data_1ZTA
# 
_entry.id   1ZTA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZTA         
WWPDB D_1000177535 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZTA 
_pdbx_database_status.recvd_initial_deposition_date   1990-10-11 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Saudek, V.'                1 
'Pastore, A.'               2 
'Castiglione Morelli, M.A.' 3 
'Frank, R.'                 4 
'Gausepohl, H.'             5 
'Gibson, T.'                6 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'The solution structure of a leucine-zipper motif peptide.'                                        'Protein Eng.' 4  519  
529 1991 PRENE9 UK 0269-2139 0859 ? 1891459 10.1093/protein/4.5.519 
1       'Solution Structure of the DNA-Binding Domain of the Yeast Transcriptional Activator Protein GCN4' 'Protein Eng.' 4  3    
?   1990 PRENE9 UK 0269-2139 0859 ? ?       ?                       
2       'Solution Structure of the Basic Region from the Transcriptional Activator GCN4'                   Biochemistry   30 1310 
?   1991 BICHAW US 0006-2960 0033 ? ?       ?                       
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Saudek, V.'                1  
primary 'Pastore, A.'               2  
primary 'Morelli, M.A.'             3  
primary 'Frank, R.'                 4  
primary 'Gausepohl, H.'             5  
primary 'Gibson, T.'                6  
1       'Saudek, V.'                7  
1       'Pastore, A.'               8  
1       'Castiglione Morelli, M.A.' 9  
1       'Frank, R.'                 10 
1       'Gausepohl, H.'             11 
1       'Gibson, T.'                12 
1       'Weih, F.'                  13 
1       'Roesch, P.'                14 
2       'Pastore, A.'               15 
2       'Saudek, V.'                16 
2       'Castiglione Morelli, M.A.' 17 
2       'Frank, R.'                 18 
2       'Gausepohl, H.'             19 
2       'Gibson, T.'                20 
2       'Weih, F.'                  21 
2       'Roesch, P.'                22 
# 
_cell.entry_id           1ZTA 
_cell.length_a           1.000 
_cell.length_b           1.000 
_cell.length_c           1.000 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         1ZTA 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 man 
_entity.pdbx_description           'LEUCINE ZIPPER MONOMER' 
_entity.formula_weight             4246.950 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       LQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_entity_poly.pdbx_seq_one_letter_code_can   LQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  LEU n 
1 2  GLN n 
1 3  ARG n 
1 4  MET n 
1 5  LYS n 
1 6  GLN n 
1 7  LEU n 
1 8  GLU n 
1 9  ASP n 
1 10 LYS n 
1 11 VAL n 
1 12 GLU n 
1 13 GLU n 
1 14 LEU n 
1 15 LEU n 
1 16 SER n 
1 17 LYS n 
1 18 ASN n 
1 19 TYR n 
1 20 HIS n 
1 21 LEU n 
1 22 GLU n 
1 23 ASN n 
1 24 GLU n 
1 25 VAL n 
1 26 ALA n 
1 27 ARG n 
1 28 LEU n 
1 29 LYS n 
1 30 LYS n 
1 31 LEU n 
1 32 VAL n 
1 33 GLY n 
1 34 GLU n 
1 35 ARG n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               
;baker's yeast
;
_entity_src_gen.gene_src_genus                     Saccharomyces 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Saccharomyces cerevisiae' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     4932 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      ? 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     ? 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    GCN4_YEAST 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P03069 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MSEYQPSLFALNPMGFSPLDGSKSTNENVSASTSTAKPMVGQLIFDKFIKTEEDPIIKQDTPSNLDFDFALPQTATAPDA
KTVLPIPELDDAVVESFFSSSTDSTPMFEYENLEDNSKEWTSLFDNDIPVTTDDVSLADKAIESTEEVSLVPSNLEVSTT
SFLPTPVLEDAKLTQTRKVKKPNSVVKKSHHVGKDDESRLDHLGVVAYNRKQRSIPLSPIVPESSDPAALKRARNTEAAR
RSRARKLQRMKQLEDKVEELLSKNYHLENEVARLKKLVGER
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZTA 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 35 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P03069 
_struct_ref_seq.db_align_beg                  247 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  281 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       35 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_pdbx_nmr_ensemble.entry_id                             1ZTA 
_pdbx_nmr_ensemble.conformers_calculated_total_number   ? 
_pdbx_nmr_ensemble.conformers_submitted_total_number    20 
_pdbx_nmr_ensemble.conformer_selection_criteria         ? 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement DISMAN ? BRAUN,GO                  1 
refinement GROMOS ? 'VAN GUNSTEREN,BERENDSEN' 2 
# 
_exptl.entry_id          1ZTA 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_struct.entry_id                  1ZTA 
_struct.title                     'THE SOLUTION STRUCTURE OF A LEUCINE-ZIPPER MOTIF PEPTIDE' 
_struct.pdbx_descriptor           'LEUCINE ZIPPER MONOMER (NMR, 20 STRUCTURES)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZTA 
_struct_keywords.pdbx_keywords   'DNA-BINDING MOTIF' 
_struct_keywords.text            'DNA-BINDING MOTIF' 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   Y 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
_struct_biol.id   1 
# 
_struct_conf.conf_type_id            HELX_P 
_struct_conf.id                      HELX_P1 
_struct_conf.pdbx_PDB_helix_id       H1 
_struct_conf.beg_label_comp_id       GLN 
_struct_conf.beg_label_asym_id       A 
_struct_conf.beg_label_seq_id        6 
_struct_conf.pdbx_beg_PDB_ins_code   ? 
_struct_conf.end_label_comp_id       GLY 
_struct_conf.end_label_asym_id       A 
_struct_conf.end_label_seq_id        33 
_struct_conf.pdbx_end_PDB_ins_code   ? 
_struct_conf.beg_auth_comp_id        GLN 
_struct_conf.beg_auth_asym_id        A 
_struct_conf.beg_auth_seq_id         6 
_struct_conf.end_auth_comp_id        GLY 
_struct_conf.end_auth_asym_id        A 
_struct_conf.end_auth_seq_id         33 
_struct_conf.pdbx_PDB_helix_class    1 
_struct_conf.details                 ? 
_struct_conf.pdbx_PDB_helix_length   28 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ZTA 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZTA 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . LEU A 1 1  ? 22.279  0.420  -8.843  1.00 0.00 ? 1  LEU A N    1  
ATOM 2    C CA   . LEU A 1 1  ? 21.308  1.561  -9.064  1.00 0.00 ? 1  LEU A CA   1  
ATOM 3    C C    . LEU A 1 1  ? 20.278  1.714  -7.923  1.00 0.00 ? 1  LEU A C    1  
ATOM 4    O O    . LEU A 1 1  ? 20.431  1.174  -6.823  1.00 0.00 ? 1  LEU A O    1  
ATOM 5    C CB   . LEU A 1 1  ? 20.645  1.335  -10.419 1.00 0.00 ? 1  LEU A CB   1  
ATOM 6    C CG   . LEU A 1 1  ? 20.958  2.447  -11.435 1.00 0.00 ? 1  LEU A CG   1  
ATOM 7    C CD1  . LEU A 1 1  ? 20.431  2.050  -12.807 1.00 0.00 ? 1  LEU A CD1  1  
ATOM 8    C CD2  . LEU A 1 1  ? 20.345  3.798  -11.039 1.00 0.00 ? 1  LEU A CD2  1  
ATOM 9    H H1   . LEU A 1 1  ? 22.754  0.560  -7.978  1.00 0.00 ? 1  LEU A H1   1  
ATOM 10   H H2   . LEU A 1 1  ? 21.744  -0.433 -8.779  1.00 0.00 ? 1  LEU A H2   1  
ATOM 11   H H3   . LEU A 1 1  ? 22.911  0.372  -9.581  1.00 0.00 ? 1  LEU A H3   1  
ATOM 12   N N    . GLN A 1 2  ? 19.261  2.536  -8.191  1.00 0.00 ? 2  GLN A N    1  
ATOM 13   C CA   . GLN A 1 2  ? 18.123  2.780  -7.260  1.00 0.00 ? 2  GLN A CA   1  
ATOM 14   C C    . GLN A 1 2  ? 17.494  1.446  -6.835  1.00 0.00 ? 2  GLN A C    1  
ATOM 15   O O    . GLN A 1 2  ? 17.294  0.560  -7.660  1.00 0.00 ? 2  GLN A O    1  
ATOM 16   C CB   . GLN A 1 2  ? 17.107  3.652  -7.999  1.00 0.00 ? 2  GLN A CB   1  
ATOM 17   C CG   . GLN A 1 2  ? 16.771  4.921  -7.212  1.00 0.00 ? 2  GLN A CG   1  
ATOM 18   C CD   . GLN A 1 2  ? 15.406  4.825  -6.521  1.00 0.00 ? 2  GLN A CD   1  
ATOM 19   O OE1  . GLN A 1 2  ? 15.261  4.453  -5.367  1.00 0.00 ? 2  GLN A OE1  1  
ATOM 20   N NE2  . GLN A 1 2  ? 14.368  5.158  -7.265  1.00 0.00 ? 2  GLN A NE2  1  
ATOM 21   H H    . GLN A 1 2  ? 19.175  2.968  -9.075  1.00 0.00 ? 2  GLN A H    1  
ATOM 22   H HE21 . GLN A 1 2  ? 14.489  5.393  -8.225  1.00 0.00 ? 2  GLN A HE21 1  
ATOM 23   H HE22 . GLN A 1 2  ? 13.480  5.130  -6.837  1.00 0.00 ? 2  GLN A HE22 1  
ATOM 24   N N    . ARG A 1 3  ? 17.268  1.341  -5.538  1.00 0.00 ? 3  ARG A N    1  
ATOM 25   C CA   . ARG A 1 3  ? 16.830  0.083  -4.848  1.00 0.00 ? 3  ARG A CA   1  
ATOM 26   C C    . ARG A 1 3  ? 17.857  -1.055 -5.011  1.00 0.00 ? 3  ARG A C    1  
ATOM 27   O O    . ARG A 1 3  ? 17.782  -1.927 -5.870  1.00 0.00 ? 3  ARG A O    1  
ATOM 28   C CB   . ARG A 1 3  ? 15.378  -0.243 -5.254  1.00 0.00 ? 3  ARG A CB   1  
ATOM 29   C CG   . ARG A 1 3  ? 14.898  -1.625 -4.779  1.00 0.00 ? 3  ARG A CG   1  
ATOM 30   C CD   . ARG A 1 3  ? 13.409  -1.959 -5.012  1.00 0.00 ? 3  ARG A CD   1  
ATOM 31   N NE   . ARG A 1 3  ? 13.026  -1.849 -6.429  1.00 0.00 ? 3  ARG A NE   1  
ATOM 32   C CZ   . ARG A 1 3  ? 13.712  -2.318 -7.485  1.00 0.00 ? 3  ARG A CZ   1  
ATOM 33   N NH1  . ARG A 1 3  ? 14.557  -3.333 -7.389  1.00 0.00 ? 3  ARG A NH1  1  
ATOM 34   N NH2  . ARG A 1 3  ? 14.039  -1.419 -8.402  1.00 0.00 ? 3  ARG A NH2  1  
ATOM 35   H H    . ARG A 1 3  ? 17.336  2.141  -4.953  1.00 0.00 ? 3  ARG A H    1  
ATOM 36   H HE   . ARG A 1 3  ? 12.083  -1.588 -6.593  1.00 0.00 ? 3  ARG A HE   1  
ATOM 37   H HH11 . ARG A 1 3  ? 14.584  -3.863 -6.536  1.00 0.00 ? 3  ARG A HH11 1  
ATOM 38   H HH12 . ARG A 1 3  ? 15.121  -3.609 -8.164  1.00 0.00 ? 3  ARG A HH12 1  
ATOM 39   H HH21 . ARG A 1 3  ? 13.785  -0.465 -8.245  1.00 0.00 ? 3  ARG A HH21 1  
ATOM 40   H HH22 . ARG A 1 3  ? 14.596  -1.673 -9.175  1.00 0.00 ? 3  ARG A HH22 1  
ATOM 41   N N    . MET A 1 4  ? 18.889  -0.939 -4.169  1.00 0.00 ? 4  MET A N    1  
ATOM 42   C CA   . MET A 1 4  ? 19.987  -1.939 -4.107  1.00 0.00 ? 4  MET A CA   1  
ATOM 43   C C    . MET A 1 4  ? 19.995  -2.819 -2.842  1.00 0.00 ? 4  MET A C    1  
ATOM 44   O O    . MET A 1 4  ? 20.525  -3.920 -2.876  1.00 0.00 ? 4  MET A O    1  
ATOM 45   C CB   . MET A 1 4  ? 21.351  -1.255 -4.284  1.00 0.00 ? 4  MET A CB   1  
ATOM 46   C CG   . MET A 1 4  ? 21.762  -0.313 -3.137  1.00 0.00 ? 4  MET A CG   1  
ATOM 47   S SD   . MET A 1 4  ? 22.055  1.410  -3.645  1.00 0.00 ? 4  MET A SD   1  
ATOM 48   C CE   . MET A 1 4  ? 20.383  1.983  -3.811  1.00 0.00 ? 4  MET A CE   1  
ATOM 49   H H    . MET A 1 4  ? 19.117  -0.051 -3.787  1.00 0.00 ? 4  MET A H    1  
ATOM 50   N N    . LYS A 1 5  ? 19.358  -2.296 -1.787  1.00 0.00 ? 5  LYS A N    1  
ATOM 51   C CA   . LYS A 1 5  ? 19.282  -2.791 -0.383  1.00 0.00 ? 5  LYS A CA   1  
ATOM 52   C C    . LYS A 1 5  ? 18.766  -1.745 0.616   1.00 0.00 ? 5  LYS A C    1  
ATOM 53   O O    . LYS A 1 5  ? 18.035  -2.056 1.546   1.00 0.00 ? 5  LYS A O    1  
ATOM 54   C CB   . LYS A 1 5  ? 20.554  -3.420 0.189   1.00 0.00 ? 5  LYS A CB   1  
ATOM 55   C CG   . LYS A 1 5  ? 20.578  -4.945 -0.038  1.00 0.00 ? 5  LYS A CG   1  
ATOM 56   C CD   . LYS A 1 5  ? 20.486  -5.797 1.241   1.00 0.00 ? 5  LYS A CD   1  
ATOM 57   C CE   . LYS A 1 5  ? 19.156  -5.686 1.990   1.00 0.00 ? 5  LYS A CE   1  
ATOM 58   N NZ   . LYS A 1 5  ? 19.436  -5.133 3.323   1.00 0.00 ? 5  LYS A NZ   1  
ATOM 59   H H    . LYS A 1 5  ? 18.690  -1.593 -1.998  1.00 0.00 ? 5  LYS A H    1  
ATOM 60   H HZ1  . LYS A 1 5  ? 19.924  -4.274 3.229   1.00 0.00 ? 5  LYS A HZ1  1  
ATOM 61   H HZ2  . LYS A 1 5  ? 18.568  -4.973 3.793   1.00 0.00 ? 5  LYS A HZ2  1  
ATOM 62   H HZ3  . LYS A 1 5  ? 19.980  -5.795 3.847   1.00 0.00 ? 5  LYS A HZ3  1  
ATOM 63   N N    . GLN A 1 6  ? 19.076  -0.472 0.342   1.00 0.00 ? 6  GLN A N    1  
ATOM 64   C CA   . GLN A 1 6  ? 18.650  0.670  1.181   1.00 0.00 ? 6  GLN A CA   1  
ATOM 65   C C    . GLN A 1 6  ? 17.313  1.269  0.742   1.00 0.00 ? 6  GLN A C    1  
ATOM 66   O O    . GLN A 1 6  ? 16.289  1.053  1.372   1.00 0.00 ? 6  GLN A O    1  
ATOM 67   C CB   . GLN A 1 6  ? 19.764  1.729  1.175   1.00 0.00 ? 6  GLN A CB   1  
ATOM 68   C CG   . GLN A 1 6  ? 20.953  1.320  2.052   1.00 0.00 ? 6  GLN A CG   1  
ATOM 69   C CD   . GLN A 1 6  ? 20.632  1.502  3.552   1.00 0.00 ? 6  GLN A CD   1  
ATOM 70   O OE1  . GLN A 1 6  ? 20.364  2.590  4.024   1.00 0.00 ? 6  GLN A OE1  1  
ATOM 71   N NE2  . GLN A 1 6  ? 20.630  0.436  4.297   1.00 0.00 ? 6  GLN A NE2  1  
ATOM 72   H H    . GLN A 1 6  ? 19.729  -0.255 -0.369  1.00 0.00 ? 6  GLN A H    1  
ATOM 73   H HE21 . GLN A 1 6  ? 20.791  -0.480 3.937   1.00 0.00 ? 6  GLN A HE21 1  
ATOM 74   H HE22 . GLN A 1 6  ? 20.441  0.588  5.269   1.00 0.00 ? 6  GLN A HE22 1  
ATOM 75   N N    . LEU A 1 7  ? 17.327  1.791  -0.485  1.00 0.00 ? 7  LEU A N    1  
ATOM 76   C CA   . LEU A 1 7  ? 16.112  2.320  -1.146  1.00 0.00 ? 7  LEU A CA   1  
ATOM 77   C C    . LEU A 1 7  ? 15.059  1.229  -1.381  1.00 0.00 ? 7  LEU A C    1  
ATOM 78   O O    . LEU A 1 7  ? 13.873  1.531  -1.439  1.00 0.00 ? 7  LEU A O    1  
ATOM 79   C CB   . LEU A 1 7  ? 16.459  3.045  -2.447  1.00 0.00 ? 7  LEU A CB   1  
ATOM 80   C CG   . LEU A 1 7  ? 17.597  4.055  -2.277  1.00 0.00 ? 7  LEU A CG   1  
ATOM 81   C CD1  . LEU A 1 7  ? 17.949  4.676  -3.628  1.00 0.00 ? 7  LEU A CD1  1  
ATOM 82   C CD2  . LEU A 1 7  ? 17.284  5.178  -1.278  1.00 0.00 ? 7  LEU A CD2  1  
ATOM 83   H H    . LEU A 1 7  ? 18.174  2.015  -0.948  1.00 0.00 ? 7  LEU A H    1  
ATOM 84   N N    . GLU A 1 8  ? 15.491  -0.039 -1.293  1.00 0.00 ? 8  GLU A N    1  
ATOM 85   C CA   . GLU A 1 8  ? 14.585  -1.208 -1.299  1.00 0.00 ? 8  GLU A CA   1  
ATOM 86   C C    . GLU A 1 8  ? 13.566  -1.150 -0.152  1.00 0.00 ? 8  GLU A C    1  
ATOM 87   O O    . GLU A 1 8  ? 12.383  -1.088 -0.450  1.00 0.00 ? 8  GLU A O    1  
ATOM 88   C CB   . GLU A 1 8  ? 15.324  -2.547 -1.418  1.00 0.00 ? 8  GLU A CB   1  
ATOM 89   C CG   . GLU A 1 8  ? 15.647  -3.376 -0.146  1.00 0.00 ? 8  GLU A CG   1  
ATOM 90   C CD   . GLU A 1 8  ? 14.414  -3.983 0.517   1.00 0.00 ? 8  GLU A CD   1  
ATOM 91   O OE1  . GLU A 1 8  ? 13.522  -4.543 -0.094  1.00 0.00 ? 8  GLU A OE1  1  
ATOM 92   O OE2  . GLU A 1 8  ? 14.313  -3.747 1.847   1.00 0.00 ? 8  GLU A OE2  1  
ATOM 93   H H    . GLU A 1 8  ? 16.447  -0.254 -1.194  1.00 0.00 ? 8  GLU A H    1  
ATOM 94   H HE2  . GLU A 1 8  ? 13.445  -4.169 2.103   1.00 0.00 ? 8  GLU A HE2  1  
ATOM 95   N N    . ASP A 1 9  ? 14.041  -0.811 1.031   1.00 0.00 ? 9  ASP A N    1  
ATOM 96   C CA   . ASP A 1 9  ? 13.187  -0.707 2.230   1.00 0.00 ? 9  ASP A CA   1  
ATOM 97   C C    . ASP A 1 9  ? 12.171  0.455  2.121   1.00 0.00 ? 9  ASP A C    1  
ATOM 98   O O    . ASP A 1 9  ? 10.990  0.236  2.318   1.00 0.00 ? 9  ASP A O    1  
ATOM 99   C CB   . ASP A 1 9  ? 14.070  -0.614 3.462   1.00 0.00 ? 9  ASP A CB   1  
ATOM 100  C CG   . ASP A 1 9  ? 13.564  -1.576 4.537   1.00 0.00 ? 9  ASP A CG   1  
ATOM 101  O OD1  . ASP A 1 9  ? 13.944  -2.735 4.646   1.00 0.00 ? 9  ASP A OD1  1  
ATOM 102  O OD2  . ASP A 1 9  ? 12.643  -1.083 5.388   1.00 0.00 ? 9  ASP A OD2  1  
ATOM 103  H H    . ASP A 1 9  ? 15.003  -0.590 1.194   1.00 0.00 ? 9  ASP A H    1  
ATOM 104  H HD2  . ASP A 1 9  ? 12.368  -1.891 5.918   1.00 0.00 ? 9  ASP A HD2  1  
ATOM 105  N N    . LYS A 1 10 ? 12.626  1.523  1.465   1.00 0.00 ? 10 LYS A N    1  
ATOM 106  C CA   . LYS A 1 10 ? 11.808  2.718  1.176   1.00 0.00 ? 10 LYS A CA   1  
ATOM 107  C C    . LYS A 1 10 ? 10.752  2.439  0.072   1.00 0.00 ? 10 LYS A C    1  
ATOM 108  O O    . LYS A 1 10 ? 9.556   2.589  0.301   1.00 0.00 ? 10 LYS A O    1  
ATOM 109  C CB   . LYS A 1 10 ? 12.754  3.873  0.833   1.00 0.00 ? 10 LYS A CB   1  
ATOM 110  C CG   . LYS A 1 10 ? 12.010  5.143  0.405   1.00 0.00 ? 10 LYS A CG   1  
ATOM 111  C CD   . LYS A 1 10 ? 12.924  6.367  0.395   1.00 0.00 ? 10 LYS A CD   1  
ATOM 112  C CE   . LYS A 1 10 ? 12.262  7.535  -0.341  1.00 0.00 ? 10 LYS A CE   1  
ATOM 113  N NZ   . LYS A 1 10 ? 12.298  7.279  -1.784  1.00 0.00 ? 10 LYS A NZ   1  
ATOM 114  H H    . LYS A 1 10 ? 13.538  1.543  1.076   1.00 0.00 ? 10 LYS A H    1  
ATOM 115  H HZ1  . LYS A 1 10 ? 11.859  6.402  -1.985  1.00 0.00 ? 10 LYS A HZ1  1  
ATOM 116  H HZ2  . LYS A 1 10 ? 11.809  8.013  -2.262  1.00 0.00 ? 10 LYS A HZ2  1  
ATOM 117  H HZ3  . LYS A 1 10 ? 13.242  7.268  -2.098  1.00 0.00 ? 10 LYS A HZ3  1  
ATOM 118  N N    . VAL A 1 11 ? 11.206  1.950  -1.074  1.00 0.00 ? 11 VAL A N    1  
ATOM 119  C CA   . VAL A 1 11 ? 10.351  1.594  -2.237  1.00 0.00 ? 11 VAL A CA   1  
ATOM 120  C C    . VAL A 1 11 ? 9.375   0.435  -1.915  1.00 0.00 ? 11 VAL A C    1  
ATOM 121  O O    . VAL A 1 11 ? 8.203   0.504  -2.266  1.00 0.00 ? 11 VAL A O    1  
ATOM 122  C CB   . VAL A 1 11 ? 11.241  1.334  -3.480  1.00 0.00 ? 11 VAL A CB   1  
ATOM 123  C CG1  . VAL A 1 11 ? 10.472  0.773  -4.679  1.00 0.00 ? 11 VAL A CG1  1  
ATOM 124  C CG2  . VAL A 1 11 ? 11.918  2.633  -3.931  1.00 0.00 ? 11 VAL A CG2  1  
ATOM 125  H H    . VAL A 1 11 ? 12.199  1.837  -1.233  1.00 0.00 ? 11 VAL A H    1  
ATOM 126  N N    . GLU A 1 12 ? 9.860   -0.568 -1.204  1.00 0.00 ? 12 GLU A N    1  
ATOM 127  C CA   . GLU A 1 12 ? 9.018   -1.687 -0.716  1.00 0.00 ? 12 GLU A CA   1  
ATOM 128  C C    . GLU A 1 12 ? 7.935   -1.178 0.241   1.00 0.00 ? 12 GLU A C    1  
ATOM 129  O O    . GLU A 1 12 ? 6.767   -1.458 0.006   1.00 0.00 ? 12 GLU A O    1  
ATOM 130  C CB   . GLU A 1 12 ? 9.893   -2.745 -0.026  1.00 0.00 ? 12 GLU A CB   1  
ATOM 131  C CG   . GLU A 1 12 ? 9.097   -3.974 0.412   1.00 0.00 ? 12 GLU A CG   1  
ATOM 132  C CD   . GLU A 1 12 ? 9.682   -4.524 1.706   1.00 0.00 ? 12 GLU A CD   1  
ATOM 133  O OE1  . GLU A 1 12 ? 9.924   -3.825 2.681   1.00 0.00 ? 12 GLU A OE1  1  
ATOM 134  O OE2  . GLU A 1 12 ? 9.931   -5.854 1.739   1.00 0.00 ? 12 GLU A OE2  1  
ATOM 135  H H    . GLU A 1 12 ? 10.841  -0.659 -0.979  1.00 0.00 ? 12 GLU A H    1  
ATOM 136  H HE2  . GLU A 1 12 ? 10.256  -6.007 2.667   1.00 0.00 ? 12 GLU A HE2  1  
ATOM 137  N N    . GLU A 1 13 ? 8.330   -0.309 1.181   1.00 0.00 ? 13 GLU A N    1  
ATOM 138  C CA   . GLU A 1 13 ? 7.399   0.374  2.117   1.00 0.00 ? 13 GLU A CA   1  
ATOM 139  C C    . GLU A 1 13 ? 6.225   1.084  1.410   1.00 0.00 ? 13 GLU A C    1  
ATOM 140  O O    . GLU A 1 13 ? 5.122   1.097  1.951   1.00 0.00 ? 13 GLU A O    1  
ATOM 141  C CB   . GLU A 1 13 ? 8.138   1.368  3.006   1.00 0.00 ? 13 GLU A CB   1  
ATOM 142  C CG   . GLU A 1 13 ? 8.350   0.792  4.410   1.00 0.00 ? 13 GLU A CG   1  
ATOM 143  C CD   . GLU A 1 13 ? 9.756   1.040  4.949   1.00 0.00 ? 13 GLU A CD   1  
ATOM 144  O OE1  . GLU A 1 13 ? 10.436  2.040  4.702   1.00 0.00 ? 13 GLU A OE1  1  
ATOM 145  O OE2  . GLU A 1 13 ? 10.217  0.096  5.797   1.00 0.00 ? 13 GLU A OE2  1  
ATOM 146  H H    . GLU A 1 13 ? 9.290   -0.068 1.324   1.00 0.00 ? 13 GLU A H    1  
ATOM 147  H HE2  . GLU A 1 13 ? 11.184  0.314  5.888   1.00 0.00 ? 13 GLU A HE2  1  
ATOM 148  N N    . LEU A 1 14 ? 6.459   1.477  0.162   1.00 0.00 ? 14 LEU A N    1  
ATOM 149  C CA   . LEU A 1 14 ? 5.405   2.074  -0.682  1.00 0.00 ? 14 LEU A CA   1  
ATOM 150  C C    . LEU A 1 14 ? 4.321   1.017  -0.941  1.00 0.00 ? 14 LEU A C    1  
ATOM 151  O O    . LEU A 1 14 ? 3.289   1.138  -0.321  1.00 0.00 ? 14 LEU A O    1  
ATOM 152  C CB   . LEU A 1 14 ? 5.907   2.621  -2.026  1.00 0.00 ? 14 LEU A CB   1  
ATOM 153  C CG   . LEU A 1 14 ? 7.074   3.605  -1.893  1.00 0.00 ? 14 LEU A CG   1  
ATOM 154  C CD1  . LEU A 1 14 ? 7.444   4.107  -3.291  1.00 0.00 ? 14 LEU A CD1  1  
ATOM 155  C CD2  . LEU A 1 14 ? 6.809   4.780  -0.946  1.00 0.00 ? 14 LEU A CD2  1  
ATOM 156  H H    . LEU A 1 14 ? 7.340   1.320  -0.286  1.00 0.00 ? 14 LEU A H    1  
ATOM 157  N N    . LEU A 1 15 ? 4.656   -0.085 -1.608  1.00 0.00 ? 15 LEU A N    1  
ATOM 158  C CA   . LEU A 1 15 ? 3.700   -1.179 -1.901  1.00 0.00 ? 15 LEU A CA   1  
ATOM 159  C C    . LEU A 1 15 ? 3.023   -1.704 -0.621  1.00 0.00 ? 15 LEU A C    1  
ATOM 160  O O    . LEU A 1 15 ? 1.809   -1.598 -0.541  1.00 0.00 ? 15 LEU A O    1  
ATOM 161  C CB   . LEU A 1 15 ? 4.327   -2.354 -2.649  1.00 0.00 ? 15 LEU A CB   1  
ATOM 162  C CG   . LEU A 1 15 ? 5.304   -1.960 -3.773  1.00 0.00 ? 15 LEU A CG   1  
ATOM 163  C CD1  . LEU A 1 15 ? 5.727   -3.222 -4.511  1.00 0.00 ? 15 LEU A CD1  1  
ATOM 164  C CD2  . LEU A 1 15 ? 4.749   -0.940 -4.776  1.00 0.00 ? 15 LEU A CD2  1  
ATOM 165  H H    . LEU A 1 15 ? 5.582   -0.222 -1.981  1.00 0.00 ? 15 LEU A H    1  
ATOM 166  N N    . SER A 1 16 ? 3.801   -1.952 0.430   1.00 0.00 ? 16 SER A N    1  
ATOM 167  C CA   . SER A 1 16 ? 3.301   -2.338 1.772   1.00 0.00 ? 16 SER A CA   1  
ATOM 168  C C    . SER A 1 16 ? 2.105   -1.495 2.271   1.00 0.00 ? 16 SER A C    1  
ATOM 169  O O    . SER A 1 16 ? 1.208   -2.011 2.929   1.00 0.00 ? 16 SER A O    1  
ATOM 170  C CB   . SER A 1 16 ? 4.403   -2.181 2.823   1.00 0.00 ? 16 SER A CB   1  
ATOM 171  O OG   . SER A 1 16 ? 5.639   -2.709 2.328   1.00 0.00 ? 16 SER A OG   1  
ATOM 172  H H    . SER A 1 16 ? 4.807   -1.979 0.342   1.00 0.00 ? 16 SER A H    1  
ATOM 173  H HG   . SER A 1 16 ? 6.388   -2.295 2.848   1.00 0.00 ? 16 SER A HG   1  
ATOM 174  N N    . LYS A 1 17 ? 2.130   -0.208 1.904   1.00 0.00 ? 17 LYS A N    1  
ATOM 175  C CA   . LYS A 1 17 ? 1.039   0.750  2.134   1.00 0.00 ? 17 LYS A CA   1  
ATOM 176  C C    . LYS A 1 17 ? 0.148   1.009  0.896   1.00 0.00 ? 17 LYS A C    1  
ATOM 177  O O    . LYS A 1 17 ? -1.051  0.851  0.986   1.00 0.00 ? 17 LYS A O    1  
ATOM 178  C CB   . LYS A 1 17 ? 1.624   2.026  2.735   1.00 0.00 ? 17 LYS A CB   1  
ATOM 179  C CG   . LYS A 1 17 ? 0.634   3.200  2.822   1.00 0.00 ? 17 LYS A CG   1  
ATOM 180  C CD   . LYS A 1 17 ? 0.970   4.234  3.905   1.00 0.00 ? 17 LYS A CD   1  
ATOM 181  C CE   . LYS A 1 17 ? 2.422   4.746  3.940   1.00 0.00 ? 17 LYS A CE   1  
ATOM 182  N NZ   . LYS A 1 17 ? 2.837   5.300  2.638   1.00 0.00 ? 17 LYS A NZ   1  
ATOM 183  H H    . LYS A 1 17 ? 2.922   0.165  1.420   1.00 0.00 ? 17 LYS A H    1  
ATOM 184  H HZ1  . LYS A 1 17 ? 2.767   4.596  1.929   1.00 0.00 ? 17 LYS A HZ1  1  
ATOM 185  H HZ2  . LYS A 1 17 ? 2.269   6.083  2.418   1.00 0.00 ? 17 LYS A HZ2  1  
ATOM 186  H HZ3  . LYS A 1 17 ? 3.788   5.594  2.714   1.00 0.00 ? 17 LYS A HZ3  1  
ATOM 187  N N    . ASN A 1 18 ? 0.697   1.386  -0.252  1.00 0.00 ? 18 ASN A N    1  
ATOM 188  C CA   . ASN A 1 18 ? -0.039  1.663  -1.503  1.00 0.00 ? 18 ASN A CA   1  
ATOM 189  C C    . ASN A 1 18 ? -0.934  0.484  -1.941  1.00 0.00 ? 18 ASN A C    1  
ATOM 190  O O    . ASN A 1 18 ? -2.111  0.643  -2.244  1.00 0.00 ? 18 ASN A O    1  
ATOM 191  C CB   . ASN A 1 18 ? 0.951   2.028  -2.626  1.00 0.00 ? 18 ASN A CB   1  
ATOM 192  C CG   . ASN A 1 18 ? 0.279   2.705  -3.831  1.00 0.00 ? 18 ASN A CG   1  
ATOM 193  O OD1  . ASN A 1 18 ? 0.521   3.858  -4.137  1.00 0.00 ? 18 ASN A OD1  1  
ATOM 194  N ND2  . ASN A 1 18 ? -0.578  2.002  -4.532  1.00 0.00 ? 18 ASN A ND2  1  
ATOM 195  H H    . ASN A 1 18 ? 1.707   1.504  -0.309  1.00 0.00 ? 18 ASN A H    1  
ATOM 196  H HD21 . ASN A 1 18 ? -0.881  1.095  -4.261  1.00 0.00 ? 18 ASN A HD21 1  
ATOM 197  H HD22 . ASN A 1 18 ? -0.982  2.478  -5.311  1.00 0.00 ? 18 ASN A HD22 1  
ATOM 198  N N    . TYR A 1 19 ? -0.358  -0.713 -1.932  1.00 0.00 ? 19 TYR A N    1  
ATOM 199  C CA   . TYR A 1 19 ? -1.060  -1.983 -2.225  1.00 0.00 ? 19 TYR A CA   1  
ATOM 200  C C    . TYR A 1 19 ? -2.171  -2.270 -1.177  1.00 0.00 ? 19 TYR A C    1  
ATOM 201  O O    . TYR A 1 19 ? -3.257  -2.705 -1.536  1.00 0.00 ? 19 TYR A O    1  
ATOM 202  C CB   . TYR A 1 19 ? -0.040  -3.133 -2.223  1.00 0.00 ? 19 TYR A CB   1  
ATOM 203  C CG   . TYR A 1 19 ? -0.212  -4.203 -3.303  1.00 0.00 ? 19 TYR A CG   1  
ATOM 204  C CD1  . TYR A 1 19 ? -1.485  -4.466 -3.867  1.00 0.00 ? 19 TYR A CD1  1  
ATOM 205  C CD2  . TYR A 1 19 ? 0.939   -4.930 -3.689  1.00 0.00 ? 19 TYR A CD2  1  
ATOM 206  C CE1  . TYR A 1 19 ? -1.606  -5.478 -4.847  1.00 0.00 ? 19 TYR A CE1  1  
ATOM 207  C CE2  . TYR A 1 19 ? 0.812   -5.944 -4.661  1.00 0.00 ? 19 TYR A CE2  1  
ATOM 208  C CZ   . TYR A 1 19 ? -0.455  -6.201 -5.219  1.00 0.00 ? 19 TYR A CZ   1  
ATOM 209  O OH   . TYR A 1 19 ? -0.584  -7.161 -6.177  1.00 0.00 ? 19 TYR A OH   1  
ATOM 210  H H    . TYR A 1 19 ? 0.592   -0.843 -1.614  1.00 0.00 ? 19 TYR A H    1  
ATOM 211  H HH   . TYR A 1 19 ? -1.545  -7.221 -6.432  1.00 0.00 ? 19 TYR A HH   1  
ATOM 212  N N    . HIS A 1 20 ? -1.902  -1.860 0.059   1.00 0.00 ? 20 HIS A N    1  
ATOM 213  C CA   . HIS A 1 20 ? -2.859  -1.890 1.187   1.00 0.00 ? 20 HIS A CA   1  
ATOM 214  C C    . HIS A 1 20 ? -3.924  -0.765 1.133   1.00 0.00 ? 20 HIS A C    1  
ATOM 215  O O    . HIS A 1 20 ? -5.035  -0.904 1.637   1.00 0.00 ? 20 HIS A O    1  
ATOM 216  C CB   . HIS A 1 20 ? -1.972  -1.863 2.453   1.00 0.00 ? 20 HIS A CB   1  
ATOM 217  C CG   . HIS A 1 20 ? -2.576  -1.324 3.747   1.00 0.00 ? 20 HIS A CG   1  
ATOM 218  N ND1  . HIS A 1 20 ? -3.075  -2.021 4.752   1.00 0.00 ? 20 HIS A ND1  1  
ATOM 219  C CD2  . HIS A 1 20 ? -2.749  -0.029 4.019   1.00 0.00 ? 20 HIS A CD2  1  
ATOM 220  C CE1  . HIS A 1 20 ? -3.588  -1.178 5.634   1.00 0.00 ? 20 HIS A CE1  1  
ATOM 221  N NE2  . HIS A 1 20 ? -3.404  0.034  5.194   1.00 0.00 ? 20 HIS A NE2  1  
ATOM 222  H H    . HIS A 1 20 ? -1.018  -1.466 0.305   1.00 0.00 ? 20 HIS A H    1  
ATOM 223  H HD1  . HIS A 1 20 ? -2.959  -3.018 4.887   1.00 0.00 ? 20 HIS A HD1  1  
ATOM 224  H HE2  . HIS A 1 20 ? -3.781  0.883  5.573   1.00 0.00 ? 20 HIS A HE2  1  
ATOM 225  N N    . LEU A 1 21 ? -3.609  0.320  0.434   1.00 0.00 ? 21 LEU A N    1  
ATOM 226  C CA   . LEU A 1 21 ? -4.456  1.523  0.254   1.00 0.00 ? 21 LEU A CA   1  
ATOM 227  C C    . LEU A 1 21 ? -5.640  1.229  -0.669  1.00 0.00 ? 21 LEU A C    1  
ATOM 228  O O    . LEU A 1 21 ? -6.784  1.526  -0.313  1.00 0.00 ? 21 LEU A O    1  
ATOM 229  C CB   . LEU A 1 21 ? -3.569  2.669  -0.270  1.00 0.00 ? 21 LEU A CB   1  
ATOM 230  C CG   . LEU A 1 21 ? -4.335  3.856  -0.873  1.00 0.00 ? 21 LEU A CG   1  
ATOM 231  C CD1  . LEU A 1 21 ? -5.058  4.695  0.187   1.00 0.00 ? 21 LEU A CD1  1  
ATOM 232  C CD2  . LEU A 1 21 ? -3.385  4.706  -1.724  1.00 0.00 ? 21 LEU A CD2  1  
ATOM 233  H H    . LEU A 1 21 ? -2.673  0.426  0.087   1.00 0.00 ? 21 LEU A H    1  
ATOM 234  N N    . GLU A 1 22 ? -5.361  0.573  -1.796  1.00 0.00 ? 22 GLU A N    1  
ATOM 235  C CA   . GLU A 1 22 ? -6.425  0.088  -2.715  1.00 0.00 ? 22 GLU A CA   1  
ATOM 236  C C    . GLU A 1 22 ? -7.425  -0.834 -1.968  1.00 0.00 ? 22 GLU A C    1  
ATOM 237  O O    . GLU A 1 22 ? -8.633  -0.689 -2.135  1.00 0.00 ? 22 GLU A O    1  
ATOM 238  C CB   . GLU A 1 22 ? -5.817  -0.591 -3.947  1.00 0.00 ? 22 GLU A CB   1  
ATOM 239  C CG   . GLU A 1 22 ? -6.925  -1.022 -4.918  1.00 0.00 ? 22 GLU A CG   1  
ATOM 240  C CD   . GLU A 1 22 ? -6.411  -1.335 -6.322  1.00 0.00 ? 22 GLU A CD   1  
ATOM 241  O OE1  . GLU A 1 22 ? -6.340  -0.489 -7.194  1.00 0.00 ? 22 GLU A OE1  1  
ATOM 242  O OE2  . GLU A 1 22 ? -6.065  -2.616 -6.583  1.00 0.00 ? 22 GLU A OE2  1  
ATOM 243  H H    . GLU A 1 22 ? -4.424  0.461  -2.117  1.00 0.00 ? 22 GLU A H    1  
ATOM 244  H HE2  . GLU A 1 22 ? -5.833  -2.598 -7.553  1.00 0.00 ? 22 GLU A HE2  1  
ATOM 245  N N    . ASN A 1 23 ? -6.897  -1.597 -1.011  1.00 0.00 ? 23 ASN A N    1  
ATOM 246  C CA   . ASN A 1 23 ? -7.730  -2.452 -0.143  1.00 0.00 ? 23 ASN A CA   1  
ATOM 247  C C    . ASN A 1 23 ? -8.774  -1.661 0.658   1.00 0.00 ? 23 ASN A C    1  
ATOM 248  O O    . ASN A 1 23 ? -9.951  -2.019 0.645   1.00 0.00 ? 23 ASN A O    1  
ATOM 249  C CB   . ASN A 1 23 ? -6.842  -3.243 0.830   1.00 0.00 ? 23 ASN A CB   1  
ATOM 250  C CG   . ASN A 1 23 ? -6.839  -4.736 0.498   1.00 0.00 ? 23 ASN A CG   1  
ATOM 251  O OD1  . ASN A 1 23 ? -5.813  -5.395 0.432   1.00 0.00 ? 23 ASN A OD1  1  
ATOM 252  N ND2  . ASN A 1 23 ? -8.013  -5.298 0.279   1.00 0.00 ? 23 ASN A ND2  1  
ATOM 253  H H    . ASN A 1 23 ? -5.922  -1.590 -0.799  1.00 0.00 ? 23 ASN A H    1  
ATOM 254  H HD21 . ASN A 1 23 ? -8.848  -4.744 0.310   1.00 0.00 ? 23 ASN A HD21 1  
ATOM 255  H HD22 . ASN A 1 23 ? -8.009  -6.260 0.073   1.00 0.00 ? 23 ASN A HD22 1  
ATOM 256  N N    . GLU A 1 24 ? -8.338  -0.520 1.181   1.00 0.00 ? 24 GLU A N    1  
ATOM 257  C CA   . GLU A 1 24 ? -9.217  0.413  1.911   1.00 0.00 ? 24 GLU A CA   1  
ATOM 258  C C    . GLU A 1 24 ? -10.285 1.019  0.999   1.00 0.00 ? 24 GLU A C    1  
ATOM 259  O O    . GLU A 1 24 ? -11.459 0.802  1.276   1.00 0.00 ? 24 GLU A O    1  
ATOM 260  C CB   . GLU A 1 24 ? -8.424  1.516  2.607   1.00 0.00 ? 24 GLU A CB   1  
ATOM 261  C CG   . GLU A 1 24 ? -8.756  1.497  4.092   1.00 0.00 ? 24 GLU A CG   1  
ATOM 262  C CD   . GLU A 1 24 ? -8.190  2.732  4.793   1.00 0.00 ? 24 GLU A CD   1  
ATOM 263  O OE1  . GLU A 1 24 ? -6.989  2.924  4.951   1.00 0.00 ? 24 GLU A OE1  1  
ATOM 264  O OE2  . GLU A 1 24 ? -9.098  3.661  5.179   1.00 0.00 ? 24 GLU A OE2  1  
ATOM 265  H H    . GLU A 1 24 ? -7.384  -0.227 1.110   1.00 0.00 ? 24 GLU A H    1  
ATOM 266  H HE2  . GLU A 1 24 ? -8.546  4.365  5.608   1.00 0.00 ? 24 GLU A HE2  1  
ATOM 267  N N    . VAL A 1 25 ? -9.885  1.596  -0.134  1.00 0.00 ? 25 VAL A N    1  
ATOM 268  C CA   . VAL A 1 25 ? -10.794 2.107  -1.188  1.00 0.00 ? 25 VAL A CA   1  
ATOM 269  C C    . VAL A 1 25 ? -11.934 1.105  -1.507  1.00 0.00 ? 25 VAL A C    1  
ATOM 270  O O    . VAL A 1 25 ? -13.090 1.509  -1.529  1.00 0.00 ? 25 VAL A O    1  
ATOM 271  C CB   . VAL A 1 25 ? -10.004 2.500  -2.465  1.00 0.00 ? 25 VAL A CB   1  
ATOM 272  C CG1  . VAL A 1 25 ? -10.911 3.066  -3.565  1.00 0.00 ? 25 VAL A CG1  1  
ATOM 273  C CG2  . VAL A 1 25 ? -8.931  3.551  -2.153  1.00 0.00 ? 25 VAL A CG2  1  
ATOM 274  H H    . VAL A 1 25 ? -8.931  1.864  -0.249  1.00 0.00 ? 25 VAL A H    1  
ATOM 275  N N    . ALA A 1 26 ? -11.595 -0.186 -1.552  1.00 0.00 ? 26 ALA A N    1  
ATOM 276  C CA   . ALA A 1 26 ? -12.573 -1.269 -1.745  1.00 0.00 ? 26 ALA A CA   1  
ATOM 277  C C    . ALA A 1 26 ? -13.540 -1.404 -0.542  1.00 0.00 ? 26 ALA A C    1  
ATOM 278  O O    . ALA A 1 26 ? -14.723 -1.086 -0.693  1.00 0.00 ? 26 ALA A O    1  
ATOM 279  C CB   . ALA A 1 26 ? -11.844 -2.583 -2.026  1.00 0.00 ? 26 ALA A CB   1  
ATOM 280  H H    . ALA A 1 26 ? -10.646 -0.476 -1.416  1.00 0.00 ? 26 ALA A H    1  
ATOM 281  N N    . ARG A 1 27 ? -13.006 -1.697 0.640   1.00 0.00 ? 27 ARG A N    1  
ATOM 282  C CA   . ARG A 1 27 ? -13.803 -1.746 1.885   1.00 0.00 ? 27 ARG A CA   1  
ATOM 283  C C    . ARG A 1 27 ? -14.629 -0.467 2.139   1.00 0.00 ? 27 ARG A C    1  
ATOM 284  O O    . ARG A 1 27 ? -15.823 -0.559 2.350   1.00 0.00 ? 27 ARG A O    1  
ATOM 285  C CB   . ARG A 1 27 ? -12.998 -2.113 3.132   1.00 0.00 ? 27 ARG A CB   1  
ATOM 286  C CG   . ARG A 1 27 ? -12.580 -3.594 3.077   1.00 0.00 ? 27 ARG A CG   1  
ATOM 287  C CD   . ARG A 1 27 ? -12.492 -4.224 4.467   1.00 0.00 ? 27 ARG A CD   1  
ATOM 288  N NE   . ARG A 1 27 ? -13.830 -4.539 5.016   1.00 0.00 ? 27 ARG A NE   1  
ATOM 289  C CZ   . ARG A 1 27 ? -14.465 -5.722 4.918   1.00 0.00 ? 27 ARG A CZ   1  
ATOM 290  N NH1  . ARG A 1 27 ? -14.036 -6.687 4.131   1.00 0.00 ? 27 ARG A NH1  1  
ATOM 291  N NH2  . ARG A 1 27 ? -15.404 -6.033 5.804   1.00 0.00 ? 27 ARG A NH2  1  
ATOM 292  H H    . ARG A 1 27 ? -12.041 -1.956 0.745   1.00 0.00 ? 27 ARG A H    1  
ATOM 293  H HE   . ARG A 1 27 ? -14.335 -3.779 5.406   1.00 0.00 ? 27 ARG A HE   1  
ATOM 294  H HH11 . ARG A 1 27 ? -13.263 -6.516 3.514   1.00 0.00 ? 27 ARG A HH11 1  
ATOM 295  H HH12 . ARG A 1 27 ? -14.512 -7.572 4.101   1.00 0.00 ? 27 ARG A HH12 1  
ATOM 296  H HH21 . ARG A 1 27 ? -15.641 -5.403 6.541   1.00 0.00 ? 27 ARG A HH21 1  
ATOM 297  H HH22 . ARG A 1 27 ? -15.864 -6.916 5.737   1.00 0.00 ? 27 ARG A HH22 1  
ATOM 298  N N    . LEU A 1 28 ? -14.052 0.680  1.813   1.00 0.00 ? 28 LEU A N    1  
ATOM 299  C CA   . LEU A 1 28 ? -14.677 2.019  1.836   1.00 0.00 ? 28 LEU A CA   1  
ATOM 300  C C    . LEU A 1 28 ? -15.868 2.135  0.875   1.00 0.00 ? 28 LEU A C    1  
ATOM 301  O O    . LEU A 1 28 ? -16.981 2.414  1.310   1.00 0.00 ? 28 LEU A O    1  
ATOM 302  C CB   . LEU A 1 28 ? -13.548 3.033  1.541   1.00 0.00 ? 28 LEU A CB   1  
ATOM 303  C CG   . LEU A 1 28 ? -13.992 4.398  0.997   1.00 0.00 ? 28 LEU A CG   1  
ATOM 304  C CD1  . LEU A 1 28 ? -14.664 5.234  2.080   1.00 0.00 ? 28 LEU A CD1  1  
ATOM 305  C CD2  . LEU A 1 28 ? -12.806 5.132  0.401   1.00 0.00 ? 28 LEU A CD2  1  
ATOM 306  H H    . LEU A 1 28 ? -13.086 0.689  1.508   1.00 0.00 ? 28 LEU A H    1  
ATOM 307  N N    . LYS A 1 29 ? -15.626 1.882  -0.414  1.00 0.00 ? 29 LYS A N    1  
ATOM 308  C CA   . LYS A 1 29 ? -16.655 1.975  -1.457  1.00 0.00 ? 29 LYS A CA   1  
ATOM 309  C C    . LYS A 1 29 ? -17.803 0.972  -1.209  1.00 0.00 ? 29 LYS A C    1  
ATOM 310  O O    . LYS A 1 29 ? -18.970 1.318  -1.354  1.00 0.00 ? 29 LYS A O    1  
ATOM 311  C CB   . LYS A 1 29 ? -15.998 1.807  -2.822  1.00 0.00 ? 29 LYS A CB   1  
ATOM 312  C CG   . LYS A 1 29 ? -16.742 2.580  -3.901  1.00 0.00 ? 29 LYS A CG   1  
ATOM 313  C CD   . LYS A 1 29 ? -15.756 3.417  -4.718  1.00 0.00 ? 29 LYS A CD   1  
ATOM 314  C CE   . LYS A 1 29 ? -16.491 4.240  -5.790  1.00 0.00 ? 29 LYS A CE   1  
ATOM 315  N NZ   . LYS A 1 29 ? -15.642 5.358  -6.210  1.00 0.00 ? 29 LYS A NZ   1  
ATOM 316  H H    . LYS A 1 29 ? -14.700 1.663  -0.748  1.00 0.00 ? 29 LYS A H    1  
ATOM 317  H HZ1  . LYS A 1 29 ? -14.779 5.025  -6.571  1.00 0.00 ? 29 LYS A HZ1  1  
ATOM 318  H HZ2  . LYS A 1 29 ? -16.117 5.874  -6.927  1.00 0.00 ? 29 LYS A HZ2  1  
ATOM 319  H HZ3  . LYS A 1 29 ? -15.485 5.979  -5.441  1.00 0.00 ? 29 LYS A HZ3  1  
ATOM 320  N N    . LYS A 1 30 ? -17.456 -0.182 -0.623  1.00 0.00 ? 30 LYS A N    1  
ATOM 321  C CA   . LYS A 1 30 ? -18.457 -1.168 -0.182  1.00 0.00 ? 30 LYS A CA   1  
ATOM 322  C C    . LYS A 1 30 ? -19.187 -0.769 1.123   1.00 0.00 ? 30 LYS A C    1  
ATOM 323  O O    . LYS A 1 30 ? -20.366 -1.038 1.283   1.00 0.00 ? 30 LYS A O    1  
ATOM 324  C CB   . LYS A 1 30 ? -17.856 -2.587 -0.182  1.00 0.00 ? 30 LYS A CB   1  
ATOM 325  C CG   . LYS A 1 30 ? -17.170 -3.102 1.079   1.00 0.00 ? 30 LYS A CG   1  
ATOM 326  C CD   . LYS A 1 30 ? -18.180 -3.661 2.096   1.00 0.00 ? 30 LYS A CD   1  
ATOM 327  C CE   . LYS A 1 30 ? -17.641 -4.875 2.847   1.00 0.00 ? 30 LYS A CE   1  
ATOM 328  N NZ   . LYS A 1 30 ? -17.315 -5.928 1.864   1.00 0.00 ? 30 LYS A NZ   1  
ATOM 329  H H    . LYS A 1 30 ? -16.496 -0.454 -0.501  1.00 0.00 ? 30 LYS A H    1  
ATOM 330  H HZ1  . LYS A 1 30 ? -18.071 -6.037 1.226   1.00 0.00 ? 30 LYS A HZ1  1  
ATOM 331  H HZ2  . LYS A 1 30 ? -16.485 -5.623 1.363   1.00 0.00 ? 30 LYS A HZ2  1  
ATOM 332  H HZ3  . LYS A 1 30 ? -17.120 -6.777 2.332   1.00 0.00 ? 30 LYS A HZ3  1  
ATOM 333  N N    . LEU A 1 31 ? -18.484 -0.047 2.010   1.00 0.00 ? 31 LEU A N    1  
ATOM 334  C CA   . LEU A 1 31 ? -19.062 0.514  3.254   1.00 0.00 ? 31 LEU A CA   1  
ATOM 335  C C    . LEU A 1 31 ? -20.133 1.582  2.981   1.00 0.00 ? 31 LEU A C    1  
ATOM 336  O O    . LEU A 1 31 ? -21.094 1.719  3.729   1.00 0.00 ? 31 LEU A O    1  
ATOM 337  C CB   . LEU A 1 31 ? -17.963 1.092  4.161   1.00 0.00 ? 31 LEU A CB   1  
ATOM 338  C CG   . LEU A 1 31 ? -17.332 0.009  5.050   1.00 0.00 ? 31 LEU A CG   1  
ATOM 339  C CD1  . LEU A 1 31 ? -15.949 0.455  5.516   1.00 0.00 ? 31 LEU A CD1  1  
ATOM 340  C CD2  . LEU A 1 31 ? -18.210 -0.259 6.277   1.00 0.00 ? 31 LEU A CD2  1  
ATOM 341  H H    . LEU A 1 31 ? -17.513 0.138  1.883   1.00 0.00 ? 31 LEU A H    1  
ATOM 342  N N    . VAL A 1 32 ? -20.048 2.173  1.786   1.00 0.00 ? 32 VAL A N    1  
ATOM 343  C CA   . VAL A 1 32 ? -21.059 3.128  1.273   1.00 0.00 ? 32 VAL A CA   1  
ATOM 344  C C    . VAL A 1 32 ? -22.232 2.387  0.568   1.00 0.00 ? 32 VAL A C    1  
ATOM 345  O O    . VAL A 1 32 ? -23.204 3.001  0.147   1.00 0.00 ? 32 VAL A O    1  
ATOM 346  C CB   . VAL A 1 32 ? -20.341 4.195  0.410   1.00 0.00 ? 32 VAL A CB   1  
ATOM 347  C CG1  . VAL A 1 32 ? -21.285 5.286  -0.106  1.00 0.00 ? 32 VAL A CG1  1  
ATOM 348  C CG2  . VAL A 1 32 ? -19.235 4.905  1.197   1.00 0.00 ? 32 VAL A CG2  1  
ATOM 349  H H    . VAL A 1 32 ? -19.263 2.026  1.187   1.00 0.00 ? 32 VAL A H    1  
ATOM 350  N N    . GLY A 1 33 ? -22.207 1.057  0.645   1.00 0.00 ? 33 GLY A N    1  
ATOM 351  C CA   . GLY A 1 33 ? -23.265 0.169  0.115   1.00 0.00 ? 33 GLY A CA   1  
ATOM 352  C C    . GLY A 1 33 ? -24.060 -0.577 1.202   1.00 0.00 ? 33 GLY A C    1  
ATOM 353  O O    . GLY A 1 33 ? -25.122 -1.117 0.917   1.00 0.00 ? 33 GLY A O    1  
ATOM 354  H H    . GLY A 1 33 ? -21.416 0.570  1.015   1.00 0.00 ? 33 GLY A H    1  
ATOM 355  N N    . GLU A 1 34 ? -23.537 -0.556 2.440   1.00 0.00 ? 34 GLU A N    1  
ATOM 356  C CA   . GLU A 1 34 ? -24.110 -1.221 3.627   1.00 0.00 ? 34 GLU A CA   1  
ATOM 357  C C    . GLU A 1 34 ? -23.319 -0.835 4.892   1.00 0.00 ? 34 GLU A C    1  
ATOM 358  O O    . GLU A 1 34 ? -22.334 -1.466 5.267   1.00 0.00 ? 34 GLU A O    1  
ATOM 359  C CB   . GLU A 1 34 ? -24.143 -2.748 3.423   1.00 0.00 ? 34 GLU A CB   1  
ATOM 360  C CG   . GLU A 1 34 ? -24.845 -3.491 4.574   1.00 0.00 ? 34 GLU A CG   1  
ATOM 361  C CD   . GLU A 1 34 ? -25.192 -4.927 4.204   1.00 0.00 ? 34 GLU A CD   1  
ATOM 362  O OE1  . GLU A 1 34 ? -24.372 -5.742 3.778   1.00 0.00 ? 34 GLU A OE1  1  
ATOM 363  O OE2  . GLU A 1 34 ? -26.475 -5.294 4.414   1.00 0.00 ? 34 GLU A OE2  1  
ATOM 364  H H    . GLU A 1 34 ? -22.733 -0.005 2.626   1.00 0.00 ? 34 GLU A H    1  
ATOM 365  H HE2  . GLU A 1 34 ? -26.502 -6.237 4.092   1.00 0.00 ? 34 GLU A HE2  1  
ATOM 366  N N    . ARG A 1 35 ? -23.747 0.273  5.483   1.00 0.00 ? 35 ARG A N    1  
ATOM 367  C CA   . ARG A 1 35 ? -23.181 0.768  6.760   1.00 0.00 ? 35 ARG A CA   1  
ATOM 368  C C    . ARG A 1 35 ? -24.160 0.724  7.944   1.00 0.00 ? 35 ARG A C    1  
ATOM 369  O O    . ARG A 1 35 ? -23.816 0.046  8.936   1.00 0.00 ? 35 ARG A O    1  
ATOM 370  C CB   . ARG A 1 35 ? -22.522 2.153  6.608   1.00 0.00 ? 35 ARG A CB   1  
ATOM 371  C CG   . ARG A 1 35 ? -23.381 3.233  5.948   1.00 0.00 ? 35 ARG A CG   1  
ATOM 372  C CD   . ARG A 1 35 ? -22.537 4.483  5.673   1.00 0.00 ? 35 ARG A CD   1  
ATOM 373  N NE   . ARG A 1 35 ? -22.845 4.921  4.301   1.00 0.00 ? 35 ARG A NE   1  
ATOM 374  C CZ   . ARG A 1 35 ? -22.963 6.175  3.863   1.00 0.00 ? 35 ARG A CZ   1  
ATOM 375  N NH1  . ARG A 1 35 ? -22.347 7.198  4.427   1.00 0.00 ? 35 ARG A NH1  1  
ATOM 376  N NH2  . ARG A 1 35 ? -24.044 6.468  3.152   1.00 0.00 ? 35 ARG A NH2  1  
ATOM 377  O OXT  . ARG A 1 35 ? -25.280 1.266  7.787   1.00 0.00 ? 35 ARG A OXT  1  
ATOM 378  H H    . ARG A 1 35 ? -24.435 0.858  5.063   1.00 0.00 ? 35 ARG A H    1  
ATOM 379  H HE   . ARG A 1 35 ? -22.700 4.215  3.615   1.00 0.00 ? 35 ARG A HE   1  
ATOM 380  H HH11 . ARG A 1 35 ? -21.626 7.034  5.101   1.00 0.00 ? 35 ARG A HH11 1  
ATOM 381  H HH12 . ARG A 1 35 ? -22.514 8.120  4.086   1.00 0.00 ? 35 ARG A HH12 1  
ATOM 382  H HH21 . ARG A 1 35 ? -24.735 5.759  3.013   1.00 0.00 ? 35 ARG A HH21 1  
ATOM 383  H HH22 . ARG A 1 35 ? -24.195 7.390  2.811   1.00 0.00 ? 35 ARG A HH22 1  
ATOM 384  N N    . LEU A 1 1  ? 21.720  7.035  5.880   1.00 0.00 ? 1  LEU A N    2  
