 108.82 ? 199 HIS B CB    1 
ATOM   4644 C CG    . HIS F 3 199 ? 34.947 -8.701  -6.745  1.00 109.84 ? 199 HIS B CG    1 
ATOM   4645 N ND1   . HIS F 3 199 ? 35.194 -9.962  -7.244  1.00 110.53 ? 199 HIS B ND1   1 
ATOM   4646 C CD2   . HIS F 3 199 ? 34.010 -8.859  -5.778  1.00 110.39 ? 199 HIS B CD2   1 
ATOM   4647 C CE1   . HIS F 3 199 ? 34.447 -10.844 -6.604  1.00 111.08 ? 199 HIS B CE1   1 
ATOM   4648 N NE2   . HIS F 3 199 ? 33.719 -10.200 -5.708  1.00 111.08 ? 199 HIS B NE2   1 
ATOM   4649 N N     . GLY F 3 200 ? 34.808 -4.069  -6.474  1.00 106.61 ? 200 GLY B N     1 
ATOM   4650 C CA    . GLY F 3 200 ? 33.771 -3.062  -6.668  1.00 105.00 ? 200 GLY B CA    1 
ATOM   4651 C C     . GLY F 3 200 ? 32.823 -2.843  -5.503  1.00 104.09 ? 200 GLY B C     1 
ATOM   4652 O O     . GLY F 3 200 ? 32.937 -1.864  -4.760  1.00 103.76 ? 200 GLY B O     1 
ATOM   4653 N N     . LYS F 3 201 ? 31.874 -3.760  -5.354  1.00 103.03 ? 201 LYS B N     1 
ATOM   4654 C CA    . LYS F 3 201 ? 30.893 -3.691  -4.284  1.00 101.35 ? 201 LYS B CA    1 
ATOM   4655 C C     . LYS F 3 201 ? 30.383 -5.093  -3.977  1.00 101.35 ? 201 LYS B C     1 
ATOM   4656 O O     . LYS F 3 201 ? 29.244 -5.260  -3.546  1.00 101.47 ? 201 LYS B O     1 
ATOM   4657 C CB    . LYS F 3 201 ? 29.727 -2.791  -4.694  1.00 99.87  ? 201 LYS B CB    1 
ATOM   4658 C CG    . LYS F 3 201 ? 30.094 -1.322  -4.848  1.00 100.02 ? 201 LYS B CG    1 
ATOM   4659 C CD    . LYS F 3 201 ? 28.930 -0.515  -5.412  1.00 100.36 ? 201 LYS B CD    1 
ATOM   4660 C CE    . LYS F 3 201 ? 27.639 -0.723  -4.606  1.00 101.41 ? 201 LYS B CE    1 
ATOM   4661 N NZ    . LYS F 3 201 ? 26.447 0.030   -5.134  1.00 100.36 ? 201 LYS B NZ    1 
ATOM   4662 N N     . THR F 3 202 ? 31.232 -6.093  -4.205  1.00 101.07 ? 202 THR B N     1 
ATOM   4663 C CA    . THR F 3 202 ? 30.882 -7.491  -3.958  1.00 101.20 ? 202 THR B CA    1 
ATOM   4664 C C     . THR F 3 202 ? 31.933 -8.132  -3.075  1.00 100.81 ? 202 THR B C     1 
ATOM   4665 O O     . THR F 3 202 ? 33.121 -7.875  -3.239  1.00 100.85 ? 202 THR B O     1 
ATOM   4666 C CB    . THR F 3 202 ? 30.829 -8.302  -5.263  1.00 101.83 ? 202 THR B CB    1 
ATOM   4667 O OG1   . THR F 3 202 ? 29.929 -7.672  -6.182  1.00 102.62 ? 202 THR B OG1   1 
ATOM   4668 C CG2   . THR F 3 202 ? 30.361 -9.729  -4.987  1.00 100.75 ? 202 THR B CG2   1 
ATOM   4669 N N     . ILE F 3 203 ? 31.504 -8.976  -2.147  1.00 100.74 ? 203 ILE B N     1 
ATOM   4670 C CA    . ILE F 3 203 ? 32.456 -9.621  -1.257  1.00 101.07 ? 203 ILE B CA    1 
ATOM   4671 C C     . ILE F 3 203 ? 32.140 -11.072 -0.919  1.00 101.37 ? 203 ILE B C     1 
ATOM   4672 O O     . ILE F 3 203 ? 30.979 -11.492 -0.827  1.00 100.79 ? 203 ILE B O     1 
ATOM   4673 C CB    . ILE F 3 203 ? 32.614 -8.830  0.070   1.00 100.97 ? 203 ILE B CB    1 
ATOM   4674 C CG1   . ILE F 3 203 ? 33.102 -7.404  -0.223  1.00 100.36 ? 203 ILE B CG1   1 
ATOM   4675 C CG2   . ILE F 3 203 ? 33.597 -9.551  0.992   1.00 100.97 ? 203 ILE B CG2   1 
ATOM   4676 C CD1   . ILE F 3 203 ? 33.374 -6.563  1.014   1.00 99.16  ? 203 ILE B CD1   1 
ATOM   4677 N N     . VAL F 3 204 ? 33.212 -11.829 -0.737  1.00 101.56 ? 204 VAL B N     1 
ATOM   4678 C CA    . VAL F 3 204 ? 33.129 -13.233 -0.401  1.00 101.97 ? 204 VAL B CA    1 
ATOM   4679 C C     . VAL F 3 204 ? 33.978 -13.453 0.836   1.00 101.88 ? 204 VAL B C     1 
ATOM   4680 O O     . VAL F 3 204 ? 35.186 -13.237 0.819   1.00 101.29 ? 204 VAL B O     1 
ATOM   4681 C CB    . VAL F 3 204 ? 33.665 -14.105 -1.550  1.00 102.54 ? 204 VAL B CB    1 
ATOM   4682 C CG1   . VAL F 3 204 ? 33.653 -15.573 -1.142  1.00 103.37 ? 204 VAL B CG1   1 
ATOM   4683 C CG2   . VAL F 3 204 ? 32.822 -13.884 -2.800  1.00 102.54 ? 204 VAL B CG2   1 
ATOM   4684 N N     . VAL F 3 205 ? 33.334 -13.875 1.914   1.00 102.59 ? 205 VAL B N     1 
ATOM   4685 C CA    . VAL F 3 205 ? 34.028 -14.118 3.165   1.00 103.93 ? 205 VAL B CA    1 
ATOM   4686 C C     . VAL F 3 205 ? 34.397 -15.587 3.252   1.00 104.72 ? 205 VAL B C     1 
ATOM   4687 O O     . VAL F 3 205 ? 33.537 -16.450 3.103   1.00 105.35 ? 205 VAL B O     1 
ATOM   4688 C CB    . VAL F 3 205 ? 33.138 -13.759 4.350   1.00 103.92 ? 205 VAL B CB    1 
ATOM   4689 C CG1   . VAL F 3 205 ? 33.945 -13.829 5.632   1.00 104.93 ? 205 VAL B CG1   1 
ATOM   4690 C CG2   . VAL F 3 205 ? 32.543 -12.371 4.146   1.00 103.96 ? 205 VAL B CG2   1 
ATOM   4691 N N     . TYR F 3 206 ? 35.668 -15.874 3.511   1.00 105.44 ? 206 TYR B N     1 
ATOM   4692 C CA    . TYR F 3 206 ? 36.118 -17.258 3.575   1.00 106.68 ? 206 TYR B CA    1 
ATOM   4693 C C     . TYR F 3 206 ? 35.868 -17.967 4.901   1.00 106.84 ? 206 TYR B C     1 
ATOM   4694 O O     . TYR F 3 206 ? 36.247 -17.484 5.966   1.00 107.14 ? 206 TYR B O     1 
ATOM   4695 C CB    . TYR F 3 206 ? 37.603 -17.342 3.204   1.00 107.32 ? 206 TYR B CB    1 
ATOM   4696 C CG    . TYR F 3 206 ? 37.945 -16.617 1.914   1.00 108.43 ? 206 TYR B CG    1 
ATOM   4697 C CD1   . TYR F 3 206 ? 36.983 -16.432 0.914   1.00 108.13 ? 206 TYR B CD1   1 
ATOM   4698 C CD2   . TYR F 3 206 ? 39.231 -16.112 1.692   1.00 108.83 ? 206 TYR B CD2   1 
ATOM   4699 C CE1   . TYR F 3 206 ? 37.291 -15.760 -0.271  1.00 108.47 ? 206 TYR B CE1   1 
ATOM   4700 C CE2   . TYR F 3 206 ? 39.549 -15.441 0.509   1.00 109.02 ? 206 TYR B CE2   1 
ATOM   4701 C CZ    . TYR F 3 206 ? 38.573 -15.268 -0.467  1.00 108.94 ? 206 TYR B CZ    1 
ATOM   4702 O OH    . TYR F 3 206 ? 38.878 -14.598 -1.633  1.00 109.20 ? 206 TYR B OH    1 
ATOM   4703 N N     . GLY F 3 207 ? 35.222 -19.127 4.808   1.00 107.14 ? 207 GLY B N     1 
ATOM   4704 C CA    . GLY F 3 207 ? 34.908 -19.932 5.976   1.00 106.93 ? 207 GLY B CA    1 
ATOM   4705 C C     . GLY F 3 207 ? 35.267 -21.401 5.788   1.00 106.71 ? 207 GLY B C     1 
ATOM   4706 O O     . GLY F 3 207 ? 34.350 -22.218 5.529   1.00 106.08 ? 207 GLY B O     1 
HETATM 4707 P P     . CMP G 4 .   ? 21.777 -12.449 30.578  1.00 43.08  ? 210 CMP A P     1 
HETATM 4708 O O1P   . CMP G 4 .   ? 22.190 -12.435 29.153  1.00 39.94  ? 210 CMP A O1P   1 
HETATM 4709 O O2P   . CMP G 4 .   ? 21.050 -13.626 31.116  1.00 42.60  ? 210 CMP A O2P   1 
HETATM 4710 O "O5'" . CMP G 4 .   ? 23.109 -12.283 31.437  1.00 41.62  ? 210 CMP A "O5'" 1 
HETATM 4711 C "C5'" . CMP G 4 .   ? 23.754 -11.012 31.542  1.00 41.72  ? 210 CMP A "C5'" 1 
