data_1ZRF
# 
_entry.id   1ZRF 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZRF         
NDB   PD0673       
RCSB  RCSB033032   
WWPDB D_1000033032 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1ZRC '4 Crystal structures of CAP-DNA with all base-pair substitutions at position 6, CAP-ICAP38 DNA'         unspecified 
PDB 1ZRD '4 crystal structures of CAP-DNA with all base-pair substitutions at position 6, CAP-[6A;17T]ICAP38 DNA' unspecified 
PDB 1ZRE '4 CRYSTAL STRUCTURES OF CAP-DNA WITH ALL BASE-PAIR SUBSTITUTIONS AT POSITION 6, CAP-[6G;17C]ICAP38 DNA' unspecified 
# 
_pdbx_database_status.entry_id                        1ZRF 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-05-19 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Berman, H.M.' 1 
'Napoli, A.A.' 2 
# 
_citation.id                        primary 
_citation.title                     
;Indirect readout of DNA sequence at the primary-kink site in the CAP-DNA complex: recognition of pyrimidine-purine and purine-purine steps.
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            357 
_citation.page_first                173 
_citation.page_last                 183 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16427082 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.12.051 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Napoli, A.A.'  1 
primary 'Lawson, C.L.'  2 
primary 'Ebright, R.H.' 3 
primary 'Berman, H.M.'  4 
# 
_cell.entry_id           1ZRF 
_cell.length_a           61.778 
_cell.length_b           77.745 
_cell.length_c           154.813 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZRF 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     syn "5'-D(*AP*TP*TP*TP*CP*GP*AP*AP*AP*AP*AP*TP*GP*CP*GP*AP*T)-3'"             5234.435  2   ? ? ? ? 
2 polymer     syn "5'-D(*CP*TP*AP*GP*AP*TP*CP*GP*CP*AP*TP*TP*TP*TP*TP*CP*GP*AP*AP*AP*T)-3'" 6412.170  2   ? ? ? ? 
3 polymer     man 'Catabolite gene activator'                                               23541.242 2   ? ? ? ? 
4 non-polymer syn "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE"                                    329.206   4   ? ? ? ? 
5 non-polymer syn '1,4-DIETHYLENE DIOXIDE'                                                  88.105    5   ? ? ? ? 
6 water       nat water                                                                     18.015    266 ? ? ? ? 
# 
_entity_name_com.entity_id   3 
_entity_name_com.name        'cAMP receptor protein, cAMP-regulatory protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DT)(DC)(DG)(DA)(DA)(DA)(DA)(DA)(DT)(DG)(DC)(DG)(DA)(DT)' ATTTCGAAAAATGCGAT W,Y ? 
2 polydeoxyribonucleotide no no 
;(DC)(DT)(DA)(DG)(DA)(DT)(DC)(DG)(DC)(DA)(DT)(DT)(DT)(DT)(DT)(DC)(DG)(DA)(DA)(DA)
(DT)
;
CTAGATCGCATTTTTCGAAAT X,Z ? 
3 'polypeptide(L)'        no no 
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
;VLGKPQTDPTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKEMILSYLNQGDFIGELGLFEEGQ
ERSAWVRAKTACEVAEISYKKFRQLIQVNPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMTHP
DGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYGTR
;
A,B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   DA  n 
1 2   DT  n 
1 3   DT  n 
1 4   DT  n 
1 5   DC  n 
1 6   DG  n 
1 7   DA  n 
1 8   DA  n 
1 9   DA  n 
1 10  DA  n 
1 11  DA  n 
1 12  DT  n 
1 13  DG  n 
1 14  DC  n 
1 15  DG  n 
1 16  DA  n 
1 17  DT  n 
2 1   DC  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DA  n 
2 6   DT  n 
2 7   DC  n 
2 8   DG  n 
2 9   DC  n 
2 10  DA  n 
2 11  DT  n 
2 12  DT  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DA  n 
2 19  DA  n 
2 20  DA  n 
2 21  DT  n 
3 1   VAL n 
3 2   LEU n 
3 3   GLY n 
3 4   LYS n 
3 5   PRO n 
3 6   GLN n 
3 7   THR n 
3 8   ASP n 
3 9   PRO n 
3 10  THR n 
3 11  LEU n 
3 12  GLU n 
3 13  TRP n 
3 14  PHE n 
3 15  LEU n 
3 16  SER n 
3 17  HIS n 
3 18  CYS n 
3 19  HIS n 
3 20  ILE n 
3 21  HIS n 
3 22  LYS n 
3 23  TYR n 
3 24  PRO n 
3 25  SER n 
3 26  LYS n 
3 27  SER n 
3 28  THR n 
3 29  LEU n 
3 30  ILE n 
3 31  HIS n 
3 32  GLN n 
3 33  GLY n 
3 34  GLU n 
3 35  LYS n 
3 36  ALA n 
3 37  GLU n 
3 38  THR n 
3 39  LEU n 
3 40  TYR n 
3 41  TYR n 
3 42  ILE n 
3 43  VAL n 
3 44  LYS n 
3 45  GLY n 
3 46  SER n 
3 47  VAL n 
3 48  ALA n 
3 49  VAL n 
3 50  LEU n 
3 51  ILE n 
3 52  LYS n 
3 53  ASP n 
3 54  GLU n 
3 55  GLU n 
3 56  GLY n 
3 57  LYS n 
3 58  GLU n 
3 59  MET n 
3 60  ILE n 
3 61  LEU n 
3 62  SER n 
3 63  TYR n 
3 64  LEU n 
3 65  ASN n 
3 66  GLN n 
3 67  GLY n 
3 68  ASP n 
3 69  PHE n 
3 70  ILE n 
3 71  GLY n 
3 72  GLU n 
3 73  LEU n 
3 74  GLY n 
3 75  LEU n 
3 76  PHE n 
3 77  GLU n 
3 78  GLU n 
3 79  GLY n 
3 80  GLN n 
3 81  GLU n 
3 82  ARG n 
3 83  SER n 
3 84  ALA n 
3 85  TRP n 
3 86  VAL n 
3 87  ARG n 
3 88  ALA n 
3 89  LYS n 
3 90  THR n 
3 91  ALA n 
3 92  CYS n 
3 93  GLU n 
3 94  VAL n 
3 95  ALA n 
3 96  GLU n 
3 97  ILE n 
3 98  SER n 
3 99  TYR n 
3 100 LYS n 
3 101 LYS n 
3 102 PHE n 
3 103 ARG n 
3 104 GLN n 
3 105 LEU n 
3 106 ILE n 
3 107 GLN n 
3 108 VAL n 
3 109 ASN n 
3 110 PRO n 
3 111 ASP n 
3 112 ILE n 
3 113 LEU n 
3 114 MET n 
3 115 ARG n 
3 116 LEU n 
3 117 SER n 
3 118 ALA n 
3 119 GLN n 
3 120 MET n 
3 121 ALA n 
3 122 ARG n 
3 123 ARG n 
3 124 LEU n 
3 125 GLN n 
3 126 VAL n 
3 127 THR n 
3 128 SER n 
3 129 GLU n 
3 130 LYS n 
3 131 VAL n 
3 132 GLY n 
3 133 ASN n 
3 134 LEU n 
3 135 ALA n 
3 136 PHE n 
3 137 LEU n 
3 138 ASP n 
3 139 VAL n 
3 140 THR n 
3 141 GLY n 
3 142 ARG n 
3 143 ILE n 
3 144 ALA n 
3 145 GLN n 
3 146 THR n 
3 147 LEU n 
3 148 LEU n 
3 149 ASN n 
3 150 LEU n 
3 151 ALA n 
3 152 LYS n 
3 153 GLN n 
3 154 PRO n 
3 155 ASP n 
3 156 ALA n 
3 157 MET n 
3 158 THR n 
3 159 HIS n 
3 160 PRO n 
3 161 ASP n 
3 162 GLY n 
3 163 MET n 
3 164 GLN n 
3 165 ILE n 
3 166 LYS n 
3 167 ILE n 
3 168 THR n 
3 169 ARG n 
3 170 GLN n 
3 171 GLU n 
3 172 ILE n 
3 173 GLY n 
3 174 GLN n 
3 175 ILE n 
3 176 VAL n 
3 177 GLY n 
3 178 CYS n 
3 179 SER n 
3 180 ARG n 
3 181 GLU n 
3 182 THR n 
3 183 VAL n 
3 184 GLY n 
3 185 ARG n 
3 186 ILE n 
3 187 LEU n 
3 188 LYS n 
3 189 MET n 
3 190 LEU n 
3 191 GLU n 
3 192 ASP n 
3 193 GLN n 
3 194 ASN n 
3 195 LEU n 
3 196 ILE n 
3 197 SER n 
3 198 ALA n 
3 199 HIS n 
3 200 GLY n 
3 201 LYS n 
3 202 THR n 
3 203 ILE n 
3 204 VAL n 
3 205 VAL n 
3 206 TYR n 
3 207 GLY n 
3 208 THR n 
3 209 ARG n 
# 
_entity_src_gen.entity_id                          3 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 'crp, cap, csm' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pAKCRP1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP CRP_ECOLI P0ACJ8 3 2 ? ? 
2 PDB 1ZRF      1ZRF   1 ? ? ? 
3 PDB 1ZRF      1ZRF   2 ? ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZRF A 1 ? 209 ? P0ACJ8 2  ? 210 ? 1  209 
2 1 1ZRF B 1 ? 209 ? P0ACJ8 2  ? 210 ? 1  209 
3 2 1ZRF W 1 ? 17  ? 1ZRF   -8 ? 9   ? -8 9   
4 3 1ZRF X 1 ? 21  ? 1ZRF   13 ? -8  ? 13 -8  
5 2 1ZRF Y 1 ? 17  ? 1ZRF   -8 ? 9   ? -8 9   
6 3 1ZRF Z 1 ? 21  ? 1ZRF   13 ? -8  ? 13 -8  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'      133.103 
CMP non-polymer         . "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" 'CYCLIC AMP; CAMP' 'C10 H12 N5 O6 P' 329.206 
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"    ?                  'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"   ?                  'C10 H14 N5 O7 P' 347.221 
DIO non-polymer         . '1,4-DIETHYLENE DIOXIDE'               ?                  'C4 H8 O2'        88.105  
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"           ?                  'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1ZRF 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.77 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   55.29 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'2mM cAMP, 0.1M MES, 0.2M NaCl, 0.05M MgCl2, 5% PEG 8000, 15% Dioxane, pH 6.2, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_exptl_crystal_grow_comp.crystal_id 
_exptl_crystal_grow_comp.id 
_exptl_crystal_grow_comp.sol_id 
_exptl_crystal_grow_comp.name 
_exptl_crystal_grow_comp.conc 
_exptl_crystal_grow_comp.volume 
_exptl_crystal_grow_comp.details 
1 1  1 cAMP       ? ? ? 
1 2  1 MES        ? ? ? 
1 3  1 NaCl       ? ? ? 
1 4  1 MgCl2      ? ? ? 
1 5  1 'PEG 8000' ? ? ? 
1 6  1 Dioxane    ? ? ? 
1 7  1 H2O        ? ? ? 
1 8  2 cAMP       ? ? ? 
1 9  2 MES        ? ? ? 
1 10 2 NaCl       ? ? ? 
1 11 2 MgCl2      ? ? ? 
1 12 2 'PEG 8000' ? ? ? 
1 13 2 H2O        ? ? ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           108 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2005-02-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.100 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'NSLS BEAMLINE X25' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.100 
_diffrn_source.pdbx_synchrotron_site       NSLS 
_diffrn_source.pdbx_synchrotron_beamline   X25 
# 
_reflns.entry_id                     1ZRF 
_reflns.d_resolution_low             32.90 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   42032 
_reflns.percent_possible_obs         97.300 
_reflns.pdbx_Rmerge_I_obs            0.109 
_reflns.pdbx_chi_squared             2.407 
_reflns.pdbx_redundancy              6.300 
_reflns.number_all                   44370 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.B_iso_Wilson_estimate        22.3 
_reflns.observed_criterion_sigma_I   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.R_free_details               ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
loop_
_reflns_shell.d_res_low 
_reflns_shell.d_res_high 
_reflns_shell.number_measured_obs 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_redundancy 
_reflns_shell.number_unique_obs 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.percent_possible_all 
_reflns_shell.number_unique_all 
_reflns_shell.number_measured_all 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_ordinal 
2.18  2.10 4203 99.100 0.886 1.914 5.500 ? ? ? ? ? ? ? 1  
2.26  2.18 4201 99.000 0.706 1.935 5.900 ? ? ? ? ? ? ? 2  
2.37  2.26 4207 98.500 0.595 1.967 6.300 ? ? ? ? ? ? ? 3  
2.49  2.37 4189 98.100 0.501 1.991 6.500 ? ? ? ? ? ? ? 4  
2.65  2.49 4171 97.300 0.345 2.059 6.600 ? ? ? ? ? ? ? 5  
2.85  2.65 4151 96.700 0.237 2.115 6.700 ? ? ? ? ? ? ? 6  
3.14  2.85 4135 96.000 0.15  2.290 6.700 ? ? ? ? ? ? ? 7  
3.59  3.14 4178 96.100 0.08  2.707 6.500 ? ? ? ? ? ? ? 8  
4.52  3.59 4209 96.200 0.057 3.415 6.300 ? ? ? ? ? ? ? 9  
50.00 4.52 4450 96.500 0.05  3.529 6.300 ? ? ? ? ? ? ? 10 
# 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             32.90 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    95.1 
_refine.ls_number_reflns_all                     44200 
_refine.ls_number_reflns_obs                     42032 
_refine.entry_id                                 1ZRF 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_R_factor_all                          0.242 
_refine.ls_R_factor_obs                          0.242 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 1ZRC, with only central 20 bps' 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.B_iso_mean                               45.93 
_refine.occupancy_min                            0.50 
_refine.occupancy_max                            1.00 
_refine.aniso_B[1][1]                            -4.14 
_refine.aniso_B[2][2]                            -3.30 
_refine.aniso_B[3][3]                            7.45 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_param_bsol                 66.9361 
_refine.solvent_model_param_ksol                 0.384069 
_refine.solvent_model_details                    'CNS bulk solvent model used' 
_refine.ls_R_factor_R_work                       0.225 
_refine.ls_R_factor_R_free                       0.266 
_refine.ls_R_factor_R_free_error                 0.004 
_refine.ls_number_reflns_R_free                  4239 
_refine.ls_percent_reflns_R_free                 10.1 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.details                                  ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZRF 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_obs    0.26 
_refine_analyze.Luzzati_sigma_a_obs             0.25 
_refine_analyze.Luzzati_coordinate_error_free   0.31 
_refine_analyze.Luzzati_sigma_a_free            0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3186 
_refine_hist.pdbx_number_atoms_nucleic_acid   1484 
_refine_hist.pdbx_number_atoms_ligand         118 
_refine_hist.number_atoms_solvent             266 
_refine_hist.number_atoms_total               5054 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        32.90 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.006 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.5  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.89  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.pdbx_refine_id 
2.10 2.20  3964 80.6 0.293 0.346 0.017 434 9.9  8 . . . . 'X-RAY DIFFRACTION' 
2.20 2.31  4806 98.6 0.259 0.283 0.012 580 10.8 8 . . . . 'X-RAY DIFFRACTION' 
2.31 2.46  4817 98.2 0.246 0.305 0.013 533 10.0 8 . . . . 'X-RAY DIFFRACTION' 
2.46 2.65  4787 97.7 0.237 0.283 0.012 562 10.5 8 . . . . 'X-RAY DIFFRACTION' 
2.65 2.92  4802 96.5 0.237 0.309 0.013 526 9.9  8 . . . . 'X-RAY DIFFRACTION' 
2.92 3.34  4763 95.9 0.221 0.242 0.011 515 9.8  8 . . . . 'X-RAY DIFFRACTION' 
3.34 4.20  4790 95.8 0.193 0.24  0.010 543 10.2 8 . . . . 'X-RAY DIFFRACTION' 
4.20 32.90 5064 96.5 0.226 0.257 0.011 546 9.7  8 . . . . 'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param protein.top       'X-RAY DIFFRACTION' 
2 dox_xplor_par.txt            dox_xplor_top.txt 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:dna-rna_rep.param dna-rna.top       'X-RAY DIFFRACTION' 
4 cmp.par                      cmp_top.top       'X-RAY DIFFRACTION' 
5 CNS_TOPPAR:water_rep.param   water.top         'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZRF 
_struct.title                     
'4 crystal structures of CAP-DNA with all base-pair substitutions at position 6, CAP-[6C;17G]ICAP38 DNA' 
_struct.pdbx_descriptor           'Catabolite gene activator/DNA Complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZRF 
_struct_keywords.pdbx_keywords   'GENE REGULATION/DNA' 
_struct_keywords.text            
'PROTEIN-DNA COMPLEX, CAP, CAP-DNA, CATABOLITE GENE ACTIVATOR PROTEIN, CAMP RECEPTOR PROTEIN, CRP, GENE REGULATION-DNA COMPLEX' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 4 ? 
M N N 4 ? 
N N N 5 ? 
O N N 5 ? 
P N N 6 ? 
Q N N 6 ? 
R N N 6 ? 
S N N 6 ? 
T N N 6 ? 
U N N 6 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP E 8   ? SER E 16  ? ASP A 8   SER A 16  1 ? 9  
HELX_P HELX_P2  2  TYR E 99  ? ASN E 109 ? TYR A 99  ASN A 109 1 ? 11 
HELX_P HELX_P3  3  PRO E 110 ? LEU E 137 ? PRO A 110 LEU A 137 1 ? 28 
HELX_P HELX_P4  4  ASP E 138 ? LYS E 152 ? ASP A 138 LYS A 152 1 ? 15 
HELX_P HELX_P5  5  THR E 168 ? GLY E 177 ? THR A 168 GLY A 177 1 ? 10 
HELX_P HELX_P6  6  SER E 179 ? GLN E 193 ? SER A 179 GLN A 193 1 ? 15 
HELX_P HELX_P7  7  ASP F 8   ? SER F 16  ? ASP B 8   SER B 16  1 ? 9  
HELX_P HELX_P8  8  TYR F 99  ? ASN F 109 ? TYR B 99  ASN B 109 1 ? 11 
HELX_P HELX_P9  9  PRO F 110 ? LEU F 137 ? PRO B 110 LEU B 137 1 ? 28 
HELX_P HELX_P10 10 ASP F 138 ? LYS F 152 ? ASP B 138 LYS B 152 1 ? 15 
HELX_P HELX_P11 11 THR F 168 ? GLY F 177 ? THR B 168 GLY B 177 1 ? 10 
HELX_P HELX_P12 12 SER F 179 ? GLN F 193 ? SER B 179 GLN B 193 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1  hydrog ? ? A DT 4  N3 ? ? ? 1_555 B DA 18 N1 ? ? W DT -5 X DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2  hydrog ? ? A DT 4  O4 ? ? ? 1_555 B DA 18 N6 ? ? W DT -5 X DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3  hydrog ? ? A DC 5  O2 ? ? ? 1_555 B DG 17 N2 ? ? W DC -4 X DG -4 1_555 ? ? ? ? ? ? 'DC-DG PAIR' ? ? 
hydrog4  hydrog ? ? A DG 6  N1 ? ? ? 1_555 B DC 16 N3 ? ? W DG -3 X DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5  hydrog ? ? A DG 6  N2 ? ? ? 1_555 B DC 16 O2 ? ? W DG -3 X DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6  hydrog ? ? A DG 6  O6 ? ? ? 1_555 B DC 16 N4 ? ? W DG -3 X DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7  hydrog ? ? A DA 7  N1 ? ? ? 1_555 B DT 15 N3 ? ? W DA -2 X DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8  hydrog ? ? A DA 7  N6 ? ? ? 1_555 B DT 15 O4 ? ? W DA -2 X DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9  hydrog ? ? A DA 8  N1 ? ? ? 1_555 B DT 14 N3 ? ? W DA -1 X DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10 hydrog ? ? A DA 8  N6 ? ? ? 1_555 B DT 14 O4 ? ? W DA -1 X DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11 hydrog ? ? A DA 9  N1 ? ? ? 1_555 B DT 13 N3 ? ? W DA 1  X DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12 hydrog ? ? A DA 9  N6 ? ? ? 1_555 B DT 13 O4 ? ? W DA 1  X DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13 hydrog ? ? A DA 10 N1 ? ? ? 1_555 B DT 12 N3 ? ? W DA 2  X DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14 hydrog ? ? A DA 10 N6 ? ? ? 1_555 B DT 12 O4 ? ? W DA 2  X DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15 hydrog ? ? A DA 11 N1 ? ? ? 1_555 B DT 11 N3 ? ? W DA 3  X DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16 hydrog ? ? A DA 11 N6 ? ? ? 1_555 B DT 11 O4 ? ? W DA 3  X DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17 hydrog ? ? A DT 12 N3 ? ? ? 1_555 B DA 10 N1 ? ? W DT 4  X DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18 hydrog ? ? A DT 12 O4 ? ? ? 1_555 B DA 10 N6 ? ? W DT 4  X DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19 hydrog ? ? A DG 13 N1 ? ? ? 1_555 B DC 9  N3 ? ? W DG 5  X DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20 hydrog ? ? A DG 13 N2 ? ? ? 1_555 B DC 9  O2 ? ? W DG 5  X DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21 hydrog ? ? A DG 13 O6 ? ? ? 1_555 B DC 9  N4 ? ? W DG 5  X DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22 hydrog ? ? A DC 14 N3 ? ? ? 1_555 B DG 8  N1 ? ? W DC 6  X DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23 hydrog ? ? A DC 14 N4 ? ? ? 1_555 B DG 8  O6 ? ? W DC 6  X DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24 hydrog ? ? A DC 14 O2 ? ? ? 1_555 B DG 8  N2 ? ? W DC 6  X DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25 hydrog ? ? A DG 15 N1 ? ? ? 1_555 B DC 7  N3 ? ? W DG 7  X DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26 hydrog ? ? A DG 15 N2 ? ? ? 1_555 B DC 7  O2 ? ? W DG 7  X DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27 hydrog ? ? A DG 15 O6 ? ? ? 1_555 B DC 7  N4 ? ? W DG 7  X DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28 hydrog ? ? A DA 16 N1 ? ? ? 1_555 B DT 6  N3 ? ? W DA 8  X DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29 hydrog ? ? A DA 16 N6 ? ? ? 1_555 B DT 6  O4 ? ? W DA 8  X DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30 hydrog ? ? A DT 17 N3 ? ? ? 1_555 B DA 5  N1 ? ? W DT 9  X DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31 hydrog ? ? A DT 17 O4 ? ? ? 1_555 B DA 5  N6 ? ? W DT 9  X DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32 hydrog ? ? B DC 1  N3 ? ? ? 1_555 D DG 4  N1 ? ? X DC 13 Z DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33 hydrog ? ? B DC 1  N4 ? ? ? 1_555 D DG 4  O6 ? ? X DC 13 Z DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34 hydrog ? ? B DC 1  O2 ? ? ? 1_555 D DG 4  N2 ? ? X DC 13 Z DG 10 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35 hydrog ? ? B DT 2  N3 ? ? ? 1_555 D DA 3  N1 ? ? X DT 12 Z DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36 hydrog ? ? B DT 2  O4 ? ? ? 1_555 D DA 3  N6 ? ? X DT 12 Z DA 11 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37 hydrog ? ? B DA 3  N1 ? ? ? 1_555 D DT 2  N3 ? ? X DA 11 Z DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38 hydrog ? ? B DA 3  N6 ? ? ? 1_555 D DT 2  O4 ? ? X DA 11 Z DT 12 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39 hydrog ? ? B DG 4  N1 ? ? ? 1_555 D DC 1  N3 ? ? X DG 10 Z DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40 hydrog ? ? B DG 4  N2 ? ? ? 1_555 D DC 1  O2 ? ? X DG 10 Z DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41 hydrog ? ? B DG 4  O6 ? ? ? 1_555 D DC 1  N4 ? ? X DG 10 Z DC 13 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42 hydrog ? ? C DT 2  N3 ? ? ? 1_555 D DA 20 N1 ? ? Y DT -7 Z DA -7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43 hydrog ? ? C DT 2  O4 ? ? ? 1_555 D DA 20 N6 ? ? Y DT -7 Z DA -7 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44 hydrog ? ? C DT 3  N3 ? ? ? 1_555 D DA 19 N1 ? ? Y DT -6 Z DA -6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45 hydrog ? ? C DT 3  O4 ? ? ? 1_555 D DA 19 N6 ? ? Y DT -6 Z DA -6 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46 hydrog ? ? C DT 4  N3 ? ? ? 1_555 D DA 18 N1 ? ? Y DT -5 Z DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47 hydrog ? ? C DT 4  O4 ? ? ? 1_555 D DA 18 N6 ? ? Y DT -5 Z DA -5 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48 hydrog ? ? C DC 5  N3 ? ? ? 1_555 D DG 17 N1 ? ? Y DC -4 Z DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49 hydrog ? ? C DC 5  N4 ? ? ? 1_555 D DG 17 O6 ? ? Y DC -4 Z DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50 hydrog ? ? C DC 5  O2 ? ? ? 1_555 D DG 17 N2 ? ? Y DC -4 Z DG -4 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51 hydrog ? ? C DG 6  N1 ? ? ? 1_555 D DC 16 N3 ? ? Y DG -3 Z DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52 hydrog ? ? C DG 6  N2 ? ? ? 1_555 D DC 16 O2 ? ? Y DG -3 Z DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53 hydrog ? ? C DG 6  O6 ? ? ? 1_555 D DC 16 N4 ? ? Y DG -3 Z DC -3 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54 hydrog ? ? C DA 7  N1 ? ? ? 1_555 D DT 15 N3 ? ? Y DA -2 Z DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55 hydrog ? ? C DA 7  N6 ? ? ? 1_555 D DT 15 O4 ? ? Y DA -2 Z DT -2 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56 hydrog ? ? C DA 8  N1 ? ? ? 1_555 D DT 14 N3 ? ? Y DA -1 Z DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57 hydrog ? ? C DA 8  N6 ? ? ? 1_555 D DT 14 O4 ? ? Y DA -1 Z DT -1 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58 hydrog ? ? C DA 9  N1 ? ? ? 1_555 D DT 13 N3 ? ? Y DA 1  Z DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59 hydrog ? ? C DA 9  N6 ? ? ? 1_555 D DT 13 O4 ? ? Y DA 1  Z DT 1  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60 hydrog ? ? C DA 10 N1 ? ? ? 1_555 D DT 12 N3 ? ? Y DA 2  Z DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61 hydrog ? ? C DA 10 N6 ? ? ? 1_555 D DT 12 O4 ? ? Y DA 2  Z DT 2  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62 hydrog ? ? C DA 11 N1 ? ? ? 1_555 D DT 11 N3 ? ? Y DA 3  Z DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63 hydrog ? ? C DA 11 N6 ? ? ? 1_555 D DT 11 O4 ? ? Y DA 3  Z DT 3  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64 hydrog ? ? C DT 12 N3 ? ? ? 1_555 D DA 10 N1 ? ? Y DT 4  Z DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65 hydrog ? ? C DT 12 O4 ? ? ? 1_555 D DA 10 N6 ? ? Y DT 4  Z DA 4  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66 hydrog ? ? C DG 13 N1 ? ? ? 1_555 D DC 9  N3 ? ? Y DG 5  Z DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67 hydrog ? ? C DG 13 N2 ? ? ? 1_555 D DC 9  O2 ? ? Y DG 5  Z DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68 hydrog ? ? C DG 13 O6 ? ? ? 1_555 D DC 9  N4 ? ? Y DG 5  Z DC 5  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69 hydrog ? ? C DC 14 N3 ? ? ? 1_555 D DG 8  N1 ? ? Y DC 6  Z DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70 hydrog ? ? C DC 14 N4 ? ? ? 1_555 D DG 8  O6 ? ? Y DC 6  Z DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71 hydrog ? ? C DC 14 O2 ? ? ? 1_555 D DG 8  N2 ? ? Y DC 6  Z DG 6  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72 hydrog ? ? C DG 15 N1 ? ? ? 1_555 D DC 7  N3 ? ? Y DG 7  Z DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73 hydrog ? ? C DG 15 N2 ? ? ? 1_555 D DC 7  O2 ? ? Y DG 7  Z DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74 hydrog ? ? C DG 15 O6 ? ? ? 1_555 D DC 7  N4 ? ? Y DG 7  Z DC 7  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75 hydrog ? ? C DA 16 N1 ? ? ? 1_555 D DT 6  N3 ? ? Y DA 8  Z DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76 hydrog ? ? C DA 16 N6 ? ? ? 1_555 D DT 6  O4 ? ? Y DA 8  Z DT 8  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77 hydrog ? ? C DT 17 N3 ? ? ? 1_555 D DA 5  N1 ? ? Y DT 9  Z DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78 hydrog ? ? C DT 17 O4 ? ? ? 1_555 D DA 5  N6 ? ? Y DT 9  Z DA 9  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 4 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS E 19  ? TYR E 23  ? HIS A 19  TYR A 23  
A 2 CYS E 92  ? SER E 98  ? CYS A 92  SER A 98  
A 3 THR E 38  ? LYS E 44  ? THR A 38  LYS A 44  
A 4 PHE E 69  ? ILE E 70  ? PHE A 69  ILE A 70  
B 1 THR E 28  ? ILE E 30  ? THR A 28  ILE A 30  
B 2 TRP E 85  ? ALA E 88  ? TRP A 85  ALA A 88  
B 3 SER E 46  ? LYS E 52  ? SER A 46  LYS A 52  
B 4 GLU E 58  ? ASN E 65  ? GLU A 58  ASN A 65  
C 1 MET E 157 ? HIS E 159 ? MET A 157 HIS A 159 
C 2 GLY E 162 ? LYS E 166 ? GLY A 162 LYS A 166 
C 3 THR E 202 ? TYR E 206 ? THR A 202 TYR A 206 
C 4 ILE E 196 ? HIS E 199 ? ILE A 196 HIS A 199 
D 1 HIS F 19  ? TYR F 23  ? HIS B 19  TYR B 23  
D 2 CYS F 92  ? SER F 98  ? CYS B 92  SER B 98  
D 3 THR F 38  ? LYS F 44  ? THR B 38  LYS B 44  
D 4 PHE F 69  ? ILE F 70  ? PHE B 69  ILE B 70  
E 1 THR F 28  ? ILE F 30  ? THR B 28  ILE B 30  
E 2 TRP F 85  ? ALA F 88  ? TRP B 85  ALA B 88  
E 3 SER F 46  ? LYS F 52  ? SER B 46  LYS B 52  
E 4 GLU F 58  ? ASN F 65  ? GLU B 58  ASN B 65  
F 1 MET F 157 ? HIS F 159 ? MET B 157 HIS B 159 
F 2 GLY F 162 ? LYS F 166 ? GLY B 162 LYS B 166 
F 3 THR F 202 ? TYR F 206 ? THR B 202 TYR B 206 
F 4 ILE F 196 ? HIS F 199 ? ILE B 196 HIS B 199 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N TYR E 23  ? N TYR A 23  O CYS E 92  ? O CYS A 92  
A 2 3 O ILE E 97  ? O ILE A 97  N LEU E 39  ? N LEU A 39  
A 3 4 N TYR E 40  ? N TYR A 40  O ILE E 70  ? O ILE A 70  
B 1 2 N LEU E 29  ? N LEU A 29  O VAL E 86  ? O VAL A 86  
B 2 3 O TRP E 85  ? O TRP A 85  N LEU E 50  ? N LEU A 50  
B 3 4 N VAL E 49  ? N VAL A 49  O SER E 62  ? O SER A 62  
C 1 2 N MET E 157 ? N MET A 157 O GLN E 164 ? O GLN A 164 
C 2 3 N ILE E 165 ? N ILE A 165 O ILE E 203 ? O ILE A 203 
C 3 4 O VAL E 204 ? O VAL A 204 N SER E 197 ? N SER A 197 
D 1 2 N TYR F 23  ? N TYR B 23  O CYS F 92  ? O CYS B 92  
D 2 3 O ILE F 97  ? O ILE B 97  N LEU F 39  ? N LEU B 39  
D 3 4 N TYR F 40  ? N TYR B 40  O ILE F 70  ? O ILE B 70  
E 1 2 N LEU F 29  ? N LEU B 29  O VAL F 86  ? O VAL B 86  
E 2 3 O TRP F 85  ? O TRP B 85  N LEU F 50  ? N LEU B 50  
E 3 4 N VAL F 49  ? N VAL B 49  O SER F 62  ? O SER B 62  
F 1 2 N MET F 157 ? N MET B 157 O GLN F 164 ? O GLN B 164 
F 2 3 N ILE F 165 ? N ILE B 165 O ILE F 203 ? O ILE B 203 
F 3 4 O VAL F 204 ? O VAL B 204 N SER F 197 ? N SER B 197 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CMP A 622'  
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CMP B 1622' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE CMP A 2622' 
AC4 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE CMP B 3622' 
AC5 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE DIO B 301'  
AC6 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE DIO B 302'  
AC7 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE DIO A 303'  
AC8 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE DIO A 304'  
AC9 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE DIO A 305'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 13 VAL E 49  ? VAL A 49   . ? 1_555 ? 
2  AC1 13 GLY E 71  ? GLY A 71   . ? 1_555 ? 
3  AC1 13 GLU E 72  ? GLU A 72   . ? 1_555 ? 
4  AC1 13 LEU E 73  ? LEU A 73   . ? 1_555 ? 
5  AC1 13 ARG E 82  ? ARG A 82   . ? 1_555 ? 
6  AC1 13 SER E 83  ? SER A 83   . ? 1_555 ? 
7  AC1 13 ALA E 84  ? ALA A 84   . ? 1_555 ? 
8  AC1 13 THR E 127 ? THR A 127  . ? 1_555 ? 
9  AC1 13 HOH T .   ? HOH A 2625 . ? 1_555 ? 
10 AC1 13 HOH T .   ? HOH A 2626 . ? 1_555 ? 
11 AC1 13 HOH T .   ? HOH A 2656 . ? 1_555 ? 
12 AC1 13 LEU F 124 ? LEU B 124  . ? 1_555 ? 
13 AC1 13 SER F 128 ? SER B 128  . ? 1_555 ? 
14 AC2 12 SER E 128 ? SER A 128  . ? 1_555 ? 
15 AC2 12 VAL F 49  ? VAL B 49   . ? 1_555 ? 
16 AC2 12 ILE F 70  ? ILE B 70   . ? 1_555 ? 
17 AC2 12 GLY F 71  ? GLY B 71   . ? 1_555 ? 
18 AC2 12 GLU F 72  ? GLU B 72   . ? 1_555 ? 
19 AC2 12 LEU F 73  ? LEU B 73   . ? 1_555 ? 
20 AC2 12 ARG F 82  ? ARG B 82   . ? 1_555 ? 
21 AC2 12 SER F 83  ? SER B 83   . ? 1_555 ? 
22 AC2 12 ALA F 84  ? ALA B 84   . ? 1_555 ? 
23 AC2 12 THR F 127 ? THR B 127  . ? 1_555 ? 
24 AC2 12 HOH U .   ? HOH B 3628 . ? 1_555 ? 
25 AC2 12 HOH U .   ? HOH B 3639 . ? 1_555 ? 
26 AC3 10 LYS E 57  ? LYS A 57   . ? 1_555 ? 
27 AC3 10 GLU E 58  ? GLU A 58   . ? 1_555 ? 
28 AC3 10 GLN E 170 ? GLN A 170  . ? 1_555 ? 
29 AC3 10 GLY E 173 ? GLY A 173  . ? 1_555 ? 
30 AC3 10 GLN E 174 ? GLN A 174  . ? 1_555 ? 
31 AC3 10 GLY E 177 ? GLY A 177  . ? 1_555 ? 
32 AC3 10 CYS E 178 ? CYS A 178  . ? 1_555 ? 
33 AC3 10 ARG E 180 ? ARG A 180  . ? 1_555 ? 
34 AC3 10 HOH T .   ? HOH A 2639 . ? 1_555 ? 
35 AC3 10 ALA F 135 ? ALA B 135  . ? 1_555 ? 
36 AC4 12 ALA E 135 ? ALA A 135  . ? 1_555 ? 
37 AC4 12 LYS F 57  ? LYS B 57   . ? 1_555 ? 
38 AC4 12 GLU F 58  ? GLU B 58   . ? 1_555 ? 
39 AC4 12 GLN F 170 ? GLN B 170  . ? 1_555 ? 
40 AC4 12 GLY F 173 ? GLY B 173  . ? 1_555 ? 
41 AC4 12 GLN F 174 ? GLN B 174  . ? 1_555 ? 
42 AC4 12 GLY F 177 ? GLY B 177  . ? 1_555 ? 
43 AC4 12 CYS F 178 ? CYS B 178  . ? 1_555 ? 
44 AC4 12 SER F 179 ? SER B 179  . ? 1_555 ? 
45 AC4 12 ARG F 180 ? ARG B 180  . ? 1_555 ? 
46 AC4 12 HOH U .   ? HOH B 3690 . ? 1_555 ? 
47 AC4 12 DA  D 5   ? DA  Z 9    . ? 1_555 ? 
48 AC5 1  ALA F 144 ? ALA B 144  . ? 1_555 ? 
49 AC6 5  LYS F 130 ? LYS B 130  . ? 1_555 ? 
50 AC6 5  ARG F 142 ? ARG B 142  . ? 1_555 ? 
51 AC6 5  THR F 146 ? THR B 146  . ? 1_555 ? 
52 AC6 5  ILE F 175 ? ILE B 175  . ? 1_555 ? 
53 AC6 5  VAL F 176 ? VAL B 176  . ? 1_555 ? 
54 AC7 3  LEU E 148 ? LEU A 148  . ? 1_555 ? 
55 AC7 3  LEU E 195 ? LEU A 195  . ? 1_555 ? 
56 AC7 3  VAL E 205 ? VAL A 205  . ? 1_555 ? 
57 AC8 7  LEU E 11  ? LEU A 11   . ? 1_555 ? 
58 AC8 7  PHE E 14  ? PHE A 14   . ? 1_555 ? 
59 AC8 7  TYR E 41  ? TYR A 41   . ? 1_555 ? 
60 AC8 7  PHE E 69  ? PHE A 69   . ? 1_555 ? 
61 AC8 7  ILE E 112 ? ILE A 112  . ? 1_555 ? 
62 AC8 7  ARG E 115 ? ARG A 115  . ? 1_555 ? 
63 AC8 7  ARG E 209 ? ARG A 209  . ? 4_545 ? 
64 AC9 6  LYS E 130 ? LYS A 130  . ? 1_555 ? 
65 AC9 6  ARG E 142 ? ARG A 142  . ? 1_555 ? 
66 AC9 6  THR E 146 ? THR A 146  . ? 1_555 ? 
67 AC9 6  ILE E 175 ? ILE A 175  . ? 1_555 ? 
68 AC9 6  VAL E 176 ? VAL A 176  . ? 1_555 ? 
69 AC9 6  HOH T .   ? HOH A 2661 . ? 1_555 ? 
# 
_atom_sites.entry_id                    1ZRF 
_atom_sites.fract_transf_matrix[1][1]   0.016187 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012863 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006459 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    O "O5'" . DT  A 1 3   ? 11.310  -9.662  25.005  1.00 120.86 ? -6   DT  W "O5'" 1 
ATOM   2    C "C5'" . DT  A 1 3   ? 11.001  -10.511 26.112  1.00 120.93 ? -6   DT  W "C5'" 1 
ATOM   3    C "C4'" . DT  A 1 3   ? 11.037  -9.764  27.425  1.00 121.43 ? -6   DT  W "C4'" 1 
ATOM   4    O "O4'" . DT  A 1 3   ? 12.360  -9.209  27.629  1.00 121.63 ? -6   DT  W "O4'" 1 
ATOM   5    C "C3'" . DT  A 1 3   ? 10.069  -8.582  27.511  1.00 121.26 ? -6   DT  W "C3'" 1 
ATOM   6    O "O3'" . DT  A 1 3   ? 9.556   -8.465  28.843  1.00 120.78 ? -6   DT  W "O3'" 1 
ATOM   7    C "C2'" . DT  A 1 3   ? 10.952  -7.392  27.187  1.00 121.50 ? -6   DT  W "C2'" 1 
ATOM   8    C "C1'" . DT  A 1 3   ? 12.267  -7.805  27.819  1.00 121.65 ? -6   DT  W "C1'" 1 
ATOM   9    N N1    . DT  A 1 3   ? 13.458  -7.180  27.215  1.00 121.79 ? -6   DT  W N1    1 
ATOM   10   C C2    . DT  A 1 3   ? 13.913  -5.999  27.757  1.00 121.65 ? -6   DT  W C2    1 
ATOM   11   O O2    . DT  A 1 3   ? 13.379  -5.453  28.710  1.00 121.20 ? -6   DT  W O2    1 
ATOM   12   N N3    . DT  A 1 3   ? 15.022  -5.477  27.140  1.00 121.62 ? -6   DT  W N3    1 
ATOM   13   C C4    . DT  A 1 3   ? 15.705  -6.006  26.061  1.00 121.74 ? -6   DT  W C4    1 
ATOM   14   O O4    . DT  A 1 3   ? 16.687  -5.421  25.611  1.00 121.56 ? -6   DT  W O4    1 
ATOM   15   C C5    . DT  A 1 3   ? 15.175  -7.247  25.545  1.00 121.84 ? -6   DT  W C5    1 
ATOM   16   C C7    . DT  A 1 3   ? 15.852  -7.898  24.381  1.00 121.85 ? -6   DT  W C7    1 
ATOM   17   C C6    . DT  A 1 3   ? 14.091  -7.765  26.140  1.00 121.84 ? -6   DT  W C6    1 
ATOM   18   P P     . DT  A 1 4   ? 8.229   -7.598  29.114  1.00 120.41 ? -5   DT  W P     1 
ATOM   19   O OP1   . DT  A 1 4   ? 7.308   -8.438  29.921  1.00 120.91 ? -5   DT  W OP1   1 
ATOM   20   O OP2   . DT  A 1 4   ? 7.765   -7.035  27.821  1.00 120.50 ? -5   DT  W OP2   1 
ATOM   21   O "O5'" . DT  A 1 4   ? 8.733   -6.398  30.033  1.00 119.34 ? -5   DT  W "O5'" 1 
ATOM   22   C "C5'" . DT  A 1 4   ? 9.921   -5.682  29.706  1.00 117.19 ? -5   DT  W "C5'" 1 
ATOM   23   C "C4'" . DT  A 1 4   ? 10.016  -4.413  30.521  1.00 115.43 ? -5   DT  W "C4'" 1 
ATOM   24   O "O4'" . DT  A 1 4   ? 11.256  -3.753  30.178  1.00 114.95 ? -5   DT  W "O4'" 1 
ATOM   25   C "C3'" . DT  A 1 4   ? 8.913   -3.396  30.239  1.00 114.49 ? -5   DT  W "C3'" 1 
ATOM   26   O "O3'" . DT  A 1 4   ? 8.610   -2.647  31.421  1.00 113.01 ? -5   DT  W "O3'" 1 
ATOM   27   C "C2'" . DT  A 1 4   ? 9.522   -2.506  29.174  1.00 114.46 ? -5   DT  W "C2'" 1 
ATOM   28   C "C1'" . DT  A 1 4   ? 11.002  -2.517  29.523  1.00 114.75 ? -5   DT  W "C1'" 1 
ATOM   29   N N1    . DT  A 1 4   ? 11.886  -2.452  28.346  1.00 114.62 ? -5   DT  W N1    1 
ATOM   30   C C2    . DT  A 1 4   ? 12.884  -1.506  28.331  1.00 114.41 ? -5   DT  W C2    1 
ATOM   31   O O2    . DT  A 1 4   ? 13.062  -0.709  29.238  1.00 114.53 ? -5   DT  W O2    1 
ATOM   32   N N3    . DT  A 1 4   ? 13.671  -1.527  27.206  1.00 114.17 ? -5   DT  W N3    1 
ATOM   33   C C4    . DT  A 1 4   ? 13.558  -2.375  26.121  1.00 113.74 ? -5   DT  W C4    1 
ATOM   34   O O4    . DT  A 1 4   ? 14.345  -2.279  25.183  1.00 113.19 ? -5   DT  W O4    1 
ATOM   35   C C5    . DT  A 1 4   ? 12.482  -3.334  26.199  1.00 113.78 ? -5   DT  W C5    1 
ATOM   36   C C7    . DT  A 1 4   ? 12.276  -4.288  25.066  1.00 113.87 ? -5   DT  W C7    1 
ATOM   37   C C6    . DT  A 1 4   ? 11.711  -3.325  27.293  1.00 114.12 ? -5   DT  W C6    1 
ATOM   38   P P     . DC  A 1 5   ? 7.324   -1.683  31.445  1.00 111.60 ? -4   DC  W P     1 
ATOM   39   O OP1   . DC  A 1 5   ? 6.774   -1.690  32.824  1.00 111.56 ? -4   DC  W OP1   1 
ATOM   40   O OP2   . DC  A 1 5   ? 6.447   -2.052  30.304  1.00 111.81 ? -4   DC  W OP2   1 
ATOM   41   O "O5'" . DC  A 1 5   ? 7.924   -0.234  31.164  1.00 110.47 ? -4   DC  W "O5'" 1 
ATOM   42   C "C5'" . DC  A 1 5   ? 8.670   0.456   32.168  1.00 107.48 ? -4   DC  W "C5'" 1 
ATOM   43   C "C4'" . DC  A 1 5   ? 9.014   1.851   31.697  1.00 104.97 ? -4   DC  W "C4'" 1 
ATOM   44   O "O4'" . DC  A 1 5   ? 9.900   1.760   30.556  1.00 104.23 ? -4   DC  W "O4'" 1 
ATOM   45   C "C3'" . DC  A 1 5   ? 7.814   2.678   31.233  1.00 103.66 ? -4   DC  W "C3'" 1 
ATOM   46   O "O3'" . DC  A 1 5   ? 8.002   4.054   31.574  1.00 102.10 ? -4   DC  W "O3'" 1 
ATOM   47   C "C2'" . DC  A 1 5   ? 7.831   2.504   29.726  1.00 103.13 ? -4   DC  W "C2'" 1 
ATOM   48   C "C1'" . DC  A 1 5   ? 9.318   2.399   29.428  1.00 102.65 ? -4   DC  W "C1'" 1 
ATOM   49   N N1    . DC  A 1 5   ? 9.651   1.599   28.238  1.00 101.42 ? -4   DC  W N1    1 
ATOM   50   C C2    . DC  A 1 5   ? 10.846  1.865   27.563  1.00 100.62 ? -4   DC  W C2    1 
ATOM   51   O O2    . DC  A 1 5   ? 11.583  2.769   27.985  1.00 100.42 ? -4   DC  W O2    1 
ATOM   52   N N3    . DC  A 1 5   ? 11.167  1.134   26.473  1.00 99.84  ? -4   DC  W N3    1 
ATOM   53   C C4    . DC  A 1 5   ? 10.346  0.171   26.051  1.00 99.69  ? -4   DC  W C4    1 
ATOM   54   N N4    . DC  A 1 5   ? 10.706  -0.528  24.973  1.00 99.64  ? -4   DC  W N4    1 
ATOM   55   C C5    . DC  A 1 5   ? 9.120   -0.119  26.716  1.00 99.89  ? -4   DC  W C5    1 
ATOM   56   C C6    . DC  A 1 5   ? 8.815   0.612   27.795  1.00 100.54 ? -4   DC  W C6    1 
ATOM   57   P P     . DG  A 1 6   ? 6.728   5.027   31.693  1.00 100.89 ? -3   DG  W P     1 
ATOM   58   O OP1   . DG  A 1 6   ? 6.454   5.229   33.139  1.00 100.89 ? -3   DG  W OP1   1 
ATOM   59   O OP2   . DG  A 1 6   ? 5.656   4.503   30.810  1.00 101.30 ? -3   DG  W OP2   1 
ATOM   60   O "O5'" . DG  A 1 6   ? 7.247   6.406   31.088  1.00 98.95  ? -3   DG  W "O5'" 1 
ATOM   61   C "C5'" . DG  A 1 6   ? 8.456   6.999   31.560  1.00 96.32  ? -3   DG  W "C5'" 1 
ATOM   62   C "C4'" . DG  A 1 6   ? 9.084   7.848   30.478  1.00 94.02  ? -3   DG  W "C4'" 1 
ATOM   63   O "O4'" . DG  A 1 6   ? 9.496   7.001   29.378  1.00 93.29  ? -3   DG  W "O4'" 1 
ATOM   64   C "C3'" . DG  A 1 6   ? 8.156   8.903   29.877  1.00 92.70  ? -3   DG  W "C3'" 1 
ATOM   65   O "O3'" . DG  A 1 6   ? 8.881   10.106  29.611  1.00 91.03  ? -3   DG  W "O3'" 1 
ATOM   66   C "C2'" . DG  A 1 6   ? 7.676   8.262   28.587  1.00 92.14  ? -3   DG  W "C2'" 1 
ATOM   67   C "C1'" . DG  A 1 6   ? 8.859   7.402   28.172  1.00 91.32  ? -3   DG  W "C1'" 1 
ATOM   68   N N9    . DG  A 1 6   ? 8.486   6.191   27.446  1.00 89.36  ? -3   DG  W N9    1 
ATOM   69   C C8    . DG  A 1 6   ? 7.367   5.419   27.649  1.00 88.91  ? -3   DG  W C8    1 
ATOM   70   N N7    . DG  A 1 6   ? 7.304   4.387   26.852  1.00 88.51  ? -3   DG  W N7    1 
ATOM   71   C C5    . DG  A 1 6   ? 8.449   4.482   26.073  1.00 87.79  ? -3   DG  W C5    1 
ATOM   72   C C6    . DG  A 1 6   ? 8.924   3.642   25.031  1.00 87.03  ? -3   DG  W C6    1 
ATOM   73   O O6    . DG  A 1 6   ? 8.411   2.614   24.576  1.00 86.96  ? -3   DG  W O6    1 
ATOM   74   N N1    . DG  A 1 6   ? 10.127  4.106   24.510  1.00 86.88  ? -3   DG  W N1    1 
ATOM   75   C C2    . DG  A 1 6   ? 10.789  5.232   24.932  1.00 87.13  ? -3   DG  W C2    1 
ATOM   76   N N2    . DG  A 1 6   ? 11.939  5.514   24.300  1.00 86.88  ? -3   DG  W N2    1 
ATOM   77   N N3    . DG  A 1 6   ? 10.357  6.025   25.902  1.00 87.50  ? -3   DG  W N3    1 
ATOM   78   C C4    . DG  A 1 6   ? 9.190   5.592   26.424  1.00 88.40  ? -3   DG  W C4    1 
ATOM   79   P P     . DA  A 1 7   ? 8.093   11.503  29.532  1.00 90.23  ? -2   DA  W P     1 
ATOM   80   O OP1   . DA  A 1 7   ? 9.099   12.596  29.515  1.00 90.26  ? -2   DA  W OP1   1 
ATOM   81   O OP2   . DA  A 1 7   ? 7.033   11.496  30.574  1.00 90.54  ? -2   DA  W OP2   1 
ATOM   82   O "O5'" . DA  A 1 7   ? 7.391   11.454  28.105  1.00 87.21  ? -2   DA  W "O5'" 1 
ATOM   83   C "C5'" . DA  A 1 7   ? 7.644   12.463  27.132  1.00 83.47  ? -2   DA  W "C5'" 1 
ATOM   84   C "C4'" . DA  A 1 7   ? 9.042   12.310  26.577  1.00 79.75  ? -2   DA  W "C4'" 1 
ATOM   85   O "O4'" . DA  A 1 7   ? 9.310   10.915  26.308  1.00 77.63  ? -2   DA  W "O4'" 1 
ATOM   86   C "C3'" . DA  A 1 7   ? 9.268   13.040  25.258  1.00 78.17  ? -2   DA  W "C3'" 1 
ATOM   87   O "O3'" . DA  A 1 7   ? 10.621  13.492  25.168  1.00 78.11  ? -2   DA  W "O3'" 1 
ATOM   88   C "C2'" . DA  A 1 7   ? 8.980   11.969  24.225  1.00 76.53  ? -2   DA  W "C2'" 1 
ATOM   89   C "C1'" . DA  A 1 7   ? 9.446   10.693  24.910  1.00 73.98  ? -2   DA  W "C1'" 1 
ATOM   90   N N9    . DA  A 1 7   ? 8.649   9.513   24.581  1.00 69.18  ? -2   DA  W N9    1 
ATOM   91   C C8    . DA  A 1 7   ? 7.421   9.176   25.096  1.00 67.39  ? -2   DA  W C8    1 
ATOM   92   N N7    . DA  A 1 7   ? 6.957   8.034   24.655  1.00 65.93  ? -2   DA  W N7    1 
ATOM   93   C C5    . DA  A 1 7   ? 7.939   7.592   23.782  1.00 64.96  ? -2   DA  W C5    1 
ATOM   94   C C6    . DA  A 1 7   ? 8.047   6.438   22.995  1.00 63.38  ? -2   DA  W C6    1 
ATOM   95   N N6    . DA  A 1 7   ? 7.124   5.476   22.967  1.00 62.51  ? -2   DA  W N6    1 
ATOM   96   N N1    . DA  A 1 7   ? 9.152   6.300   22.229  1.00 63.91  ? -2   DA  W N1    1 
ATOM   97   C C2    . DA  A 1 7   ? 10.081  7.267   22.264  1.00 64.35  ? -2   DA  W C2    1 
ATOM   98   N N3    . DA  A 1 7   ? 10.093  8.398   22.966  1.00 65.05  ? -2   DA  W N3    1 
ATOM   99   C C4    . DA  A 1 7   ? 8.982   8.500   23.716  1.00 66.44  ? -2   DA  W C4    1 
ATOM   100  P P     . DA  A 1 8   ? 11.005  14.639  24.112  1.00 78.01  ? -1   DA  W P     1 
ATOM   101  O OP1   . DA  A 1 8   ? 12.327  15.201  24.489  1.00 77.44  ? -1   DA  W OP1   1 
ATOM   102  O OP2   . DA  A 1 8   ? 9.828   15.539  24.005  1.00 78.38  ? -1   DA  W OP2   1 
ATOM   103  O "O5'" . DA  A 1 8   ? 11.170  13.852  22.736  1.00 75.47  ? -1   DA  W "O5'" 1 
ATOM   104  C "C5'" . DA  A 1 8   ? 12.369  13.132  22.448  1.00 70.79  ? -1   DA  W "C5'" 1 
ATOM   105  C "C4'" . DA  A 1 8   ? 12.295  12.506  21.074  1.00 68.27  ? -1   DA  W "C4'" 1 
ATOM   106  O "O4'" . DA  A 1 8   ? 11.328  11.425  21.067  1.00 66.15  ? -1   DA  W "O4'" 1 
ATOM   107  C "C3'" . DA  A 1 8   ? 11.885  13.452  19.943  1.00 67.04  ? -1   DA  W "C3'" 1 
ATOM   108  O "O3'" . DA  A 1 8   ? 12.663  13.164  18.772  1.00 67.06  ? -1   DA  W "O3'" 1 
ATOM   109  C "C2'" . DA  A 1 8   ? 10.421  13.111  19.715  1.00 65.58  ? -1   DA  W "C2'" 1 
ATOM   110  C "C1'" . DA  A 1 8   ? 10.393  11.620  20.014  1.00 63.52  ? -1   DA  W "C1'" 1 
ATOM   111  N N9    . DA  A 1 8   ? 9.098   11.102  20.459  1.00 59.46  ? -1   DA  W N9    1 
ATOM   112  C C8    . DA  A 1 8   ? 8.186   11.714  21.281  1.00 58.01  ? -1   DA  W C8    1 
ATOM   113  N N7    . DA  A 1 8   ? 7.127   10.983  21.537  1.00 57.36  ? -1   DA  W N7    1 
ATOM   114  C C5    . DA  A 1 8   ? 7.350   9.812   20.825  1.00 55.92  ? -1   DA  W C5    1 
ATOM   115  C C6    . DA  A 1 8   ? 6.596   8.629   20.683  1.00 53.44  ? -1   DA  W C6    1 
ATOM   116  N N6    . DA  A 1 8   ? 5.425   8.421   21.289  1.00 51.04  ? -1   DA  W N6    1 
ATOM   117  N N1    . DA  A 1 8   ? 7.095   7.657   19.889  1.00 50.35  ? -1   DA  W N1    1 
ATOM   118  C C2    . DA  A 1 8   ? 8.273   7.865   19.288  1.00 51.98  ? -1   DA  W C2    1 
ATOM   119  N N3    . DA  A 1 8   ? 9.078   8.928   19.348  1.00 53.90  ? -1   DA  W N3    1 
ATOM   120  C C4    . DA  A 1 8   ? 8.554   9.877   20.144  1.00 56.48  ? -1   DA  W C4    1 
ATOM   121  P P     . DA  A 1 9   ? 12.392  13.974  17.409  1.00 67.43  ? 1    DA  W P     1 
ATOM   122  O OP1   . DA  A 1 9   ? 13.703  14.141  16.726  1.00 66.84  ? 1    DA  W OP1   1 
ATOM   123  O OP2   . DA  A 1 9   ? 11.573  15.173  17.724  1.00 65.69  ? 1    DA  W OP2   1 
ATOM   124  O "O5'" . DA  A 1 9   ? 11.493  12.975  16.547  1.00 64.94  ? 1    DA  W "O5'" 1 
ATOM   125  C "C5'" . DA  A 1 9   ? 12.052  11.811  15.920  1.00 61.11  ? 1    DA  W "C5'" 1 
ATOM   126  C "C4'" . DA  A 1 9   ? 11.044  11.204  14.969  1.00 57.68  ? 1    DA  W "C4'" 1 
ATOM   127  O "O4'" . DA  A 1 9   ? 9.969   10.603  15.742  1.00 55.72  ? 1    DA  W "O4'" 1 
ATOM   128  C "C3'" . DA  A 1 9   ? 10.393  12.266  14.076  1.00 57.06  ? 1    DA  W "C3'" 1 
ATOM   129  O "O3'" . DA  A 1 9   ? 9.996   11.791  12.779  1.00 57.96  ? 1    DA  W "O3'" 1 
ATOM   130  C "C2'" . DA  A 1 9   ? 9.094   12.547  14.809  1.00 55.84  ? 1    DA  W "C2'" 1 
ATOM   131  C "C1'" . DA  A 1 9   ? 8.741   11.157  15.314  1.00 52.91  ? 1    DA  W "C1'" 1 
ATOM   132  N N9    . DA  A 1 9   ? 7.783   11.128  16.424  1.00 49.24  ? 1    DA  W N9    1 
ATOM   133  C C8    . DA  A 1 9   ? 7.522   12.136  17.320  1.00 48.11  ? 1    DA  W C8    1 
ATOM   134  N N7    . DA  A 1 9   ? 6.513   11.886  18.120  1.00 46.42  ? 1    DA  W N7    1 
ATOM   135  C C5    . DA  A 1 9   ? 6.100   10.616  17.747  1.00 44.90  ? 1    DA  W C5    1 
ATOM   136  C C6    . DA  A 1 9   ? 5.054   9.796   18.198  1.00 44.21  ? 1    DA  W C6    1 
ATOM   137  N N6    . DA  A 1 9   ? 4.178   10.167  19.134  1.00 43.76  ? 1    DA  W N6    1 
ATOM   138  N N1    . DA  A 1 9   ? 4.924   8.573   17.637  1.00 42.24  ? 1    DA  W N1    1 
ATOM   139  C C2    . DA  A 1 9   ? 5.783   8.221   16.674  1.00 41.54  ? 1    DA  W C2    1 
ATOM   140  N N3    . DA  A 1 9   ? 6.792   8.914   16.149  1.00 45.04  ? 1    DA  W N3    1 
ATOM   141  C C4    . DA  A 1 9   ? 6.898   10.119  16.732  1.00 45.22  ? 1    DA  W C4    1 
ATOM   142  P P     . DA  A 1 10  ? 10.991  10.924  11.858  1.00 56.72  ? 2    DA  W P     1 
ATOM   143  O OP1   . DA  A 1 10  ? 12.167  10.448  12.631  1.00 58.67  ? 2    DA  W OP1   1 
ATOM   144  O OP2   . DA  A 1 10  ? 11.192  11.697  10.612  1.00 56.79  ? 2    DA  W OP2   1 
ATOM   145  O "O5'" . DA  A 1 10  ? 10.058  9.672   11.546  1.00 53.98  ? 2    DA  W "O5'" 1 
ATOM   146  C "C5'" . DA  A 1 10  ? 8.909   9.487   12.366  1.00 48.56  ? 2    DA  W "C5'" 1 
ATOM   147  C "C4'" . DA  A 1 10  ? 8.006   8.395   11.851  1.00 43.00  ? 2    DA  W "C4'" 1 
ATOM   148  O "O4'" . DA  A 1 10  ? 6.943   8.332   12.824  1.00 40.98  ? 2    DA  W "O4'" 1 
ATOM   149  C "C3'" . DA  A 1 10  ? 7.318   8.643   10.509  1.00 40.58  ? 2    DA  W "C3'" 1 
ATOM   150  O "O3'" . DA  A 1 10  ? 7.032   7.375   9.899   1.00 37.80  ? 2    DA  W "O3'" 1 
ATOM   151  C "C2'" . DA  A 1 10  ? 6.053   9.384   10.902  1.00 38.36  ? 2    DA  W "C2'" 1 
ATOM   152  C "C1'" . DA  A 1 10  ? 5.727   8.819   12.281  1.00 39.90  ? 2    DA  W "C1'" 1 
ATOM   153  N N9    . DA  A 1 10  ? 5.186   9.806   13.219  1.00 36.94  ? 2    DA  W N9    1 
ATOM   154  C C8    . DA  A 1 10  ? 5.650   11.078  13.451  1.00 36.60  ? 2    DA  W C8    1 
ATOM   155  N N7    . DA  A 1 10  ? 4.942   11.749  14.329  1.00 36.44  ? 2    DA  W N7    1 
ATOM   156  C C5    . DA  A 1 10  ? 3.946   10.859  14.705  1.00 35.95  ? 2    DA  W C5    1 
ATOM   157  C C6    . DA  A 1 10  ? 2.866   10.969  15.601  1.00 36.38  ? 2    DA  W C6    1 
ATOM   158  N N6    . DA  A 1 10  ? 2.596   12.075  16.305  1.00 34.95  ? 2    DA  W N6    1 
ATOM   159  N N1    . DA  A 1 10  ? 2.060   9.893   15.752  1.00 33.83  ? 2    DA  W N1    1 
ATOM   160  C C2    . DA  A 1 10  ? 2.332   8.788   15.047  1.00 34.67  ? 2    DA  W C2    1 
ATOM   161  N N3    . DA  A 1 10  ? 3.314   8.564   14.170  1.00 36.82  ? 2    DA  W N3    1 
ATOM   162  C C4    . DA  A 1 10  ? 4.092   9.652   14.040  1.00 35.81  ? 2    DA  W C4    1 
ATOM   163  P P     . DA  A 1 11  ? 6.143   7.293   8.559   1.00 38.28  ? 3    DA  W P     1 
ATOM   164  O OP1   . DA  A 1 11  ? 6.598   6.056   7.872   1.00 38.00  ? 3    DA  W OP1   1 
ATOM   165  O OP2   . DA  A 1 11  ? 6.104   8.576   7.817   1.00 36.09  ? 3    DA  W OP2   1 
ATOM   166  O "O5'" . DA  A 1 11  ? 4.672   7.024   9.109   1.00 37.17  ? 3    DA  W "O5'" 1 
ATOM   167  C "C5'" . DA  A 1 11  ? 4.415   5.876   9.904   1.00 34.75  ? 3    DA  W "C5'" 1 
ATOM   168  C "C4'" . DA  A 1 11  ? 2.952   5.786   10.269  1.00 33.04  ? 3    DA  W "C4'" 1 
ATOM   169  O "O4'" . DA  A 1 11  ? 2.575   6.823   11.208  1.00 32.65  ? 3    DA  W "O4'" 1 
ATOM   170  C "C3'" . DA  A 1 11  ? 1.939   5.841   9.127   1.00 30.63  ? 3    DA  W "C3'" 1 
ATOM   171  O "O3'" . DA  A 1 11  ? 1.017   4.764   9.320   1.00 29.43  ? 3    DA  W "O3'" 1 
ATOM   172  C "C2'" . DA  A 1 11  ? 1.270   7.198   9.300   1.00 29.71  ? 3    DA  W "C2'" 1 
ATOM   173  C "C1'" . DA  A 1 11  ? 1.363   7.436   10.802  1.00 32.00  ? 3    DA  W "C1'" 1 
ATOM   174  N N9    . DA  A 1 11  ? 1.426   8.839   11.221  1.00 32.60  ? 3    DA  W N9    1 
ATOM   175  C C8    . DA  A 1 11  ? 2.307   9.804   10.794  1.00 31.59  ? 3    DA  W C8    1 
ATOM   176  N N7    . DA  A 1 11  ? 2.155   10.962  11.392  1.00 32.55  ? 3    DA  W N7    1 
ATOM   177  C C5    . DA  A 1 11  ? 1.095   10.751  12.265  1.00 32.93  ? 3    DA  W C5    1 
ATOM   178  C C6    . DA  A 1 11  ? 0.452   11.592  13.200  1.00 33.56  ? 3    DA  W C6    1 
ATOM   179  N N6    . DA  A 1 11  ? 0.813   12.856  13.433  1.00 31.72  ? 3    DA  W N6    1 
ATOM   180  N N1    . DA  A 1 11  ? -0.581  11.074  13.904  1.00 31.57  ? 3    DA  W N1    1 
ATOM   181  C C2    . DA  A 1 11  ? -0.922  9.795   13.692  1.00 31.92  ? 3    DA  W C2    1 
ATOM   182  N N3    . DA  A 1 11  ? -0.388  8.905   12.856  1.00 31.86  ? 3    DA  W N3    1 
ATOM   183  C C4    . DA  A 1 11  ? 0.627   9.452   12.160  1.00 33.01  ? 3    DA  W C4    1 
ATOM   184  P P     . DT  A 1 12  ? -0.197  4.547   8.301   1.00 28.24  ? 4    DT  W P     1 
ATOM   185  O OP1   . DT  A 1 12  ? -0.557  3.103   8.336   1.00 27.56  ? 4    DT  W OP1   1 
ATOM   186  O OP2   . DT  A 1 12  ? 0.100   5.200   6.996   1.00 29.89  ? 4    DT  W OP2   1 
ATOM   187  O "O5'" . DT  A 1 12  ? -1.385  5.323   9.009   1.00 29.91  ? 4    DT  W "O5'" 1 
ATOM   188  C "C5'" . DT  A 1 12  ? -1.841  4.893   10.282  1.00 29.70  ? 4    DT  W "C5'" 1 
ATOM   189  C "C4'" . DT  A 1 12  ? -3.065  5.672   10.699  1.00 31.37  ? 4    DT  W "C4'" 1 
ATOM   190  O "O4'" . DT  A 1 12  ? -2.686  7.015   11.083  1.00 32.91  ? 4    DT  W "O4'" 1 
ATOM   191  C "C3'" . DT  A 1 12  ? -4.157  5.809   9.639   1.00 32.30  ? 4    DT  W "C3'" 1 
ATOM   192  O "O3'" . DT  A 1 12  ? -5.371  5.250   10.143  1.00 34.76  ? 4    DT  W "O3'" 1 
ATOM   193  C "C2'" . DT  A 1 12  ? -4.266  7.315   9.399   1.00 32.03  ? 4    DT  W "C2'" 1 
ATOM   194  C "C1'" . DT  A 1 12  ? -3.674  7.934   10.659  1.00 30.92  ? 4    DT  W "C1'" 1 
ATOM   195  N N1    . DT  A 1 12  ? -3.009  9.257   10.508  1.00 30.86  ? 4    DT  W N1    1 
ATOM   196  C C2    . DT  A 1 12  ? -3.388  10.300  11.346  1.00 32.79  ? 4    DT  W C2    1 
ATOM   197  O O2    . DT  A 1 12  ? -4.282  10.213  12.174  1.00 32.47  ? 4    DT  W O2    1 
ATOM   198  N N3    . DT  A 1 12  ? -2.672  11.459  11.178  1.00 30.61  ? 4    DT  W N3    1 
ATOM   199  C C4    . DT  A 1 12  ? -1.648  11.687  10.280  1.00 32.63  ? 4    DT  W C4    1 
ATOM   200  O O4    . DT  A 1 12  ? -1.074  12.770  10.272  1.00 30.66  ? 4    DT  W O4    1 
ATOM   201  C C5    . DT  A 1 12  ? -1.332  10.572  9.407   1.00 30.35  ? 4    DT  W C5    1 
ATOM   202  C C7    . DT  A 1 12  ? -0.268  10.743  8.370   1.00 29.84  ? 4    DT  W C7    1 
ATOM   203  C C6    . DT  A 1 12  ? -2.016  9.430   9.567   1.00 31.90  ? 4    DT  W C6    1 
ATOM   204  P P     . DG  A 1 13  ? -6.646  5.100   9.176   1.00 36.98  ? 5    DG  W P     1 
ATOM   205  O OP1   . DG  A 1 13  ? -7.253  3.782   9.451   1.00 38.38  ? 5    DG  W OP1   1 
ATOM   206  O OP2   . DG  A 1 13  ? -6.296  5.470   7.783   1.00 38.53  ? 5    DG  W OP2   1 
ATOM   207  O "O5'" . DG  A 1 13  ? -7.619  6.226   9.739   1.00 38.32  ? 5    DG  W "O5'" 1 
ATOM   208  C "C5'" . DG  A 1 13  ? -7.851  6.334   11.140  1.00 39.66  ? 5    DG  W "C5'" 1 
ATOM   209  C "C4'" . DG  A 1 13  ? -8.699  7.547   11.437  1.00 40.49  ? 5    DG  W "C4'" 1 
ATOM   210  O "O4'" . DG  A 1 13  ? -7.910  8.754   11.300  1.00 39.29  ? 5    DG  W "O4'" 1 
ATOM   211  C "C3'" . DG  A 1 13  ? -9.903  7.710   10.512  1.00 41.56  ? 5    DG  W "C3'" 1 
ATOM   212  O "O3'" . DG  A 1 13  ? -11.030 8.128   11.293  1.00 47.24  ? 5    DG  W "O3'" 1 
ATOM   213  C "C2'" . DG  A 1 13  ? -9.439  8.770   9.523   1.00 39.29  ? 5    DG  W "C2'" 1 
ATOM   214  C "C1'" . DG  A 1 13  ? -8.520  9.638   10.372  1.00 37.15  ? 5    DG  W "C1'" 1 
ATOM   215  N N9    . DG  A 1 13  ? -7.447  10.336  9.667   1.00 37.32  ? 5    DG  W N9    1 
ATOM   216  C C8    . DG  A 1 13  ? -6.691  9.862   8.620   1.00 35.60  ? 5    DG  W C8    1 
ATOM   217  N N7    . DG  A 1 13  ? -5.747  10.687  8.256   1.00 34.35  ? 5    DG  W N7    1 
ATOM   218  C C5    . DG  A 1 13  ? -5.897  11.781  9.098   1.00 34.55  ? 5    DG  W C5    1 
ATOM   219  C C6    . DG  A 1 13  ? -5.145  12.990  9.186   1.00 35.40  ? 5    DG  W C6    1 
ATOM   220  O O6    . DG  A 1 13  ? -4.162  13.336  8.526   1.00 34.18  ? 5    DG  W O6    1 
ATOM   221  N N1    . DG  A 1 13  ? -5.642  13.832  10.177  1.00 36.53  ? 5    DG  W N1    1 
ATOM   222  C C2    . DG  A 1 13  ? -6.718  13.551  10.987  1.00 36.96  ? 5    DG  W C2    1 
ATOM   223  N N2    . DG  A 1 13  ? -7.045  14.498  11.888  1.00 33.53  ? 5    DG  W N2    1 
ATOM   224  N N3    . DG  A 1 13  ? -7.421  12.428  10.919  1.00 35.20  ? 5    DG  W N3    1 
ATOM   225  C C4    . DG  A 1 13  ? -6.956  11.594  9.960   1.00 36.49  ? 5    DG  W C4    1 
ATOM   226  P P     . DC  A 1 14  ? -12.509 8.106   10.660  1.00 48.89  ? 6    DC  W P     1 
ATOM   227  O OP1   . DC  A 1 14  ? -13.434 7.572   11.690  1.00 53.33  ? 6    DC  W OP1   1 
ATOM   228  O OP2   . DC  A 1 14  ? -12.480 7.493   9.310   1.00 49.96  ? 6    DC  W OP2   1 
ATOM   229  O "O5'" . DC  A 1 14  ? -12.820 9.654   10.500  1.00 51.90  ? 6    DC  W "O5'" 1 
ATOM   230  C "C5'" . DC  A 1 14  ? -11.739 10.559  10.355  1.00 53.30  ? 6    DC  W "C5'" 1 
ATOM   231  C "C4'" . DC  A 1 14  ? -12.231 11.979  10.296  1.00 52.62  ? 6    DC  W "C4'" 1 
ATOM   232  O "O4'" . DC  A 1 14  ? -11.088 12.790  9.952   1.00 49.94  ? 6    DC  W "O4'" 1 
ATOM   233  C "C3'" . DC  A 1 14  ? -13.257 12.221  9.196   1.00 54.44  ? 6    DC  W "C3'" 1 
ATOM   234  O "O3'" . DC  A 1 14  ? -14.096 13.311  9.580   1.00 60.33  ? 6    DC  W "O3'" 1 
ATOM   235  C "C2'" . DC  A 1 14  ? -12.398 12.578  8.000   1.00 51.49  ? 6    DC  W "C2'" 1 
ATOM   236  C "C1'" . DC  A 1 14  ? -11.222 13.302  8.639   1.00 47.28  ? 6    DC  W "C1'" 1 
ATOM   237  N N1    . DC  A 1 14  ? -9.935  13.110  7.957   1.00 42.92  ? 6    DC  W N1    1 
ATOM   238  C C2    . DC  A 1 14  ? -8.929  14.040  8.181   1.00 41.05  ? 6    DC  W C2    1 
ATOM   239  O O2    . DC  A 1 14  ? -9.142  14.967  8.981   1.00 41.62  ? 6    DC  W O2    1 
ATOM   240  N N3    . DC  A 1 14  ? -7.753  13.915  7.526   1.00 38.39  ? 6    DC  W N3    1 
ATOM   241  C C4    . DC  A 1 14  ? -7.570  12.907  6.674   1.00 37.32  ? 6    DC  W C4    1 
ATOM   242  N N4    . DC  A 1 14  ? -6.408  12.852  6.015   1.00 36.56  ? 6    DC  W N4    1 
ATOM   243  C C5    . DC  A 1 14  ? -8.571  11.918  6.452   1.00 37.69  ? 6    DC  W C5    1 
ATOM   244  C C6    . DC  A 1 14  ? -9.728  12.055  7.110   1.00 40.00  ? 6    DC  W C6    1 
ATOM   245  P P     . DG  A 1 15  ? -15.687 13.136  9.553   1.00 64.30  ? 7    DG  W P     1 
ATOM   246  O OP1   . DG  A 1 15  ? -16.251 14.250  10.358  1.00 64.91  ? 7    DG  W OP1   1 
ATOM   247  O OP2   . DG  A 1 15  ? -16.025 11.730  9.898   1.00 64.28  ? 7    DG  W OP2   1 
ATOM   248  O "O5'" . DG  A 1 15  ? -16.068 13.387  8.030   1.00 64.69  ? 7    DG  W "O5'" 1 
ATOM   249  C "C5'" . DG  A 1 15  ? -16.476 14.678  7.590   1.00 65.71  ? 7    DG  W "C5'" 1 
ATOM   250  C "C4'" . DG  A 1 15  ? -16.769 14.652  6.109   1.00 66.18  ? 7    DG  W "C4'" 1 
ATOM   251  O "O4'" . DG  A 1 15  ? -15.535 14.632  5.352   1.00 65.36  ? 7    DG  W "O4'" 1 
ATOM   252  C "C3'" . DG  A 1 15  ? -17.572 13.434  5.649   1.00 67.65  ? 7    DG  W "C3'" 1 
ATOM   253  O "O3'" . DG  A 1 15  ? -18.491 13.838  4.634   1.00 71.21  ? 7    DG  W "O3'" 1 
ATOM   254  C "C2'" . DG  A 1 15  ? -16.509 12.532  5.044   1.00 66.09  ? 7    DG  W "C2'" 1 
ATOM   255  C "C1'" . DG  A 1 15  ? -15.567 13.555  4.430   1.00 63.79  ? 7    DG  W "C1'" 1 
ATOM   256  N N9    . DG  A 1 15  ? -14.195 13.108  4.209   1.00 60.36  ? 7    DG  W N9    1 
ATOM   257  C C8    . DG  A 1 15  ? -13.688 11.846  4.402   1.00 59.28  ? 7    DG  W C8    1 
ATOM   258  N N7    . DG  A 1 15  ? -12.417 11.755  4.118   1.00 57.90  ? 7    DG  W N7    1 
ATOM   259  C C5    . DG  A 1 15  ? -12.062 13.035  3.711   1.00 57.42  ? 7    DG  W C5    1 
ATOM   260  C C6    . DG  A 1 15  ? -10.809 13.550  3.276   1.00 57.10  ? 7    DG  W C6    1 
ATOM   261  O O6    . DG  A 1 15  ? -9.727  12.958  3.159   1.00 54.94  ? 7    DG  W O6    1 
ATOM   262  N N1    . DG  A 1 15  ? -10.896 14.901  2.958   1.00 57.23  ? 7    DG  W N1    1 
ATOM   263  C C2    . DG  A 1 15  ? -12.036 15.661  3.046   1.00 56.18  ? 7    DG  W C2    1 
ATOM   264  N N2    . DG  A 1 15  ? -11.909 16.952  2.697   1.00 56.31  ? 7    DG  W N2    1 
ATOM   265  N N3    . DG  A 1 15  ? -13.208 15.194  3.445   1.00 55.95  ? 7    DG  W N3    1 
ATOM   266  C C4    . DG  A 1 15  ? -13.148 13.882  3.761   1.00 57.82  ? 7    DG  W C4    1 
ATOM   267  P P     . DA  A 1 16  ? -20.041 14.048  4.996   1.00 72.82  ? 8    DA  W P     1 
ATOM   268  O OP1   . DA  A 1 16  ? -20.121 14.488  6.415   1.00 72.27  ? 8    DA  W OP1   1 
ATOM   269  O OP2   . DA  A 1 16  ? -20.788 12.840  4.557   1.00 72.14  ? 8    DA  W OP2   1 
ATOM   270  O "O5'" . DA  A 1 16  ? -20.460 15.286  4.087   1.00 73.12  ? 8    DA  W "O5'" 1 
ATOM   271  C "C5'" . DA  A 1 16  ? -20.167 16.616  4.504   1.00 73.52  ? 8    DA  W "C5'" 1 
ATOM   272  C "C4'" . DA  A 1 16  ? -19.577 17.413  3.363   1.00 74.49  ? 8    DA  W "C4'" 1 
ATOM   273  O "O4'" . DA  A 1 16  ? -18.296 16.852  2.981   1.00 73.42  ? 8    DA  W "O4'" 1 
ATOM   274  C "C3'" . DA  A 1 16  ? -20.416 17.471  2.085   1.00 75.31  ? 8    DA  W "C3'" 1 
ATOM   275  O "O3'" . DA  A 1 16  ? -20.337 18.794  1.536   1.00 77.04  ? 8    DA  W "O3'" 1 
ATOM   276  C "C2'" . DA  A 1 16  ? -19.740 16.459  1.175   1.00 74.00  ? 8    DA  W "C2'" 1 
ATOM   277  C "C1'" . DA  A 1 16  ? -18.281 16.574  1.587   1.00 73.14  ? 8    DA  W "C1'" 1 
ATOM   278  N N9    . DA  A 1 16  ? -17.482 15.365  1.381   1.00 71.34  ? 8    DA  W N9    1 
ATOM   279  C C8    . DA  A 1 16  ? -17.861 14.058  1.570   1.00 70.81  ? 8    DA  W C8    1 
ATOM   280  N N7    . DA  A 1 16  ? -16.909 13.191  1.327   1.00 70.08  ? 8    DA  W N7    1 
ATOM   281  C C5    . DA  A 1 16  ? -15.830 13.978  0.949   1.00 69.75  ? 8    DA  W C5    1 
ATOM   282  C C6    . DA  A 1 16  ? -14.512 13.660  0.572   1.00 69.52  ? 8    DA  W C6    1 
ATOM   283  N N6    . DA  A 1 16  ? -14.034 12.415  0.529   1.00 68.82  ? 8    DA  W N6    1 
ATOM   284  N N1    . DA  A 1 16  ? -13.690 14.680  0.244   1.00 69.78  ? 8    DA  W N1    1 
ATOM   285  C C2    . DA  A 1 16  ? -14.166 15.930  0.301   1.00 69.30  ? 8    DA  W C2    1 
ATOM   286  N N3    . DA  A 1 16  ? -15.378 16.354  0.648   1.00 69.50  ? 8    DA  W N3    1 
ATOM   287  C C4    . DA  A 1 16  ? -16.172 15.317  0.966   1.00 69.84  ? 8    DA  W C4    1 
ATOM   288  P P     . DT  A 1 17  ? -21.193 19.181  0.228   1.00 78.06  ? 9    DT  W P     1 
ATOM   289  O OP1   . DT  A 1 17  ? -22.129 20.277  0.590   1.00 78.16  ? 9    DT  W OP1   1 
ATOM   290  O OP2   . DT  A 1 17  ? -21.722 17.935  -0.388  1.00 78.01  ? 9    DT  W OP2   1 
ATOM   291  O "O5'" . DT  A 1 17  ? -20.089 19.787  -0.742  1.00 77.21  ? 9    DT  W "O5'" 1 
ATOM   292  C "C5'" . DT  A 1 17  ? -18.807 19.175  -0.826  1.00 75.61  ? 9    DT  W "C5'" 1 
ATOM   293  C "C4'" . DT  A 1 17  ? -17.859 20.034  -1.627  1.00 74.04  ? 9    DT  W "C4'" 1 
ATOM   294  O "O4'" . DT  A 1 17  ? -16.644 19.269  -1.792  1.00 72.19  ? 9    DT  W "O4'" 1 
ATOM   295  C "C3'" . DT  A 1 17  ? -18.344 20.306  -3.046  1.00 73.27  ? 9    DT  W "C3'" 1 
ATOM   296  O "O3'" . DT  A 1 17  ? -17.594 21.380  -3.623  1.00 74.28  ? 9    DT  W "O3'" 1 
ATOM   297  C "C2'" . DT  A 1 17  ? -17.943 19.031  -3.761  1.00 72.35  ? 9    DT  W "C2'" 1 
ATOM   298  C "C1'" . DT  A 1 17  ? -16.635 18.645  -3.072  1.00 69.61  ? 9    DT  W "C1'" 1 
ATOM   299  N N1    . DT  A 1 17  ? -16.502 17.192  -2.854  1.00 66.62  ? 9    DT  W N1    1 
ATOM   300  C C2    . DT  A 1 17  ? -15.257 16.623  -2.974  1.00 64.22  ? 9    DT  W C2    1 
ATOM   301  O O2    . DT  A 1 17  ? -14.253 17.266  -3.240  1.00 63.30  ? 9    DT  W O2    1 
ATOM   302  N N3    . DT  A 1 17  ? -15.227 15.267  -2.768  1.00 62.27  ? 9    DT  W N3    1 
ATOM   303  C C4    . DT  A 1 17  ? -16.291 14.444  -2.457  1.00 62.54  ? 9    DT  W C4    1 
ATOM   304  O O4    . DT  A 1 17  ? -16.108 13.237  -2.301  1.00 60.50  ? 9    DT  W O4    1 
ATOM   305  C C5    . DT  A 1 17  ? -17.570 15.110  -2.339  1.00 63.77  ? 9    DT  W C5    1 
ATOM   306  C C7    . DT  A 1 17  ? -18.783 14.302  -1.997  1.00 62.54  ? 9    DT  W C7    1 
ATOM   307  C C6    . DT  A 1 17  ? -17.609 16.432  -2.542  1.00 63.74  ? 9    DT  W C6    1 
ATOM   308  O "O5'" . DC  B 2 1   ? -26.043 7.262   -12.073 1.00 53.33  ? 13   DC  X "O5'" 1 
ATOM   309  C "C5'" . DC  B 2 1   ? -26.208 6.172   -12.986 1.00 50.53  ? 13   DC  X "C5'" 1 
ATOM   310  C "C4'" . DC  B 2 1   ? -24.926 5.386   -13.124 1.00 50.39  ? 13   DC  X "C4'" 1 
ATOM   311  O "O4'" . DC  B 2 1   ? -24.002 6.122   -13.965 1.00 50.95  ? 13   DC  X "O4'" 1 
ATOM   312  C "C3'" . DC  B 2 1   ? -24.212 5.157   -11.792 1.00 50.20  ? 13   DC  X "C3'" 1 
ATOM   313  O "O3'" . DC  B 2 1   ? -23.713 3.827   -11.678 1.00 48.49  ? 13   DC  X "O3'" 1 
ATOM   314  C "C2'" . DC  B 2 1   ? -23.067 6.152   -11.809 1.00 51.13  ? 13   DC  X "C2'" 1 
ATOM   315  C "C1'" . DC  B 2 1   ? -22.766 6.325   -13.288 1.00 51.29  ? 13   DC  X "C1'" 1 
ATOM   316  N N1    . DC  B 2 1   ? -22.287 7.684   -13.610 1.00 50.01  ? 13   DC  X N1    1 
ATOM   317  C C2    . DC  B 2 1   ? -20.996 7.851   -14.150 1.00 47.42  ? 13   DC  X C2    1 
ATOM   318  O O2    . DC  B 2 1   ? -20.301 6.852   -14.379 1.00 43.84  ? 13   DC  X O2    1 
ATOM   319  N N3    . DC  B 2 1   ? -20.547 9.101   -14.408 1.00 46.26  ? 13   DC  X N3    1 
ATOM   320  C C4    . DC  B 2 1   ? -21.325 10.156  -14.160 1.00 47.68  ? 13   DC  X C4    1 
ATOM   321  N N4    . DC  B 2 1   ? -20.836 11.367  -14.427 1.00 46.94  ? 13   DC  X N4    1 
ATOM   322  C C5    . DC  B 2 1   ? -22.643 10.015  -13.628 1.00 47.80  ? 13   DC  X C5    1 
ATOM   323  C C6    . DC  B 2 1   ? -23.080 8.774   -13.373 1.00 48.86  ? 13   DC  X C6    1 
ATOM   324  P P     . DT  B 2 2   ? -23.209 3.295   -10.245 1.00 49.65  ? 12   DT  X P     1 
ATOM   325  O OP1   . DT  B 2 2   ? -23.565 1.855   -10.135 1.00 48.60  ? 12   DT  X OP1   1 
ATOM   326  O OP2   . DT  B 2 2   ? -23.669 4.246   -9.207  1.00 47.43  ? 12   DT  X OP2   1 
ATOM   327  O "O5'" . DT  B 2 2   ? -21.622 3.401   -10.348 1.00 48.51  ? 12   DT  X "O5'" 1 
ATOM   328  C "C5'" . DT  B 2 2   ? -20.911 2.637   -11.319 1.00 47.66  ? 12   DT  X "C5'" 1 
ATOM   329  C "C4'" . DT  B 2 2   ? -19.424 2.836   -11.154 1.00 49.06  ? 12   DT  X "C4'" 1 
ATOM   330  O "O4'" . DT  B 2 2   ? -19.043 4.157   -11.611 1.00 47.58  ? 12   DT  X "O4'" 1 
ATOM   331  C "C3'" . DT  B 2 2   ? -18.914 2.712   -9.717  1.00 49.13  ? 12   DT  X "C3'" 1 
ATOM   332  O "O3'" . DT  B 2 2   ? -17.681 1.983   -9.722  1.00 50.51  ? 12   DT  X "O3'" 1 
ATOM   333  C "C2'" . DT  B 2 2   ? -18.728 4.158   -9.281  1.00 47.11  ? 12   DT  X "C2'" 1 
ATOM   334  C "C1'" . DT  B 2 2   ? -18.357 4.852   -10.584 1.00 46.73  ? 12   DT  X "C1'" 1 
ATOM   335  N N1    . DT  B 2 2   ? -18.726 6.279   -10.687 1.00 44.20  ? 12   DT  X N1    1 
ATOM   336  C C2    . DT  B 2 2   ? -17.760 7.151   -11.141 1.00 45.19  ? 12   DT  X C2    1 
ATOM   337  O O2    . DT  B 2 2   ? -16.627 6.797   -11.417 1.00 44.53  ? 12   DT  X O2    1 
ATOM   338  N N3    . DT  B 2 2   ? -18.171 8.456   -11.259 1.00 41.43  ? 12   DT  X N3    1 
ATOM   339  C C4    . DT  B 2 2   ? -19.424 8.964   -10.967 1.00 43.73  ? 12   DT  X C4    1 
ATOM   340  O O4    . DT  B 2 2   ? -19.662 10.155  -11.148 1.00 43.35  ? 12   DT  X O4    1 
ATOM   341  C C5    . DT  B 2 2   ? -20.376 8.003   -10.467 1.00 44.30  ? 12   DT  X C5    1 
ATOM   342  C C7    . DT  B 2 2   ? -21.745 8.477   -10.090 1.00 45.81  ? 12   DT  X C7    1 
ATOM   343  C C6    . DT  B 2 2   ? -19.987 6.722   -10.357 1.00 44.95  ? 12   DT  X C6    1 
ATOM   344  P P     . DA  B 2 3   ? -16.957 1.604   -8.336  1.00 51.92  ? 11   DA  X P     1 
ATOM   345  O OP1   . DA  B 2 3   ? -16.807 0.124   -8.289  1.00 52.03  ? 11   DA  X OP1   1 
ATOM   346  O OP2   . DA  B 2 3   ? -17.620 2.315   -7.209  1.00 48.88  ? 11   DA  X OP2   1 
ATOM   347  O "O5'" . DA  B 2 3   ? -15.517 2.235   -8.536  1.00 47.36  ? 11   DA  X "O5'" 1 
ATOM   348  C "C5'" . DA  B 2 3   ? -15.405 3.478   -9.186  1.00 46.24  ? 11   DA  X "C5'" 1 
ATOM   349  C "C4'" . DA  B 2 3   ? -13.962 3.879   -9.344  1.00 45.23  ? 11   DA  X "C4'" 1 
ATOM   350  O "O4'" . DA  B 2 3   ? -14.025 5.289   -9.640  1.00 45.01  ? 11   DA  X "O4'" 1 
ATOM   351  C "C3'" . DA  B 2 3   ? -13.126 3.777   -8.072  1.00 43.21  ? 11   DA  X "C3'" 1 
ATOM   352  O "O3'" . DA  B 2 3   ? -11.737 3.759   -8.458  1.00 43.37  ? 11   DA  X "O3'" 1 
ATOM   353  C "C2'" . DA  B 2 3   ? -13.512 5.051   -7.340  1.00 43.65  ? 11   DA  X "C2'" 1 
ATOM   354  C "C1'" . DA  B 2 3   ? -13.720 6.049   -8.480  1.00 45.54  ? 11   DA  X "C1'" 1 
ATOM   355  N N9    . DA  B 2 3   ? -14.811 7.009   -8.295  1.00 46.69  ? 11   DA  X N9    1 
ATOM   356  C C8    . DA  B 2 3   ? -16.062 6.789   -7.763  1.00 45.83  ? 11   DA  X C8    1 
ATOM   357  N N7    . DA  B 2 3   ? -16.832 7.850   -7.770  1.00 44.82  ? 11   DA  X N7    1 
ATOM   358  C C5    . DA  B 2 3   ? -16.035 8.839   -8.333  1.00 45.97  ? 11   DA  X C5    1 
ATOM   359  C C6    . DA  B 2 3   ? -16.268 10.201  -8.620  1.00 46.24  ? 11   DA  X C6    1 
ATOM   360  N N6    . DA  B 2 3   ? -17.422 10.826  -8.382  1.00 48.02  ? 11   DA  X N6    1 
ATOM   361  N N1    . DA  B 2 3   ? -15.260 10.907  -9.175  1.00 46.21  ? 11   DA  X N1    1 
ATOM   362  C C2    . DA  B 2 3   ? -14.103 10.280  -9.430  1.00 45.49  ? 11   DA  X C2    1 
ATOM   363  N N3    . DA  B 2 3   ? -13.767 9.011   -9.215  1.00 45.67  ? 11   DA  X N3    1 
ATOM   364  C C4    . DA  B 2 3   ? -14.787 8.336   -8.655  1.00 45.73  ? 11   DA  X C4    1 
ATOM   365  P P     . DG  B 2 4   ? -10.603 3.215   -7.444  1.00 37.33  ? 10   DG  X P     1 
ATOM   366  O OP1   . DG  B 2 4   ? -9.634  2.453   -8.262  1.00 37.85  ? 10   DG  X OP1   1 
ATOM   367  O OP2   . DG  B 2 4   ? -11.204 2.598   -6.236  1.00 35.07  ? 10   DG  X OP2   1 
ATOM   368  O "O5'" . DG  B 2 4   ? -9.862  4.529   -6.975  1.00 38.38  ? 10   DG  X "O5'" 1 
ATOM   369  C "C5'" . DG  B 2 4   ? -10.593 5.712   -6.847  1.00 42.87  ? 10   DG  X "C5'" 1 
ATOM   370  C "C4'" . DG  B 2 4   ? -9.696  6.909   -6.996  1.00 39.50  ? 10   DG  X "C4'" 1 
ATOM   371  O "O4'" . DG  B 2 4   ? -10.579 8.023   -7.185  1.00 39.61  ? 10   DG  X "O4'" 1 
ATOM   372  C "C3'" . DG  B 2 4   ? -8.891  7.235   -5.743  1.00 39.84  ? 10   DG  X "C3'" 1 
ATOM   373  O "O3'" . DG  B 2 4   ? -7.798  8.060   -6.147  1.00 41.14  ? 10   DG  X "O3'" 1 
ATOM   374  C "C2'" . DG  B 2 4   ? -9.899  8.007   -4.917  1.00 40.11  ? 10   DG  X "C2'" 1 
ATOM   375  C "C1'" . DG  B 2 4   ? -10.681 8.765   -5.987  1.00 39.91  ? 10   DG  X "C1'" 1 
ATOM   376  N N9    . DG  B 2 4   ? -12.101 8.947   -5.722  1.00 38.61  ? 10   DG  X N9    1 
ATOM   377  C C8    . DG  B 2 4   ? -13.004 8.019   -5.259  1.00 39.34  ? 10   DG  X C8    1 
ATOM   378  N N7    . DG  B 2 4   ? -14.207 8.507   -5.119  1.00 38.60  ? 10   DG  X N7    1 
ATOM   379  C C5    . DG  B 2 4   ? -14.084 9.833   -5.516  1.00 36.89  ? 10   DG  X C5    1 
ATOM   380  C C6    . DG  B 2 4   ? -15.047 10.870  -5.578  1.00 37.81  ? 10   DG  X C6    1 
ATOM   381  O O6    . DG  B 2 4   ? -16.245 10.828  -5.277  1.00 40.44  ? 10   DG  X O6    1 
ATOM   382  N N1    . DG  B 2 4   ? -14.490 12.056  -6.049  1.00 36.94  ? 10   DG  X N1    1 
ATOM   383  C C2    . DG  B 2 4   ? -13.174 12.219  -6.415  1.00 37.42  ? 10   DG  X C2    1 
ATOM   384  N N2    . DG  B 2 4   ? -12.814 13.427  -6.863  1.00 38.94  ? 10   DG  X N2    1 
ATOM   385  N N3    . DG  B 2 4   ? -12.272 11.263  -6.351  1.00 36.86  ? 10   DG  X N3    1 
ATOM   386  C C4    . DG  B 2 4   ? -12.792 10.109  -5.897  1.00 35.54  ? 10   DG  X C4    1 
ATOM   387  P P     . DA  B 2 5   ? -6.602  8.391   -5.133  1.00 36.72  ? 9    DA  X P     1 
ATOM   388  O OP1   . DA  B 2 5   ? -5.384  7.854   -5.765  1.00 42.35  ? 9    DA  X OP1   1 
ATOM   389  O OP2   . DA  B 2 5   ? -6.939  8.008   -3.748  1.00 40.74  ? 9    DA  X OP2   1 
ATOM   390  O "O5'" . DA  B 2 5   ? -6.511  9.972   -5.221  1.00 39.72  ? 9    DA  X "O5'" 1 
ATOM   391  C "C5'" . DA  B 2 5   ? -6.342  10.608  -6.483  1.00 41.14  ? 9    DA  X "C5'" 1 
ATOM   392  C "C4'" . DA  B 2 5   ? -6.330  12.104  -6.306  1.00 42.07  ? 9    DA  X "C4'" 1 
ATOM   393  O "O4'" . DA  B 2 5   ? -7.669  12.576  -6.026  1.00 42.55  ? 9    DA  X "O4'" 1 
ATOM   394  C "C3'" . DA  B 2 5   ? -5.469  12.551  -5.131  1.00 44.78  ? 9    DA  X "C3'" 1 
ATOM   395  O "O3'" . DA  B 2 5   ? -4.830  13.784  -5.473  1.00 48.57  ? 9    DA  X "O3'" 1 
ATOM   396  C "C2'" . DA  B 2 5   ? -6.476  12.681  -3.997  1.00 43.51  ? 9    DA  X "C2'" 1 
ATOM   397  C "C1'" . DA  B 2 5   ? -7.755  13.113  -4.710  1.00 42.81  ? 9    DA  X "C1'" 1 
ATOM   398  N N9    . DA  B 2 5   ? -9.000  12.609  -4.121  1.00 43.12  ? 9    DA  X N9    1 
ATOM   399  C C8    . DA  B 2 5   ? -9.265  11.329  -3.700  1.00 43.07  ? 9    DA  X C8    1 