ATOM 385  C CA   . LEU A 1 1  ? 21.066  7.431  4.613   1.00 0.00 ? 1  LEU A CA   2  
ATOM 386  C C    . LEU A 1 1  ? 21.900  7.042  3.371   1.00 0.00 ? 1  LEU A C    2  
ATOM 387  O O    . LEU A 1 1  ? 22.942  7.617  3.067   1.00 0.00 ? 1  LEU A O    2  
ATOM 388  C CB   . LEU A 1 1  ? 20.793  8.942  4.651   1.00 0.00 ? 1  LEU A CB   2  
ATOM 389  C CG   . LEU A 1 1  ? 19.586  9.327  3.794   1.00 0.00 ? 1  LEU A CG   2  
ATOM 390  C CD1  . LEU A 1 1  ? 18.274  8.865  4.452   1.00 0.00 ? 1  LEU A CD1  2  
ATOM 391  C CD2  . LEU A 1 1  ? 19.568  10.841 3.567   1.00 0.00 ? 1  LEU A CD2  2  
ATOM 392  H H1   . LEU A 1 1  ? 22.625  7.472  5.926   1.00 0.00 ? 1  LEU A H1   2  
ATOM 393  H H2   . LEU A 1 1  ? 21.166  7.357  6.649   1.00 0.00 ? 1  LEU A H2   2  
ATOM 394  H H3   . LEU A 1 1  ? 21.821  6.040  5.937   1.00 0.00 ? 1  LEU A H3   2  
ATOM 395  N N    . GLN A 1 2  ? 21.435  5.972  2.735   1.00 0.00 ? 2  GLN A N    2  
ATOM 396  C CA   . GLN A 1 2  ? 22.114  5.344  1.577   1.00 0.00 ? 2  GLN A CA   2  
ATOM 397  C C    . GLN A 1 2  ? 21.282  5.462  0.288   1.00 0.00 ? 2  GLN A C    2  
ATOM 398  O O    . GLN A 1 2  ? 20.062  5.514  0.318   1.00 0.00 ? 2  GLN A O    2  
ATOM 399  C CB   . GLN A 1 2  ? 22.408  3.873  1.877   1.00 0.00 ? 2  GLN A CB   2  
ATOM 400  C CG   . GLN A 1 2  ? 23.388  3.650  3.036   1.00 0.00 ? 2  GLN A CG   2  
ATOM 401  C CD   . GLN A 1 2  ? 24.812  4.125  2.720   1.00 0.00 ? 2  GLN A CD   2  
ATOM 402  O OE1  . GLN A 1 2  ? 25.166  5.292  2.815   1.00 0.00 ? 2  GLN A OE1  2  
ATOM 403  N NE2  . GLN A 1 2  ? 25.691  3.216  2.360   1.00 0.00 ? 2  GLN A NE2  2  
ATOM 404  H H    . GLN A 1 2  ? 20.553  5.576  2.992   1.00 0.00 ? 2  GLN A H    2  
ATOM 405  H HE21 . GLN A 1 2  ? 25.458  2.242  2.346   1.00 0.00 ? 2  GLN A HE21 2  
ATOM 406  H HE22 . GLN A 1 2  ? 26.608  3.545  2.170   1.00 0.00 ? 2  GLN A HE22 2  
ATOM 407  N N    . ARG A 1 3  ? 21.973  5.277  -0.832  1.00 0.00 ? 3  ARG A N    2  
ATOM 408  C CA   . ARG A 1 3  ? 21.362  5.360  -2.172  1.00 0.00 ? 3  ARG A CA   2  
ATOM 409  C C    . ARG A 1 3  ? 21.413  3.987  -2.856  1.00 0.00 ? 3  ARG A C    2  
ATOM 410  O O    . ARG A 1 3  ? 22.329  3.209  -2.603  1.00 0.00 ? 3  ARG A O    2  
ATOM 411  C CB   . ARG A 1 3  ? 22.139  6.404  -2.963  1.00 0.00 ? 3  ARG A CB   2  
ATOM 412  C CG   . ARG A 1 3  ? 21.221  7.206  -3.891  1.00 0.00 ? 3  ARG A CG   2  
ATOM 413  C CD   . ARG A 1 3  ? 20.217  8.058  -3.105  1.00 0.00 ? 3  ARG A CD   2  
ATOM 414  N NE   . ARG A 1 3  ? 19.958  9.243  -3.928  1.00 0.00 ? 3  ARG A NE   2  
ATOM 415  C CZ   . ARG A 1 3  ? 19.036  9.346  -4.887  1.00 0.00 ? 3  ARG A CZ   2  
ATOM 416  N NH1  . ARG A 1 3  ? 17.863  8.739  -4.819  1.00 0.00 ? 3  ARG A NH1  2  
ATOM 417  N NH2  . ARG A 1 3  ? 19.164  10.341 -5.765  1.00 0.00 ? 3  ARG A NH2  2  
ATOM 418  H H    . ARG A 1 3  ? 22.950  5.045  -0.821  1.00 0.00 ? 3  ARG A H    2  
ATOM 419  H HE   . ARG A 1 3  ? 20.450  10.068 -3.661  1.00 0.00 ? 3  ARG A HE   2  
ATOM 420  H HH11 . ARG A 1 3  ? 17.639  8.206  -4.004  1.00 0.00 ? 3  ARG A HH11 2  
ATOM 421  H HH12 . ARG A 1 3  ? 17.198  8.854  -5.553  1.00 0.00 ? 3  ARG A HH12 2  
ATOM 422  H HH21 . ARG A 1 3  ? 20.000  10.885 -5.768  1.00 0.00 ? 3  ARG A HH21 2  
ATOM 423  H HH22 . ARG A 1 3  ? 18.479  10.465 -6.476  1.00 0.00 ? 3  ARG A HH22 2  
ATOM 424  N N    . MET A 1 4  ? 20.285  3.640  -3.493  1.00 0.00 ? 4  MET A N    2  
ATOM 425  C CA   . MET A 1 4  ? 20.030  2.311  -4.105  1.00 0.00 ? 4  MET A CA   2  
ATOM 426  C C    . MET A 1 4  ? 19.943  1.121  -3.134  1.00 0.00 ? 4  MET A C    2  
ATOM 427  O O    . MET A 1 4  ? 19.629  0.005  -3.523  1.00 0.00 ? 4  MET A O    2  
ATOM 428  C CB   . MET A 1 4  ? 21.015  1.984  -5.241  1.00 0.00 ? 4  MET A CB   2  
ATOM 429  C CG   . MET A 1 4  ? 20.484  2.288  -6.644  1.00 0.00 ? 4  MET A CG   2  
ATOM 430  S SD   . MET A 1 4  ? 20.591  4.046  -7.182  1.00 0.00 ? 4  MET A SD   2  
ATOM 431  C CE   . MET A 1 4  ? 19.039  4.699  -6.590  1.00 0.00 ? 4  MET A CE   2  
ATOM 432  H H    . MET A 1 4  ? 19.555  4.314  -3.617  1.00 0.00 ? 4  MET A H    2  
ATOM 433  N N    . LYS A 1 5  ? 20.069  1.444  -1.856  1.00 0.00 ? 5  LYS A N    2  
ATOM 434  C CA   . LYS A 1 5  ? 20.021  0.463  -0.747  1.00 0.00 ? 5  LYS A CA   2  
ATOM 435  C C    . LYS A 1 5  ? 18.857  0.780  0.220   1.00 0.00 ? 5  LYS A C    2  
ATOM 436  O O    . LYS A 1 5  ? 17.955  -0.032 0.403   1.00 0.00 ? 5  LYS A O    2  
ATOM 437  C CB   . LYS A 1 5  ? 21.363  0.489  -0.014  1.00 0.00 ? 5  LYS A CB   2  
ATOM 438  C CG   . LYS A 1 5  ? 21.861  -0.911 0.346   1.00 0.00 ? 5  LYS A CG   2  
ATOM 439  C CD   . LYS A 1 5  ? 22.607  -1.574 -0.822  1.00 0.00 ? 5  LYS A CD   2  
ATOM 440  C CE   . LYS A 1 5  ? 23.189  -2.910 -0.380  1.00 0.00 ? 5  LYS A CE   2  
ATOM 441  N NZ   . LYS A 1 5  ? 24.233  -3.346 -1.323  1.00 0.00 ? 5  LYS A NZ   2  
ATOM 442  H H    . LYS A 1 5  ? 20.377  2.356  -1.621  1.00 0.00 ? 5  LYS A H    2  
ATOM 443  H HZ1  . LYS A 1 5  ? 23.852  -3.462 -2.237  1.00 0.00 ? 5  LYS A HZ1  2  
ATOM 444  H HZ2  . LYS A 1 5  ? 24.966  -2.669 -1.326  1.00 0.00 ? 5  LYS A HZ2  2  
ATOM 445  H HZ3  . LYS A 1 5  ? 24.604  -4.224 -1.016  1.00 0.00 ? 5  LYS A HZ3  2  
ATOM 446  N N    . GLN A 1 6  ? 18.789  2.040  0.646   1.00 0.00 ? 6  GLN A N    2  
ATOM 447  C CA   . GLN A 1 6  ? 17.697  2.550  1.498   1.00 0.00 ? 6  GLN A CA   2  
ATOM 448  C C    . GLN A 1 6  ? 16.373  2.697  0.740   1.00 0.00 ? 6  GLN A C    2  
ATOM 449  O O    . GLN A 1 6  ? 15.307  2.384  1.265   1.00 0.00 ? 6  GLN A O    2  
ATOM 450  C CB   . GLN A 1 6  ? 18.104  3.877  2.126   1.00 0.00 ? 6  GLN A CB   2  
ATOM 451  C CG   . GLN A 1 6  ? 18.293  3.747  3.649   1.00 0.00 ? 6  GLN A CG   2  
ATOM 452  C CD   . GLN A 1 6  ? 17.006  4.071  4.401   1.00 0.00 ? 6  GLN A CD   2  
ATOM 453  O OE1  . GLN A 1 6  ? 16.581  5.219  4.482   1.00 0.00 ? 6  GLN A OE1  2  
ATOM 454  N NE2  . GLN A 1 6  ? 16.360  3.093  4.985   1.00 0.00 ? 6  GLN A NE2  2  
ATOM 455  H H    . GLN A 1 6  ? 19.493  2.719  0.438   1.00 0.00 ? 6  GLN A H    2  
ATOM 456  H HE21 . GLN A 1 6  ? 16.689  2.151  4.957   1.00 0.00 ? 6  GLN A HE21 2  
ATOM 457  H HE22 . GLN A 1 6  ? 15.528  3.349  5.477   1.00 0.00 ? 6  GLN A HE22 2  
ATOM 458  N N    . LEU A 1 7  ? 16.469  3.005  -0.556  1.00 0.00 ? 7  LEU A N    2  
ATOM 459  C CA   . LEU A 1 7  ? 15.317  3.046  -1.466  1.00 0.00 ? 7  LEU A CA   2  
ATOM 460  C C    . LEU A 1 7  ? 14.587  1.692  -1.537  1.00 0.00 ? 7  LEU A C    2  
ATOM 461  O O    . LEU A 1 7  ? 13.407  1.653  -1.218  1.00 0.00 ? 7  LEU A O    2  
ATOM 462  C CB   . LEU A 1 7  ? 15.732  3.541  -2.852  1.00 0.00 ? 7  LEU A CB   2  
ATOM 463  C CG   . LEU A 1 7  ? 16.324  4.954  -2.718  1.00 0.00 ? 7  LEU A CG   2  
ATOM 464  C CD1  . LEU A 1 7  ? 17.086  5.328  -3.976  1.00 0.00 ? 7  LEU A CD1  2  
ATOM 465  C CD2  . LEU A 1 7  ? 15.253  6.016  -2.492  1.00 0.00 ? 7  LEU A CD2  2  
ATOM 466  H H    . LEU A 1 7  ? 17.324  3.332  -0.960  1.00 0.00 ? 7  LEU A H    2  
ATOM 467  N N    . GLU A 1 8  ? 15.359  0.607  -1.551  1.00 0.00 ? 8  GLU A N    2  
ATOM 468  C CA   . GLU A 1 8  ? 14.805  -0.767 -1.496  1.00 0.00 ? 8  GLU A CA   2  
ATOM 469  C C    . GLU A 1 8  ? 14.115  -1.104 -0.157  1.00 0.00 ? 8  GLU A C    2  
ATOM 470  O O    . GLU A 1 8  ? 13.094  -1.799 -0.145  1.00 0.00 ? 8  GLU A O    2  
ATOM 471  C CB   . GLU A 1 8  ? 15.896  -1.789 -1.822  1.00 0.00 ? 8  GLU A CB   2  
ATOM 472  C CG   . GLU A 1 8  ? 16.261  -1.705 -3.310  1.00 0.00 ? 8  GLU A CG   2  
ATOM 473  C CD   . GLU A 1 8  ? 17.483  -2.545 -3.692  1.00 0.00 ? 8  GLU A CD   2  
ATOM 474  O OE1  . GLU A 1 8  ? 18.310  -2.953 -2.885  1.00 0.00 ? 8  GLU A OE1  2  
ATOM 475  O OE2  . GLU A 1 8  ? 17.631  -2.783 -5.010  1.00 0.00 ? 8  GLU A OE2  2  
ATOM 476  H H    . GLU A 1 8  ? 16.349  0.662  -1.539  1.00 0.00 ? 8  GLU A H    2  
ATOM 477  H HE2  . GLU A 1 8  ? 18.499  -3.273 -5.049  1.00 0.00 ? 8  GLU A HE2  2  
ATOM 478  N N    . ASP A 1 9  ? 14.506  -0.388 0.892   1.00 0.00 ? 9  ASP A N    2  
ATOM 479  C CA   . ASP A 1 9  ? 13.891  -0.493 2.231   1.00 0.00 ? 9  ASP A CA   2  
ATOM 480  C C    . ASP A 1 9  ? 12.633  0.378  2.374   1.00 0.00 ? 9  ASP A C    2  
ATOM 481  O O    . ASP A 1 9  ? 11.844  0.127  3.278   1.00 0.00 ? 9  ASP A O    2  
ATOM 482  C CB   . ASP A 1 9  ? 14.917  -0.102 3.292   1.00 0.00 ? 9  ASP A CB   2  
ATOM 483  C CG   . ASP A 1 9  ? 15.084  -1.215 4.335   1.00 0.00 ? 9  ASP A CG   2  
ATOM 484  O OD1  . ASP A 1 9  ? 14.324  -1.359 5.282   1.00 0.00 ? 9  ASP A OD1  2  
ATOM 485  O OD2  . ASP A 1 9  ? 16.176  -1.998 4.187   1.00 0.00 ? 9  ASP A OD2  2  
ATOM 486  H H    . ASP A 1 9  ? 15.181  0.335  0.805   1.00 0.00 ? 9  ASP A H    2  
ATOM 487  H HD2  . ASP A 1 9  ? 16.097  -2.650 4.938   1.00 0.00 ? 9  ASP A HD2  2  
ATOM 488  N N    . LYS A 1 10 ? 12.519  1.450  1.582   1.00 0.00 ? 10 LYS A N    2  
ATOM 489  C CA   . LYS A 1 10 ? 11.320  2.320  1.579   1.00 0.00 ? 10 LYS A CA   2  
ATOM 490  C C    . LYS A 1 10 ? 10.293  1.919  0.503   1.00 0.00 ? 10 LYS A C    2  
ATOM 491  O O    . LYS A 1 10 ? 9.085   1.944  0.752   1.00 0.00 ? 10 LYS A O    2  
ATOM 492  C CB   . LYS A 1 10 ? 11.702  3.818  1.542   1.00 0.00 ? 10 LYS A CB   2  
ATOM 493  C CG   . LYS A 1 10 ? 12.163  4.422  0.203   1.00 0.00 ? 10 LYS A CG   2  
ATOM 494  C CD   . LYS A 1 10 ? 10.994  4.856  -0.692  1.00 0.00 ? 10 LYS A CD   2  
ATOM 495  C CE   . LYS A 1 10 ? 10.912  6.368  -0.876  1.00 0.00 ? 10 LYS A CE   2  
ATOM 496  N NZ   . LYS A 1 10 ? 9.683   6.702  -1.611  1.00 0.00 ? 10 LYS A NZ   2  
ATOM 497  H H    . LYS A 1 10 ? 13.281  1.767  1.024   1.00 0.00 ? 10 LYS A H    2  
ATOM 498  H HZ1  . LYS A 1 10 ? 9.632   6.183  -2.466  1.00 0.00 ? 10 LYS A HZ1  2  
ATOM 499  H HZ2  . LYS A 1 10 ? 8.891   6.491  -1.040  1.00 0.00 ? 10 LYS A HZ2  2  
ATOM 500  H HZ3  . LYS A 1 10 ? 9.673   7.679  -1.812  1.00 0.00 ? 10 LYS A HZ3  2  
ATOM 501  N N    . VAL A 1 11 ? 10.785  1.445  -0.642  1.00 0.00 ? 11 VAL A N    2  
ATOM 502  C CA   . VAL A 1 11 ? 9.974   0.933  -1.778  1.00 0.00 ? 11 VAL A CA   2  
ATOM 503  C C    . VAL A 1 11 ? 9.100   -0.257 -1.344  1.00 0.00 ? 11 VAL A C    2  
ATOM 504  O O    . VAL A 1 11 ? 7.923   -0.309 -1.703  1.00 0.00 ? 11 VAL A O    2  
ATOM 505  C CB   . VAL A 1 11 ? 10.876  0.642  -2.989  1.00 0.00 ? 11 VAL A CB   2  
ATOM 506  C CG1  . VAL A 1 11 ? 10.191  -0.152 -4.113  1.00 0.00 ? 11 VAL A CG1  2  
ATOM 507  C CG2  . VAL A 1 11 ? 11.358  1.958  -3.607  1.00 0.00 ? 11 VAL A CG2  2  
ATOM 508  H H    . VAL A 1 11 ? 11.772  1.501  -0.836  1.00 0.00 ? 11 VAL A H    2  
ATOM 509  N N    . GLU A 1 12 ? 9.641   -1.095 -0.470  1.00 0.00 ? 12 GLU A N    2  
ATOM 510  C CA   . GLU A 1 12 ? 8.882   -2.197 0.154   1.00 0.00 ? 12 GLU A CA   2  
ATOM 511  C C    . GLU A 1 12 ? 7.664   -1.707 0.947   1.00 0.00 ? 12 GLU A C    2  
ATOM 512  O O    . GLU A 1 12 ? 6.541   -2.106 0.615   1.00 0.00 ? 12 GLU A O    2  
ATOM 513  C CB   . GLU A 1 12 ? 9.798   -3.051 1.021   1.00 0.00 ? 12 GLU A CB   2  
ATOM 514  C CG   . GLU A 1 12 ? 10.398  -4.174 0.177   1.00 0.00 ? 12 GLU A CG   2  
ATOM 515  C CD   . GLU A 1 12 ? 11.899  -4.353 0.396   1.00 0.00 ? 12 GLU A CD   2  
ATOM 516  O OE1  . GLU A 1 12 ? 12.648  -4.657 -0.523  1.00 0.00 ? 12 GLU A OE1  2  
ATOM 517  O OE2  . GLU A 1 12 ? 12.380  -4.148 1.635   1.00 0.00 ? 12 GLU A OE2  2  
ATOM 518  H H    . GLU A 1 12 ? 10.601  -1.036 -0.210  1.00 0.00 ? 12 GLU A H    2  
ATOM 519  H HE2  . GLU A 1 12 ? 13.369  -4.221 1.504   1.00 0.00 ? 12 GLU A HE2  2  
ATOM 520  N N    . GLU A 1 13 ? 7.852   -0.658 1.748   1.00 0.00 ? 13 GLU A N    2  
ATOM 521  C CA   . GLU A 1 13 ? 6.752   0.022  2.459   1.00 0.00 ? 13 GLU A CA   2  
ATOM 522  C C    . GLU A 1 13 ? 5.704   0.599  1.501   1.00 0.00 ? 13 GLU A C    2  
ATOM 523  O O    . GLU A 1 13 ? 4.519   0.409  1.730   1.00 0.00 ? 13 GLU A O    2  
ATOM 524  C CB   . GLU A 1 13 ? 7.200   1.130  3.416   1.00 0.00 ? 13 GLU A CB   2  
ATOM 525  C CG   . GLU A 1 13 ? 7.735   0.601  4.759   1.00 0.00 ? 13 GLU A CG   2  
ATOM 526  C CD   . GLU A 1 13 ? 9.208   0.204  4.646   1.00 0.00 ? 13 GLU A CD   2  
ATOM 527  O OE1  . GLU A 1 13 ? 9.553   -0.922 4.286   1.00 0.00 ? 13 GLU A OE1  2  
ATOM 528  O OE2  . GLU A 1 13 ? 10.093  1.172  4.913   1.00 0.00 ? 13 GLU A OE2  2  
ATOM 529  H H    . GLU A 1 13 ? 8.767   -0.265 1.903   1.00 0.00 ? 13 GLU A H    2  
ATOM 530  H HE2  . GLU A 1 13 ? 10.959  0.754  4.597   1.00 0.00 ? 13 GLU A HE2  2  
ATOM 531  N N    . LEU A 1 14 ? 6.153   1.077  0.338   1.00 0.00 ? 14 LEU A N    2  
ATOM 532  C CA   . LEU A 1 14 ? 5.247   1.628  -0.698  1.00 0.00 ? 14 LEU A CA   2  
ATOM 533  C C    . LEU A 1 14 ? 4.307   0.543  -1.219  1.00 0.00 ? 14 LEU A C    2  
ATOM 534  O O    . LEU A 1 14 ? 3.106   0.646  -1.019  1.00 0.00 ? 14 LEU A O    2  
ATOM 535  C CB   . LEU A 1 14 ? 5.962   2.261  -1.888  1.00 0.00 ? 14 LEU A CB   2  
ATOM 536  C CG   . LEU A 1 14 ? 7.006   3.333  -1.516  1.00 0.00 ? 14 LEU A CG   2  
ATOM 537  C CD1  . LEU A 1 14 ? 7.561   3.919  -2.815  1.00 0.00 ? 14 LEU A CD1  2  
ATOM 538  C CD2  . LEU A 1 14 ? 6.456   4.438  -0.621  1.00 0.00 ? 14 LEU A CD2  2  
ATOM 539  H H    . LEU A 1 14 ? 7.123   1.042  0.089   1.00 0.00 ? 14 LEU A H    2  
ATOM 540  N N    . LEU A 1 15 ? 4.869   -0.541 -1.754  1.00 0.00 ? 15 LEU A N    2  
ATOM 541  C CA   . LEU A 1 15 ? 4.081   -1.684 -2.275  1.00 0.00 ? 15 LEU A CA   2  
ATOM 542  C C    . LEU A 1 15 ? 3.203   -2.305 -1.186  1.00 0.00 ? 15 LEU A C    2  
ATOM 543  O O    . LEU A 1 15 ? 1.987   -2.291 -1.320  1.00 0.00 ? 15 LEU A O    2  
ATOM 544  C CB   . LEU A 1 15 ? 4.962   -2.762 -2.920  1.00 0.00 ? 15 LEU A CB   2  
ATOM 545  C CG   . LEU A 1 15 ? 6.079   -2.230 -3.831  1.00 0.00 ? 15 LEU A CG   2  
ATOM 546  C CD1  . LEU A 1 15 ? 6.726   -3.419 -4.534  1.00 0.00 ? 15 LEU A CD1  2  
ATOM 547  C CD2  . LEU A 1 15 ? 5.638   -1.188 -4.864  1.00 0.00 ? 15 LEU A CD2  2  
ATOM 548  H H    . LEU A 1 15 ? 5.849   -0.585 -1.941  1.00 0.00 ? 15 LEU A H    2  
ATOM 549  N N    . SER A 1 16 ? 3.801   -2.621 -0.028  1.00 0.00 ? 16 SER A N    2  
ATOM 550  C CA   . SER A 1 16 ? 3.059   -3.104 1.164   1.00 0.00 ? 16 SER A CA   2  
ATOM 551  C C    . SER A 1 16 ? 1.904   -2.200 1.601   1.00 0.00 ? 16 SER A C    2  
ATOM 552  O O    . SER A 1 16 ? 0.877   -2.699 2.049   1.00 0.00 ? 16 SER A O    2  
ATOM 553  C CB   . SER A 1 16 ? 3.979   -3.320 2.366   1.00 0.00 ? 16 SER A CB   2  
ATOM 554  O OG   . SER A 1 16 ? 4.728   -4.533 2.197   1.00 0.00 ? 16 SER A OG   2  
ATOM 555  H H    . SER A 1 16 ? 4.799   -2.620 0.056   1.00 0.00 ? 16 SER A H    2  
ATOM 556  H HG   . SER A 1 16 ? 5.129   -4.799 3.074   1.00 0.00 ? 16 SER A HG   2  
ATOM 557  N N    . LYS A 1 17 ? 2.041   -0.892 1.372   1.00 0.00 ? 17 LYS A N    2  
ATOM 558  C CA   . LYS A 1 17 ? 0.957   0.087  1.601   1.00 0.00 ? 17 LYS A CA   2  
ATOM 559  C C    . LYS A 1 17 ? -0.019  0.184  0.424   1.00 0.00 ? 17 LYS A C    2  
ATOM 560  O O    . LYS A 1 17 ? -1.209  0.133  0.640   1.00 0.00 ? 17 LYS A O    2  
ATOM 561  C CB   . LYS A 1 17 ? 1.450   1.497  1.923   1.00 0.00 ? 17 LYS A CB   2  
ATOM 562  C CG   . LYS A 1 17 ? 2.051   1.597  3.325   1.00 0.00 ? 17 LYS A CG   2  
ATOM 563  C CD   . LYS A 1 17 ? 1.927   3.041  3.824   1.00 0.00 ? 17 LYS A CD   2  
ATOM 564  C CE   . LYS A 1 17 ? 2.826   3.276  5.027   1.00 0.00 ? 17 LYS A CE   2  
ATOM 565  N NZ   . LYS A 1 17 ? 2.054   3.890  6.112   1.00 0.00 ? 17 LYS A NZ   2  
ATOM 566  H H    . LYS A 1 17 ? 2.903   -0.503 1.031   1.00 0.00 ? 17 LYS A H    2  
ATOM 567  H HZ1  . LYS A 1 17 ? 1.535   4.678  5.769   1.00 0.00 ? 17 LYS A HZ1  2  
ATOM 568  H HZ2  . LYS A 1 17 ? 1.433   3.202  6.496   1.00 0.00 ? 17 LYS A HZ2  2  
ATOM 569  H HZ3  . LYS A 1 17 ? 2.683   4.190  6.832   1.00 0.00 ? 17 LYS A HZ3  2  
ATOM 570  N N    . ASN A 1 18 ? 0.485   0.285  -0.803  1.00 0.00 ? 18 ASN A N    2  
ATOM 571  C CA   . ASN A 1 18 ? -0.334  0.359  -2.019  1.00 0.00 ? 18 ASN A CA   2  
ATOM 572  C C    . ASN A 1 18 ? -1.225  -0.882 -2.207  1.00 0.00 ? 18 ASN A C    2  
ATOM 573  O O    . ASN A 1 18 ? -2.431  -0.749 -2.355  1.00 0.00 ? 18 ASN A O    2  
ATOM 574  C CB   . ASN A 1 18 ? 0.526   0.601  -3.264  1.00 0.00 ? 18 ASN A CB   2  
ATOM 575  C CG   . ASN A 1 18 ? -0.216  1.342  -4.392  1.00 0.00 ? 18 ASN A CG   2  
ATOM 576  O OD1  . ASN A 1 18 ? 0.374   1.792  -5.356  1.00 0.00 ? 18 ASN A OD1  2  
ATOM 577  N ND2  . ASN A 1 18 ? -1.524  1.407  -4.348  1.00 0.00 ? 18 ASN A ND2  2  
ATOM 578  H H    . ASN A 1 18 ? 1.481   0.401  -0.949  1.00 0.00 ? 18 ASN A H    2  
ATOM 579  H HD21 . ASN A 1 18 ? -2.053  0.840  -3.717  1.00 0.00 ? 18 ASN A HD21 2  
ATOM 580  H HD22 . ASN A 1 18 ? -1.977  1.919  -5.076  1.00 0.00 ? 18 ASN A HD22 2  
ATOM 581  N N    . TYR A 1 19 ? -0.635  -2.063 -2.010  1.00 0.00 ? 19 TYR A N    2  
ATOM 582  C CA   . TYR A 1 19 ? -1.353  -3.360 -1.988  1.00 0.00 ? 19 TYR A CA   2  
ATOM 583  C C    . TYR A 1 19 ? -2.458  -3.409 -0.909  1.00 0.00 ? 19 TYR A C    2  
ATOM 584  O O    . TYR A 1 19 ? -3.590  -3.782 -1.194  1.00 0.00 ? 19 TYR A O    2  
ATOM 585  C CB   . TYR A 1 19 ? -0.347  -4.500 -1.799  1.00 0.00 ? 19 TYR A CB   2  
ATOM 586  C CG   . TYR A 1 19 ? 0.360   -4.909 -3.100  1.00 0.00 ? 19 TYR A CG   2  
ATOM 587  C CD1  . TYR A 1 19 ? 1.373   -4.103 -3.665  1.00 0.00 ? 19 TYR A CD1  2  
ATOM 588  C CD2  . TYR A 1 19 ? 0.006   -6.154 -3.671  1.00 0.00 ? 19 TYR A CD2  2  
ATOM 589  C CE1  . TYR A 1 19 ? 2.047   -4.548 -4.811  1.00 0.00 ? 19 TYR A CE1  2  
ATOM 590  C CE2  . TYR A 1 19 ? 0.676   -6.597 -4.825  1.00 0.00 ? 19 TYR A CE2  2  
ATOM 591  C CZ   . TYR A 1 19 ? 1.685   -5.789 -5.377  1.00 0.00 ? 19 TYR A CZ   2  
ATOM 592  O OH   . TYR A 1 19 ? 2.338   -6.213 -6.493  1.00 0.00 ? 19 TYR A OH   2  
ATOM 593  H H    . TYR A 1 19 ? 0.358   -2.130 -1.863  1.00 0.00 ? 19 TYR A H    2  
ATOM 594  H HH   . TYR A 1 19 ? 1.956   -7.095 -6.787  1.00 0.00 ? 19 TYR A HH   2  
ATOM 595  N N    . HIS A 1 20 ? -2.160  -2.808 0.243   1.00 0.00 ? 20 HIS A N    2  
ATOM 596  C CA   . HIS A 1 20 ? -3.096  -2.609 1.372   1.00 0.00 ? 20 HIS A CA   2  
ATOM 597  C C    . HIS A 1 20 ? -4.157  -1.515 1.092   1.00 0.00 ? 20 HIS A C    2  
ATOM 598  O O    . HIS A 1 20 ? -5.316  -1.635 1.468   1.00 0.00 ? 20 HIS A O    2  
ATOM 599  C CB   . HIS A 1 20 ? -2.203  -2.347 2.586   1.00 0.00 ? 20 HIS A CB   2  
ATOM 600  C CG   . HIS A 1 20 ? -2.773  -1.457 3.692   1.00 0.00 ? 20 HIS A CG   2  
ATOM 601  N ND1  . HIS A 1 20 ? -3.441  -1.849 4.770   1.00 0.00 ? 20 HIS A ND1  2  
ATOM 602  C CD2  . HIS A 1 20 ? -2.715  -0.130 3.705   1.00 0.00 ? 20 HIS A CD2  2  
ATOM 603  C CE1  . HIS A 1 20 ? -3.834  -0.769 5.429   1.00 0.00 ? 20 HIS A CE1  2  
ATOM 604  N NE2  . HIS A 1 20 ? -3.395  0.289  4.764   1.00 0.00 ? 20 HIS A NE2  2  
ATOM 605  H H    . HIS A 1 20 ? -1.246  -2.427 0.406   1.00 0.00 ? 20 HIS A H    2  
ATOM 606  H HD1  . HIS A 1 20 ? -3.561  -2.796 5.068   1.00 0.00 ? 20 HIS A HD1  2  
ATOM 607  H HE2  . HIS A 1 20 ? -3.704  1.225  4.907   1.00 0.00 ? 20 HIS A HE2  2  
ATOM 608  N N    . LEU A 1 21 ? -3.756  -0.521 0.298   1.00 0.00 ? 21 LEU A N    2  
ATOM 609  C CA   . LEU A 1 21 ? -4.585  0.617  -0.153  1.00 0.00 ? 21 LEU A CA   2  
ATOM 610  C C    . LEU A 1 21 ? -5.680  0.155  -1.109  1.00 0.00 ? 21 LEU A C    2  
ATOM 611  O O    . LEU A 1 21 ? -6.844  0.415  -0.833  1.00 0.00 ? 21 LEU A O    2  
ATOM 612  C CB   . LEU A 1 21 ? -3.669  1.682  -0.786  1.00 0.00 ? 21 LEU A CB   2  
ATOM 613  C CG   . LEU A 1 21 ? -4.414  2.822  -1.487  1.00 0.00 ? 21 LEU A CG   2  
ATOM 614  C CD1  . LEU A 1 21 ? -5.053  3.800  -0.494  1.00 0.00 ? 21 LEU A CD1  2  
ATOM 615  C CD2  . LEU A 1 21 ? -3.466  3.557  -2.436  1.00 0.00 ? 21 LEU A CD2  2  
ATOM 616  H H    . LEU A 1 21 ? -2.792  -0.451 0.039   1.00 0.00 ? 21 LEU A H    2  
ATOM 617  N N    . GLU A 1 22 ? -5.330  -0.694 -2.069  1.00 0.00 ? 22 GLU A N    2  
ATOM 618  C CA   . GLU A 1 22 ? -6.316  -1.340 -2.974  1.00 0.00 ? 22 GLU A CA   2  
ATOM 619  C C    . GLU A 1 22 ? -7.401  -2.152 -2.237  1.00 0.00 ? 22 GLU A C    2  
ATOM 620  O O    . GLU A 1 22 ? -8.504  -2.315 -2.736  1.00 0.00 ? 22 GLU A O    2  
ATOM 621  C CB   . GLU A 1 22 ? -5.610  -2.193 -4.019  1.00 0.00 ? 22 GLU A CB   2  
ATOM 622  C CG   . GLU A 1 22 ? -5.396  -1.382 -5.299  1.00 0.00 ? 22 GLU A CG   2  
ATOM 623  C CD   . GLU A 1 22 ? -3.964  -1.511 -5.818  1.00 0.00 ? 22 GLU A CD   2  
ATOM 624  O OE1  . GLU A 1 22 ? -3.658  -2.108 -6.840  1.00 0.00 ? 22 GLU A OE1  2  
ATOM 625  O OE2  . GLU A 1 22 ? -3.035  -0.883 -5.087  1.00 0.00 ? 22 GLU A OE2  2  
ATOM 626  H H    . GLU A 1 22 ? -4.369  -0.921 -2.246  1.00 0.00 ? 22 GLU A H    2  
ATOM 627  H HE2  . GLU A 1 22 ? -2.180  -1.026 -5.591  1.00 0.00 ? 22 GLU A HE2  2  
ATOM 628  N N    . ASN A 1 23 ? -7.055  -2.598 -1.029  1.00 0.00 ? 23 ASN A N    2  
ATOM 629  C CA   . ASN A 1 23 ? -8.009  -3.272 -0.116  1.00 0.00 ? 23 ASN A CA   2  
ATOM 630  C C    . ASN A 1 23 ? -8.838  -2.288 0.719   1.00 0.00 ? 23 ASN A C    2  
ATOM 631  O O    . ASN A 1 23 ? -10.064 -2.329 0.653   1.00 0.00 ? 23 ASN A O    2  
ATOM 632  C CB   . ASN A 1 23 ? -7.258  -4.256 0.793   1.00 0.00 ? 23 ASN A CB   2  
ATOM 633  C CG   . ASN A 1 23 ? -6.894  -5.579 0.096   1.00 0.00 ? 23 ASN A CG   2  
ATOM 634  O OD1  . ASN A 1 23 ? -6.768  -6.615 0.720   1.00 0.00 ? 23 ASN A OD1  2  
ATOM 635  N ND2  . ASN A 1 23 ? -6.780  -5.585 -1.214  1.00 0.00 ? 23 ASN A ND2  2  
ATOM 636  H H    . ASN A 1 23 ? -6.149  -2.438 -0.652  1.00 0.00 ? 23 ASN A H    2  
ATOM 637  H HD21 . ASN A 1 23 ? -6.965  -4.770 -1.761  1.00 0.00 ? 23 ASN A HD21 2  
ATOM 638  H HD22 . ASN A 1 23 ? -6.540  -6.460 -1.629  1.00 0.00 ? 23 ASN A HD22 2  
ATOM 639  N N    . GLU A 1 24 ? -8.175  -1.323 1.362   1.00 0.00 ? 24 GLU A N    2  
ATOM 640  C CA   . GLU A 1 24 ? -8.881  -0.277 2.142   1.00 0.00 ? 24 GLU A CA   2  
ATOM 641  C C    . GLU A 1 24 ? -9.844  0.546  1.266   1.00 0.00 ? 24 GLU A C    2  
ATOM 642  O O    . GLU A 1 24 ? -11.012 0.635  1.607   1.00 0.00 ? 24 GLU A O    2  
ATOM 643  C CB   . GLU A 1 24 ? -7.940  0.623  2.964   1.00 0.00 ? 24 GLU A CB   2  
ATOM 644  C CG   . GLU A 1 24 ? -7.189  1.672  2.129   1.00 0.00 ? 24 GLU A CG   2  
ATOM 645  C CD   . GLU A 1 24 ? -6.365  2.669  2.935   1.00 0.00 ? 24 GLU A CD   2  
ATOM 646  O OE1  . GLU A 1 24 ? -6.465  3.884  2.771   1.00 0.00 ? 24 GLU A OE1  2  
ATOM 647  O OE2  . GLU A 1 24 ? -5.455  2.181  3.791   1.00 0.00 ? 24 GLU A OE2  2  
ATOM 648  H H    . GLU A 1 24 ? -7.169  -1.314 1.433   1.00 0.00 ? 24 GLU A H    2  
ATOM 649  H HE2  . GLU A 1 24 ? -5.049  3.012  4.161   1.00 0.00 ? 24 GLU A HE2  2  
ATOM 650  N N    . VAL A 1 25 ? -9.390  0.943  0.074   1.00 0.00 ? 25 VAL A N    2  
ATOM 651  C CA   . VAL A 1 25 ? -10.171 1.644  -0.965  1.00 0.00 ? 25 VAL A CA   2  
ATOM 652  C C    . VAL A 1 25 ? -11.493 0.918  -1.254  1.00 0.00 ? 25 VAL A C    2  
ATOM 653  O O    . VAL A 1 25 ? -12.507 1.604  -1.348  1.00 0.00 ? 25 VAL A O    2  
ATOM 654  C CB   . VAL A 1 25 ? -9.335  1.922  -2.233  1.00 0.00 ? 25 VAL A CB   2  
ATOM 655  C CG1  . VAL A 1 25 ? -10.148 2.411  -3.439  1.00 0.00 ? 25 VAL A CG1  2  
ATOM 656  C CG2  . VAL A 1 25 ? -8.321  3.025  -1.930  1.00 0.00 ? 25 VAL A CG2  2  
ATOM 657  H H    . VAL A 1 25 ? -8.409  0.867  -0.147  1.00 0.00 ? 25 VAL A H    2  
ATOM 658  N N    . ALA A 1 26 ? -11.508 -0.412 -1.197  1.00 0.00 ? 26 ALA A N    2  
ATOM 659  C CA   . ALA A 1 26 ? -12.750 -1.186 -1.366  1.00 0.00 ? 26 ALA A CA   2  
ATOM 660  C C    . ALA A 1 26 ? -13.747 -0.933 -0.213  1.00 0.00 ? 26 ALA A C    2  
ATOM 661  O O    . ALA A 1 26 ? -14.744 -0.238 -0.428  1.00 0.00 ? 26 ALA A O    2  
ATOM 662  C CB   . ALA A 1 26 ? -12.405 -2.673 -1.513  1.00 0.00 ? 26 ALA A CB   2  
ATOM 663  H H    . ALA A 1 26 ? -10.695 -0.932 -0.963  1.00 0.00 ? 26 ALA A H    2  
ATOM 664  N N    . ARG A 1 27 ? -13.358 -1.290 1.013   1.00 0.00 ? 27 ARG A N    2  
ATOM 665  C CA   . ARG A 1 27 ? -14.149 -1.001 2.238   1.00 0.00 ? 27 ARG A CA   2  
ATOM 666  C C    . ARG A 1 27 ? -14.465 0.489  2.465   1.00 0.00 ? 27 ARG A C    2  
ATOM 667  O O    . ARG A 1 27 ? -15.479 0.836  3.064   1.00 0.00 ? 27 ARG A O    2  
ATOM 668  C CB   . ARG A 1 27 ? -13.472 -1.601 3.477   1.00 0.00 ? 27 ARG A CB   2  
ATOM 669  C CG   . ARG A 1 27 ? -13.659 -3.121 3.491   1.00 0.00 ? 27 ARG A CG   2  
ATOM 670  C CD   . ARG A 1 27 ? -12.356 -3.847 3.823   1.00 0.00 ? 27 ARG A CD   2  
ATOM 671  N NE   . ARG A 1 27 ? -12.346 -4.295 5.231   1.00 0.00 ? 27 ARG A NE   2  
ATOM 672  C CZ   . ARG A 1 27 ? -12.152 -5.549 5.649   1.00 0.00 ? 27 ARG A CZ   2  
ATOM 673  N NH1  . ARG A 1 27 ? -11.822 -6.531 4.820   1.00 0.00 ? 27 ARG A NH1  2  
ATOM 674  N NH2  . ARG A 1 27 ? -12.449 -5.885 6.897   1.00 0.00 ? 27 ARG A NH2  2  
ATOM 675  H H    . ARG A 1 27 ? -12.524 -1.816 1.166   1.00 0.00 ? 27 ARG A H    2  
ATOM 676  H HE   . ARG A 1 27 ? -12.384 -3.574 5.915   1.00 0.00 ? 27 ARG A HE   2  
ATOM 677  H HH11 . ARG A 1 27 ? -11.660 -6.319 3.855   1.00 0.00 ? 27 ARG A HH11 2  
ATOM 678  H HH12 . ARG A 1 27 ? -11.701 -7.460 5.155   1.00 0.00 ? 27 ARG A HH12 2  
ATOM 679  H HH21 . ARG A 1 27 ? -12.836 -5.214 7.519   1.00 0.00 ? 27 ARG A HH21 2  
ATOM 680  H HH22 . ARG A 1 27 ? -12.302 -6.826 7.204   1.00 0.00 ? 27 ARG A HH22 2  
ATOM 681  N N    . LEU A 1 28 ? -13.598 1.359  1.945   1.00 0.00 ? 28 LEU A N    2  
ATOM 682  C CA   . LEU A 1 28 ? -13.768 2.821  1.882   1.00 0.00 ? 28 LEU A CA   2  
ATOM 683  C C    . LEU A 1 28 ? -14.807 3.262  0.843   1.00 0.00 ? 28 LEU A C    2  
ATOM 684  O O    . LEU A 1 28 ? -15.770 3.945  1.186   1.00 0.00 ? 28 LEU A O    2  
ATOM 685  C CB   . LEU A 1 28 ? -12.376 3.434  1.649   1.00 0.00 ? 28 LEU A CB   2  
ATOM 686  C CG   . LEU A 1 28 ? -12.358 4.826  0.995   1.00 0.00 ? 28 LEU A CG   2  
ATOM 687  C CD1  . LEU A 1 28 ? -12.866 5.906  1.955   1.00 0.00 ? 28 LEU A CD1  2  
ATOM 688  C CD2  . LEU A 1 28 ? -10.953 5.173  0.510   1.00 0.00 ? 28 LEU A CD2  2  
ATOM 689  H H    . LEU A 1 28 ? -12.702 1.027  1.629   1.00 0.00 ? 28 LEU A H    2  
ATOM 690  N N    . LYS A 1 29 ? -14.629 2.880  -0.419  1.00 0.00 ? 29 LYS A N    2  
ATOM 691  C CA   . LYS A 1 29 ? -15.532 3.241  -1.527  1.00 0.00 ? 29 LYS A CA   2  
ATOM 692  C C    . LYS A 1 29 ? -16.964 2.706  -1.295  1.00 0.00 ? 29 LYS A C    2  
ATOM 693  O O    . LYS A 1 29 ? -17.941 3.363  -1.649  1.00 0.00 ? 29 LYS A O    2  
ATOM 694  C CB   . LYS A 1 29 ? -14.918 2.722  -2.828  1.00 0.00 ? 29 LYS A CB   2  
ATOM 695  C CG   . LYS A 1 29 ? -15.368 3.528  -4.034  1.00 0.00 ? 29 LYS A CG   2  
ATOM 696  C CD   . LYS A 1 29 ? -14.175 3.782  -4.953  1.00 0.00 ? 29 LYS A CD   2  
ATOM 697  C CE   . LYS A 1 29 ? -14.618 4.542  -6.212  1.00 0.00 ? 29 LYS A CE   2  
ATOM 698  N NZ   . LYS A 1 29 ? -13.749 5.702  -6.433  1.00 0.00 ? 29 LYS A NZ   2  
ATOM 699  H H    . LYS A 1 29 ? -13.809 2.360  -0.709  1.00 0.00 ? 29 LYS A H    2  
ATOM 700  H HZ1  . LYS A 1 29 ? -12.794 5.396  -6.539  1.00 0.00 ? 29 LYS A HZ1  2  
ATOM 701  H HZ2  . LYS A 1 29 ? -14.037 6.167  -7.270  1.00 0.00 ? 29 LYS A HZ2  2  
ATOM 702  H HZ3  . LYS A 1 29 ? -13.825 6.337  -5.664  1.00 0.00 ? 29 LYS A HZ3  2  
ATOM 703  N N    . LYS A 1 30 ? -17.026 1.635  -0.497  1.00 0.00 ? 30 LYS A N    2  
ATOM 704  C CA   . LYS A 1 30 ? -18.255 1.087  0.116   1.00 0.00 ? 30 LYS A CA   2  
ATOM 705  C C    . LYS A 1 30 ? -19.087 2.145  0.871   1.00 0.00 ? 30 LYS A C    2  
ATOM 706  O O    . LYS A 1 30 ? -20.313 2.136  0.839   1.00 0.00 ? 30 LYS A O    2  
ATOM 707  C CB   . LYS A 1 30 ? -17.768 -0.052 1.015   1.00 0.00 ? 30 LYS A CB   2  
ATOM 708  C CG   . LYS A 1 30 ? -18.679 -0.355 2.208   1.00 0.00 ? 30 LYS A CG   2  
ATOM 709  C CD   . LYS A 1 30 ? -18.058 -1.234 3.295   1.00 0.00 ? 30 LYS A CD   2  
ATOM 710  C CE   . LYS A 1 30 ? -19.043 -1.383 4.456   1.00 0.00 ? 30 LYS A CE   2  
ATOM 711  N NZ   . LYS A 1 30 ? -19.413 -0.061 5.005   1.00 0.00 ? 30 LYS A NZ   2  
ATOM 712  H H    . LYS A 1 30 ? -16.200 1.131  -0.253  1.00 0.00 ? 30 LYS A H    2  
ATOM 713  H HZ1  . LYS A 1 30 ? -19.811 0.490  4.273   1.00 0.00 ? 30 LYS A HZ1  2  
ATOM 714  H HZ2  . LYS A 1 30 ? -20.082 -0.175 5.731   1.00 0.00 ? 30 LYS A HZ2  2  
ATOM 715  H HZ3  . LYS A 1 30 ? -18.600 0.397  5.370   1.00 0.00 ? 30 LYS A HZ3  2  
ATOM 716  N N    . LEU A 1 31 ? -18.425 3.086  1.530   1.00 0.00 ? 31 LEU A N    2  
ATOM 717  C CA   . LEU A 1 31 ? -19.067 4.204  2.255   1.00 0.00 ? 31 LEU A CA   2  
ATOM 718  C C    . LEU A 1 31 ? -20.022 4.990  1.340   1.00 0.00 ? 31 LEU A C    2  
ATOM 719  O O    . LEU A 1 31 ? -21.207 5.079  1.654   1.00 0.00 ? 31 LEU A O    2  
ATOM 720  C CB   . LEU A 1 31 ? -17.987 5.133  2.831   1.00 0.00 ? 31 LEU A CB   2  
ATOM 721  C CG   . LEU A 1 31 ? -17.333 4.689  4.153   1.00 0.00 ? 31 LEU A CG   2  
ATOM 722  C CD1  . LEU A 1 31 ? -17.002 3.196  4.289   1.00 0.00 ? 31 LEU A CD1  2  
ATOM 723  C CD2  . LEU A 1 31 ? -16.022 5.461  4.310   1.00 0.00 ? 31 LEU A CD2  2  
ATOM 724  H H    . LEU A 1 31 ? -17.411 3.105  1.566   1.00 0.00 ? 31 LEU A H    2  
ATOM 725  N N    . VAL A 1 32 ? -19.585 5.194  0.109   1.00 0.00 ? 32 VAL A N    2  
ATOM 726  C CA   . VAL A 1 32 ? -20.377 5.868  -0.946  1.00 0.00 ? 32 VAL A CA   2  
ATOM 727  C C    . VAL A 1 32 ? -21.117 4.832  -1.852  1.00 0.00 ? 32 VAL A C    2  
ATOM 728  O O    . VAL A 1 32 ? -21.644 5.162  -2.913  1.00 0.00 ? 32 VAL A O    2  
ATOM 729  C CB   . VAL A 1 32 ? -19.509 6.833  -1.795  1.00 0.00 ? 32 VAL A CB   2  
ATOM 730  C CG1  . VAL A 1 32 ? -20.388 7.895  -2.465  1.00 0.00 ? 32 VAL A CG1  2  
ATOM 731  C CG2  . VAL A 1 32 ? -18.401 7.557  -1.019  1.00 0.00 ? 32 VAL A CG2  2  
ATOM 732  H H    . VAL A 1 32 ? -18.684 4.881  -0.193  1.00 0.00 ? 32 VAL A H    2  
ATOM 733  N N    . GLY A 1 33 ? -21.218 3.604  -1.350  1.00 0.00 ? 33 GLY A N    2  
ATOM 734  C CA   . GLY A 1 33 ? -21.924 2.469  -1.990  1.00 0.00 ? 33 GLY A CA   2  
ATOM 735  C C    . GLY A 1 33 ? -23.145 1.987  -1.197  1.00 0.00 ? 33 GLY A C    2  
ATOM 736  O O    . GLY A 1 33 ? -24.075 1.419  -1.758  1.00 0.00 ? 33 GLY A O    2  
ATOM 737  H H    . GLY A 1 33 ? -20.747 3.359  -0.500  1.00 0.00 ? 33 GLY A H    2  
ATOM 738  N N    . GLU A 1 34 ? -23.100 2.169  0.124   1.00 0.00 ? 34 GLU A N    2  
ATOM 739  C CA   . GLU A 1 34 ? -24.188 1.814  1.063   1.00 0.00 ? 34 GLU A CA   2  
ATOM 740  C C    . GLU A 1 34 ? -24.337 2.808  2.223   1.00 0.00 ? 34 GLU A C    2  
ATOM 741  O O    . GLU A 1 34 ? -24.243 2.484  3.409   1.00 0.00 ? 34 GLU A O    2  
ATOM 742  C CB   . GLU A 1 34 ? -24.051 0.349  1.536   1.00 0.00 ? 34 GLU A CB   2  
ATOM 743  C CG   . GLU A 1 34 ? -22.691 0.009  2.157   1.00 0.00 ? 34 GLU A CG   2  
ATOM 744  C CD   . GLU A 1 34 ? -21.981 -1.048 1.313   1.00 0.00 ? 34 GLU A CD   2  
ATOM 745  O OE1  . GLU A 1 34 ? -22.188 -2.247 1.449   1.00 0.00 ? 34 GLU A OE1  2  
ATOM 746  O OE2  . GLU A 1 34 ? -21.133 -0.610 0.357   1.00 0.00 ? 34 GLU A OE2  2  
ATOM 747  H H    . GLU A 1 34 ? -22.256 2.483  0.567   1.00 0.00 ? 34 GLU A H    2  
ATOM 748  H HE2  . GLU A 1 34 ? -20.729 -1.451 0.010   1.00 0.00 ? 34 GLU A HE2  2  
ATOM 749  N N    . ARG A 1 35 ? -24.608 4.044  1.839   1.00 0.00 ? 35 ARG A N    2  
ATOM 750  C CA   . ARG A 1 35 ? -24.790 5.168  2.789   1.00 0.00 ? 35 ARG A CA   2  
ATOM 751  C C    . ARG A 1 35 ? -26.012 4.986  3.710   1.00 0.00 ? 35 ARG A C    2  
ATOM 752  O O    . ARG A 1 35 ? -26.992 4.348  3.244   1.00 0.00 ? 35 ARG A O    2  
ATOM 753  C CB   . ARG A 1 35 ? -24.928 6.489  2.029   1.00 0.00 ? 35 ARG A CB   2  
ATOM 754  C CG   . ARG A 1 35 ? -23.831 6.722  0.977   1.00 0.00 ? 35 ARG A CG   2  
ATOM 755  C CD   . ARG A 1 35 ? -23.323 8.165  0.919   1.00 0.00 ? 35 ARG A CD   2  
ATOM 756  N NE   . ARG A 1 35 ? -24.386 9.126  0.598   1.00 0.00 ? 35 ARG A NE   2  
ATOM 757  C CZ   . ARG A 1 35 ? -24.903 9.977  1.479   1.00 0.00 ? 35 ARG A CZ   2  
ATOM 758  N NH1  . ARG A 1 35 ? -25.916 9.624  2.255   1.00 0.00 ? 35 ARG A NH1  2  
ATOM 759  N NH2  . ARG A 1 35 ? -24.451 11.218 1.548   1.00 0.00 ? 35 ARG A NH2  2  
ATOM 760  O OXT  . ARG A 1 35 ? -25.988 5.551  4.825   1.00 0.00 ? 35 ARG A OXT  2  
ATOM 761  H H    . ARG A 1 35 ? -24.637 4.289  0.874   1.00 0.00 ? 35 ARG A H    2  
ATOM 762  H HE   . ARG A 1 35 ? -24.745 9.113  -0.340  1.00 0.00 ? 35 ARG A HE   2  
ATOM 763  H HH11 . ARG A 1 35 ? -26.287 8.703  2.187   1.00 0.00 ? 35 ARG A HH11 2  
ATOM 764  H HH12 . ARG A 1 35 ? -26.296 10.267 2.910   1.00 0.00 ? 35 ARG A HH12 2  
ATOM 765  H HH21 . ARG A 1 35 ? -23.684 11.487 0.973   1.00 0.00 ? 35 ARG A HH21 2  
ATOM 766  H HH22 . ARG A 1 35 ? -24.839 11.853 2.217   1.00 0.00 ? 35 ARG A HH22 2  
ATOM 767  N N    . LEU A 1 1  ? 24.137  3.213  -6.824  1.00 0.00 ? 1  LEU A N    3  
ATOM 768  C CA   . LEU A 1 1  ? 25.196  3.724  -5.921  1.00 0.00 ? 1  LEU A CA   3  
ATOM 769  C C    . LEU A 1 1  ? 25.362  2.965  -4.575  1.00 0.00 ? 1  LEU A C    3  
ATOM 770  O O    . LEU A 1 1  ? 25.755  3.515  -3.550  1.00 0.00 ? 1  LEU A O    3  
ATOM 771  C CB   . LEU A 1 1  ? 25.009  5.241  -5.718  1.00 0.00 ? 1  LEU A CB   3  
ATOM 772  C CG   . LEU A 1 1  ? 23.771  5.607  -4.882  1.00 0.00 ? 1  LEU A CG   3  
ATOM 773  C CD1  . LEU A 1 1  ? 24.205  6.524  -3.733  1.00 0.00 ? 1  LEU A CD1  3  
ATOM 774  C CD2  . LEU A 1 1  ? 22.688  6.291  -5.711  1.00 0.00 ? 1  LEU A CD2  3  
ATOM 775  H H1   . LEU A 1 1  ? 23.242  3.240  -6.369  1.00 0.00 ? 1  LEU A H1   3  
ATOM 776  H H2   . LEU A 1 1  ? 24.094  3.796  -7.633  1.00 0.00 ? 1  LEU A H2   3  
ATOM 777  H H3   . LEU A 1 1  ? 24.353  2.285  -7.142  1.00 0.00 ? 1  LEU A H3   3  
ATOM 778  N N    . GLN A 1 2  ? 25.116  1.655  -4.658  1.00 0.00 ? 2  GLN A N    3  
ATOM 779  C CA   . GLN A 1 2  ? 25.100  0.726  -3.506  1.00 0.00 ? 2  GLN A CA   3  
ATOM 780  C C    . GLN A 1 2  ? 24.121  1.135  -2.397  1.00 0.00 ? 2  GLN A C    3  
ATOM 781  O O    . GLN A 1 2  ? 24.422  1.182  -1.204  1.00 0.00 ? 2  GLN A O    3  
ATOM 782  C CB   . GLN A 1 2  ? 26.502  0.554  -2.918  1.00 0.00 ? 2  GLN A CB   3  
ATOM 783  C CG   . GLN A 1 2  ? 27.336  -0.553 -3.562  1.00 0.00 ? 2  GLN A CG   3  
ATOM 784  C CD   . GLN A 1 2  ? 28.659  -0.779 -2.808  1.00 0.00 ? 2  GLN A CD   3  
ATOM 785  O OE1  . GLN A 1 2  ? 29.648  -1.243 -3.363  1.00 0.00 ? 2  GLN A OE1  3  
ATOM 786  N NE2  . GLN A 1 2  ? 28.704  -0.481 -1.534  1.00 0.00 ? 2  GLN A NE2  3  
ATOM 787  H H    . GLN A 1 2  ? 24.997  1.230  -5.552  1.00 0.00 ? 2  GLN A H    3  
ATOM 788  H HE21 . GLN A 1 2  ? 27.929  -0.040 -1.081  1.00 0.00 ? 2  GLN A HE21 3  
ATOM 789  H HE22 . GLN A 1 2  ? 29.563  -0.639 -1.055  1.00 0.00 ? 2  GLN A HE22 3  
ATOM 790  N N    . ARG A 1 3  ? 22.887  1.370  -2.839  1.00 0.00 ? 3  ARG A N    3  
ATOM 791  C CA   . ARG A 1 3  ? 21.776  1.769  -1.955  1.00 0.00 ? 3  ARG A CA   3  
ATOM 792  C C    . ARG A 1 3  ? 20.499  0.933  -2.153  1.00 0.00 ? 3  ARG A C    3  
ATOM 793  O O    . ARG A 1 3  ? 19.496  1.158  -1.484  1.00 0.00 ? 3  ARG A O    3  
ATOM 794  C CB   . ARG A 1 3  ? 21.501  3.253  -2.170  1.00 0.00 ? 3  ARG A CB   3  
ATOM 795  C CG   . ARG A 1 3  ? 22.505  4.191  -1.494  1.00 0.00 ? 3  ARG A CG   3  
ATOM 796  C CD   . ARG A 1 3  ? 22.075  4.598  -0.085  1.00 0.00 ? 3  ARG A CD   3  
ATOM 797  N NE   . ARG A 1 3  ? 22.834  5.796  0.296   1.00 0.00 ? 3  ARG A NE   3  
ATOM 798  C CZ   . ARG A 1 3  ? 22.823  6.406  1.491   1.00 0.00 ? 3  ARG A CZ   3  
ATOM 799  N NH1  . ARG A 1 3  ? 22.044  6.000  2.479   1.00 0.00 ? 3  ARG A NH1  3  
ATOM 800  N NH2  . ARG A 1 3  ? 23.584  7.466  1.692   1.00 0.00 ? 3  ARG A NH2  3  
ATOM 801  H H    . ARG A 1 3  ? 22.698  1.412  -3.816  1.00 0.00 ? 3  ARG A H    3  
ATOM 802  H HE   . ARG A 1 3  ? 23.363  6.220  -0.440  1.00 0.00 ? 3  ARG A HE   3  
ATOM 803  H HH11 . ARG A 1 3  ? 21.438  5.225  2.323   1.00 0.00 ? 3  ARG A HH11 3  
ATOM 804  H HH12 . ARG A 1 3  ? 22.064  6.465  3.362   1.00 0.00 ? 3  ARG A HH12 3  
ATOM 805  H HH21 . ARG A 1 3  ? 24.170  7.824  0.967   1.00 0.00 ? 3  ARG A HH21 3  
ATOM 806  H HH22 . ARG A 1 3  ? 23.568  7.919  2.591   1.00 0.00 ? 3  ARG A HH22 3  
ATOM 807  N N    . MET A 1 4  ? 20.654  -0.192 -2.844  1.00 0.00 ? 4  MET A N    3  
ATOM 808  C CA   . MET A 1 4  ? 19.541  -1.113 -3.162  1.00 0.00 ? 4  MET A CA   3  
ATOM 809  C C    . MET A 1 4  ? 19.107  -2.006 -1.979  1.00 0.00 ? 4  MET A C    3  
ATOM 810  O O    . MET A 1 4  ? 18.147  -2.765 -2.081  1.00 0.00 ? 4  MET A O    3  
ATOM 811  C CB   . MET A 1 4  ? 19.892  -1.950 -4.402  1.00 0.00 ? 4  MET A CB   3  
ATOM 812  C CG   . MET A 1 4  ? 20.185  -1.114 -5.651  1.00 0.00 ? 4  MET A CG   3  
ATOM 813  S SD   . MET A 1 4  ? 18.852  0.045  -6.148  1.00 0.00 ? 4  MET A SD   3  
ATOM 814  C CE   . MET A 1 4  ? 19.560  1.605  -5.631  1.00 0.00 ? 4  MET A CE   3  
ATOM 815  H H    . MET A 1 4  ? 21.555  -0.511 -3.121  1.00 0.00 ? 4  MET A H    3  
ATOM 816  N N    . LYS A 1 5  ? 19.726  -1.734 -0.828  1.00 0.00 ? 5  LYS A N    3  
ATOM 817  C CA   . LYS A 1 5  ? 19.411  -2.354 0.469   1.00 0.00 ? 5  LYS A CA   3  
ATOM 818  C C    . LYS A 1 5  ? 18.659  -1.404 1.430   1.00 0.00 ? 5  LYS A C    3  
ATOM 819  O O    . LYS A 1 5  ? 17.861  -1.854 2.250   1.00 0.00 ? 5  LYS A O    3  
ATOM 820  C CB   . LYS A 1 5  ? 20.693  -2.881 1.122   1.00 0.00 ? 5  LYS A CB   3  
ATOM 821  C CG   . LYS A 1 5  ? 20.557  -4.366 1.436   1.00 0.00 ? 5  LYS A CG   3  
ATOM 822  C CD   . LYS A 1 5  ? 20.612  -5.212 0.165   1.00 0.00 ? 5  LYS A CD   3  
ATOM 823  C CE   . LYS A 1 5  ? 19.799  -6.492 0.296   1.00 0.00 ? 5  LYS A CE   3  
ATOM 824  N NZ   . LYS A 1 5  ? 19.895  -7.248 -0.969  1.00 0.00 ? 5  LYS A NZ   3  
ATOM 825  H H    . LYS A 1 5  ? 20.468  -1.068 -0.809  1.00 0.00 ? 5  LYS A H    3  
ATOM 826  H HZ1  . LYS A 1 5  ? 19.746  -6.629 -1.744  1.00 0.00 ? 5  LYS A HZ1  3  
ATOM 827  H HZ2  . LYS A 1 5  ? 20.794  -7.667 -1.022  1.00 0.00 ? 5  LYS A HZ2  3  
ATOM 828  H HZ3  . LYS A 1 5  ? 19.196  -7.963 -0.970  1.00 0.00 ? 5  LYS A HZ3  3  
ATOM 829  N N    . GLN A 1 6  ? 18.879  -0.100 1.259   1.00 0.00 ? 6  GLN A N    3  
ATOM 830  C CA   . GLN A 1 6  ? 18.227  0.949  2.065   1.00 0.00 ? 6  GLN A CA   3  
ATOM 831  C C    . GLN A 1 6  ? 17.052  1.596  1.322   1.00 0.00 ? 6  GLN A C    3  
ATOM 832  O O    . GLN A 1 6  ? 15.937  1.635  1.843   1.00 0.00 ? 6  GLN A O    3  
ATOM 833  C CB   . GLN A 1 6  ? 19.227  2.032  2.476   1.00 0.00 ? 6  GLN A CB   3  
ATOM 834  C CG   . GLN A 1 6  ? 20.250  1.559  3.520   1.00 0.00 ? 6  GLN A CG   3  
ATOM 835  C CD   . GLN A 1 6  ? 21.225  0.491  2.988   1.00 0.00 ? 6  GLN A CD   3  
ATOM 836  O OE1  . GLN A 1 6  ? 21.659  0.485  1.843   1.00 0.00 ? 6  GLN A OE1  3  
ATOM 837  N NE2  . GLN A 1 6  ? 21.480  -0.500 3.807   1.00 0.00 ? 6  GLN A NE2  3  
ATOM 838  H H    . GLN A 1 6  ? 19.626  0.220  0.691   1.00 0.00 ? 6  GLN A H    3  
ATOM 839  H HE21 . GLN A 1 6  ? 21.027  -0.578 4.691   1.00 0.00 ? 6  GLN A HE21 3  
ATOM 840  H HE22 . GLN A 1 6  ? 22.134  -1.191 3.500   1.00 0.00 ? 6  GLN A HE22 3  
ATOM 841  N N    . LEU A 1 7  ? 17.261  1.934  0.056   1.00 0.00 ? 7  LEU A N    3  
ATOM 842  C CA   . LEU A 1 7  ? 16.186  2.459  -0.809  1.00 0.00 ? 7  LEU A CA   3  
ATOM 843  C C    . LEU A 1 7  ? 15.050  1.451  -0.972  1.00 0.00 ? 7  LEU A C    3  