HETATM 4712 C "C4'" . CMP G 4 .   ? 22.736 -10.005 31.959  1.00 40.79  ? 210 CMP A "C4'" 1 
HETATM 4713 O "O4'" . CMP G 4 .   ? 23.260 -8.658  32.075  1.00 40.95  ? 210 CMP A "O4'" 1 
HETATM 4714 C "C3'" . CMP G 4 .   ? 21.660 -9.850  30.918  1.00 40.27  ? 210 CMP A "C3'" 1 
HETATM 4715 O "O3'" . CMP G 4 .   ? 20.949 -11.087 30.894  1.00 41.84  ? 210 CMP A "O3'" 1 
HETATM 4716 C "C2'" . CMP G 4 .   ? 20.989 -8.587  31.437  1.00 38.93  ? 210 CMP A "C2'" 1 
HETATM 4717 O "O2'" . CMP G 4 .   ? 20.320 -8.782  32.664  1.00 35.68  ? 210 CMP A "O2'" 1 
HETATM 4718 C "C1'" . CMP G 4 .   ? 22.223 -7.741  31.764  1.00 39.47  ? 210 CMP A "C1'" 1 
HETATM 4719 N N9    . CMP G 4 .   ? 22.634 -6.934  30.619  1.00 38.79  ? 210 CMP A N9    1 
HETATM 4720 C C8    . CMP G 4 .   ? 23.353 -7.302  29.512  1.00 37.36  ? 210 CMP A C8    1 
HETATM 4721 N N7    . CMP G 4 .   ? 23.490 -6.348  28.632  1.00 35.57  ? 210 CMP A N7    1 
HETATM 4722 C C5    . CMP G 4 .   ? 22.827 -5.274  29.203  1.00 37.68  ? 210 CMP A C5    1 
HETATM 4723 C C6    . CMP G 4 .   ? 22.591 -3.965  28.763  1.00 37.48  ? 210 CMP A C6    1 
HETATM 4724 N N6    . CMP G 4 .   ? 22.998 -3.501  27.586  1.00 36.96  ? 210 CMP A N6    1 
HETATM 4725 N N1    . CMP G 4 .   ? 21.903 -3.139  29.583  1.00 38.98  ? 210 CMP A N1    1 
HETATM 4726 C C2    . CMP G 4 .   ? 21.476 -3.610  30.758  1.00 38.82  ? 210 CMP A C2    1 
HETATM 4727 N N3    . CMP G 4 .   ? 21.623 -4.824  31.277  1.00 40.55  ? 210 CMP A N3    1 
HETATM 4728 C C4    . CMP G 4 .   ? 22.315 -5.617  30.437  1.00 39.35  ? 210 CMP A C4    1 
HETATM 4729 P P     . CMP H 4 .   ? 11.196 3.398   18.188  1.00 42.48  ? 210 CMP B P     1 
HETATM 4730 O O1P   . CMP H 4 .   ? 12.003 3.974   19.289  1.00 42.00  ? 210 CMP B O1P   1 
HETATM 4731 O O2P   . CMP H 4 .   ? 9.720  3.528   18.228  1.00 42.89  ? 210 CMP B O2P   1 
HETATM 4732 O "O5'" . CMP H 4 .   ? 11.774 4.049   16.846  1.00 43.41  ? 210 CMP B "O5'" 1 
HETATM 4733 C "C5'" . CMP H 4 .   ? 13.008 3.578   16.270  1.00 40.38  ? 210 CMP B "C5'" 1 
HETATM 4734 C "C4'" . CMP H 4 .   ? 12.962 2.087   16.194  1.00 38.65  ? 210 CMP B "C4'" 1 
HETATM 4735 O "O4'" . CMP H 4 .   ? 14.178 1.497   15.693  1.00 40.25  ? 210 CMP B "O4'" 1 
HETATM 4736 C "C3'" . CMP H 4 .   ? 12.867 1.507   17.569  1.00 40.71  ? 210 CMP B "C3'" 1 
HETATM 4737 O "O3'" . CMP H 4 .   ? 11.565 1.840   18.012  1.00 41.09  ? 210 CMP B "O3'" 1 
HETATM 4738 C "C2'" . CMP H 4 .   ? 13.233 0.052   17.310  1.00 40.31  ? 210 CMP B "C2'" 1 
HETATM 4739 O "O2'" . CMP H 4 .   ? 12.195 -0.694  16.721  1.00 41.79  ? 210 CMP B "O2'" 1 
HETATM 4740 C "C1'" . CMP H 4 .   ? 14.362 0.220   16.291  1.00 39.43  ? 210 CMP B "C1'" 1 
HETATM 4741 N N9    . CMP H 4 .   ? 15.668 0.231   16.931  1.00 39.45  ? 210 CMP B N9    1 
HETATM 4742 C C8    . CMP H 4 .   ? 16.210 1.293   17.582  1.00 40.44  ? 210 CMP B C8    1 
HETATM 4743 N N7    . CMP H 4 .   ? 17.397 1.064   18.074  1.00 42.42  ? 210 CMP B N7    1 
HETATM 4744 C C5    . CMP H 4 .   ? 17.648 -0.249  17.732  1.00 40.86  ? 210 CMP B C5    1 
HETATM 4745 C C6    . CMP H 4 .   ? 18.735 -1.083  17.984  1.00 43.16  ? 210 CMP B C6    1 
HETATM 4746 N N6    . CMP H 4 .   ? 19.813 -0.687  18.677  1.00 41.71  ? 210 CMP B N6    1 
HETATM 4747 N N1    . CMP H 4 .   ? 18.682 -2.352  17.500  1.00 43.34  ? 210 CMP B N1    1 
HETATM 4748 C C2    . CMP H 4 .   ? 17.597 -2.728  16.814  1.00 38.03  ? 210 CMP B C2    1 
HETATM 4749 N N3    . CMP H 4 .   ? 16.508 -2.027  16.523  1.00 41.02  ? 210 CMP B N3    1 
HETATM 4750 C C4    . CMP H 4 .   ? 16.596 -0.777  17.018  1.00 40.51  ? 210 CMP B C4    1 
HETATM 4751 O O     . HOH I 5 .   ? 55.931 7.015   32.543  1.00 58.91  ? 36  HOH W O     1 
HETATM 4752 O O     . HOH J 5 .   ? 31.732 0.040   55.663  1.00 62.32  ? 17  HOH X O     1 
HETATM 4753 O O     . HOH J 5 .   ? 35.484 -5.928  56.709  1.00 63.51  ? 37  HOH X O     1 
HETATM 4754 O O     . HOH K 5 .   ? 27.511 7.210   30.153  1.00 37.91  ? 211 HOH A O     1 
HETATM 4755 O O     . HOH K 5 .   ? 32.719 15.828  20.810  1.00 41.65  ? 212 HOH A O     1 
HETATM 4756 O O     . HOH K 5 .   ? 20.745 2.769   35.924  1.00 43.42  ? 213 HOH A O     1 
HETATM 4757 O O     . HOH K 5 .   ? 26.494 3.989   33.019  1.00 47.06  ? 214 HOH A O     1 
HETATM 4758 O O     . HOH K 5 .   ? 28.385 4.450   40.882  1.00 48.32  ? 215 HOH A O     1 
HETATM 4759 O O     . HOH K 5 .   ? 16.238 -1.010  33.465  1.00 35.26  ? 216 HOH A O     1 
HETATM 4760 O O     . HOH K 5 .   ? 22.181 6.437   31.546  1.00 45.63  ? 217 HOH A O     1 
HETATM 4761 O O     . HOH K 5 .   ? 21.568 8.992   28.949  1.00 66.93  ? 218 HOH A O     1 
HETATM 4762 O O     . HOH K 5 .   ? 16.661 5.931   26.327  1.00 81.50  ? 219 HOH A O     1 
HETATM 4763 O O     . HOH K 5 .   ? 22.848 19.062  40.762  1.00 66.79  ? 220 HOH A O     1 
HETATM 4764 O O     . HOH K 5 .   ? 28.858 6.428   27.133  1.00 35.90  ? 221 HOH A O     1 
HETATM 4765 O O     . HOH K 5 .   ? 25.791 -17.264 35.391  1.00 68.68  ? 222 HOH A O     1 
HETATM 4766 O O     . HOH K 5 .   ? 28.098 7.708   42.355  1.00 46.17  ? 223 HOH A O     1 
HETATM 4767 O O     . HOH K 5 .   ? 4.953  -2.114  32.032  1.00 46.07  ? 224 HOH A O     1 
HETATM 4768 O O     . HOH K 5 .   ? 27.843 26.650  42.944  1.00 51.13  ? 225 HOH A O     1 
HETATM 4769 O O     . HOH K 5 .   ? 17.718 2.209   37.839  1.00 41.79  ? 226 HOH A O     1 
HETATM 4770 O O     . HOH K 5 .   ? 3.007  -21.052 39.368  1.00 73.94  ? 227 HOH A O     1 
HETATM 4771 O O     . HOH K 5 .   ? 20.399 11.539  27.954  1.00 65.46  ? 228 HOH A O     1 
HETATM 4772 O O     . HOH K 5 .   ? 28.583 25.210  34.360  1.00 47.77  ? 229 HOH A O     1 
HETATM 4773 O O     . HOH K 5 .   ? 29.816 18.266  32.710  1.00 36.53  ? 230 HOH A O     1 
HETATM 4774 O O     . HOH K 5 .   ? 23.170 3.069   41.030  1.00 68.00  ? 231 HOH A O     1 
HETATM 4775 O O     . HOH K 5 .   ? 42.967 1.697   32.623  1.00 42.40  ? 232 HOH A O     1 
HETATM 4776 O O     . HOH K 5 .   ? 34.491 -10.223 36.469  1.00 60.65  ? 233 HOH A O     1 
HETATM 4777 O O     . HOH L 5 .   ? 36.430 -11.963 7.889   1.00 61.05  ? 211 HOH B O     1 
HETATM 4778 O O     . HOH L 5 .   ? 15.085 -8.256  15.520  1.00 40.62  ? 212 HOH B O     1 