ATOM   400  N N7    . DA  B 2 5   ? -10.494 11.154  -3.276  1.00 43.44  ? 9    DA  X N7    1 
ATOM   401  C C5    . DA  B 2 5   ? -11.075 12.407  -3.410  1.00 43.08  ? 9    DA  X C5    1 
ATOM   402  C C6    . DA  B 2 5   ? -12.376 12.882  -3.144  1.00 43.23  ? 9    DA  X C6    1 
ATOM   403  N N6    . DA  B 2 5   ? -13.368 12.119  -2.680  1.00 41.79  ? 9    DA  X N6    1 
ATOM   404  N N1    . DA  B 2 5   ? -12.627 14.184  -3.384  1.00 44.73  ? 9    DA  X N1    1 
ATOM   405  C C2    . DA  B 2 5   ? -11.638 14.949  -3.865  1.00 45.40  ? 9    DA  X C2    1 
ATOM   406  N N3    . DA  B 2 5   ? -10.382 14.618  -4.163  1.00 44.49  ? 9    DA  X N3    1 
ATOM   407  C C4    . DA  B 2 5   ? -10.162 13.317  -3.911  1.00 42.74  ? 9    DA  X C4    1 
ATOM   408  P P     . DT  B 2 6   ? -3.586  14.314  -4.605  1.00 51.16  ? 8    DT  X P     1 
ATOM   409  O OP1   . DT  B 2 6   ? -2.639  14.960  -5.545  1.00 52.59  ? 8    DT  X OP1   1 
ATOM   410  O OP2   . DT  B 2 6   ? -3.109  13.228  -3.712  1.00 53.10  ? 8    DT  X OP2   1 
ATOM   411  O "O5'" . DT  B 2 6   ? -4.250  15.448  -3.715  1.00 52.20  ? 8    DT  X "O5'" 1 
ATOM   412  C "C5'" . DT  B 2 6   ? -5.641  15.403  -3.446  1.00 53.13  ? 8    DT  X "C5'" 1 
ATOM   413  C "C4'" . DT  B 2 6   ? -6.155  16.775  -3.104  1.00 53.16  ? 8    DT  X "C4'" 1 
ATOM   414  O "O4'" . DT  B 2 6   ? -7.572  16.670  -2.849  1.00 52.70  ? 8    DT  X "O4'" 1 
ATOM   415  C "C3'" . DT  B 2 6   ? -5.533  17.328  -1.832  1.00 55.82  ? 8    DT  X "C3'" 1 
ATOM   416  O "O3'" . DT  B 2 6   ? -5.332  18.729  -1.972  1.00 60.16  ? 8    DT  X "O3'" 1 
ATOM   417  C "C2'" . DT  B 2 6   ? -6.528  16.965  -0.742  1.00 53.78  ? 8    DT  X "C2'" 1 
ATOM   418  C "C1'" . DT  B 2 6   ? -7.865  16.841  -1.468  1.00 51.14  ? 8    DT  X "C1'" 1 
ATOM   419  N N1    . DT  B 2 6   ? -8.664  15.669  -1.044  1.00 47.83  ? 8    DT  X N1    1 
ATOM   420  C C2    . DT  B 2 6   ? -10.022 15.819  -0.865  1.00 45.85  ? 8    DT  X C2    1 
ATOM   421  O O2    . DT  B 2 6   ? -10.600 16.877  -1.027  1.00 50.22  ? 8    DT  X O2    1 
ATOM   422  N N3    . DT  B 2 6   ? -10.682 14.677  -0.487  1.00 43.30  ? 8    DT  X N3    1 
ATOM   423  C C4    . DT  B 2 6   ? -10.131 13.428  -0.270  1.00 43.55  ? 8    DT  X C4    1 
ATOM   424  O O4    . DT  B 2 6   ? -10.848 12.490  0.063   1.00 42.32  ? 8    DT  X O4    1 
ATOM   425  C C5    . DT  B 2 6   ? -8.701  13.343  -0.464  1.00 44.71  ? 8    DT  X C5    1 
ATOM   426  C C7    . DT  B 2 6   ? -8.014  12.032  -0.232  1.00 43.13  ? 8    DT  X C7    1 
ATOM   427  C C6    . DT  B 2 6   ? -8.050  14.452  -0.840  1.00 45.04  ? 8    DT  X C6    1 
ATOM   428  P P     . DC  B 2 7   ? -3.971  19.384  -1.436  1.00 64.09  ? 7    DC  X P     1 
ATOM   429  O OP1   . DC  B 2 7   ? -3.620  20.494  -2.365  1.00 64.53  ? 7    DC  X OP1   1 
ATOM   430  O OP2   . DC  B 2 7   ? -2.979  18.312  -1.162  1.00 62.59  ? 7    DC  X OP2   1 
ATOM   431  O "O5'" . DC  B 2 7   ? -4.417  20.005  -0.042  1.00 62.79  ? 7    DC  X "O5'" 1 
ATOM   432  C "C5'" . DC  B 2 7   ? -5.554  20.859  0.041   1.00 59.14  ? 7    DC  X "C5'" 1 
ATOM   433  C "C4'" . DC  B 2 7   ? -5.907  21.086  1.488   1.00 57.85  ? 7    DC  X "C4'" 1 
ATOM   434  O "O4'" . DC  B 2 7   ? -6.782  20.035  1.968   1.00 57.09  ? 7    DC  X "O4'" 1 
ATOM   435  C "C3'" . DC  B 2 7   ? -4.665  21.061  2.372   1.00 57.42  ? 7    DC  X "C3'" 1 
ATOM   436  O "O3'" . DC  B 2 7   ? -4.681  22.110  3.325   1.00 57.27  ? 7    DC  X "O3'" 1 
ATOM   437  C "C2'" . DC  B 2 7   ? -4.729  19.710  3.059   1.00 58.56  ? 7    DC  X "C2'" 1 
ATOM   438  C "C1'" . DC  B 2 7   ? -6.218  19.402  3.106   1.00 57.18  ? 7    DC  X "C1'" 1 
ATOM   439  N N1    . DC  B 2 7   ? -6.510  17.958  3.015   1.00 55.37  ? 7    DC  X N1    1 
ATOM   440  C C2    . DC  B 2 7   ? -7.830  17.537  2.807   1.00 54.82  ? 7    DC  X C2    1 
ATOM   441  O O2    . DC  B 2 7   ? -8.723  18.389  2.686   1.00 54.52  ? 7    DC  X O2    1 
ATOM   442  N N3    . DC  B 2 7   ? -8.096  16.209  2.740   1.00 53.85  ? 7    DC  X N3    1 
ATOM   443  C C4    . DC  B 2 7   ? -7.102  15.322  2.865   1.00 52.49  ? 7    DC  X C4    1 
ATOM   444  N N4    . DC  B 2 7   ? -7.404  14.024  2.792   1.00 50.63  ? 7    DC  X N4    1 
ATOM   445  C C5    . DC  B 2 7   ? -5.754  15.726  3.069   1.00 52.25  ? 7    DC  X C5    1 
ATOM   446  C C6    . DC  B 2 7   ? -5.505  17.038  3.137   1.00 53.77  ? 7    DC  X C6    1 
ATOM   447  P P     . DG  B 2 8   ? -3.295  22.636  3.928   1.00 55.20  ? 6    DG  X P     1 
ATOM   448  O OP1   . DG  B 2 8   ? -2.986  23.935  3.278   1.00 58.26  ? 6    DG  X OP1   1 
ATOM   449  O OP2   . DG  B 2 8   ? -2.299  21.538  3.876   1.00 56.79  ? 6    DG  X OP2   1 
ATOM   450  O "O5'" . DG  B 2 8   ? -3.664  22.910  5.449   1.00 54.52  ? 6    DG  X "O5'" 1 
ATOM   451  C "C5'" . DG  B 2 8   ? -4.876  23.570  5.790   1.00 50.21  ? 6    DG  X "C5'" 1 
ATOM   452  C "C4'" . DG  B 2 8   ? -5.247  23.253  7.217   1.00 49.52  ? 6    DG  X "C4'" 1 
ATOM   453  O "O4'" . DG  B 2 8   ? -5.647  21.865  7.326   1.00 48.09  ? 6    DG  X "O4'" 1 
ATOM   454  C "C3'" . DG  B 2 8   ? -4.098  23.438  8.202   1.00 49.39  ? 6    DG  X "C3'" 1 
ATOM   455  O "O3'" . DG  B 2 8   ? -4.626  23.936  9.433   1.00 51.26  ? 6    DG  X "O3'" 1 
ATOM   456  C "C2'" . DG  B 2 8   ? -3.529  22.033  8.343   1.00 46.20  ? 6    DG  X "C2'" 1 
ATOM   457  C "C1'" . DG  B 2 8   ? -4.757  21.148  8.174   1.00 44.33  ? 6    DG  X "C1'" 1 
ATOM   458  N N9    . DG  B 2 8   ? -4.508  19.853  7.542   1.00 42.41  ? 6    DG  X N9    1 
ATOM   459  C C8    . DG  B 2 8   ? -3.526  19.544  6.629   1.00 40.45  ? 6    DG  X C8    1 
ATOM   460  N N7    . DG  B 2 8   ? -3.585  18.309  6.210   1.00 39.11  ? 6    DG  X N7    1 
ATOM   461  C C5    . DG  B 2 8   ? -4.666  17.765  6.892   1.00 38.53  ? 6    DG  X C5    1 
ATOM   462  C C6    . DG  B 2 8   ? -5.224  16.457  6.844   1.00 37.56  ? 6    DG  X C6    1 
ATOM   463  O O6    . DG  B 2 8   ? -4.869  15.485  6.151   1.00 35.30  ? 6    DG  X O6    1 
ATOM   464  N N1    . DG  B 2 8   ? -6.306  16.334  7.712   1.00 36.52  ? 6    DG  X N1    1 
ATOM   465  C C2    . DG  B 2 8   ? -6.794  17.340  8.516   1.00 37.44  ? 6    DG  X C2    1 
ATOM   466  N N2    . DG  B 2 8   ? -7.841  17.029  9.289   1.00 34.61  ? 6    DG  X N2    1 
ATOM   467  N N3    . DG  B 2 8   ? -6.291  18.561  8.559   1.00 37.13  ? 6    DG  X N3    1 
ATOM   468  C C4    . DG  B 2 8   ? -5.237  18.702  7.730   1.00 39.19  ? 6    DG  X C4    1 
ATOM   469  P P     . DC  B 2 9   ? -3.637  24.530  10.546  1.00 53.17  ? 5    DC  X P     1 
ATOM   470  O OP1   . DC  B 2 9   ? -4.152  25.863  10.953  1.00 57.03  ? 5    DC  X OP1   1 
ATOM   471  O OP2   . DC  B 2 9   ? -2.234  24.394  10.086  1.00 52.90  ? 5    DC  X OP2   1 
ATOM   472  O "O5'" . DC  B 2 9   ? -3.858  23.530  11.753  1.00 53.65  ? 5    DC  X "O5'" 1 
ATOM   473  C "C5'" . DC  B 2 9   ? -4.082  22.163  11.476  1.00 53.72  ? 5    DC  X "C5'" 1 
ATOM   474  C "C4'" . DC  B 2 9   ? -4.946  21.540  12.540  1.00 51.12  ? 5    DC  X "C4'" 1 
ATOM   475  O "O4'" . DC  B 2 9   ? -5.343  20.247  12.039  1.00 50.47  ? 5    DC  X "O4'" 1 
ATOM   476  C "C3'" . DC  B 2 9   ? -4.202  21.277  13.844  1.00 50.81  ? 5    DC  X "C3'" 1 
ATOM   477  O "O3'" . DC  B 2 9   ? -5.118  21.339  14.941  1.00 52.02  ? 5    DC  X "O3'" 1 
ATOM   478  C "C2'" . DC  B 2 9   ? -3.629  19.887  13.633  1.00 48.52  ? 5    DC  X "C2'" 1 
ATOM   479  C "C1'" . DC  B 2 9   ? -4.633  19.214  12.699  1.00 47.72  ? 5    DC  X "C1'" 1 
ATOM   480  N N1    . DC  B 2 9   ? -4.021  18.375  11.654  1.00 44.35  ? 5    DC  X N1    1 
ATOM   481  C C2    . DC  B 2 9   ? -4.547  17.105  11.421  1.00 43.56  ? 5    DC  X C2    1 
ATOM   482  O O2    . DC  B 2 9   ? -5.518  16.730  12.095  1.00 43.35  ? 5    DC  X O2    1 
ATOM   483  N N3    . DC  B 2 9   ? -3.985  16.319  10.468  1.00 43.41  ? 5    DC  X N3    1 
ATOM   484  C C4    . DC  B 2 9   ? -2.938  16.765  9.769   1.00 42.44  ? 5    DC  X C4    1 
ATOM   485  N N4    . DC  B 2 9   ? -2.404  15.957  8.852   1.00 41.67  ? 5    DC  X N4    1 
ATOM   486  C C5    . DC  B 2 9   ? -2.388  18.062  9.982   1.00 41.54  ? 5    DC  X C5    1 
ATOM   487  C C6    . DC  B 2 9   ? -2.956  18.826  10.925  1.00 42.77  ? 5    DC  X C6    1 
ATOM   488  P P     . DA  B 2 10  ? -4.575  21.250  16.455  1.00 51.05  ? 4    DA  X P     1 
ATOM   489  O OP1   . DA  B 2 10  ? -5.132  22.411  17.191  1.00 52.44  ? 4    DA  X OP1   1 
ATOM   490  O OP2   . DA  B 2 10  ? -3.110  21.017  16.457  1.00 50.94  ? 4    DA  X OP2   1 
ATOM   491  O "O5'" . DA  B 2 10  ? -5.301  19.947  17.005  1.00 50.39  ? 4    DA  X "O5'" 1 
ATOM   492  C "C5'" . DA  B 2 10  ? -6.694  19.751  16.775  1.00 49.61  ? 4    DA  X "C5'" 1 
ATOM   493  C "C4'" . DA  B 2 10  ? -7.073  18.321  17.069  1.00 49.89  ? 4    DA  X "C4'" 1 
ATOM   494  O "O4'" . DA  B 2 10  ? -6.518  17.440  16.060  1.00 49.08  ? 4    DA  X "O4'" 1 
ATOM   495  C "C3'" . DA  B 2 10  ? -6.544  17.813  18.406  1.00 50.72  ? 4    DA  X "C3'" 1 
ATOM   496  O "O3'" . DA  B 2 10  ? -7.505  16.926  18.983  1.00 54.37  ? 4    DA  X "O3'" 1 
ATOM   497  C "C2'" . DA  B 2 10  ? -5.268  17.085  18.017  1.00 49.41  ? 4    DA  X "C2'" 1 
ATOM   498  C "C1'" . DA  B 2 10  ? -5.618  16.514  16.650  1.00 46.25  ? 4    DA  X "C1'" 1 
ATOM   499  N N9    . DA  B 2 10  ? -4.480  16.364  15.740  1.00 44.39  ? 4    DA  X N9    1 
ATOM   500  C C8    . DA  B 2 10  ? -3.424  17.225  15.567  1.00 42.33  ? 4    DA  X C8    1 
ATOM   501  N N7    . DA  B 2 10  ? -2.566  16.834  14.657  1.00 42.01  ? 4    DA  X N7    1 
ATOM   502  C C5    . DA  B 2 10  ? -3.086  15.629  14.203  1.00 40.28  ? 4    DA  X C5    1 
ATOM   503  C C6    . DA  B 2 10  ? -2.641  14.712  13.229  1.00 39.61  ? 4    DA  X C6    1 
ATOM   504  N N6    . DA  B 2 10  ? -1.520  14.879  12.512  1.00 34.85  ? 4    DA  X N6    1 
ATOM   505  N N1    . DA  B 2 10  ? -3.395  13.608  13.015  1.00 36.91  ? 4    DA  X N1    1 
ATOM   506  C C2    . DA  B 2 10  ? -4.513  13.446  13.736  1.00 38.46  ? 4    DA  X C2    1 
ATOM   507  N N3    . DA  B 2 10  ? -5.032  14.235  14.678  1.00 39.71  ? 4    DA  X N3    1 
ATOM   508  C C4    . DA  B 2 10  ? -4.262  15.323  14.864  1.00 40.23  ? 4    DA  X C4    1 
ATOM   509  P P     . DT  B 2 11  ? -7.304  16.402  20.486  1.00 58.87  ? 3    DT  X P     1 
ATOM   510  O OP1   . DT  B 2 11  ? -8.584  16.612  21.209  1.00 60.62  ? 3    DT  X OP1   1 
ATOM   511  O OP2   . DT  B 2 11  ? -6.041  16.981  21.026  1.00 57.65  ? 3    DT  X OP2   1 
ATOM   512  O "O5'" . DT  B 2 11  ? -7.089  14.843  20.292  1.00 57.37  ? 3    DT  X "O5'" 1 
ATOM   513  C "C5'" . DT  B 2 11  ? -6.342  14.375  19.185  1.00 56.21  ? 3    DT  X "C5'" 1 
ATOM   514  C "C4'" . DT  B 2 11  ? -6.812  13.003  18.778  1.00 53.68  ? 3    DT  X "C4'" 1 
ATOM   515  O "O4'" . DT  B 2 11  ? -6.068  12.623  17.604  1.00 51.18  ? 3    DT  X "O4'" 1 
ATOM   516  C "C3'" . DT  B 2 11  ? -6.506  11.940  19.823  1.00 54.23  ? 3    DT  X "C3'" 1 
ATOM   517  O "O3'" . DT  B 2 11  ? -7.505  10.916  19.778  1.00 55.24  ? 3    DT  X "O3'" 1 
ATOM   518  C "C2'" . DT  B 2 11  ? -5.114  11.467  19.441  1.00 50.73  ? 3    DT  X "C2'" 1 
ATOM   519  C "C1'" . DT  B 2 11  ? -5.042  11.699  17.934  1.00 49.08  ? 3    DT  X "C1'" 1 
ATOM   520  N N1    . DT  B 2 11  ? -3.770  12.290  17.472  1.00 47.21  ? 3    DT  X N1    1 
ATOM   521  C C2    . DT  B 2 11  ? -3.088  11.671  16.448  1.00 44.37  ? 3    DT  X C2    1 
ATOM   522  O O2    . DT  B 2 11  ? -3.460  10.637  15.929  1.00 45.20  ? 3    DT  X O2    1 
ATOM   523  N N3    . DT  B 2 11  ? -1.942  12.312  16.055  1.00 43.43  ? 3    DT  X N3    1 
ATOM   524  C C4    . DT  B 2 11  ? -1.415  13.474  16.575  1.00 43.25  ? 3    DT  X C4    1 
ATOM   525  O O4    . DT  B 2 11  ? -0.382  13.937  16.109  1.00 42.36  ? 3    DT  X O4    1 
ATOM   526  C C5    . DT  B 2 11  ? -2.169  14.061  17.661  1.00 44.70  ? 3    DT  X C5    1 
ATOM   527  C C7    . DT  B 2 11  ? -1.663  15.318  18.297  1.00 44.72  ? 3    DT  X C7    1 
ATOM   528  C C6    . DT  B 2 11  ? -3.293  13.447  18.050  1.00 44.24  ? 3    DT  X C6    1 
ATOM   529  P P     . DT  B 2 12  ? -7.237  9.512   20.501  1.00 58.25  ? 2    DT  X P     1 
ATOM   530  O OP1   . DT  B 2 12  ? -8.499  8.728   20.464  1.00 57.69  ? 2    DT  X OP1   1 
ATOM   531  O OP2   . DT  B 2 12  ? -6.535  9.719   21.793  1.00 56.12  ? 2    DT  X OP2   1 
ATOM   532  O "O5'" . DT  B 2 12  ? -6.209  8.836   19.507  1.00 57.20  ? 2    DT  X "O5'" 1 
ATOM   533  C "C5'" . DT  B 2 12  ? -5.562  7.642   19.854  1.00 55.44  ? 2    DT  X "C5'" 1 
ATOM   534  C "C4'" . DT  B 2 12  ? -5.204  6.885   18.603  1.00 52.70  ? 2    DT  X "C4'" 1 
ATOM   535  O "O4'" . DT  B 2 12  ? -4.361  7.715   17.768  1.00 49.96  ? 2    DT  X "O4'" 1 
ATOM   536  C "C3'" . DT  B 2 12  ? -4.398  5.641   18.924  1.00 50.60  ? 2    DT  X "C3'" 1 
ATOM   537  O "O3'" . DT  B 2 12  ? -4.768  4.583   18.053  1.00 50.60  ? 2    DT  X "O3'" 1 
ATOM   538  C "C2'" . DT  B 2 12  ? -2.960  6.089   18.752  1.00 49.59  ? 2    DT  X "C2'" 1 
ATOM   539  C "C1'" . DT  B 2 12  ? -3.046  7.184   17.701  1.00 47.81  ? 2    DT  X "C1'" 1 
ATOM   540  N N1    . DT  B 2 12  ? -2.105  8.293   17.936  1.00 45.84  ? 2    DT  X N1    1 
ATOM   541  C C2    . DT  B 2 12  ? -0.993  8.379   17.133  1.00 43.73  ? 2    DT  X C2    1 
ATOM   542  O O2    . DT  B 2 12  ? -0.733  7.558   16.271  1.00 41.14  ? 2    DT  X O2    1 
ATOM   543  N N3    . DT  B 2 12  ? -0.186  9.460   17.386  1.00 43.69  ? 2    DT  X N3    1 
ATOM   544  C C4    . DT  B 2 12  ? -0.372  10.439  18.347  1.00 45.20  ? 2    DT  X C4    1 
ATOM   545  O O4    . DT  B 2 12  ? 0.426   11.375  18.435  1.00 42.98  ? 2    DT  X O4    1 
ATOM   546  C C5    . DT  B 2 12  ? -1.540  10.265  19.180  1.00 45.73  ? 2    DT  X C5    1 
ATOM   547  C C7    . DT  B 2 12  ? -1.801  11.249  20.276  1.00 47.50  ? 2    DT  X C7    1 
ATOM   548  C C6    . DT  B 2 12  ? -2.341  9.219   18.932  1.00 47.15  ? 2    DT  X C6    1 
ATOM   549  P P     . DT  B 2 13  ? -4.354  3.089   18.429  1.00 50.08  ? 1    DT  X P     1 
ATOM   550  O OP1   . DT  B 2 13  ? -5.266  2.173   17.702  1.00 51.36  ? 1    DT  X OP1   1 
ATOM   551  O OP2   . DT  B 2 13  ? -4.233  2.997   19.908  1.00 51.82  ? 1    DT  X OP2   1 
ATOM   552  O "O5'" . DT  B 2 13  ? -2.897  2.978   17.804  1.00 49.31  ? 1    DT  X "O5'" 1 
ATOM   553  C "C5'" . DT  B 2 13  ? -2.696  3.261   16.431  1.00 43.14  ? 1    DT  X "C5'" 1 
ATOM   554  C "C4'" . DT  B 2 13  ? -1.235  3.152   16.080  1.00 41.70  ? 1    DT  X "C4'" 1 
ATOM   555  O "O4'" . DT  B 2 13  ? -0.528  4.378   16.380  1.00 42.02  ? 1    DT  X "O4'" 1 
ATOM   556  C "C3'" . DT  B 2 13  ? -0.460  2.019   16.754  1.00 40.01  ? 1    DT  X "C3'" 1 
ATOM   557  O "O3'" . DT  B 2 13  ? 0.231   1.309   15.735  1.00 40.05  ? 1    DT  X "O3'" 1 
ATOM   558  C "C2'" . DT  B 2 13  ? 0.506   2.743   17.682  1.00 39.62  ? 1    DT  X "C2'" 1 
ATOM   559  C "C1'" . DT  B 2 13  ? 0.720   4.072   16.972  1.00 39.82  ? 1    DT  X "C1'" 1 
ATOM   560  N N1    . DT  B 2 13  ? 1.086   5.214   17.834  1.00 40.16  ? 1    DT  X N1    1 
ATOM   561  C C2    . DT  B 2 13  ? 2.201   5.957   17.500  1.00 38.17  ? 1    DT  X C2    1 
ATOM   562  O O2    . DT  B 2 13  ? 2.939   5.680   16.566  1.00 36.08  ? 1    DT  X O2    1 
ATOM   563  N N3    . DT  B 2 13  ? 2.426   7.040   18.312  1.00 37.67  ? 1    DT  X N3    1 
ATOM   564  C C4    . DT  B 2 13  ? 1.683   7.435   19.411  1.00 38.57  ? 1    DT  X C4    1 
ATOM   565  O O4    . DT  B 2 13  ? 1.998   8.450   20.032  1.00 36.54  ? 1    DT  X O4    1 
ATOM   566  C C5    . DT  B 2 13  ? 0.559   6.586   19.729  1.00 38.89  ? 1    DT  X C5    1 
ATOM   567  C C7    . DT  B 2 13  ? -0.273  6.907   20.930  1.00 38.30  ? 1    DT  X C7    1 
ATOM   568  C C6    . DT  B 2 13  ? 0.315   5.537   18.931  1.00 39.31  ? 1    DT  X C6    1 
ATOM   569  P P     . DT  B 2 14  ? 1.199   0.092   16.107  1.00 39.65  ? -1   DT  X P     1 
ATOM   570  O OP1   . DT  B 2 14  ? 0.970   -0.946  15.072  1.00 38.87  ? -1   DT  X OP1   1 
ATOM   571  O OP2   . DT  B 2 14  ? 1.076   -0.258  17.549  1.00 39.72  ? -1   DT  X OP2   1 
ATOM   572  O "O5'" . DT  B 2 14  ? 2.631   0.724   15.834  1.00 40.65  ? -1   DT  X "O5'" 1 
ATOM   573  C "C5'" . DT  B 2 14  ? 2.837   1.495   14.656  1.00 41.00  ? -1   DT  X "C5'" 1 
ATOM   574  C "C4'" . DT  B 2 14  ? 4.255   2.001   14.598  1.00 42.75  ? -1   DT  X "C4'" 1 
ATOM   575  O "O4'" . DT  B 2 14  ? 4.421   3.132   15.482  1.00 41.44  ? -1   DT  X "O4'" 1 
ATOM   576  C "C3'" . DT  B 2 14  ? 5.324   0.978   14.981  1.00 42.88  ? -1   DT  X "C3'" 1 
ATOM   577  O "O3'" . DT  B 2 14  ? 6.380   1.037   14.020  1.00 44.97  ? -1   DT  X "O3'" 1 
ATOM   578  C "C2'" . DT  B 2 14  ? 5.778   1.434   16.362  1.00 43.07  ? -1   DT  X "C2'" 1 
ATOM   579  C "C1'" . DT  B 2 14  ? 5.559   2.942   16.309  1.00 42.73  ? -1   DT  X "C1'" 1 
ATOM   580  N N1    . DT  B 2 14  ? 5.278   3.604   17.601  1.00 40.59  ? -1   DT  X N1    1 
ATOM   581  C C2    . DT  B 2 14  ? 5.977   4.751   17.916  1.00 40.51  ? -1   DT  X C2    1 
ATOM   582  O O2    . DT  B 2 14  ? 6.862   5.210   17.218  1.00 39.53  ? -1   DT  X O2    1 
ATOM   583  N N3    . DT  B 2 14  ? 5.601   5.343   19.090  1.00 39.80  ? -1   DT  X N3    1 
ATOM   584  C C4    . DT  B 2 14  ? 4.630   4.911   19.969  1.00 41.71  ? -1   DT  X C4    1 
ATOM   585  O O4    . DT  B 2 14  ? 4.383   5.568   20.974  1.00 41.71  ? -1   DT  X O4    1 
ATOM   586  C C5    . DT  B 2 14  ? 3.965   3.681   19.599  1.00 41.53  ? -1   DT  X C5    1 
ATOM   587  C C7    . DT  B 2 14  ? 2.917   3.119   20.505  1.00 41.71  ? -1   DT  X C7    1 
ATOM   588  C C6    . DT  B 2 14  ? 4.320   3.097   18.450  1.00 41.43  ? -1   DT  X C6    1 
ATOM   589  P P     . DT  B 2 15  ? 7.668   0.089   14.179  1.00 46.55  ? -2   DT  X P     1 
ATOM   590  O OP1   . DT  B 2 15  ? 8.040   -0.407  12.827  1.00 46.97  ? -2   DT  X OP1   1 
ATOM   591  O OP2   . DT  B 2 15  ? 7.414   -0.875  15.274  1.00 46.07  ? -2   DT  X OP2   1 
ATOM   592  O "O5'" . DT  B 2 15  ? 8.803   1.112   14.628  1.00 49.99  ? -2   DT  X "O5'" 1 
ATOM   593  C "C5'" . DT  B 2 15  ? 8.963   2.345   13.930  1.00 53.04  ? -2   DT  X "C5'" 1 
ATOM   594  C "C4'" . DT  B 2 15  ? 10.057  3.172   14.559  1.00 56.52  ? -2   DT  X "C4'" 1 
ATOM   595  O "O4'" . DT  B 2 15  ? 9.605   3.782   15.793  1.00 55.42  ? -2   DT  X "O4'" 1 
ATOM   596  C "C3'" . DT  B 2 15  ? 11.324  2.391   14.899  1.00 59.58  ? -2   DT  X "C3'" 1 
ATOM   597  O "O3'" . DT  B 2 15  ? 12.463  3.147   14.490  1.00 67.07  ? -2   DT  X "O3'" 1 
ATOM   598  C "C2'" . DT  B 2 15  ? 11.261  2.234   16.411  1.00 57.21  ? -2   DT  X "C2'" 1 
ATOM   599  C "C1'" . DT  B 2 15  ? 10.506  3.479   16.851  1.00 54.86  ? -2   DT  X "C1'" 1 
ATOM   600  N N1    . DT  B 2 15  ? 9.706   3.331   18.089  1.00 52.59  ? -2   DT  X N1    1 
ATOM   601  C C2    . DT  B 2 15  ? 9.728   4.365   19.006  1.00 51.83  ? -2   DT  X C2    1 
ATOM   602  O O2    . DT  B 2 15  ? 10.412  5.368   18.871  1.00 52.32  ? -2   DT  X O2    1 
ATOM   603  N N3    . DT  B 2 15  ? 8.915   4.178   20.098  1.00 49.81  ? -2   DT  X N3    1 
ATOM   604  C C4    . DT  B 2 15  ? 8.111   3.086   20.365  1.00 49.18  ? -2   DT  X C4    1 
ATOM   605  O O4    . DT  B 2 15  ? 7.416   3.071   21.378  1.00 45.83  ? -2   DT  X O4    1 
ATOM   606  C C5    . DT  B 2 15  ? 8.162   2.028   19.383  1.00 49.22  ? -2   DT  X C5    1 
ATOM   607  C C7    . DT  B 2 15  ? 7.342   0.796   19.606  1.00 48.24  ? -2   DT  X C7    1 
ATOM   608  C C6    . DT  B 2 15  ? 8.947   2.200   18.308  1.00 50.73  ? -2   DT  X C6    1 
ATOM   609  P P     . DC  B 2 16  ? 13.934  2.556   14.721  1.00 72.00  ? -3   DC  X P     1 
ATOM   610  O OP1   . DC  B 2 16  ? 14.791  3.068   13.622  1.00 72.08  ? -3   DC  X OP1   1 
ATOM   611  O OP2   . DC  B 2 16  ? 13.838  1.093   14.960  1.00 72.59  ? -3   DC  X OP2   1 
ATOM   612  O "O5'" . DC  B 2 16  ? 14.378  3.251   16.078  1.00 74.88  ? -3   DC  X "O5'" 1 
ATOM   613  C "C5'" . DC  B 2 16  ? 14.423  4.670   16.183  1.00 80.08  ? -3   DC  X "C5'" 1 
ATOM   614  C "C4'" . DC  B 2 16  ? 15.011  5.060   17.514  1.00 84.25  ? -3   DC  X "C4'" 1 
ATOM   615  O "O4'" . DC  B 2 16  ? 14.014  4.930   18.557  1.00 84.24  ? -3   DC  X "O4'" 1 
ATOM   616  C "C3'" . DC  B 2 16  ? 16.176  4.158   17.922  1.00 86.70  ? -3   DC  X "C3'" 1 
ATOM   617  O "O3'" . DC  B 2 16  ? 17.187  4.926   18.572  1.00 91.44  ? -3   DC  X "O3'" 1 
ATOM   618  C "C2'" . DC  B 2 16  ? 15.539  3.194   18.906  1.00 85.66  ? -3   DC  X "C2'" 1 
ATOM   619  C "C1'" . DC  B 2 16  ? 14.516  4.089   19.582  1.00 84.27  ? -3   DC  X "C1'" 1 
ATOM   620  N N1    . DC  B 2 16  ? 13.376  3.396   20.207  1.00 83.03  ? -3   DC  X N1    1 
ATOM   621  C C2    . DC  B 2 16  ? 12.733  4.010   21.287  1.00 82.53  ? -3   DC  X C2    1 
ATOM   622  O O2    . DC  B 2 16  ? 13.136  5.118   21.672  1.00 82.71  ? -3   DC  X O2    1 
ATOM   623  N N3    . DC  B 2 16  ? 11.691  3.384   21.881  1.00 81.69  ? -3   DC  X N3    1 
ATOM   624  C C4    . DC  B 2 16  ? 11.286  2.194   21.434  1.00 81.13  ? -3   DC  X C4    1 
ATOM   625  N N4    . DC  B 2 16  ? 10.256  1.614   22.052  1.00 81.03  ? -3   DC  X N4    1 
ATOM   626  C C5    . DC  B 2 16  ? 11.920  1.547   20.333  1.00 81.57  ? -3   DC  X C5    1 
ATOM   627  C C6    . DC  B 2 16  ? 12.951  2.177   19.754  1.00 82.66  ? -3   DC  X C6    1 
ATOM   628  P P     . DG  B 2 17  ? 18.732  4.544   18.364  1.00 94.46  ? -4   DG  X P     1 
ATOM   629  O OP1   . DG  B 2 17  ? 19.267  5.429   17.296  1.00 94.35  ? -4   DG  X OP1   1 
ATOM   630  O OP2   . DG  B 2 17  ? 18.845  3.068   18.223  1.00 94.24  ? -4   DG  X OP2   1 
ATOM   631  O "O5'" . DG  B 2 17  ? 19.396  4.970   19.744  1.00 94.70  ? -4   DG  X "O5'" 1 
ATOM   632  C "C5'" . DG  B 2 17  ? 19.118  6.241   20.323  1.00 95.65  ? -4   DG  X "C5'" 1 
ATOM   633  C "C4'" . DG  B 2 17  ? 19.005  6.108   21.823  1.00 96.72  ? -4   DG  X "C4'" 1 
ATOM   634  O "O4'" . DG  B 2 17  ? 17.766  5.435   22.163  1.00 96.59  ? -4   DG  X "O4'" 1 
ATOM   635  C "C3'" . DG  B 2 17  ? 20.126  5.274   22.444  1.00 97.67  ? -4   DG  X "C3'" 1 
ATOM   636  O "O3'" . DG  B 2 17  ? 20.537  5.832   23.692  1.00 98.52  ? -4   DG  X "O3'" 1 
ATOM   637  C "C2'" . DG  B 2 17  ? 19.476  3.922   22.668  1.00 97.25  ? -4   DG  X "C2'" 1 
ATOM   638  C "C1'" . DG  B 2 17  ? 18.044  4.312   22.985  1.00 96.35  ? -4   DG  X "C1'" 1 
ATOM   639  N N9    . DG  B 2 17  ? 17.060  3.275   22.690  1.00 95.30  ? -4   DG  X N9    1 
ATOM   640  C C8    . DG  B 2 17  ? 17.071  2.400   21.631  1.00 94.66  ? -4   DG  X C8    1 
ATOM   641  N N7    . DG  B 2 17  ? 16.066  1.567   21.645  1.00 94.33  ? -4   DG  X N7    1 
ATOM   642  C C5    . DG  B 2 17  ? 15.345  1.915   22.780  1.00 94.08  ? -4   DG  X C5    1 
ATOM   643  C C6    . DG  B 2 17  ? 14.155  1.358   23.323  1.00 94.08  ? -4   DG  X C6    1 
ATOM   644  O O6    . DG  B 2 17  ? 13.480  0.412   22.896  1.00 94.62  ? -4   DG  X O6    1 
ATOM   645  N N1    . DG  B 2 17  ? 13.768  2.016   24.486  1.00 93.08  ? -4   DG  X N1    1 
ATOM   646  C C2    . DG  B 2 17  ? 14.436  3.068   25.057  1.00 93.03  ? -4   DG  X C2    1 
ATOM   647  N N2    . DG  B 2 17  ? 13.901  3.564   26.179  1.00 92.60  ? -4   DG  X N2    1 
ATOM   648  N N3    . DG  B 2 17  ? 15.547  3.594   24.565  1.00 93.38  ? -4   DG  X N3    1 
ATOM   649  C C4    . DG  B 2 17  ? 15.942  2.972   23.433  1.00 94.28  ? -4   DG  X C4    1 
ATOM   650  P P     . DA  B 2 18  ? 21.978  5.457   24.290  1.00 99.01  ? -5   DA  X P     1 
ATOM   651  O OP1   . DA  B 2 18  ? 22.792  6.701   24.297  1.00 99.03  ? -5   DA  X OP1   1 
ATOM   652  O OP2   . DA  B 2 18  ? 22.482  4.251   23.583  1.00 99.56  ? -5   DA  X OP2   1 
ATOM   653  O "O5'" . DA  B 2 18  ? 21.664  5.055   25.796  1.00 98.65  ? -5   DA  X "O5'" 1 
ATOM   654  C "C5'" . DA  B 2 18  ? 21.013  5.970   26.671  1.00 98.73  ? -5   DA  X "C5'" 1 
ATOM   655  C "C4'" . DA  B 2 18  ? 20.330  5.222   27.790  1.00 98.38  ? -5   DA  X "C4'" 1 
ATOM   656  O "O4'" . DA  B 2 18  ? 19.247  4.428   27.246  1.00 97.77  ? -5   DA  X "O4'" 1 
ATOM   657  C "C3'" . DA  B 2 18  ? 21.236  4.243   28.540  1.00 98.62  ? -5   DA  X "C3'" 1 
ATOM   658  O "O3'" . DA  B 2 18  ? 20.890  4.234   29.925  1.00 99.23  ? -5   DA  X "O3'" 1 
ATOM   659  C "C2'" . DA  B 2 18  ? 20.886  2.903   27.920  1.00 97.94  ? -5   DA  X "C2'" 1 
ATOM   660  C "C1'" . DA  B 2 18  ? 19.406  3.075   27.643  1.00 96.85  ? -5   DA  X "C1'" 1 
ATOM   661  N N9    . DA  B 2 18  ? 18.889  2.219   26.576  1.00 95.41  ? -5   DA  X N9    1 
ATOM   662  C C8    . DA  B 2 18  ? 19.456  1.935   25.358  1.00 94.47  ? -5   DA  X C8    1 
ATOM   663  N N7    . DA  B 2 18  ? 18.753  1.102   24.630  1.00 93.71  ? -5   DA  X N7    1 
ATOM   664  C C5    . DA  B 2 18  ? 17.648  0.821   25.420  1.00 93.47  ? -5   DA  X C5    1 
ATOM   665  C C6    . DA  B 2 18  ? 16.528  -0.004  25.223  1.00 93.12  ? -5   DA  X C6    1 
ATOM   666  N N6    . DA  B 2 18  ? 16.334  -0.739  24.126  1.00 93.34  ? -5   DA  X N6    1 
ATOM   667  N N1    . DA  B 2 18  ? 15.603  -0.052  26.205  1.00 92.54  ? -5   DA  X N1    1 
ATOM   668  C C2    . DA  B 2 18  ? 15.802  0.678   27.309  1.00 92.48  ? -5   DA  X C2    1 
ATOM   669  N N3    . DA  B 2 18  ? 16.814  1.483   27.614  1.00 93.07  ? -5   DA  X N3    1 
ATOM   670  C C4    . DA  B 2 18  ? 17.714  1.510   26.616  1.00 94.17  ? -5   DA  X C4    1 
ATOM   671  P P     . DA  B 2 19  ? 21.832  3.474   30.983  1.00 99.37  ? -6   DA  X P     1 
ATOM   672  O OP1   . DA  B 2 19  ? 22.880  4.429   31.424  1.00 99.52  ? -6   DA  X OP1   1 
ATOM   673  O OP2   . DA  B 2 19  ? 22.227  2.156   30.422  1.00 99.02  ? -6   DA  X OP2   1 
ATOM   674  O "O5'" . DA  B 2 19  ? 20.849  3.224   32.208  1.00 98.53  ? -6   DA  X "O5'" 1 
ATOM   675  C "C5'" . DA  B 2 19  ? 19.782  4.132   32.473  1.00 96.54  ? -6   DA  X "C5'" 1 
ATOM   676  C "C4'" . DA  B 2 19  ? 18.559  3.375   32.931  1.00 94.83  ? -6   DA  X "C4'" 1 
ATOM   677  O "O4'" . DA  B 2 19  ? 17.995  2.625   31.828  1.00 93.63  ? -6   DA  X "O4'" 1 
ATOM   678  C "C3'" . DA  B 2 19  ? 18.849  2.356   34.030  1.00 94.16  ? -6   DA  X "C3'" 1 
ATOM   679  O "O3'" . DA  B 2 19  ? 17.784  2.339   34.976  1.00 94.03  ? -6   DA  X "O3'" 1 
ATOM   680  C "C2'" . DA  B 2 19  ? 18.922  1.038   33.282  1.00 93.46  ? -6   DA  X "C2'" 1 
ATOM   681  C "C1'" . DA  B 2 19  ? 17.917  1.247   32.166  1.00 92.35  ? -6   DA  X "C1'" 1 
ATOM   682  N N9    . DA  B 2 19  ? 18.195  0.472   30.956  1.00 90.21  ? -6   DA  X N9    1 
ATOM   683  C C8    . DA  B 2 19  ? 19.267  0.591   30.106  1.00 89.67  ? -6   DA  X C8    1 
ATOM   684  N N7    . DA  B 2 19  ? 19.236  -0.242  29.094  1.00 88.52  ? -6   DA  X N7    1 
ATOM   685  C C5    . DA  B 2 19  ? 18.065  -0.960  29.291  1.00 87.97  ? -6   DA  X C5    1 
ATOM   686  C C6    . DA  B 2 19  ? 17.456  -1.996  28.560  1.00 87.09  ? -6   DA  X C6    1 
ATOM   687  N N6    . DA  B 2 19  ? 17.962  -2.507  27.434  1.00 85.71  ? -6   DA  X N6    1 
ATOM   688  N N1    . DA  B 2 19  ? 16.291  -2.494  29.030  1.00 86.67  ? -6   DA  X N1    1 
ATOM   689  C C2    . DA  B 2 19  ? 15.782  -1.980  30.158  1.00 86.76  ? -6   DA  X C2    1 
ATOM   690  N N3    . DA  B 2 19  ? 16.258  -1.007  30.931  1.00 87.25  ? -6   DA  X N3    1 
ATOM   691  C C4    . DA  B 2 19  ? 17.415  -0.533  30.437  1.00 88.70  ? -6   DA  X C4    1 
ATOM   692  P P     . DA  B 2 20  ? 17.934  1.469   36.310  1.00 94.34  ? -7   DA  X P     1 
ATOM   693  O OP1   . DA  B 2 20  ? 17.169  2.148   37.387  1.00 94.59  ? -7   DA  X OP1   1 
ATOM   694  O OP2   . DA  B 2 20  ? 19.376  1.176   36.505  1.00 94.68  ? -7   DA  X OP2   1 
ATOM   695  O "O5'" . DA  B 2 20  ? 17.201  0.105   35.943  1.00 95.56  ? -7   DA  X "O5'" 1 
ATOM   696  C "C5'" . DA  B 2 20  ? 15.795  0.070   35.718  1.00 96.13  ? -7   DA  X "C5'" 1 
ATOM   697  C "C4'" . DA  B 2 20  ? 15.335  -1.357  35.543  1.00 96.57  ? -7   DA  X "C4'" 1 
ATOM   698  O "O4'" . DA  B 2 20  ? 15.848  -1.870  34.290  1.00 97.00  ? -7   DA  X "O4'" 1 
ATOM   699  C "C3'" . DA  B 2 20  ? 15.834  -2.312  36.627  1.00 96.42  ? -7   DA  X "C3'" 1 
ATOM   700  O "O3'" . DA  B 2 20  ? 14.826  -3.277  36.935  1.00 96.66  ? -7   DA  X "O3'" 1 
ATOM   701  C "C2'" . DA  B 2 20  ? 17.038  -2.974  35.983  1.00 96.63  ? -7   DA  X "C2'" 1 
ATOM   702  C "C1'" . DA  B 2 20  ? 16.637  -3.028  34.520  1.00 96.71  ? -7   DA  X "C1'" 1 
ATOM   703  N N9    . DA  B 2 20  ? 17.764  -2.995  33.588  1.00 96.89  ? -7   DA  X N9    1 
ATOM   704  C C8    . DA  B 2 20  ? 18.944  -2.301  33.711  1.00 97.22  ? -7   DA  X C8    1 
ATOM   705  N N7    . DA  B 2 20  ? 19.768  -2.477  32.707  1.00 96.99  ? -7   DA  X N7    1 
ATOM   706  C C5    . DA  B 2 20  ? 19.087  -3.345  31.865  1.00 96.96  ? -7   DA  X C5    1 
ATOM   707  C C6    . DA  B 2 20  ? 19.423  -3.922  30.627  1.00 97.15  ? -7   DA  X C6    1 
ATOM   708  N N6    . DA  B 2 20  ? 20.580  -3.703  29.996  1.00 97.19  ? -7   DA  X N6    1 
ATOM   709  N N1    . DA  B 2 20  ? 18.519  -4.744  30.052  1.00 97.17  ? -7   DA  X N1    1 
ATOM   710  C C2    . DA  B 2 20  ? 17.359  -4.965  30.685  1.00 96.89  ? -7   DA  X C2    1 
ATOM   711  N N3    . DA  B 2 20  ? 16.928  -4.482  31.849  1.00 96.75  ? -7   DA  X N3    1 
ATOM   712  C C4    . DA  B 2 20  ? 17.850  -3.670  32.394  1.00 96.76  ? -7   DA  X C4    1 
ATOM   713  P P     . DT  B 2 21  ? 15.142  -4.457  37.979  1.00 96.52  ? -8   DT  X P     1 
ATOM   714  O OP1   . DT  B 2 21  ? 13.929  -4.638  38.818  1.00 96.66  ? -8   DT  X OP1   1 
ATOM   715  O OP2   . DT  B 2 21  ? 16.448  -4.173  38.632  1.00 96.70  ? -8   DT  X OP2   1 
ATOM   716  O "O5'" . DT  B 2 21  ? 15.308  -5.741  37.048  1.00 95.12  ? -8   DT  X "O5'" 1 
ATOM   717  C "C5'" . DT  B 2 21  ? 14.309  -6.073  36.083  1.00 92.90  ? -8   DT  X "C5'" 1 
ATOM   718  C "C4'" . DT  B 2 21  ? 14.721  -7.288  35.283  1.00 91.84  ? -8   DT  X "C4'" 1 
ATOM   719  O "O4'" . DT  B 2 21  ? 15.810  -6.959  34.385  1.00 90.64  ? -8   DT  X "O4'" 1 
ATOM   720  C "C3'" . DT  B 2 21  ? 15.200  -8.482  36.109  1.00 91.63  ? -8   DT  X "C3'" 1 
ATOM   721  O "O3'" . DT  B 2 21  ? 14.877  -9.700  35.436  1.00 91.98  ? -8   DT  X "O3'" 1 
ATOM   722  C "C2'" . DT  B 2 21  ? 16.710  -8.356  36.035  1.00 90.92  ? -8   DT  X "C2'" 1 
ATOM   723  C "C1'" . DT  B 2 21  ? 16.904  -7.833  34.622  1.00 89.96  ? -8   DT  X "C1'" 1 
ATOM   724  N N1    . DT  B 2 21  ? 18.154  -7.076  34.408  1.00 88.76  ? -8   DT  X N1    1 
ATOM   725  C C2    . DT  B 2 21  ? 18.850  -7.286  33.237  1.00 88.25  ? -8   DT  X C2    1 
ATOM   726  O O2    . DT  B 2 21  ? 18.471  -8.047  32.362  1.00 87.29  ? -8   DT  X O2    1 
ATOM   727  N N3    . DT  B 2 21  ? 20.013  -6.564  33.126  1.00 88.10  ? -8   DT  X N3    1 
ATOM   728  C C4    . DT  B 2 21  ? 20.532  -5.669  34.044  1.00 88.62  ? -8   DT  X C4    1 
ATOM   729  O O4    . DT  B 2 21  ? 21.593  -5.099  33.812  1.00 89.41  ? -8   DT  X O4    1 
ATOM   730  C C5    . DT  B 2 21  ? 19.744  -5.487  35.239  1.00 88.63  ? -8   DT  X C5    1 
ATOM   731  C C7    . DT  B 2 21  ? 20.222  -4.527  36.282  1.00 88.49  ? -8   DT  X C7    1 
ATOM   732  C C6    . DT  B 2 21  ? 18.611  -6.190  35.361  1.00 88.88  ? -8   DT  X C6    1 
ATOM   733  O "O5'" . DT  C 1 2   ? 5.031   0.602   -60.843 1.00 125.31 ? -7   DT  Y "O5'" 1 
ATOM   734  C "C5'" . DT  C 1 2   ? 5.338   1.563   -61.857 1.00 125.63 ? -7   DT  Y "C5'" 1 
ATOM   735  C "C4'" . DT  C 1 2   ? 4.135   2.384   -62.258 1.00 125.53 ? -7   DT  Y "C4'" 1 
ATOM   736  O "O4'" . DT  C 1 2   ? 3.084   1.502   -62.723 1.00 125.81 ? -7   DT  Y "O4'" 1 
ATOM   737  C "C3'" . DT  C 1 2   ? 3.517   3.208   -61.127 1.00 125.36 ? -7   DT  Y "C3'" 1 
ATOM   738  O "O3'" . DT  C 1 2   ? 3.009   4.444   -61.641 1.00 124.91 ? -7   DT  Y "O3'" 1 
ATOM   739  C "C2'" . DT  C 1 2   ? 2.367   2.339   -60.655 1.00 125.41 ? -7   DT  Y "C2'" 1 
ATOM   740  C "C1'" . DT  C 1 2   ? 1.907   1.705   -61.953 1.00 125.51 ? -7   DT  Y "C1'" 1 
ATOM   741  N N1    . DT  C 1 2   ? 1.244   0.402   -61.789 1.00 125.25 ? -7   DT  Y N1    1 
ATOM   742  C C2    . DT  C 1 2   ? -0.023  0.252   -62.302 1.00 124.91 ? -7   DT  Y C2    1 
ATOM   743  O O2    . DT  C 1 2   ? -0.621  1.149   -62.875 1.00 124.30 ? -7   DT  Y O2    1 
ATOM   744  N N3    . DT  C 1 2   ? -0.569  -0.994  -62.118 1.00 125.02 ? -7   DT  Y N3    1 
ATOM   745  C C4    . DT  C 1 2   ? 0.013   -2.077  -61.486 1.00 125.11 ? -7   DT  Y C4    1 
ATOM   746  O O4    . DT  C 1 2   ? -0.599  -3.139  -61.403 1.00 125.22 ? -7   DT  Y O4    1 
ATOM   747  C C5    . DT  C 1 2   ? 1.340   -1.846  -60.965 1.00 125.16 ? -7   DT  Y C5    1 
ATOM   748  C C7    . DT  C 1 2   ? 2.048   -2.958  -60.259 1.00 125.09 ? -7   DT  Y C7    1 
ATOM   749  C C6    . DT  C 1 2   ? 1.882   -0.634  -61.141 1.00 125.26 ? -7   DT  Y C6    1 
ATOM   750  P P     . DT  C 1 3   ? 2.549   5.600   -60.623 1.00 124.80 ? -6   DT  Y P     1 
ATOM   751  O OP1   . DT  C 1 3   ? 3.491   6.742   -60.751 1.00 124.47 ? -6   DT  Y OP1   1 
ATOM   752  O OP2   . DT  C 1 3   ? 2.335   4.971   -59.294 1.00 124.55 ? -6   DT  Y OP2   1 
ATOM   753  O "O5'" . DT  C 1 3   ? 1.129   6.059   -61.180 1.00 122.99 ? -6   DT  Y "O5'" 1 
ATOM   754  C "C5'" . DT  C 1 3   ? 0.182   6.694   -60.323 1.00 120.44 ? -6   DT  Y "C5'" 1 
ATOM   755  C "C4'" . DT  C 1 3   ? -1.145  6.841   -61.029 1.00 118.40 ? -6   DT  Y "C4'" 1 
ATOM   756  O "O4'" . DT  C 1 3   ? -1.573  5.546   -61.516 1.00 117.51 ? -6   DT  Y "O4'" 1 
ATOM   757  C "C3'" . DT  C 1 3   ? -2.274  7.347   -60.131 1.00 117.67 ? -6   DT  Y "C3'" 1 
ATOM   758  O "O3'" . DT  C 1 3   ? -3.136  8.225   -60.861 1.00 116.81 ? -6   DT  Y "O3'" 1 
ATOM   759  C "C2'" . DT  C 1 3   ? -3.007  6.079   -59.737 1.00 117.12 ? -6   DT  Y "C2'" 1 
ATOM   760  C "C1'" . DT  C 1 3   ? -2.838  5.206   -60.967 1.00 116.37 ? -6   DT  Y "C1'" 1 
ATOM   761  N N1    . DT  C 1 3   ? -2.831  3.762   -60.673 1.00 115.15 ? -6   DT  Y N1    1 
ATOM   762  C C2    . DT  C 1 3   ? -3.839  2.982   -61.195 1.00 114.56 ? -6   DT  Y C2    1 
ATOM   763  O O2    . DT  C 1 3   ? -4.732  3.426   -61.897 1.00 114.44 ? -6   DT  Y O2    1 
ATOM   764  N N3    . DT  C 1 3   ? -3.762  1.652   -60.863 1.00 113.73 ? -6   DT  Y N3    1 
ATOM   765  C C4    . DT  C 1 3   ? -2.800  1.041   -60.082 1.00 113.30 ? -6   DT  Y C4    1 
ATOM   766  O O4    . DT  C 1 3   ? -2.863  -0.165  -59.866 1.00 112.69 ? -6   DT  Y O4    1 
ATOM   767  C C5    . DT  C 1 3   ? -1.771  1.917   -59.572 1.00 113.51 ? -6   DT  Y C5    1 
ATOM   768  C C7    . DT  C 1 3   ? -0.687  1.342   -58.718 1.00 113.55 ? -6   DT  Y C7    1 
ATOM   769  C C6    . DT  C 1 3   ? -1.837  3.216   -59.890 1.00 114.29 ? -6   DT  Y C6    1 
ATOM   770  P P     . DT  C 1 4   ? -4.469  8.790   -60.162 1.00 116.19 ? -5   DT  Y P     1 
ATOM   771  O OP1   . DT  C 1 4   ? -4.914  9.977   -60.938 1.00 116.31 ? -5   DT  Y OP1   1 
ATOM   772  O OP2   . DT  C 1 4   ? -4.222  8.918   -58.702 1.00 116.06 ? -5   DT  Y OP2   1 
ATOM   773  O "O5'" . DT  C 1 4   ? -5.530  7.626   -60.395 1.00 113.89 ? -5   DT  Y "O5'" 1 
ATOM   774  C "C5'" . DT  C 1 4   ? -6.053  7.375   -61.696 1.00 110.20 ? -5   DT  Y "C5'" 1 
ATOM   775  C "C4'" . DT  C 1 4   ? -7.347  6.602   -61.598 1.00 107.65 ? -5   DT  Y "C4'" 1 
ATOM   776  O "O4'" . DT  C 1 4   ? -7.073  5.222   -61.256 1.00 106.76 ? -5   DT  Y "O4'" 1 
ATOM   777  C "C3'" . DT  C 1 4   ? -8.314  7.122   -60.535 1.00 106.41 ? -5   DT  Y "C3'" 1 
ATOM   778  O "O3'" . DT  C 1 4   ? -9.656  7.083   -61.027 1.00 105.02 ? -5   DT  Y "O3'" 1 
ATOM   779  C "C2'" . DT  C 1 4   ? -8.138  6.143   -59.388 1.00 105.83 ? -5   DT  Y "C2'" 1 
ATOM   780  C "C1'" . DT  C 1 4   ? -7.835  4.848   -60.118 1.00 105.38 ? -5   DT  Y "C1'" 1 
ATOM   781  N N1    . DT  C 1 4   ? -7.046  3.870   -59.344 1.00 103.81 ? -5   DT  Y N1    1 
ATOM   782  C C2    . DT  C 1 4   ? -7.490  2.568   -59.301 1.00 103.01 ? -5   DT  Y C2    1 
ATOM   783  O O2    . DT  C 1 4   ? -8.499  2.188   -59.873 1.00 103.08 ? -5   DT  Y O2    1 
ATOM   784  N N3    . DT  C 1 4   ? -6.706  1.720   -58.560 1.00 102.34 ? -5   DT  Y N3    1 
ATOM   785  C C4    . DT  C 1 4   ? -5.551  2.037   -57.873 1.00 102.12 ? -5   DT  Y C4    1 
ATOM   786  O O4    . DT  C 1 4   ? -4.952  1.166   -57.249 1.00 101.20 ? -5   DT  Y O4    1 
ATOM   787  C C5    . DT  C 1 4   ? -5.142  3.419   -57.961 1.00 102.49 ? -5   DT  Y C5    1 
ATOM   788  C C7    . DT  C 1 4   ? -3.902  3.855   -57.248 1.00 102.92 ? -5   DT  Y C7    1 
ATOM   789  C C6    . DT  C 1 4   ? -5.899  4.255   -58.683 1.00 103.12 ? -5   DT  Y C6    1 
ATOM   790  P P     . DC  C 1 5   ? -10.868 7.521   -60.068 1.00 104.25 ? -4   DC  Y P     1 
ATOM   791  O OP1   . DC  C 1 5   ? -11.889 8.200   -60.909 1.00 103.76 ? -4   DC  Y OP1   1 
ATOM   792  O OP2   . DC  C 1 5   ? -10.306 8.224   -58.884 1.00 103.94 ? -4   DC  Y OP2   1 
ATOM   793  O "O5'" . DC  C 1 5   ? -11.469 6.129   -59.583 1.00 102.49 ? -4   DC  Y "O5'" 1 
ATOM   794  C "C5'" . DC  C 1 5   ? -11.971 5.187   -60.529 1.00 99.56  ? -4   DC  Y "C5'" 1 
ATOM   795  C "C4'" . DC  C 1 5   ? -12.648 4.042   -59.814 1.00 97.36  ? -4   DC  Y "C4'" 1 
ATOM   796  O "O4'" . DC  C 1 5   ? -11.654 3.205   -59.174 1.00 96.03  ? -4   DC  Y "O4'" 1 
ATOM   797  C "C3'" . DC  C 1 5   ? -13.607 4.485   -58.711 1.00 96.25  ? -4   DC  Y "C3'" 1 
ATOM   798  O "O3'" . DC  C 1 5   ? -14.748 3.628   -58.676 1.00 95.56  ? -4   DC  Y "O3'" 1 
ATOM   799  C "C2'" . DC  C 1 5   ? -12.785 4.315   -57.447 1.00 95.56  ? -4   DC  Y "C2'" 1 
ATOM   800  C "C1'" . DC  C 1 5   ? -11.923 3.111   -57.785 1.00 94.87  ? -4   DC  Y "C1'" 1 
ATOM   801  N N1    . DC  C 1 5   ? -10.634 3.063   -57.076 1.00 93.70  ? -4   DC  Y N1    1 
ATOM   802  C C2    . DC  C 1 5   ? -10.174 1.831   -56.598 1.00 92.81  ? -4   DC  Y C2    1 
ATOM   803  O O2    . DC  C 1 5   ? -10.861 0.818   -56.795 1.00 92.34  ? -4   DC  Y O2    1 
ATOM   804  N N3    . DC  C 1 5   ? -8.996  1.776   -55.936 1.00 91.98  ? -4   DC  Y N3    1 
ATOM   805  C C4    . DC  C 1 5   ? -8.284  2.889   -55.749 1.00 91.84  ? -4   DC  Y C4    1 
ATOM   806  N N4    . DC  C 1 5   ? -7.128  2.788   -55.090 1.00 91.62  ? -4   DC  Y N4    1 
ATOM   807  C C5    . DC  C 1 5   ? -8.725  4.156   -56.230 1.00 92.16  ? -4   DC  Y C5    1 
ATOM   808  C C6    . DC  C 1 5   ? -9.895  4.197   -56.882 1.00 93.07  ? -4   DC  Y C6    1 
ATOM   809  P P     . DG  C 1 6   ? -16.200 4.247   -58.379 1.00 95.52  ? -3   DG  Y P     1 
ATOM   810  O OP1   . DG  C 1 6   ? -16.848 4.504   -59.690 1.00 95.74  ? -3   DG  Y OP1   1 
ATOM   811  O OP2   . DG  C 1 6   ? -16.056 5.355   -57.401 1.00 95.42  ? -3   DG  Y OP2   1 
ATOM   812  O "O5'" . DG  C 1 6   ? -16.973 3.049   -57.673 1.00 94.00  ? -3   DG  Y "O5'" 1 
ATOM   813  C "C5'" . DG  C 1 6   ? -17.010 1.757   -58.270 1.00 92.26  ? -3   DG  Y "C5'" 1 
ATOM   814  C "C4'" . DG  C 1 6   ? -16.973 0.689   -57.203 1.00 91.29  ? -3   DG  Y "C4'" 1 
ATOM   815  O "O4'" . DG  C 1 6   ? -15.659 0.646   -56.596 1.00 90.39  ? -3   DG  Y "O4'" 1 
ATOM   816  C "C3'" . DG  C 1 6   ? -17.963 0.918   -56.061 1.00 91.36  ? -3   DG  Y "C3'" 1 
ATOM   817  O "O3'" . DG  C 1 6   ? -18.558 -0.319  -55.662 1.00 91.68  ? -3   DG  Y "O3'" 1 
ATOM   818  C "C2'" . DG  C 1 6   ? -17.098 1.484   -54.949 1.00 90.54  ? -3   DG  Y "C2'" 1 
ATOM   819  C "C1'" . DG  C 1 6   ? -15.771 0.786   -55.187 1.00 89.50  ? -3   DG  Y "C1'" 1 
ATOM   820  N N9    . DG  C 1 6   ? -14.601 1.521   -54.713 1.00 87.64  ? -3   DG  Y N9    1 
ATOM   821  C C8    . DG  C 1 6   ? -14.400 2.880   -54.750 1.00 87.05  ? -3   DG  Y C8    1 
ATOM   822  N N7    . DG  C 1 6   ? -13.248 3.242   -54.254 1.00 86.19  ? -3   DG  Y N7    1 
ATOM   823  C C5    . DG  C 1 6   ? -12.652 2.050   -53.864 1.00 85.51  ? -3   DG  Y C5    1 
ATOM   824  C C6    . DG  C 1 6   ? -11.389 1.806   -53.259 1.00 84.78  ? -3   DG  Y C6    1 
ATOM   825  O O6    . DG  C 1 6   ? -10.516 2.620   -52.941 1.00 84.72  ? -3   DG  Y O6    1 
ATOM   826  N N1    . DG  C 1 6   ? -11.185 0.450   -53.031 1.00 84.65  ? -3   DG  Y N1    1 
ATOM   827  C C2    . DG  C 1 6   ? -12.075 -0.546  -53.346 1.00 84.82  ? -3   DG  Y C2    1 
ATOM   828  N N2    . DG  C 1 6   ? -11.690 -1.796  -53.052 1.00 84.06  ? -3   DG  Y N2    1 
ATOM   829  N N3    . DG  C 1 6   ? -13.255 -0.334  -53.908 1.00 85.51  ? -3   DG  Y N3    1 
ATOM   830  C C4    . DG  C 1 6   ? -13.475 0.978   -54.138 1.00 86.38  ? -3   DG  Y C4    1 
ATOM   831  P P     . DA  C 1 7   ? -20.038 -0.317  -55.041 1.00 92.29  ? -2   DA  Y P     1 
ATOM   832  O OP1   . DA  C 1 7   ? -20.601 -1.682  -55.209 1.00 92.21  ? -2   DA  Y OP1   1 
ATOM   833  O OP2   . DA  C 1 7   ? -20.769 0.852   -55.594 1.00 92.02  ? -2   DA  Y OP2   1 
ATOM   834  O "O5'" . DA  C 1 7   ? -19.792 -0.056  -53.491 1.00 90.90  ? -2   DA  Y "O5'" 1 
ATOM   835  C "C5'" . DA  C 1 7   ? -19.974 -1.097  -52.538 1.00 89.52  ? -2   DA  Y "C5'" 1 
ATOM   836  C "C4'" . DA  C 1 7   ? -19.005 -2.224  -52.810 1.00 88.28  ? -2   DA  Y "C4'" 1 
ATOM   837  O "O4'" . DA  C 1 7   ? -17.682 -1.688  -53.041 1.00 88.10  ? -2   DA  Y "O4'" 1 
ATOM   838  C "C3'" . DA  C 1 7   ? -18.864 -3.210  -51.657 1.00 87.79  ? -2   DA  Y "C3'" 1 
ATOM   839  O "O3'" . DA  C 1 7   ? -18.672 -4.533  -52.157 1.00 87.31  ? -2   DA  Y "O3'" 1 
ATOM   840  C "C2'" . DA  C 1 7   ? -17.633 -2.716  -50.921 1.00 87.15  ? -2   DA  Y "C2'" 1 
ATOM   841  C "C1'" . DA  C 1 7   ? -16.781 -2.127  -52.033 1.00 86.66  ? -2   DA  Y "C1'" 1 
ATOM   842  N N9    . DA  C 1 7   ? -15.989 -0.968  -51.622 1.00 85.25  ? -2   DA  Y N9    1 
ATOM   843  C C8    . DA  C 1 7   ? -16.333 0.355   -51.740 1.00 84.36  ? -2   DA  Y C8    1 
ATOM   844  N N7    . DA  C 1 7   ? -15.416 1.182   -51.304 1.00 83.71  ? -2   DA  Y N7    1 
ATOM   845  C C5    . DA  C 1 7   ? -14.400 0.347   -50.862 1.00 83.03  ? -2   DA  Y C5    1 
ATOM   846  C C6    . DA  C 1 7   ? -13.147 0.611   -50.288 1.00 81.99  ? -2   DA  Y C6    1 
ATOM   847  N N6    . DA  C 1 7   ? -12.687 1.840   -50.052 1.00 81.27  ? -2   DA  Y N6    1 
ATOM   848  N N1    . DA  C 1 7   ? -12.372 -0.445  -49.961 1.00 81.80  ? -2   DA  Y N1    1 
ATOM   849  C C2    . DA  C 1 7   ? -12.836 -1.678  -50.197 1.00 82.55  ? -2   DA  Y C2    1 
ATOM   850  N N3    . DA  C 1 7   ? -13.997 -2.054  -50.732 1.00 83.59  ? -2   DA  Y N3    1 
ATOM   851  C C4    . DA  C 1 7   ? -14.741 -0.980  -51.047 1.00 83.82  ? -2   DA  Y C4    1 
ATOM   852  P P     . DA  C 1 8   ? -19.047 -5.786  -51.230 1.00 87.50  ? -1   DA  Y P     1 
ATOM   853  O OP1   . DA  C 1 8   ? -19.053 -7.022  -52.055 1.00 87.56  ? -1   DA  Y OP1   1 
ATOM   854  O OP2   . DA  C 1 8   ? -20.264 -5.408  -50.463 1.00 86.51  ? -1   DA  Y OP2   1 
ATOM   855  O "O5'" . DA  C 1 8   ? -17.825 -5.874  -50.217 1.00 85.54  ? -1   DA  Y "O5'" 1 
ATOM   856  C "C5'" . DA  C 1 8   ? -18.041 -6.173  -48.846 1.00 82.92  ? -1   DA  Y "C5'" 1 
ATOM   857  C "C4'" . DA  C 1 8   ? -16.721 -6.387  -48.147 1.00 80.98  ? -1   DA  Y "C4'" 1 
ATOM   858  O "O4'" . DA  C 1 8   ? -15.869 -5.238  -48.371 1.00 80.00  ? -1   DA  Y "O4'" 1 
ATOM   859  C "C3'" . DA  C 1 8   ? -16.855 -6.527  -46.634 1.00 79.79  ? -1   DA  Y "C3'" 1 
ATOM   860  O "O3'" . DA  C 1 8   ? -15.926 -7.490  -46.136 1.00 78.21  ? -1   DA  Y "O3'" 1 
ATOM   861  C "C2'" . DA  C 1 8   ? -16.550 -5.134  -46.116 1.00 78.80  ? -1   DA  Y "C2'" 1 
ATOM   862  C "C1'" . DA  C 1 8   ? -15.571 -4.587  -47.143 1.00 78.34  ? -1   DA  Y "C1'" 1 
ATOM   863  N N9    . DA  C 1 8   ? -15.714 -3.148  -47.358 1.00 76.58  ? -1   DA  Y N9    1 
ATOM   864  C C8    . DA  C 1 8   ? -16.834 -2.479  -47.785 1.00 75.38  ? -1   DA  Y C8    1 
ATOM   865  N N7    . DA  C 1 8   ? -16.676 -1.181  -47.870 1.00 74.33  ? -1   DA  Y N7    1 
ATOM   866  C C5    . DA  C 1 8   ? -15.361 -0.980  -47.472 1.00 73.60  ? -1   DA  Y C5    1 
ATOM   867  C C6    . DA  C 1 8   ? -14.581 0.183   -47.337 1.00 71.89  ? -1   DA  Y C6    1 
ATOM   868  N N6    . DA  C 1 8   ? -15.035 1.412   -47.591 1.00 70.21  ? -1   DA  Y N6    1 
ATOM   869  N N1    . DA  C 1 8   ? -13.305 0.037   -46.923 1.00 71.12  ? -1   DA  Y N1    1 
ATOM   870  C C2    . DA  C 1 8   ? -12.853 -1.196  -46.662 1.00 72.32  ? -1   DA  Y C2    1 
ATOM   871  N N3    . DA  C 1 8   ? -13.488 -2.364  -46.747 1.00 73.26  ? -1   DA  Y N3    1 
ATOM   872  C C4    . DA  C 1 8   ? -14.754 -2.184  -47.162 1.00 74.44  ? -1   DA  Y C4    1 
ATOM   873  P P     . DA  C 1 9   ? -15.858 -7.776  -44.561 1.00 78.00  ? 1    DA  Y P     1 
ATOM   874  O OP1   . DA  C 1 9   ? -15.259 -9.123  -44.360 1.00 76.58  ? 1    DA  Y OP1   1 
ATOM   875  O OP2   . DA  C 1 9   ? -17.186 -7.460  -43.971 1.00 77.37  ? 1    DA  Y OP2   1 
ATOM   876  O "O5'" . DA  C 1 9   ? -14.825 -6.683  -44.046 1.00 75.35  ? 1    DA  Y "O5'" 1 
ATOM   877  C "C5'" . DA  C 1 9   ? -13.517 -6.609  -44.601 1.00 70.84  ? 1    DA  Y "C5'" 1 
ATOM   878  C "C4'" . DA  C 1 9   ? -12.685 -5.622  -43.821 1.00 67.31  ? 1    DA  Y "C4'" 1 
ATOM   879  O "O4'" . DA  C 1 9   ? -13.049 -4.267  -44.184 1.00 66.08  ? 1    DA  Y "O4'" 1 
ATOM   880  C "C3'" . DA  C 1 9   ? -12.881 -5.732  -42.310 1.00 65.42  ? 1    DA  Y "C3'" 1 
ATOM   881  O "O3'" . DA  C 1 9   ? -11.624 -5.624  -41.648 1.00 64.04  ? 1    DA  Y "O3'" 1 
ATOM   882  C "C2'" . DA  C 1 9   ? -13.787 -4.559  -41.979 1.00 63.80  ? 1    DA  Y "C2'" 1 
ATOM   883  C "C1'" . DA  C 1 9   ? -13.388 -3.529  -43.021 1.00 63.79  ? 1    DA  Y "C1'" 1 
ATOM   884  N N9    . DA  C 1 9   ? -14.445 -2.581  -43.379 1.00 62.41  ? 1    DA  Y N9    1 
ATOM   885  C C8    . DA  C 1 9   ? -15.775 -2.844  -43.609 1.00 61.46  ? 1    DA  Y C8    1 
ATOM   886  N N7    . DA  C 1 9   ? -16.482 -1.778  -43.904 1.00 60.97  ? 1    DA  Y N7    1 
ATOM   887  C C5    . DA  C 1 9   ? -15.557 -0.742  -43.867 1.00 60.26  ? 1    DA  Y C5    1 
ATOM   888  C C6    . DA  C 1 9   ? -15.676 0.646   -44.083 1.00 59.12  ? 1    DA  Y C6    1 
ATOM   889  N N6    . DA  C 1 9   ? -16.823 1.256   -44.395 1.00 57.40  ? 1    DA  Y N6    1 
ATOM   890  N N1    . DA  C 1 9   ? -14.559 1.396   -43.965 1.00 58.66  ? 1    DA  Y N1    1 
ATOM   891  C C2    . DA  C 1 9   ? -13.408 0.788   -43.655 1.00 58.06  ? 1    DA  Y C2    1 
ATOM   892  N N3    . DA  C 1 9   ? -13.170 -0.501  -43.429 1.00 60.15  ? 1    DA  Y N3    1 
ATOM   893  C C4    . DA  C 1 9   ? -14.298 -1.222  -43.549 1.00 60.87  ? 1    DA  Y C4    1 
ATOM   894  P P     . DA  C 1 10  ? -11.541 -5.811  -40.055 1.00 63.87  ? 2    DA  Y P     1 
ATOM   895  O OP1   . DA  C 1 10  ? -10.398 -6.708  -39.762 1.00 63.76  ? 2    DA  Y OP1   1 
ATOM   896  O OP2   . DA  C 1 10  ? -12.894 -6.141  -39.533 1.00 62.31  ? 2    DA  Y OP2   1 
ATOM   897  O "O5'" . DA  C 1 10  ? -11.160 -4.347  -39.568 1.00 61.88  ? 2    DA  Y "O5'" 1 
ATOM   898  C "C5'" . DA  C 1 10  ? -10.196 -3.594  -40.294 1.00 57.85  ? 2    DA  Y "C5'" 1 
ATOM   899  C "C4'" . DA  C 1 10  ? -10.206 -2.153  -39.846 1.00 54.94  ? 2    DA  Y "C4'" 1 
ATOM   900  O "O4'" . DA  C 1 10  ? -11.324 -1.431  -40.419 1.00 52.65  ? 2    DA  Y "O4'" 1 
ATOM   901  C "C3'" . DA  C 1 10  ? -10.287 -1.957  -38.332 1.00 52.16  ? 2    DA  Y "C3'" 1 
ATOM   902  O "O3'" . DA  C 1 10  ? -9.293  -1.012  -37.950 1.00 48.09  ? 2    DA  Y "O3'" 1 
ATOM   903  C "C2'" . DA  C 1 10  ? -11.697 -1.430  -38.109 1.00 51.25  ? 2    DA  Y "C2'" 1 
ATOM   904  C "C1'" . DA  C 1 10  ? -11.985 -0.692  -39.407 1.00 51.77  ? 2    DA  Y "C1'" 1 
ATOM   905  N N9    . DA  C 1 10  ? -13.400 -0.597  -39.773 1.00 51.73  ? 2    DA  Y N9    1 
ATOM   906  C C8    . DA  C 1 10  ? -14.327 -1.609  -39.809 1.00 52.35  ? 2    DA  Y C8    1 
ATOM   907  N N7    . DA  C 1 10  ? -15.522 -1.221  -40.186 1.00 52.29  ? 2    DA  Y N7    1 
ATOM   908  C C5    . DA  C 1 10  ? -15.373 0.141   -40.414 1.00 52.89  ? 2    DA  Y C5    1 
ATOM   909  C C6    . DA  C 1 10  ? -16.278 1.135   -40.840 1.00 53.00  ? 2    DA  Y C6    1 
ATOM   910  N N6    . DA  C 1 10  ? -17.560 0.893   -41.126 1.00 52.16  ? 2    DA  Y N6    1 
ATOM   911  N N1    . DA  C 1 10  ? -15.811 2.398   -40.964 1.00 50.17  ? 2    DA  Y N1    1 
ATOM   912  C C2    . DA  C 1 10  ? -14.525 2.633   -40.682 1.00 50.95  ? 2    DA  Y C2    1 
ATOM   913  N N3    . DA  C 1 10  ? -13.579 1.785   -40.277 1.00 50.02  ? 2    DA  Y N3    1 
ATOM   914  C C4    . DA  C 1 10  ? -14.073 0.541   -40.160 1.00 51.68  ? 2    DA  Y C4    1 
ATOM   915  P P     . DA  C 1 11  ? -9.169  -0.546  -36.422 1.00 48.97  ? 3    DA  Y P     1 
ATOM   916  O OP1   . DA  C 1 11  ? -7.716  -0.364  -36.187 1.00 47.96  ? 3    DA  Y OP1   1 
ATOM   917  O OP2   . DA  C 1 11  ? -9.962  -1.415  -35.514 1.00 45.78  ? 3    DA  Y OP2   1 
ATOM   918  O "O5'" . DA  C 1 11  ? -9.848  0.892   -36.456 1.00 45.08  ? 3    DA  Y "O5'" 1 
ATOM   919  C "C5'" . DA  C 1 11  ? -9.483  1.820   -37.467 1.00 39.74  ? 3    DA  Y "C5'" 1 
ATOM   920  C "C4'" . DA  C 1 11  ? -10.247 3.108   -37.293 1.00 38.10  ? 3    DA  Y "C4'" 1 
ATOM   921  O "O4'" . DA  C 1 11  ? -11.604 2.965   -37.773 1.00 37.83  ? 3    DA  Y "O4'" 1 
ATOM   922  C "C3'" . DA  C 1 11  ? -10.342 3.620   -35.855 1.00 36.15  ? 3    DA  Y "C3'" 1 
ATOM   923  O "O3'" . DA  C 1 11  ? -10.046 5.017   -35.857 1.00 31.03  ? 3    DA  Y "O3'" 1 
ATOM   924  C "C2'" . DA  C 1 11  ? -11.784 3.329   -35.464 1.00 35.01  ? 3    DA  Y "C2'" 1 
ATOM   925  C "C1'" . DA  C 1 11  ? -12.520 3.418   -36.791 1.00 36.92  ? 3    DA  Y "C1'" 1 
ATOM   926  N N9    . DA  C 1 11  ? -13.728 2.597   -36.904 1.00 40.66  ? 3    DA  Y N9    1 
ATOM   927  C C8    . DA  C 1 11  ? -13.863 1.252   -36.668 1.00 40.25  ? 3    DA  Y C8    1 
ATOM   928  N N7    . DA  C 1 11  ? -15.076 0.795   -36.887 1.00 40.77  ? 3    DA  Y N7    1 
ATOM   929  C C5    . DA  C 1 11  ? -15.790 1.916   -37.286 1.00 42.24  ? 3    DA  Y C5    1 
ATOM   930  C C6    . DA  C 1 11  ? -17.135 2.099   -37.673 1.00 44.12  ? 3    DA  Y C6    1 
ATOM   931  N N6    . DA  C 1 11  ? -18.035 1.113   -37.725 1.00 44.99  ? 3    DA  Y N6    1 
ATOM   932  N N1    . DA  C 1 11  ? -17.528 3.349   -38.013 1.00 43.09  ? 3    DA  Y N1    1 
ATOM   933  C C2    . DA  C 1 11  ? -16.622 4.337   -37.972 1.00 42.66  ? 3    DA  Y C2    1 
ATOM   934  N N3    . DA  C 1 11  ? -15.331 4.288   -37.632 1.00 42.22  ? 3    DA  Y N3    1 
ATOM   935  C C4    . DA  C 1 11  ? -14.974 3.036   -37.296 1.00 42.02  ? 3    DA  Y C4    1 
ATOM   936  P P     . DT  C 1 12  ? -10.057 5.848   -34.487 1.00 31.25  ? 4    DT  Y P     1 
ATOM   937  O OP1   . DT  C 1 12  ? -9.078  6.950   -34.666 1.00 29.61  ? 4    DT  Y OP1   1 
ATOM   938  O OP2   . DT  C 1 12  ? -9.947  4.956   -33.292 1.00 30.91  ? 4    DT  Y OP2   1 
ATOM   939  O "O5'" . DT  C 1 12  ? -11.495 6.515   -34.510 1.00 33.94  ? 4    DT  Y "O5'" 1 
ATOM   940  C "C5'" . DT  C 1 12  ? -11.860 7.342   -35.612 1.00 34.35  ? 4    DT  Y "C5'" 1 
ATOM   941  C "C4'" . DT  C 1 12  ? -13.211 7.966   -35.374 1.00 35.75  ? 4    DT  Y "C4'" 1 
ATOM   942  O "O4'" . DT  C 1 12  ? -14.255 6.993   -35.611 1.00 35.89  ? 4    DT  Y "O4'" 1 
ATOM   943  C "C3'" . DT  C 1 12  ? -13.435 8.512   -33.964 1.00 34.52  ? 4    DT  Y "C3'" 1 
ATOM   944  O "O3'" . DT  C 1 12  ? -13.882 9.856   -34.061 1.00 36.95  ? 4    DT  Y "O3'" 1 
ATOM   945  C "C2'" . DT  C 1 12  ? -14.523 7.616   -33.384 1.00 35.28  ? 4    DT  Y "C2'" 1 
ATOM   946  C "C1'" . DT  C 1 12  ? -15.258 7.123   -34.620 1.00 35.08  ? 4    DT  Y "C1'" 1 
ATOM   947  N N1    . DT  C 1 12  ? -15.939 5.811   -34.506 1.00 35.26  ? 4    DT  Y N1    1 
ATOM   948  C C2    . DT  C 1 12  ? -17.250 5.717   -34.928 1.00 37.30  ? 4    DT  Y C2    1 
ATOM   949  O O2    . DT  C 1 12  ? -17.895 6.673   -35.327 1.00 42.24  ? 4    DT  Y O2    1 
ATOM   950  N N3    . DT  C 1 12  ? -17.787 4.457   -34.858 1.00 36.06  ? 4    DT  Y N3    1 
ATOM   951  C C4    . DT  C 1 12  ? -17.166 3.312   -34.401 1.00 37.54  ? 4    DT  Y C4    1 
ATOM   952  O O4    . DT  C 1 12  ? -17.771 2.248   -34.407 1.00 38.30  ? 4    DT  Y O4    1 
ATOM   953  C C5    . DT  C 1 12  ? -15.802 3.489   -33.943 1.00 36.18  ? 4    DT  Y C5    1 
ATOM   954  C C7    . DT  C 1 12  ? -15.055 2.305   -33.414 1.00 33.14  ? 4    DT  Y C7    1 
ATOM   955  C C6    . DT  C 1 12  ? -15.267 4.713   -34.016 1.00 34.01  ? 4    DT  Y C6    1 
ATOM   956  P P     . DG  C 1 13  ? -14.029 10.745  -32.739 1.00 38.15  ? 5    DG  Y P     1 
ATOM   957  O OP1   . DG  C 1 13  ? -13.316 12.014  -32.998 1.00 39.26  ? 5    DG  Y OP1   1 
ATOM   958  O OP2   . DG  C 1 13  ? -13.685 9.947   -31.540 1.00 38.86  ? 5    DG  Y OP2   1 
ATOM   959  O "O5'" . DG  C 1 13  ? -15.590 11.052  -32.711 1.00 43.56  ? 5    DG  Y "O5'" 1 
ATOM   960  C "C5'" . DG  C 1 13  ? -16.266 11.441  -33.909 1.00 45.51  ? 5    DG  Y "C5'" 1 
ATOM   961  C "C4'" . DG  C 1 13  ? -17.761 11.438  -33.695 1.00 48.65  ? 5    DG  Y "C4'" 1 
ATOM   962  O "O4'" . DG  C 1 13  ? -18.271 10.086  -33.633 1.00 47.72  ? 5    DG  Y "O4'" 1 
ATOM   963  C "C3'" . DG  C 1 13  ? -18.216 12.117  -32.408 1.00 51.67  ? 5    DG  Y "C3'" 1 
ATOM   964  O "O3'" . DG  C 1 13  ? -19.446 12.799  -32.670 1.00 57.83  ? 5    DG  Y "O3'" 1 
ATOM   965  C "C2'" . DG  C 1 13  ? -18.416 10.946  -31.461 1.00 48.74  ? 5    DG  Y "C2'" 1 
ATOM   966  C "C1'" . DG  C 1 13  ? -18.947 9.877   -32.400 1.00 47.38  ? 5    DG  Y "C1'" 1 
ATOM   967  N N9    . DG  C 1 13  ? -18.702 8.496   -31.996 1.00 47.32  ? 5    DG  Y N9    1 
ATOM   968  C C8    . DG  C 1 13  ? -17.569 7.989   -31.410 1.00 45.32  ? 5    DG  Y C8    1 
ATOM   969  N N7    . DG  C 1 13  ? -17.616 6.695   -31.239 1.00 46.98  ? 5    DG  Y N7    1 
ATOM   970  C C5    . DG  C 1 13  ? -18.863 6.328   -31.726 1.00 46.87  ? 5    DG  Y C5    1 
ATOM   971  C C6    . DG  C 1 13  ? -19.478 5.050   -31.816 1.00 48.22  ? 5    DG  Y C6    1 
ATOM   972  O O6    . DG  C 1 13  ? -19.020 3.946   -31.490 1.00 50.01  ? 5    DG  Y O6    1 
ATOM   973  N N1    . DG  C 1 13  ? -20.754 5.134   -32.359 1.00 47.47  ? 5    DG  Y N1    1 
ATOM   974  C C2    . DG  C 1 13  ? -21.359 6.293   -32.772 1.00 48.92  ? 5    DG  Y C2    1 
ATOM   975  N N2    . DG  C 1 13  ? -22.599 6.168   -33.270 1.00 49.64  ? 5    DG  Y N2    1 
ATOM   976  N N3    . DG  C 1 13  ? -20.794 7.488   -32.703 1.00 47.93  ? 5    DG  Y N3    1 
ATOM   977  C C4    . DG  C 1 13  ? -19.555 7.431   -32.174 1.00 47.78  ? 5    DG  Y C4    1 
ATOM   978  P P     . DC  C 1 14  ? -19.872 14.060  -31.772 1.00 61.74  ? 6    DC  Y P     1 
ATOM   979  O OP1   . DC  C 1 14  ? -20.404 15.088  -32.701 1.00 62.82  ? 6    DC  Y OP1   1 
ATOM   980  O OP2   . DC  C 1 14  ? -18.761 14.403  -30.849 1.00 63.03  ? 6    DC  Y OP2   1 
ATOM   981  O "O5'" . DC  C 1 14  ? -21.077 13.480  -30.915 1.00 65.02  ? 6    DC  Y "O5'" 1 
ATOM   982  C "C5'" . DC  C 1 14  ? -21.188 12.077  -30.731 1.00 66.83  ? 6    DC  Y "C5'" 1 
ATOM   983  C "C4'" . DC  C 1 14  ? -22.632 11.668  -30.593 1.00 67.48  ? 6    DC  Y "C4'" 1 
ATOM   984  O "O4'" . DC  C 1 14  ? -22.688 10.230  -30.690 1.00 68.29  ? 6    DC  Y "O4'" 1 
ATOM   985  C "C3'" . DC  C 1 14  ? -23.236 12.019  -29.240 1.00 68.99  ? 6    DC  Y "C3'" 1 
ATOM   986  O "O3'" . DC  C 1 14  ? -24.634 12.280  -29.382 1.00 71.06  ? 6    DC  Y "O3'" 1 
ATOM   987  C "C2'" . DC  C 1 14  ? -22.961 10.781  -28.405 1.00 67.90  ? 6    DC  Y "C2'" 1 
ATOM   988  C "C1'" . DC  C 1 14  ? -22.983 9.651   -29.429 1.00 67.19  ? 6    DC  Y "C1'" 1 
ATOM   989  N N1    . DC  C 1 14  ? -21.990 8.589   -29.199 1.00 65.32  ? 6    DC  Y N1    1 
ATOM   990  C C2    . DC  C 1 14  ? -22.278 7.302   -29.646 1.00 65.28  ? 6    DC  Y C2    1 
ATOM   991  O O2    . DC  C 1 14  ? -23.353 7.101   -30.232 1.00 66.76  ? 6    DC  Y O2    1 
ATOM   992  N N3    . DC  C 1 14  ? -21.382 6.310   -29.437 1.00 63.55  ? 6    DC  Y N3    1 
ATOM   993  C C4    . DC  C 1 14  ? -20.232 6.573   -28.812 1.00 62.65  ? 6    DC  Y C4    1 
ATOM   994  N N4    . DC  C 1 14  ? -19.380 5.561   -28.619 1.00 60.20  ? 6    DC  Y N4    1 
ATOM   995  C C5    . DC  C 1 14  ? -19.906 7.883   -28.357 1.00 62.06  ? 6    DC  Y C5    1 
ATOM   996  C C6    . DC  C 1 14  ? -20.806 8.852   -28.566 1.00 63.63  ? 6    DC  Y C6    1 
ATOM   997  P P     . DG  C 1 15  ? -25.237 13.663  -28.837 1.00 72.60  ? 7    DG  Y P     1 
ATOM   998  O OP1   . DG  C 1 15  ? -26.696 13.661  -29.110 1.00 73.02  ? 7    DG  Y OP1   1 
ATOM   999  O OP2   . DG  C 1 15  ? -24.395 14.777  -29.345 1.00 71.44  ? 7    DG  Y OP2   1 
ATOM   1000 O "O5'" . DG  C 1 15  ? -25.026 13.559  -27.263 1.00 73.27  ? 7    DG  Y "O5'" 1 
ATOM   1001 C "C5'" . DG  C 1 15  ? -25.938 12.823  -26.455 1.00 72.87  ? 7    DG  Y "C5'" 1 
ATOM   1002 C "C4'" . DG  C 1 15  ? -25.367 12.628  -25.070 1.00 72.80  ? 7    DG  Y "C4'" 1 
ATOM   1003 O "O4'" . DG  C 1 15  ? -24.414 11.534  -25.053 1.00 71.29  ? 7    DG  Y "O4'" 1 
ATOM   1004 C "C3'" . DG  C 1 15  ? -24.633 13.850  -24.507 1.00 73.38  ? 7    DG  Y "C3'" 1 
ATOM   1005 O "O3'" . DG  C 1 15  ? -24.980 14.042  -23.133 1.00 74.29  ? 7    DG  Y "O3'" 1 
ATOM   1006 C "C2'" . DG  C 1 15  ? -23.172 13.444  -24.595 1.00 72.58  ? 7    DG  Y "C2'" 1 
ATOM   1007 C "C1'" . DG  C 1 15  ? -23.275 11.956  -24.328 1.00 70.92  ? 7    DG  Y "C1'" 1 
ATOM   1008 N N9    . DG  C 1 15  ? -22.131 11.142  -24.732 1.00 69.36  ? 7    DG  Y N9    1 
ATOM   1009 C C8    . DG  C 1 15  ? -20.931 11.585  -25.238 1.00 69.13  ? 7    DG  Y C8    1 
ATOM   1010 N N7    . DG  C 1 15  ? -20.073 10.620  -25.440 1.00 68.82  ? 7    DG  Y N7    1 
ATOM   1011 C C5    . DG  C 1 15  ? -20.752 9.470   -25.058 1.00 67.61  ? 7    DG  Y C5    1 
ATOM   1012 C C6    . DG  C 1 15  ? -20.327 8.113   -25.037 1.00 66.38  ? 7    DG  Y C6    1 
ATOM   1013 O O6    . DG  C 1 15  ? -19.228 7.643   -25.353 1.00 64.30  ? 7    DG  Y O6    1 
ATOM   1014 N N1    . DG  C 1 15  ? -21.334 7.271   -24.581 1.00 66.54  ? 7    DG  Y N1    1 
ATOM   1015 C C2    . DG  C 1 15  ? -22.586 7.678   -24.188 1.00 67.23  ? 7    DG  Y C2    1 
ATOM   1016 N N2    . DG  C 1 15  ? -23.417 6.713   -23.775 1.00 67.87  ? 7    DG  Y N2    1 
ATOM   1017 N N3    . DG  C 1 15  ? -22.992 8.936   -24.196 1.00 67.63  ? 7    DG  Y N3    1 
ATOM   1018 C C4    . DG  C 1 15  ? -22.030 9.773   -24.637 1.00 68.33  ? 7    DG  Y C4    1 
ATOM   1019 P P     . DA  C 1 16  ? -25.790 15.357  -22.690 1.00 75.54  ? 8    DA  Y P     1 
ATOM   1020 O OP1   . DA  C 1 16  ? -26.390 15.954  -23.912 1.00 75.07  ? 8    DA  Y OP1   1 
ATOM   1021 O OP2   . DA  C 1 16  ? -24.923 16.190  -21.817 1.00 74.75  ? 8    DA  Y OP2   1 
ATOM   1022 O "O5'" . DA  C 1 16  ? -26.974 14.765  -21.806 1.00 74.68  ? 8    DA  Y "O5'" 1 
ATOM   1023 C "C5'" . DA  C 1 16  ? -27.974 13.939  -22.397 1.00 73.79  ? 8    DA  Y "C5'" 1 
ATOM   1024 C "C4'" . DA  C 1 16  ? -28.052 12.614  -21.676 1.00 73.63  ? 8    DA  Y "C4'" 1 
ATOM   1025 O "O4'" . DA  C 1 16  ? -26.826 11.869  -21.889 1.00 73.17  ? 8    DA  Y "O4'" 1 
ATOM   1026 C "C3'" . DA  C 1 16  ? -28.226 12.716  -20.160 1.00 73.41  ? 8    DA  Y "C3'" 1 
ATOM   1027 O "O3'" . DA  C 1 16  ? -29.104 11.677  -19.707 1.00 73.82  ? 8    DA  Y "O3'" 1 
ATOM   1028 C "C2'" . DA  C 1 16  ? -26.819 12.491  -19.635 1.00 72.75  ? 8    DA  Y "C2'" 1 
ATOM   1029 C "C1'" . DA  C 1 16  ? -26.277 11.487  -20.638 1.00 72.62  ? 8    DA  Y "C1'" 1 
ATOM   1030 N N9    . DA  C 1 16  ? -24.818 11.465  -20.768 1.00 72.51  ? 8    DA  Y N9    1 
ATOM   1031 C C8    . DA  C 1 16  ? -23.958 12.535  -20.827 1.00 72.37  ? 8    DA  Y C8    1 
ATOM   1032 N N7    . DA  C 1 16  ? -22.697 12.194  -20.946 1.00 71.40  ? 8    DA  Y N7    1 
ATOM   1033 C C5    . DA  C 1 16  ? -22.727 10.806  -20.969 1.00 70.81  ? 8    DA  Y C5    1 
ATOM   1034 C C6    . DA  C 1 16  ? -21.711 9.840   -21.084 1.00 70.13  ? 8    DA  Y C6    1 
ATOM   1035 N N6    . DA  C 1 16  ? -20.418 10.141  -21.218 1.00 68.93  ? 8    DA  Y N6    1 
ATOM   1036 N N1    . DA  C 1 16  ? -22.075 8.539   -21.063 1.00 69.61  ? 8    DA  Y N1    1 
ATOM   1037 C C2    . DA  C 1 16  ? -23.376 8.241   -20.945 1.00 70.51  ? 8    DA  Y C2    1 
ATOM   1038 N N3    . DA  C 1 16  ? -24.423 9.059   -20.838 1.00 70.54  ? 8    DA  Y N3    1 
ATOM   1039 C C4    . DA  C 1 16  ? -24.026 10.343  -20.856 1.00 71.33  ? 8    DA  Y C4    1 
ATOM   1040 P P     . DT  C 1 17  ? -29.728 11.743  -18.226 1.00 73.63  ? 9    DT  Y P     1 
ATOM   1041 O OP1   . DT  C 1 17  ? -31.195 11.547  -18.354 1.00 73.32  ? 9    DT  Y OP1   1 
ATOM   1042 O OP2   . DT  C 1 17  ? -29.201 12.952  -17.537 1.00 72.60  ? 9    DT  Y OP2   1 
ATOM   1043 O "O5'" . DT  C 1 17  ? -29.129 10.452  -17.508 1.00 73.53  ? 9    DT  Y "O5'" 1 
ATOM   1044 C "C5'" . DT  C 1 17  ? -27.785 10.054  -17.747 1.00 72.36  ? 9    DT  Y "C5'" 1 
ATOM   1045 C "C4'" . DT  C 1 17  ? -27.567 8.628   -17.303 1.00 71.59  ? 9    DT  Y "C4'" 1 
ATOM   1046 O "O4'" . DT  C 1 17  ? -26.237 8.242   -17.713 1.00 70.59  ? 9    DT  Y "O4'" 1 
ATOM   1047 C "C3'" . DT  C 1 17  ? -27.595 8.427   -15.792 1.00 71.27  ? 9    DT  Y "C3'" 1 
ATOM   1048 O "O3'" . DT  C 1 17  ? -27.792 7.035   -15.509 1.00 70.76  ? 9    DT  Y "O3'" 1 
ATOM   1049 C "C2'" . DT  C 1 17  ? -26.164 8.748   -15.404 1.00 71.03  ? 9    DT  Y "C2'" 1 
ATOM   1050 C "C1'" . DT  C 1 17  ? -25.372 8.195   -16.586 1.00 70.00  ? 9    DT  Y "C1'" 1 
ATOM   1051 N N1    . DT  C 1 17  ? -24.171 8.975   -16.928 1.00 69.06  ? 9    DT  Y N1    1 
ATOM   1052 C C2    . DT  C 1 17  ? -23.041 8.295   -17.321 1.00 67.20  ? 9    DT  Y C2    1 
ATOM   1053 O O2    . DT  C 1 17  ? -22.981 7.078   -17.383 1.00 64.89  ? 9    DT  Y O2    1 
ATOM   1054 N N3    . DT  C 1 17  ? -21.977 9.098   -17.643 1.00 67.35  ? 9    DT  Y N3    1 
ATOM   1055 C C4    . DT  C 1 17  ? -21.930 10.478  -17.607 1.00 67.85  ? 9    DT  Y C4    1 
ATOM   1056 O O4    . DT  C 1 17  ? -20.903 11.063  -17.933 1.00 67.49  ? 9    DT  Y O4    1 
ATOM   1057 C C5    . DT  C 1 17  ? -23.148 11.126  -17.174 1.00 68.78  ? 9    DT  Y C5    1 
ATOM   1058 C C7    . DT  C 1 17  ? -23.187 12.619  -17.089 1.00 68.02  ? 9    DT  Y C7    1 
ATOM   1059 C C6    . DT  C 1 17  ? -24.193 10.352  -16.862 1.00 68.63  ? 9    DT  Y C6    1 
ATOM   1060 O "O5'" . DC  D 2 1   ? -19.066 19.519  -7.044  1.00 70.88  ? 13   DC  Z "O5'" 1 
ATOM   1061 C "C5'" . DC  D 2 1   ? -18.207 20.529  -6.505  1.00 70.13  ? 13   DC  Z "C5'" 1 
ATOM   1062 C "C4'" . DC  D 2 1   ? -16.756 20.221  -6.792  1.00 69.71  ? 13   DC  Z "C4'" 1 
ATOM   1063 O "O4'" . DC  D 2 1   ? -16.361 19.029  -6.066  1.00 68.85  ? 13   DC  Z "O4'" 1 
ATOM   1064 C "C3'" . DC  D 2 1   ? -16.491 19.928  -8.268  1.00 69.19  ? 13   DC  Z "C3'" 1 
ATOM   1065 O "O3'" . DC  D 2 1   ? -15.256 20.488  -8.707  1.00 68.99  ? 13   DC  Z "O3'" 1 
ATOM   1066 C "C2'" . DC  D 2 1   ? -16.427 18.417  -8.332  1.00 68.42  ? 13   DC  Z "C2'" 1 
ATOM   1067 C "C1'" . DC  D 2 1   ? -15.894 18.033  -6.964  1.00 66.68  ? 13   DC  Z "C1'" 1 
ATOM   1068 N N1    . DC  D 2 1   ? -16.418 16.733  -6.519  1.00 63.78  ? 13   DC  Z N1    1 
ATOM   1069 C C2    . DC  D 2 1   ? -15.549 15.639  -6.458  1.00 62.34  ? 13   DC  Z C2    1 
ATOM   1070 O O2    . DC  D 2 1   ? -14.347 15.811  -6.714  1.00 62.00  ? 13   DC  Z O2    1 
ATOM   1071 N N3    . DC  D 2 1   ? -16.039 14.425  -6.118  1.00 60.96  ? 13   DC  Z N3    1 
ATOM   1072 C C4    . DC  D 2 1   ? -17.337 14.285  -5.835  1.00 60.82  ? 13   DC  Z C4    1 
ATOM   1073 N N4    . DC  D 2 1   ? -17.781 13.068  -5.530  1.00 58.89  ? 13   DC  Z N4    1 
ATOM   1074 C C5    . DC  D 2 1   ? -18.237 15.390  -5.857  1.00 60.79  ? 13   DC  Z C5    1 
ATOM   1075 C C6    . DC  D 2 1   ? -17.739 16.584  -6.198  1.00 61.56  ? 13   DC  Z C6    1 
ATOM   1076 P P     . DT  D 2 2   ? -15.020 20.715  -10.277 1.00 69.74  ? 12   DT  Z P     1 
ATOM   1077 O OP1   . DT  D 2 2   ? -14.393 22.051  -10.461 1.00 68.39  ? 12   DT  Z OP1   1 
ATOM   1078 O OP2   . DT  D 2 2   ? -16.302 20.398  -10.963 1.00 67.77  ? 12   DT  Z OP2   1 
ATOM   1079 O "O5'" . DT  D 2 2   ? -13.964 19.592  -10.672 1.00 68.37  ? 12   DT  Z "O5'" 1 
ATOM   1080 C "C5'" . DT  D 2 2   ? -12.654 19.590  -10.114 1.00 66.00  ? 12   DT  Z "C5'" 1 
ATOM   1081 C "C4'" . DT  D 2 2   ? -11.888 18.389  -10.612 1.00 64.52  ? 12   DT  Z "C4'" 1 
ATOM   1082 O "O4'" . DT  D 2 2   ? -12.435 17.187  -10.015 1.00 64.82  ? 12   DT  Z "O4'" 1 
ATOM   1083 C "C3'" . DT  D 2 2   ? -11.980 18.194  -12.127 1.00 63.69  ? 12   DT  Z "C3'" 1 
ATOM   1084 O "O3'" . DT  D 2 2   ? -10.720 17.783  -12.658 1.00 61.99  ? 12   DT  Z "O3'" 1 
ATOM   1085 C "C2'" . DT  D 2 2   ? -13.021 17.100  -12.286 1.00 62.83  ? 12   DT  Z "C2'" 1 
ATOM   1086 C "C1'" . DT  D 2 2   ? -12.809 16.268  -11.034 1.00 63.99  ? 12   DT  Z "C1'" 1 
ATOM   1087 N N1    . DT  D 2 2   ? -14.006 15.525  -10.579 1.00 62.00  ? 12   DT  Z N1    1 
ATOM   1088 C C2    . DT  D 2 2   ? -13.851 14.196  -10.249 1.00 61.45  ? 12   DT  Z C2    1 
ATOM   1089 O O2    . DT  D 2 2   ? -12.775 13.621  -10.290 1.00 59.21  ? 12   DT  Z O2    1 
ATOM   1090 N N3    . DT  D 2 2   ? -15.008 13.562  -9.866  1.00 61.09  ? 12   DT  Z N3    1 
ATOM   1091 C C4    . DT  D 2 2   ? -16.273 14.111  -9.780  1.00 62.31  ? 12   DT  Z C4    1 
ATOM   1092 O O4    . DT  D 2 2   ? -17.223 13.415  -9.423  1.00 62.46  ? 12   DT  Z O4    1 
ATOM   1093 C C5    . DT  D 2 2   ? -16.361 15.508  -10.131 1.00 62.67  ? 12   DT  Z C5    1 
ATOM   1094 C C7    . DT  D 2 2   ? -17.696 16.183  -10.074 1.00 63.17  ? 12   DT  Z C7    1 
ATOM   1095 C C6    . DT  D 2 2   ? -15.237 16.139  -10.503 1.00 62.49  ? 12   DT  Z C6    1 
ATOM   1096 P P     . DA  D 2 3   ? -10.606 17.386  -14.211 1.00 61.64  ? 11   DA  Z P     1 
ATOM   1097 O OP1   . DA  D 2 3   ? -9.289  17.857  -14.715 1.00 60.84  ? 11   DA  Z OP1   1 
ATOM   1098 O OP2   . DA  D 2 3   ? -11.854 17.797  -14.908 1.00 61.86  ? 11   DA  Z OP2   1 
ATOM   1099 O "O5'" . DA  D 2 3   ? -10.563 15.800  -14.160 1.00 57.89  ? 11   DA  Z "O5'" 1 
ATOM   1100 C "C5'" . DA  D 2 3   ? -9.660  15.139  -13.287 1.00 51.31  ? 11   DA  Z "C5'" 1 
ATOM   1101 C "C4'" . DA  D 2 3   ? -9.735  13.651  -13.513 1.00 47.23  ? 11   DA  Z "C4'" 1 
ATOM   1102 O "O4'" . DA  D 2 3   ? -10.995 13.155  -12.999 1.00 45.23  ? 11   DA  Z "O4'" 1 
ATOM   1103 C "C3'" . DA  D 2 3   ? -9.694  13.270  -14.991 1.00 44.68  ? 11   DA  Z "C3'" 1 
ATOM   1104 O "O3'" . DA  D 2 3   ? -8.904  12.084  -15.149 1.00 43.26  ? 11   DA  Z "O3'" 1 
ATOM   1105 C "C2'" . DA  D 2 3   ? -11.161 13.043  -15.328 1.00 43.97  ? 11   DA  Z "C2'" 1 
ATOM   1106 C "C1'" . DA  D 2 3   ? -11.712 12.492  -14.020 1.00 43.02  ? 11   DA  Z "C1'" 1 
ATOM   1107 N N9    . DA  D 2 3   ? -13.142 12.709  -13.774 1.00 42.61  ? 11   DA  Z N9    1 
ATOM   1108 C C8    . DA  D 2 3   ? -13.867 13.865  -13.950 1.00 42.74  ? 11   DA  Z C8    1 
ATOM   1109 N N7    . DA  D 2 3   ? -15.131 13.755  -13.613 1.00 41.52  ? 11   DA  Z N7    1 
ATOM   1110 C C5    . DA  D 2 3   ? -15.253 12.437  -13.190 1.00 41.69  ? 11   DA  Z C5    1 
ATOM   1111 C C6    . DA  D 2 3   ? -16.347 11.691  -12.696 1.00 40.13  ? 11   DA  Z C6    1 
ATOM   1112 N N6    . DA  D 2 3   ? -17.573 12.192  -12.524 1.00 39.41  ? 11   DA  Z N6    1 
ATOM   1113 N N1    . DA  D 2 3   ? -16.132 10.398  -12.373 1.00 37.04  ? 11   DA  Z N1    1 
ATOM   1114 C C2    . DA  D 2 3   ? -14.902 9.896   -12.529 1.00 39.27  ? 11   DA  Z C2    1 
ATOM   1115 N N3    . DA  D 2 3   ? -13.795 10.493  -12.972 1.00 40.56  ? 11   DA  Z N3    1 
ATOM   1116 C C4    . DA  D 2 3   ? -14.038 11.777  -13.292 1.00 41.41  ? 11   DA  Z C4    1 
ATOM   1117 P P     . DG  D 2 4   ? -8.196  11.769  -16.558 1.00 40.25  ? 10   DG  Z P     1 
ATOM   1118 O OP1   . DG  D 2 4   ? -6.804  11.312  -16.289 1.00 39.76  ? 10   DG  Z OP1   1 
ATOM   1119 O OP2   . DG  D 2 4   ? -8.438  12.889  -17.499 1.00 39.50  ? 10   DG  Z OP2   1 
ATOM   1120 O "O5'" . DG  D 2 4   ? -9.011  10.524  -17.090 1.00 37.77  ? 10   DG  Z "O5'" 1 
ATOM   1121 C "C5'" . DG  D 2 4   ? -10.362 10.397  -16.741 1.00 41.14  ? 10   DG  Z "C5'" 1 
ATOM   1122 C "C4'" . DG  D 2 4   ? -10.752 8.945   -16.663 1.00 38.08  ? 10   DG  Z "C4'" 1 
ATOM   1123 O "O4'" . DG  D 2 4   ? -12.025 8.915   -15.996 1.00 36.14  ? 10   DG  Z "O4'" 1 
ATOM   1124 C "C3'" . DG  D 2 4   ? -10.981 8.299   -18.023 1.00 37.98  ? 10   DG  Z "C3'" 1 
ATOM   1125 O "O3'" . DG  D 2 4   ? -10.777 6.893   -17.887 1.00 36.85  ? 10   DG  Z "O3'" 1 
ATOM   1126 C "C2'" . DG  D 2 4   ? -12.425 8.654   -18.313 1.00 37.63  ? 10   DG  Z "C2'" 1 
ATOM   1127 C "C1'" . DG  D 2 4   ? -13.059 8.663   -16.927 1.00 36.13  ? 10   DG  Z "C1'" 1 
ATOM   1128 N N9    . DG  D 2 4   ? -14.084 9.681   -16.725 1.00 35.48  ? 10   DG  Z N9    1 
ATOM   1129 C C8    . DG  D 2 4   ? -14.019 11.019  -17.034 1.00 34.15  ? 10   DG  Z C8    1 
ATOM   1130 N N7    . DG  D 2 4   ? -15.128 11.659  -16.767 1.00 34.56  ? 10   DG  Z N7    1 