ATOM 844  O O    . LEU A 1 7  ? 13.882  1.837  -0.863  1.00 0.00 ? 7  LEU A O    3  
ATOM 845  C CB   . LEU A 1 7  ? 16.693  2.889  -2.186  1.00 0.00 ? 7  LEU A CB   3  
ATOM 846  C CG   . LEU A 1 7  ? 17.759  3.987  -2.103  1.00 0.00 ? 7  LEU A CG   3  
ATOM 847  C CD1  . LEU A 1 7  ? 18.266  4.287  -3.511  1.00 0.00 ? 7  LEU A CD1  3  
ATOM 848  C CD2  . LEU A 1 7  ? 17.243  5.288  -1.478  1.00 0.00 ? 7  LEU A CD2  3  
ATOM 849  H H    . LEU A 1 7  ? 18.156  1.865  -0.387  1.00 0.00 ? 7  LEU A H    3  
ATOM 850  N N    . GLU A 1 8  ? 15.405  0.162  -1.004  1.00 0.00 ? 8  GLU A N    3  
ATOM 851  C CA   . GLU A 1 8  ? 14.416  -0.933 -1.028  1.00 0.00 ? 8  GLU A CA   3  
ATOM 852  C C    . GLU A 1 8  ? 13.437  -0.851 0.153   1.00 0.00 ? 8  GLU A C    3  
ATOM 853  O O    . GLU A 1 8  ? 12.244  -0.813 -0.117  1.00 0.00 ? 8  GLU A O    3  
ATOM 854  C CB   . GLU A 1 8  ? 15.041  -2.336 -1.117  1.00 0.00 ? 8  GLU A CB   3  
ATOM 855  C CG   . GLU A 1 8  ? 15.645  -2.850 0.200   1.00 0.00 ? 8  GLU A CG   3  
ATOM 856  C CD   . GLU A 1 8  ? 16.106  -4.307 0.174   1.00 0.00 ? 8  GLU A CD   3  
ATOM 857  O OE1  . GLU A 1 8  ? 17.034  -4.696 0.866   1.00 0.00 ? 8  GLU A OE1  3  
ATOM 858  O OE2  . GLU A 1 8  ? 15.407  -5.174 -0.591  1.00 0.00 ? 8  GLU A OE2  3  
ATOM 859  H H    . GLU A 1 8  ? 16.361  -0.118 -1.067  1.00 0.00 ? 8  GLU A H    3  
ATOM 860  H HE2  . GLU A 1 8  ? 15.894  -6.028 -0.433  1.00 0.00 ? 8  GLU A HE2  3  
ATOM 861  N N    . ASP A 1 9  ? 13.914  -0.457 1.339   1.00 0.00 ? 9  ASP A N    3  
ATOM 862  C CA   . ASP A 1 9  ? 13.090  -0.302 2.557   1.00 0.00 ? 9  ASP A CA   3  
ATOM 863  C C    . ASP A 1 9  ? 11.917  0.662  2.342   1.00 0.00 ? 9  ASP A C    3  
ATOM 864  O O    . ASP A 1 9  ? 10.790  0.359  2.722   1.00 0.00 ? 9  ASP A O    3  
ATOM 865  C CB   . ASP A 1 9  ? 13.985  0.178  3.695   1.00 0.00 ? 9  ASP A CB   3  
ATOM 866  C CG   . ASP A 1 9  ? 13.733  -0.536 5.032   1.00 0.00 ? 9  ASP A CG   3  
ATOM 867  O OD1  . ASP A 1 9  ? 13.005  -1.522 5.149   1.00 0.00 ? 9  ASP A OD1  3  
ATOM 868  O OD2  . ASP A 1 9  ? 14.417  -0.063 6.087   1.00 0.00 ? 9  ASP A OD2  3  
ATOM 869  H H    . ASP A 1 9  ? 14.882  -0.233 1.459   1.00 0.00 ? 9  ASP A H    3  
ATOM 870  H HD2  . ASP A 1 9  ? 14.149  -0.662 6.836   1.00 0.00 ? 9  ASP A HD2  3  
ATOM 871  N N    . LYS A 1 10 ? 12.171  1.670  1.499   1.00 0.00 ? 10 LYS A N    3  
ATOM 872  C CA   . LYS A 1 10 ? 11.191  2.698  1.095   1.00 0.00 ? 10 LYS A CA   3  
ATOM 873  C C    . LYS A 1 10 ? 10.396  2.259  -0.157  1.00 0.00 ? 10 LYS A C    3  
ATOM 874  O O    . LYS A 1 10 ? 9.179   2.168  -0.105  1.00 0.00 ? 10 LYS A O    3  
ATOM 875  C CB   . LYS A 1 10 ? 11.906  4.028  0.843   1.00 0.00 ? 10 LYS A CB   3  
ATOM 876  C CG   . LYS A 1 10 ? 12.672  4.491  2.095   1.00 0.00 ? 10 LYS A CG   3  
ATOM 877  C CD   . LYS A 1 10 ? 13.494  5.735  1.807   1.00 0.00 ? 10 LYS A CD   3  
ATOM 878  C CE   . LYS A 1 10 ? 14.431  6.101  2.974   1.00 0.00 ? 10 LYS A CE   3  
ATOM 879  N NZ   . LYS A 1 10 ? 13.699  6.670  4.122   1.00 0.00 ? 10 LYS A NZ   3  
ATOM 880  H H    . LYS A 1 10 ? 13.059  1.753  1.063   1.00 0.00 ? 10 LYS A H    3  
ATOM 881  H HZ1  . LYS A 1 10 ? 13.004  6.013  4.433   1.00 0.00 ? 10 LYS A HZ1  3  
ATOM 882  H HZ2  . LYS A 1 10 ? 14.343  6.843  4.868   1.00 0.00 ? 10 LYS A HZ2  3  
ATOM 883  H HZ3  . LYS A 1 10 ? 13.269  7.533  3.854   1.00 0.00 ? 10 LYS A HZ3  3  
ATOM 884  N N    . VAL A 1 11 ? 11.099  1.812  -1.200  1.00 0.00 ? 11 VAL A N    3  
ATOM 885  C CA   . VAL A 1 11 ? 10.502  1.309  -2.457  1.00 0.00 ? 11 VAL A CA   3  
ATOM 886  C C    . VAL A 1 11 ? 9.525   0.121  -2.228  1.00 0.00 ? 11 VAL A C    3  
ATOM 887  O O    . VAL A 1 11 ? 8.405   0.121  -2.729  1.00 0.00 ? 11 VAL A O    3  
ATOM 888  C CB   . VAL A 1 11 ? 11.579  0.972  -3.513  1.00 0.00 ? 11 VAL A CB   3  
ATOM 889  C CG1  . VAL A 1 11 ? 10.977  0.637  -4.878  1.00 0.00 ? 11 VAL A CG1  3  
ATOM 890  C CG2  . VAL A 1 11 ? 12.591  2.114  -3.719  1.00 0.00 ? 11 VAL A CG2  3  
ATOM 891  H H    . VAL A 1 11 ? 12.110  1.875  -1.208  1.00 0.00 ? 11 VAL A H    3  
ATOM 892  N N    . GLU A 1 12 ? 9.922   -0.805 -1.350  1.00 0.00 ? 12 GLU A N    3  
ATOM 893  C CA   . GLU A 1 12 ? 9.092   -1.949 -0.900  1.00 0.00 ? 12 GLU A CA   3  
ATOM 894  C C    . GLU A 1 12 ? 7.903   -1.472 -0.045  1.00 0.00 ? 12 GLU A C    3  
ATOM 895  O O    . GLU A 1 12 ? 6.774   -1.920 -0.261  1.00 0.00 ? 12 GLU A O    3  
ATOM 896  C CB   . GLU A 1 12 ? 9.928   -3.012 -0.146  1.00 0.00 ? 12 GLU A CB   3  
ATOM 897  C CG   . GLU A 1 12 ? 10.296  -2.649 1.310   1.00 0.00 ? 12 GLU A CG   3  
ATOM 898  C CD   . GLU A 1 12 ? 11.317  -3.573 1.969   1.00 0.00 ? 12 GLU A CD   3  
ATOM 899  O OE1  . GLU A 1 12 ? 12.507  -3.536 1.697   1.00 0.00 ? 12 GLU A OE1  3  
ATOM 900  O OE2  . GLU A 1 12 ? 10.849  -4.387 2.933   1.00 0.00 ? 12 GLU A OE2  3  
ATOM 901  H H    . GLU A 1 12 ? 10.844  -0.771 -0.943  1.00 0.00 ? 12 GLU A H    3  
ATOM 902  H HE2  . GLU A 1 12 ? 11.660  -4.818 3.300   1.00 0.00 ? 12 GLU A HE2  3  
ATOM 903  N N    . GLU A 1 13 ? 8.156   -0.479 0.809   1.00 0.00 ? 13 GLU A N    3  
ATOM 904  C CA   . GLU A 1 13 ? 7.129   0.165  1.660   1.00 0.00 ? 13 GLU A CA   3  
ATOM 905  C C    . GLU A 1 13 ? 6.055   0.829  0.785   1.00 0.00 ? 13 GLU A C    3  
ATOM 906  O O    . GLU A 1 13 ? 4.885   0.633  1.073   1.00 0.00 ? 13 GLU A O    3  
ATOM 907  C CB   . GLU A 1 13 ? 7.827   1.161  2.611   1.00 0.00 ? 13 GLU A CB   3  
ATOM 908  C CG   . GLU A 1 13 ? 6.906   1.948  3.545   1.00 0.00 ? 13 GLU A CG   3  
ATOM 909  C CD   . GLU A 1 13 ? 6.662   3.361  3.019   1.00 0.00 ? 13 GLU A CD   3  
ATOM 910  O OE1  . GLU A 1 13 ? 7.379   4.306  3.317   1.00 0.00 ? 13 GLU A OE1  3  
ATOM 911  O OE2  . GLU A 1 13 ? 5.637   3.523  2.157   1.00 0.00 ? 13 GLU A OE2  3  
ATOM 912  H H    . GLU A 1 13 ? 9.074   -0.095 0.913   1.00 0.00 ? 13 GLU A H    3  
ATOM 913  H HE2  . GLU A 1 13 ? 5.587   4.508  2.033   1.00 0.00 ? 13 GLU A HE2  3  
ATOM 914  N N    . LEU A 1 14 ? 6.446   1.306  -0.402  1.00 0.00 ? 14 LEU A N    3  
ATOM 915  C CA   . LEU A 1 14 ? 5.514   1.914  -1.358  1.00 0.00 ? 14 LEU A CA   3  
ATOM 916  C C    . LEU A 1 14 ? 4.458   0.896  -1.798  1.00 0.00 ? 14 LEU A C    3  
ATOM 917  O O    . LEU A 1 14 ? 3.281   1.080  -1.489  1.00 0.00 ? 14 LEU A O    3  
ATOM 918  C CB   . LEU A 1 14 ? 6.182   2.485  -2.617  1.00 0.00 ? 14 LEU A CB   3  
ATOM 919  C CG   . LEU A 1 14 ? 7.310   3.488  -2.338  1.00 0.00 ? 14 LEU A CG   3  
ATOM 920  C CD1  . LEU A 1 14 ? 7.802   4.040  -3.680  1.00 0.00 ? 14 LEU A CD1  3  
ATOM 921  C CD2  . LEU A 1 14 ? 6.925   4.626  -1.384  1.00 0.00 ? 14 LEU A CD2  3  
ATOM 922  H H    . LEU A 1 14 ? 7.410   1.293  -0.677  1.00 0.00 ? 14 LEU A H    3  
ATOM 923  N N    . LEU A 1 15 ? 4.902   -0.225 -2.376  1.00 0.00 ? 15 LEU A N    3  
ATOM 924  C CA   . LEU A 1 15 ? 4.002   -1.308 -2.803  1.00 0.00 ? 15 LEU A CA   3  
ATOM 925  C C    . LEU A 1 15 ? 3.186   -1.867 -1.632  1.00 0.00 ? 15 LEU A C    3  
ATOM 926  O O    . LEU A 1 15 ? 1.963   -1.758 -1.659  1.00 0.00 ? 15 LEU A O    3  
ATOM 927  C CB   . LEU A 1 15 ? 4.759   -2.444 -3.506  1.00 0.00 ? 15 LEU A CB   3  
ATOM 928  C CG   . LEU A 1 15 ? 5.800   -1.985 -4.538  1.00 0.00 ? 15 LEU A CG   3  
ATOM 929  C CD1  . LEU A 1 15 ? 6.331   -3.210 -5.266  1.00 0.00 ? 15 LEU A CD1  3  
ATOM 930  C CD2  . LEU A 1 15 ? 5.292   -0.959 -5.555  1.00 0.00 ? 15 LEU A CD2  3  
ATOM 931  H H    . LEU A 1 15 ? 5.860   -0.315 -2.657  1.00 0.00 ? 15 LEU A H    3  
ATOM 932  N N    . SER A 1 16 ? 3.877   -2.239 -0.550  1.00 0.00 ? 16 SER A N    3  
ATOM 933  C CA   . SER A 1 16 ? 3.223   -2.656 0.723   1.00 0.00 ? 16 SER A CA   3  
ATOM 934  C C    . SER A 1 16 ? 2.150   -1.694 1.242   1.00 0.00 ? 16 SER A C    3  
ATOM 935  O O    . SER A 1 16 ? 1.134   -2.137 1.772   1.00 0.00 ? 16 SER A O    3  
ATOM 936  C CB   . SER A 1 16 ? 4.239   -2.906 1.844   1.00 0.00 ? 16 SER A CB   3  
ATOM 937  O OG   . SER A 1 16 ? 4.622   -4.277 1.852   1.00 0.00 ? 16 SER A OG   3  
ATOM 938  H H    . SER A 1 16 ? 4.881   -2.312 -0.559  1.00 0.00 ? 16 SER A H    3  
ATOM 939  H HG   . SER A 1 16 ? 5.088   -4.485 2.714   1.00 0.00 ? 16 SER A HG   3  
ATOM 940  N N    . LYS A 1 17 ? 2.348   -0.394 1.013   1.00 0.00 ? 17 LYS A N    3  
ATOM 941  C CA   . LYS A 1 17 ? 1.362   0.660  1.331   1.00 0.00 ? 17 LYS A CA   3  
ATOM 942  C C    . LYS A 1 17 ? 0.289   0.844  0.255   1.00 0.00 ? 17 LYS A C    3  
ATOM 943  O O    . LYS A 1 17 ? -0.888  0.872  0.586   1.00 0.00 ? 17 LYS A O    3  
ATOM 944  C CB   . LYS A 1 17 ? 1.994   2.022  1.615   1.00 0.00 ? 17 LYS A CB   3  
ATOM 945  C CG   . LYS A 1 17 ? 2.704   2.034  2.972   1.00 0.00 ? 17 LYS A CG   3  
ATOM 946  C CD   . LYS A 1 17 ? 2.718   3.454  3.546   1.00 0.00 ? 17 LYS A CD   3  
ATOM 947  C CE   . LYS A 1 17 ? 3.534   3.553  4.835   1.00 0.00 ? 17 LYS A CE   3  
ATOM 948  N NZ   . LYS A 1 17 ? 3.053   2.584  5.839   1.00 0.00 ? 17 LYS A NZ   3  
ATOM 949  H H    . LYS A 1 17 ? 3.221   -0.059 0.642   1.00 0.00 ? 17 LYS A H    3  
ATOM 950  H HZ1  . LYS A 1 17 ? 2.096   2.757  6.045   1.00 0.00 ? 17 LYS A HZ1  3  
ATOM 951  H HZ2  . LYS A 1 17 ? 3.170   1.657  5.467   1.00 0.00 ? 17 LYS A HZ2  3  
ATOM 952  H HZ3  . LYS A 1 17 ? 3.604   2.671  6.670   1.00 0.00 ? 17 LYS A HZ3  3  
ATOM 953  N N    . ASN A 1 18 ? 0.675   0.925  -1.011  1.00 0.00 ? 18 ASN A N    3  
ATOM 954  C CA   . ASN A 1 18 ? -0.263  1.065  -2.149  1.00 0.00 ? 18 ASN A CA   3  
ATOM 955  C C    . ASN A 1 18 ? -1.230  -0.123 -2.238  1.00 0.00 ? 18 ASN A C    3  
ATOM 956  O O    . ASN A 1 18 ? -2.438  0.053  -2.414  1.00 0.00 ? 18 ASN A O    3  
ATOM 957  C CB   . ASN A 1 18 ? 0.526   1.209  -3.463  1.00 0.00 ? 18 ASN A CB   3  
ATOM 958  C CG   . ASN A 1 18 ? -0.292  1.900  -4.561  1.00 0.00 ? 18 ASN A CG   3  
ATOM 959  O OD1  . ASN A 1 18 ? 0.086   2.922  -5.103  1.00 0.00 ? 18 ASN A OD1  3  
ATOM 960  N ND2  . ASN A 1 18 ? -1.455  1.383  -4.894  1.00 0.00 ? 18 ASN A ND2  3  
ATOM 961  H H    . ASN A 1 18 ? 1.653   0.986  -1.250  1.00 0.00 ? 18 ASN A H    3  
ATOM 962  H HD21 . ASN A 1 18 ? -1.855  0.619  -4.385  1.00 0.00 ? 18 ASN A HD21 3  
ATOM 963  H HD22 . ASN A 1 18 ? -1.959  1.846  -5.616  1.00 0.00 ? 18 ASN A HD22 3  
ATOM 964  N N    . TYR A 1 19 ? -0.685  -1.336 -2.088  1.00 0.00 ? 19 TYR A N    3  
ATOM 965  C CA   . TYR A 1 19 ? -1.477  -2.587 -1.968  1.00 0.00 ? 19 TYR A CA   3  
ATOM 966  C C    . TYR A 1 19 ? -2.449  -2.550 -0.781  1.00 0.00 ? 19 TYR A C    3  
ATOM 967  O O    . TYR A 1 19 ? -3.650  -2.730 -0.961  1.00 0.00 ? 19 TYR A O    3  
ATOM 968  C CB   . TYR A 1 19 ? -0.536  -3.800 -1.884  1.00 0.00 ? 19 TYR A CB   3  
ATOM 969  C CG   . TYR A 1 19 ? -0.036  -4.264 -3.253  1.00 0.00 ? 19 TYR A CG   3  
ATOM 970  C CD1  . TYR A 1 19 ? 1.128   -3.694 -3.826  1.00 0.00 ? 19 TYR A CD1  3  
ATOM 971  C CD2  . TYR A 1 19 ? -0.715  -5.325 -3.892  1.00 0.00 ? 19 TYR A CD2  3  
ATOM 972  C CE1  . TYR A 1 19 ? 1.628   -4.201 -5.045  1.00 0.00 ? 19 TYR A CE1  3  
ATOM 973  C CE2  . TYR A 1 19 ? -0.230  -5.832 -5.111  1.00 0.00 ? 19 TYR A CE2  3  
ATOM 974  C CZ   . TYR A 1 19 ? 0.941   -5.266 -5.672  1.00 0.00 ? 19 TYR A CZ   3  
ATOM 975  O OH   . TYR A 1 19 ? 1.433   -5.761 -6.839  1.00 0.00 ? 19 TYR A OH   3  
ATOM 976  H H    . TYR A 1 19 ? 0.311   -1.454 -2.023  1.00 0.00 ? 19 TYR A H    3  
ATOM 977  H HH   . TYR A 1 19 ? 2.248   -5.264 -7.099  1.00 0.00 ? 19 TYR A HH   3  
ATOM 978  N N    . HIS A 1 20 ? -1.986  -1.984 0.337   1.00 0.00 ? 20 HIS A N    3  
ATOM 979  C CA   . HIS A 1 20 ? -2.810  -1.731 1.539   1.00 0.00 ? 20 HIS A CA   3  
ATOM 980  C C    . HIS A 1 20 ? -3.849  -0.591 1.349   1.00 0.00 ? 20 HIS A C    3  
ATOM 981  O O    . HIS A 1 20 ? -4.943  -0.614 1.923   1.00 0.00 ? 20 HIS A O    3  
ATOM 982  C CB   . HIS A 1 20 ? -1.795  -1.507 2.675   1.00 0.00 ? 20 HIS A CB   3  
ATOM 983  C CG   . HIS A 1 20 ? -2.244  -0.628 3.834   1.00 0.00 ? 20 HIS A CG   3  
ATOM 984  N ND1  . HIS A 1 20 ? -2.784  -1.044 4.986   1.00 0.00 ? 20 HIS A ND1  3  
ATOM 985  C CD2  . HIS A 1 20 ? -2.225  0.698  3.852   1.00 0.00 ? 20 HIS A CD2  3  
ATOM 986  C CE1  . HIS A 1 20 ? -3.131  0.027  5.686   1.00 0.00 ? 20 HIS A CE1  3  
ATOM 987  N NE2  . HIS A 1 20 ? -2.786  1.104  4.977   1.00 0.00 ? 20 HIS A NE2  3  
ATOM 988  H H    . HIS A 1 20 ? -1.032  -1.694 0.429   1.00 0.00 ? 20 HIS A H    3  
ATOM 989  H HD1  . HIS A 1 20 ? -2.828  -1.986 5.295   1.00 0.00 ? 20 HIS A HD1  3  
ATOM 990  H HE2  . HIS A 1 20 ? -2.994  2.045  5.209   1.00 0.00 ? 20 HIS A HE2  3  
ATOM 991  N N    . LEU A 1 21 ? -3.510  0.384  0.512   1.00 0.00 ? 21 LEU A N    3  
ATOM 992  C CA   . LEU A 1 21 ? -4.336  1.558  0.164   1.00 0.00 ? 21 LEU A CA   3  
ATOM 993  C C    . LEU A 1 21 ? -5.573  1.156  -0.636  1.00 0.00 ? 21 LEU A C    3  
ATOM 994  O O    . LEU A 1 21 ? -6.694  1.486  -0.256  1.00 0.00 ? 21 LEU A O    3  
ATOM 995  C CB   . LEU A 1 21 ? -3.446  2.575  -0.576  1.00 0.00 ? 21 LEU A CB   3  
ATOM 996  C CG   . LEU A 1 21 ? -4.197  3.663  -1.346  1.00 0.00 ? 21 LEU A CG   3  
ATOM 997  C CD1  . LEU A 1 21 ? -4.857  4.690  -0.413  1.00 0.00 ? 21 LEU A CD1  3  
ATOM 998  C CD2  . LEU A 1 21 ? -3.256  4.342  -2.342  1.00 0.00 ? 21 LEU A CD2  3  
ATOM 999  H H    . LEU A 1 21 ? -2.581  0.409  0.134   1.00 0.00 ? 21 LEU A H    3  
ATOM 1000 N N    . GLU A 1 22 ? -5.351  0.358  -1.681  1.00 0.00 ? 22 GLU A N    3  
ATOM 1001 C CA   . GLU A 1 22 ? -6.460  -0.200 -2.492  1.00 0.00 ? 22 GLU A CA   3  
ATOM 1002 C C    . GLU A 1 22 ? -7.421  -1.053 -1.660  1.00 0.00 ? 22 GLU A C    3  
ATOM 1003 O O    . GLU A 1 22 ? -8.629  -1.000 -1.872  1.00 0.00 ? 22 GLU A O    3  
ATOM 1004 C CB   . GLU A 1 22 ? -5.968  -0.947 -3.742  1.00 0.00 ? 22 GLU A CB   3  
ATOM 1005 C CG   . GLU A 1 22 ? -5.205  -2.239 -3.441  1.00 0.00 ? 22 GLU A CG   3  
ATOM 1006 C CD   . GLU A 1 22 ? -5.130  -3.204 -4.621  1.00 0.00 ? 22 GLU A CD   3  
ATOM 1007 O OE1  . GLU A 1 22 ? -4.130  -3.866 -4.867  1.00 0.00 ? 22 GLU A OE1  3  
ATOM 1008 O OE2  . GLU A 1 22 ? -6.227  -3.312 -5.400  1.00 0.00 ? 22 GLU A OE2  3  
ATOM 1009 H H    . GLU A 1 22 ? -4.421  0.120  -1.981  1.00 0.00 ? 22 GLU A H    3  
ATOM 1010 H HE2  . GLU A 1 22 ? -5.979  -3.992 -6.080  1.00 0.00 ? 22 GLU A HE2  3  
ATOM 1011 N N    . ASN A 1 23 ? -6.886  -1.679 -0.593  1.00 0.00 ? 23 ASN A N    3  
ATOM 1012 C CA   . ASN A 1 23 ? -7.679  -2.412 0.416   1.00 0.00 ? 23 ASN A CA   3  
ATOM 1013 C C    . ASN A 1 23 ? -8.697  -1.501 1.125   1.00 0.00 ? 23 ASN A C    3  
ATOM 1014 O O    . ASN A 1 23 ? -9.885  -1.845 1.181   1.00 0.00 ? 23 ASN A O    3  
ATOM 1015 C CB   . ASN A 1 23 ? -6.782  -3.065 1.463   1.00 0.00 ? 23 ASN A CB   3  
ATOM 1016 C CG   . ASN A 1 23 ? -6.211  -4.399 0.982   1.00 0.00 ? 23 ASN A CG   3  
ATOM 1017 O OD1  . ASN A 1 23 ? -5.096  -4.520 0.500   1.00 0.00 ? 23 ASN A OD1  3  
ATOM 1018 N ND2  . ASN A 1 23 ? -6.954  -5.460 1.185   1.00 0.00 ? 23 ASN A ND2  3  
ATOM 1019 H H    . ASN A 1 23 ? -5.897  -1.671 -0.434  1.00 0.00 ? 23 ASN A H    3  
ATOM 1020 H HD21 . ASN A 1 23 ? -7.856  -5.379 1.611   1.00 0.00 ? 23 ASN A HD21 3  
ATOM 1021 H HD22 . ASN A 1 23 ? -6.583  -6.330 0.880   1.00 0.00 ? 23 ASN A HD22 3  
ATOM 1022 N N    . GLU A 1 24 ? -8.228  -0.333 1.567   1.00 0.00 ? 24 GLU A N    3  
ATOM 1023 C CA   . GLU A 1 24 ? -9.097  0.698  2.170   1.00 0.00 ? 24 GLU A CA   3  
ATOM 1024 C C    . GLU A 1 24 ? -10.157 1.175  1.183   1.00 0.00 ? 24 GLU A C    3  
ATOM 1025 O O    . GLU A 1 24 ? -11.332 0.919  1.419   1.00 0.00 ? 24 GLU A O    3  
ATOM 1026 C CB   . GLU A 1 24 ? -8.312  1.861  2.782   1.00 0.00 ? 24 GLU A CB   3  
ATOM 1027 C CG   . GLU A 1 24 ? -9.251  2.957  3.321   1.00 0.00 ? 24 GLU A CG   3  
ATOM 1028 C CD   . GLU A 1 24 ? -9.073  3.234  4.809   1.00 0.00 ? 24 GLU A CD   3  
ATOM 1029 O OE1  . GLU A 1 24 ? -9.865  2.854  5.659   1.00 0.00 ? 24 GLU A OE1  3  
ATOM 1030 O OE2  . GLU A 1 24 ? -8.052  4.053  5.137   1.00 0.00 ? 24 GLU A OE2  3  
ATOM 1031 H H    . GLU A 1 24 ? -7.259  -0.090 1.486   1.00 0.00 ? 24 GLU A H    3  
ATOM 1032 H HE2  . GLU A 1 24 ? -8.152  4.162  6.119   1.00 0.00 ? 24 GLU A HE2  3  
ATOM 1033 N N    . VAL A 1 25 ? -9.724  1.774  0.084   1.00 0.00 ? 25 VAL A N    3  
ATOM 1034 C CA   . VAL A 1 25 ? -10.591 2.265  -1.022  1.00 0.00 ? 25 VAL A CA   3  
ATOM 1035 C C    . VAL A 1 25 ? -11.712 1.258  -1.359  1.00 0.00 ? 25 VAL A C    3  
ATOM 1036 O O    . VAL A 1 25 ? -12.871 1.649  -1.435  1.00 0.00 ? 25 VAL A O    3  
ATOM 1037 C CB   . VAL A 1 25 ? -9.753  2.640  -2.264  1.00 0.00 ? 25 VAL A CB   3  
ATOM 1038 C CG1  . VAL A 1 25 ? -10.614 3.306  -3.346  1.00 0.00 ? 25 VAL A CG1  3  
ATOM 1039 C CG2  . VAL A 1 25 ? -8.598  3.602  -1.922  1.00 0.00 ? 25 VAL A CG2  3  
ATOM 1040 H H    . VAL A 1 25 ? -8.761  2.029  -0.015  1.00 0.00 ? 25 VAL A H    3  
ATOM 1041 N N    . ALA A 1 26 ? -11.372 -0.024 -1.275  1.00 0.00 ? 26 ALA A N    3  
ATOM 1042 C CA   . ALA A 1 26 ? -12.310 -1.147 -1.409  1.00 0.00 ? 26 ALA A CA   3  
ATOM 1043 C C    . ALA A 1 26 ? -13.359 -1.219 -0.276  1.00 0.00 ? 26 ALA A C    3  
ATOM 1044 O O    . ALA A 1 26 ? -14.524 -0.871 -0.519  1.00 0.00 ? 26 ALA A O    3  
ATOM 1045 C CB   . ALA A 1 26 ? -11.536 -2.455 -1.553  1.00 0.00 ? 26 ALA A CB   3  
ATOM 1046 H H    . ALA A 1 26 ? -10.425 -0.294 -1.079  1.00 0.00 ? 26 ALA A H    3  
ATOM 1047 N N    . ARG A 1 27 ? -12.959 -1.598 0.937   1.00 0.00 ? 27 ARG A N    3  
ATOM 1048 C CA   . ARG A 1 27 ? -13.854 -1.630 2.130   1.00 0.00 ? 27 ARG A CA   3  
ATOM 1049 C C    . ARG A 1 27 ? -14.628 -0.306 2.349   1.00 0.00 ? 27 ARG A C    3  
ATOM 1050 O O    . ARG A 1 27 ? -15.811 -0.330 2.656   1.00 0.00 ? 27 ARG A O    3  
ATOM 1051 C CB   . ARG A 1 27 ? -13.086 -2.041 3.403   1.00 0.00 ? 27 ARG A CB   3  
ATOM 1052 C CG   . ARG A 1 27 ? -12.017 -1.039 3.855   1.00 0.00 ? 27 ARG A CG   3  
ATOM 1053 C CD   . ARG A 1 27 ? -11.306 -1.418 5.157   1.00 0.00 ? 27 ARG A CD   3  
ATOM 1054 N NE   . ARG A 1 27 ? -9.882  -1.646 4.872   1.00 0.00 ? 27 ARG A NE   3  
ATOM 1055 C CZ   . ARG A 1 27 ? -8.847  -0.893 5.246   1.00 0.00 ? 27 ARG A CZ   3  
ATOM 1056 N NH1  . ARG A 1 27 ? -8.920  -0.017 6.230   1.00 0.00 ? 27 ARG A NH1  3  
ATOM 1057 N NH2  . ARG A 1 27 ? -7.647  -1.136 4.729   1.00 0.00 ? 27 ARG A NH2  3  
ATOM 1058 H H    . ARG A 1 27 ? -12.013 -1.900 1.104   1.00 0.00 ? 27 ARG A H    3  
ATOM 1059 H HE   . ARG A 1 27 ? -9.687  -2.537 4.468   1.00 0.00 ? 27 ARG A HE   3  
ATOM 1060 H HH11 . ARG A 1 27 ? -9.787  0.133  6.703   1.00 0.00 ? 27 ARG A HH11 3  
ATOM 1061 H HH12 . ARG A 1 27 ? -8.117  0.521  6.484   1.00 0.00 ? 27 ARG A HH12 3  
ATOM 1062 H HH21 . ARG A 1 27 ? -7.541  -1.799 4.002   1.00 0.00 ? 27 ARG A HH21 3  
ATOM 1063 H HH22 . ARG A 1 27 ? -6.865  -0.587 5.018   1.00 0.00 ? 27 ARG A HH22 3  
ATOM 1064 N N    . LEU A 1 28 ? -13.968 0.804  2.007   1.00 0.00 ? 28 LEU A N    3  
ATOM 1065 C CA   . LEU A 1 28 ? -14.507 2.168  1.968   1.00 0.00 ? 28 LEU A CA   3  
ATOM 1066 C C    . LEU A 1 28 ? -15.679 2.278  0.977   1.00 0.00 ? 28 LEU A C    3  
ATOM 1067 O O    . LEU A 1 28 ? -16.800 2.485  1.408   1.00 0.00 ? 28 LEU A O    3  
ATOM 1068 C CB   . LEU A 1 28 ? -13.359 3.136  1.635   1.00 0.00 ? 28 LEU A CB   3  
ATOM 1069 C CG   . LEU A 1 28 ? -13.780 4.512  1.124   1.00 0.00 ? 28 LEU A CG   3  
ATOM 1070 C CD1  . LEU A 1 28 ? -14.350 5.370  2.253   1.00 0.00 ? 28 LEU A CD1  3  
ATOM 1071 C CD2  . LEU A 1 28 ? -12.601 5.229  0.465   1.00 0.00 ? 28 LEU A CD2  3  
ATOM 1072 H H    . LEU A 1 28 ? -12.997 0.739  1.743   1.00 0.00 ? 28 LEU A H    3  
ATOM 1073 N N    . LYS A 1 29 ? -15.420 2.000  -0.299  1.00 0.00 ? 29 LYS A N    3  
ATOM 1074 C CA   . LYS A 1 29 ? -16.457 2.073  -1.341  1.00 0.00 ? 29 LYS A CA   3  
ATOM 1075 C C    . LYS A 1 29 ? -17.611 1.086  -1.106  1.00 0.00 ? 29 LYS A C    3  
ATOM 1076 O O    . LYS A 1 29 ? -18.769 1.422  -1.315  1.00 0.00 ? 29 LYS A O    3  
ATOM 1077 C CB   . LYS A 1 29 ? -15.788 1.911  -2.693  1.00 0.00 ? 29 LYS A CB   3  
ATOM 1078 C CG   . LYS A 1 29 ? -16.409 2.887  -3.677  1.00 0.00 ? 29 LYS A CG   3  
ATOM 1079 C CD   . LYS A 1 29 ? -15.410 3.249  -4.780  1.00 0.00 ? 29 LYS A CD   3  
ATOM 1080 C CE   . LYS A 1 29 ? -16.045 4.152  -5.834  1.00 0.00 ? 29 LYS A CE   3  
ATOM 1081 N NZ   . LYS A 1 29 ? -17.142 3.438  -6.502  1.00 0.00 ? 29 LYS A NZ   3  
ATOM 1082 H H    . LYS A 1 29 ? -14.497 1.808  -0.639  1.00 0.00 ? 29 LYS A H    3  
ATOM 1083 H HZ1  . LYS A 1 29 ? -16.791 2.598  -6.923  1.00 0.00 ? 29 LYS A HZ1  3  
ATOM 1084 H HZ2  . LYS A 1 29 ? -17.848 3.215  -5.829  1.00 0.00 ? 29 LYS A HZ2  3  
ATOM 1085 H HZ3  . LYS A 1 29 ? -17.539 4.028  -7.216  1.00 0.00 ? 29 LYS A HZ3  3  
ATOM 1086 N N    . LYS A 1 30 ? -17.298 -0.026 -0.444  1.00 0.00 ? 30 LYS A N    3  
ATOM 1087 C CA   . LYS A 1 30 ? -18.298 -0.999 0.058   1.00 0.00 ? 30 LYS A CA   3  
ATOM 1088 C C    . LYS A 1 30 ? -19.115 -0.513 1.262   1.00 0.00 ? 30 LYS A C    3  
ATOM 1089 O O    . LYS A 1 30 ? -20.304 -0.801 1.348   1.00 0.00 ? 30 LYS A O    3  
ATOM 1090 C CB   . LYS A 1 30 ? -17.641 -2.361 0.329   1.00 0.00 ? 30 LYS A CB   3  
ATOM 1091 C CG   . LYS A 1 30 ? -17.665 -3.194 -0.961  1.00 0.00 ? 30 LYS A CG   3  
ATOM 1092 C CD   . LYS A 1 30 ? -16.268 -3.700 -1.311  1.00 0.00 ? 30 LYS A CD   3  
ATOM 1093 C CE   . LYS A 1 30 ? -15.959 -3.359 -2.766  1.00 0.00 ? 30 LYS A CE   3  
ATOM 1094 N NZ   . LYS A 1 30 ? -14.537 -2.978 -2.819  1.00 0.00 ? 30 LYS A NZ   3  
ATOM 1095 H H    . LYS A 1 30 ? -16.337 -0.271 -0.282  1.00 0.00 ? 30 LYS A H    3  
ATOM 1096 H HZ1  . LYS A 1 30 ? -14.395 -2.220 -2.182  1.00 0.00 ? 30 LYS A HZ1  3  
ATOM 1097 H HZ2  . LYS A 1 30 ? -13.973 -3.763 -2.562  1.00 0.00 ? 30 LYS A HZ2  3  
ATOM 1098 H HZ3  . LYS A 1 30 ? -14.296 -2.679 -3.738  1.00 0.00 ? 30 LYS A HZ3  3  
ATOM 1099 N N    . LEU A 1 31 ? -18.529 0.362  2.090   1.00 0.00 ? 31 LEU A N    3  
ATOM 1100 C CA   . LEU A 1 31 ? -19.226 1.008  3.227   1.00 0.00 ? 31 LEU A CA   3  
ATOM 1101 C C    . LEU A 1 31 ? -19.734 2.423  2.895   1.00 0.00 ? 31 LEU A C    3  
ATOM 1102 O O    . LEU A 1 31 ? -20.329 3.105  3.733   1.00 0.00 ? 31 LEU A O    3  
ATOM 1103 C CB   . LEU A 1 31 ? -18.346 0.899  4.498   1.00 0.00 ? 31 LEU A CB   3  
ATOM 1104 C CG   . LEU A 1 31 ? -17.438 2.085  4.829   1.00 0.00 ? 31 LEU A CG   3  
ATOM 1105 C CD1  . LEU A 1 31 ? -18.078 2.977  5.899   1.00 0.00 ? 31 LEU A CD1  3  
ATOM 1106 C CD2  . LEU A 1 31 ? -16.063 1.613  5.333   1.00 0.00 ? 31 LEU A CD2  3  
ATOM 1107 H H    . LEU A 1 31 ? -17.553 0.601  2.002   1.00 0.00 ? 31 LEU A H    3  
ATOM 1108 N N    . VAL A 1 32 ? -19.589 2.823  1.629   1.00 0.00 ? 32 VAL A N    3  
ATOM 1109 C CA   . VAL A 1 32 ? -20.031 4.138  1.101   1.00 0.00 ? 32 VAL A CA   3  
ATOM 1110 C C    . VAL A 1 32 ? -20.989 3.980  -0.116  1.00 0.00 ? 32 VAL A C    3  
ATOM 1111 O O    . VAL A 1 32 ? -21.544 4.944  -0.626  1.00 0.00 ? 32 VAL A O    3  
ATOM 1112 C CB   . VAL A 1 32 ? -18.778 5.011  0.825   1.00 0.00 ? 32 VAL A CB   3  
ATOM 1113 C CG1  . VAL A 1 32 ? -19.041 6.356  0.131   1.00 0.00 ? 32 VAL A CG1  3  
ATOM 1114 C CG2  . VAL A 1 32 ? -18.082 5.351  2.145   1.00 0.00 ? 32 VAL A CG2  3  
ATOM 1115 H H    . VAL A 1 32 ? -19.010 2.302  1.006   1.00 0.00 ? 32 VAL A H    3  
ATOM 1116 N N    . GLY A 1 33 ? -21.317 2.721  -0.408  1.00 0.00 ? 33 GLY A N    3  
ATOM 1117 C CA   . GLY A 1 33 ? -22.255 2.330  -1.488  1.00 0.00 ? 33 GLY A CA   3  
ATOM 1118 C C    . GLY A 1 33 ? -23.546 1.670  -0.974  1.00 0.00 ? 33 GLY A C    3  
ATOM 1119 O O    . GLY A 1 33 ? -24.515 1.586  -1.716  1.00 0.00 ? 33 GLY A O    3  
ATOM 1120 H H    . GLY A 1 33 ? -20.846 1.962  0.028   1.00 0.00 ? 33 GLY A H    3  
ATOM 1121 N N    . GLU A 1 34 ? -23.528 1.259  0.293   1.00 0.00 ? 34 GLU A N    3  
ATOM 1122 C CA   . GLU A 1 34 ? -24.608 0.500  0.981   1.00 0.00 ? 34 GLU A CA   3  
ATOM 1123 C C    . GLU A 1 34 ? -24.303 0.279  2.471   1.00 0.00 ? 34 GLU A C    3  
ATOM 1124 O O    . GLU A 1 34 ? -23.789 -0.749 2.905   1.00 0.00 ? 34 GLU A O    3  
ATOM 1125 C CB   . GLU A 1 34 ? -24.848 -0.845 0.268   1.00 0.00 ? 34 GLU A CB   3  
ATOM 1126 C CG   . GLU A 1 34 ? -26.199 -0.873 -0.449  1.00 0.00 ? 34 GLU A CG   3  
ATOM 1127 C CD   . GLU A 1 34 ? -27.332 -1.254 0.502   1.00 0.00 ? 34 GLU A CD   3  
ATOM 1128 O OE1  . GLU A 1 34 ? -27.863 -0.461 1.273   1.00 0.00 ? 34 GLU A OE1  3  
ATOM 1129 O OE2  . GLU A 1 34 ? -27.712 -2.544 0.464   1.00 0.00 ? 34 GLU A OE2  3  
ATOM 1130 H H    . GLU A 1 34 ? -22.770 1.515  0.897   1.00 0.00 ? 34 GLU A H    3  
ATOM 1131 H HE2  . GLU A 1 34 ? -28.418 -2.604 1.162   1.00 0.00 ? 34 GLU A HE2  3  
ATOM 1132 N N    . ARG A 1 35 ? -24.601 1.321  3.235   1.00 0.00 ? 35 ARG A N    3  
ATOM 1133 C CA   . ARG A 1 35 ? -24.401 1.356  4.709   1.00 0.00 ? 35 ARG A CA   3  
ATOM 1134 C C    . ARG A 1 35 ? -25.682 1.576  5.543   1.00 0.00 ? 35 ARG A C    3  
ATOM 1135 O O    . ARG A 1 35 ? -26.772 1.454  4.937   1.00 0.00 ? 35 ARG A O    3  
ATOM 1136 C CB   . ARG A 1 35 ? -23.288 2.375  5.063   1.00 0.00 ? 35 ARG A CB   3  
ATOM 1137 C CG   . ARG A 1 35 ? -23.304 3.693  4.278   1.00 0.00 ? 35 ARG A CG   3  
ATOM 1138 C CD   . ARG A 1 35 ? -24.572 4.527  4.454   1.00 0.00 ? 35 ARG A CD   3  
ATOM 1139 N NE   . ARG A 1 35 ? -24.563 5.180  5.765   1.00 0.00 ? 35 ARG A NE   3  
ATOM 1140 C CZ   . ARG A 1 35 ? -25.047 6.394  6.020   1.00 0.00 ? 35 ARG A CZ   3  
ATOM 1141 N NH1  . ARG A 1 35 ? -25.882 7.001  5.186   1.00 0.00 ? 35 ARG A NH1  3  
ATOM 1142 N NH2  . ARG A 1 35 ? -24.846 6.947  7.204   1.00 0.00 ? 35 ARG A NH2  3  
ATOM 1143 O OXT  . ARG A 1 35 ? -25.565 1.900  6.748   1.00 0.00 ? 35 ARG A OXT  3  
ATOM 1144 H H    . ARG A 1 35 ? -24.966 2.165  2.835   1.00 0.00 ? 35 ARG A H    3  
ATOM 1145 H HE   . ARG A 1 35 ? -24.230 4.627  6.530   1.00 0.00 ? 35 ARG A HE   3  
ATOM 1146 H HH11 . ARG A 1 35 ? -26.150 6.522  4.354   1.00 0.00 ? 35 ARG A HH11 3  
ATOM 1147 H HH12 . ARG A 1 35 ? -26.231 7.909  5.388   1.00 0.00 ? 35 ARG A HH12 3  
ATOM 1148 H HH21 . ARG A 1 35 ? -24.265 6.488  7.881   1.00 0.00 ? 35 ARG A HH21 3  
ATOM 1149 H HH22 . ARG A 1 35 ? -25.216 7.851  7.400   1.00 0.00 ? 35 ARG A HH22 3  
ATOM 1150 N N    . LEU A 1 1  ? 24.315  8.801  0.215   1.00 0.00 ? 1  LEU A N    4  
ATOM 1151 C CA   . LEU A 1 1  ? 24.193  7.755  1.255   1.00 0.00 ? 1  LEU A CA   4  
ATOM 1152 C C    . LEU A 1 1  ? 23.384  6.556  0.722   1.00 0.00 ? 1  LEU A C    4  
ATOM 1153 O O    . LEU A 1 1  ? 22.200  6.712  0.413   1.00 0.00 ? 1  LEU A O    4  
ATOM 1154 C CB   . LEU A 1 1  ? 23.515  8.349  2.499   1.00 0.00 ? 1  LEU A CB   4  
ATOM 1155 C CG   . LEU A 1 1  ? 23.305  7.316  3.613   1.00 0.00 ? 1  LEU A CG   4  
ATOM 1156 C CD1  . LEU A 1 1  ? 24.615  6.940  4.314   1.00 0.00 ? 1  LEU A CD1  4  
ATOM 1157 C CD2  . LEU A 1 1  ? 22.252  7.823  4.612   1.00 0.00 ? 1  LEU A CD2  4  
ATOM 1158 H H1   . LEU A 1 1  ? 23.393  9.091  -0.057  1.00 0.00 ? 1  LEU A H1   4  
ATOM 1159 H H2   . LEU A 1 1  ? 24.832  9.585  0.567   1.00 0.00 ? 1  LEU A H2   4  
ATOM 1160 H H3   . LEU A 1 1  ? 24.789  8.438  -0.593  1.00 0.00 ? 1  LEU A H3   4  
ATOM 1161 N N    . GLN A 1 2  ? 24.094  5.460  0.485   1.00 0.00 ? 2  GLN A N    4  
ATOM 1162 C CA   . GLN A 1 2  ? 23.564  4.218  -0.129  1.00 0.00 ? 2  GLN A CA   4  
ATOM 1163 C C    . GLN A 1 2  ? 22.712  4.535  -1.391  1.00 0.00 ? 2  GLN A C    4  
ATOM 1164 O O    . GLN A 1 2  ? 22.836  5.608  -1.977  1.00 0.00 ? 2  GLN A O    4  
ATOM 1165 C CB   . GLN A 1 2  ? 22.804  3.451  0.960   1.00 0.00 ? 2  GLN A CB   4  
ATOM 1166 C CG   . GLN A 1 2  ? 23.158  1.974  1.095   1.00 0.00 ? 2  GLN A CG   4  
ATOM 1167 C CD   . GLN A 1 2  ? 23.713  1.706  2.500   1.00 0.00 ? 2  GLN A CD   4  
ATOM 1168 O OE1  . GLN A 1 2  ? 24.883  1.932  2.779   1.00 0.00 ? 2  GLN A OE1  4  
ATOM 1169 N NE2  . GLN A 1 2  ? 22.878  1.287  3.417   1.00 0.00 ? 2  GLN A NE2  4  
ATOM 1170 H H    . GLN A 1 2  ? 25.049  5.404  0.769   1.00 0.00 ? 2  GLN A H    4  
ATOM 1171 H HE21 . GLN A 1 2  ? 21.899  1.181  3.267   1.00 0.00 ? 2  GLN A HE21 4  
ATOM 1172 H HE22 . GLN A 1 2  ? 23.276  1.137  4.324   1.00 0.00 ? 2  GLN A HE22 4  
ATOM 1173 N N    . ARG A 1 3  ? 21.935  3.563  -1.848  1.00 0.00 ? 3  ARG A N    4  
ATOM 1174 C CA   . ARG A 1 3  ? 21.134  3.687  -3.085  1.00 0.00 ? 3  ARG A CA   4  
ATOM 1175 C C    . ARG A 1 3  ? 19.818  2.911  -2.966  1.00 0.00 ? 3  ARG A C    4  
ATOM 1176 O O    . ARG A 1 3  ? 19.279  2.780  -1.867  1.00 0.00 ? 3  ARG A O    4  
ATOM 1177 C CB   . ARG A 1 3  ? 21.998  3.192  -4.250  1.00 0.00 ? 3  ARG A CB   4  
ATOM 1178 C CG   . ARG A 1 3  ? 22.886  4.264  -4.903  1.00 0.00 ? 3  ARG A CG   4  
ATOM 1179 C CD   . ARG A 1 3  ? 23.930  3.605  -5.814  1.00 0.00 ? 3  ARG A CD   4  
ATOM 1180 N NE   . ARG A 1 3  ? 25.091  3.225  -4.993  1.00 0.00 ? 3  ARG A NE   4  
ATOM 1181 C CZ   . ARG A 1 3  ? 25.153  2.163  -4.189  1.00 0.00 ? 3  ARG A CZ   4  
ATOM 1182 N NH1  . ARG A 1 3  ? 25.194  0.931  -4.684  1.00 0.00 ? 3  ARG A NH1  4  
ATOM 1183 N NH2  . ARG A 1 3  ? 25.670  2.342  -2.980  1.00 0.00 ? 3  ARG A NH2  4  
ATOM 1184 H H    . ARG A 1 3  ? 21.832  2.713  -1.349  1.00 0.00 ? 3  ARG A H    4  
ATOM 1185 H HE   . ARG A 1 3  ? 25.950  3.652  -5.259  1.00 0.00 ? 3  ARG A HE   4  
ATOM 1186 H HH11 . ARG A 1 3  ? 25.168  0.788  -5.671  1.00 0.00 ? 3  ARG A HH11 4  
ATOM 1187 H HH12 . ARG A 1 3  ? 25.296  0.151  -4.061  1.00 0.00 ? 3  ARG A HH12 4  
ATOM 1188 H HH21 . ARG A 1 3  ? 25.792  3.278  -2.650  1.00 0.00 ? 3  ARG A HH21 4  
ATOM 1189 H HH22 . ARG A 1 3  ? 25.796  1.570  -2.361  1.00 0.00 ? 3  ARG A HH22 4  
ATOM 1190 N N    . MET A 1 4  ? 19.370  2.349  -4.083  1.00 0.00 ? 4  MET A N    4  
ATOM 1191 C CA   . MET A 1 4  ? 18.275  1.355  -4.173  1.00 0.00 ? 4  MET A CA   4  
ATOM 1192 C C    . MET A 1 4  ? 18.318  0.310  -3.055  1.00 0.00 ? 4  MET A C    4  
ATOM 1193 O O    . MET A 1 4  ? 17.279  0.068  -2.481  1.00 0.00 ? 4  MET A O    4  
ATOM 1194 C CB   . MET A 1 4  ? 18.273  0.674  -5.542  1.00 0.00 ? 4  MET A CB   4  
ATOM 1195 C CG   . MET A 1 4  ? 17.966  1.645  -6.694  1.00 0.00 ? 4  MET A CG   4  
ATOM 1196 S SD   . MET A 1 4  ? 16.372  2.525  -6.550  1.00 0.00 ? 4  MET A SD   4  
ATOM 1197 C CE   . MET A 1 4  ? 16.903  4.107  -5.920  1.00 0.00 ? 4  MET A CE   4  
ATOM 1198 H H    . MET A 1 4  ? 19.708  2.664  -4.979  1.00 0.00 ? 4  MET A H    4  
ATOM 1199 N N    . LYS A 1 5  ? 19.492  0.019  -2.527  1.00 0.00 ? 5  LYS A N    4  
ATOM 1200 C CA   . LYS A 1 5  ? 19.667  -0.896 -1.378  1.00 0.00 ? 5  LYS A CA   4  
ATOM 1201 C C    . LYS A 1 5  ? 18.966  -0.405 -0.084  1.00 0.00 ? 5  LYS A C    4  
ATOM 1202 O O    . LYS A 1 5  ? 18.093  -1.099 0.425   1.00 0.00 ? 5  LYS A O    4  
ATOM 1203 C CB   . LYS A 1 5  ? 21.165  -1.173 -1.181  1.00 0.00 ? 5  LYS A CB   4  
ATOM 1204 C CG   . LYS A 1 5  ? 21.927  -1.527 -2.487  1.00 0.00 ? 5  LYS A CG   4  
ATOM 1205 C CD   . LYS A 1 5  ? 21.252  -2.608 -3.341  1.00 0.00 ? 5  LYS A CD   4  
ATOM 1206 C CE   . LYS A 1 5  ? 22.072  -3.038 -4.561  1.00 0.00 ? 5  LYS A CE   4  
ATOM 1207 N NZ   . LYS A 1 5  ? 22.215  -1.998 -5.590  1.00 0.00 ? 5  LYS A NZ   4  
ATOM 1208 H H    . LYS A 1 5  ? 20.331  0.347  -2.953  1.00 0.00 ? 5  LYS A H    4  
ATOM 1209 H HZ1  . LYS A 1 5  ? 22.678  -1.197 -5.214  1.00 0.00 ? 5  LYS A HZ1  4  
ATOM 1210 H HZ2  . LYS A 1 5  ? 22.784  -2.375 -6.330  1.00 0.00 ? 5  LYS A HZ2  4  
ATOM 1211 H HZ3  . LYS A 1 5  ? 21.333  -1.751 -5.972  1.00 0.00 ? 5  LYS A HZ3  4  
ATOM 1212 N N    . GLN A 1 6  ? 19.180  0.858  0.302   1.00 0.00 ? 6  GLN A N    4  
ATOM 1213 C CA   . GLN A 1 6  ? 18.460  1.486  1.447   1.00 0.00 ? 6  GLN A CA   4  
ATOM 1214 C C    . GLN A 1 6  ? 17.051  1.977  1.036   1.00 0.00 ? 6  GLN A C    4  
ATOM 1215 O O    . GLN A 1 6  ? 16.066  1.705  1.714   1.00 0.00 ? 6  GLN A O    4  
ATOM 1216 C CB   . GLN A 1 6  ? 19.238  2.636  2.113   1.00 0.00 ? 6  GLN A CB   4  
ATOM 1217 C CG   . GLN A 1 6  ? 19.343  3.897  1.245   1.00 0.00 ? 6  GLN A CG   4  
ATOM 1218 C CD   . GLN A 1 6  ? 19.936  5.128  1.926   1.00 0.00 ? 6  GLN A CD   4  
ATOM 1219 O OE1  . GLN A 1 6  ? 20.721  5.080  2.853   1.00 0.00 ? 6  GLN A OE1  4  
ATOM 1220 N NE2  . GLN A 1 6  ? 19.593  6.279  1.393   1.00 0.00 ? 6  GLN A NE2  4  
ATOM 1221 H H    . GLN A 1 6  ? 19.717  1.492  -0.249  1.00 0.00 ? 6  GLN A H    4  
ATOM 1222 H HE21 . GLN A 1 6  ? 19.046  6.343  0.568   1.00 0.00 ? 6  GLN A HE21 4  
ATOM 1223 H HE22 . GLN A 1 6  ? 20.046  7.083  1.772   1.00 0.00 ? 6  GLN A HE22 4  
ATOM 1224 N N    . LEU A 1 7  ? 16.992  2.596  -0.141  1.00 0.00 ? 7  LEU A N    4  
ATOM 1225 C CA   . LEU A 1 7  ? 15.770  3.153  -0.735  1.00 0.00 ? 7  LEU A CA   4  
ATOM 1226 C C    . LEU A 1 7  ? 14.747  2.053  -1.052  1.00 0.00 ? 7  LEU A C    4  
ATOM 1227 O O    . LEU A 1 7  ? 13.565  2.344  -1.125  1.00 0.00 ? 7  LEU A O    4  
ATOM 1228 C CB   . LEU A 1 7  ? 16.091  3.980  -1.986  1.00 0.00 ? 7  LEU A CB   4  
ATOM 1229 C CG   . LEU A 1 7  ? 17.025  5.160  -1.657  1.00 0.00 ? 7  LEU A CG   4  
ATOM 1230 C CD1  . LEU A 1 7  ? 17.638  5.764  -2.914  1.00 0.00 ? 7  LEU A CD1  4  
ATOM 1231 C CD2  . LEU A 1 7  ? 16.308  6.279  -0.900  1.00 0.00 ? 7  LEU A CD2  4  
ATOM 1232 H H    . LEU A 1 7  ? 17.821  2.763  -0.688  1.00 0.00 ? 7  LEU A H    4  
ATOM 1233 N N    . GLU A 1 8  ? 15.201  0.801  -1.091  1.00 0.00 ? 8  GLU A N    4  
ATOM 1234 C CA   . GLU A 1 8  ? 14.378  -0.418 -1.176  1.00 0.00 ? 8  GLU A CA   4  
ATOM 1235 C C    . GLU A 1 8  ? 13.410  -0.468 -0.002  1.00 0.00 ? 8  GLU A C    4  
ATOM 1236 O O    . GLU A 1 8  ? 12.233  -0.314 -0.269  1.00 0.00 ? 8  GLU A O    4  
ATOM 1237 C CB   . GLU A 1 8  ? 15.228  -1.702 -1.159  1.00 0.00 ? 8  GLU A CB   4  
ATOM 1238 C CG   . GLU A 1 8  ? 15.421  -2.333 -2.539  1.00 0.00 ? 8  GLU A CG   4  
ATOM 1239 C CD   . GLU A 1 8  ? 14.228  -3.153 -3.021  1.00 0.00 ? 8  GLU A CD   4  
ATOM 1240 O OE1  . GLU A 1 8  ? 13.460  -3.743 -2.253  1.00 0.00 ? 8  GLU A OE1  4  
ATOM 1241 O OE2  . GLU A 1 8  ? 14.070  -3.267 -4.350  1.00 0.00 ? 8  GLU A OE2  4  
ATOM 1242 H H    . GLU A 1 8  ? 16.190  0.627  -1.207  1.00 0.00 ? 8  GLU A H    4  
ATOM 1243 H HE2  . GLU A 1 8  ? 13.301  -3.896 -4.447  1.00 0.00 ? 8  GLU A HE2  4  
ATOM 1244 N N    . ASP A 1 9  ? 13.932  -0.268 1.200   1.00 0.00 ? 9  ASP A N    4  
ATOM 1245 C CA   . ASP A 1 9  ? 13.087  -0.223 2.414   1.00 0.00 ? 9  ASP A CA   4  
ATOM 1246 C C    . ASP A 1 9  ? 12.029  0.911  2.334   1.00 0.00 ? 9  ASP A C    4  
ATOM 1247 O O    . ASP A 1 9  ? 10.859  0.632  2.571   1.00 0.00 ? 9  ASP A O    4  
ATOM 1248 C CB   . ASP A 1 9  ? 13.953  -0.151 3.669   1.00 0.00 ? 9  ASP A CB   4  
ATOM 1249 C CG   . ASP A 1 9  ? 13.090  -0.225 4.931   1.00 0.00 ? 9  ASP A CG   4  
ATOM 1250 O OD1  . ASP A 1 9  ? 12.481  -1.232 5.270   1.00 0.00 ? 9  ASP A OD1  4  
ATOM 1251 O OD2  . ASP A 1 9  ? 13.021  0.914  5.643   1.00 0.00 ? 9  ASP A OD2  4  
ATOM 1252 H H    . ASP A 1 9  ? 14.904  -0.049 1.350   1.00 0.00 ? 9  ASP A H    4  
ATOM 1253 H HD2  . ASP A 1 9  ? 12.243  0.740  6.245   1.00 0.00 ? 9  ASP A HD2  4  
ATOM 1254 N N    . LYS A 1 10 ? 12.404  2.024  1.719   1.00 0.00 ? 10 LYS A N    4  
ATOM 1255 C CA   . LYS A 1 10 ? 11.495  3.169  1.455   1.00 0.00 ? 10 LYS A CA   4  
ATOM 1256 C C    . LYS A 1 10 ? 10.456  2.901  0.337   1.00 0.00 ? 10 LYS A C    4  
ATOM 1257 O O    . LYS A 1 10 ? 9.253   3.054  0.535   1.00 0.00 ? 10 LYS A O    4  
ATOM 1258 C CB   . LYS A 1 10 ? 12.359  4.416  1.217   1.00 0.00 ? 10 LYS A CB   4  
ATOM 1259 C CG   . LYS A 1 10 ? 11.576  5.623  0.688   1.00 0.00 ? 10 LYS A CG   4  
ATOM 1260 C CD   . LYS A 1 10 ? 12.288  6.945  0.964   1.00 0.00 ? 10 LYS A CD   4  
ATOM 1261 C CE   . LYS A 1 10 ? 11.595  8.107  0.258   1.00 0.00 ? 10 LYS A CE   4  
ATOM 1262 N NZ   . LYS A 1 10 ? 12.035  8.177  -1.143  1.00 0.00 ? 10 LYS A NZ   4  
ATOM 1263 H H    . LYS A 1 10 ? 13.317  2.122  1.327   1.00 0.00 ? 10 LYS A H    4  
ATOM 1264 H HZ1  . LYS A 1 10 ? 11.895  7.290  -1.582  1.00 0.00 ? 10 LYS A HZ1  4  
ATOM 1265 H HZ2  . LYS A 1 10 ? 11.503  8.862  -1.626  1.00 0.00 ? 10 LYS A HZ2  4  
ATOM 1266 H HZ3  . LYS A 1 10 ? 13.003  8.425  -1.164  1.00 0.00 ? 10 LYS A HZ3  4  
ATOM 1267 N N    . VAL A 1 11 ? 10.938  2.480  -0.827  1.00 0.00 ? 11 VAL A N    4  
ATOM 1268 C CA   . VAL A 1 11 ? 10.129  2.140  -2.019  1.00 0.00 ? 11 VAL A CA   4  
ATOM 1269 C C    . VAL A 1 11 ? 9.233   0.902  -1.790  1.00 0.00 ? 11 VAL A C    4  
ATOM 1270 O O    . VAL A 1 11 ? 8.035   0.945  -2.044  1.00 0.00 ? 11 VAL A O    4  
ATOM 1271 C CB   . VAL A 1 11 ? 11.077  1.981  -3.235  1.00 0.00 ? 11 VAL A CB   4  
ATOM 1272 C CG1  . VAL A 1 11 ? 10.400  1.384  -4.484  1.00 0.00 ? 11 VAL A CG1  4  
ATOM 1273 C CG2  . VAL A 1 11 ? 11.658  3.344  -3.632  1.00 0.00 ? 11 VAL A CG2  4  
ATOM 1274 H H    . VAL A 1 11 ? 11.932  2.407  -0.969  1.00 0.00 ? 11 VAL A H    4  
ATOM 1275 N N    . GLU A 1 12 ? 9.797   -0.169 -1.236  1.00 0.00 ? 12 GLU A N    4  
ATOM 1276 C CA   . GLU A 1 12 ? 9.034   -1.380 -0.864  1.00 0.00 ? 12 GLU A CA   4  
ATOM 1277 C C    . GLU A 1 12 ? 7.979   -1.071 0.220   1.00 0.00 ? 12 GLU A C    4  
ATOM 1278 O O    . GLU A 1 12 ? 6.882   -1.613 0.158   1.00 0.00 ? 12 GLU A O    4  
ATOM 1279 C CB   . GLU A 1 12 ? 9.923   -2.577 -0.512  1.00 0.00 ? 12 GLU A CB   4  
ATOM 1280 C CG   . GLU A 1 12 ? 10.563  -2.641 0.894   1.00 0.00 ? 12 GLU A CG   4  
ATOM 1281 C CD   . GLU A 1 12 ? 9.611   -3.022 2.021   1.00 0.00 ? 12 GLU A CD   4  
ATOM 1282 O OE1  . GLU A 1 12 ? 8.552   -3.614 1.856   1.00 0.00 ? 12 GLU A OE1  4  
ATOM 1283 O OE2  . GLU A 1 12 ? 9.963   -2.644 3.269   1.00 0.00 ? 12 GLU A OE2  4  
ATOM 1284 H H    . GLU A 1 12 ? 10.788  -0.200 -1.022  1.00 0.00 ? 12 GLU A H    4  
ATOM 1285 H HE2  . GLU A 1 12 ? 9.266   -3.028 3.854   1.00 0.00 ? 12 GLU A HE2  4  
ATOM 1286 N N    . GLU A 1 13 ? 8.274   -0.079 1.067   1.00 0.00 ? 13 GLU A N    4  
ATOM 1287 C CA   . GLU A 1 13 ? 7.312   0.444  2.065   1.00 0.00 ? 13 GLU A CA   4  
ATOM 1288 C C    . GLU A 1 13 ? 6.030   0.982  1.417   1.00 0.00 ? 13 GLU A C    4  
ATOM 1289 O O    . GLU A 1 13 ? 4.969   0.888  2.023   1.00 0.00 ? 13 GLU A O    4  
ATOM 1290 C CB   . GLU A 1 13 ? 7.949   1.530  2.934   1.00 0.00 ? 13 GLU A CB   4  
ATOM 1291 C CG   . GLU A 1 13 ? 8.196   1.018  4.355   1.00 0.00 ? 13 GLU A CG   4  
ATOM 1292 C CD   . GLU A 1 13 ? 9.341   1.752  5.057   1.00 0.00 ? 13 GLU A CD   4  
ATOM 1293 O OE1  . GLU A 1 13 ? 10.301  1.149  5.531   1.00 0.00 ? 13 GLU A OE1  4  
ATOM 1294 O OE2  . GLU A 1 13 ? 9.226   3.085  5.232   1.00 0.00 ? 13 GLU A OE2  4  
ATOM 1295 H H    . GLU A 1 13 ? 9.158   0.409  1.051   1.00 0.00 ? 13 GLU A H    4  
ATOM 1296 H HE2  . GLU A 1 13 ? 10.075  3.330  5.693   1.00 0.00 ? 13 GLU A HE2  4  
ATOM 1297 N N    . LEU A 1 14 ? 6.132   1.358  0.142   1.00 0.00 ? 14 LEU A N    4  
ATOM 1298 C CA   . LEU A 1 14 ? 4.962   1.771  -0.662  1.00 0.00 ? 14 LEU A CA   4  
ATOM 1299 C C    . LEU A 1 14 ? 4.140   0.533  -1.036  1.00 0.00 ? 14 LEU A C    4  
ATOM 1300 O O    . LEU A 1 14 ? 3.062   0.392  -0.494  1.00 0.00 ? 14 LEU A O    4  
ATOM 1301 C CB   . LEU A 1 14 ? 5.318   2.550  -1.929  1.00 0.00 ? 14 LEU A CB   4  