HETATM 4779 O O     . HOH L 5 .   ? 50.652 -9.267  1.765   1.00 68.07  ? 213 HOH B O     1 
HETATM 4780 O O     . HOH L 5 .   ? 17.053 -10.432 11.397  1.00 57.77  ? 214 HOH B O     1 
HETATM 4781 O O     . HOH L 5 .   ? 31.202 -8.512  22.470  1.00 86.42  ? 215 HOH B O     1 
HETATM 4782 O O     . HOH L 5 .   ? 32.337 -10.763 20.167  1.00 87.98  ? 216 HOH B O     1 
HETATM 4783 O O     . HOH L 5 .   ? 20.833 9.269   20.291  1.00 40.32  ? 217 HOH B O     1 
HETATM 4784 O O     . HOH L 5 .   ? 13.424 8.799   22.987  1.00 52.47  ? 218 HOH B O     1 
HETATM 4785 O O     . HOH L 5 .   ? 34.716 -7.772  21.708  1.00 50.68  ? 219 HOH B O     1 
HETATM 4786 O O     . HOH L 5 .   ? 31.178 17.453  16.280  1.00 67.63  ? 220 HOH B O     1 
HETATM 4787 O O     . HOH L 5 .   ? 46.679 -2.141  11.345  1.00 43.89  ? 221 HOH B O     1 
HETATM 4788 O O     . HOH L 5 .   ? 38.710 0.438   27.065  1.00 52.49  ? 222 HOH B O     1 
HETATM 4789 O O     . HOH L 5 .   ? 39.692 2.233   20.000  1.00 50.07  ? 223 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   -8  -8  DA  A   W . n 
A 1 2   DT  2   -7  -7  DT  T   W . n 
A 1 3   DT  3   -6  -6  DT  T   W . n 
A 1 4   DT  4   -5  -5  DT  T   W . n 
A 1 5   DC  5   -4  -4  DC  C   W . n 
A 1 6   DG  6   -3  -3  DG  G   W . n 
A 1 7   DA  7   -2  -2  DA  A   W . n 
A 1 8   DA  8   -1  -1  DA  A   W . n 
A 1 9   DA  9   1   1   DA  A   W . n 
A 1 10  DA  10  2   2   DA  A   W . n 
A 1 11  DA  11  3   3   DA  A   W . n 
A 1 12  DT  12  4   4   DT  T   W . n 
A 1 13  DG  13  5   5   DG  G   W . n 
A 1 14  DT  14  6   6   DT  T   W . n 
A 1 15  DG  15  7   7   DG  G   W . n 
A 1 16  DA  16  8   8   DA  A   W . n 
A 1 17  DT  17  9   9   DT  T   W . n 
B 2 1   DC  1   13  13  DC  C   X . n 
B 2 2   DT  2   12  12  DT  T   X . n 
B 2 3   DA  3   11  11  DA  A   X . n 
B 2 4   DG  4   10  10  DG  G   X . n 
B 2 5   DA  5   9   9   DA  A   X . n 
B 2 6   DT  6   8   8   DT  T   X . n 
B 2 7   DC  7   7   7   DC  C   X . n 
B 2 8   DA  8   6   6   DA  A   X . n 
B 2 9   DC  9   5   5   DC  C   X . n 
B 2 10  DA  10  4   4   DA  A   X . n 
B 2 11  DT  11  3   3   DT  T   X . n 
B 2 12  DT  12  2   2   DT  T   X . n 
B 2 13  DT  13  1   1   DT  T   X . n 
B 2 14  DT  14  -1  -1  DT  T   X . n 
B 2 15  DT  15  -2  -2  DT  T   X . n 
B 2 16  DC  16  -3  -3  DC  C   X . n 
B 2 17  DG  17  -4  -4  DG  G   X . n 
B 2 18  DA  18  -5  -5  DA  A   X . n 
B 2 19  DA  19  -6  -6  DA  A   X . n 
B 2 20  DA  20  -7  -7  DA  A   X . n 
B 2 21  DT  21  -8  -8  DT  T   X . n 
C 1 1   DA  1   -8  -8  DA  A   Y . n 
C 1 2   DT  2   -7  -7  DT  T   Y . n 
C 1 3   DT  3   -6  -6  DT  T   Y . n 
C 1 4   DT  4   -5  -5  DT  T   Y . n 
C 1 5   DC  5   -4  -4  DC  C   Y . n 
C 1 6   DG  6   -3  -3  DG  G   Y . n 
C 1 7   DA  7   -2  -2  DA  A   Y . n 
C 1 8   DA  8   -1  -1  DA  A   Y . n 
C 1 9   DA  9   1   1   DA  A   Y . n 
C 1 10  DA  10  2   2   DA  A   Y . n 
C 1 11  DA  11  3   3   DA  A   Y . n 
C 1 12  DT  12  4   4   DT  T   Y . n 
C 1 13  DG  13  5   5   DG  G   Y . n 
C 1 14  DT  14  6   6   DT  T   Y . n 
C 1 15  DG  15  7   7   DG  G   Y . n 
C 1 16  DA  16  8   8   DA  A   Y . n 
C 1 17  DT  17  9   9   DT  T   Y . n 
D 2 1   DC  1   13  13  DC  C   Z . n 
D 2 2   DT  2   12  12  DT  T   Z . n 
D 2 3   DA  3   11  11  DA  A   Z . n 
D 2 4   DG  4   10  10  DG  G   Z . n 
D 2 5   DA  5   9   9   DA  A   Z . n 
D 2 6   DT  6   8   8   DT  T   Z . n 
D 2 7   DC  7   7   7   DC  C   Z . n 
D 2 8   DA  8   6   6   DA  A   Z . n 
D 2 9   DC  9   5   5   DC  C   Z . n 
D 2 10  DA  10  4   4   DA  A   Z . n 
D 2 11  DT  11  3   3   DT  T   Z . n 
D 2 12  DT  12  2   2   DT  T   Z . n 
D 2 13  DT  13  1   1   DT  T   Z . n 
D 2 14  DT  14  -1  -1  DT  T   Z . n 
D 2 15  DT  15  -2  -2  DT  T   Z . n 
D 2 16  DC  16  -3  -3  DC  C   Z . n 
D 2 17  DG  17  -4  -4  DG  G   Z . n 
D 2 18  DA  18  -5  -5  DA  A   Z . n 
D 2 19  DA  19  -6  -6  DA  A   Z . n 
D 2 20  DA  20  -7  -7  DA  A   Z . n 
D 2 21  DT  21  -8  -8  DT  T   Z . n 
E 3 1   VAL 1   1   ?   ?   ?   A . n 
E 3 2   LEU 2   2   ?   ?   ?   A . n 
E 3 3   GLY 3   3   ?   ?   ?   A . n 
E 3 4   LYS 4   4   ?   ?   ?   A . n 
E 3 5   PRO 5   5   ?   ?   ?   A . n 
E 3 6   GLN 6   6   ?   ?   ?   A . n 
E 3 7   THR 7   7   ?   ?   ?   A . n 
E 3 8   ASP 8   8   8   ASP ASP A . n 
E 3 9   PRO 9   9   9   PRO PRO A . n 
E 3 10  THR 10  10  10  THR THR A . n 
E 3 11  LEU 11  11  11  LEU LEU A . n 
E 3 12  GLU 12  12  12  GLU GLU A . n 
E 3 13  TRP 13  13  13  TRP TRP A . n 
E 3 14  PHE 14  14  14  PHE PHE A . n 
E 3 15  LEU 15  15  15  LEU LEU A . n 
E 3 16  SER 16  16  16  SER SER A . n 
E 3 17  HIS 17  17  17  HIS HIS A . n 
E 3 18  CYS 18  18  18  CYS CYS A . n 
E 3 19  HIS 19  19  19  HIS HIS A . n 
E 3 20  ILE 20  20  20  ILE ILE A . n 
E 3 21  HIS 21  21  21  HIS HIS A . n 
E 3 22  LYS 22  22  22  LYS LYS A . n 
E 3 23  TYR 23  23  23  TYR TYR A . n 
E 3 24  PRO 24  24  24  PRO PRO A . n 
E 3 25  SER 25  25  25  SER SER A . n 
E 3 26  LYS 26  26  26  LYS LYS A . n 
E 3 27  SER 27  27  27  SER SER A . n 
E 3 28  THR 28  28  28  THR THR A . n 
E 3 29  LEU 29  29  29  LEU LEU A . n 
E 3 30  ILE 30  30  30  ILE ILE A . n 
E 3 31  HIS 31  31  31  HIS HIS A . n 
E 3 32  GLN 32  32  32  GLN GLN A . n 
E 3 33  GLY 33  33  33  GLY GLY A . n 
E 3 34  GLU 34  34  34  GLU GLU A . n 
E 3 35  LYS 35  35  35  LYS LYS A . n 
E 3 36  ALA 36  36  36  ALA ALA A . n 
E 3 37  GLU 37  37  37  GLU GLU A . n 
E 3 38  THR 38  38  38  THR THR A . n 
E 3 39  LEU 39  39  39  LEU LEU A . n 
E 3 40  TYR 40  40  40  TYR TYR A . n 
E 3 41  TYR 41  41  41  TYR TYR A . n 
E 3 42  ILE 42  42  42  ILE ILE A . n 
E 3 43  VAL 43  43  43  VAL VAL A . n 
E 3 44  LYS 44  44  44  LYS LYS A . n 
E 3 45  GLY 45  45  45  GLY GLY A . n 
E 3 46  SER 46  46  46  SER SER A . n 
E 3 47  VAL 47  47  47  VAL VAL A . n 
E 3 48  ALA 48  48  48  ALA ALA A . n 
E 3 49  VAL 49  49  49  VAL VAL A . n 
E 3 50  LEU 50  50  50  LEU LEU A . n 
E 3 51  ILE 51  51  51  ILE ILE A . n 
E 3 52  LYS 52  52  52  LYS LYS A . n 
E 3 53  ASP 53  53  53  ASP ASP A . n 
E 3 54  GLU 54  54  54  GLU GLU A . n 
E 3 55  GLU 55  55  55  GLU GLU A . n 
E 3 56  GLY 56  56  56  GLY GLY A . n 
E 3 57  LYS 57  57  57  LYS LYS A . n 
E 3 58  GLU 58  58  58  GLU GLU A . n 