ATOM   1131 C C5    . DG  D 2 4   ? -15.968 10.683  -16.244 1.00 36.06  ? 10   DG  Z C5    1 
ATOM   1132 C C6    . DG  D 2 4   ? -17.312 10.764  -15.780 1.00 36.74  ? 10   DG  Z C6    1 
ATOM   1133 O O6    . DG  D 2 4   ? -18.058 11.743  -15.747 1.00 37.43  ? 10   DG  Z O6    1 
ATOM   1134 N N1    . DG  D 2 4   ? -17.772 9.528   -15.327 1.00 35.95  ? 10   DG  Z N1    1 
ATOM   1135 C C2    . DG  D 2 4   ? -17.040 8.367   -15.327 1.00 33.69  ? 10   DG  Z C2    1 
ATOM   1136 N N2    . DG  D 2 4   ? -17.660 7.267   -14.875 1.00 30.38  ? 10   DG  Z N2    1 
ATOM   1137 N N3    . DG  D 2 4   ? -15.794 8.284   -15.749 1.00 34.56  ? 10   DG  Z N3    1 
ATOM   1138 C C4    . DG  D 2 4   ? -15.328 9.464   -16.195 1.00 35.13  ? 10   DG  Z C4    1 
ATOM   1139 P P     . DA  D 2 5   ? -10.942 5.919   -19.150 1.00 36.23  ? 9    DA  Z P     1 
ATOM   1140 O OP1   . DA  D 2 5   ? -9.802  4.969   -19.077 1.00 41.26  ? 9    DA  Z OP1   1 
ATOM   1141 O OP2   . DA  D 2 5   ? -11.185 6.668   -20.403 1.00 40.28  ? 9    DA  Z OP2   1 
ATOM   1142 O "O5'" . DA  D 2 5   ? -12.247 5.087   -18.790 1.00 39.41  ? 9    DA  Z "O5'" 1 
ATOM   1143 C "C5'" . DA  D 2 5   ? -12.277 4.294   -17.605 1.00 38.81  ? 9    DA  Z "C5'" 1 
ATOM   1144 C "C4'" . DA  D 2 5   ? -13.566 3.515   -17.524 1.00 38.72  ? 9    DA  Z "C4'" 1 
ATOM   1145 O "O4'" . DA  D 2 5   ? -14.678 4.409   -17.290 1.00 38.21  ? 9    DA  Z "O4'" 1 
ATOM   1146 C "C3'" . DA  D 2 5   ? -13.907 2.735   -18.788 1.00 41.14  ? 9    DA  Z "C3'" 1 
ATOM   1147 O "O3'" . DA  D 2 5   ? -14.483 1.485   -18.401 1.00 43.77  ? 9    DA  Z "O3'" 1 
ATOM   1148 C "C2'" . DA  D 2 5   ? -14.898 3.645   -19.499 1.00 40.43  ? 9    DA  Z "C2'" 1 
ATOM   1149 C "C1'" . DA  D 2 5   ? -15.625 4.327   -18.346 1.00 38.30  ? 9    DA  Z "C1'" 1 
ATOM   1150 N N9    . DA  D 2 5   ? -16.086 5.691   -18.620 1.00 37.89  ? 9    DA  Z N9    1 
ATOM   1151 C C8    . DA  D 2 5   ? -15.339 6.725   -19.119 1.00 37.14  ? 9    DA  Z C8    1 
ATOM   1152 N N7    . DA  D 2 5   ? -15.994 7.858   -19.207 1.00 38.51  ? 9    DA  Z N7    1 
ATOM   1153 C C5    . DA  D 2 5   ? -17.265 7.547   -18.745 1.00 37.46  ? 9    DA  Z C5    1 
ATOM   1154 C C6    . DA  D 2 5   ? -18.434 8.326   -18.578 1.00 37.89  ? 9    DA  Z C6    1 
ATOM   1155 N N6    . DA  D 2 5   ? -18.504 9.628   -18.861 1.00 34.98  ? 9    DA  Z N6    1 
ATOM   1156 N N1    . DA  D 2 5   ? -19.536 7.711   -18.099 1.00 36.92  ? 9    DA  Z N1    1 
ATOM   1157 C C2    . DA  D 2 5   ? -19.462 6.404   -17.806 1.00 37.11  ? 9    DA  Z C2    1 
ATOM   1158 N N3    . DA  D 2 5   ? -18.425 5.569   -17.915 1.00 38.46  ? 9    DA  Z N3    1 
ATOM   1159 C C4    . DA  D 2 5   ? -17.343 6.211   -18.395 1.00 38.14  ? 9    DA  Z C4    1 
ATOM   1160 P P     . DT  D 2 6   ? -14.672 0.313   -19.482 1.00 49.68  ? 8    DT  Z P     1 
ATOM   1161 O OP1   . DT  D 2 6   ? -14.183 -0.940  -18.844 1.00 52.67  ? 8    DT  Z OP1   1 
ATOM   1162 O OP2   . DT  D 2 6   ? -14.134 0.720   -20.807 1.00 49.34  ? 8    DT  Z OP2   1 
ATOM   1163 O "O5'" . DT  D 2 6   ? -16.249 0.214   -19.602 1.00 48.67  ? 8    DT  Z "O5'" 1 
ATOM   1164 C "C5'" . DT  D 2 6   ? -17.045 1.359   -19.357 1.00 49.13  ? 8    DT  Z "C5'" 1 
ATOM   1165 C "C4'" . DT  D 2 6   ? -18.502 1.027   -19.540 1.00 48.59  ? 8    DT  Z "C4'" 1 
ATOM   1166 O "O4'" . DT  D 2 6   ? -19.213 2.281   -19.515 1.00 46.86  ? 8    DT  Z "O4'" 1 
ATOM   1167 C "C3'" . DT  D 2 6   ? -18.798 0.394   -20.894 1.00 50.78  ? 8    DT  Z "C3'" 1 
ATOM   1168 O "O3'" . DT  D 2 6   ? -19.818 -0.596  -20.781 1.00 55.91  ? 8    DT  Z "O3'" 1 
ATOM   1169 C "C2'" . DT  D 2 6   ? -19.230 1.559   -21.763 1.00 48.94  ? 8    DT  Z "C2'" 1 
ATOM   1170 C "C1'" . DT  D 2 6   ? -19.786 2.574   -20.777 1.00 45.18  ? 8    DT  Z "C1'" 1 
ATOM   1171 N N1    . DT  D 2 6   ? -19.420 3.962   -21.108 1.00 43.72  ? 8    DT  Z N1    1 
ATOM   1172 C C2    . DT  D 2 6   ? -20.349 4.953   -20.892 1.00 42.15  ? 8    DT  Z C2    1 
ATOM   1173 O O2    . DT  D 2 6   ? -21.454 4.742   -20.418 1.00 42.62  ? 8    DT  Z O2    1 
ATOM   1174 N N3    . DT  D 2 6   ? -19.931 6.210   -21.247 1.00 39.78  ? 8    DT  Z N3    1 
ATOM   1175 C C4    . DT  D 2 6   ? -18.705 6.567   -21.769 1.00 38.36  ? 8    DT  Z C4    1 
ATOM   1176 O O4    . DT  D 2 6   ? -18.474 7.739   -22.040 1.00 34.87  ? 8    DT  Z O4    1 
ATOM   1177 C C5    . DT  D 2 6   ? -17.773 5.481   -21.953 1.00 39.43  ? 8    DT  Z C5    1 
ATOM   1178 C C7    . DT  D 2 6   ? -16.411 5.780   -22.497 1.00 38.75  ? 8    DT  Z C7    1 
ATOM   1179 C C6    . DT  D 2 6   ? -18.173 4.249   -21.623 1.00 40.57  ? 8    DT  Z C6    1 
ATOM   1180 P P     . DC  D 2 7   ? -19.913 -1.759  -21.885 1.00 59.38  ? 7    DC  Z P     1 
ATOM   1181 O OP1   . DC  D 2 7   ? -20.058 -3.057  -21.177 1.00 60.17  ? 7    DC  Z OP1   1 
ATOM   1182 O OP2   . DC  D 2 7   ? -18.820 -1.580  -22.876 1.00 59.87  ? 7    DC  Z OP2   1 
ATOM   1183 O "O5'" . DC  D 2 7   ? -21.274 -1.432  -22.630 1.00 60.72  ? 7    DC  Z "O5'" 1 
ATOM   1184 C "C5'" . DC  D 2 7   ? -22.471 -1.199  -21.898 1.00 60.54  ? 7    DC  Z "C5'" 1 
ATOM   1185 C "C4'" . DC  D 2 7   ? -23.518 -0.646  -22.829 1.00 61.61  ? 7    DC  Z "C4'" 1 
ATOM   1186 O "O4'" . DC  D 2 7   ? -23.250 0.761   -23.050 1.00 60.64  ? 7    DC  Z "O4'" 1 
ATOM   1187 C "C3'" . DC  D 2 7   ? -23.448 -1.321  -24.198 1.00 63.67  ? 7    DC  Z "C3'" 1 
ATOM   1188 O "O3'" . DC  D 2 7   ? -24.738 -1.616  -24.723 1.00 67.80  ? 7    DC  Z "O3'" 1 
ATOM   1189 C "C2'" . DC  D 2 7   ? -22.720 -0.313  -25.068 1.00 62.50  ? 7    DC  Z "C2'" 1 
ATOM   1190 C "C1'" . DC  D 2 7   ? -23.091 1.019   -24.436 1.00 60.88  ? 7    DC  Z "C1'" 1 
ATOM   1191 N N1    . DC  D 2 7   ? -22.063 2.066   -24.591 1.00 58.52  ? 7    DC  Z N1    1 
ATOM   1192 C C2    . DC  D 2 7   ? -22.337 3.363   -24.136 1.00 56.78  ? 7    DC  Z C2    1 
ATOM   1193 O O2    . DC  D 2 7   ? -23.422 3.590   -23.580 1.00 54.13  ? 7    DC  Z O2    1 
ATOM   1194 N N3    . DC  D 2 7   ? -21.411 4.334   -24.311 1.00 56.57  ? 7    DC  Z N3    1 
ATOM   1195 C C4    . DC  D 2 7   ? -20.248 4.048   -24.905 1.00 57.13  ? 7    DC  Z C4    1 
ATOM   1196 N N4    . DC  D 2 7   ? -19.371 5.040   -25.073 1.00 57.39  ? 7    DC  Z N4    1 
ATOM   1197 C C5    . DC  D 2 7   ? -19.935 2.733   -25.358 1.00 57.29  ? 7    DC  Z C5    1 
ATOM   1198 C C6    . DC  D 2 7   ? -20.861 1.783   -25.182 1.00 57.90  ? 7    DC  Z C6    1 
ATOM   1199 P P     . DG  D 2 8   ? -24.909 -2.865  -25.715 1.00 70.64  ? 6    DG  Z P     1 
ATOM   1200 O OP1   . DG  D 2 8   ? -25.679 -3.907  -24.990 1.00 72.79  ? 6    DG  Z OP1   1 
ATOM   1201 O OP2   . DG  D 2 8   ? -23.576 -3.196  -26.280 1.00 68.32  ? 6    DG  Z OP2   1 
ATOM   1202 O "O5'" . DG  D 2 8   ? -25.814 -2.293  -26.891 1.00 71.35  ? 6    DG  Z "O5'" 1 
ATOM   1203 C "C5'" . DG  D 2 8   ? -27.045 -1.630  -26.617 1.00 73.70  ? 6    DG  Z "C5'" 1 
ATOM   1204 C "C4'" . DG  D 2 8   ? -27.495 -0.875  -27.844 1.00 75.94  ? 6    DG  Z "C4'" 1 
ATOM   1205 O "O4'" . DG  D 2 8   ? -26.567 0.207   -28.095 1.00 76.19  ? 6    DG  Z "O4'" 1 
ATOM   1206 C "C3'" . DG  D 2 8   ? -27.490 -1.725  -29.113 1.00 77.30  ? 6    DG  Z "C3'" 1 
ATOM   1207 O "O3'" . DG  D 2 8   ? -28.537 -1.293  -29.989 1.00 79.67  ? 6    DG  Z "O3'" 1 
ATOM   1208 C "C2'" . DG  D 2 8   ? -26.122 -1.443  -29.707 1.00 77.28  ? 6    DG  Z "C2'" 1 
ATOM   1209 C "C1'" . DG  D 2 8   ? -25.915 0.017   -29.342 1.00 77.13  ? 6    DG  Z "C1'" 1 
ATOM   1210 N N9    . DG  D 2 8   ? -24.522 0.425   -29.180 1.00 77.29  ? 6    DG  Z N9    1 
ATOM   1211 C C8    . DG  D 2 8   ? -23.436 -0.379  -28.925 1.00 77.14  ? 6    DG  Z C8    1 
ATOM   1212 N N7    . DG  D 2 8   ? -22.320 0.289   -28.808 1.00 76.68  ? 6    DG  Z N7    1 
ATOM   1213 C C5    . DG  D 2 8   ? -22.690 1.613   -29.002 1.00 77.00  ? 6    DG  Z C5    1 
ATOM   1214 C C6    . DG  D 2 8   ? -21.910 2.802   -28.985 1.00 76.54  ? 6    DG  Z C6    1 
ATOM   1215 O O6    . DG  D 2 8   ? -20.696 2.927   -28.783 1.00 75.57  ? 6    DG  Z O6    1 
ATOM   1216 N N1    . DG  D 2 8   ? -22.690 3.927   -29.235 1.00 76.89  ? 6    DG  Z N1    1 
ATOM   1217 C C2    . DG  D 2 8   ? -24.045 3.915   -29.467 1.00 77.56  ? 6    DG  Z C2    1 
ATOM   1218 N N2    . DG  D 2 8   ? -24.621 5.103   -29.691 1.00 77.20  ? 6    DG  Z N2    1 
ATOM   1219 N N3    . DG  D 2 8   ? -24.782 2.817   -29.478 1.00 77.71  ? 6    DG  Z N3    1 
ATOM   1220 C C4    . DG  D 2 8   ? -24.045 1.712   -29.241 1.00 77.43  ? 6    DG  Z C4    1 
ATOM   1221 P P     . DC  D 2 9   ? -28.912 -2.173  -31.280 1.00 81.90  ? 5    DC  Z P     1 
ATOM   1222 O OP1   . DC  D 2 9   ? -30.394 -2.275  -31.334 1.00 81.99  ? 5    DC  Z OP1   1 
ATOM   1223 O OP2   . DC  D 2 9   ? -28.087 -3.410  -31.271 1.00 81.50  ? 5    DC  Z OP2   1 
ATOM   1224 O "O5'" . DC  D 2 9   ? -28.433 -1.270  -32.497 1.00 81.09  ? 5    DC  Z "O5'" 1 
ATOM   1225 C "C5'" . DC  D 2 9   ? -27.265 -0.475  -32.373 1.00 81.64  ? 5    DC  Z "C5'" 1 
ATOM   1226 C "C4'" . DC  D 2 9   ? -27.349 0.731   -33.275 1.00 81.42  ? 5    DC  Z "C4'" 1 
ATOM   1227 O "O4'" . DC  D 2 9   ? -26.264 1.623   -32.939 1.00 81.84  ? 5    DC  Z "O4'" 1 
ATOM   1228 C "C3'" . DC  D 2 9   ? -27.182 0.415   -34.756 1.00 80.79  ? 5    DC  Z "C3'" 1 
ATOM   1229 O "O3'" . DC  D 2 9   ? -27.882 1.400   -35.518 1.00 80.63  ? 5    DC  Z "O3'" 1 
ATOM   1230 C "C2'" . DC  D 2 9   ? -25.682 0.536   -34.953 1.00 81.29  ? 5    DC  Z "C2'" 1 
ATOM   1231 C "C1'" . DC  D 2 9   ? -25.302 1.649   -33.983 1.00 81.72  ? 5    DC  Z "C1'" 1 
ATOM   1232 N N1    . DC  D 2 9   ? -23.981 1.490   -33.357 1.00 81.02  ? 5    DC  Z N1    1 
ATOM   1233 C C2    . DC  D 2 9   ? -23.128 2.593   -33.300 1.00 80.76  ? 5    DC  Z C2    1 
ATOM   1234 O O2    . DC  D 2 9   ? -23.501 3.664   -33.799 1.00 80.68  ? 5    DC  Z O2    1 
ATOM   1235 N N3    . DC  D 2 9   ? -21.921 2.464   -32.705 1.00 80.59  ? 5    DC  Z N3    1 
ATOM   1236 C C4    . DC  D 2 9   ? -21.555 1.290   -32.185 1.00 80.54  ? 5    DC  Z C4    1 
ATOM   1237 N N4    . DC  D 2 9   ? -20.357 1.211   -31.600 1.00 79.37  ? 5    DC  Z N4    1 
ATOM   1238 C C5    . DC  D 2 9   ? -22.403 0.146   -32.240 1.00 80.42  ? 5    DC  Z C5    1 
ATOM   1239 C C6    . DC  D 2 9   ? -23.595 0.289   -32.829 1.00 80.62  ? 5    DC  Z C6    1 
ATOM   1240 P P     . DA  D 2 10  ? -28.329 1.083   -37.026 1.00 79.85  ? 4    DA  Z P     1 
ATOM   1241 O OP1   . DA  D 2 10  ? -29.750 0.653   -36.990 1.00 79.93  ? 4    DA  Z OP1   1 
ATOM   1242 O OP2   . DA  D 2 10  ? -27.312 0.205   -37.659 1.00 79.24  ? 4    DA  Z OP2   1 
ATOM   1243 O "O5'" . DA  D 2 10  ? -28.269 2.516   -37.718 1.00 78.44  ? 4    DA  Z "O5'" 1 
ATOM   1244 C "C5'" . DA  D 2 10  ? -28.770 3.671   -37.041 1.00 77.04  ? 4    DA  Z "C5'" 1 
ATOM   1245 C "C4'" . DA  D 2 10  ? -27.913 4.875   -37.356 1.00 75.44  ? 4    DA  Z "C4'" 1 
ATOM   1246 O "O4'" . DA  D 2 10  ? -26.618 4.737   -36.716 1.00 75.35  ? 4    DA  Z "O4'" 1 
ATOM   1247 C "C3'" . DA  D 2 10  ? -27.633 5.061   -38.847 1.00 74.37  ? 4    DA  Z "C3'" 1 
ATOM   1248 O "O3'" . DA  D 2 10  ? -27.657 6.446   -39.198 1.00 71.68  ? 4    DA  Z "O3'" 1 
ATOM   1249 C "C2'" . DA  D 2 10  ? -26.234 4.497   -39.018 1.00 74.99  ? 4    DA  Z "C2'" 1 
ATOM   1250 C "C1'" . DA  D 2 10  ? -25.584 4.827   -37.687 1.00 74.99  ? 4    DA  Z "C1'" 1 
ATOM   1251 N N9    . DA  D 2 10  ? -24.522 3.895   -37.308 1.00 75.11  ? 4    DA  Z N9    1 
ATOM   1252 C C8    . DA  D 2 10  ? -24.540 2.524   -37.387 1.00 74.90  ? 4    DA  Z C8    1 
ATOM   1253 N N7    . DA  D 2 10  ? -23.428 1.956   -36.985 1.00 74.63  ? 4    DA  Z N7    1 
ATOM   1254 C C5    . DA  D 2 10  ? -22.624 3.024   -36.612 1.00 74.45  ? 4    DA  Z C5    1 
ATOM   1255 C C6    . DA  D 2 10  ? -21.317 3.090   -36.094 1.00 73.40  ? 4    DA  Z C6    1 
ATOM   1256 N N6    . DA  D 2 10  ? -20.561 2.017   -35.853 1.00 71.66  ? 4    DA  Z N6    1 
ATOM   1257 N N1    . DA  D 2 10  ? -20.808 4.312   -35.830 1.00 73.08  ? 4    DA  Z N1    1 
ATOM   1258 C C2    . DA  D 2 10  ? -21.568 5.388   -36.070 1.00 73.67  ? 4    DA  Z C2    1 
ATOM   1259 N N3    . DA  D 2 10  ? -22.808 5.455   -36.551 1.00 74.19  ? 4    DA  Z N3    1 
ATOM   1260 C C4    . DA  D 2 10  ? -23.285 4.224   -36.804 1.00 74.65  ? 4    DA  Z C4    1 
ATOM   1261 P P     . DT  D 2 11  ? -27.320 6.887   -40.706 1.00 69.73  ? 3    DT  Z P     1 
ATOM   1262 O OP1   . DT  D 2 11  ? -28.195 8.041   -41.029 1.00 70.47  ? 3    DT  Z OP1   1 
ATOM   1263 O OP2   . DT  D 2 11  ? -27.343 5.682   -41.572 1.00 68.81  ? 3    DT  Z OP2   1 
ATOM   1264 O "O5'" . DT  D 2 11  ? -25.822 7.416   -40.615 1.00 67.71  ? 3    DT  Z "O5'" 1 
ATOM   1265 C "C5'" . DT  D 2 11  ? -25.473 8.420   -39.669 1.00 62.68  ? 3    DT  Z "C5'" 1 
ATOM   1266 C "C4'" . DT  D 2 11  ? -23.998 8.736   -39.748 1.00 60.75  ? 3    DT  Z "C4'" 1 
ATOM   1267 O "O4'" . DT  D 2 11  ? -23.206 7.640   -39.222 1.00 59.11  ? 3    DT  Z "O4'" 1 
ATOM   1268 C "C3'" . DT  D 2 11  ? -23.456 9.023   -41.151 1.00 59.36  ? 3    DT  Z "C3'" 1 
ATOM   1269 O "O3'" . DT  D 2 11  ? -22.602 10.164  -41.086 1.00 58.76  ? 3    DT  Z "O3'" 1 
ATOM   1270 C "C2'" . DT  D 2 11  ? -22.646 7.782   -41.482 1.00 58.45  ? 3    DT  Z "C2'" 1 
ATOM   1271 C "C1'" . DT  D 2 11  ? -22.135 7.376   -40.113 1.00 57.71  ? 3    DT  Z "C1'" 1 
ATOM   1272 N N1    . DT  D 2 11  ? -21.757 5.956   -39.978 1.00 56.53  ? 3    DT  Z N1    1 
ATOM   1273 C C2    . DT  D 2 11  ? -20.542 5.670   -39.388 1.00 55.32  ? 3    DT  Z C2    1 
ATOM   1274 O O2    . DT  D 2 11  ? -19.785 6.532   -38.970 1.00 52.65  ? 3    DT  Z O2    1 
ATOM   1275 N N3    . DT  D 2 11  ? -20.246 4.332   -39.306 1.00 53.55  ? 3    DT  Z N3    1 
ATOM   1276 C C4    . DT  D 2 11  ? -21.024 3.276   -39.746 1.00 55.16  ? 3    DT  Z C4    1 
ATOM   1277 O O4    . DT  D 2 11  ? -20.625 2.121   -39.607 1.00 52.71  ? 3    DT  Z O4    1 
ATOM   1278 C C5    . DT  D 2 11  ? -22.285 3.651   -40.355 1.00 55.01  ? 3    DT  Z C5    1 
ATOM   1279 C C7    . DT  D 2 11  ? -23.189 2.575   -40.869 1.00 55.53  ? 3    DT  Z C7    1 
ATOM   1280 C C6    . DT  D 2 11  ? -22.585 4.954   -40.434 1.00 55.12  ? 3    DT  Z C6    1 
ATOM   1281 P P     . DT  D 2 12  ? -21.824 10.667  -42.398 1.00 58.79  ? 2    DT  Z P     1 
ATOM   1282 O OP1   . DT  D 2 12  ? -22.040 12.134  -42.473 1.00 57.03  ? 2    DT  Z OP1   1 
ATOM   1283 O OP2   . DT  D 2 12  ? -22.144 9.810   -43.568 1.00 57.04  ? 2    DT  Z OP2   1 
ATOM   1284 O "O5'" . DT  D 2 12  ? -20.301 10.416  -42.015 1.00 56.58  ? 2    DT  Z "O5'" 1 
ATOM   1285 C "C5'" . DT  D 2 12  ? -19.827 10.770  -40.722 1.00 53.30  ? 2    DT  Z "C5'" 1 
ATOM   1286 C "C4'" . DT  D 2 12  ? -18.353 10.472  -40.606 1.00 50.07  ? 2    DT  Z "C4'" 1 
ATOM   1287 O "O4'" . DT  D 2 12  ? -18.133 9.050   -40.456 1.00 48.21  ? 2    DT  Z "O4'" 1 
ATOM   1288 C "C3'" . DT  D 2 12  ? -17.527 10.917  -41.809 1.00 49.44  ? 2    DT  Z "C3'" 1 
ATOM   1289 O "O3'" . DT  D 2 12  ? -16.381 11.626  -41.336 1.00 49.55  ? 2    DT  Z "O3'" 1 
ATOM   1290 C "C2'" . DT  D 2 12  ? -17.193 9.616   -42.530 1.00 48.10  ? 2    DT  Z "C2'" 1 
ATOM   1291 C "C1'" . DT  D 2 12  ? -17.202 8.578   -41.414 1.00 47.75  ? 2    DT  Z "C1'" 1 
ATOM   1292 N N1    . DT  D 2 12  ? -17.633 7.215   -41.801 1.00 46.84  ? 2    DT  Z N1    1 
ATOM   1293 C C2    . DT  D 2 12  ? -16.826 6.137   -41.482 1.00 46.84  ? 2    DT  Z C2    1 
ATOM   1294 O O2    . DT  D 2 12  ? -15.732 6.246   -40.956 1.00 47.36  ? 2    DT  Z O2    1 
ATOM   1295 N N3    . DT  D 2 12  ? -17.352 4.913   -41.806 1.00 46.33  ? 2    DT  Z N3    1 
ATOM   1296 C C4    . DT  D 2 12  ? -18.568 4.658   -42.412 1.00 49.28  ? 2    DT  Z C4    1 
ATOM   1297 O O4    . DT  D 2 12  ? -18.925 3.494   -42.602 1.00 47.96  ? 2    DT  Z O4    1 
ATOM   1298 C C5    . DT  D 2 12  ? -19.337 5.833   -42.765 1.00 48.24  ? 2    DT  Z C5    1 
ATOM   1299 C C7    . DT  D 2 12  ? -20.645 5.661   -43.473 1.00 49.72  ? 2    DT  Z C7    1 
ATOM   1300 C C6    . DT  D 2 12  ? -18.838 7.034   -42.443 1.00 48.51  ? 2    DT  Z C6    1 
ATOM   1301 P P     . DT  D 2 13  ? -15.150 11.897  -42.318 1.00 48.41  ? 1    DT  Z P     1 
ATOM   1302 O OP1   . DT  D 2 13  ? -14.331 13.000  -41.751 1.00 49.34  ? 1    DT  Z OP1   1 
ATOM   1303 O OP2   . DT  D 2 13  ? -15.639 11.987  -43.716 1.00 50.55  ? 1    DT  Z OP2   1 
ATOM   1304 O "O5'" . DT  D 2 13  ? -14.330 10.555  -42.160 1.00 49.00  ? 1    DT  Z "O5'" 1 
ATOM   1305 C "C5'" . DT  D 2 13  ? -13.158 10.345  -42.895 1.00 48.09  ? 1    DT  Z "C5'" 1 
ATOM   1306 C "C4'" . DT  D 2 13  ? -12.300 9.329   -42.192 1.00 45.29  ? 1    DT  Z "C4'" 1 
ATOM   1307 O "O4'" . DT  D 2 13  ? -13.039 8.090   -42.046 1.00 44.69  ? 1    DT  Z "O4'" 1 
ATOM   1308 C "C3'" . DT  D 2 13  ? -11.071 8.999   -43.017 1.00 44.77  ? 1    DT  Z "C3'" 1 
ATOM   1309 O "O3'" . DT  D 2 13  ? -9.944  8.830   -42.158 1.00 41.81  ? 1    DT  Z "O3'" 1 
ATOM   1310 C "C2'" . DT  D 2 13  ? -11.478 7.741   -43.766 1.00 42.97  ? 1    DT  Z "C2'" 1 
ATOM   1311 C "C1'" . DT  D 2 13  ? -12.420 7.054   -42.793 1.00 44.33  ? 1    DT  Z "C1'" 1 
ATOM   1312 N N1    . DT  D 2 13  ? -13.484 6.268   -43.448 1.00 44.93  ? 1    DT  Z N1    1 
ATOM   1313 C C2    . DT  D 2 13  ? -13.390 4.894   -43.426 1.00 45.46  ? 1    DT  Z C2    1 
ATOM   1314 O O2    . DT  D 2 13  ? -12.462 4.297   -42.904 1.00 47.91  ? 1    DT  Z O2    1 
ATOM   1315 N N3    . DT  D 2 13  ? -14.423 4.238   -44.050 1.00 46.45  ? 1    DT  Z N3    1 
ATOM   1316 C C4    . DT  D 2 13  ? -15.510 4.807   -44.689 1.00 45.36  ? 1    DT  Z C4    1 
ATOM   1317 O O4    . DT  D 2 13  ? -16.361 4.089   -45.201 1.00 43.09  ? 1    DT  Z O4    1 
ATOM   1318 C C5    . DT  D 2 13  ? -15.537 6.253   -44.688 1.00 45.60  ? 1    DT  Z C5    1 
ATOM   1319 C C7    . DT  D 2 13  ? -16.664 6.960   -45.375 1.00 46.14  ? 1    DT  Z C7    1 
ATOM   1320 C C6    . DT  D 2 13  ? -14.540 6.902   -44.068 1.00 44.74  ? 1    DT  Z C6    1 
ATOM   1321 P P     . DT  D 2 14  ? -8.469  8.898   -42.776 1.00 43.17  ? -1   DT  Z P     1 
ATOM   1322 O OP1   . DT  D 2 14  ? -7.583  9.606   -41.815 1.00 42.11  ? -1   DT  Z OP1   1 
ATOM   1323 O OP2   . DT  D 2 14  ? -8.580  9.381   -44.173 1.00 42.16  ? -1   DT  Z OP2   1 
ATOM   1324 O "O5'" . DT  D 2 14  ? -8.028  7.375   -42.800 1.00 43.98  ? -1   DT  Z "O5'" 1 
ATOM   1325 C "C5'" . DT  D 2 14  ? -9.009  6.363   -42.806 1.00 44.79  ? -1   DT  Z "C5'" 1 
ATOM   1326 C "C4'" . DT  D 2 14  ? -8.365  5.014   -42.635 1.00 46.45  ? -1   DT  Z "C4'" 1 
ATOM   1327 O "O4'" . DT  D 2 14  ? -9.344  4.045   -43.061 1.00 46.30  ? -1   DT  Z "O4'" 1 
ATOM   1328 C "C3'" . DT  D 2 14  ? -7.155  4.809   -43.538 1.00 47.68  ? -1   DT  Z "C3'" 1 
ATOM   1329 O "O3'" . DT  D 2 14  ? -6.218  3.943   -42.894 1.00 49.68  ? -1   DT  Z "O3'" 1 
ATOM   1330 C "C2'" . DT  D 2 14  ? -7.750  4.230   -44.808 1.00 47.60  ? -1   DT  Z "C2'" 1 
ATOM   1331 C "C1'" . DT  D 2 14  ? -9.010  3.513   -44.334 1.00 47.44  ? -1   DT  Z "C1'" 1 
ATOM   1332 N N1    . DT  D 2 14  ? -10.184 3.713   -45.208 1.00 47.49  ? -1   DT  Z N1    1 
ATOM   1333 C C2    . DT  D 2 14  ? -10.928 2.613   -45.557 1.00 46.24  ? -1   DT  Z C2    1 
ATOM   1334 O O2    . DT  D 2 14  ? -10.646 1.483   -45.202 1.00 46.78  ? -1   DT  Z O2    1 
ATOM   1335 N N3    . DT  D 2 14  ? -12.021 2.886   -46.343 1.00 46.92  ? -1   DT  Z N3    1 
ATOM   1336 C C4    . DT  D 2 14  ? -12.429 4.124   -46.804 1.00 47.37  ? -1   DT  Z C4    1 
ATOM   1337 O O4    . DT  D 2 14  ? -13.442 4.220   -47.493 1.00 48.55  ? -1   DT  Z O4    1 
ATOM   1338 C C5    . DT  D 2 14  ? -11.593 5.233   -46.413 1.00 46.25  ? -1   DT  Z C5    1 
ATOM   1339 C C7    . DT  D 2 14  ? -11.952 6.610   -46.874 1.00 46.01  ? -1   DT  Z C7    1 
ATOM   1340 C C6    . DT  D 2 14  ? -10.526 4.975   -45.646 1.00 46.76  ? -1   DT  Z C6    1 
ATOM   1341 P P     . DT  D 2 15  ? -4.926  3.424   -43.694 1.00 52.01  ? -2   DT  Z P     1 
ATOM   1342 O OP1   . DT  D 2 15  ? -3.861  3.161   -42.694 1.00 52.92  ? -2   DT  Z OP1   1 
ATOM   1343 O OP2   . DT  D 2 15  ? -4.652  4.325   -44.836 1.00 53.10  ? -2   DT  Z OP2   1 
ATOM   1344 O "O5'" . DT  D 2 15  ? -5.425  2.023   -44.251 1.00 53.47  ? -2   DT  Z "O5'" 1 
ATOM   1345 C "C5'" . DT  D 2 15  ? -6.103  1.125   -43.385 1.00 55.95  ? -2   DT  Z "C5'" 1 
ATOM   1346 C "C4'" . DT  D 2 15  ? -6.525  -0.110  -44.140 1.00 59.00  ? -2   DT  Z "C4'" 1 
ATOM   1347 O "O4'" . DT  D 2 15  ? -7.684  0.166   -44.963 1.00 57.65  ? -2   DT  Z "O4'" 1 
ATOM   1348 C "C3'" . DT  D 2 15  ? -5.451  -0.661  -45.075 1.00 60.83  ? -2   DT  Z "C3'" 1 
ATOM   1349 O "O3'" . DT  D 2 15  ? -5.430  -2.086  -44.959 1.00 65.47  ? -2   DT  Z "O3'" 1 
ATOM   1350 C "C2'" . DT  D 2 15  ? -5.914  -0.202  -46.449 1.00 59.26  ? -2   DT  Z "C2'" 1 
ATOM   1351 C "C1'" . DT  D 2 15  ? -7.428  -0.232  -46.300 1.00 58.69  ? -2   DT  Z "C1'" 1 
ATOM   1352 N N1    . DT  D 2 15  ? -8.194  0.667   -47.190 1.00 56.99  ? -2   DT  Z N1    1 
ATOM   1353 C C2    . DT  D 2 15  ? -9.289  0.147   -47.846 1.00 56.92  ? -2   DT  Z C2    1 
ATOM   1354 O O2    . DT  D 2 15  ? -9.613  -1.026  -47.779 1.00 58.05  ? -2   DT  Z O2    1 
ATOM   1355 N N3    . DT  D 2 15  ? -9.992  1.057   -48.593 1.00 55.52  ? -2   DT  Z N3    1 
ATOM   1356 C C4    . DT  D 2 15  ? -9.711  2.398   -48.758 1.00 55.45  ? -2   DT  Z C4    1 
ATOM   1357 O O4    . DT  D 2 15  ? -10.453 3.099   -49.440 1.00 55.12  ? -2   DT  Z O4    1 
ATOM   1358 C C5    . DT  D 2 15  ? -8.528  2.868   -48.077 1.00 54.71  ? -2   DT  Z C5    1 
ATOM   1359 C C7    . DT  D 2 15  ? -8.129  4.302   -48.225 1.00 54.28  ? -2   DT  Z C7    1 
ATOM   1360 C C6    . DT  D 2 15  ? -7.838  1.991   -47.337 1.00 55.67  ? -2   DT  Z C6    1 
ATOM   1361 P P     . DC  D 2 16  ? -4.186  -2.921  -45.539 1.00 68.84  ? -3   DC  Z P     1 
ATOM   1362 O OP1   . DC  D 2 16  ? -3.745  -3.870  -44.484 1.00 69.34  ? -3   DC  Z OP1   1 
ATOM   1363 O OP2   . DC  D 2 16  ? -3.209  -1.977  -46.140 1.00 68.05  ? -3   DC  Z OP2   1 
ATOM   1364 O "O5'" . DC  D 2 16  ? -4.867  -3.745  -46.714 1.00 71.33  ? -3   DC  Z "O5'" 1 
ATOM   1365 C "C5'" . DC  D 2 16  ? -5.961  -3.172  -47.417 1.00 74.83  ? -3   DC  Z "C5'" 1 
ATOM   1366 C "C4'" . DC  D 2 16  ? -6.629  -4.198  -48.296 1.00 76.17  ? -3   DC  Z "C4'" 1 
ATOM   1367 O "O4'" . DC  D 2 16  ? -7.658  -3.503  -49.033 1.00 75.94  ? -3   DC  Z "O4'" 1 
ATOM   1368 C "C3'" . DC  D 2 16  ? -5.697  -4.789  -49.346 1.00 77.95  ? -3   DC  Z "C3'" 1 
ATOM   1369 O "O3'" . DC  D 2 16  ? -6.130  -6.110  -49.679 1.00 82.43  ? -3   DC  Z "O3'" 1 
ATOM   1370 C "C2'" . DC  D 2 16  ? -5.840  -3.830  -50.512 1.00 76.52  ? -3   DC  Z "C2'" 1 
ATOM   1371 C "C1'" . DC  D 2 16  ? -7.277  -3.333  -50.391 1.00 74.85  ? -3   DC  Z "C1'" 1 
ATOM   1372 N N1    . DC  D 2 16  ? -7.451  -1.909  -50.721 1.00 72.78  ? -3   DC  Z N1    1 
ATOM   1373 C C2    . DC  D 2 16  ? -8.634  -1.503  -51.345 1.00 73.08  ? -3   DC  Z C2    1 
ATOM   1374 O O2    . DC  D 2 16  ? -9.499  -2.355  -51.600 1.00 73.84  ? -3   DC  Z O2    1 
ATOM   1375 N N3    . DC  D 2 16  ? -8.806  -0.195  -51.652 1.00 72.17  ? -3   DC  Z N3    1 
ATOM   1376 C C4    . DC  D 2 16  ? -7.853  0.691   -51.355 1.00 70.58  ? -3   DC  Z C4    1 
ATOM   1377 N N4    . DC  D 2 16  ? -8.070  1.970   -51.672 1.00 69.45  ? -3   DC  Z N4    1 
ATOM   1378 C C5    . DC  D 2 16  ? -6.636  0.305   -50.719 1.00 69.91  ? -3   DC  Z C5    1 
ATOM   1379 C C6    . DC  D 2 16  ? -6.479  -0.992  -50.423 1.00 71.53  ? -3   DC  Z C6    1 
ATOM   1380 P P     . DG  D 2 17  ? -5.082  -7.169  -50.282 1.00 85.99  ? -4   DG  Z P     1 
ATOM   1381 O OP1   . DG  D 2 17  ? -5.051  -8.336  -49.362 1.00 85.33  ? -4   DG  Z OP1   1 
ATOM   1382 O OP2   . DG  D 2 17  ? -3.816  -6.462  -50.615 1.00 85.84  ? -4   DG  Z OP2   1 
ATOM   1383 O "O5'" . DG  D 2 17  ? -5.773  -7.627  -51.641 1.00 87.33  ? -4   DG  Z "O5'" 1 
ATOM   1384 C "C5'" . DG  D 2 17  ? -7.150  -8.004  -51.663 1.00 89.95  ? -4   DG  Z "C5'" 1 
ATOM   1385 C "C4'" . DG  D 2 17  ? -7.757  -7.690  -53.011 1.00 91.63  ? -4   DG  Z "C4'" 1 
ATOM   1386 O "O4'" . DG  D 2 17  ? -7.884  -6.256  -53.188 1.00 90.69  ? -4   DG  Z "O4'" 1 
ATOM   1387 C "C3'" . DG  D 2 17  ? -6.939  -8.189  -54.203 1.00 93.50  ? -4   DG  Z "C3'" 1 
ATOM   1388 O "O3'" . DG  D 2 17  ? -7.822  -8.639  -55.231 1.00 97.89  ? -4   DG  Z "O3'" 1 
ATOM   1389 C "C2'" . DG  D 2 17  ? -6.216  -6.941  -54.672 1.00 91.70  ? -4   DG  Z "C2'" 1 
ATOM   1390 C "C1'" . DG  D 2 17  ? -7.265  -5.879  -54.409 1.00 89.33  ? -4   DG  Z "C1'" 1 
ATOM   1391 N N9    . DG  D 2 17  ? -6.748  -4.522  -54.261 1.00 86.66  ? -4   DG  Z N9    1 
ATOM   1392 C C8    . DG  D 2 17  ? -5.558  -4.139  -53.691 1.00 85.74  ? -4   DG  Z C8    1 
ATOM   1393 N N7    . DG  D 2 17  ? -5.375  -2.847  -53.709 1.00 84.69  ? -4   DG  Z N7    1 
ATOM   1394 C C5    . DG  D 2 17  ? -6.512  -2.347  -54.329 1.00 83.72  ? -4   DG  Z C5    1 
ATOM   1395 C C6    . DG  D 2 17  ? -6.882  -1.010  -54.632 1.00 83.01  ? -4   DG  Z C6    1 
ATOM   1396 O O6    . DG  D 2 17  ? -6.261  0.035   -54.404 1.00 81.86  ? -4   DG  Z O6    1 
ATOM   1397 N N1    . DG  D 2 17  ? -8.118  -0.956  -55.269 1.00 82.62  ? -4   DG  Z N1    1 
ATOM   1398 C C2    . DG  D 2 17  ? -8.898  -2.045  -55.575 1.00 82.53  ? -4   DG  Z C2    1 
ATOM   1399 N N2    . DG  D 2 17  ? -10.057 -1.787  -56.197 1.00 81.74  ? -4   DG  Z N2    1 
ATOM   1400 N N3    . DG  D 2 17  ? -8.565  -3.292  -55.296 1.00 83.06  ? -4   DG  Z N3    1 
ATOM   1401 C C4    . DG  D 2 17  ? -7.368  -3.369  -54.677 1.00 84.55  ? -4   DG  Z C4    1 
ATOM   1402 P P     . DA  D 2 18  ? -7.263  -9.575  -56.408 1.00 101.15 ? -5   DA  Z P     1 
ATOM   1403 O OP1   . DA  D 2 18  ? -7.575  -10.978 -56.029 1.00 100.90 ? -5   DA  Z OP1   1 
ATOM   1404 O OP2   . DA  D 2 18  ? -5.860  -9.186  -56.701 1.00 100.78 ? -5   DA  Z OP2   1 
ATOM   1405 O "O5'" . DA  D 2 18  ? -8.166  -9.167  -57.655 1.00 102.62 ? -5   DA  Z "O5'" 1 
ATOM   1406 C "C5'" . DA  D 2 18  ? -9.563  -8.938  -57.492 1.00 106.13 ? -5   DA  Z "C5'" 1 
ATOM   1407 C "C4'" . DA  D 2 18  ? -10.011 -7.785  -58.359 1.00 108.66 ? -5   DA  Z "C4'" 1 
ATOM   1408 O "O4'" . DA  D 2 18  ? -9.391  -6.558  -57.902 1.00 109.15 ? -5   DA  Z "O4'" 1 
ATOM   1409 C "C3'" . DA  D 2 18  ? -9.646  -7.914  -59.839 1.00 110.34 ? -5   DA  Z "C3'" 1 
ATOM   1410 O "O3'" . DA  D 2 18  ? -10.709 -7.395  -60.642 1.00 112.86 ? -5   DA  Z "O3'" 1 
ATOM   1411 C "C2'" . DA  D 2 18  ? -8.417  -7.034  -59.974 1.00 110.04 ? -5   DA  Z "C2'" 1 
ATOM   1412 C "C1'" . DA  D 2 18  ? -8.724  -5.927  -58.985 1.00 109.53 ? -5   DA  Z "C1'" 1 
ATOM   1413 N N9    . DA  D 2 18  ? -7.548  -5.239  -58.453 1.00 109.58 ? -5   DA  Z N9    1 
ATOM   1414 C C8    . DA  D 2 18  ? -6.424  -5.794  -57.892 1.00 109.69 ? -5   DA  Z C8    1 
ATOM   1415 N N7    . DA  D 2 18  ? -5.536  -4.910  -57.503 1.00 109.60 ? -5   DA  Z N7    1 
ATOM   1416 C C5    . DA  D 2 18  ? -6.113  -3.691  -57.832 1.00 109.19 ? -5   DA  Z C5    1 
ATOM   1417 C C6    . DA  D 2 18  ? -5.675  -2.363  -57.676 1.00 109.00 ? -5   DA  Z C6    1 
ATOM   1418 N N6    . DA  D 2 18  ? -4.505  -2.029  -57.127 1.00 108.91 ? -5   DA  Z N6    1 
ATOM   1419 N N1    . DA  D 2 18  ? -6.491  -1.378  -58.110 1.00 108.86 ? -5   DA  Z N1    1 
ATOM   1420 C C2    . DA  D 2 18  ? -7.664  -1.714  -58.661 1.00 108.81 ? -5   DA  Z C2    1 
ATOM   1421 N N3    . DA  D 2 18  ? -8.186  -2.923  -58.861 1.00 108.89 ? -5   DA  Z N3    1 
ATOM   1422 C C4    . DA  D 2 18  ? -7.351  -3.879  -58.419 1.00 109.18 ? -5   DA  Z C4    1 
ATOM   1423 P P     . DA  D 2 19  ? -10.745 -7.710  -62.216 1.00 114.70 ? -6   DA  Z P     1 
ATOM   1424 O OP1   . DA  D 2 19  ? -12.107 -8.208  -62.540 1.00 114.39 ? -6   DA  Z OP1   1 
ATOM   1425 O OP2   . DA  D 2 19  ? -9.559  -8.540  -62.552 1.00 114.81 ? -6   DA  Z OP2   1 
ATOM   1426 O "O5'" . DA  D 2 19  ? -10.564 -6.281  -62.894 1.00 115.47 ? -6   DA  Z "O5'" 1 
ATOM   1427 C "C5'" . DA  D 2 19  ? -11.618 -5.321  -62.862 1.00 117.16 ? -6   DA  Z "C5'" 1 
ATOM   1428 C "C4'" . DA  D 2 19  ? -11.186 -4.050  -63.554 1.00 118.23 ? -6   DA  Z "C4'" 1 
ATOM   1429 O "O4'" . DA  D 2 19  ? -10.148 -3.405  -62.776 1.00 117.77 ? -6   DA  Z "O4'" 1 
ATOM   1430 C "C3'" . DA  D 2 19  ? -10.597 -4.261  -64.949 1.00 119.43 ? -6   DA  Z "C3'" 1 
ATOM   1431 O "O3'" . DA  D 2 19  ? -10.981 -3.186  -65.809 1.00 121.98 ? -6   DA  Z "O3'" 1 
ATOM   1432 C "C2'" . DA  D 2 19  ? -9.101  -4.219  -64.704 1.00 118.66 ? -6   DA  Z "C2'" 1 
ATOM   1433 C "C1'" . DA  D 2 19  ? -9.002  -3.199  -63.587 1.00 117.46 ? -6   DA  Z "C1'" 1 
ATOM   1434 N N9    . DA  D 2 19  ? -7.818  -3.345  -62.743 1.00 116.43 ? -6   DA  Z N9    1 
ATOM   1435 C C8    . DA  D 2 19  ? -7.310  -4.489  -62.181 1.00 116.01 ? -6   DA  Z C8    1 
ATOM   1436 N N7    . DA  D 2 19  ? -6.220  -4.295  -61.480 1.00 115.67 ? -6   DA  Z N7    1 
ATOM   1437 C C5    . DA  D 2 19  ? -5.996  -2.929  -61.586 1.00 115.70 ? -6   DA  Z C5    1 
ATOM   1438 C C6    . DA  D 2 19  ? -4.993  -2.091  -61.067 1.00 115.61 ? -6   DA  Z C6    1 
ATOM   1439 N N6    . DA  D 2 19  ? -3.985  -2.525  -60.309 1.00 115.52 ? -6   DA  Z N6    1 
ATOM   1440 N N1    . DA  D 2 19  ? -5.062  -0.773  -61.360 1.00 115.44 ? -6   DA  Z N1    1 
ATOM   1441 C C2    . DA  D 2 19  ? -6.073  -0.339  -62.123 1.00 115.58 ? -6   DA  Z C2    1 
ATOM   1442 N N3    . DA  D 2 19  ? -7.072  -1.027  -62.669 1.00 115.69 ? -6   DA  Z N3    1 
ATOM   1443 C C4    . DA  D 2 19  ? -6.974  -2.331  -62.358 1.00 115.95 ? -6   DA  Z C4    1 
ATOM   1444 P P     . DA  D 2 20  ? -10.534 -3.200  -67.352 1.00 123.98 ? -7   DA  Z P     1 
ATOM   1445 O OP1   . DA  D 2 20  ? -11.755 -2.960  -68.164 1.00 123.94 ? -7   DA  Z OP1   1 
ATOM   1446 O OP2   . DA  D 2 20  ? -9.721  -4.420  -67.594 1.00 123.65 ? -7   DA  Z OP2   1 
ATOM   1447 O "O5'" . DA  D 2 20  ? -9.586  -1.925  -67.484 1.00 125.00 ? -7   DA  Z "O5'" 1 
ATOM   1448 C "C5'" . DA  D 2 20  ? -10.056 -0.626  -67.120 1.00 126.98 ? -7   DA  Z "C5'" 1 
ATOM   1449 C "C4'" . DA  D 2 20  ? -8.940  0.388   -67.220 1.00 128.39 ? -7   DA  Z "C4'" 1 
ATOM   1450 O "O4'" . DA  D 2 20  ? -7.913  0.075   -66.248 1.00 128.11 ? -7   DA  Z "O4'" 1 
ATOM   1451 C "C3'" . DA  D 2 20  ? -8.235  0.446   -68.576 1.00 129.72 ? -7   DA  Z "C3'" 1 
ATOM   1452 O "O3'" . DA  D 2 20  ? -7.883  1.799   -68.889 1.00 132.39 ? -7   DA  Z "O3'" 1 
ATOM   1453 C "C2'" . DA  D 2 20  ? -6.978  -0.373  -68.348 1.00 128.82 ? -7   DA  Z "C2'" 1 
ATOM   1454 C "C1'" . DA  D 2 20  ? -6.658  -0.052  -66.900 1.00 127.64 ? -7   DA  Z "C1'" 1 
ATOM   1455 N N9    . DA  D 2 20  ? -5.891  -1.086  -66.206 1.00 126.36 ? -7   DA  Z N9    1 
ATOM   1456 C C8    . DA  D 2 20  ? -6.080  -2.446  -66.235 1.00 125.91 ? -7   DA  Z C8    1 
ATOM   1457 N N7    . DA  D 2 20  ? -5.216  -3.114  -65.511 1.00 125.24 ? -7   DA  Z N7    1 
ATOM   1458 C C5    . DA  D 2 20  ? -4.405  -2.129  -64.967 1.00 125.00 ? -7   DA  Z C5    1 
ATOM   1459 C C6    . DA  D 2 20  ? -3.298  -2.186  -64.108 1.00 124.72 ? -7   DA  Z C6    1 
ATOM   1460 N N6    . DA  D 2 20  ? -2.792  -3.325  -63.630 1.00 124.40 ? -7   DA  Z N6    1 
ATOM   1461 N N1    . DA  D 2 20  ? -2.717  -1.019  -63.754 1.00 124.79 ? -7   DA  Z N1    1 
ATOM   1462 C C2    . DA  D 2 20  ? -3.223  0.122   -64.238 1.00 124.77 ? -7   DA  Z C2    1 
ATOM   1463 N N3    . DA  D 2 20  ? -4.257  0.305   -65.054 1.00 125.07 ? -7   DA  Z N3    1 
ATOM   1464 C C4    . DA  D 2 20  ? -4.811  -0.875  -65.385 1.00 125.49 ? -7   DA  Z C4    1 
ATOM   1465 P P     . DT  D 2 21  ? -7.807  2.269   -70.425 1.00 134.36 ? -8   DT  Z P     1 
ATOM   1466 O OP1   . DT  D 2 21  ? -8.753  3.404   -70.589 1.00 134.16 ? -8   DT  Z OP1   1 
ATOM   1467 O OP2   . DT  D 2 21  ? -7.945  1.067   -71.288 1.00 134.22 ? -8   DT  Z OP2   1 
ATOM   1468 O "O5'" . DT  D 2 21  ? -6.322  2.829   -70.586 1.00 135.26 ? -8   DT  Z "O5'" 1 
ATOM   1469 C "C5'" . DT  D 2 21  ? -5.856  3.922   -69.792 1.00 136.76 ? -8   DT  Z "C5'" 1 
ATOM   1470 C "C4'" . DT  D 2 21  ? -4.350  4.032   -69.883 1.00 137.69 ? -8   DT  Z "C4'" 1 
ATOM   1471 O "O4'" . DT  D 2 21  ? -3.770  2.804   -69.387 1.00 138.21 ? -8   DT  Z "O4'" 1 
ATOM   1472 C "C3'" . DT  D 2 21  ? -3.800  4.197   -71.298 1.00 137.93 ? -8   DT  Z "C3'" 1 
ATOM   1473 O "O3'" . DT  D 2 21  ? -2.492  4.774   -71.245 1.00 137.87 ? -8   DT  Z "O3'" 1 
ATOM   1474 C "C2'" . DT  D 2 21  ? -3.606  2.761   -71.744 1.00 138.24 ? -8   DT  Z "C2'" 1 
ATOM   1475 C "C1'" . DT  D 2 21  ? -3.178  2.070   -70.453 1.00 138.67 ? -8   DT  Z "C1'" 1 
ATOM   1476 N N1    . DT  D 2 21  ? -3.634  0.671   -70.334 1.00 139.36 ? -8   DT  Z N1    1 
ATOM   1477 C C2    . DT  D 2 21  ? -3.411  0.018   -69.142 1.00 139.76 ? -8   DT  Z C2    1 
ATOM   1478 O O2    . DT  D 2 21  ? -2.854  0.540   -68.188 1.00 139.45 ? -8   DT  Z O2    1 
ATOM   1479 N N3    . DT  D 2 21  ? -3.870  -1.277  -69.106 1.00 140.26 ? -8   DT  Z N3    1 
ATOM   1480 C C4    . DT  D 2 21  ? -4.512  -1.966  -70.120 1.00 140.43 ? -8   DT  Z C4    1 
ATOM   1481 O O4    . DT  D 2 21  ? -4.868  -3.129  -69.941 1.00 140.82 ? -8   DT  Z O4    1 
ATOM   1482 C C5    . DT  D 2 21  ? -4.709  -1.221  -71.342 1.00 140.25 ? -8   DT  Z C5    1 
ATOM   1483 C C7    . DT  D 2 21  ? -5.394  -1.885  -72.495 1.00 140.09 ? -8   DT  Z C7    1 
ATOM   1484 C C6    . DT  D 2 21  ? -4.266  0.042   -71.387 1.00 139.83 ? -8   DT  Z C6    1 
ATOM   1485 N N     . THR E 3 7   ? 29.464  -17.409 2.149   1.00 49.01  ? 7    THR A N     1 
ATOM   1486 C CA    . THR E 3 7   ? 30.456  -16.934 1.147   1.00 49.27  ? 7    THR A CA    1 
ATOM   1487 C C     . THR E 3 7   ? 31.283  -18.089 0.596   1.00 48.51  ? 7    THR A C     1 
ATOM   1488 O O     . THR E 3 7   ? 31.336  -19.166 1.189   1.00 49.04  ? 7    THR A O     1 
ATOM   1489 C CB    . THR E 3 7   ? 31.424  -15.905 1.763   1.00 50.61  ? 7    THR A CB    1 
ATOM   1490 O OG1   . THR E 3 7   ? 32.387  -15.502 0.780   1.00 52.43  ? 7    THR A OG1   1 
ATOM   1491 C CG2   . THR E 3 7   ? 32.153  -16.507 2.955   1.00 51.74  ? 7    THR A CG2   1 
ATOM   1492 N N     . ASP E 3 8   ? 31.917  -17.862 -0.550  1.00 46.23  ? 8    ASP A N     1 
ATOM   1493 C CA    . ASP E 3 8   ? 32.760  -18.878 -1.161  1.00 43.91  ? 8    ASP A CA    1 
ATOM   1494 C C     . ASP E 3 8   ? 33.962  -18.216 -1.824  1.00 42.11  ? 8    ASP A C     1 
ATOM   1495 O O     . ASP E 3 8   ? 34.132  -16.996 -1.741  1.00 42.47  ? 8    ASP A O     1 
ATOM   1496 C CB    . ASP E 3 8   ? 31.966  -19.717 -2.175  1.00 44.74  ? 8    ASP A CB    1 
ATOM   1497 C CG    . ASP E 3 8   ? 31.356  -18.887 -3.293  1.00 47.10  ? 8    ASP A CG    1 
ATOM   1498 O OD1   . ASP E 3 8   ? 32.032  -17.973 -3.810  1.00 43.97  ? 8    ASP A OD1   1 
ATOM   1499 O OD2   . ASP E 3 8   ? 30.196  -19.171 -3.668  1.00 47.33  ? 8    ASP A OD2   1 
ATOM   1500 N N     . PRO E 3 9   ? 34.826  -19.008 -2.476  1.00 39.24  ? 9    PRO A N     1 
ATOM   1501 C CA    . PRO E 3 9   ? 35.996  -18.410 -3.125  1.00 38.12  ? 9    PRO A CA    1 
ATOM   1502 C C     . PRO E 3 9   ? 35.676  -17.410 -4.238  1.00 36.98  ? 9    PRO A C     1 
ATOM   1503 O O     . PRO E 3 9   ? 36.482  -16.527 -4.519  1.00 36.40  ? 9    PRO A O     1 
ATOM   1504 C CB    . PRO E 3 9   ? 36.761  -19.630 -3.645  1.00 38.22  ? 9    PRO A CB    1 
ATOM   1505 C CG    . PRO E 3 9   ? 36.431  -20.683 -2.624  1.00 38.53  ? 9    PRO A CG    1 
ATOM   1506 C CD    . PRO E 3 9   ? 34.940  -20.479 -2.447  1.00 38.37  ? 9    PRO A CD    1 
ATOM   1507 N N     . THR E 3 10  ? 34.516  -17.543 -4.876  1.00 34.82  ? 10   THR A N     1 
ATOM   1508 C CA    . THR E 3 10  ? 34.154  -16.628 -5.958  1.00 35.77  ? 10   THR A CA    1 
ATOM   1509 C C     . THR E 3 10  ? 33.699  -15.277 -5.404  1.00 36.98  ? 10   THR A C     1 
ATOM   1510 O O     . THR E 3 10  ? 34.094  -14.220 -5.915  1.00 37.01  ? 10   THR A O     1 
ATOM   1511 C CB    . THR E 3 10  ? 33.047  -17.229 -6.862  1.00 36.84  ? 10   THR A CB    1 
ATOM   1512 O OG1   . THR E 3 10  ? 33.479  -18.500 -7.368  1.00 35.60  ? 10   THR A OG1   1 
ATOM   1513 C CG2   . THR E 3 10  ? 32.765  -16.318 -8.049  1.00 35.44  ? 10   THR A CG2   1 
ATOM   1514 N N     . LEU E 3 11  ? 32.887  -15.313 -4.350  1.00 36.57  ? 11   LEU A N     1 
ATOM   1515 C CA    . LEU E 3 11  ? 32.407  -14.093 -3.717  1.00 37.83  ? 11   LEU A CA    1 
ATOM   1516 C C     . LEU E 3 11  ? 33.593  -13.326 -3.128  1.00 38.81  ? 11   LEU A C     1 
ATOM   1517 O O     . LEU E 3 11  ? 33.703  -12.108 -3.296  1.00 38.91  ? 11   LEU A O     1 
ATOM   1518 C CB    . LEU E 3 11  ? 31.397  -14.421 -2.615  1.00 37.16  ? 11   LEU A CB    1 
ATOM   1519 C CG    . LEU E 3 11  ? 30.784  -13.220 -1.877  1.00 38.69  ? 11   LEU A CG    1 
ATOM   1520 C CD1   . LEU E 3 11  ? 30.109  -12.299 -2.880  1.00 36.12  ? 11   LEU A CD1   1 
ATOM   1521 C CD2   . LEU E 3 11  ? 29.779  -13.692 -0.831  1.00 37.47  ? 11   LEU A CD2   1 
ATOM   1522 N N     . GLU E 3 12  ? 34.485  -14.045 -2.446  1.00 39.69  ? 12   GLU A N     1 
ATOM   1523 C CA    . GLU E 3 12  ? 35.664  -13.431 -1.842  1.00 40.17  ? 12   GLU A CA    1 
ATOM   1524 C C     . GLU E 3 12  ? 36.556  -12.827 -2.916  1.00 38.82  ? 12   GLU A C     1 
ATOM   1525 O O     . GLU E 3 12  ? 37.085  -11.726 -2.743  1.00 38.18  ? 12   GLU A O     1 
ATOM   1526 C CB    . GLU E 3 12  ? 36.443  -14.459 -1.014  1.00 43.03  ? 12   GLU A CB    1 
ATOM   1527 C CG    . GLU E 3 12  ? 36.049  -14.467 0.460   1.00 49.64  ? 12   GLU A CG    1 
ATOM   1528 C CD    . GLU E 3 12  ? 36.718  -13.347 1.255   1.00 53.89  ? 12   GLU A CD    1 
ATOM   1529 O OE1   . GLU E 3 12  ? 37.923  -13.479 1.574   1.00 56.06  ? 12   GLU A OE1   1 
ATOM   1530 O OE2   . GLU E 3 12  ? 36.049  -12.332 1.556   1.00 56.42  ? 12   GLU A OE2   1 
ATOM   1531 N N     . TRP E 3 13  ? 36.725  -13.547 -4.022  1.00 36.53  ? 13   TRP A N     1 
ATOM   1532 C CA    . TRP E 3 13  ? 37.530  -13.038 -5.128  1.00 36.31  ? 13   TRP A CA    1 
ATOM   1533 C C     . TRP E 3 13  ? 36.913  -11.720 -5.601  1.00 36.20  ? 13   TRP A C     1 
ATOM   1534 O O     . TRP E 3 13  ? 37.608  -10.718 -5.782  1.00 36.65  ? 13   TRP A O     1 
ATOM   1535 C CB    . TRP E 3 13  ? 37.536  -14.037 -6.284  1.00 36.31  ? 13   TRP A CB    1 
ATOM   1536 C CG    . TRP E 3 13  ? 38.030  -13.465 -7.584  1.00 37.77  ? 13   TRP A CG    1 
ATOM   1537 C CD1   . TRP E 3 13  ? 39.329  -13.190 -7.928  1.00 37.06  ? 13   TRP A CD1   1 
ATOM   1538 C CD2   . TRP E 3 13  ? 37.228  -13.070 -8.705  1.00 36.85  ? 13   TRP A CD2   1 
ATOM   1539 N NE1   . TRP E 3 13  ? 39.378  -12.651 -9.193  1.00 37.23  ? 13   TRP A NE1   1 
ATOM   1540 C CE2   . TRP E 3 13  ? 38.105  -12.565 -9.692  1.00 38.31  ? 13   TRP A CE2   1 
ATOM   1541 C CE3   . TRP E 3 13  ? 35.850  -13.094 -8.972  1.00 38.83  ? 13   TRP A CE3   1 
ATOM   1542 C CZ2   . TRP E 3 13  ? 37.648  -12.084 -10.928 1.00 38.39  ? 13   TRP A CZ2   1 
ATOM   1543 C CZ3   . TRP E 3 13  ? 35.395  -12.617 -10.203 1.00 36.67  ? 13   TRP A CZ3   1 
ATOM   1544 C CH2   . TRP E 3 13  ? 36.294  -12.119 -11.163 1.00 37.67  ? 13   TRP A CH2   1 
ATOM   1545 N N     . PHE E 3 14  ? 35.599  -11.729 -5.794  1.00 35.43  ? 14   PHE A N     1 
ATOM   1546 C CA    . PHE E 3 14  ? 34.884  -10.541 -6.253  1.00 34.77  ? 14   PHE A CA    1 
ATOM   1547 C C     . PHE E 3 14  ? 35.011  -9.371  -5.284  1.00 33.20  ? 14   PHE A C     1 
ATOM   1548 O O     . PHE E 3 14  ? 35.356  -8.261  -5.685  1.00 33.51  ? 14   PHE A O     1 
ATOM   1549 C CB    . PHE E 3 14  ? 33.389  -10.845 -6.458  1.00 34.60  ? 14   PHE A CB    1 
ATOM   1550 C CG    . PHE E 3 14  ? 32.579  -9.635  -6.842  1.00 32.73  ? 14   PHE A CG    1 
ATOM   1551 C CD1   . PHE E 3 14  ? 32.748  -9.039  -8.086  1.00 31.83  ? 14   PHE A CD1   1 
ATOM   1552 C CD2   . PHE E 3 14  ? 31.688  -9.061  -5.940  1.00 31.98  ? 14   PHE A CD2   1 
ATOM   1553 C CE1   . PHE E 3 14  ? 32.042  -7.879  -8.429  1.00 33.08  ? 14   PHE A CE1   1 
ATOM   1554 C CE2   . PHE E 3 14  ? 30.978  -7.905  -6.271  1.00 31.68  ? 14   PHE A CE2   1 
ATOM   1555 C CZ    . PHE E 3 14  ? 31.158  -7.313  -7.521  1.00 31.47  ? 14   PHE A CZ    1 
ATOM   1556 N N     . LEU E 3 15  ? 34.731  -9.623  -4.009  1.00 32.02  ? 15   LEU A N     1 
ATOM   1557 C CA    . LEU E 3 15  ? 34.791  -8.569  -3.001  1.00 32.23  ? 15   LEU A CA    1 
ATOM   1558 C C     . LEU E 3 15  ? 36.178  -7.957  -2.802  1.00 33.63  ? 15   LEU A C     1 
ATOM   1559 O O     . LEU E 3 15  ? 36.282  -6.787  -2.453  1.00 32.24  ? 15   LEU A O     1 
ATOM   1560 C CB    . LEU E 3 15  ? 34.235  -9.082  -1.658  1.00 31.01  ? 15   LEU A CB    1 
ATOM   1561 C CG    . LEU E 3 15  ? 32.750  -9.494  -1.689  1.00 31.36  ? 15   LEU A CG    1 
ATOM   1562 C CD1   . LEU E 3 15  ? 32.299  -9.993  -0.319  1.00 32.61  ? 15   LEU A CD1   1 
ATOM   1563 C CD2   . LEU E 3 15  ? 31.897  -8.297  -2.121  1.00 29.32  ? 15   LEU A CD2   1 
ATOM   1564 N N     . SER E 3 16  ? 37.239  -8.727  -3.044  1.00 33.87  ? 16   SER A N     1 
ATOM   1565 C CA    . SER E 3 16  ? 38.593  -8.205  -2.860  1.00 35.48  ? 16   SER A CA    1 
ATOM   1566 C C     . SER E 3 16  ? 38.900  -7.106  -3.870  1.00 36.92  ? 16   SER A C     1 
ATOM   1567 O O     . SER E 3 16  ? 39.879  -6.373  -3.717  1.00 36.50  ? 16   SER A O     1 
ATOM   1568 C CB    . SER E 3 16  ? 39.637  -9.317  -2.998  1.00 35.56  ? 16   SER A CB    1 
ATOM   1569 O OG    . SER E 3 16  ? 39.796  -9.698  -4.354  1.00 35.07  ? 16   SER A OG    1 
ATOM   1570 N N     . HIS E 3 17  ? 38.069  -7.002  -4.904  1.00 36.92  ? 17   HIS A N     1 
ATOM   1571 C CA    . HIS E 3 17  ? 38.246  -5.973  -5.925  1.00 36.63  ? 17   HIS A CA    1 
ATOM   1572 C C     . HIS E 3 17  ? 37.307  -4.792  -5.670  1.00 37.05  ? 17   HIS A C     1 
ATOM   1573 O O     . HIS E 3 17  ? 37.282  -3.842  -6.455  1.00 35.71  ? 17   HIS A O     1 
ATOM   1574 C CB    . HIS E 3 17  ? 37.941  -6.518  -7.324  1.00 38.64  ? 17   HIS A CB    1 
ATOM   1575 C CG    . HIS E 3 17  ? 38.908  -7.549  -7.811  1.00 40.20  ? 17   HIS A CG    1 
ATOM   1576 N ND1   . HIS E 3 17  ? 38.830  -8.876  -7.447  1.00 42.25  ? 17   HIS A ND1   1 
ATOM   1577 C CD2   . HIS E 3 17  ? 39.961  -7.451  -8.658  1.00 41.39  ? 17   HIS A CD2   1 
ATOM   1578 C CE1   . HIS E 3 17  ? 39.791  -9.553  -8.053  1.00 42.09  ? 17   HIS A CE1   1 
ATOM   1579 N NE2   . HIS E 3 17  ? 40.491  -8.712  -8.793  1.00 42.81  ? 17   HIS A NE2   1 
ATOM   1580 N N     . CYS E 3 18  ? 36.541  -4.855  -4.582  1.00 36.15  ? 18   CYS A N     1 
ATOM   1581 C CA    . CYS E 3 18  ? 35.572  -3.808  -4.250  1.00 37.02  ? 18   CYS A CA    1 
ATOM   1582 C C     . CYS E 3 18  ? 35.893  -3.030  -2.979  1.00 38.99  ? 18   CYS A C     1 
ATOM   1583 O O     . CYS E 3 18  ? 36.775  -3.405  -2.208  1.00 38.32  ? 18   CYS A O     1 
ATOM   1584 C CB    . CYS E 3 18  ? 34.172  -4.414  -4.044  1.00 35.57  ? 18   CYS A CB    1 
ATOM   1585 S SG    . CYS E 3 18  ? 33.466  -5.356  -5.406  1.00 32.41  ? 18   CYS A SG    1 
ATOM   1586 N N     . HIS E 3 19  ? 35.143  -1.949  -2.774  1.00 38.95  ? 19   HIS A N     1 
ATOM   1587 C CA    . HIS E 3 19  ? 35.248  -1.124  -1.573  1.00 41.80  ? 19   HIS A CA    1 
ATOM   1588 C C     . HIS E 3 19  ? 33.957  -1.398  -0.806  1.00 40.82  ? 19   HIS A C     1 
ATOM   1589 O O     . HIS E 3 19  ? 32.858  -1.257  -1.348  1.00 40.20  ? 19   HIS A O     1 
ATOM   1590 C CB    . HIS E 3 19  ? 35.322  0.370   -1.911  1.00 44.06  ? 19   HIS A CB    1 
ATOM   1591 C CG    . HIS E 3 19  ? 36.636  0.800   -2.486  1.00 49.55  ? 19   HIS A CG    1 
ATOM   1592 N ND1   . HIS E 3 19  ? 37.086  0.374   -3.718  1.00 50.66  ? 19   HIS A ND1   1 
ATOM   1593 C CD2   . HIS E 3 19  ? 37.595  1.623   -1.999  1.00 50.45  ? 19   HIS A CD2   1 
ATOM   1594 C CE1   . HIS E 3 19  ? 38.266  0.916   -3.965  1.00 50.96  ? 19   HIS A CE1   1 
ATOM   1595 N NE2   . HIS E 3 19  ? 38.597  1.678   -2.938  1.00 52.46  ? 19   HIS A NE2   1 
ATOM   1596 N N     . ILE E 3 20  ? 34.085  -1.790  0.452   1.00 41.47  ? 20   ILE A N     1 
ATOM   1597 C CA    . ILE E 3 20  ? 32.912  -2.097  1.250   1.00 42.51  ? 20   ILE A CA    1 
ATOM   1598 C C     . ILE E 3 20  ? 32.543  -0.972  2.201   1.00 43.02  ? 20   ILE A C     1 
ATOM   1599 O O     . ILE E 3 20  ? 33.390  -0.448  2.918   1.00 43.18  ? 20   ILE A O     1 
ATOM   1600 C CB    . ILE E 3 20  ? 33.125  -3.414  2.018   1.00 43.39  ? 20   ILE A CB    1 
ATOM   1601 C CG1   . ILE E 3 20  ? 33.235  -4.563  1.004   1.00 42.89  ? 20   ILE A CG1   1 
ATOM   1602 C CG2   . ILE E 3 20  ? 31.994  -3.641  3.004   1.00 42.92  ? 20   ILE A CG2   1 
ATOM   1603 C CD1   . ILE E 3 20  ? 33.447  -5.924  1.615   1.00 44.63  ? 20   ILE A CD1   1 
ATOM   1604 N N     . HIS E 3 21  ? 31.266  -0.600  2.179   1.00 44.17  ? 21   HIS A N     1 
ATOM   1605 C CA    . HIS E 3 21  ? 30.736  0.471   3.015   1.00 45.17  ? 21   HIS A CA    1 
ATOM   1606 C C     . HIS E 3 21  ? 29.443  0.028   3.682   1.00 45.06  ? 21   HIS A C     1 
ATOM   1607 O O     . HIS E 3 21  ? 28.706  -0.800  3.141   1.00 42.10  ? 21   HIS A O     1 
ATOM   1608 C CB    . HIS E 3 21  ? 30.444  1.706   2.165   1.00 50.21  ? 21   HIS A CB    1 
ATOM   1609 C CG    . HIS E 3 21  ? 31.640  2.243   1.445   1.00 55.02  ? 21   HIS A CG    1 
ATOM   1610 N ND1   . HIS E 3 21  ? 32.754  2.716   2.105   1.00 57.69  ? 21   HIS A ND1   1 
ATOM   1611 C CD2   . HIS E 3 21  ? 31.897  2.385   0.123   1.00 56.86  ? 21   HIS A CD2   1 
ATOM   1612 C CE1   . HIS E 3 21  ? 33.646  3.128   1.222   1.00 59.14  ? 21   HIS A CE1   1 
ATOM   1613 N NE2   . HIS E 3 21  ? 33.151  2.938   0.011   1.00 58.35  ? 21   HIS A NE2   1 
ATOM   1614 N N     . LYS E 3 22  ? 29.170  0.593   4.854   1.00 43.95  ? 22   LYS A N     1 
ATOM   1615 C CA    . LYS E 3 22  ? 27.960  0.269   5.596   1.00 45.06  ? 22   LYS A CA    1 
ATOM   1616 C C     . LYS E 3 22  ? 27.043  1.481   5.669   1.00 44.74  ? 22   LYS A C     1 
ATOM   1617 O O     . LYS E 3 22  ? 27.486  2.585   5.969   1.00 45.96  ? 22   LYS A O     1 
ATOM   1618 C CB    . LYS E 3 22  ? 28.317  -0.197  7.005   1.00 46.92  ? 22   LYS A CB    1 
ATOM   1619 C CG    . LYS E 3 22  ? 28.992  -1.561  7.054   1.00 50.26  ? 22   LYS A CG    1 
ATOM   1620 C CD    . LYS E 3 22  ? 29.485  -1.878  8.458   1.00 52.02  ? 22   LYS A CD    1 
ATOM   1621 C CE    . LYS E 3 22  ? 30.003  -3.302  8.559   1.00 52.36  ? 22   LYS A CE    1 
ATOM   1622 N NZ    . LYS E 3 22  ? 28.905  -4.288  8.353   1.00 55.15  ? 22   LYS A NZ    1 
ATOM   1623 N N     . TYR E 3 23  ? 25.764  1.268   5.383   1.00 44.60  ? 23   TYR A N     1 
ATOM   1624 C CA    . TYR E 3 23  ? 24.776  2.343   5.413   1.00 43.45  ? 23   TYR A CA    1 
ATOM   1625 C C     . TYR E 3 23  ? 23.693  2.057   6.447   1.00 41.36  ? 23   TYR A C     1 
ATOM   1626 O O     . TYR E 3 23  ? 23.216  0.933   6.562   1.00 41.12  ? 23   TYR A O     1 
ATOM   1627 C CB    . TYR E 3 23  ? 24.092  2.498   4.049   1.00 43.29  ? 23   TYR A CB    1 
ATOM   1628 C CG    . TYR E 3 23  ? 24.998  2.877   2.898   1.00 43.43  ? 23   TYR A CG    1 
ATOM   1629 C CD1   . TYR E 3 23  ? 25.957  1.989   2.414   1.00 43.00  ? 23   TYR A CD1   1 
ATOM   1630 C CD2   . TYR E 3 23  ? 24.862  4.112   2.261   1.00 43.52  ? 23   TYR A CD2   1 
ATOM   1631 C CE1   . TYR E 3 23  ? 26.756  2.317   1.319   1.00 45.05  ? 23   TYR A CE1   1 
ATOM   1632 C CE2   . TYR E 3 23  ? 25.654  4.452   1.164   1.00 45.17  ? 23   TYR A CE2   1 
ATOM   1633 C CZ    . TYR E 3 23  ? 26.598  3.549   0.697   1.00 45.06  ? 23   TYR A CZ    1 
ATOM   1634 O OH    . TYR E 3 23  ? 27.368  3.867   -0.400  1.00 43.97  ? 23   TYR A OH    1 
ATOM   1635 N N     . PRO E 3 24  ? 23.297  3.073   7.220   1.00 41.17  ? 24   PRO A N     1 
ATOM   1636 C CA    . PRO E 3 24  ? 22.252  2.855   8.220   1.00 40.19  ? 24   PRO A CA    1 
ATOM   1637 C C     . PRO E 3 24  ? 20.869  2.922   7.558   1.00 40.78  ? 24   PRO A C     1 
ATOM   1638 O O     . PRO E 3 24  ? 20.725  3.431   6.444   1.00 40.60  ? 24   PRO A O     1 
ATOM   1639 C CB    . PRO E 3 24  ? 22.479  3.999   9.199   1.00 39.68  ? 24   PRO A CB    1 
ATOM   1640 C CG    . PRO E 3 24  ? 22.932  5.103   8.301   1.00 39.15  ? 24   PRO A CG    1 
ATOM   1641 C CD    . PRO E 3 24  ? 23.912  4.403   7.383   1.00 40.16  ? 24   PRO A CD    1 
ATOM   1642 N N     . SER E 3 25  ? 19.861  2.404   8.245   1.00 40.03  ? 25   SER A N     1 
ATOM   1643 C CA    . SER E 3 25  ? 18.493  2.416   7.739   1.00 39.66  ? 25   SER A CA    1 
ATOM   1644 C C     . SER E 3 25  ? 18.070  3.826   7.318   1.00 39.52  ? 25   SER A C     1 
ATOM   1645 O O     . SER E 3 25  ? 18.504  4.814   7.907   1.00 37.31  ? 25   SER A O     1 
ATOM   1646 C CB    . SER E 3 25  ? 17.550  1.904   8.824   1.00 40.39  ? 25   SER A CB    1 
ATOM   1647 O OG    . SER E 3 25  ? 16.226  1.801   8.343   1.00 46.97  ? 25   SER A OG    1 
ATOM   1648 N N     . LYS E 3 26  ? 17.230  3.909   6.289   1.00 39.99  ? 26   LYS A N     1 
ATOM   1649 C CA    . LYS E 3 26  ? 16.719  5.187   5.784   1.00 39.30  ? 26   LYS A CA    1 
ATOM   1650 C C     . LYS E 3 26  ? 17.710  6.018   4.977   1.00 38.21  ? 26   LYS A C     1 
ATOM   1651 O O     . LYS E 3 26  ? 17.337  7.062   4.425   1.00 35.95  ? 26   LYS A O     1 
ATOM   1652 C CB    . LYS E 3 26  ? 16.199  6.064   6.933   1.00 41.47  ? 26   LYS A CB    1 
ATOM   1653 C CG    . LYS E 3 26  ? 15.033  5.496   7.726   1.00 45.72  ? 26   LYS A CG    1 
ATOM   1654 C CD    . LYS E 3 26  ? 14.529  6.546   8.728   1.00 51.01  ? 26   LYS A CD    1 
ATOM   1655 C CE    . LYS E 3 26  ? 13.447  6.004   9.644   1.00 51.88  ? 26   LYS A CE    1 
ATOM   1656 N NZ    . LYS E 3 26  ? 13.963  4.920   10.523  1.00 54.32  ? 26   LYS A NZ    1 
ATOM   1657 N N     . SER E 3 27  ? 18.966  5.590   4.904   1.00 35.31  ? 27   SER A N     1 
ATOM   1658 C CA    . SER E 3 27  ? 19.929  6.373   4.143   1.00 35.97  ? 27   SER A CA    1 
ATOM   1659 C C     . SER E 3 27  ? 19.756  6.162   2.635   1.00 34.62  ? 27   SER A C     1 
ATOM   1660 O O     . SER E 3 27  ? 19.179  5.156   2.194   1.00 32.26  ? 27   SER A O     1 
ATOM   1661 C CB    . SER E 3 27  ? 21.374  6.056   4.574   1.00 36.34  ? 27   SER A CB    1 
ATOM   1662 O OG    . SER E 3 27  ? 21.784  4.760   4.185   1.00 40.13  ? 27   SER A OG    1 
ATOM   1663 N N     . THR E 3 28  ? 20.241  7.134   1.862   1.00 31.88  ? 28   THR A N     1 
ATOM   1664 C CA    . THR E 3 28  ? 20.165  7.107   0.406   1.00 31.07  ? 28   THR A CA    1 
ATOM   1665 C C     . THR E 3 28  ? 21.464  6.586   -0.216  1.00 31.26  ? 28   THR A C     1 
ATOM   1666 O O     . THR E 3 28  ? 22.521  7.186   -0.041  1.00 32.45  ? 28   THR A O     1 
ATOM   1667 C CB    . THR E 3 28  ? 19.901  8.523   -0.158  1.00 30.91  ? 28   THR A CB    1 
ATOM   1668 O OG1   . THR E 3 28  ? 18.676  9.039   0.377   1.00 30.90  ? 28   THR A OG1   1 
ATOM   1669 C CG2   . THR E 3 28  ? 19.798  8.481   -1.678  1.00 31.71  ? 28   THR A CG2   1 
ATOM   1670 N N     . LEU E 3 29  ? 21.391  5.470   -0.935  1.00 30.51  ? 29   LEU A N     1 
ATOM   1671 C CA    . LEU E 3 29  ? 22.576  4.914   -1.581  1.00 29.55  ? 29   LEU A CA    1 
ATOM   1672 C C     . LEU E 3 29  ? 22.772  5.488   -2.975  1.00 29.23  ? 29   LEU A C     1 
ATOM   1673 O O     . LEU E 3 29  ? 23.901  5.754   -3.390  1.00 28.07  ? 29   LEU A O     1 
ATOM   1674 C CB    . LEU E 3 29  ? 22.483  3.383   -1.696  1.00 31.67  ? 29   LEU A CB    1 
ATOM   1675 C CG    . LEU E 3 29  ? 22.610  2.543   -0.422  1.00 33.10  ? 29   LEU A CG    1 
ATOM   1676 C CD1   . LEU E 3 29  ? 21.383  2.740   0.465   1.00 34.34  ? 29   LEU A CD1   1 
ATOM   1677 C CD2   . LEU E 3 29  ? 22.755  1.074   -0.806  1.00 34.42  ? 29   LEU A CD2   1 
ATOM   1678 N N     . ILE E 3 30  ? 21.666  5.666   -3.692  1.00 28.05  ? 30   ILE A N     1 
ATOM   1679 C CA    . ILE E 3 30  ? 21.686  6.189   -5.058  1.00 26.00  ? 30   ILE A CA    1 
ATOM   1680 C C     . ILE E 3 30  ? 20.666  7.317   -5.240  1.00 26.90  ? 30   ILE A C     1 
ATOM   1681 O O     . ILE E 3 30  ? 19.486  7.172   -4.895  1.00 21.60  ? 30   ILE A O     1 
ATOM   1682 C CB    . ILE E 3 30  ? 21.368  5.062   -6.080  1.00 26.72  ? 30   ILE A CB    1 
ATOM   1683 C CG1   . ILE E 3 30  ? 22.445  3.969   -6.012  1.00 27.60  ? 30   ILE A CG1   1 
ATOM   1684 C CG2   . ILE E 3 30  ? 21.307  5.627   -7.490  1.00 25.73  ? 30   ILE A CG2   1 
ATOM   1685 C CD1   . ILE E 3 30  ? 22.270  2.863   -7.040  1.00 27.08  ? 30   ILE A CD1   1 
ATOM   1686 N N     . HIS E 3 31  ? 21.134  8.432   -5.793  1.00 27.65  ? 31   HIS A N     1 
ATOM   1687 C CA    . HIS E 3 31  ? 20.303  9.613   -6.045  1.00 28.48  ? 31   HIS A CA    1 
ATOM   1688 C C     . HIS E 3 31  ? 19.925  9.656   -7.520  1.00 27.79  ? 31   HIS A C     1 
ATOM   1689 O O     . HIS E 3 31  ? 20.802  9.601   -8.385  1.00 26.21  ? 31   HIS A O     1 
ATOM   1690 C CB    . HIS E 3 31  ? 21.087  10.888  -5.706  1.00 31.81  ? 31   HIS A CB    1 
ATOM   1691 C CG    . HIS E 3 31  ? 21.237  11.143  -4.239  1.00 37.25  ? 31   HIS A CG    1 
ATOM   1692 N ND1   . HIS E 3 31  ? 20.329  11.888  -3.516  1.00 40.05  ? 31   HIS A ND1   1 
ATOM   1693 C CD2   . HIS E 3 31  ? 22.193  10.757  -3.359  1.00 39.55  ? 31   HIS A CD2   1 
ATOM   1694 C CE1   . HIS E 3 31  ? 20.720  11.952  -2.254  1.00 39.92  ? 31   HIS A CE1   1 
ATOM   1695 N NE2   . HIS E 3 31  ? 21.848  11.275  -2.132  1.00 40.24  ? 31   HIS A NE2   1 
ATOM   1696 N N     . GLN E 3 32  ? 18.636  9.780   -7.822  1.00 27.64  ? 32   GLN A N     1 
ATOM   1697 C CA    . GLN E 3 32  ? 18.229  9.820   -9.221  1.00 29.66  ? 32   GLN A CA    1 
ATOM   1698 C C     . GLN E 3 32  ? 18.836  11.042  -9.902  1.00 29.65  ? 32   GLN A C     1 
ATOM   1699 O O     . GLN E 3 32  ? 18.947  12.103  -9.296  1.00 26.50  ? 32   GLN A O     1 
ATOM   1700 C CB    . GLN E 3 32  ? 16.711  9.883   -9.344  1.00 32.96  ? 32   GLN A CB    1 
ATOM   1701 C CG    . GLN E 3 32  ? 16.241  9.863   -10.773 1.00 39.89  ? 32   GLN A CG    1 
ATOM   1702 C CD    . GLN E 3 32  ? 14.891  10.513  -10.948 1.00 46.71  ? 32   GLN A CD    1 
ATOM   1703 O OE1   . GLN E 3 32  ? 14.734  11.712  -10.703 1.00 50.22  ? 32   GLN A OE1   1 
ATOM   1704 N NE2   . GLN E 3 32  ? 13.902  9.729   -11.375 1.00 48.28  ? 32   GLN A NE2   1 
ATOM   1705 N N     . GLY E 3 33  ? 19.243  10.885  -11.156 1.00 29.76  ? 33   GLY A N     1 
ATOM   1706 C CA    . GLY E 3 33  ? 19.811  12.007  -11.885 1.00 28.79  ? 33   GLY A CA    1 
ATOM   1707 C C     . GLY E 3 33  ? 21.327  12.166  -11.848 1.00 29.15  ? 33   GLY A C     1 
ATOM   1708 O O     . GLY E 3 33  ? 21.895  12.826  -12.708 1.00 30.39  ? 33   GLY A O     1 
ATOM   1709 N N     . GLU E 3 34  ? 22.002  11.586  -10.864 1.00 28.69  ? 34   GLU A N     1 
ATOM   1710 C CA    . GLU E 3 34  ? 23.456  11.721  -10.822 1.00 29.92  ? 34   GLU A CA    1 
ATOM   1711 C C     . GLU E 3 34  ? 24.112  10.833  -11.883 1.00 29.17  ? 34   GLU A C     1 
ATOM   1712 O O     . GLU E 3 34  ? 23.514  9.854   -12.354 1.00 26.13  ? 34   GLU A O     1 
ATOM   1713 C CB    . GLU E 3 34  ? 23.990  11.369  -9.429  1.00 32.15  ? 34   GLU A CB    1 
ATOM   1714 C CG    . GLU E 3 34  ? 23.580  12.383  -8.360  1.00 39.18  ? 34   GLU A CG    1 
ATOM   1715 C CD    . GLU E 3 34  ? 24.192  12.100  -6.997  1.00 40.56  ? 34   GLU A CD    1 
ATOM   1716 O OE1   . GLU E 3 34  ? 23.961  12.897  -6.063  1.00 44.39  ? 34   GLU A OE1   1 
ATOM   1717 O OE2   . GLU E 3 34  ? 24.898  11.083  -6.857  1.00 42.37  ? 34   GLU A OE2   1 
ATOM   1718 N N     . LYS E 3 35  ? 25.338  11.182  -12.255 1.00 28.69  ? 35   LYS A N     1 
ATOM   1719 C CA    . LYS E 3 35  ? 26.082  10.427  -13.252 1.00 30.80  ? 35   LYS A CA    1 
ATOM   1720 C C     . LYS E 3 35  ? 26.363  9.041   -12.694 1.00 28.31  ? 35   LYS A C     1 
ATOM   1721 O O     . LYS E 3 35  ? 26.710  8.901   -11.523 1.00 30.62  ? 35   LYS A O     1 
ATOM   1722 C CB    . LYS E 3 35  ? 27.401  11.142  -13.591 1.00 33.61  ? 35   LYS A CB    1 
ATOM   1723 C CG    . LYS E 3 35  ? 27.205  12.486  -14.293 1.00 38.62  ? 35   LYS A CG    1 
ATOM   1724 C CD    . LYS E 3 35  ? 26.389  12.293  -15.567 1.00 43.48  ? 35   LYS A CD    1 
ATOM   1725 C CE    . LYS E 3 35  ? 25.792  13.589  -16.092 1.00 44.84  ? 35   LYS A CE    1 
ATOM   1726 N NZ    . LYS E 3 35  ? 24.901  13.300  -17.253 1.00 46.18  ? 35   LYS A NZ    1 
ATOM   1727 N N     . ALA E 3 36  ? 26.200  8.020   -13.527 1.00 26.62  ? 36   ALA A N     1 
ATOM   1728 C CA    . ALA E 3 36  ? 26.433  6.643   -13.103 1.00 25.04  ? 36   ALA A CA    1 
ATOM   1729 C C     . ALA E 3 36  ? 27.813  6.164   -13.561 1.00 26.81  ? 36   ALA A C     1 
ATOM   1730 O O     . ALA E 3 36  ? 28.079  6.065   -14.758 1.00 25.97  ? 36   ALA A O     1 
ATOM   1731 C CB    . ALA E 3 36  ? 25.347  5.734   -13.674 1.00 24.77  ? 36   ALA A CB    1 
ATOM   1732 N N     . GLU E 3 37  ? 28.687  5.856   -12.610 1.00 26.93  ? 37   GLU A N     1 
ATOM   1733 C CA    . GLU E 3 37  ? 30.028  5.395   -12.954 1.00 31.27  ? 37   GLU A CA    1 
ATOM   1734 C C     . GLU E 3 37  ? 30.417  4.156   -12.159 1.00 30.23  ? 37   GLU A C     1 
ATOM   1735 O O     . GLU E 3 37  ? 31.479  3.575   -12.387 1.00 30.79  ? 37   GLU A O     1 
ATOM   1736 C CB    . GLU E 3 37  ? 31.050  6.504   -12.666 1.00 34.28  ? 37   GLU A CB    1 
ATOM   1737 C CG    . GLU E 3 37  ? 30.931  7.732   -13.559 1.00 41.52  ? 37   GLU A CG    1 
ATOM   1738 C CD    . GLU E 3 37  ? 31.698  8.928   -13.007 1.00 45.31  ? 37   GLU A CD    1 
ATOM   1739 O OE1   . GLU E 3 37  ? 32.767  8.725   -12.387 1.00 46.31  ? 37   GLU A OE1   1 
ATOM   1740 O OE2   . GLU E 3 37  ? 31.236  10.073  -13.201 1.00 48.57  ? 37   GLU A OE2   1 
ATOM   1741 N N     . THR E 3 38  ? 29.555  3.769   -11.224 1.00 28.91  ? 38   THR A N     1 
ATOM   1742 C CA    . THR E 3 38  ? 29.818  2.640   -10.355 1.00 28.37  ? 38   THR A CA    1 
ATOM   1743 C C     . THR E 3 38  ? 28.634  1.677   -10.219 1.00 29.04  ? 38   THR A C     1 
ATOM   1744 O O     . THR E 3 38  ? 27.482  2.034   -10.471 1.00 27.25  ? 38   THR A O     1 
ATOM   1745 C CB    . THR E 3 38  ? 30.206  3.142   -8.949  1.00 29.97  ? 38   THR A CB    1 
ATOM   1746 O OG1   . THR E 3 38  ? 29.093  3.827   -8.367  1.00 29.43  ? 38   THR A OG1   1 
ATOM   1747 C CG2   . THR E 3 38  ? 31.382  4.123   -9.032  1.00 30.68  ? 38   THR A CG2   1 
ATOM   1748 N N     . LEU E 3 39  ? 28.948  0.456   -9.798  1.00 28.42  ? 39   LEU A N     1 
ATOM   1749 C CA    . LEU E 3 39  ? 27.977  -0.615  -9.598  1.00 28.36  ? 39   LEU A CA    1 
ATOM   1750 C C     . LEU E 3 39  ? 28.064  -1.024  -8.123  1.00 28.25  ? 39   LEU A C     1 
ATOM   1751 O O     . LEU E 3 39  ? 29.137  -0.928  -7.513  1.00 25.66  ? 39   LEU A O     1 
ATOM   1752 C CB    . LEU E 3 39  ? 28.358  -1.811  -10.477 1.00 31.69  ? 39   LEU A CB    1 
ATOM   1753 C CG    . LEU E 3 39  ? 27.584  -3.120  -10.324 1.00 36.16  ? 39   LEU A CG    1 
ATOM   1754 C CD1   . LEU E 3 39  ? 26.277  -3.016  -11.090 1.00 36.95  ? 39   LEU A CD1   1 
ATOM   1755 C CD2   . LEU E 3 39  ? 28.405  -4.278  -10.870 1.00 38.00  ? 39   LEU A CD2   1 
ATOM   1756 N N     . TYR E 3 40  ? 26.944  -1.473  -7.557  1.00 24.50  ? 40   TYR A N     1 
ATOM   1757 C CA    . TYR E 3 40  ? 26.900  -1.912  -6.169  1.00 23.99  ? 40   TYR A CA    1 
ATOM   1758 C C     . TYR E 3 40  ? 26.394  -3.359  -6.070  1.00 25.59  ? 40   TYR A C     1 
ATOM   1759 O O     . TYR E 3 40  ? 25.664  -3.846  -6.936  1.00 24.88  ? 40   TYR A O     1 
ATOM   1760 C CB    . TYR E 3 40  ? 25.968  -1.018  -5.331  1.00 27.80  ? 40   TYR A CB    1 
ATOM   1761 C CG    . TYR E 3 40  ? 26.306  0.461   -5.319  1.00 31.07  ? 40   TYR A CG    1 
ATOM   1762 C CD1   . TYR E 3 40  ? 26.034  1.269   -6.420  1.00 32.00  ? 40   TYR A CD1   1 
ATOM   1763 C CD2   . TYR E 3 40  ? 26.898  1.049   -4.203  1.00 33.93  ? 40   TYR A CD2   1 
ATOM   1764 C CE1   . TYR E 3 40  ? 26.341  2.626   -6.412  1.00 36.13  ? 40   TYR A CE1   1 
ATOM   1765 C CE2   . TYR E 3 40  ? 27.211  2.407   -4.182  1.00 36.72  ? 40   TYR A CE2   1 
ATOM   1766 C CZ    . TYR E 3 40  ? 26.927  3.188   -5.290  1.00 38.22  ? 40   TYR A CZ    1 
ATOM   1767 O OH    . TYR E 3 40  ? 27.219  4.530   -5.272  1.00 39.28  ? 40   TYR A OH    1 
ATOM   1768 N N     . TYR E 3 41  ? 26.794  -4.040  -5.009  1.00 25.04  ? 41   TYR A N     1 
ATOM   1769 C CA    . TYR E 3 41  ? 26.354  -5.405  -4.759  1.00 26.76  ? 41   TYR A CA    1 
ATOM   1770 C C     . TYR E 3 41  ? 25.963  -5.448  -3.289  1.00 26.37  ? 41   TYR A C     1 
ATOM   1771 O O     . TYR E 3 41  ? 26.748  -5.069  -2.423  1.00 26.04  ? 41   TYR A O     1 
ATOM   1772 C CB    . TYR E 3 41  ? 27.474  -6.413  -5.061  1.00 26.30  ? 41   TYR A CB    1 
ATOM   1773 C CG    . TYR E 3 41  ? 27.166  -7.822  -4.589  1.00 27.56  ? 41   TYR A CG    1 
ATOM   1774 C CD1   . TYR E 3 41  ? 27.553  -8.245  -3.322  1.00 27.11  ? 41   TYR A CD1   1 
ATOM   1775 C CD2   . TYR E 3 41  ? 26.432  -8.707  -5.387  1.00 28.66  ? 41   TYR A CD2   1 
ATOM   1776 C CE1   . TYR E 3 41  ? 27.216  -9.512  -2.853  1.00 31.97  ? 41   TYR A CE1   1 
ATOM   1777 C CE2   . TYR E 3 41  ? 26.083  -9.981  -4.927  1.00 29.32  ? 41   TYR A CE2   1 
ATOM   1778 C CZ    . TYR E 3 41  ? 26.479  -10.370 -3.659  1.00 29.86  ? 41   TYR A CZ    1 
ATOM   1779 O OH    . TYR E 3 41  ? 26.129  -11.595 -3.170  1.00 35.09  ? 41   TYR A OH    1 
ATOM   1780 N N     . ILE E 3 42  ? 24.741  -5.880  -3.007  1.00 26.91  ? 42   ILE A N     1 
ATOM   1781 C CA    . ILE E 3 42  ? 24.281  -5.934  -1.624  1.00 27.26  ? 42   ILE A CA    1 
ATOM   1782 C C     . ILE E 3 42  ? 24.846  -7.157  -0.909  1.00 29.20  ? 42   ILE A C     1 
ATOM   1783 O O     . ILE E 3 42  ? 24.502  -8.290  -1.234  1.00 28.48  ? 42   ILE A O     1 
ATOM   1784 C CB    . ILE E 3 42  ? 22.741  -5.971  -1.542  1.00 26.54  ? 42   ILE A CB    1 
ATOM   1785 C CG1   . ILE E 3 42  ? 22.149  -4.763  -2.271  1.00 27.14  ? 42   ILE A CG1   1 
ATOM   1786 C CG2   . ILE E 3 42  ? 22.303  -5.953  -0.079  1.00 28.69  ? 42   ILE A CG2   1 
ATOM   1787 C CD1   . ILE E 3 42  ? 20.628  -4.679  -2.191  1.00 30.26  ? 42   ILE A CD1   1 
ATOM   1788 N N     . VAL E 3 43  ? 25.720  -6.921  0.064   1.00 31.19  ? 43   VAL A N     1 
ATOM   1789 C CA    . VAL E 3 43  ? 26.331  -8.014  0.813   1.00 31.58  ? 43   VAL A CA    1 
ATOM   1790 C C     . VAL E 3 43  ? 25.356  -8.493  1.877   1.00 32.83  ? 43   VAL A C     1 
ATOM   1791 O O     . VAL E 3 43  ? 25.162  -9.697  2.050   1.00 33.29  ? 43   VAL A O     1 
ATOM   1792 C CB    . VAL E 3 43  ? 27.665  -7.567  1.477   1.00 30.46  ? 43   VAL A CB    1 
ATOM   1793 C CG1   . VAL E 3 43  ? 28.240  -8.698  2.328   1.00 29.97  ? 43   VAL A CG1   1 
ATOM   1794 C CG2   . VAL E 3 43  ? 28.673  -7.171  0.403   1.00 27.74  ? 43   VAL A CG2   1 
ATOM   1795 N N     . LYS E 3 44  ? 24.744  -7.537  2.574   1.00 32.53  ? 44   LYS A N     1 
ATOM   1796 C CA    . LYS E 3 44  ? 23.764  -7.801  3.626   1.00 32.77  ? 44   LYS A CA    1 
ATOM   1797 C C     . LYS E 3 44  ? 22.760  -6.652  3.645   1.00 30.47  ? 44   LYS A C     1 
ATOM   1798 O O     . LYS E 3 44  ? 23.139  -5.516  3.389   1.00 30.14  ? 44   LYS A O     1 
ATOM   1799 C CB    . LYS E 3 44  ? 24.446  -7.874  5.003   1.00 37.63  ? 44   LYS A CB    1 
ATOM   1800 C CG    . LYS E 3 44  ? 24.654  -9.278  5.564   1.00 43.18  ? 44   LYS A CG    1 
ATOM   1801 C CD    . LYS E 3 44  ? 25.653  -10.078 4.734   1.00 49.13  ? 44   LYS A CD    1 
ATOM   1802 C CE    . LYS E 3 44  ? 25.812  -11.511 5.242   1.00 49.68  ? 44   LYS A CE    1 
ATOM   1803 N NZ    . LYS E 3 44  ? 26.718  -12.294 4.351   1.00 49.66  ? 44   LYS A NZ    1 
ATOM   1804 N N     . GLY E 3 45  ? 21.493  -6.945  3.945   1.00 29.00  ? 45   GLY A N     1 
ATOM   1805 C CA    . GLY E 3 45  ? 20.481  -5.896  4.017   1.00 29.56  ? 45   GLY A CA    1 
ATOM   1806 C C     . GLY E 3 45  ? 19.438  -5.839  2.902   1.00 30.38  ? 45   GLY A C     1 
ATOM   1807 O O     . GLY E 3 45  ? 19.415  -6.683  2.020   1.00 29.48  ? 45   GLY A O     1 
ATOM   1808 N N     . SER E 3 46  ? 18.565  -4.836  2.939   1.00 31.07  ? 46   SER A N     1 
ATOM   1809 C CA    . SER E 3 46  ? 17.543  -4.706  1.907   1.00 32.23  ? 46   SER A CA    1 
ATOM   1810 C C     . SER E 3 46  ? 17.306  -3.235  1.607   1.00 30.96  ? 46   SER A C     1 
ATOM   1811 O O     . SER E 3 46  ? 17.475  -2.376  2.486   1.00 29.61  ? 46   SER A O     1 
ATOM   1812 C CB    . SER E 3 46  ? 16.229  -5.370  2.349   1.00 33.51  ? 46   SER A CB    1 
ATOM   1813 O OG    . SER E 3 46  ? 15.502  -4.533  3.235   1.00 40.22  ? 46   SER A OG    1 
ATOM   1814 N N     . VAL E 3 47  ? 16.910  -2.954  0.367   1.00 27.92  ? 47   VAL A N     1 
ATOM   1815 C CA    . VAL E 3 47  ? 16.664  -1.587  -0.075  1.00 26.05  ? 47   VAL A CA    1 
ATOM   1816 C C     . VAL E 3 47  ? 15.362  -1.453  -0.875  1.00 24.28  ? 47   VAL A C     1 
ATOM   1817 O O     . VAL E 3 47  ? 14.776  -2.444  -1.292  1.00 24.15  ? 47   VAL A O     1 
ATOM   1818 C CB    . VAL E 3 47  ? 17.824  -1.082  -0.982  1.00 26.19  ? 47   VAL A CB    1 
ATOM   1819 C CG1   . VAL E 3 47  ? 19.155  -1.199  -0.252  1.00 26.04  ? 47   VAL A CG1   1 
ATOM   1820 C CG2   . VAL E 3 47  ? 17.861  -1.893  -2.274  1.00 24.51  ? 47   VAL A CG2   1 
ATOM   1821 N N     . ALA E 3 48  ? 14.923  -0.216  -1.076  1.00 20.91  ? 48   ALA A N     1 
ATOM   1822 C CA    . ALA E 3 48  ? 13.719  0.060   -1.851  1.00 21.90  ? 48   ALA A CA    1 
ATOM   1823 C C     . ALA E 3 48  ? 14.118  0.929   -3.034  1.00 21.20  ? 48   ALA A C     1 
ATOM   1824 O O     . ALA E 3 48  ? 14.870  1.899   -2.873  1.00 21.49  ? 48   ALA A O     1 
ATOM   1825 C CB    . ALA E 3 48  ? 12.676  0.797   -1.000  1.00 20.70  ? 48   ALA A CB    1 
ATOM   1826 N N     . VAL E 3 49  ? 13.648  0.559   -4.221  1.00 19.20  ? 49   VAL A N     1 
ATOM   1827 C CA    . VAL E 3 49  ? 13.929  1.330   -5.426  1.00 19.44  ? 49   VAL A CA    1 
ATOM   1828 C C     . VAL E 3 49  ? 12.705  2.227   -5.649  1.00 23.30  ? 49   VAL A C     1 
ATOM   1829 O O     . VAL E 3 49  ? 11.564  1.746   -5.660  1.00 20.63  ? 49   VAL A O     1 
ATOM   1830 C CB    . VAL E 3 49  ? 14.105  0.421   -6.665  1.00 19.94  ? 49   VAL A CB    1 
ATOM   1831 C CG1   . VAL E 3 49  ? 14.301  1.293   -7.909  1.00 20.40  ? 49   VAL A CG1   1 
ATOM   1832 C CG2   . VAL E 3 49  ? 15.313  -0.534  -6.473  1.00 16.67  ? 49   VAL A CG2   1 
ATOM   1833 N N     . LEU E 3 50  ? 12.921  3.525   -5.823  1.00 21.23  ? 50   LEU A N     1 
ATOM   1834 C CA    . LEU E 3 50  ? 11.780  4.393   -6.030  1.00 24.82  ? 50   LEU A CA    1 
ATOM   1835 C C     . LEU E 3 50  ? 12.009  5.568   -6.960  1.00 22.47  ? 50   LEU A C     1 
ATOM   1836 O O     . LEU E 3 50  ? 13.142  5.984   -7.220  1.00 23.81  ? 50   LEU A O     1 
ATOM   1837 C CB    . LEU E 3 50  ? 11.255  4.889   -4.677  1.00 26.84  ? 50   LEU A CB    1 
ATOM   1838 C CG    . LEU E 3 50  ? 12.262  5.708   -3.891  1.00 29.12  ? 50   LEU A CG    1 
ATOM   1839 C CD1   . LEU E 3 50  ? 11.984  7.177   -4.134  1.00 32.69  ? 50   LEU A CD1   1 
ATOM   1840 C CD2   . LEU E 3 50  ? 12.156  5.372   -2.397  1.00 33.98  ? 50   LEU A CD2   1 
ATOM   1841 N N     . ILE E 3 51  ? 10.899  6.073   -7.473  1.00 22.69  ? 51   ILE A N     1 
ATOM   1842 C CA    . ILE E 3 51  ? 10.871  7.214   -8.376  1.00 25.37  ? 51   ILE A CA    1 
ATOM   1843 C C     . ILE E 3 51  ? 9.860   8.185   -7.779  1.00 26.96  ? 51   ILE A C     1 
ATOM   1844 O O     . ILE E 3 51  ? 9.040   7.792   -6.946  1.00 26.81  ? 51   ILE A O     1 
ATOM   1845 C CB    . ILE E 3 51  ? 10.379  6.811   -9.771  1.00 25.61  ? 51   ILE A CB    1 
ATOM   1846 C CG1   . ILE E 3 51  ? 9.064   6.026   -9.646  1.00 24.08  ? 51   ILE A CG1   1 
ATOM   1847 C CG2   . ILE E 3 51  ? 11.445  6.001   -10.484 1.00 24.88  ? 51   ILE A CG2   1 
ATOM   1848 C CD1   . ILE E 3 51  ? 8.512   5.532   -10.987 1.00 27.22  ? 51   ILE A CD1   1 
ATOM   1849 N N     . LYS E 3 52  ? 9.911   9.444   -8.197  1.00 28.75  ? 52   LYS A N     1 
ATOM   1850 C CA    . LYS E 3 52  ? 8.976   10.435  -7.679  1.00 34.09  ? 52   LYS A CA    1 
ATOM   1851 C C     . LYS E 3 52  ? 8.556   11.487  -8.704  1.00 35.22  ? 52   LYS A C     1 
ATOM   1852 O O     . LYS E 3 52  ? 9.249   11.709  -9.692  1.00 36.79  ? 52   LYS A O     1 
ATOM   1853 C CB    . LYS E 3 52  ? 9.570   11.106  -6.433  1.00 35.71  ? 52   LYS A CB    1 
ATOM   1854 C CG    . LYS E 3 52  ? 11.045  11.401  -6.530  1.00 39.93  ? 52   LYS A CG    1 
ATOM   1855 C CD    . LYS E 3 52  ? 11.590  11.990  -5.239  1.00 40.72  ? 52   LYS A CD    1 
ATOM   1856 C CE    . LYS E 3 52  ? 11.588  10.984  -4.110  1.00 44.17  ? 52   LYS A CE    1 
ATOM   1857 N NZ    . LYS E 3 52  ? 12.219  11.547  -2.877  1.00 44.28  ? 52   LYS A NZ    1 
ATOM   1858 N N     . ASP E 3 53  ? 7.404   12.113  -8.478  1.00 37.32  ? 53   ASP A N     1 
ATOM   1859 C CA    . ASP E 3 53  ? 6.917   13.147  -9.389  1.00 41.89  ? 53   ASP A CA    1 
ATOM   1860 C C     . ASP E 3 53  ? 7.441   14.521  -8.952  1.00 44.79  ? 53   ASP A C     1 