ATOM 1302 C CG   . LEU A 1 14 ? 6.268   3.732  -1.682  1.00 0.00 ? 14 LEU A CG   4  
ATOM 1303 C CD1  . LEU A 1 14 ? 6.453   4.474  -3.006  1.00 0.00 ? 14 LEU A CD1  4  
ATOM 1304 C CD2  . LEU A 1 14 ? 5.805   4.701  -0.589  1.00 0.00 ? 14 LEU A CD2  4  
ATOM 1305 H H    . LEU A 1 14 ? 6.989   1.287  -0.370  1.00 0.00 ? 14 LEU A H    4  
ATOM 1306 N N    . LEU A 1 15 ? 4.700   -0.425 -1.765  1.00 0.00 ? 15 LEU A N    4  
ATOM 1307 C CA   . LEU A 1 15 ? 3.981   -1.658 -2.164  1.00 0.00 ? 15 LEU A CA   4  
ATOM 1308 C C    . LEU A 1 15 ? 3.345   -2.403 -0.967  1.00 0.00 ? 15 LEU A C    4  
ATOM 1309 O O    . LEU A 1 15 ? 2.134   -2.613 -0.993  1.00 0.00 ? 15 LEU A O    4  
ATOM 1310 C CB   . LEU A 1 15 ? 4.867   -2.622 -2.960  1.00 0.00 ? 15 LEU A CB   4  
ATOM 1311 C CG   . LEU A 1 15 ? 5.744   -1.943 -4.024  1.00 0.00 ? 15 LEU A CG   4  
ATOM 1312 C CD1  . LEU A 1 15 ? 6.444   -3.020 -4.826  1.00 0.00 ? 15 LEU A CD1  4  
ATOM 1313 C CD2  . LEU A 1 15 ? 4.988   -1.001 -4.973  1.00 0.00 ? 15 LEU A CD2  4  
ATOM 1314 H H    . LEU A 1 15 ? 5.584   -0.282 -2.214  1.00 0.00 ? 15 LEU A H    4  
ATOM 1315 N N    . SER A 1 16 ? 4.094   -2.534 0.128   1.00 0.00 ? 16 SER A N    4  
ATOM 1316 C CA   . SER A 1 16 ? 3.598   -3.091 1.416   1.00 0.00 ? 16 SER A CA   4  
ATOM 1317 C C    . SER A 1 16 ? 2.252   -2.499 1.868   1.00 0.00 ? 16 SER A C    4  
ATOM 1318 O O    . SER A 1 16 ? 1.331   -3.224 2.241   1.00 0.00 ? 16 SER A O    4  
ATOM 1319 C CB   . SER A 1 16 ? 4.615   -2.861 2.536   1.00 0.00 ? 16 SER A CB   4  
ATOM 1320 O OG   . SER A 1 16 ? 5.758   -3.662 2.248   1.00 0.00 ? 16 SER A OG   4  
ATOM 1321 H H    . SER A 1 16 ? 5.080   -2.343 0.122   1.00 0.00 ? 16 SER A H    4  
ATOM 1322 H HG   . SER A 1 16 ? 6.545   -3.352 2.781   1.00 0.00 ? 16 SER A HG   4  
ATOM 1323 N N    . LYS A 1 17 ? 2.134   -1.191 1.690   1.00 0.00 ? 17 LYS A N    4  
ATOM 1324 C CA   . LYS A 1 17 ? 0.895   -0.456 1.971   1.00 0.00 ? 17 LYS A CA   4  
ATOM 1325 C C    . LYS A 1 17 ? -0.038  -0.292 0.760   1.00 0.00 ? 17 LYS A C    4  
ATOM 1326 O O    . LYS A 1 17 ? -1.235  -0.535 0.859   1.00 0.00 ? 17 LYS A O    4  
ATOM 1327 C CB   . LYS A 1 17 ? 1.175   0.871  2.700   1.00 0.00 ? 17 LYS A CB   4  
ATOM 1328 C CG   . LYS A 1 17 ? 2.034   1.863  1.919   1.00 0.00 ? 17 LYS A CG   4  
ATOM 1329 C CD   . LYS A 1 17 ? 1.898   3.324  2.377   1.00 0.00 ? 17 LYS A CD   4  
ATOM 1330 C CE   . LYS A 1 17 ? 0.465   3.863  2.310   1.00 0.00 ? 17 LYS A CE   4  
ATOM 1331 N NZ   . LYS A 1 17 ? -0.197  3.499  1.040   1.00 0.00 ? 17 LYS A NZ   4  
ATOM 1332 H H    . LYS A 1 17 ? 2.880   -0.642 1.306   1.00 0.00 ? 17 LYS A H    4  
ATOM 1333 H HZ1  . LYS A 1 17 ? 0.341   3.834  0.259   1.00 0.00 ? 17 LYS A HZ1  4  
ATOM 1334 H HZ2  . LYS A 1 17 ? -0.272  2.500  0.994   1.00 0.00 ? 17 LYS A HZ2  4  
ATOM 1335 H HZ3  . LYS A 1 17 ? -1.108  3.907  1.016   1.00 0.00 ? 17 LYS A HZ3  4  
ATOM 1336 N N    . ASN A 1 18 ? 0.507   -0.052 -0.429  1.00 0.00 ? 18 ASN A N    4  
ATOM 1337 C CA   . ASN A 1 18 ? -0.243  0.018  -1.700  1.00 0.00 ? 18 ASN A CA   4  
ATOM 1338 C C    . ASN A 1 18 ? -1.069  -1.254 -1.981  1.00 0.00 ? 18 ASN A C    4  
ATOM 1339 O O    . ASN A 1 18 ? -2.187  -1.173 -2.486  1.00 0.00 ? 18 ASN A O    4  
ATOM 1340 C CB   . ASN A 1 18 ? 0.711   0.324  -2.860  1.00 0.00 ? 18 ASN A CB   4  
ATOM 1341 C CG   . ASN A 1 18 ? 0.095   1.169  -3.975  1.00 0.00 ? 18 ASN A CG   4  
ATOM 1342 O OD1  . ASN A 1 18 ? 0.765   1.954  -4.630  1.00 0.00 ? 18 ASN A OD1  4  
ATOM 1343 N ND2  . ASN A 1 18 ? -1.184  1.022  -4.231  1.00 0.00 ? 18 ASN A ND2  4  
ATOM 1344 H H    . ASN A 1 18 ? 1.489   0.139  -0.506  1.00 0.00 ? 18 ASN A H    4  
ATOM 1345 H HD21 . ASN A 1 18 ? -1.749  0.366  -3.733  1.00 0.00 ? 18 ASN A HD21 4  
ATOM 1346 H HD22 . ASN A 1 18 ? -1.562  1.597  -4.949  1.00 0.00 ? 18 ASN A HD22 4  
ATOM 1347 N N    . TYR A 1 19 ? -0.538  -2.398 -1.532  1.00 0.00 ? 19 TYR A N    4  
ATOM 1348 C CA   . TYR A 1 19 ? -1.222  -3.704 -1.532  1.00 0.00 ? 19 TYR A CA   4  
ATOM 1349 C C    . TYR A 1 19 ? -2.458  -3.740 -0.603  1.00 0.00 ? 19 TYR A C    4  
ATOM 1350 O O    . TYR A 1 19 ? -3.561  -3.996 -1.090  1.00 0.00 ? 19 TYR A O    4  
ATOM 1351 C CB   . TYR A 1 19 ? -0.238  -4.834 -1.187  1.00 0.00 ? 19 TYR A CB   4  
ATOM 1352 C CG   . TYR A 1 19 ? 0.640   -5.267 -2.374  1.00 0.00 ? 19 TYR A CG   4  
ATOM 1353 C CD1  . TYR A 1 19 ? 0.035   -5.575 -3.609  1.00 0.00 ? 19 TYR A CD1  4  
ATOM 1354 C CD2  . TYR A 1 19 ? 2.026   -5.428 -2.173  1.00 0.00 ? 19 TYR A CD2  4  
ATOM 1355 C CE1  . TYR A 1 19 ? 0.830   -6.047 -4.674  1.00 0.00 ? 19 TYR A CE1  4  
ATOM 1356 C CE2  . TYR A 1 19 ? 2.833   -5.897 -3.234  1.00 0.00 ? 19 TYR A CE2  4  
ATOM 1357 C CZ   . TYR A 1 19 ? 2.218   -6.201 -4.467  1.00 0.00 ? 19 TYR A CZ   4  
ATOM 1358 O OH   . TYR A 1 19 ? 2.989   -6.636 -5.497  1.00 0.00 ? 19 TYR A OH   4  
ATOM 1359 H H    . TYR A 1 19 ? 0.414   -2.423 -1.204  1.00 0.00 ? 19 TYR A H    4  
ATOM 1360 H HH   . TYR A 1 19 ? 3.939   -6.712 -5.206  1.00 0.00 ? 19 TYR A HH   4  
ATOM 1361 N N    . HIS A 1 20 ? -2.304  -3.234 0.622   1.00 0.00 ? 20 HIS A N    4  
ATOM 1362 C CA   . HIS A 1 20 ? -3.437  -3.117 1.561   1.00 0.00 ? 20 HIS A CA   4  
ATOM 1363 C C    . HIS A 1 20 ? -4.403  -1.963 1.214   1.00 0.00 ? 20 HIS A C    4  
ATOM 1364 O O    . HIS A 1 20 ? -5.571  -1.952 1.600   1.00 0.00 ? 20 HIS A O    4  
ATOM 1365 C CB   . HIS A 1 20 ? -2.973  -3.074 3.039   1.00 0.00 ? 20 HIS A CB   4  
ATOM 1366 C CG   . HIS A 1 20 ? -2.280  -1.809 3.582   1.00 0.00 ? 20 HIS A CG   4  
ATOM 1367 N ND1  . HIS A 1 20 ? -1.329  -1.805 4.510   1.00 0.00 ? 20 HIS A ND1  4  
ATOM 1368 C CD2  . HIS A 1 20 ? -2.661  -0.538 3.421   1.00 0.00 ? 20 HIS A CD2  4  
ATOM 1369 C CE1  . HIS A 1 20 ? -1.128  -0.567 4.925   1.00 0.00 ? 20 HIS A CE1  4  
ATOM 1370 N NE2  . HIS A 1 20 ? -1.918  0.225  4.205   1.00 0.00 ? 20 HIS A NE2  4  
ATOM 1371 H H    . HIS A 1 20 ? -1.451  -2.806 0.925   1.00 0.00 ? 20 HIS A H    4  
ATOM 1372 H HD1  . HIS A 1 20 ? -0.788  -2.606 4.792   1.00 0.00 ? 20 HIS A HD1  4  
ATOM 1373 H HE2  . HIS A 1 20 ? -1.779  1.202  4.066   1.00 0.00 ? 20 HIS A HE2  4  
ATOM 1374 N N    . LEU A 1 21 ? -3.890  -1.035 0.399   1.00 0.00 ? 21 LEU A N    4  
ATOM 1375 C CA   . LEU A 1 21 ? -4.625  0.142  -0.111  1.00 0.00 ? 21 LEU A CA   4  
ATOM 1376 C C    . LEU A 1 21 ? -5.751  -0.275 -1.061  1.00 0.00 ? 21 LEU A C    4  
ATOM 1377 O O    . LEU A 1 21 ? -6.897  0.053  -0.794  1.00 0.00 ? 21 LEU A O    4  
ATOM 1378 C CB   . LEU A 1 21 ? -3.639  1.117  -0.764  1.00 0.00 ? 21 LEU A CB   4  
ATOM 1379 C CG   . LEU A 1 21 ? -4.311  2.325  -1.436  1.00 0.00 ? 21 LEU A CG   4  
ATOM 1380 C CD1  . LEU A 1 21 ? -4.852  3.325  -0.407  1.00 0.00 ? 21 LEU A CD1  4  
ATOM 1381 C CD2  . LEU A 1 21 ? -3.337  3.005  -2.389  1.00 0.00 ? 21 LEU A CD2  4  
ATOM 1382 H H    . LEU A 1 21 ? -2.929  -1.069 0.136   1.00 0.00 ? 21 LEU A H    4  
ATOM 1383 N N    . GLU A 1 22 ? -5.438  -1.189 -1.973  1.00 0.00 ? 22 GLU A N    4  
ATOM 1384 C CA   . GLU A 1 22 ? -6.455  -1.750 -2.899  1.00 0.00 ? 22 GLU A CA   4  
ATOM 1385 C C    . GLU A 1 22 ? -7.595  -2.500 -2.193  1.00 0.00 ? 22 GLU A C    4  
ATOM 1386 O O    . GLU A 1 22 ? -8.736  -2.485 -2.654  1.00 0.00 ? 22 GLU A O    4  
ATOM 1387 C CB   . GLU A 1 22 ? -5.779  -2.586 -3.989  1.00 0.00 ? 22 GLU A CB   4  
ATOM 1388 C CG   . GLU A 1 22 ? -4.863  -1.747 -4.888  1.00 0.00 ? 22 GLU A CG   4  
ATOM 1389 C CD   . GLU A 1 22 ? -5.604  -0.548 -5.518  1.00 0.00 ? 22 GLU A CD   4  
ATOM 1390 O OE1  . GLU A 1 22 ? -5.454  0.595  -5.105  1.00 0.00 ? 22 GLU A OE1  4  
ATOM 1391 O OE2  . GLU A 1 22 ? -6.414  -0.819 -6.555  1.00 0.00 ? 22 GLU A OE2  4  
ATOM 1392 H H    . GLU A 1 22 ? -4.500  -1.511 -2.115  1.00 0.00 ? 22 GLU A H    4  
ATOM 1393 H HE2  . GLU A 1 22 ? -6.821  0.067  -6.779  1.00 0.00 ? 22 GLU A HE2  4  
ATOM 1394 N N    . ASN A 1 23 ? -7.295  -2.979 -0.989  1.00 0.00 ? 23 ASN A N    4  
ATOM 1395 C CA   . ASN A 1 23 ? -8.292  -3.578 -0.072  1.00 0.00 ? 23 ASN A CA   4  
ATOM 1396 C C    . ASN A 1 23 ? -9.082  -2.511 0.725   1.00 0.00 ? 23 ASN A C    4  
ATOM 1397 O O    . ASN A 1 23 ? -10.309 -2.523 0.682   1.00 0.00 ? 23 ASN A O    4  
ATOM 1398 C CB   . ASN A 1 23 ? -7.630  -4.580 0.877   1.00 0.00 ? 23 ASN A CB   4  
ATOM 1399 C CG   . ASN A 1 23 ? -7.258  -5.858 0.133   1.00 0.00 ? 23 ASN A CG   4  
ATOM 1400 O OD1  . ASN A 1 23 ? -6.107  -6.158 -0.148  1.00 0.00 ? 23 ASN A OD1  4  
ATOM 1401 N ND2  . ASN A 1 23 ? -8.262  -6.632 -0.223  1.00 0.00 ? 23 ASN A ND2  4  
ATOM 1402 H H    . ASN A 1 23 ? -6.356  -2.955 -0.641  1.00 0.00 ? 23 ASN A H    4  
ATOM 1403 H HD21 . ASN A 1 23 ? -9.200  -6.354 -0.068  1.00 0.00 ? 23 ASN A HD21 4  
ATOM 1404 H HD22 . ASN A 1 23 ? -8.023  -7.481 -0.694  1.00 0.00 ? 23 ASN A HD22 4  
ATOM 1405 N N    . GLU A 1 24 ? -8.370  -1.584 1.357   1.00 0.00 ? 24 GLU A N    4  
ATOM 1406 C CA   . GLU A 1 24 ? -9.019  -0.486 2.115   1.00 0.00 ? 24 GLU A CA   4  
ATOM 1407 C C    . GLU A 1 24 ? -9.892  0.418  1.229   1.00 0.00 ? 24 GLU A C    4  
ATOM 1408 O O    . GLU A 1 24 ? -11.051 0.640  1.543   1.00 0.00 ? 24 GLU A O    4  
ATOM 1409 C CB   . GLU A 1 24 ? -8.031  0.328  2.979   1.00 0.00 ? 24 GLU A CB   4  
ATOM 1410 C CG   . GLU A 1 24 ? -7.137  1.271  2.182   1.00 0.00 ? 24 GLU A CG   4  
ATOM 1411 C CD   . GLU A 1 24 ? -6.270  2.189  3.023   1.00 0.00 ? 24 GLU A CD   4  
ATOM 1412 O OE1  . GLU A 1 24 ? -5.223  1.833  3.543   1.00 0.00 ? 24 GLU A OE1  4  
ATOM 1413 O OE2  . GLU A 1 24 ? -6.655  3.485  3.073   1.00 0.00 ? 24 GLU A OE2  4  
ATOM 1414 H H    . GLU A 1 24 ? -7.370  -1.627 1.417   1.00 0.00 ? 24 GLU A H    4  
ATOM 1415 H HE2  . GLU A 1 24 ? -5.951  3.925  3.626   1.00 0.00 ? 24 GLU A HE2  4  
ATOM 1416 N N    . VAL A 1 25 ? -9.379  0.787  0.051   1.00 0.00 ? 25 VAL A N    4  
ATOM 1417 C CA   . VAL A 1 25 ? -10.114 1.543  -0.982  1.00 0.00 ? 25 VAL A CA   4  
ATOM 1418 C C    . VAL A 1 25 ? -11.474 0.903  -1.303  1.00 0.00 ? 25 VAL A C    4  
ATOM 1419 O O    . VAL A 1 25 ? -12.448 1.632  -1.394  1.00 0.00 ? 25 VAL A O    4  
ATOM 1420 C CB   . VAL A 1 25 ? -9.248  1.794  -2.237  1.00 0.00 ? 25 VAL A CB   4  
ATOM 1421 C CG1  . VAL A 1 25 ? -10.014 2.381  -3.430  1.00 0.00 ? 25 VAL A CG1  4  
ATOM 1422 C CG2  . VAL A 1 25 ? -8.144  2.796  -1.896  1.00 0.00 ? 25 VAL A CG2  4  
ATOM 1423 H H    . VAL A 1 25 ? -8.410  0.647  -0.161  1.00 0.00 ? 25 VAL A H    4  
ATOM 1424 N N    . ALA A 1 26 ? -11.559 -0.425 -1.254  1.00 0.00 ? 26 ALA A N    4  
ATOM 1425 C CA   . ALA A 1 26 ? -12.840 -1.141 -1.427  1.00 0.00 ? 26 ALA A CA   4  
ATOM 1426 C C    . ALA A 1 26 ? -13.844 -0.840 -0.288  1.00 0.00 ? 26 ALA A C    4  
ATOM 1427 O O    . ALA A 1 26 ? -14.811 -0.128 -0.540  1.00 0.00 ? 26 ALA A O    4  
ATOM 1428 C CB   . ALA A 1 26 ? -12.573 -2.640 -1.594  1.00 0.00 ? 26 ALA A CB   4  
ATOM 1429 H H    . ALA A 1 26 ? -10.777 -0.998 -1.027  1.00 0.00 ? 26 ALA A H    4  
ATOM 1430 N N    . ARG A 1 27 ? -13.498 -1.199 0.956   1.00 0.00 ? 27 ARG A N    4  
ATOM 1431 C CA   . ARG A 1 27 ? -14.320 -0.858 2.143   1.00 0.00 ? 27 ARG A CA   4  
ATOM 1432 C C    . ARG A 1 27 ? -14.633 0.647  2.283   1.00 0.00 ? 27 ARG A C    4  
ATOM 1433 O O    . ARG A 1 27 ? -15.665 1.032  2.820   1.00 0.00 ? 27 ARG A O    4  
ATOM 1434 C CB   . ARG A 1 27 ? -13.735 -1.357 3.475   1.00 0.00 ? 27 ARG A CB   4  
ATOM 1435 C CG   . ARG A 1 27 ? -12.393 -0.717 3.863   1.00 0.00 ? 27 ARG A CG   4  
ATOM 1436 C CD   . ARG A 1 27 ? -11.855 -1.039 5.269   1.00 0.00 ? 27 ARG A CD   4  
ATOM 1437 N NE   . ARG A 1 27 ? -11.939 -2.483 5.557   1.00 0.00 ? 27 ARG A NE   4  
ATOM 1438 C CZ   . ARG A 1 27 ? -11.530 -3.462 4.747   1.00 0.00 ? 27 ARG A CZ   4  
ATOM 1439 N NH1  . ARG A 1 27 ? -10.342 -3.452 4.157   1.00 0.00 ? 27 ARG A NH1  4  
ATOM 1440 N NH2  . ARG A 1 27 ? -12.209 -4.599 4.776   1.00 0.00 ? 27 ARG A NH2  4  
ATOM 1441 H H    . ARG A 1 27 ? -12.708 -1.783 1.131   1.00 0.00 ? 27 ARG A H    4  
ATOM 1442 H HE   . ARG A 1 27 ? -12.108 -2.701 6.513   1.00 0.00 ? 27 ARG A HE   4  
ATOM 1443 H HH11 . ARG A 1 27 ? -9.727  -2.678 4.325   1.00 0.00 ? 27 ARG A HH11 4  
ATOM 1444 H HH12 . ARG A 1 27 ? -10.074 -4.200 3.563   1.00 0.00 ? 27 ARG A HH12 4  
ATOM 1445 H HH21 . ARG A 1 27 ? -13.100 -4.607 5.247   1.00 0.00 ? 27 ARG A HH21 4  
ATOM 1446 H HH22 . ARG A 1 27 ? -11.931 -5.365 4.209   1.00 0.00 ? 27 ARG A HH22 4  
ATOM 1447 N N    . LEU A 1 28 ? -13.672 1.463  1.865   1.00 0.00 ? 28 LEU A N    4  
ATOM 1448 C CA   . LEU A 1 28 ? -13.736 2.926  1.820   1.00 0.00 ? 28 LEU A CA   4  
ATOM 1449 C C    . LEU A 1 28 ? -14.732 3.444  0.759   1.00 0.00 ? 28 LEU A C    4  
ATOM 1450 O O    . LEU A 1 28 ? -15.637 4.209  1.067   1.00 0.00 ? 28 LEU A O    4  
ATOM 1451 C CB   . LEU A 1 28 ? -12.306 3.436  1.619   1.00 0.00 ? 28 LEU A CB   4  
ATOM 1452 C CG   . LEU A 1 28 ? -12.174 4.839  1.040   1.00 0.00 ? 28 LEU A CG   4  
ATOM 1453 C CD1  . LEU A 1 28 ? -12.592 5.898  2.056   1.00 0.00 ? 28 LEU A CD1  4  
ATOM 1454 C CD2  . LEU A 1 28 ? -10.744 5.102  0.575   1.00 0.00 ? 28 LEU A CD2  4  
ATOM 1455 H H    . LEU A 1 28 ? -12.773 1.085  1.619   1.00 0.00 ? 28 LEU A H    4  
ATOM 1456 N N    . LYS A 1 29 ? -14.555 3.013  -0.480  1.00 0.00 ? 29 LYS A N    4  
ATOM 1457 C CA   . LYS A 1 29 ? -15.420 3.409  -1.606  1.00 0.00 ? 29 LYS A CA   4  
ATOM 1458 C C    . LYS A 1 29 ? -16.870 2.935  -1.400  1.00 0.00 ? 29 LYS A C    4  
ATOM 1459 O O    . LYS A 1 29 ? -17.812 3.668  -1.713  1.00 0.00 ? 29 LYS A O    4  
ATOM 1460 C CB   . LYS A 1 29 ? -14.830 2.872  -2.904  1.00 0.00 ? 29 LYS A CB   4  
ATOM 1461 C CG   . LYS A 1 29 ? -15.170 3.771  -4.104  1.00 0.00 ? 29 LYS A CG   4  
ATOM 1462 C CD   . LYS A 1 29 ? -13.880 4.133  -4.840  1.00 0.00 ? 29 LYS A CD   4  
ATOM 1463 C CE   . LYS A 1 29 ? -14.142 5.022  -6.069  1.00 0.00 ? 29 LYS A CE   4  
ATOM 1464 N NZ   . LYS A 1 29 ? -14.498 4.209  -7.242  1.00 0.00 ? 29 LYS A NZ   4  
ATOM 1465 H H    . LYS A 1 29 ? -13.764 2.440  -0.751  1.00 0.00 ? 29 LYS A H    4  
ATOM 1466 H HZ1  . LYS A 1 29 ? -15.275 3.630  -7.019  1.00 0.00 ? 29 LYS A HZ1  4  
ATOM 1467 H HZ2  . LYS A 1 29 ? -14.745 4.817  -7.997  1.00 0.00 ? 29 LYS A HZ2  4  
ATOM 1468 H HZ3  . LYS A 1 29 ? -13.713 3.652  -7.512  1.00 0.00 ? 29 LYS A HZ3  4  
ATOM 1469 N N    . LYS A 1 30 ? -17.012 1.840  -0.654  1.00 0.00 ? 30 LYS A N    4  
ATOM 1470 C CA   . LYS A 1 30 ? -18.306 1.336  -0.146  1.00 0.00 ? 30 LYS A CA   4  
ATOM 1471 C C    . LYS A 1 30 ? -19.071 2.360  0.738   1.00 0.00 ? 30 LYS A C    4  
ATOM 1472 O O    . LYS A 1 30 ? -20.292 2.456  0.663   1.00 0.00 ? 30 LYS A O    4  
ATOM 1473 C CB   . LYS A 1 30 ? -18.006 -0.008 0.530   1.00 0.00 ? 30 LYS A CB   4  
ATOM 1474 C CG   . LYS A 1 30 ? -18.504 -0.245 1.955   1.00 0.00 ? 30 LYS A CG   4  
ATOM 1475 C CD   . LYS A 1 30 ? -18.011 -1.622 2.364   1.00 0.00 ? 30 LYS A CD   4  
ATOM 1476 C CE   . LYS A 1 30 ? -18.703 -2.141 3.625   1.00 0.00 ? 30 LYS A CE   4  
ATOM 1477 N NZ   . LYS A 1 30 ? -18.516 -3.592 3.569   1.00 0.00 ? 30 LYS A NZ   4  
ATOM 1478 H H    . LYS A 1 30 ? -16.230 1.267  -0.427  1.00 0.00 ? 30 LYS A H    4  
ATOM 1479 H HZ1  . LYS A 1 30 ? -18.733 -3.912 2.651   1.00 0.00 ? 30 LYS A HZ1  4  
ATOM 1480 H HZ2  . LYS A 1 30 ? -17.568 -3.809 3.803   1.00 0.00 ? 30 LYS A HZ2  4  
ATOM 1481 H HZ3  . LYS A 1 30 ? -19.120 -4.034 4.234   1.00 0.00 ? 30 LYS A HZ3  4  
ATOM 1482 N N    . LEU A 1 31 ? -18.316 3.215  1.431   1.00 0.00 ? 31 LEU A N    4  
ATOM 1483 C CA   . LEU A 1 31 ? -18.881 4.295  2.266   1.00 0.00 ? 31 LEU A CA   4  
ATOM 1484 C C    . LEU A 1 31 ? -19.531 5.389  1.398   1.00 0.00 ? 31 LEU A C    4  
ATOM 1485 O O    . LEU A 1 31 ? -20.658 5.801  1.680   1.00 0.00 ? 31 LEU A O    4  
ATOM 1486 C CB   . LEU A 1 31 ? -17.818 4.901  3.186   1.00 0.00 ? 31 LEU A CB   4  
ATOM 1487 C CG   . LEU A 1 31 ? -17.045 3.856  4.005   1.00 0.00 ? 31 LEU A CG   4  
ATOM 1488 C CD1  . LEU A 1 31 ? -15.864 4.528  4.720   1.00 0.00 ? 31 LEU A CD1  4  
ATOM 1489 C CD2  . LEU A 1 31 ? -17.918 3.116  5.023   1.00 0.00 ? 31 LEU A CD2  4  
ATOM 1490 H H    . LEU A 1 31 ? -17.318 3.208  1.371   1.00 0.00 ? 31 LEU A H    4  
ATOM 1491 N N    . VAL A 1 32 ? -18.932 5.650  0.236   1.00 0.00 ? 32 VAL A N    4  
ATOM 1492 C CA   . VAL A 1 32 ? -19.457 6.586  -0.777  1.00 0.00 ? 32 VAL A CA   4  
ATOM 1493 C C    . VAL A 1 32 ? -20.415 5.850  -1.772  1.00 0.00 ? 32 VAL A C    4  
ATOM 1494 O O    . VAL A 1 32 ? -20.849 6.395  -2.784  1.00 0.00 ? 32 VAL A O    4  
ATOM 1495 C CB   . VAL A 1 32 ? -18.281 7.310  -1.476  1.00 0.00 ? 32 VAL A CB   4  
ATOM 1496 C CG1  . VAL A 1 32 ? -18.717 8.389  -2.477  1.00 0.00 ? 32 VAL A CG1  4  
ATOM 1497 C CG2  . VAL A 1 32 ? -17.347 7.994  -0.464  1.00 0.00 ? 32 VAL A CG2  4  
ATOM 1498 H H    . VAL A 1 32 ? -18.112 5.149  -0.058  1.00 0.00 ? 32 VAL A H    4  
ATOM 1499 N N    . GLY A 1 33 ? -20.845 4.655  -1.360  1.00 0.00 ? 33 GLY A N    4  
ATOM 1500 C CA   . GLY A 1 33 ? -21.796 3.817  -2.102  1.00 0.00 ? 33 GLY A CA   4  
ATOM 1501 C C    . GLY A 1 33 ? -23.212 3.929  -1.515  1.00 0.00 ? 33 GLY A C    4  
ATOM 1502 O O    . GLY A 1 33 ? -24.171 4.151  -2.244  1.00 0.00 ? 33 GLY A O    4  
ATOM 1503 H H    . GLY A 1 33 ? -20.495 4.253  -0.514  1.00 0.00 ? 33 GLY A H    4  
ATOM 1504 N N    . GLU A 1 34 ? -23.282 3.758  -0.186  1.00 0.00 ? 34 GLU A N    4  
ATOM 1505 C CA   . GLU A 1 34 ? -24.541 3.757  0.619   1.00 0.00 ? 34 GLU A CA   4  
ATOM 1506 C C    . GLU A 1 34 ? -24.266 3.592  2.122   1.00 0.00 ? 34 GLU A C    4  
ATOM 1507 O O    . GLU A 1 34 ? -24.310 2.509  2.693   1.00 0.00 ? 34 GLU A O    4  
ATOM 1508 C CB   . GLU A 1 34 ? -25.537 2.705  0.098   1.00 0.00 ? 34 GLU A CB   4  
ATOM 1509 C CG   . GLU A 1 34 ? -24.950 1.292  -0.044  1.00 0.00 ? 34 GLU A CG   4  
ATOM 1510 C CD   . GLU A 1 34 ? -25.492 0.522  -1.254  1.00 0.00 ? 34 GLU A CD   4  
ATOM 1511 O OE1  . GLU A 1 34 ? -26.625 0.653  -1.696  1.00 0.00 ? 34 GLU A OE1  4  
ATOM 1512 O OE2  . GLU A 1 34 ? -24.643 -0.369 -1.809  1.00 0.00 ? 34 GLU A OE2  4  
ATOM 1513 H H    . GLU A 1 34 ? -22.455 3.611  0.347   1.00 0.00 ? 34 GLU A H    4  
ATOM 1514 H HE2  . GLU A 1 34 ? -25.175 -0.746 -2.564  1.00 0.00 ? 34 GLU A HE2  4  
ATOM 1515 N N    . ARG A 1 35 ? -23.918 4.713  2.765   1.00 0.00 ? 35 ARG A N    4  
ATOM 1516 C CA   . ARG A 1 35 ? -23.662 4.716  4.222   1.00 0.00 ? 35 ARG A CA   4  
ATOM 1517 C C    . ARG A 1 35 ? -24.902 5.154  5.029   1.00 0.00 ? 35 ARG A C    4  
ATOM 1518 O O    . ARG A 1 35 ? -24.991 6.347  5.394   1.00 0.00 ? 35 ARG A O    4  
ATOM 1519 C CB   . ARG A 1 35 ? -22.414 5.569  4.501   1.00 0.00 ? 35 ARG A CB   4  
ATOM 1520 C CG   . ARG A 1 35 ? -21.822 5.268  5.876   1.00 0.00 ? 35 ARG A CG   4  
ATOM 1521 C CD   . ARG A 1 35 ? -21.980 6.416  6.885   1.00 0.00 ? 35 ARG A CD   4  
ATOM 1522 N NE   . ARG A 1 35 ? -21.288 6.015  8.114   1.00 0.00 ? 35 ARG A NE   4  
ATOM 1523 C CZ   . ARG A 1 35 ? -19.959 5.864  8.232   1.00 0.00 ? 35 ARG A CZ   4  
ATOM 1524 N NH1  . ARG A 1 35 ? -19.115 6.527  7.461   1.00 0.00 ? 35 ARG A NH1  4  
ATOM 1525 N NH2  . ARG A 1 35 ? -19.531 4.670  8.618   1.00 0.00 ? 35 ARG A NH2  4  
ATOM 1526 O OXT  . ARG A 1 35 ? -25.789 4.290  5.195   1.00 0.00 ? 35 ARG A OXT  4  
ATOM 1527 H H    . ARG A 1 35 ? -23.689 5.547  2.279   1.00 0.00 ? 35 ARG A H    4  
ATOM 1528 H HE   . ARG A 1 35 ? -21.825 6.058  8.948   1.00 0.00 ? 35 ARG A HE   4  
ATOM 1529 H HH11 . ARG A 1 35 ? -19.466 7.288  6.905   1.00 0.00 ? 35 ARG A HH11 4  
ATOM 1530 H HH12 . ARG A 1 35 ? -18.136 6.357  7.505   1.00 0.00 ? 35 ARG A HH12 4  
ATOM 1531 H HH21 . ARG A 1 35 ? -20.201 3.947  8.794   1.00 0.00 ? 35 ARG A HH21 4  
ATOM 1532 H HH22 . ARG A 1 35 ? -18.554 4.479  8.683   1.00 0.00 ? 35 ARG A HH22 4  
ATOM 1533 N N    . LEU A 1 1  ? 27.941  1.320  -5.734  1.00 0.00 ? 1  LEU A N    5  
ATOM 1534 C CA   . LEU A 1 1  ? 27.018  2.359  -6.246  1.00 0.00 ? 1  LEU A CA   5  
ATOM 1535 C C    . LEU A 1 1  ? 25.549  1.851  -6.291  1.00 0.00 ? 1  LEU A C    5  
ATOM 1536 O O    . LEU A 1 1  ? 25.262  0.778  -5.775  1.00 0.00 ? 1  LEU A O    5  
ATOM 1537 C CB   . LEU A 1 1  ? 27.536  2.772  -7.640  1.00 0.00 ? 1  LEU A CB   5  
ATOM 1538 C CG   . LEU A 1 1  ? 27.894  4.261  -7.673  1.00 0.00 ? 1  LEU A CG   5  
ATOM 1539 C CD1  . LEU A 1 1  ? 28.953  4.507  -8.739  1.00 0.00 ? 1  LEU A CD1  5  
ATOM 1540 C CD2  . LEU A 1 1  ? 26.658  5.117  -7.983  1.00 0.00 ? 1  LEU A CD2  5  
ATOM 1541 H H1   . LEU A 1 1  ? 27.660  1.039  -4.819  1.00 0.00 ? 1  LEU A H1   5  
ATOM 1542 H H2   . LEU A 1 1  ? 27.931  0.529  -6.342  1.00 0.00 ? 1  LEU A H2   5  
ATOM 1543 H H3   . LEU A 1 1  ? 28.870  1.690  -5.690  1.00 0.00 ? 1  LEU A H3   5  
ATOM 1544 N N    . GLN A 1 2  ? 24.690  2.569  -7.017  1.00 0.00 ? 2  GLN A N    5  
ATOM 1545 C CA   . GLN A 1 2  ? 23.245  2.235  -7.223  1.00 0.00 ? 2  GLN A CA   5  
ATOM 1546 C C    . GLN A 1 2  ? 22.490  2.196  -5.886  1.00 0.00 ? 2  GLN A C    5  
ATOM 1547 O O    . GLN A 1 2  ? 22.596  1.268  -5.093  1.00 0.00 ? 2  GLN A O    5  
ATOM 1548 C CB   . GLN A 1 2  ? 23.038  0.901  -7.952  1.00 0.00 ? 2  GLN A CB   5  
ATOM 1549 C CG   . GLN A 1 2  ? 23.857  0.766  -9.240  1.00 0.00 ? 2  GLN A CG   5  
ATOM 1550 C CD   . GLN A 1 2  ? 24.774  -0.475 -9.225  1.00 0.00 ? 2  GLN A CD   5  
ATOM 1551 O OE1  . GLN A 1 2  ? 24.689  -1.343 -10.083 1.00 0.00 ? 2  GLN A OE1  5  
ATOM 1552 N NE2  . GLN A 1 2  ? 25.625  -0.622 -8.239  1.00 0.00 ? 2  GLN A NE2  5  
ATOM 1553 H H    . GLN A 1 2  ? 24.999  3.388  -7.493  1.00 0.00 ? 2  GLN A H    5  
ATOM 1554 H HE21 . GLN A 1 2  ? 25.536  -0.107 -7.382  1.00 0.00 ? 2  GLN A HE21 5  
ATOM 1555 H HE22 . GLN A 1 2  ? 26.233  -1.406 -8.300  1.00 0.00 ? 2  GLN A HE22 5  
ATOM 1556 N N    . ARG A 1 3  ? 21.571  3.137  -5.750  1.00 0.00 ? 3  ARG A N    5  
ATOM 1557 C CA   . ARG A 1 3  ? 20.750  3.212  -4.520  1.00 0.00 ? 3  ARG A CA   5  
ATOM 1558 C C    . ARG A 1 3  ? 19.490  2.329  -4.518  1.00 0.00 ? 3  ARG A C    5  
ATOM 1559 O O    . ARG A 1 3  ? 18.808  2.230  -3.500  1.00 0.00 ? 3  ARG A O    5  
ATOM 1560 C CB   . ARG A 1 3  ? 20.471  4.657  -4.128  1.00 0.00 ? 3  ARG A CB   5  
ATOM 1561 C CG   . ARG A 1 3  ? 21.720  5.269  -3.498  1.00 0.00 ? 3  ARG A CG   5  
ATOM 1562 C CD   . ARG A 1 3  ? 21.377  6.254  -2.371  1.00 0.00 ? 3  ARG A CD   5  
ATOM 1563 N NE   . ARG A 1 3  ? 20.935  7.554  -2.876  1.00 0.00 ? 3  ARG A NE   5  
ATOM 1564 C CZ   . ARG A 1 3  ? 20.233  8.463  -2.196  1.00 0.00 ? 3  ARG A CZ   5  
ATOM 1565 N NH1  . ARG A 1 3  ? 19.731  8.217  -0.993  1.00 0.00 ? 3  ARG A NH1  5  
ATOM 1566 N NH2  . ARG A 1 3  ? 20.162  9.717  -2.626  1.00 0.00 ? 3  ARG A NH2  5  
ATOM 1567 H H    . ARG A 1 3  ? 21.356  3.811  -6.458  1.00 0.00 ? 3  ARG A H    5  
ATOM 1568 H HE   . ARG A 1 3  ? 21.232  7.798  -3.807  1.00 0.00 ? 3  ARG A HE   5  
ATOM 1569 H HH11 . ARG A 1 3  ? 19.845  7.305  -0.591  1.00 0.00 ? 3  ARG A HH11 5  
ATOM 1570 H HH12 . ARG A 1 3  ? 19.233  8.920  -0.501  1.00 0.00 ? 3  ARG A HH12 5  
ATOM 1571 H HH21 . ARG A 1 3  ? 20.642  9.993  -3.462  1.00 0.00 ? 3  ARG A HH21 5  
ATOM 1572 H HH22 . ARG A 1 3  ? 19.651  10.385 -2.100  1.00 0.00 ? 3  ARG A HH22 5  
ATOM 1573 N N    . MET A 1 4  ? 19.489  1.397  -5.473  1.00 0.00 ? 4  MET A N    5  
ATOM 1574 C CA   . MET A 1 4  ? 18.379  0.446  -5.710  1.00 0.00 ? 4  MET A CA   5  
ATOM 1575 C C    . MET A 1 4  ? 18.387  -0.752 -4.741  1.00 0.00 ? 4  MET A C    5  
ATOM 1576 O O    . MET A 1 4  ? 17.617  -1.678 -4.905  1.00 0.00 ? 4  MET A O    5  
ATOM 1577 C CB   . MET A 1 4  ? 18.417  -0.037 -7.160  1.00 0.00 ? 4  MET A CB   5  
ATOM 1578 C CG   . MET A 1 4  ? 18.275  1.088  -8.192  1.00 0.00 ? 4  MET A CG   5  
ATOM 1579 S SD   . MET A 1 4  ? 16.794  2.150  -7.975  1.00 0.00 ? 4  MET A SD   5  
ATOM 1580 C CE   . MET A 1 4  ? 17.528  3.588  -7.211  1.00 0.00 ? 4  MET A CE   5  
ATOM 1581 H H    . MET A 1 4  ? 20.299  1.223  -6.031  1.00 0.00 ? 4  MET A H    5  
ATOM 1582 N N    . LYS A 1 5  ? 19.250  -0.661 -3.743  1.00 0.00 ? 5  LYS A N    5  
ATOM 1583 C CA   . LYS A 1 5  ? 19.388  -1.677 -2.681  1.00 0.00 ? 5  LYS A CA   5  
ATOM 1584 C C    . LYS A 1 5  ? 18.907  -1.148 -1.301  1.00 0.00 ? 5  LYS A C    5  
ATOM 1585 O O    . LYS A 1 5  ? 18.275  -1.863 -0.534  1.00 0.00 ? 5  LYS A O    5  
ATOM 1586 C CB   . LYS A 1 5  ? 20.841  -2.155 -2.608  1.00 0.00 ? 5  LYS A CB   5  
ATOM 1587 C CG   . LYS A 1 5  ? 21.471  -2.611 -3.949  1.00 0.00 ? 5  LYS A CG   5  
ATOM 1588 C CD   . LYS A 1 5  ? 20.607  -3.589 -4.747  1.00 0.00 ? 5  LYS A CD   5  
ATOM 1589 C CE   . LYS A 1 5  ? 21.408  -4.523 -5.664  1.00 0.00 ? 5  LYS A CE   5  
ATOM 1590 N NZ   . LYS A 1 5  ? 22.214  -3.816 -6.673  1.00 0.00 ? 5  LYS A NZ   5  
ATOM 1591 H H    . LYS A 1 5  ? 19.950  0.046  -3.759  1.00 0.00 ? 5  LYS A H    5  
ATOM 1592 H HZ1  . LYS A 1 5  ? 22.821  -3.158 -6.224  1.00 0.00 ? 5  LYS A HZ1  5  
ATOM 1593 H HZ2  . LYS A 1 5  ? 22.767  -4.488 -7.165  1.00 0.00 ? 5  LYS A HZ2  5  
ATOM 1594 H HZ3  . LYS A 1 5  ? 21.620  -3.347 -7.334  1.00 0.00 ? 5  LYS A HZ3  5  
ATOM 1595 N N    . GLN A 1 6  ? 19.068  0.165  -1.113  1.00 0.00 ? 6  GLN A N    5  
ATOM 1596 C CA   . GLN A 1 6  ? 18.594  0.897  0.079   1.00 0.00 ? 6  GLN A CA   5  
ATOM 1597 C C    . GLN A 1 6  ? 17.223  1.555  -0.128  1.00 0.00 ? 6  GLN A C    5  
ATOM 1598 O O    . GLN A 1 6  ? 16.313  1.361  0.663   1.00 0.00 ? 6  GLN A O    5  
ATOM 1599 C CB   . GLN A 1 6  ? 19.609  1.969  0.463   1.00 0.00 ? 6  GLN A CB   5  
ATOM 1600 C CG   . GLN A 1 6  ? 20.701  1.417  1.385   1.00 0.00 ? 6  GLN A CG   5  
ATOM 1601 C CD   . GLN A 1 6  ? 21.938  2.299  1.501   1.00 0.00 ? 6  GLN A CD   5  
ATOM 1602 O OE1  . GLN A 1 6  ? 23.001  1.872  1.924   1.00 0.00 ? 6  GLN A OE1  5  
ATOM 1603 N NE2  . GLN A 1 6  ? 21.877  3.571  1.118   1.00 0.00 ? 6  GLN A NE2  5  
ATOM 1604 H H    . GLN A 1 6  ? 19.536  0.723  -1.787  1.00 0.00 ? 6  GLN A H    5  
ATOM 1605 H HE21 . GLN A 1 6  ? 21.026  3.986  0.822   1.00 0.00 ? 6  GLN A HE21 5  
ATOM 1606 H HE22 . GLN A 1 6  ? 22.722  4.081  1.192   1.00 0.00 ? 6  GLN A HE22 5  
ATOM 1607 N N    . LEU A 1 7  ? 17.074  2.245  -1.267  1.00 0.00 ? 7  LEU A N    5  
ATOM 1608 C CA   . LEU A 1 7  ? 15.783  2.848  -1.657  1.00 0.00 ? 7  LEU A CA   5  
ATOM 1609 C C    . LEU A 1 7  ? 14.699  1.767  -1.810  1.00 0.00 ? 7  LEU A C    5  
ATOM 1610 O O    . LEU A 1 7  ? 13.573  2.012  -1.393  1.00 0.00 ? 7  LEU A O    5  
ATOM 1611 C CB   . LEU A 1 7  ? 15.861  3.643  -2.957  1.00 0.00 ? 7  LEU A CB   5  
ATOM 1612 C CG   . LEU A 1 7  ? 16.827  4.831  -2.868  1.00 0.00 ? 7  LEU A CG   5  
ATOM 1613 C CD1  . LEU A 1 7  ? 16.870  5.538  -4.230  1.00 0.00 ? 7  LEU A CD1  5  
ATOM 1614 C CD2  . LEU A 1 7  ? 16.434  5.859  -1.796  1.00 0.00 ? 7  LEU A CD2  5  
ATOM 1615 H H    . LEU A 1 7  ? 17.816  2.384  -1.919  1.00 0.00 ? 7  LEU A H    5  
ATOM 1616 N N    . GLU A 1 8  ? 15.093  0.576  -2.243  1.00 0.00 ? 8  GLU A N    5  
ATOM 1617 C CA   . GLU A 1 8  ? 14.200  -0.598 -2.231  1.00 0.00 ? 8  GLU A CA   5  
ATOM 1618 C C    . GLU A 1 8  ? 13.608  -0.897 -0.850  1.00 0.00 ? 8  GLU A C    5  
ATOM 1619 O O    . GLU A 1 8  ? 12.402  -0.944 -0.768  1.00 0.00 ? 8  GLU A O    5  
ATOM 1620 C CB   . GLU A 1 8  ? 14.863  -1.859 -2.774  1.00 0.00 ? 8  GLU A CB   5  
ATOM 1621 C CG   . GLU A 1 8  ? 14.610  -1.984 -4.279  1.00 0.00 ? 8  GLU A CG   5  
ATOM 1622 C CD   . GLU A 1 8  ? 15.142  -3.302 -4.858  1.00 0.00 ? 8  GLU A CD   5  
ATOM 1623 O OE1  . GLU A 1 8  ? 14.682  -3.774 -5.890  1.00 0.00 ? 8  GLU A OE1  5  
ATOM 1624 O OE2  . GLU A 1 8  ? 16.105  -3.963 -4.187  1.00 0.00 ? 8  GLU A OE2  5  
ATOM 1625 H H    . GLU A 1 8  ? 15.991  0.427  -2.650  1.00 0.00 ? 8  GLU A H    5  
ATOM 1626 H HE2  . GLU A 1 8  ? 16.369  -4.699 -4.803  1.00 0.00 ? 8  GLU A HE2  5  
ATOM 1627 N N    . ASP A 1 9  ? 14.407  -0.796 0.217   1.00 0.00 ? 9  ASP A N    5  
ATOM 1628 C CA   . ASP A 1 9  ? 13.912  -0.988 1.597   1.00 0.00 ? 9  ASP A CA   5  
ATOM 1629 C C    . ASP A 1 9  ? 12.950  0.148  2.052   1.00 0.00 ? 9  ASP A C    5  
ATOM 1630 O O    . ASP A 1 9  ? 11.927  -0.129 2.669   1.00 0.00 ? 9  ASP A O    5  
ATOM 1631 C CB   . ASP A 1 9  ? 15.134  -1.115 2.517   1.00 0.00 ? 9  ASP A CB   5  
ATOM 1632 C CG   . ASP A 1 9  ? 14.805  -1.907 3.790   1.00 0.00 ? 9  ASP A CG   5  
ATOM 1633 O OD1  . ASP A 1 9  ? 14.800  -3.132 3.827   1.00 0.00 ? 9  ASP A OD1  5  
ATOM 1634 O OD2  . ASP A 1 9  ? 14.518  -1.181 4.889   1.00 0.00 ? 9  ASP A OD2  5  
ATOM 1635 H H    . ASP A 1 9  ? 15.371  -0.569 0.144   1.00 0.00 ? 9  ASP A H    5  
ATOM 1636 H HD2  . ASP A 1 9  ? 14.342  -1.877 5.584   1.00 0.00 ? 9  ASP A HD2  5  
ATOM 1637 N N    . LYS A 1 10 ? 13.217  1.358  1.562   1.00 0.00 ? 10 LYS A N    5  
ATOM 1638 C CA   . LYS A 1 10 ? 12.370  2.562  1.772   1.00 0.00 ? 10 LYS A CA   5  
ATOM 1639 C C    . LYS A 1 10 ? 11.033  2.484  0.991   1.00 0.00 ? 10 LYS A C    5  
ATOM 1640 O O    . LYS A 1 10 ? 9.971   2.731  1.528   1.00 0.00 ? 10 LYS A O    5  
ATOM 1641 C CB   . LYS A 1 10 ? 13.193  3.810  1.444   1.00 0.00 ? 10 LYS A CB   5  
ATOM 1642 C CG   . LYS A 1 10 ? 12.357  5.091  1.295   1.00 0.00 ? 10 LYS A CG   5  
ATOM 1643 C CD   . LYS A 1 10 ? 13.144  6.351  1.647   1.00 0.00 ? 10 LYS A CD   5  
ATOM 1644 C CE   . LYS A 1 10 ? 12.281  7.596  1.417   1.00 0.00 ? 10 LYS A CE   5  
ATOM 1645 N NZ   . LYS A 1 10 ? 12.609  8.208  0.121   1.00 0.00 ? 10 LYS A NZ   5  
ATOM 1646 H H    . LYS A 1 10 ? 14.003  1.508  0.969   1.00 0.00 ? 10 LYS A H    5  
ATOM 1647 H HZ1  . LYS A 1 10 ? 12.532  7.527  -0.602  1.00 0.00 ? 10 LYS A HZ1  5  
ATOM 1648 H HZ2  . LYS A 1 10 ? 11.969  8.954  -0.059  1.00 0.00 ? 10 LYS A HZ2  5  
ATOM 1649 H HZ3  . LYS A 1 10 ? 13.537  8.573  0.156   1.00 0.00 ? 10 LYS A HZ3  5  
ATOM 1650 N N    . VAL A 1 11 ? 11.140  2.168  -0.295  1.00 0.00 ? 11 VAL A N    5  
ATOM 1651 C CA   . VAL A 1 11 ? 9.988   1.982  -1.202  1.00 0.00 ? 11 VAL A CA   5  
ATOM 1652 C C    . VAL A 1 11 ? 9.187   0.700  -0.868  1.00 0.00 ? 11 VAL A C    5  
ATOM 1653 O O    . VAL A 1 11 ? 7.972   0.718  -0.974  1.00 0.00 ? 11 VAL A O    5  
ATOM 1654 C CB   . VAL A 1 11 ? 10.468  2.084  -2.656  1.00 0.00 ? 11 VAL A CB   5  
ATOM 1655 C CG1  . VAL A 1 11 ? 9.438   1.673  -3.710  1.00 0.00 ? 11 VAL A CG1  5  
ATOM 1656 C CG2  . VAL A 1 11 ? 10.873  3.529  -2.958  1.00 0.00 ? 11 VAL A CG2  5  
ATOM 1657 H H    . VAL A 1 11 ? 12.038  2.098  -0.735  1.00 0.00 ? 11 VAL A H    5  
ATOM 1658 N N    . GLU A 1 12 ? 9.870   -0.317 -0.361  1.00 0.00 ? 12 GLU A N    5  
ATOM 1659 C CA   . GLU A 1 12 ? 9.251   -1.577 0.106   1.00 0.00 ? 12 GLU A CA   5  
ATOM 1660 C C    . GLU A 1 12 ? 8.170   -1.314 1.169   1.00 0.00 ? 12 GLU A C    5  
ATOM 1661 O O    . GLU A 1 12 ? 7.016   -1.669 0.915   1.00 0.00 ? 12 GLU A O    5  
ATOM 1662 C CB   . GLU A 1 12 ? 10.288  -2.577 0.620   1.00 0.00 ? 12 GLU A CB   5  
ATOM 1663 C CG   . GLU A 1 12 ? 9.742   -3.858 1.256   1.00 0.00 ? 12 GLU A CG   5  
ATOM 1664 C CD   . GLU A 1 12 ? 8.866   -4.743 0.359   1.00 0.00 ? 12 GLU A CD   5  
ATOM 1665 O OE1  . GLU A 1 12 ? 8.058   -4.324 -0.464  1.00 0.00 ? 12 GLU A OE1  5  
ATOM 1666 O OE2  . GLU A 1 12 ? 8.936   -6.061 0.582   1.00 0.00 ? 12 GLU A OE2  5  
ATOM 1667 H H    . GLU A 1 12 ? 10.874  -0.363 -0.408  1.00 0.00 ? 12 GLU A H    5  
ATOM 1668 H HE2  . GLU A 1 12 ? 8.279   -6.434 -0.074  1.00 0.00 ? 12 GLU A HE2  5  
ATOM 1669 N N    . GLU A 1 13 ? 8.530   -0.585 2.211   1.00 0.00 ? 13 GLU A N    5  
ATOM 1670 C CA   . GLU A 1 13 ? 7.570   -0.195 3.271   1.00 0.00 ? 13 GLU A CA   5  
ATOM 1671 C C    . GLU A 1 13 ? 6.402   0.663  2.746   1.00 0.00 ? 13 GLU A C    5  
ATOM 1672 O O    . GLU A 1 13 ? 5.304   0.617  3.282   1.00 0.00 ? 13 GLU A O    5  
ATOM 1673 C CB   . GLU A 1 13 ? 8.281   0.456  4.468   1.00 0.00 ? 13 GLU A CB   5  
ATOM 1674 C CG   . GLU A 1 13 ? 8.935   1.814  4.218   1.00 0.00 ? 13 GLU A CG   5  
ATOM 1675 C CD   . GLU A 1 13 ? 8.136   3.025  4.720   1.00 0.00 ? 13 GLU A CD   5  
ATOM 1676 O OE1  . GLU A 1 13 ? 6.979   2.959  5.122   1.00 0.00 ? 13 GLU A OE1  5  
ATOM 1677 O OE2  . GLU A 1 13 ? 8.804   4.189  4.779   1.00 0.00 ? 13 GLU A OE2  5  
ATOM 1678 H H    . GLU A 1 13 ? 9.476   -0.279 2.348   1.00 0.00 ? 13 GLU A H    5  
ATOM 1679 H HE2  . GLU A 1 13 ? 8.145   4.822  5.175   1.00 0.00 ? 13 GLU A HE2  5  
ATOM 1680 N N    . LEU A 1 14 ? 6.647   1.350  1.621   1.00 0.00 ? 14 LEU A N    5  
ATOM 1681 C CA   . LEU A 1 14 ? 5.591   2.100  0.918   1.00 0.00 ? 14 LEU A CA   5  
ATOM 1682 C C    . LEU A 1 14 ? 4.684   1.125  0.168   1.00 0.00 ? 14 LEU A C    5  
ATOM 1683 O O    . LEU A 1 14 ? 3.572   0.941  0.623   1.00 0.00 ? 14 LEU A O    5  
ATOM 1684 C CB   . LEU A 1 14 ? 6.126   3.155  -0.061  1.00 0.00 ? 14 LEU A CB   5  
ATOM 1685 C CG   . LEU A 1 14 ? 7.148   4.121  0.568   1.00 0.00 ? 14 LEU A CG   5  
ATOM 1686 C CD1  . LEU A 1 14 ? 7.555   5.140  -0.495  1.00 0.00 ? 14 LEU A CD1  5  
ATOM 1687 C CD2  . LEU A 1 14 ? 6.621   4.839  1.819   1.00 0.00 ? 14 LEU A CD2  5  
ATOM 1688 H H    . LEU A 1 14 ? 7.529   1.314  1.163   1.00 0.00 ? 14 LEU A H    5  
ATOM 1689 N N    . LEU A 1 15 ? 5.216   0.375  -0.798  1.00 0.00 ? 15 LEU A N    5  
ATOM 1690 C CA   . LEU A 1 15 ? 4.448   -0.588 -1.613  1.00 0.00 ? 15 LEU A CA   5  
ATOM 1691 C C    . LEU A 1 15 ? 3.697   -1.619 -0.757  1.00 0.00 ? 15 LEU A C    5  
ATOM 1692 O O    . LEU A 1 15 ? 2.482   -1.694 -0.878  1.00 0.00 ? 15 LEU A O    5  
ATOM 1693 C CB   . LEU A 1 15 ? 5.310   -1.341 -2.628  1.00 0.00 ? 15 LEU A CB   5  
ATOM 1694 C CG   . LEU A 1 15 ? 6.251   -0.456 -3.451  1.00 0.00 ? 15 LEU A CG   5  
ATOM 1695 C CD1  . LEU A 1 15 ? 6.925   -1.308 -4.520  1.00 0.00 ? 15 LEU A CD1  5  
ATOM 1696 C CD2  . LEU A 1 15 ? 5.592   0.775  -4.095  1.00 0.00 ? 15 LEU A CD2  5  
ATOM 1697 H H    . LEU A 1 15 ? 6.172   0.493  -1.074  1.00 0.00 ? 15 LEU A H    5  
ATOM 1698 N N    . SER A 1 16 ? 4.377   -2.236 0.214   1.00 0.00 ? 16 SER A N    5  
ATOM 1699 C CA   . SER A 1 16 ? 3.776   -3.180 1.192   1.00 0.00 ? 16 SER A CA   5  
ATOM 1700 C C    . SER A 1 16 ? 2.484   -2.622 1.835   1.00 0.00 ? 16 SER A C    5  
ATOM 1701 O O    . SER A 1 16 ? 1.488   -3.331 1.970   1.00 0.00 ? 16 SER A O    5  
ATOM 1702 C CB   . SER A 1 16 ? 4.765   -3.520 2.313   1.00 0.00 ? 16 SER A CB   5  
ATOM 1703 O OG   . SER A 1 16 ? 5.069   -2.338 3.052   1.00 0.00 ? 16 SER A OG   5  
ATOM 1704 H H    . SER A 1 16 ? 5.360   -2.054 0.350   1.00 0.00 ? 16 SER A H    5  
ATOM 1705 H HG   . SER A 1 16 ? 5.669   -2.548 3.829   1.00 0.00 ? 16 SER A HG   5  
ATOM 1706 N N    . LYS A 1 17 ? 2.501   -1.310 2.060   1.00 0.00 ? 17 LYS A N    5  
ATOM 1707 C CA   . LYS A 1 17 ? 1.363   -0.532 2.587   1.00 0.00 ? 17 LYS A CA   5  
ATOM 1708 C C    . LYS A 1 17 ? 0.439   0.030  1.494   1.00 0.00 ? 17 LYS A C    5  
ATOM 1709 O O    . LYS A 1 17 ? -0.761  -0.195 1.516   1.00 0.00 ? 17 LYS A O    5  
ATOM 1710 C CB   . LYS A 1 17 ? 1.855   0.553  3.539   1.00 0.00 ? 17 LYS A CB   5  
ATOM 1711 C CG   . LYS A 1 17 ? 2.514   -0.084 4.778   1.00 0.00 ? 17 LYS A CG   5  
ATOM 1712 C CD   . LYS A 1 17 ? 2.340   0.731  6.059   1.00 0.00 ? 17 LYS A CD   5  
ATOM 1713 C CE   . LYS A 1 17 ? 3.473   1.733  6.334   1.00 0.00 ? 17 LYS A CE   5  
ATOM 1714 N NZ   . LYS A 1 17 ? 3.476   2.824  5.356   1.00 0.00 ? 17 LYS A NZ   5  
ATOM 1715 H H    . LYS A 1 17 ? 3.356   -0.793 1.967   1.00 0.00 ? 17 LYS A H    5  
ATOM 1716 H HZ1  . LYS A 1 17 ? 3.601   2.432  4.437   1.00 0.00 ? 17 LYS A HZ1  5  
ATOM 1717 H HZ2  . LYS A 1 17 ? 2.621   3.332  5.412   1.00 0.00 ? 17 LYS A HZ2  5  
ATOM 1718 H HZ3  . LYS A 1 17 ? 4.242   3.431  5.555   1.00 0.00 ? 17 LYS A HZ3  5  
ATOM 1719 N N    . ASN A 1 18 ? 0.997   0.623  0.444   1.00 0.00 ? 18 ASN A N    5  
ATOM 1720 C CA   . ASN A 1 18 ? 0.263   1.114  -0.739  1.00 0.00 ? 18 ASN A CA   5  
ATOM 1721 C C    . ASN A 1 18 ? -0.610  0.008  -1.393  1.00 0.00 ? 18 ASN A C    5  
ATOM 1722 O O    . ASN A 1 18 ? -1.703  0.292  -1.882  1.00 0.00 ? 18 ASN A O    5  
ATOM 1723 C CB   . ASN A 1 18 ? 1.250   1.703  -1.753  1.00 0.00 ? 18 ASN A CB   5  
ATOM 1724 C CG   . ASN A 1 18 ? 0.661   2.829  -2.609  1.00 0.00 ? 18 ASN A CG   5  
ATOM 1725 O OD1  . ASN A 1 18 ? 1.319   3.820  -2.902  1.00 0.00 ? 18 ASN A OD1  5  
ATOM 1726 N ND2  . ASN A 1 18 ? -0.584  2.726  -3.012  1.00 0.00 ? 18 ASN A ND2  5  
ATOM 1727 H H    . ASN A 1 18 ? 1.984   0.823  0.443   1.00 0.00 ? 18 ASN A H    5  
ATOM 1728 H HD21 . ASN A 1 18 ? -1.156  1.946  -2.745  1.00 0.00 ? 18 ASN A HD21 5  
ATOM 1729 H HD22 . ASN A 1 18 ? -0.938  3.480  -3.557  1.00 0.00 ? 18 ASN A HD22 5  
ATOM 1730 N N    . TYR A 1 19 ? -0.139  -1.235 -1.316  1.00 0.00 ? 19 TYR A N    5  
ATOM 1731 C CA   . TYR A 1 19 ? -0.882  -2.446 -1.700  1.00 0.00 ? 19 TYR A CA   5  
ATOM 1732 C C    . TYR A 1 19 ? -2.108  -2.669 -0.785  1.00 0.00 ? 19 TYR A C    5  
ATOM 1733 O O    . TYR A 1 19 ? -3.233  -2.615 -1.266  1.00 0.00 ? 19 TYR A O    5  
ATOM 1734 C CB   . TYR A 1 19 ? 0.012   -3.695 -1.691  1.00 0.00 ? 19 TYR A CB   5  
ATOM 1735 C CG   . TYR A 1 19 ? 0.963   -3.764 -2.900  1.00 0.00 ? 19 TYR A CG   5  
ATOM 1736 C CD1  . TYR A 1 19 ? 0.463   -3.555 -4.195  1.00 0.00 ? 19 TYR A CD1  5  
ATOM 1737 C CD2  . TYR A 1 19 ? 2.323   -4.100 -2.670  1.00 0.00 ? 19 TYR A CD2  5  
ATOM 1738 C CE1  . TYR A 1 19 ? 1.342   -3.657 -5.299  1.00 0.00 ? 19 TYR A CE1  5  
ATOM 1739 C CE2  . TYR A 1 19 ? 3.198   -4.185 -3.760  1.00 0.00 ? 19 TYR A CE2  5  
ATOM 1740 C CZ   . TYR A 1 19 ? 2.700   -3.963 -5.063  1.00 0.00 ? 19 TYR A CZ   5  
ATOM 1741 O OH   . TYR A 1 19 ? 3.550   -4.023 -6.118  1.00 0.00 ? 19 TYR A OH   5  
ATOM 1742 H H    . TYR A 1 19 ? 0.812   -1.402 -1.022  1.00 0.00 ? 19 TYR A H    5  
ATOM 1743 H HH   . TYR A 1 19 ? 3.025   -3.925 -6.964  1.00 0.00 ? 19 TYR A HH   5  
ATOM 1744 N N    . HIS A 1 20 ? -1.883  -2.640 0.523   1.00 0.00 ? 20 HIS A N    5  
ATOM 1745 C CA   . HIS A 1 20 ? -2.990  -2.753 1.491   1.00 0.00 ? 20 HIS A CA   5  
ATOM 1746 C C    . HIS A 1 20 ? -3.906  -1.501 1.494   1.00 0.00 ? 20 HIS A C    5  
ATOM 1747 O O    . HIS A 1 20 ? -4.998  -1.560 2.025   1.00 0.00 ? 20 HIS A O    5  
ATOM 1748 C CB   . HIS A 1 20 ? -2.529  -3.143 2.906   1.00 0.00 ? 20 HIS A CB   5  
ATOM 1749 C CG   . HIS A 1 20 ? -1.863  -2.094 3.807   1.00 0.00 ? 20 HIS A CG   5  
ATOM 1750 N ND1  . HIS A 1 20 ? -0.946  -2.370 4.735   1.00 0.00 ? 20 HIS A ND1  5  
ATOM 1751 C CD2  . HIS A 1 20 ? -2.189  -0.820 3.966   1.00 0.00 ? 20 HIS A CD2  5  
ATOM 1752 C CE1  . HIS A 1 20 ? -0.730  -1.283 5.455   1.00 0.00 ? 20 HIS A CE1  5  
ATOM 1753 N NE2  . HIS A 1 20 ? -1.439  -0.296 4.932   1.00 0.00 ? 20 HIS A NE2  5  
ATOM 1754 H H    . HIS A 1 20 ? -0.991  -2.420 0.934   1.00 0.00 ? 20 HIS A H    5  
ATOM 1755 H HD1  . HIS A 1 20 ? -0.423  -3.220 4.788   1.00 0.00 ? 20 HIS A HD1  5  
ATOM 1756 H HE2  . HIS A 1 20 ? -1.219  0.677  5.012   1.00 0.00 ? 20 HIS A HE2  5  
ATOM 1757 N N    . LEU A 1 21 ? -3.460  -0.390 0.906   1.00 0.00 ? 21 LEU A N    5  
ATOM 1758 C CA   . LEU A 1 21 ? -4.255  0.848  0.767   1.00 0.00 ? 21 LEU A CA   5  
ATOM 1759 C C    . LEU A 1 21 ? -5.486  0.659  -0.155  1.00 0.00 ? 21 LEU A C    5  