E 3 59  MET 59  59  59  MET MET A . n 
E 3 60  ILE 60  60  60  ILE ILE A . n 
E 3 61  LEU 61  61  61  LEU LEU A . n 
E 3 62  SER 62  62  62  SER SER A . n 
E 3 63  TYR 63  63  63  TYR TYR A . n 
E 3 64  LEU 64  64  64  LEU LEU A . n 
E 3 65  ASN 65  65  65  ASN ASN A . n 
E 3 66  GLN 66  66  66  GLN GLN A . n 
E 3 67  GLY 67  67  67  GLY GLY A . n 
E 3 68  ASP 68  68  68  ASP ASP A . n 
E 3 69  PHE 69  69  69  PHE PHE A . n 
E 3 70  ILE 70  70  70  ILE ILE A . n 
E 3 71  GLY 71  71  71  GLY GLY A . n 
E 3 72  GLU 72  72  72  GLU GLU A . n 
E 3 73  LEU 73  73  73  LEU LEU A . n 
E 3 74  GLY 74  74  74  GLY GLY A . n 
E 3 75  LEU 75  75  75  LEU LEU A . n 
E 3 76  PHE 76  76  76  PHE PHE A . n 
E 3 77  GLU 77  77  77  GLU GLU A . n 
E 3 78  GLU 78  78  78  GLU GLU A . n 
E 3 79  GLY 79  79  79  GLY GLY A . n 
E 3 80  GLN 80  80  80  GLN GLN A . n 
E 3 81  GLU 81  81  81  GLU GLU A . n 
E 3 82  ARG 82  82  82  ARG ARG A . n 
E 3 83  SER 83  83  83  SER SER A . n 
E 3 84  ALA 84  84  84  ALA ALA A . n 
E 3 85  TRP 85  85  85  TRP TRP A . n 
E 3 86  VAL 86  86  86  VAL VAL A . n 
E 3 87  ARG 87  87  87  ARG ARG A . n 
E 3 88  ALA 88  88  88  ALA ALA A . n 
E 3 89  LYS 89  89  89  LYS LYS A . n 
E 3 90  THR 90  90  90  THR THR A . n 
E 3 91  ALA 91  91  91  ALA ALA A . n 
E 3 92  CYS 92  92  92  CYS CYS A . n 
E 3 93  GLU 93  93  93  GLU GLU A . n 
E 3 94  VAL 94  94  94  VAL VAL A . n 
E 3 95  ALA 95  95  95  ALA ALA A . n 
E 3 96  GLU 96  96  96  GLU GLU A . n 
E 3 97  ILE 97  97  97  ILE ILE A . n 
E 3 98  SER 98  98  98  SER SER A . n 
E 3 99  TYR 99  99  99  TYR TYR A . n 
E 3 100 LYS 100 100 100 LYS LYS A . n 
E 3 101 LYS 101 101 101 LYS LYS A . n 
E 3 102 PHE 102 102 102 PHE PHE A . n 
E 3 103 ARG 103 103 103 ARG ARG A . n 
E 3 104 GLN 104 104 104 GLN GLN A . n 
E 3 105 LEU 105 105 105 LEU LEU A . n 
E 3 106 ILE 106 106 106 ILE ILE A . n 
E 3 107 GLN 107 107 107 GLN GLN A . n 
E 3 108 VAL 108 108 108 VAL VAL A . n 
E 3 109 ASN 109 109 109 ASN ASN A . n 
E 3 110 PRO 110 110 110 PRO PRO A . n 
E 3 111 ASP 111 111 111 ASP ASP A . n 
E 3 112 ILE 112 112 112 ILE ILE A . n 
E 3 113 LEU 113 113 113 LEU LEU A . n 
E 3 114 MET 114 114 114 MET MET A . n 
E 3 115 ARG 115 115 115 ARG ARG A . n 
E 3 116 LEU 116 116 116 LEU LEU A . n 
E 3 117 SER 117 117 117 SER SER A . n 
E 3 118 ALA 118 118 118 ALA ALA A . n 
E 3 119 GLN 119 119 119 GLN GLN A . n 
E 3 120 MET 120 120 120 MET MET A . n 
E 3 121 ALA 121 121 121 ALA ALA A . n 
E 3 122 ARG 122 122 122 ARG ARG A . n 
E 3 123 ARG 123 123 123 ARG ARG A . n 
E 3 124 LEU 124 124 124 LEU LEU A . n 
E 3 125 GLN 125 125 125 GLN GLN A . n 
E 3 126 VAL 126 126 126 VAL VAL A . n 
E 3 127 THR 127 127 127 THR THR A . n 
E 3 128 SER 128 128 128 SER SER A . n 
E 3 129 GLU 129 129 129 GLU GLU A . n 
E 3 130 LYS 130 130 130 LYS LYS A . n 
E 3 131 VAL 131 131 131 VAL VAL A . n 
E 3 132 GLY 132 132 132 GLY GLY A . n 
E 3 133 ASN 133 133 133 ASN ASN A . n 
E 3 134 LEU 134 134 134 LEU LEU A . n 
E 3 135 ALA 135 135 135 ALA ALA A . n 
E 3 136 PHE 136 136 136 PHE PHE A . n 
E 3 137 LEU 137 137 137 LEU LEU A . n 
E 3 138 ASP 138 138 138 ASP ASP A . n 
E 3 139 VAL 139 139 139 VAL VAL A . n 
E 3 140 THR 140 140 140 THR THR A . n 
E 3 141 GLY 141 141 141 GLY GLY A . n 
E 3 142 ARG 142 142 142 ARG ARG A . n 
E 3 143 ILE 143 143 143 ILE ILE A . n 
E 3 144 ALA 144 144 144 ALA ALA A . n 
E 3 145 GLN 145 145 145 GLN GLN A . n 
E 3 146 THR 146 146 146 THR THR A . n 
E 3 147 LEU 147 147 147 LEU LEU A . n 
E 3 148 LEU 148 148 148 LEU LEU A . n 
E 3 149 ASN 149 149 149 ASN ASN A . n 
E 3 150 LEU 150 150 150 LEU LEU A . n 
E 3 151 ALA 151 151 151 ALA ALA A . n 
E 3 152 LYS 152 152 152 LYS LYS A . n 
E 3 153 GLN 153 153 153 GLN GLN A . n 
E 3 154 PRO 154 154 154 PRO PRO A . n 
E 3 155 ASP 155 155 155 ASP ASP A . n 
E 3 156 ALA 156 156 156 ALA ALA A . n 
E 3 157 MET 157 157 157 MET MET A . n 
E 3 158 THR 158 158 158 THR THR A . n 
E 3 159 HIS 159 159 159 HIS HIS A . n 
E 3 160 PRO 160 160 160 PRO PRO A . n 
E 3 161 ASP 161 161 161 ASP ASP A . n 
E 3 162 GLY 162 162 162 GLY GLY A . n 
E 3 163 MET 163 163 163 MET MET A . n 
E 3 164 GLN 164 164 164 GLN GLN A . n 
E 3 165 ILE 165 165 165 ILE ILE A . n 
E 3 166 LYS 166 166 166 LYS LYS A . n 
E 3 167 ILE 167 167 167 ILE ILE A . n 
E 3 168 THR 168 168 168 THR THR A . n 
E 3 169 ARG 169 169 169 ARG ARG A . n 
E 3 170 GLN 170 170 170 GLN GLN A . n 
E 3 171 GLU 171 171 171 GLU GLU A . n 
E 3 172 ILE 172 172 172 ILE ILE A . n 
E 3 173 GLY 173 173 173 GLY GLY A . n 
E 3 174 GLN 174 174 174 GLN GLN A . n 
E 3 175 ILE 175 175 175 ILE ILE A . n 
E 3 176 VAL 176 176 176 VAL VAL A . n 
E 3 177 GLY 177 177 177 GLY GLY A . n 
E 3 178 CYS 178 178 178 CYS CYS A . n 
E 3 179 SER 179 179 179 SER SER A . n 
E 3 180 ARG 180 180 180 ARG ARG A . n 
E 3 181 GLU 181 181 181 GLU GLU A . n 
E 3 182 THR 182 182 182 THR THR A . n 
E 3 183 VAL 183 183 183 VAL VAL A . n 
E 3 184 GLY 184 184 184 GLY GLY A . n 
E 3 185 ARG 185 185 185 ARG ARG A . n 
E 3 186 ILE 186 186 186 ILE ILE A . n 
E 3 187 LEU 187 187 187 LEU LEU A . n 
E 3 188 LYS 188 188 188 LYS LYS A . n 
E 3 189 MET 189 189 189 MET MET A . n 
E 3 190 LEU 190 190 190 LEU LEU A . n 
E 3 191 GLU 191 191 191 GLU GLU A . n 
E 3 192 ASP 192 192 192 ASP ASP A . n 
E 3 193 GLN 193 193 193 GLN GLN A . n 
E 3 194 ASN 194 194 194 ASN ASN A . n 
E 3 195 LEU 195 195 195 LEU LEU A . n 
E 3 196 ILE 196 196 196 ILE ILE A . n 
E 3 197 SER 197 197 197 SER SER A . n 
E 3 198 ALA 198 198 198 ALA ALA A . n 
E 3 199 HIS 199 199 199 HIS HIS A . n 
E 3 200 GLY 200 200 200 GLY GLY A . n 
E 3 201 LYS 201 201 201 LYS LYS A . n 
E 3 202 THR 202 202 202 THR THR A . n 
E 3 203 ILE 203 203 203 ILE ILE A . n 
E 3 204 VAL 204 204 204 VAL VAL A . n 
E 3 205 VAL 205 205 205 VAL VAL A . n 
E 3 206 TYR 206 206 206 TYR TYR A . n 
E 3 207 GLY 207 207 207 GLY GLY A . n 
E 3 208 THR 208 208 ?   ?   ?   A . n 
E 3 209 ARG 209 209 ?   ?   ?   A . n 
F 3 1   VAL 1   1   ?   ?   ?   B . n 
F 3 2   LEU 2   2   ?   ?   ?   B . n 
F 3 3   GLY 3   3   ?   ?   ?   B . n 
F 3 4   LYS 4   4   ?   ?   ?   B . n 
F 3 5   PRO 5   5   ?   ?   ?   B . n 
F 3 6   GLN 6   6   ?   ?   ?   B . n 
F 3 7   THR 7   7   ?   ?   ?   B . n 
F 3 8   ASP 8   8   8   ASP ASP B . n 
F 3 9   PRO 9   9   9   PRO PRO B . n 