ATOM   1861 O O     . ASP E 3 53  ? 8.230   14.625  -8.010  1.00 43.88  ? 53   ASP A O     1 
ATOM   1862 C CB    . ASP E 3 53  ? 5.380   13.163  -9.438  1.00 41.19  ? 53   ASP A CB    1 
ATOM   1863 C CG    . ASP E 3 53  ? 4.750   13.661  -8.146  1.00 44.03  ? 53   ASP A CG    1 
ATOM   1864 O OD1   . ASP E 3 53  ? 3.500   13.746  -8.083  1.00 45.66  ? 53   ASP A OD1   1 
ATOM   1865 O OD2   . ASP E 3 53  ? 5.493   13.967  -7.192  1.00 43.18  ? 53   ASP A OD2   1 
ATOM   1866 N N     . GLU E 3 54  ? 6.984   15.566  -9.636  1.00 47.74  ? 54   GLU A N     1 
ATOM   1867 C CA    . GLU E 3 54  ? 7.407   16.934  -9.361  1.00 50.15  ? 54   GLU A CA    1 
ATOM   1868 C C     . GLU E 3 54  ? 7.020   17.447  -7.980  1.00 50.13  ? 54   GLU A C     1 
ATOM   1869 O O     . GLU E 3 54  ? 7.678   18.333  -7.443  1.00 51.13  ? 54   GLU A O     1 
ATOM   1870 C CB    . GLU E 3 54  ? 6.845   17.881  -10.428 1.00 53.46  ? 54   GLU A CB    1 
ATOM   1871 C CG    . GLU E 3 54  ? 5.318   17.881  -10.529 1.00 58.35  ? 54   GLU A CG    1 
ATOM   1872 C CD    . GLU E 3 54  ? 4.761   16.630  -11.201 1.00 61.44  ? 54   GLU A CD    1 
ATOM   1873 O OE1   . GLU E 3 54  ? 3.522   16.445  -11.184 1.00 62.88  ? 54   GLU A OE1   1 
ATOM   1874 O OE2   . GLU E 3 54  ? 5.557   15.837  -11.754 1.00 62.82  ? 54   GLU A OE2   1 
ATOM   1875 N N     . GLU E 3 55  ? 5.960   16.894  -7.403  1.00 50.10  ? 55   GLU A N     1 
ATOM   1876 C CA    . GLU E 3 55  ? 5.515   17.335  -6.088  1.00 50.11  ? 55   GLU A CA    1 
ATOM   1877 C C     . GLU E 3 55  ? 6.006   16.454  -4.952  1.00 48.22  ? 55   GLU A C     1 
ATOM   1878 O O     . GLU E 3 55  ? 5.591   16.615  -3.806  1.00 47.79  ? 55   GLU A O     1 
ATOM   1879 C CB    . GLU E 3 55  ? 3.992   17.428  -6.059  1.00 53.72  ? 55   GLU A CB    1 
ATOM   1880 C CG    . GLU E 3 55  ? 3.455   18.485  -7.001  1.00 58.58  ? 55   GLU A CG    1 
ATOM   1881 C CD    . GLU E 3 55  ? 1.949   18.469  -7.100  1.00 61.38  ? 55   GLU A CD    1 
ATOM   1882 O OE1   . GLU E 3 55  ? 1.283   18.640  -6.057  1.00 62.89  ? 55   GLU A OE1   1 
ATOM   1883 O OE2   . GLU E 3 55  ? 1.436   18.286  -8.226  1.00 63.89  ? 55   GLU A OE2   1 
ATOM   1884 N N     . GLY E 3 56  ? 6.892   15.518  -5.268  1.00 46.63  ? 56   GLY A N     1 
ATOM   1885 C CA    . GLY E 3 56  ? 7.425   14.656  -4.234  1.00 43.15  ? 56   GLY A CA    1 
ATOM   1886 C C     . GLY E 3 56  ? 6.714   13.337  -4.006  1.00 39.98  ? 56   GLY A C     1 
ATOM   1887 O O     . GLY E 3 56  ? 7.157   12.548  -3.181  1.00 40.19  ? 56   GLY A O     1 
ATOM   1888 N N     . LYS E 3 57  ? 5.612   13.089  -4.702  1.00 38.89  ? 57   LYS A N     1 
ATOM   1889 C CA    . LYS E 3 57  ? 4.914   11.815  -4.537  1.00 38.78  ? 57   LYS A CA    1 
ATOM   1890 C C     . LYS E 3 57  ? 5.867   10.693  -4.968  1.00 35.93  ? 57   LYS A C     1 
ATOM   1891 O O     . LYS E 3 57  ? 6.558   10.817  -5.976  1.00 31.78  ? 57   LYS A O     1 
ATOM   1892 C CB    . LYS E 3 57  ? 3.643   11.769  -5.394  1.00 41.08  ? 57   LYS A CB    1 
ATOM   1893 C CG    . LYS E 3 57  ? 2.514   12.668  -4.902  1.00 45.86  ? 57   LYS A CG    1 
ATOM   1894 C CD    . LYS E 3 57  ? 1.226   12.413  -5.684  1.00 46.89  ? 57   LYS A CD    1 
ATOM   1895 C CE    . LYS E 3 57  ? 0.082   13.265  -5.161  1.00 48.51  ? 57   LYS A CE    1 
ATOM   1896 N NZ    . LYS E 3 57  ? 0.373   14.721  -5.300  1.00 50.53  ? 57   LYS A NZ    1 
ATOM   1897 N N     . GLU E 3 58  ? 5.889   9.604   -4.205  1.00 33.27  ? 58   GLU A N     1 
ATOM   1898 C CA    . GLU E 3 58  ? 6.774   8.486   -4.497  1.00 32.02  ? 58   GLU A CA    1 
ATOM   1899 C C     . GLU E 3 58  ? 6.072   7.192   -4.912  1.00 31.16  ? 58   GLU A C     1 
ATOM   1900 O O     . GLU E 3 58  ? 5.016   6.848   -4.392  1.00 30.91  ? 58   GLU A O     1 
ATOM   1901 C CB    . GLU E 3 58  ? 7.650   8.197   -3.278  1.00 34.91  ? 58   GLU A CB    1 
ATOM   1902 C CG    . GLU E 3 58  ? 8.315   9.425   -2.657  1.00 39.45  ? 58   GLU A CG    1 
ATOM   1903 C CD    . GLU E 3 58  ? 9.232   9.058   -1.494  1.00 42.91  ? 58   GLU A CD    1 
ATOM   1904 O OE1   . GLU E 3 58  ? 8.948   8.055   -0.811  1.00 45.58  ? 58   GLU A OE1   1 
ATOM   1905 O OE2   . GLU E 3 58  ? 10.229  9.770   -1.248  1.00 46.66  ? 58   GLU A OE2   1 
ATOM   1906 N N     . MET E 3 59  ? 6.681   6.478   -5.853  1.00 29.29  ? 59   MET A N     1 
ATOM   1907 C CA    . MET E 3 59  ? 6.166   5.195   -6.331  1.00 29.08  ? 59   MET A CA    1 
ATOM   1908 C C     . MET E 3 59  ? 7.298   4.170   -6.154  1.00 29.28  ? 59   MET A C     1 
ATOM   1909 O O     . MET E 3 59  ? 8.404   4.369   -6.657  1.00 27.00  ? 59   MET A O     1 
ATOM   1910 C CB    . MET E 3 59  ? 5.783   5.316   -7.806  1.00 31.50  ? 59   MET A CB    1 
ATOM   1911 C CG    . MET E 3 59  ? 5.716   4.007   -8.565  1.00 37.82  ? 59   MET A CG    1 
ATOM   1912 S SD    . MET E 3 59  ? 4.359   2.923   -8.123  1.00 45.67  ? 59   MET A SD    1 
ATOM   1913 C CE    . MET E 3 59  ? 2.988   4.045   -8.205  1.00 37.85  ? 59   MET A CE    1 
ATOM   1914 N N     . ILE E 3 60  ? 7.035   3.090   -5.424  1.00 26.26  ? 60   ILE A N     1 
ATOM   1915 C CA    . ILE E 3 60  ? 8.058   2.076   -5.207  1.00 26.65  ? 60   ILE A CA    1 
ATOM   1916 C C     . ILE E 3 60  ? 8.048   1.083   -6.355  1.00 27.10  ? 60   ILE A C     1 
ATOM   1917 O O     . ILE E 3 60  ? 7.027   0.452   -6.635  1.00 25.64  ? 60   ILE A O     1 
ATOM   1918 C CB    . ILE E 3 60  ? 7.833   1.324   -3.873  1.00 27.32  ? 60   ILE A CB    1 
ATOM   1919 C CG1   . ILE E 3 60  ? 7.959   2.309   -2.704  1.00 28.00  ? 60   ILE A CG1   1 
ATOM   1920 C CG2   . ILE E 3 60  ? 8.838   0.183   -3.737  1.00 24.64  ? 60   ILE A CG2   1 
ATOM   1921 C CD1   . ILE E 3 60  ? 7.654   1.713   -1.339  1.00 28.05  ? 60   ILE A CD1   1 
ATOM   1922 N N     . LEU E 3 61  ? 9.191   0.961   -7.020  1.00 25.59  ? 61   LEU A N     1 
ATOM   1923 C CA    . LEU E 3 61  ? 9.345   0.054   -8.150  1.00 27.64  ? 61   LEU A CA    1 
ATOM   1924 C C     . LEU E 3 61  ? 9.743   -1.344  -7.714  1.00 27.84  ? 61   LEU A C     1 
ATOM   1925 O O     . LEU E 3 61  ? 9.389   -2.329  -8.362  1.00 30.53  ? 61   LEU A O     1 
ATOM   1926 C CB    . LEU E 3 61  ? 10.414  0.572   -9.124  1.00 24.33  ? 61   LEU A CB    1 
ATOM   1927 C CG    . LEU E 3 61  ? 10.151  1.889   -9.865  1.00 27.78  ? 61   LEU A CG    1 
ATOM   1928 C CD1   . LEU E 3 61  ? 11.315  2.212   -10.799 1.00 24.57  ? 61   LEU A CD1   1 
ATOM   1929 C CD2   . LEU E 3 61  ? 8.867   1.775   -10.659 1.00 27.63  ? 61   LEU A CD2   1 
ATOM   1930 N N     . SER E 3 62  ? 10.482  -1.440  -6.617  1.00 28.17  ? 62   SER A N     1 
ATOM   1931 C CA    . SER E 3 62  ? 10.945  -2.744  -6.184  1.00 27.51  ? 62   SER A CA    1 
ATOM   1932 C C     . SER E 3 62  ? 11.720  -2.736  -4.881  1.00 26.60  ? 62   SER A C     1 
ATOM   1933 O O     . SER E 3 62  ? 12.235  -1.706  -4.443  1.00 24.01  ? 62   SER A O     1 
ATOM   1934 C CB    . SER E 3 62  ? 11.840  -3.333  -7.282  1.00 31.50  ? 62   SER A CB    1 
ATOM   1935 O OG    . SER E 3 62  ? 12.577  -4.455  -6.827  1.00 35.08  ? 62   SER A OG    1 
ATOM   1936 N N     . TYR E 3 63  ? 11.793  -3.911  -4.269  1.00 24.74  ? 63   TYR A N     1 
ATOM   1937 C CA    . TYR E 3 63  ? 12.559  -4.097  -3.045  1.00 27.65  ? 63   TYR A CA    1 
ATOM   1938 C C     . TYR E 3 63  ? 13.706  -5.000  -3.489  1.00 26.27  ? 63   TYR A C     1 
ATOM   1939 O O     . TYR E 3 63  ? 13.468  -5.951  -4.231  1.00 26.80  ? 63   TYR A O     1 
ATOM   1940 C CB    . TYR E 3 63  ? 11.725  -4.813  -1.979  1.00 25.82  ? 63   TYR A CB    1 
ATOM   1941 C CG    . TYR E 3 63  ? 10.590  -3.989  -1.408  1.00 29.90  ? 63   TYR A CG    1 
ATOM   1942 C CD1   . TYR E 3 63  ? 10.831  -2.758  -0.786  1.00 28.96  ? 63   TYR A CD1   1 
ATOM   1943 C CD2   . TYR E 3 63  ? 9.274   -4.447  -1.477  1.00 29.80  ? 63   TYR A CD2   1 
ATOM   1944 C CE1   . TYR E 3 63  ? 9.783   -2.004  -0.245  1.00 27.54  ? 63   TYR A CE1   1 
ATOM   1945 C CE2   . TYR E 3 63  ? 8.223   -3.705  -0.944  1.00 32.18  ? 63   TYR A CE2   1 
ATOM   1946 C CZ    . TYR E 3 63  ? 8.484   -2.489  -0.330  1.00 31.06  ? 63   TYR A CZ    1 
ATOM   1947 O OH    . TYR E 3 63  ? 7.437   -1.782  0.203   1.00 32.42  ? 63   TYR A OH    1 
ATOM   1948 N N     . LEU E 3 64  ? 14.938  -4.696  -3.087  1.00 25.03  ? 64   LEU A N     1 
ATOM   1949 C CA    . LEU E 3 64  ? 16.076  -5.544  -3.465  1.00 25.78  ? 64   LEU A CA    1 
ATOM   1950 C C     . LEU E 3 64  ? 16.748  -6.035  -2.187  1.00 27.75  ? 64   LEU A C     1 
ATOM   1951 O O     . LEU E 3 64  ? 16.670  -5.368  -1.153  1.00 27.40  ? 64   LEU A O     1 
ATOM   1952 C CB    . LEU E 3 64  ? 17.063  -4.779  -4.363  1.00 27.59  ? 64   LEU A CB    1 
ATOM   1953 C CG    . LEU E 3 64  ? 16.475  -4.349  -5.723  1.00 29.07  ? 64   LEU A CG    1 
ATOM   1954 C CD1   . LEU E 3 64  ? 17.495  -3.519  -6.489  1.00 30.18  ? 64   LEU A CD1   1 
ATOM   1955 C CD2   . LEU E 3 64  ? 16.052  -5.574  -6.542  1.00 25.67  ? 64   LEU A CD2   1 
ATOM   1956 N N     . ASN E 3 65  ? 17.391  -7.200  -2.254  1.00 29.06  ? 65   ASN A N     1 
ATOM   1957 C CA    . ASN E 3 65  ? 18.020  -7.807  -1.074  1.00 31.13  ? 65   ASN A CA    1 
ATOM   1958 C C     . ASN E 3 65  ? 19.454  -8.298  -1.288  1.00 29.73  ? 65   ASN A C     1 
ATOM   1959 O O     . ASN E 3 65  ? 20.009  -8.177  -2.380  1.00 27.16  ? 65   ASN A O     1 
ATOM   1960 C CB    . ASN E 3 65  ? 17.153  -8.978  -0.599  1.00 35.37  ? 65   ASN A CB    1 
ATOM   1961 C CG    . ASN E 3 65  ? 15.705  -8.575  -0.382  1.00 41.19  ? 65   ASN A CG    1 
ATOM   1962 O OD1   . ASN E 3 65  ? 15.393  -7.808  0.530   1.00 44.95  ? 65   ASN A OD1   1 
ATOM   1963 N ND2   . ASN E 3 65  ? 14.813  -9.078  -1.232  1.00 41.25  ? 65   ASN A ND2   1 
ATOM   1964 N N     . GLN E 3 66  ? 20.048  -8.875  -0.246  1.00 30.47  ? 66   GLN A N     1 
ATOM   1965 C CA    . GLN E 3 66  ? 21.421  -9.349  -0.362  1.00 31.41  ? 66   GLN A CA    1 
ATOM   1966 C C     . GLN E 3 66  ? 21.549  -10.306 -1.535  1.00 28.97  ? 66   GLN A C     1 
ATOM   1967 O O     . GLN E 3 66  ? 20.707  -11.178 -1.733  1.00 30.04  ? 66   GLN A O     1 
ATOM   1968 C CB    . GLN E 3 66  ? 21.894  -10.014 0.935   1.00 36.89  ? 66   GLN A CB    1 
ATOM   1969 C CG    . GLN E 3 66  ? 21.353  -11.397 1.216   1.00 41.25  ? 66   GLN A CG    1 
ATOM   1970 C CD    . GLN E 3 66  ? 22.109  -12.060 2.362   1.00 47.38  ? 66   GLN A CD    1 
ATOM   1971 O OE1   . GLN E 3 66  ? 23.299  -12.370 2.242   1.00 47.82  ? 66   GLN A OE1   1 
ATOM   1972 N NE2   . GLN E 3 66  ? 21.425  -12.265 3.482   1.00 46.17  ? 66   GLN A NE2   1 
ATOM   1973 N N     . GLY E 3 67  ? 22.601  -10.121 -2.320  1.00 27.55  ? 67   GLY A N     1 
ATOM   1974 C CA    . GLY E 3 67  ? 22.810  -10.948 -3.491  1.00 26.11  ? 67   GLY A CA    1 
ATOM   1975 C C     . GLY E 3 67  ? 22.464  -10.162 -4.745  1.00 24.65  ? 67   GLY A C     1 
ATOM   1976 O O     . GLY E 3 67  ? 22.904  -10.491 -5.850  1.00 24.31  ? 67   GLY A O     1 
ATOM   1977 N N     . ASP E 3 68  ? 21.672  -9.108  -4.573  1.00 24.53  ? 68   ASP A N     1 
ATOM   1978 C CA    . ASP E 3 68  ? 21.258  -8.266  -5.694  1.00 24.91  ? 68   ASP A CA    1 
ATOM   1979 C C     . ASP E 3 68  ? 22.263  -7.177  -6.063  1.00 25.02  ? 68   ASP A C     1 
ATOM   1980 O O     . ASP E 3 68  ? 22.843  -6.543  -5.193  1.00 27.85  ? 68   ASP A O     1 
ATOM   1981 C CB    . ASP E 3 68  ? 19.926  -7.561  -5.385  1.00 24.90  ? 68   ASP A CB    1 
ATOM   1982 C CG    . ASP E 3 68  ? 18.718  -8.490  -5.472  1.00 31.59  ? 68   ASP A CG    1 
ATOM   1983 O OD1   . ASP E 3 68  ? 18.583  -9.211  -6.486  1.00 35.07  ? 68   ASP A OD1   1 
ATOM   1984 O OD2   . ASP E 3 68  ? 17.891  -8.482  -4.530  1.00 32.38  ? 68   ASP A OD2   1 
ATOM   1985 N N     . PHE E 3 69  ? 22.458  -6.960  -7.359  1.00 25.87  ? 69   PHE A N     1 
ATOM   1986 C CA    . PHE E 3 69  ? 23.313  -5.879  -7.826  1.00 26.17  ? 69   PHE A CA    1 
ATOM   1987 C C     . PHE E 3 69  ? 22.403  -4.643  -7.874  1.00 26.61  ? 69   PHE A C     1 
ATOM   1988 O O     . PHE E 3 69  ? 21.182  -4.769  -8.009  1.00 23.67  ? 69   PHE A O     1 
ATOM   1989 C CB    . PHE E 3 69  ? 23.830  -6.133  -9.248  1.00 26.51  ? 69   PHE A CB    1 
ATOM   1990 C CG    . PHE E 3 69  ? 24.939  -7.147  -9.336  1.00 25.45  ? 69   PHE A CG    1 
ATOM   1991 C CD1   . PHE E 3 69  ? 24.682  -8.453  -9.757  1.00 27.05  ? 69   PHE A CD1   1 
ATOM   1992 C CD2   . PHE E 3 69  ? 26.243  -6.790  -9.023  1.00 24.57  ? 69   PHE A CD2   1 
ATOM   1993 C CE1   . PHE E 3 69  ? 25.717  -9.391  -9.867  1.00 26.87  ? 69   PHE A CE1   1 
ATOM   1994 C CE2   . PHE E 3 69  ? 27.286  -7.716  -9.127  1.00 24.18  ? 69   PHE A CE2   1 
ATOM   1995 C CZ    . PHE E 3 69  ? 27.022  -9.016  -9.551  1.00 25.40  ? 69   PHE A CZ    1 
ATOM   1996 N N     . ILE E 3 70  ? 22.996  -3.460  -7.758  1.00 26.57  ? 70   ILE A N     1 
ATOM   1997 C CA    . ILE E 3 70  ? 22.247  -2.211  -7.836  1.00 27.60  ? 70   ILE A CA    1 
ATOM   1998 C C     . ILE E 3 70  ? 23.090  -1.230  -8.628  1.00 25.00  ? 70   ILE A C     1 
ATOM   1999 O O     . ILE E 3 70  ? 24.321  -1.290  -8.576  1.00 25.56  ? 70   ILE A O     1 
ATOM   2000 C CB    . ILE E 3 70  ? 22.005  -1.551  -6.462  1.00 31.53  ? 70   ILE A CB    1 
ATOM   2001 C CG1   . ILE E 3 70  ? 21.742  -2.590  -5.379  1.00 34.66  ? 70   ILE A CG1   1 
ATOM   2002 C CG2   . ILE E 3 70  ? 20.799  -0.646  -6.558  1.00 34.47  ? 70   ILE A CG2   1 
ATOM   2003 C CD1   . ILE E 3 70  ? 21.784  -1.988  -3.982  1.00 38.48  ? 70   ILE A CD1   1 
ATOM   2004 N N     . GLY E 3 71  ? 22.428  -0.315  -9.328  1.00 23.61  ? 71   GLY A N     1 
ATOM   2005 C CA    . GLY E 3 71  ? 23.130  0.685   -10.119 1.00 25.35  ? 71   GLY A CA    1 
ATOM   2006 C C     . GLY E 3 71  ? 23.748  0.112   -11.378 1.00 26.14  ? 71   GLY A C     1 
ATOM   2007 O O     . GLY E 3 71  ? 24.734  0.631   -11.897 1.00 27.81  ? 71   GLY A O     1 
ATOM   2008 N N     . GLU E 3 72  ? 23.151  -0.960  -11.877 1.00 25.62  ? 72   GLU A N     1 
ATOM   2009 C CA    . GLU E 3 72  ? 23.652  -1.637  -13.065 1.00 27.42  ? 72   GLU A CA    1 
ATOM   2010 C C     . GLU E 3 72  ? 23.241  -1.019  -14.411 1.00 26.99  ? 72   GLU A C     1 
ATOM   2011 O O     . GLU E 3 72  ? 23.928  -1.203  -15.420 1.00 28.01  ? 72   GLU A O     1 
ATOM   2012 C CB    . GLU E 3 72  ? 23.196  -3.106  -13.036 1.00 29.59  ? 72   GLU A CB    1 
ATOM   2013 C CG    . GLU E 3 72  ? 21.707  -3.346  -13.410 1.00 27.45  ? 72   GLU A CG    1 
ATOM   2014 C CD    . GLU E 3 72  ? 20.702  -3.090  -12.274 1.00 30.46  ? 72   GLU A CD    1 
ATOM   2015 O OE1   . GLU E 3 72  ? 19.480  -3.318  -12.493 1.00 29.33  ? 72   GLU A OE1   1 
ATOM   2016 O OE2   . GLU E 3 72  ? 21.112  -2.671  -11.168 1.00 28.40  ? 72   GLU A OE2   1 
ATOM   2017 N N     . LEU E 3 73  ? 22.138  -0.281  -14.434 1.00 24.52  ? 73   LEU A N     1 
ATOM   2018 C CA    . LEU E 3 73  ? 21.651  0.262   -15.695 1.00 26.36  ? 73   LEU A CA    1 
ATOM   2019 C C     . LEU E 3 73  ? 22.580  1.201   -16.460 1.00 26.33  ? 73   LEU A C     1 
ATOM   2020 O O     . LEU E 3 73  ? 22.402  1.378   -17.659 1.00 27.01  ? 73   LEU A O     1 
ATOM   2021 C CB    . LEU E 3 73  ? 20.269  0.908   -15.496 1.00 25.13  ? 73   LEU A CB    1 
ATOM   2022 C CG    . LEU E 3 73  ? 19.228  0.000   -14.824 1.00 26.09  ? 73   LEU A CG    1 
ATOM   2023 C CD1   . LEU E 3 73  ? 17.838  0.663   -14.877 1.00 22.94  ? 73   LEU A CD1   1 
ATOM   2024 C CD2   . LEU E 3 73  ? 19.200  -1.367  -15.510 1.00 24.53  ? 73   LEU A CD2   1 
ATOM   2025 N N     . GLY E 3 74  ? 23.576  1.785   -15.792 1.00 28.83  ? 74   GLY A N     1 
ATOM   2026 C CA    . GLY E 3 74  ? 24.500  2.675   -16.487 1.00 27.34  ? 74   GLY A CA    1 
ATOM   2027 C C     . GLY E 3 74  ? 25.747  1.982   -17.028 1.00 29.89  ? 74   GLY A C     1 
ATOM   2028 O O     . GLY E 3 74  ? 26.558  2.578   -17.741 1.00 28.37  ? 74   GLY A O     1 
ATOM   2029 N N     . LEU E 3 75  ? 25.895  0.701   -16.716 1.00 30.25  ? 75   LEU A N     1 
ATOM   2030 C CA    . LEU E 3 75  ? 27.066  -0.061  -17.143 1.00 31.61  ? 75   LEU A CA    1 
ATOM   2031 C C     . LEU E 3 75  ? 27.320  -0.226  -18.648 1.00 33.79  ? 75   LEU A C     1 
ATOM   2032 O O     . LEU E 3 75  ? 28.475  -0.216  -19.094 1.00 32.19  ? 75   LEU A O     1 
ATOM   2033 C CB    . LEU E 3 75  ? 27.010  -1.451  -16.505 1.00 31.31  ? 75   LEU A CB    1 
ATOM   2034 C CG    . LEU E 3 75  ? 28.044  -2.514  -16.891 1.00 31.43  ? 75   LEU A CG    1 
ATOM   2035 C CD1   . LEU E 3 75  ? 29.441  -2.122  -16.391 1.00 31.50  ? 75   LEU A CD1   1 
ATOM   2036 C CD2   . LEU E 3 75  ? 27.629  -3.838  -16.274 1.00 30.26  ? 75   LEU A CD2   1 
ATOM   2037 N N     . PHE E 3 76  ? 26.254  -0.358  -19.431 1.00 33.91  ? 76   PHE A N     1 
ATOM   2038 C CA    . PHE E 3 76  ? 26.395  -0.626  -20.858 1.00 36.62  ? 76   PHE A CA    1 
ATOM   2039 C C     . PHE E 3 76  ? 26.585  0.525   -21.842 1.00 39.54  ? 76   PHE A C     1 
ATOM   2040 O O     . PHE E 3 76  ? 26.785  0.294   -23.032 1.00 42.19  ? 76   PHE A O     1 
ATOM   2041 C CB    . PHE E 3 76  ? 25.226  -1.509  -21.299 1.00 35.92  ? 76   PHE A CB    1 
ATOM   2042 C CG    . PHE E 3 76  ? 24.980  -2.674  -20.381 1.00 33.70  ? 76   PHE A CG    1 
ATOM   2043 C CD1   . PHE E 3 76  ? 24.129  -2.546  -19.282 1.00 32.79  ? 76   PHE A CD1   1 
ATOM   2044 C CD2   . PHE E 3 76  ? 25.641  -3.881  -20.579 1.00 32.88  ? 76   PHE A CD2   1 
ATOM   2045 C CE1   . PHE E 3 76  ? 23.943  -3.610  -18.391 1.00 33.49  ? 76   PHE A CE1   1 
ATOM   2046 C CE2   . PHE E 3 76  ? 25.465  -4.947  -19.699 1.00 32.38  ? 76   PHE A CE2   1 
ATOM   2047 C CZ    . PHE E 3 76  ? 24.615  -4.814  -18.602 1.00 33.99  ? 76   PHE A CZ    1 
ATOM   2048 N N     . GLU E 3 77  ? 26.539  1.757   -21.356 1.00 42.14  ? 77   GLU A N     1 
ATOM   2049 C CA    . GLU E 3 77  ? 26.730  2.921   -22.216 1.00 45.37  ? 77   GLU A CA    1 
ATOM   2050 C C     . GLU E 3 77  ? 27.127  4.100   -21.337 1.00 45.18  ? 77   GLU A C     1 
ATOM   2051 O O     . GLU E 3 77  ? 26.486  4.357   -20.326 1.00 43.81  ? 77   GLU A O     1 
ATOM   2052 C CB    . GLU E 3 77  ? 25.438  3.227   -22.976 1.00 49.08  ? 77   GLU A CB    1 
ATOM   2053 C CG    . GLU E 3 77  ? 25.515  4.443   -23.886 1.00 53.82  ? 77   GLU A CG    1 
ATOM   2054 C CD    . GLU E 3 77  ? 24.345  4.512   -24.852 1.00 58.16  ? 77   GLU A CD    1 
ATOM   2055 O OE1   . GLU E 3 77  ? 23.183  4.469   -24.387 1.00 60.98  ? 77   GLU A OE1   1 
ATOM   2056 O OE2   . GLU E 3 77  ? 24.586  4.607   -26.077 1.00 59.63  ? 77   GLU A OE2   1 
ATOM   2057 N N     . GLU E 3 78  ? 28.184  4.814   -21.711 1.00 46.27  ? 78   GLU A N     1 
ATOM   2058 C CA    . GLU E 3 78  ? 28.629  5.944   -20.898 1.00 46.94  ? 78   GLU A CA    1 
ATOM   2059 C C     . GLU E 3 78  ? 27.721  7.154   -21.021 1.00 44.27  ? 78   GLU A C     1 
ATOM   2060 O O     . GLU E 3 78  ? 26.888  7.228   -21.920 1.00 42.03  ? 78   GLU A O     1 
ATOM   2061 C CB    . GLU E 3 78  ? 30.064  6.346   -21.256 1.00 51.28  ? 78   GLU A CB    1 
ATOM   2062 C CG    . GLU E 3 78  ? 31.048  6.187   -20.094 1.00 56.21  ? 78   GLU A CG    1 
ATOM   2063 C CD    . GLU E 3 78  ? 30.654  7.001   -18.866 1.00 59.53  ? 78   GLU A CD    1 
ATOM   2064 O OE1   . GLU E 3 78  ? 30.648  8.249   -18.954 1.00 61.19  ? 78   GLU A OE1   1 
ATOM   2065 O OE2   . GLU E 3 78  ? 30.349  6.391   -17.813 1.00 60.91  ? 78   GLU A OE2   1 
ATOM   2066 N N     . GLY E 3 79  ? 27.886  8.093   -20.093 1.00 42.53  ? 79   GLY A N     1 
ATOM   2067 C CA    . GLY E 3 79  ? 27.083  9.304   -20.097 1.00 39.96  ? 79   GLY A CA    1 
ATOM   2068 C C     . GLY E 3 79  ? 25.692  9.127   -19.516 1.00 37.98  ? 79   GLY A C     1 
ATOM   2069 O O     . GLY E 3 79  ? 24.858  10.023  -19.629 1.00 38.87  ? 79   GLY A O     1 
ATOM   2070 N N     . GLN E 3 80  ? 25.443  7.986   -18.879 1.00 36.32  ? 80   GLN A N     1 
ATOM   2071 C CA    . GLN E 3 80  ? 24.132  7.698   -18.296 1.00 35.19  ? 80   GLN A CA    1 
ATOM   2072 C C     . GLN E 3 80  ? 23.947  8.262   -16.887 1.00 33.28  ? 80   GLN A C     1 
ATOM   2073 O O     . GLN E 3 80  ? 24.911  8.421   -16.143 1.00 28.51  ? 80   GLN A O     1 
ATOM   2074 C CB    . GLN E 3 80  ? 23.902  6.185   -18.248 1.00 36.30  ? 80   GLN A CB    1 
ATOM   2075 C CG    . GLN E 3 80  ? 23.901  5.517   -19.610 1.00 39.18  ? 80   GLN A CG    1 
ATOM   2076 C CD    . GLN E 3 80  ? 22.580  5.663   -20.316 1.00 41.04  ? 80   GLN A CD    1 
ATOM   2077 O OE1   . GLN E 3 80  ? 21.636  4.918   -20.052 1.00 37.49  ? 80   GLN A OE1   1 
ATOM   2078 N NE2   . GLN E 3 80  ? 22.495  6.642   -21.212 1.00 43.86  ? 80   GLN A NE2   1 
ATOM   2079 N N     . GLU E 3 81  ? 22.691  8.541   -16.538 1.00 30.77  ? 81   GLU A N     1 
ATOM   2080 C CA    . GLU E 3 81  ? 22.323  9.062   -15.225 1.00 31.58  ? 81   GLU A CA    1 
ATOM   2081 C C     . GLU E 3 81  ? 21.522  8.005   -14.460 1.00 28.47  ? 81   GLU A C     1 
ATOM   2082 O O     . GLU E 3 81  ? 20.851  7.178   -15.067 1.00 27.30  ? 81   GLU A O     1 
ATOM   2083 C CB    . GLU E 3 81  ? 21.445  10.307  -15.373 1.00 36.12  ? 81   GLU A CB    1 
ATOM   2084 C CG    . GLU E 3 81  ? 22.144  11.541  -15.914 1.00 41.91  ? 81   GLU A CG    1 
ATOM   2085 C CD    . GLU E 3 81  ? 21.181  12.710  -16.077 1.00 45.65  ? 81   GLU A CD    1 
ATOM   2086 O OE1   . GLU E 3 81  ? 21.652  13.852  -16.272 1.00 49.71  ? 81   GLU A OE1   1 
ATOM   2087 O OE2   . GLU E 3 81  ? 19.950  12.482  -16.011 1.00 45.27  ? 81   GLU A OE2   1 
ATOM   2088 N N     . ARG E 3 82  ? 21.583  8.044   -13.132 1.00 26.33  ? 82   ARG A N     1 
ATOM   2089 C CA    . ARG E 3 82  ? 20.840  7.090   -12.312 1.00 24.93  ? 82   ARG A CA    1 
ATOM   2090 C C     . ARG E 3 82  ? 19.350  7.267   -12.639 1.00 25.28  ? 82   ARG A C     1 
ATOM   2091 O O     . ARG E 3 82  ? 18.835  8.396   -12.664 1.00 25.86  ? 82   ARG A O     1 
ATOM   2092 C CB    . ARG E 3 82  ? 21.103  7.350   -10.816 1.00 23.14  ? 82   ARG A CB    1 
ATOM   2093 C CG    . ARG E 3 82  ? 22.594  7.283   -10.384 1.00 25.09  ? 82   ARG A CG    1 
ATOM   2094 C CD    . ARG E 3 82  ? 23.190  5.882   -10.573 1.00 24.14  ? 82   ARG A CD    1 
ATOM   2095 N NE    . ARG E 3 82  ? 24.525  5.736   -9.985  1.00 21.10  ? 82   ARG A NE    1 
ATOM   2096 C CZ    . ARG E 3 82  ? 25.268  4.638   -10.099 1.00 23.87  ? 82   ARG A CZ    1 
ATOM   2097 N NH1   . ARG E 3 82  ? 24.801  3.589   -10.781 1.00 18.55  ? 82   ARG A NH1   1 
ATOM   2098 N NH2   . ARG E 3 82  ? 26.483  4.583   -9.548  1.00 18.35  ? 82   ARG A NH2   1 
ATOM   2099 N N     . SER E 3 83  ? 18.665  6.156   -12.891 1.00 23.41  ? 83   SER A N     1 
ATOM   2100 C CA    . SER E 3 83  ? 17.245  6.177   -13.250 1.00 23.31  ? 83   SER A CA    1 
ATOM   2101 C C     . SER E 3 83  ? 16.262  6.235   -12.081 1.00 22.48  ? 83   SER A C     1 
ATOM   2102 O O     . SER E 3 83  ? 15.074  6.451   -12.288 1.00 22.66  ? 83   SER A O     1 
ATOM   2103 C CB    . SER E 3 83  ? 16.910  4.947   -14.094 1.00 23.96  ? 83   SER A CB    1 
ATOM   2104 O OG    . SER E 3 83  ? 17.078  3.769   -13.323 1.00 24.52  ? 83   SER A OG    1 
ATOM   2105 N N     . ALA E 3 84  ? 16.741  6.045   -10.857 1.00 20.74  ? 84   ALA A N     1 
ATOM   2106 C CA    . ALA E 3 84  ? 15.845  6.062   -9.703  1.00 21.00  ? 84   ALA A CA    1 
ATOM   2107 C C     . ALA E 3 84  ? 16.624  6.249   -8.415  1.00 21.60  ? 84   ALA A C     1 
ATOM   2108 O O     . ALA E 3 84  ? 17.853  6.245   -8.414  1.00 22.55  ? 84   ALA A O     1 
ATOM   2109 C CB    . ALA E 3 84  ? 15.062  4.724   -9.629  1.00 19.20  ? 84   ALA A CB    1 
ATOM   2110 N N     . TRP E 3 85  ? 15.898  6.406   -7.317  1.00 22.43  ? 85   TRP A N     1 
ATOM   2111 C CA    . TRP E 3 85  ? 16.529  6.527   -6.017  1.00 23.24  ? 85   TRP A CA    1 
ATOM   2112 C C     . TRP E 3 85  ? 16.551  5.135   -5.424  1.00 24.73  ? 85   TRP A C     1 
ATOM   2113 O O     . TRP E 3 85  ? 15.654  4.324   -5.703  1.00 21.99  ? 85   TRP A O     1 
ATOM   2114 C CB    . TRP E 3 85  ? 15.707  7.394   -5.069  1.00 26.45  ? 85   TRP A CB    1 
ATOM   2115 C CG    . TRP E 3 85  ? 15.381  8.729   -5.586  1.00 32.98  ? 85   TRP A CG    1 
ATOM   2116 C CD1   . TRP E 3 85  ? 14.423  9.043   -6.507  1.00 34.23  ? 85   TRP A CD1   1 
ATOM   2117 C CD2   . TRP E 3 85  ? 16.027  9.952   -5.241  1.00 34.77  ? 85   TRP A CD2   1 
ATOM   2118 N NE1   . TRP E 3 85  ? 14.432  10.386  -6.756  1.00 35.94  ? 85   TRP A NE1   1 
ATOM   2119 C CE2   . TRP E 3 85  ? 15.406  10.974  -5.991  1.00 34.82  ? 85   TRP A CE2   1 
ATOM   2120 C CE3   . TRP E 3 85  ? 17.070  10.285  -4.371  1.00 35.65  ? 85   TRP A CE3   1 
ATOM   2121 C CZ2   . TRP E 3 85  ? 15.793  12.310  -5.899  1.00 36.68  ? 85   TRP A CZ2   1 
ATOM   2122 C CZ3   . TRP E 3 85  ? 17.460  11.617  -4.278  1.00 38.93  ? 85   TRP A CZ3   1 
ATOM   2123 C CH2   . TRP E 3 85  ? 16.821  12.614  -5.038  1.00 40.19  ? 85   TRP A CH2   1 
ATOM   2124 N N     . VAL E 3 86  ? 17.578  4.856   -4.626  1.00 22.77  ? 86   VAL A N     1 
ATOM   2125 C CA    . VAL E 3 86  ? 17.671  3.591   -3.912  1.00 23.19  ? 86   VAL A CA    1 
ATOM   2126 C C     . VAL E 3 86  ? 17.940  3.960   -2.454  1.00 23.34  ? 86   VAL A C     1 
ATOM   2127 O O     . VAL E 3 86  ? 18.921  4.638   -2.133  1.00 23.48  ? 86   VAL A O     1 
ATOM   2128 C CB    . VAL E 3 86  ? 18.776  2.690   -4.424  1.00 21.77  ? 86   VAL A CB    1 
ATOM   2129 C CG1   . VAL E 3 86  ? 18.856  1.452   -3.534  1.00 20.97  ? 86   VAL A CG1   1 
ATOM   2130 C CG2   . VAL E 3 86  ? 18.481  2.274   -5.875  1.00 21.97  ? 86   VAL A CG2   1 
ATOM   2131 N N     . ARG E 3 87  ? 17.049  3.508   -1.582  1.00 24.40  ? 87   ARG A N     1 
ATOM   2132 C CA    . ARG E 3 87  ? 17.105  3.817   -0.159  1.00 27.02  ? 87   ARG A CA    1 
ATOM   2133 C C     . ARG E 3 87  ? 17.222  2.571   0.722   1.00 25.74  ? 87   ARG A C     1 
ATOM   2134 O O     . ARG E 3 87  ? 16.550  1.578   0.491   1.00 26.04  ? 87   ARG A O     1 
ATOM   2135 C CB    . ARG E 3 87  ? 15.836  4.613   0.180   1.00 27.71  ? 87   ARG A CB    1 
ATOM   2136 C CG    . ARG E 3 87  ? 15.565  4.889   1.642   1.00 33.80  ? 87   ARG A CG    1 
ATOM   2137 C CD    . ARG E 3 87  ? 14.158  5.495   1.785   1.00 38.20  ? 87   ARG A CD    1 
ATOM   2138 N NE    . ARG E 3 87  ? 14.000  6.730   1.008   1.00 42.69  ? 87   ARG A NE    1 
ATOM   2139 C CZ    . ARG E 3 87  ? 12.826  7.285   0.703   1.00 44.79  ? 87   ARG A CZ    1 
ATOM   2140 N NH1   . ARG E 3 87  ? 11.696  6.713   1.102   1.00 41.28  ? 87   ARG A NH1   1 
ATOM   2141 N NH2   . ARG E 3 87  ? 12.777  8.421   0.008   1.00 42.75  ? 87   ARG A NH2   1 
ATOM   2142 N N     . ALA E 3 88  ? 18.085  2.621   1.731   1.00 28.38  ? 88   ALA A N     1 
ATOM   2143 C CA    . ALA E 3 88  ? 18.247  1.474   2.626   1.00 30.90  ? 88   ALA A CA    1 
ATOM   2144 C C     . ALA E 3 88  ? 16.978  1.278   3.451   1.00 31.85  ? 88   ALA A C     1 
ATOM   2145 O O     . ALA E 3 88  ? 16.497  2.207   4.100   1.00 31.64  ? 88   ALA A O     1 
ATOM   2146 C CB    . ALA E 3 88  ? 19.449  1.677   3.550   1.00 28.19  ? 88   ALA A CB    1 
ATOM   2147 N N     . LYS E 3 89  ? 16.436  0.066   3.406   1.00 33.62  ? 89   LYS A N     1 
ATOM   2148 C CA    . LYS E 3 89  ? 15.223  -0.276  4.137   1.00 37.30  ? 89   LYS A CA    1 
ATOM   2149 C C     . LYS E 3 89  ? 15.622  -0.715  5.552   1.00 38.83  ? 89   LYS A C     1 
ATOM   2150 O O     . LYS E 3 89  ? 14.904  -0.469  6.519   1.00 39.92  ? 89   LYS A O     1 
ATOM   2151 C CB    . LYS E 3 89  ? 14.490  -1.396  3.397   1.00 40.02  ? 89   LYS A CB    1 
ATOM   2152 C CG    . LYS E 3 89  ? 13.028  -1.554  3.756   1.00 45.26  ? 89   LYS A CG    1 
ATOM   2153 C CD    . LYS E 3 89  ? 12.379  -2.621  2.891   1.00 48.02  ? 89   LYS A CD    1 
ATOM   2154 C CE    . LYS E 3 89  ? 10.883  -2.696  3.136   1.00 51.47  ? 89   LYS A CE    1 
ATOM   2155 N NZ    . LYS E 3 89  ? 10.256  -3.796  2.350   1.00 54.70  ? 89   LYS A NZ    1 
ATOM   2156 N N     . THR E 3 90  ? 16.772  -1.378  5.653   1.00 38.43  ? 90   THR A N     1 
ATOM   2157 C CA    . THR E 3 90  ? 17.331  -1.826  6.927   1.00 36.68  ? 90   THR A CA    1 
ATOM   2158 C C     . THR E 3 90  ? 18.777  -1.360  6.851   1.00 37.74  ? 90   THR A C     1 
ATOM   2159 O O     . THR E 3 90  ? 19.146  -0.638  5.925   1.00 37.50  ? 90   THR A O     1 
ATOM   2160 C CB    . THR E 3 90  ? 17.366  -3.368  7.061   1.00 38.39  ? 90   THR A CB    1 
ATOM   2161 O OG1   . THR E 3 90  ? 18.295  -3.911  6.111   1.00 37.94  ? 90   THR A OG1   1 
ATOM   2162 C CG2   . THR E 3 90  ? 15.991  -3.970  6.816   1.00 38.27  ? 90   THR A CG2   1 
ATOM   2163 N N     . ALA E 3 91  ? 19.597  -1.761  7.816   1.00 37.66  ? 91   ALA A N     1 
ATOM   2164 C CA    . ALA E 3 91  ? 21.007  -1.405  7.786   1.00 35.56  ? 91   ALA A CA    1 
ATOM   2165 C C     . ALA E 3 91  ? 21.544  -2.226  6.611   1.00 35.56  ? 91   ALA A C     1 
ATOM   2166 O O     . ALA E 3 91  ? 21.056  -3.327  6.361   1.00 34.45  ? 91   ALA A O     1 
ATOM   2167 C CB    . ALA E 3 91  ? 21.683  -1.823  9.091   1.00 35.54  ? 91   ALA A CB    1 
ATOM   2168 N N     . CYS E 3 92  ? 22.528  -1.701  5.890   1.00 36.32  ? 92   CYS A N     1 
ATOM   2169 C CA    . CYS E 3 92  ? 23.078  -2.404  4.731   1.00 38.39  ? 92   CYS A CA    1 
ATOM   2170 C C     . CYS E 3 92  ? 24.597  -2.388  4.640   1.00 38.55  ? 92   CYS A C     1 
ATOM   2171 O O     . CYS E 3 92  ? 25.247  -1.403  5.002   1.00 38.23  ? 92   CYS A O     1 
ATOM   2172 C CB    . CYS E 3 92  ? 22.553  -1.784  3.425   1.00 40.03  ? 92   CYS A CB    1 
ATOM   2173 S SG    . CYS E 3 92  ? 20.819  -2.039  3.062   1.00 44.35  ? 92   CYS A SG    1 
ATOM   2174 N N     . GLU E 3 93  ? 25.147  -3.484  4.127   1.00 36.95  ? 93   GLU A N     1 
ATOM   2175 C CA    . GLU E 3 93  ? 26.579  -3.602  3.903   1.00 36.30  ? 93   GLU A CA    1 
ATOM   2176 C C     . GLU E 3 93  ? 26.608  -3.750  2.391   1.00 33.41  ? 93   GLU A C     1 
ATOM   2177 O O     . GLU E 3 93  ? 26.077  -4.724  1.853   1.00 30.06  ? 93   GLU A O     1 
ATOM   2178 C CB    . GLU E 3 93  ? 27.152  -4.853  4.573   1.00 39.60  ? 93   GLU A CB    1 
ATOM   2179 C CG    . GLU E 3 93  ? 28.673  -4.942  4.463   1.00 45.87  ? 93   GLU A CG    1 
ATOM   2180 C CD    . GLU E 3 93  ? 29.228  -6.245  5.006   1.00 50.08  ? 93   GLU A CD    1 
ATOM   2181 O OE1   . GLU E 3 93  ? 28.869  -6.618  6.145   1.00 52.71  ? 93   GLU A OE1   1 
ATOM   2182 O OE2   . GLU E 3 93  ? 30.026  -6.896  4.297   1.00 53.22  ? 93   GLU A OE2   1 
ATOM   2183 N N     . VAL E 3 94  ? 27.207  -2.779  1.707   1.00 31.60  ? 94   VAL A N     1 
ATOM   2184 C CA    . VAL E 3 94  ? 27.241  -2.781  0.250   1.00 31.48  ? 94   VAL A CA    1 
ATOM   2185 C C     . VAL E 3 94  ? 28.636  -2.654  -0.362  1.00 32.26  ? 94   VAL A C     1 
ATOM   2186 O O     . VAL E 3 94  ? 29.441  -1.826  0.065   1.00 32.48  ? 94   VAL A O     1 
ATOM   2187 C CB    . VAL E 3 94  ? 26.346  -1.633  -0.285  1.00 32.93  ? 94   VAL A CB    1 
ATOM   2188 C CG1   . VAL E 3 94  ? 26.479  -1.512  -1.791  1.00 34.74  ? 94   VAL A CG1   1 
ATOM   2189 C CG2   . VAL E 3 94  ? 24.886  -1.884  0.113   1.00 31.98  ? 94   VAL A CG2   1 
ATOM   2190 N N     . ALA E 3 95  ? 28.912  -3.468  -1.376  1.00 30.32  ? 95   ALA A N     1 
ATOM   2191 C CA    . ALA E 3 95  ? 30.198  -3.427  -2.051  1.00 29.98  ? 95   ALA A CA    1 
ATOM   2192 C C     . ALA E 3 95  ? 30.052  -2.555  -3.285  1.00 30.42  ? 95   ALA A C     1 
ATOM   2193 O O     . ALA E 3 95  ? 29.052  -2.646  -4.000  1.00 31.99  ? 95   ALA A O     1 
ATOM   2194 C CB    . ALA E 3 95  ? 30.643  -4.831  -2.451  1.00 26.30  ? 95   ALA A CB    1 
ATOM   2195 N N     . GLU E 3 96  ? 31.054  -1.721  -3.542  1.00 29.34  ? 96   GLU A N     1 
ATOM   2196 C CA    . GLU E 3 96  ? 31.011  -0.831  -4.694  1.00 28.43  ? 96   GLU A CA    1 
ATOM   2197 C C     . GLU E 3 96  ? 32.240  -0.990  -5.576  1.00 26.33  ? 96   GLU A C     1 
ATOM   2198 O O     . GLU E 3 96  ? 33.355  -1.162  -5.087  1.00 26.55  ? 96   GLU A O     1 
ATOM   2199 C CB    . GLU E 3 96  ? 30.863  0.623   -4.209  1.00 28.52  ? 96   GLU A CB    1 
ATOM   2200 C CG    . GLU E 3 96  ? 30.920  1.675   -5.307  1.00 36.76  ? 96   GLU A CG    1 
ATOM   2201 C CD    . GLU E 3 96  ? 30.446  3.051   -4.833  1.00 41.42  ? 96   GLU A CD    1 
ATOM   2202 O OE1   . GLU E 3 96  ? 30.612  3.365   -3.630  1.00 42.56  ? 96   GLU A OE1   1 
ATOM   2203 O OE2   . GLU E 3 96  ? 29.916  3.820   -5.668  1.00 42.15  ? 96   GLU A OE2   1 
ATOM   2204 N N     . ILE E 3 97  ? 32.036  -0.928  -6.885  1.00 26.19  ? 97   ILE A N     1 
ATOM   2205 C CA    . ILE E 3 97  ? 33.137  -1.066  -7.821  1.00 26.24  ? 97   ILE A CA    1 
ATOM   2206 C C     . ILE E 3 97  ? 32.828  -0.253  -9.072  1.00 27.50  ? 97   ILE A C     1 
ATOM   2207 O O     . ILE E 3 97  ? 31.679  -0.195  -9.507  1.00 29.96  ? 97   ILE A O     1 
ATOM   2208 C CB    . ILE E 3 97  ? 33.365  -2.562  -8.190  1.00 27.28  ? 97   ILE A CB    1 
ATOM   2209 C CG1   . ILE E 3 97  ? 34.667  -2.715  -8.987  1.00 27.74  ? 97   ILE A CG1   1 
ATOM   2210 C CG2   . ILE E 3 97  ? 32.178  -3.102  -8.996  1.00 25.28  ? 97   ILE A CG2   1 
ATOM   2211 C CD1   . ILE E 3 97  ? 35.071  -4.169  -9.231  1.00 25.55  ? 97   ILE A CD1   1 
ATOM   2212 N N     . SER E 3 98  ? 33.846  0.391   -9.637  1.00 28.01  ? 98   SER A N     1 
ATOM   2213 C CA    . SER E 3 98  ? 33.662  1.201   -10.834 1.00 28.31  ? 98   SER A CA    1 
ATOM   2214 C C     . SER E 3 98  ? 33.271  0.320   -12.015 1.00 29.55  ? 98   SER A C     1 
ATOM   2215 O O     . SER E 3 98  ? 33.629  -0.863  -12.063 1.00 27.47  ? 98   SER A O     1 
ATOM   2216 C CB    . SER E 3 98  ? 34.950  1.959   -11.176 1.00 30.10  ? 98   SER A CB    1 
ATOM   2217 O OG    . SER E 3 98  ? 35.969  1.066   -11.596 1.00 31.84  ? 98   SER A OG    1 
ATOM   2218 N N     . TYR E 3 99  ? 32.536  0.899   -12.964 1.00 29.46  ? 99   TYR A N     1 
ATOM   2219 C CA    . TYR E 3 99  ? 32.119  0.164   -14.150 1.00 30.25  ? 99   TYR A CA    1 
ATOM   2220 C C     . TYR E 3 99  ? 33.367  -0.284  -14.899 1.00 32.44  ? 99   TYR A C     1 
ATOM   2221 O O     . TYR E 3 99  ? 33.417  -1.381  -15.451 1.00 34.12  ? 99   TYR A O     1 
ATOM   2222 C CB    . TYR E 3 99  ? 31.278  1.046   -15.078 1.00 27.24  ? 99   TYR A CB    1 
ATOM   2223 C CG    . TYR E 3 99  ? 29.876  1.372   -14.588 1.00 29.42  ? 99   TYR A CG    1 
ATOM   2224 C CD1   . TYR E 3 99  ? 29.176  0.491   -13.759 1.00 28.50  ? 99   TYR A CD1   1 
ATOM   2225 C CD2   . TYR E 3 99  ? 29.218  2.524   -15.027 1.00 27.20  ? 99   TYR A CD2   1 
ATOM   2226 C CE1   . TYR E 3 99  ? 27.856  0.745   -13.383 1.00 29.75  ? 99   TYR A CE1   1 
ATOM   2227 C CE2   . TYR E 3 99  ? 27.894  2.784   -14.660 1.00 29.82  ? 99   TYR A CE2   1 
ATOM   2228 C CZ    . TYR E 3 99  ? 27.218  1.893   -13.841 1.00 29.13  ? 99   TYR A CZ    1 
ATOM   2229 O OH    . TYR E 3 99  ? 25.902  2.134   -13.494 1.00 27.25  ? 99   TYR A OH    1 
ATOM   2230 N N     . LYS E 3 100 ? 34.374  0.584   -14.912 1.00 33.85  ? 100  LYS A N     1 
ATOM   2231 C CA    . LYS E 3 100 ? 35.636  0.306   -15.599 1.00 35.78  ? 100  LYS A CA    1 
ATOM   2232 C C     . LYS E 3 100 ? 36.308  -0.981  -15.108 1.00 34.89  ? 100  LYS A C     1 
ATOM   2233 O O     . LYS E 3 100 ? 36.732  -1.816  -15.911 1.00 34.46  ? 100  LYS A O     1 
ATOM   2234 C CB    . LYS E 3 100 ? 36.582  1.495   -15.416 1.00 37.95  ? 100  LYS A CB    1 
ATOM   2235 C CG    . LYS E 3 100 ? 37.913  1.360   -16.119 1.00 43.86  ? 100  LYS A CG    1 
ATOM   2236 C CD    . LYS E 3 100 ? 38.758  2.613   -15.912 1.00 45.79  ? 100  LYS A CD    1 
ATOM   2237 C CE    . LYS E 3 100 ? 38.061  3.865   -16.444 1.00 46.82  ? 100  LYS A CE    1 
ATOM   2238 N NZ    . LYS E 3 100 ? 37.892  3.849   -17.925 1.00 45.44  ? 100  LYS A NZ    1 
ATOM   2239 N N     . LYS E 3 101 ? 36.399  -1.149  -13.792 1.00 32.52  ? 101  LYS A N     1 
ATOM   2240 C CA    . LYS E 3 101 ? 37.025  -2.345  -13.242 1.00 34.98  ? 101  LYS A CA    1 
ATOM   2241 C C     . LYS E 3 101 ? 36.100  -3.567  -13.342 1.00 35.36  ? 101  LYS A C     1 
ATOM   2242 O O     . LYS E 3 101 ? 36.566  -4.701  -13.509 1.00 32.49  ? 101  LYS A O     1 
ATOM   2243 C CB    . LYS E 3 101 ? 37.430  -2.111  -11.781 1.00 37.07  ? 101  LYS A CB    1 
ATOM   2244 C CG    . LYS E 3 101 ? 38.244  -3.246  -11.189 1.00 42.83  ? 101  LYS A CG    1 
ATOM   2245 C CD    . LYS E 3 101 ? 39.546  -3.448  -11.968 1.00 46.30  ? 101  LYS A CD    1 
ATOM   2246 C CE    . LYS E 3 101 ? 40.336  -4.650  -11.455 1.00 50.21  ? 101  LYS A CE    1 
ATOM   2247 N NZ    . LYS E 3 101 ? 41.603  -4.877  -12.227 1.00 50.87  ? 101  LYS A NZ    1 
ATOM   2248 N N     . PHE E 3 102 ? 34.792  -3.334  -13.241 1.00 32.87  ? 102  PHE A N     1 
ATOM   2249 C CA    . PHE E 3 102 ? 33.829  -4.425  -13.331 1.00 33.19  ? 102  PHE A CA    1 
ATOM   2250 C C     . PHE E 3 102 ? 33.942  -5.094  -14.691 1.00 33.54  ? 102  PHE A C     1 
ATOM   2251 O O     . PHE E 3 102 ? 33.832  -6.315  -14.800 1.00 31.51  ? 102  PHE A O     1 
ATOM   2252 C CB    . PHE E 3 102 ? 32.397  -3.917  -13.156 1.00 32.59  ? 102  PHE A CB    1 
ATOM   2253 C CG    . PHE E 3 102 ? 31.383  -5.017  -13.054 1.00 31.35  ? 102  PHE A CG    1 
ATOM   2254 C CD1   . PHE E 3 102 ? 31.283  -5.778  -11.893 1.00 31.63  ? 102  PHE A CD1   1 
ATOM   2255 C CD2   . PHE E 3 102 ? 30.544  -5.306  -14.117 1.00 31.44  ? 102  PHE A CD2   1 
ATOM   2256 C CE1   . PHE E 3 102 ? 30.353  -6.815  -11.794 1.00 33.42  ? 102  PHE A CE1   1 
ATOM   2257 C CE2   . PHE E 3 102 ? 29.607  -6.345  -14.030 1.00 30.95  ? 102  PHE A CE2   1 
ATOM   2258 C CZ    . PHE E 3 102 ? 29.513  -7.097  -12.869 1.00 30.40  ? 102  PHE A CZ    1 
ATOM   2259 N N     . ARG E 3 103 ? 34.153  -4.291  -15.730 1.00 34.92  ? 103  ARG A N     1 
ATOM   2260 C CA    . ARG E 3 103 ? 34.290  -4.841  -17.075 1.00 38.51  ? 103  ARG A CA    1 
ATOM   2261 C C     . ARG E 3 103 ? 35.556  -5.687  -17.204 1.00 39.19  ? 103  ARG A C     1 
ATOM   2262 O O     . ARG E 3 103 ? 35.588  -6.651  -17.966 1.00 40.62  ? 103  ARG A O     1 
ATOM   2263 C CB    . ARG E 3 103 ? 34.291  -3.720  -18.117 1.00 39.68  ? 103  ARG A CB    1 
ATOM   2264 C CG    . ARG E 3 103 ? 32.958  -3.012  -18.209 1.00 41.59  ? 103  ARG A CG    1 
ATOM   2265 C CD    . ARG E 3 103 ? 32.948  -1.912  -19.254 1.00 43.97  ? 103  ARG A CD    1 
ATOM   2266 N NE    . ARG E 3 103 ? 32.262  -0.731  -18.740 1.00 47.79  ? 103  ARG A NE    1 
ATOM   2267 C CZ    . ARG E 3 103 ? 31.806  0.266   -19.490 1.00 50.50  ? 103  ARG A CZ    1 
ATOM   2268 N NH1   . ARG E 3 103 ? 31.956  0.237   -20.812 1.00 51.91  ? 103  ARG A NH1   1 
ATOM   2269 N NH2   . ARG E 3 103 ? 31.200  1.297   -18.914 1.00 48.41  ? 103  ARG A NH2   1 
ATOM   2270 N N     . GLN E 3 104 ? 36.600  -5.334  -16.464 1.00 38.86  ? 104  GLN A N     1 
ATOM   2271 C CA    . GLN E 3 104 ? 37.817  -6.129  -16.516 1.00 41.39  ? 104  GLN A CA    1 
ATOM   2272 C C     . GLN E 3 104 ? 37.524  -7.476  -15.862 1.00 41.45  ? 104  GLN A C     1 
ATOM   2273 O O     . GLN E 3 104 ? 37.961  -8.519  -16.352 1.00 42.04  ? 104  GLN A O     1 
ATOM   2274 C CB    . GLN E 3 104 ? 38.967  -5.427  -15.788 1.00 41.94  ? 104  GLN A CB    1 
ATOM   2275 C CG    . GLN E 3 104 ? 39.634  -4.335  -16.616 1.00 46.26  ? 104  GLN A CG    1 
ATOM   2276 C CD    . GLN E 3 104 ? 40.705  -3.584  -15.840 1.00 50.23  ? 104  GLN A CD    1 
ATOM   2277 O OE1   . GLN E 3 104 ? 41.111  -4.004  -14.753 1.00 50.97  ? 104  GLN A OE1   1 
ATOM   2278 N NE2   . GLN E 3 104 ? 41.173  -2.470  -16.400 1.00 50.40  ? 104  GLN A NE2   1 
ATOM   2279 N N     . LEU E 3 105 ? 36.772  -7.455  -14.765 1.00 39.94  ? 105  LEU A N     1 
ATOM   2280 C CA    . LEU E 3 105 ? 36.429  -8.693  -14.073 1.00 40.23  ? 105  LEU A CA    1 
ATOM   2281 C C     . LEU E 3 105 ? 35.586  -9.609  -14.956 1.00 40.78  ? 105  LEU A C     1 
ATOM   2282 O O     . LEU E 3 105 ? 35.697  -10.836 -14.868 1.00 40.29  ? 105  LEU A O     1 
ATOM   2283 C CB    . LEU E 3 105 ? 35.672  -8.403  -12.774 1.00 38.60  ? 105  LEU A CB    1 
ATOM   2284 C CG    . LEU E 3 105 ? 36.428  -7.621  -11.700 1.00 39.25  ? 105  LEU A CG    1 
ATOM   2285 C CD1   . LEU E 3 105 ? 35.663  -7.706  -10.386 1.00 38.13  ? 105  LEU A CD1   1 
ATOM   2286 C CD2   . LEU E 3 105 ? 37.822  -8.195  -11.527 1.00 37.73  ? 105  LEU A CD2   1 
ATOM   2287 N N     . ILE E 3 106 ? 34.744  -9.015  -15.802 1.00 40.65  ? 106  ILE A N     1 
ATOM   2288 C CA    . ILE E 3 106 ? 33.891  -9.796  -16.697 1.00 41.51  ? 106  ILE A CA    1 
ATOM   2289 C C     . ILE E 3 106 ? 34.766  -10.537 -17.694 1.00 42.63  ? 106  ILE A C     1 
ATOM   2290 O O     . ILE E 3 106 ? 34.469  -11.663 -18.090 1.00 41.88  ? 106  ILE A O     1 
ATOM   2291 C CB    . ILE E 3 106 ? 32.900  -8.898  -17.486 1.00 40.74  ? 106  ILE A CB    1 
ATOM   2292 C CG1   . ILE E 3 106 ? 31.869  -8.290  -16.530 1.00 40.24  ? 106  ILE A CG1   1 
ATOM   2293 C CG2   . ILE E 3 106 ? 32.202  -9.722  -18.572 1.00 41.30  ? 106  ILE A CG2   1 
ATOM   2294 C CD1   . ILE E 3 106 ? 30.789  -7.476  -17.218 1.00 39.62  ? 106  ILE A CD1   1 
ATOM   2295 N N     . GLN E 3 107 ? 35.850  -9.888  -18.095 1.00 43.90  ? 107  GLN A N     1 
ATOM   2296 C CA    . GLN E 3 107 ? 36.786  -10.469 -19.040 1.00 46.19  ? 107  GLN A CA    1 
ATOM   2297 C C     . GLN E 3 107 ? 37.379  -11.769 -18.490 1.00 45.57  ? 107  GLN A C     1 
ATOM   2298 O O     . GLN E 3 107 ? 37.508  -12.752 -19.213 1.00 46.24  ? 107  GLN A O     1 
ATOM   2299 C CB    . GLN E 3 107 ? 37.892  -9.452  -19.335 1.00 49.67  ? 107  GLN A CB    1 
ATOM   2300 C CG    . GLN E 3 107 ? 39.060  -9.976  -20.152 1.00 55.01  ? 107  GLN A CG    1 
ATOM   2301 C CD    . GLN E 3 107 ? 40.101  -8.896  -20.418 1.00 58.68  ? 107  GLN A CD    1 
ATOM   2302 O OE1   . GLN E 3 107 ? 40.571  -8.226  -19.492 1.00 59.42  ? 107  GLN A OE1   1 
ATOM   2303 N NE2   . GLN E 3 107 ? 40.466  -8.724  -21.686 1.00 60.00  ? 107  GLN A NE2   1 
ATOM   2304 N N     . VAL E 3 108 ? 37.726  -11.784 -17.209 1.00 44.46  ? 108  VAL A N     1 
ATOM   2305 C CA    . VAL E 3 108 ? 38.307  -12.984 -16.623 1.00 43.80  ? 108  VAL A CA    1 
ATOM   2306 C C     . VAL E 3 108 ? 37.262  -14.003 -16.159 1.00 43.39  ? 108  VAL A C     1 
ATOM   2307 O O     . VAL E 3 108 ? 37.559  -15.194 -16.072 1.00 42.69  ? 108  VAL A O     1 
ATOM   2308 C CB    . VAL E 3 108 ? 39.237  -12.633 -15.440 1.00 45.40  ? 108  VAL A CB    1 
ATOM   2309 C CG1   . VAL E 3 108 ? 40.081  -11.410 -15.791 1.00 45.47  ? 108  VAL A CG1   1 
ATOM   2310 C CG2   . VAL E 3 108 ? 38.433  -12.402 -14.183 1.00 45.81  ? 108  VAL A CG2   1 
ATOM   2311 N N     . ASN E 3 109 ? 36.045  -13.547 -15.865 1.00 41.50  ? 109  ASN A N     1 
ATOM   2312 C CA    . ASN E 3 109 ? 34.985  -14.461 -15.426 1.00 40.75  ? 109  ASN A CA    1 
ATOM   2313 C C     . ASN E 3 109 ? 33.594  -13.980 -15.835 1.00 39.64  ? 109  ASN A C     1 
ATOM   2314 O O     . ASN E 3 109 ? 32.883  -13.359 -15.047 1.00 38.54  ? 109  ASN A O     1 
ATOM   2315 C CB    . ASN E 3 109 ? 35.023  -14.655 -13.908 1.00 41.92  ? 109  ASN A CB    1 
ATOM   2316 C CG    . ASN E 3 109 ? 33.992  -15.666 -13.432 1.00 44.70  ? 109  ASN A CG    1 
ATOM   2317 O OD1   . ASN E 3 109 ? 33.330  -16.317 -14.243 1.00 48.00  ? 109  ASN A OD1   1 
ATOM   2318 N ND2   . ASN E 3 109 ? 33.854  -15.807 -12.118 1.00 43.97  ? 109  ASN A ND2   1 
ATOM   2319 N N     . PRO E 3 110 ? 33.187  -14.287 -17.076 1.00 39.27  ? 110  PRO A N     1 
ATOM   2320 C CA    . PRO E 3 110 ? 31.892  -13.911 -17.650 1.00 39.54  ? 110  PRO A CA    1 
ATOM   2321 C C     . PRO E 3 110 ? 30.620  -14.394 -16.940 1.00 39.05  ? 110  PRO A C     1 
ATOM   2322 O O     . PRO E 3 110 ? 29.529  -13.908 -17.237 1.00 39.37  ? 110  PRO A O     1 
ATOM   2323 C CB    . PRO E 3 110 ? 32.002  -14.400 -19.098 1.00 40.03  ? 110  PRO A CB    1 
ATOM   2324 C CG    . PRO E 3 110 ? 32.991  -15.518 -19.017 1.00 41.82  ? 110  PRO A CG    1 
ATOM   2325 C CD    . PRO E 3 110 ? 34.021  -14.976 -18.077 1.00 39.17  ? 110  PRO A CD    1 
ATOM   2326 N N     . ASP E 3 111 ? 30.743  -15.339 -16.015 1.00 37.94  ? 111  ASP A N     1 
ATOM   2327 C CA    . ASP E 3 111 ? 29.569  -15.801 -15.276 1.00 38.02  ? 111  ASP A CA    1 
ATOM   2328 C C     . ASP E 3 111 ? 28.950  -14.605 -14.552 1.00 36.91  ? 111  ASP A C     1 
ATOM   2329 O O     . ASP E 3 111 ? 27.738  -14.549 -14.341 1.00 36.44  ? 111  ASP A O     1 
ATOM   2330 C CB    . ASP E 3 111 ? 29.940  -16.840 -14.208 1.00 39.47  ? 111  ASP A CB    1 
ATOM   2331 C CG    . ASP E 3 111 ? 30.451  -18.145 -14.794 1.00 43.06  ? 111  ASP A CG    1 
ATOM   2332 O OD1   . ASP E 3 111 ? 30.036  -18.516 -15.913 1.00 43.72  ? 111  ASP A OD1   1 
ATOM   2333 O OD2   . ASP E 3 111 ? 31.255  -18.815 -14.111 1.00 43.22  ? 111  ASP A OD2   1 
ATOM   2334 N N     . ILE E 3 112 ? 29.787  -13.653 -14.151 1.00 36.08  ? 112  ILE A N     1 
ATOM   2335 C CA    . ILE E 3 112 ? 29.276  -12.495 -13.432 1.00 35.87  ? 112  ILE A CA    1 
ATOM   2336 C C     . ILE E 3 112 ? 28.282  -11.697 -14.271 1.00 33.06  ? 112  ILE A C     1 
ATOM   2337 O O     . ILE E 3 112 ? 27.336  -11.143 -13.732 1.00 30.17  ? 112  ILE A O     1 
ATOM   2338 C CB    . ILE E 3 112 ? 30.415  -11.577 -12.935 1.00 37.50  ? 112  ILE A CB    1 
ATOM   2339 C CG1   . ILE E 3 112 ? 31.212  -11.030 -14.109 1.00 39.29  ? 112  ILE A CG1   1 
ATOM   2340 C CG2   . ILE E 3 112 ? 31.333  -12.353 -12.006 1.00 38.33  ? 112  ILE A CG2   1 
ATOM   2341 C CD1   . ILE E 3 112 ? 32.332  -10.100 -13.674 1.00 43.48  ? 112  ILE A CD1   1 
ATOM   2342 N N     . LEU E 3 113 ? 28.477  -11.653 -15.585 1.00 31.80  ? 113  LEU A N     1 
ATOM   2343 C CA    . LEU E 3 113 ? 27.540  -10.928 -16.439 1.00 32.71  ? 113  LEU A CA    1 
ATOM   2344 C C     . LEU E 3 113 ? 26.227  -11.715 -16.568 1.00 33.42  ? 113  LEU A C     1 
ATOM   2345 O O     . LEU E 3 113 ? 25.139  -11.134 -16.669 1.00 30.79  ? 113  LEU A O     1 
ATOM   2346 C CB    . LEU E 3 113 ? 28.139  -10.697 -17.830 1.00 31.96  ? 113  LEU A CB    1 
ATOM   2347 C CG    . LEU E 3 113 ? 27.210  -9.959  -18.817 1.00 34.75  ? 113  LEU A CG    1 
ATOM   2348 C CD1   . LEU E 3 113 ? 26.840  -8.592  -18.265 1.00 32.22  ? 113  LEU A CD1   1 
ATOM   2349 C CD2   . LEU E 3 113 ? 27.890  -9.807  -20.161 1.00 34.42  ? 113  LEU A CD2   1 
ATOM   2350 N N     . MET E 3 114 ? 26.331  -13.041 -16.551 1.00 33.91  ? 114  MET A N     1 
ATOM   2351 C CA    . MET E 3 114 ? 25.151  -13.896 -16.674 1.00 34.20  ? 114  MET A CA    1 
ATOM   2352 C C     . MET E 3 114 ? 24.224  -13.679 -15.481 1.00 31.70  ? 114  MET A C     1 
ATOM   2353 O O     . MET E 3 114 ? 23.010  -13.617 -15.632 1.00 30.15  ? 114  MET A O     1 
ATOM   2354 C CB    . MET E 3 114 ? 25.569  -15.368 -16.747 1.00 36.67  ? 114  MET A CB    1 
ATOM   2355 C CG    . MET E 3 114 ? 24.461  -16.316 -17.211 1.00 45.80  ? 114  MET A CG    1 
ATOM   2356 S SD    . MET E 3 114 ? 24.027  -16.109 -18.965 1.00 52.19  ? 114  MET A SD    1 
ATOM   2357 C CE    . MET E 3 114 ? 22.472  -17.028 -19.054 1.00 51.46  ? 114  MET A CE    1 
ATOM   2358 N N     . ARG E 3 115 ? 24.818  -13.569 -14.297 1.00 30.90  ? 115  ARG A N     1 
ATOM   2359 C CA    . ARG E 3 115 ? 24.082  -13.346 -13.059 1.00 31.33  ? 115  ARG A CA    1 
ATOM   2360 C C     . ARG E 3 115 ? 23.403  -11.974 -13.096 1.00 30.84  ? 115  ARG A C     1 
ATOM   2361 O O     . ARG E 3 115 ? 22.228  -11.835 -12.746 1.00 28.29  ? 115  ARG A O     1 
ATOM   2362 C CB    . ARG E 3 115 ? 25.049  -13.408 -11.868 1.00 34.14  ? 115  ARG A CB    1 
ATOM   2363 C CG    . ARG E 3 115 ? 24.433  -13.108 -10.496 1.00 37.94  ? 115  ARG A CG    1 
ATOM   2364 C CD    . ARG E 3 115 ? 23.924  -14.366 -9.801  1.00 43.46  ? 115  ARG A CD    1 
ATOM   2365 N NE    . ARG E 3 115 ? 23.446  -14.100 -8.442  1.00 46.17  ? 115  ARG A NE    1 
ATOM   2366 C CZ    . ARG E 3 115 ? 24.212  -13.648 -7.451  1.00 46.75  ? 115  ARG A CZ    1 
ATOM   2367 N NH1   . ARG E 3 115 ? 25.498  -13.411 -7.665  1.00 50.18  ? 115  ARG A NH1   1 
ATOM   2368 N NH2   . ARG E 3 115 ? 23.697  -13.434 -6.246  1.00 45.39  ? 115  ARG A NH2   1 
ATOM   2369 N N     . LEU E 3 116 ? 24.149  -10.962 -13.527 1.00 30.38  ? 116  LEU A N     1 
ATOM   2370 C CA    . LEU E 3 116 ? 23.615  -9.609  -13.591 1.00 29.31  ? 116  LEU A CA    1 
ATOM   2371 C C     . LEU E 3 116 ? 22.466  -9.544  -14.595 1.00 27.72  ? 116  LEU A C     1 
ATOM   2372 O O     . LEU E 3 116 ? 21.452  -8.895  -14.351 1.00 22.34  ? 116  LEU A O     1 
ATOM   2373 C CB    . LEU E 3 116 ? 24.724  -8.622  -13.989 1.00 31.92  ? 116  LEU A CB    1 
ATOM   2374 C CG    . LEU E 3 116 ? 24.452  -7.119  -13.809 1.00 33.56  ? 116  LEU A CG    1 
ATOM   2375 C CD1   . LEU E 3 116 ? 25.763  -6.338  -13.892 1.00 33.90  ? 116  LEU A CD1   1 
ATOM   2376 C CD2   . LEU E 3 116 ? 23.489  -6.634  -14.873 1.00 38.00  ? 116  LEU A CD2   1 
ATOM   2377 N N     . SER E 3 117 ? 22.633  -10.230 -15.720 1.00 26.76  ? 117  SER A N     1 
ATOM   2378 C CA    . SER E 3 117 ? 21.617  -10.246 -16.764 1.00 26.92  ? 117  SER A CA    1 
ATOM   2379 C C     . SER E 3 117 ? 20.334  -10.920 -16.278 1.00 24.04  ? 117  SER A C     1 
ATOM   2380 O O     . SER E 3 117 ? 19.243  -10.457 -16.567 1.00 24.09  ? 117  SER A O     1 
ATOM   2381 C CB    . SER E 3 117 ? 22.141  -10.989 -18.001 1.00 29.94  ? 117  SER A CB    1 
ATOM   2382 O OG    . SER E 3 117 ? 23.329  -10.399 -18.492 1.00 35.60  ? 117  SER A OG    1 
ATOM   2383 N N     . ALA E 3 118 ? 20.473  -12.021 -15.551 1.00 23.26  ? 118  ALA A N     1 
ATOM   2384 C CA    . ALA E 3 118 ? 19.314  -12.745 -15.039 1.00 22.54  ? 118  ALA A CA    1 
ATOM   2385 C C     . ALA E 3 118 ? 18.503  -11.837 -14.117 1.00 24.16  ? 118  ALA A C     1 
ATOM   2386 O O     . ALA E 3 118 ? 17.274  -11.833 -14.172 1.00 21.31  ? 118  ALA A O     1 
ATOM   2387 C CB    . ALA E 3 118 ? 19.762  -13.996 -14.282 1.00 22.38  ? 118  ALA A CB    1 
ATOM   2388 N N     . GLN E 3 119 ? 19.193  -11.068 -13.274 1.00 22.50  ? 119  GLN A N     1 
ATOM   2389 C CA    . GLN E 3 119 ? 18.502  -10.166 -12.355 1.00 24.90  ? 119  GLN A CA    1 
ATOM   2390 C C     . GLN E 3 119 ? 17.728  -9.088  -13.102 1.00 24.07  ? 119  GLN A C     1 
ATOM   2391 O O     . GLN E 3 119 ? 16.592  -8.760  -12.730 1.00 24.72  ? 119  GLN A O     1 
ATOM   2392 C CB    . GLN E 3 119 ? 19.492  -9.540  -11.359 1.00 25.07  ? 119  GLN A CB    1 
ATOM   2393 C CG    . GLN E 3 119 ? 19.983  -10.529 -10.294 1.00 24.83  ? 119  GLN A CG    1 
ATOM   2394 C CD    . GLN E 3 119 ? 20.972  -9.909  -9.303  1.00 27.26  ? 119  GLN A CD    1 
ATOM   2395 O OE1   . GLN E 3 119 ? 21.188  -8.694  -9.294  1.00 25.55  ? 119  GLN A OE1   1 
ATOM   2396 N NE2   . GLN E 3 119 ? 21.562  -10.747 -8.454  1.00 25.26  ? 119  GLN A NE2   1 
ATOM   2397 N N     . MET E 3 120 ? 18.327  -8.544  -14.159 1.00 24.09  ? 120  MET A N     1 
ATOM   2398 C CA    . MET E 3 120 ? 17.649  -7.528  -14.958 1.00 24.62  ? 120  MET A CA    1 
ATOM   2399 C C     . MET E 3 120 ? 16.424  -8.128  -15.654 1.00 22.81  ? 120  MET A C     1 
ATOM   2400 O O     . MET E 3 120 ? 15.400  -7.459  -15.812 1.00 22.38  ? 120  MET A O     1 
ATOM   2401 C CB    . MET E 3 120 ? 18.593  -6.941  -16.018 1.00 24.24  ? 120  MET A CB    1 
ATOM   2402 C CG    . MET E 3 120 ? 19.606  -5.924  -15.476 1.00 27.83  ? 120  MET A CG    1 
ATOM   2403 S SD    . MET E 3 120 ? 20.469  -5.058  -16.810 1.00 33.33  ? 120  MET A SD    1 
ATOM   2404 C CE    . MET E 3 120 ? 21.397  -6.418  -17.493 1.00 29.37  ? 120  MET A CE    1 
ATOM   2405 N N     . ALA E 3 121 ? 16.537  -9.382  -16.085 1.00 20.30  ? 121  ALA A N     1 
ATOM   2406 C CA    . ALA E 3 121 ? 15.422  -10.042 -16.761 1.00 22.24  ? 121  ALA A CA    1 
ATOM   2407 C C     . ALA E 3 121 ? 14.245  -10.173 -15.806 1.00 21.65  ? 121  ALA A C     1 
ATOM   2408 O O     . ALA E 3 121 ? 13.105  -9.913  -16.173 1.00 23.22  ? 121  ALA A O     1 
ATOM   2409 C CB    . ALA E 3 121 ? 15.838  -11.424 -17.267 1.00 23.95  ? 121  ALA A CB    1 
ATOM   2410 N N     . ARG E 3 122 ? 14.524  -10.569 -14.573 1.00 22.31  ? 122  ARG A N     1 
ATOM   2411 C CA    . ARG E 3 122 ? 13.466  -10.711 -13.592 1.00 24.02  ? 122  ARG A CA    1 
ATOM   2412 C C     . ARG E 3 122 ? 12.804  -9.363  -13.286 1.00 24.19  ? 122  ARG A C     1 
ATOM   2413 O O     . ARG E 3 122 ? 11.583  -9.276  -13.152 1.00 24.81  ? 122  ARG A O     1 
ATOM   2414 C CB    . ARG E 3 122 ? 14.021  -11.306 -12.299 1.00 25.87  ? 122  ARG A CB    1 
ATOM   2415 C CG    . ARG E 3 122 ? 12.988  -11.370 -11.206 1.00 31.61  ? 122  ARG A CG    1 
ATOM   2416 C CD    . ARG E 3 122 ? 11.881  -12.339 -11.574 1.00 40.54  ? 122  ARG A CD    1 
ATOM   2417 N NE    . ARG E 3 122 ? 12.209  -13.688 -11.132 1.00 48.70  ? 122  ARG A NE    1 
ATOM   2418 C CZ    . ARG E 3 122 ? 11.560  -14.784 -11.509 1.00 52.58  ? 122  ARG A CZ    1 
ATOM   2419 N NH1   . ARG E 3 122 ? 10.538  -14.700 -12.353 1.00 55.45  ? 122  ARG A NH1   1 
ATOM   2420 N NH2   . ARG E 3 122 ? 11.924  -15.962 -11.024 1.00 53.71  ? 122  ARG A NH2   1 
ATOM   2421 N N     . ARG E 3 123 ? 13.616  -8.319  -13.163 1.00 21.15  ? 123  ARG A N     1 
ATOM   2422 C CA    . ARG E 3 123 ? 13.106  -6.987  -12.868 1.00 21.56  ? 123  ARG A CA    1 
ATOM   2423 C C     . ARG E 3 123 ? 12.217  -6.473  -14.007 1.00 20.30  ? 123  ARG A C     1 
ATOM   2424 O O     . ARG E 3 123 ? 11.231  -5.776  -13.769 1.00 20.97  ? 123  ARG A O     1 
ATOM   2425 C CB    . ARG E 3 123 ? 14.286  -6.028  -12.590 1.00 19.65  ? 123  ARG A CB    1 
ATOM   2426 C CG    . ARG E 3 123 ? 15.040  -6.383  -11.290 1.00 22.21  ? 123  ARG A CG    1 
ATOM   2427 C CD    . ARG E 3 123 ? 16.389  -5.657  -11.129 1.00 22.56  ? 123  ARG A CD    1 
ATOM   2428 N NE    . ARG E 3 123 ? 17.237  -6.306  -10.123 1.00 25.47  ? 123  ARG A NE    1 
ATOM   2429 C CZ    . ARG E 3 123 ? 18.393  -5.812  -9.680  1.00 25.42  ? 123  ARG A CZ    1 
ATOM   2430 N NH1   . ARG E 3 123 ? 18.846  -4.654  -10.145 1.00 22.94  ? 123  ARG A NH1   1 
ATOM   2431 N NH2   . ARG E 3 123 ? 19.110  -6.482  -8.786  1.00 27.18  ? 123  ARG A NH2   1 
ATOM   2432 N N     . LEU E 3 124 ? 12.550  -6.833  -15.241 1.00 18.13  ? 124  LEU A N     1 
ATOM   2433 C CA    . LEU E 3 124 ? 11.741  -6.397  -16.369 1.00 21.48  ? 124  LEU A CA    1 
ATOM   2434 C C     . LEU E 3 124 ? 10.371  -7.108  -16.339 1.00 21.03  ? 124  LEU A C     1 
ATOM   2435 O O     . LEU E 3 124 ? 9.344   -6.481  -16.594 1.00 21.48  ? 124  LEU A O     1 
ATOM   2436 C CB    . LEU E 3 124 ? 12.481  -6.656  -17.696 1.00 20.47  ? 124  LEU A CB    1 
ATOM   2437 C CG    . LEU E 3 124 ? 11.848  -6.048  -18.952 1.00 28.51  ? 124  LEU A CG    1 
ATOM   2438 C CD1   . LEU E 3 124 ? 11.771  -4.514  -18.817 1.00 22.51  ? 124  LEU A CD1   1 
ATOM   2439 C CD2   . LEU E 3 124 ? 12.657  -6.452  -20.181 1.00 26.77  ? 124  LEU A CD2   1 
ATOM   2440 N N     . GLN E 3 125 ? 10.347  -8.402  -16.015 1.00 22.19  ? 125  GLN A N     1 
ATOM   2441 C CA    . GLN E 3 125 ? 9.068   -9.130  -15.926 1.00 25.08  ? 125  GLN A CA    1 
ATOM   2442 C C     . GLN E 3 125 ? 8.180   -8.506  -14.832 1.00 25.06  ? 125  GLN A C     1 
ATOM   2443 O O     . GLN E 3 125 ? 6.987   -8.290  -15.033 1.00 25.41  ? 125  GLN A O     1 
ATOM   2444 C CB    . GLN E 3 125 ? 9.293   -10.620 -15.589 1.00 25.93  ? 125  GLN A CB    1 
ATOM   2445 C CG    . GLN E 3 125 ? 10.047  -11.427 -16.662 1.00 30.59  ? 125  GLN A CG    1 
ATOM   2446 C CD    . GLN E 3 125 ? 10.419  -12.843 -16.207 1.00 35.27  ? 125  GLN A CD    1 
ATOM   2447 O OE1   . GLN E 3 125 ? 10.818  -13.060 -15.061 1.00 37.97  ? 125  GLN A OE1   1 
ATOM   2448 N NE2   . GLN E 3 125 ? 10.310  -13.807 -17.119 1.00 33.14  ? 125  GLN A NE2   1 
ATOM   2449 N N     . VAL E 3 126 ? 8.767   -8.220  -13.673 1.00 24.32  ? 126  VAL A N     1 
ATOM   2450 C CA    . VAL E 3 126 ? 8.008   -7.641  -12.569 1.00 25.72  ? 126  VAL A CA    1 
ATOM   2451 C C     . VAL E 3 126 ? 7.465   -6.256  -12.890 1.00 26.62  ? 126  VAL A C     1 
ATOM   2452 O O     . VAL E 3 126 ? 6.302   -5.958  -12.600 1.00 25.81  ? 126  VAL A O     1 
ATOM   2453 C CB    . VAL E 3 126 ? 8.863   -7.545  -11.259 1.00 26.00  ? 126  VAL A CB    1 
ATOM   2454 C CG1   . VAL E 3 126 ? 8.170   -6.638  -10.233 1.00 24.87  ? 126  VAL A CG1   1 
ATOM   2455 C CG2   . VAL E 3 126 ? 9.037   -8.935  -10.647 1.00 23.84  ? 126  VAL A CG2   1 
ATOM   2456 N N     . THR E 3 127 ? 8.304   -5.416  -13.491 1.00 26.08  ? 127  THR A N     1 
ATOM   2457 C CA    . THR E 3 127 ? 7.905   -4.052  -13.827 1.00 23.92  ? 127  THR A CA    1 
ATOM   2458 C C     . THR E 3 127 ? 6.847   -4.040  -14.937 1.00 23.82  ? 127  THR A C     1 
ATOM   2459 O O     . THR E 3 127 ? 5.980   -3.166  -14.968 1.00 24.24  ? 127  THR A O     1 
ATOM   2460 C CB    . THR E 3 127 ? 9.144   -3.216  -14.245 1.00 28.10  ? 127  THR A CB    1 
ATOM   2461 O OG1   . THR E 3 127 ? 10.148  -3.317  -13.226 1.00 27.96  ? 127  THR A OG1   1 
ATOM   2462 C CG2   . THR E 3 127 ? 8.778   -1.745  -14.431 1.00 25.04  ? 127  THR A CG2   1 
ATOM   2463 N N     . SER E 3 128 ? 6.911   -5.004  -15.847 1.00 23.40  ? 128  SER A N     1 
ATOM   2464 C CA    . SER E 3 128 ? 5.918   -5.076  -16.919 1.00 23.18  ? 128  SER A CA    1 
ATOM   2465 C C     . SER E 3 128 ? 4.561   -5.438  -16.320 1.00 23.51  ? 128  SER A C     1 
ATOM   2466 O O     . SER E 3 128 ? 3.527   -4.943  -16.750 1.00 24.40  ? 128  SER A O     1 
ATOM   2467 C CB    . SER E 3 128 ? 6.329   -6.115  -17.967 1.00 23.25  ? 128  SER A CB    1 
ATOM   2468 O OG    . SER E 3 128 ? 7.387   -5.613  -18.768 1.00 22.47  ? 128  SER A OG    1 
ATOM   2469 N N     . GLU E 3 129 ? 4.579   -6.293  -15.307 1.00 23.32  ? 129  GLU A N     1 
ATOM   2470 C CA    . GLU E 3 129 ? 3.358   -6.700  -14.628 1.00 26.61  ? 129  GLU A CA    1 
ATOM   2471 C C     . GLU E 3 129 ? 2.724   -5.509  -13.883 1.00 26.54  ? 129  GLU A C     1 
ATOM   2472 O O     . GLU E 3 129 ? 1.498   -5.395  -13.808 1.00 24.61  ? 129  GLU A O     1 
ATOM   2473 C CB    . GLU E 3 129 ? 3.681   -7.846  -13.668 1.00 30.16  ? 129  GLU A CB    1 
ATOM   2474 C CG    . GLU E 3 129 ? 2.566   -8.237  -12.741 1.00 39.41  ? 129  GLU A CG    1 
ATOM   2475 C CD    . GLU E 3 129 ? 2.625   -9.704  -12.378 1.00 45.09  ? 129  GLU A CD    1 
ATOM   2476 O OE1   . GLU E 3 129 ? 3.751   -10.257 -12.312 1.00 46.72  ? 129  GLU A OE1   1 
ATOM   2477 O OE2   . GLU E 3 129 ? 1.546   -10.302 -12.159 1.00 48.11  ? 129  GLU A OE2   1 
ATOM   2478 N N     . LYS E 3 130 ? 3.559   -4.625  -13.344 1.00 24.71  ? 130  LYS A N     1 
ATOM   2479 C CA    . LYS E 3 130 ? 3.068   -3.442  -12.640 1.00 26.70  ? 130  LYS A CA    1 
ATOM   2480 C C     . LYS E 3 130 ? 2.337   -2.536  -13.625 1.00 25.51  ? 130  LYS A C     1 
ATOM   2481 O O     . LYS E 3 130 ? 1.294   -1.975  -13.296 1.00 26.05  ? 130  LYS A O     1 
ATOM   2482 C CB    . LYS E 3 130 ? 4.223   -2.670  -11.983 1.00 30.80  ? 130  LYS A CB    1 
ATOM   2483 C CG    . LYS E 3 130 ? 4.885   -3.410  -10.821 1.00 35.34  ? 130  LYS A CG    1 
ATOM   2484 C CD    . LYS E 3 130 ? 5.833   -2.493  -10.052 1.00 41.39  ? 130  LYS A CD    1 
ATOM   2485 C CE    . LYS E 3 130 ? 6.430   -3.194  -8.831  1.00 42.95  ? 130  LYS A CE    1 
ATOM   2486 N NZ    . LYS E 3 130 ? 5.400   -3.541  -7.809  1.00 44.20  ? 130  LYS A NZ    1 
ATOM   2487 N N     . VAL E 3 131 ? 2.895   -2.382  -14.825 1.00 23.28  ? 131  VAL A N     1 
ATOM   2488 C CA    . VAL E 3 131 ? 2.258   -1.581  -15.860 1.00 24.52  ? 131  VAL A CA    1 
ATOM   2489 C C     . VAL E 3 131 ? 0.858   -2.160  -16.105 1.00 25.93  ? 131  VAL A C     1 
ATOM   2490 O O     . VAL E 3 131 ? -0.120  -1.422  -16.207 1.00 25.21  ? 131  VAL A O     1 
ATOM   2491 C CB    . VAL E 3 131 ? 3.061   -1.622  -17.185 1.00 26.70  ? 131  VAL A CB    1 
ATOM   2492 C CG1   . VAL E 3 131 ? 2.273   -0.933  -18.301 1.00 24.79  ? 131  VAL A CG1   1 
ATOM   2493 C CG2   . VAL E 3 131 ? 4.407   -0.927  -17.004 1.00 24.77  ? 131  VAL A CG2   1 
ATOM   2494 N N     . GLY E 3 132 ? 0.768   -3.486  -16.186 1.00 25.93  ? 132  GLY A N     1 
ATOM   2495 C CA    . GLY E 3 132 ? -0.520  -4.121  -16.404 1.00 26.52  ? 132  GLY A CA    1 
ATOM   2496 C C     . GLY E 3 132 ? -1.507  -3.860  -15.280 1.00 26.02  ? 132  GLY A C     1 
ATOM   2497 O O     . GLY E 3 132 ? -2.645  -3.474  -15.522 1.00 27.09  ? 132  GLY A O     1 
ATOM   2498 N N     . ASN E 3 133 ? -1.075  -4.064  -14.042 1.00 26.82  ? 133  ASN A N     1 
ATOM   2499 C CA    . ASN E 3 133 ? -1.938  -3.840  -12.883 1.00 27.36  ? 133  ASN A CA    1 
ATOM   2500 C C     . ASN E 3 133 ? -2.501  -2.415  -12.857 1.00 27.44  ? 133  ASN A C     1 
ATOM   2501 O O     . ASN E 3 133 ? -3.695  -2.206  -12.636 1.00 26.78  ? 133  ASN A O     1 
ATOM   2502 C CB    . ASN E 3 133 ? -1.156  -4.115  -11.599 1.00 27.05  ? 133  ASN A CB    1 
ATOM   2503 C CG    . ASN E 3 133 ? -0.831  -5.588  -11.420 1.00 31.54  ? 133  ASN A CG    1 
ATOM   2504 O OD1   . ASN E 3 133 ? 0.060   -5.949  -10.644 1.00 30.89  ? 133  ASN A OD1   1 
ATOM   2505 N ND2   . ASN E 3 133 ? -1.556  -6.444  -12.125 1.00 31.67  ? 133  ASN A ND2   1 
ATOM   2506 N N     . LEU E 3 134 ? -1.631  -1.442  -13.093 1.00 26.20  ? 134  LEU A N     1 
ATOM   2507 C CA    . LEU E 3 134 ? -2.019  -0.036  -13.099 1.00 28.40  ? 134  LEU A CA    1 
ATOM   2508 C C     . LEU E 3 134 ? -3.002  0.284   -14.226 1.00 29.12  ? 134  LEU A C     1 
ATOM   2509 O O     . LEU E 3 134 ? -3.890  1.132   -14.073 1.00 29.40  ? 134  LEU A O     1 
ATOM   2510 C CB    . LEU E 3 134 ? -0.769  0.852   -13.237 1.00 25.83  ? 134  LEU A CB    1 
ATOM   2511 C CG    . LEU E 3 134 ? 0.132   0.976   -12.002 1.00 26.70  ? 134  LEU A CG    1 
ATOM   2512 C CD1   . LEU E 3 134 ? 1.428   1.708   -12.367 1.00 23.79  ? 134  LEU A CD1   1 
ATOM   2513 C CD2   . LEU E 3 134 ? -0.622  1.742   -10.902 1.00 25.87  ? 134  LEU A CD2   1 
ATOM   2514 N N     . ALA E 3 135 ? -2.841  -0.392  -15.357 1.00 27.41  ? 135  ALA A N     1 
ATOM   2515 C CA    . ALA E 3 135 ? -3.708  -0.165  -16.506 1.00 28.35  ? 135  ALA A CA    1 
ATOM   2516 C C     . ALA E 3 135 ? -5.058  -0.874  -16.439 1.00 27.77  ? 135  ALA A C     1 
ATOM   2517 O O     . ALA E 3 135 ? -6.079  -0.328  -16.871 1.00 27.70  ? 135  ALA A O     1 
ATOM   2518 C CB    . ALA E 3 135 ? -2.984  -0.584  -17.794 1.00 27.94  ? 135  ALA A CB    1 
ATOM   2519 N N     . PHE E 3 136 ? -5.068  -2.081  -15.886 1.00 27.92  ? 136  PHE A N     1 
ATOM   2520 C CA    . PHE E 3 136 ? -6.284  -2.881  -15.845 1.00 28.98  ? 136  PHE A CA    1 
ATOM   2521 C C     . PHE E 3 136 ? -7.019  -3.024  -14.522 1.00 29.73  ? 136  PHE A C     1 
ATOM   2522 O O     . PHE E 3 136 ? -8.179  -3.414  -14.521 1.00 28.99  ? 136  PHE A O     1 
ATOM   2523 C CB    . PHE E 3 136 ? -5.988  -4.295  -16.350 1.00 28.92  ? 136  PHE A CB    1 
ATOM   2524 C CG    . PHE E 3 136 ? -5.334  -4.345  -17.703 1.00 32.96  ? 136  PHE A CG    1 
ATOM   2525 C CD1   . PHE E 3 136 ? -5.831  -3.595  -18.766 1.00 34.03  ? 136  PHE A CD1   1 
ATOM   2526 C CD2   . PHE E 3 136 ? -4.260  -5.202  -17.934 1.00 31.42  ? 136  PHE A CD2   1 
ATOM   2527 C CE1   . PHE E 3 136 ? -5.271  -3.703  -20.038 1.00 33.56  ? 136  PHE A CE1   1 
ATOM   2528 C CE2   . PHE E 3 136 ? -3.695  -5.316  -19.203 1.00 32.57  ? 136  PHE A CE2   1 
ATOM   2529 C CZ    . PHE E 3 136 ? -4.200  -4.568  -20.254 1.00 30.98  ? 136  PHE A CZ    1 
ATOM   2530 N N     . LEU E 3 137 ? -6.363  -2.727  -13.405 1.00 29.64  ? 137  LEU A N     1 
ATOM   2531 C CA    . LEU E 3 137 ? -7.002  -2.903  -12.103 1.00 30.46  ? 137  LEU A CA    1 
ATOM   2532 C C     . LEU E 3 137 ? -7.360  -1.637  -11.338 1.00 32.62  ? 137  LEU A C     1 
ATOM   2533 O O     . LEU E 3 137 ? -6.611  -0.652  -11.346 1.00 30.91  ? 137  LEU A O     1 
ATOM   2534 C CB    . LEU E 3 137 ? -6.109  -3.770  -11.203 1.00 31.84  ? 137  LEU A CB    1 
ATOM   2535 C CG    . LEU E 3 137 ? -5.927  -5.253  -11.542 1.00 33.11  ? 137  LEU A CG    1 
ATOM   2536 C CD1   . LEU E 3 137 ? -4.915  -5.879  -10.595 1.00 30.88  ? 137  LEU A CD1   1 
ATOM   2537 C CD2   . LEU E 3 137 ? -7.266  -5.971  -11.425 1.00 34.15  ? 137  LEU A CD2   1 
ATOM   2538 N N     . ASP E 3 138 ? -8.511  -1.668  -10.668 1.00 31.29  ? 138  ASP A N     1 
ATOM   2539 C CA    . ASP E 3 138 ? -8.919  -0.531  -9.861  1.00 31.76  ? 138  ASP A CA    1 
ATOM   2540 C C     . ASP E 3 138 ? -8.078  -0.661  -8.588  1.00 29.65  ? 138  ASP A C     1 
ATOM   2541 O O     . ASP E 3 138 ? -7.414  -1.686  -8.389  1.00 27.71  ? 138  ASP A O     1 
ATOM   2542 C CB    . ASP E 3 138 ? -10.434 -0.576  -9.571  1.00 34.59  ? 138  ASP A CB    1 
ATOM   2543 C CG    . ASP E 3 138 ? -10.863 -1.805  -8.769  1.00 41.17  ? 138  ASP A CG    1 
ATOM   2544 O OD1   . ASP E 3 138 ? -12.076 -2.123  -8.775  1.00 44.51  ? 138  ASP A OD1   1 
ATOM   2545 O OD2   . ASP E 3 138 ? -10.010 -2.448  -8.122  1.00 43.40  ? 138  ASP A OD2   1 
ATOM   2546 N N     . VAL E 3 139 ? -8.096  0.351   -7.731  1.00 26.42  ? 139  VAL A N     1 
ATOM   2547 C CA    . VAL E 3 139 ? -7.279  0.318   -6.524  1.00 25.82  ? 139  VAL A CA    1 
ATOM   2548 C C     . VAL E 3 139 ? -7.580  -0.858  -5.596  1.00 26.20  ? 139  VAL A C     1 
ATOM   2549 O O     . VAL E 3 139 ? -6.665  -1.428  -5.004  1.00 23.79  ? 139  VAL A O     1 
ATOM   2550 C CB    . VAL E 3 139 ? -7.385  1.657   -5.747  1.00 29.57  ? 139  VAL A CB    1 
ATOM   2551 C CG1   . VAL E 3 139 ? -6.505  1.613   -4.495  1.00 28.04  ? 139  VAL A CG1   1 
ATOM   2552 C CG2   . VAL E 3 139 ? -6.939  2.812   -6.647  1.00 26.15  ? 139  VAL A CG2   1 
ATOM   2553 N N     . THR E 3 140 ? -8.844  -1.247  -5.480  1.00 26.58  ? 140  THR A N     1 
ATOM   2554 C CA    . THR E 3 140 ? -9.188  -2.373  -4.620  1.00 28.23  ? 140  THR A CA    1 
ATOM   2555 C C     . THR E 3 140 ? -8.483  -3.641  -5.115  1.00 27.85  ? 140  THR A C     1 
ATOM   2556 O O     . THR E 3 140 ? -7.927  -4.404  -4.327  1.00 28.13  ? 140  THR A O     1 
ATOM   2557 C CB    . THR E 3 140 ? -10.710 -2.607  -4.589  1.00 31.52  ? 140  THR A CB    1 
ATOM   2558 O OG1   . THR E 3 140 ? -11.345 -1.498  -3.942  1.00 33.30  ? 140  THR A OG1   1 
ATOM   2559 C CG2   . THR E 3 140 ? -11.040 -3.882  -3.834  1.00 31.71  ? 140  THR A CG2   1 
ATOM   2560 N N     . GLY E 3 141 ? -8.504  -3.858  -6.426  1.00 26.97  ? 141  GLY A N     1 
ATOM   2561 C CA    . GLY E 3 141 ? -7.836  -5.018  -6.979  1.00 24.89  ? 141  GLY A CA    1 
ATOM   2562 C C     . GLY E 3 141 ? -6.320  -4.951  -6.790  1.00 24.40  ? 141  GLY A C     1 
ATOM   2563 O O     . GLY E 3 141 ? -5.695  -5.954  -6.494  1.00 25.69  ? 141  GLY A O     1 
ATOM   2564 N N     . ARG E 3 142 ? -5.721  -3.773  -6.951  1.00 23.67  ? 142  ARG A N     1 
ATOM   2565 C CA    . ARG E 3 142 ? -4.277  -3.649  -6.797  1.00 24.27  ? 142  ARG A CA    1 
ATOM   2566 C C     . ARG E 3 142 ? -3.831  -3.906  -5.363  1.00 23.96  ? 142  ARG A C     1 
ATOM   2567 O O     . ARG E 3 142 ? -2.846  -4.610  -5.128  1.00 22.83  ? 142  ARG A O     1 
ATOM   2568 C CB    . ARG E 3 142 ? -3.806  -2.263  -7.257  1.00 25.17  ? 142  ARG A CB    1 
ATOM   2569 C CG    . ARG E 3 142 ? -4.173  -1.968  -8.702  1.00 26.69  ? 142  ARG A CG    1 
ATOM   2570 C CD    . ARG E 3 142 ? -3.163  -1.060  -9.383  1.00 27.48  ? 142  ARG A CD    1 
ATOM   2571 N NE    . ARG E 3 142 ? -3.145  0.312   -8.883  1.00 27.53  ? 142  ARG A NE    1 
ATOM   2572 C CZ    . ARG E 3 142 ? -4.016  1.253   -9.238  1.00 29.11  ? 142  ARG A CZ    1 
ATOM   2573 N NH1   . ARG E 3 142 ? -4.987  0.967   -10.087 1.00 28.87  ? 142  ARG A NH1   1 
ATOM   2574 N NH2   . ARG E 3 142 ? -3.888  2.495   -8.781  1.00 26.60  ? 142  ARG A NH2   1 
ATOM   2575 N N     . ILE E 3 143 ? -4.558  -3.333  -4.406  1.00 21.38  ? 143  ILE A N     1 
ATOM   2576 C CA    . ILE E 3 143 ? -4.243  -3.519  -2.997  1.00 23.53  ? 143  ILE A CA    1 
ATOM   2577 C C     . ILE E 3 143 ? -4.433  -4.978  -2.599  1.00 25.16  ? 143  ILE A C     1 
ATOM   2578 O O     . ILE E 3 143 ? -3.614  -5.540  -1.868  1.00 27.20  ? 143  ILE A O     1 
ATOM   2579 C CB    . ILE E 3 143 ? -5.134  -2.626  -2.090  1.00 23.16  ? 143  ILE A CB    1 
ATOM   2580 C CG1   . ILE E 3 143 ? -4.732  -1.151  -2.244  1.00 23.76  ? 143  ILE A CG1   1 
ATOM   2581 C CG2   . ILE E 3 143 ? -4.983  -3.043  -0.622  1.00 24.52  ? 143  ILE A CG2   1 
ATOM   2582 C CD1   . ILE E 3 143 ? -5.608  -0.188  -1.414  1.00 24.73  ? 143  ILE A CD1   1 
ATOM   2583 N N     . ALA E 3 144 ? -5.513  -5.591  -3.077  1.00 27.34  ? 144  ALA A N     1 
ATOM   2584 C CA    . ALA E 3 144 ? -5.787  -6.991  -2.754  1.00 29.68  ? 144  ALA A CA    1 
ATOM   2585 C C     . ALA E 3 144 ? -4.629  -7.884  -3.194  1.00 30.29  ? 144  ALA A C     1 
ATOM   2586 O O     . ALA E 3 144 ? -4.207  -8.765  -2.456  1.00 31.22  ? 144  ALA A O     1 
ATOM   2587 C CB    . ALA E 3 144 ? -7.077  -7.448  -3.429  1.00 26.89  ? 144  ALA A CB    1 
ATOM   2588 N N     . GLN E 3 145 ? -4.127  -7.648  -4.403  1.00 31.98  ? 145  GLN A N     1 
ATOM   2589 C CA    . GLN E 3 145 ? -3.025  -8.431  -4.949  1.00 33.10  ? 145  GLN A CA    1 
ATOM   2590 C C     . GLN E 3 145 ? -1.716  -8.148  -4.217  1.00 32.77  ? 145  GLN A C     1 