ATOM 1760 O O    . LEU A 1 21 ? -6.560  1.165  0.141   1.00 0.00 ? 21 LEU A O    5  
ATOM 1761 C CB   . LEU A 1 21 ? -3.315  1.962  0.288   1.00 0.00 ? 21 LEU A CB   5  
ATOM 1762 C CG   . LEU A 1 21 ? -4.001  3.218  -0.264  1.00 0.00 ? 21 LEU A CG   5  
ATOM 1763 C CD1  . LEU A 1 21 ? -4.717  4.029  0.821   1.00 0.00 ? 21 LEU A CD1  5  
ATOM 1764 C CD2  . LEU A 1 21 ? -2.971  4.085  -0.992  1.00 0.00 ? 21 LEU A CD2  5  
ATOM 1765 H H    . LEU A 1 21 ? -2.505  -0.313 0.631   1.00 0.00 ? 21 LEU A H    5  
ATOM 1766 N N    . GLU A 1 22 ? -5.322  -0.152 -1.194  1.00 0.00 ? 22 GLU A N    5  
ATOM 1767 C CA   . GLU A 1 22 ? -6.433  -0.478 -2.116  1.00 0.00 ? 22 GLU A CA   5  
ATOM 1768 C C    . GLU A 1 22 ? -7.613  -1.167 -1.398  1.00 0.00 ? 22 GLU A C    5  
ATOM 1769 O O    . GLU A 1 22 ? -8.763  -0.959 -1.781  1.00 0.00 ? 22 GLU A O    5  
ATOM 1770 C CB   . GLU A 1 22 ? -5.924  -1.297 -3.318  1.00 0.00 ? 22 GLU A CB   5  
ATOM 1771 C CG   . GLU A 1 22 ? -5.706  -2.788 -3.020  1.00 0.00 ? 22 GLU A CG   5  
ATOM 1772 C CD   . GLU A 1 22 ? -5.013  -3.532 -4.153  1.00 0.00 ? 22 GLU A CD   5  
ATOM 1773 O OE1  . GLU A 1 22 ? -5.346  -3.431 -5.330  1.00 0.00 ? 22 GLU A OE1  5  
ATOM 1774 O OE2  . GLU A 1 22 ? -4.034  -4.379 -3.792  1.00 0.00 ? 22 GLU A OE2  5  
ATOM 1775 H H    . GLU A 1 22 ? -4.429  -0.570 -1.410  1.00 0.00 ? 22 GLU A H    5  
ATOM 1776 H HE2  . GLU A 1 22 ? -3.722  -4.767 -4.648  1.00 0.00 ? 22 GLU A HE2  5  
ATOM 1777 N N    . ASN A 1 23 ? -7.314  -1.867 -0.301  1.00 0.00 ? 23 ASN A N    5  
ATOM 1778 C CA   . ASN A 1 23 ? -8.325  -2.521 0.567   1.00 0.00 ? 23 ASN A CA   5  
ATOM 1779 C C    . ASN A 1 23 ? -9.381  -1.513 1.057   1.00 0.00 ? 23 ASN A C    5  
ATOM 1780 O O    . ASN A 1 23 ? -10.569 -1.838 1.137   1.00 0.00 ? 23 ASN A O    5  
ATOM 1781 C CB   . ASN A 1 23 ? -7.659  -3.248 1.754   1.00 0.00 ? 23 ASN A CB   5  
ATOM 1782 C CG   . ASN A 1 23 ? -7.430  -2.467 3.055   1.00 0.00 ? 23 ASN A CG   5  
ATOM 1783 O OD1  . ASN A 1 23 ? -7.278  -1.255 3.140   1.00 0.00 ? 23 ASN A OD1  5  
ATOM 1784 N ND2  . ASN A 1 23 ? -7.458  -3.144 4.178   1.00 0.00 ? 23 ASN A ND2  5  
ATOM 1785 H H    . ASN A 1 23 ? -6.364  -1.948 0.025   1.00 0.00 ? 23 ASN A H    5  
ATOM 1786 H HD21 . ASN A 1 23 ? -7.608  -4.119 4.198   1.00 0.00 ? 23 ASN A HD21 5  
ATOM 1787 H HD22 . ASN A 1 23 ? -7.290  -2.591 4.991   1.00 0.00 ? 23 ASN A HD22 5  
ATOM 1788 N N    . GLU A 1 24 ? -8.930  -0.273 1.206   1.00 0.00 ? 24 GLU A N    5  
ATOM 1789 C CA   . GLU A 1 24 ? -9.720  0.868  1.691   1.00 0.00 ? 24 GLU A CA   5  
ATOM 1790 C C    . GLU A 1 24 ? -10.685 1.313  0.599   1.00 0.00 ? 24 GLU A C    5  
ATOM 1791 O O    . GLU A 1 24 ? -11.882 1.162  0.788   1.00 0.00 ? 24 GLU A O    5  
ATOM 1792 C CB   . GLU A 1 24 ? -8.826  2.003  2.175   1.00 0.00 ? 24 GLU A CB   5  
ATOM 1793 C CG   . GLU A 1 24 ? -9.643  3.047  2.949   1.00 0.00 ? 24 GLU A CG   5  
ATOM 1794 C CD   . GLU A 1 24 ? -9.436  2.943  4.463   1.00 0.00 ? 24 GLU A CD   5  
ATOM 1795 O OE1  . GLU A 1 24 ? -9.785  1.984  5.139   1.00 0.00 ? 24 GLU A OE1  5  
ATOM 1796 O OE2  . GLU A 1 24 ? -8.815  3.994  5.031   1.00 0.00 ? 24 GLU A OE2  5  
ATOM 1797 H H    . GLU A 1 24 ? -7.949  -0.075 1.102   1.00 0.00 ? 24 GLU A H    5  
ATOM 1798 H HE2  . GLU A 1 24 ? -8.764  3.730  5.990   1.00 0.00 ? 24 GLU A HE2  5  
ATOM 1799 N N    . VAL A 1 25 ? -10.157 1.720  -0.549  1.00 0.00 ? 25 VAL A N    5  
ATOM 1800 C CA   . VAL A 1 25 ? -10.946 2.054  -1.764  1.00 0.00 ? 25 VAL A CA   5  
ATOM 1801 C C    . VAL A 1 25 ? -12.102 1.046  -2.011  1.00 0.00 ? 25 VAL A C    5  
ATOM 1802 O O    . VAL A 1 25 ? -13.238 1.484  -2.156  1.00 0.00 ? 25 VAL A O    5  
ATOM 1803 C CB   . VAL A 1 25 ? -9.999  2.220  -2.970  1.00 0.00 ? 25 VAL A CB   5  
ATOM 1804 C CG1  . VAL A 1 25 ? -10.728 2.384  -4.312  1.00 0.00 ? 25 VAL A CG1  5  
ATOM 1805 C CG2  . VAL A 1 25 ? -9.119  3.460  -2.776  1.00 0.00 ? 25 VAL A CG2  5  
ATOM 1806 H H    . VAL A 1 25 ? -9.192  1.958  -0.605  1.00 0.00 ? 25 VAL A H    5  
ATOM 1807 N N    . ALA A 1 26 ? -11.825 -0.232 -1.770  1.00 0.00 ? 26 ALA A N    5  
ATOM 1808 C CA   . ALA A 1 26 ? -12.829 -1.308 -1.851  1.00 0.00 ? 26 ALA A CA   5  
ATOM 1809 C C    . ALA A 1 26 ? -13.940 -1.177 -0.780  1.00 0.00 ? 26 ALA A C    5  
ATOM 1810 O O    . ALA A 1 26 ? -15.056 -0.803 -1.110  1.00 0.00 ? 26 ALA A O    5  
ATOM 1811 C CB   . ALA A 1 26 ? -12.127 -2.671 -1.782  1.00 0.00 ? 26 ALA A CB   5  
ATOM 1812 H H    . ALA A 1 26 ? -10.918 -0.527 -1.467  1.00 0.00 ? 26 ALA A H    5  
ATOM 1813 N N    . ARG A 1 27 ? -13.568 -1.339 0.487   1.00 0.00 ? 27 ARG A N    5  
ATOM 1814 C CA   . ARG A 1 27 ? -14.481 -1.178 1.652   1.00 0.00 ? 27 ARG A CA   5  
ATOM 1815 C C    . ARG A 1 27 ? -15.244 0.171  1.655   1.00 0.00 ? 27 ARG A C    5  
ATOM 1816 O O    . ARG A 1 27 ? -16.444 0.211  1.871   1.00 0.00 ? 27 ARG A O    5  
ATOM 1817 C CB   . ARG A 1 27 ? -13.648 -1.418 2.925   1.00 0.00 ? 27 ARG A CB   5  
ATOM 1818 C CG   . ARG A 1 27 ? -12.808 -0.219 3.401   1.00 0.00 ? 27 ARG A CG   5  
ATOM 1819 C CD   . ARG A 1 27 ? -11.744 -0.505 4.484   1.00 0.00 ? 27 ARG A CD   5  
ATOM 1820 N NE   . ARG A 1 27 ? -12.244 -1.347 5.580   1.00 0.00 ? 27 ARG A NE   5  
ATOM 1821 C CZ   . ARG A 1 27 ? -13.457 -1.265 6.144   1.00 0.00 ? 27 ARG A CZ   5  
ATOM 1822 N NH1  . ARG A 1 27 ? -13.977 -0.107 6.526   1.00 0.00 ? 27 ARG A NH1  5  
ATOM 1823 N NH2  . ARG A 1 27 ? -14.029 -2.383 6.514   1.00 0.00 ? 27 ARG A NH2  5  
ATOM 1824 H H    . ARG A 1 27 ? -12.643 -1.662 0.735   1.00 0.00 ? 27 ARG A H    5  
ATOM 1825 H HE   . ARG A 1 27 ? -11.535 -1.827 6.087   1.00 0.00 ? 27 ARG A HE   5  
ATOM 1826 H HH11 . ARG A 1 27 ? -13.460 0.741  6.398   1.00 0.00 ? 27 ARG A HH11 5  
ATOM 1827 H HH12 . ARG A 1 27 ? -14.888 -0.079 6.934   1.00 0.00 ? 27 ARG A HH12 5  
ATOM 1828 H HH21 . ARG A 1 27 ? -13.640 -3.247 6.182   1.00 0.00 ? 27 ARG A HH21 5  
ATOM 1829 H HH22 . ARG A 1 27 ? -14.930 -2.376 6.945   1.00 0.00 ? 27 ARG A HH22 5  
ATOM 1830 N N    . LEU A 1 28 ? -14.546 1.216  1.212   1.00 0.00 ? 28 LEU A N    5  
ATOM 1831 C CA   . LEU A 1 28 ? -15.029 2.595  1.011   1.00 0.00 ? 28 LEU A CA   5  
ATOM 1832 C C    . LEU A 1 28 ? -16.111 2.684  -0.072  1.00 0.00 ? 28 LEU A C    5  
ATOM 1833 O O    . LEU A 1 28 ? -17.199 3.184  0.182   1.00 0.00 ? 28 LEU A O    5  
ATOM 1834 C CB   . LEU A 1 28 ? -13.795 3.468  0.704   1.00 0.00 ? 28 LEU A CB   5  
ATOM 1835 C CG   . LEU A 1 28 ? -14.068 4.769  -0.071  1.00 0.00 ? 28 LEU A CG   5  
ATOM 1836 C CD1  . LEU A 1 28 ? -14.796 5.795  0.799   1.00 0.00 ? 28 LEU A CD1  5  
ATOM 1837 C CD2  . LEU A 1 28 ? -12.767 5.346  -0.606  1.00 0.00 ? 28 LEU A CD2  5  
ATOM 1838 H H    . LEU A 1 28 ? -13.566 1.100  1.012   1.00 0.00 ? 28 LEU A H    5  
ATOM 1839 N N    . LYS A 1 29 ? -15.797 2.160  -1.255  1.00 0.00 ? 29 LYS A N    5  
ATOM 1840 C CA   . LYS A 1 29 ? -16.757 2.120  -2.379  1.00 0.00 ? 29 LYS A CA   5  
ATOM 1841 C C    . LYS A 1 29 ? -18.000 1.279  -2.020  1.00 0.00 ? 29 LYS A C    5  
ATOM 1842 O O    . LYS A 1 29 ? -19.108 1.606  -2.428  1.00 0.00 ? 29 LYS A O    5  
ATOM 1843 C CB   . LYS A 1 29 ? -16.031 1.567  -3.602  1.00 0.00 ? 29 LYS A CB   5  
ATOM 1844 C CG   . LYS A 1 29 ? -16.632 2.110  -4.896  1.00 0.00 ? 29 LYS A CG   5  
ATOM 1845 C CD   . LYS A 1 29 ? -15.594 2.939  -5.659  1.00 0.00 ? 29 LYS A CD   5  
ATOM 1846 C CE   . LYS A 1 29 ? -16.175 3.566  -6.934  1.00 0.00 ? 29 LYS A CE   5  
ATOM 1847 N NZ   . LYS A 1 29 ? -17.298 4.459  -6.615  1.00 0.00 ? 29 LYS A NZ   5  
ATOM 1848 H H    . LYS A 1 29 ? -14.882 1.827  -1.475  1.00 0.00 ? 29 LYS A H    5  
ATOM 1849 H HZ1  . LYS A 1 29 ? -16.989 5.155  -5.966  1.00 0.00 ? 29 LYS A HZ1  5  
ATOM 1850 H HZ2  . LYS A 1 29 ? -17.622 4.898  -7.443  1.00 0.00 ? 29 LYS A HZ2  5  
ATOM 1851 H HZ3  . LYS A 1 29 ? -18.046 3.925  -6.209  1.00 0.00 ? 29 LYS A HZ3  5  
ATOM 1852 N N    . LYS A 1 30 ? -17.813 0.332  -1.094  1.00 0.00 ? 30 LYS A N    5  
ATOM 1853 C CA   . LYS A 1 30 ? -18.907 -0.456 -0.489  1.00 0.00 ? 30 LYS A CA   5  
ATOM 1854 C C    . LYS A 1 30 ? -19.728 0.286  0.576   1.00 0.00 ? 30 LYS A C    5  
ATOM 1855 O O    . LYS A 1 30 ? -20.929 0.058  0.704   1.00 0.00 ? 30 LYS A O    5  
ATOM 1856 C CB   . LYS A 1 30 ? -18.362 -1.781 0.046   1.00 0.00 ? 30 LYS A CB   5  
ATOM 1857 C CG   . LYS A 1 30 ? -17.938 -2.759 -1.058  1.00 0.00 ? 30 LYS A CG   5  
ATOM 1858 C CD   . LYS A 1 30 ? -19.104 -3.074 -2.005  1.00 0.00 ? 30 LYS A CD   5  
ATOM 1859 C CE   . LYS A 1 30 ? -19.199 -4.559 -2.366  1.00 0.00 ? 30 LYS A CE   5  
ATOM 1860 N NZ   . LYS A 1 30 ? -18.021 -4.994 -3.129  1.00 0.00 ? 30 LYS A NZ   5  
ATOM 1861 H H    . LYS A 1 30 ? -16.889 0.087  -0.799  1.00 0.00 ? 30 LYS A H    5  
ATOM 1862 H HZ1  . LYS A 1 30 ? -17.200 -4.845 -2.578  1.00 0.00 ? 30 LYS A HZ1  5  
ATOM 1863 H HZ2  . LYS A 1 30 ? -18.110 -5.966 -3.336  1.00 0.00 ? 30 LYS A HZ2  5  
ATOM 1864 H HZ3  . LYS A 1 30 ? -17.953 -4.483 -3.986  1.00 0.00 ? 30 LYS A HZ3  5  
ATOM 1865 N N    . LEU A 1 31 ? -19.115 1.292  1.205   1.00 0.00 ? 31 LEU A N    5  
ATOM 1866 C CA   . LEU A 1 31 ? -19.804 2.217  2.141   1.00 0.00 ? 31 LEU A CA   5  
ATOM 1867 C C    . LEU A 1 31 ? -20.744 3.175  1.389   1.00 0.00 ? 31 LEU A C    5  
ATOM 1868 O O    . LEU A 1 31 ? -21.874 3.401  1.828   1.00 0.00 ? 31 LEU A O    5  
ATOM 1869 C CB   . LEU A 1 31 ? -18.780 2.995  2.972   1.00 0.00 ? 31 LEU A CB   5  
ATOM 1870 C CG   . LEU A 1 31 ? -18.070 2.093  3.989   1.00 0.00 ? 31 LEU A CG   5  
ATOM 1871 C CD1  . LEU A 1 31 ? -16.739 2.709  4.413   1.00 0.00 ? 31 LEU A CD1  5  
ATOM 1872 C CD2  . LEU A 1 31 ? -18.941 1.870  5.234   1.00 0.00 ? 31 LEU A CD2  5  
ATOM 1873 H H    . LEU A 1 31 ? -18.153 1.498  1.040   1.00 0.00 ? 31 LEU A H    5  
ATOM 1874 N N    . VAL A 1 32 ? -20.367 3.532  0.167   1.00 0.00 ? 32 VAL A N    5  
ATOM 1875 C CA   . VAL A 1 32 ? -21.212 4.369  -0.733  1.00 0.00 ? 32 VAL A CA   5  
ATOM 1876 C C    . VAL A 1 32 ? -22.214 3.504  -1.550  1.00 0.00 ? 32 VAL A C    5  
ATOM 1877 O O    . VAL A 1 32 ? -22.957 4.013  -2.384  1.00 0.00 ? 32 VAL A O    5  
ATOM 1878 C CB   . VAL A 1 32 ? -20.289 5.273  -1.599  1.00 0.00 ? 32 VAL A CB   5  
ATOM 1879 C CG1  . VAL A 1 32 ? -21.057 6.266  -2.479  1.00 0.00 ? 32 VAL A CG1  5  
ATOM 1880 C CG2  . VAL A 1 32 ? -19.342 6.107  -0.725  1.00 0.00 ? 32 VAL A CG2  5  
ATOM 1881 H H    . VAL A 1 32 ? -19.480 3.276  -0.212  1.00 0.00 ? 32 VAL A H    5  
ATOM 1882 N N    . GLY A 1 33 ? -22.365 2.253  -1.138  1.00 0.00 ? 33 GLY A N    5  
ATOM 1883 C CA   . GLY A 1 33 ? -23.311 1.276  -1.721  1.00 0.00 ? 33 GLY A CA   5  
ATOM 1884 C C    . GLY A 1 33 ? -24.654 1.234  -0.970  1.00 0.00 ? 33 GLY A C    5  
ATOM 1885 O O    . GLY A 1 33 ? -25.712 1.123  -1.582  1.00 0.00 ? 33 GLY A O    5  
ATOM 1886 H H    . GLY A 1 33 ? -21.791 1.887  -0.407  1.00 0.00 ? 33 GLY A H    5  
ATOM 1887 N N    . GLU A 1 34 ? -24.559 1.265  0.359   1.00 0.00 ? 34 GLU A N    5  
ATOM 1888 C CA   . GLU A 1 34 ? -25.746 1.221  1.237   1.00 0.00 ? 34 GLU A CA   5  
ATOM 1889 C C    . GLU A 1 34 ? -25.639 2.088  2.521   1.00 0.00 ? 34 GLU A C    5  
ATOM 1890 O O    . GLU A 1 34 ? -26.438 1.923  3.437   1.00 0.00 ? 34 GLU A O    5  
ATOM 1891 C CB   . GLU A 1 34 ? -25.990 -0.242 1.628   1.00 0.00 ? 34 GLU A CB   5  
ATOM 1892 C CG   . GLU A 1 34 ? -27.480 -0.620 1.601   1.00 0.00 ? 34 GLU A CG   5  
ATOM 1893 C CD   . GLU A 1 34 ? -27.971 -0.834 0.168   1.00 0.00 ? 34 GLU A CD   5  
ATOM 1894 O OE1  . GLU A 1 34 ? -27.536 -1.719 -0.550  1.00 0.00 ? 34 GLU A OE1  5  
ATOM 1895 O OE2  . GLU A 1 34 ? -29.014 -0.078 -0.239  1.00 0.00 ? 34 GLU A OE2  5  
ATOM 1896 H H    . GLU A 1 34 ? -23.669 1.216  0.821   1.00 0.00 ? 34 GLU A H    5  
ATOM 1897 H HE2  . GLU A 1 34 ? -29.129 -0.362 -1.189  1.00 0.00 ? 34 GLU A HE2  5  
ATOM 1898 N N    . ARG A 1 35 ? -24.706 3.035  2.544   1.00 0.00 ? 35 ARG A N    5  
ATOM 1899 C CA   . ARG A 1 35 ? -24.450 3.923  3.712   1.00 0.00 ? 35 ARG A CA   5  
ATOM 1900 C C    . ARG A 1 35 ? -24.198 3.130  5.029   1.00 0.00 ? 35 ARG A C    5  
ATOM 1901 O O    . ARG A 1 35 ? -23.012 2.783  5.245   1.00 0.00 ? 35 ARG A O    5  
ATOM 1902 C CB   . ARG A 1 35 ? -25.572 4.970  3.757   1.00 0.00 ? 35 ARG A CB   5  
ATOM 1903 C CG   . ARG A 1 35 ? -25.498 6.088  4.795   1.00 0.00 ? 35 ARG A CG   5  
ATOM 1904 C CD   . ARG A 1 35 ? -26.494 5.882  5.948   1.00 0.00 ? 35 ARG A CD   5  
ATOM 1905 N NE   . ARG A 1 35 ? -25.792 5.197  7.049   1.00 0.00 ? 35 ARG A NE   5  
ATOM 1906 C CZ   . ARG A 1 35 ? -24.953 5.776  7.895   1.00 0.00 ? 35 ARG A CZ   5  
ATOM 1907 N NH1  . ARG A 1 35 ? -25.283 6.925  8.474   1.00 0.00 ? 35 ARG A NH1  5  
ATOM 1908 N NH2  . ARG A 1 35 ? -24.022 5.045  8.481   1.00 0.00 ? 35 ARG A NH2  5  
ATOM 1909 O OXT  . ARG A 1 35 ? -25.173 2.757  5.709   1.00 0.00 ? 35 ARG A OXT  5  
ATOM 1910 H H    . ARG A 1 35 ? -24.149 3.253  1.746   1.00 0.00 ? 35 ARG A H    5  
ATOM 1911 H HE   . ARG A 1 35 ? -26.116 4.265  7.244   1.00 0.00 ? 35 ARG A HE   5  
ATOM 1912 H HH11 . ARG A 1 35 ? -26.175 7.320  8.286   1.00 0.00 ? 35 ARG A HH11 5  
ATOM 1913 H HH12 . ARG A 1 35 ? -24.643 7.368  9.102   1.00 0.00 ? 35 ARG A HH12 5  
ATOM 1914 H HH21 . ARG A 1 35 ? -23.866 4.112  8.174   1.00 0.00 ? 35 ARG A HH21 5  
ATOM 1915 H HH22 . ARG A 1 35 ? -23.399 5.472  9.132   1.00 0.00 ? 35 ARG A HH22 5  
ATOM 1916 N N    . LEU A 1 1  ? 28.690  0.659  -5.997  1.00 0.00 ? 1  LEU A N    6  
ATOM 1917 C CA   . LEU A 1 1  ? 27.764  1.172  -4.939  1.00 0.00 ? 1  LEU A CA   6  
ATOM 1918 C C    . LEU A 1 1  ? 26.621  2.032  -5.503  1.00 0.00 ? 1  LEU A C    6  
ATOM 1919 O O    . LEU A 1 1  ? 26.748  2.703  -6.535  1.00 0.00 ? 1  LEU A O    6  
ATOM 1920 C CB   . LEU A 1 1  ? 28.606  1.835  -3.837  1.00 0.00 ? 1  LEU A CB   6  
ATOM 1921 C CG   . LEU A 1 1  ? 28.173  3.241  -3.376  1.00 0.00 ? 1  LEU A CG   6  
ATOM 1922 C CD1  . LEU A 1 1  ? 28.646  3.504  -1.949  1.00 0.00 ? 1  LEU A CD1  6  
ATOM 1923 C CD2  . LEU A 1 1  ? 28.752  4.318  -4.300  1.00 0.00 ? 1  LEU A CD2  6  
ATOM 1924 H H1   . LEU A 1 1  ? 28.182  0.111  -6.653  1.00 0.00 ? 1  LEU A H1   6  
ATOM 1925 H H2   . LEU A 1 1  ? 29.087  1.458  -6.466  1.00 0.00 ? 1  LEU A H2   6  
ATOM 1926 H H3   . LEU A 1 1  ? 29.407  0.128  -5.591  1.00 0.00 ? 1  LEU A H3   6  
ATOM 1927 N N    . GLN A 1 2  ? 25.481  1.905  -4.837  1.00 0.00 ? 2  GLN A N    6  
ATOM 1928 C CA   . GLN A 1 2  ? 24.232  2.589  -5.240  1.00 0.00 ? 2  GLN A CA   6  
ATOM 1929 C C    . GLN A 1 2  ? 23.221  2.622  -4.094  1.00 0.00 ? 2  GLN A C    6  
ATOM 1930 O O    . GLN A 1 2  ? 23.371  1.946  -3.081  1.00 0.00 ? 2  GLN A O    6  
ATOM 1931 C CB   . GLN A 1 2  ? 23.637  1.937  -6.494  1.00 0.00 ? 2  GLN A CB   6  
ATOM 1932 C CG   . GLN A 1 2  ? 23.570  0.405  -6.446  1.00 0.00 ? 2  GLN A CG   6  
ATOM 1933 C CD   . GLN A 1 2  ? 23.166  -0.206 -7.790  1.00 0.00 ? 2  GLN A CD   6  
ATOM 1934 O OE1  . GLN A 1 2  ? 22.339  -1.098 -7.864  1.00 0.00 ? 2  GLN A OE1  6  
ATOM 1935 N NE2  . GLN A 1 2  ? 23.726  0.261  -8.885  1.00 0.00 ? 2  GLN A NE2  6  
ATOM 1936 H H    . GLN A 1 2  ? 25.413  1.347  -4.023  1.00 0.00 ? 2  GLN A H    6  
ATOM 1937 H HE21 . GLN A 1 2  ? 24.438  0.955  -8.845  1.00 0.00 ? 2  GLN A HE21 6  
ATOM 1938 H HE22 . GLN A 1 2  ? 23.429  -0.141 -9.742  1.00 0.00 ? 2  GLN A HE22 6  
ATOM 1939 N N    . ARG A 1 3  ? 22.138  3.341  -4.352  1.00 0.00 ? 3  ARG A N    6  
ATOM 1940 C CA   . ARG A 1 3  ? 21.028  3.438  -3.385  1.00 0.00 ? 3  ARG A CA   6  
ATOM 1941 C C    . ARG A 1 3  ? 19.952  2.362  -3.550  1.00 0.00 ? 3  ARG A C    6  
ATOM 1942 O O    . ARG A 1 3  ? 19.025  2.331  -2.751  1.00 0.00 ? 3  ARG A O    6  
ATOM 1943 C CB   . ARG A 1 3  ? 20.450  4.841  -3.445  1.00 0.00 ? 3  ARG A CB   6  
ATOM 1944 C CG   . ARG A 1 3  ? 21.190  5.790  -2.510  1.00 0.00 ? 3  ARG A CG   6  
ATOM 1945 C CD   . ARG A 1 3  ? 20.594  7.183  -2.674  1.00 0.00 ? 3  ARG A CD   6  
ATOM 1946 N NE   . ARG A 1 3  ? 20.769  8.002  -1.465  1.00 0.00 ? 3  ARG A NE   6  
ATOM 1947 C CZ   . ARG A 1 3  ? 21.600  9.043  -1.334  1.00 0.00 ? 3  ARG A CZ   6  
ATOM 1948 N NH1  . ARG A 1 3  ? 22.824  9.011  -1.839  1.00 0.00 ? 3  ARG A NH1  6  
ATOM 1949 N NH2  . ARG A 1 3  ? 21.390  9.915  -0.367  1.00 0.00 ? 3  ARG A NH2  6  
ATOM 1950 H H    . ARG A 1 3  ? 22.024  3.855  -5.188  1.00 0.00 ? 3  ARG A H    6  
ATOM 1951 H HE   . ARG A 1 3  ? 20.322  7.664  -0.643  1.00 0.00 ? 3  ARG A HE   6  
ATOM 1952 H HH11 . ARG A 1 3  ? 23.141  8.180  -2.315  1.00 0.00 ? 3  ARG A HH11 6  
ATOM 1953 H HH12 . ARG A 1 3  ? 23.436  9.795  -1.738  1.00 0.00 ? 3  ARG A HH12 6  
ATOM 1954 H HH21 . ARG A 1 3  ? 20.526  9.890  0.151   1.00 0.00 ? 3  ARG A HH21 6  
ATOM 1955 H HH22 . ARG A 1 3  ? 22.020  10.672 -0.242  1.00 0.00 ? 3  ARG A HH22 6  
ATOM 1956 N N    . MET A 1 4  ? 20.244  1.326  -4.343  1.00 0.00 ? 4  MET A N    6  
ATOM 1957 C CA   . MET A 1 4  ? 19.296  0.196  -4.547  1.00 0.00 ? 4  MET A CA   6  
ATOM 1958 C C    . MET A 1 4  ? 19.076  -0.687 -3.305  1.00 0.00 ? 4  MET A C    6  
ATOM 1959 O O    . MET A 1 4  ? 18.013  -1.295 -3.174  1.00 0.00 ? 4  MET A O    6  
ATOM 1960 C CB   . MET A 1 4  ? 19.684  -0.637 -5.771  1.00 0.00 ? 4  MET A CB   6  
ATOM 1961 C CG   . MET A 1 4  ? 19.220  -0.007 -7.095  1.00 0.00 ? 4  MET A CG   6  
ATOM 1962 S SD   . MET A 1 4  ? 20.267  1.318  -7.803  1.00 0.00 ? 4  MET A SD   6  
ATOM 1963 C CE   . MET A 1 4  ? 19.560  2.805  -7.164  1.00 0.00 ? 4  MET A CE   6  
ATOM 1964 H H    . MET A 1 4  ? 21.105  1.249  -4.827  1.00 0.00 ? 4  MET A H    6  
ATOM 1965 N N    . LYS A 1 5  ? 19.919  -0.492 -2.301  1.00 0.00 ? 5  LYS A N    6  
ATOM 1966 C CA   . LYS A 1 5  ? 19.781  -1.138 -0.971  1.00 0.00 ? 5  LYS A CA   6  
ATOM 1967 C C    . LYS A 1 5  ? 18.855  -0.343 -0.038  1.00 0.00 ? 5  LYS A C    6  
ATOM 1968 O O    . LYS A 1 5  ? 18.175  -0.922 0.817   1.00 0.00 ? 5  LYS A O    6  
ATOM 1969 C CB   . LYS A 1 5  ? 21.181  -1.280 -0.350  1.00 0.00 ? 5  LYS A CB   6  
ATOM 1970 C CG   . LYS A 1 5  ? 21.301  -2.416 0.682   1.00 0.00 ? 5  LYS A CG   6  
ATOM 1971 C CD   . LYS A 1 5  ? 21.720  -3.740 0.037   1.00 0.00 ? 5  LYS A CD   6  
ATOM 1972 C CE   . LYS A 1 5  ? 20.548  -4.665 -0.310  1.00 0.00 ? 5  LYS A CE   6  
ATOM 1973 N NZ   . LYS A 1 5  ? 20.902  -5.447 -1.499  1.00 0.00 ? 5  LYS A NZ   6  
ATOM 1974 H H    . LYS A 1 5  ? 20.684  0.145  -2.386  1.00 0.00 ? 5  LYS A H    6  
ATOM 1975 H HZ1  . LYS A 1 5  ? 21.773  -5.913 -1.351  1.00 0.00 ? 5  LYS A HZ1  6  
ATOM 1976 H HZ2  . LYS A 1 5  ? 20.190  -6.125 -1.676  1.00 0.00 ? 5  LYS A HZ2  6  
ATOM 1977 H HZ3  . LYS A 1 5  ? 20.966  -4.834 -2.295  1.00 0.00 ? 5  LYS A HZ3  6  
ATOM 1978 N N    . GLN A 1 6  ? 18.743  0.965  -0.279  1.00 0.00 ? 6  GLN A N    6  
ATOM 1979 C CA   . GLN A 1 6  ? 17.863  1.860  0.497   1.00 0.00 ? 6  GLN A CA   6  
ATOM 1980 C C    . GLN A 1 6  ? 16.546  2.153  -0.244  1.00 0.00 ? 6  GLN A C    6  
ATOM 1981 O O    . GLN A 1 6  ? 15.482  2.026  0.349   1.00 0.00 ? 6  GLN A O    6  
ATOM 1982 C CB   . GLN A 1 6  ? 18.635  3.123  0.939   1.00 0.00 ? 6  GLN A CB   6  
ATOM 1983 C CG   . GLN A 1 6  ? 18.612  4.360  0.027   1.00 0.00 ? 6  GLN A CG   6  
ATOM 1984 C CD   . GLN A 1 6  ? 17.314  5.167  0.189   1.00 0.00 ? 6  GLN A CD   6  
ATOM 1985 O OE1  . GLN A 1 6  ? 16.423  5.179  -0.633  1.00 0.00 ? 6  GLN A OE1  6  
ATOM 1986 N NE2  . GLN A 1 6  ? 17.175  5.861  1.288   1.00 0.00 ? 6  GLN A NE2  6  
ATOM 1987 H H    . GLN A 1 6  ? 19.185  1.384  -1.068  1.00 0.00 ? 6  GLN A H    6  
ATOM 1988 H HE21 . GLN A 1 6  ? 17.861  5.847  2.016   1.00 0.00 ? 6  GLN A HE21 6  
ATOM 1989 H HE22 . GLN A 1 6  ? 16.318  6.371  1.373   1.00 0.00 ? 6  GLN A HE22 6  
ATOM 1990 N N    . LEU A 1 7  ? 16.631  2.335  -1.560  1.00 0.00 ? 7  LEU A N    6  
ATOM 1991 C CA   . LEU A 1 7  ? 15.465  2.564  -2.437  1.00 0.00 ? 7  LEU A CA   6  
ATOM 1992 C C    . LEU A 1 7  ? 14.532  1.345  -2.413  1.00 0.00 ? 7  LEU A C    6  
ATOM 1993 O O    . LEU A 1 7  ? 13.422  1.488  -1.910  1.00 0.00 ? 7  LEU A O    6  
ATOM 1994 C CB   . LEU A 1 7  ? 15.870  2.950  -3.862  1.00 0.00 ? 7  LEU A CB   6  
ATOM 1995 C CG   . LEU A 1 7  ? 16.554  4.324  -3.897  1.00 0.00 ? 7  LEU A CG   6  
ATOM 1996 C CD1  . LEU A 1 7  ? 17.175  4.554  -5.270  1.00 0.00 ? 7  LEU A CD1  6  
ATOM 1997 C CD2  . LEU A 1 7  ? 15.592  5.486  -3.621  1.00 0.00 ? 7  LEU A CD2  6  
ATOM 1998 H H    . LEU A 1 7  ? 17.516  2.434  -2.020  1.00 0.00 ? 7  LEU A H    6  
ATOM 1999 N N    . GLU A 1 8  ? 15.097  0.153  -2.555  1.00 0.00 ? 8  GLU A N    6  
ATOM 2000 C CA   . GLU A 1 8  ? 14.294  -1.093 -2.434  1.00 0.00 ? 8  GLU A CA   6  
ATOM 2001 C C    . GLU A 1 8  ? 13.710  -1.332 -1.028  1.00 0.00 ? 8  GLU A C    6  
ATOM 2002 O O    . GLU A 1 8  ? 12.548  -1.711 -0.912  1.00 0.00 ? 8  GLU A O    6  
ATOM 2003 C CB   . GLU A 1 8  ? 15.050  -2.315 -2.943  1.00 0.00 ? 8  GLU A CB   6  
ATOM 2004 C CG   . GLU A 1 8  ? 15.137  -2.308 -4.472  1.00 0.00 ? 8  GLU A CG   6  
ATOM 2005 C CD   . GLU A 1 8  ? 15.814  -3.581 -4.985  1.00 0.00 ? 8  GLU A CD   6  
ATOM 2006 O OE1  . GLU A 1 8  ? 15.181  -4.574 -5.307  1.00 0.00 ? 8  GLU A OE1  6  
ATOM 2007 O OE2  . GLU A 1 8  ? 17.163  -3.544 -5.100  1.00 0.00 ? 8  GLU A OE2  6  
ATOM 2008 H H    . GLU A 1 8  ? 16.076  0.031  -2.746  1.00 0.00 ? 8  GLU A H    6  
ATOM 2009 H HE2  . GLU A 1 8  ? 17.379  -4.474 -5.396  1.00 0.00 ? 8  GLU A HE2  6  
ATOM 2010 N N    . ASP A 1 9  ? 14.418  -0.837 -0.013  1.00 0.00 ? 9  ASP A N    6  
ATOM 2011 C CA   . ASP A 1 9  ? 13.958  -0.872 1.392   1.00 0.00 ? 9  ASP A CA   6  
ATOM 2012 C C    . ASP A 1 9  ? 12.810  0.126  1.658   1.00 0.00 ? 9  ASP A C    6  
ATOM 2013 O O    . ASP A 1 9  ? 11.844  -0.206 2.348   1.00 0.00 ? 9  ASP A O    6  
ATOM 2014 C CB   . ASP A 1 9  ? 15.169  -0.634 2.299   1.00 0.00 ? 9  ASP A CB   6  
ATOM 2015 C CG   . ASP A 1 9  ? 14.807  -0.454 3.772   1.00 0.00 ? 9  ASP A CG   6  
ATOM 2016 O OD1  . ASP A 1 9  ? 14.859  -1.363 4.592   1.00 0.00 ? 9  ASP A OD1  6  
ATOM 2017 O OD2  . ASP A 1 9  ? 14.450  0.802  4.133   1.00 0.00 ? 9  ASP A OD2  6  
ATOM 2018 H H    . ASP A 1 9  ? 15.260  -0.314 -0.154  1.00 0.00 ? 9  ASP A H    6  
ATOM 2019 H HD2  . ASP A 1 9  ? 14.187  0.697  5.084   1.00 0.00 ? 9  ASP A HD2  6  
ATOM 2020 N N    . LYS A 1 10 ? 12.879  1.301  1.038   1.00 0.00 ? 10 LYS A N    6  
ATOM 2021 C CA   . LYS A 1 10 ? 11.854  2.357  1.196   1.00 0.00 ? 10 LYS A CA   6  
ATOM 2022 C C    . LYS A 1 10 ? 10.658  2.186  0.238   1.00 0.00 ? 10 LYS A C    6  
ATOM 2023 O O    . LYS A 1 10 ? 9.524   2.530  0.585   1.00 0.00 ? 10 LYS A O    6  
ATOM 2024 C CB   . LYS A 1 10 ? 12.519  3.745  1.140   1.00 0.00 ? 10 LYS A CB   6  
ATOM 2025 C CG   . LYS A 1 10 ? 12.879  4.333  -0.233  1.00 0.00 ? 10 LYS A CG   6  
ATOM 2026 C CD   . LYS A 1 10 ? 11.702  5.120  -0.825  1.00 0.00 ? 10 LYS A CD   6  
ATOM 2027 C CE   . LYS A 1 10 ? 12.127  6.475  -1.387  1.00 0.00 ? 10 LYS A CE   6  
ATOM 2028 N NZ   . LYS A 1 10 ? 12.700  7.302  -0.303  1.00 0.00 ? 10 LYS A NZ   6  
ATOM 2029 H H    . LYS A 1 10 ? 13.692  1.568  0.502   1.00 0.00 ? 10 LYS A H    6  
ATOM 2030 H HZ1  . LYS A 1 10 ? 12.064  7.369  0.453   1.00 0.00 ? 10 LYS A HZ1  6  
ATOM 2031 H HZ2  . LYS A 1 10 ? 13.554  6.862  -0.007  1.00 0.00 ? 10 LYS A HZ2  6  
ATOM 2032 H HZ3  . LYS A 1 10 ? 12.897  8.212  -0.664  1.00 0.00 ? 10 LYS A HZ3  6  
ATOM 2033 N N    . VAL A 1 11 ? 10.913  1.617  -0.933  1.00 0.00 ? 11 VAL A N    6  
ATOM 2034 C CA   . VAL A 1 11 ? 9.898   1.276  -1.953  1.00 0.00 ? 11 VAL A CA   6  
ATOM 2035 C C    . VAL A 1 11 ? 9.023   0.097  -1.490  1.00 0.00 ? 11 VAL A C    6  
ATOM 2036 O O    . VAL A 1 11 ? 7.808   0.126  -1.689  1.00 0.00 ? 11 VAL A O    6  
ATOM 2037 C CB   . VAL A 1 11 ? 10.556  1.050  -3.335  1.00 0.00 ? 11 VAL A CB   6  
ATOM 2038 C CG1  . VAL A 1 11 ? 9.599   0.519  -4.402  1.00 0.00 ? 11 VAL A CG1  6  
ATOM 2039 C CG2  . VAL A 1 11 ? 11.141  2.359  -3.861  1.00 0.00 ? 11 VAL A CG2  6  
ATOM 2040 H H    . VAL A 1 11 ? 11.868  1.479  -1.229  1.00 0.00 ? 11 VAL A H    6  
ATOM 2041 N N    . GLU A 1 12 ? 9.621   -0.872 -0.813  1.00 0.00 ? 12 GLU A N    6  
ATOM 2042 C CA   . GLU A 1 12 ? 8.860   -1.987 -0.217  1.00 0.00 ? 12 GLU A CA   6  
ATOM 2043 C C    . GLU A 1 12 ? 7.852   -1.540 0.839   1.00 0.00 ? 12 GLU A C    6  
ATOM 2044 O O    . GLU A 1 12 ? 6.670   -1.912 0.754   1.00 0.00 ? 12 GLU A O    6  
ATOM 2045 C CB   . GLU A 1 12 ? 9.802   -3.054 0.329   1.00 0.00 ? 12 GLU A CB   6  
ATOM 2046 C CG   . GLU A 1 12 ? 9.557   -4.399 -0.356  1.00 0.00 ? 12 GLU A CG   6  
ATOM 2047 C CD   . GLU A 1 12 ? 9.692   -4.320 -1.886  1.00 0.00 ? 12 GLU A CD   6  
ATOM 2048 O OE1  . GLU A 1 12 ? 8.763   -4.568 -2.648  1.00 0.00 ? 12 GLU A OE1  6  
ATOM 2049 O OE2  . GLU A 1 12 ? 10.875  -3.871 -2.367  1.00 0.00 ? 12 GLU A OE2  6  
ATOM 2050 H H    . GLU A 1 12 ? 10.619  -0.951 -0.741  1.00 0.00 ? 12 GLU A H    6  
ATOM 2051 H HE2  . GLU A 1 12 ? 10.741  -3.898 -3.359  1.00 0.00 ? 12 GLU A HE2  6  
ATOM 2052 N N    . GLU A 1 13 ? 8.264   -0.569 1.642   1.00 0.00 ? 13 GLU A N    6  
ATOM 2053 C CA   . GLU A 1 13 ? 7.373   0.086  2.638   1.00 0.00 ? 13 GLU A CA   6  
ATOM 2054 C C    . GLU A 1 13 ? 6.160   0.772  1.986   1.00 0.00 ? 13 GLU A C    6  
ATOM 2055 O O    . GLU A 1 13 ? 5.062   0.741  2.546   1.00 0.00 ? 13 GLU A O    6  
ATOM 2056 C CB   . GLU A 1 13 ? 8.171   1.043  3.524   1.00 0.00 ? 13 GLU A CB   6  
ATOM 2057 C CG   . GLU A 1 13 ? 7.396   1.458  4.787   1.00 0.00 ? 13 GLU A CG   6  
ATOM 2058 C CD   . GLU A 1 13 ? 7.023   0.257  5.653   1.00 0.00 ? 13 GLU A CD   6  
ATOM 2059 O OE1  . GLU A 1 13 ? 7.783   -0.227 6.485   1.00 0.00 ? 13 GLU A OE1  6  
ATOM 2060 O OE2  . GLU A 1 13 ? 5.812   -0.306 5.426   1.00 0.00 ? 13 GLU A OE2  6  
ATOM 2061 H H    . GLU A 1 13 ? 9.214   -0.266 1.675   1.00 0.00 ? 13 GLU A H    6  
ATOM 2062 H HE2  . GLU A 1 13 ? 5.773   -1.063 6.082   1.00 0.00 ? 13 GLU A HE2  6  
ATOM 2063 N N    . LEU A 1 14 ? 6.325   1.203  0.739   1.00 0.00 ? 14 LEU A N    6  
ATOM 2064 C CA   . LEU A 1 14 ? 5.223   1.805  -0.046  1.00 0.00 ? 14 LEU A CA   6  
ATOM 2065 C C    . LEU A 1 14 ? 4.156   0.745  -0.302  1.00 0.00 ? 14 LEU A C    6  
ATOM 2066 O O    . LEU A 1 14 ? 3.139   0.804  0.342   1.00 0.00 ? 14 LEU A O    6  
ATOM 2067 C CB   . LEU A 1 14 ? 5.658   2.431  -1.374  1.00 0.00 ? 14 LEU A CB   6  
ATOM 2068 C CG   . LEU A 1 14 ? 6.807   3.444  -1.235  1.00 0.00 ? 14 LEU A CG   6  
ATOM 2069 C CD1  . LEU A 1 14 ? 7.107   4.021  -2.612  1.00 0.00 ? 14 LEU A CD1  6  
ATOM 2070 C CD2  . LEU A 1 14 ? 6.536   4.556  -0.227  1.00 0.00 ? 14 LEU A CD2  6  
ATOM 2071 H H    . LEU A 1 14 ? 7.162   1.043  0.226   1.00 0.00 ? 14 LEU A H    6  
ATOM 2072 N N    . LEU A 1 15 ? 4.512   -0.331 -1.018  1.00 0.00 ? 15 LEU A N    6  
ATOM 2073 C CA   . LEU A 1 15 ? 3.566   -1.431 -1.324  1.00 0.00 ? 15 LEU A CA   6  
ATOM 2074 C C    . LEU A 1 15 ? 2.947   -2.025 -0.047  1.00 0.00 ? 15 LEU A C    6  
ATOM 2075 O O    . LEU A 1 15 ? 1.735   -1.943 0.094   1.00 0.00 ? 15 LEU A O    6  
ATOM 2076 C CB   . LEU A 1 15 ? 4.205   -2.548 -2.159  1.00 0.00 ? 15 LEU A CB   6  
ATOM 2077 C CG   . LEU A 1 15 ? 5.129   -2.063 -3.291  1.00 0.00 ? 15 LEU A CG   6  
ATOM 2078 C CD1  . LEU A 1 15 ? 5.593   -3.267 -4.101  1.00 0.00 ? 15 LEU A CD1  6  
ATOM 2079 C CD2  . LEU A 1 15 ? 4.503   -1.023 -4.225  1.00 0.00 ? 15 LEU A CD2  6  
ATOM 2080 H H    . LEU A 1 15 ? 5.404   -0.393 -1.470  1.00 0.00 ? 15 LEU A H    6  
ATOM 2081 N N    . SER A 1 16 ? 3.764   -2.316 0.960   1.00 0.00 ? 16 SER A N    6  
ATOM 2082 C CA   . SER A 1 16 ? 3.285   -2.755 2.306   1.00 0.00 ? 16 SER A CA   6  
ATOM 2083 C C    . SER A 1 16 ? 2.119   -1.927 2.882   1.00 0.00 ? 16 SER A C    6  
ATOM 2084 O O    . SER A 1 16 ? 1.222   -2.496 3.511   1.00 0.00 ? 16 SER A O    6  
ATOM 2085 C CB   . SER A 1 16 ? 4.410   -2.746 3.345   1.00 0.00 ? 16 SER A CB   6  
ATOM 2086 O OG   . SER A 1 16 ? 5.041   -4.025 3.378   1.00 0.00 ? 16 SER A OG   6  
ATOM 2087 H H    . SER A 1 16 ? 4.765   -2.316 0.849   1.00 0.00 ? 16 SER A H    6  
ATOM 2088 H HG   . SER A 1 16 ? 5.578   -4.105 4.223   1.00 0.00 ? 16 SER A HG   6  
ATOM 2089 N N    . LYS A 1 17 ? 2.120   -0.636 2.590   1.00 0.00 ? 17 LYS A N    6  
ATOM 2090 C CA   . LYS A 1 17 ? 1.027   0.296  2.909   1.00 0.00 ? 17 LYS A CA   6  
ATOM 2091 C C    . LYS A 1 17 ? 0.065   0.489  1.717   1.00 0.00 ? 17 LYS A C    6  
ATOM 2092 O O    . LYS A 1 17 ? -1.112  0.196  1.845   1.00 0.00 ? 17 LYS A O    6  
ATOM 2093 C CB   . LYS A 1 17 ? 1.624   1.634  3.345   1.00 0.00 ? 17 LYS A CB   6  
ATOM 2094 C CG   . LYS A 1 17 ? 0.543   2.643  3.766   1.00 0.00 ? 17 LYS A CG   6  
ATOM 2095 C CD   . LYS A 1 17 ? 1.097   4.060  3.930   1.00 0.00 ? 17 LYS A CD   6  
ATOM 2096 C CE   . LYS A 1 17 ? 1.548   4.714  2.605   1.00 0.00 ? 17 LYS A CE   6  
ATOM 2097 N NZ   . LYS A 1 17 ? 0.416   4.922  1.696   1.00 0.00 ? 17 LYS A NZ   6  
ATOM 2098 H H    . LYS A 1 17 ? 2.881   -0.231 2.070   1.00 0.00 ? 17 LYS A H    6  
ATOM 2099 H HZ1  . LYS A 1 17 ? -0.315  5.407  2.179   1.00 0.00 ? 17 LYS A HZ1  6  
ATOM 2100 H HZ2  . LYS A 1 17 ? 0.726   5.470  0.917   1.00 0.00 ? 17 LYS A HZ2  6  
ATOM 2101 H HZ3  . LYS A 1 17 ? 0.085   4.036  1.350   1.00 0.00 ? 17 LYS A HZ3  6  
ATOM 2102 N N    . ASN A 1 18 ? 0.539   0.947  0.571   1.00 0.00 ? 18 ASN A N    6  
ATOM 2103 C CA   . ASN A 1 18 ? -0.235  1.261  -0.648  1.00 0.00 ? 18 ASN A CA   6  
ATOM 2104 C C    . ASN A 1 18 ? -1.068  0.078  -1.191  1.00 0.00 ? 18 ASN A C    6  
ATOM 2105 O O    . ASN A 1 18 ? -2.242  0.233  -1.494  1.00 0.00 ? 18 ASN A O    6  
ATOM 2106 C CB   . ASN A 1 18 ? 0.750   1.795  -1.695  1.00 0.00 ? 18 ASN A CB   6  
ATOM 2107 C CG   . ASN A 1 18 ? 0.096   2.594  -2.831  1.00 0.00 ? 18 ASN A CG   6  
ATOM 2108 O OD1  . ASN A 1 18 ? 0.452   3.731  -3.120  1.00 0.00 ? 18 ASN A OD1  6  
ATOM 2109 N ND2  . ASN A 1 18 ? -0.900  2.046  -3.474  1.00 0.00 ? 18 ASN A ND2  6  
ATOM 2110 H H    . ASN A 1 18 ? 1.541   1.100  0.487   1.00 0.00 ? 18 ASN A H    6  
ATOM 2111 H HD21 . ASN A 1 18 ? -1.347  1.203  -3.161  1.00 0.00 ? 18 ASN A HD21 6  
ATOM 2112 H HD22 . ASN A 1 18 ? -1.256  2.543  -4.257  1.00 0.00 ? 18 ASN A HD22 6  
ATOM 2113 N N    . TYR A 1 19 ? -0.453  -1.104 -1.271  1.00 0.00 ? 19 TYR A N    6  
ATOM 2114 C CA   . TYR A 1 19 ? -1.115  -2.379 -1.635  1.00 0.00 ? 19 TYR A CA   6  
ATOM 2115 C C    . TYR A 1 19 ? -2.187  -2.735 -0.586  1.00 0.00 ? 19 TYR A C    6  
ATOM 2116 O O    . TYR A 1 19 ? -3.295  -3.158 -0.925  1.00 0.00 ? 19 TYR A O    6  
ATOM 2117 C CB   . TYR A 1 19 ? -0.034  -3.462 -1.661  1.00 0.00 ? 19 TYR A CB   6  
ATOM 2118 C CG   . TYR A 1 19 ? -0.218  -4.544 -2.732  1.00 0.00 ? 19 TYR A CG   6  
ATOM 2119 C CD1  . TYR A 1 19 ? -1.034  -5.659 -2.442  1.00 0.00 ? 19 TYR A CD1  6  
ATOM 2120 C CD2  . TYR A 1 19 ? 0.521   -4.440 -3.929  1.00 0.00 ? 19 TYR A CD2  6  
ATOM 2121 C CE1  . TYR A 1 19 ? -1.125  -6.697 -3.390  1.00 0.00 ? 19 TYR A CE1  6  
ATOM 2122 C CE2  . TYR A 1 19 ? 0.437   -5.472 -4.874  1.00 0.00 ? 19 TYR A CE2  6  
ATOM 2123 C CZ   . TYR A 1 19 ? -0.394  -6.579 -4.599  1.00 0.00 ? 19 TYR A CZ   6  
ATOM 2124 O OH   . TYR A 1 19 ? -0.534  -7.556 -5.540  1.00 0.00 ? 19 TYR A OH   6  
ATOM 2125 H H    . TYR A 1 19 ? 0.508   -1.209 -0.994  1.00 0.00 ? 19 TYR A H    6  
ATOM 2126 H HH   . TYR A 1 19 ? 0.017   -7.321 -6.337  1.00 0.00 ? 19 TYR A HH   6  
ATOM 2127 N N    . HIS A 1 20 ? -1.901  -2.399 0.669   1.00 0.00 ? 20 HIS A N    6  
ATOM 2128 C CA   . HIS A 1 20 ? -2.816  -2.485 1.827   1.00 0.00 ? 20 HIS A CA   6  
ATOM 2129 C C    . HIS A 1 20 ? -3.711  -1.223 2.001   1.00 0.00 ? 20 HIS A C    6  
ATOM 2130 O O    . HIS A 1 20 ? -4.509  -1.133 2.939   1.00 0.00 ? 20 HIS A O    6  
ATOM 2131 C CB   . HIS A 1 20 ? -1.912  -2.804 3.030   1.00 0.00 ? 20 HIS A CB   6  
ATOM 2132 C CG   . HIS A 1 20 ? -2.367  -2.322 4.416   1.00 0.00 ? 20 HIS A CG   6  
ATOM 2133 N ND1  . HIS A 1 20 ? -3.175  -2.961 5.258   1.00 0.00 ? 20 HIS A ND1  6  
ATOM 2134 C CD2  . HIS A 1 20 ? -2.200  -1.081 4.878   1.00 0.00 ? 20 HIS A CD2  6  
ATOM 2135 C CE1  . HIS A 1 20 ? -3.562  -2.105 6.198   1.00 0.00 ? 20 HIS A CE1  6  
ATOM 2136 N NE2  . HIS A 1 20 ? -2.972  -0.951 5.967   1.00 0.00 ? 20 HIS A NE2  6  
ATOM 2137 H H    . HIS A 1 20 ? -0.994  -2.025 0.907   1.00 0.00 ? 20 HIS A H    6  
ATOM 2138 H HD1  . HIS A 1 20 ? -3.320  -3.949 5.278   1.00 0.00 ? 20 HIS A HD1  6  
ATOM 2139 H HE2  . HIS A 1 20 ? -3.104  -0.093 6.461   1.00 0.00 ? 20 HIS A HE2  6  
ATOM 2140 N N    . LEU A 1 21 ? -3.676  -0.303 1.061   1.00 0.00 ? 21 LEU A N    6  
ATOM 2141 C CA   . LEU A 1 21 ? -4.478  0.931  1.081   1.00 0.00 ? 21 LEU A CA   6  
ATOM 2142 C C    . LEU A 1 21 ? -5.536  0.912  -0.020  1.00 0.00 ? 21 LEU A C    6  
ATOM 2143 O O    . LEU A 1 21 ? -6.712  1.153  0.252   1.00 0.00 ? 21 LEU A O    6  
ATOM 2144 C CB   . LEU A 1 21 ? -3.518  2.134  0.966   1.00 0.00 ? 21 LEU A CB   6  
ATOM 2145 C CG   . LEU A 1 21 ? -4.177  3.485  0.676   1.00 0.00 ? 21 LEU A CG   6  
ATOM 2146 C CD1  . LEU A 1 21 ? -5.036  3.985  1.844   1.00 0.00 ? 21 LEU A CD1  6  
ATOM 2147 C CD2  . LEU A 1 21 ? -3.097  4.498  0.312   1.00 0.00 ? 21 LEU A CD2  6  
ATOM 2148 H H    . LEU A 1 21 ? -2.904  -0.287 0.409   1.00 0.00 ? 21 LEU A H    6  
ATOM 2149 N N    . GLU A 1 22 ? -5.122  0.451  -1.195  1.00 0.00 ? 22 GLU A N    6  
ATOM 2150 C CA   . GLU A 1 22 ? -6.046  0.216  -2.326  1.00 0.00 ? 22 GLU A CA   6  
ATOM 2151 C C    . GLU A 1 22 ? -7.152  -0.799 -1.996  1.00 0.00 ? 22 GLU A C    6  
ATOM 2152 O O    . GLU A 1 22 ? -8.297  -0.592 -2.413  1.00 0.00 ? 22 GLU A O    6  
ATOM 2153 C CB   . GLU A 1 22 ? -5.268  -0.210 -3.570  1.00 0.00 ? 22 GLU A CB   6  
ATOM 2154 C CG   . GLU A 1 22 ? -5.321  0.881  -4.653  1.00 0.00 ? 22 GLU A CG   6  
ATOM 2155 C CD   . GLU A 1 22 ? -4.062  1.737  -4.715  1.00 0.00 ? 22 GLU A CD   6  
ATOM 2156 O OE1  . GLU A 1 22 ? -3.041  1.341  -5.252  1.00 0.00 ? 22 GLU A OE1  6  
ATOM 2157 O OE2  . GLU A 1 22 ? -4.113  2.956  -4.139  1.00 0.00 ? 22 GLU A OE2  6  
ATOM 2158 H H    . GLU A 1 22 ? -4.152  0.309  -1.385  1.00 0.00 ? 22 GLU A H    6  
ATOM 2159 H HE2  . GLU A 1 22 ? -3.247  3.405  -4.368  1.00 0.00 ? 22 GLU A HE2  6  
ATOM 2160 N N    . ASN A 1 23 ? -6.867  -1.753 -1.108  1.00 0.00 ? 23 ASN A N    6  
ATOM 2161 C CA   . ASN A 1 23 ? -7.887  -2.717 -0.624  1.00 0.00 ? 23 ASN A CA   6  
ATOM 2162 C C    . ASN A 1 23 ? -8.976  -2.022 0.203   1.00 0.00 ? 23 ASN A C    6  
ATOM 2163 O O    . ASN A 1 23 ? -10.167 -2.185 -0.055  1.00 0.00 ? 23 ASN A O    6  
ATOM 2164 C CB   . ASN A 1 23 ? -7.257  -3.899 0.152   1.00 0.00 ? 23 ASN A CB   6  
ATOM 2165 C CG   . ASN A 1 23 ? -7.072  -3.667 1.667   1.00 0.00 ? 23 ASN A CG   6  
ATOM 2166 O OD1  . ASN A 1 23 ? -8.005  -3.670 2.452   1.00 0.00 ? 23 ASN A OD1  6  
ATOM 2167 N ND2  . ASN A 1 23 ? -5.867  -3.459 2.092   1.00 0.00 ? 23 ASN A ND2  6  
ATOM 2168 H H    . ASN A 1 23 ? -5.945  -1.876 -0.738  1.00 0.00 ? 23 ASN A H    6  
ATOM 2169 H HD21 . ASN A 1 23 ? -5.052  -3.656 1.548   1.00 0.00 ? 23 ASN A HD21 6  
ATOM 2170 H HD22 . ASN A 1 23 ? -5.790  -3.164 3.051   1.00 0.00 ? 23 ASN A HD22 6  
ATOM 2171 N N    . GLU A 1 24 ? -8.529  -1.123 1.084   1.00 0.00 ? 24 GLU A N    6  
ATOM 2172 C CA   . GLU A 1 24 ? -9.407  -0.364 1.989   1.00 0.00 ? 24 GLU A CA   6  
ATOM 2173 C C    . GLU A 1 24 ? -10.290 0.619  1.229   1.00 0.00 ? 24 GLU A C    6  
ATOM 2174 O O    . GLU A 1 24 ? -11.498 0.455  1.274   1.00 0.00 ? 24 GLU A O    6  
ATOM 2175 C CB   . GLU A 1 24 ? -8.595  0.352  3.075   1.00 0.00 ? 24 GLU A CB   6  
ATOM 2176 C CG   . GLU A 1 24 ? -8.832  -0.357 4.402   1.00 0.00 ? 24 GLU A CG   6  
ATOM 2177 C CD   . GLU A 1 24 ? -7.527  -0.393 5.203   1.00 0.00 ? 24 GLU A CD   6  
ATOM 2178 O OE1  . GLU A 1 24 ? -7.364  0.226  6.248   1.00 0.00 ? 24 GLU A OE1  6  
ATOM 2179 O OE2  . GLU A 1 24 ? -6.582  -1.208 4.700   1.00 0.00 ? 24 GLU A OE2  6  
ATOM 2180 H H    . GLU A 1 24 ? -7.555  -0.946 1.207   1.00 0.00 ? 24 GLU A H    6  
ATOM 2181 H HE2  . GLU A 1 24 ? -5.747  -1.002 5.204   1.00 0.00 ? 24 GLU A HE2  6  
ATOM 2182 N N    . VAL A 1 25 ? -9.666  1.457  0.397   1.00 0.00 ? 25 VAL A N    6  
ATOM 2183 C CA   . VAL A 1 25 ? -10.346 2.344  -0.578  1.00 0.00 ? 25 VAL A CA   6  
ATOM 2184 C C    . VAL A 1 25 ? -11.486 1.607  -1.308  1.00 0.00 ? 25 VAL A C    6  
ATOM 2185 O O    . VAL A 1 25 ? -12.599 2.124  -1.321  1.00 0.00 ? 25 VAL A O    6  
ATOM 2186 C CB   . VAL A 1 25 ? -9.302  2.944  -1.537  1.00 0.00 ? 25 VAL A CB   6  
ATOM 2187 C CG1  . VAL A 1 25 ? -9.934  3.811  -2.640  1.00 0.00 ? 25 VAL A CG1  6  
ATOM 2188 C CG2  . VAL A 1 25 ? -8.291  3.819  -0.786  1.00 0.00 ? 25 VAL A CG2  6  
ATOM 2189 H H    . VAL A 1 25 ? -8.686  1.617  0.478   1.00 0.00 ? 25 VAL A H    6  
ATOM 2190 N N    . ALA A 1 26 ? -11.251 0.350  -1.686  1.00 0.00 ? 26 ALA A N    6  
ATOM 2191 C CA   . ALA A 1 26 ? -12.289 -0.520 -2.289  1.00 0.00 ? 26 ALA A CA   6  
ATOM 2192 C C    . ALA A 1 26 ? -13.427 -0.840 -1.304  1.00 0.00 ? 26 ALA A C    6  
ATOM 2193 O O    . ALA A 1 26 ? -14.490 -0.226 -1.444  1.00 0.00 ? 26 ALA A O    6  
ATOM 2194 C CB   . ALA A 1 26 ? -11.637 -1.791 -2.850  1.00 0.00 ? 26 ALA A CB   6  
ATOM 2195 H H    . ALA A 1 26 ? -10.380 -0.102 -1.504  1.00 0.00 ? 26 ALA A H    6  
ATOM 2196 N N    . ARG A 1 27 ? -13.172 -1.601 -0.245  1.00 0.00 ? 27 ARG A N    6  
ATOM 2197 C CA   . ARG A 1 27 ? -14.179 -1.928 0.793   1.00 0.00 ? 27 ARG A CA   6  
ATOM 2198 C C    . ARG A 1 27 ? -14.910 -0.695 1.384   1.00 0.00 ? 27 ARG A C    6  
ATOM 2199 O O    . ARG A 1 27 ? -16.105 -0.740 1.635   1.00 0.00 ? 27 ARG A O    6  
ATOM 2200 C CB   . ARG A 1 27 ? -13.613 -2.750 1.947   1.00 0.00 ? 27 ARG A CB   6  
ATOM 2201 C CG   . ARG A 1 27 ? -13.135 -4.149 1.532   1.00 0.00 ? 27 ARG A CG   6  
ATOM 2202 C CD   . ARG A 1 27 ? -13.030 -5.104 2.726   1.00 0.00 ? 27 ARG A CD   6  
ATOM 2203 N NE   . ARG A 1 27 ? -12.216 -4.541 3.815   1.00 0.00 ? 27 ARG A NE   6  
ATOM 2204 C CZ   . ARG A 1 27 ? -10.975 -4.900 4.150   1.00 0.00 ? 27 ARG A CZ   6  
ATOM 2205 N NH1  . ARG A 1 27 ? -10.202 -5.587 3.322   1.00 0.00 ? 27 ARG A NH1  6  
ATOM 2206 N NH2  . ARG A 1 27 ? -10.416 -4.387 5.227   1.00 0.00 ? 27 ARG A NH2  6  
ATOM 2207 H H    . ARG A 1 27 ? -12.276 -2.038 -0.114  1.00 0.00 ? 27 ARG A H    6  
ATOM 2208 H HE   . ARG A 1 27 ? -12.604 -3.752 4.276   1.00 0.00 ? 27 ARG A HE   6  
ATOM 2209 H HH11 . ARG A 1 27 ? -10.541 -5.815 2.411   1.00 0.00 ? 27 ARG A HH11 6  
ATOM 2210 H HH12 . ARG A 1 27 ? -9.266  -5.809 3.580   1.00 0.00 ? 27 ARG A HH12 6  
ATOM 2211 H HH21 . ARG A 1 27 ? -10.944 -3.796 5.845   1.00 0.00 ? 27 ARG A HH21 6  
ATOM 2212 H HH22 . ARG A 1 27 ? -9.476  -4.630 5.456   1.00 0.00 ? 27 ARG A HH22 6  
ATOM 2213 N N    . LEU A 1 28 ? -14.167 0.408  1.515   1.00 0.00 ? 28 LEU A N    6  
ATOM 2214 C CA   . LEU A 1 28 ? -14.636 1.749  1.905   1.00 0.00 ? 28 LEU A CA   6  
ATOM 2215 C C    . LEU A 1 28 ? -15.629 2.334  0.881   1.00 0.00 ? 28 LEU A C    6  
ATOM 2216 O O    . LEU A 1 28 ? -16.776 2.595  1.208   1.00 0.00 ? 28 LEU A O    6  
ATOM 2217 C CB   . LEU A 1 28 ? -13.398 2.631  2.133   1.00 0.00 ? 28 LEU A CB   6  