F 3 10  THR 10  10  10  THR THR B . n 
F 3 11  LEU 11  11  11  LEU LEU B . n 
F 3 12  GLU 12  12  12  GLU GLU B . n 
F 3 13  TRP 13  13  13  TRP TRP B . n 
F 3 14  PHE 14  14  14  PHE PHE B . n 
F 3 15  LEU 15  15  15  LEU LEU B . n 
F 3 16  SER 16  16  16  SER SER B . n 
F 3 17  HIS 17  17  17  HIS HIS B . n 
F 3 18  CYS 18  18  18  CYS CYS B . n 
F 3 19  HIS 19  19  19  HIS HIS B . n 
F 3 20  ILE 20  20  20  ILE ILE B . n 
F 3 21  HIS 21  21  21  HIS HIS B . n 
F 3 22  LYS 22  22  22  LYS LYS B . n 
F 3 23  TYR 23  23  23  TYR TYR B . n 
F 3 24  PRO 24  24  24  PRO PRO B . n 
F 3 25  SER 25  25  25  SER SER B . n 
F 3 26  LYS 26  26  26  LYS LYS B . n 
F 3 27  SER 27  27  27  SER SER B . n 
F 3 28  THR 28  28  28  THR THR B . n 
F 3 29  LEU 29  29  29  LEU LEU B . n 
F 3 30  ILE 30  30  30  ILE ILE B . n 
F 3 31  HIS 31  31  31  HIS HIS B . n 
F 3 32  GLN 32  32  32  GLN GLN B . n 
F 3 33  GLY 33  33  33  GLY GLY B . n 
F 3 34  GLU 34  34  34  GLU GLU B . n 
F 3 35  LYS 35  35  35  LYS LYS B . n 
F 3 36  ALA 36  36  36  ALA ALA B . n 
F 3 37  GLU 37  37  37  GLU GLU B . n 
F 3 38  THR 38  38  38  THR THR B . n 
F 3 39  LEU 39  39  39  LEU LEU B . n 
F 3 40  TYR 40  40  40  TYR TYR B . n 
F 3 41  TYR 41  41  41  TYR TYR B . n 
F 3 42  ILE 42  42  42  ILE ILE B . n 
F 3 43  VAL 43  43  43  VAL VAL B . n 
F 3 44  LYS 44  44  44  LYS LYS B . n 
F 3 45  GLY 45  45  45  GLY GLY B . n 
F 3 46  SER 46  46  46  SER SER B . n 
F 3 47  VAL 47  47  47  VAL VAL B . n 
F 3 48  ALA 48  48  48  ALA ALA B . n 
F 3 49  VAL 49  49  49  VAL VAL B . n 
F 3 50  LEU 50  50  50  LEU LEU B . n 
F 3 51  ILE 51  51  51  ILE ILE B . n 
F 3 52  LYS 52  52  52  LYS LYS B . n 
F 3 53  ASP 53  53  53  ASP ASP B . n 
F 3 54  GLU 54  54  54  GLU GLU B . n 
F 3 55  GLU 55  55  55  GLU GLU B . n 
F 3 56  GLY 56  56  56  GLY GLY B . n 
F 3 57  LYS 57  57  57  LYS LYS B . n 
F 3 58  GLU 58  58  58  GLU GLU B . n 
F 3 59  MET 59  59  59  MET MET B . n 
F 3 60  ILE 60  60  60  ILE ILE B . n 
F 3 61  LEU 61  61  61  LEU LEU B . n 
F 3 62  SER 62  62  62  SER SER B . n 
F 3 63  TYR 63  63  63  TYR TYR B . n 
F 3 64  LEU 64  64  64  LEU LEU B . n 
F 3 65  ASN 65  65  65  ASN ASN B . n 
F 3 66  GLN 66  66  66  GLN GLN B . n 
F 3 67  GLY 67  67  67  GLY GLY B . n 
F 3 68  ASP 68  68  68  ASP ASP B . n 
F 3 69  PHE 69  69  69  PHE PHE B . n 
F 3 70  ILE 70  70  70  ILE ILE B . n 
F 3 71  GLY 71  71  71  GLY GLY B . n 
F 3 72  GLU 72  72  72  GLU GLU B . n 
F 3 73  LEU 73  73  73  LEU LEU B . n 
F 3 74  GLY 74  74  74  GLY GLY B . n 
F 3 75  LEU 75  75  75  LEU LEU B . n 
F 3 76  PHE 76  76  76  PHE PHE B . n 
F 3 77  GLU 77  77  77  GLU GLU B . n 
F 3 78  GLU 78  78  78  GLU GLU B . n 
F 3 79  GLY 79  79  79  GLY GLY B . n 
F 3 80  GLN 80  80  80  GLN GLN B . n 
F 3 81  GLU 81  81  81  GLU GLU B . n 
F 3 82  ARG 82  82  82  ARG ARG B . n 
F 3 83  SER 83  83  83  SER SER B . n 
F 3 84  ALA 84  84  84  ALA ALA B . n 
F 3 85  TRP 85  85  85  TRP TRP B . n 
F 3 86  VAL 86  86  86  VAL VAL B . n 
F 3 87  ARG 87  87  87  ARG ARG B . n 
F 3 88  ALA 88  88  88  ALA ALA B . n 
F 3 89  LYS 89  89  89  LYS LYS B . n 
F 3 90  THR 90  90  90  THR THR B . n 
F 3 91  ALA 91  91  91  ALA ALA B . n 
F 3 92  CYS 92  92  92  CYS CYS B . n 
F 3 93  GLU 93  93  93  GLU GLU B . n 
F 3 94  VAL 94  94  94  VAL VAL B . n 
F 3 95  ALA 95  95  95  ALA ALA B . n 
F 3 96  GLU 96  96  96  GLU GLU B . n 
F 3 97  ILE 97  97  97  ILE ILE B . n 
F 3 98  SER 98  98  98  SER SER B . n 
F 3 99  TYR 99  99  99  TYR TYR B . n 
F 3 100 LYS 100 100 100 LYS LYS B . n 
F 3 101 LYS 101 101 101 LYS LYS B . n 
F 3 102 PHE 102 102 102 PHE PHE B . n 
F 3 103 ARG 103 103 103 ARG ARG B . n 
F 3 104 GLN 104 104 104 GLN GLN B . n 
F 3 105 LEU 105 105 105 LEU LEU B . n 
F 3 106 ILE 106 106 106 ILE ILE B . n 
F 3 107 GLN 107 107 107 GLN GLN B . n 
F 3 108 VAL 108 108 108 VAL VAL B . n 
F 3 109 ASN 109 109 109 ASN ASN B . n 
F 3 110 PRO 110 110 110 PRO PRO B . n 
F 3 111 ASP 111 111 111 ASP ASP B . n 
F 3 112 ILE 112 112 112 ILE ILE B . n 
F 3 113 LEU 113 113 113 LEU LEU B . n 
F 3 114 MET 114 114 114 MET MET B . n 
F 3 115 ARG 115 115 115 ARG ARG B . n 
F 3 116 LEU 116 116 116 LEU LEU B . n 
F 3 117 SER 117 117 117 SER SER B . n 
F 3 118 ALA 118 118 118 ALA ALA B . n 
F 3 119 GLN 119 119 119 GLN GLN B . n 
F 3 120 MET 120 120 120 MET MET B . n 
F 3 121 ALA 121 121 121 ALA ALA B . n 
F 3 122 ARG 122 122 122 ARG ARG B . n 
F 3 123 ARG 123 123 123 ARG ARG B . n 
F 3 124 LEU 124 124 124 LEU LEU B . n 
F 3 125 GLN 125 125 125 GLN GLN B . n 
F 3 126 VAL 126 126 126 VAL VAL B . n 
F 3 127 THR 127 127 127 THR THR B . n 
F 3 128 SER 128 128 128 SER SER B . n 
F 3 129 GLU 129 129 129 GLU GLU B . n 
F 3 130 LYS 130 130 130 LYS LYS B . n 
F 3 131 VAL 131 131 131 VAL VAL B . n 
F 3 132 GLY 132 132 132 GLY GLY B . n 
F 3 133 ASN 133 133 133 ASN ASN B . n 
F 3 134 LEU 134 134 134 LEU LEU B . n 
F 3 135 ALA 135 135 135 ALA ALA B . n 
F 3 136 PHE 136 136 136 PHE PHE B . n 
F 3 137 LEU 137 137 137 LEU LEU B . n 
F 3 138 ASP 138 138 138 ASP ASP B . n 
F 3 139 VAL 139 139 139 VAL VAL B . n 
F 3 140 THR 140 140 140 THR THR B . n 
F 3 141 GLY 141 141 141 GLY GLY B . n 
F 3 142 ARG 142 142 142 ARG ARG B . n 
F 3 143 ILE 143 143 143 ILE ILE B . n 
F 3 144 ALA 144 144 144 ALA ALA B . n 
F 3 145 GLN 145 145 145 GLN GLN B . n 
F 3 146 THR 146 146 146 THR THR B . n 
F 3 147 LEU 147 147 147 LEU LEU B . n 
F 3 148 LEU 148 148 148 LEU LEU B . n 
F 3 149 ASN 149 149 149 ASN ASN B . n 
F 3 150 LEU 150 150 150 LEU LEU B . n 
F 3 151 ALA 151 151 151 ALA ALA B . n 
F 3 152 LYS 152 152 152 LYS LYS B . n 
F 3 153 GLN 153 153 153 GLN GLN B . n 
F 3 154 PRO 154 154 154 PRO PRO B . n 
F 3 155 ASP 155 155 155 ASP ASP B . n 
F 3 156 ALA 156 156 156 ALA ALA B . n 
F 3 157 MET 157 157 157 MET MET B . n 
F 3 158 THR 158 158 158 THR THR B . n 
F 3 159 HIS 159 159 159 HIS HIS B . n 
F 3 160 PRO 160 160 160 PRO PRO B . n 
F 3 161 ASP 161 161 161 ASP ASP B . n 
F 3 162 GLY 162 162 162 GLY GLY B . n 
F 3 163 MET 163 163 163 MET MET B . n 
F 3 164 GLN 164 164 164 GLN GLN B . n 
F 3 165 ILE 165 165 165 ILE ILE B . n 
F 3 166 LYS 166 166 166 LYS LYS B . n 
F 3 167 ILE 167 167 167 ILE ILE B . n 
F 3 168 THR 168 168 168 THR THR B . n 
F 3 169 ARG 169 169 169 ARG ARG B . n 