ATOM   2591 O O     . GLN E 3 145 ? -0.911  -9.051  -3.987  1.00 31.92  ? 145  GLN A O     1 
ATOM   2592 C CB    . GLN E 3 145 ? -2.846  -8.121  -6.439  1.00 38.35  ? 145  GLN A CB    1 
ATOM   2593 C CG    . GLN E 3 145 ? -1.640  -8.803  -7.061  1.00 45.56  ? 145  GLN A CG    1 
ATOM   2594 C CD    . GLN E 3 145 ? -1.348  -8.315  -8.466  1.00 50.91  ? 145  GLN A CD    1 
ATOM   2595 O OE1   . GLN E 3 145 ? -2.176  -8.451  -9.368  1.00 53.03  ? 145  GLN A OE1   1 
ATOM   2596 N NE2   . GLN E 3 145 ? -0.161  -7.739  -8.660  1.00 54.40  ? 145  GLN A NE2   1 
ATOM   2597 N N     . THR E 3 146 ? -1.495  -6.888  -3.872  1.00 29.07  ? 146  THR A N     1 
ATOM   2598 C CA    . THR E 3 146 ? -0.287  -6.509  -3.166  1.00 27.75  ? 146  THR A CA    1 
ATOM   2599 C C     . THR E 3 146 ? -0.266  -7.156  -1.772  1.00 27.09  ? 146  THR A C     1 
ATOM   2600 O O     . THR E 3 146 ? 0.772   -7.641  -1.333  1.00 26.78  ? 146  THR A O     1 
ATOM   2601 C CB    . THR E 3 146 ? -0.184  -4.967  -3.035  1.00 26.84  ? 146  THR A CB    1 
ATOM   2602 O OG1   . THR E 3 146 ? -0.068  -4.387  -4.340  1.00 26.20  ? 146  THR A OG1   1 
ATOM   2603 C CG2   . THR E 3 146 ? 1.025   -4.574  -2.192  1.00 25.31  ? 146  THR A CG2   1 
ATOM   2604 N N     . LEU E 3 147 ? -1.404  -7.172  -1.080  1.00 26.74  ? 147  LEU A N     1 
ATOM   2605 C CA    . LEU E 3 147 ? -1.452  -7.787  0.247   1.00 28.06  ? 147  LEU A CA    1 
ATOM   2606 C C     . LEU E 3 147 ? -1.145  -9.289  0.181   1.00 30.29  ? 147  LEU A C     1 
ATOM   2607 O O     . LEU E 3 147 ? -0.450  -9.829  1.049   1.00 30.54  ? 147  LEU A O     1 
ATOM   2608 C CB    . LEU E 3 147 ? -2.820  -7.563  0.908   1.00 29.05  ? 147  LEU A CB    1 
ATOM   2609 C CG    . LEU E 3 147 ? -3.183  -6.128  1.327   1.00 30.90  ? 147  LEU A CG    1 
ATOM   2610 C CD1   . LEU E 3 147 ? -4.568  -6.110  1.940   1.00 31.98  ? 147  LEU A CD1   1 
ATOM   2611 C CD2   . LEU E 3 147 ? -2.162  -5.597  2.320   1.00 30.19  ? 147  LEU A CD2   1 
ATOM   2612 N N     . LEU E 3 148 ? -1.661  -9.970  -0.842  1.00 31.66  ? 148  LEU A N     1 
ATOM   2613 C CA    . LEU E 3 148 ? -1.399  -11.407 -0.983  1.00 33.02  ? 148  LEU A CA    1 
ATOM   2614 C C     . LEU E 3 148 ? 0.073   -11.668 -1.288  1.00 32.90  ? 148  LEU A C     1 
ATOM   2615 O O     . LEU E 3 148 ? 0.668   -12.614 -0.767  1.00 32.27  ? 148  LEU A O     1 
ATOM   2616 C CB    . LEU E 3 148 ? -2.247  -12.012 -2.099  1.00 32.46  ? 148  LEU A CB    1 
ATOM   2617 C CG    . LEU E 3 148 ? -3.707  -12.276 -1.767  1.00 37.03  ? 148  LEU A CG    1 
ATOM   2618 C CD1   . LEU E 3 148 ? -4.446  -12.659 -3.041  1.00 38.82  ? 148  LEU A CD1   1 
ATOM   2619 C CD2   . LEU E 3 148 ? -3.804  -13.389 -0.714  1.00 36.50  ? 148  LEU A CD2   1 
ATOM   2620 N N     . ASN E 3 149 ? 0.657   -10.823 -2.128  1.00 31.27  ? 149  ASN A N     1 
ATOM   2621 C CA    . ASN E 3 149 ? 2.057   -10.983 -2.499  1.00 33.92  ? 149  ASN A CA    1 
ATOM   2622 C C     . ASN E 3 149 ? 3.023   -10.804 -1.327  1.00 33.22  ? 149  ASN A C     1 
ATOM   2623 O O     . ASN E 3 149 ? 3.966   -11.586 -1.163  1.00 32.70  ? 149  ASN A O     1 
ATOM   2624 C CB    . ASN E 3 149 ? 2.410   -10.012 -3.630  1.00 35.98  ? 149  ASN A CB    1 
ATOM   2625 C CG    . ASN E 3 149 ? 3.873   -10.066 -4.000  1.00 42.80  ? 149  ASN A CG    1 
ATOM   2626 O OD1   . ASN E 3 149 ? 4.656   -9.180  -3.634  1.00 47.19  ? 149  ASN A OD1   1 
ATOM   2627 N ND2   . ASN E 3 149 ? 4.262   -11.117 -4.720  1.00 43.66  ? 149  ASN A ND2   1 
ATOM   2628 N N     . LEU E 3 150 ? 2.793   -9.777  -0.514  1.00 31.44  ? 150  LEU A N     1 
ATOM   2629 C CA    . LEU E 3 150 ? 3.649   -9.521  0.642   1.00 31.08  ? 150  LEU A CA    1 
ATOM   2630 C C     . LEU E 3 150 ? 3.527   -10.660 1.651   1.00 32.26  ? 150  LEU A C     1 
ATOM   2631 O O     . LEU E 3 150 ? 4.519   -11.097 2.234   1.00 30.42  ? 150  LEU A O     1 
ATOM   2632 C CB    . LEU E 3 150 ? 3.244   -8.212  1.321   1.00 31.23  ? 150  LEU A CB    1 
ATOM   2633 C CG    . LEU E 3 150 ? 3.559   -6.917  0.572   1.00 33.30  ? 150  LEU A CG    1 
ATOM   2634 C CD1   . LEU E 3 150 ? 2.836   -5.745  1.226   1.00 32.86  ? 150  LEU A CD1   1 
ATOM   2635 C CD2   . LEU E 3 150 ? 5.068   -6.702  0.571   1.00 33.75  ? 150  LEU A CD2   1 
ATOM   2636 N N     . ALA E 3 151 ? 2.295   -11.130 1.842   1.00 31.91  ? 151  ALA A N     1 
ATOM   2637 C CA    . ALA E 3 151 ? 1.993   -12.202 2.786   1.00 32.13  ? 151  ALA A CA    1 
ATOM   2638 C C     . ALA E 3 151 ? 2.712   -13.505 2.458   1.00 34.26  ? 151  ALA A C     1 
ATOM   2639 O O     . ALA E 3 151 ? 2.818   -14.390 3.311   1.00 34.78  ? 151  ALA A O     1 
ATOM   2640 C CB    . ALA E 3 151 ? 0.486   -12.444 2.820   1.00 27.76  ? 151  ALA A CB    1 
ATOM   2641 N N     . LYS E 3 152 ? 3.204   -13.630 1.229   1.00 34.79  ? 152  LYS A N     1 
ATOM   2642 C CA    . LYS E 3 152 ? 3.890   -14.851 0.826   1.00 37.33  ? 152  LYS A CA    1 
ATOM   2643 C C     . LYS E 3 152 ? 5.403   -14.719 0.702   1.00 38.63  ? 152  LYS A C     1 
ATOM   2644 O O     . LYS E 3 152 ? 6.068   -15.642 0.244   1.00 39.62  ? 152  LYS A O     1 
ATOM   2645 C CB    . LYS E 3 152 ? 3.307   -15.371 -0.489  1.00 38.76  ? 152  LYS A CB    1 
ATOM   2646 C CG    . LYS E 3 152 ? 1.839   -15.757 -0.385  1.00 43.35  ? 152  LYS A CG    1 
ATOM   2647 C CD    . LYS E 3 152 ? 1.317   -16.314 -1.700  1.00 47.73  ? 152  LYS A CD    1 
ATOM   2648 C CE    . LYS E 3 152 ? -0.199  -16.490 -1.671  1.00 50.71  ? 152  LYS A CE    1 
ATOM   2649 N NZ    . LYS E 3 152 ? -0.650  -17.422 -0.594  1.00 53.89  ? 152  LYS A NZ    1 
ATOM   2650 N N     . GLN E 3 153 ? 5.946   -13.579 1.114   1.00 40.54  ? 153  GLN A N     1 
ATOM   2651 C CA    . GLN E 3 153 ? 7.388   -13.363 1.059   1.00 43.49  ? 153  GLN A CA    1 
ATOM   2652 C C     . GLN E 3 153 ? 8.055   -14.018 2.278   1.00 44.62  ? 153  GLN A C     1 
ATOM   2653 O O     . GLN E 3 153 ? 7.387   -14.350 3.261   1.00 44.46  ? 153  GLN A O     1 
ATOM   2654 C CB    . GLN E 3 153 ? 7.695   -11.866 1.039   1.00 44.69  ? 153  GLN A CB    1 
ATOM   2655 C CG    . GLN E 3 153 ? 7.188   -11.138 -0.191  1.00 48.60  ? 153  GLN A CG    1 
ATOM   2656 C CD    . GLN E 3 153 ? 7.781   -11.678 -1.481  1.00 52.05  ? 153  GLN A CD    1 
ATOM   2657 O OE1   . GLN E 3 153 ? 7.306   -12.670 -2.036  1.00 52.67  ? 153  GLN A OE1   1 
ATOM   2658 N NE2   . GLN E 3 153 ? 8.839   -11.029 -1.959  1.00 55.46  ? 153  GLN A NE2   1 
ATOM   2659 N N     . PRO E 3 154 ? 9.384   -14.210 2.233   1.00 45.32  ? 154  PRO A N     1 
ATOM   2660 C CA    . PRO E 3 154 ? 10.076  -14.835 3.367   1.00 45.37  ? 154  PRO A CA    1 
ATOM   2661 C C     . PRO E 3 154 ? 10.107  -14.016 4.658   1.00 45.86  ? 154  PRO A C     1 
ATOM   2662 O O     . PRO E 3 154 ? 10.354  -14.566 5.731   1.00 46.99  ? 154  PRO A O     1 
ATOM   2663 C CB    . PRO E 3 154 ? 11.472  -15.118 2.808   1.00 44.94  ? 154  PRO A CB    1 
ATOM   2664 C CG    . PRO E 3 154 ? 11.667  -14.032 1.822   1.00 46.47  ? 154  PRO A CG    1 
ATOM   2665 C CD    . PRO E 3 154 ? 10.320  -13.960 1.123   1.00 45.79  ? 154  PRO A CD    1 
ATOM   2666 N N     . ASP E 3 155 ? 9.863   -12.710 4.573   1.00 44.33  ? 155  ASP A N     1 
ATOM   2667 C CA    . ASP E 3 155 ? 9.864   -11.903 5.788   1.00 43.42  ? 155  ASP A CA    1 
ATOM   2668 C C     . ASP E 3 155 ? 8.479   -11.883 6.431   1.00 41.91  ? 155  ASP A C     1 
ATOM   2669 O O     . ASP E 3 155 ? 8.295   -11.323 7.511   1.00 41.74  ? 155  ASP A O     1 
ATOM   2670 C CB    . ASP E 3 155 ? 10.354  -10.473 5.503   1.00 45.22  ? 155  ASP A CB    1 
ATOM   2671 C CG    . ASP E 3 155 ? 9.423   -9.690  4.586   1.00 47.67  ? 155  ASP A CG    1 
ATOM   2672 O OD1   . ASP E 3 155 ? 9.040   -10.207 3.510   1.00 46.92  ? 155  ASP A OD1   1 
ATOM   2673 O OD2   . ASP E 3 155 ? 9.088   -8.539  4.943   1.00 48.26  ? 155  ASP A OD2   1 
ATOM   2674 N N     . ALA E 3 156 ? 7.504   -12.507 5.772   1.00 39.02  ? 156  ALA A N     1 
ATOM   2675 C CA    . ALA E 3 156 ? 6.146   -12.552 6.310   1.00 36.94  ? 156  ALA A CA    1 
ATOM   2676 C C     . ALA E 3 156 ? 6.075   -13.573 7.448   1.00 35.78  ? 156  ALA A C     1 
ATOM   2677 O O     . ALA E 3 156 ? 6.768   -14.587 7.420   1.00 32.77  ? 156  ALA A O     1 
ATOM   2678 C CB    . ALA E 3 156 ? 5.161   -12.912 5.212   1.00 35.46  ? 156  ALA A CB    1 
ATOM   2679 N N     . MET E 3 157 ? 5.247   -13.296 8.451   1.00 34.76  ? 157  MET A N     1 
ATOM   2680 C CA    . MET E 3 157 ? 5.102   -14.191 9.595   1.00 36.05  ? 157  MET A CA    1 
ATOM   2681 C C     . MET E 3 157 ? 3.861   -15.071 9.485   1.00 35.72  ? 157  MET A C     1 
ATOM   2682 O O     . MET E 3 157 ? 2.832   -14.654 8.948   1.00 29.50  ? 157  MET A O     1 
ATOM   2683 C CB    . MET E 3 157 ? 5.000   -13.391 10.893  1.00 39.41  ? 157  MET A CB    1 
ATOM   2684 C CG    . MET E 3 157 ? 6.247   -12.636 11.291  1.00 45.99  ? 157  MET A CG    1 
ATOM   2685 S SD    . MET E 3 157 ? 5.938   -11.678 12.790  1.00 53.74  ? 157  MET A SD    1 
ATOM   2686 C CE    . MET E 3 157 ? 5.831   -13.004 14.007  1.00 51.63  ? 157  MET A CE    1 
ATOM   2687 N N     . THR E 3 158 ? 3.951   -16.284 10.023  1.00 35.44  ? 158  THR A N     1 
ATOM   2688 C CA    . THR E 3 158 ? 2.815   -17.195 9.984   1.00 37.18  ? 158  THR A CA    1 
ATOM   2689 C C     . THR E 3 158 ? 1.753   -16.714 10.968  1.00 36.91  ? 158  THR A C     1 
ATOM   2690 O O     . THR E 3 158 ? 2.044   -15.940 11.882  1.00 36.88  ? 158  THR A O     1 
ATOM   2691 C CB    . THR E 3 158 ? 3.220   -18.638 10.353  1.00 39.34  ? 158  THR A CB    1 
ATOM   2692 O OG1   . THR E 3 158 ? 2.109   -19.510 10.118  1.00 43.15  ? 158  THR A OG1   1 
ATOM   2693 C CG2   . THR E 3 158 ? 3.621   -18.728 11.819  1.00 35.71  ? 158  THR A CG2   1 
ATOM   2694 N N     . HIS E 3 159 ? 0.525   -17.177 10.773  1.00 36.79  ? 159  HIS A N     1 
ATOM   2695 C CA    . HIS E 3 159 ? -0.596  -16.796 11.623  1.00 35.52  ? 159  HIS A CA    1 
ATOM   2696 C C     . HIS E 3 159 ? -1.678  -17.870 11.486  1.00 35.95  ? 159  HIS A C     1 
ATOM   2697 O O     . HIS E 3 159 ? -1.882  -18.419 10.407  1.00 35.52  ? 159  HIS A O     1 
ATOM   2698 C CB    . HIS E 3 159 ? -1.119  -15.427 11.180  1.00 36.08  ? 159  HIS A CB    1 
ATOM   2699 C CG    . HIS E 3 159 ? -2.272  -14.918 11.989  1.00 36.33  ? 159  HIS A CG    1 
ATOM   2700 N ND1   . HIS E 3 159 ? -3.547  -15.430 11.877  1.00 37.81  ? 159  HIS A ND1   1 
ATOM   2701 C CD2   . HIS E 3 159 ? -2.339  -13.944 12.929  1.00 33.78  ? 159  HIS A CD2   1 
ATOM   2702 C CE1   . HIS E 3 159 ? -4.350  -14.796 12.713  1.00 36.60  ? 159  HIS A CE1   1 
ATOM   2703 N NE2   . HIS E 3 159 ? -3.642  -13.890 13.365  1.00 37.10  ? 159  HIS A NE2   1 
ATOM   2704 N N     . PRO E 3 160 ? -2.370  -18.204 12.587  1.00 37.31  ? 160  PRO A N     1 
ATOM   2705 C CA    . PRO E 3 160 ? -3.425  -19.228 12.543  1.00 37.97  ? 160  PRO A CA    1 
ATOM   2706 C C     . PRO E 3 160 ? -4.480  -19.042 11.446  1.00 40.55  ? 160  PRO A C     1 
ATOM   2707 O O     . PRO E 3 160 ? -5.052  -20.021 10.959  1.00 40.68  ? 160  PRO A O     1 
ATOM   2708 C CB    . PRO E 3 160 ? -4.026  -19.173 13.952  1.00 38.48  ? 160  PRO A CB    1 
ATOM   2709 C CG    . PRO E 3 160 ? -3.669  -17.771 14.442  1.00 38.97  ? 160  PRO A CG    1 
ATOM   2710 C CD    . PRO E 3 160 ? -2.264  -17.613 13.930  1.00 35.89  ? 160  PRO A CD    1 
ATOM   2711 N N     . ASP E 3 161 ? -4.728  -17.797 11.044  1.00 41.49  ? 161  ASP A N     1 
ATOM   2712 C CA    . ASP E 3 161 ? -5.727  -17.522 10.012  1.00 42.39  ? 161  ASP A CA    1 
ATOM   2713 C C     . ASP E 3 161 ? -5.175  -17.240 8.616   1.00 40.48  ? 161  ASP A C     1 
ATOM   2714 O O     . ASP E 3 161 ? -5.939  -16.981 7.691   1.00 40.71  ? 161  ASP A O     1 
ATOM   2715 C CB    . ASP E 3 161 ? -6.613  -16.351 10.440  1.00 46.18  ? 161  ASP A CB    1 
ATOM   2716 C CG    . ASP E 3 161 ? -7.394  -16.649 11.703  1.00 50.80  ? 161  ASP A CG    1 
ATOM   2717 O OD1   . ASP E 3 161 ? -6.884  -16.352 12.805  1.00 52.02  ? 161  ASP A OD1   1 
ATOM   2718 O OD2   . ASP E 3 161 ? -8.512  -17.198 11.590  1.00 52.04  ? 161  ASP A OD2   1 
ATOM   2719 N N     . GLY E 3 162 ? -3.857  -17.290 8.467   1.00 38.45  ? 162  GLY A N     1 
ATOM   2720 C CA    . GLY E 3 162 ? -3.247  -17.036 7.176   1.00 37.44  ? 162  GLY A CA    1 
ATOM   2721 C C     . GLY E 3 162 ? -1.813  -16.589 7.357   1.00 36.58  ? 162  GLY A C     1 
ATOM   2722 O O     . GLY E 3 162 ? -0.981  -17.349 7.847   1.00 37.10  ? 162  GLY A O     1 
ATOM   2723 N N     . MET E 3 163 ? -1.511  -15.359 6.960   1.00 35.80  ? 163  MET A N     1 
ATOM   2724 C CA    . MET E 3 163 ? -0.157  -14.829 7.116   1.00 35.84  ? 163  MET A CA    1 
ATOM   2725 C C     . MET E 3 163 ? -0.215  -13.393 7.634   1.00 35.12  ? 163  MET A C     1 
ATOM   2726 O O     . MET E 3 163 ? -1.180  -12.665 7.385   1.00 34.65  ? 163  MET A O     1 
ATOM   2727 C CB    . MET E 3 163 ? 0.603   -14.886 5.787   1.00 35.70  ? 163  MET A CB    1 
ATOM   2728 C CG    . MET E 3 163 ? 0.837   -16.306 5.232   1.00 37.39  ? 163  MET A CG    1 
ATOM   2729 S SD    . MET E 3 163 ? 2.043   -17.334 6.151   1.00 37.38  ? 163  MET A SD    1 
ATOM   2730 C CE    . MET E 3 163 ? 3.611   -16.595 5.639   1.00 39.11  ? 163  MET A CE    1 
ATOM   2731 N N     . GLN E 3 164 ? 0.827   -12.990 8.354   1.00 34.03  ? 164  GLN A N     1 
ATOM   2732 C CA    . GLN E 3 164 ? 0.893   -11.659 8.936   1.00 33.28  ? 164  GLN A CA    1 
ATOM   2733 C C     . GLN E 3 164 ? 2.068   -10.846 8.387   1.00 33.30  ? 164  GLN A C     1 
ATOM   2734 O O     . GLN E 3 164 ? 3.179   -11.358 8.223   1.00 30.26  ? 164  GLN A O     1 
ATOM   2735 C CB    . GLN E 3 164 ? 1.021   -11.791 10.451  1.00 34.96  ? 164  GLN A CB    1 
ATOM   2736 C CG    . GLN E 3 164 ? 0.862   -10.503 11.225  1.00 37.32  ? 164  GLN A CG    1 
ATOM   2737 C CD    . GLN E 3 164 ? 0.997   -10.720 12.713  1.00 37.63  ? 164  GLN A CD    1 
ATOM   2738 O OE1   . GLN E 3 164 ? 2.081   -10.578 13.275  1.00 41.57  ? 164  GLN A OE1   1 
ATOM   2739 N NE2   . GLN E 3 164 ? -0.102  -11.087 13.359  1.00 38.64  ? 164  GLN A NE2   1 
ATOM   2740 N N     . ILE E 3 165 ? 1.807   -9.575  8.101   1.00 30.95  ? 165  ILE A N     1 
ATOM   2741 C CA    . ILE E 3 165 ? 2.829   -8.672  7.587   1.00 30.16  ? 165  ILE A CA    1 
ATOM   2742 C C     . ILE E 3 165 ? 2.759   -7.363  8.364   1.00 31.57  ? 165  ILE A C     1 
ATOM   2743 O O     . ILE E 3 165 ? 1.748   -7.063  9.004   1.00 28.80  ? 165  ILE A O     1 
ATOM   2744 C CB    . ILE E 3 165 ? 2.595   -8.320  6.107   1.00 29.53  ? 165  ILE A CB    1 
ATOM   2745 C CG1   . ILE E 3 165 ? 1.203   -7.693  5.947   1.00 28.28  ? 165  ILE A CG1   1 
ATOM   2746 C CG2   . ILE E 3 165 ? 2.753   -9.559  5.240   1.00 30.54  ? 165  ILE A CG2   1 
ATOM   2747 C CD1   . ILE E 3 165 ? 0.937   -7.102  4.582   1.00 25.45  ? 165  ILE A CD1   1 
ATOM   2748 N N     . LYS E 3 166 ? 3.834   -6.584  8.299   1.00 30.54  ? 166  LYS A N     1 
ATOM   2749 C CA    . LYS E 3 166 ? 3.873   -5.296  8.969   1.00 31.40  ? 166  LYS A CA    1 
ATOM   2750 C C     . LYS E 3 166 ? 4.249   -4.241  7.937   1.00 31.57  ? 166  LYS A C     1 
ATOM   2751 O O     . LYS E 3 166 ? 5.335   -4.278  7.361   1.00 32.30  ? 166  LYS A O     1 
ATOM   2752 C CB    . LYS E 3 166 ? 4.868   -5.338  10.130  1.00 34.55  ? 166  LYS A CB    1 
ATOM   2753 C CG    . LYS E 3 166 ? 4.360   -6.218  11.278  1.00 38.82  ? 166  LYS A CG    1 
ATOM   2754 C CD    . LYS E 3 166 ? 5.407   -6.491  12.346  1.00 44.58  ? 166  LYS A CD    1 
ATOM   2755 C CE    . LYS E 3 166 ? 5.738   -5.255  13.152  1.00 46.19  ? 166  LYS A CE    1 
ATOM   2756 N NZ    . LYS E 3 166 ? 6.759   -5.576  14.191  1.00 49.18  ? 166  LYS A NZ    1 
ATOM   2757 N N     . ILE E 3 167 ? 3.322   -3.320  7.687   1.00 30.66  ? 167  ILE A N     1 
ATOM   2758 C CA    . ILE E 3 167 ? 3.518   -2.258  6.702   1.00 30.01  ? 167  ILE A CA    1 
ATOM   2759 C C     . ILE E 3 167 ? 2.495   -1.137  6.927   1.00 28.95  ? 167  ILE A C     1 
ATOM   2760 O O     . ILE E 3 167 ? 1.399   -1.373  7.434   1.00 29.60  ? 167  ILE A O     1 
ATOM   2761 C CB    . ILE E 3 167 ? 3.358   -2.829  5.257   1.00 28.78  ? 167  ILE A CB    1 
ATOM   2762 C CG1   . ILE E 3 167 ? 3.676   -1.768  4.210   1.00 28.01  ? 167  ILE A CG1   1 
ATOM   2763 C CG2   . ILE E 3 167 ? 1.927   -3.318  5.043   1.00 29.43  ? 167  ILE A CG2   1 
ATOM   2764 C CD1   . ILE E 3 167 ? 3.583   -2.301  2.781   1.00 26.84  ? 167  ILE A CD1   1 
ATOM   2765 N N     . THR E 3 168 ? 2.847   0.083   6.541   1.00 27.09  ? 168  THR A N     1 
ATOM   2766 C CA    . THR E 3 168 ? 1.943   1.209   6.717   1.00 26.31  ? 168  THR A CA    1 
ATOM   2767 C C     . THR E 3 168 ? 1.023   1.437   5.515   1.00 27.28  ? 168  THR A C     1 
ATOM   2768 O O     . THR E 3 168 ? 1.296   0.977   4.396   1.00 24.08  ? 168  THR A O     1 
ATOM   2769 C CB    . THR E 3 168 ? 2.734   2.500   6.963   1.00 28.25  ? 168  THR A CB    1 
ATOM   2770 O OG1   . THR E 3 168 ? 3.573   2.756   5.833   1.00 27.34  ? 168  THR A OG1   1 
ATOM   2771 C CG2   . THR E 3 168 ? 3.601   2.378   8.226   1.00 27.21  ? 168  THR A CG2   1 
ATOM   2772 N N     . ARG E 3 169 ? -0.078  2.145   5.756   1.00 25.70  ? 169  ARG A N     1 
ATOM   2773 C CA    . ARG E 3 169 ? -1.026  2.475   4.696   1.00 24.72  ? 169  ARG A CA    1 
ATOM   2774 C C     . ARG E 3 169 ? -0.325  3.384   3.683   1.00 23.93  ? 169  ARG A C     1 
ATOM   2775 O O     . ARG E 3 169 ? -0.576  3.296   2.480   1.00 24.88  ? 169  ARG A O     1 
ATOM   2776 C CB    . ARG E 3 169 ? -2.275  3.160   5.300   1.00 26.15  ? 169  ARG A CB    1 
ATOM   2777 C CG    . ARG E 3 169 ? -3.160  2.173   6.079   1.00 26.71  ? 169  ARG A CG    1 
ATOM   2778 C CD    . ARG E 3 169 ? -3.821  2.770   7.323   1.00 27.65  ? 169  ARG A CD    1 
ATOM   2779 N NE    . ARG E 3 169 ? -4.449  1.714   8.112   1.00 29.68  ? 169  ARG A NE    1 
ATOM   2780 C CZ    . ARG E 3 169 ? -3.789  0.861   8.890   1.00 26.60  ? 169  ARG A CZ    1 
ATOM   2781 N NH1   . ARG E 3 169 ? -4.452  -0.075  9.552   1.00 29.65  ? 169  ARG A NH1   1 
ATOM   2782 N NH2   . ARG E 3 169 ? -2.475  0.962   9.036   1.00 27.25  ? 169  ARG A NH2   1 
ATOM   2783 N N     . GLN E 3 170 ? 0.566   4.247   4.164   1.00 22.63  ? 170  GLN A N     1 
ATOM   2784 C CA    . GLN E 3 170 ? 1.306   5.126   3.271   1.00 24.25  ? 170  GLN A CA    1 
ATOM   2785 C C     . GLN E 3 170 ? 2.180   4.305   2.310   1.00 23.51  ? 170  GLN A C     1 
ATOM   2786 O O     . GLN E 3 170 ? 2.188   4.563   1.111   1.00 23.96  ? 170  GLN A O     1 
ATOM   2787 C CB    . GLN E 3 170 ? 2.202   6.093   4.058   1.00 27.14  ? 170  GLN A CB    1 
ATOM   2788 C CG    . GLN E 3 170 ? 1.450   7.065   4.952   1.00 35.30  ? 170  GLN A CG    1 
ATOM   2789 C CD    . GLN E 3 170 ? 2.366   8.087   5.621   1.00 36.89  ? 170  GLN A CD    1 
ATOM   2790 O OE1   . GLN E 3 170 ? 3.498   7.776   6.008   1.00 39.68  ? 170  GLN A OE1   1 
ATOM   2791 N NE2   . GLN E 3 170 ? 1.871   9.305   5.774   1.00 37.68  ? 170  GLN A NE2   1 
ATOM   2792 N N     . GLU E 3 171 ? 2.903   3.309   2.825   1.00 22.28  ? 171  GLU A N     1 
ATOM   2793 C CA    . GLU E 3 171 ? 3.754   2.520   1.942   1.00 24.40  ? 171  GLU A CA    1 
ATOM   2794 C C     . GLU E 3 171 ? 2.928   1.720   0.940   1.00 22.36  ? 171  GLU A C     1 
ATOM   2795 O O     . GLU E 3 171 ? 3.337   1.561   -0.210  1.00 24.29  ? 171  GLU A O     1 
ATOM   2796 C CB    . GLU E 3 171 ? 4.689   1.591   2.731   1.00 27.37  ? 171  GLU A CB    1 
ATOM   2797 C CG    . GLU E 3 171 ? 5.891   1.161   1.890   1.00 31.67  ? 171  GLU A CG    1 
ATOM   2798 C CD    . GLU E 3 171 ? 6.985   0.468   2.679   1.00 37.19  ? 171  GLU A CD    1 
ATOM   2799 O OE1   . GLU E 3 171 ? 7.177   0.807   3.866   1.00 39.51  ? 171  GLU A OE1   1 
ATOM   2800 O OE2   . GLU E 3 171 ? 7.673   -0.403  2.101   1.00 35.22  ? 171  GLU A OE2   1 
ATOM   2801 N N     . ILE E 3 172 ? 1.771   1.215   1.364   1.00 23.20  ? 172  ILE A N     1 
ATOM   2802 C CA    . ILE E 3 172 ? 0.903   0.481   0.446   1.00 22.94  ? 172  ILE A CA    1 
ATOM   2803 C C     . ILE E 3 172 ? 0.511   1.436   -0.692  1.00 22.41  ? 172  ILE A C     1 
ATOM   2804 O O     . ILE E 3 172 ? 0.508   1.058   -1.865  1.00 25.23  ? 172  ILE A O     1 
ATOM   2805 C CB    . ILE E 3 172 ? -0.362  -0.045  1.171   1.00 24.89  ? 172  ILE A CB    1 
ATOM   2806 C CG1   . ILE E 3 172 ? 0.028   -1.214  2.084   1.00 24.95  ? 172  ILE A CG1   1 
ATOM   2807 C CG2   . ILE E 3 172 ? -1.418  -0.490  0.155   1.00 21.76  ? 172  ILE A CG2   1 
ATOM   2808 C CD1   . ILE E 3 172 ? -1.075  -1.653  3.042   1.00 27.24  ? 172  ILE A CD1   1 
ATOM   2809 N N     . GLY E 3 173 ? 0.204   2.683   -0.338  1.00 22.91  ? 173  GLY A N     1 
ATOM   2810 C CA    . GLY E 3 173 ? -0.158  3.681   -1.334  1.00 21.99  ? 173  GLY A CA    1 
ATOM   2811 C C     . GLY E 3 173 ? 0.993   3.959   -2.305  1.00 23.44  ? 173  GLY A C     1 
ATOM   2812 O O     . GLY E 3 173 ? 0.777   4.211   -3.499  1.00 21.74  ? 173  GLY A O     1 
ATOM   2813 N N     . GLN E 3 174 ? 2.225   3.896   -1.807  1.00 22.90  ? 174  GLN A N     1 
ATOM   2814 C CA    . GLN E 3 174 ? 3.390   4.128   -2.663  1.00 25.70  ? 174  GLN A CA    1 
ATOM   2815 C C     . GLN E 3 174 ? 3.654   2.949   -3.606  1.00 26.40  ? 174  GLN A C     1 
ATOM   2816 O O     . GLN E 3 174 ? 4.324   3.093   -4.629  1.00 26.44  ? 174  GLN A O     1 
ATOM   2817 C CB    . GLN E 3 174 ? 4.612   4.414   -1.800  1.00 26.96  ? 174  GLN A CB    1 
ATOM   2818 C CG    . GLN E 3 174 ? 4.392   5.604   -0.872  1.00 30.31  ? 174  GLN A CG    1 
ATOM   2819 C CD    . GLN E 3 174 ? 5.567   5.858   0.038   1.00 33.32  ? 174  GLN A CD    1 
ATOM   2820 O OE1   . GLN E 3 174 ? 6.110   4.932   0.639   1.00 37.41  ? 174  GLN A OE1   1 
ATOM   2821 N NE2   . GLN E 3 174 ? 5.961   7.118   0.159   1.00 34.74  ? 174  GLN A NE2   1 
ATOM   2822 N N     . ILE E 3 175 ? 3.127   1.780   -3.259  1.00 25.72  ? 175  ILE A N     1 
ATOM   2823 C CA    . ILE E 3 175 ? 3.283   0.596   -4.099  1.00 24.69  ? 175  ILE A CA    1 
ATOM   2824 C C     . ILE E 3 175 ? 2.177   0.551   -5.166  1.00 26.25  ? 175  ILE A C     1 
ATOM   2825 O O     . ILE E 3 175 ? 2.463   0.368   -6.354  1.00 24.02  ? 175  ILE A O     1 
ATOM   2826 C CB    . ILE E 3 175 ? 3.191   -0.709  -3.264  1.00 25.01  ? 175  ILE A CB    1 
ATOM   2827 C CG1   . ILE E 3 175 ? 4.346   -0.767  -2.256  1.00 24.76  ? 175  ILE A CG1   1 
ATOM   2828 C CG2   . ILE E 3 175 ? 3.189   -1.933  -4.192  1.00 25.01  ? 175  ILE A CG2   1 
ATOM   2829 C CD1   . ILE E 3 175 ? 4.293   -1.974  -1.304  1.00 23.63  ? 175  ILE A CD1   1 
ATOM   2830 N N     . VAL E 3 176 ? 0.922   0.721   -4.737  1.00 25.43  ? 176  VAL A N     1 
ATOM   2831 C CA    . VAL E 3 176 ? -0.229  0.654   -5.644  1.00 24.97  ? 176  VAL A CA    1 
ATOM   2832 C C     . VAL E 3 176 ? -0.556  1.923   -6.430  1.00 25.75  ? 176  VAL A C     1 
ATOM   2833 O O     . VAL E 3 176 ? -1.321  1.871   -7.399  1.00 25.21  ? 176  VAL A O     1 
ATOM   2834 C CB    . VAL E 3 176 ? -1.531  0.221   -4.885  1.00 24.39  ? 176  VAL A CB    1 
ATOM   2835 C CG1   . VAL E 3 176 ? -1.332  -1.142  -4.213  1.00 23.66  ? 176  VAL A CG1   1 
ATOM   2836 C CG2   . VAL E 3 176 ? -1.914  1.260   -3.856  1.00 21.99  ? 176  VAL A CG2   1 
ATOM   2837 N N     . GLY E 3 177 ? 0.020   3.054   -6.025  1.00 25.62  ? 177  GLY A N     1 
ATOM   2838 C CA    . GLY E 3 177 ? -0.260  4.307   -6.706  1.00 24.62  ? 177  GLY A CA    1 
ATOM   2839 C C     . GLY E 3 177 ? -1.573  4.986   -6.294  1.00 26.10  ? 177  GLY A C     1 
ATOM   2840 O O     . GLY E 3 177 ? -2.409  5.285   -7.138  1.00 27.48  ? 177  GLY A O     1 
ATOM   2841 N N     . CYS E 3 178 ? -1.791  5.202   -5.003  1.00 24.09  ? 178  CYS A N     1 
ATOM   2842 C CA    . CYS E 3 178 ? -3.009  5.894   -4.564  1.00 25.81  ? 178  CYS A CA    1 
ATOM   2843 C C     . CYS E 3 178 ? -2.705  6.615   -3.254  1.00 26.23  ? 178  CYS A C     1 
ATOM   2844 O O     . CYS E 3 178 ? -1.629  6.427   -2.679  1.00 25.26  ? 178  CYS A O     1 
ATOM   2845 C CB    . CYS E 3 178 ? -4.175  4.913   -4.359  1.00 22.98  ? 178  CYS A CB    1 
ATOM   2846 S SG    . CYS E 3 178 ? -4.024  3.841   -2.924  1.00 26.21  ? 178  CYS A SG    1 
ATOM   2847 N N     . SER E 3 179 ? -3.641  7.437   -2.786  1.00 25.95  ? 179  SER A N     1 
ATOM   2848 C CA    . SER E 3 179 ? -3.431  8.180   -1.545  1.00 24.41  ? 179  SER A CA    1 
ATOM   2849 C C     . SER E 3 179 ? -3.557  7.264   -0.336  1.00 24.87  ? 179  SER A C     1 
ATOM   2850 O O     . SER E 3 179 ? -4.224  6.219   -0.389  1.00 24.12  ? 179  SER A O     1 
ATOM   2851 C CB    . SER E 3 179 ? -4.449  9.321   -1.415  1.00 24.82  ? 179  SER A CB    1 
ATOM   2852 O OG    . SER E 3 179 ? -5.759  8.809   -1.226  1.00 27.30  ? 179  SER A OG    1 
ATOM   2853 N N     . ARG E 3 180 ? -2.918  7.662   0.757   1.00 24.20  ? 180  ARG A N     1 
ATOM   2854 C CA    . ARG E 3 180 ? -2.963  6.881   1.989   1.00 25.68  ? 180  ARG A CA    1 
ATOM   2855 C C     . ARG E 3 180 ? -4.393  6.814   2.532   1.00 26.46  ? 180  ARG A C     1 
ATOM   2856 O O     . ARG E 3 180 ? -4.734  5.876   3.247   1.00 26.56  ? 180  ARG A O     1 
ATOM   2857 C CB    . ARG E 3 180 ? -2.043  7.497   3.046   1.00 23.95  ? 180  ARG A CB    1 
ATOM   2858 C CG    . ARG E 3 180 ? -2.435  8.914   3.479   1.00 24.73  ? 180  ARG A CG    1 
ATOM   2859 C CD    . ARG E 3 180 ? -1.385  9.522   4.420   1.00 27.77  ? 180  ARG A CD    1 
ATOM   2860 N NE    . ARG E 3 180 ? -1.734  10.866  4.889   1.00 30.50  ? 180  ARG A NE    1 
ATOM   2861 C CZ    . ARG E 3 180 ? -2.640  11.128  5.826   1.00 29.59  ? 180  ARG A CZ    1 
ATOM   2862 N NH1   . ARG E 3 180 ? -3.298  10.134  6.402   1.00 26.11  ? 180  ARG A NH1   1 
ATOM   2863 N NH2   . ARG E 3 180 ? -2.884  12.386  6.193   1.00 27.23  ? 180  ARG A NH2   1 
ATOM   2864 N N     . GLU E 3 181 ? -5.219  7.810   2.200   1.00 27.28  ? 181  GLU A N     1 
ATOM   2865 C CA    . GLU E 3 181 ? -6.606  7.840   2.673   1.00 28.25  ? 181  GLU A CA    1 
ATOM   2866 C C     . GLU E 3 181 ? -7.420  6.745   1.991   1.00 27.87  ? 181  GLU A C     1 
ATOM   2867 O O     . GLU E 3 181 ? -8.223  6.065   2.631   1.00 27.20  ? 181  GLU A O     1 
ATOM   2868 C CB    . GLU E 3 181 ? -7.258  9.210   2.404   1.00 30.36  ? 181  GLU A CB    1 
ATOM   2869 C CG    . GLU E 3 181 ? -6.783  10.364  3.316   1.00 33.84  ? 181  GLU A CG    1 
ATOM   2870 C CD    . GLU E 3 181 ? -5.498  11.044  2.842   1.00 36.25  ? 181  GLU A CD    1 
ATOM   2871 O OE1   . GLU E 3 181 ? -5.056  12.002  3.515   1.00 36.73  ? 181  GLU A OE1   1 
ATOM   2872 O OE2   . GLU E 3 181 ? -4.928  10.631  1.808   1.00 35.74  ? 181  GLU A OE2   1 
ATOM   2873 N N     . THR E 3 182 ? -7.221  6.598   0.682   1.00 26.95  ? 182  THR A N     1 
ATOM   2874 C CA    . THR E 3 182 ? -7.909  5.572   -0.089  1.00 26.01  ? 182  THR A CA    1 
ATOM   2875 C C     . THR E 3 182 ? -7.506  4.183   0.444   1.00 26.36  ? 182  THR A C     1 
ATOM   2876 O O     . THR E 3 182 ? -8.359  3.306   0.628   1.00 27.72  ? 182  THR A O     1 
ATOM   2877 C CB    . THR E 3 182 ? -7.578  5.727   -1.598  1.00 27.78  ? 182  THR A CB    1 
ATOM   2878 O OG1   . THR E 3 182 ? -8.168  6.940   -2.073  1.00 25.62  ? 182  THR A OG1   1 
ATOM   2879 C CG2   . THR E 3 182 ? -8.123  4.559   -2.421  1.00 25.88  ? 182  THR A CG2   1 
ATOM   2880 N N     . VAL E 3 183 ? -6.217  3.986   0.720   1.00 24.36  ? 183  VAL A N     1 
ATOM   2881 C CA    . VAL E 3 183 ? -5.778  2.704   1.265   1.00 23.16  ? 183  VAL A CA    1 
ATOM   2882 C C     . VAL E 3 183 ? -6.520  2.422   2.577   1.00 25.14  ? 183  VAL A C     1 
ATOM   2883 O O     . VAL E 3 183 ? -7.063  1.332   2.781   1.00 23.20  ? 183  VAL A O     1 
ATOM   2884 C CB    . VAL E 3 183 ? -4.259  2.675   1.583   1.00 22.88  ? 183  VAL A CB    1 
ATOM   2885 C CG1   . VAL E 3 183 ? -3.903  1.320   2.204   1.00 21.72  ? 183  VAL A CG1   1 
ATOM   2886 C CG2   . VAL E 3 183 ? -3.430  2.908   0.311   1.00 21.14  ? 183  VAL A CG2   1 
ATOM   2887 N N     . GLY E 3 184 ? -6.519  3.409   3.471   1.00 25.37  ? 184  GLY A N     1 
ATOM   2888 C CA    . GLY E 3 184 ? -7.194  3.254   4.750   1.00 26.93  ? 184  GLY A CA    1 
ATOM   2889 C C     . GLY E 3 184 ? -8.673  2.893   4.633   1.00 28.46  ? 184  GLY A C     1 
ATOM   2890 O O     . GLY E 3 184 ? -9.179  2.071   5.399   1.00 28.15  ? 184  GLY A O     1 
ATOM   2891 N N     . ARG E 3 185 ? -9.367  3.514   3.682   1.00 29.30  ? 185  ARG A N     1 
ATOM   2892 C CA    . ARG E 3 185 ? -10.790 3.261   3.471   1.00 30.50  ? 185  ARG A CA    1 
ATOM   2893 C C     . ARG E 3 185 ? -11.050 1.885   2.885   1.00 32.88  ? 185  ARG A C     1 
ATOM   2894 O O     . ARG E 3 185 ? -12.080 1.264   3.162   1.00 34.55  ? 185  ARG A O     1 
ATOM   2895 C CB    . ARG E 3 185 ? -11.382 4.308   2.530   1.00 35.17  ? 185  ARG A CB    1 
ATOM   2896 C CG    . ARG E 3 185 ? -12.861 4.099   2.233   1.00 38.68  ? 185  ARG A CG    1 
ATOM   2897 C CD    . ARG E 3 185 ? -13.372 5.156   1.265   1.00 44.66  ? 185  ARG A CD    1 
ATOM   2898 N NE    . ARG E 3 185 ? -12.922 4.941   -0.111  1.00 48.77  ? 185  ARG A NE    1 
ATOM   2899 C CZ    . ARG E 3 185 ? -12.451 5.904   -0.899  1.00 50.77  ? 185  ARG A CZ    1 
ATOM   2900 N NH1   . ARG E 3 185 ? -12.073 5.627   -2.139  1.00 50.91  ? 185  ARG A NH1   1 
ATOM   2901 N NH2   . ARG E 3 185 ? -12.334 7.144   -0.439  1.00 53.08  ? 185  ARG A NH2   1 
ATOM   2902 N N     . ILE E 3 186 ? -10.131 1.412   2.054   1.00 32.01  ? 186  ILE A N     1 
ATOM   2903 C CA    . ILE E 3 186 ? -10.295 0.105   1.447   1.00 31.33  ? 186  ILE A CA    1 
ATOM   2904 C C     . ILE E 3 186 ? -9.944  -1.000  2.437   1.00 30.08  ? 186  ILE A C     1 
ATOM   2905 O O     . ILE E 3 186 ? -10.610 -2.034  2.466   1.00 28.76  ? 186  ILE A O     1 
ATOM   2906 C CB    . ILE E 3 186 ? -9.454  -0.007  0.146   1.00 32.09  ? 186  ILE A CB    1 
ATOM   2907 C CG1   . ILE E 3 186 ? -10.114 0.853   -0.938  1.00 32.46  ? 186  ILE A CG1   1 
ATOM   2908 C CG2   . ILE E 3 186 ? -9.341  -1.465  -0.301  1.00 30.98  ? 186  ILE A CG2   1 
ATOM   2909 C CD1   . ILE E 3 186 ? -9.342  0.963   -2.243  1.00 37.35  ? 186  ILE A CD1   1 
ATOM   2910 N N     . LEU E 3 187 ? -8.914  -0.789  3.255   1.00 29.83  ? 187  LEU A N     1 
ATOM   2911 C CA    . LEU E 3 187 ? -8.545  -1.807  4.238   1.00 31.53  ? 187  LEU A CA    1 
ATOM   2912 C C     . LEU E 3 187 ? -9.723  -2.043  5.194   1.00 33.75  ? 187  LEU A C     1 
ATOM   2913 O O     . LEU E 3 187 ? -9.968  -3.172  5.623   1.00 32.92  ? 187  LEU A O     1 
ATOM   2914 C CB    . LEU E 3 187 ? -7.293  -1.393  5.038   1.00 28.70  ? 187  LEU A CB    1 
ATOM   2915 C CG    . LEU E 3 187 ? -5.930  -1.398  4.316   1.00 29.27  ? 187  LEU A CG    1 
ATOM   2916 C CD1   . LEU E 3 187 ? -4.813  -1.167  5.323   1.00 23.67  ? 187  LEU A CD1   1 
ATOM   2917 C CD2   . LEU E 3 187 ? -5.699  -2.732  3.612   1.00 25.73  ? 187  LEU A CD2   1 
ATOM   2918 N N     . LYS E 3 188 ? -10.450 -0.979  5.527   1.00 35.71  ? 188  LYS A N     1 
ATOM   2919 C CA    . LYS E 3 188 ? -11.600 -1.118  6.415   1.00 40.00  ? 188  LYS A CA    1 
ATOM   2920 C C     . LYS E 3 188 ? -12.721 -1.879  5.713   1.00 39.31  ? 188  LYS A C     1 
ATOM   2921 O O     . LYS E 3 188 ? -13.421 -2.668  6.339   1.00 40.08  ? 188  LYS A O     1 
ATOM   2922 C CB    . LYS E 3 188 ? -12.120 0.246   6.884   1.00 41.55  ? 188  LYS A CB    1 
ATOM   2923 C CG    . LYS E 3 188 ? -13.175 0.125   7.991   1.00 48.69  ? 188  LYS A CG    1 
ATOM   2924 C CD    . LYS E 3 188 ? -12.596 -0.581  9.233   1.00 52.12  ? 188  LYS A CD    1 
ATOM   2925 C CE    . LYS E 3 188 ? -13.529 -1.663  9.794   1.00 53.60  ? 188  LYS A CE    1 
ATOM   2926 N NZ    . LYS E 3 188 ? -14.786 -1.126  10.400  1.00 55.76  ? 188  LYS A NZ    1 
ATOM   2927 N N     . MET E 3 189 ? -12.899 -1.646  4.417   1.00 39.68  ? 189  MET A N     1 
ATOM   2928 C CA    . MET E 3 189 ? -13.933 -2.364  3.677   1.00 40.26  ? 189  MET A CA    1 
ATOM   2929 C C     . MET E 3 189 ? -13.554 -3.841  3.584   1.00 39.80  ? 189  MET A C     1 
ATOM   2930 O O     . MET E 3 189 ? -14.407 -4.725  3.740   1.00 38.83  ? 189  MET A O     1 
ATOM   2931 C CB    . MET E 3 189 ? -14.118 -1.771  2.276   1.00 42.45  ? 189  MET A CB    1 
ATOM   2932 C CG    . MET E 3 189 ? -14.813 -0.411  2.284   1.00 47.30  ? 189  MET A CG    1 
ATOM   2933 S SD    . MET E 3 189 ? -15.061 0.327   0.643   1.00 51.75  ? 189  MET A SD    1 
ATOM   2934 C CE    . MET E 3 189 ? -13.603 1.349   0.535   1.00 49.98  ? 189  MET A CE    1 
ATOM   2935 N N     . LEU E 3 190 ? -12.274 -4.112  3.341   1.00 37.37  ? 190  LEU A N     1 
ATOM   2936 C CA    . LEU E 3 190 ? -11.814 -5.493  3.260   1.00 35.88  ? 190  LEU A CA    1 
ATOM   2937 C C     . LEU E 3 190 ? -12.031 -6.192  4.609   1.00 35.57  ? 190  LEU A C     1 
ATOM   2938 O O     . LEU E 3 190 ? -12.404 -7.369  4.657   1.00 35.58  ? 190  LEU A O     1 
ATOM   2939 C CB    . LEU E 3 190 ? -10.327 -5.552  2.851   1.00 33.41  ? 190  LEU A CB    1 
ATOM   2940 C CG    . LEU E 3 190 ? -9.988  -5.131  1.408   1.00 33.72  ? 190  LEU A CG    1 
ATOM   2941 C CD1   . LEU E 3 190 ? -8.488  -5.216  1.171   1.00 29.23  ? 190  LEU A CD1   1 
ATOM   2942 C CD2   . LEU E 3 190 ? -10.726 -6.029  0.412   1.00 33.89  ? 190  LEU A CD2   1 
ATOM   2943 N N     . GLU E 3 191 ? -11.809 -5.478  5.707   1.00 36.98  ? 191  GLU A N     1 
ATOM   2944 C CA    . GLU E 3 191 ? -12.007 -6.086  7.023   1.00 41.14  ? 191  GLU A CA    1 
ATOM   2945 C C     . GLU E 3 191 ? -13.498 -6.336  7.289   1.00 42.69  ? 191  GLU A C     1 
ATOM   2946 O O     . GLU E 3 191 ? -13.870 -7.330  7.913   1.00 42.39  ? 191  GLU A O     1 
ATOM   2947 C CB    . GLU E 3 191 ? -11.423 -5.210  8.133   1.00 41.86  ? 191  GLU A CB    1 
ATOM   2948 C CG    . GLU E 3 191 ? -11.448 -5.896  9.497   1.00 46.80  ? 191  GLU A CG    1 
ATOM   2949 C CD    . GLU E 3 191 ? -10.589 -5.202  10.539  1.00 49.31  ? 191  GLU A CD    1 
ATOM   2950 O OE1   . GLU E 3 191 ? -9.423  -4.870  10.239  1.00 50.85  ? 191  GLU A OE1   1 
ATOM   2951 O OE2   . GLU E 3 191 ? -11.074 -5.003  11.671  1.00 53.82  ? 191  GLU A OE2   1 
ATOM   2952 N N     . ASP E 3 192 ? -14.346 -5.430  6.814   1.00 43.51  ? 192  ASP A N     1 
ATOM   2953 C CA    . ASP E 3 192 ? -15.784 -5.578  6.991   1.00 46.17  ? 192  ASP A CA    1 
ATOM   2954 C C     . ASP E 3 192 ? -16.251 -6.819  6.227   1.00 46.24  ? 192  ASP A C     1 
ATOM   2955 O O     . ASP E 3 192 ? -17.157 -7.526  6.663   1.00 46.26  ? 192  ASP A O     1 
ATOM   2956 C CB    . ASP E 3 192 ? -16.506 -4.323  6.484   1.00 46.85  ? 192  ASP A CB    1 
ATOM   2957 C CG    . ASP E 3 192 ? -16.267 -3.111  7.373   1.00 50.05  ? 192  ASP A CG    1 
ATOM   2958 O OD1   . ASP E 3 192 ? -16.604 -1.983  6.953   1.00 51.89  ? 192  ASP A OD1   1 
ATOM   2959 O OD2   . ASP E 3 192 ? -15.749 -3.282  8.500   1.00 52.51  ? 192  ASP A OD2   1 
ATOM   2960 N N     . GLN E 3 193 ? -15.617 -7.078  5.086   1.00 48.17  ? 193  GLN A N     1 
ATOM   2961 C CA    . GLN E 3 193 ? -15.937 -8.238  4.256   1.00 47.23  ? 193  GLN A CA    1 
ATOM   2962 C C     . GLN E 3 193 ? -15.211 -9.456  4.818   1.00 47.10  ? 193  GLN A C     1 
ATOM   2963 O O     . GLN E 3 193 ? -15.153 -10.513 4.186   1.00 47.32  ? 193  GLN A O     1 
ATOM   2964 C CB    . GLN E 3 193 ? -15.484 -7.997  2.814   1.00 47.35  ? 193  GLN A CB    1 
ATOM   2965 C CG    . GLN E 3 193 ? -16.256 -6.913  2.089   1.00 49.43  ? 193  GLN A CG    1 
ATOM   2966 C CD    . GLN E 3 193 ? -15.625 -6.525  0.761   1.00 49.97  ? 193  GLN A CD    1 
ATOM   2967 O OE1   . GLN E 3 193 ? -15.310 -7.380  -0.068  1.00 51.66  ? 193  GLN A OE1   1 
ATOM   2968 N NE2   . GLN E 3 193 ? -15.446 -5.229  0.552   1.00 52.24  ? 193  GLN A NE2   1 
ATOM   2969 N N     . ASN E 3 194 ? -14.653 -9.289  6.012   1.00 46.56  ? 194  ASN A N     1 
ATOM   2970 C CA    . ASN E 3 194 ? -13.905 -10.344 6.684   1.00 47.21  ? 194  ASN A CA    1 
ATOM   2971 C C     . ASN E 3 194 ? -12.875 -11.060 5.807   1.00 45.02  ? 194  ASN A C     1 
ATOM   2972 O O     . ASN E 3 194 ? -12.808 -12.291 5.773   1.00 42.81  ? 194  ASN A O     1 
ATOM   2973 C CB    . ASN E 3 194 ? -14.873 -11.346 7.317   1.00 50.06  ? 194  ASN A CB    1 
ATOM   2974 C CG    . ASN E 3 194 ? -15.106 -11.059 8.785   1.00 52.49  ? 194  ASN A CG    1 
ATOM   2975 O OD1   . ASN E 3 194 ? -14.265 -11.377 9.627   1.00 54.80  ? 194  ASN A OD1   1 
ATOM   2976 N ND2   . ASN E 3 194 ? -16.236 -10.431 9.100   1.00 53.11  ? 194  ASN A ND2   1 
ATOM   2977 N N     . LEU E 3 195 ? -12.070 -10.269 5.102   1.00 42.59  ? 195  LEU A N     1 
ATOM   2978 C CA    . LEU E 3 195 ? -11.020 -10.804 4.241   1.00 39.40  ? 195  LEU A CA    1 
ATOM   2979 C C     . LEU E 3 195 ? -9.675  -10.575 4.920   1.00 37.43  ? 195  LEU A C     1 
ATOM   2980 O O     . LEU E 3 195 ? -8.694  -11.256 4.617   1.00 36.07  ? 195  LEU A O     1 
ATOM   2981 C CB    . LEU E 3 195 ? -11.044 -10.118 2.870   1.00 39.29  ? 195  LEU A CB    1 
ATOM   2982 C CG    . LEU E 3 195 ? -12.278 -10.406 2.002   1.00 40.33  ? 195  LEU A CG    1 
ATOM   2983 C CD1   . LEU E 3 195 ? -12.169 -9.684  0.654   1.00 37.98  ? 195  LEU A CD1   1 
ATOM   2984 C CD2   . LEU E 3 195 ? -12.390 -11.907 1.782   1.00 40.67  ? 195  LEU A CD2   1 
ATOM   2985 N N     . ILE E 3 196 ? -9.643  -9.612  5.840   1.00 35.20  ? 196  ILE A N     1 
ATOM   2986 C CA    . ILE E 3 196 ? -8.430  -9.285  6.585   1.00 36.16  ? 196  ILE A CA    1 
ATOM   2987 C C     . ILE E 3 196 ? -8.762  -8.685  7.950   1.00 38.17  ? 196  ILE A C     1 
ATOM   2988 O O     . ILE E 3 196 ? -9.918  -8.387  8.255   1.00 39.90  ? 196  ILE A O     1 
ATOM   2989 C CB    . ILE E 3 196 ? -7.555  -8.220  5.859   1.00 34.93  ? 196  ILE A CB    1 
ATOM   2990 C CG1   . ILE E 3 196 ? -8.248  -6.855  5.923   1.00 33.27  ? 196  ILE A CG1   1 
ATOM   2991 C CG2   . ILE E 3 196 ? -7.302  -8.624  4.416   1.00 35.23  ? 196  ILE A CG2   1 
ATOM   2992 C CD1   . ILE E 3 196 ? -7.396  -5.694  5.431   1.00 36.53  ? 196  ILE A CD1   1 
ATOM   2993 N N     . SER E 3 197 ? -7.725  -8.500  8.759   1.00 39.77  ? 197  SER A N     1 
ATOM   2994 C CA    . SER E 3 197 ? -7.853  -7.873  10.070  1.00 42.74  ? 197  SER A CA    1 
ATOM   2995 C C     . SER E 3 197 ? -6.637  -6.953  10.147  1.00 42.85  ? 197  SER A C     1 
ATOM   2996 O O     . SER E 3 197 ? -5.512  -7.381  9.883   1.00 42.25  ? 197  SER A O     1 
ATOM   2997 C CB    . SER E 3 197 ? -7.810  -8.915  11.194  1.00 44.51  ? 197  SER A CB    1 
ATOM   2998 O OG    . SER E 3 197 ? -6.559  -9.582  11.226  1.00 51.78  ? 197  SER A OG    1 
ATOM   2999 N N     . ALA E 3 198 ? -6.856  -5.688  10.485  1.00 42.75  ? 198  ALA A N     1 
ATOM   3000 C CA    . ALA E 3 198 ? -5.749  -4.745  10.557  1.00 44.04  ? 198  ALA A CA    1 
ATOM   3001 C C     . ALA E 3 198 ? -5.796  -3.828  11.771  1.00 45.00  ? 198  ALA A C     1 
ATOM   3002 O O     . ALA E 3 198 ? -6.797  -3.158  12.017  1.00 48.12  ? 198  ALA A O     1 
ATOM   3003 C CB    . ALA E 3 198 ? -5.704  -3.914  9.286   1.00 42.31  ? 198  ALA A CB    1 
ATOM   3004 N N     . HIS E 3 199 ? -4.704  -3.811  12.529  1.00 45.39  ? 199  HIS A N     1 
ATOM   3005 C CA    . HIS E 3 199 ? -4.588  -2.959  13.709  1.00 45.65  ? 199  HIS A CA    1 
ATOM   3006 C C     . HIS E 3 199 ? -3.185  -2.363  13.668  1.00 43.35  ? 199  HIS A C     1 
ATOM   3007 O O     . HIS E 3 199 ? -2.202  -3.072  13.879  1.00 43.05  ? 199  HIS A O     1 
ATOM   3008 C CB    . HIS E 3 199 ? -4.757  -3.775  14.993  1.00 49.32  ? 199  HIS A CB    1 
ATOM   3009 C CG    . HIS E 3 199 ? -5.956  -4.673  14.993  1.00 55.63  ? 199  HIS A CG    1 
ATOM   3010 N ND1   . HIS E 3 199 ? -7.153  -4.321  14.404  1.00 58.28  ? 199  HIS A ND1   1 
ATOM   3011 C CD2   . HIS E 3 199 ? -6.151  -5.898  15.539  1.00 57.69  ? 199  HIS A CD2   1 
ATOM   3012 C CE1   . HIS E 3 199 ? -8.033  -5.290  14.587  1.00 58.67  ? 199  HIS A CE1   1 
ATOM   3013 N NE2   . HIS E 3 199 ? -7.451  -6.258  15.274  1.00 58.89  ? 199  HIS A NE2   1 
ATOM   3014 N N     . GLY E 3 200 ? -3.091  -1.067  13.394  1.00 41.04  ? 200  GLY A N     1 
ATOM   3015 C CA    . GLY E 3 200 ? -1.786  -0.432  13.308  1.00 38.10  ? 200  GLY A CA    1 
ATOM   3016 C C     . GLY E 3 200 ? -1.082  -0.881  12.035  1.00 36.34  ? 200  GLY A C     1 
ATOM   3017 O O     . GLY E 3 200 ? -1.714  -0.977  10.988  1.00 35.40  ? 200  GLY A O     1 
ATOM   3018 N N     . LYS E 3 201 ? 0.220   -1.148  12.123  1.00 35.33  ? 201  LYS A N     1 
ATOM   3019 C CA    . LYS E 3 201 ? 1.003   -1.607  10.980  1.00 35.16  ? 201  LYS A CA    1 
ATOM   3020 C C     . LYS E 3 201 ? 0.828   -3.109  10.743  1.00 34.81  ? 201  LYS A C     1 
ATOM   3021 O O     . LYS E 3 201 ? 1.302   -3.637  9.732   1.00 35.88  ? 201  LYS A O     1 
ATOM   3022 C CB    . LYS E 3 201 ? 2.498   -1.342  11.197  1.00 34.26  ? 201  LYS A CB    1 
ATOM   3023 C CG    . LYS E 3 201 ? 2.903   0.103   11.151  1.00 35.85  ? 201  LYS A CG    1 
ATOM   3024 C CD    . LYS E 3 201 ? 4.397   0.276   11.394  1.00 38.59  ? 201  LYS A CD    1 
ATOM   3025 C CE    . LYS E 3 201 ? 5.228   -0.272  10.251  1.00 37.50  ? 201  LYS A CE    1 
ATOM   3026 N NZ    . LYS E 3 201 ? 6.660   0.053   10.464  1.00 41.87  ? 201  LYS A NZ    1 
ATOM   3027 N N     . THR E 3 202 ? 0.164   -3.790  11.673  1.00 33.85  ? 202  THR A N     1 
ATOM   3028 C CA    . THR E 3 202 ? -0.034  -5.233  11.573  1.00 33.91  ? 202  THR A CA    1 
ATOM   3029 C C     . THR E 3 202 ? -1.279  -5.610  10.801  1.00 33.65  ? 202  THR A C     1 
ATOM   3030 O O     . THR E 3 202 ? -2.395  -5.270  11.189  1.00 34.06  ? 202  THR A O     1 
ATOM   3031 C CB    . THR E 3 202 ? -0.114  -5.883  12.972  1.00 35.22  ? 202  THR A CB    1 
ATOM   3032 O OG1   . THR E 3 202 ? 1.122   -5.670  13.662  1.00 38.59  ? 202  THR A OG1   1 
ATOM   3033 C CG2   . THR E 3 202 ? -0.361  -7.383  12.856  1.00 35.15  ? 202  THR A CG2   1 
ATOM   3034 N N     . ILE E 3 203 ? -1.079  -6.321  9.698   1.00 32.13  ? 203  ILE A N     1 
ATOM   3035 C CA    . ILE E 3 203 ? -2.183  -6.749  8.858   1.00 31.89  ? 203  ILE A CA    1 
ATOM   3036 C C     . ILE E 3 203 ? -2.188  -8.265  8.691   1.00 32.40  ? 203  ILE A C     1 
ATOM   3037 O O     . ILE E 3 203 ? -1.165  -8.867  8.358   1.00 30.09  ? 203  ILE A O     1 
ATOM   3038 C CB    . ILE E 3 203 ? -2.082  -6.136  7.452   1.00 32.69  ? 203  ILE A CB    1 
ATOM   3039 C CG1   . ILE E 3 203 ? -2.081  -4.612  7.539   1.00 33.09  ? 203  ILE A CG1   1 
ATOM   3040 C CG2   . ILE E 3 203 ? -3.251  -6.613  6.597   1.00 33.29  ? 203  ILE A CG2   1 
ATOM   3041 C CD1   . ILE E 3 203 ? -1.861  -3.948  6.192   1.00 36.59  ? 203  ILE A CD1   1 
ATOM   3042 N N     . VAL E 3 204 ? -3.343  -8.876  8.915   1.00 31.53  ? 204  VAL A N     1 
ATOM   3043 C CA    . VAL E 3 204 ? -3.464  -10.315 8.746   1.00 31.72  ? 204  VAL A CA    1 
ATOM   3044 C C     . VAL E 3 204 ? -4.294  -10.571 7.500   1.00 31.58  ? 204  VAL A C     1 
ATOM   3045 O O     . VAL E 3 204 ? -5.430  -10.096 7.397   1.00 30.77  ? 204  VAL A O     1 
ATOM   3046 C CB    . VAL E 3 204 ? -4.180  -10.993 9.935   1.00 33.23  ? 204  VAL A CB    1 
ATOM   3047 C CG1   . VAL E 3 204 ? -4.180  -12.515 9.734   1.00 32.35  ? 204  VAL A CG1   1 
ATOM   3048 C CG2   . VAL E 3 204 ? -3.504  -10.622 11.242  1.00 31.65  ? 204  VAL A CG2   1 
ATOM   3049 N N     . VAL E 3 205 ? -3.719  -11.307 6.553   1.00 31.12  ? 205  VAL A N     1 
ATOM   3050 C CA    . VAL E 3 205 ? -4.405  -11.665 5.317   1.00 33.28  ? 205  VAL A CA    1 
ATOM   3051 C C     . VAL E 3 205 ? -4.990  -13.072 5.505   1.00 35.56  ? 205  VAL A C     1 
ATOM   3052 O O     . VAL E 3 205 ? -4.245  -14.040 5.720   1.00 35.40  ? 205  VAL A O     1 
ATOM   3053 C CB    . VAL E 3 205 ? -3.429  -11.666 4.120   1.00 32.03  ? 205  VAL A CB    1 
ATOM   3054 C CG1   . VAL E 3 205 ? -4.159  -12.049 2.854   1.00 33.77  ? 205  VAL A CG1   1 
ATOM   3055 C CG2   . VAL E 3 205 ? -2.802  -10.282 3.963   1.00 35.52  ? 205  VAL A CG2   1 
ATOM   3056 N N     . TYR E 3 206 ? -6.316  -13.184 5.435   1.00 37.04  ? 206  TYR A N     1 
ATOM   3057 C CA    . TYR E 3 206 ? -6.982  -14.478 5.619   1.00 40.66  ? 206  TYR A CA    1 
ATOM   3058 C C     . TYR E 3 206 ? -6.978  -15.357 4.376   1.00 42.79  ? 206  TYR A C     1 
ATOM   3059 O O     . TYR E 3 206 ? -6.700  -14.900 3.272   1.00 44.79  ? 206  TYR A O     1 
ATOM   3060 C CB    . TYR E 3 206 ? -8.446  -14.300 6.037   1.00 37.23  ? 206  TYR A CB    1 
ATOM   3061 C CG    . TYR E 3 206 ? -8.690  -13.527 7.307   1.00 38.47  ? 206  TYR A CG    1 
ATOM   3062 C CD1   . TYR E 3 206 ? -7.837  -13.644 8.405   1.00 37.70  ? 206  TYR A CD1   1 
ATOM   3063 C CD2   . TYR E 3 206 ? -9.820  -12.721 7.435   1.00 38.65  ? 206  TYR A CD2   1 
ATOM   3064 C CE1   . TYR E 3 206 ? -8.109  -12.976 9.602   1.00 38.41  ? 206  TYR A CE1   1 
ATOM   3065 C CE2   . TYR E 3 206 ? -10.103 -12.053 8.623   1.00 38.78  ? 206  TYR A CE2   1 
ATOM   3066 C CZ    . TYR E 3 206 ? -9.248  -12.182 9.700   1.00 38.44  ? 206  TYR A CZ    1 
ATOM   3067 O OH    . TYR E 3 206 ? -9.530  -11.504 10.865  1.00 38.45  ? 206  TYR A OH    1 
ATOM   3068 N N     . GLY E 3 207 ? -7.315  -16.627 4.578   1.00 47.28  ? 207  GLY A N     1 
ATOM   3069 C CA    . GLY E 3 207 ? -7.398  -17.580 3.484   1.00 47.99  ? 207  GLY A CA    1 
ATOM   3070 C C     . GLY E 3 207 ? -6.321  -17.480 2.429   1.00 50.09  ? 207  GLY A C     1 
ATOM   3071 O O     . GLY E 3 207 ? -6.612  -17.497 1.234   1.00 50.63  ? 207  GLY A O     1 
ATOM   3072 N N     . THR E 3 208 ? -5.073  -17.363 2.867   1.00 51.34  ? 208  THR A N     1 
ATOM   3073 C CA    . THR E 3 208 ? -3.943  -17.293 1.952   1.00 51.87  ? 208  THR A CA    1 
ATOM   3074 C C     . THR E 3 208 ? -3.426  -18.725 1.881   1.00 53.73  ? 208  THR A C     1 
ATOM   3075 O O     . THR E 3 208 ? -2.449  -19.036 1.190   1.00 53.52  ? 208  THR A O     1 
ATOM   3076 C CB    . THR E 3 208 ? -2.833  -16.397 2.513   1.00 52.64  ? 208  THR A CB    1 
ATOM   3077 O OG1   . THR E 3 208 ? -1.836  -16.191 1.508   1.00 55.97  ? 208  THR A OG1   1 
ATOM   3078 C CG2   . THR E 3 208 ? -2.187  -17.049 3.727   1.00 50.51  ? 208  THR A CG2   1 
ATOM   3079 N N     . ARG E 3 209 ? -4.122  -19.588 2.616   1.00 54.32  ? 209  ARG A N     1 
ATOM   3080 C CA    . ARG E 3 209 ? -3.799  -21.001 2.727   1.00 54.49  ? 209  ARG A CA    1 
ATOM   3081 C C     . ARG E 3 209 ? -5.109  -21.794 2.738   1.00 55.56  ? 209  ARG A C     1 
ATOM   3082 O O     . ARG E 3 209 ? -6.152  -21.177 3.049   1.00 55.81  ? 209  ARG A O     1 
ATOM   3083 C CB    . ARG E 3 209 ? -3.032  -21.212 4.037   1.00 53.68  ? 209  ARG A CB    1 
ATOM   3084 C CG    . ARG E 3 209 ? -2.643  -22.625 4.353   1.00 51.67  ? 209  ARG A CG    1 
ATOM   3085 C CD    . ARG E 3 209 ? -1.534  -22.674 5.404   1.00 49.39  ? 209  ARG A CD    1 
ATOM   3086 N NE    . ARG E 3 209 ? -1.928  -22.197 6.728   1.00 47.07  ? 209  ARG A NE    1 
ATOM   3087 C CZ    . ARG E 3 209 ? -1.784  -20.947 7.164   1.00 46.82  ? 209  ARG A CZ    1 
ATOM   3088 N NH1   . ARG E 3 209 ? -1.255  -20.019 6.377   1.00 45.85  ? 209  ARG A NH1   1 
ATOM   3089 N NH2   . ARG E 3 209 ? -2.142  -20.631 8.404   1.00 43.86  ? 209  ARG A NH2   1 
ATOM   3090 O OXT   . ARG E 3 209 ? -5.081  -23.013 2.453   1.00 55.27  ? 209  ARG A OXT   1 
ATOM   3091 N N     . ASP F 3 8   ? 31.099  -6.141  -38.478 1.00 74.69  ? 8    ASP B N     1 
ATOM   3092 C CA    . ASP F 3 8   ? 30.175  -6.846  -37.545 1.00 73.81  ? 8    ASP B CA    1 
ATOM   3093 C C     . ASP F 3 8   ? 30.376  -8.356  -37.645 1.00 72.58  ? 8    ASP B C     1 
ATOM   3094 O O     . ASP F 3 8   ? 29.440  -9.099  -37.941 1.00 72.49  ? 8    ASP B O     1 
ATOM   3095 C CB    . ASP F 3 8   ? 28.725  -6.499  -37.886 1.00 75.55  ? 8    ASP B CB    1 
ATOM   3096 C CG    . ASP F 3 8   ? 28.500  -5.004  -38.019 1.00 77.59  ? 8    ASP B CG    1 
ATOM   3097 O OD1   . ASP F 3 8   ? 28.789  -4.268  -37.049 1.00 79.14  ? 8    ASP B OD1   1 
ATOM   3098 O OD2   . ASP F 3 8   ? 28.035  -4.564  -39.094 1.00 77.70  ? 8    ASP B OD2   1 
ATOM   3099 N N     . PRO F 3 9   ? 31.607  -8.829  -37.394 1.00 71.02  ? 9    PRO B N     1 
ATOM   3100 C CA    . PRO F 3 9   ? 31.927  -10.257 -37.462 1.00 69.63  ? 9    PRO B CA    1 
ATOM   3101 C C     . PRO F 3 9   ? 31.019  -11.107 -36.581 1.00 68.66  ? 9    PRO B C     1 
ATOM   3102 O O     . PRO F 3 9   ? 30.496  -12.133 -37.017 1.00 68.38  ? 9    PRO B O     1 
ATOM   3103 C CB    . PRO F 3 9   ? 33.381  -10.305 -36.999 1.00 69.86  ? 9    PRO B CB    1 
ATOM   3104 C CG    . PRO F 3 9   ? 33.912  -8.974  -37.423 1.00 69.94  ? 9    PRO B CG    1 
ATOM   3105 C CD    . PRO F 3 9   ? 32.797  -8.049  -37.018 1.00 70.09  ? 9    PRO B CD    1 
ATOM   3106 N N     . THR F 3 10  ? 30.839  -10.674 -35.338 1.00 67.09  ? 10   THR B N     1 
ATOM   3107 C CA    . THR F 3 10  ? 30.002  -11.406 -34.400 1.00 66.68  ? 10   THR B CA    1 
ATOM   3108 C C     . THR F 3 10  ? 28.559  -11.490 -34.894 1.00 64.96  ? 10   THR B C     1 
ATOM   3109 O O     . THR F 3 10  ? 27.922  -12.540 -34.786 1.00 65.00  ? 10   THR B O     1 
ATOM   3110 C CB    . THR F 3 10  ? 30.029  -10.749 -33.004 1.00 67.11  ? 10   THR B CB    1 
ATOM   3111 O OG1   . THR F 3 10  ? 29.483  -9.429  -33.085 1.00 69.08  ? 10   THR B OG1   1 
ATOM   3112 C CG2   . THR F 3 10  ? 31.459  -10.666 -32.485 1.00 67.29  ? 10   THR B CG2   1 
ATOM   3113 N N     . LEU F 3 11  ? 28.048  -10.389 -35.438 1.00 62.96  ? 11   LEU B N     1 
ATOM   3114 C CA    . LEU F 3 11  ? 26.681  -10.365 -35.950 1.00 60.78  ? 11   LEU B CA    1 
ATOM   3115 C C     . LEU F 3 11  ? 26.523  -11.392 -37.068 1.00 59.73  ? 11   LEU B C     1 
ATOM   3116 O O     . LEU F 3 11  ? 25.541  -12.138 -37.098 1.00 58.93  ? 11   LEU B O     1 
ATOM   3117 C CB    . LEU F 3 11  ? 26.323  -8.971  -36.474 1.00 60.07  ? 11   LEU B CB    1 
ATOM   3118 C CG    . LEU F 3 11  ? 24.935  -8.830  -37.110 1.00 60.08  ? 11   LEU B CG    1 
ATOM   3119 C CD1   . LEU F 3 11  ? 23.860  -9.192  -36.093 1.00 60.67  ? 11   LEU B CD1   1 
ATOM   3120 C CD2   . LEU F 3 11  ? 24.739  -7.406  -37.607 1.00 58.85  ? 11   LEU B CD2   1 
ATOM   3121 N N     . GLU F 3 12  ? 27.484  -11.424 -37.989 1.00 57.78  ? 12   GLU B N     1 
ATOM   3122 C CA    . GLU F 3 12  ? 27.439  -12.384 -39.089 1.00 56.95  ? 12   GLU B CA    1 
ATOM   3123 C C     . GLU F 3 12  ? 27.564  -13.786 -38.520 1.00 54.05  ? 12   GLU B C     1 
ATOM   3124 O O     . GLU F 3 12  ? 26.868  -14.711 -38.941 1.00 53.94  ? 12   GLU B O     1 
ATOM   3125 C CB    . GLU F 3 12  ? 28.584  -12.152 -40.081 1.00 59.57  ? 12   GLU B CB    1 
ATOM   3126 C CG    . GLU F 3 12  ? 28.332  -11.066 -41.115 1.00 63.63  ? 12   GLU B CG    1 
ATOM   3127 C CD    . GLU F 3 12  ? 29.338  -11.112 -42.257 1.00 65.57  ? 12   GLU B CD    1 
ATOM   3128 O OE1   . GLU F 3 12  ? 29.278  -10.235 -43.146 1.00 66.65  ? 12   GLU B OE1   1 
ATOM   3129 O OE2   . GLU F 3 12  ? 30.188  -12.029 -42.267 1.00 66.91  ? 12   GLU B OE2   1 
ATOM   3130 N N     . TRP F 3 13  ? 28.464  -13.931 -37.556 1.00 51.25  ? 13   TRP B N     1 
ATOM   3131 C CA    . TRP F 3 13  ? 28.702  -15.213 -36.915 1.00 48.24  ? 13   TRP B CA    1 
ATOM   3132 C C     . TRP F 3 13  ? 27.438  -15.700 -36.208 1.00 46.13  ? 13   TRP B C     1 
ATOM   3133 O O     . TRP F 3 13  ? 27.087  -16.883 -36.274 1.00 45.39  ? 13   TRP B O     1 
ATOM   3134 C CB    . TRP F 3 13  ? 29.851  -15.078 -35.918 1.00 48.52  ? 13   TRP B CB    1 
ATOM   3135 C CG    . TRP F 3 13  ? 30.026  -16.266 -35.049 1.00 48.96  ? 13   TRP B CG    1 
ATOM   3136 C CD1   . TRP F 3 13  ? 30.491  -17.492 -35.416 1.00 49.88  ? 13   TRP B CD1   1 
ATOM   3137 C CD2   . TRP F 3 13  ? 29.702  -16.355 -33.661 1.00 50.21  ? 13   TRP B CD2   1 
ATOM   3138 N NE1   . TRP F 3 13  ? 30.479  -18.346 -34.338 1.00 50.43  ? 13   TRP B NE1   1 
ATOM   3139 C CE2   . TRP F 3 13  ? 29.996  -17.672 -33.248 1.00 49.94  ? 13   TRP B CE2   1 
ATOM   3140 C CE3   . TRP F 3 13  ? 29.186  -15.449 -32.723 1.00 49.43  ? 13   TRP B CE3   1 
ATOM   3141 C CZ2   . TRP F 3 13  ? 29.792  -18.106 -31.940 1.00 50.05  ? 13   TRP B CZ2   1 
ATOM   3142 C CZ3   . TRP F 3 13  ? 28.983  -15.879 -31.424 1.00 49.52  ? 13   TRP B CZ3   1 
ATOM   3143 C CH2   . TRP F 3 13  ? 29.286  -17.199 -31.044 1.00 50.27  ? 13   TRP B CH2   1 
ATOM   3144 N N     . PHE F 3 14  ? 26.756  -14.780 -35.537 1.00 43.77  ? 14   PHE B N     1 
ATOM   3145 C CA    . PHE F 3 14  ? 25.527  -15.108 -34.820 1.00 41.85  ? 14   PHE B CA    1 
ATOM   3146 C C     . PHE F 3 14  ? 24.421  -15.540 -35.783 1.00 39.75  ? 14   PHE B C     1 
ATOM   3147 O O     . PHE F 3 14  ? 23.776  -16.560 -35.578 1.00 38.19  ? 14   PHE B O     1 
ATOM   3148 C CB    . PHE F 3 14  ? 25.054  -13.897 -34.000 1.00 39.99  ? 14   PHE B CB    1 
ATOM   3149 C CG    . PHE F 3 14  ? 23.676  -14.062 -33.401 1.00 38.47  ? 14   PHE B CG    1 
ATOM   3150 C CD1   . PHE F 3 14  ? 23.414  -15.072 -32.484 1.00 37.57  ? 14   PHE B CD1   1 
ATOM   3151 C CD2   . PHE F 3 14  ? 22.638  -13.212 -33.771 1.00 39.46  ? 14   PHE B CD2   1 
ATOM   3152 C CE1   . PHE F 3 14  ? 22.134  -15.233 -31.947 1.00 38.75  ? 14   PHE B CE1   1 
ATOM   3153 C CE2   . PHE F 3 14  ? 21.354  -13.364 -33.241 1.00 36.90  ? 14   PHE B CE2   1 
ATOM   3154 C CZ    . PHE F 3 14  ? 21.103  -14.375 -32.329 1.00 37.24  ? 14   PHE B CZ    1 
ATOM   3155 N N     . LEU F 3 15  ? 24.208  -14.759 -36.834 1.00 39.86  ? 15   LEU B N     1 
ATOM   3156 C CA    . LEU F 3 15  ? 23.162  -15.066 -37.798 1.00 40.38  ? 15   LEU B CA    1 
ATOM   3157 C C     . LEU F 3 15  ? 23.371  -16.379 -38.540 1.00 41.34  ? 15   LEU B C     1 
ATOM   3158 O O     . LEU F 3 15  ? 22.402  -17.043 -38.903 1.00 42.19  ? 15   LEU B O     1 
ATOM   3159 C CB    . LEU F 3 15  ? 23.010  -13.915 -38.791 1.00 38.29  ? 15   LEU B CB    1 
ATOM   3160 C CG    . LEU F 3 15  ? 22.484  -12.626 -38.154 1.00 36.36  ? 15   LEU B CG    1 
ATOM   3161 C CD1   . LEU F 3 15  ? 22.533  -11.489 -39.156 1.00 36.12  ? 15   LEU B CD1   1 
ATOM   3162 C CD2   . LEU F 3 15  ? 21.060  -12.851 -37.652 1.00 36.54  ? 15   LEU B CD2   1 
ATOM   3163 N N     . SER F 3 16  ? 24.626  -16.768 -38.749 1.00 42.18  ? 16   SER B N     1 
ATOM   3164 C CA    . SER F 3 16  ? 24.921  -18.017 -39.451 1.00 41.11  ? 16   SER B CA    1 
ATOM   3165 C C     . SER F 3 16  ? 24.412  -19.226 -38.669 1.00 40.83  ? 16   SER B C     1 
ATOM   3166 O O     . SER F 3 16  ? 24.271  -20.317 -39.228 1.00 39.16  ? 16   SER B O     1 
ATOM   3167 C CB    . SER F 3 16  ? 26.427  -18.163 -39.693 1.00 42.94  ? 16   SER B CB    1 
ATOM   3168 O OG    . SER F 3 16  ? 27.117  -18.421 -38.483 1.00 45.98  ? 16   SER B OG    1 
ATOM   3169 N N     . HIS F 3 17  ? 24.146  -19.033 -37.376 1.00 39.47  ? 17   HIS B N     1 
ATOM   3170 C CA    . HIS F 3 17  ? 23.636  -20.109 -36.532 1.00 38.96  ? 17   HIS B CA    1 
ATOM   3171 C C     . HIS F 3 17  ? 22.125  -20.020 -36.296 1.00 37.64  ? 17   HIS B C     1 
ATOM   3172 O O     . HIS F 3 17  ? 21.567  -20.819 -35.545 1.00 37.16  ? 17   HIS B O     1 
ATOM   3173 C CB    . HIS F 3 17  ? 24.330  -20.106 -35.169 1.00 41.86  ? 17   HIS B CB    1 
ATOM   3174 C CG    . HIS F 3 17  ? 25.790  -20.426 -35.228 1.00 44.44  ? 17   HIS B CG    1 
ATOM   3175 N ND1   . HIS F 3 17  ? 26.738  -19.513 -35.638 1.00 45.63  ? 17   HIS B ND1   1 
ATOM   3176 C CD2   . HIS F 3 17  ? 26.465  -21.556 -34.914 1.00 44.83  ? 17   HIS B CD2   1 
ATOM   3177 C CE1   . HIS F 3 17  ? 27.935  -20.067 -35.569 1.00 46.56  ? 17   HIS B CE1   1 
ATOM   3178 N NE2   . HIS F 3 17  ? 27.797  -21.307 -35.132 1.00 46.87  ? 17   HIS B NE2   1 
ATOM   3179 N N     . CYS F 3 18  ? 21.466  -19.058 -36.934 1.00 37.68  ? 18   CYS B N     1 
ATOM   3180 C CA    . CYS F 3 18  ? 20.019  -18.867 -36.759 1.00 38.62  ? 18   CYS B CA    1 
ATOM   3181 C C     . CYS F 3 18  ? 19.178  -19.336 -37.947 1.00 39.32  ? 18   CYS B C     1 
ATOM   3182 O O     . CYS F 3 18  ? 19.704  -19.657 -39.011 1.00 39.20  ? 18   CYS B O     1 
ATOM   3183 C CB    . CYS F 3 18  ? 19.706  -17.381 -36.514 1.00 37.36  ? 18   CYS B CB    1 
ATOM   3184 S SG    . CYS F 3 18  ? 20.404  -16.650 -34.993 1.00 38.07  ? 18   CYS B SG    1 
ATOM   3185 N N     . HIS F 3 19  ? 17.864  -19.373 -37.741 1.00 40.70  ? 19   HIS B N     1 
ATOM   3186 C CA    . HIS F 3 19  ? 16.905  -19.739 -38.779 1.00 39.87  ? 19   HIS B CA    1 
ATOM   3187 C C     . HIS F 3 19  ? 16.155  -18.439 -39.076 1.00 39.39  ? 19   HIS B C     1 
ATOM   3188 O O     . HIS F 3 19  ? 15.688  -17.760 -38.156 1.00 36.34  ? 19   HIS B O     1 
ATOM   3189 C CB    . HIS F 3 19  ? 15.919  -20.797 -38.264 1.00 43.55  ? 19   HIS B CB    1 
ATOM   3190 C CG    . HIS F 3 19  ? 15.048  -21.380 -39.335 1.00 48.56  ? 19   HIS B CG    1 
ATOM   3191 N ND1   . HIS F 3 19  ? 14.359  -20.601 -40.242 1.00 49.94  ? 19   HIS B ND1   1 
ATOM   3192 C CD2   . HIS F 3 19  ? 14.765  -22.667 -39.653 1.00 49.58  ? 19   HIS B CD2   1 
ATOM   3193 C CE1   . HIS F 3 19  ? 13.693  -21.383 -41.074 1.00 49.04  ? 19   HIS B CE1   1 
ATOM   3194 N NE2   . HIS F 3 19  ? 13.921  -22.640 -40.738 1.00 50.97  ? 19   HIS B NE2   1 
ATOM   3195 N N     . ILE F 3 20  ? 16.034  -18.089 -40.350 1.00 36.84  ? 20   ILE B N     1 
ATOM   3196 C CA    . ILE F 3 20  ? 15.360  -16.860 -40.726 1.00 35.99  ? 20   ILE B CA    1 
ATOM   3197 C C     . ILE F 3 20  ? 13.888  -17.082 -41.086 1.00 36.05  ? 20   ILE B C     1 
ATOM   3198 O O     . ILE F 3 20  ? 13.559  -17.978 -41.865 1.00 34.57  ? 20   ILE B O     1 
ATOM   3199 C CB    . ILE F 3 20  ? 16.076  -16.198 -41.932 1.00 39.22  ? 20   ILE B CB    1 
ATOM   3200 C CG1   . ILE F 3 20  ? 17.561  -15.978 -41.610 1.00 38.98  ? 20   ILE B CG1   1 
ATOM   3201 C CG2   . ILE F 3 20  ? 15.401  -14.882 -42.285 1.00 37.03  ? 20   ILE B CG2   1 
ATOM   3202 C CD1   . ILE F 3 20  ? 17.807  -15.067 -40.428 1.00 40.76  ? 20   ILE B CD1   1 
ATOM   3203 N N     . HIS F 3 21  ? 13.007  -16.268 -40.509 1.00 32.93  ? 21   HIS B N     1 
ATOM   3204 C CA    . HIS F 3 21  ? 11.577  -16.357 -40.790 1.00 31.69  ? 21   HIS B CA    1 
ATOM   3205 C C     . HIS F 3 21  ? 11.024  -14.999 -41.198 1.00 32.85  ? 21   HIS B C     1 
ATOM   3206 O O     . HIS F 3 21  ? 11.661  -13.971 -40.955 1.00 31.31  ? 21   HIS B O     1 
ATOM   3207 C CB    . HIS F 3 21  ? 10.810  -16.858 -39.567 1.00 31.57  ? 21   HIS B CB    1 
ATOM   3208 C CG    . HIS F 3 21  ? 11.001  -18.314 -39.295 1.00 33.85  ? 21   HIS B CG    1 
ATOM   3209 N ND1   . HIS F 3 21  ? 12.009  -18.796 -38.488 1.00 36.04  ? 21   HIS B ND1   1 
ATOM   3210 C CD2   . HIS F 3 21  ? 10.312  -19.397 -39.725 1.00 32.85  ? 21   HIS B CD2   1 
ATOM   3211 C CE1   . HIS F 3 21  ? 11.930  -20.113 -38.429 1.00 34.94  ? 21   HIS B CE1   1 
ATOM   3212 N NE2   . HIS F 3 21  ? 10.908  -20.502 -39.170 1.00 34.85  ? 21   HIS B NE2   1 
ATOM   3213 N N     . LYS F 3 22  ? 9.839   -14.998 -41.812 1.00 30.82  ? 22   LYS B N     1 
ATOM   3214 C CA    . LYS F 3 22  ? 9.194   -13.759 -42.228 1.00 31.47  ? 22   LYS B CA    1 
ATOM   3215 C C     . LYS F 3 22  ? 7.785   -13.753 -41.651 1.00 32.04  ? 22   LYS B C     1 
ATOM   3216 O O     . LYS F 3 22  ? 7.147   -14.803 -41.542 1.00 31.63  ? 22   LYS B O     1 
ATOM   3217 C CB    . LYS F 3 22  ? 9.108   -13.668 -43.757 1.00 34.60  ? 22   LYS B CB    1 
ATOM   3218 C CG    . LYS F 3 22  ? 10.258  -14.332 -44.497 1.00 40.25  ? 22   LYS B CG    1 
ATOM   3219 C CD    . LYS F 3 22  ? 11.557  -13.561 -44.372 1.00 43.20  ? 22   LYS B CD    1 
ATOM   3220 C CE    . LYS F 3 22  ? 11.582  -12.403 -45.341 1.00 46.94  ? 22   LYS B CE    1 
ATOM   3221 N NZ    . LYS F 3 22  ? 11.444  -12.891 -46.743 1.00 49.59  ? 22   LYS B NZ    1 
ATOM   3222 N N     . TYR F 3 23  ? 7.305   -12.573 -41.271 1.00 30.16  ? 23   TYR B N     1 
ATOM   3223 C CA    . TYR F 3 23  ? 5.964   -12.434 -40.719 1.00 29.18  ? 23   TYR B CA    1 
ATOM   3224 C C     . TYR F 3 23  ? 5.300   -11.206 -41.317 1.00 29.28  ? 23   TYR B C     1 
ATOM   3225 O O     . TYR F 3 23  ? 5.872   -10.117 -41.298 1.00 31.79  ? 23   TYR B O     1 
ATOM   3226 C CB    . TYR F 3 23  ? 5.994   -12.242 -39.201 1.00 26.98  ? 23   TYR B CB    1 
ATOM   3227 C CG    . TYR F 3 23  ? 6.581   -13.381 -38.424 1.00 26.96  ? 23   TYR B CG    1 
ATOM   3228 C CD1   . TYR F 3 23  ? 7.952   -13.456 -38.190 1.00 24.45  ? 23   TYR B CD1   1 
ATOM   3229 C CD2   . TYR F 3 23  ? 5.766   -14.399 -37.927 1.00 25.89  ? 23   TYR B CD2   1 
ATOM   3230 C CE1   . TYR F 3 23  ? 8.495   -14.518 -37.481 1.00 24.41  ? 23   TYR B CE1   1 
ATOM   3231 C CE2   . TYR F 3 23  ? 6.296   -15.456 -37.223 1.00 25.15  ? 23   TYR B CE2   1 
ATOM   3232 C CZ    . TYR F 3 23  ? 7.665   -15.510 -37.002 1.00 24.04  ? 23   TYR B CZ    1 
ATOM   3233 O OH    . TYR F 3 23  ? 8.197   -16.556 -36.291 1.00 26.10  ? 23   TYR B OH    1 
ATOM   3234 N N     . PRO F 3 24  ? 4.084   -11.359 -41.855 1.00 29.28  ? 24   PRO B N     1 
ATOM   3235 C CA    . PRO F 3 24  ? 3.399   -10.203 -42.435 1.00 29.76  ? 24   PRO B CA    1 
ATOM   3236 C C     . PRO F 3 24  ? 2.856   -9.307  -41.314 1.00 31.48  ? 24   PRO B C     1 
ATOM   3237 O O     . PRO F 3 24  ? 2.702   -9.747  -40.173 1.00 29.27  ? 24   PRO B O     1 
ATOM   3238 C CB    . PRO F 3 24  ? 2.278   -10.844 -43.234 1.00 28.59  ? 24   PRO B CB    1 
ATOM   3239 C CG    . PRO F 3 24  ? 1.901   -12.010 -42.370 1.00 28.43  ? 24   PRO B CG    1 
ATOM   3240 C CD    . PRO F 3 24  ? 3.249   -12.571 -41.948 1.00 29.13  ? 24   PRO B CD    1 
ATOM   3241 N N     . SER F 3 25  ? 2.568   -8.057  -41.652 1.00 32.86  ? 25   SER B N     1 
ATOM   3242 C CA    . SER F 3 25  ? 2.018   -7.096  -40.707 1.00 34.86  ? 25   SER B CA    1 
ATOM   3243 C C     . SER F 3 25  ? 0.754   -7.642  -40.033 1.00 34.44  ? 25   SER B C     1 
ATOM   3244 O O     . SER F 3 25  ? -0.066  -8.289  -40.680 1.00 33.52  ? 25   SER B O     1 
ATOM   3245 C CB    . SER F 3 25  ? 1.689   -5.799  -41.451 1.00 37.03  ? 25   SER B CB    1 
ATOM   3246 O OG    . SER F 3 25  ? 0.902   -4.935  -40.654 1.00 44.61  ? 25   SER B OG    1 
ATOM   3247 N N     . LYS F 3 26  ? 0.628   -7.395  -38.729 1.00 33.83  ? 26   LYS B N     1 
ATOM   3248 C CA    . LYS F 3 26  ? -0.521  -7.819  -37.925 1.00 34.82  ? 26   LYS B CA    1 
ATOM   3249 C C     . LYS F 3 26  ? -0.493  -9.267  -37.426 1.00 35.16  ? 26   LYS B C     1 
ATOM   3250 O O     . LYS F 3 26  ? -1.297  -9.647  -36.571 1.00 35.21  ? 26   LYS B O     1 
ATOM   3251 C CB    . LYS F 3 26  ? -1.836  -7.554  -38.684 1.00 40.62  ? 26   LYS B CB    1 
ATOM   3252 C CG    . LYS F 3 26  ? -2.017  -6.099  -39.120 1.00 46.85  ? 26   LYS B CG    1 
ATOM   3253 C CD    . LYS F 3 26  ? -3.356  -5.847  -39.823 1.00 50.30  ? 26   LYS B CD    1 
ATOM   3254 C CE    . LYS F 3 26  ? -4.532  -5.962  -38.861 1.00 54.51  ? 26   LYS B CE    1 
ATOM   3255 N NZ    . LYS F 3 26  ? -5.839  -5.600  -39.493 1.00 56.91  ? 26   LYS B NZ    1 
ATOM   3256 N N     . SER F 3 27  ? 0.428   -10.078 -37.937 1.00 32.57  ? 27   SER B N     1 
ATOM   3257 C CA    . SER F 3 27  ? 0.515   -11.462 -37.484 1.00 29.90  ? 27   SER B CA    1 
ATOM   3258 C C     . SER F 3 27  ? 1.161   -11.541 -36.098 1.00 31.07  ? 27   SER B C     1 
ATOM   3259 O O     . SER F 3 27  ? 1.843   -10.605 -35.647 1.00 28.05  ? 27   SER B O     1 
ATOM   3260 C CB    . SER F 3 27  ? 1.326   -12.310 -38.471 1.00 30.52  ? 27   SER B CB    1 
ATOM   3261 O OG    . SER F 3 27  ? 2.703   -11.978 -38.442 1.00 29.40  ? 27   SER B OG    1 
ATOM   3262 N N     . THR F 3 28  ? 0.960   -12.677 -35.442 1.00 28.79  ? 28   THR B N     1 
ATOM   3263 C CA    . THR F 3 28  ? 1.483   -12.904 -34.105 1.00 29.06  ? 28   THR B CA    1 
ATOM   3264 C C     . THR F 3 28  ? 2.802   -13.678 -34.101 1.00 30.18  ? 28   THR B C     1 
ATOM   3265 O O     . THR F 3 28  ? 2.851   -14.819 -34.572 1.00 29.66  ? 28   THR B O     1 
ATOM   3266 C CB    . THR F 3 28  ? 0.456   -13.697 -33.282 1.00 30.34  ? 28   THR B CB    1 
ATOM   3267 O OG1   . THR F 3 28  ? -0.799  -13.005 -33.306 1.00 31.40  ? 28   THR B OG1   1 
ATOM   3268 C CG2   . THR F 3 28  ? 0.926   -13.867 -31.841 1.00 28.35  ? 28   THR B CG2   1 
ATOM   3269 N N     . LEU F 3 29  ? 3.866   -13.063 -33.578 1.00 28.90  ? 29   LEU B N     1 
ATOM   3270 C CA    . LEU F 3 29  ? 5.171   -13.732 -33.491 1.00 29.48  ? 29   LEU B CA    1 
ATOM   3271 C C     . LEU F 3 29  ? 5.269   -14.520 -32.199 1.00 28.97  ? 29   LEU B C     1 
ATOM   3272 O O     . LEU F 3 29  ? 5.721   -15.664 -32.190 1.00 31.14  ? 29   LEU B O     1 
ATOM   3273 C CB    . LEU F 3 29  ? 6.340   -12.733 -33.524 1.00 27.89  ? 29   LEU B CB    1 
ATOM   3274 C CG    . LEU F 3 29  ? 6.735   -12.108 -34.863 1.00 30.07  ? 29   LEU B CG    1 
ATOM   3275 C CD1   . LEU F 3 29  ? 5.605   -11.220 -35.363 1.00 27.39  ? 29   LEU B CD1   1 
ATOM   3276 C CD2   . LEU F 3 29  ? 8.031   -11.303 -34.704 1.00 27.94  ? 29   LEU B CD2   1 
ATOM   3277 N N     . ILE F 3 30  ? 4.853   -13.898 -31.102 1.00 29.61  ? 30   ILE B N     1 
ATOM   3278 C CA    . ILE F 3 30  ? 4.902   -14.539 -29.787 1.00 29.31  ? 30   ILE B CA    1 
ATOM   3279 C C     . ILE F 3 30  ? 3.548   -14.476 -29.085 1.00 29.52  ? 30   ILE B C     1 
ATOM   3280 O O     . ILE F 3 30  ? 2.911   -13.422 -29.038 1.00 29.97  ? 30   ILE B O     1 
ATOM   3281 C CB    . ILE F 3 30  ? 5.955   -13.863 -28.888 1.00 29.15  ? 30   ILE B CB    1 
ATOM   3282 C CG1   . ILE F 3 30  ? 7.346   -14.022 -29.505 1.00 27.80  ? 30   ILE B CG1   1 
ATOM   3283 C CG2   . ILE F 3 30  ? 5.902   -14.450 -27.489 1.00 27.65  ? 30   ILE B CG2   1 
ATOM   3284 C CD1   . ILE F 3 30  ? 8.429   -13.288 -28.744 1.00 30.01  ? 30   ILE B CD1   1 
ATOM   3285 N N     . HIS F 3 31  ? 3.123   -15.607 -28.534 1.00 30.09  ? 31   HIS B N     1 
ATOM   3286 C CA    . HIS F 3 31  ? 1.842   -15.708 -27.832 1.00 31.98  ? 31   HIS B CA    1 
ATOM   3287 C C     . HIS F 3 31  ? 2.084   -15.695 -26.321 1.00 30.32  ? 31   HIS B C     1 
ATOM   3288 O O     . HIS F 3 31  ? 2.871   -16.489 -25.804 1.00 28.26  ? 31   HIS B O     1 
ATOM   3289 C CB    . HIS F 3 31  ? 1.133   -17.019 -28.207 1.00 35.21  ? 31   HIS B CB    1 
ATOM   3290 C CG    . HIS F 3 31  ? 1.030   -17.266 -29.681 1.00 41.49  ? 31   HIS B CG    1 
ATOM   3291 N ND1   . HIS F 3 31  ? -0.102  -16.969 -30.412 1.00 43.98  ? 31   HIS B ND1   1 
ATOM   3292 C CD2   . HIS F 3 31  ? 1.914   -17.801 -30.559 1.00 41.74  ? 31   HIS B CD2   1 
ATOM   3293 C CE1   . HIS F 3 31  ? 0.089   -17.314 -31.675 1.00 42.54  ? 31   HIS B CE1   1 
ATOM   3294 N NE2   . HIS F 3 31  ? 1.304   -17.821 -31.790 1.00 43.22  ? 31   HIS B NE2   1 
ATOM   3295 N N     . GLN F 3 32  ? 1.393   -14.813 -25.608 1.00 31.60  ? 32   GLN B N     1 
ATOM   3296 C CA    . GLN F 3 32  ? 1.566   -14.727 -24.163 1.00 32.94  ? 32   GLN B CA    1 
ATOM   3297 C C     . GLN F 3 32  ? 1.056   -15.988 -23.478 1.00 34.34  ? 32   GLN B C     1 
ATOM   3298 O O     . GLN F 3 32  ? -0.010  -16.498 -23.821 1.00 33.75  ? 32   GLN B O     1 
ATOM   3299 C CB    . GLN F 3 32  ? 0.822   -13.511 -23.606 1.00 37.16  ? 32   GLN B CB    1 
ATOM   3300 C CG    . GLN F 3 32  ? 1.184   -13.186 -22.165 1.00 41.86  ? 32   GLN B CG    1 
ATOM   3301 C CD    . GLN F 3 32  ? 0.270   -12.153 -21.544 1.00 45.49  ? 32   GLN B CD    1 
ATOM   3302 O OE1   . GLN F 3 32  ? 0.040   -11.081 -22.110 1.00 47.82  ? 32   GLN B OE1   1 
ATOM   3303 N NE2   . GLN F 3 32  ? -0.259  -12.469 -20.364 1.00 49.95  ? 32   GLN B NE2   1 
ATOM   3304 N N     . GLY F 3 33  ? 1.825   -16.491 -22.514 1.00 34.30  ? 33   GLY B N     1 
ATOM   3305 C CA    . GLY F 3 33  ? 1.420   -17.679 -21.786 1.00 35.85  ? 33   GLY B CA    1 
ATOM   3306 C C     . GLY F 3 33  ? 2.030   -18.996 -22.241 1.00 37.97  ? 33   GLY B C     1 
ATOM   3307 O O     . GLY F 3 33  ? 1.992   -19.984 -21.503 1.00 36.91  ? 33   GLY B O     1 
ATOM   3308 N N     . GLU F 3 34  ? 2.580   -19.032 -23.450 1.00 38.32  ? 34   GLU B N     1 
ATOM   3309 C CA    . GLU F 3 34  ? 3.186   -20.262 -23.950 1.00 40.25  ? 34   GLU B CA    1 
ATOM   3310 C C     . GLU F 3 34  ? 4.610   -20.432 -23.425 1.00 40.63  ? 34   GLU B C     1 
ATOM   3311 O O     . GLU F 3 34  ? 5.239   -19.467 -22.980 1.00 40.23  ? 34   GLU B O     1 
ATOM   3312 C CB    . GLU F 3 34  ? 3.201   -20.264 -25.477 1.00 43.38  ? 34   GLU B CB    1 
ATOM   3313 C CG    . GLU F 3 34  ? 1.852   -19.970 -26.099 1.00 48.28  ? 34   GLU B CG    1 
ATOM   3314 C CD    . GLU F 3 34  ? 1.802   -20.329 -27.572 1.00 53.58  ? 34   GLU B CD    1 
ATOM   3315 O OE1   . GLU F 3 34  ? 2.782   -20.031 -28.296 1.00 55.35  ? 34   GLU B OE1   1 
ATOM   3316 O OE2   . GLU F 3 34  ? 0.777   -20.904 -28.006 1.00 54.90  ? 34   GLU B OE2   1 
ATOM   3317 N N     . LYS F 3 35  ? 5.116   -21.659 -23.495 1.00 40.20  ? 35   LYS B N     1 
ATOM   3318 C CA    . LYS F 3 35  ? 6.455   -21.969 -23.016 1.00 42.38  ? 35   LYS B CA    1 
ATOM   3319 C C     . LYS F 3 35  ? 7.533   -21.303 -23.864 1.00 41.23  ? 35   LYS B C     1 
ATOM   3320 O O     . LYS F 3 35  ? 7.496   -21.364 -25.089 1.00 41.66  ? 35   LYS B O     1 
ATOM   3321 C CB    . LYS F 3 35  ? 6.678   -23.486 -23.000 1.00 45.26  ? 35   LYS B CB    1 