ATOM 2218 C CG   . LEU A 1 28 ? -13.583 4.144  1.934   1.00 0.00 ? 28 LEU A CG   6  
ATOM 2219 C CD1  . LEU A 1 28 ? -14.465 4.750  3.021   1.00 0.00 ? 28 LEU A CD1  6  
ATOM 2220 C CD2  . LEU A 1 28 ? -12.233 4.855  1.889   1.00 0.00 ? 28 LEU A CD2  6  
ATOM 2221 H H    . LEU A 1 28 ? -13.176 0.360  1.335   1.00 0.00 ? 28 LEU A H    6  
ATOM 2222 N N    . LYS A 1 29 ? -15.176 2.498  -0.363  1.00 0.00 ? 29 LYS A N    6  
ATOM 2223 C CA   . LYS A 1 29 ? -16.029 3.023  -1.441  1.00 0.00 ? 29 LYS A CA   6  
ATOM 2224 C C    . LYS A 1 29 ? -17.205 2.080  -1.771  1.00 0.00 ? 29 LYS A C    6  
ATOM 2225 O O    . LYS A 1 29 ? -18.262 2.562  -2.162  1.00 0.00 ? 29 LYS A O    6  
ATOM 2226 C CB   . LYS A 1 29 ? -15.221 3.367  -2.693  1.00 0.00 ? 29 LYS A CB   6  
ATOM 2227 C CG   . LYS A 1 29 ? -14.407 4.652  -2.463  1.00 0.00 ? 29 LYS A CG   6  
ATOM 2228 C CD   . LYS A 1 29 ? -13.890 5.172  -3.808  1.00 0.00 ? 29 LYS A CD   6  
ATOM 2229 C CE   . LYS A 1 29 ? -13.200 6.541  -3.680  1.00 0.00 ? 29 LYS A CE   6  
ATOM 2230 N NZ   . LYS A 1 29 ? -11.807 6.386  -3.244  1.00 0.00 ? 29 LYS A NZ   6  
ATOM 2231 H H    . LYS A 1 29 ? -14.227 2.307  -0.632  1.00 0.00 ? 29 LYS A H    6  
ATOM 2232 H HZ1  . LYS A 1 29 ? -11.772 5.868  -2.389  1.00 0.00 ? 29 LYS A HZ1  6  
ATOM 2233 H HZ2  . LYS A 1 29 ? -11.294 5.902  -3.964  1.00 0.00 ? 29 LYS A HZ2  6  
ATOM 2234 H HZ3  . LYS A 1 29 ? -11.400 7.290  -3.108  1.00 0.00 ? 29 LYS A HZ3  6  
ATOM 2235 N N    . LYS A 1 30 ? -17.090 0.822  -1.385  1.00 0.00 ? 30 LYS A N    6  
ATOM 2236 C CA   . LYS A 1 30 ? -18.205 -0.154 -1.419  1.00 0.00 ? 30 LYS A CA   6  
ATOM 2237 C C    . LYS A 1 30 ? -19.364 0.193  -0.459  1.00 0.00 ? 30 LYS A C    6  
ATOM 2238 O O    . LYS A 1 30 ? -20.509 -0.179 -0.727  1.00 0.00 ? 30 LYS A O    6  
ATOM 2239 C CB   . LYS A 1 30 ? -17.698 -1.577 -1.156  1.00 0.00 ? 30 LYS A CB   6  
ATOM 2240 C CG   . LYS A 1 30 ? -16.865 -2.128 -2.314  1.00 0.00 ? 30 LYS A CG   6  
ATOM 2241 C CD   . LYS A 1 30 ? -17.638 -2.179 -3.628  1.00 0.00 ? 30 LYS A CD   6  
ATOM 2242 C CE   . LYS A 1 30 ? -17.449 -3.513 -4.359  1.00 0.00 ? 30 LYS A CE   6  
ATOM 2243 N NZ   . LYS A 1 30 ? -18.031 -4.591 -3.556  1.00 0.00 ? 30 LYS A NZ   6  
ATOM 2244 H H    . LYS A 1 30 ? -16.189 0.430  -1.135  1.00 0.00 ? 30 LYS A H    6  
ATOM 2245 H HZ1  . LYS A 1 30 ? -18.997 -4.406 -3.403  1.00 0.00 ? 30 LYS A HZ1  6  
ATOM 2246 H HZ2  . LYS A 1 30 ? -17.925 -5.456 -4.040  1.00 0.00 ? 30 LYS A HZ2  6  
ATOM 2247 H HZ3  . LYS A 1 30 ? -17.546 -4.647 -2.680  1.00 0.00 ? 30 LYS A HZ3  6  
ATOM 2248 N N    . LEU A 1 31 ? -19.073 1.019  0.536   1.00 0.00 ? 31 LEU A N    6  
ATOM 2249 C CA   . LEU A 1 31 ? -20.063 1.533  1.504   1.00 0.00 ? 31 LEU A CA   6  
ATOM 2250 C C    . LEU A 1 31 ? -20.612 2.914  1.065   1.00 0.00 ? 31 LEU A C    6  
ATOM 2251 O O    . LEU A 1 31 ? -21.742 3.266  1.386   1.00 0.00 ? 31 LEU A O    6  
ATOM 2252 C CB   . LEU A 1 31 ? -19.423 1.698  2.898   1.00 0.00 ? 31 LEU A CB   6  
ATOM 2253 C CG   . LEU A 1 31 ? -18.484 0.551  3.298   1.00 0.00 ? 31 LEU A CG   6  
ATOM 2254 C CD1  . LEU A 1 31 ? -17.720 0.932  4.569   1.00 0.00 ? 31 LEU A CD1  6  
ATOM 2255 C CD2  . LEU A 1 31 ? -19.178 -0.796 3.461   1.00 0.00 ? 31 LEU A CD2  6  
ATOM 2256 H H    . LEU A 1 31 ? -18.124 1.281  0.728   1.00 0.00 ? 31 LEU A H    6  
ATOM 2257 N N    . VAL A 1 32 ? -19.810 3.648  0.291   1.00 0.00 ? 32 VAL A N    6  
ATOM 2258 C CA   . VAL A 1 32 ? -20.148 4.982  -0.256  1.00 0.00 ? 32 VAL A CA   6  
ATOM 2259 C C    . VAL A 1 32 ? -20.500 4.906  -1.771  1.00 0.00 ? 32 VAL A C    6  
ATOM 2260 O O    . VAL A 1 32 ? -20.602 5.906  -2.479  1.00 0.00 ? 32 VAL A O    6  
ATOM 2261 C CB   . VAL A 1 32 ? -18.984 5.955  0.067   1.00 0.00 ? 32 VAL A CB   6  
ATOM 2262 C CG1  . VAL A 1 32 ? -19.226 7.410  -0.368  1.00 0.00 ? 32 VAL A CG1  6  
ATOM 2263 C CG2  . VAL A 1 32 ? -18.667 5.997  1.567   1.00 0.00 ? 32 VAL A CG2  6  
ATOM 2264 H H    . VAL A 1 32 ? -18.885 3.340  0.070   1.00 0.00 ? 32 VAL A H    6  
ATOM 2265 N N    . GLY A 1 33 ? -20.804 3.693  -2.219  1.00 0.00 ? 33 GLY A N    6  
ATOM 2266 C CA   . GLY A 1 33 ? -21.164 3.379  -3.619  1.00 0.00 ? 33 GLY A CA   6  
ATOM 2267 C C    . GLY A 1 33 ? -22.574 2.802  -3.732  1.00 0.00 ? 33 GLY A C    6  
ATOM 2268 O O    . GLY A 1 33 ? -23.346 3.198  -4.609  1.00 0.00 ? 33 GLY A O    6  
ATOM 2269 H H    . GLY A 1 33 ? -20.596 2.903  -1.648  1.00 0.00 ? 33 GLY A H    6  
ATOM 2270 N N    . GLU A 1 34 ? -22.927 1.955  -2.764  1.00 0.00 ? 34 GLU A N    6  
ATOM 2271 C CA   . GLU A 1 34 ? -24.252 1.297  -2.692  1.00 0.00 ? 34 GLU A CA   6  
ATOM 2272 C C    . GLU A 1 34 ? -25.109 1.900  -1.558  1.00 0.00 ? 34 GLU A C    6  
ATOM 2273 O O    . GLU A 1 34 ? -25.915 1.219  -0.924  1.00 0.00 ? 34 GLU A O    6  
ATOM 2274 C CB   . GLU A 1 34 ? -24.013 -0.202 -2.481  1.00 0.00 ? 34 GLU A CB   6  
ATOM 2275 C CG   . GLU A 1 34 ? -23.211 -0.908 -3.596  1.00 0.00 ? 34 GLU A CG   6  
ATOM 2276 C CD   . GLU A 1 34 ? -24.020 -1.269 -4.843  1.00 0.00 ? 34 GLU A CD   6  
ATOM 2277 O OE1  . GLU A 1 34 ? -25.222 -1.524 -4.841  1.00 0.00 ? 34 GLU A OE1  6  
ATOM 2278 O OE2  . GLU A 1 34 ? -23.316 -1.440 -5.984  1.00 0.00 ? 34 GLU A OE2  6  
ATOM 2279 H H    . GLU A 1 34 ? -22.282 1.665  -2.064  1.00 0.00 ? 34 GLU A H    6  
ATOM 2280 H HE2  . GLU A 1 34 ? -24.001 -1.729 -6.645  1.00 0.00 ? 34 GLU A HE2  6  
ATOM 2281 N N    . ARG A 1 35 ? -24.948 3.212  -1.336  1.00 0.00 ? 35 ARG A N    6  
ATOM 2282 C CA   . ARG A 1 35 ? -25.660 3.971  -0.275  1.00 0.00 ? 35 ARG A CA   6  
ATOM 2283 C C    . ARG A 1 35 ? -25.947 5.436  -0.630  1.00 0.00 ? 35 ARG A C    6  
ATOM 2284 O O    . ARG A 1 35 ? -25.006 6.264  -0.510  1.00 0.00 ? 35 ARG A O    6  
ATOM 2285 C CB   . ARG A 1 35 ? -24.895 3.886  1.055   1.00 0.00 ? 35 ARG A CB   6  
ATOM 2286 C CG   . ARG A 1 35 ? -25.760 3.290  2.165   1.00 0.00 ? 35 ARG A CG   6  
ATOM 2287 C CD   . ARG A 1 35 ? -25.485 1.798  2.375   1.00 0.00 ? 35 ARG A CD   6  
ATOM 2288 N NE   . ARG A 1 35 ? -24.263 1.623  3.172   1.00 0.00 ? 35 ARG A NE   6  
ATOM 2289 C CZ   . ARG A 1 35 ? -23.985 0.590  3.989   1.00 0.00 ? 35 ARG A CZ   6  
ATOM 2290 N NH1  . ARG A 1 35 ? -24.787 -0.455 4.093   1.00 0.00 ? 35 ARG A NH1  6  
ATOM 2291 N NH2  . ARG A 1 35 ? -22.956 0.662  4.811   1.00 0.00 ? 35 ARG A NH2  6  
ATOM 2292 O OXT  . ARG A 1 35 ? -27.067 5.692  -1.111  1.00 0.00 ? 35 ARG A OXT  6  
ATOM 2293 H H    . ARG A 1 35 ? -24.384 3.759  -1.955  1.00 0.00 ? 35 ARG A H    6  
ATOM 2294 H HE   . ARG A 1 35 ? -23.566 2.323  3.040   1.00 0.00 ? 35 ARG A HE   6  
ATOM 2295 H HH11 . ARG A 1 35 ? -25.593 -0.501 3.503   1.00 0.00 ? 35 ARG A HH11 6  
ATOM 2296 H HH12 . ARG A 1 35 ? -24.569 -1.201 4.710   1.00 0.00 ? 35 ARG A HH12 6  
ATOM 2297 H HH21 . ARG A 1 35 ? -22.380 1.474  4.834   1.00 0.00 ? 35 ARG A HH21 6  
ATOM 2298 H HH22 . ARG A 1 35 ? -22.758 -0.105 5.419   1.00 0.00 ? 35 ARG A HH22 6  
ATOM 2299 N N    . LEU A 1 1  ? 22.035  10.807 -4.535  1.00 0.00 ? 1  LEU A N    7  
ATOM 2300 C CA   . LEU A 1 1  ? 20.986  10.265 -5.430  1.00 0.00 ? 1  LEU A CA   7  
ATOM 2301 C C    . LEU A 1 1  ? 21.189  8.752  -5.630  1.00 0.00 ? 1  LEU A C    7  
ATOM 2302 O O    . LEU A 1 1  ? 21.863  8.115  -4.824  1.00 0.00 ? 1  LEU A O    7  
ATOM 2303 C CB   . LEU A 1 1  ? 21.022  11.031 -6.763  1.00 0.00 ? 1  LEU A CB   7  
ATOM 2304 C CG   . LEU A 1 1  ? 19.678  11.721 -7.057  1.00 0.00 ? 1  LEU A CG   7  
ATOM 2305 C CD1  . LEU A 1 1  ? 19.847  12.604 -8.298  1.00 0.00 ? 1  LEU A CD1  7  
ATOM 2306 C CD2  . LEU A 1 1  ? 18.536  10.723 -7.313  1.00 0.00 ? 1  LEU A CD2  7  
ATOM 2307 H H1   . LEU A 1 1  ? 22.931  10.615 -4.943  1.00 0.00 ? 1  LEU A H1   7  
ATOM 2308 H H2   . LEU A 1 1  ? 21.915  11.792 -4.406  1.00 0.00 ? 1  LEU A H2   7  
ATOM 2309 H H3   . LEU A 1 1  ? 21.983  10.347 -3.652  1.00 0.00 ? 1  LEU A H3   7  
ATOM 2310 N N    . GLN A 1 2  ? 20.542  8.167  -6.656  1.00 0.00 ? 2  GLN A N    7  
ATOM 2311 C CA   . GLN A 1 2  ? 20.611  6.724  -6.998  1.00 0.00 ? 2  GLN A CA   7  
ATOM 2312 C C    . GLN A 1 2  ? 20.656  5.792  -5.767  1.00 0.00 ? 2  GLN A C    7  
ATOM 2313 O O    . GLN A 1 2  ? 21.292  4.742  -5.759  1.00 0.00 ? 2  GLN A O    7  
ATOM 2314 C CB   . GLN A 1 2  ? 21.753  6.393  -7.983  1.00 0.00 ? 2  GLN A CB   7  
ATOM 2315 C CG   . GLN A 1 2  ? 23.190  6.685  -7.497  1.00 0.00 ? 2  GLN A CG   7  
ATOM 2316 C CD   . GLN A 1 2  ? 23.569  8.166  -7.590  1.00 0.00 ? 2  GLN A CD   7  
ATOM 2317 O OE1  . GLN A 1 2  ? 23.964  8.825  -6.637  1.00 0.00 ? 2  GLN A OE1  7  
ATOM 2318 N NE2  . GLN A 1 2  ? 23.447  8.734  -8.765  1.00 0.00 ? 2  GLN A NE2  7  
ATOM 2319 H H    . GLN A 1 2  ? 19.981  8.712  -7.270  1.00 0.00 ? 2  GLN A H    7  
ATOM 2320 H HE21 . GLN A 1 2  ? 23.215  8.190  -9.563  1.00 0.00 ? 2  GLN A HE21 7  
ATOM 2321 H HE22 . GLN A 1 2  ? 23.678  9.696  -8.816  1.00 0.00 ? 2  GLN A HE22 7  
ATOM 2322 N N    . ARG A 1 3  ? 19.832  6.153  -4.774  1.00 0.00 ? 3  ARG A N    7  
ATOM 2323 C CA   . ARG A 1 3  ? 19.806  5.438  -3.497  1.00 0.00 ? 3  ARG A CA   7  
ATOM 2324 C C    . ARG A 1 3  ? 18.982  4.157  -3.613  1.00 0.00 ? 3  ARG A C    7  
ATOM 2325 O O    . ARG A 1 3  ? 18.292  3.766  -2.680  1.00 0.00 ? 3  ARG A O    7  
ATOM 2326 C CB   . ARG A 1 3  ? 19.331  6.365  -2.352  1.00 0.00 ? 3  ARG A CB   7  
ATOM 2327 C CG   . ARG A 1 3  ? 20.394  7.373  -1.882  1.00 0.00 ? 3  ARG A CG   7  
ATOM 2328 C CD   . ARG A 1 3  ? 20.033  8.843  -2.153  1.00 0.00 ? 3  ARG A CD   7  
ATOM 2329 N NE   . ARG A 1 3  ? 18.818  9.246  -1.428  1.00 0.00 ? 3  ARG A NE   7  
ATOM 2330 C CZ   . ARG A 1 3  ? 17.808  9.957  -1.923  1.00 0.00 ? 3  ARG A CZ   7  
ATOM 2331 N NH1  . ARG A 1 3  ? 17.899  10.735 -3.004  1.00 0.00 ? 3  ARG A NH1  7  
ATOM 2332 N NH2  . ARG A 1 3  ? 16.585  9.602  -1.559  1.00 0.00 ? 3  ARG A NH2  7  
ATOM 2333 H H    . ARG A 1 3  ? 19.275  6.979  -4.818  1.00 0.00 ? 3  ARG A H    7  
ATOM 2334 H HE   . ARG A 1 3  ? 18.867  9.161  -0.442  1.00 0.00 ? 3  ARG A HE   7  
ATOM 2335 H HH11 . ARG A 1 3  ? 18.794  10.960 -3.374  1.00 0.00 ? 3  ARG A HH11 7  
ATOM 2336 H HH12 . ARG A 1 3  ? 17.087  11.210 -3.341  1.00 0.00 ? 3  ARG A HH12 7  
ATOM 2337 H HH21 . ARG A 1 3  ? 16.460  8.813  -0.966  1.00 0.00 ? 3  ARG A HH21 7  
ATOM 2338 H HH22 . ARG A 1 3  ? 15.785  10.105 -1.909  1.00 0.00 ? 3  ARG A HH22 7  
ATOM 2339 N N    . MET A 1 4  ? 19.270  3.379  -4.655  1.00 0.00 ? 4  MET A N    7  
ATOM 2340 C CA   . MET A 1 4  ? 18.641  2.078  -4.950  1.00 0.00 ? 4  MET A CA   7  
ATOM 2341 C C    . MET A 1 4  ? 18.893  1.039  -3.850  1.00 0.00 ? 4  MET A C    7  
ATOM 2342 O O    . MET A 1 4  ? 18.198  0.037  -3.762  1.00 0.00 ? 4  MET A O    7  
ATOM 2343 C CB   . MET A 1 4  ? 19.109  1.555  -6.317  1.00 0.00 ? 4  MET A CB   7  
ATOM 2344 C CG   . MET A 1 4  ? 18.816  2.520  -7.476  1.00 0.00 ? 4  MET A CG   7  
ATOM 2345 S SD   . MET A 1 4  ? 17.064  3.037  -7.647  1.00 0.00 ? 4  MET A SD   7  
ATOM 2346 C CE   . MET A 1 4  ? 17.124  4.669  -6.942  1.00 0.00 ? 4  MET A CE   7  
ATOM 2347 H H    . MET A 1 4  ? 19.986  3.669  -5.289  1.00 0.00 ? 4  MET A H    7  
ATOM 2348 N N    . LYS A 1 5  ? 19.857  1.349  -2.993  1.00 0.00 ? 5  LYS A N    7  
ATOM 2349 C CA   . LYS A 1 5  ? 20.129  0.640  -1.736  1.00 0.00 ? 5  LYS A CA   7  
ATOM 2350 C C    . LYS A 1 5  ? 19.114  1.030  -0.639  1.00 0.00 ? 5  LYS A C    7  
ATOM 2351 O O    . LYS A 1 5  ? 18.432  0.150  -0.132  1.00 0.00 ? 5  LYS A O    7  
ATOM 2352 C CB   . LYS A 1 5  ? 21.606  0.912  -1.413  1.00 0.00 ? 5  LYS A CB   7  
ATOM 2353 C CG   . LYS A 1 5  ? 22.122  0.520  -0.026  1.00 0.00 ? 5  LYS A CG   7  
ATOM 2354 C CD   . LYS A 1 5  ? 21.814  1.637  0.988   1.00 0.00 ? 5  LYS A CD   7  
ATOM 2355 C CE   . LYS A 1 5  ? 22.928  1.866  2.007   1.00 0.00 ? 5  LYS A CE   7  
ATOM 2356 N NZ   . LYS A 1 5  ? 23.129  0.658  2.805   1.00 0.00 ? 5  LYS A NZ   7  
ATOM 2357 H H    . LYS A 1 5  ? 20.453  2.126  -3.170  1.00 0.00 ? 5  LYS A H    7  
ATOM 2358 H HZ1  . LYS A 1 5  ? 23.377  -0.093 2.196   1.00 0.00 ? 5  LYS A HZ1  7  
ATOM 2359 H HZ2  . LYS A 1 5  ? 23.875  0.827  3.455   1.00 0.00 ? 5  LYS A HZ2  7  
ATOM 2360 H HZ3  . LYS A 1 5  ? 22.294  0.436  3.314   1.00 0.00 ? 5  LYS A HZ3  7  
ATOM 2361 N N    . GLN A 1 6  ? 18.979  2.322  -0.350  1.00 0.00 ? 6  GLN A N    7  
ATOM 2362 C CA   . GLN A 1 6  ? 18.084  2.892  0.692   1.00 0.00 ? 6  GLN A CA   7  
ATOM 2363 C C    . GLN A 1 6  ? 16.611  3.000  0.259   1.00 0.00 ? 6  GLN A C    7  
ATOM 2364 O O    . GLN A 1 6  ? 15.716  2.640  1.022   1.00 0.00 ? 6  GLN A O    7  
ATOM 2365 C CB   . GLN A 1 6  ? 18.652  4.245  1.175   1.00 0.00 ? 6  GLN A CB   7  
ATOM 2366 C CG   . GLN A 1 6  ? 17.633  5.102  1.949   1.00 0.00 ? 6  GLN A CG   7  
ATOM 2367 C CD   . GLN A 1 6  ? 18.192  5.735  3.226   1.00 0.00 ? 6  GLN A CD   7  
ATOM 2368 O OE1  . GLN A 1 6  ? 18.932  6.702  3.202   1.00 0.00 ? 6  GLN A OE1  7  
ATOM 2369 N NE2  . GLN A 1 6  ? 17.766  5.228  4.353   1.00 0.00 ? 6  GLN A NE2  7  
ATOM 2370 H H    . GLN A 1 6  ? 19.470  3.017  -0.878  1.00 0.00 ? 6  GLN A H    7  
ATOM 2371 H HE21 . GLN A 1 6  ? 17.152  4.443  4.376   1.00 0.00 ? 6  GLN A HE21 7  
ATOM 2372 H HE22 . GLN A 1 6  ? 18.110  5.649  5.184   1.00 0.00 ? 6  GLN A HE22 7  
ATOM 2373 N N    . LEU A 1 7  ? 16.375  3.572  -0.917  1.00 0.00 ? 7  LEU A N    7  
ATOM 2374 C CA   . LEU A 1 7  ? 15.047  3.658  -1.552  1.00 0.00 ? 7  LEU A CA   7  
ATOM 2375 C C    . LEU A 1 7  ? 14.384  2.275  -1.620  1.00 0.00 ? 7  LEU A C    7  
ATOM 2376 O O    . LEU A 1 7  ? 13.238  2.146  -1.208  1.00 0.00 ? 7  LEU A O    7  
ATOM 2377 C CB   . LEU A 1 7  ? 15.099  4.356  -2.915  1.00 0.00 ? 7  LEU A CB   7  
ATOM 2378 C CG   . LEU A 1 7  ? 15.641  5.790  -2.799  1.00 0.00 ? 7  LEU A CG   7  
ATOM 2379 C CD1  . LEU A 1 7  ? 15.887  6.401  -4.178  1.00 0.00 ? 7  LEU A CD1  7  
ATOM 2380 C CD2  . LEU A 1 7  ? 14.688  6.731  -2.065  1.00 0.00 ? 7  LEU A CD2  7  
ATOM 2381 H H    . LEU A 1 7  ? 17.134  3.903  -1.493  1.00 0.00 ? 7  LEU A H    7  
ATOM 2382 N N    . GLU A 1 8  ? 15.221  1.242  -1.739  1.00 0.00 ? 8  GLU A N    7  
ATOM 2383 C CA   . GLU A 1 8  ? 14.782  -0.166 -1.649  1.00 0.00 ? 8  GLU A CA   7  
ATOM 2384 C C    . GLU A 1 8  ? 14.247  -0.629 -0.276  1.00 0.00 ? 8  GLU A C    7  
ATOM 2385 O O    . GLU A 1 8  ? 13.375  -1.493 -0.253  1.00 0.00 ? 8  GLU A O    7  
ATOM 2386 C CB   . GLU A 1 8  ? 15.841  -1.142 -2.164  1.00 0.00 ? 8  GLU A CB   7  
ATOM 2387 C CG   . GLU A 1 8  ? 15.557  -1.514 -3.621  1.00 0.00 ? 8  GLU A CG   7  
ATOM 2388 C CD   . GLU A 1 8  ? 16.679  -2.352 -4.249  1.00 0.00 ? 8  GLU A CD   7  
ATOM 2389 O OE1  . GLU A 1 8  ? 16.842  -2.419 -5.462  1.00 0.00 ? 8  GLU A OE1  7  
ATOM 2390 O OE2  . GLU A 1 8  ? 17.457  -3.096 -3.424  1.00 0.00 ? 8  GLU A OE2  7  
ATOM 2391 H H    . GLU A 1 8  ? 16.205  1.362  -1.849  1.00 0.00 ? 8  GLU A H    7  
ATOM 2392 H HE2  . GLU A 1 8  ? 18.116  -3.515 -4.052  1.00 0.00 ? 8  GLU A HE2  7  
ATOM 2393 N N    . ASP A 1 9  ? 14.629  0.066  0.800   1.00 0.00 ? 9  ASP A N    7  
ATOM 2394 C CA   . ASP A 1 9  ? 14.157  -0.205 2.175   1.00 0.00 ? 9  ASP A CA   7  
ATOM 2395 C C    . ASP A 1 9  ? 12.686  0.224  2.326   1.00 0.00 ? 9  ASP A C    7  
ATOM 2396 O O    . ASP A 1 9  ? 11.893  -0.416 3.025   1.00 0.00 ? 9  ASP A O    7  
ATOM 2397 C CB   . ASP A 1 9  ? 14.969  0.543  3.248   1.00 0.00 ? 9  ASP A CB   7  
ATOM 2398 C CG   . ASP A 1 9  ? 16.469  0.222  3.297   1.00 0.00 ? 9  ASP A CG   7  
ATOM 2399 O OD1  . ASP A 1 9  ? 17.129  0.287  4.325   1.00 0.00 ? 9  ASP A OD1  7  
ATOM 2400 O OD2  . ASP A 1 9  ? 17.072  -0.025 2.126   1.00 0.00 ? 9  ASP A OD2  7  
ATOM 2401 H H    . ASP A 1 9  ? 15.285  0.819  0.729   1.00 0.00 ? 9  ASP A H    7  
ATOM 2402 H HD2  . ASP A 1 9  ? 18.038  -0.177 2.310   1.00 0.00 ? 9  ASP A HD2  7  
ATOM 2403 N N    . LYS A 1 10 ? 12.364  1.349  1.694   1.00 0.00 ? 10 LYS A N    7  
ATOM 2404 C CA   . LYS A 1 10 ? 10.977  1.847  1.632   1.00 0.00 ? 10 LYS A CA   7  
ATOM 2405 C C    . LYS A 1 10 ? 10.160  1.340  0.437   1.00 0.00 ? 10 LYS A C    7  
ATOM 2406 O O    . LYS A 1 10 ? 8.949   1.254  0.549   1.00 0.00 ? 10 LYS A O    7  
ATOM 2407 C CB   . LYS A 1 10 ? 10.837  3.368  1.773   1.00 0.00 ? 10 LYS A CB   7  
ATOM 2408 C CG   . LYS A 1 10 ? 11.730  4.220  0.879   1.00 0.00 ? 10 LYS A CG   7  
ATOM 2409 C CD   . LYS A 1 10 ? 13.017  4.551  1.629   1.00 0.00 ? 10 LYS A CD   7  
ATOM 2410 C CE   . LYS A 1 10 ? 13.527  5.922  1.219   1.00 0.00 ? 10 LYS A CE   7  
ATOM 2411 N NZ   . LYS A 1 10 ? 13.961  6.635  2.421   1.00 0.00 ? 10 LYS A NZ   7  
ATOM 2412 H H    . LYS A 1 10 ? 13.046  1.900  1.218   1.00 0.00 ? 10 LYS A H    7  
ATOM 2413 H HZ1  . LYS A 1 10 ? 13.212  6.642  3.079   1.00 0.00 ? 10 LYS A HZ1  7  
ATOM 2414 H HZ2  . LYS A 1 10 ? 14.766  6.180  2.803   1.00 0.00 ? 10 LYS A HZ2  7  
ATOM 2415 H HZ3  . LYS A 1 10 ? 14.201  7.573  2.178   1.00 0.00 ? 10 LYS A HZ3  7  
ATOM 2416 N N    . VAL A 1 11 ? 10.822  0.927  -0.647  1.00 0.00 ? 11 VAL A N    7  
ATOM 2417 C CA   . VAL A 1 11 ? 10.161  0.264  -1.791  1.00 0.00 ? 11 VAL A CA   7  
ATOM 2418 C C    . VAL A 1 11 ? 9.226   -0.889 -1.365  1.00 0.00 ? 11 VAL A C    7  
ATOM 2419 O O    . VAL A 1 11 ? 8.070   -0.931 -1.776  1.00 0.00 ? 11 VAL A O    7  
ATOM 2420 C CB   . VAL A 1 11 ? 11.205  -0.146 -2.863  1.00 0.00 ? 11 VAL A CB   7  
ATOM 2421 C CG1  . VAL A 1 11 ? 10.739  -1.186 -3.886  1.00 0.00 ? 11 VAL A CG1  7  
ATOM 2422 C CG2  . VAL A 1 11 ? 11.618  1.103  -3.661  1.00 0.00 ? 11 VAL A CG2  7  
ATOM 2423 H H    . VAL A 1 11 ? 11.769  1.214  -0.820  1.00 0.00 ? 11 VAL A H    7  
ATOM 2424 N N    . GLU A 1 12 ? 9.684   -1.679 -0.392  1.00 0.00 ? 12 GLU A N    7  
ATOM 2425 C CA   . GLU A 1 12 ? 8.884   -2.780 0.174   1.00 0.00 ? 12 GLU A CA   7  
ATOM 2426 C C    . GLU A 1 12 ? 7.717   -2.255 1.036   1.00 0.00 ? 12 GLU A C    7  
ATOM 2427 O O    . GLU A 1 12 ? 6.567   -2.653 0.856   1.00 0.00 ? 12 GLU A O    7  
ATOM 2428 C CB   . GLU A 1 12 ? 9.735   -3.736 1.012   1.00 0.00 ? 12 GLU A CB   7  
ATOM 2429 C CG   . GLU A 1 12 ? 10.976  -4.256 0.272   1.00 0.00 ? 12 GLU A CG   7  
ATOM 2430 C CD   . GLU A 1 12 ? 12.264  -3.804 0.973   1.00 0.00 ? 12 GLU A CD   7  
ATOM 2431 O OE1  . GLU A 1 12 ? 12.300  -2.926 1.817   1.00 0.00 ? 12 GLU A OE1  7  
ATOM 2432 O OE2  . GLU A 1 12 ? 13.399  -4.451 0.631   1.00 0.00 ? 12 GLU A OE2  7  
ATOM 2433 H H    . GLU A 1 12 ? 10.609  -1.570 -0.027  1.00 0.00 ? 12 GLU A H    7  
ATOM 2434 H HE2  . GLU A 1 12 ? 14.093  -3.956 1.135   1.00 0.00 ? 12 GLU A HE2  7  
ATOM 2435 N N    . GLU A 1 13 ? 8.016   -1.229 1.839   1.00 0.00 ? 13 GLU A N    7  
ATOM 2436 C CA   . GLU A 1 13 ? 7.022   -0.476 2.624   1.00 0.00 ? 13 GLU A CA   7  
ATOM 2437 C C    . GLU A 1 13 ? 5.941   0.223  1.783   1.00 0.00 ? 13 GLU A C    7  
ATOM 2438 O O    . GLU A 1 13 ? 4.852   0.498  2.270   1.00 0.00 ? 13 GLU A O    7  
ATOM 2439 C CB   . GLU A 1 13 ? 7.692   0.550  3.550   1.00 0.00 ? 13 GLU A CB   7  
ATOM 2440 C CG   . GLU A 1 13 ? 7.798   0.030  4.992   1.00 0.00 ? 13 GLU A CG   7  
ATOM 2441 C CD   . GLU A 1 13 ? 6.416   -0.319 5.549   1.00 0.00 ? 13 GLU A CD   7  
ATOM 2442 O OE1  . GLU A 1 13 ? 6.071   -1.475 5.786   1.00 0.00 ? 13 GLU A OE1  7  
ATOM 2443 O OE2  . GLU A 1 13 ? 5.531   0.685  5.659   1.00 0.00 ? 13 GLU A OE2  7  
ATOM 2444 H H    . GLU A 1 13 ? 8.952   -0.866 1.896   1.00 0.00 ? 13 GLU A H    7  
ATOM 2445 H HE2  . GLU A 1 13 ? 4.661   0.259  5.882   1.00 0.00 ? 13 GLU A HE2  7  
ATOM 2446 N N    . LEU A 1 14 ? 6.233   0.439  0.498   1.00 0.00 ? 14 LEU A N    7  
ATOM 2447 C CA   . LEU A 1 14 ? 5.260   1.000  -0.458  1.00 0.00 ? 14 LEU A CA   7  
ATOM 2448 C C    . LEU A 1 14 ? 4.140   -0.003 -0.656  1.00 0.00 ? 14 LEU A C    7  
ATOM 2449 O O    . LEU A 1 14 ? 3.062   0.227  -0.125  1.00 0.00 ? 14 LEU A O    7  
ATOM 2450 C CB   . LEU A 1 14 ? 5.841   1.396  -1.814  1.00 0.00 ? 14 LEU A CB   7  
ATOM 2451 C CG   . LEU A 1 14 ? 7.008   2.386  -1.743  1.00 0.00 ? 14 LEU A CG   7  
ATOM 2452 C CD1  . LEU A 1 14 ? 7.433   2.745  -3.160  1.00 0.00 ? 14 LEU A CD1  7  
ATOM 2453 C CD2  . LEU A 1 14 ? 6.725   3.640  -0.911  1.00 0.00 ? 14 LEU A CD2  7  
ATOM 2454 H H    . LEU A 1 14 ? 7.151   0.260  0.139   1.00 0.00 ? 14 LEU A H    7  
ATOM 2455 N N    . LEU A 1 15 ? 4.464   -1.189 -1.184  1.00 0.00 ? 15 LEU A N    7  
ATOM 2456 C CA   . LEU A 1 15 ? 3.466   -2.260 -1.422  1.00 0.00 ? 15 LEU A CA   7  
ATOM 2457 C C    . LEU A 1 15 ? 2.705   -2.629 -0.131  1.00 0.00 ? 15 LEU A C    7  
ATOM 2458 O O    . LEU A 1 15 ? 1.496   -2.480 -0.132  1.00 0.00 ? 15 LEU A O    7  
ATOM 2459 C CB   . LEU A 1 15 ? 4.088   -3.531 -2.022  1.00 0.00 ? 15 LEU A CB   7  
ATOM 2460 C CG   . LEU A 1 15 ? 5.141   -3.270 -3.106  1.00 0.00 ? 15 LEU A CG   7  
ATOM 2461 C CD1  . LEU A 1 15 ? 5.568   -4.609 -3.688  1.00 0.00 ? 15 LEU A CD1  7  
ATOM 2462 C CD2  . LEU A 1 15 ? 4.680   -2.348 -4.244  1.00 0.00 ? 15 LEU A CD2  7  
ATOM 2463 H H    . LEU A 1 15 ? 5.367   -1.365 -1.561  1.00 0.00 ? 15 LEU A H    7  
ATOM 2464 N N    . SER A 1 16 ? 3.412   -2.782 0.992   1.00 0.00 ? 16 SER A N    7  
ATOM 2465 C CA   . SER A 1 16 ? 2.761   -3.059 2.301   1.00 0.00 ? 16 SER A CA   7  
ATOM 2466 C C    . SER A 1 16 ? 1.614   -2.092 2.665   1.00 0.00 ? 16 SER A C    7  
ATOM 2467 O O    . SER A 1 16 ? 0.641   -2.495 3.300   1.00 0.00 ? 16 SER A O    7  
ATOM 2468 C CB   . SER A 1 16 ? 3.762   -3.100 3.465   1.00 0.00 ? 16 SER A CB   7  
ATOM 2469 O OG   . SER A 1 16 ? 4.097   -1.789 3.929   1.00 0.00 ? 16 SER A OG   7  
ATOM 2470 H H    . SER A 1 16 ? 4.417   -2.779 0.984   1.00 0.00 ? 16 SER A H    7  
ATOM 2471 H HG   . SER A 1 16 ? 4.722   -1.870 4.722   1.00 0.00 ? 16 SER A HG   7  
ATOM 2472 N N    . LYS A 1 17 ? 1.702   -0.865 2.138   1.00 0.00 ? 17 LYS A N    7  
ATOM 2473 C CA   . LYS A 1 17 ? 0.694   0.204  2.257   1.00 0.00 ? 17 LYS A CA   7  
ATOM 2474 C C    . LYS A 1 17 ? -0.138  0.375  0.976   1.00 0.00 ? 17 LYS A C    7  
ATOM 2475 O O    . LYS A 1 17 ? -1.349  0.250  1.028   1.00 0.00 ? 17 LYS A O    7  
ATOM 2476 C CB   . LYS A 1 17 ? 1.396   1.508  2.644   1.00 0.00 ? 17 LYS A CB   7  
ATOM 2477 C CG   . LYS A 1 17 ? 2.129   1.357  3.978   1.00 0.00 ? 17 LYS A CG   7  
ATOM 2478 C CD   . LYS A 1 17 ? 2.998   2.553  4.377   1.00 0.00 ? 17 LYS A CD   7  
ATOM 2479 C CE   . LYS A 1 17 ? 2.172   3.737  4.885   1.00 0.00 ? 17 LYS A CE   7  
ATOM 2480 N NZ   . LYS A 1 17 ? 1.937   4.707  3.802   1.00 0.00 ? 17 LYS A NZ   7  
ATOM 2481 H H    . LYS A 1 17 ? 2.550   -0.591 1.666   1.00 0.00 ? 17 LYS A H    7  
ATOM 2482 H HZ1  . LYS A 1 17 ? 1.483   4.245  3.037   1.00 0.00 ? 17 LYS A HZ1  7  
ATOM 2483 H HZ2  . LYS A 1 17 ? 1.351   5.439  4.147   1.00 0.00 ? 17 LYS A HZ2  7  
ATOM 2484 H HZ3  . LYS A 1 17 ? 2.814   5.091  3.512   1.00 0.00 ? 17 LYS A HZ3  7  
ATOM 2485 N N    . ASN A 1 18 ? 0.485   0.549  -0.198  1.00 0.00 ? 18 ASN A N    7  
ATOM 2486 C CA   . ASN A 1 18 ? -0.156  0.722  -1.520  1.00 0.00 ? 18 ASN A CA   7  
ATOM 2487 C C    . ASN A 1 18 ? -1.041  -0.468 -1.952  1.00 0.00 ? 18 ASN A C    7  
ATOM 2488 O O    . ASN A 1 18 ? -2.204  -0.294 -2.324  1.00 0.00 ? 18 ASN A O    7  
ATOM 2489 C CB   . ASN A 1 18 ? 0.926   0.992  -2.562  1.00 0.00 ? 18 ASN A CB   7  
ATOM 2490 C CG   . ASN A 1 18 ? 0.340   1.584  -3.847  1.00 0.00 ? 18 ASN A CG   7  
ATOM 2491 O OD1  . ASN A 1 18 ? 0.226   0.948  -4.876  1.00 0.00 ? 18 ASN A OD1  7  
ATOM 2492 N ND2  . ASN A 1 18 ? -0.054  2.839  -3.774  1.00 0.00 ? 18 ASN A ND2  7  
ATOM 2493 H H    . ASN A 1 18 ? 1.488   0.585  -0.206  1.00 0.00 ? 18 ASN A H    7  
ATOM 2494 H HD21 . ASN A 1 18 ? 0.011   3.343  -2.926  1.00 0.00 ? 18 ASN A HD21 7  
ATOM 2495 H HD22 . ASN A 1 18 ? -0.437  3.234  -4.608  1.00 0.00 ? 18 ASN A HD22 7  
ATOM 2496 N N    . TYR A 1 19 ? -0.529  -1.682 -1.764  1.00 0.00 ? 19 TYR A N    7  
ATOM 2497 C CA   . TYR A 1 19 ? -1.250  -2.945 -1.991  1.00 0.00 ? 19 TYR A CA   7  
ATOM 2498 C C    . TYR A 1 19 ? -2.422  -3.110 -0.997  1.00 0.00 ? 19 TYR A C    7  
ATOM 2499 O O    . TYR A 1 19 ? -3.531  -3.440 -1.389  1.00 0.00 ? 19 TYR A O    7  
ATOM 2500 C CB   . TYR A 1 19 ? -0.232  -4.082 -1.811  1.00 0.00 ? 19 TYR A CB   7  
ATOM 2501 C CG   . TYR A 1 19 ? -0.441  -5.286 -2.718  1.00 0.00 ? 19 TYR A CG   7  
ATOM 2502 C CD1  . TYR A 1 19 ? -0.262  -5.129 -4.116  1.00 0.00 ? 19 TYR A CD1  7  
ATOM 2503 C CD2  . TYR A 1 19 ? -0.710  -6.539 -2.131  1.00 0.00 ? 19 TYR A CD2  7  
ATOM 2504 C CE1  . TYR A 1 19 ? -0.352  -6.265 -4.939  1.00 0.00 ? 19 TYR A CE1  7  
ATOM 2505 C CE2  . TYR A 1 19 ? -0.800  -7.675 -2.954  1.00 0.00 ? 19 TYR A CE2  7  
ATOM 2506 C CZ   . TYR A 1 19 ? -0.628  -7.516 -4.345  1.00 0.00 ? 19 TYR A CZ   7  
ATOM 2507 O OH   . TYR A 1 19 ? -0.762  -8.605 -5.159  1.00 0.00 ? 19 TYR A OH   7  
ATOM 2508 H H    . TYR A 1 19 ? 0.398   -1.794 -1.396  1.00 0.00 ? 19 TYR A H    7  
ATOM 2509 H HH   . TYR A 1 19 ? -0.705  -8.299 -6.110  1.00 0.00 ? 19 TYR A HH   7  
ATOM 2510 N N    . HIS A 1 20 ? -2.188  -2.687 0.248   1.00 0.00 ? 20 HIS A N    7  
ATOM 2511 C CA   . HIS A 1 20 ? -3.206  -2.589 1.312   1.00 0.00 ? 20 HIS A CA   7  
ATOM 2512 C C    . HIS A 1 20 ? -4.248  -1.480 1.028   1.00 0.00 ? 20 HIS A C    7  
ATOM 2513 O O    . HIS A 1 20 ? -5.424  -1.598 1.373   1.00 0.00 ? 20 HIS A O    7  
ATOM 2514 C CB   . HIS A 1 20 ? -2.431  -2.395 2.623   1.00 0.00 ? 20 HIS A CB   7  
ATOM 2515 C CG   . HIS A 1 20 ? -3.172  -1.707 3.781   1.00 0.00 ? 20 HIS A CG   7  
ATOM 2516 N ND1  . HIS A 1 20 ? -3.818  -2.296 4.783   1.00 0.00 ? 20 HIS A ND1  7  
ATOM 2517 C CD2  . HIS A 1 20 ? -3.333  -0.392 3.910   1.00 0.00 ? 20 HIS A CD2  7  
ATOM 2518 C CE1  . HIS A 1 20 ? -4.410  -1.353 5.506   1.00 0.00 ? 20 HIS A CE1  7  
ATOM 2519 N NE2  . HIS A 1 20 ? -4.115  -0.177 4.963   1.00 0.00 ? 20 HIS A NE2  7  
ATOM 2520 H H    . HIS A 1 20 ? -1.274  -2.355 0.523   1.00 0.00 ? 20 HIS A H    7  
ATOM 2521 H HD1  . HIS A 1 20 ? -3.746  -3.258 5.035   1.00 0.00 ? 20 HIS A HD1  7  
ATOM 2522 H HE2  . HIS A 1 20 ? -4.555  0.699  5.177   1.00 0.00 ? 20 HIS A HE2  7  
ATOM 2523 N N    . LEU A 1 21 ? -3.810  -0.444 0.316   1.00 0.00 ? 21 LEU A N    7  
ATOM 2524 C CA   . LEU A 1 21 ? -4.595  0.726  -0.100  1.00 0.00 ? 21 LEU A CA   7  
ATOM 2525 C C    . LEU A 1 21 ? -5.660  0.333  -1.120  1.00 0.00 ? 21 LEU A C    7  
ATOM 2526 O O    . LEU A 1 21 ? -6.836  0.541  -0.835  1.00 0.00 ? 21 LEU A O    7  
ATOM 2527 C CB   . LEU A 1 21 ? -3.645  1.821  -0.625  1.00 0.00 ? 21 LEU A CB   7  
ATOM 2528 C CG   . LEU A 1 21 ? -4.331  3.004  -1.305  1.00 0.00 ? 21 LEU A CG   7  
ATOM 2529 C CD1  . LEU A 1 21 ? -4.924  3.981  -0.277  1.00 0.00 ? 21 LEU A CD1  7  
ATOM 2530 C CD2  . LEU A 1 21 ? -3.363  3.701  -2.252  1.00 0.00 ? 21 LEU A CD2  7  
ATOM 2531 H H    . LEU A 1 21 ? -2.841  -0.386 0.078   1.00 0.00 ? 21 LEU A H    7  
ATOM 2532 N N    . GLU A 1 22 ? -5.265  -0.452 -2.120  1.00 0.00 ? 22 GLU A N    7  
ATOM 2533 C CA   . GLU A 1 22 ? -6.196  -0.990 -3.134  1.00 0.00 ? 22 GLU A CA   7  
ATOM 2534 C C    . GLU A 1 22 ? -7.300  -1.880 -2.510  1.00 0.00 ? 22 GLU A C    7  
ATOM 2535 O O    . GLU A 1 22 ? -8.431  -1.883 -3.003  1.00 0.00 ? 22 GLU A O    7  
ATOM 2536 C CB   . GLU A 1 22 ? -5.352  -1.719 -4.180  1.00 0.00 ? 22 GLU A CB   7  
ATOM 2537 C CG   . GLU A 1 22 ? -5.988  -1.724 -5.574  1.00 0.00 ? 22 GLU A CG   7  
ATOM 2538 C CD   . GLU A 1 22 ? -6.975  -2.879 -5.826  1.00 0.00 ? 22 GLU A CD   7  
ATOM 2539 O OE1  . GLU A 1 22 ? -7.039  -3.879 -5.125  1.00 0.00 ? 22 GLU A OE1  7  
ATOM 2540 O OE2  . GLU A 1 22 ? -7.679  -2.805 -6.976  1.00 0.00 ? 22 GLU A OE2  7  
ATOM 2541 H H    . GLU A 1 22 ? -4.297  -0.668 -2.259  1.00 0.00 ? 22 GLU A H    7  
ATOM 2542 H HE2  . GLU A 1 22 ? -8.206  -3.649 -6.972  1.00 0.00 ? 22 GLU A HE2  7  
ATOM 2543 N N    . ASN A 1 23 ? -7.008  -2.441 -1.339  1.00 0.00 ? 23 ASN A N    7  
ATOM 2544 C CA   . ASN A 1 23 ? -7.993  -3.140 -0.486  1.00 0.00 ? 23 ASN A CA   7  
ATOM 2545 C C    . ASN A 1 23 ? -8.847  -2.152 0.335   1.00 0.00 ? 23 ASN A C    7  
ATOM 2546 O O    . ASN A 1 23 ? -10.072 -2.194 0.261   1.00 0.00 ? 23 ASN A O    7  
ATOM 2547 C CB   . ASN A 1 23 ? -7.266  -4.139 0.436   1.00 0.00 ? 23 ASN A CB   7  
ATOM 2548 C CG   . ASN A 1 23 ? -8.234  -4.903 1.336   1.00 0.00 ? 23 ASN A CG   7  
ATOM 2549 O OD1  . ASN A 1 23 ? -8.642  -6.027 1.065   1.00 0.00 ? 23 ASN A OD1  7  
ATOM 2550 N ND2  . ASN A 1 23 ? -8.655  -4.297 2.429   1.00 0.00 ? 23 ASN A ND2  7  
ATOM 2551 H H    . ASN A 1 23 ? -6.081  -2.378 -0.953  1.00 0.00 ? 23 ASN A H    7  
ATOM 2552 H HD21 . ASN A 1 23 ? -8.359  -3.374 2.663   1.00 0.00 ? 23 ASN A HD21 7  
ATOM 2553 H HD22 . ASN A 1 23 ? -9.300  -4.807 2.987   1.00 0.00 ? 23 ASN A HD22 7  
ATOM 2554 N N    . GLU A 1 24 ? -8.202  -1.296 1.138   1.00 0.00 ? 24 GLU A N    7  
ATOM 2555 C CA   . GLU A 1 24 ? -8.919  -0.322 1.988   1.00 0.00 ? 24 GLU A CA   7  
ATOM 2556 C C    . GLU A 1 24 ? -9.853  0.592  1.186   1.00 0.00 ? 24 GLU A C    7  
ATOM 2557 O O    . GLU A 1 24 ? -11.036 0.636  1.501   1.00 0.00 ? 24 GLU A O    7  
ATOM 2558 C CB   . GLU A 1 24 ? -7.993  0.482  2.932   1.00 0.00 ? 24 GLU A CB   7  
ATOM 2559 C CG   . GLU A 1 24 ? -7.168  1.560  2.221   1.00 0.00 ? 24 GLU A CG   7  
ATOM 2560 C CD   . GLU A 1 24 ? -6.389  2.497  3.133   1.00 0.00 ? 24 GLU A CD   7  
ATOM 2561 O OE1  . GLU A 1 24 ? -5.748  2.127  4.110   1.00 0.00 ? 24 GLU A OE1  7  
ATOM 2562 O OE2  . GLU A 1 24 ? -6.371  3.788  2.749   1.00 0.00 ? 24 GLU A OE2  7  
ATOM 2563 H H    . GLU A 1 24 ? -7.196  -1.278 1.186   1.00 0.00 ? 24 GLU A H    7  
ATOM 2564 H HE2  . GLU A 1 24 ? -5.798  4.249  3.427   1.00 0.00 ? 24 GLU A HE2  7  
ATOM 2565 N N    . VAL A 1 25 ? -9.363  1.098  0.051   1.00 0.00 ? 25 VAL A N    7  
ATOM 2566 C CA   . VAL A 1 25 ? -10.098 1.890  -0.960  1.00 0.00 ? 25 VAL A CA   7  
ATOM 2567 C C    . VAL A 1 25 ? -11.412 1.210  -1.365  1.00 0.00 ? 25 VAL A C    7  
ATOM 2568 O O    . VAL A 1 25 ? -12.424 1.895  -1.425  1.00 0.00 ? 25 VAL A O    7  
ATOM 2569 C CB   . VAL A 1 25 ? -9.178  2.223  -2.156  1.00 0.00 ? 25 VAL A CB   7  
ATOM 2570 C CG1  . VAL A 1 25 ? -9.887  2.737  -3.404  1.00 0.00 ? 25 VAL A CG1  7  
ATOM 2571 C CG2  . VAL A 1 25 ? -8.198  3.315  -1.733  1.00 0.00 ? 25 VAL A CG2  7  
ATOM 2572 H H    . VAL A 1 25 ? -8.388  1.012  -0.165  1.00 0.00 ? 25 VAL A H    7  
ATOM 2573 N N    . ALA A 1 26 ? -11.405 -0.120 -1.440  1.00 0.00 ? 26 ALA A N    7  
ATOM 2574 C CA   . ALA A 1 26 ? -12.620 -0.904 -1.726  1.00 0.00 ? 26 ALA A CA   7  
ATOM 2575 C C    . ALA A 1 26 ? -13.645 -0.759 -0.583  1.00 0.00 ? 26 ALA A C    7  
ATOM 2576 O O    . ALA A 1 26 ? -14.572 0.035  -0.749  1.00 0.00 ? 26 ALA A O    7  
ATOM 2577 C CB   . ALA A 1 26 ? -12.251 -2.374 -1.994  1.00 0.00 ? 26 ALA A CB   7  
ATOM 2578 H H    . ALA A 1 26 ? -10.593 -0.650 -1.218  1.00 0.00 ? 26 ALA A H    7  
ATOM 2579 N N    . ARG A 1 27 ? -13.334 -1.261 0.615   1.00 0.00 ? 27 ARG A N    7  
ATOM 2580 C CA   . ARG A 1 27 ? -14.195 -1.107 1.807   1.00 0.00 ? 27 ARG A CA   7  
ATOM 2581 C C    . ARG A 1 27 ? -14.594 0.369  2.042   1.00 0.00 ? 27 ARG A C    7  
ATOM 2582 O O    . ARG A 1 27 ? -15.770 0.673  2.179   1.00 0.00 ? 27 ARG A O    7  
ATOM 2583 C CB   . ARG A 1 27 ? -13.519 -1.677 3.058   1.00 0.00 ? 27 ARG A CB   7  
ATOM 2584 C CG   . ARG A 1 27 ? -14.541 -1.791 4.191   1.00 0.00 ? 27 ARG A CG   7  
ATOM 2585 C CD   . ARG A 1 27 ? -13.950 -1.706 5.594   1.00 0.00 ? 27 ARG A CD   7  
ATOM 2586 N NE   . ARG A 1 27 ? -15.059 -1.232 6.433   1.00 0.00 ? 27 ARG A NE   7  
ATOM 2587 C CZ   . ARG A 1 27 ? -15.689 -1.889 7.405   1.00 0.00 ? 27 ARG A CZ   7  
ATOM 2588 N NH1  . ARG A 1 27 ? -15.049 -2.727 8.212   1.00 0.00 ? 27 ARG A NH1  7  
ATOM 2589 N NH2  . ARG A 1 27 ? -16.864 -1.449 7.807   1.00 0.00 ? 27 ARG A NH2  7  
ATOM 2590 H H    . ARG A 1 27 ? -12.509 -1.824 0.743   1.00 0.00 ? 27 ARG A H    7  
ATOM 2591 H HE   . ARG A 1 27 ? -15.284 -0.266 6.322   1.00 0.00 ? 27 ARG A HE   7  
ATOM 2592 H HH11 . ARG A 1 27 ? -14.063 -2.857 8.088   1.00 0.00 ? 27 ARG A HH11 7  
ATOM 2593 H HH12 . ARG A 1 27 ? -15.544 -3.198 8.931   1.00 0.00 ? 27 ARG A HH12 7  
ATOM 2594 H HH21 . ARG A 1 27 ? -17.330 -0.728 7.297   1.00 0.00 ? 27 ARG A HH21 7  
ATOM 2595 H HH22 . ARG A 1 27 ? -17.338 -1.904 8.557   1.00 0.00 ? 27 ARG A HH22 7  
ATOM 2596 N N    . LEU A 1 28 ? -13.628 1.272  1.859   1.00 0.00 ? 28 LEU A N    7  
ATOM 2597 C CA   . LEU A 1 28 ? -13.784 2.745  1.898   1.00 0.00 ? 28 LEU A CA   7  
ATOM 2598 C C    . LEU A 1 28 ? -14.847 3.239  0.904   1.00 0.00 ? 28 LEU A C    7  
ATOM 2599 O O    . LEU A 1 28 ? -15.900 3.672  1.347   1.00 0.00 ? 28 LEU A O    7  
ATOM 2600 C CB   . LEU A 1 28 ? -12.398 3.387  1.679   1.00 0.00 ? 28 LEU A CB   7  
ATOM 2601 C CG   . LEU A 1 28 ? -12.403 4.831  1.175   1.00 0.00 ? 28 LEU A CG   7  
ATOM 2602 C CD1  . LEU A 1 28 ? -12.860 5.807  2.257   1.00 0.00 ? 28 LEU A CD1  7  
ATOM 2603 C CD2  . LEU A 1 28 ? -11.016 5.226  0.666   1.00 0.00 ? 28 LEU A CD2  7  
ATOM 2604 H H    . LEU A 1 28 ? -12.695 0.967  1.629   1.00 0.00 ? 28 LEU A H    7  
ATOM 2605 N N    . LYS A 1 29 ? -14.631 3.059  -0.389  1.00 0.00 ? 29 LYS A N    7  
ATOM 2606 C CA   . LYS A 1 29 ? -15.580 3.477  -1.441  1.00 0.00 ? 29 LYS A CA   7  
ATOM 2607 C C    . LYS A 1 29 ? -16.915 2.713  -1.392  1.00 0.00 ? 29 LYS A C    7  
ATOM 2608 O O    . LYS A 1 29 ? -17.944 3.216  -1.834  1.00 0.00 ? 29 LYS A O    7  
ATOM 2609 C CB   . LYS A 1 29 ? -14.939 3.398  -2.824  1.00 0.00 ? 29 LYS A CB   7  
ATOM 2610 C CG   . LYS A 1 29 ? -13.859 4.481  -2.992  1.00 0.00 ? 29 LYS A CG   7  
ATOM 2611 C CD   . LYS A 1 29 ? -13.225 4.399  -4.381  1.00 0.00 ? 29 LYS A CD   7  
ATOM 2612 C CE   . LYS A 1 29 ? -12.087 5.399  -4.588  1.00 0.00 ? 29 LYS A CE   7  
ATOM 2613 N NZ   . LYS A 1 29 ? -12.590 6.783  -4.700  1.00 0.00 ? 29 LYS A NZ   7  
ATOM 2614 H H    . LYS A 1 29 ? -13.801 2.593  -0.737  1.00 0.00 ? 29 LYS A H    7  
ATOM 2615 H HZ1  . LYS A 1 29 ? -13.110 7.023  -3.879  1.00 0.00 ? 29 LYS A HZ1  7  
ATOM 2616 H HZ2  . LYS A 1 29 ? -11.802 7.402  -4.786  1.00 0.00 ? 29 LYS A HZ2  7  
ATOM 2617 H HZ3  . LYS A 1 29 ? -13.158 6.868  -5.511  1.00 0.00 ? 29 LYS A HZ3  7  
ATOM 2618 N N    . LYS A 1 30 ? -16.917 1.567  -0.701  1.00 0.00 ? 30 LYS A N    7  
ATOM 2619 C CA   . LYS A 1 30 ? -18.132 0.808  -0.373  1.00 0.00 ? 30 LYS A CA   7  
ATOM 2620 C C    . LYS A 1 30 ? -18.934 1.421  0.798   1.00 0.00 ? 30 LYS A C    7  
ATOM 2621 O O    . LYS A 1 30 ? -20.153 1.433  0.768   1.00 0.00 ? 30 LYS A O    7  
ATOM 2622 C CB   . LYS A 1 30 ? -17.800 -0.660 -0.118  1.00 0.00 ? 30 LYS A CB   7  
ATOM 2623 C CG   . LYS A 1 30 ? -17.322 -1.382 -1.391  1.00 0.00 ? 30 LYS A CG   7  
ATOM 2624 C CD   . LYS A 1 30 ? -18.416 -1.426 -2.466  1.00 0.00 ? 30 LYS A CD   7  
ATOM 2625 C CE   . LYS A 1 30 ? -18.643 -2.842 -2.999  1.00 0.00 ? 30 LYS A CE   7  
ATOM 2626 N NZ   . LYS A 1 30 ? -19.106 -3.712 -1.911  1.00 0.00 ? 30 LYS A NZ   7  
ATOM 2627 H H    . LYS A 1 30 ? -16.044 1.121  -0.448  1.00 0.00 ? 30 LYS A H    7  
ATOM 2628 H HZ1  . LYS A 1 30 ? -19.946 -3.328 -1.525  1.00 0.00 ? 30 LYS A HZ1  7  
ATOM 2629 H HZ2  . LYS A 1 30 ? -19.292 -4.625 -2.276  1.00 0.00 ? 30 LYS A HZ2  7  
ATOM 2630 H HZ3  . LYS A 1 30 ? -18.392 -3.777 -1.212  1.00 0.00 ? 30 LYS A HZ3  7  
ATOM 2631 N N    . LEU A 1 31 ? -18.229 2.080  1.717   1.00 0.00 ? 31 LEU A N    7  
ATOM 2632 C CA   . LEU A 1 31 ? -18.846 2.829  2.829   1.00 0.00 ? 31 LEU A CA   7  
ATOM 2633 C C    . LEU A 1 31 ? -18.932 4.358  2.630   1.00 0.00 ? 31 LEU A C    7  
ATOM 2634 O O    . LEU A 1 31 ? -19.506 5.073  3.453   1.00 0.00 ? 31 LEU A O    7  
ATOM 2635 C CB   . LEU A 1 31 ? -18.258 2.419  4.193   1.00 0.00 ? 31 LEU A CB   7  
ATOM 2636 C CG   . LEU A 1 31 ? -16.786 2.748  4.427   1.00 0.00 ? 31 LEU A CG   7  
ATOM 2637 C CD1  . LEU A 1 31 ? -16.591 4.135  5.044   1.00 0.00 ? 31 LEU A CD1  7  
ATOM 2638 C CD2  . LEU A 1 31 ? -16.149 1.687  5.324   1.00 0.00 ? 31 LEU A CD2  7  
ATOM 2639 H H    . LEU A 1 31 ? -17.215 2.050  1.733   1.00 0.00 ? 31 LEU A H    7  
ATOM 2640 N N    . VAL A 1 32 ? -18.426 4.817  1.486   1.00 0.00 ? 32 VAL A N    7  
ATOM 2641 C CA   . VAL A 1 32 ? -18.407 6.245  1.061   1.00 0.00 ? 32 VAL A CA   7  
ATOM 2642 C C    . VAL A 1 32 ? -19.072 6.441  -0.326  1.00 0.00 ? 32 VAL A C    7  
ATOM 2643 O O    . VAL A 1 32 ? -19.199 7.561  -0.824  1.00 0.00 ? 32 VAL A O    7  
ATOM 2644 C CB   . VAL A 1 32 ? -16.946 6.752  1.132   1.00 0.00 ? 32 VAL A CB   7  
ATOM 2645 C CG1  . VAL A 1 32 ? -16.689 8.167  0.586   1.00 0.00 ? 32 VAL A CG1  7  
ATOM 2646 C CG2  . VAL A 1 32 ? -16.465 6.790  2.590   1.00 0.00 ? 32 VAL A CG2  7  
ATOM 2647 H H    . VAL A 1 32 ? -17.836 4.212  0.940   1.00 0.00 ? 32 VAL A H    7  
ATOM 2648 N N    . GLY A 1 33 ? -19.617 5.360  -0.867  1.00 0.00 ? 33 GLY A N    7  
ATOM 2649 C CA   . GLY A 1 33 ? -20.350 5.357  -2.152  1.00 0.00 ? 33 GLY A CA   7  
ATOM 2650 C C    . GLY A 1 33 ? -21.864 5.290  -1.946  1.00 0.00 ? 33 GLY A C    7  
ATOM 2651 O O    . GLY A 1 33 ? -22.615 5.960  -2.650  1.00 0.00 ? 33 GLY A O    7  
ATOM 2652 H H    . GLY A 1 33 ? -19.473 4.458  -0.472  1.00 0.00 ? 33 GLY A H    7  
ATOM 2653 N N    . GLU A 1 34 ? -22.267 4.448  -0.990  1.00 0.00 ? 34 GLU A N    7  
ATOM 2654 C CA   . GLU A 1 34 ? -23.684 4.131  -0.666  1.00 0.00 ? 34 GLU A CA   7  
ATOM 2655 C C    . GLU A 1 34 ? -23.844 3.221  0.564   1.00 0.00 ? 34 GLU A C    7  
ATOM 2656 O O    . GLU A 1 34 ? -24.183 2.037  0.485   1.00 0.00 ? 34 GLU A O    7  
ATOM 2657 C CB   . GLU A 1 34 ? -24.421 3.555  -1.899  1.00 0.00 ? 34 GLU A CB   7  
ATOM 2658 C CG   . GLU A 1 34 ? -23.641 2.477  -2.669  1.00 0.00 ? 34 GLU A CG   7  
ATOM 2659 C CD   . GLU A 1 34 ? -24.331 1.116  -2.638  1.00 0.00 ? 34 GLU A CD   7  
ATOM 2660 O OE1  . GLU A 1 34 ? -23.705 0.070  -2.460  1.00 0.00 ? 34 GLU A OE1  7  
ATOM 2661 O OE2  . GLU A 1 34 ? -25.646 1.086  -2.936  1.00 0.00 ? 34 GLU A OE2  7  
ATOM 2662 H H    . GLU A 1 34 ? -21.604 3.946  -0.436  1.00 0.00 ? 34 GLU A H    7  
ATOM 2663 H HE2  . GLU A 1 34 ? -25.868 0.121  -2.845  1.00 0.00 ? 34 GLU A HE2  7  
ATOM 2664 N N    . ARG A 1 35 ? -23.562 3.800  1.735   1.00 0.00 ? 35 ARG A N    7  
ATOM 2665 C CA   . ARG A 1 35 ? -23.744 3.124  3.042   1.00 0.00 ? 35 ARG A CA   7  
ATOM 2666 C C    . ARG A 1 35 ? -24.431 4.001  4.102   1.00 0.00 ? 35 ARG A C    7  
ATOM 2667 O O    . ARG A 1 35 ? -24.021 5.179  4.230   1.00 0.00 ? 35 ARG A O    7  
ATOM 2668 C CB   . ARG A 1 35 ? -22.388 2.601  3.523   1.00 0.00 ? 35 ARG A CB   7  
ATOM 2669 C CG   . ARG A 1 35 ? -22.386 2.020  4.940   1.00 0.00 ? 35 ARG A CG   7  
ATOM 2670 C CD   . ARG A 1 35 ? -21.514 0.763  5.045   1.00 0.00 ? 35 ARG A CD   7  
ATOM 2671 N NE   . ARG A 1 35 ? -22.245 -0.410 4.541   1.00 0.00 ? 35 ARG A NE   7  
ATOM 2672 C CZ   . ARG A 1 35 ? -21.849 -1.222 3.554   1.00 0.00 ? 35 ARG A CZ   7  
ATOM 2673 N NH1  . ARG A 1 35 ? -20.935 -0.885 2.669   1.00 0.00 ? 35 ARG A NH1  7  
ATOM 2674 N NH2  . ARG A 1 35 ? -22.107 -2.514 3.682   1.00 0.00 ? 35 ARG A NH2  7  
ATOM 2675 O OXT  . ARG A 1 35 ? -25.342 3.477  4.778   1.00 0.00 ? 35 ARG A OXT  7  