F 3 170 GLN 170 170 170 GLN GLN B . n 
F 3 171 GLU 171 171 171 GLU GLU B . n 
F 3 172 ILE 172 172 172 ILE ILE B . n 
F 3 173 GLY 173 173 173 GLY GLY B . n 
F 3 174 GLN 174 174 174 GLN GLN B . n 
F 3 175 ILE 175 175 175 ILE ILE B . n 
F 3 176 VAL 176 176 176 VAL VAL B . n 
F 3 177 GLY 177 177 177 GLY GLY B . n 
F 3 178 CYS 178 178 178 CYS CYS B . n 
F 3 179 SER 179 179 179 SER SER B . n 
F 3 180 ARG 180 180 180 ARG ARG B . n 
F 3 181 GLU 181 181 181 GLU GLU B . n 
F 3 182 THR 182 182 182 THR THR B . n 
F 3 183 VAL 183 183 183 VAL VAL B . n 
F 3 184 GLY 184 184 184 GLY GLY B . n 
F 3 185 ARG 185 185 185 ARG ARG B . n 
F 3 186 ILE 186 186 186 ILE ILE B . n 
F 3 187 LEU 187 187 187 LEU LEU B . n 
F 3 188 LYS 188 188 188 LYS LYS B . n 
F 3 189 MET 189 189 189 MET MET B . n 
F 3 190 LEU 190 190 190 LEU LEU B . n 
F 3 191 GLU 191 191 191 GLU GLU B . n 
F 3 192 ASP 192 192 192 ASP ASP B . n 
F 3 193 GLN 193 193 193 GLN GLN B . n 
F 3 194 ASN 194 194 194 ASN ASN B . n 
F 3 195 LEU 195 195 195 LEU LEU B . n 
F 3 196 ILE 196 196 196 ILE ILE B . n 
F 3 197 SER 197 197 197 SER SER B . n 
F 3 198 ALA 198 198 198 ALA ALA B . n 
F 3 199 HIS 199 199 199 HIS HIS B . n 
F 3 200 GLY 200 200 200 GLY GLY B . n 
F 3 201 LYS 201 201 201 LYS LYS B . n 
F 3 202 THR 202 202 202 THR THR B . n 
F 3 203 ILE 203 203 203 ILE ILE B . n 
F 3 204 VAL 204 204 204 VAL VAL B . n 
F 3 205 VAL 205 205 205 VAL VAL B . n 
F 3 206 TYR 206 206 206 TYR TYR B . n 
F 3 207 GLY 207 207 207 GLY GLY B . n 
F 3 208 THR 208 208 ?   ?   ?   B . n 
F 3 209 ARG 209 209 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CMP 1  210 101 CMP CMP A . 
H 4 CMP 1  210 102 CMP CMP B . 
I 5 HOH 1  36  36  HOH HOH W . 
J 5 HOH 1  17  17  HOH HOH X . 
J 5 HOH 2  37  37  HOH HOH X . 
K 5 HOH 1  211 1   HOH HOH A . 
K 5 HOH 2  212 2   HOH HOH A . 
K 5 HOH 3  213 3   HOH HOH A . 
K 5 HOH 4  214 4   HOH HOH A . 
K 5 HOH 5  215 5   HOH HOH A . 
K 5 HOH 6  216 6   HOH HOH A . 
K 5 HOH 7  217 7   HOH HOH A . 
K 5 HOH 8  218 15  HOH HOH A . 
K 5 HOH 9  219 16  HOH HOH A . 
K 5 HOH 10 220 18  HOH HOH A . 
K 5 HOH 11 221 21  HOH HOH A . 
K 5 HOH 12 222 22  HOH HOH A . 
K 5 HOH 13 223 23  HOH HOH A . 
K 5 HOH 14 224 24  HOH HOH A . 
K 5 HOH 15 225 25  HOH HOH A . 
K 5 HOH 16 226 26  HOH HOH A . 
K 5 HOH 17 227 27  HOH HOH A . 
K 5 HOH 18 228 28  HOH HOH A . 
K 5 HOH 19 229 29  HOH HOH A . 
K 5 HOH 20 230 30  HOH HOH A . 
K 5 HOH 21 231 31  HOH HOH A . 
K 5 HOH 22 232 35  HOH HOH A . 
K 5 HOH 23 233 39  HOH HOH A . 
L 5 HOH 1  211 8   HOH HOH B . 
L 5 HOH 2  212 9   HOH HOH B . 
L 5 HOH 3  213 10  HOH HOH B . 
L 5 HOH 4  214 11  HOH HOH B . 
L 5 HOH 5  215 12  HOH HOH B . 
L 5 HOH 6  216 13  HOH HOH B . 
L 5 HOH 7  217 14  HOH HOH B . 
L 5 HOH 8  218 19  HOH HOH B . 
L 5 HOH 9  219 20  HOH HOH B . 
L 5 HOH 10 220 32  HOH HOH B . 
L 5 HOH 11 221 33  HOH HOH B . 
L 5 HOH 12 222 34  HOH HOH B . 
L 5 HOH 13 223 38  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-21 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_phasing_MR.entry_id                     1ZRC 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     54.800 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   53.200 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   19.500 
_pdbx_phasing_MR.d_res_high_rotation          3.000 
_pdbx_phasing_MR.d_res_low_rotation           91.287 
_pdbx_phasing_MR.d_res_high_translation       3.000 
_pdbx_phasing_MR.d_res_low_translation        91.287 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
AMoRE       .     ?               program 'Jorge Navaza'       ccp4@dl.ac.uk            phasing           
http://www.ccp4.ac.uk/main.html                  Fortran    ? 3 
CNS         .     ?               package 'Axel T. Brunger'    axel.brunger@yale.edu    refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 4 
PDB_EXTRACT 1.601 'Jan. 30, 2005' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
CBASS       .     ?               ?       ?                    ?                        'data collection' ? ?          ? 6 
HKL-2000    .     ?               ?       ?                    ?                        'data scaling'    ? ?          ? 7 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE2 
_pdbx_validate_close_contact.auth_asym_id_1   B 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    72 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   "O2'" 
_pdbx_validate_close_contact.auth_asym_id_2   B 
_pdbx_validate_close_contact.auth_comp_id_2   CMP 
_pdbx_validate_close_contact.auth_seq_id_2    210 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.15 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 12  ? ? -150.50 -41.38  
2  1 LYS A 26  ? ? 65.96   -4.73   
3  1 GLU A 37  ? ? -150.81 -8.87   
4  1 SER A 62  ? ? 179.21  169.35  
5  1 LEU A 73  ? ? -54.25  -8.84   
6  1 GLU A 77  ? ? -176.17 139.02  
7  1 GLN A 107 ? ? -67.01  7.36    
8  1 VAL A 108 ? ? -143.58 22.12   
9  1 ASN A 109 ? ? 153.13  75.80   
10 1 PRO A 110 ? ? -61.45  1.05    
11 1 LYS B 26  ? ? 59.35   -9.36   
12 1 ASN B 65  ? ? -100.37 -147.74 
13 1 LYS B 89  ? ? -73.22  -85.66  
14 1 THR B 90  ? ? -72.09  -166.75 
15 1 ILE B 97  ? ? 176.10  137.51  
16 1 ASN B 109 ? ? 172.35  84.59   
17 1 ALA B 151 ? ? -81.88  32.75   
18 1 GLU B 181 ? ? -59.76  -70.30  
19 1 GLN B 193 ? ? -72.53  28.09   
20 1 ASN B 194 ? ? 25.29   88.97   
21 1 LEU B 195 ? ? -144.14 -19.43  
22 1 HIS B 199 ? ? 168.83  105.62  
23 1 LYS B 201 ? ? -154.55 29.15   
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DG 
_pdbx_validate_planes.auth_asym_id    W 
_pdbx_validate_planes.auth_seq_id     5 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.053 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A VAL 1   ? E VAL 1   
2  1 Y 1 A LEU 2   ? E LEU 2   
3  1 Y 1 A GLY 3   ? E GLY 3   
4  1 Y 1 A LYS 4   ? E LYS 4   
5  1 Y 1 A PRO 5   ? E PRO 5   
6  1 Y 1 A GLN 6   ? E GLN 6   
7  1 Y 1 A THR 7   ? E THR 7   
8  1 Y 1 A THR 208 ? E THR 208 
9  1 Y 1 A ARG 209 ? E ARG 209 
10 1 Y 1 B VAL 1   ? F VAL 1   
11 1 Y 1 B LEU 2   ? F LEU 2   
12 1 Y 1 B GLY 3   ? F GLY 3   
13 1 Y 1 B LYS 4   ? F LYS 4   
14 1 Y 1 B PRO 5   ? F PRO 5   
15 1 Y 1 B GLN 6   ? F GLN 6   
16 1 Y 1 B THR 7   ? F THR 7   
17 1 Y 1 B THR 208 ? F THR 208 