ATOM   3322 C CG    . LYS F 3 35  ? 8.011   -23.907 -22.387 1.00 49.22  ? 35   LYS B CG    1 
ATOM   3323 C CD    . LYS F 3 35  ? 8.351   -25.361 -22.719 1.00 53.68  ? 35   LYS B CD    1 
ATOM   3324 C CE    . LYS F 3 35  ? 7.487   -26.354 -21.954 1.00 55.23  ? 35   LYS B CE    1 
ATOM   3325 N NZ    . LYS F 3 35  ? 7.848   -26.418 -20.506 1.00 57.69  ? 35   LYS B NZ    1 
ATOM   3326 N N     . ALA F 3 36  ? 8.492   -20.668 -23.197 1.00 40.39  ? 36   ALA B N     1 
ATOM   3327 C CA    . ALA F 3 36  ? 9.584   -19.983 -23.879 1.00 38.49  ? 36   ALA B CA    1 
ATOM   3328 C C     . ALA F 3 36  ? 10.783  -20.908 -24.060 1.00 37.43  ? 36   ALA B C     1 
ATOM   3329 O O     . ALA F 3 36  ? 11.326  -21.436 -23.088 1.00 35.63  ? 36   ALA B O     1 
ATOM   3330 C CB    . ALA F 3 36  ? 9.994   -18.744 -23.083 1.00 37.85  ? 36   ALA B CB    1 
ATOM   3331 N N     . GLU F 3 37  ? 11.193  -21.098 -25.310 1.00 37.34  ? 37   GLU B N     1 
ATOM   3332 C CA    . GLU F 3 37  ? 12.328  -21.955 -25.618 1.00 39.54  ? 37   GLU B CA    1 
ATOM   3333 C C     . GLU F 3 37  ? 13.210  -21.397 -26.731 1.00 38.93  ? 37   GLU B C     1 
ATOM   3334 O O     . GLU F 3 37  ? 14.267  -21.961 -27.027 1.00 37.76  ? 37   GLU B O     1 
ATOM   3335 C CB    . GLU F 3 37  ? 11.835  -23.350 -26.016 1.00 43.71  ? 37   GLU B CB    1 
ATOM   3336 C CG    . GLU F 3 37  ? 11.312  -24.176 -24.852 1.00 49.07  ? 37   GLU B CG    1 
ATOM   3337 C CD    . GLU F 3 37  ? 10.863  -25.570 -25.266 1.00 54.38  ? 37   GLU B CD    1 
ATOM   3338 O OE1   . GLU F 3 37  ? 10.622  -26.404 -24.365 1.00 56.55  ? 37   GLU B OE1   1 
ATOM   3339 O OE2   . GLU F 3 37  ? 10.745  -25.835 -26.485 1.00 56.58  ? 37   GLU B OE2   1 
ATOM   3340 N N     . THR F 3 38  ? 12.785  -20.294 -27.346 1.00 36.64  ? 38   THR B N     1 
ATOM   3341 C CA    . THR F 3 38  ? 13.558  -19.719 -28.440 1.00 35.95  ? 38   THR B CA    1 
ATOM   3342 C C     . THR F 3 38  ? 13.726  -18.200 -28.372 1.00 33.74  ? 38   THR B C     1 
ATOM   3343 O O     . THR F 3 38  ? 12.847  -17.476 -27.891 1.00 31.86  ? 38   THR B O     1 
ATOM   3344 C CB    . THR F 3 38  ? 12.933  -20.087 -29.817 1.00 39.11  ? 38   THR B CB    1 
ATOM   3345 O OG1   . THR F 3 38  ? 11.786  -19.274 -30.056 1.00 43.29  ? 38   THR B OG1   1 
ATOM   3346 C CG2   . THR F 3 38  ? 12.492  -21.547 -29.834 1.00 40.39  ? 38   THR B CG2   1 
ATOM   3347 N N     . LEU F 3 39  ? 14.871  -17.737 -28.866 1.00 29.49  ? 39   LEU B N     1 
ATOM   3348 C CA    . LEU F 3 39  ? 15.210  -16.325 -28.891 1.00 27.55  ? 39   LEU B CA    1 
ATOM   3349 C C     . LEU F 3 39  ? 15.061  -15.779 -30.317 1.00 28.28  ? 39   LEU B C     1 
ATOM   3350 O O     . LEU F 3 39  ? 15.365  -16.479 -31.297 1.00 26.03  ? 39   LEU B O     1 
ATOM   3351 C CB    . LEU F 3 39  ? 16.656  -16.148 -28.405 1.00 25.90  ? 39   LEU B CB    1 
ATOM   3352 C CG    . LEU F 3 39  ? 17.255  -14.741 -28.404 1.00 27.63  ? 39   LEU B CG    1 
ATOM   3353 C CD1   . LEU F 3 39  ? 16.679  -13.923 -27.247 1.00 26.58  ? 39   LEU B CD1   1 
ATOM   3354 C CD2   . LEU F 3 39  ? 18.783  -14.836 -28.282 1.00 28.32  ? 39   LEU B CD2   1 
ATOM   3355 N N     . TYR F 3 40  ? 14.593  -14.536 -30.421 1.00 24.06  ? 40   TYR B N     1 
ATOM   3356 C CA    . TYR F 3 40  ? 14.407  -13.862 -31.705 1.00 25.15  ? 40   TYR B CA    1 
ATOM   3357 C C     . TYR F 3 40  ? 15.316  -12.636 -31.837 1.00 26.16  ? 40   TYR B C     1 
ATOM   3358 O O     . TYR F 3 40  ? 15.679  -12.003 -30.840 1.00 27.47  ? 40   TYR B O     1 
ATOM   3359 C CB    . TYR F 3 40  ? 12.959  -13.369 -31.865 1.00 26.25  ? 40   TYR B CB    1 
ATOM   3360 C CG    . TYR F 3 40  ? 11.899  -14.434 -31.756 1.00 28.10  ? 40   TYR B CG    1 
ATOM   3361 C CD1   . TYR F 3 40  ? 11.592  -15.021 -30.528 1.00 26.83  ? 40   TYR B CD1   1 
ATOM   3362 C CD2   . TYR F 3 40  ? 11.222  -14.881 -32.889 1.00 29.74  ? 40   TYR B CD2   1 
ATOM   3363 C CE1   . TYR F 3 40  ? 10.640  -16.033 -30.435 1.00 30.19  ? 40   TYR B CE1   1 
ATOM   3364 C CE2   . TYR F 3 40  ? 10.265  -15.889 -32.807 1.00 31.05  ? 40   TYR B CE2   1 
ATOM   3365 C CZ    . TYR F 3 40  ? 9.983   -16.463 -31.580 1.00 30.50  ? 40   TYR B CZ    1 
ATOM   3366 O OH    . TYR F 3 40  ? 9.063   -17.485 -31.507 1.00 33.41  ? 40   TYR B OH    1 
ATOM   3367 N N     . TYR F 3 41  ? 15.650  -12.291 -33.076 1.00 25.84  ? 41   TYR B N     1 
ATOM   3368 C CA    . TYR F 3 41  ? 16.469  -11.117 -33.374 1.00 28.08  ? 41   TYR B CA    1 
ATOM   3369 C C     . TYR F 3 41  ? 15.903  -10.499 -34.642 1.00 30.18  ? 41   TYR B C     1 
ATOM   3370 O O     . TYR F 3 41  ? 15.894  -11.131 -35.698 1.00 27.87  ? 41   TYR B O     1 
ATOM   3371 C CB    . TYR F 3 41  ? 17.934  -11.496 -33.592 1.00 30.68  ? 41   TYR B CB    1 
ATOM   3372 C CG    . TYR F 3 41  ? 18.797  -10.319 -34.006 1.00 34.43  ? 41   TYR B CG    1 
ATOM   3373 C CD1   . TYR F 3 41  ? 18.926  -9.960  -35.349 1.00 35.79  ? 41   TYR B CD1   1 
ATOM   3374 C CD2   . TYR F 3 41  ? 19.469  -9.553  -33.053 1.00 35.61  ? 41   TYR B CD2   1 
ATOM   3375 C CE1   . TYR F 3 41  ? 19.705  -8.867  -35.735 1.00 37.97  ? 41   TYR B CE1   1 
ATOM   3376 C CE2   . TYR F 3 41  ? 20.252  -8.456  -33.425 1.00 37.93  ? 41   TYR B CE2   1 
ATOM   3377 C CZ    . TYR F 3 41  ? 20.367  -8.122  -34.768 1.00 38.62  ? 41   TYR B CZ    1 
ATOM   3378 O OH    . TYR F 3 41  ? 21.162  -7.066  -35.142 1.00 39.00  ? 41   TYR B OH    1 
ATOM   3379 N N     . ILE F 3 42  ? 15.416  -9.267  -34.538 1.00 29.56  ? 42   ILE B N     1 
ATOM   3380 C CA    . ILE F 3 42  ? 14.828  -8.602  -35.689 1.00 29.05  ? 42   ILE B CA    1 
ATOM   3381 C C     . ILE F 3 42  ? 15.877  -8.111  -36.685 1.00 31.48  ? 42   ILE B C     1 
ATOM   3382 O O     . ILE F 3 42  ? 16.723  -7.271  -36.365 1.00 30.88  ? 42   ILE B O     1 
ATOM   3383 C CB    . ILE F 3 42  ? 13.938  -7.404  -35.242 1.00 29.03  ? 42   ILE B CB    1 
ATOM   3384 C CG1   . ILE F 3 42  ? 12.930  -7.876  -34.183 1.00 25.86  ? 42   ILE B CG1   1 
ATOM   3385 C CG2   . ILE F 3 42  ? 13.209  -6.811  -36.450 1.00 28.55  ? 42   ILE B CG2   1 
ATOM   3386 C CD1   . ILE F 3 42  ? 12.014  -6.784  -33.645 1.00 28.89  ? 42   ILE B CD1   1 
ATOM   3387 N N     . VAL F 3 43  ? 15.823  -8.650  -37.898 1.00 32.23  ? 43   VAL B N     1 
ATOM   3388 C CA    . VAL F 3 43  ? 16.755  -8.246  -38.937 1.00 33.25  ? 43   VAL B CA    1 
ATOM   3389 C C     . VAL F 3 43  ? 16.138  -7.092  -39.717 1.00 33.66  ? 43   VAL B C     1 
ATOM   3390 O O     . VAL F 3 43  ? 16.838  -6.194  -40.154 1.00 36.51  ? 43   VAL B O     1 
ATOM   3391 C CB    . VAL F 3 43  ? 17.068  -9.412  -39.897 1.00 33.85  ? 43   VAL B CB    1 
ATOM   3392 C CG1   . VAL F 3 43  ? 17.970  -8.932  -41.019 1.00 35.91  ? 43   VAL B CG1   1 
ATOM   3393 C CG2   . VAL F 3 43  ? 17.747  -10.535 -39.138 1.00 33.69  ? 43   VAL B CG2   1 
ATOM   3394 N N     . LYS F 3 44  ? 14.820  -7.113  -39.869 1.00 32.60  ? 44   LYS B N     1 
ATOM   3395 C CA    . LYS F 3 44  ? 14.108  -6.067  -40.591 1.00 34.30  ? 44   LYS B CA    1 
ATOM   3396 C C     . LYS F 3 44  ? 12.664  -5.945  -40.114 1.00 33.12  ? 44   LYS B C     1 
ATOM   3397 O O     . LYS F 3 44  ? 12.010  -6.950  -39.834 1.00 33.34  ? 44   LYS B O     1 
ATOM   3398 C CB    . LYS F 3 44  ? 14.095  -6.362  -42.095 1.00 37.67  ? 44   LYS B CB    1 
ATOM   3399 C CG    . LYS F 3 44  ? 15.332  -5.920  -42.868 1.00 44.56  ? 44   LYS B CG    1 
ATOM   3400 C CD    . LYS F 3 44  ? 15.285  -6.491  -44.289 1.00 50.46  ? 44   LYS B CD    1 
ATOM   3401 C CE    . LYS F 3 44  ? 16.254  -5.792  -45.243 1.00 51.63  ? 44   LYS B CE    1 
ATOM   3402 N NZ    . LYS F 3 44  ? 15.773  -4.429  -45.621 1.00 53.29  ? 44   LYS B NZ    1 
ATOM   3403 N N     . GLY F 3 45  ? 12.171  -4.713  -40.032 1.00 29.28  ? 45   GLY B N     1 
ATOM   3404 C CA    . GLY F 3 45  ? 10.799  -4.503  -39.620 1.00 31.44  ? 45   GLY B CA    1 
ATOM   3405 C C     . GLY F 3 45  ? 10.633  -4.051  -38.182 1.00 31.32  ? 45   GLY B C     1 
ATOM   3406 O O     . GLY F 3 45  ? 11.609  -3.817  -37.477 1.00 30.83  ? 45   GLY B O     1 
ATOM   3407 N N     . SER F 3 46  ? 9.384   -3.939  -37.744 1.00 30.32  ? 46   SER B N     1 
ATOM   3408 C CA    . SER F 3 46  ? 9.106   -3.515  -36.387 1.00 30.28  ? 46   SER B CA    1 
ATOM   3409 C C     . SER F 3 46  ? 7.900   -4.258  -35.830 1.00 30.21  ? 46   SER B C     1 
ATOM   3410 O O     . SER F 3 46  ? 7.008   -4.675  -36.575 1.00 29.83  ? 46   SER B O     1 
ATOM   3411 C CB    . SER F 3 46  ? 8.854   -2.005  -36.351 1.00 30.14  ? 46   SER B CB    1 
ATOM   3412 O OG    . SER F 3 46  ? 7.571   -1.702  -36.850 1.00 32.12  ? 46   SER B OG    1 
ATOM   3413 N N     . VAL F 3 47  ? 7.876   -4.414  -34.509 1.00 28.65  ? 47   VAL B N     1 
ATOM   3414 C CA    . VAL F 3 47  ? 6.792   -5.119  -33.839 1.00 26.75  ? 47   VAL B CA    1 
ATOM   3415 C C     . VAL F 3 47  ? 6.311   -4.334  -32.627 1.00 27.38  ? 47   VAL B C     1 
ATOM   3416 O O     . VAL F 3 47  ? 6.906   -3.324  -32.251 1.00 26.69  ? 47   VAL B O     1 
ATOM   3417 C CB    . VAL F 3 47  ? 7.270   -6.516  -33.349 1.00 27.80  ? 47   VAL B CB    1 
ATOM   3418 C CG1   . VAL F 3 47  ? 7.933   -7.289  -34.503 1.00 23.28  ? 47   VAL B CG1   1 
ATOM   3419 C CG2   . VAL F 3 47  ? 8.257   -6.347  -32.212 1.00 25.01  ? 47   VAL B CG2   1 
ATOM   3420 N N     . ALA F 3 48  ? 5.222   -4.805  -32.026 1.00 28.31  ? 48   ALA B N     1 
ATOM   3421 C CA    . ALA F 3 48  ? 4.671   -4.199  -30.814 1.00 28.14  ? 48   ALA B CA    1 
ATOM   3422 C C     . ALA F 3 48  ? 4.602   -5.294  -29.757 1.00 26.45  ? 48   ALA B C     1 
ATOM   3423 O O     . ALA F 3 48  ? 4.259   -6.435  -30.065 1.00 27.09  ? 48   ALA B O     1 
ATOM   3424 C CB    . ALA F 3 48  ? 3.264   -3.646  -31.072 1.00 28.06  ? 48   ALA B CB    1 
ATOM   3425 N N     . VAL F 3 49  ? 4.948   -4.950  -28.523 1.00 24.87  ? 49   VAL B N     1 
ATOM   3426 C CA    . VAL F 3 49  ? 4.883   -5.886  -27.408 1.00 25.58  ? 49   VAL B CA    1 
ATOM   3427 C C     . VAL F 3 49  ? 3.662   -5.433  -26.623 1.00 27.38  ? 49   VAL B C     1 
ATOM   3428 O O     . VAL F 3 49  ? 3.564   -4.255  -26.255 1.00 26.63  ? 49   VAL B O     1 
ATOM   3429 C CB    . VAL F 3 49  ? 6.118   -5.783  -26.479 1.00 25.09  ? 49   VAL B CB    1 
ATOM   3430 C CG1   . VAL F 3 49  ? 5.968   -6.752  -25.309 1.00 21.75  ? 49   VAL B CG1   1 
ATOM   3431 C CG2   . VAL F 3 49  ? 7.392   -6.072  -27.256 1.00 26.24  ? 49   VAL B CG2   1 
ATOM   3432 N N     . LEU F 3 50  ? 2.735   -6.342  -26.355 1.00 26.64  ? 50   LEU B N     1 
ATOM   3433 C CA    . LEU F 3 50  ? 1.537   -5.940  -25.630 1.00 30.24  ? 50   LEU B CA    1 
ATOM   3434 C C     . LEU F 3 50  ? 1.003   -6.993  -24.670 1.00 30.58  ? 50   LEU B C     1 
ATOM   3435 O O     . LEU F 3 50  ? 1.293   -8.179  -24.809 1.00 30.74  ? 50   LEU B O     1 
ATOM   3436 C CB    . LEU F 3 50  ? 0.446   -5.551  -26.631 1.00 32.77  ? 50   LEU B CB    1 
ATOM   3437 C CG    . LEU F 3 50  ? -0.065  -6.647  -27.570 1.00 36.06  ? 50   LEU B CG    1 
ATOM   3438 C CD1   . LEU F 3 50  ? -1.170  -7.421  -26.869 1.00 37.13  ? 50   LEU B CD1   1 
ATOM   3439 C CD2   . LEU F 3 50  ? -0.599  -6.027  -28.864 1.00 37.20  ? 50   LEU B CD2   1 
ATOM   3440 N N     . ILE F 3 51  ? 0.237   -6.536  -23.683 1.00 28.83  ? 51   ILE B N     1 
ATOM   3441 C CA    . ILE F 3 51  ? -0.382  -7.417  -22.703 1.00 30.06  ? 51   ILE B CA    1 
ATOM   3442 C C     . ILE F 3 51  ? -1.885  -7.179  -22.772 1.00 31.62  ? 51   ILE B C     1 
ATOM   3443 O O     . ILE F 3 51  ? -2.330  -6.105  -23.181 1.00 31.16  ? 51   ILE B O     1 
ATOM   3444 C CB    . ILE F 3 51  ? 0.134   -7.139  -21.271 1.00 29.24  ? 51   ILE B CB    1 
ATOM   3445 C CG1   . ILE F 3 51  ? 0.014   -5.652  -20.945 1.00 28.54  ? 51   ILE B CG1   1 
ATOM   3446 C CG2   . ILE F 3 51  ? 1.583   -7.607  -21.147 1.00 29.19  ? 51   ILE B CG2   1 
ATOM   3447 C CD1   . ILE F 3 51  ? 0.459   -5.307  -19.527 1.00 29.94  ? 51   ILE B CD1   1 
ATOM   3448 N N     . LYS F 3 52  ? -2.665  -8.178  -22.383 1.00 34.49  ? 52   LYS B N     1 
ATOM   3449 C CA    . LYS F 3 52  ? -4.118  -8.068  -22.446 1.00 40.11  ? 52   LYS B CA    1 
ATOM   3450 C C     . LYS F 3 52  ? -4.761  -8.474  -21.130 1.00 41.93  ? 52   LYS B C     1 
ATOM   3451 O O     . LYS F 3 52  ? -4.215  -9.301  -20.405 1.00 43.46  ? 52   LYS B O     1 
ATOM   3452 C CB    . LYS F 3 52  ? -4.642  -8.971  -23.568 1.00 42.13  ? 52   LYS B CB    1 
ATOM   3453 C CG    . LYS F 3 52  ? -3.843  -8.839  -24.856 1.00 47.34  ? 52   LYS B CG    1 
ATOM   3454 C CD    . LYS F 3 52  ? -4.267  -9.835  -25.932 1.00 51.04  ? 52   LYS B CD    1 
ATOM   3455 C CE    . LYS F 3 52  ? -5.617  -9.495  -26.535 1.00 53.73  ? 52   LYS B CE    1 
ATOM   3456 N NZ    . LYS F 3 52  ? -5.903  -10.364 -27.716 1.00 54.17  ? 52   LYS B NZ    1 
ATOM   3457 N N     . ASP F 3 53  ? -5.915  -7.893  -20.813 1.00 43.52  ? 53   ASP B N     1 
ATOM   3458 C CA    . ASP F 3 53  ? -6.596  -8.264  -19.581 1.00 47.63  ? 53   ASP B CA    1 
ATOM   3459 C C     . ASP F 3 53  ? -7.564  -9.415  -19.863 1.00 49.88  ? 53   ASP B C     1 
ATOM   3460 O O     . ASP F 3 53  ? -7.640  -9.913  -20.989 1.00 49.89  ? 53   ASP B O     1 
ATOM   3461 C CB    . ASP F 3 53  ? -7.339  -7.067  -18.967 1.00 46.72  ? 53   ASP B CB    1 
ATOM   3462 C CG    . ASP F 3 53  ? -8.579  -6.668  -19.744 1.00 48.71  ? 53   ASP B CG    1 
ATOM   3463 O OD1   . ASP F 3 53  ? -9.303  -5.775  -19.255 1.00 50.82  ? 53   ASP B OD1   1 
ATOM   3464 O OD2   . ASP F 3 53  ? -8.838  -7.228  -20.829 1.00 48.01  ? 53   ASP B OD2   1 
ATOM   3465 N N     . GLU F 3 54  ? -8.298  -9.837  -18.842 1.00 52.73  ? 54   GLU B N     1 
ATOM   3466 C CA    . GLU F 3 54  ? -9.235  -10.945 -18.985 1.00 55.93  ? 54   GLU B CA    1 
ATOM   3467 C C     . GLU F 3 54  ? -10.350 -10.646 -19.980 1.00 55.98  ? 54   GLU B C     1 
ATOM   3468 O O     . GLU F 3 54  ? -10.916 -11.558 -20.584 1.00 56.14  ? 54   GLU B O     1 
ATOM   3469 C CB    . GLU F 3 54  ? -9.837  -11.286 -17.618 1.00 58.26  ? 54   GLU B CB    1 
ATOM   3470 C CG    . GLU F 3 54  ? -8.788  -11.646 -16.573 1.00 63.46  ? 54   GLU B CG    1 
ATOM   3471 C CD    . GLU F 3 54  ? -9.353  -11.727 -15.164 1.00 66.15  ? 54   GLU B CD    1 
ATOM   3472 O OE1   . GLU F 3 54  ? -10.267 -12.549 -14.930 1.00 67.29  ? 54   GLU B OE1   1 
ATOM   3473 O OE2   . GLU F 3 54  ? -8.875  -10.966 -14.291 1.00 67.34  ? 54   GLU B OE2   1 
ATOM   3474 N N     . GLU F 3 55  ? -10.648 -9.365  -20.159 1.00 55.76  ? 55   GLU B N     1 
ATOM   3475 C CA    . GLU F 3 55  ? -11.714 -8.947  -21.057 1.00 54.94  ? 55   GLU B CA    1 
ATOM   3476 C C     . GLU F 3 55  ? -11.213 -8.648  -22.463 1.00 53.36  ? 55   GLU B C     1 
ATOM   3477 O O     . GLU F 3 55  ? -11.989 -8.268  -23.338 1.00 53.57  ? 55   GLU B O     1 
ATOM   3478 C CB    . GLU F 3 55  ? -12.410 -7.716  -20.475 1.00 57.74  ? 55   GLU B CB    1 
ATOM   3479 C CG    . GLU F 3 55  ? -13.741 -7.385  -21.112 1.00 61.14  ? 55   GLU B CG    1 
ATOM   3480 C CD    . GLU F 3 55  ? -14.502 -6.330  -20.336 1.00 63.05  ? 55   GLU B CD    1 
ATOM   3481 O OE1   . GLU F 3 55  ? -14.019 -5.177  -20.259 1.00 63.87  ? 55   GLU B OE1   1 
ATOM   3482 O OE2   . GLU F 3 55  ? -15.582 -6.659  -19.798 1.00 64.66  ? 55   GLU B OE2   1 
ATOM   3483 N N     . GLY F 3 56  ? -9.913  -8.813  -22.681 1.00 50.79  ? 56   GLY B N     1 
ATOM   3484 C CA    . GLY F 3 56  ? -9.364  -8.557  -23.998 1.00 46.80  ? 56   GLY B CA    1 
ATOM   3485 C C     . GLY F 3 56  ? -8.840  -7.153  -24.258 1.00 44.88  ? 56   GLY B C     1 
ATOM   3486 O O     . GLY F 3 56  ? -8.380  -6.876  -25.366 1.00 45.67  ? 56   GLY B O     1 
ATOM   3487 N N     . LYS F 3 57  ? -8.911  -6.258  -23.274 1.00 41.27  ? 57   LYS B N     1 
ATOM   3488 C CA    . LYS F 3 57  ? -8.387  -4.908  -23.478 1.00 38.97  ? 57   LYS B CA    1 
ATOM   3489 C C     . LYS F 3 57  ? -6.864  -5.010  -23.601 1.00 37.08  ? 57   LYS B C     1 
ATOM   3490 O O     . LYS F 3 57  ? -6.242  -5.838  -22.937 1.00 34.95  ? 57   LYS B O     1 
ATOM   3491 C CB    . LYS F 3 57  ? -8.785  -3.986  -22.320 1.00 37.83  ? 57   LYS B CB    1 
ATOM   3492 C CG    . LYS F 3 57  ? -10.280 -3.657  -22.303 1.00 43.35  ? 57   LYS B CG    1 
ATOM   3493 C CD    . LYS F 3 57  ? -10.636 -2.532  -21.324 1.00 46.49  ? 57   LYS B CD    1 
ATOM   3494 C CE    . LYS F 3 57  ? -10.270 -2.891  -19.887 1.00 51.07  ? 57   LYS B CE    1 
ATOM   3495 N NZ    . LYS F 3 57  ? -10.701 -1.843  -18.913 1.00 51.56  ? 57   LYS B NZ    1 
ATOM   3496 N N     . GLU F 3 58  ? -6.262  -4.171  -24.443 1.00 34.73  ? 58   GLU B N     1 
ATOM   3497 C CA    . GLU F 3 58  ? -4.820  -4.237  -24.660 1.00 34.38  ? 58   GLU B CA    1 
ATOM   3498 C C     . GLU F 3 58  ? -4.025  -3.008  -24.239 1.00 31.83  ? 58   GLU B C     1 
ATOM   3499 O O     . GLU F 3 58  ? -4.527  -1.888  -24.280 1.00 30.85  ? 58   GLU B O     1 
ATOM   3500 C CB    . GLU F 3 58  ? -4.538  -4.536  -26.140 1.00 36.91  ? 58   GLU B CB    1 
ATOM   3501 C CG    . GLU F 3 58  ? -5.405  -5.651  -26.709 1.00 43.30  ? 58   GLU B CG    1 
ATOM   3502 C CD    . GLU F 3 58  ? -4.993  -6.078  -28.106 1.00 46.70  ? 58   GLU B CD    1 
ATOM   3503 O OE1   . GLU F 3 58  ? -4.831  -5.202  -28.976 1.00 49.96  ? 58   GLU B OE1   1 
ATOM   3504 O OE2   . GLU F 3 58  ? -4.841  -7.296  -28.336 1.00 50.21  ? 58   GLU B OE2   1 
ATOM   3505 N N     . MET F 3 59  ? -2.776  -3.244  -23.844 1.00 28.78  ? 59   MET B N     1 
ATOM   3506 C CA    . MET F 3 59  ? -1.848  -2.201  -23.426 1.00 30.64  ? 59   MET B CA    1 
ATOM   3507 C C     . MET F 3 59  ? -0.506  -2.478  -24.093 1.00 31.67  ? 59   MET B C     1 
ATOM   3508 O O     . MET F 3 59  ? 0.045   -3.582  -23.994 1.00 32.09  ? 59   MET B O     1 
ATOM   3509 C CB    . MET F 3 59  ? -1.693  -2.203  -21.898 1.00 33.95  ? 59   MET B CB    1 
ATOM   3510 C CG    . MET F 3 59  ? -0.428  -1.525  -21.349 1.00 37.68  ? 59   MET B CG    1 
ATOM   3511 S SD    . MET F 3 59  ? -0.350  0.285   -21.467 1.00 47.16  ? 59   MET B SD    1 
ATOM   3512 C CE    . MET F 3 59  ? -1.958  0.732   -20.871 1.00 39.51  ? 59   MET B CE    1 
ATOM   3513 N N     . ILE F 3 60  ? 0.015   -1.475  -24.785 1.00 30.46  ? 60   ILE B N     1 
ATOM   3514 C CA    . ILE F 3 60  ? 1.284   -1.614  -25.479 1.00 31.21  ? 60   ILE B CA    1 
ATOM   3515 C C     . ILE F 3 60  ? 2.452   -1.312  -24.544 1.00 31.26  ? 60   ILE B C     1 
ATOM   3516 O O     . ILE F 3 60  ? 2.520   -0.240  -23.959 1.00 30.99  ? 60   ILE B O     1 
ATOM   3517 C CB    . ILE F 3 60  ? 1.325   -0.666  -26.703 1.00 32.44  ? 60   ILE B CB    1 
ATOM   3518 C CG1   . ILE F 3 60  ? 0.245   -1.087  -27.706 1.00 30.16  ? 60   ILE B CG1   1 
ATOM   3519 C CG2   . ILE F 3 60  ? 2.713   -0.668  -27.326 1.00 28.70  ? 60   ILE B CG2   1 
ATOM   3520 C CD1   . ILE F 3 60  ? -0.069  -0.047  -28.756 1.00 34.09  ? 60   ILE B CD1   1 
ATOM   3521 N N     . LEU F 3 61  ? 3.368   -2.266  -24.405 1.00 30.23  ? 61   LEU B N     1 
ATOM   3522 C CA    . LEU F 3 61  ? 4.525   -2.088  -23.536 1.00 29.25  ? 61   LEU B CA    1 
ATOM   3523 C C     . LEU F 3 61  ? 5.694   -1.460  -24.252 1.00 29.95  ? 61   LEU B C     1 
ATOM   3524 O O     . LEU F 3 61  ? 6.504   -0.761  -23.637 1.00 29.62  ? 61   LEU B O     1 
ATOM   3525 C CB    . LEU F 3 61  ? 4.986   -3.420  -22.958 1.00 27.53  ? 61   LEU B CB    1 
ATOM   3526 C CG    . LEU F 3 61  ? 4.200   -3.992  -21.783 1.00 28.48  ? 61   LEU B CG    1 
ATOM   3527 C CD1   . LEU F 3 61  ? 4.818   -5.335  -21.400 1.00 25.66  ? 61   LEU B CD1   1 
ATOM   3528 C CD2   . LEU F 3 61  ? 4.245   -3.004  -20.602 1.00 28.35  ? 61   LEU B CD2   1 
ATOM   3529 N N     . SER F 3 62  ? 5.784   -1.706  -25.552 1.00 28.16  ? 62   SER B N     1 
ATOM   3530 C CA    . SER F 3 62  ? 6.884   -1.168  -26.325 1.00 28.44  ? 62   SER B CA    1 
ATOM   3531 C C     . SER F 3 62  ? 6.815   -1.541  -27.797 1.00 29.66  ? 62   SER B C     1 
ATOM   3532 O O     . SER F 3 62  ? 6.118   -2.473  -28.191 1.00 26.94  ? 62   SER B O     1 
ATOM   3533 C CB    . SER F 3 62  ? 8.204   -1.696  -25.745 1.00 30.98  ? 62   SER B CB    1 
ATOM   3534 O OG    . SER F 3 62  ? 9.311   -1.359  -26.557 1.00 32.40  ? 62   SER B OG    1 
ATOM   3535 N N     . TYR F 3 63  ? 7.547   -0.785  -28.604 1.00 30.78  ? 63   TYR B N     1 
ATOM   3536 C CA    . TYR F 3 63  ? 7.663   -1.053  -30.023 1.00 31.96  ? 63   TYR B CA    1 
ATOM   3537 C C     . TYR F 3 63  ? 9.137   -1.432  -30.136 1.00 33.12  ? 63   TYR B C     1 
ATOM   3538 O O     . TYR F 3 63  ? 9.980   -0.798  -29.498 1.00 33.13  ? 63   TYR B O     1 
ATOM   3539 C CB    . TYR F 3 63  ? 7.407   0.206   -30.851 1.00 32.27  ? 63   TYR B CB    1 
ATOM   3540 C CG    . TYR F 3 63  ? 5.971   0.678   -30.863 1.00 34.45  ? 63   TYR B CG    1 
ATOM   3541 C CD1   . TYR F 3 63  ? 4.943   -0.168  -31.281 1.00 32.32  ? 63   TYR B CD1   1 
ATOM   3542 C CD2   . TYR F 3 63  ? 5.641   1.977   -30.476 1.00 34.42  ? 63   TYR B CD2   1 
ATOM   3543 C CE1   . TYR F 3 63  ? 3.624   0.262   -31.315 1.00 33.10  ? 63   TYR B CE1   1 
ATOM   3544 C CE2   . TYR F 3 63  ? 4.319   2.424   -30.505 1.00 35.56  ? 63   TYR B CE2   1 
ATOM   3545 C CZ    . TYR F 3 63  ? 3.319   1.559   -30.926 1.00 35.34  ? 63   TYR B CZ    1 
ATOM   3546 O OH    . TYR F 3 63  ? 2.016   1.987   -30.954 1.00 35.87  ? 63   TYR B OH    1 
ATOM   3547 N N     . LEU F 3 64  ? 9.452   -2.464  -30.913 1.00 31.58  ? 64   LEU B N     1 
ATOM   3548 C CA    . LEU F 3 64  ? 10.843  -2.883  -31.096 1.00 29.42  ? 64   LEU B CA    1 
ATOM   3549 C C     . LEU F 3 64  ? 11.150  -2.855  -32.602 1.00 30.69  ? 64   LEU B C     1 
ATOM   3550 O O     . LEU F 3 64  ? 10.248  -3.042  -33.423 1.00 29.81  ? 64   LEU B O     1 
ATOM   3551 C CB    . LEU F 3 64  ? 11.061  -4.285  -30.500 1.00 27.27  ? 64   LEU B CB    1 
ATOM   3552 C CG    . LEU F 3 64  ? 10.857  -4.404  -28.978 1.00 27.69  ? 64   LEU B CG    1 
ATOM   3553 C CD1   . LEU F 3 64  ? 11.043  -5.851  -28.534 1.00 25.57  ? 64   LEU B CD1   1 
ATOM   3554 C CD2   . LEU F 3 64  ? 11.850  -3.502  -28.236 1.00 27.46  ? 64   LEU B CD2   1 
ATOM   3555 N N     . ASN F 3 65  ? 12.407  -2.617  -32.967 1.00 30.40  ? 65   ASN B N     1 
ATOM   3556 C CA    . ASN F 3 65  ? 12.767  -2.529  -34.384 1.00 33.99  ? 65   ASN B CA    1 
ATOM   3557 C C     . ASN F 3 65  ? 14.019  -3.331  -34.751 1.00 31.80  ? 65   ASN B C     1 
ATOM   3558 O O     . ASN F 3 65  ? 14.592  -4.028  -33.910 1.00 30.87  ? 65   ASN B O     1 
ATOM   3559 C CB    . ASN F 3 65  ? 12.971  -1.054  -34.770 1.00 38.57  ? 65   ASN B CB    1 
ATOM   3560 C CG    . ASN F 3 65  ? 11.937  -0.138  -34.141 1.00 43.67  ? 65   ASN B CG    1 
ATOM   3561 O OD1   . ASN F 3 65  ? 12.063  0.258   -32.976 1.00 47.42  ? 65   ASN B OD1   1 
ATOM   3562 N ND2   . ASN F 3 65  ? 10.895  0.193   -34.903 1.00 46.92  ? 65   ASN B ND2   1 
ATOM   3563 N N     . GLN F 3 66  ? 14.458  -3.211  -36.001 1.00 30.05  ? 66   GLN B N     1 
ATOM   3564 C CA    . GLN F 3 66  ? 15.627  -3.957  -36.445 1.00 31.25  ? 66   GLN B CA    1 
ATOM   3565 C C     . GLN F 3 66  ? 16.801  -3.754  -35.501 1.00 29.20  ? 66   GLN B C     1 
ATOM   3566 O O     . GLN F 3 66  ? 17.084  -2.634  -35.074 1.00 29.64  ? 66   GLN B O     1 
ATOM   3567 C CB    . GLN F 3 66  ? 16.036  -3.562  -37.872 1.00 36.17  ? 66   GLN B CB    1 
ATOM   3568 C CG    . GLN F 3 66  ? 16.886  -2.308  -37.978 1.00 41.61  ? 66   GLN B CG    1 
ATOM   3569 C CD    . GLN F 3 66  ? 17.607  -2.217  -39.310 1.00 47.45  ? 66   GLN B CD    1 
ATOM   3570 O OE1   . GLN F 3 66  ? 18.419  -3.083  -39.650 1.00 50.46  ? 66   GLN B OE1   1 
ATOM   3571 N NE2   . GLN F 3 66  ? 17.317  -1.167  -40.073 1.00 47.80  ? 66   GLN B NE2   1 
ATOM   3572 N N     . GLY F 3 67  ? 17.478  -4.850  -35.174 1.00 28.84  ? 67   GLY B N     1 
ATOM   3573 C CA    . GLY F 3 67  ? 18.614  -4.786  -34.275 1.00 26.91  ? 67   GLY B CA    1 
ATOM   3574 C C     . GLY F 3 67  ? 18.218  -5.202  -32.872 1.00 27.30  ? 67   GLY B C     1 
ATOM   3575 O O     . GLY F 3 67  ? 19.078  -5.456  -32.034 1.00 27.56  ? 67   GLY B O     1 
ATOM   3576 N N     . ASP F 3 68  ? 16.915  -5.287  -32.615 1.00 26.92  ? 68   ASP B N     1 
ATOM   3577 C CA    . ASP F 3 68  ? 16.431  -5.681  -31.295 1.00 26.05  ? 68   ASP B CA    1 
ATOM   3578 C C     . ASP F 3 68  ? 16.169  -7.167  -31.110 1.00 28.05  ? 68   ASP B C     1 
ATOM   3579 O O     . ASP F 3 68  ? 15.668  -7.846  -32.014 1.00 26.91  ? 68   ASP B O     1 
ATOM   3580 C CB    . ASP F 3 68  ? 15.130  -4.954  -30.956 1.00 27.98  ? 68   ASP B CB    1 
ATOM   3581 C CG    . ASP F 3 68  ? 15.335  -3.484  -30.686 1.00 29.41  ? 68   ASP B CG    1 
ATOM   3582 O OD1   . ASP F 3 68  ? 16.275  -3.146  -29.938 1.00 35.53  ? 68   ASP B OD1   1 
ATOM   3583 O OD2   . ASP F 3 68  ? 14.550  -2.671  -31.211 1.00 32.55  ? 68   ASP B OD2   1 
ATOM   3584 N N     . PHE F 3 69  ? 16.493  -7.660  -29.919 1.00 27.08  ? 69   PHE B N     1 
ATOM   3585 C CA    . PHE F 3 69  ? 16.232  -9.049  -29.565 1.00 26.84  ? 69   PHE B CA    1 
ATOM   3586 C C     . PHE F 3 69  ? 14.797  -9.085  -29.033 1.00 26.42  ? 69   PHE B C     1 
ATOM   3587 O O     . PHE F 3 69  ? 14.255  -8.058  -28.623 1.00 26.18  ? 69   PHE B O     1 
ATOM   3588 C CB    . PHE F 3 69  ? 17.165  -9.521  -28.441 1.00 26.12  ? 69   PHE B CB    1 
ATOM   3589 C CG    . PHE F 3 69  ? 18.565  -9.873  -28.892 1.00 27.51  ? 69   PHE B CG    1 
ATOM   3590 C CD1   . PHE F 3 69  ? 19.599  -8.943  -28.801 1.00 27.20  ? 69   PHE B CD1   1 
ATOM   3591 C CD2   . PHE F 3 69  ? 18.859  -11.163 -29.353 1.00 26.47  ? 69   PHE B CD2   1 
ATOM   3592 C CE1   . PHE F 3 69  ? 20.913  -9.287  -29.153 1.00 28.64  ? 69   PHE B CE1   1 
ATOM   3593 C CE2   . PHE F 3 69  ? 20.170  -11.523 -29.710 1.00 26.58  ? 69   PHE B CE2   1 
ATOM   3594 C CZ    . PHE F 3 69  ? 21.199  -10.583 -29.608 1.00 28.29  ? 69   PHE B CZ    1 
ATOM   3595 N N     . ILE F 3 70  ? 14.180  -10.260 -29.056 1.00 25.08  ? 70   ILE B N     1 
ATOM   3596 C CA    . ILE F 3 70  ? 12.841  -10.437 -28.515 1.00 25.01  ? 70   ILE B CA    1 
ATOM   3597 C C     . ILE F 3 70  ? 12.807  -11.835 -27.947 1.00 26.17  ? 70   ILE B C     1 
ATOM   3598 O O     . ILE F 3 70  ? 13.557  -12.699 -28.399 1.00 24.99  ? 70   ILE B O     1 
ATOM   3599 C CB    . ILE F 3 70  ? 11.711  -10.387 -29.553 1.00 28.15  ? 70   ILE B CB    1 
ATOM   3600 C CG1   . ILE F 3 70  ? 12.146  -9.700  -30.845 1.00 29.48  ? 70   ILE B CG1   1 
ATOM   3601 C CG2   . ILE F 3 70  ? 10.526  -9.640  -28.948 1.00 28.64  ? 70   ILE B CG2   1 
ATOM   3602 C CD1   . ILE F 3 70  ? 11.027  -9.675  -31.877 1.00 29.90  ? 70   ILE B CD1   1 
ATOM   3603 N N     . GLY F 3 71  ? 11.931  -12.056 -26.968 1.00 26.93  ? 71   GLY B N     1 
ATOM   3604 C CA    . GLY F 3 71  ? 11.811  -13.367 -26.353 1.00 26.89  ? 71   GLY B CA    1 
ATOM   3605 C C     . GLY F 3 71  ? 13.019  -13.741 -25.518 1.00 28.78  ? 71   GLY B C     1 
ATOM   3606 O O     . GLY F 3 71  ? 13.336  -14.925 -25.350 1.00 29.66  ? 71   GLY B O     1 
ATOM   3607 N N     . GLU F 3 72  ? 13.696  -12.737 -24.978 1.00 25.79  ? 72   GLU B N     1 
ATOM   3608 C CA    . GLU F 3 72  ? 14.877  -12.990 -24.172 1.00 28.08  ? 72   GLU B CA    1 
ATOM   3609 C C     . GLU F 3 72  ? 14.596  -13.283 -22.699 1.00 29.18  ? 72   GLU B C     1 
ATOM   3610 O O     . GLU F 3 72  ? 15.409  -13.918 -22.022 1.00 27.40  ? 72   GLU B O     1 
ATOM   3611 C CB    . GLU F 3 72  ? 15.839  -11.796 -24.262 1.00 30.02  ? 72   GLU B CB    1 
ATOM   3612 C CG    . GLU F 3 72  ? 15.425  -10.560 -23.442 1.00 30.11  ? 72   GLU B CG    1 
ATOM   3613 C CD    . GLU F 3 72  ? 14.282  -9.768  -24.056 1.00 33.92  ? 72   GLU B CD    1 
ATOM   3614 O OE1   . GLU F 3 72  ? 13.832  -8.795  -23.410 1.00 38.32  ? 72   GLU B OE1   1 
ATOM   3615 O OE2   . GLU F 3 72  ? 13.837  -10.096 -25.179 1.00 31.82  ? 72   GLU B OE2   1 
ATOM   3616 N N     . LEU F 3 73  ? 13.444  -12.840 -22.206 1.00 29.66  ? 73   LEU B N     1 
ATOM   3617 C CA    . LEU F 3 73  ? 13.122  -13.008 -20.790 1.00 32.13  ? 73   LEU B CA    1 
ATOM   3618 C C     . LEU F 3 73  ? 13.018  -14.431 -20.246 1.00 33.90  ? 73   LEU B C     1 
ATOM   3619 O O     . LEU F 3 73  ? 13.224  -14.647 -19.054 1.00 36.57  ? 73   LEU B O     1 
ATOM   3620 C CB    . LEU F 3 73  ? 11.856  -12.209 -20.444 1.00 29.71  ? 73   LEU B CB    1 
ATOM   3621 C CG    . LEU F 3 73  ? 11.950  -10.704 -20.744 1.00 31.86  ? 73   LEU B CG    1 
ATOM   3622 C CD1   . LEU F 3 73  ? 10.737  -9.964  -20.164 1.00 31.18  ? 73   LEU B CD1   1 
ATOM   3623 C CD2   . LEU F 3 73  ? 13.238  -10.143 -20.142 1.00 31.18  ? 73   LEU B CD2   1 
ATOM   3624 N N     . GLY F 3 74  ? 12.720  -15.405 -21.098 1.00 36.65  ? 74   GLY B N     1 
ATOM   3625 C CA    . GLY F 3 74  ? 12.622  -16.777 -20.613 1.00 38.23  ? 74   GLY B CA    1 
ATOM   3626 C C     . GLY F 3 74  ? 13.935  -17.552 -20.602 1.00 39.40  ? 74   GLY B C     1 
ATOM   3627 O O     . GLY F 3 74  ? 13.978  -18.705 -20.167 1.00 40.15  ? 74   GLY B O     1 
ATOM   3628 N N     . LEU F 3 75  ? 15.011  -16.911 -21.046 1.00 39.07  ? 75   LEU B N     1 
ATOM   3629 C CA    . LEU F 3 75  ? 16.330  -17.543 -21.142 1.00 40.45  ? 75   LEU B CA    1 
ATOM   3630 C C     . LEU F 3 75  ? 17.145  -17.774 -19.863 1.00 42.47  ? 75   LEU B C     1 
ATOM   3631 O O     . LEU F 3 75  ? 17.969  -18.689 -19.806 1.00 42.35  ? 75   LEU B O     1 
ATOM   3632 C CB    . LEU F 3 75  ? 17.190  -16.739 -22.122 1.00 40.14  ? 75   LEU B CB    1 
ATOM   3633 C CG    . LEU F 3 75  ? 18.663  -17.121 -22.310 1.00 42.64  ? 75   LEU B CG    1 
ATOM   3634 C CD1   . LEU F 3 75  ? 18.793  -18.334 -23.244 1.00 36.87  ? 75   LEU B CD1   1 
ATOM   3635 C CD2   . LEU F 3 75  ? 19.405  -15.919 -22.889 1.00 41.30  ? 75   LEU B CD2   1 
ATOM   3636 N N     . PHE F 3 76  ? 16.926  -16.963 -18.836 1.00 43.92  ? 76   PHE B N     1 
ATOM   3637 C CA    . PHE F 3 76  ? 17.715  -17.085 -17.614 1.00 44.93  ? 76   PHE B CA    1 
ATOM   3638 C C     . PHE F 3 76  ? 17.145  -17.976 -16.525 1.00 47.29  ? 76   PHE B C     1 
ATOM   3639 O O     . PHE F 3 76  ? 17.799  -18.212 -15.511 1.00 47.94  ? 76   PHE B O     1 
ATOM   3640 C CB    . PHE F 3 76  ? 17.985  -15.685 -17.046 1.00 39.85  ? 76   PHE B CB    1 
ATOM   3641 C CG    . PHE F 3 76  ? 18.596  -14.744 -18.046 1.00 35.30  ? 76   PHE B CG    1 
ATOM   3642 C CD1   . PHE F 3 76  ? 17.797  -14.048 -18.939 1.00 32.79  ? 76   PHE B CD1   1 
ATOM   3643 C CD2   . PHE F 3 76  ? 19.975  -14.618 -18.143 1.00 34.00  ? 76   PHE B CD2   1 
ATOM   3644 C CE1   . PHE F 3 76  ? 18.361  -13.245 -19.918 1.00 32.66  ? 76   PHE B CE1   1 
ATOM   3645 C CE2   . PHE F 3 76  ? 20.553  -13.819 -19.118 1.00 33.46  ? 76   PHE B CE2   1 
ATOM   3646 C CZ    . PHE F 3 76  ? 19.746  -13.131 -20.010 1.00 32.86  ? 76   PHE B CZ    1 
ATOM   3647 N N     . GLU F 3 77  ? 15.940  -18.485 -16.740 1.00 51.58  ? 77   GLU B N     1 
ATOM   3648 C CA    . GLU F 3 77  ? 15.287  -19.328 -15.749 1.00 54.91  ? 77   GLU B CA    1 
ATOM   3649 C C     . GLU F 3 77  ? 14.482  -20.420 -16.458 1.00 55.67  ? 77   GLU B C     1 
ATOM   3650 O O     . GLU F 3 77  ? 13.860  -20.172 -17.490 1.00 54.45  ? 77   GLU B O     1 
ATOM   3651 C CB    . GLU F 3 77  ? 14.379  -18.444 -14.889 1.00 58.61  ? 77   GLU B CB    1 
ATOM   3652 C CG    . GLU F 3 77  ? 13.954  -19.008 -13.546 1.00 62.46  ? 77   GLU B CG    1 
ATOM   3653 C CD    . GLU F 3 77  ? 13.378  -17.920 -12.644 1.00 65.19  ? 77   GLU B CD    1 
ATOM   3654 O OE1   . GLU F 3 77  ? 12.463  -17.195 -13.095 1.00 66.27  ? 77   GLU B OE1   1 
ATOM   3655 O OE2   . GLU F 3 77  ? 13.842  -17.784 -11.491 1.00 65.98  ? 77   GLU B OE2   1 
ATOM   3656 N N     . GLU F 3 78  ? 14.503  -21.628 -15.904 1.00 56.81  ? 78   GLU B N     1 
ATOM   3657 C CA    . GLU F 3 78  ? 13.788  -22.754 -16.495 1.00 57.70  ? 78   GLU B CA    1 
ATOM   3658 C C     . GLU F 3 78  ? 12.285  -22.693 -16.250 1.00 56.48  ? 78   GLU B C     1 
ATOM   3659 O O     . GLU F 3 78  ? 11.822  -22.130 -15.254 1.00 56.47  ? 78   GLU B O     1 
ATOM   3660 C CB    . GLU F 3 78  ? 14.332  -24.076 -15.940 1.00 60.54  ? 78   GLU B CB    1 
ATOM   3661 C CG    . GLU F 3 78  ? 15.779  -24.369 -16.300 1.00 65.16  ? 78   GLU B CG    1 
ATOM   3662 C CD    . GLU F 3 78  ? 15.991  -24.570 -17.792 1.00 68.64  ? 78   GLU B CD    1 
ATOM   3663 O OE1   . GLU F 3 78  ? 17.144  -24.838 -18.202 1.00 69.48  ? 78   GLU B OE1   1 
ATOM   3664 O OE2   . GLU F 3 78  ? 15.007  -24.461 -18.556 1.00 70.64  ? 78   GLU B OE2   1 
ATOM   3665 N N     . GLY F 3 79  ? 11.528  -23.278 -17.173 1.00 54.69  ? 79   GLY B N     1 
ATOM   3666 C CA    . GLY F 3 79  ? 10.083  -23.305 -17.043 1.00 52.94  ? 79   GLY B CA    1 
ATOM   3667 C C     . GLY F 3 79  ? 9.378   -21.961 -17.067 1.00 51.78  ? 79   GLY B C     1 
ATOM   3668 O O     . GLY F 3 79  ? 8.361   -21.785 -16.397 1.00 52.04  ? 79   GLY B O     1 
ATOM   3669 N N     . GLN F 3 80  ? 9.902   -21.006 -17.828 1.00 48.61  ? 80   GLN B N     1 
ATOM   3670 C CA    . GLN F 3 80  ? 9.259   -19.705 -17.896 1.00 46.21  ? 80   GLN B CA    1 
ATOM   3671 C C     . GLN F 3 80  ? 8.295   -19.611 -19.071 1.00 42.41  ? 80   GLN B C     1 
ATOM   3672 O O     . GLN F 3 80  ? 8.463   -20.287 -20.083 1.00 41.17  ? 80   GLN B O     1 
ATOM   3673 C CB    . GLN F 3 80  ? 10.299  -18.597 -18.003 1.00 48.54  ? 80   GLN B CB    1 
ATOM   3674 C CG    . GLN F 3 80  ? 11.263  -18.539 -16.837 1.00 53.35  ? 80   GLN B CG    1 
ATOM   3675 C CD    . GLN F 3 80  ? 11.622  -17.118 -16.483 1.00 55.98  ? 80   GLN B CD    1 
ATOM   3676 O OE1   . GLN F 3 80  ? 10.783  -16.366 -15.978 1.00 57.68  ? 80   GLN B OE1   1 
ATOM   3677 N NE2   . GLN F 3 80  ? 12.867  -16.731 -16.755 1.00 55.56  ? 80   GLN B NE2   1 
ATOM   3678 N N     . GLU F 3 81  ? 7.284   -18.765 -18.920 1.00 40.35  ? 81   GLU B N     1 
ATOM   3679 C CA    . GLU F 3 81  ? 6.280   -18.553 -19.951 1.00 40.50  ? 81   GLU B CA    1 
ATOM   3680 C C     . GLU F 3 81  ? 6.438   -17.159 -20.547 1.00 38.34  ? 81   GLU B C     1 
ATOM   3681 O O     . GLU F 3 81  ? 6.913   -16.242 -19.876 1.00 35.43  ? 81   GLU B O     1 
ATOM   3682 C CB    . GLU F 3 81  ? 4.873   -18.680 -19.361 1.00 42.81  ? 81   GLU B CB    1 
ATOM   3683 C CG    . GLU F 3 81  ? 4.570   -20.030 -18.736 1.00 49.36  ? 81   GLU B CG    1 
ATOM   3684 C CD    . GLU F 3 81  ? 3.178   -20.098 -18.124 1.00 52.34  ? 81   GLU B CD    1 
ATOM   3685 O OE1   . GLU F 3 81  ? 2.824   -21.170 -17.588 1.00 55.17  ? 81   GLU B OE1   1 
ATOM   3686 O OE2   . GLU F 3 81  ? 2.439   -19.087 -18.178 1.00 53.60  ? 81   GLU B OE2   1 
ATOM   3687 N N     . ARG F 3 82  ? 6.038   -17.008 -21.808 1.00 35.11  ? 82   ARG B N     1 
ATOM   3688 C CA    . ARG F 3 82  ? 6.111   -15.718 -22.484 1.00 32.56  ? 82   ARG B CA    1 
ATOM   3689 C C     . ARG F 3 82  ? 5.330   -14.700 -21.645 1.00 32.79  ? 82   ARG B C     1 
ATOM   3690 O O     . ARG F 3 82  ? 4.163   -14.926 -21.309 1.00 32.53  ? 82   ARG B O     1 
ATOM   3691 C CB    . ARG F 3 82  ? 5.496   -15.819 -23.882 1.00 32.14  ? 82   ARG B CB    1 
ATOM   3692 C CG    . ARG F 3 82  ? 6.182   -16.818 -24.810 1.00 28.66  ? 82   ARG B CG    1 
ATOM   3693 C CD    . ARG F 3 82  ? 7.619   -16.416 -25.109 1.00 28.91  ? 82   ARG B CD    1 
ATOM   3694 N NE    . ARG F 3 82  ? 8.244   -17.306 -26.082 1.00 29.00  ? 82   ARG B NE    1 
ATOM   3695 C CZ    . ARG F 3 82  ? 9.533   -17.278 -26.409 1.00 29.19  ? 82   ARG B CZ    1 
ATOM   3696 N NH1   . ARG F 3 82  ? 10.354  -16.397 -25.844 1.00 25.73  ? 82   ARG B NH1   1 
ATOM   3697 N NH2   . ARG F 3 82  ? 10.004  -18.137 -27.296 1.00 26.70  ? 82   ARG B NH2   1 
ATOM   3698 N N     . SER F 3 83  ? 5.978   -13.583 -21.318 1.00 30.28  ? 83   SER B N     1 
ATOM   3699 C CA    . SER F 3 83  ? 5.371   -12.530 -20.500 1.00 27.49  ? 83   SER B CA    1 
ATOM   3700 C C     . SER F 3 83  ? 4.405   -11.626 -21.268 1.00 27.50  ? 83   SER B C     1 
ATOM   3701 O O     . SER F 3 83  ? 3.690   -10.829 -20.671 1.00 24.87  ? 83   SER B O     1 
ATOM   3702 C CB    . SER F 3 83  ? 6.474   -11.656 -19.883 1.00 26.35  ? 83   SER B CB    1 
ATOM   3703 O OG    . SER F 3 83  ? 7.160   -10.932 -20.896 1.00 23.28  ? 83   SER B OG    1 
ATOM   3704 N N     . ALA F 3 84  ? 4.374   -11.742 -22.590 1.00 26.27  ? 84   ALA B N     1 
ATOM   3705 C CA    . ALA F 3 84  ? 3.502   -10.874 -23.359 1.00 24.71  ? 84   ALA B CA    1 
ATOM   3706 C C     . ALA F 3 84  ? 3.373   -11.341 -24.795 1.00 26.41  ? 84   ALA B C     1 
ATOM   3707 O O     . ALA F 3 84  ? 4.078   -12.256 -25.210 1.00 25.59  ? 84   ALA B O     1 
ATOM   3708 C CB    . ALA F 3 84  ? 4.067   -9.475  -23.342 1.00 23.85  ? 84   ALA B CB    1 
ATOM   3709 N N     . TRP F 3 85  ? 2.466   -10.704 -25.540 1.00 23.25  ? 85   TRP B N     1 
ATOM   3710 C CA    . TRP F 3 85  ? 2.274   -11.009 -26.947 1.00 26.13  ? 85   TRP B CA    1 
ATOM   3711 C C     . TRP F 3 85  ? 3.185   -10.083 -27.743 1.00 26.39  ? 85   TRP B C     1 
ATOM   3712 O O     . TRP F 3 85  ? 3.486   -8.970  -27.310 1.00 24.80  ? 85   TRP B O     1 
ATOM   3713 C CB    . TRP F 3 85  ? 0.846   -10.703 -27.416 1.00 29.39  ? 85   TRP B CB    1 
ATOM   3714 C CG    . TRP F 3 85  ? -0.241  -11.448 -26.757 1.00 34.61  ? 85   TRP B CG    1 
ATOM   3715 C CD1   . TRP F 3 85  ? -0.777  -11.206 -25.522 1.00 36.80  ? 85   TRP B CD1   1 
ATOM   3716 C CD2   . TRP F 3 85  ? -0.984  -12.526 -27.316 1.00 38.25  ? 85   TRP B CD2   1 
ATOM   3717 N NE1   . TRP F 3 85  ? -1.816  -12.065 -25.284 1.00 37.53  ? 85   TRP B NE1   1 
ATOM   3718 C CE2   . TRP F 3 85  ? -1.966  -12.889 -26.370 1.00 40.06  ? 85   TRP B CE2   1 
ATOM   3719 C CE3   . TRP F 3 85  ? -0.921  -13.222 -28.531 1.00 40.30  ? 85   TRP B CE3   1 
ATOM   3720 C CZ2   . TRP F 3 85  ? -2.880  -13.919 -26.600 1.00 42.31  ? 85   TRP B CZ2   1 
ATOM   3721 C CZ3   . TRP F 3 85  ? -1.832  -14.247 -28.762 1.00 42.94  ? 85   TRP B CZ3   1 
ATOM   3722 C CH2   . TRP F 3 85  ? -2.798  -14.586 -27.800 1.00 44.40  ? 85   TRP B CH2   1 
ATOM   3723 N N     . VAL F 3 86  ? 3.631   -10.543 -28.906 1.00 25.53  ? 86   VAL B N     1 
ATOM   3724 C CA    . VAL F 3 86  ? 4.425   -9.694  -29.775 1.00 25.52  ? 86   VAL B CA    1 
ATOM   3725 C C     . VAL F 3 86  ? 3.775   -9.809  -31.145 1.00 27.84  ? 86   VAL B C     1 
ATOM   3726 O O     . VAL F 3 86  ? 3.680   -10.907 -31.709 1.00 27.07  ? 86   VAL B O     1 
ATOM   3727 C CB    . VAL F 3 86  ? 5.898   -10.116 -29.851 1.00 24.51  ? 86   VAL B CB    1 
ATOM   3728 C CG1   . VAL F 3 86  ? 6.621   -9.214  -30.840 1.00 20.59  ? 86   VAL B CG1   1 
ATOM   3729 C CG2   . VAL F 3 86  ? 6.550   -10.003 -28.467 1.00 24.98  ? 86   VAL B CG2   1 
ATOM   3730 N N     . ARG F 3 87  ? 3.311   -8.672  -31.659 1.00 29.02  ? 87   ARG B N     1 
ATOM   3731 C CA    . ARG F 3 87  ? 2.630   -8.612  -32.949 1.00 32.75  ? 87   ARG B CA    1 
ATOM   3732 C C     . ARG F 3 87  ? 3.414   -7.766  -33.941 1.00 32.83  ? 87   ARG B C     1 
ATOM   3733 O O     . ARG F 3 87  ? 3.945   -6.711  -33.591 1.00 33.38  ? 87   ARG B O     1 
ATOM   3734 C CB    . ARG F 3 87  ? 1.224   -8.022  -32.743 1.00 34.88  ? 87   ARG B CB    1 
ATOM   3735 C CG    . ARG F 3 87  ? 0.371   -7.876  -33.990 1.00 39.34  ? 87   ARG B CG    1 
ATOM   3736 C CD    . ARG F 3 87  ? -0.954  -7.181  -33.647 1.00 42.16  ? 87   ARG B CD    1 
ATOM   3737 N NE    . ARG F 3 87  ? -1.682  -7.882  -32.589 1.00 47.08  ? 87   ARG B NE    1 
ATOM   3738 C CZ    . ARG F 3 87  ? -2.574  -7.310  -31.778 1.00 48.75  ? 87   ARG B CZ    1 
ATOM   3739 N NH1   . ARG F 3 87  ? -2.854  -6.016  -31.897 1.00 49.51  ? 87   ARG B NH1   1 
ATOM   3740 N NH2   . ARG F 3 87  ? -3.189  -8.030  -30.845 1.00 47.69  ? 87   ARG B NH2   1 
ATOM   3741 N N     . ALA F 3 88  ? 3.502   -8.229  -35.182 1.00 32.39  ? 88   ALA B N     1 
ATOM   3742 C CA    . ALA F 3 88  ? 4.224   -7.473  -36.201 1.00 32.68  ? 88   ALA B CA    1 
ATOM   3743 C C     . ALA F 3 88  ? 3.436   -6.211  -36.572 1.00 32.43  ? 88   ALA B C     1 
ATOM   3744 O O     . ALA F 3 88  ? 2.214   -6.261  -36.704 1.00 32.44  ? 88   ALA B O     1 
ATOM   3745 C CB    . ALA F 3 88  ? 4.445   -8.349  -37.450 1.00 31.71  ? 88   ALA B CB    1 
ATOM   3746 N N     . LYS F 3 89  ? 4.128   -5.081  -36.712 1.00 35.42  ? 89   LYS B N     1 
ATOM   3747 C CA    . LYS F 3 89  ? 3.475   -3.825  -37.100 1.00 38.70  ? 89   LYS B CA    1 
ATOM   3748 C C     . LYS F 3 89  ? 3.629   -3.697  -38.603 1.00 38.48  ? 89   LYS B C     1 
ATOM   3749 O O     . LYS F 3 89  ? 2.686   -3.360  -39.311 1.00 40.88  ? 89   LYS B O     1 
ATOM   3750 C CB    . LYS F 3 89  ? 4.137   -2.611  -36.434 1.00 42.10  ? 89   LYS B CB    1 
ATOM   3751 C CG    . LYS F 3 89  ? 3.846   -2.460  -34.957 1.00 43.83  ? 89   LYS B CG    1 
ATOM   3752 C CD    . LYS F 3 89  ? 4.430   -1.161  -34.408 1.00 46.73  ? 89   LYS B CD    1 
ATOM   3753 C CE    . LYS F 3 89  ? 3.590   0.062   -34.764 1.00 47.86  ? 89   LYS B CE    1 
ATOM   3754 N NZ    . LYS F 3 89  ? 3.616   0.395   -36.209 1.00 53.07  ? 89   LYS B NZ    1 
ATOM   3755 N N     . THR F 3 90  ? 4.848   -3.953  -39.064 1.00 38.01  ? 90   THR B N     1 
ATOM   3756 C CA    . THR F 3 90  ? 5.200   -3.933  -40.479 1.00 37.44  ? 90   THR B CA    1 
ATOM   3757 C C     . THR F 3 90  ? 5.612   -5.377  -40.793 1.00 37.25  ? 90   THR B C     1 
ATOM   3758 O O     . THR F 3 90  ? 5.631   -6.230  -39.897 1.00 35.90  ? 90   THR B O     1 
ATOM   3759 C CB    . THR F 3 90  ? 6.426   -3.034  -40.752 1.00 37.08  ? 90   THR B CB    1 
ATOM   3760 O OG1   . THR F 3 90  ? 7.542   -3.522  -39.997 1.00 37.43  ? 90   THR B OG1   1 
ATOM   3761 C CG2   . THR F 3 90  ? 6.149   -1.592  -40.369 1.00 36.01  ? 90   THR B CG2   1 
ATOM   3762 N N     . ALA F 3 91  ? 5.933   -5.656  -42.052 1.00 34.90  ? 91   ALA B N     1 
ATOM   3763 C CA    . ALA F 3 91  ? 6.370   -6.997  -42.421 1.00 35.79  ? 91   ALA B CA    1 
ATOM   3764 C C     . ALA F 3 91  ? 7.750   -7.152  -41.788 1.00 34.52  ? 91   ALA B C     1 
ATOM   3765 O O     . ALA F 3 91  ? 8.569   -6.238  -41.868 1.00 33.48  ? 91   ALA B O     1 
ATOM   3766 C CB    . ALA F 3 91  ? 6.459   -7.128  -43.943 1.00 34.94  ? 91   ALA B CB    1 
ATOM   3767 N N     . CYS F 3 92  ? 8.015   -8.302  -41.175 1.00 33.16  ? 92   CYS B N     1 
ATOM   3768 C CA    . CYS F 3 92  ? 9.296   -8.511  -40.506 1.00 32.85  ? 92   CYS B CA    1 
ATOM   3769 C C     . CYS F 3 92  ? 10.148  -9.676  -40.987 1.00 32.12  ? 92   CYS B C     1 
ATOM   3770 O O     . CYS F 3 92  ? 9.628   -10.683 -41.465 1.00 30.99  ? 92   CYS B O     1 
ATOM   3771 C CB    . CYS F 3 92  ? 9.068   -8.707  -39.001 1.00 35.26  ? 92   CYS B CB    1 
ATOM   3772 S SG    . CYS F 3 92  ? 8.331   -7.319  -38.137 1.00 42.28  ? 92   CYS B SG    1 
ATOM   3773 N N     . GLU F 3 93  ? 11.463  -9.519  -40.835 1.00 30.49  ? 93   GLU B N     1 
ATOM   3774 C CA    . GLU F 3 93  ? 12.433  -10.565 -41.153 1.00 32.94  ? 93   GLU B CA    1 
ATOM   3775 C C     . GLU F 3 93  ? 13.093  -10.809 -39.801 1.00 31.30  ? 93   GLU B C     1 
ATOM   3776 O O     . GLU F 3 93  ? 13.731  -9.909  -39.243 1.00 30.52  ? 93   GLU B O     1 
ATOM   3777 C CB    . GLU F 3 93  ? 13.497  -10.109 -42.159 1.00 33.28  ? 93   GLU B CB    1 
ATOM   3778 C CG    . GLU F 3 93  ? 14.359  -11.280 -42.640 1.00 38.13  ? 93   GLU B CG    1 
ATOM   3779 C CD    . GLU F 3 93  ? 15.486  -10.865 -43.568 1.00 41.12  ? 93   GLU B CD    1 
ATOM   3780 O OE1   . GLU F 3 93  ? 15.283  -9.936  -44.380 1.00 44.75  ? 93   GLU B OE1   1 
ATOM   3781 O OE2   . GLU F 3 93  ? 16.572  -11.481 -43.495 1.00 41.91  ? 93   GLU B OE2   1 
ATOM   3782 N N     . VAL F 3 94  ? 12.951  -12.020 -39.281 1.00 29.24  ? 94   VAL B N     1 
ATOM   3783 C CA    . VAL F 3 94  ? 13.478  -12.331 -37.965 1.00 29.41  ? 94   VAL B CA    1 
ATOM   3784 C C     . VAL F 3 94  ? 14.357  -13.577 -37.872 1.00 30.16  ? 94   VAL B C     1 
ATOM   3785 O O     . VAL F 3 94  ? 14.040  -14.624 -38.433 1.00 29.93  ? 94   VAL B O     1 
ATOM   3786 C CB    . VAL F 3 94  ? 12.308  -12.487 -36.971 1.00 31.11  ? 94   VAL B CB    1 
ATOM   3787 C CG1   . VAL F 3 94  ? 12.825  -12.481 -35.545 1.00 34.18  ? 94   VAL B CG1   1 
ATOM   3788 C CG2   . VAL F 3 94  ? 11.296  -11.361 -37.182 1.00 34.33  ? 94   VAL B CG2   1 
ATOM   3789 N N     . ALA F 3 95  ? 15.461  -13.450 -37.145 1.00 29.19  ? 95   ALA B N     1 
ATOM   3790 C CA    . ALA F 3 95  ? 16.381  -14.557 -36.926 1.00 29.86  ? 95   ALA B CA    1 
ATOM   3791 C C     . ALA F 3 95  ? 15.879  -15.243 -35.661 1.00 31.33  ? 95   ALA B C     1 
ATOM   3792 O O     . ALA F 3 95  ? 15.523  -14.579 -34.684 1.00 33.49  ? 95   ALA B O     1 
ATOM   3793 C CB    . ALA F 3 95  ? 17.804  -14.034 -36.722 1.00 27.40  ? 95   ALA B CB    1 
ATOM   3794 N N     . GLU F 3 96  ? 15.842  -16.567 -35.674 1.00 30.34  ? 96   GLU B N     1 
ATOM   3795 C CA    . GLU F 3 96  ? 15.353  -17.319 -34.530 1.00 29.98  ? 96   GLU B CA    1 
ATOM   3796 C C     . GLU F 3 96  ? 16.352  -18.407 -34.155 1.00 30.37  ? 96   GLU B C     1 
ATOM   3797 O O     . GLU F 3 96  ? 16.922  -19.068 -35.022 1.00 30.17  ? 96   GLU B O     1 
ATOM   3798 C CB    . GLU F 3 96  ? 13.977  -17.923 -34.868 1.00 30.00  ? 96   GLU B CB    1 
ATOM   3799 C CG    . GLU F 3 96  ? 12.973  -16.863 -35.336 1.00 29.51  ? 96   GLU B CG    1 
ATOM   3800 C CD    . GLU F 3 96  ? 11.578  -17.401 -35.625 1.00 33.85  ? 96   GLU B CD    1 
ATOM   3801 O OE1   . GLU F 3 96  ? 11.286  -18.567 -35.277 1.00 34.40  ? 96   GLU B OE1   1 
ATOM   3802 O OE2   . GLU F 3 96  ? 10.763  -16.638 -36.196 1.00 32.24  ? 96   GLU B OE2   1 
ATOM   3803 N N     . ILE F 3 97  ? 16.570  -18.583 -32.857 1.00 29.55  ? 97   ILE B N     1 
ATOM   3804 C CA    . ILE F 3 97  ? 17.514  -19.581 -32.391 1.00 30.11  ? 97   ILE B CA    1 
ATOM   3805 C C     . ILE F 3 97  ? 17.044  -20.128 -31.056 1.00 31.44  ? 97   ILE B C     1 
ATOM   3806 O O     . ILE F 3 97  ? 16.429  -19.413 -30.269 1.00 31.93  ? 97   ILE B O     1 
ATOM   3807 C CB    . ILE F 3 97  ? 18.938  -18.965 -32.260 1.00 30.83  ? 97   ILE B CB    1 
ATOM   3808 C CG1   . ILE F 3 97  ? 19.956  -20.047 -31.886 1.00 31.87  ? 97   ILE B CG1   1 
ATOM   3809 C CG2   . ILE F 3 97  ? 18.935  -17.858 -31.221 1.00 29.13  ? 97   ILE B CG2   1 
ATOM   3810 C CD1   . ILE F 3 97  ? 21.403  -19.554 -31.905 1.00 30.25  ? 97   ILE B CD1   1 
ATOM   3811 N N     . SER F 3 98  ? 17.312  -21.406 -30.810 1.00 30.53  ? 98   SER B N     1 
ATOM   3812 C CA    . SER F 3 98  ? 16.902  -22.042 -29.563 1.00 30.98  ? 98   SER B CA    1 
ATOM   3813 C C     . SER F 3 98  ? 17.744  -21.539 -28.401 1.00 31.06  ? 98   SER B C     1 
ATOM   3814 O O     . SER F 3 98  ? 18.899  -21.169 -28.593 1.00 31.99  ? 98   SER B O     1 
ATOM   3815 C CB    . SER F 3 98  ? 17.079  -23.550 -29.668 1.00 34.11  ? 98   SER B CB    1 
ATOM   3816 O OG    . SER F 3 98  ? 18.458  -23.856 -29.832 1.00 35.79  ? 98   SER B OG    1 
ATOM   3817 N N     . TYR F 3 99  ? 17.167  -21.528 -27.200 1.00 31.97  ? 99   TYR B N     1 
ATOM   3818 C CA    . TYR F 3 99  ? 17.899  -21.092 -26.014 1.00 33.71  ? 99   TYR B CA    1 
ATOM   3819 C C     . TYR F 3 99  ? 19.126  -21.982 -25.856 1.00 36.04  ? 99   TYR B C     1 
ATOM   3820 O O     . TYR F 3 99  ? 20.223  -21.499 -25.564 1.00 38.12  ? 99   TYR B O     1 
ATOM   3821 C CB    . TYR F 3 99  ? 17.032  -21.205 -24.753 1.00 31.19  ? 99   TYR B CB    1 
ATOM   3822 C CG    . TYR F 3 99  ? 15.967  -20.134 -24.604 1.00 33.35  ? 99   TYR B CG    1 
ATOM   3823 C CD1   . TYR F 3 99  ? 16.074  -18.906 -25.271 1.00 32.12  ? 99   TYR B CD1   1 
ATOM   3824 C CD2   . TYR F 3 99  ? 14.883  -20.323 -23.744 1.00 32.87  ? 99   TYR B CD2   1 
ATOM   3825 C CE1   . TYR F 3 99  ? 15.134  -17.893 -25.078 1.00 32.98  ? 99   TYR B CE1   1 
ATOM   3826 C CE2   . TYR F 3 99  ? 13.938  -19.316 -23.543 1.00 34.69  ? 99   TYR B CE2   1 
ATOM   3827 C CZ    . TYR F 3 99  ? 14.070  -18.102 -24.210 1.00 33.38  ? 99   TYR B CZ    1 
ATOM   3828 O OH    . TYR F 3 99  ? 13.152  -17.091 -23.982 1.00 32.11  ? 99   TYR B OH    1 
ATOM   3829 N N     . LYS F 3 100 ? 18.930  -23.283 -26.058 1.00 36.57  ? 100  LYS B N     1 
ATOM   3830 C CA    . LYS F 3 100 ? 20.013  -24.254 -25.948 1.00 38.88  ? 100  LYS B CA    1 
ATOM   3831 C C     . LYS F 3 100 ? 21.219  -23.848 -26.778 1.00 37.75  ? 100  LYS B C     1 
ATOM   3832 O O     . LYS F 3 100 ? 22.330  -23.753 -26.271 1.00 39.07  ? 100  LYS B O     1 
ATOM   3833 C CB    . LYS F 3 100 ? 19.542  -25.634 -26.406 1.00 41.03  ? 100  LYS B CB    1 
ATOM   3834 C CG    . LYS F 3 100 ? 20.659  -26.668 -26.483 1.00 47.23  ? 100  LYS B CG    1 
ATOM   3835 C CD    . LYS F 3 100 ? 20.206  -27.937 -27.198 1.00 51.13  ? 100  LYS B CD    1 
ATOM   3836 C CE    . LYS F 3 100 ? 21.382  -28.875 -27.462 1.00 52.91  ? 100  LYS B CE    1 
ATOM   3837 N NZ    . LYS F 3 100 ? 22.029  -29.337 -26.195 1.00 54.48  ? 100  LYS B NZ    1 
ATOM   3838 N N     . LYS F 3 101 ? 20.999  -23.603 -28.062 1.00 38.31  ? 101  LYS B N     1 
ATOM   3839 C CA    . LYS F 3 101 ? 22.093  -23.228 -28.934 1.00 38.67  ? 101  LYS B CA    1 
ATOM   3840 C C     . LYS F 3 101 ? 22.671  -21.853 -28.624 1.00 38.04  ? 101  LYS B C     1 
ATOM   3841 O O     . LYS F 3 101 ? 23.870  -21.630 -28.795 1.00 36.78  ? 101  LYS B O     1 
ATOM   3842 C CB    . LYS F 3 101 ? 21.646  -23.281 -30.392 1.00 40.83  ? 101  LYS B CB    1 
ATOM   3843 C CG    . LYS F 3 101 ? 22.805  -23.216 -31.370 1.00 45.08  ? 101  LYS B CG    1 
ATOM   3844 C CD    . LYS F 3 101 ? 23.863  -24.256 -31.006 1.00 49.95  ? 101  LYS B CD    1 
ATOM   3845 C CE    . LYS F 3 101 ? 24.816  -24.533 -32.157 1.00 52.78  ? 101  LYS B CE    1 
ATOM   3846 N NZ    . LYS F 3 101 ? 24.099  -25.166 -33.305 1.00 54.69  ? 101  LYS B NZ    1 
ATOM   3847 N N     . PHE F 3 102 ? 21.824  -20.927 -28.181 1.00 36.31  ? 102  PHE B N     1 
ATOM   3848 C CA    . PHE F 3 102 ? 22.301  -19.588 -27.860 1.00 35.44  ? 102  PHE B CA    1 
ATOM   3849 C C     . PHE F 3 102 ? 23.287  -19.657 -26.701 1.00 36.22  ? 102  PHE B C     1 
ATOM   3850 O O     . PHE F 3 102 ? 24.306  -18.969 -26.703 1.00 35.77  ? 102  PHE B O     1 
ATOM   3851 C CB    . PHE F 3 102 ? 21.142  -18.670 -27.474 1.00 31.38  ? 102  PHE B CB    1 
ATOM   3852 C CG    . PHE F 3 102 ? 21.553  -17.234 -27.258 1.00 29.13  ? 102  PHE B CG    1 
ATOM   3853 C CD1   . PHE F 3 102 ? 21.903  -16.428 -28.334 1.00 26.67  ? 102  PHE B CD1   1 
ATOM   3854 C CD2   . PHE F 3 102 ? 21.571  -16.688 -25.977 1.00 29.73  ? 102  PHE B CD2   1 
ATOM   3855 C CE1   . PHE F 3 102 ? 22.263  -15.090 -28.149 1.00 28.38  ? 102  PHE B CE1   1 
ATOM   3856 C CE2   . PHE F 3 102 ? 21.929  -15.353 -25.771 1.00 28.01  ? 102  PHE B CE2   1 
ATOM   3857 C CZ    . PHE F 3 102 ? 22.276  -14.548 -26.865 1.00 30.27  ? 102  PHE B CZ    1 
ATOM   3858 N N     . ARG F 3 103 ? 22.975  -20.481 -25.707 1.00 38.18  ? 103  ARG B N     1 
ATOM   3859 C CA    . ARG F 3 103 ? 23.855  -20.619 -24.553 1.00 41.40  ? 103  ARG B CA    1 
ATOM   3860 C C     . ARG F 3 103 ? 25.229  -21.107 -25.012 1.00 43.05  ? 103  ARG B C     1 
ATOM   3861 O O     . ARG F 3 103 ? 26.257  -20.678 -24.492 1.00 43.07  ? 103  ARG B O     1 
ATOM   3862 C CB    . ARG F 3 103 ? 23.232  -21.577 -23.532 1.00 42.15  ? 103  ARG B CB    1 
ATOM   3863 C CG    . ARG F 3 103 ? 22.050  -20.961 -22.776 1.00 44.16  ? 103  ARG B CG    1 
ATOM   3864 C CD    . ARG F 3 103 ? 21.164  -22.007 -22.117 1.00 44.28  ? 103  ARG B CD    1 
ATOM   3865 N NE    . ARG F 3 103 ? 19.996  -21.409 -21.467 1.00 45.19  ? 103  ARG B NE    1 
ATOM   3866 C CZ    . ARG F 3 103 ? 18.832  -22.034 -21.304 1.00 44.87  ? 103  ARG B CZ    1 
ATOM   3867 N NH1   . ARG F 3 103 ? 18.686  -23.275 -21.750 1.00 45.61  ? 103  ARG B NH1   1 
ATOM   3868 N NH2   . ARG F 3 103 ? 17.814  -21.426 -20.699 1.00 41.44  ? 103  ARG B NH2   1 
ATOM   3869 N N     . GLN F 3 104 ? 25.239  -21.986 -26.010 1.00 43.82  ? 104  GLN B N     1 
ATOM   3870 C CA    . GLN F 3 104 ? 26.489  -22.502 -26.554 1.00 45.00  ? 104  GLN B CA    1 
ATOM   3871 C C     . GLN F 3 104 ? 27.297  -21.385 -27.214 1.00 44.50  ? 104  GLN B C     1 
ATOM   3872 O O     . GLN F 3 104 ? 28.524  -21.366 -27.129 1.00 44.33  ? 104  GLN B O     1 
ATOM   3873 C CB    . GLN F 3 104 ? 26.205  -23.611 -27.577 1.00 46.20  ? 104  GLN B CB    1 
ATOM   3874 C CG    . GLN F 3 104 ? 26.131  -25.007 -26.979 1.00 47.54  ? 104  GLN B CG    1 
ATOM   3875 C CD    . GLN F 3 104 ? 25.584  -26.040 -27.957 1.00 50.92  ? 104  GLN B CD    1 
ATOM   3876 O OE1   . GLN F 3 104 ? 25.873  -25.998 -29.154 1.00 51.90  ? 104  GLN B OE1   1 
ATOM   3877 N NE2   . GLN F 3 104 ? 24.798  -26.983 -27.443 1.00 50.93  ? 104  GLN B NE2   1 
ATOM   3878 N N     . LEU F 3 105 ? 26.614  -20.456 -27.874 1.00 43.40  ? 105  LEU B N     1 
ATOM   3879 C CA    . LEU F 3 105 ? 27.313  -19.356 -28.528 1.00 44.81  ? 105  LEU B CA    1 
ATOM   3880 C C     . LEU F 3 105 ? 27.891  -18.394 -27.496 1.00 45.31  ? 105  LEU B C     1 
ATOM   3881 O O     . LEU F 3 105 ? 28.962  -17.823 -27.705 1.00 44.86  ? 105  LEU B O     1 
ATOM   3882 C CB    . LEU F 3 105 ? 26.377  -18.596 -29.474 1.00 43.44  ? 105  LEU B CB    1 
ATOM   3883 C CG    . LEU F 3 105 ? 25.785  -19.373 -30.655 1.00 44.30  ? 105  LEU B CG    1 
ATOM   3884 C CD1   . LEU F 3 105 ? 25.025  -18.412 -31.561 1.00 41.58  ? 105  LEU B CD1   1 
ATOM   3885 C CD2   . LEU F 3 105 ? 26.896  -20.064 -31.440 1.00 42.98  ? 105  LEU B CD2   1 
ATOM   3886 N N     . ILE F 3 106 ? 27.177  -18.214 -26.385 1.00 46.24  ? 106  ILE B N     1 
ATOM   3887 C CA    . ILE F 3 106 ? 27.627  -17.323 -25.315 1.00 47.27  ? 106  ILE B CA    1 
ATOM   3888 C C     . ILE F 3 106 ? 28.998  -17.752 -24.796 1.00 48.39  ? 106  ILE B C     1 
ATOM   3889 O O     . ILE F 3 106 ? 29.849  -16.919 -24.482 1.00 46.60  ? 106  ILE B O     1 
ATOM   3890 C CB    . ILE F 3 106 ? 26.630  -17.324 -24.136 1.00 47.18  ? 106  ILE B CB    1 
ATOM   3891 C CG1   . ILE F 3 106 ? 25.339  -16.617 -24.553 1.00 47.66  ? 106  ILE B CG1   1 
ATOM   3892 C CG2   . ILE F 3 106 ? 27.252  -16.642 -22.915 1.00 46.84  ? 106  ILE B CG2   1 
ATOM   3893 C CD1   . ILE F 3 106 ? 24.274  -16.623 -23.481 1.00 46.32  ? 106  ILE B CD1   1 
ATOM   3894 N N     . GLN F 3 107 ? 29.200  -19.062 -24.711 1.00 50.77  ? 107  GLN B N     1 
ATOM   3895 C CA    . GLN F 3 107 ? 30.461  -19.616 -24.237 1.00 53.97  ? 107  GLN B CA    1 
ATOM   3896 C C     . GLN F 3 107 ? 31.664  -19.209 -25.085 1.00 54.21  ? 107  GLN B C     1 
ATOM   3897 O O     . GLN F 3 107 ? 32.655  -18.708 -24.554 1.00 55.97  ? 107  GLN B O     1 
ATOM   3898 C CB    . GLN F 3 107 ? 30.381  -21.143 -24.187 1.00 55.18  ? 107  GLN B CB    1 
ATOM   3899 C CG    . GLN F 3 107 ? 29.524  -21.692 -23.067 1.00 57.99  ? 107  GLN B CG    1 
ATOM   3900 C CD    . GLN F 3 107 ? 29.317  -23.191 -23.185 1.00 61.37  ? 107  GLN B CD    1 
ATOM   3901 O OE1   . GLN F 3 107 ? 30.272  -23.952 -23.361 1.00 63.38  ? 107  GLN B OE1   1 
ATOM   3902 N NE2   . GLN F 3 107 ? 28.064  -23.625 -23.085 1.00 61.60  ? 107  GLN B NE2   1 
ATOM   3903 N N     . VAL F 3 108 ? 31.583  -19.415 -26.397 1.00 53.69  ? 108  VAL B N     1 
ATOM   3904 C CA    . VAL F 3 108 ? 32.707  -19.084 -27.270 1.00 53.74  ? 108  VAL B CA    1 
ATOM   3905 C C     . VAL F 3 108 ? 32.927  -17.583 -27.417 1.00 54.23  ? 108  VAL B C     1 
ATOM   3906 O O     . VAL F 3 108 ? 34.041  -17.137 -27.692 1.00 54.35  ? 108  VAL B O     1 
ATOM   3907 C CB    . VAL F 3 108 ? 32.547  -19.713 -28.681 1.00 53.69  ? 108  VAL B CB    1 
ATOM   3908 C CG1   . VAL F 3 108 ? 31.966  -21.113 -28.569 1.00 52.65  ? 108  VAL B CG1   1 
ATOM   3909 C CG2   . VAL F 3 108 ? 31.692  -18.840 -29.554 1.00 53.89  ? 108  VAL B CG2   1 
ATOM   3910 N N     . ASN F 3 109 ? 31.868  -16.803 -27.239 1.00 54.06  ? 109  ASN B N     1 
ATOM   3911 C CA    . ASN F 3 109 ? 31.984  -15.356 -27.345 1.00 53.40  ? 109  ASN B CA    1 
ATOM   3912 C C     . ASN F 3 109 ? 30.913  -14.683 -26.501 1.00 52.87  ? 109  ASN B C     1 
ATOM   3913 O O     . ASN F 3 109 ? 29.811  -14.407 -26.973 1.00 52.67  ? 109  ASN B O     1 
ATOM   3914 C CB    . ASN F 3 109 ? 31.873  -14.910 -28.805 1.00 52.89  ? 109  ASN B CB    1 
ATOM   3915 C CG    . ASN F 3 109 ? 32.061  -13.412 -28.968 1.00 54.88  ? 109  ASN B CG    1 
ATOM   3916 O OD1   . ASN F 3 109 ? 32.607  -12.745 -28.087 1.00 55.00  ? 109  ASN B OD1   1 
ATOM   3917 N ND2   . ASN F 3 109 ? 31.623  -12.878 -30.104 1.00 55.50  ? 109  ASN B ND2   1 
ATOM   3918 N N     . PRO F 3 110 ? 31.232  -14.409 -25.228 1.00 51.95  ? 110  PRO B N     1 
ATOM   3919 C CA    . PRO F 3 110 ? 30.304  -13.768 -24.295 1.00 50.51  ? 110  PRO B CA    1 
ATOM   3920 C C     . PRO F 3 110 ? 29.941  -12.324 -24.628 1.00 49.44  ? 110  PRO B C     1 
ATOM   3921 O O     . PRO F 3 110 ? 29.126  -11.715 -23.934 1.00 49.76  ? 110  PRO B O     1 
ATOM   3922 C CB    . PRO F 3 110 ? 31.020  -13.905 -22.953 1.00 51.19  ? 110  PRO B CB    1 
ATOM   3923 C CG    . PRO F 3 110 ? 32.463  -13.820 -23.345 1.00 50.90  ? 110  PRO B CG    1 
ATOM   3924 C CD    . PRO F 3 110 ? 32.513  -14.714 -24.564 1.00 51.82  ? 110  PRO B CD    1 
ATOM   3925 N N     . ASP F 3 111 ? 30.537  -11.765 -25.676 1.00 47.66  ? 111  ASP B N     1 
ATOM   3926 C CA    . ASP F 3 111 ? 30.200  -10.398 -26.049 1.00 45.68  ? 111  ASP B CA    1 
ATOM   3927 C C     . ASP F 3 111 ? 28.790  -10.388 -26.634 1.00 44.52  ? 111  ASP B C     1 
ATOM   3928 O O     . ASP F 3 111 ? 28.170  -9.334  -26.767 1.00 44.12  ? 111  ASP B O     1 
ATOM   3929 C CB    . ASP F 3 111 ? 31.177  -9.838  -27.081 1.00 48.17  ? 111  ASP B CB    1 
ATOM   3930 C CG    . ASP F 3 111 ? 30.832  -8.412  -27.491 1.00 52.57  ? 111  ASP B CG    1 
ATOM   3931 O OD1   . ASP F 3 111 ? 30.795  -7.522  -26.611 1.00 52.88  ? 111  ASP B OD1   1 
ATOM   3932 O OD2   . ASP F 3 111 ? 30.588  -8.177  -28.694 1.00 55.83  ? 111  ASP B OD2   1 
ATOM   3933 N N     . ILE F 3 112 ? 28.284  -11.565 -26.991 1.00 41.57  ? 112  ILE B N     1 
ATOM   3934 C CA    . ILE F 3 112 ? 26.941  -11.644 -27.541 1.00 39.67  ? 112  ILE B CA    1 
ATOM   3935 C C     . ILE F 3 112 ? 25.947  -11.398 -26.407 1.00 37.85  ? 112  ILE B C     1 
ATOM   3936 O O     . ILE F 3 112 ? 24.900  -10.785 -26.615 1.00 36.34  ? 112  ILE B O     1 
ATOM   3937 C CB    . ILE F 3 112 ? 26.667  -13.022 -28.201 1.00 40.57  ? 112  ILE B CB    1 
ATOM   3938 C CG1   . ILE F 3 112 ? 25.288  -13.016 -28.856 1.00 40.39  ? 112  ILE B CG1   1 
ATOM   3939 C CG2   . ILE F 3 112 ? 26.728  -14.126 -27.171 1.00 39.40  ? 112  ILE B CG2   1 
ATOM   3940 C CD1   . ILE F 3 112 ? 25.109  -11.934 -29.889 1.00 43.80  ? 112  ILE B CD1   1 
ATOM   3941 N N     . LEU F 3 113 ? 26.292  -11.861 -25.207 1.00 35.68  ? 113  LEU B N     1 
ATOM   3942 C CA    . LEU F 3 113 ? 25.435  -11.665 -24.038 1.00 36.34  ? 113  LEU B CA    1 
ATOM   3943 C C     . LEU F 3 113 ? 25.444  -10.182 -23.649 1.00 35.93  ? 113  LEU B C     1 
ATOM   3944 O O     . LEU F 3 113 ? 24.432  -9.642  -23.207 1.00 36.99  ? 113  LEU B O     1 
ATOM   3945 C CB    . LEU F 3 113 ? 25.938  -12.493 -22.850 1.00 33.90  ? 113  LEU B CB    1 
ATOM   3946 C CG    . LEU F 3 113 ? 24.925  -12.987 -21.805 1.00 36.56  ? 113  LEU B CG    1 
ATOM   3947 C CD1   . LEU F 3 113 ? 25.567  -12.951 -20.438 1.00 34.47  ? 113  LEU B CD1   1 
ATOM   3948 C CD2   . LEU F 3 113 ? 23.665  -12.147 -21.813 1.00 35.40  ? 113  LEU B CD2   1 
ATOM   3949 N N     . MET F 3 114 ? 26.598  -9.539  -23.819 1.00 34.67  ? 114  MET B N     1 
ATOM   3950 C CA    . MET F 3 114 ? 26.775  -8.126  -23.493 1.00 35.96  ? 114  MET B CA    1 
ATOM   3951 C C     . MET F 3 114 ? 25.799  -7.240  -24.268 1.00 35.01  ? 114  MET B C     1 
ATOM   3952 O O     . MET F 3 114 ? 25.177  -6.340  -23.704 1.00 32.84  ? 114  MET B O     1 
ATOM   3953 C CB    . MET F 3 114 ? 28.212  -7.694  -23.809 1.00 38.08  ? 114  MET B CB    1 
ATOM   3954 C CG    . MET F 3 114 ? 28.625  -6.355  -23.222 1.00 41.39  ? 114  MET B CG    1 
ATOM   3955 S SD    . MET F 3 114 ? 28.950  -6.443  -21.447 1.00 48.84  ? 114  MET B SD    1 
ATOM   3956 C CE    . MET F 3 114 ? 29.115  -4.665  -21.042 1.00 45.83  ? 114  MET B CE    1 
ATOM   3957 N N     . ARG F 3 115 ? 25.685  -7.484  -25.568 1.00 34.40  ? 115  ARG B N     1 
ATOM   3958 C CA    . ARG F 3 115 ? 24.780  -6.709  -26.400 1.00 34.50  ? 115  ARG B CA    1 
ATOM   3959 C C     . ARG F 3 115 ? 23.334  -6.966  -25.973 1.00 34.08  ? 115  ARG B C     1 
ATOM   3960 O O     . ARG F 3 115 ? 22.502  -6.068  -26.014 1.00 30.34  ? 115  ARG B O     1 
ATOM   3961 C CB    . ARG F 3 115 ? 24.955  -7.090  -27.871 1.00 38.92  ? 115  ARG B CB    1 
ATOM   3962 C CG    . ARG F 3 115 ? 26.338  -6.792  -28.436 1.00 45.19  ? 115  ARG B CG    1 
ATOM   3963 C CD    . ARG F 3 115 ? 26.449  -7.306  -29.861 1.00 49.08  ? 115  ARG B CD    1 
ATOM   3964 N NE    . ARG F 3 115 ? 27.731  -6.984  -30.481 1.00 54.94  ? 115  ARG B NE    1 
ATOM   3965 C CZ    . ARG F 3 115 ? 28.087  -7.375  -31.702 1.00 56.19  ? 115  ARG B CZ    1 
ATOM   3966 N NH1   . ARG F 3 115 ? 27.254  -8.105  -32.435 1.00 59.02  ? 115  ARG B NH1   1 
ATOM   3967 N NH2   . ARG F 3 115 ? 29.275  -7.042  -32.190 1.00 56.76  ? 115  ARG B NH2   1 
ATOM   3968 N N     . LEU F 3 116 ? 23.041  -8.198  -25.566 1.00 32.74  ? 116  LEU B N     1 
ATOM   3969 C CA    . LEU F 3 116 ? 21.692  -8.551  -25.129 1.00 30.39  ? 116  LEU B CA    1 
ATOM   3970 C C     . LEU F 3 116 ? 21.377  -7.851  -23.813 1.00 30.26  ? 116  LEU B C     1 
ATOM   3971 O O     . LEU F 3 116 ? 20.297  -7.270  -23.647 1.00 27.08  ? 116  LEU B O     1 
ATOM   3972 C CB    . LEU F 3 116 ? 21.568  -10.074 -24.960 1.00 31.48  ? 116  LEU B CB    1 
ATOM   3973 C CG    . LEU F 3 116 ? 20.304  -10.616 -24.275 1.00 32.42  ? 116  LEU B CG    1 
ATOM   3974 C CD1   . LEU F 3 116 ? 19.071  -10.118 -25.009 1.00 33.73  ? 116  LEU B CD1   1 
ATOM   3975 C CD2   . LEU F 3 116 ? 20.337  -12.143 -24.255 1.00 34.35  ? 116  LEU B CD2   1 
ATOM   3976 N N     . SER F 3 117 ? 22.330  -7.897  -22.885 1.00 27.92  ? 117  SER B N     1 
ATOM   3977 C CA    . SER F 3 117 ? 22.162  -7.269  -21.579 1.00 26.48  ? 117  SER B CA    1 
ATOM   3978 C C     . SER F 3 117 ? 21.955  -5.762  -21.744 1.00 26.69  ? 117  SER B C     1 
ATOM   3979 O O     . SER F 3 117 ? 21.140  -5.155  -21.048 1.00 27.87  ? 117  SER B O     1 
ATOM   3980 C CB    . SER F 3 117 ? 23.391  -7.538  -20.712 1.00 27.30  ? 117  SER B CB    1 
ATOM   3981 O OG    . SER F 3 117 ? 23.707  -8.922  -20.706 1.00 28.22  ? 117  SER B OG    1 
ATOM   3982 N N     . ALA F 3 118 ? 22.689  -5.160  -22.675 1.00 24.71  ? 118  ALA B N     1 
ATOM   3983 C CA    . ALA F 3 118 ? 22.560  -3.731  -22.922 1.00 24.92  ? 118  ALA B CA    1 
ATOM   3984 C C     . ALA F 3 118 ? 21.121  -3.352  -23.329 1.00 26.66  ? 118  ALA B C     1 
ATOM   3985 O O     . ALA F 3 118 ? 20.616  -2.295  -22.937 1.00 25.32  ? 118  ALA B O     1 
ATOM   3986 C CB    . ALA F 3 118 ? 23.552  -3.301  -24.008 1.00 24.11  ? 118  ALA B CB    1 
ATOM   3987 N N     . GLN F 3 119 ? 20.456  -4.207  -24.107 1.00 23.86  ? 119  GLN B N     1 
ATOM   3988 C CA    . GLN F 3 119 ? 19.080  -3.910  -24.521 1.00 24.84  ? 119  GLN B CA    1 
ATOM   3989 C C     . GLN F 3 119 ? 18.088  -4.087  -23.367 1.00 24.10  ? 119  GLN B C     1 
ATOM   3990 O O     . GLN F 3 119 ? 17.119  -3.320  -23.239 1.00 24.34  ? 119  GLN B O     1 
ATOM   3991 C CB    . GLN F 3 119 ? 18.676  -4.778  -25.729 1.00 24.94  ? 119  GLN B CB    1 
ATOM   3992 C CG    . GLN F 3 119 ? 19.583  -4.541  -26.963 1.00 27.15  ? 119  GLN B CG    1 
ATOM   3993 C CD    . GLN F 3 119 ? 19.055  -5.187  -28.248 1.00 29.97  ? 119  GLN B CD    1 
ATOM   3994 O OE1   . GLN F 3 119 ? 17.959  -5.744  -28.274 1.00 26.87  ? 119  GLN B OE1   1 
ATOM   3995 N NE2   . GLN F 3 119 ? 19.840  -5.101  -29.321 1.00 27.17  ? 119  GLN B NE2   1 
ATOM   3996 N N     . MET F 3 120 ? 18.325  -5.088  -22.523 1.00 23.23  ? 120  MET B N     1 
ATOM   3997 C CA    . MET F 3 120 ? 17.450  -5.308  -21.381 1.00 26.87  ? 120  MET B CA    1 
ATOM   3998 C C     . MET F 3 120 ? 17.578  -4.137  -20.415 1.00 25.92  ? 120  MET B C     1 
ATOM   3999 O O     . MET F 3 120 ? 16.596  -3.731  -19.805 1.00 23.94  ? 120  MET B O     1 
ATOM   4000 C CB    . MET F 3 120 ? 17.780  -6.620  -20.658 1.00 27.88  ? 120  MET B CB    1 
ATOM   4001 C CG    . MET F 3 120 ? 17.344  -7.874  -21.418 1.00 31.55  ? 120  MET B CG    1 
ATOM   4002 S SD    . MET F 3 120 ? 17.418  -9.367  -20.384 1.00 38.01  ? 120  MET B SD    1 
ATOM   4003 C CE    . MET F 3 120 ? 19.170  -9.519  -20.172 1.00 32.49  ? 120  MET B CE    1 
ATOM   4004 N N     . ALA F 3 121 ? 18.788  -3.593  -20.287 1.00 25.93  ? 121  ALA B N     1 
ATOM   4005 C CA    . ALA F 3 121 ? 19.014  -2.447  -19.407 1.00 25.29  ? 121  ALA B CA    1 
ATOM   4006 C C     . ALA F 3 121 ? 18.166  -1.267  -19.895 1.00 25.53  ? 121  ALA B C     1 
ATOM   4007 O O     . ALA F 3 121 ? 17.467  -0.628  -19.109 1.00 24.67  ? 121  ALA B O     1 
ATOM   4008 C CB    . ALA F 3 121 ? 20.509  -2.074  -19.390 1.00 23.50  ? 121  ALA B CB    1 
ATOM   4009 N N     . ARG F 3 122 ? 18.211  -0.993  -21.196 1.00 26.11  ? 122  ARG B N     1 
ATOM   4010 C CA    . ARG F 3 122 ? 17.435  0.106   -21.769 1.00 26.44  ? 122  ARG B CA    1 
ATOM   4011 C C     . ARG F 3 122 ? 15.920  -0.117  -21.624 1.00 26.26  ? 122  ARG B C     1 
ATOM   4012 O O     . ARG F 3 122 ? 15.167  0.826   -21.345 1.00 23.58  ? 122  ARG B O     1 
ATOM   4013 C CB    . ARG F 3 122 ? 17.789  0.295   -23.250 1.00 30.21  ? 122  ARG B CB    1 
ATOM   4014 C CG    . ARG F 3 122 ? 17.025  1.430   -23.934 1.00 31.81  ? 122  ARG B CG    1 
ATOM   4015 C CD    . ARG F 3 122 ? 17.237  2.746   -23.201 1.00 36.97  ? 122  ARG B CD    1 
ATOM   4016 N NE    . ARG F 3 122 ? 18.658  3.055   -23.059 1.00 42.74  ? 122  ARG B NE    1 
ATOM   4017 C CZ    . ARG F 3 122 ? 19.405  3.617   -24.004 1.00 46.25  ? 122  ARG B CZ    1 
ATOM   4018 N NH1   . ARG F 3 122 ? 18.872  3.949   -25.177 1.00 47.62  ? 122  ARG B NH1   1 
ATOM   4019 N NH2   . ARG F 3 122 ? 20.695  3.840   -23.778 1.00 50.33  ? 122  ARG B NH2   1 
ATOM   4020 N N     . ARG F 3 123 ? 15.471  -1.355  -21.813 1.00 25.37  ? 123  ARG B N     1 
ATOM   4021 C CA    . ARG F 3 123 ? 14.045  -1.654  -21.676 1.00 25.12  ? 123  ARG B CA    1 
ATOM   4022 C C     . ARG F 3 123 ? 13.554  -1.471  -20.243 1.00 24.18  ? 123  ARG B C     1 
ATOM   4023 O O     . ARG F 3 123 ? 12.395  -1.090  -20.017 1.00 24.90  ? 123  ARG B O     1 
ATOM   4024 C CB    . ARG F 3 123 ? 13.749  -3.076  -22.154 1.00 26.04  ? 123  ARG B CB    1 
ATOM   4025 C CG    . ARG F 3 123 ? 14.028  -3.234  -23.632 1.00 28.37  ? 123  ARG B CG    1 
ATOM   4026 C CD    . ARG F 3 123 ? 13.950  -4.658  -24.123 1.00 27.19  ? 123  ARG B CD    1 
ATOM   4027 N NE    . ARG F 3 123 ? 14.511  -4.724  -25.473 1.00 28.82  ? 123  ARG B NE    1 
ATOM   4028 C CZ    . ARG F 3 123 ? 14.485  -5.802  -26.252 1.00 27.36  ? 123  ARG B CZ    1 
ATOM   4029 N NH1   . ARG F 3 123 ? 13.915  -6.926  -25.830 1.00 25.22  ? 123  ARG B NH1   1 
ATOM   4030 N NH2   . ARG F 3 123 ? 15.060  -5.757  -27.444 1.00 26.63  ? 123  ARG B NH2   1 
ATOM   4031 N N     . LEU F 3 124 ? 14.421  -1.734  -19.270 1.00 21.69  ? 124  LEU B N     1 
ATOM   4032 C CA    . LEU F 3 124 ? 14.015  -1.575  -17.879 1.00 21.78  ? 124  LEU B CA    1 
ATOM   4033 C C     . LEU F 3 124 ? 13.875  -0.085  -17.557 1.00 21.89  ? 124  LEU B C     1 
ATOM   4034 O O     . LEU F 3 124 ? 12.932  0.318   -16.868 1.00 23.25  ? 124  LEU B O     1 
ATOM   4035 C CB    . LEU F 3 124 ? 15.025  -2.244  -16.928 1.00 25.95  ? 124  LEU B CB    1 
ATOM   4036 C CG    . LEU F 3 124 ? 14.619  -2.227  -15.439 1.00 26.44  ? 124  LEU B CG    1 
ATOM   4037 C CD1   . LEU F 3 124 ? 13.269  -2.909  -15.272 1.00 22.15  ? 124  LEU B CD1   1 
ATOM   4038 C CD2   . LEU F 3 124 ? 15.684  -2.915  -14.582 1.00 26.39  ? 124  LEU B CD2   1 
ATOM   4039 N N     . GLN F 3 125 ? 14.795  0.732   -18.071 1.00 22.81  ? 125  GLN B N     1 
ATOM   4040 C CA    . GLN F 3 125 ? 14.736  2.184   -17.851 1.00 24.89  ? 125  GLN B CA    1 
ATOM   4041 C C     . GLN F 3 125 ? 13.427  2.718   -18.452 1.00 23.74  ? 125  GLN B C     1 
ATOM   4042 O O     . GLN F 3 125 ? 12.701  3.469   -17.810 1.00 22.60  ? 125  GLN B O     1 
ATOM   4043 C CB    . GLN F 3 125 ? 15.918  2.912   -18.531 1.00 24.85  ? 125  GLN B CB    1 
ATOM   4044 C CG    . GLN F 3 125 ? 17.333  2.568   -18.009 1.00 27.08  ? 125  GLN B CG    1 
ATOM   4045 C CD    . GLN F 3 125 ? 18.443  3.218   -18.840 1.00 29.27  ? 125  GLN B CD    1 
ATOM   4046 O OE1   . GLN F 3 125 ? 18.379  3.235   -20.068 1.00 32.56  ? 125  GLN B OE1   1 
ATOM   4047 N NE2   . GLN F 3 125 ? 19.467  3.738   -18.174 1.00 31.28  ? 125  GLN B NE2   1 
ATOM   4048 N N     . VAL F 3 126 ? 13.143  2.321   -19.689 1.00 24.60  ? 126  VAL B N     1 
ATOM   4049 C CA    . VAL F 3 126 ? 11.945  2.756   -20.404 1.00 26.79  ? 126  VAL B CA    1 
ATOM   4050 C C     . VAL F 3 126 ? 10.650  2.314   -19.719 1.00 26.18  ? 126  VAL B C     1 
ATOM   4051 O O     . VAL F 3 126 ? 9.731   3.108   -19.554 1.00 25.94  ? 126  VAL B O     1 