ATOM 2676 H H    . ARG A 1 35 ? -23.201 4.734  1.776   1.00 0.00 ? 35 ARG A H    7  
ATOM 2677 H HE   . ARG A 1 35 ? -23.191 -0.482 4.839   1.00 0.00 ? 35 ARG A HE   7  
ATOM 2678 H HH11 . ARG A 1 35 ? -20.678 0.072  2.558   1.00 0.00 ? 35 ARG A HH11 7  
ATOM 2679 H HH12 . ARG A 1 35 ? -20.629 -1.550 1.980   1.00 0.00 ? 35 ARG A HH12 7  
ATOM 2680 H HH21 . ARG A 1 35 ? -22.561 -2.854 4.511   1.00 0.00 ? 35 ARG A HH21 7  
ATOM 2681 H HH22 . ARG A 1 35 ? -21.802 -3.152 2.980   1.00 0.00 ? 35 ARG A HH22 7  
ATOM 2682 N N    . LEU A 1 1  ? 29.660  3.479  1.665   1.00 0.00 ? 1  LEU A N    8  
ATOM 2683 C CA   . LEU A 1 1  ? 28.354  4.026  1.138   1.00 0.00 ? 1  LEU A CA   8  
ATOM 2684 C C    . LEU A 1 1  ? 27.190  3.035  1.258   1.00 0.00 ? 1  LEU A C    8  
ATOM 2685 O O    . LEU A 1 1  ? 27.278  1.861  0.889   1.00 0.00 ? 1  LEU A O    8  
ATOM 2686 C CB   . LEU A 1 1  ? 28.558  4.433  -0.321  1.00 0.00 ? 1  LEU A CB   8  
ATOM 2687 C CG   . LEU A 1 1  ? 28.181  5.904  -0.553  1.00 0.00 ? 1  LEU A CG   8  
ATOM 2688 C CD1  . LEU A 1 1  ? 28.793  6.376  -1.872  1.00 0.00 ? 1  LEU A CD1  8  
ATOM 2689 C CD2  . LEU A 1 1  ? 26.660  6.102  -0.602  1.00 0.00 ? 1  LEU A CD2  8  
ATOM 2690 H H1   . LEU A 1 1  ? 29.879  2.651  1.146   1.00 0.00 ? 1  LEU A H1   8  
ATOM 2691 H H2   . LEU A 1 1  ? 30.367  4.159  1.527   1.00 0.00 ? 1  LEU A H2   8  
ATOM 2692 H H3   . LEU A 1 1  ? 29.578  3.276  2.622   1.00 0.00 ? 1  LEU A H3   8  
ATOM 2693 N N    . GLN A 1 2  ? 26.068  3.579  1.725   1.00 0.00 ? 2  GLN A N    8  
ATOM 2694 C CA   . GLN A 1 2  ? 24.807  2.790  1.877   1.00 0.00 ? 2  GLN A CA   8  
ATOM 2695 C C    . GLN A 1 2  ? 23.728  3.289  0.908   1.00 0.00 ? 2  GLN A C    8  
ATOM 2696 O O    . GLN A 1 2  ? 22.859  4.104  1.219   1.00 0.00 ? 2  GLN A O    8  
ATOM 2697 C CB   . GLN A 1 2  ? 24.367  2.742  3.334   1.00 0.00 ? 2  GLN A CB   8  
ATOM 2698 C CG   . GLN A 1 2  ? 23.069  1.928  3.490   1.00 0.00 ? 2  GLN A CG   8  
ATOM 2699 C CD   . GLN A 1 2  ? 23.012  1.091  4.750   1.00 0.00 ? 2  GLN A CD   8  
ATOM 2700 O OE1  . GLN A 1 2  ? 23.150  1.545  5.875   1.00 0.00 ? 2  GLN A OE1  8  
ATOM 2701 N NE2  . GLN A 1 2  ? 22.708  -0.184 4.574   1.00 0.00 ? 2  GLN A NE2  8  
ATOM 2702 H H    . GLN A 1 2  ? 25.996  4.529  1.952   1.00 0.00 ? 2  GLN A H    8  
ATOM 2703 H HE21 . GLN A 1 2  ? 22.581  -0.565 3.665   1.00 0.00 ? 2  GLN A HE21 8  
ATOM 2704 H HE22 . GLN A 1 2  ? 22.650  -0.750 5.387   1.00 0.00 ? 2  GLN A HE22 8  
ATOM 2705 N N    . ARG A 1 3  ? 23.798  2.684  -0.259  1.00 0.00 ? 3  ARG A N    8  
ATOM 2706 C CA   . ARG A 1 3  ? 22.842  2.933  -1.368  1.00 0.00 ? 3  ARG A CA   8  
ATOM 2707 C C    . ARG A 1 3  ? 22.372  1.601  -1.959  1.00 0.00 ? 3  ARG A C    8  
ATOM 2708 O O    . ARG A 1 3  ? 22.991  0.556  -1.719  1.00 0.00 ? 3  ARG A O    8  
ATOM 2709 C CB   . ARG A 1 3  ? 23.473  3.837  -2.430  1.00 0.00 ? 3  ARG A CB   8  
ATOM 2710 C CG   . ARG A 1 3  ? 24.850  3.355  -2.901  1.00 0.00 ? 3  ARG A CG   8  
ATOM 2711 C CD   . ARG A 1 3  ? 24.923  3.286  -4.432  1.00 0.00 ? 3  ARG A CD   8  
ATOM 2712 N NE   . ARG A 1 3  ? 24.684  4.593  -5.075  1.00 0.00 ? 3  ARG A NE   8  
ATOM 2713 C CZ   . ARG A 1 3  ? 25.538  5.598  -5.203  1.00 0.00 ? 3  ARG A CZ   8  
ATOM 2714 N NH1  . ARG A 1 3  ? 26.660  5.693  -4.492  1.00 0.00 ? 3  ARG A NH1  8  
ATOM 2715 N NH2  . ARG A 1 3  ? 25.485  6.322  -6.302  1.00 0.00 ? 3  ARG A NH2  8  
ATOM 2716 H H    . ARG A 1 3  ? 24.505  2.025  -0.465  1.00 0.00 ? 3  ARG A H    8  
ATOM 2717 H HE   . ARG A 1 3  ? 23.738  4.766  -5.331  1.00 0.00 ? 3  ARG A HE   8  
ATOM 2718 H HH11 . ARG A 1 3  ? 26.818  5.049  -3.741  1.00 0.00 ? 3  ARG A HH11 8  
ATOM 2719 H HH12 . ARG A 1 3  ? 27.304  6.437  -4.661  1.00 0.00 ? 3  ARG A HH12 8  
ATOM 2720 H HH21 . ARG A 1 3  ? 24.834  6.086  -7.024  1.00 0.00 ? 3  ARG A HH21 8  
ATOM 2721 H HH22 . ARG A 1 3  ? 26.123  7.078  -6.445  1.00 0.00 ? 3  ARG A HH22 8  
ATOM 2722 N N    . MET A 1 4  ? 21.141  1.635  -2.472  1.00 0.00 ? 4  MET A N    8  
ATOM 2723 C CA   . MET A 1 4  ? 20.428  0.454  -3.051  1.00 0.00 ? 4  MET A CA   8  
ATOM 2724 C C    . MET A 1 4  ? 20.109  -0.665 -2.035  1.00 0.00 ? 4  MET A C    8  
ATOM 2725 O O    . MET A 1 4  ? 19.508  -1.673 -2.387  1.00 0.00 ? 4  MET A O    8  
ATOM 2726 C CB   . MET A 1 4  ? 21.182  -0.109 -4.274  1.00 0.00 ? 4  MET A CB   8  
ATOM 2727 C CG   . MET A 1 4  ? 21.557  0.922  -5.349  1.00 0.00 ? 4  MET A CG   8  
ATOM 2728 S SD   . MET A 1 4  ? 20.151  1.830  -6.106  1.00 0.00 ? 4  MET A SD   8  
ATOM 2729 C CE   . MET A 1 4  ? 20.187  3.365  -5.200  1.00 0.00 ? 4  MET A CE   8  
ATOM 2730 H H    . MET A 1 4  ? 20.678  2.500  -2.607  1.00 0.00 ? 4  MET A H    8  
ATOM 2731 N N    . LYS A 1 5  ? 20.386  -0.372 -0.773  1.00 0.00 ? 5  LYS A N    8  
ATOM 2732 C CA   . LYS A 1 5  ? 20.039  -1.234 0.389   1.00 0.00 ? 5  LYS A CA   8  
ATOM 2733 C C    . LYS A 1 5  ? 18.909  -0.666 1.257   1.00 0.00 ? 5  LYS A C    8  
ATOM 2734 O O    . LYS A 1 5  ? 18.033  -1.403 1.696   1.00 0.00 ? 5  LYS A O    8  
ATOM 2735 C CB   . LYS A 1 5  ? 21.253  -1.489 1.278   1.00 0.00 ? 5  LYS A CB   8  
ATOM 2736 C CG   . LYS A 1 5  ? 21.973  -2.773 0.921   1.00 0.00 ? 5  LYS A CG   8  
ATOM 2737 C CD   . LYS A 1 5  ? 23.004  -3.020 2.023   1.00 0.00 ? 5  LYS A CD   8  
ATOM 2738 C CE   . LYS A 1 5  ? 24.182  -3.849 1.529   1.00 0.00 ? 5  LYS A CE   8  
ATOM 2739 N NZ   . LYS A 1 5  ? 25.318  -3.481 2.367   1.00 0.00 ? 5  LYS A NZ   8  
ATOM 2740 H H    . LYS A 1 5  ? 21.037  0.359  -0.589  1.00 0.00 ? 5  LYS A H    8  
ATOM 2741 H HZ1  . LYS A 1 5  ? 25.454  -2.494 2.344   1.00 0.00 ? 5  LYS A HZ1  8  
ATOM 2742 H HZ2  . LYS A 1 5  ? 25.150  -3.784 3.305   1.00 0.00 ? 5  LYS A HZ2  8  
ATOM 2743 H HZ3  . LYS A 1 5  ? 26.145  -3.929 2.026   1.00 0.00 ? 5  LYS A HZ3  8  
ATOM 2744 N N    . GLN A 1 6  ? 18.960  0.637  1.498   1.00 0.00 ? 6  GLN A N    8  
ATOM 2745 C CA   . GLN A 1 6  ? 17.864  1.337  2.237   1.00 0.00 ? 6  GLN A CA   8  
ATOM 2746 C C    . GLN A 1 6  ? 16.793  1.917  1.311   1.00 0.00 ? 6  GLN A C    8  
ATOM 2747 O O    . GLN A 1 6  ? 15.599  1.795  1.558   1.00 0.00 ? 6  GLN A O    8  
ATOM 2748 C CB   . GLN A 1 6  ? 18.425  2.420  3.172   1.00 0.00 ? 6  GLN A CB   8  
ATOM 2749 C CG   . GLN A 1 6  ? 19.236  3.511  2.469   1.00 0.00 ? 6  GLN A CG   8  
ATOM 2750 C CD   . GLN A 1 6  ? 19.553  4.651  3.425   1.00 0.00 ? 6  GLN A CD   8  
ATOM 2751 O OE1  . GLN A 1 6  ? 19.017  5.747  3.349   1.00 0.00 ? 6  GLN A OE1  8  
ATOM 2752 N NE2  . GLN A 1 6  ? 20.456  4.402  4.355   1.00 0.00 ? 6  GLN A NE2  8  
ATOM 2753 H H    . GLN A 1 6  ? 19.759  1.184  1.307   1.00 0.00 ? 6  GLN A H    8  
ATOM 2754 H HE21 . GLN A 1 6  ? 20.854  3.495  4.461   1.00 0.00 ? 6  GLN A HE21 8  
ATOM 2755 H HE22 . GLN A 1 6  ? 20.666  5.148  4.972   1.00 0.00 ? 6  GLN A HE22 8  
ATOM 2756 N N    . LEU A 1 7  ? 17.249  2.374  0.143   1.00 0.00 ? 7  LEU A N    8  
ATOM 2757 C CA   . LEU A 1 7  ? 16.373  2.958  -0.898  1.00 0.00 ? 7  LEU A CA   8  
ATOM 2758 C C    . LEU A 1 7  ? 15.405  1.919  -1.474  1.00 0.00 ? 7  LEU A C    8  
ATOM 2759 O O    . LEU A 1 7  ? 14.206  2.194  -1.585  1.00 0.00 ? 7  LEU A O    8  
ATOM 2760 C CB   . LEU A 1 7  ? 17.248  3.639  -1.972  1.00 0.00 ? 7  LEU A CB   8  
ATOM 2761 C CG   . LEU A 1 7  ? 18.253  4.622  -1.351  1.00 0.00 ? 7  LEU A CG   8  
ATOM 2762 C CD1  . LEU A 1 7  ? 19.163  5.221  -2.426  1.00 0.00 ? 7  LEU A CD1  8  
ATOM 2763 C CD2  . LEU A 1 7  ? 17.576  5.775  -0.601  1.00 0.00 ? 7  LEU A CD2  8  
ATOM 2764 H H    . LEU A 1 7  ? 18.219  2.442  -0.052  1.00 0.00 ? 7  LEU A H    8  
ATOM 2765 N N    . GLU A 1 8  ? 15.874  0.667  -1.521  1.00 0.00 ? 8  GLU A N    8  
ATOM 2766 C CA   . GLU A 1 8  ? 15.051  -0.496 -1.908  1.00 0.00 ? 8  GLU A CA   8  
ATOM 2767 C C    . GLU A 1 8  ? 13.983  -0.858 -0.841  1.00 0.00 ? 8  GLU A C    8  
ATOM 2768 O O    . GLU A 1 8  ? 12.825  -1.068 -1.184  1.00 0.00 ? 8  GLU A O    8  
ATOM 2769 C CB   . GLU A 1 8  ? 15.948  -1.678 -2.294  1.00 0.00 ? 8  GLU A CB   8  
ATOM 2770 C CG   . GLU A 1 8  ? 16.687  -2.372 -1.134  1.00 0.00 ? 8  GLU A CG   8  
ATOM 2771 C CD   . GLU A 1 8  ? 16.026  -3.664 -0.665  1.00 0.00 ? 8  GLU A CD   8  
ATOM 2772 O OE1  . GLU A 1 8  ? 16.667  -4.616 -0.239  1.00 0.00 ? 8  GLU A OE1  8  
ATOM 2773 O OE2  . GLU A 1 8  ? 14.671  -3.760 -0.756  1.00 0.00 ? 8  GLU A OE2  8  
ATOM 2774 H H    . GLU A 1 8  ? 16.809  0.460  -1.275  1.00 0.00 ? 8  GLU A H    8  
ATOM 2775 H HE2  . GLU A 1 8  ? 14.477  -4.683 -0.451  1.00 0.00 ? 8  GLU A HE2  8  
ATOM 2776 N N    . ASP A 1 9  ? 14.338  -0.670 0.429   1.00 0.00 ? 9  ASP A N    8  
ATOM 2777 C CA   . ASP A 1 9  ? 13.424  -0.857 1.575   1.00 0.00 ? 9  ASP A CA   8  
ATOM 2778 C C    . ASP A 1 9  ? 12.282  0.157  1.579   1.00 0.00 ? 9  ASP A C    8  
ATOM 2779 O O    . ASP A 1 9  ? 11.113  -0.210 1.752   1.00 0.00 ? 9  ASP A O    8  
ATOM 2780 C CB   . ASP A 1 9  ? 14.176  -0.829 2.905   1.00 0.00 ? 9  ASP A CB   8  
ATOM 2781 C CG   . ASP A 1 9  ? 14.781  -2.181 3.258   1.00 0.00 ? 9  ASP A CG   8  
ATOM 2782 O OD1  . ASP A 1 9  ? 15.458  -2.844 2.488   1.00 0.00 ? 9  ASP A OD1  8  
ATOM 2783 O OD2  . ASP A 1 9  ? 14.542  -2.617 4.520   1.00 0.00 ? 9  ASP A OD2  8  
ATOM 2784 H H    . ASP A 1 9  ? 15.252  -0.354 0.681   1.00 0.00 ? 9  ASP A H    8  
ATOM 2785 H HD2  . ASP A 1 9  ? 14.988  -3.498 4.569   1.00 0.00 ? 9  ASP A HD2  8  
ATOM 2786 N N    . LYS A 1 10 ? 12.612  1.389  1.209   1.00 0.00 ? 10 LYS A N    8  
ATOM 2787 C CA   . LYS A 1 10 ? 11.613  2.472  1.013   1.00 0.00 ? 10 LYS A CA   8  
ATOM 2788 C C    . LYS A 1 10 ? 10.696  2.207  -0.192  1.00 0.00 ? 10 LYS A C    8  
ATOM 2789 O O    . LYS A 1 10 ? 9.478   2.354  -0.093  1.00 0.00 ? 10 LYS A O    8  
ATOM 2790 C CB   . LYS A 1 10 ? 12.426  3.787  0.982   1.00 0.00 ? 10 LYS A CB   8  
ATOM 2791 C CG   . LYS A 1 10 ? 11.725  5.044  0.449   1.00 0.00 ? 10 LYS A CG   8  
ATOM 2792 C CD   . LYS A 1 10 ? 11.891  5.079  -1.074  1.00 0.00 ? 10 LYS A CD   8  
ATOM 2793 C CE   . LYS A 1 10 ? 12.175  6.486  -1.589  1.00 0.00 ? 10 LYS A CE   8  
ATOM 2794 N NZ   . LYS A 1 10 ? 13.208  6.349  -2.618  1.00 0.00 ? 10 LYS A NZ   8  
ATOM 2795 H H    . LYS A 1 10 ? 13.557  1.657  1.064   1.00 0.00 ? 10 LYS A H    8  
ATOM 2796 H HZ1  . LYS A 1 10 ? 14.026  5.936  -2.215  1.00 0.00 ? 10 LYS A HZ1  8  
ATOM 2797 H HZ2  . LYS A 1 10 ? 12.855  5.772  -3.354  1.00 0.00 ? 10 LYS A HZ2  8  
ATOM 2798 H HZ3  . LYS A 1 10 ? 13.437  7.244  -2.981  1.00 0.00 ? 10 LYS A HZ3  8  
ATOM 2799 N N    . VAL A 1 11 ? 11.281  1.694  -1.274  1.00 0.00 ? 11 VAL A N    8  
ATOM 2800 C CA   . VAL A 1 11 ? 10.536  1.318  -2.502  1.00 0.00 ? 11 VAL A CA   8  
ATOM 2801 C C    . VAL A 1 11 ? 9.550   0.163  -2.257  1.00 0.00 ? 11 VAL A C    8  
ATOM 2802 O O    . VAL A 1 11 ? 8.372   0.250  -2.616  1.00 0.00 ? 11 VAL A O    8  
ATOM 2803 C CB   . VAL A 1 11 ? 11.539  1.050  -3.657  1.00 0.00 ? 11 VAL A CB   8  
ATOM 2804 C CG1  . VAL A 1 11 ? 10.900  0.423  -4.906  1.00 0.00 ? 11 VAL A CG1  8  
ATOM 2805 C CG2  . VAL A 1 11 ? 12.192  2.358  -4.090  1.00 0.00 ? 11 VAL A CG2  8  
ATOM 2806 H H    . VAL A 1 11 ? 12.262  1.579  -1.339  1.00 0.00 ? 11 VAL A H    8  
ATOM 2807 N N    . GLU A 1 12 ? 9.996   -0.875 -1.556  1.00 0.00 ? 12 GLU A N    8  
ATOM 2808 C CA   . GLU A 1 12 ? 9.103   -2.004 -1.168  1.00 0.00 ? 12 GLU A CA   8  
ATOM 2809 C C    . GLU A 1 12 ? 8.026   -1.590 -0.150  1.00 0.00 ? 12 GLU A C    8  
ATOM 2810 O O    . GLU A 1 12 ? 6.885   -2.029 -0.229  1.00 0.00 ? 12 GLU A O    8  
ATOM 2811 C CB   . GLU A 1 12 ? 9.897   -3.230 -0.706  1.00 0.00 ? 12 GLU A CB   8  
ATOM 2812 C CG   . GLU A 1 12 ? 10.537  -3.077 0.689   1.00 0.00 ? 12 GLU A CG   8  
ATOM 2813 C CD   . GLU A 1 12 ? 11.342  -4.271 1.160   1.00 0.00 ? 12 GLU A CD   8  
ATOM 2814 O OE1  . GLU A 1 12 ? 11.429  -5.342 0.576   1.00 0.00 ? 12 GLU A OE1  8  
ATOM 2815 O OE2  . GLU A 1 12 ? 12.047  -4.075 2.315   1.00 0.00 ? 12 GLU A OE2  8  
ATOM 2816 H H    . GLU A 1 12 ? 10.962  -0.987 -1.334  1.00 0.00 ? 12 GLU A H    8  
ATOM 2817 H HE2  . GLU A 1 12 ? 12.449  -4.966 2.482   1.00 0.00 ? 12 GLU A HE2  8  
ATOM 2818 N N    . GLU A 1 13 ? 8.384   -0.625 0.715   1.00 0.00 ? 13 GLU A N    8  
ATOM 2819 C CA   . GLU A 1 13 ? 7.480   -0.053 1.721   1.00 0.00 ? 13 GLU A CA   8  
ATOM 2820 C C    . GLU A 1 13 ? 6.264   0.651  1.099   1.00 0.00 ? 13 GLU A C    8  
ATOM 2821 O O    . GLU A 1 13 ? 5.208   0.747  1.727   1.00 0.00 ? 13 GLU A O    8  
ATOM 2822 C CB   . GLU A 1 13 ? 8.233   0.928  2.622   1.00 0.00 ? 13 GLU A CB   8  
ATOM 2823 C CG   . GLU A 1 13 ? 8.057   0.611  4.114   1.00 0.00 ? 13 GLU A CG   8  
ATOM 2824 C CD   . GLU A 1 13 ? 6.602   0.672  4.557   1.00 0.00 ? 13 GLU A CD   8  
ATOM 2825 O OE1  . GLU A 1 13 ? 6.019   1.729  4.767   1.00 0.00 ? 13 GLU A OE1  8  
ATOM 2826 O OE2  . GLU A 1 13 ? 5.960   -0.513 4.713   1.00 0.00 ? 13 GLU A OE2  8  
ATOM 2827 H H    . GLU A 1 13 ? 9.316   -0.268 0.750   1.00 0.00 ? 13 GLU A H    8  
ATOM 2828 H HE2  . GLU A 1 13 ? 5.030   -0.230 4.949   1.00 0.00 ? 13 GLU A HE2  8  
ATOM 2829 N N    . LEU A 1 14 ? 6.404   1.007  -0.183  1.00 0.00 ? 14 LEU A N    8  
ATOM 2830 C CA   . LEU A 1 14 ? 5.307   1.611  -0.969  1.00 0.00 ? 14 LEU A CA   8  
ATOM 2831 C C    . LEU A 1 14 ? 4.206   0.569  -1.159  1.00 0.00 ? 14 LEU A C    8  
ATOM 2832 O O    . LEU A 1 14 ? 3.196   0.699  -0.492  1.00 0.00 ? 14 LEU A O    8  
ATOM 2833 C CB   . LEU A 1 14 ? 5.756   2.158  -2.324  1.00 0.00 ? 14 LEU A CB   8  
ATOM 2834 C CG   . LEU A 1 14 ? 6.927   3.149  -2.241  1.00 0.00 ? 14 LEU A CG   8  
ATOM 2835 C CD1  . LEU A 1 14 ? 7.219   3.663  -3.650  1.00 0.00 ? 14 LEU A CD1  8  
ATOM 2836 C CD2  . LEU A 1 14 ? 6.699   4.314  -1.284  1.00 0.00 ? 14 LEU A CD2  8  
ATOM 2837 H H    . LEU A 1 14 ? 7.240   0.825  -0.698  1.00 0.00 ? 14 LEU A H    8  
ATOM 2838 N N    . LEU A 1 15 ? 4.487   -0.522 -1.858  1.00 0.00 ? 15 LEU A N    8  
ATOM 2839 C CA   . LEU A 1 15 ? 3.515   -1.603 -2.114  1.00 0.00 ? 15 LEU A CA   8  
ATOM 2840 C C    . LEU A 1 15 ? 2.915   -2.156 -0.801  1.00 0.00 ? 15 LEU A C    8  
ATOM 2841 O O    . LEU A 1 15 ? 1.712   -2.046 -0.638  1.00 0.00 ? 15 LEU A O    8  
ATOM 2842 C CB   . LEU A 1 15 ? 4.090   -2.766 -2.939  1.00 0.00 ? 15 LEU A CB   8  
ATOM 2843 C CG   . LEU A 1 15 ? 4.976   -2.326 -4.104  1.00 0.00 ? 15 LEU A CG   8  
ATOM 2844 C CD1  . LEU A 1 15 ? 5.374   -3.570 -4.909  1.00 0.00 ? 15 LEU A CD1  8  
ATOM 2845 C CD2  . LEU A 1 15 ? 4.348   -1.291 -5.046  1.00 0.00 ? 15 LEU A CD2  8  
ATOM 2846 H H    . LEU A 1 15 ? 5.360   -0.614 -2.360  1.00 0.00 ? 15 LEU A H    8  
ATOM 2847 N N    . SER A 1 16 ? 3.763   -2.435 0.197   1.00 0.00 ? 16 SER A N    8  
ATOM 2848 C CA   . SER A 1 16 ? 3.308   -2.822 1.546   1.00 0.00 ? 16 SER A CA   8  
ATOM 2849 C C    . SER A 1 16 ? 2.175   -1.952 2.143   1.00 0.00 ? 16 SER A C    8  
ATOM 2850 O O    . SER A 1 16 ? 1.330   -2.460 2.867   1.00 0.00 ? 16 SER A O    8  
ATOM 2851 C CB   . SER A 1 16 ? 4.453   -2.826 2.565   1.00 0.00 ? 16 SER A CB   8  
ATOM 2852 O OG   . SER A 1 16 ? 5.294   -3.969 2.350   1.00 0.00 ? 16 SER A OG   8  
ATOM 2853 H H    . SER A 1 16 ? 4.753   -2.509 0.048   1.00 0.00 ? 16 SER A H    8  
ATOM 2854 H HG   . SER A 1 16 ? 5.823   -4.119 3.184   1.00 0.00 ? 16 SER A HG   8  
ATOM 2855 N N    . LYS A 1 17 ? 2.171   -0.677 1.769   1.00 0.00 ? 17 LYS A N    8  
ATOM 2856 C CA   . LYS A 1 17 ? 1.104   0.285  2.094   1.00 0.00 ? 17 LYS A CA   8  
ATOM 2857 C C    . LYS A 1 17 ? 0.123   0.594  0.941   1.00 0.00 ? 17 LYS A C    8  
ATOM 2858 O O    . LYS A 1 17 ? -1.074  0.427  1.118   1.00 0.00 ? 17 LYS A O    8  
ATOM 2859 C CB   . LYS A 1 17 ? 1.715   1.546  2.692   1.00 0.00 ? 17 LYS A CB   8  
ATOM 2860 C CG   . LYS A 1 17 ? 1.578   1.581  4.224   1.00 0.00 ? 17 LYS A CG   8  
ATOM 2861 C CD   . LYS A 1 17 ? 2.230   0.388  4.940   1.00 0.00 ? 17 LYS A CD   8  
ATOM 2862 C CE   . LYS A 1 17 ? 1.206   -0.402 5.773   1.00 0.00 ? 17 LYS A CE   8  
ATOM 2863 N NZ   . LYS A 1 17 ? 0.765   0.388  6.931   1.00 0.00 ? 17 LYS A NZ   8  
ATOM 2864 H H    . LYS A 1 17 ? 2.910   -0.314 1.189   1.00 0.00 ? 17 LYS A H    8  
ATOM 2865 H HZ1  . LYS A 1 17 ? 0.427   1.276  6.612   1.00 0.00 ? 17 LYS A HZ1  8  
ATOM 2866 H HZ2  . LYS A 1 17 ? 0.017   -0.106 7.389   1.00 0.00 ? 17 LYS A HZ2  8  
ATOM 2867 H HZ3  . LYS A 1 17 ? 1.528   0.504  7.563   1.00 0.00 ? 17 LYS A HZ3  8  
ATOM 2868 N N    . ASN A 1 18 ? 0.599   0.924  -0.244  1.00 0.00 ? 18 ASN A N    8  
ATOM 2869 C CA   . ASN A 1 18 ? -0.195  1.225  -1.452  1.00 0.00 ? 18 ASN A CA   8  
ATOM 2870 C C    . ASN A 1 18 ? -1.108  0.052  -1.888  1.00 0.00 ? 18 ASN A C    8  
ATOM 2871 O O    . ASN A 1 18 ? -2.322  0.220  -2.022  1.00 0.00 ? 18 ASN A O    8  
ATOM 2872 C CB   . ASN A 1 18 ? 0.748   1.642  -2.582  1.00 0.00 ? 18 ASN A CB   8  
ATOM 2873 C CG   . ASN A 1 18 ? 0.000   2.373  -3.683  1.00 0.00 ? 18 ASN A CG   8  
ATOM 2874 O OD1  . ASN A 1 18 ? -0.465  1.810  -4.664  1.00 0.00 ? 18 ASN A OD1  8  
ATOM 2875 N ND2  . ASN A 1 18 ? -0.151  3.676  -3.521  1.00 0.00 ? 18 ASN A ND2  8  
ATOM 2876 H H    . ASN A 1 18 ? 1.604   1.006  -0.370  1.00 0.00 ? 18 ASN A H    8  
ATOM 2877 H HD21 . ASN A 1 18 ? 0.200   4.122  -2.704  1.00 0.00 ? 18 ASN A HD21 8  
ATOM 2878 H HD22 . ASN A 1 18 ? -0.654  4.153  -4.229  1.00 0.00 ? 18 ASN A HD22 8  
ATOM 2879 N N    . TYR A 1 19 ? -0.534  -1.137 -1.918  1.00 0.00 ? 19 TYR A N    8  
ATOM 2880 C CA   . TYR A 1 19 ? -1.232  -2.408 -2.217  1.00 0.00 ? 19 TYR A CA   8  
ATOM 2881 C C    . TYR A 1 19 ? -2.259  -2.744 -1.108  1.00 0.00 ? 19 TYR A C    8  
ATOM 2882 O O    . TYR A 1 19 ? -3.362  -3.203 -1.405  1.00 0.00 ? 19 TYR A O    8  
ATOM 2883 C CB   . TYR A 1 19 ? -0.176  -3.505 -2.304  1.00 0.00 ? 19 TYR A CB   8  
ATOM 2884 C CG   . TYR A 1 19 ? -0.457  -4.603 -3.327  1.00 0.00 ? 19 TYR A CG   8  
ATOM 2885 C CD1  . TYR A 1 19 ? -0.711  -4.259 -4.669  1.00 0.00 ? 19 TYR A CD1  8  
ATOM 2886 C CD2  . TYR A 1 19 ? -0.336  -5.949 -2.917  1.00 0.00 ? 19 TYR A CD2  8  
ATOM 2887 C CE1  . TYR A 1 19 ? -0.867  -5.277 -5.622  1.00 0.00 ? 19 TYR A CE1  8  
ATOM 2888 C CE2  . TYR A 1 19 ? -0.483  -6.971 -3.866  1.00 0.00 ? 19 TYR A CE2  8  
ATOM 2889 C CZ   . TYR A 1 19 ? -0.761  -6.623 -5.204  1.00 0.00 ? 19 TYR A CZ   8  
ATOM 2890 O OH   . TYR A 1 19 ? -0.971  -7.597 -6.122  1.00 0.00 ? 19 TYR A OH   8  
ATOM 2891 H H    . TYR A 1 19 ? 0.440   -1.257 -1.669  1.00 0.00 ? 19 TYR A H    8  
ATOM 2892 H HH   . TYR A 1 19 ? -1.231  -7.184 -6.993  1.00 0.00 ? 19 TYR A HH   8  
ATOM 2893 N N    . HIS A 1 20 ? -1.923  -2.397 0.131   1.00 0.00 ? 20 HIS A N    8  
ATOM 2894 C CA   . HIS A 1 20 ? -2.810  -2.470 1.309   1.00 0.00 ? 20 HIS A CA   8  
ATOM 2895 C C    . HIS A 1 20 ? -3.914  -1.385 1.302   1.00 0.00 ? 20 HIS A C    8  
ATOM 2896 O O    . HIS A 1 20 ? -5.047  -1.641 1.702   1.00 0.00 ? 20 HIS A O    8  
ATOM 2897 C CB   . HIS A 1 20 ? -1.865  -2.433 2.533   1.00 0.00 ? 20 HIS A CB   8  
ATOM 2898 C CG   . HIS A 1 20 ? -2.404  -1.789 3.813   1.00 0.00 ? 20 HIS A CG   8  
ATOM 2899 N ND1  . HIS A 1 20 ? -2.937  -2.393 4.862   1.00 0.00 ? 20 HIS A ND1  8  
ATOM 2900 C CD2  . HIS A 1 20 ? -2.431  -0.475 4.054   1.00 0.00 ? 20 HIS A CD2  8  
ATOM 2901 C CE1  . HIS A 1 20 ? -3.324  -1.476 5.728   1.00 0.00 ? 20 HIS A CE1  8  
ATOM 2902 N NE2  . HIS A 1 20 ? -3.032  -0.305 5.243   1.00 0.00 ? 20 HIS A NE2  8  
ATOM 2903 H H    . HIS A 1 20 ? -1.007  -2.028 0.326   1.00 0.00 ? 20 HIS A H    8  
ATOM 2904 H HD1  . HIS A 1 20 ? -2.945  -3.394 5.009   1.00 0.00 ? 20 HIS A HD1  8  
ATOM 2905 H HE2  . HIS A 1 20 ? -3.304  0.587  5.597   1.00 0.00 ? 20 HIS A HE2  8  
ATOM 2906 N N    . LEU A 1 21 ? -3.627  -0.239 0.692   1.00 0.00 ? 21 LEU A N    8  
ATOM 2907 C CA   . LEU A 1 21 ? -4.520  0.936  0.568   1.00 0.00 ? 21 LEU A CA   8  
ATOM 2908 C C    . LEU A 1 21 ? -5.712  0.648  -0.352  1.00 0.00 ? 21 LEU A C    8  
ATOM 2909 O O    . LEU A 1 21 ? -6.840  1.017  -0.031  1.00 0.00 ? 21 LEU A O    8  
ATOM 2910 C CB   . LEU A 1 21 ? -3.684  2.129  0.082   1.00 0.00 ? 21 LEU A CB   8  
ATOM 2911 C CG   . LEU A 1 21 ? -4.484  3.290  -0.519  1.00 0.00 ? 21 LEU A CG   8  
ATOM 2912 C CD1  . LEU A 1 21 ? -5.242  4.086  0.554   1.00 0.00 ? 21 LEU A CD1  8  
ATOM 2913 C CD2  . LEU A 1 21 ? -3.574  4.180  -1.366  1.00 0.00 ? 21 LEU A CD2  8  
ATOM 2914 H H    . LEU A 1 21 ? -2.706  -0.098 0.330   1.00 0.00 ? 21 LEU A H    8  
ATOM 2915 N N    . GLU A 1 22 ? -5.426  -0.014 -1.479  1.00 0.00 ? 22 GLU A N    8  
ATOM 2916 C CA   . GLU A 1 22 ? -6.488  -0.470 -2.417  1.00 0.00 ? 22 GLU A CA   8  
ATOM 2917 C C    . GLU A 1 22 ? -7.583  -1.281 -1.713  1.00 0.00 ? 22 GLU A C    8  
ATOM 2918 O O    . GLU A 1 22 ? -8.774  -1.068 -1.963  1.00 0.00 ? 22 GLU A O    8  
ATOM 2919 C CB   . GLU A 1 22 ? -5.845  -1.264 -3.550  1.00 0.00 ? 22 GLU A CB   8  
ATOM 2920 C CG   . GLU A 1 22 ? -6.231  -0.648 -4.898  1.00 0.00 ? 22 GLU A CG   8  
ATOM 2921 C CD   . GLU A 1 22 ? -5.546  -1.335 -6.070  1.00 0.00 ? 22 GLU A CD   8  
ATOM 2922 O OE1  . GLU A 1 22 ? -6.159  -1.737 -7.056  1.00 0.00 ? 22 GLU A OE1  8  
ATOM 2923 O OE2  . GLU A 1 22 ? -4.198  -1.484 -6.005  1.00 0.00 ? 22 GLU A OE2  8  
ATOM 2924 H H    . GLU A 1 22 ? -4.487  -0.146 -1.792  1.00 0.00 ? 22 GLU A H    8  
ATOM 2925 H HE2  . GLU A 1 22 ? -3.975  -1.947 -6.854  1.00 0.00 ? 22 GLU A HE2  8  
ATOM 2926 N N    . ASN A 1 23 ? -7.186  -1.998 -0.663  1.00 0.00 ? 23 ASN A N    8  
ATOM 2927 C CA   . ASN A 1 23 ? -8.115  -2.745 0.216   1.00 0.00 ? 23 ASN A CA   8  
ATOM 2928 C C    . ASN A 1 23 ? -9.039  -1.805 1.008   1.00 0.00 ? 23 ASN A C    8  
ATOM 2929 O O    . ASN A 1 23 ? -10.246 -2.033 1.088   1.00 0.00 ? 23 ASN A O    8  
ATOM 2930 C CB   . ASN A 1 23 ? -7.291  -3.629 1.168   1.00 0.00 ? 23 ASN A CB   8  
ATOM 2931 C CG   . ASN A 1 23 ? -8.062  -4.837 1.652   1.00 0.00 ? 23 ASN A CG   8  
ATOM 2932 O OD1  . ASN A 1 23 ? -7.702  -5.985 1.422   1.00 0.00 ? 23 ASN A OD1  8  
ATOM 2933 N ND2  . ASN A 1 23 ? -9.185  -4.636 2.330   1.00 0.00 ? 23 ASN A ND2  8  
ATOM 2934 H H    . ASN A 1 23 ? -6.216  -2.081 -0.421  1.00 0.00 ? 23 ASN A H    8  
ATOM 2935 H HD21 . ASN A 1 23 ? -9.571  -3.725 2.448   1.00 0.00 ? 23 ASN A HD21 8  
ATOM 2936 H HD22 . ASN A 1 23 ? -9.652  -5.454 2.639   1.00 0.00 ? 23 ASN A HD22 8  
ATOM 2937 N N    . GLU A 1 24 ? -8.475  -0.746 1.607   1.00 0.00 ? 24 GLU A N    8  
ATOM 2938 C CA   . GLU A 1 24 ? -9.264  0.303  2.313   1.00 0.00 ? 24 GLU A CA   8  
ATOM 2939 C C    . GLU A 1 24 ? -10.243 1.037  1.394   1.00 0.00 ? 24 GLU A C    8  
ATOM 2940 O O    . GLU A 1 24 ? -11.432 1.131  1.725   1.00 0.00 ? 24 GLU A O    8  
ATOM 2941 C CB   . GLU A 1 24 ? -8.356  1.316  2.999   1.00 0.00 ? 24 GLU A CB   8  
ATOM 2942 C CG   . GLU A 1 24 ? -7.998  0.904  4.440   1.00 0.00 ? 24 GLU A CG   8  
ATOM 2943 C CD   . GLU A 1 24 ? -7.269  -0.437 4.491   1.00 0.00 ? 24 GLU A CD   8  
ATOM 2944 O OE1  . GLU A 1 24 ? -6.137  -0.581 4.047   1.00 0.00 ? 24 GLU A OE1  8  
ATOM 2945 O OE2  . GLU A 1 24 ? -7.977  -1.489 4.942   1.00 0.00 ? 24 GLU A OE2  8  
ATOM 2946 H H    . GLU A 1 24 ? -7.488  -0.616 1.601   1.00 0.00 ? 24 GLU A H    8  
ATOM 2947 H HE2  . GLU A 1 24 ? -7.313  -2.239 4.902   1.00 0.00 ? 24 GLU A HE2  8  
ATOM 2948 N N    . VAL A 1 25 ? -9.753  1.477  0.242   1.00 0.00 ? 25 VAL A N    8  
ATOM 2949 C CA   . VAL A 1 25 ? -10.566 2.039  -0.864  1.00 0.00 ? 25 VAL A CA   8  
ATOM 2950 C C    . VAL A 1 25 ? -11.781 1.137  -1.132  1.00 0.00 ? 25 VAL A C    8  
ATOM 2951 O O    . VAL A 1 25 ? -12.883 1.667  -1.136  1.00 0.00 ? 25 VAL A O    8  
ATOM 2952 C CB   . VAL A 1 25 ? -9.733  2.258  -2.143  1.00 0.00 ? 25 VAL A CB   8  
ATOM 2953 C CG1  . VAL A 1 25 ? -10.573 2.864  -3.275  1.00 0.00 ? 25 VAL A CG1  8  
ATOM 2954 C CG2  . VAL A 1 25 ? -8.547  3.183  -1.893  1.00 0.00 ? 25 VAL A CG2  8  
ATOM 2955 H H    . VAL A 1 25 ? -8.768  1.595  0.117   1.00 0.00 ? 25 VAL A H    8  
ATOM 2956 N N    . ALA A 1 26 ? -11.601 -0.182 -1.102  1.00 0.00 ? 26 ALA A N    8  
ATOM 2957 C CA   . ALA A 1 26 ? -12.713 -1.143 -1.208  1.00 0.00 ? 26 ALA A CA   8  
ATOM 2958 C C    . ALA A 1 26 ? -13.712 -1.006 -0.037  1.00 0.00 ? 26 ALA A C    8  
ATOM 2959 O O    . ALA A 1 26 ? -14.770 -0.463 -0.294  1.00 0.00 ? 26 ALA A O    8  
ATOM 2960 C CB   . ALA A 1 26 ? -12.194 -2.574 -1.342  1.00 0.00 ? 26 ALA A CB   8  
ATOM 2961 H H    . ALA A 1 26 ? -10.688 -0.589 -0.994  1.00 0.00 ? 26 ALA A H    8  
ATOM 2962 N N    . ARG A 1 27 ? -13.294 -1.237 1.212   1.00 0.00 ? 27 ARG A N    8  
ATOM 2963 C CA   . ARG A 1 27 ? -14.149 -1.068 2.412   1.00 0.00 ? 27 ARG A CA   8  
ATOM 2964 C C    . ARG A 1 27 ? -14.928 0.276  2.427   1.00 0.00 ? 27 ARG A C    8  
ATOM 2965 O O    . ARG A 1 27 ? -16.136 0.272  2.640   1.00 0.00 ? 27 ARG A O    8  
ATOM 2966 C CB   . ARG A 1 27 ? -13.331 -1.275 3.695   1.00 0.00 ? 27 ARG A CB   8  
ATOM 2967 C CG   . ARG A 1 27 ? -14.114 -1.125 5.009   1.00 0.00 ? 27 ARG A CG   8  
ATOM 2968 C CD   . ARG A 1 27 ? -15.349 -2.032 5.109   1.00 0.00 ? 27 ARG A CD   8  
ATOM 2969 N NE   . ARG A 1 27 ? -16.539 -1.190 5.314   1.00 0.00 ? 27 ARG A NE   8  
ATOM 2970 C CZ   . ARG A 1 27 ? -17.565 -1.457 6.112   1.00 0.00 ? 27 ARG A CZ   8  
ATOM 2971 N NH1  . ARG A 1 27 ? -17.988 -2.703 6.300   1.00 0.00 ? 27 ARG A NH1  8  
ATOM 2972 N NH2  . ARG A 1 27 ? -18.428 -0.495 6.404   1.00 0.00 ? 27 ARG A NH2  8  
ATOM 2973 H H    . ARG A 1 27 ? -12.369 -1.603 1.393   1.00 0.00 ? 27 ARG A H    8  
ATOM 2974 H HE   . ARG A 1 27 ? -16.643 -0.456 4.647   1.00 0.00 ? 27 ARG A HE   8  
ATOM 2975 H HH11 . ARG A 1 27 ? -17.532 -3.445 5.818   1.00 0.00 ? 27 ARG A HH11 8  
ATOM 2976 H HH12 . ARG A 1 27 ? -18.767 -2.879 6.899   1.00 0.00 ? 27 ARG A HH12 8  
ATOM 2977 H HH21 . ARG A 1 27 ? -18.249 0.444  6.121   1.00 0.00 ? 27 ARG A HH21 8  
ATOM 2978 H HH22 . ARG A 1 27 ? -19.220 -0.695 6.978   1.00 0.00 ? 27 ARG A HH22 8  
ATOM 2979 N N    . LEU A 1 28 ? -14.258 1.340  2.019   1.00 0.00 ? 28 LEU A N    8  
ATOM 2980 C CA   . LEU A 1 28 ? -14.792 2.693  1.804   1.00 0.00 ? 28 LEU A CA   8  
ATOM 2981 C C    . LEU A 1 28 ? -15.829 2.744  0.643   1.00 0.00 ? 28 LEU A C    8  
ATOM 2982 O O    . LEU A 1 28 ? -16.986 3.092  0.843   1.00 0.00 ? 28 LEU A O    8  
ATOM 2983 C CB   . LEU A 1 28 ? -13.574 3.592  1.570   1.00 0.00 ? 28 LEU A CB   8  
ATOM 2984 C CG   . LEU A 1 28 ? -13.846 4.890  0.801   1.00 0.00 ? 28 LEU A CG   8  
ATOM 2985 C CD1  . LEU A 1 28 ? -14.562 5.924  1.675   1.00 0.00 ? 28 LEU A CD1  8  
ATOM 2986 C CD2  . LEU A 1 28 ? -12.545 5.468  0.248   1.00 0.00 ? 28 LEU A CD2  8  
ATOM 2987 H H    . LEU A 1 28 ? -13.268 1.258  1.806   1.00 0.00 ? 28 LEU A H    8  
ATOM 2988 N N    . LYS A 1 29 ? -15.388 2.379  -0.549  1.00 0.00 ? 29 LYS A N    8  
ATOM 2989 C CA   . LYS A 1 29 ? -16.196 2.357  -1.772  1.00 0.00 ? 29 LYS A CA   8  
ATOM 2990 C C    . LYS A 1 29 ? -17.400 1.390  -1.616  1.00 0.00 ? 29 LYS A C    8  
ATOM 2991 O O    . LYS A 1 29 ? -18.460 1.717  -2.100  1.00 0.00 ? 29 LYS A O    8  
ATOM 2992 C CB   . LYS A 1 29 ? -15.348 1.960  -2.982  1.00 0.00 ? 29 LYS A CB   8  
ATOM 2993 C CG   . LYS A 1 29 ? -15.696 2.658  -4.303  1.00 0.00 ? 29 LYS A CG   8  
ATOM 2994 C CD   . LYS A 1 29 ? -17.190 2.584  -4.626  1.00 0.00 ? 29 LYS A CD   8  
ATOM 2995 C CE   . LYS A 1 29 ? -17.578 2.905  -6.066  1.00 0.00 ? 29 LYS A CE   8  
ATOM 2996 N NZ   . LYS A 1 29 ? -17.210 1.763  -6.913  1.00 0.00 ? 29 LYS A NZ   8  
ATOM 2997 H H    . LYS A 1 29 ? -14.422 2.101  -0.701  1.00 0.00 ? 29 LYS A H    8  
ATOM 2998 H HZ1  . LYS A 1 29 ? -17.610 0.929  -6.526  1.00 0.00 ? 29 LYS A HZ1  8  
ATOM 2999 H HZ2  . LYS A 1 29 ? -17.565 1.904  -7.828  1.00 0.00 ? 29 LYS A HZ2  8  
ATOM 3000 H HZ3  . LYS A 1 29 ? -16.213 1.685  -6.946  1.00 0.00 ? 29 LYS A HZ3  8  
ATOM 3001 N N    . LYS A 1 30 ? -17.293 0.337  -0.804  1.00 0.00 ? 30 LYS A N    8  
ATOM 3002 C CA   . LYS A 1 30 ? -18.429 -0.540 -0.461  1.00 0.00 ? 30 LYS A CA   8  
ATOM 3003 C C    . LYS A 1 30 ? -19.667 0.276  -0.008  1.00 0.00 ? 30 LYS A C    8  
ATOM 3004 O O    . LYS A 1 30 ? -20.772 0.026  -0.489  1.00 0.00 ? 30 LYS A O    8  
ATOM 3005 C CB   . LYS A 1 30 ? -18.045 -1.567 0.614   1.00 0.00 ? 30 LYS A CB   8  
ATOM 3006 C CG   . LYS A 1 30 ? -16.899 -2.519 0.202   1.00 0.00 ? 30 LYS A CG   8  
ATOM 3007 C CD   . LYS A 1 30 ? -17.302 -3.681 -0.718  1.00 0.00 ? 30 LYS A CD   8  
ATOM 3008 C CE   . LYS A 1 30 ? -16.067 -4.325 -1.361  1.00 0.00 ? 30 LYS A CE   8  
ATOM 3009 N NZ   . LYS A 1 30 ? -15.666 -3.535 -2.535  1.00 0.00 ? 30 LYS A NZ   8  
ATOM 3010 H H    . LYS A 1 30 ? -16.382 0.044  -0.457  1.00 0.00 ? 30 LYS A H    8  
ATOM 3011 H HZ1  . LYS A 1 30 ? -16.428 -3.471 -3.170  1.00 0.00 ? 30 LYS A HZ1  8  
ATOM 3012 H HZ2  . LYS A 1 30 ? -15.386 -2.607 -2.241  1.00 0.00 ? 30 LYS A HZ2  8  
ATOM 3013 H HZ3  . LYS A 1 30 ? -14.892 -3.976 -2.991  1.00 0.00 ? 30 LYS A HZ3  8  
ATOM 3014 N N    . LEU A 1 31 ? -19.407 1.407  0.660   1.00 0.00 ? 31 LEU A N    8  
ATOM 3015 C CA   . LEU A 1 31 ? -20.434 2.391  1.051   1.00 0.00 ? 31 LEU A CA   8  
ATOM 3016 C C    . LEU A 1 31 ? -20.999 3.198  -0.144  1.00 0.00 ? 31 LEU A C    8  
ATOM 3017 O O    . LEU A 1 31 ? -22.196 3.179  -0.381  1.00 0.00 ? 31 LEU A O    8  
ATOM 3018 C CB   . LEU A 1 31 ? -19.910 3.371  2.125   1.00 0.00 ? 31 LEU A CB   8  
ATOM 3019 C CG   . LEU A 1 31 ? -19.683 2.711  3.492   1.00 0.00 ? 31 LEU A CG   8  
ATOM 3020 C CD1  . LEU A 1 31 ? -18.299 2.089  3.622   1.00 0.00 ? 31 LEU A CD1  8  
ATOM 3021 C CD2  . LEU A 1 31 ? -19.900 3.738  4.604   1.00 0.00 ? 31 LEU A CD2  8  
ATOM 3022 H H    . LEU A 1 31 ? -18.460 1.683  0.848   1.00 0.00 ? 31 LEU A H    8  
ATOM 3023 N N    . VAL A 1 32 ? -20.110 3.715  -0.985  1.00 0.00 ? 32 VAL A N    8  
ATOM 3024 C CA   . VAL A 1 32 ? -20.470 4.515  -2.198  1.00 0.00 ? 32 VAL A CA   8  
ATOM 3025 C C    . VAL A 1 32 ? -20.666 3.599  -3.441  1.00 0.00 ? 32 VAL A C    8  
ATOM 3026 O O    . VAL A 1 32 ? -20.680 4.054  -4.590  1.00 0.00 ? 32 VAL A O    8  
ATOM 3027 C CB   . VAL A 1 32 ? -19.398 5.603  -2.494  1.00 0.00 ? 32 VAL A CB   8  
ATOM 3028 C CG1  . VAL A 1 32 ? -19.984 6.720  -3.364  1.00 0.00 ? 32 VAL A CG1  8  
ATOM 3029 C CG2  . VAL A 1 32 ? -18.751 6.234  -1.258  1.00 0.00 ? 32 VAL A CG2  8  
ATOM 3030 H H    . VAL A 1 32 ? -19.130 3.543  -0.890  1.00 0.00 ? 32 VAL A H    8  
ATOM 3031 N N    . GLY A 1 33 ? -20.858 2.312  -3.173  1.00 0.00 ? 33 GLY A N    8  
ATOM 3032 C CA   . GLY A 1 33 ? -21.001 1.245  -4.179  1.00 0.00 ? 33 GLY A CA   8  
ATOM 3033 C C    . GLY A 1 33 ? -22.340 0.512  -4.035  1.00 0.00 ? 33 GLY A C    8  
ATOM 3034 O O    . GLY A 1 33 ? -23.043 0.296  -5.024  1.00 0.00 ? 33 GLY A O    8  
ATOM 3035 H H    . GLY A 1 33 ? -20.699 1.991  -2.242  1.00 0.00 ? 33 GLY A H    8  
ATOM 3036 N N    . GLU A 1 34 ? -22.718 0.253  -2.783  1.00 0.00 ? 34 GLU A N    8  
ATOM 3037 C CA   . GLU A 1 34 ? -24.046 -0.341 -2.486  1.00 0.00 ? 34 GLU A CA   8  
ATOM 3038 C C    . GLU A 1 34 ? -25.090 0.760  -2.175  1.00 0.00 ? 34 GLU A C    8  
ATOM 3039 O O    . GLU A 1 34 ? -25.955 0.623  -1.310  1.00 0.00 ? 34 GLU A O    8  
ATOM 3040 C CB   . GLU A 1 34 ? -23.857 -1.336 -1.335  1.00 0.00 ? 34 GLU A CB   8  
ATOM 3041 C CG   . GLU A 1 34 ? -24.768 -2.567 -1.454  1.00 0.00 ? 34 GLU A CG   8  
ATOM 3042 C CD   . GLU A 1 34 ? -26.251 -2.225 -1.357  1.00 0.00 ? 34 GLU A CD   8  
ATOM 3043 O OE1  . GLU A 1 34 ? -26.989 -2.152 -2.338  1.00 0.00 ? 34 GLU A OE1  8  
ATOM 3044 O OE2  . GLU A 1 34 ? -26.750 -2.061 -0.109  1.00 0.00 ? 34 GLU A OE2  8  
ATOM 3045 H H    . GLU A 1 34 ? -22.124 0.374  -1.999  1.00 0.00 ? 34 GLU A H    8  
ATOM 3046 H HE2  . GLU A 1 34 ? -27.656 -1.683 -0.292  1.00 0.00 ? 34 GLU A HE2  8  
ATOM 3047 N N    . ARG A 1 35 ? -24.979 1.858  -2.925  1.00 0.00 ? 35 ARG A N    8  
ATOM 3048 C CA   . ARG A 1 35 ? -25.922 2.995  -2.808  1.00 0.00 ? 35 ARG A CA   8  
ATOM 3049 C C    . ARG A 1 35 ? -26.562 3.360  -4.168  1.00 0.00 ? 35 ARG A C    8  
ATOM 3050 O O    . ARG A 1 35 ? -25.925 4.109  -4.946  1.00 0.00 ? 35 ARG A O    8  
ATOM 3051 C CB   . ARG A 1 35 ? -25.213 4.196  -2.173  1.00 0.00 ? 35 ARG A CB   8  
ATOM 3052 C CG   . ARG A 1 35 ? -26.216 5.216  -1.659  1.00 0.00 ? 35 ARG A CG   8  
ATOM 3053 C CD   . ARG A 1 35 ? -25.693 6.640  -1.859  1.00 0.00 ? 35 ARG A CD   8  
ATOM 3054 N NE   . ARG A 1 35 ? -25.437 7.419  -0.631  1.00 0.00 ? 35 ARG A NE   8  
ATOM 3055 C CZ   . ARG A 1 35 ? -26.337 7.844  0.264   1.00 0.00 ? 35 ARG A CZ   8  
ATOM 3056 N NH1  . ARG A 1 35 ? -27.265 7.061  0.801   1.00 0.00 ? 35 ARG A NH1  8  
ATOM 3057 N NH2  . ARG A 1 35 ? -26.627 9.137  0.243   1.00 0.00 ? 35 ARG A NH2  8  
ATOM 3058 O OXT  . ARG A 1 35 ? -27.650 2.804  -4.440  1.00 0.00 ? 35 ARG A OXT  8  
ATOM 3059 H H    . ARG A 1 35 ? -24.252 1.960  -3.592  1.00 0.00 ? 35 ARG A H    8  
ATOM 3060 H HE   . ARG A 1 35 ? -24.476 7.470  -0.361  1.00 0.00 ? 35 ARG A HE   8  
ATOM 3061 H HH11 . ARG A 1 35 ? -27.175 6.071  0.708   1.00 0.00 ? 35 ARG A HH11 8  
ATOM 3062 H HH12 . ARG A 1 35 ? -27.950 7.447  1.404   1.00 0.00 ? 35 ARG A HH12 8  
ATOM 3063 H HH21 . ARG A 1 35 ? -26.177 9.727  -0.438  1.00 0.00 ? 35 ARG A HH21 8  
ATOM 3064 H HH22 . ARG A 1 35 ? -27.318 9.514  0.848   1.00 0.00 ? 35 ARG A HH22 8  
ATOM 3065 N N    . LEU A 1 1  ? 27.591  3.757  -4.606  1.00 0.00 ? 1  LEU A N    9  
ATOM 3066 C CA   . LEU A 1 1  ? 27.315  3.219  -3.251  1.00 0.00 ? 1  LEU A CA   9  
ATOM 3067 C C    . LEU A 1 1  ? 26.139  2.206  -3.207  1.00 0.00 ? 1  LEU A C    9  
ATOM 3068 O O    . LEU A 1 1  ? 25.655  1.765  -4.249  1.00 0.00 ? 1  LEU A O    9  
ATOM 3069 C CB   . LEU A 1 1  ? 27.164  4.354  -2.236  1.00 0.00 ? 1  LEU A CB   9  
ATOM 3070 C CG   . LEU A 1 1  ? 26.121  5.425  -2.611  1.00 0.00 ? 1  LEU A CG   9  
ATOM 3071 C CD1  . LEU A 1 1  ? 25.479  5.992  -1.349  1.00 0.00 ? 1  LEU A CD1  9  
ATOM 3072 C CD2  . LEU A 1 1  ? 26.795  6.581  -3.364  1.00 0.00 ? 1  LEU A CD2  9  
ATOM 3073 H H1   . LEU A 1 1  ? 27.790  3.004  -5.229  1.00 0.00 ? 1  LEU A H1   9  
ATOM 3074 H H2   . LEU A 1 1  ? 26.774  4.244  -4.930  1.00 0.00 ? 1  LEU A H2   9  
ATOM 3075 H H3   . LEU A 1 1  ? 28.360  4.383  -4.569  1.00 0.00 ? 1  LEU A H3   9  
ATOM 3076 N N    . GLN A 1 2  ? 25.760  1.787  -2.003  1.00 0.00 ? 2  GLN A N    9  
ATOM 3077 C CA   . GLN A 1 2  ? 24.670  0.797  -1.788  1.00 0.00 ? 2  GLN A CA   9  
ATOM 3078 C C    . GLN A 1 2  ? 23.308  1.301  -2.314  1.00 0.00 ? 2  GLN A C    9  
ATOM 3079 O O    . GLN A 1 2  ? 22.572  2.038  -1.668  1.00 0.00 ? 2  GLN A O    9  
ATOM 3080 C CB   . GLN A 1 2  ? 24.619  0.422  -0.310  1.00 0.00 ? 2  GLN A CB   9  
ATOM 3081 C CG   . GLN A 1 2  ? 24.027  -0.976 -0.126  1.00 0.00 ? 2  GLN A CG   9  
ATOM 3082 C CD   . GLN A 1 2  ? 24.143  -1.433 1.331   1.00 0.00 ? 2  GLN A CD   9  
ATOM 3083 O OE1  . GLN A 1 2  ? 25.220  -1.581 1.894   1.00 0.00 ? 2  GLN A OE1  9  
ATOM 3084 N NE2  . GLN A 1 2  ? 23.019  -1.737 1.947   1.00 0.00 ? 2  GLN A NE2  9  
ATOM 3085 H H    . GLN A 1 2  ? 26.238  2.061  -1.178  1.00 0.00 ? 2  GLN A H    9  
ATOM 3086 H HE21 . GLN A 1 2  ? 22.141  -1.683 1.501   1.00 0.00 ? 2  GLN A HE21 9  
ATOM 3087 H HE22 . GLN A 1 2  ? 23.120  -2.010 2.901   1.00 0.00 ? 2  GLN A HE22 9  
ATOM 3088 N N    . ARG A 1 3  ? 23.032  0.864  -3.533  1.00 0.00 ? 3  ARG A N    9  
ATOM 3089 C CA   . ARG A 1 3  ? 21.807  1.211  -4.286  1.00 0.00 ? 3  ARG A CA   9  
ATOM 3090 C C    . ARG A 1 3  ? 21.007  -0.026 -4.714  1.00 0.00 ? 3  ARG A C    9  
ATOM 3091 O O    . ARG A 1 3  ? 21.518  -1.131 -4.700  1.00 0.00 ? 3  ARG A O    9  
ATOM 3092 C CB   . ARG A 1 3  ? 22.162  2.077  -5.494  1.00 0.00 ? 3  ARG A CB   9  
ATOM 3093 C CG   . ARG A 1 3  ? 22.239  3.533  -5.050  1.00 0.00 ? 3  ARG A CG   9  
ATOM 3094 C CD   . ARG A 1 3  ? 23.478  4.217  -5.634  1.00 0.00 ? 3  ARG A CD   9  
ATOM 3095 N NE   . ARG A 1 3  ? 23.228  4.839  -6.946  1.00 0.00 ? 3  ARG A NE   9  
ATOM 3096 C CZ   . ARG A 1 3  ? 22.803  4.237  -8.053  1.00 0.00 ? 3  ARG A CZ   9  
ATOM 3097 N NH1  . ARG A 1 3  ? 23.248  3.040  -8.407  1.00 0.00 ? 3  ARG A NH1  9  
ATOM 3098 N NH2  . ARG A 1 3  ? 22.273  4.977  -9.021  1.00 0.00 ? 3  ARG A NH2  9  
ATOM 3099 H H    . ARG A 1 3  ? 23.706  0.330  -4.044  1.00 0.00 ? 3  ARG A H    9  
ATOM 3100 H HE   . ARG A 1 3  ? 23.673  5.720  -7.068  1.00 0.00 ? 3  ARG A HE   9  
ATOM 3101 H HH11 . ARG A 1 3  ? 23.903  2.564  -7.818  1.00 0.00 ? 3  ARG A HH11 9  
ATOM 3102 H HH12 . ARG A 1 3  ? 22.924  2.608  -9.252  1.00 0.00 ? 3  ARG A HH12 9  
ATOM 3103 H HH21 . ARG A 1 3  ? 22.067  5.938  -8.847  1.00 0.00 ? 3  ARG A HH21 9  
ATOM 3104 H HH22 . ARG A 1 3  ? 21.985  4.543  -9.872  1.00 0.00 ? 3  ARG A HH22 9  
ATOM 3105 N N    . MET A 1 4  ? 19.699  0.221  -4.815  1.00 0.00 ? 4  MET A N    9  
ATOM 3106 C CA   . MET A 1 4  ? 18.648  -0.819 -4.960  1.00 0.00 ? 4  MET A CA   9  
ATOM 3107 C C    . MET A 1 4  ? 18.576  -1.814 -3.789  1.00 0.00 ? 4  MET A C    9  
ATOM 3108 O O    . MET A 1 4  ? 17.698  -2.677 -3.737  1.00 0.00 ? 4  MET A O    9  
ATOM 3109 C CB   . MET A 1 4  ? 18.753  -1.560 -6.303  1.00 0.00 ? 4  MET A CB   9  
ATOM 3110 C CG   . MET A 1 4  ? 18.291  -0.756 -7.528  1.00 0.00 ? 4  MET A CG   9  
ATOM 3111 S SD   . MET A 1 4  ? 19.494  0.457  -8.193  1.00 0.00 ? 4  MET A SD   9  
ATOM 3112 C CE   . MET A 1 4  ? 18.883  1.977  -7.497  1.00 0.00 ? 4  MET A CE   9  
ATOM 3113 H H    . MET A 1 4  ? 19.377  1.164  -4.911  1.00 0.00 ? 4  MET A H    9  
ATOM 3114 N N    . LYS A 1 5  ? 19.378  -1.529 -2.769  1.00 0.00 ? 5  LYS A N    9  
ATOM 3115 C CA   . LYS A 1 5  ? 19.494  -2.331 -1.521  1.00 0.00 ? 5  LYS A CA   9  
ATOM 3116 C C    . LYS A 1 5  ? 19.050  -1.588 -0.252  1.00 0.00 ? 5  LYS A C    9  
ATOM 3117 O O    . LYS A 1 5  ? 18.614  -2.198 0.731   1.00 0.00 ? 5  LYS A O    9  
ATOM 3118 C CB   . LYS A 1 5  ? 20.923  -2.840 -1.409  1.00 0.00 ? 5  LYS A CB   9  
ATOM 3119 C CG   . LYS A 1 5  ? 20.919  -4.348 -1.130  1.00 0.00 ? 5  LYS A CG   9  
ATOM 3120 C CD   . LYS A 1 5  ? 20.648  -4.679 0.338   1.00 0.00 ? 5  LYS A CD   9  
ATOM 3121 C CE   . LYS A 1 5  ? 20.084  -6.091 0.466   1.00 0.00 ? 5  LYS A CE   9  
ATOM 3122 N NZ   . LYS A 1 5  ? 20.658  -6.743 1.645   1.00 0.00 ? 5  LYS A NZ   9  
ATOM 3123 H H    . LYS A 1 5  ? 20.119  -0.888 -2.913  1.00 0.00 ? 5  LYS A H    9  
ATOM 3124 H HZ1  . LYS A 1 5  ? 20.494  -6.183 2.457   1.00 0.00 ? 5  LYS A HZ1  9  
ATOM 3125 H HZ2  . LYS A 1 5  ? 20.228  -7.638 1.763   1.00 0.00 ? 5  LYS A HZ2  9  
ATOM 3126 H HZ3  . LYS A 1 5  ? 21.639  -6.870 1.503   1.00 0.00 ? 5  LYS A HZ3  9  
ATOM 3127 N N    . GLN A 1 6  ? 19.092  -0.258 -0.315  1.00 0.00 ? 6  GLN A N    9  
ATOM 3128 C CA   . GLN A 1 6  ? 18.425  0.623  0.677   1.00 0.00 ? 6  GLN A CA   9  
ATOM 3129 C C    . GLN A 1 6  ? 17.210  1.380  0.105   1.00 0.00 ? 6  GLN A C    9  
ATOM 3130 O O    . GLN A 1 6  ? 16.229  1.629  0.802   1.00 0.00 ? 6  GLN A O    9  
ATOM 3131 C CB   . GLN A 1 6  ? 19.427  1.604  1.269   1.00 0.00 ? 6  GLN A CB   9  
ATOM 3132 C CG   . GLN A 1 6  ? 20.285  0.918  2.341   1.00 0.00 ? 6  GLN A CG   9  
ATOM 3133 C CD   . GLN A 1 6  ? 21.383  1.814  2.912   1.00 0.00 ? 6  GLN A CD   9  