18 1 Y 1 B ARG 209 ? F ARG 209 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1ZRC 'double helix'        
1ZRC 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DA 1  1_555 B DT 21 1_555 0.017  -0.192 -0.819 -5.249  2.984   6.457  1  W_DA-8:DT-8_X W -8 ? X -8 ? 20 1 
1 A DT 2  1_555 B DA 20 1_555 -0.191 -0.265 -1.335 22.817  1.288   2.562  2  W_DT-7:DA-7_X W -7 ? X -7 ? 20 1 
1 A DT 3  1_555 B DA 19 1_555 -0.168 -0.029 0.033  0.410   -6.827  -0.951 3  W_DT-6:DA-6_X W -6 ? X -6 ? 20 1 
1 A DT 4  1_555 B DA 18 1_555 -0.116 0.011  0.126  -1.391  -7.108  0.503  4  W_DT-5:DA-5_X W -5 ? X -5 ? 20 1 
1 A DC 5  1_555 B DG 17 1_555 0.247  -0.064 -0.218 -4.416  -12.218 3.160  5  W_DC-4:DG-4_X W -4 ? X -4 ? 19 1 
1 A DG 6  1_555 B DC 16 1_555 -0.292 -0.069 -0.246 4.261   -15.845 4.923  6  W_DG-3:DC-3_X W -3 ? X -3 ? 19 1 
1 A DA 7  1_555 B DT 15 1_555 -0.076 -0.108 -0.215 3.138   -14.014 -2.581 7  W_DA-2:DT-2_X W -2 ? X -2 ? 20 1 
1 A DA 8  1_555 B DT 14 1_555 0.127  -0.105 -0.205 0.236   -6.675  -2.537 8  W_DA-1:DT-1_X W -1 ? X -1 ? 20 1 
1 A DA 9  1_555 B DT 13 1_555 0.078  -0.008 0.232  6.539   -2.258  -3.246 9  W_DA1:DT1_X   W 1  ? X 1  ? 20 1 
1 A DA 10 1_555 B DT 12 1_555 0.066  -0.237 0.433  10.374  -14.254 3.745  10 W_DA2:DT2_X   W 2  ? X 2  ? 20 1 
1 A DA 11 1_555 B DT 11 1_555 0.068  -0.157 0.617  -1.031  -11.000 -5.967 11 W_DA3:DT3_X   W 3  ? X 3  ? 20 1 
1 A DT 12 1_555 B DA 10 1_555 0.029  -0.098 0.120  -11.725 -16.373 -0.199 12 W_DT4:DA4_X   W 4  ? X 4  ? 20 1 
1 A DG 13 1_555 B DC 9  1_555 -0.217 -0.096 -1.111 -19.536 -2.062  1.660  13 W_DG5:DC5_X   W 5  ? X 5  ? 19 1 
1 A DT 14 1_555 B DA 8  1_555 -0.082 -0.103 -1.047 25.155  -4.953  -0.297 14 W_DT6:DA6_X   W 6  ? X 6  ? 20 1 
1 A DG 15 1_555 B DC 7  1_555 0.063  0.001  -0.671 -25.290 0.255   -7.039 15 W_DG7:DC7_X   W 7  ? X 7  ? 19 1 
1 A DA 16 1_555 B DT 6  1_555 -0.060 -0.072 -0.907 -15.976 -17.666 0.839  16 W_DA8:DT8_X   W 8  ? X 8  ? 20 1 
1 A DT 17 1_555 B DA 5  1_555 -0.161 -0.139 -0.730 6.700   -12.311 3.380  17 W_DT9:DA9_X   W 9  ? X 9  ? 20 1 
1 D DC 1  1_555 B DG 4  1_555 0.142  -0.016 -0.398 5.716   -10.385 2.251  18 Z_DC13:DG10_X Z 13 ? X 10 ? 19 1 
1 D DT 2  1_555 B DA 3  1_555 0.004  0.011  0.430  5.237   -3.853  -3.715 19 Z_DT12:DA11_X Z 12 ? X 11 ? 20 1 
1 D DA 3  1_555 B DT 2  1_555 -0.496 -0.293 0.802  4.740   -4.016  -2.345 20 Z_DA11:DT12_X Z 11 ? X 12 ? 20 1 
1 D DG 4  1_555 B DC 1  1_555 0.126  -0.366 -0.839 -2.908  -6.514  1.215  21 Z_DG10:DC13_X Z 10 ? X 13 ? 19 1 
1 D DA 5  1_555 C DT 17 1_555 0.035  -0.003 -0.110 5.431   -6.189  7.825  22 Z_DA9:DT9_Y   Z 9  ? Y 9  ? 20 1 
1 D DT 6  1_555 C DA 16 1_555 0.057  -0.112 -0.547 1.649   -11.752 4.492  23 Z_DT8:DA8_Y   Z 8  ? Y 8  ? 20 1 
1 D DC 7  1_555 C DG 15 1_555 0.185  -0.003 0.134  -7.213  0.209   0.242  24 Z_DC7:DG7_Y   Z 7  ? Y 7  ? 19 1 
1 D DA 8  1_555 C DT 14 1_555 0.140  -0.060 0.221  -0.865  6.604   1.676  25 Z_DA6:DT6_Y   Z 6  ? Y 6  ? 20 1 
1 D DC 9  1_555 C DG 13 1_555 0.219  -0.284 0.513  5.902   6.708   1.464  26 Z_DC5:DG5_Y   Z 5  ? Y 5  ? 19 1 
1 D DA 10 1_555 C DT 12 1_555 -0.052 -0.121 0.047  7.402   -8.877  2.742  27 Z_DA4:DT4_Y   Z 4  ? Y 4  ? 20 1 
1 D DT 11 1_555 C DA 11 1_555 -0.074 0.024  0.261  -2.498  -10.179 -0.209 28 Z_DT3:DA3_Y   Z 3  ? Y 3  ? 20 1 
1 D DT 12 1_555 C DA 10 1_555 -0.219 -0.120 0.659  -13.972 -10.714 -2.930 29 Z_DT2:DA2_Y   Z 2  ? Y 2  ? 20 1 
1 D DT 13 1_555 C DA 9  1_555 -0.285 -0.073 -0.001 -9.385  -16.397 -0.668 30 Z_DT1:DA1_Y   Z 1  ? Y 1  ? 20 1 
1 D DT 14 1_555 C DA 8  1_555 -0.070 -0.276 -0.785 -4.930  -17.186 3.543  31 Z_DT-1:DA-1_Y Z -1 ? Y -1 ? 20 1 
1 D DT 15 1_555 C DA 7  1_555 -0.117 -0.186 0.445  -13.097 -23.124 -8.437 32 Z_DT-2:DA-2_Y Z -2 ? Y -2 ? 20 1 
1 D DC 16 1_555 C DG 6  1_555 0.077  -0.033 -0.175 1.490   -8.739  1.299  33 Z_DC-3:DG-3_Y Z -3 ? Y -3 ? 19 1 
1 D DG 17 1_555 C DC 5  1_555 -0.115 -0.046 0.062  15.559  -3.014  0.091  34 Z_DG-4:DC-4_Y Z -4 ? Y -4 ? 19 1 
1 D DA 18 1_555 C DT 4  1_555 0.114  -0.135 -0.460 6.080   -19.898 1.468  35 Z_DA-5:DT-5_Y Z -5 ? Y -5 ? 20 1 
1 D DA 19 1_555 C DT 3  1_555 0.123  -0.040 0.385  14.646  -15.133 -1.169 36 Z_DA-6:DT-6_Y Z -6 ? Y -6 ? 20 1 
1 D DA 20 1_555 C DT 2  1_555 0.141  0.079  -0.222 -2.529  -4.704  -5.562 37 Z_DA-7:DT-7_Y Z -7 ? Y -7 ? 20 1 
1 D DT 21 1_555 C DA 1  1_555 0.064  -0.101 0.171  -5.408  -0.397  -0.120 38 Z_DT-8:DA-8_Y Z -8 ? Y -8 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DA 1  1_555 B DT 21 1_555 A DT 2  1_555 B DA 20 1_555 -0.013 0.251  2.488 6.312   7.813   31.300 -0.589 0.858  2.431 14.036  
-11.338 32.834 1  WW_DA-8DT-7:DA-7DT-8_XX W -8 ? X -8 ? W -7 ? X -7 ? 
1 A DT 2  1_555 B DA 20 1_555 A DT 3  1_555 B DA 19 1_555 -0.367 -0.693 4.102 -10.508 0.304   35.761 -1.137 -1.200 4.041 0.482   
16.672  37.225 2  WW_DT-7DT-6:DA-6DA-7_XX W -7 ? X -7 ? W -6 ? X -6 ? 
1 A DT 3  1_555 B DA 19 1_555 A DT 4  1_555 B DA 18 1_555 0.491  -0.300 3.070 0.537   9.625   36.032 -1.657 -0.702 2.904 15.227  
-0.849  37.258 3  WW_DT-6DT-5:DA-5DA-6_XX W -6 ? X -6 ? W -5 ? X -5 ? 
1 A DT 4  1_555 B DA 18 1_555 A DC 5  1_555 B DG 17 1_555 -0.161 -0.074 3.264 5.863   13.361  32.855 -2.024 1.096  2.945 22.303  
-9.787  35.867 4  WW_DT-5DC-4:DG-4DA-5_XX W -5 ? X -5 ? W -4 ? X -4 ? 
1 A DC 5  1_555 B DG 17 1_555 A DG 6  1_555 B DC 16 1_555 -0.097 1.442  3.046 -4.723  14.835  30.680 0.032  -0.603 3.353 26.041  
8.290   34.319 5  WW_DC-4DG-3:DC-3DG-4_XX W -4 ? X -4 ? W -3 ? X -3 ? 
1 A DG 6  1_555 B DC 16 1_555 A DA 7  1_555 B DT 15 1_555 -0.470 0.139  3.420 -6.411  -6.526  36.305 1.123  -0.157 3.378 -10.274 
10.092  37.402 6  WW_DG-3DA-2:DT-2DC-3_XX W -3 ? X -3 ? W -2 ? X -2 ? 
1 A DA 7  1_555 B DT 15 1_555 A DA 8  1_555 B DT 14 1_555 0.208  -0.251 3.293 2.302   -3.900  38.073 0.112  -0.025 3.308 -5.953  
-3.514  38.331 7  WW_DA-2DA-1:DT-1DT-2_XX W -2 ? X -2 ? W -1 ? X -1 ? 
1 A DA 8  1_555 B DT 14 1_555 A DA 9  1_555 B DT 13 1_555 -0.028 -0.372 3.007 -1.814  -8.215  35.985 0.448  -0.185 3.015 -13.078 
2.887   36.924 8  WW_DA-1DA1:DT1DT-1_XX   W -1 ? X -1 ? W 1  ? X 1  ? 
1 A DA 9  1_555 B DT 13 1_555 A DA 10 1_555 B DT 12 1_555 0.506  -0.905 3.070 2.172   -1.226  36.118 -1.293 -0.524 3.122 -1.974  
-3.498  36.201 9  WW_DA1DA2:DT2DT1_XX     W 1  ? X 1  ? W 2  ? X 2  ? 