ATOM   4052 C CB    . VAL F 3 126 ? 11.937  2.222   -21.873 1.00 28.88  ? 126  VAL B CB    1 
ATOM   4053 C CG1   . VAL F 3 126 ? 10.558  2.418   -22.500 1.00 29.46  ? 126  VAL B CG1   1 
ATOM   4054 C CG2   . VAL F 3 126 ? 12.993  2.955   -22.705 1.00 28.00  ? 126  VAL B CG2   1 
ATOM   4055 N N     . THR F 3 127 ? 10.579  1.049   -19.320 1.00 26.68  ? 127  THR B N     1 
ATOM   4056 C CA    . THR F 3 127 ? 9.381   0.533   -18.671 1.00 24.75  ? 127  THR B CA    1 
ATOM   4057 C C     . THR F 3 127 ? 9.175   1.162   -17.275 1.00 25.45  ? 127  THR B C     1 
ATOM   4058 O O     . THR F 3 127 ? 8.040   1.354   -16.839 1.00 24.91  ? 127  THR B O     1 
ATOM   4059 C CB    . THR F 3 127 ? 9.448   -1.014  -18.599 1.00 26.29  ? 127  THR B CB    1 
ATOM   4060 O OG1   . THR F 3 127 ? 9.711   -1.530  -19.913 1.00 26.98  ? 127  THR B OG1   1 
ATOM   4061 C CG2   . THR F 3 127 ? 8.138   -1.597  -18.111 1.00 27.98  ? 127  THR B CG2   1 
ATOM   4062 N N     . SER F 3 128 ? 10.262  1.494   -16.586 1.00 23.51  ? 128  SER B N     1 
ATOM   4063 C CA    . SER F 3 128 ? 10.153  2.136   -15.268 1.00 24.43  ? 128  SER B CA    1 
ATOM   4064 C C     . SER F 3 128 ? 9.571   3.543   -15.469 1.00 24.69  ? 128  SER B C     1 
ATOM   4065 O O     . SER F 3 128 ? 8.759   4.026   -14.677 1.00 24.06  ? 128  SER B O     1 
ATOM   4066 C CB    . SER F 3 128 ? 11.527  2.234   -14.593 1.00 23.49  ? 128  SER B CB    1 
ATOM   4067 O OG    . SER F 3 128 ? 12.047  0.949   -14.288 1.00 24.58  ? 128  SER B OG    1 
ATOM   4068 N N     . GLU F 3 129 ? 9.991   4.197   -16.544 1.00 24.85  ? 129  GLU B N     1 
ATOM   4069 C CA    . GLU F 3 129 ? 9.488   5.522   -16.856 1.00 26.18  ? 129  GLU B CA    1 
ATOM   4070 C C     . GLU F 3 129 ? 7.986   5.427   -17.146 1.00 27.36  ? 129  GLU B C     1 
ATOM   4071 O O     . GLU F 3 129 ? 7.205   6.316   -16.764 1.00 25.67  ? 129  GLU B O     1 
ATOM   4072 C CB    . GLU F 3 129 ? 10.220  6.083   -18.073 1.00 28.57  ? 129  GLU B CB    1 
ATOM   4073 C CG    . GLU F 3 129 ? 9.942   7.551   -18.336 1.00 36.71  ? 129  GLU B CG    1 
ATOM   4074 C CD    . GLU F 3 129 ? 10.335  7.955   -19.739 1.00 42.52  ? 129  GLU B CD    1 
ATOM   4075 O OE1   . GLU F 3 129 ? 11.354  7.426   -20.244 1.00 44.70  ? 129  GLU B OE1   1 
ATOM   4076 O OE2   . GLU F 3 129 ? 9.629   8.802   -20.330 1.00 47.42  ? 129  GLU B OE2   1 
ATOM   4077 N N     . LYS F 3 130 ? 7.579   4.350   -17.822 1.00 24.83  ? 130  LYS B N     1 
ATOM   4078 C CA    . LYS F 3 130 ? 6.167   4.160   -18.136 1.00 24.31  ? 130  LYS B CA    1 
ATOM   4079 C C     . LYS F 3 130 ? 5.347   4.012   -16.847 1.00 24.49  ? 130  LYS B C     1 
ATOM   4080 O O     . LYS F 3 130 ? 4.233   4.538   -16.760 1.00 25.44  ? 130  LYS B O     1 
ATOM   4081 C CB    . LYS F 3 130 ? 5.974   2.936   -19.042 1.00 26.32  ? 130  LYS B CB    1 
ATOM   4082 C CG    . LYS F 3 130 ? 4.565   2.801   -19.616 1.00 31.31  ? 130  LYS B CG    1 
ATOM   4083 C CD    . LYS F 3 130 ? 4.424   1.600   -20.562 1.00 35.50  ? 130  LYS B CD    1 
ATOM   4084 C CE    . LYS F 3 130 ? 5.492   1.601   -21.662 1.00 37.33  ? 130  LYS B CE    1 
ATOM   4085 N NZ    . LYS F 3 130 ? 5.406   2.760   -22.608 1.00 39.26  ? 130  LYS B NZ    1 
ATOM   4086 N N     . VAL F 3 131 ? 5.887   3.302   -15.853 1.00 22.39  ? 131  VAL B N     1 
ATOM   4087 C CA    . VAL F 3 131 ? 5.201   3.133   -14.565 1.00 22.38  ? 131  VAL B CA    1 
ATOM   4088 C C     . VAL F 3 131 ? 4.982   4.516   -13.925 1.00 23.41  ? 131  VAL B C     1 
ATOM   4089 O O     . VAL F 3 131 ? 3.890   4.831   -13.434 1.00 23.11  ? 131  VAL B O     1 
ATOM   4090 C CB    . VAL F 3 131 ? 6.035   2.272   -13.569 1.00 25.72  ? 131  VAL B CB    1 
ATOM   4091 C CG1   . VAL F 3 131 ? 5.358   2.273   -12.183 1.00 23.37  ? 131  VAL B CG1   1 
ATOM   4092 C CG2   . VAL F 3 131 ? 6.177   0.838   -14.093 1.00 26.39  ? 131  VAL B CG2   1 
ATOM   4093 N N     . GLY F 3 132 ? 6.027   5.336   -13.930 1.00 22.76  ? 132  GLY B N     1 
ATOM   4094 C CA    . GLY F 3 132 ? 5.915   6.678   -13.374 1.00 22.87  ? 132  GLY B CA    1 
ATOM   4095 C C     . GLY F 3 132 ? 4.829   7.499   -14.059 1.00 24.20  ? 132  GLY B C     1 
ATOM   4096 O O     . GLY F 3 132 ? 4.033   8.181   -13.403 1.00 23.70  ? 132  GLY B O     1 
ATOM   4097 N N     . ASN F 3 133 ? 4.788   7.438   -15.384 1.00 24.00  ? 133  ASN B N     1 
ATOM   4098 C CA    . ASN F 3 133 ? 3.781   8.174   -16.139 1.00 25.34  ? 133  ASN B CA    1 
ATOM   4099 C C     . ASN F 3 133 ? 2.347   7.720   -15.819 1.00 24.89  ? 133  ASN B C     1 
ATOM   4100 O O     . ASN F 3 133 ? 1.441   8.547   -15.708 1.00 24.30  ? 133  ASN B O     1 
ATOM   4101 C CB    . ASN F 3 133 ? 4.044   8.036   -17.643 1.00 27.19  ? 133  ASN B CB    1 
ATOM   4102 C CG    . ASN F 3 133 ? 5.282   8.804   -18.095 1.00 31.42  ? 133  ASN B CG    1 
ATOM   4103 O OD1   . ASN F 3 133 ? 5.647   9.817   -17.500 1.00 33.70  ? 133  ASN B OD1   1 
ATOM   4104 N ND2   . ASN F 3 133 ? 5.922   8.330   -19.156 1.00 31.20  ? 133  ASN B ND2   1 
ATOM   4105 N N     . LEU F 3 134 ? 2.141   6.414   -15.670 1.00 24.04  ? 134  LEU B N     1 
ATOM   4106 C CA    . LEU F 3 134 ? 0.812   5.882   -15.373 1.00 25.31  ? 134  LEU B CA    1 
ATOM   4107 C C     . LEU F 3 134 ? 0.365   6.264   -13.972 1.00 27.06  ? 134  LEU B C     1 
ATOM   4108 O O     . LEU F 3 134 ? -0.819  6.493   -13.724 1.00 29.97  ? 134  LEU B O     1 
ATOM   4109 C CB    . LEU F 3 134 ? 0.790   4.351   -15.511 1.00 24.13  ? 134  LEU B CB    1 
ATOM   4110 C CG    . LEU F 3 134 ? 0.765   3.771   -16.937 1.00 29.02  ? 134  LEU B CG    1 
ATOM   4111 C CD1   . LEU F 3 134 ? 0.967   2.237   -16.902 1.00 25.07  ? 134  LEU B CD1   1 
ATOM   4112 C CD2   . LEU F 3 134 ? -0.577  4.120   -17.598 1.00 24.95  ? 134  LEU B CD2   1 
ATOM   4113 N N     . ALA F 3 135 ? 1.313   6.348   -13.052 1.00 25.65  ? 135  ALA B N     1 
ATOM   4114 C CA    . ALA F 3 135 ? 0.972   6.689   -11.680 1.00 27.61  ? 135  ALA B CA    1 
ATOM   4115 C C     . ALA F 3 135 ? 0.878   8.191   -11.416 1.00 27.63  ? 135  ALA B C     1 
ATOM   4116 O O     . ALA F 3 135 ? 0.029   8.618   -10.635 1.00 27.67  ? 135  ALA B O     1 
ATOM   4117 C CB    . ALA F 3 135 ? 1.990   6.064   -10.724 1.00 25.52  ? 135  ALA B CB    1 
ATOM   4118 N N     . PHE F 3 136 ? 1.719   8.982   -12.086 1.00 26.73  ? 136  PHE B N     1 
ATOM   4119 C CA    . PHE F 3 136 ? 1.777   10.428  -11.850 1.00 29.63  ? 136  PHE B CA    1 
ATOM   4120 C C     . PHE F 3 136 ? 1.068   11.393  -12.809 1.00 31.06  ? 136  PHE B C     1 
ATOM   4121 O O     . PHE F 3 136 ? 0.804   12.531  -12.433 1.00 32.90  ? 136  PHE B O     1 
ATOM   4122 C CB    . PHE F 3 136 ? 3.242   10.894  -11.753 1.00 29.69  ? 136  PHE B CB    1 
ATOM   4123 C CG    . PHE F 3 136 ? 4.079   10.123  -10.755 1.00 28.80  ? 136  PHE B CG    1 
ATOM   4124 C CD1   . PHE F 3 136 ? 3.557   9.742   -9.522  1.00 31.70  ? 136  PHE B CD1   1 
ATOM   4125 C CD2   . PHE F 3 136 ? 5.408   9.814   -11.046 1.00 28.86  ? 136  PHE B CD2   1 
ATOM   4126 C CE1   . PHE F 3 136 ? 4.350   9.059   -8.584  1.00 29.35  ? 136  PHE B CE1   1 
ATOM   4127 C CE2   . PHE F 3 136 ? 6.211   9.136   -10.121 1.00 28.51  ? 136  PHE B CE2   1 
ATOM   4128 C CZ    . PHE F 3 136 ? 5.679   8.759   -8.889  1.00 28.51  ? 136  PHE B CZ    1 
ATOM   4129 N N     . LEU F 3 137 ? 0.764   10.971  -14.029 1.00 29.20  ? 137  LEU B N     1 
ATOM   4130 C CA    . LEU F 3 137 ? 0.121   11.880  -14.979 1.00 29.27  ? 137  LEU B CA    1 
ATOM   4131 C C     . LEU F 3 137 ? -1.323  11.541  -15.316 1.00 28.85  ? 137  LEU B C     1 
ATOM   4132 O O     . LEU F 3 137 ? -1.683  10.365  -15.388 1.00 28.35  ? 137  LEU B O     1 
ATOM   4133 C CB    . LEU F 3 137 ? 0.907   11.900  -16.285 1.00 29.50  ? 137  LEU B CB    1 
ATOM   4134 C CG    . LEU F 3 137 ? 2.393   12.239  -16.213 1.00 34.03  ? 137  LEU B CG    1 
ATOM   4135 C CD1   . LEU F 3 137 ? 3.053   11.952  -17.562 1.00 34.83  ? 137  LEU B CD1   1 
ATOM   4136 C CD2   . LEU F 3 137 ? 2.553   13.707  -15.827 1.00 36.66  ? 137  LEU B CD2   1 
ATOM   4137 N N     . ASP F 3 138 ? -2.149  12.569  -15.529 1.00 26.20  ? 138  ASP B N     1 
ATOM   4138 C CA    . ASP F 3 138 ? -3.531  12.328  -15.932 1.00 26.86  ? 138  ASP B CA    1 
ATOM   4139 C C     . ASP F 3 138 ? -3.468  11.976  -17.428 1.00 24.69  ? 138  ASP B C     1 
ATOM   4140 O O     . ASP F 3 138 ? -2.420  12.119  -18.049 1.00 21.82  ? 138  ASP B O     1 
ATOM   4141 C CB    . ASP F 3 138 ? -4.428  13.554  -15.688 1.00 28.81  ? 138  ASP B CB    1 
ATOM   4142 C CG    . ASP F 3 138 ? -3.893  14.836  -16.323 1.00 34.62  ? 138  ASP B CG    1 
ATOM   4143 O OD1   . ASP F 3 138 ? -3.248  14.785  -17.397 1.00 36.58  ? 138  ASP B OD1   1 
ATOM   4144 O OD2   . ASP F 3 138 ? -4.147  15.918  -15.745 1.00 38.95  ? 138  ASP B OD2   1 
ATOM   4145 N N     . VAL F 3 139 ? -4.575  11.504  -17.991 1.00 24.24  ? 139  VAL B N     1 
ATOM   4146 C CA    . VAL F 3 139 ? -4.607  11.089  -19.389 1.00 25.13  ? 139  VAL B CA    1 
ATOM   4147 C C     . VAL F 3 139 ? -4.169  12.164  -20.384 1.00 25.43  ? 139  VAL B C     1 
ATOM   4148 O O     . VAL F 3 139 ? -3.503  11.864  -21.377 1.00 26.46  ? 139  VAL B O     1 
ATOM   4149 C CB    . VAL F 3 139 ? -6.019  10.573  -19.776 1.00 26.96  ? 139  VAL B CB    1 
ATOM   4150 C CG1   . VAL F 3 139 ? -6.037  10.117  -21.235 1.00 24.88  ? 139  VAL B CG1   1 
ATOM   4151 C CG2   . VAL F 3 139 ? -6.400  9.403   -18.879 1.00 28.76  ? 139  VAL B CG2   1 
ATOM   4152 N N     . THR F 3 140 ? -4.530  13.413  -20.119 1.00 24.22  ? 140  THR B N     1 
ATOM   4153 C CA    . THR F 3 140 ? -4.150  14.489  -21.013 1.00 26.64  ? 140  THR B CA    1 
ATOM   4154 C C     . THR F 3 140 ? -2.631  14.599  -21.072 1.00 27.14  ? 140  THR B C     1 
ATOM   4155 O O     . THR F 3 140 ? -2.056  14.755  -22.152 1.00 28.95  ? 140  THR B O     1 
ATOM   4156 C CB    . THR F 3 140 ? -4.774  15.824  -20.560 1.00 27.45  ? 140  THR B CB    1 
ATOM   4157 O OG1   . THR F 3 140 ? -6.202  15.704  -20.617 1.00 27.05  ? 140  THR B OG1   1 
ATOM   4158 C CG2   . THR F 3 140 ? -4.331  16.973  -21.476 1.00 26.44  ? 140  THR B CG2   1 
ATOM   4159 N N     . GLY F 3 141 ? -1.980  14.480  -19.920 1.00 25.22  ? 141  GLY B N     1 
ATOM   4160 C CA    . GLY F 3 141 ? -0.529  14.562  -19.885 1.00 25.02  ? 141  GLY B CA    1 
ATOM   4161 C C     . GLY F 3 141 ? 0.145   13.367  -20.548 1.00 25.27  ? 141  GLY B C     1 
ATOM   4162 O O     . GLY F 3 141 ? 1.194   13.507  -21.179 1.00 26.35  ? 141  GLY B O     1 
ATOM   4163 N N     . ARG F 3 142 ? -0.443  12.183  -20.412 1.00 23.99  ? 142  ARG B N     1 
ATOM   4164 C CA    . ARG F 3 142 ? 0.155   11.003  -21.023 1.00 23.59  ? 142  ARG B CA    1 
ATOM   4165 C C     . ARG F 3 142 ? 0.014   11.092  -22.541 1.00 24.16  ? 142  ARG B C     1 
ATOM   4166 O O     . ARG F 3 142 ? 0.946   10.763  -23.275 1.00 22.15  ? 142  ARG B O     1 
ATOM   4167 C CB    . ARG F 3 142 ? -0.502  9.715   -20.492 1.00 22.35  ? 142  ARG B CB    1 
ATOM   4168 C CG    . ARG F 3 142 ? -0.377  9.553   -18.979 1.00 26.36  ? 142  ARG B CG    1 
ATOM   4169 C CD    . ARG F 3 142 ? -0.477  8.109   -18.513 1.00 22.94  ? 142  ARG B CD    1 
ATOM   4170 N NE    . ARG F 3 142 ? -1.751  7.457   -18.776 1.00 26.64  ? 142  ARG B NE    1 
ATOM   4171 C CZ    . ARG F 3 142 ? -2.839  7.571   -18.019 1.00 28.29  ? 142  ARG B CZ    1 
ATOM   4172 N NH1   . ARG F 3 142 ? -2.826  8.328   -16.934 1.00 26.88  ? 142  ARG B NH1   1 
ATOM   4173 N NH2   . ARG F 3 142 ? -3.939  6.895   -18.337 1.00 29.60  ? 142  ARG B NH2   1 
ATOM   4174 N N     . ILE F 3 143 ? -1.147  11.553  -23.007 1.00 23.41  ? 143  ILE B N     1 
ATOM   4175 C CA    . ILE F 3 143 ? -1.383  11.686  -24.446 1.00 24.74  ? 143  ILE B CA    1 
ATOM   4176 C C     . ILE F 3 143 ? -0.463  12.723  -25.090 1.00 23.91  ? 143  ILE B C     1 
ATOM   4177 O O     . ILE F 3 143 ? 0.057   12.506  -26.185 1.00 25.66  ? 143  ILE B O     1 
ATOM   4178 C CB    . ILE F 3 143 ? -2.881  12.026  -24.735 1.00 23.03  ? 143  ILE B CB    1 
ATOM   4179 C CG1   . ILE F 3 143 ? -3.743  10.795  -24.437 1.00 24.32  ? 143  ILE B CG1   1 
ATOM   4180 C CG2   . ILE F 3 143 ? -3.073  12.446  -26.188 1.00 26.04  ? 143  ILE B CG2   1 
ATOM   4181 C CD1   . ILE F 3 143 ? -5.250  10.999  -24.639 1.00 22.21  ? 143  ILE B CD1   1 
ATOM   4182 N N     . ALA F 3 144 ? -0.242  13.836  -24.402 1.00 26.76  ? 144  ALA B N     1 
ATOM   4183 C CA    . ALA F 3 144 ? 0.619   14.901  -24.912 1.00 27.32  ? 144  ALA B CA    1 
ATOM   4184 C C     . ALA F 3 144 ? 2.059   14.426  -25.074 1.00 29.89  ? 144  ALA B C     1 
ATOM   4185 O O     . ALA F 3 144 ? 2.707   14.688  -26.096 1.00 29.16  ? 144  ALA B O     1 
ATOM   4186 C CB    . ALA F 3 144 ? 0.575   16.102  -23.973 1.00 26.17  ? 144  ALA B CB    1 
ATOM   4187 N N     . GLN F 3 145 ? 2.566   13.736  -24.058 1.00 30.86  ? 145  GLN B N     1 
ATOM   4188 C CA    . GLN F 3 145 ? 3.931   13.237  -24.113 1.00 32.64  ? 145  GLN B CA    1 
ATOM   4189 C C     . GLN F 3 145 ? 4.094   12.210  -25.233 1.00 31.62  ? 145  GLN B C     1 
ATOM   4190 O O     . GLN F 3 145 ? 5.137   12.153  -25.881 1.00 31.53  ? 145  GLN B O     1 
ATOM   4191 C CB    . GLN F 3 145 ? 4.328   12.603  -22.771 1.00 34.67  ? 145  GLN B CB    1 
ATOM   4192 C CG    . GLN F 3 145 ? 5.623   11.794  -22.853 1.00 41.09  ? 145  GLN B CG    1 
ATOM   4193 C CD    . GLN F 3 145 ? 5.984   11.092  -21.552 1.00 46.64  ? 145  GLN B CD    1 
ATOM   4194 O OE1   . GLN F 3 145 ? 6.686   10.073  -21.559 1.00 50.04  ? 145  GLN B OE1   1 
ATOM   4195 N NE2   . GLN F 3 145 ? 5.521   11.639  -20.428 1.00 46.73  ? 145  GLN B NE2   1 
ATOM   4196 N N     . THR F 3 146 ? 3.068   11.389  -25.440 1.00 29.71  ? 146  THR B N     1 
ATOM   4197 C CA    . THR F 3 146 ? 3.101   10.357  -26.471 1.00 30.00  ? 146  THR B CA    1 
ATOM   4198 C C     . THR F 3 146 ? 3.087   10.975  -27.882 1.00 30.07  ? 146  THR B C     1 
ATOM   4199 O O     . THR F 3 146 ? 3.830   10.551  -28.769 1.00 29.84  ? 146  THR B O     1 
ATOM   4200 C CB    . THR F 3 146 ? 1.895   9.403   -26.319 1.00 30.82  ? 146  THR B CB    1 
ATOM   4201 O OG1   . THR F 3 146 ? 1.969   8.742   -25.048 1.00 30.04  ? 146  THR B OG1   1 
ATOM   4202 C CG2   . THR F 3 146 ? 1.888   8.360   -27.433 1.00 28.97  ? 146  THR B CG2   1 
ATOM   4203 N N     . LEU F 3 147 ? 2.235   11.974  -28.086 1.00 28.58  ? 147  LEU B N     1 
ATOM   4204 C CA    . LEU F 3 147 ? 2.163   12.638  -29.378 1.00 29.32  ? 147  LEU B CA    1 
ATOM   4205 C C     . LEU F 3 147 ? 3.514   13.271  -29.704 1.00 30.72  ? 147  LEU B C     1 
ATOM   4206 O O     . LEU F 3 147 ? 3.995   13.176  -30.831 1.00 28.01  ? 147  LEU B O     1 
ATOM   4207 C CB    . LEU F 3 147 ? 1.065   13.711  -29.374 1.00 28.11  ? 147  LEU B CB    1 
ATOM   4208 C CG    . LEU F 3 147 ? -0.369  13.172  -29.310 1.00 27.85  ? 147  LEU B CG    1 
ATOM   4209 C CD1   . LEU F 3 147 ? -1.372  14.316  -29.260 1.00 29.85  ? 147  LEU B CD1   1 
ATOM   4210 C CD2   . LEU F 3 147 ? -0.616  12.284  -30.512 1.00 26.16  ? 147  LEU B CD2   1 
ATOM   4211 N N     . LEU F 3 148 ? 4.124   13.901  -28.706 1.00 31.52  ? 148  LEU B N     1 
ATOM   4212 C CA    . LEU F 3 148 ? 5.411   14.557  -28.885 1.00 34.96  ? 148  LEU B CA    1 
ATOM   4213 C C     . LEU F 3 148 ? 6.555   13.573  -29.161 1.00 36.07  ? 148  LEU B C     1 
ATOM   4214 O O     . LEU F 3 148 ? 7.412   13.833  -30.008 1.00 33.45  ? 148  LEU B O     1 
ATOM   4215 C CB    . LEU F 3 148 ? 5.729   15.410  -27.655 1.00 38.32  ? 148  LEU B CB    1 
ATOM   4216 C CG    . LEU F 3 148 ? 6.872   16.417  -27.784 1.00 42.21  ? 148  LEU B CG    1 
ATOM   4217 C CD1   . LEU F 3 148 ? 6.706   17.236  -29.061 1.00 45.62  ? 148  LEU B CD1   1 
ATOM   4218 C CD2   . LEU F 3 148 ? 6.884   17.327  -26.563 1.00 44.71  ? 148  LEU B CD2   1 
ATOM   4219 N N     . ASN F 3 149 ? 6.574   12.447  -28.453 1.00 36.76  ? 149  ASN B N     1 
ATOM   4220 C CA    . ASN F 3 149 ? 7.626   11.457  -28.673 1.00 39.27  ? 149  ASN B CA    1 
ATOM   4221 C C     . ASN F 3 149 ? 7.491   10.814  -30.051 1.00 37.67  ? 149  ASN B C     1 
ATOM   4222 O O     . ASN F 3 149 ? 8.488   10.569  -30.731 1.00 36.20  ? 149  ASN B O     1 
ATOM   4223 C CB    . ASN F 3 149 ? 7.600   10.371  -27.589 1.00 41.51  ? 149  ASN B CB    1 
ATOM   4224 C CG    . ASN F 3 149 ? 8.147   10.864  -26.258 1.00 46.14  ? 149  ASN B CG    1 
ATOM   4225 O OD1   . ASN F 3 149 ? 9.036   11.719  -26.218 1.00 47.48  ? 149  ASN B OD1   1 
ATOM   4226 N ND2   . ASN F 3 149 ? 7.631   10.313  -25.163 1.00 47.60  ? 149  ASN B ND2   1 
ATOM   4227 N N     . LEU F 3 150 ? 6.254   10.540  -30.457 1.00 36.22  ? 150  LEU B N     1 
ATOM   4228 C CA    . LEU F 3 150 ? 5.995   9.944   -31.762 1.00 35.72  ? 150  LEU B CA    1 
ATOM   4229 C C     . LEU F 3 150 ? 6.418   10.891  -32.880 1.00 36.22  ? 150  LEU B C     1 
ATOM   4230 O O     . LEU F 3 150 ? 6.923   10.456  -33.916 1.00 35.39  ? 150  LEU B O     1 
ATOM   4231 C CB    . LEU F 3 150 ? 4.509   9.625   -31.917 1.00 34.53  ? 150  LEU B CB    1 
ATOM   4232 C CG    . LEU F 3 150 ? 3.932   8.490   -31.079 1.00 33.24  ? 150  LEU B CG    1 
ATOM   4233 C CD1   . LEU F 3 150 ? 2.432   8.398   -31.314 1.00 33.07  ? 150  LEU B CD1   1 
ATOM   4234 C CD2   . LEU F 3 150 ? 4.614   7.185   -31.453 1.00 34.26  ? 150  LEU B CD2   1 
ATOM   4235 N N     . ALA F 3 151 ? 6.223   12.187  -32.653 1.00 35.34  ? 151  ALA B N     1 
ATOM   4236 C CA    . ALA F 3 151 ? 6.560   13.202  -33.641 1.00 37.58  ? 151  ALA B CA    1 
ATOM   4237 C C     . ALA F 3 151 ? 8.054   13.410  -33.846 1.00 39.77  ? 151  ALA B C     1 
ATOM   4238 O O     . ALA F 3 151 ? 8.458   14.051  -34.818 1.00 38.84  ? 151  ALA B O     1 
ATOM   4239 C CB    . ALA F 3 151 ? 5.906   14.531  -33.274 1.00 36.60  ? 151  ALA B CB    1 
ATOM   4240 N N     . LYS F 3 152 ? 8.879   12.890  -32.942 1.00 41.43  ? 152  LYS B N     1 
ATOM   4241 C CA    . LYS F 3 152 ? 10.315  13.061  -33.101 1.00 43.60  ? 152  LYS B CA    1 
ATOM   4242 C C     . LYS F 3 152 ? 11.027  11.760  -33.435 1.00 44.82  ? 152  LYS B C     1 
ATOM   4243 O O     . LYS F 3 152 ? 12.249  11.669  -33.339 1.00 44.45  ? 152  LYS B O     1 
ATOM   4244 C CB    . LYS F 3 152 ? 10.941  13.712  -31.862 1.00 45.04  ? 152  LYS B CB    1 
ATOM   4245 C CG    . LYS F 3 152 ? 10.604  13.071  -30.540 1.00 49.34  ? 152  LYS B CG    1 
ATOM   4246 C CD    . LYS F 3 152 ? 11.489  13.631  -29.422 1.00 52.67  ? 152  LYS B CD    1 
ATOM   4247 C CE    . LYS F 3 152 ? 11.440  15.159  -29.340 1.00 53.64  ? 152  LYS B CE    1 
ATOM   4248 N NZ    . LYS F 3 152 ? 10.119  15.690  -28.894 1.00 55.41  ? 152  LYS B NZ    1 
ATOM   4249 N N     . GLN F 3 153 ? 10.255  10.757  -33.836 1.00 45.38  ? 153  GLN B N     1 
ATOM   4250 C CA    . GLN F 3 153 ? 10.823  9.477   -34.225 1.00 48.33  ? 153  GLN B CA    1 
ATOM   4251 C C     . GLN F 3 153 ? 11.217  9.584   -35.698 1.00 50.05  ? 153  GLN B C     1 
ATOM   4252 O O     . GLN F 3 153 ? 10.652  10.391  -36.441 1.00 49.60  ? 153  GLN B O     1 
ATOM   4253 C CB    . GLN F 3 153 ? 9.806   8.349   -34.031 1.00 47.92  ? 153  GLN B CB    1 
ATOM   4254 C CG    . GLN F 3 153 ? 9.411   8.126   -32.585 1.00 51.43  ? 153  GLN B CG    1 
ATOM   4255 C CD    . GLN F 3 153 ? 10.615  7.968   -31.678 1.00 52.83  ? 153  GLN B CD    1 
ATOM   4256 O OE1   . GLN F 3 153 ? 11.375  7.008   -31.800 1.00 55.19  ? 153  GLN B OE1   1 
ATOM   4257 N NE2   . GLN F 3 153 ? 10.802  8.920   -30.768 1.00 53.54  ? 153  GLN B NE2   1 
ATOM   4258 N N     . PRO F 3 154 ? 12.188  8.768   -36.142 1.00 51.14  ? 154  PRO B N     1 
ATOM   4259 C CA    . PRO F 3 154 ? 12.643  8.795   -37.537 1.00 51.22  ? 154  PRO B CA    1 
ATOM   4260 C C     . PRO F 3 154 ? 11.537  8.646   -38.582 1.00 51.67  ? 154  PRO B C     1 
ATOM   4261 O O     . PRO F 3 154 ? 11.618  9.236   -39.664 1.00 50.85  ? 154  PRO B O     1 
ATOM   4262 C CB    . PRO F 3 154 ? 13.655  7.649   -37.589 1.00 52.00  ? 154  PRO B CB    1 
ATOM   4263 C CG    . PRO F 3 154 ? 13.126  6.689   -36.561 1.00 52.65  ? 154  PRO B CG    1 
ATOM   4264 C CD    . PRO F 3 154 ? 12.783  7.627   -35.425 1.00 50.83  ? 154  PRO B CD    1 
ATOM   4265 N N     . ASP F 3 155 ? 10.507  7.864   -38.262 1.00 51.87  ? 155  ASP B N     1 
ATOM   4266 C CA    . ASP F 3 155 ? 9.408   7.650   -39.200 1.00 51.49  ? 155  ASP B CA    1 
ATOM   4267 C C     . ASP F 3 155 ? 8.353   8.755   -39.187 1.00 51.14  ? 155  ASP B C     1 
ATOM   4268 O O     . ASP F 3 155 ? 7.254   8.576   -39.716 1.00 50.75  ? 155  ASP B O     1 
ATOM   4269 C CB    . ASP F 3 155 ? 8.730   6.297   -38.949 1.00 53.91  ? 155  ASP B CB    1 
ATOM   4270 C CG    . ASP F 3 155 ? 8.120   6.186   -37.563 1.00 56.89  ? 155  ASP B CG    1 
ATOM   4271 O OD1   . ASP F 3 155 ? 7.395   7.115   -37.148 1.00 58.58  ? 155  ASP B OD1   1 
ATOM   4272 O OD2   . ASP F 3 155 ? 8.355   5.154   -36.895 1.00 59.68  ? 155  ASP B OD2   1 
ATOM   4273 N N     . ALA F 3 156 ? 8.684   9.890   -38.580 1.00 49.08  ? 156  ALA B N     1 
ATOM   4274 C CA    . ALA F 3 156 ? 7.761   11.017  -38.533 1.00 48.41  ? 156  ALA B CA    1 
ATOM   4275 C C     . ALA F 3 156 ? 7.904   11.785  -39.841 1.00 47.59  ? 156  ALA B C     1 
ATOM   4276 O O     . ALA F 3 156 ? 8.992   11.864  -40.407 1.00 47.97  ? 156  ALA B O     1 
ATOM   4277 C CB    . ALA F 3 156 ? 8.087   11.921  -37.350 1.00 47.31  ? 156  ALA B CB    1 
ATOM   4278 N N     . MET F 3 157 ? 6.807   12.353  -40.320 1.00 47.51  ? 157  MET B N     1 
ATOM   4279 C CA    . MET F 3 157 ? 6.828   13.098  -41.569 1.00 47.79  ? 157  MET B CA    1 
ATOM   4280 C C     . MET F 3 157 ? 6.999   14.595  -41.352 1.00 47.02  ? 157  MET B C     1 
ATOM   4281 O O     . MET F 3 157 ? 6.520   15.158  -40.359 1.00 45.18  ? 157  MET B O     1 
ATOM   4282 C CB    . MET F 3 157 ? 5.539   12.832  -42.348 1.00 49.61  ? 157  MET B CB    1 
ATOM   4283 C CG    . MET F 3 157 ? 5.312   11.365  -42.671 1.00 53.71  ? 157  MET B CG    1 
ATOM   4284 S SD    . MET F 3 157 ? 3.591   10.977  -43.088 1.00 60.49  ? 157  MET B SD    1 
ATOM   4285 C CE    . MET F 3 157 ? 2.958   10.501  -41.476 1.00 57.51  ? 157  MET B CE    1 
ATOM   4286 N N     . THR F 3 158 ? 7.700   15.231  -42.287 1.00 45.49  ? 158  THR B N     1 
ATOM   4287 C CA    . THR F 3 158 ? 7.925   16.667  -42.237 1.00 44.26  ? 158  THR B CA    1 
ATOM   4288 C C     . THR F 3 158 ? 6.635   17.356  -42.654 1.00 43.31  ? 158  THR B C     1 
ATOM   4289 O O     . THR F 3 158 ? 5.893   16.855  -43.489 1.00 44.60  ? 158  THR B O     1 
ATOM   4290 C CB    . THR F 3 158 ? 9.045   17.098  -43.205 1.00 45.23  ? 158  THR B CB    1 
ATOM   4291 O OG1   . THR F 3 158 ? 8.795   16.533  -44.498 1.00 45.33  ? 158  THR B OG1   1 
ATOM   4292 C CG2   . THR F 3 158 ? 10.410  16.633  -42.695 1.00 45.01  ? 158  THR B CG2   1 
ATOM   4293 N N     . HIS F 3 159 ? 6.368   18.509  -42.065 1.00 42.88  ? 159  HIS B N     1 
ATOM   4294 C CA    . HIS F 3 159 ? 5.167   19.256  -42.379 1.00 42.33  ? 159  HIS B CA    1 
ATOM   4295 C C     . HIS F 3 159 ? 5.544   20.710  -42.144 1.00 42.37  ? 159  HIS B C     1 
ATOM   4296 O O     . HIS F 3 159 ? 6.303   21.018  -41.224 1.00 43.79  ? 159  HIS B O     1 
ATOM   4297 C CB    . HIS F 3 159 ? 4.032   18.805  -41.448 1.00 40.98  ? 159  HIS B CB    1 
ATOM   4298 C CG    . HIS F 3 159 ? 2.702   19.426  -41.747 1.00 37.73  ? 159  HIS B CG    1 
ATOM   4299 N ND1   . HIS F 3 159 ? 2.377   20.712  -41.371 1.00 38.02  ? 159  HIS B ND1   1 
ATOM   4300 C CD2   . HIS F 3 159 ? 1.601   18.922  -42.355 1.00 35.89  ? 159  HIS B CD2   1 
ATOM   4301 C CE1   . HIS F 3 159 ? 1.133   20.973  -41.734 1.00 37.75  ? 159  HIS B CE1   1 
ATOM   4302 N NE2   . HIS F 3 159 ? 0.640   19.903  -42.333 1.00 35.82  ? 159  HIS B NE2   1 
ATOM   4303 N N     . PRO F 3 160 ? 5.040   21.623  -42.983 1.00 42.19  ? 160  PRO B N     1 
ATOM   4304 C CA    . PRO F 3 160 ? 5.372   23.041  -42.810 1.00 42.06  ? 160  PRO B CA    1 
ATOM   4305 C C     . PRO F 3 160 ? 5.043   23.651  -41.449 1.00 41.59  ? 160  PRO B C     1 
ATOM   4306 O O     . PRO F 3 160 ? 5.652   24.648  -41.061 1.00 42.64  ? 160  PRO B O     1 
ATOM   4307 C CB    . PRO F 3 160 ? 4.615   23.718  -43.959 1.00 41.74  ? 160  PRO B CB    1 
ATOM   4308 C CG    . PRO F 3 160 ? 3.475   22.768  -44.235 1.00 42.99  ? 160  PRO B CG    1 
ATOM   4309 C CD    . PRO F 3 160 ? 4.149   21.426  -44.137 1.00 41.65  ? 160  PRO B CD    1 
ATOM   4310 N N     . ASP F 3 161 ? 4.092   23.071  -40.721 1.00 38.75  ? 161  ASP B N     1 
ATOM   4311 C CA    . ASP F 3 161 ? 3.729   23.623  -39.418 1.00 39.62  ? 161  ASP B CA    1 
ATOM   4312 C C     . ASP F 3 161 ? 4.384   22.868  -38.257 1.00 37.61  ? 161  ASP B C     1 
ATOM   4313 O O     . ASP F 3 161 ? 4.194   23.217  -37.091 1.00 37.54  ? 161  ASP B O     1 
ATOM   4314 C CB    . ASP F 3 161 ? 2.200   23.628  -39.239 1.00 41.26  ? 161  ASP B CB    1 
ATOM   4315 C CG    . ASP F 3 161 ? 1.473   24.346  -40.378 1.00 44.08  ? 161  ASP B CG    1 
ATOM   4316 O OD1   . ASP F 3 161 ? 2.045   25.309  -40.928 1.00 45.18  ? 161  ASP B OD1   1 
ATOM   4317 O OD2   . ASP F 3 161 ? 0.327   23.957  -40.712 1.00 43.78  ? 161  ASP B OD2   1 
ATOM   4318 N N     . GLY F 3 162 ? 5.157   21.840  -38.586 1.00 36.49  ? 162  GLY B N     1 
ATOM   4319 C CA    . GLY F 3 162 ? 5.822   21.049  -37.567 1.00 37.22  ? 162  GLY B CA    1 
ATOM   4320 C C     . GLY F 3 162 ? 6.096   19.640  -38.057 1.00 37.90  ? 162  GLY B C     1 
ATOM   4321 O O     . GLY F 3 162 ? 6.789   19.449  -39.055 1.00 40.80  ? 162  GLY B O     1 
ATOM   4322 N N     . MET F 3 163 ? 5.548   18.648  -37.368 1.00 37.35  ? 163  MET B N     1 
ATOM   4323 C CA    . MET F 3 163 ? 5.753   17.261  -37.759 1.00 37.75  ? 163  MET B CA    1 
ATOM   4324 C C     . MET F 3 163 ? 4.399   16.551  -37.865 1.00 36.30  ? 163  MET B C     1 
ATOM   4325 O O     . MET F 3 163 ? 3.426   16.938  -37.218 1.00 36.38  ? 163  MET B O     1 
ATOM   4326 C CB    . MET F 3 163 ? 6.668   16.569  -36.745 1.00 40.28  ? 163  MET B CB    1 
ATOM   4327 C CG    . MET F 3 163 ? 7.749   15.685  -37.359 1.00 47.24  ? 163  MET B CG    1 
ATOM   4328 S SD    . MET F 3 163 ? 9.016   16.554  -38.347 1.00 47.67  ? 163  MET B SD    1 
ATOM   4329 C CE    . MET F 3 163 ? 10.158  17.087  -37.061 1.00 49.82  ? 163  MET B CE    1 
ATOM   4330 N N     . GLN F 3 164 ? 4.340   15.512  -38.687 1.00 35.18  ? 164  GLN B N     1 
ATOM   4331 C CA    . GLN F 3 164 ? 3.096   14.791  -38.901 1.00 33.71  ? 164  GLN B CA    1 
ATOM   4332 C C     . GLN F 3 164 ? 3.193   13.304  -38.605 1.00 32.92  ? 164  GLN B C     1 
ATOM   4333 O O     . GLN F 3 164 ? 4.173   12.660  -38.980 1.00 32.07  ? 164  GLN B O     1 
ATOM   4334 C CB    . GLN F 3 164 ? 2.663   14.974  -40.352 1.00 35.56  ? 164  GLN B CB    1 
ATOM   4335 C CG    . GLN F 3 164 ? 1.348   14.314  -40.713 1.00 35.82  ? 164  GLN B CG    1 
ATOM   4336 C CD    . GLN F 3 164 ? 1.081   14.372  -42.207 1.00 39.33  ? 164  GLN B CD    1 
ATOM   4337 O OE1   . GLN F 3 164 ? 1.386   13.425  -42.937 1.00 37.02  ? 164  GLN B OE1   1 
ATOM   4338 N NE2   . GLN F 3 164 ? 0.532   15.486  -42.672 1.00 41.15  ? 164  GLN B NE2   1 
ATOM   4339 N N     . ILE F 3 165 ? 2.173   12.765  -37.936 1.00 29.40  ? 165  ILE B N     1 
ATOM   4340 C CA    . ILE F 3 165 ? 2.125   11.338  -37.626 1.00 28.46  ? 165  ILE B CA    1 
ATOM   4341 C C     . ILE F 3 165 ? 0.751   10.771  -37.969 1.00 28.62  ? 165  ILE B C     1 
ATOM   4342 O O     . ILE F 3 165 ? -0.227  11.511  -38.157 1.00 24.67  ? 165  ILE B O     1 
ATOM   4343 C CB    . ILE F 3 165 ? 2.390   11.045  -36.126 1.00 29.73  ? 165  ILE B CB    1 
ATOM   4344 C CG1   . ILE F 3 165 ? 1.307   11.703  -35.270 1.00 30.06  ? 165  ILE B CG1   1 
ATOM   4345 C CG2   . ILE F 3 165 ? 3.780   11.540  -35.727 1.00 28.43  ? 165  ILE B CG2   1 
ATOM   4346 C CD1   . ILE F 3 165 ? 1.457   11.450  -33.788 1.00 31.63  ? 165  ILE B CD1   1 
ATOM   4347 N N     . LYS F 3 166 ? 0.684   9.449   -38.046 1.00 30.31  ? 166  LYS B N     1 
ATOM   4348 C CA    . LYS F 3 166 ? -0.560  8.764   -38.351 1.00 32.91  ? 166  LYS B CA    1 
ATOM   4349 C C     . LYS F 3 166 ? -0.776  7.664   -37.335 1.00 32.93  ? 166  LYS B C     1 
ATOM   4350 O O     . LYS F 3 166 ? 0.070   6.786   -37.155 1.00 33.09  ? 166  LYS B O     1 
ATOM   4351 C CB    . LYS F 3 166 ? -0.517  8.200   -39.769 1.00 37.29  ? 166  LYS B CB    1 
ATOM   4352 C CG    . LYS F 3 166 ? -0.409  9.292   -40.820 1.00 40.19  ? 166  LYS B CG    1 
ATOM   4353 C CD    . LYS F 3 166 ? -0.735  8.779   -42.212 1.00 45.61  ? 166  LYS B CD    1 
ATOM   4354 C CE    . LYS F 3 166 ? -0.800  9.933   -43.202 1.00 46.81  ? 166  LYS B CE    1 
ATOM   4355 N NZ    . LYS F 3 166 ? -1.499  9.529   -44.450 1.00 51.94  ? 166  LYS B NZ    1 
ATOM   4356 N N     . ILE F 3 167 ? -1.919  7.718   -36.667 1.00 31.72  ? 167  ILE B N     1 
ATOM   4357 C CA    . ILE F 3 167 ? -2.226  6.751   -35.632 1.00 30.16  ? 167  ILE B CA    1 
ATOM   4358 C C     . ILE F 3 167 ? -3.706  6.885   -35.273 1.00 29.44  ? 167  ILE B C     1 
ATOM   4359 O O     . ILE F 3 167 ? -4.284  7.963   -35.418 1.00 28.66  ? 167  ILE B O     1 
ATOM   4360 C CB    . ILE F 3 167 ? -1.304  7.030   -34.405 1.00 32.67  ? 167  ILE B CB    1 
ATOM   4361 C CG1   . ILE F 3 167 ? -1.512  5.980   -33.314 1.00 33.76  ? 167  ILE B CG1   1 
ATOM   4362 C CG2   . ILE F 3 167 ? -1.554  8.442   -33.876 1.00 32.35  ? 167  ILE B CG2   1 
ATOM   4363 C CD1   . ILE F 3 167 ? -0.384  5.969   -32.304 1.00 32.40  ? 167  ILE B CD1   1 
ATOM   4364 N N     . THR F 3 168 ? -4.333  5.797   -34.836 1.00 27.47  ? 168  THR B N     1 
ATOM   4365 C CA    . THR F 3 168 ? -5.748  5.852   -34.475 1.00 26.09  ? 168  THR B CA    1 
ATOM   4366 C C     . THR F 3 168 ? -5.905  6.248   -33.014 1.00 26.75  ? 168  THR B C     1 
ATOM   4367 O O     . THR F 3 168 ? -4.962  6.152   -32.231 1.00 23.79  ? 168  THR B O     1 
ATOM   4368 C CB    . THR F 3 168 ? -6.455  4.490   -34.655 1.00 28.77  ? 168  THR B CB    1 
ATOM   4369 O OG1   . THR F 3 168 ? -5.743  3.482   -33.921 1.00 30.13  ? 168  THR B OG1   1 
ATOM   4370 C CG2   . THR F 3 168 ? -6.539  4.107   -36.138 1.00 28.57  ? 168  THR B CG2   1 
ATOM   4371 N N     . ARG F 3 169 ? -7.103  6.698   -32.662 1.00 24.29  ? 169  ARG B N     1 
ATOM   4372 C CA    . ARG F 3 169 ? -7.405  7.080   -31.297 1.00 25.87  ? 169  ARG B CA    1 
ATOM   4373 C C     . ARG F 3 169 ? -7.392  5.807   -30.449 1.00 26.08  ? 169  ARG B C     1 
ATOM   4374 O O     . ARG F 3 169 ? -7.036  5.837   -29.276 1.00 27.61  ? 169  ARG B O     1 
ATOM   4375 C CB    . ARG F 3 169 ? -8.774  7.779   -31.254 1.00 25.58  ? 169  ARG B CB    1 
ATOM   4376 C CG    . ARG F 3 169 ? -8.733  9.157   -31.951 1.00 26.86  ? 169  ARG B CG    1 
ATOM   4377 C CD    . ARG F 3 169 ? -10.075 9.633   -32.537 1.00 27.77  ? 169  ARG B CD    1 
ATOM   4378 N NE    . ARG F 3 169 ? -9.862  10.847  -33.339 1.00 28.82  ? 169  ARG B NE    1 
ATOM   4379 C CZ    . ARG F 3 169 ? -9.173  10.880  -34.480 1.00 31.33  ? 169  ARG B CZ    1 
ATOM   4380 N NH1   . ARG F 3 169 ? -8.639  9.764   -34.980 1.00 28.64  ? 169  ARG B NH1   1 
ATOM   4381 N NH2   . ARG F 3 169 ? -8.965  12.040  -35.098 1.00 29.84  ? 169  ARG B NH2   1 
ATOM   4382 N N     . GLN F 3 170 ? -7.772  4.686   -31.056 1.00 27.68  ? 170  GLN B N     1 
ATOM   4383 C CA    . GLN F 3 170 ? -7.775  3.408   -30.353 1.00 29.49  ? 170  GLN B CA    1 
ATOM   4384 C C     . GLN F 3 170 ? -6.345  2.994   -29.979 1.00 27.35  ? 170  GLN B C     1 
ATOM   4385 O O     . GLN F 3 170 ? -6.115  2.532   -28.868 1.00 28.19  ? 170  GLN B O     1 
ATOM   4386 C CB    . GLN F 3 170 ? -8.436  2.314   -31.206 1.00 31.93  ? 170  GLN B CB    1 
ATOM   4387 C CG    . GLN F 3 170 ? -9.908  2.598   -31.539 1.00 41.09  ? 170  GLN B CG    1 
ATOM   4388 C CD    . GLN F 3 170 ? -10.604 1.436   -32.242 1.00 43.74  ? 170  GLN B CD    1 
ATOM   4389 O OE1   . GLN F 3 170 ? -10.050 0.829   -33.157 1.00 44.86  ? 170  GLN B OE1   1 
ATOM   4390 N NE2   . GLN F 3 170 ? -11.825 1.134   -31.821 1.00 46.63  ? 170  GLN B NE2   1 
ATOM   4391 N N     . GLU F 3 171 ? -5.382  3.166   -30.886 1.00 26.65  ? 171  GLU B N     1 
ATOM   4392 C CA    . GLU F 3 171 ? -3.997  2.792   -30.563 1.00 26.53  ? 171  GLU B CA    1 
ATOM   4393 C C     . GLU F 3 171 ? -3.373  3.719   -29.518 1.00 26.23  ? 171  GLU B C     1 
ATOM   4394 O O     . GLU F 3 171 ? -2.615  3.269   -28.655 1.00 25.35  ? 171  GLU B O     1 
ATOM   4395 C CB    . GLU F 3 171 ? -3.109  2.758   -31.812 1.00 29.87  ? 171  GLU B CB    1 
ATOM   4396 C CG    . GLU F 3 171 ? -1.627  2.494   -31.486 1.00 34.91  ? 171  GLU B CG    1 
ATOM   4397 C CD    . GLU F 3 171 ? -0.898  1.689   -32.556 1.00 39.19  ? 171  GLU B CD    1 
ATOM   4398 O OE1   . GLU F 3 171 ? -1.222  1.833   -33.756 1.00 40.74  ? 171  GLU B OE1   1 
ATOM   4399 O OE2   . GLU F 3 171 ? 0.019   0.919   -32.196 1.00 42.06  ? 171  GLU B OE2   1 
ATOM   4400 N N     . ILE F 3 172 ? -3.668  5.014   -29.594 1.00 24.45  ? 172  ILE B N     1 
ATOM   4401 C CA    . ILE F 3 172 ? -3.137  5.925   -28.597 1.00 25.19  ? 172  ILE B CA    1 
ATOM   4402 C C     . ILE F 3 172 ? -3.691  5.429   -27.257 1.00 24.37  ? 172  ILE B C     1 
ATOM   4403 O O     . ILE F 3 172 ? -2.983  5.393   -26.258 1.00 25.00  ? 172  ILE B O     1 
ATOM   4404 C CB    . ILE F 3 172 ? -3.593  7.387   -28.850 1.00 26.16  ? 172  ILE B CB    1 
ATOM   4405 C CG1   . ILE F 3 172 ? -2.779  7.988   -30.006 1.00 26.83  ? 172  ILE B CG1   1 
ATOM   4406 C CG2   . ILE F 3 172 ? -3.400  8.229   -27.575 1.00 23.09  ? 172  ILE B CG2   1 
ATOM   4407 C CD1   . ILE F 3 172 ? -3.331  9.324   -30.522 1.00 26.53  ? 172  ILE B CD1   1 
ATOM   4408 N N     . GLY F 3 173 ? -4.958  5.031   -27.257 1.00 24.82  ? 173  GLY B N     1 
ATOM   4409 C CA    . GLY F 3 173 ? -5.578  4.520   -26.044 1.00 24.70  ? 173  GLY B CA    1 
ATOM   4410 C C     . GLY F 3 173 ? -4.874  3.282   -25.494 1.00 25.08  ? 173  GLY B C     1 
ATOM   4411 O O     . GLY F 3 173 ? -4.794  3.100   -24.276 1.00 24.47  ? 173  GLY B O     1 
ATOM   4412 N N     . GLN F 3 174 ? -4.356  2.435   -26.379 1.00 24.25  ? 174  GLN B N     1 
ATOM   4413 C CA    . GLN F 3 174 ? -3.662  1.226   -25.944 1.00 27.42  ? 174  GLN B CA    1 
ATOM   4414 C C     . GLN F 3 174 ? -2.264  1.562   -25.417 1.00 27.03  ? 174  GLN B C     1 
ATOM   4415 O O     . GLN F 3 174 ? -1.674  0.802   -24.644 1.00 25.58  ? 174  GLN B O     1 
ATOM   4416 C CB    . GLN F 3 174 ? -3.577  0.224   -27.100 1.00 26.54  ? 174  GLN B CB    1 
ATOM   4417 C CG    . GLN F 3 174 ? -4.951  -0.166  -27.638 1.00 31.37  ? 174  GLN B CG    1 
ATOM   4418 C CD    . GLN F 3 174 ? -4.881  -1.004  -28.902 1.00 33.34  ? 174  GLN B CD    1 
ATOM   4419 O OE1   . GLN F 3 174 ? -4.085  -0.730  -29.803 1.00 34.28  ? 174  GLN B OE1   1 
ATOM   4420 N NE2   . GLN F 3 174 ? -5.726  -2.018  -28.980 1.00 31.82  ? 174  GLN B NE2   1 
ATOM   4421 N N     . ILE F 3 175 ? -1.739  2.706   -25.836 1.00 26.18  ? 175  ILE B N     1 
ATOM   4422 C CA    . ILE F 3 175 ? -0.431  3.139   -25.377 1.00 26.05  ? 175  ILE B CA    1 
ATOM   4423 C C     . ILE F 3 175 ? -0.542  3.830   -24.009 1.00 27.13  ? 175  ILE B C     1 
ATOM   4424 O O     . ILE F 3 175 ? 0.250   3.537   -23.111 1.00 25.52  ? 175  ILE B O     1 
ATOM   4425 C CB    . ILE F 3 175 ? 0.232   4.137   -26.373 1.00 26.45  ? 175  ILE B CB    1 
ATOM   4426 C CG1   . ILE F 3 175 ? 0.578   3.438   -27.691 1.00 24.75  ? 175  ILE B CG1   1 
ATOM   4427 C CG2   . ILE F 3 175 ? 1.496   4.717   -25.763 1.00 26.36  ? 175  ILE B CG2   1 
ATOM   4428 C CD1   . ILE F 3 175 ? 1.074   4.383   -28.782 1.00 21.50  ? 175  ILE B CD1   1 
ATOM   4429 N N     . VAL F 3 176 ? -1.523  4.726   -23.834 1.00 25.99  ? 176  VAL B N     1 
ATOM   4430 C CA    . VAL F 3 176 ? -1.640  5.456   -22.560 1.00 25.55  ? 176  VAL B CA    1 
ATOM   4431 C C     . VAL F 3 176 ? -2.541  4.849   -21.482 1.00 25.55  ? 176  VAL B C     1 
ATOM   4432 O O     . VAL F 3 176 ? -2.531  5.302   -20.331 1.00 25.63  ? 176  VAL B O     1 
ATOM   4433 C CB    . VAL F 3 176 ? -2.092  6.934   -22.779 1.00 24.53  ? 176  VAL B CB    1 
ATOM   4434 C CG1   . VAL F 3 176 ? -1.222  7.594   -23.835 1.00 22.18  ? 176  VAL B CG1   1 
ATOM   4435 C CG2   . VAL F 3 176 ? -3.567  6.990   -23.175 1.00 25.02  ? 176  VAL B CG2   1 
ATOM   4436 N N     . GLY F 3 177 ? -3.322  3.838   -21.844 1.00 25.15  ? 177  GLY B N     1 
ATOM   4437 C CA    . GLY F 3 177 ? -4.209  3.214   -20.874 1.00 25.20  ? 177  GLY B CA    1 
ATOM   4438 C C     . GLY F 3 177 ? -5.533  3.929   -20.618 1.00 26.37  ? 177  GLY B C     1 
ATOM   4439 O O     . GLY F 3 177 ? -5.848  4.252   -19.481 1.00 24.75  ? 177  GLY B O     1 
ATOM   4440 N N     . CYS F 3 178 ? -6.309  4.190   -21.666 1.00 26.38  ? 178  CYS B N     1 
ATOM   4441 C CA    . CYS F 3 178 ? -7.614  4.842   -21.501 1.00 25.42  ? 178  CYS B CA    1 
ATOM   4442 C C     . CYS F 3 178 ? -8.517  4.406   -22.654 1.00 25.24  ? 178  CYS B C     1 
ATOM   4443 O O     . CYS F 3 178 ? -8.049  3.780   -23.597 1.00 26.55  ? 178  CYS B O     1 
ATOM   4444 C CB    . CYS F 3 178 ? -7.460  6.372   -21.486 1.00 24.01  ? 178  CYS B CB    1 
ATOM   4445 S SG    . CYS F 3 178 ? -7.109  7.112   -23.109 1.00 23.72  ? 178  CYS B SG    1 
ATOM   4446 N N     . SER F 3 179 ? -9.810  4.706   -22.578 1.00 28.17  ? 179  SER B N     1 
ATOM   4447 C CA    . SER F 3 179 ? -10.725 4.307   -23.647 1.00 26.84  ? 179  SER B CA    1 
ATOM   4448 C C     . SER F 3 179 ? -10.537 5.161   -24.896 1.00 27.51  ? 179  SER B C     1 
ATOM   4449 O O     . SER F 3 179 ? -10.051 6.293   -24.828 1.00 25.78  ? 179  SER B O     1 
ATOM   4450 C CB    . SER F 3 179 ? -12.192 4.409   -23.195 1.00 27.73  ? 179  SER B CB    1 
ATOM   4451 O OG    . SER F 3 179 ? -12.632 5.762   -23.164 1.00 30.21  ? 179  SER B OG    1 
ATOM   4452 N N     . ARG F 3 180 ? -10.936 4.603   -26.033 1.00 27.27  ? 180  ARG B N     1 
ATOM   4453 C CA    . ARG F 3 180 ? -10.832 5.291   -27.312 1.00 30.14  ? 180  ARG B CA    1 
ATOM   4454 C C     . ARG F 3 180 ? -11.656 6.579   -27.291 1.00 29.20  ? 180  ARG B C     1 
ATOM   4455 O O     . ARG F 3 180 ? -11.254 7.570   -27.889 1.00 29.03  ? 180  ARG B O     1 
ATOM   4456 C CB    . ARG F 3 180 ? -11.319 4.373   -28.446 1.00 31.08  ? 180  ARG B CB    1 
ATOM   4457 C CG    . ARG F 3 180 ? -12.814 4.024   -28.383 1.00 33.19  ? 180  ARG B CG    1 
ATOM   4458 C CD    . ARG F 3 180 ? -13.155 2.890   -29.350 1.00 36.15  ? 180  ARG B CD    1 
ATOM   4459 N NE    . ARG F 3 180 ? -14.588 2.591   -29.433 1.00 39.78  ? 180  ARG B NE    1 
ATOM   4460 C CZ    . ARG F 3 180 ? -15.516 3.422   -29.913 1.00 43.47  ? 180  ARG B CZ    1 
ATOM   4461 N NH1   . ARG F 3 180 ? -15.178 4.624   -30.360 1.00 43.21  ? 180  ARG B NH1   1 
ATOM   4462 N NH2   . ARG F 3 180 ? -16.792 3.044   -29.960 1.00 44.12  ? 180  ARG B NH2   1 
ATOM   4463 N N     . GLU F 3 181 ? -12.797 6.566   -26.598 1.00 28.91  ? 181  GLU B N     1 
ATOM   4464 C CA    . GLU F 3 181 ? -13.655 7.753   -26.527 1.00 31.23  ? 181  GLU B CA    1 
ATOM   4465 C C     . GLU F 3 181 ? -12.961 8.903   -25.815 1.00 31.22  ? 181  GLU B C     1 
ATOM   4466 O O     . GLU F 3 181 ? -13.118 10.066  -26.200 1.00 29.62  ? 181  GLU B O     1 
ATOM   4467 C CB    . GLU F 3 181 ? -14.970 7.468   -25.795 1.00 33.19  ? 181  GLU B CB    1 
ATOM   4468 C CG    . GLU F 3 181 ? -16.019 6.694   -26.589 1.00 37.25  ? 181  GLU B CG    1 
ATOM   4469 C CD    . GLU F 3 181 ? -15.974 5.199   -26.319 1.00 40.78  ? 181  GLU B CD    1 
ATOM   4470 O OE1   . GLU F 3 181 ? -17.015 4.534   -26.510 1.00 44.34  ? 181  GLU B OE1   1 
ATOM   4471 O OE2   . GLU F 3 181 ? -14.901 4.687   -25.922 1.00 38.90  ? 181  GLU B OE2   1 
ATOM   4472 N N     . THR F 3 182 ? -12.215 8.573   -24.763 1.00 29.43  ? 182  THR B N     1 
ATOM   4473 C CA    . THR F 3 182 ? -11.487 9.572   -23.996 1.00 26.25  ? 182  THR B CA    1 
ATOM   4474 C C     . THR F 3 182 ? -10.368 10.164  -24.853 1.00 23.51  ? 182  THR B C     1 
ATOM   4475 O O     . THR F 3 182 ? -10.127 11.362  -24.810 1.00 23.80  ? 182  THR B O     1 
ATOM   4476 C CB    . THR F 3 182 ? -10.909 8.958   -22.696 1.00 26.05  ? 182  THR B CB    1 
ATOM   4477 O OG1   . THR F 3 182 ? -11.989 8.616   -21.820 1.00 27.35  ? 182  THR B OG1   1 
ATOM   4478 C CG2   . THR F 3 182 ? -9.986  9.945   -21.983 1.00 25.19  ? 182  THR B CG2   1 
ATOM   4479 N N     . VAL F 3 183 ? -9.675  9.330   -25.625 1.00 23.37  ? 183  VAL B N     1 
ATOM   4480 C CA    . VAL F 3 183 ? -8.616  9.848   -26.497 1.00 21.87  ? 183  VAL B CA    1 
ATOM   4481 C C     . VAL F 3 183 ? -9.282  10.838  -27.469 1.00 24.17  ? 183  VAL B C     1 
ATOM   4482 O O     . VAL F 3 183 ? -8.773  11.935  -27.695 1.00 22.84  ? 183  VAL B O     1 
ATOM   4483 C CB    . VAL F 3 183 ? -7.926  8.720   -27.324 1.00 22.01  ? 183  VAL B CB    1 
ATOM   4484 C CG1   . VAL F 3 183 ? -6.920  9.324   -28.311 1.00 17.28  ? 183  VAL B CG1   1 
ATOM   4485 C CG2   . VAL F 3 183 ? -7.189  7.748   -26.382 1.00 20.51  ? 183  VAL B CG2   1 
ATOM   4486 N N     . GLY F 3 184 ? -10.435 10.444  -28.015 1.00 24.71  ? 184  GLY B N     1 
ATOM   4487 C CA    . GLY F 3 184 ? -11.150 11.294  -28.958 1.00 26.53  ? 184  GLY B CA    1 
ATOM   4488 C C     . GLY F 3 184 ? -11.508 12.658  -28.407 1.00 27.62  ? 184  GLY B C     1 
ATOM   4489 O O     . GLY F 3 184 ? -11.376 13.675  -29.092 1.00 28.88  ? 184  GLY B O     1 
ATOM   4490 N N     . ARG F 3 185 ? -11.967 12.690  -27.163 1.00 28.16  ? 185  ARG B N     1 
ATOM   4491 C CA    . ARG F 3 185 ? -12.324 13.949  -26.531 1.00 28.24  ? 185  ARG B CA    1 
ATOM   4492 C C     . ARG F 3 185 ? -11.077 14.769  -26.218 1.00 27.41  ? 185  ARG B C     1 
ATOM   4493 O O     . ARG F 3 185 ? -11.075 15.989  -26.373 1.00 27.77  ? 185  ARG B O     1 
ATOM   4494 C CB    . ARG F 3 185 ? -13.124 13.682  -25.249 1.00 32.83  ? 185  ARG B CB    1 
ATOM   4495 C CG    . ARG F 3 185 ? -13.554 14.939  -24.504 1.00 36.37  ? 185  ARG B CG    1 
ATOM   4496 C CD    . ARG F 3 185 ? -14.623 14.632  -23.462 1.00 41.52  ? 185  ARG B CD    1 
ATOM   4497 N NE    . ARG F 3 185 ? -14.194 13.622  -22.494 1.00 45.32  ? 185  ARG B NE    1 
ATOM   4498 C CZ    . ARG F 3 185 ? -13.213 13.795  -21.612 1.00 46.69  ? 185  ARG B CZ    1 
ATOM   4499 N NH1   . ARG F 3 185 ? -12.547 14.945  -21.571 1.00 46.41  ? 185  ARG B NH1   1 
ATOM   4500 N NH2   . ARG F 3 185 ? -12.900 12.819  -20.766 1.00 44.77  ? 185  ARG B NH2   1 
ATOM   4501 N N     . ILE F 3 186 ? -10.006 14.114  -25.781 1.00 25.82  ? 186  ILE B N     1 
ATOM   4502 C CA    . ILE F 3 186 ? -8.790  14.863  -25.469 1.00 24.58  ? 186  ILE B CA    1 
ATOM   4503 C C     . ILE F 3 186 ? -8.136  15.451  -26.728 1.00 23.64  ? 186  ILE B C     1 
ATOM   4504 O O     . ILE F 3 186 ? -7.615  16.565  -26.695 1.00 24.86  ? 186  ILE B O     1 
ATOM   4505 C CB    . ILE F 3 186 ? -7.786  13.985  -24.685 1.00 25.59  ? 186  ILE B CB    1 
ATOM   4506 C CG1   . ILE F 3 186 ? -8.398  13.636  -23.324 1.00 25.95  ? 186  ILE B CG1   1 
ATOM   4507 C CG2   . ILE F 3 186 ? -6.461  14.723  -24.490 1.00 21.35  ? 186  ILE B CG2   1 
ATOM   4508 C CD1   . ILE F 3 186 ? -7.626  12.588  -22.555 1.00 29.16  ? 186  ILE B CD1   1 
ATOM   4509 N N     . LEU F 3 187 ? -8.157  14.723  -27.840 1.00 21.66  ? 187  LEU B N     1 
ATOM   4510 C CA    . LEU F 3 187 ? -7.569  15.287  -29.061 1.00 25.55  ? 187  LEU B CA    1 
ATOM   4511 C C     . LEU F 3 187 ? -8.357  16.543  -29.482 1.00 25.02  ? 187  LEU B C     1 
ATOM   4512 O O     . LEU F 3 187 ? -7.774  17.520  -29.931 1.00 24.67  ? 187  LEU B O     1 
ATOM   4513 C CB    . LEU F 3 187 ? -7.563  14.266  -30.205 1.00 23.81  ? 187  LEU B CB    1 
ATOM   4514 C CG    . LEU F 3 187 ? -6.646  13.046  -30.048 1.00 28.79  ? 187  LEU B CG    1 
ATOM   4515 C CD1   . LEU F 3 187 ? -6.596  12.289  -31.369 1.00 23.60  ? 187  LEU B CD1   1 
ATOM   4516 C CD2   . LEU F 3 187 ? -5.233  13.476  -29.624 1.00 21.45  ? 187  LEU B CD2   1 
ATOM   4517 N N     . LYS F 3 188 ? -9.678  16.522  -29.333 1.00 27.43  ? 188  LYS B N     1 
ATOM   4518 C CA    . LYS F 3 188 ? -10.471 17.694  -29.691 1.00 30.48  ? 188  LYS B CA    1 
ATOM   4519 C C     . LYS F 3 188 ? -10.102 18.884  -28.814 1.00 29.76  ? 188  LYS B C     1 
ATOM   4520 O O     . LYS F 3 188 ? -9.995  20.006  -29.306 1.00 30.47  ? 188  LYS B O     1 
ATOM   4521 C CB    . LYS F 3 188 ? -11.969 17.386  -29.596 1.00 33.50  ? 188  LYS B CB    1 
ATOM   4522 C CG    . LYS F 3 188 ? -12.463 16.493  -30.738 1.00 39.16  ? 188  LYS B CG    1 
ATOM   4523 C CD    . LYS F 3 188 ? -13.929 16.119  -30.568 1.00 42.89  ? 188  LYS B CD    1 
ATOM   4524 C CE    . LYS F 3 188 ? -14.350 15.043  -31.559 1.00 45.30  ? 188  LYS B CE    1 
ATOM   4525 N NZ    . LYS F 3 188 ? -14.354 15.532  -32.966 1.00 49.81  ? 188  LYS B NZ    1 
ATOM   4526 N N     . MET F 3 189 ? -9.882  18.636  -27.523 1.00 29.30  ? 189  MET B N     1 
ATOM   4527 C CA    . MET F 3 189 ? -9.494  19.692  -26.589 1.00 29.17  ? 189  MET B CA    1 
ATOM   4528 C C     . MET F 3 189 ? -8.074  20.208  -26.908 1.00 29.60  ? 189  MET B C     1 
ATOM   4529 O O     . MET F 3 189 ? -7.802  21.410  -26.797 1.00 27.52  ? 189  MET B O     1 
ATOM   4530 C CB    . MET F 3 189 ? -9.548  19.178  -25.139 1.00 32.69  ? 189  MET B CB    1 
ATOM   4531 C CG    . MET F 3 189 ? -10.962 18.928  -24.573 1.00 36.24  ? 189  MET B CG    1 
ATOM   4532 S SD    . MET F 3 189 ? -10.966 18.136  -22.902 1.00 43.45  ? 189  MET B SD    1 
ATOM   4533 C CE    . MET F 3 189 ? -10.392 19.498  -21.890 1.00 39.66  ? 189  MET B CE    1 
ATOM   4534 N N     . LEU F 3 190 ? -7.166  19.308  -27.290 1.00 26.60  ? 190  LEU B N     1 
ATOM   4535 C CA    . LEU F 3 190 ? -5.805  19.738  -27.634 1.00 27.16  ? 190  LEU B CA    1 
ATOM   4536 C C     . LEU F 3 190 ? -5.840  20.566  -28.923 1.00 28.39  ? 190  LEU B C     1 
ATOM   4537 O O     . LEU F 3 190 ? -5.033  21.478  -29.100 1.00 28.34  ? 190  LEU B O     1 
ATOM   4538 C CB    . LEU F 3 190 ? -4.861  18.537  -27.812 1.00 27.01  ? 190  LEU B CB    1 
ATOM   4539 C CG    . LEU F 3 190 ? -4.499  17.729  -26.554 1.00 26.61  ? 190  LEU B CG    1 
ATOM   4540 C CD1   . LEU F 3 190 ? -3.661  16.517  -26.934 1.00 21.96  ? 190  LEU B CD1   1 
ATOM   4541 C CD2   . LEU F 3 190 ? -3.742  18.612  -25.573 1.00 25.35  ? 190  LEU B CD2   1 
ATOM   4542 N N     . GLU F 3 191 ? -6.765  20.242  -29.828 1.00 27.88  ? 191  GLU B N     1 
ATOM   4543 C CA    . GLU F 3 191 ? -6.884  21.015  -31.062 1.00 30.27  ? 191  GLU B CA    1 
ATOM   4544 C C     . GLU F 3 191 ? -7.436  22.398  -30.670 1.00 31.46  ? 191  GLU B C     1 
ATOM   4545 O O     . GLU F 3 191 ? -6.970  23.423  -31.158 1.00 32.07  ? 191  GLU B O     1 
ATOM   4546 C CB    . GLU F 3 191 ? -7.812  20.317  -32.080 1.00 28.65  ? 191  GLU B CB    1 
ATOM   4547 C CG    . GLU F 3 191 ? -8.019  21.140  -33.366 1.00 32.94  ? 191  GLU B CG    1 
ATOM   4548 C CD    . GLU F 3 191 ? -8.436  20.317  -34.594 1.00 34.23  ? 191  GLU B CD    1 
ATOM   4549 O OE1   . GLU F 3 191 ? -8.956  20.924  -35.550 1.00 36.18  ? 191  GLU B OE1   1 
ATOM   4550 O OE2   . GLU F 3 191 ? -8.236  19.083  -34.630 1.00 30.98  ? 191  GLU B OE2   1 
ATOM   4551 N N     . ASP F 3 192 ? -8.410  22.413  -29.764 1.00 32.94  ? 192  ASP B N     1 
ATOM   4552 C CA    . ASP F 3 192 ? -9.003  23.659  -29.277 1.00 34.10  ? 192  ASP B CA    1 
ATOM   4553 C C     . ASP F 3 192 ? -7.942  24.598  -28.713 1.00 34.15  ? 192  ASP B C     1 
ATOM   4554 O O     . ASP F 3 192 ? -8.107  25.817  -28.730 1.00 35.02  ? 192  ASP B O     1 
ATOM   4555 C CB    . ASP F 3 192 ? -10.020 23.374  -28.172 1.00 38.44  ? 192  ASP B CB    1 
ATOM   4556 C CG    . ASP F 3 192 ? -11.339 22.884  -28.704 1.00 42.75  ? 192  ASP B CG    1 
ATOM   4557 O OD1   . ASP F 3 192 ? -12.235 22.595  -27.888 1.00 46.68  ? 192  ASP B OD1   1 
ATOM   4558 O OD2   . ASP F 3 192 ? -11.485 22.793  -29.938 1.00 48.46  ? 192  ASP B OD2   1 
ATOM   4559 N N     . GLN F 3 193 ? -6.859  24.023  -28.205 1.00 33.42  ? 193  GLN B N     1 
ATOM   4560 C CA    . GLN F 3 193 ? -5.773  24.804  -27.624 1.00 32.28  ? 193  GLN B CA    1 
ATOM   4561 C C     . GLN F 3 193 ? -4.683  25.083  -28.652 1.00 31.25  ? 193  GLN B C     1 
ATOM   4562 O O     . GLN F 3 193 ? -3.631  25.631  -28.326 1.00 29.88  ? 193  GLN B O     1 
ATOM   4563 C CB    . GLN F 3 193 ? -5.188  24.055  -26.420 1.00 35.69  ? 193  GLN B CB    1 
ATOM   4564 C CG    . GLN F 3 193 ? -6.144  23.970  -25.224 1.00 39.51  ? 193  GLN B CG    1 
ATOM   4565 C CD    . GLN F 3 193 ? -5.775  22.863  -24.251 1.00 42.97  ? 193  GLN B CD    1 
ATOM   4566 O OE1   . GLN F 3 193 ? -4.598  22.627  -23.982 1.00 44.08  ? 193  GLN B OE1   1 
ATOM   4567 N NE2   . GLN F 3 193 ? -6.783  22.185  -23.710 1.00 44.44  ? 193  GLN B NE2   1 
ATOM   4568 N N     . ASN F 3 194 ? -4.942  24.685  -29.894 1.00 31.05  ? 194  ASN B N     1 
ATOM   4569 C CA    . ASN F 3 194 ? -4.012  24.893  -31.004 1.00 30.37  ? 194  ASN B CA    1 
ATOM   4570 C C     . ASN F 3 194 ? -2.659  24.218  -30.848 1.00 30.25  ? 194  ASN B C     1 
ATOM   4571 O O     . ASN F 3 194 ? -1.649  24.728  -31.334 1.00 30.44  ? 194  ASN B O     1 
ATOM   4572 C CB    . ASN F 3 194 ? -3.796  26.396  -31.260 1.00 31.84  ? 194  ASN B CB    1 
ATOM   4573 C CG    . ASN F 3 194 ? -5.070  27.107  -31.703 1.00 35.02  ? 194  ASN B CG    1 
ATOM   4574 O OD1   . ASN F 3 194 ? -5.874  26.557  -32.455 1.00 38.10  ? 194  ASN B OD1   1 
ATOM   4575 N ND2   . ASN F 3 194 ? -5.248  28.338  -31.252 1.00 36.95  ? 194  ASN B ND2   1 
ATOM   4576 N N     . LEU F 3 195 ? -2.633  23.067  -30.186 1.00 28.26  ? 195  LEU B N     1 
ATOM   4577 C CA    . LEU F 3 195 ? -1.380  22.346  -30.008 1.00 26.77  ? 195  LEU B CA    1 
ATOM   4578 C C     . LEU F 3 195 ? -1.229  21.326  -31.127 1.00 25.93  ? 195  LEU B C     1 
ATOM   4579 O O     . LEU F 3 195 ? -0.117  20.946  -31.492 1.00 25.85  ? 195  LEU B O     1 
ATOM   4580 C CB    . LEU F 3 195 ? -1.358  21.654  -28.645 1.00 27.39  ? 195  LEU B CB    1 
ATOM   4581 C CG    . LEU F 3 195 ? -1.372  22.651  -27.482 1.00 29.40  ? 195  LEU B CG    1 
ATOM   4582 C CD1   . LEU F 3 195 ? -1.447  21.919  -26.142 1.00 29.96  ? 195  LEU B CD1   1 
ATOM   4583 C CD2   . LEU F 3 195 ? -0.107  23.514  -27.550 1.00 30.43  ? 195  LEU B CD2   1 
ATOM   4584 N N     . ILE F 3 196 ? -2.357  20.895  -31.677 1.00 26.35  ? 196  ILE B N     1 
ATOM   4585 C CA    . ILE F 3 196 ? -2.360  19.923  -32.764 1.00 27.33  ? 196  ILE B CA    1 
ATOM   4586 C C     . ILE F 3 196 ? -3.523  20.163  -33.721 1.00 27.37  ? 196  ILE B C     1 
ATOM   4587 O O     . ILE F 3 196 ? -4.429  20.947  -33.446 1.00 23.68  ? 196  ILE B O     1 
ATOM   4588 C CB    . ILE F 3 196 ? -2.532  18.462  -32.258 1.00 24.97  ? 196  ILE B CB    1 
ATOM   4589 C CG1   . ILE F 3 196 ? -3.896  18.311  -31.587 1.00 27.06  ? 196  ILE B CG1   1 
ATOM   4590 C CG2   . ILE F 3 196 ? -1.389  18.071  -31.322 1.00 28.07  ? 196  ILE B CG2   1 
ATOM   4591 C CD1   . ILE F 3 196 ? -4.311  16.852  -31.321 1.00 26.20  ? 196  ILE B CD1   1 
ATOM   4592 N N     . SER F 3 197 ? -3.484  19.446  -34.836 1.00 28.01  ? 197  SER B N     1 
ATOM   4593 C CA    . SER F 3 197 ? -4.529  19.489  -35.843 1.00 30.27  ? 197  SER B CA    1 
ATOM   4594 C C     . SER F 3 197 ? -4.777  18.024  -36.192 1.00 31.37  ? 197  SER B C     1 
ATOM   4595 O O     . SER F 3 197 ? -3.856  17.327  -36.614 1.00 32.20  ? 197  SER B O     1 
ATOM   4596 C CB    . SER F 3 197 ? -4.051  20.236  -37.087 1.00 31.70  ? 197  SER B CB    1 
ATOM   4597 O OG    . SER F 3 197 ? -5.061  20.230  -38.075 1.00 34.55  ? 197  SER B OG    1 
ATOM   4598 N N     . ALA F 3 198 ? -6.005  17.547  -36.020 1.00 30.80  ? 198  ALA B N     1 
ATOM   4599 C CA    . ALA F 3 198 ? -6.285  16.151  -36.326 1.00 31.77  ? 198  ALA B CA    1 
ATOM   4600 C C     . ALA F 3 198 ? -7.431  15.922  -37.301 1.00 31.86  ? 198  ALA B C     1 
ATOM   4601 O O     . ALA F 3 198 ? -8.563  16.333  -37.055 1.00 34.86  ? 198  ALA B O     1 
ATOM   4602 C CB    . ALA F 3 198 ? -6.552  15.374  -35.031 1.00 30.86  ? 198  ALA B CB    1 
ATOM   4603 N N     . HIS F 3 199 ? -7.116  15.261  -38.409 1.00 30.64  ? 199  HIS B N     1 
ATOM   4604 C CA    . HIS F 3 199 ? -8.099  14.912  -39.425 1.00 30.38  ? 199  HIS B CA    1 
ATOM   4605 C C     . HIS F 3 199 ? -7.959  13.402  -39.609 1.00 30.77  ? 199  HIS B C     1 
ATOM   4606 O O     . HIS F 3 199 ? -6.930  12.924  -40.093 1.00 29.93  ? 199  HIS B O     1 
ATOM   4607 C CB    . HIS F 3 199 ? -7.805  15.621  -40.755 1.00 31.10  ? 199  HIS B CB    1 
ATOM   4608 C CG    . HIS F 3 199 ? -7.988  17.107  -40.706 1.00 31.93  ? 199  HIS B CG    1 
ATOM   4609 N ND1   . HIS F 3 199 ? -7.074  17.953  -40.117 1.00 34.45  ? 199  HIS B ND1   1 
ATOM   4610 C CD2   . HIS F 3 199 ? -8.996  17.894  -41.151 1.00 32.81  ? 199  HIS B CD2   1 
ATOM   4611 C CE1   . HIS F 3 199 ? -7.510  19.197  -40.202 1.00 33.07  ? 199  HIS B CE1   1 
ATOM   4612 N NE2   . HIS F 3 199 ? -8.674  19.190  -40.823 1.00 33.59  ? 199  HIS B NE2   1 
ATOM   4613 N N     . GLY F 3 200 ? -8.979  12.650  -39.209 1.00 29.70  ? 200  GLY B N     1 
ATOM   4614 C CA    . GLY F 3 200 ? -8.901  11.206  -39.344 1.00 29.61  ? 200  GLY B CA    1 
ATOM   4615 C C     . GLY F 3 200 ? -7.730  10.670  -38.536 1.00 27.88  ? 200  GLY B C     1 
ATOM   4616 O O     . GLY F 3 200 ? -7.583  11.008  -37.366 1.00 28.84  ? 200  GLY B O     1 
ATOM   4617 N N     . LYS F 3 201 ? -6.886  9.859   -39.167 1.00 29.36  ? 201  LYS B N     1 
ATOM   4618 C CA    . LYS F 3 201 ? -5.715  9.269   -38.510 1.00 32.24  ? 201  LYS B CA    1 
ATOM   4619 C C     . LYS F 3 201 ? -4.482  10.159  -38.584 1.00 30.40  ? 201  LYS B C     1 
ATOM   4620 O O     . LYS F 3 201 ? -3.452  9.841   -38.000 1.00 30.27  ? 201  LYS B O     1 
ATOM   4621 C CB    . LYS F 3 201 ? -5.355  7.927   -39.153 1.00 35.17  ? 201  LYS B CB    1 
ATOM   4622 C CG    . LYS F 3 201 ? -6.305  6.792   -38.859 1.00 41.57  ? 201  LYS B CG    1 
ATOM   4623 C CD    . LYS F 3 201 ? -5.874  5.509   -39.588 1.00 43.61  ? 201  LYS B CD    1 
ATOM   4624 C CE    . LYS F 3 201 ? -4.444  5.088   -39.234 1.00 45.87  ? 201  LYS B CE    1 
ATOM   4625 N NZ    . LYS F 3 201 ? -4.084  3.754   -39.806 1.00 44.06  ? 201  LYS B NZ    1 
ATOM   4626 N N     . THR F 3 202 ? -4.586  11.269  -39.304 1.00 30.23  ? 202  THR B N     1 
ATOM   4627 C CA    . THR F 3 202 ? -3.460  12.173  -39.475 1.00 27.86  ? 202  THR B CA    1 
ATOM   4628 C C     . THR F 3 202 ? -3.419  13.258  -38.416 1.00 28.48  ? 202  THR B C     1 
ATOM   4629 O O     . THR F 3 202 ? -4.366  14.028  -38.259 1.00 29.00  ? 202  THR B O     1 
ATOM   4630 C CB    . THR F 3 202 ? -3.505  12.854  -40.869 1.00 30.17  ? 202  THR B CB    1 
ATOM   4631 O OG1   . THR F 3 202 ? -3.467  11.853  -41.892 1.00 29.35  ? 202  THR B OG1   1 
ATOM   4632 C CG2   . THR F 3 202 ? -2.327  13.799  -41.045 1.00 29.78  ? 202  THR B CG2   1 
ATOM   4633 N N     . ILE F 3 203 ? -2.312  13.326  -37.691 1.00 28.06  ? 203  ILE B N     1 
ATOM   4634 C CA    . ILE F 3 203 ? -2.169  14.341  -36.666 1.00 27.46  ? 203  ILE B CA    1 
ATOM   4635 C C     . ILE F 3 203 ? -0.923  15.177  -36.914 1.00 27.76  ? 203  ILE B C     1 
ATOM   4636 O O     . ILE F 3 203 ? 0.174   14.648  -37.136 1.00 26.48  ? 203  ILE B O     1 
ATOM   4637 C CB    . ILE F 3 203 ? -2.059  13.729  -35.261 1.00 27.24  ? 203  ILE B CB    1 
ATOM   4638 C CG1   . ILE F 3 203 ? -3.347  12.973  -34.908 1.00 28.39  ? 203  ILE B CG1   1 
ATOM   4639 C CG2   . ILE F 3 203 ? -1.789  14.834  -34.246 1.00 28.42  ? 203  ILE B CG2   1 
ATOM   4640 C CD1   . ILE F 3 203 ? -3.289  12.239  -33.561 1.00 27.81  ? 203  ILE B CD1   1 
ATOM   4641 N N     . VAL F 3 204 ? -1.103  16.489  -36.895 1.00 26.16  ? 204  VAL B N     1 
ATOM   4642 C CA    . VAL F 3 204 ? 0.014   17.392  -37.066 1.00 26.78  ? 204  VAL B CA    1 
ATOM   4643 C C     . VAL F 3 204 ? 0.329   17.966  -35.690 1.00 27.54  ? 204  VAL B C     1 
ATOM   4644 O O     . VAL F 3 204 ? -0.548  18.548  -35.036 1.00 27.37  ? 204  VAL B O     1 
ATOM   4645 C CB    . VAL F 3 204 ? -0.334  18.556  -38.028 1.00 27.94  ? 204  VAL B CB    1 
ATOM   4646 C CG1   . VAL F 3 204 ? 0.839   19.525  -38.120 1.00 28.49  ? 204  VAL B CG1   1 
ATOM   4647 C CG2   . VAL F 3 204 ? -0.666  18.010  -39.404 1.00 28.09  ? 204  VAL B CG2   1 
ATOM   4648 N N     . VAL F 3 205 ? 1.569   17.782  -35.245 1.00 26.55  ? 205  VAL B N     1 
ATOM   4649 C CA    . VAL F 3 205 ? 2.008   18.314  -33.960 1.00 26.88  ? 205  VAL B CA    1 
ATOM   4650 C C     . VAL F 3 205 ? 2.733   19.630  -34.255 1.00 28.41  ? 205  VAL B C     1 
ATOM   4651 O O     . VAL F 3 205 ? 3.833   19.629  -34.810 1.00 26.59  ? 205  VAL B O     1 
ATOM   4652 C CB    . VAL F 3 205 ? 2.968   17.334  -33.238 1.00 26.74  ? 205  VAL B CB    1 
ATOM   4653 C CG1   . VAL F 3 205 ? 3.442   17.940  -31.932 1.00 26.94  ? 205  VAL B CG1   1 
ATOM   4654 C CG2   . VAL F 3 205 ? 2.259   16.010  -32.966 1.00 26.52  ? 205  VAL B CG2   1 
ATOM   4655 N N     . TYR F 3 206 ? 2.111   20.749  -33.890 1.00 29.98  ? 206  TYR B N     1 
ATOM   4656 C CA    . TYR F 3 206 ? 2.681   22.062  -34.157 1.00 33.20  ? 206  TYR B CA    1 
ATOM   4657 C C     . TYR F 3 206 ? 4.023   22.343  -33.483 1.00 38.75  ? 206  TYR B C     1 
ATOM   4658 O O     . TYR F 3 206 ? 4.228   22.042  -32.297 1.00 38.30  ? 206  TYR B O     1 
ATOM   4659 C CB    . TYR F 3 206 ? 1.666   23.144  -33.799 1.00 31.53  ? 206  TYR B CB    1 
ATOM   4660 C CG    . TYR F 3 206 ? 0.464   23.141  -34.719 1.00 33.02  ? 206  TYR B CG    1 
ATOM   4661 C CD1   . TYR F 3 206 ? -0.834  23.172  -34.206 1.00 32.18  ? 206  TYR B CD1   1 
ATOM   4662 C CD2   . TYR F 3 206 ? 0.624   23.106  -36.111 1.00 32.14  ? 206  TYR B CD2   1 
ATOM   4663 C CE1   . TYR F 3 206 ? -1.944  23.167  -35.053 1.00 29.65  ? 206  TYR B CE1   1 
ATOM   4664 C CE2   . TYR F 3 206 ? -0.477  23.103  -36.963 1.00 29.91  ? 206  TYR B CE2   1 
ATOM   4665 C CZ    . TYR F 3 206 ? -1.759  23.134  -36.425 1.00 31.44  ? 206  TYR B CZ    1 
ATOM   4666 O OH    . TYR F 3 206 ? -2.859  23.156  -37.256 1.00 30.83  ? 206  TYR B OH    1 
ATOM   4667 N N     . GLY F 3 207 ? 4.936   22.916  -34.265 1.00 42.10  ? 207  GLY B N     1 
ATOM   4668 C CA    . GLY F 3 207 ? 6.259   23.239  -33.765 1.00 48.71  ? 207  GLY B CA    1 
ATOM   4669 C C     . GLY F 3 207 ? 7.008   24.153  -34.716 1.00 53.10  ? 207  GLY B C     1 
ATOM   4670 O O     . GLY F 3 207 ? 7.948   23.674  -35.392 1.00 55.85  ? 207  GLY B O     1 
HETATM 4671 P P     . CMP G 4 .   ? 20.848  2.914   -11.987 1.00 22.57  ? 622  CMP A P     1 
HETATM 4672 O O1P   . CMP G 4 .   ? 19.999  3.501   -13.052 1.00 18.02  ? 622  CMP A O1P   1 
HETATM 4673 O O2P   . CMP G 4 .   ? 22.324  2.943   -12.130 1.00 20.98  ? 622  CMP A O2P   1 
HETATM 4674 O "O5'" . CMP G 4 .   ? 20.407  3.607   -10.607 1.00 21.35  ? 622  CMP A "O5'" 1 
HETATM 4675 C "C5'" . CMP G 4 .   ? 19.132  3.298   -10.015 1.00 21.09  ? 622  CMP A "C5'" 1 
HETATM 4676 C "C4'" . CMP G 4 .   ? 18.994  1.803   -9.939  1.00 22.96  ? 622  CMP A "C4'" 1 
HETATM 4677 O "O4'" . CMP G 4 .   ? 17.694  1.348   -9.489  1.00 25.13  ? 622  CMP A "O4'" 1 
HETATM 4678 C "C3'" . CMP G 4 .   ? 19.067  1.157   -11.296 1.00 23.57  ? 622  CMP A "C3'" 1 
HETATM 4679 O "O3'" . CMP G 4 .   ? 20.375  1.388   -11.785 1.00 21.71  ? 622  CMP A "O3'" 1 
HETATM 4680 C "C2'" . CMP G 4 .   ? 18.647  -0.261  -10.947 1.00 23.82  ? 622  CMP A "C2'" 1 
HETATM 4681 O "O2'" . CMP G 4 .   ? 19.654  -0.961  -10.245 1.00 26.85  ? 622  CMP A "O2'" 1 
HETATM 4682 C "C1'" . CMP G 4 .   ? 17.478  0.031   -9.995  1.00 24.35  ? 622  CMP A "C1'" 1 
HETATM 4683 N N9    . CMP G 4 .   ? 16.197  0.015   -10.700 1.00 22.74  ? 622  CMP A N9    1 
HETATM 4684 C C8    . CMP G 4 .   ? 15.705  0.961   -11.566 1.00 21.55  ? 622  CMP A C8    1 
HETATM 4685 N N7    . CMP G 4 .   ? 14.535  0.656   -12.071 1.00 21.58  ? 622  CMP A N7    1 
HETATM 4686 C C5    . CMP G 4 .   ? 14.233  -0.569  -11.492 1.00 22.39  ? 622  CMP A C5    1 
HETATM 4687 C C6    . CMP G 4 .   ? 13.122  -1.429  -11.620 1.00 22.94  ? 622  CMP A C6    1 
HETATM 4688 N N6    . CMP G 4 .   ? 12.065  -1.162  -12.398 1.00 25.24  ? 622  CMP A N6    1 
HETATM 4689 N N1    . CMP G 4 .   ? 13.135  -2.579  -10.912 1.00 22.24  ? 622  CMP A N1    1 
HETATM 4690 C C2    . CMP G 4 .   ? 14.194  -2.840  -10.128 1.00 22.80  ? 622  CMP A C2    1 
HETATM 4691 N N3    . CMP G 4 .   ? 15.292  -2.108  -9.923  1.00 19.63  ? 622  CMP A N3    1 
HETATM 4692 C C4    . CMP G 4 .   ? 15.247  -0.973  -10.642 1.00 18.94  ? 622  CMP A C4    1 
HETATM 4693 P P     . CMP H 4 .   ? 0.795   9.745   0.921   0.50 33.04  ? 2622 CMP A P     1 
HETATM 4694 O O1P   . CMP H 4 .   ? -0.623  10.103  0.641   0.50 28.65  ? 2622 CMP A O1P   1 
HETATM 4695 O O2P   . CMP H 4 .   ? 1.472   10.300  2.117   0.50 31.97  ? 2622 CMP A O2P   1 
HETATM 4696 O "O5'" . CMP H 4 .   ? 0.871   8.142   0.981   0.50 33.30  ? 2622 CMP A "O5'" 1 
HETATM 4697 C "C5'" . CMP H 4 .   ? 0.854   7.360   -0.223  0.50 31.35  ? 2622 CMP A "C5'" 1 
HETATM 4698 C "C4'" . CMP H 4 .   ? 1.842   7.952   -1.185  0.50 31.13  ? 2622 CMP A "C4'" 1 
HETATM 4699 O "O4'" . CMP H 4 .   ? 1.897   7.293   -2.471  0.50 32.64  ? 2622 CMP A "O4'" 1 
HETATM 4700 C "C3'" . CMP H 4 .   ? 1.466   9.358   -1.567  0.50 31.84  ? 2622 CMP A "C3'" 1 
HETATM 4701 O "O3'" . CMP H 4 .   ? 1.650   10.129  -0.392  0.50 31.09  ? 2622 CMP A "O3'" 1 
HETATM 4702 C "C2'" . CMP H 4 .   ? 2.408   9.605   -2.739  0.50 31.57  ? 2622 CMP A "C2'" 1 
HETATM 4703 O "O2'" . CMP H 4 .   ? 3.729   9.872   -2.307  0.50 31.85  ? 2622 CMP A "O2'" 1 
HETATM 4704 C "C1'" . CMP H 4 .   ? 2.381   8.230   -3.425  0.50 31.66  ? 2622 CMP A "C1'" 1 
HETATM 4705 N N9    . CMP H 4 .   ? 1.568   8.137   -4.640  0.50 30.17  ? 2622 CMP A N9    1 
HETATM 4706 C C8    . CMP H 4 .   ? 1.891   7.457   -5.791  0.50 30.65  ? 2622 CMP A C8    1 
HETATM 4707 N N7    . CMP H 4 .   ? 0.992   7.563   -6.740  0.50 29.52  ? 2622 CMP A N7    1 
HETATM 4708 C C5    . CMP H 4 .   ? 0.004   8.357   -6.174  0.50 30.84  ? 2622 CMP A C5    1 
HETATM 4709 C C6    . CMP H 4 .   ? -1.224  8.831   -6.665  0.50 30.68  ? 2622 CMP A C6    1 
HETATM 4710 N N6    . CMP H 4 .   ? -1.682  8.564   -7.890  0.50 31.75  ? 2622 CMP A N6    1 
HETATM 4711 N N1    . CMP H 4 .   ? -1.976  9.600   -5.846  0.50 29.57  ? 2622 CMP A N1    1 
HETATM 4712 C C2    . CMP H 4 .   ? -1.514  9.868   -4.621  0.50 28.73  ? 2622 CMP A C2    1 
HETATM 4713 N N3    . CMP H 4 .   ? -0.379  9.481   -4.044  0.50 29.91  ? 2622 CMP A N3    1 
HETATM 4714 C C4    . CMP H 4 .   ? 0.345   8.719   -4.881  0.50 30.13  ? 2622 CMP A C4    1 
HETATM 4715 C C1    . DIO I 5 .   ? -6.427  -10.700 0.512   1.00 61.64  ? 303  DIO A C1    1 
HETATM 4716 C C2    . DIO I 5 .   ? -8.152  -9.096  0.563   1.00 60.45  ? 303  DIO A C2    1 
HETATM 4717 C "C1'" . DIO I 5 .   ? -7.068  -11.353 -0.731  1.00 62.43  ? 303  DIO A "C1'" 1 
HETATM 4718 C "C2'" . DIO I 5 .   ? -8.789  -9.740  -0.685  1.00 60.63  ? 303  DIO A "C2'" 1 
HETATM 4719 O O1    . DIO I 5 .   ? -6.720  -9.285  0.526   1.00 60.37  ? 303  DIO A O1    1 
HETATM 4720 O "O1'" . DIO I 5 .   ? -8.500  -11.156 -0.704  1.00 60.83  ? 303  DIO A "O1'" 1 
HETATM 4721 C C1    . DIO J 5 .   ? 30.576  -13.274 -7.199  1.00 50.05  ? 304  DIO A C1    1 
HETATM 4722 C C2    . DIO J 5 .   ? 29.034  -11.877 -6.081  1.00 50.90  ? 304  DIO A C2    1 
HETATM 4723 C "C1'" . DIO J 5 .   ? 30.158  -12.650 -8.548  1.00 50.49  ? 304  DIO A "C1'" 1 
HETATM 4724 C "C2'" . DIO J 5 .   ? 28.633  -11.247 -7.428  1.00 50.53  ? 304  DIO A "C2'" 1 
HETATM 4725 O O1    . DIO J 5 .   ? 30.419  -12.302 -6.136  1.00 50.86  ? 304  DIO A O1    1 
HETATM 4726 O "O1'" . DIO J 5 .   ? 28.774  -12.225 -8.480  1.00 50.76  ? 304  DIO A "O1'" 1 
HETATM 4727 C C1    . DIO K 5 .   ? 2.136   -3.221  -8.699  1.00 51.96  ? 305  DIO A C1    1 
HETATM 4728 C C2    . DIO K 5 .   ? -0.013  -3.491  -7.759  1.00 50.65  ? 305  DIO A C2    1 
HETATM 4729 C "C1'" . DIO K 5 .   ? 1.908   -1.694  -8.799  1.00 51.99  ? 305  DIO A "C1'" 1 
HETATM 4730 C "C2'" . DIO K 5 .   ? -0.234  -1.973  -7.828  1.00 50.47  ? 305  DIO A "C2'" 1 
HETATM 4731 O O1    . DIO K 5 .   ? 1.398   -3.752  -7.573  1.00 52.27  ? 305  DIO A O1    1 
HETATM 4732 O "O1'" . DIO K 5 .   ? 0.493   -1.423  -8.955  1.00 51.59  ? 305  DIO A "O1'" 1 
HETATM 4733 P P     . CMP L 4 .   ? 9.449   -13.282 -23.461 1.00 27.23  ? 1622 CMP B P     1 
HETATM 4734 O O1P   . CMP L 4 .   ? 8.916   -13.153 -22.078 1.00 27.11  ? 1622 CMP B O1P   1 
HETATM 4735 O O2P   . CMP L 4 .   ? 10.181  -14.512 -23.849 1.00 26.39  ? 1622 CMP B O2P   1 
HETATM 4736 O "O5'" . CMP L 4 .   ? 8.205   -13.065 -24.445 1.00 24.36  ? 1622 CMP B "O5'" 1 
HETATM 4737 C "C5'" . CMP L 4 .   ? 7.638   -11.762 -24.625 1.00 24.07  ? 1622 CMP B "C5'" 1 
HETATM 4738 C "C4'" . CMP L 4 .   ? 8.750   -10.809 -24.932 1.00 25.83  ? 1622 CMP B "C4'" 1 
HETATM 4739 O "O4'" . CMP L 4 .   ? 8.333   -9.429  -25.049 1.00 26.80  ? 1622 CMP B "O4'" 1 
HETATM 4740 C "C3'" . CMP L 4 .   ? 9.753   -10.733 -23.809 1.00 26.07  ? 1622 CMP B "C3'" 1 
HETATM 4741 O "O3'" . CMP L 4 .   ? 10.377  -12.006 -23.742 1.00 24.16  ? 1622 CMP B "O3'" 1 
HETATM 4742 C "C2'" . CMP L 4 .   ? 10.571  -9.536  -24.260 1.00 24.77  ? 1622 CMP B "C2'" 1 
HETATM 4743 O "O2'" . CMP L 4 .   ? 11.401  -9.845  -25.368 1.00 28.43  ? 1622 CMP B "O2'" 1 
HETATM 4744 C "C1'" . CMP L 4 .   ? 9.445   -8.599  -24.722 1.00 25.98  ? 1622 CMP B "C1'" 1 
HETATM 4745 N N9    . CMP L 4 .   ? 9.044   -7.700  -23.645 1.00 26.65  ? 1622 CMP B N9    1 
HETATM 4746 C C8    . CMP L 4 .   ? 8.316   -7.996  -22.521 1.00 24.62  ? 1622 CMP B C8    1 
HETATM 4747 N N7    . CMP L 4 .   ? 8.156   -6.975  -21.712 1.00 26.82  ? 1622 CMP B N7    1 
HETATM 4748 C C5    . CMP L 4 .   ? 8.815   -5.937  -22.351 1.00 26.10  ? 1622 CMP B C5    1 
HETATM 4749 C C6    . CMP L 4 .   ? 9.003   -4.589  -22.016 1.00 27.21  ? 1622 CMP B C6    1 
HETATM 4750 N N6    . CMP L 4 .   ? 8.542   -4.035  -20.892 1.00 26.93  ? 1622 CMP B N6    1 
HETATM 4751 N N1    . CMP L 4 .   ? 9.686   -3.815  -22.886 1.00 27.65  ? 1622 CMP B N1    1 
HETATM 4752 C C2    . CMP L 4 .   ? 10.153  -4.372  -24.010 1.00 27.28  ? 1622 CMP B C2    1 
HETATM 4753 N N3    . CMP L 4 .   ? 10.047  -5.626  -24.434 1.00 26.87  ? 1622 CMP B N3    1 
HETATM 4754 C C4    . CMP L 4 .   ? 9.357   -6.366  -23.550 1.00 27.84  ? 1622 CMP B C4    1 
HETATM 4755 P P     . CMP M 4 .   ? -10.798 0.962   -26.877 0.50 36.76  ? 3622 CMP B P     1 
HETATM 4756 O O1P   . CMP M 4 .   ? -11.620 1.749   -25.915 0.50 31.89  ? 3622 CMP B O1P   1 
HETATM 4757 O O2P   . CMP M 4 .   ? -11.412 0.452   -28.127 0.50 33.22  ? 3622 CMP B O2P   1 
HETATM 4758 O "O5'" . CMP M 4 .   ? -9.505  1.835   -27.243 0.50 34.66  ? 3622 CMP B "O5'" 1 
HETATM 4759 C "C5'" . CMP M 4 .   ? -8.399  1.940   -26.330 0.50 35.85  ? 3622 CMP B "C5'" 1 
HETATM 4760 C "C4'" . CMP M 4 .   ? -8.053  0.566   -25.829 0.50 35.46  ? 3622 CMP B "C4'" 1 
HETATM 4761 O "O4'" . CMP M 4 .   ? -6.996  0.545   -24.837 0.50 37.01  ? 3622 CMP B "O4'" 1 
HETATM 4762 C "C3'" . CMP M 4 .   ? -9.208  -0.040  -25.080 0.50 35.61  ? 3622 CMP B "C3'" 1 
HETATM 4763 O "O3'" . CMP M 4 .   ? -10.201 -0.292  -26.054 0.50 35.98  ? 3622 CMP B "O3'" 1 
HETATM 4764 C "C2'" . CMP M 4 .   ? -8.527  -1.219  -24.404 0.50 36.31  ? 3622 CMP B "C2'" 1 
HETATM 4765 O "O2'" . CMP M 4 .   ? -8.243  -2.265  -25.311 0.50 33.24  ? 3622 CMP B "O2'" 1 
HETATM 4766 C "C1'" . CMP M 4 .   ? -7.207  -0.564  -23.971 0.50 36.28  ? 3622 CMP B "C1'" 1 
HETATM 4767 N N9    . CMP M 4 .   ? -7.200  -0.083  -22.587 0.50 37.42  ? 3622 CMP B N9    1 
HETATM 4768 C C8    . CMP M 4 .   ? -6.155  -0.136  -21.697 0.50 37.81  ? 3622 CMP B C8    1 
HETATM 4769 N N7    . CMP M 4 .   ? -6.442  0.351   -20.514 0.50 36.68  ? 3622 CMP B N7    1 
HETATM 4770 C C5    . CMP M 4 .   ? -7.762  0.760   -20.633 0.50 37.30  ? 3622 CMP B C5    1 
HETATM 4771 C C6    . CMP M 4 .   ? -8.650  1.366   -19.726 0.50 38.13  ? 3622 CMP B C6    1 
HETATM 4772 N N6    . CMP M 4 .   ? -8.328  1.677   -18.468 0.50 39.32  ? 3622 CMP B N6    1 
HETATM 4773 N N1    . CMP M 4 .   ? -9.897  1.647   -20.160 0.50 38.48  ? 3622 CMP B N1    1 
HETATM 4774 C C2    . CMP M 4 .   ? -10.220 1.337   -21.421 0.50 38.02  ? 3622 CMP B C2    1 
HETATM 4775 N N3    . CMP M 4 .   ? -9.476  0.768   -22.367 0.50 38.47  ? 3622 CMP B N3    1 
HETATM 4776 C C4    . CMP M 4 .   ? -8.243  0.500   -21.904 0.50 36.93  ? 3622 CMP B C4    1 
HETATM 4777 C C1    . DIO N 5 .   ? 0.643   18.490  -26.681 1.00 48.54  ? 301  DIO B C1    1 
HETATM 4778 C C2    . DIO N 5 .   ? 1.878   17.183  -28.213 1.00 47.75  ? 301  DIO B C2    1 
HETATM 4779 C "C1'" . DIO N 5 .   ? 1.788   19.525  -26.644 1.00 48.79  ? 301  DIO B "C1'" 1 
HETATM 4780 C "C2'" . DIO N 5 .   ? 3.033   18.208  -28.161 1.00 48.19  ? 301  DIO B "C2'" 1 
HETATM 4781 O O1    . DIO N 5 .   ? 0.613   17.849  -27.976 1.00 46.42  ? 301  DIO B O1    1 
HETATM 4782 O "O1'" . DIO N 5 .   ? 3.053   18.857  -26.868 1.00 49.44  ? 301  DIO B "O1'" 1 