1 A DA 10 1_555 B DT 12 1_555 A DA 11 1_555 B DT 11 1_555 -0.395 -0.568 3.313 -2.110  -2.315  36.965 -0.577 0.332  3.358 -3.644  
3.321   37.093 10 WW_DA2DA3:DT3DT2_XX     W 2  ? X 2  ? W 3  ? X 3  ? 
1 A DA 11 1_555 B DT 11 1_555 A DT 12 1_555 B DA 10 1_555 -0.229 -1.116 3.449 1.590   5.314   33.817 -2.753 0.647  3.228 9.059   
-2.711  34.256 11 WW_DA3DT4:DA4DT3_XX     W 3  ? X 3  ? W 4  ? X 4  ? 
1 A DT 12 1_555 B DA 10 1_555 A DG 13 1_555 B DC 9  1_555 -0.252 1.726  3.605 3.187   2.517   38.827 2.245  0.806  3.674 3.774   
-4.778  39.030 12 WW_DT4DG5:DC5DA4_XX     W 4  ? X 4  ? W 5  ? X 5  ? 
1 A DG 13 1_555 B DC 9  1_555 A DT 14 1_555 B DA 8  1_555 -0.300 0.556  2.106 -3.412  1.851   25.093 0.914  0.037  2.161 4.227   
7.794   25.387 13 WW_DG5DT6:DA6DC5_XX     W 5  ? X 5  ? W 6  ? X 6  ? 
1 A DT 14 1_555 B DA 8  1_555 A DG 15 1_555 B DC 7  1_555 -0.102 2.356  5.574 -6.069  40.819  16.015 -5.622 -1.167 4.245 68.940  
10.250  44.139 14 WW_DT6DG7:DC7DA6_XX     W 6  ? X 6  ? W 7  ? X 7  ? 
1 A DG 15 1_555 B DC 7  1_555 A DA 16 1_555 B DT 6  1_555 -0.814 1.859  3.146 -5.159  3.494   33.192 2.630  0.557  3.403 6.050   
8.933   33.755 15 WW_DG7DA8:DT8DC7_XX     W 7  ? X 7  ? W 8  ? X 8  ? 
1 A DA 16 1_555 B DT 6  1_555 A DT 17 1_555 B DA 5  1_555 0.048  -0.265 2.644 0.063   3.313   30.813 -1.010 -0.079 2.602 6.213   
-0.118  30.986 16 WW_DA8DT9:DA9DT8_XX     W 8  ? X 8  ? W 9  ? X 9  ? 
1 A DT 17 1_555 B DA 5  1_555 D DC 1  1_555 B DG 4  1_555 1.243  0.537  3.296 0.465   -5.904  38.498 1.521  -1.809 3.197 -8.889  
-0.700  38.934 17 WZ_DT9DC13:DG10DA9_XX   W 9  ? X 9  ? Z 13 ? X 10 ? 
1 D DC 1  1_555 B DG 4  1_555 D DT 2  1_555 B DA 3  1_555 -0.571 0.055  3.373 -3.188  15.121  26.881 -2.971 0.422  3.024 29.622  
6.245   30.935 18 ZZ_DC13DT12:DA11DG10_XX Z 13 ? X 10 ? Z 12 ? X 11 ? 
1 D DT 2  1_555 B DA 3  1_555 D DA 3  1_555 B DT 2  1_555 0.262  2.039  3.507 -3.224  -13.243 45.730 3.577  -0.580 2.823 -16.610 
4.044   47.613 19 ZZ_DT12DA11:DT12DA11_XX Z 12 ? X 11 ? Z 11 ? X 12 ? 
1 D DA 3  1_555 B DT 2  1_555 D DG 4  1_555 B DC 1  1_555 0.289  -0.369 3.884 8.117   8.842   33.259 -2.162 0.950  3.641 14.859  
-13.641 35.301 20 ZZ_DA11DG10:DC13DT12_XX Z 11 ? X 12 ? Z 10 ? X 13 ? 
1 D DG 4  1_555 B DC 1  1_555 D DA 5  1_555 C DT 17 1_555 -0.240 0.092  3.150 -9.713  -0.926  36.046 0.263  -0.876 3.105 -1.464  
15.354  37.301 21 ZZ_DG10DA9:DT9DC13_YX   Z 10 ? X 13 ? Z 9  ? Y 9  ? 
1 D DA 5  1_555 C DT 17 1_555 D DT 6  1_555 C DA 16 1_555 -0.299 -0.674 3.362 1.750   1.651   32.199 -1.511 0.854  3.304 2.971   
-3.151  32.286 22 ZZ_DA9DT8:DA8DT9_YY     Z 9  ? Y 9  ? Z 8  ? Y 8  ? 
1 D DT 6  1_555 C DA 16 1_555 D DC 7  1_555 C DG 15 1_555 -0.015 -0.134 3.505 -4.497  3.770   33.816 -0.860 -0.730 3.444 6.422   
7.659   34.306 23 ZZ_DT8DC7:DG7DA8_YY     Z 8  ? Y 8  ? Z 7  ? Y 7  ? 
1 D DC 7  1_555 C DG 15 1_555 D DA 8  1_555 C DT 14 1_555 0.200  0.701  3.327 -1.090  11.486  30.555 -0.863 -0.557 3.357 20.884  
1.983   32.612 24 ZZ_DC7DA6:DT6DG7_YY     Z 7  ? Y 7  ? Z 6  ? Y 6  ? 
1 D DA 8  1_555 C DT 14 1_555 D DC 9  1_555 C DG 13 1_555 -0.117 -1.367 3.215 -2.141  4.296   25.372 -4.197 -0.306 2.946 9.671   
4.819   25.815 25 ZZ_DA6DC5:DG5DT6_YY     Z 6  ? Y 6  ? Z 5  ? Y 5  ? 
1 D DC 9  1_555 C DG 13 1_555 D DA 10 1_555 C DT 12 1_555 0.017  0.559  3.201 6.085   0.385   41.011 0.750  0.612  3.177 0.546   
-8.627  41.443 26 ZZ_DC5DA4:DT4DG5_YY     Z 5  ? Y 5  ? Z 4  ? Y 4  ? 
1 D DA 10 1_555 C DT 12 1_555 D DT 11 1_555 C DA 11 1_555 -0.210 -1.243 3.579 -2.236  1.688   30.826 -2.684 -0.077 3.514 3.167   
4.196   30.950 27 ZZ_DA4DT3:DA3DT4_YY     Z 4  ? Y 4  ? Z 3  ? Y 3  ? 
1 D DT 11 1_555 C DA 11 1_555 D DT 12 1_555 C DA 10 1_555 -0.491 -0.824 3.468 -3.913  -3.667  31.591 -0.777 0.125  3.572 -6.674  
7.123   32.032 28 ZZ_DT3DT2:DA2DA3_YY     Z 3  ? Y 3  ? Z 2  ? Y 2  ? 
1 D DT 12 1_555 C DA 10 1_555 D DT 13 1_555 C DA 9  1_555 -0.660 -0.570 2.876 4.400   -4.082  40.683 -0.423 1.358  2.834 -5.832  
-6.288  41.105 29 ZZ_DT2DT1:DA1DA2_YY     Z 2  ? Y 2  ? Z 1  ? Y 1  ? 
1 D DT 13 1_555 C DA 9  1_555 D DT 14 1_555 C DA 8  1_555 0.126  0.092  3.046 3.990   -2.293  39.062 0.391  0.254  3.033 -3.415  
-5.942  39.322 30 ZZ_DT1DT-1:DA-1DA1_YY   Z 1  ? Y 1  ? Z -1 ? Y -1 ? 
1 D DT 14 1_555 C DA 8  1_555 D DT 15 1_555 C DA 7  1_555 -0.406 0.130  3.527 -11.277 0.673   40.393 0.105  -0.725 3.514 0.953   
15.958  41.879 31 ZZ_DT-1DT-2:DA-2DA-1_YY Z -1 ? Y -1 ? Z -2 ? Y -2 ? 
1 D DT 15 1_555 C DA 7  1_555 D DC 16 1_555 C DG 6  1_555 0.991  0.251  3.049 6.773   -0.482  33.226 0.505  -0.652 3.179 -0.832  
-11.692 33.894 32 ZZ_DT-2DC-3:DG-3DA-2_YY Z -2 ? Y -2 ? Z -3 ? Y -3 ? 
1 D DC 16 1_555 C DG 6  1_555 D DG 17 1_555 C DC 5  1_555 0.081  1.742  3.178 -4.313  -2.669  33.613 3.386  -0.794 3.002 -4.583  
7.405   33.983 33 ZZ_DC-3DG-4:DC-4DG-3_YY Z -3 ? Y -3 ? Z -4 ? Y -4 ? 
1 D DG 17 1_555 C DC 5  1_555 D DA 18 1_555 C DT 4  1_555 -0.238 0.339  3.539 3.975   8.308   38.549 -0.561 0.860  3.494 12.370  
-5.919  39.594 34 ZZ_DG-4DA-5:DT-5DC-4_YY Z -4 ? Y -4 ? Z -5 ? Y -5 ? 
1 D DA 18 1_555 C DT 4  1_555 D DA 19 1_555 C DT 3  1_555 0.289  0.052  2.842 -3.809  -1.884  40.253 0.257  -0.786 2.799 -2.729  
5.516   40.467 35 ZZ_DA-5DA-6:DT-6DT-5_YY Z -5 ? Y -5 ? Z -6 ? Y -6 ? 
1 D DA 19 1_555 C DT 3  1_555 D DA 20 1_555 C DT 2  1_555 -0.654 -0.372 3.493 0.969   -1.131  37.061 -0.424 1.166  3.485 -1.778  
-1.524  37.090 36 ZZ_DA-6DA-7:DT-7DT-6_YY Z -6 ? Y -6 ? Z -7 ? Y -7 ? 
1 D DA 20 1_555 C DT 2  1_555 D DT 21 1_555 C DA 1  1_555 0.625  -1.188 3.376 -2.268  0.229   33.729 -2.081 -1.450 3.321 0.395   
3.904   33.804 37 ZZ_DA-7DT-8:DA-8DT-7_YY Z -7 ? Y -7 ? Z -8 ? Y -8 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
5 water                                  HOH 
#