HETATM 4783 C C1    . DIO O 5 .   ? 2.008   5.735   -20.301 1.00 52.47  ? 302  DIO B C1    1 
HETATM 4784 C C2    . DIO O 5 .   ? 3.799   5.545   -21.835 1.00 50.81  ? 302  DIO B C2    1 
HETATM 4785 C "C1'" . DIO O 5 .   ? 1.381   6.835   -21.181 1.00 50.93  ? 302  DIO B "C1'" 1 
HETATM 4786 C "C2'" . DIO O 5 .   ? 3.163   6.640   -22.711 1.00 50.75  ? 302  DIO B "C2'" 1 
HETATM 4787 O O1    . DIO O 5 .   ? 2.759   4.817   -21.130 1.00 53.38  ? 302  DIO B O1    1 
HETATM 4788 O "O1'" . DIO O 5 .   ? 2.423   7.560   -21.872 1.00 51.11  ? 302  DIO B "O1'" 1 
HETATM 4789 O O     . HOH P 6 .   ? -7.328  1.643   7.759   1.00 34.86  ? 10   HOH W O     1 
HETATM 4790 O O     . HOH P 6 .   ? -2.070  7.270   6.796   1.00 28.75  ? 11   HOH W O     1 
HETATM 4791 O O     . HOH P 6 .   ? 1.003   4.643   13.132  1.00 26.86  ? 12   HOH W O     1 
HETATM 4792 O O     . HOH P 6 .   ? -4.379  6.121   5.997   1.00 28.79  ? 13   HOH W O     1 
HETATM 4793 O O     . HOH P 6 .   ? 6.248   5.062   13.093  1.00 38.69  ? 14   HOH W O     1 
HETATM 4794 O O     . HOH P 6 .   ? -3.442  5.773   14.248  1.00 43.50  ? 15   HOH W O     1 
HETATM 4795 O O     . HOH P 6 .   ? 3.884   12.988  10.873  1.00 46.13  ? 16   HOH W O     1 
HETATM 4796 O O     . HOH P 6 .   ? -8.453  10.023  14.928  1.00 53.74  ? 17   HOH W O     1 
HETATM 4797 O O     . HOH P 6 .   ? 4.599   14.914  14.588  1.00 52.61  ? 18   HOH W O     1 
HETATM 4798 O O     . HOH P 6 .   ? -3.527  2.673   12.743  1.00 50.71  ? 19   HOH W O     1 
HETATM 4799 O O     . HOH P 6 .   ? 7.983   12.967  11.475  1.00 53.46  ? 20   HOH W O     1 
HETATM 4800 O O     . HOH P 6 .   ? 15.959  -12.469 25.067  1.00 67.53  ? 21   HOH W O     1 
HETATM 4801 O O     . HOH P 6 .   ? 21.177  -6.787  25.581  1.00 71.15  ? 22   HOH W O     1 
HETATM 4802 O O     . HOH P 6 .   ? 1.168   14.236  9.215   1.00 57.95  ? 23   HOH W O     1 
HETATM 4803 O O     . HOH P 6 .   ? -6.674  2.293   11.982  1.00 54.99  ? 24   HOH W O     1 
HETATM 4804 O O     . HOH P 6 .   ? -14.746 22.643  -2.743  1.00 61.57  ? 25   HOH W O     1 
HETATM 4805 O O     . HOH Q 6 .   ? -11.461 0.166   -6.198  1.00 29.73  ? 14   HOH X O     1 
HETATM 4806 O O     . HOH Q 6 .   ? -0.788  6.355   13.877  1.00 32.53  ? 15   HOH X O     1 
HETATM 4807 O O     . HOH Q 6 .   ? -0.177  16.266  7.122   1.00 44.17  ? 16   HOH X O     1 
HETATM 4808 O O     . HOH Q 6 .   ? 3.587   5.506   13.932  1.00 33.52  ? 17   HOH X O     1 
HETATM 4809 O O     . HOH Q 6 .   ? -5.123  8.999   14.592  1.00 40.62  ? 18   HOH X O     1 
HETATM 4810 O O     . HOH Q 6 .   ? 3.668   -0.059  18.706  1.00 46.33  ? 19   HOH X O     1 
HETATM 4811 O O     . HOH Q 6 .   ? -2.302  15.068  4.921   1.00 46.52  ? 20   HOH X O     1 
HETATM 4812 O O     . HOH Q 6 .   ? -8.649  18.789  5.828   1.00 44.48  ? 21   HOH X O     1 
HETATM 4813 O O     . HOH Q 6 .   ? 0.571   17.275  12.764  1.00 45.40  ? 22   HOH X O     1 
HETATM 4814 O O     . HOH Q 6 .   ? -11.198 18.144  6.894   1.00 44.66  ? 23   HOH X O     1 
HETATM 4815 O O     . HOH Q 6 .   ? 5.488   2.141   23.180  1.00 60.85  ? 24   HOH X O     1 
HETATM 4816 O O     . HOH Q 6 .   ? 7.314   -3.147  20.519  1.00 53.09  ? 25   HOH X O     1 
HETATM 4817 O O     . HOH Q 6 .   ? -5.141  6.445   -7.711  1.00 50.80  ? 26   HOH X O     1 
HETATM 4818 O O     . HOH Q 6 .   ? -17.019 3.661   -14.386 1.00 64.20  ? 27   HOH X O     1 
HETATM 4819 O O     . HOH Q 6 .   ? -17.129 9.019   -3.592  1.00 73.90  ? 28   HOH X O     1 
HETATM 4820 O O     . HOH Q 6 .   ? 8.273   6.177   14.964  1.00 51.78  ? 29   HOH X O     1 
HETATM 4821 O O     . HOH Q 6 .   ? 2.093   13.309  20.067  1.00 54.88  ? 30   HOH X O     1 
HETATM 4822 O O     . HOH Q 6 .   ? -3.803  16.220  -7.454  1.00 56.20  ? 31   HOH X O     1 
HETATM 4823 O O     . HOH Q 6 .   ? -10.080 14.815  -8.275  1.00 55.99  ? 32   HOH X O     1 
HETATM 4824 O O     . HOH Q 6 .   ? 17.392  8.035   28.792  1.00 55.16  ? 33   HOH X O     1 
HETATM 4825 O O     . HOH Q 6 .   ? 1.991   10.109  22.517  1.00 67.31  ? 34   HOH X O     1 
HETATM 4826 O O     . HOH Q 6 .   ? 10.137  -0.962  21.164  1.00 63.13  ? 35   HOH X O     1 
HETATM 4827 O O     . HOH Q 6 .   ? -7.226  5.362   22.678  1.00 63.91  ? 36   HOH X O     1 
HETATM 4828 O O     . HOH Q 6 .   ? -11.393 1.538   -11.715 1.00 51.39  ? 37   HOH X O     1 
HETATM 4829 O O     . HOH R 6 .   ? -11.134 13.134  -31.981 1.00 28.01  ? 10   HOH Y O     1 
HETATM 4830 O O     . HOH R 6 .   ? -11.344 3.420   -40.482 1.00 32.83  ? 11   HOH Y O     1 
HETATM 4831 O O     . HOH R 6 .   ? -11.589 5.788   -39.365 1.00 36.46  ? 12   HOH Y O     1 
HETATM 4832 O O     . HOH R 6 .   ? -12.522 5.100   -31.747 1.00 41.81  ? 13   HOH Y O     1 
HETATM 4833 O O     . HOH R 6 .   ? -15.125 8.811   -38.313 1.00 39.48  ? 14   HOH Y O     1 
HETATM 4834 O O     . HOH R 6 .   ? -14.619 10.515  -29.242 1.00 49.77  ? 15   HOH Y O     1 
HETATM 4835 O O     . HOH R 6 .   ? -17.390 10.820  -27.238 1.00 62.36  ? 16   HOH Y O     1 
HETATM 4836 O O     . HOH R 6 .   ? -12.253 10.414  -37.652 1.00 38.86  ? 17   HOH Y O     1 
HETATM 4837 O O     . HOH R 6 .   ? -26.039 7.037   -19.949 1.00 57.46  ? 18   HOH Y O     1 
HETATM 4838 O O     . HOH R 6 .   ? -21.860 9.715   -35.590 1.00 61.89  ? 19   HOH Y O     1 
HETATM 4839 O O     . HOH R 6 .   ? -26.383 13.619  -11.963 1.00 65.42  ? 20   HOH Y O     1 
HETATM 4840 O O     . HOH R 6 .   ? 6.850   1.140   -58.527 1.00 63.00  ? 21   HOH Y O     1 
HETATM 4841 O O     . HOH R 6 .   ? -23.800 -1.036  -56.691 1.00 69.27  ? 22   HOH Y O     1 
HETATM 4842 O O     . HOH R 6 .   ? -32.718 14.615  -18.637 1.00 77.64  ? 23   HOH Y O     1 
HETATM 4843 O O     . HOH R 6 .   ? -28.278 4.439   -16.489 1.00 51.53  ? 24   HOH Y O     1 
HETATM 4844 O O     . HOH R 6 .   ? -18.920 12.491  -22.244 1.00 54.30  ? 25   HOH Y O     1 
HETATM 4845 O O     . HOH R 6 .   ? -6.461  0.996   -34.354 1.00 39.08  ? 26   HOH Y O     1 
HETATM 4846 O O     . HOH S 6 .   ? -14.017 6.498   -38.865 1.00 32.85  ? 34   HOH Z O     1 
HETATM 4847 O O     . HOH S 6 .   ? -6.814  14.422  -18.359 1.00 24.87  ? 43   HOH Z O     1 
HETATM 4848 O O     . HOH S 6 .   ? -9.725  -0.423  -43.177 1.00 50.61  ? 55   HOH Z O     1 
HETATM 4849 O O     . HOH S 6 .   ? -15.723 14.382  -17.676 1.00 50.23  ? 72   HOH Z O     1 
HETATM 4850 O O     . HOH S 6 .   ? -10.689 -3.584  -47.321 1.00 61.75  ? 81   HOH Z O     1 
HETATM 4851 O O     . HOH S 6 .   ? -27.419 3.440   -31.887 1.00 45.43  ? 114  HOH Z O     1 
HETATM 4852 O O     . HOH S 6 .   ? -16.920 11.579  -47.691 1.00 51.11  ? 152  HOH Z O     1 
HETATM 4853 O O     . HOH S 6 .   ? -32.876 -1.871  -34.172 1.00 71.03  ? 166  HOH Z O     1 
HETATM 4854 O O     . HOH S 6 .   ? -0.762  -5.516  -49.208 1.00 58.53  ? 172  HOH Z O     1 
HETATM 4855 O O     . HOH S 6 .   ? -11.810 8.655   -13.167 1.00 36.80  ? 188  HOH Z O     1 
HETATM 4856 O O     . HOH S 6 .   ? -4.985  4.110   -50.730 1.00 51.96  ? 193  HOH Z O     1 
HETATM 4857 O O     . HOH S 6 .   ? -16.745 10.012  -23.474 1.00 52.32  ? 195  HOH Z O     1 
HETATM 4858 O O     . HOH S 6 .   ? -32.205 6.257   -40.728 1.00 64.24  ? 198  HOH Z O     1 
HETATM 4859 O O     . HOH S 6 .   ? -20.158 13.517  -10.157 1.00 71.20  ? 204  HOH Z O     1 
HETATM 4860 O O     . HOH S 6 .   ? -21.072 -0.750  -40.025 1.00 56.97  ? 261  HOH Z O     1 
HETATM 4861 O O     . HOH S 6 .   ? 1.013   -0.023  -45.935 1.00 67.68  ? 263  HOH Z O     1 
HETATM 4862 O O     . HOH T 6 .   ? 16.824  -8.952  -8.798  1.00 34.42  ? 2623 HOH A O     1 
HETATM 4863 O O     . HOH T 6 .   ? 5.826   0.651   6.034   1.00 29.10  ? 2624 HOH A O     1 
HETATM 4864 O O     . HOH T 6 .   ? 11.316  -4.641  -10.372 1.00 27.63  ? 2625 HOH A O     1 
HETATM 4865 O O     . HOH T 6 .   ? 20.235  4.370   -15.598 1.00 26.85  ? 2626 HOH A O     1 
HETATM 4866 O O     . HOH T 6 .   ? 33.934  3.453   -14.215 1.00 32.50  ? 2627 HOH A O     1 
HETATM 4867 O O     . HOH T 6 .   ? 12.050  -6.252  -8.859  1.00 29.66  ? 2628 HOH A O     1 
HETATM 4868 O O     . HOH T 6 .   ? 26.786  5.538   -17.735 1.00 32.58  ? 2629 HOH A O     1 
HETATM 4869 O O     . HOH T 6 .   ? 18.768  -3.237  10.437  1.00 41.06  ? 2630 HOH A O     1 
HETATM 4870 O O     . HOH T 6 .   ? 36.508  0.361   -8.051  1.00 39.38  ? 2631 HOH A O     1 
HETATM 4871 O O     . HOH T 6 .   ? 20.693  -9.880  4.232   1.00 42.59  ? 2632 HOH A O     1 
HETATM 4872 O O     . HOH T 6 .   ? 28.813  6.630   -9.806  1.00 37.72  ? 2633 HOH A O     1 
HETATM 4873 O O     . HOH T 6 .   ? 18.352  -11.839 -6.555  1.00 45.71  ? 2634 HOH A O     1 
HETATM 4874 O O     . HOH T 6 .   ? 5.146   4.906   5.796   1.00 42.48  ? 2635 HOH A O     1 
HETATM 4875 O O     . HOH T 6 .   ? 0.628   -21.098 11.418  1.00 36.30  ? 2636 HOH A O     1 
HETATM 4876 O O     . HOH T 6 .   ? 39.013  -16.767 -3.959  1.00 46.59  ? 2637 HOH A O     1 
HETATM 4877 O O     . HOH T 6 .   ? 4.887   -0.856  -7.605  1.00 32.88  ? 2638 HOH A O     1 
HETATM 4878 O O     . HOH T 6 .   ? -2.491  11.962  0.784   1.00 36.64  ? 2639 HOH A O     1 
HETATM 4879 O O     . HOH T 6 .   ? 23.983  8.476   -6.573  1.00 40.95  ? 2640 HOH A O     1 
HETATM 4880 O O     . HOH T 6 .   ? -10.119 -3.804  -11.296 1.00 49.12  ? 2641 HOH A O     1 
HETATM 4881 O O     . HOH T 6 .   ? 6.060   -7.645  6.774   1.00 36.61  ? 2642 HOH A O     1 
HETATM 4882 O O     . HOH T 6 .   ? -9.930  -3.905  -16.556 1.00 52.05  ? 2643 HOH A O     1 
HETATM 4883 O O     . HOH T 6 .   ? 36.801  -1.309  1.765   1.00 44.09  ? 2644 HOH A O     1 
HETATM 4884 O O     . HOH T 6 .   ? -12.117 3.957   -4.098  1.00 49.52  ? 2645 HOH A O     1 
HETATM 4885 O O     . HOH T 6 .   ? 18.034  9.270   2.830   1.00 39.42  ? 2646 HOH A O     1 
HETATM 4886 O O     . HOH T 6 .   ? 25.990  8.076   -8.597  1.00 45.61  ? 2647 HOH A O     1 
HETATM 4887 O O     . HOH T 6 .   ? 6.669   -2.960  -5.668  1.00 42.24  ? 2648 HOH A O     1 
HETATM 4888 O O     . HOH T 6 .   ? 7.761   -4.609  3.617   1.00 57.71  ? 2649 HOH A O     1 
HETATM 4889 O O     . HOH T 6 .   ? 21.735  9.252   3.361   1.00 46.96  ? 2650 HOH A O     1 
HETATM 4890 O O     . HOH T 6 .   ? 10.499  3.130   1.647   1.00 55.44  ? 2651 HOH A O     1 
HETATM 4891 O O     . HOH T 6 .   ? 20.679  -13.677 -8.458  1.00 47.77  ? 2652 HOH A O     1 
HETATM 4892 O O     . HOH T 6 .   ? 40.174  -2.843  -3.716  1.00 49.65  ? 2653 HOH A O     1 
HETATM 4893 O O     . HOH T 6 .   ? -7.272  -0.692  8.997   1.00 43.89  ? 2654 HOH A O     1 
HETATM 4894 O O     . HOH T 6 .   ? 5.627   -9.841  -16.789 1.00 36.46  ? 2655 HOH A O     1 
HETATM 4895 O O     . HOH T 6 .   ? 14.810  2.511   -14.252 1.00 33.11  ? 2656 HOH A O     1 
HETATM 4896 O O     . HOH T 6 .   ? 15.828  -14.166 -14.495 1.00 35.30  ? 2657 HOH A O     1 
HETATM 4897 O O     . HOH T 6 .   ? 17.465  -13.648 -11.131 1.00 57.39  ? 2658 HOH A O     1 
HETATM 4898 O O     . HOH T 6 .   ? 13.282  -14.443 -14.911 1.00 48.31  ? 2659 HOH A O     1 
HETATM 4899 O O     . HOH T 6 .   ? 10.209  4.544   11.196  1.00 53.90  ? 2660 HOH A O     1 
HETATM 4900 O O     . HOH T 6 .   ? 2.162   -5.456  -5.323  1.00 62.63  ? 2661 HOH A O     1 
HETATM 4901 O O     . HOH T 6 .   ? 37.408  -15.773 -10.458 1.00 54.07  ? 2662 HOH A O     1 
HETATM 4902 O O     . HOH T 6 .   ? 10.154  -6.241  -5.249  1.00 46.89  ? 2663 HOH A O     1 
HETATM 4903 O O     . HOH T 6 .   ? 16.009  9.300   -15.163 1.00 60.54  ? 2664 HOH A O     1 
HETATM 4904 O O     . HOH T 6 .   ? 26.904  -18.029 -17.560 1.00 45.43  ? 2665 HOH A O     1 
HETATM 4905 O O     . HOH T 6 .   ? 27.453  -2.644  -23.908 1.00 54.14  ? 2666 HOH A O     1 
HETATM 4906 O O     . HOH T 6 .   ? -3.378  -7.171  -14.283 1.00 46.38  ? 2667 HOH A O     1 
HETATM 4907 O O     . HOH T 6 .   ? 40.852  -13.699 -3.003  1.00 61.54  ? 2668 HOH A O     1 
HETATM 4908 O O     . HOH T 6 .   ? 25.756  -3.934  8.521   1.00 73.28  ? 2669 HOH A O     1 
HETATM 4909 O O     . HOH T 6 .   ? 15.527  8.746   -0.808  1.00 52.24  ? 2670 HOH A O     1 
HETATM 4910 O O     . HOH T 6 .   ? -11.171 -8.259  -3.417  1.00 64.22  ? 2671 HOH A O     1 
HETATM 4911 O O     . HOH T 6 .   ? 37.792  -19.976 -7.752  1.00 55.65  ? 2672 HOH A O     1 
HETATM 4912 O O     . HOH T 6 .   ? -6.034  0.052   12.913  1.00 51.63  ? 2673 HOH A O     1 
HETATM 4913 O O     . HOH T 6 .   ? -3.113  -22.857 10.319  1.00 56.87  ? 2674 HOH A O     1 
HETATM 4914 O O     . HOH T 6 .   ? 9.537   12.386  -1.663  1.00 55.19  ? 2675 HOH A O     1 
HETATM 4915 O O     . HOH T 6 .   ? -7.345  -15.637 -2.551  1.00 66.22  ? 2676 HOH A O     1 
HETATM 4916 O O     . HOH T 6 .   ? -9.712  6.734   5.680   1.00 56.35  ? 2677 HOH A O     1 
HETATM 4917 O O     . HOH T 6 .   ? -8.171  -24.494 1.210   1.00 54.43  ? 2678 HOH A O     1 
HETATM 4918 O O     . HOH T 6 .   ? 21.149  15.545  -14.218 1.00 60.42  ? 2679 HOH A O     1 
HETATM 4919 O O     . HOH T 6 .   ? 6.777   -16.624 11.668  1.00 63.94  ? 2680 HOH A O     1 
HETATM 4920 O O     . HOH T 6 .   ? 12.382  -7.365  1.623   1.00 48.23  ? 2681 HOH A O     1 
HETATM 4921 O O     . HOH T 6 .   ? 11.848  15.789  -7.676  1.00 64.66  ? 2682 HOH A O     1 
HETATM 4922 O O     . HOH T 6 .   ? 41.799  -16.052 -7.528  1.00 63.47  ? 2683 HOH A O     1 
HETATM 4923 O O     . HOH T 6 .   ? 13.909  -18.215 1.666   1.00 69.63  ? 2684 HOH A O     1 
HETATM 4924 O O     . HOH T 6 .   ? 17.424  -7.787  5.322   1.00 49.13  ? 2685 HOH A O     1 
HETATM 4925 O O     . HOH T 6 .   ? 20.903  14.920  -8.914  1.00 50.88  ? 2686 HOH A O     1 
HETATM 4926 O O     . HOH T 6 .   ? -4.474  -11.510 15.349  1.00 50.27  ? 2687 HOH A O     1 
HETATM 4927 O O     . HOH T 6 .   ? 26.191  -11.515 0.001   1.00 59.97  ? 2688 HOH A O     1 
HETATM 4928 O O     . HOH T 6 .   ? 24.334  -10.060 9.780   1.00 69.68  ? 2689 HOH A O     1 
HETATM 4929 O O     . HOH T 6 .   ? 12.360  -12.128 -2.237  1.00 64.76  ? 2690 HOH A O     1 
HETATM 4930 O O     . HOH T 6 .   ? 35.736  4.017   -1.206  1.00 64.24  ? 2691 HOH A O     1 
HETATM 4931 O O     . HOH T 6 .   ? 3.203   -6.660  -7.847  1.00 67.36  ? 2692 HOH A O     1 
HETATM 4932 O O     . HOH T 6 .   ? 19.735  -10.913 8.088   1.00 54.83  ? 2693 HOH A O     1 
HETATM 4933 O O     . HOH T 6 .   ? 41.088  -14.277 -20.226 1.00 61.49  ? 2694 HOH A O     1 
HETATM 4934 O O     . HOH T 6 .   ? -14.528 1.579   -3.712  1.00 63.19  ? 2695 HOH A O     1 
HETATM 4935 O O     . HOH T 6 .   ? 26.924  -3.239  -27.002 1.00 54.17  ? 2696 HOH A O     1 
HETATM 4936 O O     . HOH T 6 .   ? 25.948  2.102   10.306  1.00 71.77  ? 2697 HOH A O     1 
HETATM 4937 O O     . HOH T 6 .   ? -16.568 -13.350 1.804   1.00 70.08  ? 2698 HOH A O     1 
HETATM 4938 O O     . HOH T 6 .   ? 4.106   -6.575  -10.676 1.00 65.48  ? 2699 HOH A O     1 
HETATM 4939 O O     . HOH T 6 .   ? 37.834  -1.818  -18.190 1.00 50.56  ? 2700 HOH A O     1 
HETATM 4940 O O     . HOH T 6 .   ? 5.801   -6.856  4.255   1.00 45.74  ? 2701 HOH A O     1 
HETATM 4941 O O     . HOH T 6 .   ? -7.166  -20.682 6.834   1.00 73.31  ? 2702 HOH A O     1 
HETATM 4942 O O     . HOH T 6 .   ? 42.240  -4.354  -7.469  1.00 51.18  ? 2703 HOH A O     1 
HETATM 4943 O O     . HOH T 6 .   ? 6.506   -9.935  -7.273  1.00 63.81  ? 2704 HOH A O     1 
HETATM 4944 O O     . HOH T 6 .   ? 37.601  -5.413  -0.093  1.00 51.56  ? 2705 HOH A O     1 
HETATM 4945 O O     . HOH T 6 .   ? 21.146  7.990   -23.013 1.00 62.19  ? 2706 HOH A O     1 
HETATM 4946 O O     . HOH T 6 .   ? -13.866 -15.527 -1.140  1.00 51.99  ? 2707 HOH A O     1 
HETATM 4947 O O     . HOH T 6 .   ? 36.584  -13.190 -21.514 1.00 53.04  ? 2708 HOH A O     1 
HETATM 4948 O O     . HOH T 6 .   ? 3.048   -12.852 -9.179  1.00 76.40  ? 2709 HOH A O     1 
HETATM 4949 O O     . HOH T 6 .   ? 29.007  5.621   -3.408  1.00 52.54  ? 2710 HOH A O     1 
HETATM 4950 O O     . HOH U 6 .   ? -10.015 14.684  -33.750 1.00 29.30  ? 3623 HOH B O     1 
HETATM 4951 O O     . HOH U 6 .   ? -4.468  17.238  -39.539 1.00 29.07  ? 3624 HOH B O     1 
HETATM 4952 O O     . HOH U 6 .   ? 21.868  0.119   -22.338 1.00 28.57  ? 3625 HOH B O     1 
HETATM 4953 O O     . HOH U 6 .   ? -10.866 13.244  -18.960 1.00 34.70  ? 3626 HOH B O     1 
HETATM 4954 O O     . HOH U 6 .   ? -2.193  22.726  -39.758 1.00 30.17  ? 3627 HOH B O     1 
HETATM 4955 O O     . HOH U 6 .   ? 9.081   -14.404 -19.772 1.00 32.73  ? 3628 HOH B O     1 
HETATM 4956 O O     . HOH U 6 .   ? 9.408   -21.266 -27.734 1.00 41.22  ? 3629 HOH B O     1 
HETATM 4957 O O     . HOH U 6 .   ? 18.049  -23.179 -33.191 1.00 32.60  ? 3630 HOH B O     1 
HETATM 4958 O O     . HOH U 6 .   ? 2.583   -7.197  -44.188 1.00 34.96  ? 3631 HOH B O     1 
HETATM 4959 O O     . HOH U 6 .   ? 6.753   -17.300 -33.951 1.00 32.57  ? 3632 HOH B O     1 
HETATM 4960 O O     . HOH U 6 .   ? 6.210   10.980  -15.041 1.00 46.17  ? 3633 HOH B O     1 
HETATM 4961 O O     . HOH U 6 .   ? 2.156   21.919  -30.545 1.00 39.54  ? 3634 HOH B O     1 
HETATM 4962 O O     . HOH U 6 .   ? -2.620  3.238   -35.408 1.00 33.33  ? 3635 HOH B O     1 
HETATM 4963 O O     . HOH U 6 .   ? -5.058  23.814  -33.900 1.00 37.85  ? 3636 HOH B O     1 
HETATM 4964 O O     . HOH U 6 .   ? 0.451   26.272  -32.014 1.00 41.57  ? 3637 HOH B O     1 
HETATM 4965 O O     . HOH U 6 .   ? 17.302  -19.831 -42.361 1.00 46.21  ? 3638 HOH B O     1 
HETATM 4966 O O     . HOH U 6 .   ? 10.649  -1.198  -22.742 1.00 29.27  ? 3639 HOH B O     1 
HETATM 4967 O O     . HOH U 6 .   ? -2.642  -11.648 -40.157 1.00 56.36  ? 3640 HOH B O     1 
HETATM 4968 O O     . HOH U 6 .   ? 4.789   -17.997 -28.698 1.00 38.85  ? 3641 HOH B O     1 
HETATM 4969 O O     . HOH U 6 .   ? 3.885   -23.203 -18.434 1.00 52.18  ? 3642 HOH B O     1 
HETATM 4970 O O     . HOH U 6 .   ? 15.504  -24.001 -22.390 1.00 44.83  ? 3643 HOH B O     1 
HETATM 4971 O O     . HOH U 6 .   ? 7.061   18.991  -33.033 1.00 61.22  ? 3644 HOH B O     1 
HETATM 4972 O O     . HOH U 6 .   ? -6.437  2.087   -39.628 1.00 45.74  ? 3645 HOH B O     1 
HETATM 4973 O O     . HOH U 6 .   ? 24.317  -10.642 -32.555 1.00 56.01  ? 3646 HOH B O     1 
HETATM 4974 O O     . HOH U 6 .   ? 11.753  -0.527  -24.962 1.00 35.45  ? 3647 HOH B O     1 
HETATM 4975 O O     . HOH U 6 .   ? 7.183   -16.999 -39.785 1.00 34.45  ? 3648 HOH B O     1 
HETATM 4976 O O     . HOH U 6 .   ? 15.924  -2.442  -27.010 1.00 43.13  ? 3649 HOH B O     1 
HETATM 4977 O O     . HOH U 6 .   ? -4.110  5.077   -11.514 1.00 57.30  ? 3650 HOH B O     1 
HETATM 4978 O O     . HOH U 6 .   ? -3.171  9.418   -12.689 1.00 64.53  ? 3651 HOH B O     1 
HETATM 4979 O O     . HOH U 6 .   ? 33.124  -15.195 -32.910 1.00 48.29  ? 3652 HOH B O     1 
HETATM 4980 O O     . HOH U 6 .   ? -11.557 21.673  -32.525 1.00 52.45  ? 3653 HOH B O     1 
HETATM 4981 O O     . HOH U 6 .   ? -2.636  -21.726 -31.711 1.00 56.15  ? 3654 HOH B O     1 
HETATM 4982 O O     . HOH U 6 .   ? 1.485   -23.027 -31.696 1.00 62.62  ? 3655 HOH B O     1 
HETATM 4983 O O     . HOH U 6 .   ? -0.519  -2.985  -33.016 1.00 63.28  ? 3656 HOH B O     1 
HETATM 4984 O O     . HOH U 6 .   ? 4.443   -3.678  -44.133 1.00 55.10  ? 3657 HOH B O     1 
HETATM 4985 O O     . HOH U 6 .   ? 7.740   2.969   -35.561 1.00 62.80  ? 3658 HOH B O     1 
HETATM 4986 O O     . HOH U 6 .   ? 3.361   3.809   -34.580 1.00 53.34  ? 3659 HOH B O     1 
HETATM 4987 O O     . HOH U 6 .   ? 14.124  -0.547  -26.406 1.00 48.67  ? 3660 HOH B O     1 
HETATM 4988 O O     . HOH U 6 .   ? 3.655   8.150   -38.058 1.00 43.69  ? 3661 HOH B O     1 
HETATM 4989 O O     . HOH U 6 .   ? -3.521  20.623  -40.662 1.00 41.70  ? 3662 HOH B O     1 
HETATM 4990 O O     . HOH U 6 .   ? 5.477   5.808   -27.788 1.00 55.21  ? 3663 HOH B O     1 
HETATM 4991 O O     . HOH U 6 .   ? 6.710   -19.649 -27.614 1.00 56.63  ? 3664 HOH B O     1 
HETATM 4992 O O     . HOH U 6 .   ? 8.429   1.984   -27.343 1.00 55.42  ? 3665 HOH B O     1 
HETATM 4993 O O     . HOH U 6 .   ? 5.791   2.694   -26.482 1.00 57.13  ? 3666 HOH B O     1 
HETATM 4994 O O     . HOH U 6 .   ? 13.163  13.286  -36.796 1.00 57.31  ? 3667 HOH B O     1 
HETATM 4995 O O     . HOH U 6 .   ? 2.842   24.586  -30.093 1.00 51.01  ? 3668 HOH B O     1 
HETATM 4996 O O     . HOH U 6 .   ? 4.021   23.602  -27.929 1.00 69.10  ? 3669 HOH B O     1 
HETATM 4997 O O     . HOH U 6 .   ? 5.929   21.164  -28.427 1.00 66.74  ? 3670 HOH B O     1 
HETATM 4998 O O     . HOH U 6 .   ? -3.685  4.893   -14.545 1.00 56.16  ? 3671 HOH B O     1 
HETATM 4999 O O     . HOH U 6 .   ? 4.294   19.624  -23.293 1.00 63.39  ? 3672 HOH B O     1 
HETATM 5000 O O     . HOH U 6 .   ? 2.249   -17.626 -34.666 1.00 53.69  ? 3673 HOH B O     1 
HETATM 5001 O O     . HOH U 6 .   ? -9.205  0.574   -15.164 1.00 53.80  ? 3674 HOH B O     1 
HETATM 5002 O O     . HOH U 6 .   ? -1.601  -20.720 -22.777 1.00 65.46  ? 3675 HOH B O     1 
HETATM 5003 O O     . HOH U 6 .   ? 28.950  -7.331  -34.905 1.00 55.46  ? 3676 HOH B O     1 
HETATM 5004 O O     . HOH U 6 .   ? -1.070  -2.607  -38.053 1.00 47.22  ? 3677 HOH B O     1 
HETATM 5005 O O     . HOH U 6 .   ? -1.460  20.122  -22.395 1.00 59.20  ? 3678 HOH B O     1 
HETATM 5006 O O     . HOH U 6 .   ? 20.572  -17.614 -13.742 1.00 61.54  ? 3679 HOH B O     1 
HETATM 5007 O O     . HOH U 6 .   ? 14.365  5.803   -16.624 1.00 38.87  ? 3680 HOH B O     1 
HETATM 5008 O O     . HOH U 6 .   ? -16.731 1.954   -27.125 1.00 46.48  ? 3681 HOH B O     1 
HETATM 5009 O O     . HOH U 6 .   ? 20.896  -0.909  -26.513 1.00 48.41  ? 3682 HOH B O     1 
HETATM 5010 O O     . HOH U 6 .   ? 9.927   5.242   -25.877 1.00 63.18  ? 3683 HOH B O     1 
HETATM 5011 O O     . HOH U 6 .   ? 0.303   -9.298  -17.533 1.00 66.37  ? 3684 HOH B O     1 
HETATM 5012 O O     . HOH U 6 .   ? -10.736 14.316  -36.873 1.00 46.39  ? 3685 HOH B O     1 
HETATM 5013 O O     . HOH U 6 .   ? 20.246  -12.359 -43.192 1.00 64.24  ? 3686 HOH B O     1 
HETATM 5014 O O     . HOH U 6 .   ? 2.914   -23.899 -24.237 1.00 62.43  ? 3687 HOH B O     1 
HETATM 5015 O O     . HOH U 6 .   ? 9.342   20.810  -39.693 1.00 56.27  ? 3688 HOH B O     1 
HETATM 5016 O O     . HOH U 6 .   ? -4.334  8.284   -44.323 1.00 59.58  ? 3689 HOH B O     1 
HETATM 5017 O O     . HOH U 6 .   ? -14.554 1.905   -25.281 1.00 60.34  ? 3690 HOH B O     1 
HETATM 5018 O O     . HOH U 6 .   ? 31.804  -4.437  -28.257 1.00 64.73  ? 3691 HOH B O     1 
HETATM 5019 O O     . HOH U 6 .   ? 17.199  -1.873  -44.247 1.00 60.72  ? 3692 HOH B O     1 
HETATM 5020 O O     . HOH U 6 .   ? 22.963  -3.675  -28.153 1.00 56.31  ? 3693 HOH B O     1 
HETATM 5021 O O     . HOH U 6 .   ? -10.203 -12.563 -10.161 1.00 67.42  ? 3694 HOH B O     1 
HETATM 5022 O O     . HOH U 6 .   ? -14.694 0.357   -27.829 1.00 57.16  ? 3695 HOH B O     1 
HETATM 5023 O O     . HOH U 6 .   ? -7.176  12.778  -43.079 1.00 69.79  ? 3696 HOH B O     1 
HETATM 5024 O O     . HOH U 6 .   ? -3.521  -15.762 -21.935 1.00 64.39  ? 3697 HOH B O     1 
HETATM 5025 O O     . HOH U 6 .   ? -4.666  18.436  -17.149 1.00 46.35  ? 3698 HOH B O     1 
HETATM 5026 O O     . HOH U 6 .   ? -7.882  -12.748 -30.920 1.00 52.37  ? 3699 HOH B O     1 
HETATM 5027 O O     . HOH U 6 .   ? -0.916  15.209  -13.913 1.00 57.22  ? 3700 HOH B O     1 
HETATM 5028 O O     . HOH U 6 .   ? -13.757 -12.720 -21.956 1.00 63.69  ? 3701 HOH B O     1 
HETATM 5029 O O     . HOH U 6 .   ? 15.511  3.900   -26.163 1.00 60.36  ? 3702 HOH B O     1 
HETATM 5030 O O     . HOH U 6 .   ? 28.181  -23.630 -31.533 1.00 70.06  ? 3703 HOH B O     1 
HETATM 5031 O O     . HOH U 6 .   ? 16.704  -24.199 -38.257 1.00 54.90  ? 3704 HOH B O     1 
HETATM 5032 O O     . HOH U 6 .   ? -14.557 10.080  -21.576 1.00 63.36  ? 3705 HOH B O     1 
HETATM 5033 O O     . HOH U 6 .   ? 3.269   6.296   -35.438 1.00 60.03  ? 3706 HOH B O     1 
HETATM 5034 O O     . HOH U 6 .   ? 0.507   -2.708  -43.476 1.00 73.48  ? 3707 HOH B O     1 
HETATM 5035 O O     . HOH U 6 .   ? 7.881   -24.358 -27.053 1.00 52.63  ? 3708 HOH B O     1 
HETATM 5036 O O     . HOH U 6 .   ? -8.660  28.492  -32.673 1.00 58.18  ? 3709 HOH B O     1 
HETATM 5037 O O     . HOH U 6 .   ? -4.604  -11.854 -18.820 1.00 56.37  ? 3710 HOH B O     1 
HETATM 5038 O O     . HOH U 6 .   ? 20.326  -25.804 -22.328 1.00 58.71  ? 3711 HOH B O     1 
HETATM 5039 O O     . HOH U 6 .   ? 23.144  -24.776 -38.760 1.00 60.04  ? 3712 HOH B O     1 
HETATM 5040 O O     . HOH U 6 .   ? -1.569  27.310  -25.695 1.00 66.24  ? 3713 HOH B O     1 
HETATM 5041 O O     . HOH U 6 .   ? 1.142   19.792  -22.136 1.00 71.11  ? 3714 HOH B O     1 
HETATM 5042 O O     . HOH U 6 .   ? 9.815   -22.756 -32.472 1.00 56.99  ? 3715 HOH B O     1 
HETATM 5043 O O     . HOH U 6 .   ? -9.604  23.101  -23.993 1.00 53.22  ? 3716 HOH B O     1 
HETATM 5044 O O     . HOH U 6 .   ? 8.754   -28.521 -19.132 1.00 74.47  ? 3717 HOH B O     1 
HETATM 5045 O O     . HOH U 6 .   ? 10.357  -24.727 -34.149 1.00 58.15  ? 3718 HOH B O     1 
HETATM 5046 O O     . HOH U 6 .   ? 10.315  15.111  -26.292 1.00 66.14  ? 3719 HOH B O     1 
HETATM 5047 O O     . HOH U 6 .   ? 33.120  -23.786 -26.146 1.00 56.84  ? 3720 HOH B O     1 
HETATM 5048 O O     . HOH U 6 .   ? 2.921   15.695  -20.707 1.00 54.20  ? 3721 HOH B O     1 
HETATM 5049 O O     . HOH U 6 .   ? 18.356  -1.684  -31.399 1.00 64.81  ? 3722 HOH B O     1 
HETATM 5050 O O     . HOH U 6 .   ? -3.287  -10.570 -30.056 1.00 60.76  ? 3723 HOH B O     1 
HETATM 5051 O O     . HOH U 6 .   ? 31.403  -3.644  -40.609 1.00 73.30  ? 3724 HOH B O     1 
HETATM 5052 O O     . HOH U 6 .   ? 0.414   27.622  -28.026 1.00 67.33  ? 3725 HOH B O     1 
HETATM 5053 O O     . HOH U 6 .   ? 17.247  -19.683 -45.203 1.00 62.72  ? 3726 HOH B O     1 
HETATM 5054 O O     . HOH U 6 .   ? -0.343  17.972  -20.668 1.00 66.24  ? 3727 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   DA  1   -8  ?   ?   ?   W . n 
A 1 2   DT  2   -7  ?   ?   ?   W . n 
A 1 3   DT  3   -6  -6  DT  T   W . n 
A 1 4   DT  4   -5  -5  DT  T   W . n 
A 1 5   DC  5   -4  -4  DC  C   W . n 
A 1 6   DG  6   -3  -3  DG  G   W . n 
A 1 7   DA  7   -2  -2  DA  A   W . n 
A 1 8   DA  8   -1  -1  DA  A   W . n 
A 1 9   DA  9   1   1   DA  A   W . n 
A 1 10  DA  10  2   2   DA  A   W . n 
A 1 11  DA  11  3   3   DA  A   W . n 
A 1 12  DT  12  4   4   DT  T   W . n 
A 1 13  DG  13  5   5   DG  G   W . n 
A 1 14  DC  14  6   6   DC  C   W . n 
A 1 15  DG  15  7   7   DG  G   W . n 
A 1 16  DA  16  8   8   DA  A   W . n 
A 1 17  DT  17  9   9   DT  T   W . n 
B 2 1   DC  1   13  13  DC  C   X . n 
B 2 2   DT  2   12  12  DT  T   X . n 
B 2 3   DA  3   11  11  DA  A   X . n 
B 2 4   DG  4   10  10  DG  G   X . n 
B 2 5   DA  5   9   9   DA  A   X . n 
B 2 6   DT  6   8   8   DT  T   X . n 
B 2 7   DC  7   7   7   DC  C   X . n 
B 2 8   DG  8   6   6   DG  G   X . n 
B 2 9   DC  9   5   5   DC  C   X . n 
B 2 10  DA  10  4   4   DA  A   X . n 
B 2 11  DT  11  3   3   DT  T   X . n 
B 2 12  DT  12  2   2   DT  T   X . n 
B 2 13  DT  13  1   1   DT  T   X . n 
B 2 14  DT  14  -1  -1  DT  T   X . n 
B 2 15  DT  15  -2  -2  DT  T   X . n 
B 2 16  DC  16  -3  -3  DC  C   X . n 
B 2 17  DG  17  -4  -4  DG  G   X . n 
B 2 18  DA  18  -5  -5  DA  A   X . n 
B 2 19  DA  19  -6  -6  DA  A   X . n 
B 2 20  DA  20  -7  -7  DA  A   X . n 
B 2 21  DT  21  -8  -8  DT  T   X . n 
C 1 1   DA  1   -8  ?   ?   ?   Y . n 
C 1 2   DT  2   -7  -7  DT  T   Y . n 
C 1 3   DT  3   -6  -6  DT  T   Y . n 
C 1 4   DT  4   -5  -5  DT  T   Y . n 
C 1 5   DC  5   -4  -4  DC  C   Y . n 
C 1 6   DG  6   -3  -3  DG  G   Y . n 
C 1 7   DA  7   -2  -2  DA  A   Y . n 
C 1 8   DA  8   -1  -1  DA  A   Y . n 
C 1 9   DA  9   1   1   DA  A   Y . n 
C 1 10  DA  10  2   2   DA  A   Y . n 
C 1 11  DA  11  3   3   DA  A   Y . n 
C 1 12  DT  12  4   4   DT  T   Y . n 
C 1 13  DG  13  5   5   DG  G   Y . n 
C 1 14  DC  14  6   6   DC  C   Y . n 
C 1 15  DG  15  7   7   DG  G   Y . n 
C 1 16  DA  16  8   8   DA  A   Y . n 
C 1 17  DT  17  9   9   DT  T   Y . n 
D 2 1   DC  1   13  13  DC  C   Z . n 
D 2 2   DT  2   12  12  DT  T   Z . n 
D 2 3   DA  3   11  11  DA  A   Z . n 
D 2 4   DG  4   10  10  DG  G   Z . n 
D 2 5   DA  5   9   9   DA  A   Z . n 
D 2 6   DT  6   8   8   DT  T   Z . n 
D 2 7   DC  7   7   7   DC  C   Z . n 
D 2 8   DG  8   6   6   DG  G   Z . n 
D 2 9   DC  9   5   5   DC  C   Z . n 
D 2 10  DA  10  4   4   DA  A   Z . n 
D 2 11  DT  11  3   3   DT  T   Z . n 
D 2 12  DT  12  2   2   DT  T   Z . n 
D 2 13  DT  13  1   1   DT  T   Z . n 
D 2 14  DT  14  -1  -1  DT  T   Z . n 
D 2 15  DT  15  -2  -2  DT  T   Z . n 
D 2 16  DC  16  -3  -3  DC  C   Z . n 
D 2 17  DG  17  -4  -4  DG  G   Z . n 
D 2 18  DA  18  -5  -5  DA  A   Z . n 
D 2 19  DA  19  -6  -6  DA  A   Z . n 
D 2 20  DA  20  -7  -7  DA  A   Z . n 
D 2 21  DT  21  -8  -8  DT  T   Z . n 
E 3 1   VAL 1   1   ?   ?   ?   A . n 
E 3 2   LEU 2   2   ?   ?   ?   A . n 
E 3 3   GLY 3   3   ?   ?   ?   A . n 
E 3 4   LYS 4   4   ?   ?   ?   A . n 
E 3 5   PRO 5   5   ?   ?   ?   A . n 
E 3 6   GLN 6   6   ?   ?   ?   A . n 
E 3 7   THR 7   7   7   THR THR A . n 
E 3 8   ASP 8   8   8   ASP ASP A . n 
E 3 9   PRO 9   9   9   PRO PRO A . n 
E 3 10  THR 10  10  10  THR THR A . n 
E 3 11  LEU 11  11  11  LEU LEU A . n 
E 3 12  GLU 12  12  12  GLU GLU A . n 
E 3 13  TRP 13  13  13  TRP TRP A . n 
E 3 14  PHE 14  14  14  PHE PHE A . n 
E 3 15  LEU 15  15  15  LEU LEU A . n 
E 3 16  SER 16  16  16  SER SER A . n 
E 3 17  HIS 17  17  17  HIS HIS A . n 
E 3 18  CYS 18  18  18  CYS CYS A . n 
E 3 19  HIS 19  19  19  HIS HIS A . n 
E 3 20  ILE 20  20  20  ILE ILE A . n 
E 3 21  HIS 21  21  21  HIS HIS A . n 
E 3 22  LYS 22  22  22  LYS LYS A . n 
E 3 23  TYR 23  23  23  TYR TYR A . n 
E 3 24  PRO 24  24  24  PRO PRO A . n 
E 3 25  SER 25  25  25  SER SER A . n 
E 3 26  LYS 26  26  26  LYS LYS A . n 
E 3 27  SER 27  27  27  SER SER A . n 
E 3 28  THR 28  28  28  THR THR A . n 
E 3 29  LEU 29  29  29  LEU LEU A . n 
E 3 30  ILE 30  30  30  ILE ILE A . n 
E 3 31  HIS 31  31  31  HIS HIS A . n 
E 3 32  GLN 32  32  32  GLN GLN A . n 
E 3 33  GLY 33  33  33  GLY GLY A . n 
E 3 34  GLU 34  34  34  GLU GLU A . n 
E 3 35  LYS 35  35  35  LYS LYS A . n 
E 3 36  ALA 36  36  36  ALA ALA A . n 
E 3 37  GLU 37  37  37  GLU GLU A . n 
E 3 38  THR 38  38  38  THR THR A . n 
E 3 39  LEU 39  39  39  LEU LEU A . n 
E 3 40  TYR 40  40  40  TYR TYR A . n 
E 3 41  TYR 41  41  41  TYR TYR A . n 
E 3 42  ILE 42  42  42  ILE ILE A . n 
E 3 43  VAL 43  43  43  VAL VAL A . n 
E 3 44  LYS 44  44  44  LYS LYS A . n 
E 3 45  GLY 45  45  45  GLY GLY A . n 
E 3 46  SER 46  46  46  SER SER A . n 
E 3 47  VAL 47  47  47  VAL VAL A . n 
E 3 48  ALA 48  48  48  ALA ALA A . n 
E 3 49  VAL 49  49  49  VAL VAL A . n 
E 3 50  LEU 50  50  50  LEU LEU A . n 
E 3 51  ILE 51  51  51  ILE ILE A . n 
E 3 52  LYS 52  52  52  LYS LYS A . n 
E 3 53  ASP 53  53  53  ASP ASP A . n 
E 3 54  GLU 54  54  54  GLU GLU A . n 
E 3 55  GLU 55  55  55  GLU GLU A . n 
E 3 56  GLY 56  56  56  GLY GLY A . n 
E 3 57  LYS 57  57  57  LYS LYS A . n 
E 3 58  GLU 58  58  58  GLU GLU A . n 
E 3 59  MET 59  59  59  MET MET A . n 
E 3 60  ILE 60  60  60  ILE ILE A . n 
E 3 61  LEU 61  61  61  LEU LEU A . n 
E 3 62  SER 62  62  62  SER SER A . n 
E 3 63  TYR 63  63  63  TYR TYR A . n 
E 3 64  LEU 64  64  64  LEU LEU A . n 
E 3 65  ASN 65  65  65  ASN ASN A . n 
E 3 66  GLN 66  66  66  GLN GLN A . n 
E 3 67  GLY 67  67  67  GLY GLY A . n 
E 3 68  ASP 68  68  68  ASP ASP A . n 
E 3 69  PHE 69  69  69  PHE PHE A . n 
E 3 70  ILE 70  70  70  ILE ILE A . n 
E 3 71  GLY 71  71  71  GLY GLY A . n 
E 3 72  GLU 72  72  72  GLU GLU A . n 
E 3 73  LEU 73  73  73  LEU LEU A . n 
E 3 74  GLY 74  74  74  GLY GLY A . n 
E 3 75  LEU 75  75  75  LEU LEU A . n 
E 3 76  PHE 76  76  76  PHE PHE A . n 
E 3 77  GLU 77  77  77  GLU GLU A . n 
E 3 78  GLU 78  78  78  GLU GLU A . n 
E 3 79  GLY 79  79  79  GLY GLY A . n 
E 3 80  GLN 80  80  80  GLN GLN A . n 
E 3 81  GLU 81  81  81  GLU GLU A . n 
E 3 82  ARG 82  82  82  ARG ARG A . n 
E 3 83  SER 83  83  83  SER SER A . n 
E 3 84  ALA 84  84  84  ALA ALA A . n 
E 3 85  TRP 85  85  85  TRP TRP A . n 
E 3 86  VAL 86  86  86  VAL VAL A . n 
E 3 87  ARG 87  87  87  ARG ARG A . n 
E 3 88  ALA 88  88  88  ALA ALA A . n 
E 3 89  LYS 89  89  89  LYS LYS A . n 
E 3 90  THR 90  90  90  THR THR A . n 
E 3 91  ALA 91  91  91  ALA ALA A . n 
E 3 92  CYS 92  92  92  CYS CYS A . n 
E 3 93  GLU 93  93  93  GLU GLU A . n 
E 3 94  VAL 94  94  94  VAL VAL A . n 
E 3 95  ALA 95  95  95  ALA ALA A . n 
E 3 96  GLU 96  96  96  GLU GLU A . n 
E 3 97  ILE 97  97  97  ILE ILE A . n 
E 3 98  SER 98  98  98  SER SER A . n 
E 3 99  TYR 99  99  99  TYR TYR A . n 
E 3 100 LYS 100 100 100 LYS LYS A . n 
E 3 101 LYS 101 101 101 LYS LYS A . n 
E 3 102 PHE 102 102 102 PHE PHE A . n 
E 3 103 ARG 103 103 103 ARG ARG A . n 
E 3 104 GLN 104 104 104 GLN GLN A . n 
E 3 105 LEU 105 105 105 LEU LEU A . n 
E 3 106 ILE 106 106 106 ILE ILE A . n 
E 3 107 GLN 107 107 107 GLN GLN A . n 
E 3 108 VAL 108 108 108 VAL VAL A . n 
E 3 109 ASN 109 109 109 ASN ASN A . n 
E 3 110 PRO 110 110 110 PRO PRO A . n 
E 3 111 ASP 111 111 111 ASP ASP A . n 
E 3 112 ILE 112 112 112 ILE ILE A . n 
E 3 113 LEU 113 113 113 LEU LEU A . n 
E 3 114 MET 114 114 114 MET MET A . n 
E 3 115 ARG 115 115 115 ARG ARG A . n 
E 3 116 LEU 116 116 116 LEU LEU A . n 
E 3 117 SER 117 117 117 SER SER A . n 
E 3 118 ALA 118 118 118 ALA ALA A . n 
E 3 119 GLN 119 119 119 GLN GLN A . n 
E 3 120 MET 120 120 120 MET MET A . n 
E 3 121 ALA 121 121 121 ALA ALA A . n 
E 3 122 ARG 122 122 122 ARG ARG A . n 
E 3 123 ARG 123 123 123 ARG ARG A . n 
E 3 124 LEU 124 124 124 LEU LEU A . n 
E 3 125 GLN 125 125 125 GLN GLN A . n 
E 3 126 VAL 126 126 126 VAL VAL A . n 
E 3 127 THR 127 127 127 THR THR A . n 
E 3 128 SER 128 128 128 SER SER A . n 
E 3 129 GLU 129 129 129 GLU GLU A . n 
E 3 130 LYS 130 130 130 LYS LYS A . n 
E 3 131 VAL 131 131 131 VAL VAL A . n 
E 3 132 GLY 132 132 132 GLY GLY A . n 
E 3 133 ASN 133 133 133 ASN ASN A . n 
E 3 134 LEU 134 134 134 LEU LEU A . n 
E 3 135 ALA 135 135 135 ALA ALA A . n 
E 3 136 PHE 136 136 136 PHE PHE A . n 
E 3 137 LEU 137 137 137 LEU LEU A . n 
E 3 138 ASP 138 138 138 ASP ASP A . n 
E 3 139 VAL 139 139 139 VAL VAL A . n 
E 3 140 THR 140 140 140 THR THR A . n 
E 3 141 GLY 141 141 141 GLY GLY A . n 
E 3 142 ARG 142 142 142 ARG ARG A . n 
E 3 143 ILE 143 143 143 ILE ILE A . n 
E 3 144 ALA 144 144 144 ALA ALA A . n 
E 3 145 GLN 145 145 145 GLN GLN A . n 
E 3 146 THR 146 146 146 THR THR A . n 
E 3 147 LEU 147 147 147 LEU LEU A . n 
E 3 148 LEU 148 148 148 LEU LEU A . n 
E 3 149 ASN 149 149 149 ASN ASN A . n 
E 3 150 LEU 150 150 150 LEU LEU A . n 
E 3 151 ALA 151 151 151 ALA ALA A . n 
E 3 152 LYS 152 152 152 LYS LYS A . n 
E 3 153 GLN 153 153 153 GLN GLN A . n 
E 3 154 PRO 154 154 154 PRO PRO A . n 
E 3 155 ASP 155 155 155 ASP ASP A . n 
E 3 156 ALA 156 156 156 ALA ALA A . n 
E 3 157 MET 157 157 157 MET MET A . n 
E 3 158 THR 158 158 158 THR THR A . n 
E 3 159 HIS 159 159 159 HIS HIS A . n 
E 3 160 PRO 160 160 160 PRO PRO A . n 
E 3 161 ASP 161 161 161 ASP ASP A . n 
E 3 162 GLY 162 162 162 GLY GLY A . n 
E 3 163 MET 163 163 163 MET MET A . n 
E 3 164 GLN 164 164 164 GLN GLN A . n 
E 3 165 ILE 165 165 165 ILE ILE A . n 
E 3 166 LYS 166 166 166 LYS LYS A . n 
E 3 167 ILE 167 167 167 ILE ILE A . n 
E 3 168 THR 168 168 168 THR THR A . n 
E 3 169 ARG 169 169 169 ARG ARG A . n 
E 3 170 GLN 170 170 170 GLN GLN A . n 
E 3 171 GLU 171 171 171 GLU GLU A . n 
E 3 172 ILE 172 172 172 ILE ILE A . n 
E 3 173 GLY 173 173 173 GLY GLY A . n 
E 3 174 GLN 174 174 174 GLN GLN A . n 
E 3 175 ILE 175 175 175 ILE ILE A . n 
E 3 176 VAL 176 176 176 VAL VAL A . n 
E 3 177 GLY 177 177 177 GLY GLY A . n 
E 3 178 CYS 178 178 178 CYS CYS A . n 
E 3 179 SER 179 179 179 SER SER A . n 
E 3 180 ARG 180 180 180 ARG ARG A . n 
E 3 181 GLU 181 181 181 GLU GLU A . n 
E 3 182 THR 182 182 182 THR THR A . n 
E 3 183 VAL 183 183 183 VAL VAL A . n 
E 3 184 GLY 184 184 184 GLY GLY A . n 
E 3 185 ARG 185 185 185 ARG ARG A . n 
E 3 186 ILE 186 186 186 ILE ILE A . n 
E 3 187 LEU 187 187 187 LEU LEU A . n 
E 3 188 LYS 188 188 188 LYS LYS A . n 
E 3 189 MET 189 189 189 MET MET A . n 
E 3 190 LEU 190 190 190 LEU LEU A . n 
E 3 191 GLU 191 191 191 GLU GLU A . n 
E 3 192 ASP 192 192 192 ASP ASP A . n 
E 3 193 GLN 193 193 193 GLN GLN A . n 
E 3 194 ASN 194 194 194 ASN ASN A . n 
E 3 195 LEU 195 195 195 LEU LEU A . n 
E 3 196 ILE 196 196 196 ILE ILE A . n 
E 3 197 SER 197 197 197 SER SER A . n 
E 3 198 ALA 198 198 198 ALA ALA A . n 
E 3 199 HIS 199 199 199 HIS HIS A . n 
E 3 200 GLY 200 200 200 GLY GLY A . n 
E 3 201 LYS 201 201 201 LYS LYS A . n 
E 3 202 THR 202 202 202 THR THR A . n 
E 3 203 ILE 203 203 203 ILE ILE A . n 
E 3 204 VAL 204 204 204 VAL VAL A . n 
E 3 205 VAL 205 205 205 VAL VAL A . n 
E 3 206 TYR 206 206 206 TYR TYR A . n 
E 3 207 GLY 207 207 207 GLY GLY A . n 
E 3 208 THR 208 208 208 THR THR A . n 
E 3 209 ARG 209 209 209 ARG ARG A . n 
F 3 1   VAL 1   1   ?   ?   ?   B . n 
F 3 2   LEU 2   2   ?   ?   ?   B . n 
F 3 3   GLY 3   3   ?   ?   ?   B . n 
F 3 4   LYS 4   4   ?   ?   ?   B . n 
F 3 5   PRO 5   5   ?   ?   ?   B . n 
F 3 6   GLN 6   6   ?   ?   ?   B . n 
F 3 7   THR 7   7   ?   ?   ?   B . n 
F 3 8   ASP 8   8   8   ASP ASP B . n 
F 3 9   PRO 9   9   9   PRO PRO B . n 
F 3 10  THR 10  10  10  THR THR B . n 
F 3 11  LEU 11  11  11  LEU LEU B . n 
F 3 12  GLU 12  12  12  GLU GLU B . n 
F 3 13  TRP 13  13  13  TRP TRP B . n 
F 3 14  PHE 14  14  14  PHE PHE B . n 
F 3 15  LEU 15  15  15  LEU LEU B . n 
F 3 16  SER 16  16  16  SER SER B . n 
F 3 17  HIS 17  17  17  HIS HIS B . n 
F 3 18  CYS 18  18  18  CYS CYS B . n 
F 3 19  HIS 19  19  19  HIS HIS B . n 
F 3 20  ILE 20  20  20  ILE ILE B . n 
F 3 21  HIS 21  21  21  HIS HIS B . n 
F 3 22  LYS 22  22  22  LYS LYS B . n 
F 3 23  TYR 23  23  23  TYR TYR B . n 
F 3 24  PRO 24  24  24  PRO PRO B . n 
F 3 25  SER 25  25  25  SER SER B . n 
F 3 26  LYS 26  26  26  LYS LYS B . n 
F 3 27  SER 27  27  27  SER SER B . n 
F 3 28  THR 28  28  28  THR THR B . n 
F 3 29  LEU 29  29  29  LEU LEU B . n 
F 3 30  ILE 30  30  30  ILE ILE B . n 
F 3 31  HIS 31  31  31  HIS HIS B . n 
F 3 32  GLN 32  32  32  GLN GLN B . n 
F 3 33  GLY 33  33  33  GLY GLY B . n 
F 3 34  GLU 34  34  34  GLU GLU B . n 
F 3 35  LYS 35  35  35  LYS LYS B . n 
F 3 36  ALA 36  36  36  ALA ALA B . n 
F 3 37  GLU 37  37  37  GLU GLU B . n 
F 3 38  THR 38  38  38  THR THR B . n 
F 3 39  LEU 39  39  39  LEU LEU B . n 
F 3 40  TYR 40  40  40  TYR TYR B . n 
F 3 41  TYR 41  41  41  TYR TYR B . n 
F 3 42  ILE 42  42  42  ILE ILE B . n 
F 3 43  VAL 43  43  43  VAL VAL B . n 
F 3 44  LYS 44  44  44  LYS LYS B . n 
F 3 45  GLY 45  45  45  GLY GLY B . n 
F 3 46  SER 46  46  46  SER SER B . n 
F 3 47  VAL 47  47  47  VAL VAL B . n 
F 3 48  ALA 48  48  48  ALA ALA B . n 
F 3 49  VAL 49  49  49  VAL VAL B . n 
F 3 50  LEU 50  50  50  LEU LEU B . n 
F 3 51  ILE 51  51  51  ILE ILE B . n 
F 3 52  LYS 52  52  52  LYS LYS B . n 
F 3 53  ASP 53  53  53  ASP ASP B . n 
F 3 54  GLU 54  54  54  GLU GLU B . n 
F 3 55  GLU 55  55  55  GLU GLU B . n 
F 3 56  GLY 56  56  56  GLY GLY B . n 
F 3 57  LYS 57  57  57  LYS LYS B . n 
F 3 58  GLU 58  58  58  GLU GLU B . n 
F 3 59  MET 59  59  59  MET MET B . n 
F 3 60  ILE 60  60  60  ILE ILE B . n 
F 3 61  LEU 61  61  61  LEU LEU B . n 
F 3 62  SER 62  62  62  SER SER B . n 
F 3 63  TYR 63  63  63  TYR TYR B . n 
F 3 64  LEU 64  64  64  LEU LEU B . n 
F 3 65  ASN 65  65  65  ASN ASN B . n 
F 3 66  GLN 66  66  66  GLN GLN B . n 
F 3 67  GLY 67  67  67  GLY GLY B . n 
F 3 68  ASP 68  68  68  ASP ASP B . n 
F 3 69  PHE 69  69  69  PHE PHE B . n 
F 3 70  ILE 70  70  70  ILE ILE B . n 
F 3 71  GLY 71  71  71  GLY GLY B . n 
F 3 72  GLU 72  72  72  GLU GLU B . n 
F 3 73  LEU 73  73  73  LEU LEU B . n 
F 3 74  GLY 74  74  74  GLY GLY B . n 
F 3 75  LEU 75  75  75  LEU LEU B . n 
F 3 76  PHE 76  76  76  PHE PHE B . n 
F 3 77  GLU 77  77  77  GLU GLU B . n 
F 3 78  GLU 78  78  78  GLU GLU B . n 
F 3 79  GLY 79  79  79  GLY GLY B . n 
F 3 80  GLN 80  80  80  GLN GLN B . n 
F 3 81  GLU 81  81  81  GLU GLU B . n 
F 3 82  ARG 82  82  82  ARG ARG B . n 
F 3 83  SER 83  83  83  SER SER B . n 
F 3 84  ALA 84  84  84  ALA ALA B . n 
F 3 85  TRP 85  85  85  TRP TRP B . n 
F 3 86  VAL 86  86  86  VAL VAL B . n 
F 3 87  ARG 87  87  87  ARG ARG B . n 
F 3 88  ALA 88  88  88  ALA ALA B . n 
F 3 89  LYS 89  89  89  LYS LYS B . n 
F 3 90  THR 90  90  90  THR THR B . n 
F 3 91  ALA 91  91  91  ALA ALA B . n 
F 3 92  CYS 92  92  92  CYS CYS B . n 
F 3 93  GLU 93  93  93  GLU GLU B . n 
F 3 94  VAL 94  94  94  VAL VAL B . n 
F 3 95  ALA 95  95  95  ALA ALA B . n 
F 3 96  GLU 96  96  96  GLU GLU B . n 
F 3 97  ILE 97  97  97  ILE ILE B . n 
F 3 98  SER 98  98  98  SER SER B . n 
F 3 99  TYR 99  99  99  TYR TYR B . n 
F 3 100 LYS 100 100 100 LYS LYS B . n 
F 3 101 LYS 101 101 101 LYS LYS B . n 
F 3 102 PHE 102 102 102 PHE PHE B . n 
F 3 103 ARG 103 103 103 ARG ARG B . n 
F 3 104 GLN 104 104 104 GLN GLN B . n 
F 3 105 LEU 105 105 105 LEU LEU B . n 
F 3 106 ILE 106 106 106 ILE ILE B . n 
F 3 107 GLN 107 107 107 GLN GLN B . n 
F 3 108 VAL 108 108 108 VAL VAL B . n 
F 3 109 ASN 109 109 109 ASN ASN B . n 
F 3 110 PRO 110 110 110 PRO PRO B . n 
F 3 111 ASP 111 111 111 ASP ASP B . n 
F 3 112 ILE 112 112 112 ILE ILE B . n 
F 3 113 LEU 113 113 113 LEU LEU B . n 
F 3 114 MET 114 114 114 MET MET B . n 
F 3 115 ARG 115 115 115 ARG ARG B . n 
F 3 116 LEU 116 116 116 LEU LEU B . n 
F 3 117 SER 117 117 117 SER SER B . n 
F 3 118 ALA 118 118 118 ALA ALA B . n 
F 3 119 GLN 119 119 119 GLN GLN B . n 
F 3 120 MET 120 120 120 MET MET B . n 
F 3 121 ALA 121 121 121 ALA ALA B . n 
F 3 122 ARG 122 122 122 ARG ARG B . n 
F 3 123 ARG 123 123 123 ARG ARG B . n 
F 3 124 LEU 124 124 124 LEU LEU B . n 
F 3 125 GLN 125 125 125 GLN GLN B . n 
F 3 126 VAL 126 126 126 VAL VAL B . n 
F 3 127 THR 127 127 127 THR THR B . n 
F 3 128 SER 128 128 128 SER SER B . n 
F 3 129 GLU 129 129 129 GLU GLU B . n 
F 3 130 LYS 130 130 130 LYS LYS B . n 
F 3 131 VAL 131 131 131 VAL VAL B . n 
F 3 132 GLY 132 132 132 GLY GLY B . n 
F 3 133 ASN 133 133 133 ASN ASN B . n 
F 3 134 LEU 134 134 134 LEU LEU B . n 
F 3 135 ALA 135 135 135 ALA ALA B . n 
F 3 136 PHE 136 136 136 PHE PHE B . n 
F 3 137 LEU 137 137 137 LEU LEU B . n 
F 3 138 ASP 138 138 138 ASP ASP B . n 
F 3 139 VAL 139 139 139 VAL VAL B . n 
F 3 140 THR 140 140 140 THR THR B . n 
F 3 141 GLY 141 141 141 GLY GLY B . n 
F 3 142 ARG 142 142 142 ARG ARG B . n 
F 3 143 ILE 143 143 143 ILE ILE B . n 
F 3 144 ALA 144 144 144 ALA ALA B . n 
F 3 145 GLN 145 145 145 GLN GLN B . n 
F 3 146 THR 146 146 146 THR THR B . n 
F 3 147 LEU 147 147 147 LEU LEU B . n 
F 3 148 LEU 148 148 148 LEU LEU B . n 
F 3 149 ASN 149 149 149 ASN ASN B . n 
F 3 150 LEU 150 150 150 LEU LEU B . n 
F 3 151 ALA 151 151 151 ALA ALA B . n 
F 3 152 LYS 152 152 152 LYS LYS B . n 
F 3 153 GLN 153 153 153 GLN GLN B . n 
F 3 154 PRO 154 154 154 PRO PRO B . n 
F 3 155 ASP 155 155 155 ASP ASP B . n 
F 3 156 ALA 156 156 156 ALA ALA B . n 
F 3 157 MET 157 157 157 MET MET B . n 
F 3 158 THR 158 158 158 THR THR B . n 
F 3 159 HIS 159 159 159 HIS HIS B . n 
F 3 160 PRO 160 160 160 PRO PRO B . n 
F 3 161 ASP 161 161 161 ASP ASP B . n 
F 3 162 GLY 162 162 162 GLY GLY B . n 
F 3 163 MET 163 163 163 MET MET B . n 
F 3 164 GLN 164 164 164 GLN GLN B . n 
F 3 165 ILE 165 165 165 ILE ILE B . n 
F 3 166 LYS 166 166 166 LYS LYS B . n 
F 3 167 ILE 167 167 167 ILE ILE B . n 
F 3 168 THR 168 168 168 THR THR B . n 
F 3 169 ARG 169 169 169 ARG ARG B . n 
F 3 170 GLN 170 170 170 GLN GLN B . n 
F 3 171 GLU 171 171 171 GLU GLU B . n 
F 3 172 ILE 172 172 172 ILE ILE B . n 
F 3 173 GLY 173 173 173 GLY GLY B . n 
F 3 174 GLN 174 174 174 GLN GLN B . n 
F 3 175 ILE 175 175 175 ILE ILE B . n 
F 3 176 VAL 176 176 176 VAL VAL B . n 
F 3 177 GLY 177 177 177 GLY GLY B . n 
F 3 178 CYS 178 178 178 CYS CYS B . n 
F 3 179 SER 179 179 179 SER SER B . n 
F 3 180 ARG 180 180 180 ARG ARG B . n 
F 3 181 GLU 181 181 181 GLU GLU B . n 
F 3 182 THR 182 182 182 THR THR B . n 
F 3 183 VAL 183 183 183 VAL VAL B . n 
F 3 184 GLY 184 184 184 GLY GLY B . n 
F 3 185 ARG 185 185 185 ARG ARG B . n 
F 3 186 ILE 186 186 186 ILE ILE B . n 
F 3 187 LEU 187 187 187 LEU LEU B . n 
F 3 188 LYS 188 188 188 LYS LYS B . n 
F 3 189 MET 189 189 189 MET MET B . n 
F 3 190 LEU 190 190 190 LEU LEU B . n 
F 3 191 GLU 191 191 191 GLU GLU B . n 
F 3 192 ASP 192 192 192 ASP ASP B . n 
F 3 193 GLN 193 193 193 GLN GLN B . n 
F 3 194 ASN 194 194 194 ASN ASN B . n 
F 3 195 LEU 195 195 195 LEU LEU B . n 
F 3 196 ILE 196 196 196 ILE ILE B . n 
F 3 197 SER 197 197 197 SER SER B . n 
F 3 198 ALA 198 198 198 ALA ALA B . n 
F 3 199 HIS 199 199 199 HIS HIS B . n 
F 3 200 GLY 200 200 200 GLY GLY B . n 
F 3 201 LYS 201 201 201 LYS LYS B . n 
F 3 202 THR 202 202 202 THR THR B . n 
F 3 203 ILE 203 203 203 ILE ILE B . n 
F 3 204 VAL 204 204 204 VAL VAL B . n 
F 3 205 VAL 205 205 205 VAL VAL B . n 
F 3 206 TYR 206 206 206 TYR TYR B . n 
F 3 207 GLY 207 207 207 GLY GLY B . n 
F 3 208 THR 208 208 ?   ?   ?   B . n 
F 3 209 ARG 209 209 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 4 CMP 1   622  622  CMP CMP A . 
H 4 CMP 1   2622 2622 CMP CMP A . 
I 5 DIO 1   303  303  DIO DOX A . 
J 5 DIO 1   304  304  DIO DOX A . 
K 5 DIO 1   305  305  DIO DOX A . 
L 4 CMP 1   1622 1622 CMP CMP B . 
M 4 CMP 1   3622 3622 CMP CMP B . 
N 5 DIO 1   301  301  DIO DOX B . 
O 5 DIO 1   302  302  DIO DOX B . 
P 6 HOH 1   10   4    HOH HOH W . 
P 6 HOH 2   11   8    HOH HOH W . 
P 6 HOH 3   12   9    HOH HOH W . 
P 6 HOH 4   13   10   HOH HOH W . 
P 6 HOH 5   14   24   HOH HOH W . 
P 6 HOH 6   15   45   HOH HOH W . 
P 6 HOH 7   16   118  HOH HOH W . 
P 6 HOH 8   17   134  HOH HOH W . 
P 6 HOH 9   18   144  HOH HOH W . 
P 6 HOH 10  19   146  HOH HOH W . 
P 6 HOH 11  20   160  HOH HOH W . 
P 6 HOH 12  21   201  HOH HOH W . 
P 6 HOH 13  22   213  HOH HOH W . 
P 6 HOH 14  23   214  HOH HOH W . 
P 6 HOH 15  24   225  HOH HOH W . 
P 6 HOH 16  25   254  HOH HOH W . 
Q 6 HOH 1   14   6    HOH HOH X . 
Q 6 HOH 2   15   15   HOH HOH X . 
Q 6 HOH 3   16   28   HOH HOH X . 
Q 6 HOH 4   17   29   HOH HOH X . 
Q 6 HOH 5   18   35   HOH HOH X . 
Q 6 HOH 6   19   38   HOH HOH X . 
Q 6 HOH 7   20   39   HOH HOH X . 
Q 6 HOH 8   21   69   HOH HOH X . 
Q 6 HOH 9   22   80   HOH HOH X . 
Q 6 HOH 10  23   84   HOH HOH X . 
Q 6 HOH 11  24   95   HOH HOH X . 
Q 6 HOH 12  25   98   HOH HOH X . 
Q 6 HOH 13  26   100  HOH HOH X . 
Q 6 HOH 14  27   117  HOH HOH X . 
Q 6 HOH 15  28   124  HOH HOH X . 
Q 6 HOH 16  29   147  HOH HOH X . 
Q 6 HOH 17  30   157  HOH HOH X . 
Q 6 HOH 18  31   167  HOH HOH X . 
Q 6 HOH 19  32   183  HOH HOH X . 
Q 6 HOH 20  33   197  HOH HOH X . 
Q 6 HOH 21  34   199  HOH HOH X . 
Q 6 HOH 22  35   203  HOH HOH X . 
Q 6 HOH 23  36   210  HOH HOH X . 
Q 6 HOH 24  37   224  HOH HOH X . 
R 6 HOH 1   10   5    HOH HOH Y . 
R 6 HOH 2   11   13   HOH HOH Y . 
R 6 HOH 3   12   18   HOH HOH Y . 
R 6 HOH 4   13   21   HOH HOH Y . 
R 6 HOH 5   14   62   HOH HOH Y . 
R 6 HOH 6   15   65   HOH HOH Y . 
R 6 HOH 7   16   74   HOH HOH Y . 
R 6 HOH 8   17   77   HOH HOH Y . 
R 6 HOH 9   18   99   HOH HOH Y . 
R 6 HOH 10  19   173  HOH HOH Y . 
R 6 HOH 11  20   182  HOH HOH Y . 
R 6 HOH 12  21   186  HOH HOH Y . 
R 6 HOH 13  22   218  HOH HOH Y . 
R 6 HOH 14  23   222  HOH HOH Y . 
R 6 HOH 15  24   227  HOH HOH Y . 
R 6 HOH 16  25   236  HOH HOH Y . 
R 6 HOH 17  26   265  HOH HOH Y . 
S 6 HOH 1   34   34   HOH HOH Z . 
S 6 HOH 2   43   43   HOH HOH Z . 
S 6 HOH 3   55   55   HOH HOH Z . 
S 6 HOH 4   72   72   HOH HOH Z . 
S 6 HOH 5   81   81   HOH HOH Z . 
S 6 HOH 6   114  114  HOH HOH Z . 
S 6 HOH 7   152  152  HOH HOH Z . 
S 6 HOH 8   166  166  HOH HOH Z . 
S 6 HOH 9   172  172  HOH HOH Z . 
S 6 HOH 10  188  188  HOH HOH Z . 
S 6 HOH 11  193  193  HOH HOH Z . 
S 6 HOH 12  195  195  HOH HOH Z . 
S 6 HOH 13  198  198  HOH HOH Z . 
S 6 HOH 14  204  204  HOH HOH Z . 
S 6 HOH 15  261  261  HOH HOH Z . 
S 6 HOH 16  263  263  HOH HOH Z . 
T 6 HOH 1   2623 2    HOH HOH A . 
T 6 HOH 2   2624 3    HOH HOH A . 
T 6 HOH 3   2625 11   HOH HOH A . 
T 6 HOH 4   2626 14   HOH HOH A . 
T 6 HOH 5   2627 16   HOH HOH A . 
T 6 HOH 6   2628 20   HOH HOH A . 
T 6 HOH 7   2629 25   HOH HOH A . 
T 6 HOH 8   2630 30   HOH HOH A . 
T 6 HOH 9   2631 31   HOH HOH A . 
T 6 HOH 10  2632 32   HOH HOH A . 
T 6 HOH 11  2633 33   HOH HOH A . 
T 6 HOH 12  2634 36   HOH HOH A . 
T 6 HOH 13  2635 40   HOH HOH A . 
T 6 HOH 14  2636 41   HOH HOH A . 
T 6 HOH 15  2637 42   HOH HOH A . 
T 6 HOH 16  2638 44   HOH HOH A . 
T 6 HOH 17  2639 46   HOH HOH A . 
T 6 HOH 18  2640 47   HOH HOH A . 
T 6 HOH 19  2641 48   HOH HOH A . 
T 6 HOH 20  2642 50   HOH HOH A . 
T 6 HOH 21  2643 51   HOH HOH A . 
T 6 HOH 22  2644 56   HOH HOH A . 
T 6 HOH 23  2645 57   HOH HOH A . 
T 6 HOH 24  2646 58   HOH HOH A . 
T 6 HOH 25  2647 60   HOH HOH A . 
T 6 HOH 26  2648 64   HOH HOH A . 
T 6 HOH 27  2649 66   HOH HOH A . 
T 6 HOH 28  2650 67   HOH HOH A . 
T 6 HOH 29  2651 71   HOH HOH A . 
T 6 HOH 30  2652 75   HOH HOH A . 
T 6 HOH 31  2653 76   HOH HOH A . 
T 6 HOH 32  2654 87   HOH HOH A . 
T 6 HOH 33  2655 88   HOH HOH A . 
T 6 HOH 34  2656 89   HOH HOH A . 
T 6 HOH 35  2657 90   HOH HOH A . 
T 6 HOH 36  2658 91   HOH HOH A . 
T 6 HOH 37  2659 92   HOH HOH A . 
T 6 HOH 38  2660 93   HOH HOH A . 
T 6 HOH 39  2661 94   HOH HOH A . 
T 6 HOH 40  2662 97   HOH HOH A . 
T 6 HOH 41  2663 102  HOH HOH A . 
T 6 HOH 42  2664 113  HOH HOH A . 
T 6 HOH 43  2665 120  HOH HOH A . 
T 6 HOH 44  2666 125  HOH HOH A . 
T 6 HOH 45  2667 130  HOH HOH A . 
T 6 HOH 46  2668 136  HOH HOH A . 
T 6 HOH 47  2669 137  HOH HOH A . 
T 6 HOH 48  2670 141  HOH HOH A . 
T 6 HOH 49  2671 142  HOH HOH A . 
T 6 HOH 50  2672 145  HOH HOH A . 
T 6 HOH 51  2673 150  HOH HOH A . 
T 6 HOH 52  2674 154  HOH HOH A . 
T 6 HOH 53  2675 155  HOH HOH A . 
T 6 HOH 54  2676 158  HOH HOH A . 
T 6 HOH 55  2677 162  HOH HOH A . 
T 6 HOH 56  2678 165  HOH HOH A . 
T 6 HOH 57  2679 168  HOH HOH A . 
T 6 HOH 58  2680 171  HOH HOH A . 
T 6 HOH 59  2681 174  HOH HOH A . 
T 6 HOH 60  2682 177  HOH HOH A . 
T 6 HOH 61  2683 178  HOH HOH A . 
T 6 HOH 62  2684 180  HOH HOH A . 
T 6 HOH 63  2685 185  HOH HOH A . 
T 6 HOH 64  2686 187  HOH HOH A . 
T 6 HOH 65  2687 189  HOH HOH A . 
T 6 HOH 66  2688 192  HOH HOH A . 
T 6 HOH 67  2689 194  HOH HOH A . 
T 6 HOH 68  2690 196  HOH HOH A . 
T 6 HOH 69  2691 202  HOH HOH A . 
T 6 HOH 70  2692 206  HOH HOH A . 
T 6 HOH 71  2693 208  HOH HOH A . 
T 6 HOH 72  2694 209  HOH HOH A . 
T 6 HOH 73  2695 211  HOH HOH A . 
T 6 HOH 74  2696 215  HOH HOH A . 
T 6 HOH 75  2697 217  HOH HOH A . 
T 6 HOH 76  2698 219  HOH HOH A . 
T 6 HOH 77  2699 231  HOH HOH A . 
T 6 HOH 78  2700 234  HOH HOH A . 
T 6 HOH 79  2701 238  HOH HOH A . 
T 6 HOH 80  2702 240  HOH HOH A . 
T 6 HOH 81  2703 244  HOH HOH A . 
T 6 HOH 82  2704 246  HOH HOH A . 
T 6 HOH 83  2705 249  HOH HOH A . 
T 6 HOH 84  2706 252  HOH HOH A . 
T 6 HOH 85  2707 257  HOH HOH A . 
T 6 HOH 86  2708 258  HOH HOH A . 
T 6 HOH 87  2709 259  HOH HOH A . 
T 6 HOH 88  2710 266  HOH HOH A . 
U 6 HOH 1   3623 1    HOH HOH B . 
U 6 HOH 2   3624 7    HOH HOH B . 
U 6 HOH 3   3625 12   HOH HOH B . 
U 6 HOH 4   3626 17   HOH HOH B . 
U 6 HOH 5   3627 19   HOH HOH B . 
U 6 HOH 6   3628 22   HOH HOH B . 
U 6 HOH 7   3629 23   HOH HOH B . 
U 6 HOH 8   3630 26   HOH HOH B . 
U 6 HOH 9   3631 27   HOH HOH B . 
U 6 HOH 10  3632 37   HOH HOH B . 
U 6 HOH 11  3633 49   HOH HOH B . 
U 6 HOH 12  3634 52   HOH HOH B . 
U 6 HOH 13  3635 53   HOH HOH B . 
U 6 HOH 14  3636 54   HOH HOH B . 
U 6 HOH 15  3637 59   HOH HOH B . 
U 6 HOH 16  3638 61   HOH HOH B . 
U 6 HOH 17  3639 63   HOH HOH B . 
U 6 HOH 18  3640 68   HOH HOH B . 
U 6 HOH 19  3641 70   HOH HOH B . 
U 6 HOH 20  3642 73   HOH HOH B . 
U 6 HOH 21  3643 78   HOH HOH B . 
U 6 HOH 22  3644 79   HOH HOH B . 
U 6 HOH 23  3645 82   HOH HOH B . 
U 6 HOH 24  3646 83   HOH HOH B . 
U 6 HOH 25  3647 85   HOH HOH B . 
U 6 HOH 26  3648 86   HOH HOH B . 
U 6 HOH 27  3649 96   HOH HOH B . 
U 6 HOH 28  3650 101  HOH HOH B . 
U 6 HOH 29  3651 103  HOH HOH B . 
U 6 HOH 30  3652 104  HOH HOH B . 
U 6 HOH 31  3653 105  HOH HOH B . 
U 6 HOH 32  3654 106  HOH HOH B . 
U 6 HOH 33  3655 107  HOH HOH B . 
U 6 HOH 34  3656 108  HOH HOH B . 
U 6 HOH 35  3657 109  HOH HOH B . 
U 6 HOH 36  3658 110  HOH HOH B . 
U 6 HOH 37  3659 111  HOH HOH B . 
U 6 HOH 38  3660 112  HOH HOH B . 
U 6 HOH 39  3661 115  HOH HOH B . 
U 6 HOH 40  3662 116  HOH HOH B . 
U 6 HOH 41  3663 119  HOH HOH B . 
U 6 HOH 42  3664 121  HOH HOH B . 
U 6 HOH 43  3665 122  HOH HOH B . 
U 6 HOH 44  3666 123  HOH HOH B . 
U 6 HOH 45  3667 126  HOH HOH B . 
U 6 HOH 46  3668 127  HOH HOH B . 
U 6 HOH 47  3669 128  HOH HOH B . 
U 6 HOH 48  3670 129  HOH HOH B . 
U 6 HOH 49  3671 131  HOH HOH B . 
U 6 HOH 50  3672 132  HOH HOH B . 
U 6 HOH 51  3673 133  HOH HOH B . 
U 6 HOH 52  3674 135  HOH HOH B . 
U 6 HOH 53  3675 138  HOH HOH B . 
U 6 HOH 54  3676 139  HOH HOH B . 
U 6 HOH 55  3677 140  HOH HOH B . 
U 6 HOH 56  3678 143  HOH HOH B . 
U 6 HOH 57  3679 148  HOH HOH B . 
U 6 HOH 58  3680 149  HOH HOH B . 
U 6 HOH 59  3681 151  HOH HOH B . 
U 6 HOH 60  3682 153  HOH HOH B . 
U 6 HOH 61  3683 156  HOH HOH B . 
U 6 HOH 62  3684 159  HOH HOH B . 
U 6 HOH 63  3685 161  HOH HOH B . 
U 6 HOH 64  3686 163  HOH HOH B . 
U 6 HOH 65  3687 164  HOH HOH B . 
U 6 HOH 66  3688 169  HOH HOH B . 
U 6 HOH 67  3689 170  HOH HOH B . 
U 6 HOH 68  3690 175  HOH HOH B . 
U 6 HOH 69  3691 176  HOH HOH B . 
U 6 HOH 70  3692 179  HOH HOH B . 
U 6 HOH 71  3693 181  HOH HOH B . 
U 6 HOH 72  3694 184  HOH HOH B . 
U 6 HOH 73  3695 190  HOH HOH B . 
U 6 HOH 74  3696 191  HOH HOH B . 
U 6 HOH 75  3697 200  HOH HOH B . 
U 6 HOH 76  3698 205  HOH HOH B . 
U 6 HOH 77  3699 207  HOH HOH B . 
U 6 HOH 78  3700 212  HOH HOH B . 
U 6 HOH 79  3701 216  HOH HOH B . 
U 6 HOH 80  3702 220  HOH HOH B . 
U 6 HOH 81  3703 221  HOH HOH B . 
U 6 HOH 82  3704 223  HOH HOH B . 
U 6 HOH 83  3705 226  HOH HOH B . 
U 6 HOH 84  3706 228  HOH HOH B . 
U 6 HOH 85  3707 229  HOH HOH B . 
U 6 HOH 86  3708 230  HOH HOH B . 
U 6 HOH 87  3709 232  HOH HOH B . 
U 6 HOH 88  3710 233  HOH HOH B . 
U 6 HOH 89  3711 235  HOH HOH B . 
U 6 HOH 90  3712 237  HOH HOH B . 
U 6 HOH 91  3713 239  HOH HOH B . 
U 6 HOH 92  3714 241  HOH HOH B . 
U 6 HOH 93  3715 242  HOH HOH B . 
U 6 HOH 94  3716 243  HOH HOH B . 
U 6 HOH 95  3717 245  HOH HOH B . 
U 6 HOH 96  3718 247  HOH HOH B . 
U 6 HOH 97  3719 248  HOH HOH B . 
U 6 HOH 98  3720 250  HOH HOH B . 
U 6 HOH 99  3721 251  HOH HOH B . 
U 6 HOH 100 3722 253  HOH HOH B . 
U 6 HOH 101 3723 255  HOH HOH B . 
U 6 HOH 102 3724 256  HOH HOH B . 
U 6 HOH 103 3725 260  HOH HOH B . 
U 6 HOH 104 3726 262  HOH HOH B . 
U 6 HOH 105 3727 264  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   hexameric 
_pdbx_struct_assembly.oligomeric_count     6 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-03-21 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_phasing_MR.entry_id                     1ZRF 
_pdbx_phasing_MR.method_rotation              ? 
_pdbx_phasing_MR.method_translation           ? 
_pdbx_phasing_MR.model_details                ? 
_pdbx_phasing_MR.R_factor                     ? 
_pdbx_phasing_MR.R_rigid_body                 ? 
_pdbx_phasing_MR.correlation_coeff_Fo_to_Fc   ? 
_pdbx_phasing_MR.correlation_coeff_Io_to_Ic   ? 
_pdbx_phasing_MR.d_res_high_rotation          ? 
_pdbx_phasing_MR.d_res_low_rotation           ? 
_pdbx_phasing_MR.d_res_high_translation       2.500 
_pdbx_phasing_MR.d_res_low_translation        32.746 
_pdbx_phasing_MR.packing                      ? 
_pdbx_phasing_MR.reflns_percent_rotation      ? 
_pdbx_phasing_MR.reflns_percent_translation   ? 
_pdbx_phasing_MR.sigma_F_rotation             ? 
_pdbx_phasing_MR.sigma_F_translation          ? 
_pdbx_phasing_MR.sigma_I_rotation             ? 
_pdbx_phasing_MR.sigma_I_translation          ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu       'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?          ? 2 
PHASER      .     ?               program 'R. J. Read'         cimr-phaser@lists.cam.ac.uk phasing           
http://www-structmed.cimr.cam.ac.uk/phaser/      ?          ? 3 
CNS         .     ?               package 'Axel T. Brunger'    axel.brunger@yale.edu       refinement        
http://cns.csb.yale.edu/v1.1/                    Fortran_77 ? 4 
PDB_EXTRACT 1.601 'Jan. 30, 2005' package PDB                  sw-help@rcsb.rutgers.edu    'data extraction' 
http://pdb.rutgers.edu/software/                 C++        ? 5 
CBASS       .     ?               ?       ?                    ?                           'data collection' ? ?          ? 6 
HKL-2000    .     ?               ?       ?                    ?                           'data scaling'    ? ?          ? 7 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS A 26  ? ? 74.72   -6.16  
2 1 LYS B 26  ? ? 82.12   -11.22 
3 1 GLU B 37  ? ? -140.79 -5.66  
4 1 ASN B 109 ? ? -153.26 89.90  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    DA 
_pdbx_validate_planes.auth_asym_id    W 
_pdbx_validate_planes.auth_seq_id     1 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.060 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 W DT -6 ? P   ? A DT 3 P   
2 1 Y 1 W DT -6 ? OP1 ? A DT 3 OP1 
3 1 Y 1 W DT -6 ? OP2 ? A DT 3 OP2 
4 1 Y 1 Y DT -7 ? P   ? C DT 2 P   
5 1 Y 1 Y DT -7 ? OP1 ? C DT 2 OP1 
6 1 Y 1 Y DT -7 ? OP2 ? C DT 2 OP2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 W DA  -8  ? A DA  1   
2  1 Y 1 W DT  -7  ? A DT  2   
3  1 Y 1 Y DA  -8  ? C DA  1   
4  1 Y 1 A VAL 1   ? E VAL 1   
5  1 Y 1 A LEU 2   ? E LEU 2   
6  1 Y 1 A GLY 3   ? E GLY 3   
7  1 Y 1 A LYS 4   ? E LYS 4   
8  1 Y 1 A PRO 5   ? E PRO 5   
9  1 Y 1 A GLN 6   ? E GLN 6   
10 1 Y 1 B VAL 1   ? F VAL 1   
11 1 Y 1 B LEU 2   ? F LEU 2   
12 1 Y 1 B GLY 3   ? F GLY 3   
13 1 Y 1 B LYS 4   ? F LYS 4   
14 1 Y 1 B PRO 5   ? F PRO 5   
15 1 Y 1 B GLN 6   ? F GLN 6   
16 1 Y 1 B THR 7   ? F THR 7   
17 1 Y 1 B THR 208 ? F THR 208 
18 1 Y 1 B ARG 209 ? F ARG 209 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
1ZRF 'double helix'        
1ZRF 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 A DT 4  1_555 B DA 18 1_555 -1.040 -0.422 -0.274 -9.837  2.625   0.096   1  W_DT-5:DA-5_X W -5 ? X -5 ? 20 1 
1 A DC 5  1_555 B DG 17 1_555 -0.056 0.435  -0.436 4.656   -0.536  5.265   2  W_DC-4:DG-4_X W -4 ? X -4 ? ?  1 
1 A DG 6  1_555 B DC 16 1_555 0.524  0.158  -0.317 3.577   -8.747  4.581   3  W_DG-3:DC-3_X W -3 ? X -3 ? 19 1 
1 A DA 7  1_555 B DT 15 1_555 -0.095 -0.043 -0.180 11.616  -20.089 -4.491  4  W_DA-2:DT-2_X W -2 ? X -2 ? 20 1 
1 A DA 8  1_555 B DT 14 1_555 0.072  -0.078 0.000  6.648   -22.187 1.784   5  W_DA-1:DT-1_X W -1 ? X -1 ? 20 1 
1 A DA 9  1_555 B DT 13 1_555 -0.094 -0.022 -0.151 8.075   -8.819  -3.937  6  W_DA1:DT1_X   W 1  ? X 1  ? 20 1 
1 A DA 10 1_555 B DT 12 1_555 0.265  -0.087 0.223  1.758   -13.646 4.302   7  W_DA2:DT2_X   W 2  ? X 2  ? 20 1 
1 A DA 11 1_555 B DT 11 1_555 0.038  -0.089 0.257  -3.861  -15.736 3.429   8  W_DA3:DT3_X   W 3  ? X 3  ? 20 1 
1 A DT 12 1_555 B DA 10 1_555 -0.020 -0.012 0.161  -5.499  -12.263 1.867   9  W_DT4:DA4_X   W 4  ? X 4  ? 20 1 
1 A DG 13 1_555 B DC 9  1_555 -0.586 -0.063 0.282  2.505   -0.687  4.095   10 W_DG5:DC5_X   W 5  ? X 5  ? 19 1 
1 A DC 14 1_555 B DG 8  1_555 0.434  -0.124 -0.480 21.360  0.097   6.583   11 W_DC6:DG6_X   W 6  ? X 6  ? 19 1 
1 A DG 15 1_555 B DC 7  1_555 0.161  0.069  -0.341 -26.406 1.547   -13.484 12 W_DG7:DC7_X   W 7  ? X 7  ? 19 1 
1 A DA 16 1_555 B DT 6  1_555 0.362  0.172  -0.082 -8.299  -9.932  0.562   13 W_DA8:DT8_X   W 8  ? X 8  ? 20 1 
1 A DT 17 1_555 B DA 5  1_555 0.185  -0.102 -0.196 3.652   -7.551  0.987   14 W_DT9:DA9_X   W 9  ? X 9  ? 20 1 
1 D DC 1  1_555 B DG 4  1_555 -0.139 -0.192 -0.078 -3.103  -3.384  -2.470  15 Z_DC13:DG10_X Z 13 ? X 10 ? 19 1 
1 D DT 2  1_555 B DA 3  1_555 -0.561 -0.198 0.002  -0.531  -9.357  -1.337  16 Z_DT12:DA11_X Z 12 ? X 11 ? 20 1 
1 D DA 3  1_555 B DT 2  1_555 0.082  0.109  0.155  1.570   -6.876  2.566   17 Z_DA11:DT12_X Z 11 ? X 12 ? 20 1 
1 D DG 4  1_555 B DC 1  1_555 0.013  -0.004 -0.101 0.177   -8.832  3.908   18 Z_DG10:DC13_X Z 10 ? X 13 ? 19 1 
1 D DA 5  1_555 C DT 17 1_555 -0.023 -0.108 -0.162 -7.309  -13.712 0.146   19 Z_DA9:DT9_Y   Z 9  ? Y 9  ? 20 1 
1 D DT 6  1_555 C DA 16 1_555 -0.027 0.186  -0.052 1.769   -17.752 -2.539  20 Z_DT8:DA8_Y   Z 8  ? Y 8  ? 20 1 
1 D DC 7  1_555 C DG 15 1_555 -0.896 -0.126 -0.655 19.303  -2.190  -8.550  21 Z_DC7:DG7_Y   Z 7  ? Y 7  ? 19 1 
1 D DG 8  1_555 C DC 14 1_555 -0.405 -0.284 -0.901 -21.066 -11.382 7.956   22 Z_DG6:DC6_Y   Z 6  ? Y 6  ? 19 1 
1 D DC 9  1_555 C DG 13 1_555 0.577  -0.159 0.380  -4.582  6.195   3.549   23 Z_DC5:DG5_Y   Z 5  ? Y 5  ? 19 1 
1 D DA 10 1_555 C DT 12 1_555 -0.149 0.162  0.052  5.102   -13.477 -3.259  24 Z_DA4:DT4_Y   Z 4  ? Y 4  ? 20 1 
1 D DT 11 1_555 C DA 11 1_555 -0.300 0.243  0.222  6.957   -16.473 0.426   25 Z_DT3:DA3_Y   Z 3  ? Y 3  ? 20 1 
1 D DT 12 1_555 C DA 10 1_555 -0.215 0.144  0.300  -4.793  -17.660 1.441   26 Z_DT2:DA2_Y   Z 2  ? Y 2  ? 20 1 
1 D DT 13 1_555 C DA 9  1_555 -0.290 -0.090 0.274  -10.302 -18.940 -0.955  27 Z_DT1:DA1_Y   Z 1  ? Y 1  ? 20 1 
1 D DT 14 1_555 C DA 8  1_555 0.614  0.068  -0.004 -10.524 -13.126 -0.642  28 Z_DT-1:DA-1_Y Z -1 ? Y -1 ? 20 1 
1 D DT 15 1_555 C DA 7  1_555 0.543  -0.142 0.056  -9.007  -15.394 -15.526 29 Z_DT-2:DA-2_Y Z -2 ? Y -2 ? 20 1 
1 D DC 16 1_555 C DG 6  1_555 0.224  -0.210 -0.109 -1.908  -3.289  0.460   30 Z_DC-3:DG-3_Y Z -3 ? Y -3 ? 19 1 
1 D DG 17 1_555 C DC 5  1_555 -0.333 -0.103 0.210  5.042   1.192   0.657   31 Z_DG-4:DC-4_Y Z -4 ? Y -4 ? 19 1 
1 D DA 18 1_555 C DT 4  1_555 1.197  0.092  0.328  8.970   -9.076  -1.223  32 Z_DA-5:DT-5_Y Z -5 ? Y -5 ? 20 1 
1 D DA 19 1_555 C DT 3  1_555 1.209  -0.292 0.098  0.726   -0.731  -6.823  33 Z_DA-6:DT-6_Y Z -6 ? Y -6 ? 20 1 
1 D DA 20 1_555 C DT 2  1_555 -0.330 -0.239 0.655  15.869  -10.597 6.703   34 Z_DA-7:DT-7_Y Z -7 ? Y -7 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 A DT 4  1_555 B DA 18 1_555 A DC 5  1_555 B DG 17 1_555 0.319  0.874  3.073 3.493   8.028  37.088 0.348  -0.057 3.202 12.411  
-5.399  38.072 1  WW_DT-5DC-4:DG-4DA-5_XX W -5 ? X -5 ? W -4 ? X -4 ? 
1 A DC 5  1_555 B DG 17 1_555 A DG 6  1_555 B DC 16 1_555 -0.241 1.688  3.461 2.187   10.363 36.895 1.109  0.676  3.762 15.975  
-3.371  38.335 2  WW_DC-4DG-3:DC-3DG-4_XX W -4 ? X -4 ? W -3 ? X -3 ? 
1 A DG 6  1_555 B DC 16 1_555 A DA 7  1_555 B DT 15 1_555 -0.614 0.290  3.027 -0.712  3.974  28.466 -0.248 1.087  3.052 8.030   
1.438   28.745 3  WW_DG-3DA-2:DT-2DC-3_XX W -3 ? X -3 ? W -2 ? X -2 ? 
1 A DA 7  1_555 B DT 15 1_555 A DA 8  1_555 B DT 14 1_555 0.270  0.247  3.365 -0.354  -2.200 42.115 0.575  -0.413 3.347 -3.059  
0.493   42.172 4  WW_DA-2DA-1:DT-1DT-2_XX W -2 ? X -2 ? W -1 ? X -1 ? 
1 A DA 8  1_555 B DT 14 1_555 A DA 9  1_555 B DT 13 1_555 0.149  -0.334 3.146 0.067   1.192  33.985 -0.754 -0.245 3.133 2.038   
-0.114  34.006 5  WW_DA-1DA1:DT1DT-1_XX   W -1 ? X -1 ? W 1  ? X 1  ? 
1 A DA 9  1_555 B DT 13 1_555 A DA 10 1_555 B DT 12 1_555 0.339  -0.486 3.481 -2.485  -4.153 38.629 -0.191 -0.831 3.485 -6.248  
3.739   38.919 6  WW_DA1DA2:DT2DT1_XX     W 1  ? X 1  ? W 2  ? X 2  ? 
1 A DA 10 1_555 B DT 12 1_555 A DA 11 1_555 B DT 11 1_555 -0.003 -0.445 3.349 1.087   -2.055 35.778 -0.421 0.166  3.367 -3.341  
-1.767  35.851 7  WW_DA2DA3:DT3DT2_XX     W 2  ? X 2  ? W 3  ? X 3  ? 
1 A DA 11 1_555 B DT 11 1_555 A DT 12 1_555 B DA 10 1_555 -0.112 -0.695 3.384 0.029   -1.038 34.540 -1.003 0.192  3.403 -1.748  
-0.049  34.555 8  WW_DA3DT4:DA4DT3_XX     W 3  ? X 3  ? W 4  ? X 4  ? 
1 A DT 12 1_555 B DA 10 1_555 A DG 13 1_555 B DC 9  1_555 0.283  0.730  3.249 0.127   -1.502 34.888 1.441  -0.453 3.217 -2.504  
-0.212  34.920 9  WW_DT4DG5:DC5DA4_XX     W 4  ? X 4  ? W 5  ? X 5  ? 
1 A DG 13 1_555 B DC 9  1_555 A DC 14 1_555 B DG 8  1_555 0.409  0.009  2.859 4.328   7.572  28.709 -1.364 -0.002 2.800 14.844  
-8.484  29.978 10 WW_DG5DC6:DG6DC5_XX     W 5  ? X 5  ? W 6  ? X 6  ? 
1 A DC 14 1_555 B DG 8  1_555 A DG 15 1_555 B DC 7  1_555 -0.460 2.806  5.579 1.870   43.315 16.763 -5.239 0.965  4.652 69.797  
-3.014  46.337 11 WW_DC6DG7:DC7DG6_XX     W 6  ? X 6  ? W 7  ? X 7  ? 
1 A DG 15 1_555 B DC 7  1_555 A DA 16 1_555 B DT 6  1_555 -0.529 2.693  3.011 -10.689 -0.594 30.350 4.965  -0.847 2.971 -1.093  
19.664  32.140 12 WW_DG7DA8:DT8DC7_XX     W 7  ? X 7  ? W 8  ? X 8  ? 
1 A DA 16 1_555 B DT 6  1_555 A DT 17 1_555 B DA 5  1_555 -0.290 -0.384 3.003 0.393   2.421  32.118 -1.086 0.587  2.963 4.367   
-0.710  32.209 13 WW_DA8DT9:DA9DT8_XX     W 8  ? X 8  ? W 9  ? X 9  ? 
1 A DT 17 1_555 B DA 5  1_555 D DC 1  1_555 B DG 4  1_555 1.471  0.218  3.530 2.244   0.862  30.115 0.226  -2.323 3.632 1.656   
-4.310  30.209 14 WZ_DT9DC13:DG10DA9_XX   W 9  ? X 9  ? Z 13 ? X 10 ? 
1 D DC 1  1_555 B DG 4  1_555 D DT 2  1_555 B DA 3  1_555 -0.450 -0.181 3.369 0.592   3.037  32.427 -0.865 0.908  3.330 5.422   
-1.057  32.570 15 ZZ_DC13DT12:DA11DG10_XX Z 13 ? X 10 ? Z 12 ? X 11 ? 
1 D DT 2  1_555 B DA 3  1_555 D DA 3  1_555 B DT 2  1_555 0.392  -0.340 3.337 -1.150  0.847  38.256 -0.627 -0.745 3.317 1.291   
1.754   38.282 16 ZZ_DT12DA11:DT12DA11_XX Z 12 ? X 11 ? Z 11 ? X 12 ? 
1 D DA 3  1_555 B DT 2  1_555 D DG 4  1_555 B DC 1  1_555 0.498  -0.336 3.466 1.945   7.135  32.665 -1.823 -0.527 3.344 12.486  
-3.405  33.469 17 ZZ_DA11DG10:DC13DT12_XX Z 11 ? X 12 ? Z 10 ? X 13 ? 
1 D DG 4  1_555 B DC 1  1_555 D DA 5  1_555 C DT 17 1_555 -1.203 -0.062 3.487 -3.294  2.507  35.256 -0.498 1.452  3.568 4.122   
5.415   35.491 18 ZZ_DG10DA9:DT9DC13_YX   Z 10 ? X 13 ? Z 9  ? Y 9  ? 
1 D DA 5  1_555 C DT 17 1_555 D DT 6  1_555 C DA 16 1_555 -0.250 -0.572 3.080 -2.210  4.303  32.685 -1.686 0.090  2.993 7.595   
3.900   33.031 19 ZZ_DA9DT8:DA8DT9_YY     Z 9  ? Y 9  ? Z 8  ? Y 8  ? 
1 D DT 6  1_555 C DA 16 1_555 D DC 7  1_555 C DG 15 1_555 0.499  2.040  2.956 9.426   -5.803 29.613 4.689  0.607  2.556 -10.886 
-17.683 31.571 20 ZZ_DT8DC7:DG7DA8_YY     Z 8  ? Y 8  ? Z 7  ? Y 7  ? 
1 D DC 7  1_555 C DG 15 1_555 D DG 8  1_555 C DC 14 1_555 -0.202 2.828  5.091 2.766   39.319 17.877 -4.612 0.869  4.696 66.388  
-4.671  43.134 21 ZZ_DC7DG6:DC6DG7_YY     Z 7  ? Y 7  ? Z 6  ? Y 6  ? 
1 D DG 8  1_555 C DC 14 1_555 D DC 9  1_555 C DG 13 1_555 0.069  -0.153 2.946 -9.891  12.097 27.217 -2.323 -1.796 2.490 23.419  
19.148  31.310 22 ZZ_DG6DC5:DG5DC6_YY     Z 6  ? Y 6  ? Z 5  ? Y 5  ? 
1 D DC 9  1_555 C DG 13 1_555 D DA 10 1_555 C DT 12 1_555 -0.634 0.765  3.188 0.813   -7.769 35.208 2.283  1.134  2.943 -12.651 
-1.324  36.038 23 ZZ_DC5DA4:DT4DG5_YY     Z 5  ? Y 5  ? Z 4  ? Y 4  ? 
1 D DA 10 1_555 C DT 12 1_555 D DT 11 1_555 C DA 11 1_555 0.400  -0.782 3.210 -0.064  -0.168 32.518 -1.367 -0.725 3.213 -0.301  
0.115   32.518 24 ZZ_DA4DT3:DA3DT4_YY     Z 4  ? Y 4  ? Z 3  ? Y 3  ? 
1 D DT 11 1_555 C DA 11 1_555 D DT 12 1_555 C DA 10 1_555 -0.164 -0.582 3.511 0.071   -0.193 38.760 -0.852 0.256  3.514 -0.291  
-0.106  38.760 25 ZZ_DT3DT2:DA2DA3_YY     Z 3  ? Y 3  ? Z 2  ? Y 2  ? 
1 D DT 12 1_555 C DA 10 1_555 D DT 13 1_555 C DA 9  1_555 -0.293 -0.548 3.323 -0.306  -0.634 36.263 -0.790 0.427  3.334 -1.018  
0.491   36.269 26 ZZ_DT2DT1:DA1DA2_YY     Z 2  ? Y 2  ? Z 1  ? Y 1  ? 
1 D DT 13 1_555 C DA 9  1_555 D DT 14 1_555 C DA 8  1_555 -0.372 -0.396 3.285 0.648   -5.502 41.119 0.034  0.596  3.302 -7.790  
-0.917  41.475 27 ZZ_DT1DT-1:DA-1DA1_YY   Z 1  ? Y 1  ? Z -1 ? Y -1 ? 
1 D DT 14 1_555 C DA 8  1_555 D DT 15 1_555 C DA 7  1_555 -0.349 -0.009 3.164 -3.720  -1.283 38.945 0.136  0.087  3.182 -1.918  
5.562   39.136 28 ZZ_DT-1DT-2:DA-2DA-1_YY Z -1 ? Y -1 ? Z -2 ? Y -2 ? 
1 D DT 15 1_555 C DA 7  1_555 D DC 16 1_555 C DG 6  1_555 0.861  -0.122 3.158 4.612   -1.736 30.532 0.103  -0.734 3.252 -3.271  
-8.686  30.918 29 ZZ_DT-2DC-3:DG-3DA-2_YY Z -2 ? Y -2 ? Z -3 ? Y -3 ? 
1 D DC 16 1_555 C DG 6  1_555 D DG 17 1_555 C DC 5  1_555 0.437  1.357  3.403 -2.190  2.016  31.699 2.088  -1.215 3.443 3.680   
3.998   31.834 30 ZZ_DC-3DG-4:DC-4DG-3_YY Z -3 ? Y -3 ? Z -4 ? Y -4 ? 
1 D DG 17 1_555 C DC 5  1_555 D DA 18 1_555 C DT 4  1_555 -0.291 0.363  3.286 -0.781  1.515  41.590 0.350  0.326  3.301 2.133   
1.100   41.623 31 ZZ_DG-4DA-5:DT-5DC-4_YY Z -4 ? Y -4 ? Z -5 ? Y -5 ? 
1 D DA 18 1_555 C DT 4  1_555 D DA 19 1_555 C DT 3  1_555 -0.645 -0.598 3.493 0.002   4.897  37.474 -1.590 0.996  3.391 7.582   
-0.003  37.782 32 ZZ_DA-5DA-6:DT-6DT-5_YY Z -5 ? Y -5 ? Z -6 ? Y -6 ? 
1 D DA 19 1_555 C DT 3  1_555 D DA 20 1_555 C DT 2  1_555 1.072  -0.469 3.007 -3.194  -0.238 32.974 -0.786 -2.367 2.897 -0.418  
5.610   33.125 33 ZZ_DA-6DA-7:DT-7DT-6_YY Z -6 ? Y -6 ? Z -7 ? Y -7 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "ADENOSINE-3',5'-CYCLIC-MONOPHOSPHATE" CMP 
5 '1,4-DIETHYLENE DIOXIDE'               DIO 
6 water                                  HOH 
#