ATOM 3134 O OE1  . GLN A 1 6  ? 22.390  1.357  3.422   1.00 0.00 ? 6  GLN A OE1  9  
ATOM 3135 N NE2  . GLN A 1 6  ? 21.221  3.134  2.884   1.00 0.00 ? 6  GLN A NE2  9  
ATOM 3136 H H    . GLN A 1 6  ? 19.724  0.207  -0.930  1.00 0.00 ? 6  GLN A H    9  
ATOM 3137 H HE21 . GLN A 1 6  ? 20.392  3.533  2.492   1.00 0.00 ? 6  GLN A HE21 9  
ATOM 3138 H HE22 . GLN A 1 6  ? 21.947  3.674  3.260   1.00 0.00 ? 6  GLN A HE22 9  
ATOM 3139 N N    . LEU A 1 7  ? 17.219  1.621  -1.204  1.00 0.00 ? 7  LEU A N    9  
ATOM 3140 C CA   . LEU A 1 7  ? 16.123  2.351  -1.868  1.00 0.00 ? 7  LEU A CA   9  
ATOM 3141 C C    . LEU A 1 7  ? 14.812  1.554  -1.834  1.00 0.00 ? 7  LEU A C    9  
ATOM 3142 O O    . LEU A 1 7  ? 13.819  2.040  -1.284  1.00 0.00 ? 7  LEU A O    9  
ATOM 3143 C CB   . LEU A 1 7  ? 16.516  2.762  -3.290  1.00 0.00 ? 7  LEU A CB   9  
ATOM 3144 C CG   . LEU A 1 7  ? 17.850  3.526  -3.335  1.00 0.00 ? 7  LEU A CG   9  
ATOM 3145 C CD1  . LEU A 1 7  ? 18.129  3.963  -4.761  1.00 0.00 ? 7  LEU A CD1  9  
ATOM 3146 C CD2  . LEU A 1 7  ? 17.897  4.760  -2.430  1.00 0.00 ? 7  LEU A CD2  9  
ATOM 3147 H H    . LEU A 1 7  ? 17.953  1.313  -1.803  1.00 0.00 ? 7  LEU A H    9  
ATOM 3148 N N    . GLU A 1 8  ? 14.948  0.250  -2.051  1.00 0.00 ? 8  GLU A N    9  
ATOM 3149 C CA   . GLU A 1 8  ? 13.839  -0.724 -1.920  1.00 0.00 ? 8  GLU A CA   9  
ATOM 3150 C C    . GLU A 1 8  ? 13.306  -0.780 -0.475  1.00 0.00 ? 8  GLU A C    9  
ATOM 3151 O O    . GLU A 1 8  ? 12.114  -0.949 -0.344  1.00 0.00 ? 8  GLU A O    9  
ATOM 3152 C CB   . GLU A 1 8  ? 14.238  -2.110 -2.460  1.00 0.00 ? 8  GLU A CB   9  
ATOM 3153 C CG   . GLU A 1 8  ? 14.701  -3.196 -1.452  1.00 0.00 ? 8  GLU A CG   9  
ATOM 3154 C CD   . GLU A 1 8  ? 15.861  -2.781 -0.563  1.00 0.00 ? 8  GLU A CD   9  
ATOM 3155 O OE1  . GLU A 1 8  ? 16.434  -1.705 -0.700  1.00 0.00 ? 8  GLU A OE1  9  
ATOM 3156 O OE2  . GLU A 1 8  ? 16.077  -3.489 0.572   1.00 0.00 ? 8  GLU A OE2  9  
ATOM 3157 H H    . GLU A 1 8  ? 15.838  -0.178 -2.192  1.00 0.00 ? 8  GLU A H    9  
ATOM 3158 H HE2  . GLU A 1 8  ? 16.923  -3.104 0.957   1.00 0.00 ? 8  GLU A HE2  9  
ATOM 3159 N N    . ASP A 1 9  ? 14.113  -0.556 0.566   1.00 0.00 ? 9  ASP A N    9  
ATOM 3160 C CA   . ASP A 1 9  ? 13.635  -0.554 1.964   1.00 0.00 ? 9  ASP A CA   9  
ATOM 3161 C C    . ASP A 1 9  ? 12.538  0.507  2.184   1.00 0.00 ? 9  ASP A C    9  
ATOM 3162 O O    . ASP A 1 9  ? 11.461  0.236  2.700   1.00 0.00 ? 9  ASP A O    9  
ATOM 3163 C CB   . ASP A 1 9  ? 14.818  -0.428 2.960   1.00 0.00 ? 9  ASP A CB   9  
ATOM 3164 C CG   . ASP A 1 9  ? 15.004  0.915  3.676   1.00 0.00 ? 9  ASP A CG   9  
ATOM 3165 O OD1  . ASP A 1 9  ? 14.134  1.426  4.380   1.00 0.00 ? 9  ASP A OD1  9  
ATOM 3166 O OD2  . ASP A 1 9  ? 16.197  1.537  3.570   1.00 0.00 ? 9  ASP A OD2  9  
ATOM 3167 H H    . ASP A 1 9  ? 15.111  -0.457 0.448   1.00 0.00 ? 9  ASP A H    9  
ATOM 3168 H HD2  . ASP A 1 9  ? 16.041  2.410  4.018   1.00 0.00 ? 9  ASP A HD2  9  
ATOM 3169 N N    . LYS A 1 10 ? 12.796  1.653  1.558   1.00 0.00 ? 10 LYS A N    9  
ATOM 3170 C CA   . LYS A 1 10 ? 11.939  2.853  1.624   1.00 0.00 ? 10 LYS A CA   9  
ATOM 3171 C C    . LYS A 1 10 ? 10.751  2.717  0.656   1.00 0.00 ? 10 LYS A C    9  
ATOM 3172 O O    . LYS A 1 10 ? 9.595   2.782  1.055   1.00 0.00 ? 10 LYS A O    9  
ATOM 3173 C CB   . LYS A 1 10 ? 12.791  4.090  1.303   1.00 0.00 ? 10 LYS A CB   9  
ATOM 3174 C CG   . LYS A 1 10 ? 14.030  4.162  2.210   1.00 0.00 ? 10 LYS A CG   9  
ATOM 3175 C CD   . LYS A 1 10 ? 14.971  5.289  1.814   1.00 0.00 ? 10 LYS A CD   9  
ATOM 3176 C CE   . LYS A 1 10 ? 16.313  5.156  2.535   1.00 0.00 ? 10 LYS A CE   9  
ATOM 3177 N NZ   . LYS A 1 10 ? 17.168  6.275  2.147   1.00 0.00 ? 10 LYS A NZ   9  
ATOM 3178 H H    . LYS A 1 10 ? 13.609  1.762  0.990   1.00 0.00 ? 10 LYS A H    9  
ATOM 3179 H HZ1  . LYS A 1 10 ? 17.238  6.325  1.149   1.00 0.00 ? 10 LYS A HZ1  9  
ATOM 3180 H HZ2  . LYS A 1 10 ? 16.769  7.129  2.492   1.00 0.00 ? 10 LYS A HZ2  9  
ATOM 3181 H HZ3  . LYS A 1 10 ? 18.081  6.153  2.538   1.00 0.00 ? 10 LYS A HZ3  9  
ATOM 3182 N N    . VAL A 1 11 ? 11.067  2.275  -0.566  1.00 0.00 ? 11 VAL A N    9  
ATOM 3183 C CA   . VAL A 1 11 ? 10.078  1.973  -1.627  1.00 0.00 ? 11 VAL A CA   9  
ATOM 3184 C C    . VAL A 1 11 ? 9.174   0.752  -1.295  1.00 0.00 ? 11 VAL A C    9  
ATOM 3185 O O    . VAL A 1 11 ? 8.071   0.614  -1.810  1.00 0.00 ? 11 VAL A O    9  
ATOM 3186 C CB   . VAL A 1 11 ? 10.789  1.875  -3.001  1.00 0.00 ? 11 VAL A CB   9  
ATOM 3187 C CG1  . VAL A 1 11 ? 9.805   1.726  -4.164  1.00 0.00 ? 11 VAL A CG1  9  
ATOM 3188 C CG2  . VAL A 1 11 ? 11.653  3.105  -3.302  1.00 0.00 ? 11 VAL A CG2  9  
ATOM 3189 H H    . VAL A 1 11 ? 12.031  2.212  -0.858  1.00 0.00 ? 11 VAL A H    9  
ATOM 3190 N N    . GLU A 1 12 ? 9.607   -0.076 -0.352  1.00 0.00 ? 12 GLU A N    9  
ATOM 3191 C CA   . GLU A 1 12 ? 8.846   -1.234 0.194   1.00 0.00 ? 12 GLU A CA   9  
ATOM 3192 C C    . GLU A 1 12 ? 7.675   -0.772 1.080   1.00 0.00 ? 12 GLU A C    9  
ATOM 3193 O O    . GLU A 1 12 ? 6.566   -1.279 0.917   1.00 0.00 ? 12 GLU A O    9  
ATOM 3194 C CB   . GLU A 1 12 ? 9.788   -2.130 1.013   1.00 0.00 ? 12 GLU A CB   9  
ATOM 3195 C CG   . GLU A 1 12 ? 9.143   -3.386 1.612   1.00 0.00 ? 12 GLU A CG   9  
ATOM 3196 C CD   . GLU A 1 12 ? 10.156  -4.295 2.315   1.00 0.00 ? 12 GLU A CD   9  
ATOM 3197 O OE1  . GLU A 1 12 ? 9.991   -5.505 2.387   1.00 0.00 ? 12 GLU A OE1  9  
ATOM 3198 O OE2  . GLU A 1 12 ? 11.259  -3.738 2.863   1.00 0.00 ? 12 GLU A OE2  9  
ATOM 3199 H H    . GLU A 1 12 ? 10.567  -0.061 -0.054  1.00 0.00 ? 12 GLU A H    9  
ATOM 3200 H HE2  . GLU A 1 12 ? 11.744  -4.520 3.236   1.00 0.00 ? 12 GLU A HE2  9  
ATOM 3201 N N    . GLU A 1 13 ? 7.933   0.271  1.861   1.00 0.00 ? 13 GLU A N    9  
ATOM 3202 C CA   . GLU A 1 13 ? 6.893   0.906  2.711   1.00 0.00 ? 13 GLU A CA   9  
ATOM 3203 C C    . GLU A 1 13 ? 5.717   1.410  1.852   1.00 0.00 ? 13 GLU A C    9  
ATOM 3204 O O    . GLU A 1 13 ? 4.579   1.447  2.328   1.00 0.00 ? 13 GLU A O    9  
ATOM 3205 C CB   . GLU A 1 13 ? 7.507   2.075  3.489   1.00 0.00 ? 13 GLU A CB   9  
ATOM 3206 C CG   . GLU A 1 13 ? 6.773   2.310  4.816   1.00 0.00 ? 13 GLU A CG   9  
ATOM 3207 C CD   . GLU A 1 13 ? 7.408   1.585  6.018   1.00 0.00 ? 13 GLU A CD   9  
ATOM 3208 O OE1  . GLU A 1 13 ? 7.144   1.919  7.173   1.00 0.00 ? 13 GLU A OE1  9  
ATOM 3209 O OE2  . GLU A 1 13 ? 8.269   0.578  5.801   1.00 0.00 ? 13 GLU A OE2  9  
ATOM 3210 H H    . GLU A 1 13 ? 8.830   0.705  1.904   1.00 0.00 ? 13 GLU A H    9  
ATOM 3211 H HE2  . GLU A 1 13 ? 8.588   0.331  6.717   1.00 0.00 ? 13 GLU A HE2  9  
ATOM 3212 N N    . LEU A 1 14 ? 5.987   1.636  0.559   1.00 0.00 ? 14 LEU A N    9  
ATOM 3213 C CA   . LEU A 1 14 ? 4.969   2.029  -0.420  1.00 0.00 ? 14 LEU A CA   9  
ATOM 3214 C C    . LEU A 1 14 ? 3.992   0.874  -0.633  1.00 0.00 ? 14 LEU A C    9  
ATOM 3215 O O    . LEU A 1 14 ? 2.915   0.960  -0.077  1.00 0.00 ? 14 LEU A O    9  
ATOM 3216 C CB   . LEU A 1 14 ? 5.524   2.483  -1.773  1.00 0.00 ? 14 LEU A CB   9  
ATOM 3217 C CG   . LEU A 1 14 ? 6.575   3.598  -1.685  1.00 0.00 ? 14 LEU A CG   9  
ATOM 3218 C CD1  . LEU A 1 14 ? 6.932   4.028  -3.104  1.00 0.00 ? 14 LEU A CD1  9  
ATOM 3219 C CD2  . LEU A 1 14 ? 6.147   4.802  -0.851  1.00 0.00 ? 14 LEU A CD2  9  
ATOM 3220 H H    . LEU A 1 14 ? 6.886   1.415  0.176   1.00 0.00 ? 14 LEU A H    9  
ATOM 3221 N N    . LEU A 1 15 ? 4.453   -0.258 -1.176  1.00 0.00 ? 15 LEU A N    9  
ATOM 3222 C CA   . LEU A 1 15 ? 3.585   -1.437 -1.407  1.00 0.00 ? 15 LEU A CA   9  
ATOM 3223 C C    . LEU A 1 15 ? 2.867   -1.891 -0.118  1.00 0.00 ? 15 LEU A C    9  
ATOM 3224 O O    . LEU A 1 15 ? 1.652   -1.843 -0.100  1.00 0.00 ? 15 LEU A O    9  
ATOM 3225 C CB   . LEU A 1 15 ? 4.332   -2.628 -2.012  1.00 0.00 ? 15 LEU A CB   9  
ATOM 3226 C CG   . LEU A 1 15 ? 5.334   -2.249 -3.122  1.00 0.00 ? 15 LEU A CG   9  
ATOM 3227 C CD1  . LEU A 1 15 ? 5.910   -3.529 -3.718  1.00 0.00 ? 15 LEU A CD1  9  
ATOM 3228 C CD2  . LEU A 1 15 ? 4.745   -1.385 -4.243  1.00 0.00 ? 15 LEU A CD2  9  
ATOM 3229 H H    . LEU A 1 15 ? 5.377   -0.332 -1.543  1.00 0.00 ? 15 LEU A H    9  
ATOM 3230 N N    . SER A 1 16 ? 3.602   -2.010 0.997   1.00 0.00 ? 16 SER A N    9  
ATOM 3231 C CA   . SER A 1 16 ? 3.013   -2.283 2.329   1.00 0.00 ? 16 SER A CA   9  
ATOM 3232 C C    . SER A 1 16 ? 1.771   -1.451 2.690   1.00 0.00 ? 16 SER A C    9  
ATOM 3233 O O    . SER A 1 16 ? 0.857   -1.954 3.342   1.00 0.00 ? 16 SER A O    9  
ATOM 3234 C CB   . SER A 1 16 ? 4.030   -2.103 3.455   1.00 0.00 ? 16 SER A CB   9  
ATOM 3235 O OG   . SER A 1 16 ? 5.031   -3.121 3.369   1.00 0.00 ? 16 SER A OG   9  
ATOM 3236 H H    . SER A 1 16 ? 4.611   -1.996 0.967   1.00 0.00 ? 16 SER A H    9  
ATOM 3237 H HG   . SER A 1 16 ? 5.481   -3.200 4.259   1.00 0.00 ? 16 SER A HG   9  
ATOM 3238 N N    . LYS A 1 17 ? 1.740   -0.208 2.207   1.00 0.00 ? 17 LYS A N    9  
ATOM 3239 C CA   . LYS A 1 17 ? 0.565   0.669  2.259   1.00 0.00 ? 17 LYS A CA   9  
ATOM 3240 C C    . LYS A 1 17 ? -0.267  0.738  0.962   1.00 0.00 ? 17 LYS A C    9  
ATOM 3241 O O    . LYS A 1 17 ? -1.450  0.445  1.024   1.00 0.00 ? 17 LYS A O    9  
ATOM 3242 C CB   . LYS A 1 17 ? 0.924   2.071  2.728   1.00 0.00 ? 17 LYS A CB   9  
ATOM 3243 C CG   . LYS A 1 17 ? 0.508   2.232  4.196   1.00 0.00 ? 17 LYS A CG   9  
ATOM 3244 C CD   . LYS A 1 17 ? 0.491   3.703  4.590   1.00 0.00 ? 17 LYS A CD   9  
ATOM 3245 C CE   . LYS A 1 17 ? 1.709   4.153  5.414   1.00 0.00 ? 17 LYS A CE   9  
ATOM 3246 N NZ   . LYS A 1 17 ? 2.971   3.934  4.699   1.00 0.00 ? 17 LYS A NZ   9  
ATOM 3247 H H    . LYS A 1 17 ? 2.518   0.156  1.679   1.00 0.00 ? 17 LYS A H    9  
ATOM 3248 H HZ1  . LYS A 1 17 ? 2.926   4.364  3.801   1.00 0.00 ? 17 LYS A HZ1  9  
ATOM 3249 H HZ2  . LYS A 1 17 ? 3.713   4.347  5.232   1.00 0.00 ? 17 LYS A HZ2  9  
ATOM 3250 H HZ3  . LYS A 1 17 ? 3.138   2.954  4.610   1.00 0.00 ? 17 LYS A HZ3  9  
ATOM 3251 N N    . ASN A 1 18 ? 0.320   1.027  -0.192  1.00 0.00 ? 18 ASN A N    9  
ATOM 3252 C CA   . ASN A 1 18 ? -0.347  1.135  -1.507  1.00 0.00 ? 18 ASN A CA   9  
ATOM 3253 C C    . ASN A 1 18 ? -1.099  -0.158 -1.919  1.00 0.00 ? 18 ASN A C    9  
ATOM 3254 O O    . ASN A 1 18 ? -2.250  -0.115 -2.338  1.00 0.00 ? 18 ASN A O    9  
ATOM 3255 C CB   . ASN A 1 18 ? 0.680   1.503  -2.586  1.00 0.00 ? 18 ASN A CB   9  
ATOM 3256 C CG   . ASN A 1 18 ? 0.040   2.182  -3.807  1.00 0.00 ? 18 ASN A CG   9  
ATOM 3257 O OD1  . ASN A 1 18 ? 0.269   3.349  -4.093  1.00 0.00 ? 18 ASN A OD1  9  
ATOM 3258 N ND2  . ASN A 1 18 ? -0.779  1.477  -4.560  1.00 0.00 ? 18 ASN A ND2  9  
ATOM 3259 H H    . ASN A 1 18 ? 1.311   1.214  -0.201  1.00 0.00 ? 18 ASN A H    9  
ATOM 3260 H HD21 . ASN A 1 18 ? -1.061  0.551  -4.317  1.00 0.00 ? 18 ASN A HD21 9  
ATOM 3261 H HD22 . ASN A 1 18 ? -1.168  1.964  -5.338  1.00 0.00 ? 18 ASN A HD22 9  
ATOM 3262 N N    . TYR A 1 19 ? -0.435  -1.297 -1.758  1.00 0.00 ? 19 TYR A N    9  
ATOM 3263 C CA   . TYR A 1 19 ? -1.002  -2.640 -1.993  1.00 0.00 ? 19 TYR A CA   9  
ATOM 3264 C C    . TYR A 1 19 ? -2.166  -2.923 -1.018  1.00 0.00 ? 19 TYR A C    9  
ATOM 3265 O O    . TYR A 1 19 ? -3.203  -3.443 -1.414  1.00 0.00 ? 19 TYR A O    9  
ATOM 3266 C CB   . TYR A 1 19 ? 0.129   -3.654 -1.812  1.00 0.00 ? 19 TYR A CB   9  
ATOM 3267 C CG   . TYR A 1 19 ? 0.043   -4.889 -2.701  1.00 0.00 ? 19 TYR A CG   9  
ATOM 3268 C CD1  . TYR A 1 19 ? 0.079   -4.732 -4.104  1.00 0.00 ? 19 TYR A CD1  9  
ATOM 3269 C CD2  . TYR A 1 19 ? 0.065   -6.162 -2.079  1.00 0.00 ? 19 TYR A CD2  9  
ATOM 3270 C CE1  . TYR A 1 19 ? 0.125   -5.884 -4.911  1.00 0.00 ? 19 TYR A CE1  9  
ATOM 3271 C CE2  . TYR A 1 19 ? 0.112   -7.311 -2.896  1.00 0.00 ? 19 TYR A CE2  9  
ATOM 3272 C CZ   . TYR A 1 19 ? 0.133   -7.158 -4.291  1.00 0.00 ? 19 TYR A CZ   9  
ATOM 3273 O OH   . TYR A 1 19 ? 0.105   -8.261 -5.079  1.00 0.00 ? 19 TYR A OH   9  
ATOM 3274 H H    . TYR A 1 19 ? 0.483   -1.308 -1.356  1.00 0.00 ? 19 TYR A H    9  
ATOM 3275 H HH   . TYR A 1 19 ? 0.047   -7.983 -6.036  1.00 0.00 ? 19 TYR A HH   9  
ATOM 3276 N N    . HIS A 1 20 ? -2.011  -2.393 0.200   1.00 0.00 ? 20 HIS A N    9  
ATOM 3277 C CA   . HIS A 1 20 ? -3.038  -2.394 1.269   1.00 0.00 ? 20 HIS A CA   9  
ATOM 3278 C C    . HIS A 1 20 ? -4.097  -1.264 1.132   1.00 0.00 ? 20 HIS A C    9  
ATOM 3279 O O    . HIS A 1 20 ? -5.172  -1.293 1.731   1.00 0.00 ? 20 HIS A O    9  
ATOM 3280 C CB   . HIS A 1 20 ? -2.236  -2.394 2.579   1.00 0.00 ? 20 HIS A CB   9  
ATOM 3281 C CG   . HIS A 1 20 ? -2.845  -1.701 3.797   1.00 0.00 ? 20 HIS A CG   9  
ATOM 3282 N ND1  . HIS A 1 20 ? -3.524  -2.267 4.788   1.00 0.00 ? 20 HIS A ND1  9  
ATOM 3283 C CD2  . HIS A 1 20 ? -2.857  -0.376 3.995   1.00 0.00 ? 20 HIS A CD2  9  
ATOM 3284 C CE1  . HIS A 1 20 ? -3.987  -1.305 5.578   1.00 0.00 ? 20 HIS A CE1  9  
ATOM 3285 N NE2  . HIS A 1 20 ? -3.582  -0.148 5.083   1.00 0.00 ? 20 HIS A NE2  9  
ATOM 3286 H H    . HIS A 1 20 ? -1.171  -1.942 0.469   1.00 0.00 ? 20 HIS A H    9  
ATOM 3287 H HD1  . HIS A 1 20 ? -3.589  -3.249 4.951   1.00 0.00 ? 20 HIS A HD1  9  
ATOM 3288 H HE2  . HIS A 1 20 ? -3.917  0.749  5.367   1.00 0.00 ? 20 HIS A HE2  9  
ATOM 3289 N N    . LEU A 1 21 ? -3.850  -0.347 0.211   1.00 0.00 ? 21 LEU A N    9  
ATOM 3290 C CA   . LEU A 1 21 ? -4.672  0.839  -0.058  1.00 0.00 ? 21 LEU A CA   9  
ATOM 3291 C C    . LEU A 1 21 ? -5.741  0.502  -1.100  1.00 0.00 ? 21 LEU A C    9  
ATOM 3292 O O    . LEU A 1 21 ? -6.926  0.657  -0.821  1.00 0.00 ? 21 LEU A O    9  
ATOM 3293 C CB   . LEU A 1 21 ? -3.767  1.996  -0.501  1.00 0.00 ? 21 LEU A CB   9  
ATOM 3294 C CG   . LEU A 1 21 ? -4.493  3.243  -1.016  1.00 0.00 ? 21 LEU A CG   9  
ATOM 3295 C CD1  . LEU A 1 21 ? -5.135  4.041  0.120   1.00 0.00 ? 21 LEU A CD1  9  
ATOM 3296 C CD2  . LEU A 1 21 ? -3.508  4.117  -1.796  1.00 0.00 ? 21 LEU A CD2  9  
ATOM 3297 H H    . LEU A 1 21 ? -2.975  -0.356 -0.276  1.00 0.00 ? 21 LEU A H    9  
ATOM 3298 N N    . GLU A 1 22 ? -5.312  -0.194 -2.136  1.00 0.00 ? 22 GLU A N    9  
ATOM 3299 C CA   . GLU A 1 22 ? -6.208  -0.712 -3.194  1.00 0.00 ? 22 GLU A CA   9  
ATOM 3300 C C    . GLU A 1 22 ? -7.271  -1.680 -2.633  1.00 0.00 ? 22 GLU A C    9  
ATOM 3301 O O    . GLU A 1 22 ? -8.418  -1.653 -3.090  1.00 0.00 ? 22 GLU A O    9  
ATOM 3302 C CB   . GLU A 1 22 ? -5.365  -1.368 -4.293  1.00 0.00 ? 22 GLU A CB   9  
ATOM 3303 C CG   . GLU A 1 22 ? -4.356  -0.399 -4.925  1.00 0.00 ? 22 GLU A CG   9  
ATOM 3304 C CD   . GLU A 1 22 ? -4.650  -0.050 -6.381  1.00 0.00 ? 22 GLU A CD   9  
ATOM 3305 O OE1  . GLU A 1 22 ? -4.915  -0.888 -7.224  1.00 0.00 ? 22 GLU A OE1  9  
ATOM 3306 O OE2  . GLU A 1 22 ? -4.441  1.235  -6.743  1.00 0.00 ? 22 GLU A OE2  9  
ATOM 3307 H H    . GLU A 1 22 ? -4.332  -0.384 -2.271  1.00 0.00 ? 22 GLU A H    9  
ATOM 3308 H HE2  . GLU A 1 22 ? -4.680  1.238  -7.721  1.00 0.00 ? 22 GLU A HE2  9  
ATOM 3309 N N    . ASN A 1 23 ? -6.928  -2.372 -1.541  1.00 0.00 ? 23 ASN A N    9  
ATOM 3310 C CA   . ASN A 1 23 ? -7.900  -3.217 -0.813  1.00 0.00 ? 23 ASN A CA   9  
ATOM 3311 C C    . ASN A 1 23 ? -8.795  -2.380 0.122   1.00 0.00 ? 23 ASN A C    9  
ATOM 3312 O O    . ASN A 1 23 ? -10.011 -2.600 0.166   1.00 0.00 ? 23 ASN A O    9  
ATOM 3313 C CB   . ASN A 1 23 ? -7.224  -4.394 -0.072  1.00 0.00 ? 23 ASN A CB   9  
ATOM 3314 C CG   . ASN A 1 23 ? -6.790  -4.107 1.367   1.00 0.00 ? 23 ASN A CG   9  
ATOM 3315 O OD1  . ASN A 1 23 ? -5.626  -3.974 1.683   1.00 0.00 ? 23 ASN A OD1  9  
ATOM 3316 N ND2  . ASN A 1 23 ? -7.722  -4.074 2.300   1.00 0.00 ? 23 ASN A ND2  9  
ATOM 3317 H H    . ASN A 1 23 ? -6.000  -2.350 -1.168  1.00 0.00 ? 23 ASN A H    9  
ATOM 3318 H HD21 . ASN A 1 23 ? -8.673  -4.335 2.112   1.00 0.00 ? 23 ASN A HD21 9  
ATOM 3319 H HD22 . ASN A 1 23 ? -7.412  -3.827 3.211   1.00 0.00 ? 23 ASN A HD22 9  
ATOM 3320 N N    . GLU A 1 24 ? -8.195  -1.488 0.910   1.00 0.00 ? 24 GLU A N    9  
ATOM 3321 C CA   . GLU A 1 24 ? -8.958  -0.676 1.874   1.00 0.00 ? 24 GLU A CA   9  
ATOM 3322 C C    . GLU A 1 24 ? -9.952  0.282  1.181   1.00 0.00 ? 24 GLU A C    9  
ATOM 3323 O O    . GLU A 1 24 ? -11.122 0.207  1.470   1.00 0.00 ? 24 GLU A O    9  
ATOM 3324 C CB   . GLU A 1 24 ? -8.091  0.042  2.919   1.00 0.00 ? 24 GLU A CB   9  
ATOM 3325 C CG   . GLU A 1 24 ? -7.278  1.214  2.363   1.00 0.00 ? 24 GLU A CG   9  
ATOM 3326 C CD   . GLU A 1 24 ? -6.516  2.049  3.386   1.00 0.00 ? 24 GLU A CD   9  
ATOM 3327 O OE1  . GLU A 1 24 ? -6.217  3.218  3.163   1.00 0.00 ? 24 GLU A OE1  9  
ATOM 3328 O OE2  . GLU A 1 24 ? -6.164  1.485  4.561   1.00 0.00 ? 24 GLU A OE2  9  
ATOM 3329 H H    . GLU A 1 24 ? -7.193  -1.417 0.987   1.00 0.00 ? 24 GLU A H    9  
ATOM 3330 H HE2  . GLU A 1 24 ? -5.715  2.241  5.029   1.00 0.00 ? 24 GLU A HE2  9  
ATOM 3331 N N    . VAL A 1 25 ? -9.472  0.961  0.122   1.00 0.00 ? 25 VAL A N    9  
ATOM 3332 C CA   . VAL A 1 25 ? -10.267 1.814  -0.781  1.00 0.00 ? 25 VAL A CA   9  
ATOM 3333 C C    . VAL A 1 25 ? -11.516 1.068  -1.291  1.00 0.00 ? 25 VAL A C    9  
ATOM 3334 O O    . VAL A 1 25 ? -12.578 1.666  -1.322  1.00 0.00 ? 25 VAL A O    9  
ATOM 3335 C CB   . VAL A 1 25 ? -9.406  2.392  -1.917  1.00 0.00 ? 25 VAL A CB   9  
ATOM 3336 C CG1  . VAL A 1 25 ? -10.197 3.113  -3.011  1.00 0.00 ? 25 VAL A CG1  9  
ATOM 3337 C CG2  . VAL A 1 25 ? -8.438  3.430  -1.340  1.00 0.00 ? 25 VAL A CG2  9  
ATOM 3338 H H    . VAL A 1 25 ? -8.484  0.976  -0.072  1.00 0.00 ? 25 VAL A H    9  
ATOM 3339 N N    . ALA A 1 26 ? -11.374 -0.245 -1.501  1.00 0.00 ? 26 ALA A N    9  
ATOM 3340 C CA   . ALA A 1 26 ? -12.505 -1.122 -1.809  1.00 0.00 ? 26 ALA A CA   9  
ATOM 3341 C C    . ALA A 1 26 ? -13.541 -1.118 -0.674  1.00 0.00 ? 26 ALA A C    9  
ATOM 3342 O O    . ALA A 1 26 ? -14.476 -0.335 -0.758  1.00 0.00 ? 26 ALA A O    9  
ATOM 3343 C CB   . ALA A 1 26 ? -12.027 -2.535 -2.188  1.00 0.00 ? 26 ALA A CB   9  
ATOM 3344 H H    . ALA A 1 26 ? -10.496 -0.707 -1.375  1.00 0.00 ? 26 ALA A H    9  
ATOM 3345 N N    . ARG A 1 27 ? -13.242 -1.735 0.474   1.00 0.00 ? 27 ARG A N    9  
ATOM 3346 C CA   . ARG A 1 27 ? -14.154 -1.738 1.643   1.00 0.00 ? 27 ARG A CA   9  
ATOM 3347 C C    . ARG A 1 27 ? -14.622 -0.337 2.116   1.00 0.00 ? 27 ARG A C    9  
ATOM 3348 O O    . ARG A 1 27 ? -15.772 -0.189 2.516   1.00 0.00 ? 27 ARG A O    9  
ATOM 3349 C CB   . ARG A 1 27 ? -13.630 -2.554 2.829   1.00 0.00 ? 27 ARG A CB   9  
ATOM 3350 C CG   . ARG A 1 27 ? -13.655 -4.050 2.538   1.00 0.00 ? 27 ARG A CG   9  
ATOM 3351 C CD   . ARG A 1 27 ? -12.341 -4.467 1.872   1.00 0.00 ? 27 ARG A CD   9  
ATOM 3352 N NE   . ARG A 1 27 ? -12.562 -5.582 0.926   1.00 0.00 ? 27 ARG A NE   9  
ATOM 3353 C CZ   . ARG A 1 27 ? -11.625 -6.103 0.140   1.00 0.00 ? 27 ARG A CZ   9  
ATOM 3354 N NH1  . ARG A 1 27 ? -10.411 -5.568 0.046   1.00 0.00 ? 27 ARG A NH1  9  
ATOM 3355 N NH2  . ARG A 1 27 ? -11.823 -7.255 -0.482  1.00 0.00 ? 27 ARG A NH2  9  
ATOM 3356 H H    . ARG A 1 27 ? -12.409 -2.287 0.570   1.00 0.00 ? 27 ARG A H    9  
ATOM 3357 H HE   . ARG A 1 27 ? -13.516 -5.837 0.762   1.00 0.00 ? 27 ARG A HE   9  
ATOM 3358 H HH11 . ARG A 1 27 ? -10.272 -4.650 0.419   1.00 0.00 ? 27 ARG A HH11 9  
ATOM 3359 H HH12 . ARG A 1 27 ? -9.710  -6.001 -0.509  1.00 0.00 ? 27 ARG A HH12 9  
ATOM 3360 H HH21 . ARG A 1 27 ? -12.672 -7.758 -0.340  1.00 0.00 ? 27 ARG A HH21 9  
ATOM 3361 H HH22 . ARG A 1 27 ? -11.112 -7.624 -1.065  1.00 0.00 ? 27 ARG A HH22 9  
ATOM 3362 N N    . LEU A 1 28 ? -13.763 0.646  1.925   1.00 0.00 ? 28 LEU A N    9  
ATOM 3363 C CA   . LEU A 1 28 ? -14.014 2.095  2.141   1.00 0.00 ? 28 LEU A CA   9  
ATOM 3364 C C    . LEU A 1 28 ? -15.086 2.663  1.190   1.00 0.00 ? 28 LEU A C    9  
ATOM 3365 O O    . LEU A 1 28 ? -16.164 3.035  1.631   1.00 0.00 ? 28 LEU A O    9  
ATOM 3366 C CB   . LEU A 1 28 ? -12.658 2.808  2.036   1.00 0.00 ? 28 LEU A CB   9  
ATOM 3367 C CG   . LEU A 1 28 ? -12.717 4.319  1.761   1.00 0.00 ? 28 LEU A CG   9  
ATOM 3368 C CD1  . LEU A 1 28 ? -13.200 5.089  2.992   1.00 0.00 ? 28 LEU A CD1  9  
ATOM 3369 C CD2  . LEU A 1 28 ? -11.365 4.854  1.306   1.00 0.00 ? 28 LEU A CD2  9  
ATOM 3370 H H    . LEU A 1 28 ? -12.829 0.450  1.599   1.00 0.00 ? 28 LEU A H    9  
ATOM 3371 N N    . LYS A 1 29 ? -14.813 2.683  -0.117  1.00 0.00 ? 29 LYS A N    9  
ATOM 3372 C CA   . LYS A 1 29 ? -15.772 3.207  -1.114  1.00 0.00 ? 29 LYS A CA   9  
ATOM 3373 C C    . LYS A 1 29 ? -17.020 2.304  -1.231  1.00 0.00 ? 29 LYS A C    9  
ATOM 3374 O O    . LYS A 1 29 ? -18.084 2.761  -1.630  1.00 0.00 ? 29 LYS A O    9  
ATOM 3375 C CB   . LYS A 1 29 ? -15.030 3.525  -2.421  1.00 0.00 ? 29 LYS A CB   9  
ATOM 3376 C CG   . LYS A 1 29 ? -15.285 2.678  -3.676  1.00 0.00 ? 29 LYS A CG   9  
ATOM 3377 C CD   . LYS A 1 29 ? -15.059 1.174  -3.475  1.00 0.00 ? 29 LYS A CD   9  
ATOM 3378 C CE   . LYS A 1 29 ? -14.651 0.417  -4.732  1.00 0.00 ? 29 LYS A CE   9  
ATOM 3379 N NZ   . LYS A 1 29 ? -13.192 0.544  -4.834  1.00 0.00 ? 29 LYS A NZ   9  
ATOM 3380 H H    . LYS A 1 29 ? -13.949 2.332  -0.502  1.00 0.00 ? 29 LYS A H    9  
ATOM 3381 H HZ1  . LYS A 1 29 ? -12.766 0.150  -4.016  1.00 0.00 ? 29 LYS A HZ1  9  
ATOM 3382 H HZ2  . LYS A 1 29 ? -12.879 0.058  -5.642  1.00 0.00 ? 29 LYS A HZ2  9  
ATOM 3383 H HZ3  . LYS A 1 29 ? -12.946 1.509  -4.905  1.00 0.00 ? 29 LYS A HZ3  9  
ATOM 3384 N N    . LYS A 1 30 ? -16.872 1.045  -0.826  1.00 0.00 ? 30 LYS A N    9  
ATOM 3385 C CA   . LYS A 1 30 ? -17.979 0.074  -0.704  1.00 0.00 ? 30 LYS A CA   9  
ATOM 3386 C C    . LYS A 1 30 ? -19.016 0.459  0.363   1.00 0.00 ? 30 LYS A C    9  
ATOM 3387 O O    . LYS A 1 30 ? -20.097 -0.105 0.376   1.00 0.00 ? 30 LYS A O    9  
ATOM 3388 C CB   . LYS A 1 30 ? -17.444 -1.333 -0.415  1.00 0.00 ? 30 LYS A CB   9  
ATOM 3389 C CG   . LYS A 1 30 ? -17.027 -2.059 -1.691  1.00 0.00 ? 30 LYS A CG   9  
ATOM 3390 C CD   . LYS A 1 30 ? -16.185 -3.334 -1.464  1.00 0.00 ? 30 LYS A CD   9  
ATOM 3391 C CE   . LYS A 1 30 ? -16.886 -4.506 -0.774  1.00 0.00 ? 30 LYS A CE   9  
ATOM 3392 N NZ   . LYS A 1 30 ? -17.030 -4.278 0.678   1.00 0.00 ? 30 LYS A NZ   9  
ATOM 3393 H H    . LYS A 1 30 ? -15.960 0.665  -0.632  1.00 0.00 ? 30 LYS A H    9  
ATOM 3394 H HZ1  . LYS A 1 30 ? -16.137 -4.170 1.101   1.00 0.00 ? 30 LYS A HZ1  9  
ATOM 3395 H HZ2  . LYS A 1 30 ? -17.581 -3.453 0.820   1.00 0.00 ? 30 LYS A HZ2  9  
ATOM 3396 H HZ3  . LYS A 1 30 ? -17.504 -5.063 1.081   1.00 0.00 ? 30 LYS A HZ3  9  
ATOM 3397 N N    . LEU A 1 31 ? -18.621 1.387  1.247   1.00 0.00 ? 31 LEU A N    9  
ATOM 3398 C CA   . LEU A 1 31 ? -19.536 2.064  2.183   1.00 0.00 ? 31 LEU A CA   9  
ATOM 3399 C C    . LEU A 1 31 ? -20.439 3.111  1.492   1.00 0.00 ? 31 LEU A C    9  
ATOM 3400 O O    . LEU A 1 31 ? -21.513 3.401  1.967   1.00 0.00 ? 31 LEU A O    9  
ATOM 3401 C CB   . LEU A 1 31 ? -18.777 2.708  3.348   1.00 0.00 ? 31 LEU A CB   9  
ATOM 3402 C CG   . LEU A 1 31 ? -17.806 1.736  4.053   1.00 0.00 ? 31 LEU A CG   9  
ATOM 3403 C CD1  . LEU A 1 31 ? -16.907 2.510  5.016   1.00 0.00 ? 31 LEU A CD1  9  
ATOM 3404 C CD2  . LEU A 1 31 ? -18.516 0.580  4.759   1.00 0.00 ? 31 LEU A CD2  9  
ATOM 3405 H H    . LEU A 1 31 ? -17.666 1.661  1.343   1.00 0.00 ? 31 LEU A H    9  
ATOM 3406 N N    . VAL A 1 32 ? -20.043 3.520  0.275   1.00 0.00 ? 32 VAL A N    9  
ATOM 3407 C CA   . VAL A 1 32 ? -20.810 4.468  -0.577  1.00 0.00 ? 32 VAL A CA   9  
ATOM 3408 C C    . VAL A 1 32 ? -21.741 3.711  -1.569  1.00 0.00 ? 32 VAL A C    9  
ATOM 3409 O O    . VAL A 1 32 ? -22.481 4.317  -2.334  1.00 0.00 ? 32 VAL A O    9  
ATOM 3410 C CB   . VAL A 1 32 ? -19.811 5.439  -1.252  1.00 0.00 ? 32 VAL A CB   9  
ATOM 3411 C CG1  . VAL A 1 32 ? -20.458 6.490  -2.157  1.00 0.00 ? 32 VAL A CG1  9  
ATOM 3412 C CG2  . VAL A 1 32 ? -18.987 6.200  -0.207  1.00 0.00 ? 32 VAL A CG2  9  
ATOM 3413 H H    . VAL A 1 32 ? -19.196 3.189  -0.146  1.00 0.00 ? 32 VAL A H    9  
ATOM 3414 N N    . GLY A 1 33 ? -21.841 2.395  -1.390  1.00 0.00 ? 33 GLY A N    9  
ATOM 3415 C CA   . GLY A 1 33 ? -22.724 1.507  -2.189  1.00 0.00 ? 33 GLY A CA   9  
ATOM 3416 C C    . GLY A 1 33 ? -24.145 1.368  -1.611  1.00 0.00 ? 33 GLY A C    9  
ATOM 3417 O O    . GLY A 1 33 ? -25.099 1.098  -2.332  1.00 0.00 ? 33 GLY A O    9  
ATOM 3418 H H    . GLY A 1 33 ? -21.332 1.934  -0.662  1.00 0.00 ? 33 GLY A H    9  
ATOM 3419 N N    . GLU A 1 34 ? -24.235 1.523  -0.299  1.00 0.00 ? 34 GLU A N    9  
ATOM 3420 C CA   . GLU A 1 34 ? -25.470 1.367  0.511   1.00 0.00 ? 34 GLU A CA   9  
ATOM 3421 C C    . GLU A 1 34 ? -25.835 2.657  1.289   1.00 0.00 ? 34 GLU A C    9  
ATOM 3422 O O    . GLU A 1 34 ? -26.394 2.596  2.383   1.00 0.00 ? 34 GLU A O    9  
ATOM 3423 C CB   . GLU A 1 34 ? -25.363 0.107  1.408   1.00 0.00 ? 34 GLU A CB   9  
ATOM 3424 C CG   . GLU A 1 34 ? -24.227 0.061  2.450   1.00 0.00 ? 34 GLU A CG   9  
ATOM 3425 C CD   . GLU A 1 34 ? -22.842 -0.089 1.831   1.00 0.00 ? 34 GLU A CD   9  
ATOM 3426 O OE1  . GLU A 1 34 ? -22.254 0.886  1.364   1.00 0.00 ? 34 GLU A OE1  9  
ATOM 3427 O OE2  . GLU A 1 34 ? -22.312 -1.321 1.701   1.00 0.00 ? 34 GLU A OE2  9  
ATOM 3428 H H    . GLU A 1 34 ? -23.399 1.674  0.242   1.00 0.00 ? 34 GLU A H    9  
ATOM 3429 H HE2  . GLU A 1 34 ? -21.434 -1.134 1.236   1.00 0.00 ? 34 GLU A HE2  9  
ATOM 3430 N N    . ARG A 1 35 ? -25.567 3.787  0.648   1.00 0.00 ? 35 ARG A N    9  
ATOM 3431 C CA   . ARG A 1 35 ? -25.881 5.158  1.139   1.00 0.00 ? 35 ARG A CA   9  
ATOM 3432 C C    . ARG A 1 35 ? -25.682 6.268  0.083   1.00 0.00 ? 35 ARG A C    9  
ATOM 3433 O O    . ARG A 1 35 ? -25.253 5.911  -1.028  1.00 0.00 ? 35 ARG A O    9  
ATOM 3434 C CB   . ARG A 1 35 ? -25.160 5.508  2.456   1.00 0.00 ? 35 ARG A CB   9  
ATOM 3435 C CG   . ARG A 1 35 ? -23.628 5.520  2.404   1.00 0.00 ? 35 ARG A CG   9  
ATOM 3436 C CD   . ARG A 1 35 ? -23.022 6.849  1.947   1.00 0.00 ? 35 ARG A CD   9  
ATOM 3437 N NE   . ARG A 1 35 ? -21.683 6.969  2.561   1.00 0.00 ? 35 ARG A NE   9  
ATOM 3438 C CZ   . ARG A 1 35 ? -21.451 7.201  3.856   1.00 0.00 ? 35 ARG A CZ   9  
ATOM 3439 N NH1  . ARG A 1 35 ? -22.367 7.762  4.639   1.00 0.00 ? 35 ARG A NH1  9  
ATOM 3440 N NH2  . ARG A 1 35 ? -20.236 7.060  4.343   1.00 0.00 ? 35 ARG A NH2  9  
ATOM 3441 O OXT  . ARG A 1 35 ? -25.974 7.444  0.415   1.00 0.00 ? 35 ARG A OXT  9  
ATOM 3442 H H    . ARG A 1 35 ? -25.152 3.761  -0.260  1.00 0.00 ? 35 ARG A H    9  
ATOM 3443 H HE   . ARG A 1 35 ? -20.911 6.956  1.929   1.00 0.00 ? 35 ARG A HE   9  
ATOM 3444 H HH11 . ARG A 1 35 ? -23.251 8.011  4.236   1.00 0.00 ? 35 ARG A HH11 9  
ATOM 3445 H HH12 . ARG A 1 35 ? -22.192 7.919  5.607   1.00 0.00 ? 35 ARG A HH12 9  
ATOM 3446 H HH21 . ARG A 1 35 ? -19.506 6.678  3.779   1.00 0.00 ? 35 ARG A HH21 9  
ATOM 3447 H HH22 . ARG A 1 35 ? -20.068 7.240  5.308   1.00 0.00 ? 35 ARG A HH22 9  
ATOM 3448 N N    . LEU A 1 1  ? 24.204  12.405 2.866   1.00 0.00 ? 1  LEU A N    10 
ATOM 3449 C CA   . LEU A 1 1  ? 24.064  11.053 3.440   1.00 0.00 ? 1  LEU A CA   10 
ATOM 3450 C C    . LEU A 1 1  ? 22.606  10.540 3.369   1.00 0.00 ? 1  LEU A C    10 
ATOM 3451 O O    . LEU A 1 1  ? 21.672  11.336 3.275   1.00 0.00 ? 1  LEU A O    10 
ATOM 3452 C CB   . LEU A 1 1  ? 24.591  10.989 4.890   1.00 0.00 ? 1  LEU A CB   10 
ATOM 3453 C CG   . LEU A 1 1  ? 23.684  11.618 5.959   1.00 0.00 ? 1  LEU A CG   10 
ATOM 3454 C CD1  . LEU A 1 1  ? 23.965  10.969 7.312   1.00 0.00 ? 1  LEU A CD1  10 
ATOM 3455 C CD2  . LEU A 1 1  ? 23.894  13.131 6.081   1.00 0.00 ? 1  LEU A CD2  10 
ATOM 3456 H H1   . LEU A 1 1  ? 23.595  13.033 3.359   1.00 0.00 ? 1  LEU A H1   10 
ATOM 3457 H H2   . LEU A 1 1  ? 25.144  12.725 2.943   1.00 0.00 ? 1  LEU A H2   10 
ATOM 3458 H H3   . LEU A 1 1  ? 23.930  12.396 1.899   1.00 0.00 ? 1  LEU A H3   10 
ATOM 3459 N N    . GLN A 1 2  ? 22.476  9.213  3.403   1.00 0.00 ? 2  GLN A N    10 
ATOM 3460 C CA   . GLN A 1 2  ? 21.179  8.480  3.395   1.00 0.00 ? 2  GLN A CA   10 
ATOM 3461 C C    . GLN A 1 2  ? 20.456  8.630  2.041   1.00 0.00 ? 2  GLN A C    10 
ATOM 3462 O O    . GLN A 1 2  ? 19.850  9.649  1.718   1.00 0.00 ? 2  GLN A O    10 
ATOM 3463 C CB   . GLN A 1 2  ? 20.312  8.944  4.584   1.00 0.00 ? 2  GLN A CB   10 
ATOM 3464 C CG   . GLN A 1 2  ? 19.487  7.821  5.195   1.00 0.00 ? 2  GLN A CG   10 
ATOM 3465 C CD   . GLN A 1 2  ? 17.975  8.012  5.036   1.00 0.00 ? 2  GLN A CD   10 
ATOM 3466 O OE1  . GLN A 1 2  ? 17.418  9.084  4.870   1.00 0.00 ? 2  GLN A OE1  10 
ATOM 3467 N NE2  . GLN A 1 2  ? 17.265  6.914  5.137   1.00 0.00 ? 2  GLN A NE2  10 
ATOM 3468 H H    . GLN A 1 2  ? 23.282  8.633  3.454   1.00 0.00 ? 2  GLN A H    10 
ATOM 3469 H HE21 . GLN A 1 2  ? 17.677  6.055  5.410   1.00 0.00 ? 2  GLN A HE21 10 
ATOM 3470 H HE22 . GLN A 1 2  ? 16.275  7.001  5.048   1.00 0.00 ? 2  GLN A HE22 10 
ATOM 3471 N N    . ARG A 1 3  ? 20.691  7.608  1.219   1.00 0.00 ? 3  ARG A N    10 
ATOM 3472 C CA   . ARG A 1 3  ? 20.152  7.421  -0.152  1.00 0.00 ? 3  ARG A CA   10 
ATOM 3473 C C    . ARG A 1 3  ? 20.561  6.037  -0.655  1.00 0.00 ? 3  ARG A C    10 
ATOM 3474 O O    . ARG A 1 3  ? 21.599  5.523  -0.230  1.00 0.00 ? 3  ARG A O    10 
ATOM 3475 C CB   . ARG A 1 3  ? 20.688  8.444  -1.168  1.00 0.00 ? 3  ARG A CB   10 
ATOM 3476 C CG   . ARG A 1 3  ? 19.544  9.371  -1.555  1.00 0.00 ? 3  ARG A CG   10 
ATOM 3477 C CD   . ARG A 1 3  ? 19.791  10.207 -2.811  1.00 0.00 ? 3  ARG A CD   10 
ATOM 3478 N NE   . ARG A 1 3  ? 19.395  11.595 -2.503  1.00 0.00 ? 3  ARG A NE   10 
ATOM 3479 C CZ   . ARG A 1 3  ? 18.224  11.980 -1.996  1.00 0.00 ? 3  ARG A CZ   10 
ATOM 3480 N NH1  . ARG A 1 3  ? 17.066  11.585 -2.511  1.00 0.00 ? 3  ARG A NH1  10 
ATOM 3481 N NH2  . ARG A 1 3  ? 18.211  13.044 -1.212  1.00 0.00 ? 3  ARG A NH2  10 
ATOM 3482 H H    . ARG A 1 3  ? 21.296  6.872  1.506   1.00 0.00 ? 3  ARG A H    10 
ATOM 3483 H HE   . ARG A 1 3  ? 19.975  12.302 -2.912  1.00 0.00 ? 3  ARG A HE   10 
ATOM 3484 H HH11 . ARG A 1 3  ? 17.063  10.998 -3.323  1.00 0.00 ? 3  ARG A HH11 10 
ATOM 3485 H HH12 . ARG A 1 3  ? 16.211  11.896 -2.112  1.00 0.00 ? 3  ARG A HH12 10 
ATOM 3486 H HH21 . ARG A 1 3  ? 19.077  13.382 -0.853  1.00 0.00 ? 3  ARG A HH21 10 
ATOM 3487 H HH22 . ARG A 1 3  ? 17.346  13.369 -0.829  1.00 0.00 ? 3  ARG A HH22 10 
ATOM 3488 N N    . MET A 1 4  ? 19.602  5.376  -1.292  1.00 0.00 ? 4  MET A N    10 
ATOM 3489 C CA   . MET A 1 4  ? 19.712  4.003  -1.860  1.00 0.00 ? 4  MET A CA   10 
ATOM 3490 C C    . MET A 1 4  ? 19.673  2.874  -0.825  1.00 0.00 ? 4  MET A C    10 
ATOM 3491 O O    . MET A 1 4  ? 18.955  1.886  -1.000  1.00 0.00 ? 4  MET A O    10 
ATOM 3492 C CB   . MET A 1 4  ? 20.923  3.869  -2.785  1.00 0.00 ? 4  MET A CB   10 
ATOM 3493 C CG   . MET A 1 4  ? 20.554  3.261  -4.143  1.00 0.00 ? 4  MET A CG   10 
ATOM 3494 S SD   . MET A 1 4  ? 19.142  4.050  -5.009  1.00 0.00 ? 4  MET A SD   10 
ATOM 3495 C CE   . MET A 1 4  ? 19.544  5.790  -4.956  1.00 0.00 ? 4  MET A CE   10 
ATOM 3496 H H    . MET A 1 4  ? 18.724  5.823  -1.458  1.00 0.00 ? 4  MET A H    10 
ATOM 3497 N N    . LYS A 1 5  ? 20.157  3.219  0.365   1.00 0.00 ? 5  LYS A N    10 
ATOM 3498 C CA   . LYS A 1 5  ? 20.199  2.329  1.530   1.00 0.00 ? 5  LYS A CA   10 
ATOM 3499 C C    . LYS A 1 5  ? 18.815  2.213  2.208   1.00 0.00 ? 5  LYS A C    10 
ATOM 3500 O O    . LYS A 1 5  ? 18.456  1.148  2.694   1.00 0.00 ? 5  LYS A O    10 
ATOM 3501 C CB   . LYS A 1 5  ? 21.250  2.850  2.502   1.00 0.00 ? 5  LYS A CB   10 
ATOM 3502 C CG   . LYS A 1 5  ? 21.890  1.696  3.279   1.00 0.00 ? 5  LYS A CG   10 
ATOM 3503 C CD   . LYS A 1 5  ? 22.978  2.215  4.226   1.00 0.00 ? 5  LYS A CD   10 
ATOM 3504 C CE   . LYS A 1 5  ? 24.223  2.692  3.481   1.00 0.00 ? 5  LYS A CE   10 
ATOM 3505 N NZ   . LYS A 1 5  ? 24.955  3.625  4.363   1.00 0.00 ? 5  LYS A NZ   10 
ATOM 3506 H H    . LYS A 1 5  ? 20.656  4.090  0.446   1.00 0.00 ? 5  LYS A H    10 
ATOM 3507 H HZ1  . LYS A 1 5  ? 25.115  3.180  5.240   1.00 0.00 ? 5  LYS A HZ1  10 
ATOM 3508 H HZ2  . LYS A 1 5  ? 25.830  3.859  3.942   1.00 0.00 ? 5  LYS A HZ2  10 
ATOM 3509 H HZ3  . LYS A 1 5  ? 24.417  4.460  4.488   1.00 0.00 ? 5  LYS A HZ3  10 
ATOM 3510 N N    . GLN A 1 6  ? 18.053  3.305  2.205   1.00 0.00 ? 6  GLN A N    10 
ATOM 3511 C CA   . GLN A 1 6  ? 16.628  3.270  2.614   1.00 0.00 ? 6  GLN A CA   10 
ATOM 3512 C C    . GLN A 1 6  ? 15.717  2.977  1.434   1.00 0.00 ? 6  GLN A C    10 
ATOM 3513 O O    . GLN A 1 6  ? 14.782  2.192  1.570   1.00 0.00 ? 6  GLN A O    10 
ATOM 3514 C CB   . GLN A 1 6  ? 16.203  4.559  3.332   1.00 0.00 ? 6  GLN A CB   10 
ATOM 3515 C CG   . GLN A 1 6  ? 14.705  4.580  3.668   1.00 0.00 ? 6  GLN A CG   10 
ATOM 3516 C CD   . GLN A 1 6  ? 14.363  5.348  4.942   1.00 0.00 ? 6  GLN A CD   10 
ATOM 3517 O OE1  . GLN A 1 6  ? 14.492  4.860  6.046   1.00 0.00 ? 6  GLN A OE1  10 
ATOM 3518 N NE2  . GLN A 1 6  ? 13.963  6.596  4.804   1.00 0.00 ? 6  GLN A NE2  10 
ATOM 3519 H H    . GLN A 1 6  ? 18.411  4.207  1.954   1.00 0.00 ? 6  GLN A H    10 
ATOM 3520 H HE21 . GLN A 1 6  ? 13.789  7.010  3.909   1.00 0.00 ? 6  GLN A HE21 10 
ATOM 3521 H HE22 . GLN A 1 6  ? 13.718  7.063  5.651   1.00 0.00 ? 6  GLN A HE22 10 
ATOM 3522 N N    . LEU A 1 7  ? 16.058  3.505  0.259   1.00 0.00 ? 7  LEU A N    10 
ATOM 3523 C CA   . LEU A 1 7  ? 15.222  3.318  -0.950  1.00 0.00 ? 7  LEU A CA   10 
ATOM 3524 C C    . LEU A 1 7  ? 14.929  1.831  -1.230  1.00 0.00 ? 7  LEU A C    10 
ATOM 3525 O O    . LEU A 1 7  ? 13.760  1.501  -1.272  1.00 0.00 ? 7  LEU A O    10 
ATOM 3526 C CB   . LEU A 1 7  ? 15.778  4.062  -2.169  1.00 0.00 ? 7  LEU A CB   10 
ATOM 3527 C CG   . LEU A 1 7  ? 16.051  5.542  -1.883  1.00 0.00 ? 7  LEU A CG   10 
ATOM 3528 C CD1  . LEU A 1 7  ? 16.600  6.229  -3.129  1.00 0.00 ? 7  LEU A CD1  10 
ATOM 3529 C CD2  . LEU A 1 7  ? 14.827  6.330  -1.419  1.00 0.00 ? 7  LEU A CD2  10 
ATOM 3530 H H    . LEU A 1 7  ? 16.847  4.094  0.125   1.00 0.00 ? 7  LEU A H    10 
ATOM 3531 N N    . GLU A 1 8  ? 15.887  0.950  -0.919  1.00 0.00 ? 8  GLU A N    10 
ATOM 3532 C CA   . GLU A 1 8  ? 15.670  -0.517 -0.950  1.00 0.00 ? 8  GLU A CA   10 
ATOM 3533 C C    . GLU A 1 8  ? 14.496  -1.018 -0.069  1.00 0.00 ? 8  GLU A C    10 
ATOM 3534 O O    . GLU A 1 8  ? 13.544  -1.627 -0.575  1.00 0.00 ? 8  GLU A O    10 
ATOM 3535 C CB   . GLU A 1 8  ? 16.999  -1.198 -0.619  1.00 0.00 ? 8  GLU A CB   10 
ATOM 3536 C CG   . GLU A 1 8  ? 16.894  -2.720 -0.481  1.00 0.00 ? 8  GLU A CG   10 
ATOM 3537 C CD   . GLU A 1 8  ? 18.015  -3.508 -1.178  1.00 0.00 ? 8  GLU A CD   10 
ATOM 3538 O OE1  . GLU A 1 8  ? 17.838  -4.653 -1.572  1.00 0.00 ? 8  GLU A OE1  10 
ATOM 3539 O OE2  . GLU A 1 8  ? 19.204  -2.913 -1.345  1.00 0.00 ? 8  GLU A OE2  10 
ATOM 3540 H H    . GLU A 1 8  ? 16.811  1.231  -0.653  1.00 0.00 ? 8  GLU A H    10 
ATOM 3541 H HE2  . GLU A 1 8  ? 19.739  -3.607 -1.819  1.00 0.00 ? 8  GLU A HE2  10 
ATOM 3542 N N    . ASP A 1 9  ? 14.498  -0.618 1.203   1.00 0.00 ? 9  ASP A N    10 
ATOM 3543 C CA   . ASP A 1 9  ? 13.446  -0.973 2.188   1.00 0.00 ? 9  ASP A CA   10 
ATOM 3544 C C    . ASP A 1 9  ? 12.133  -0.183 2.036   1.00 0.00 ? 9  ASP A C    10 
ATOM 3545 O O    . ASP A 1 9  ? 11.054  -0.692 2.338   1.00 0.00 ? 9  ASP A O    10 
ATOM 3546 C CB   . ASP A 1 9  ? 13.972  -0.916 3.635   1.00 0.00 ? 9  ASP A CB   10 
ATOM 3547 C CG   . ASP A 1 9  ? 14.936  0.232  3.923   1.00 0.00 ? 9  ASP A CG   10 
ATOM 3548 O OD1  . ASP A 1 9  ? 14.576  1.339  4.318   1.00 0.00 ? 9  ASP A OD1  10 
ATOM 3549 O OD2  . ASP A 1 9  ? 16.211  -0.027 3.565   1.00 0.00 ? 9  ASP A OD2  10 
ATOM 3550 H H    . ASP A 1 9  ? 15.174  0.049  1.517   1.00 0.00 ? 9  ASP A H    10 
ATOM 3551 H HD2  . ASP A 1 9  ? 16.759  0.785  3.780   1.00 0.00 ? 9  ASP A HD2  10 
ATOM 3552 N N    . LYS A 1 10 ? 12.245  0.983  1.421   1.00 0.00 ? 10 LYS A N    10 
ATOM 3553 C CA   . LYS A 1 10 ? 11.121  1.877  1.059   1.00 0.00 ? 10 LYS A CA   10 
ATOM 3554 C C    . LYS A 1 10 ? 10.428  1.455  -0.256  1.00 0.00 ? 10 LYS A C    10 
ATOM 3555 O O    . LYS A 1 10 ? 9.207   1.538  -0.345  1.00 0.00 ? 10 LYS A O    10 
ATOM 3556 C CB   . LYS A 1 10 ? 11.728  3.282  1.102   1.00 0.00 ? 10 LYS A CB   10 
ATOM 3557 C CG   . LYS A 1 10 ? 10.973  4.454  0.466   1.00 0.00 ? 10 LYS A CG   10 
ATOM 3558 C CD   . LYS A 1 10 ? 11.224  4.497  -1.044  1.00 0.00 ? 10 LYS A CD   10 
ATOM 3559 C CE   . LYS A 1 10 ? 11.271  5.924  -1.608  1.00 0.00 ? 10 LYS A CE   10 
ATOM 3560 N NZ   . LYS A 1 10 ? 10.020  6.639  -1.363  1.00 0.00 ? 10 LYS A NZ   10 
ATOM 3561 H H    . LYS A 1 10 ? 13.151  1.362  1.206   1.00 0.00 ? 10 LYS A H    10 
ATOM 3562 H HZ1  . LYS A 1 10 ? 9.833   6.657  -0.384  1.00 0.00 ? 10 LYS A HZ1  10 
ATOM 3563 H HZ2  . LYS A 1 10 ? 10.111  7.581  -1.709  1.00 0.00 ? 10 LYS A HZ2  10 
ATOM 3564 H HZ3  . LYS A 1 10 ? 9.273   6.189  -1.851  1.00 0.00 ? 10 LYS A HZ3  10 
ATOM 3565 N N    . VAL A 1 11 ? 11.191  0.885  -1.189  1.00 0.00 ? 11 VAL A N    10 
ATOM 3566 C CA   . VAL A 1 11 ? 10.723  0.360  -2.495  1.00 0.00 ? 11 VAL A CA   10 
ATOM 3567 C C    . VAL A 1 11 ? 9.818   -0.871 -2.314  1.00 0.00 ? 11 VAL A C    10 
ATOM 3568 O O    . VAL A 1 11 ? 8.723   -0.921 -2.872  1.00 0.00 ? 11 VAL A O    10 
ATOM 3569 C CB   . VAL A 1 11 ? 11.914  0.134  -3.452  1.00 0.00 ? 11 VAL A CB   10 
ATOM 3570 C CG1  . VAL A 1 11 ? 11.627  -0.778 -4.650  1.00 0.00 ? 11 VAL A CG1  10 
ATOM 3571 C CG2  . VAL A 1 11 ? 12.367  1.479  -4.020  1.00 0.00 ? 11 VAL A CG2  10 
ATOM 3572 H H    . VAL A 1 11 ? 12.188  0.865  -1.077  1.00 0.00 ? 11 VAL A H    10 
ATOM 3573 N N    . GLU A 1 12 ? 10.254  -1.785 -1.447  1.00 0.00 ? 12 GLU A N    10 
ATOM 3574 C CA   . GLU A 1 12 ? 9.422   -2.943 -1.088  1.00 0.00 ? 12 GLU A CA   10 
ATOM 3575 C C    . GLU A 1 12 ? 8.160   -2.512 -0.311  1.00 0.00 ? 12 GLU A C    10 
ATOM 3576 O O    . GLU A 1 12 ? 7.047   -2.853 -0.713  1.00 0.00 ? 12 GLU A O    10 
ATOM 3577 C CB   . GLU A 1 12 ? 10.236  -4.011 -0.353  1.00 0.00 ? 12 GLU A CB   10 
ATOM 3578 C CG   . GLU A 1 12 ? 9.424   -5.242 0.062   1.00 0.00 ? 12 GLU A CG   10 
ATOM 3579 C CD   . GLU A 1 12 ? 8.538   -5.807 -1.057  1.00 0.00 ? 12 GLU A CD   10 
ATOM 3580 O OE1  . GLU A 1 12 ? 8.977   -6.221 -2.124  1.00 0.00 ? 12 GLU A OE1  10 
ATOM 3581 O OE2  . GLU A 1 12 ? 7.211   -5.785 -0.823  1.00 0.00 ? 12 GLU A OE2  10 
ATOM 3582 H H    . GLU A 1 12 ? 11.164  -1.743 -1.030  1.00 0.00 ? 12 GLU A H    10 
ATOM 3583 H HE2  . GLU A 1 12 ? 6.802   -6.120 -1.669  1.00 0.00 ? 12 GLU A HE2  10 
ATOM 3584 N N    . GLU A 1 13 ? 8.363   -1.565 0.613   1.00 0.00 ? 13 GLU A N    10 
ATOM 3585 C CA   . GLU A 1 13 ? 7.263   -0.999 1.404   1.00 0.00 ? 13 GLU A CA   10 
ATOM 3586 C C    . GLU A 1 13 ? 6.173   -0.334 0.532   1.00 0.00 ? 13 GLU A C    10 
ATOM 3587 O O    . GLU A 1 13 ? 5.001   -0.433 0.893   1.00 0.00 ? 13 GLU A O    10 
ATOM 3588 C CB   . GLU A 1 13 ? 7.802   -0.007 2.440   1.00 0.00 ? 13 GLU A CB   10 
ATOM 3589 C CG   . GLU A 1 13 ? 7.188   -0.282 3.820   1.00 0.00 ? 13 GLU A CG   10 
ATOM 3590 C CD   . GLU A 1 13 ? 7.610   0.728  4.885   1.00 0.00 ? 13 GLU A CD   10 
ATOM 3591 O OE1  . GLU A 1 13 ? 8.439   1.620  4.711   1.00 0.00 ? 13 GLU A OE1  10 
ATOM 3592 O OE2  . GLU A 1 13 ? 6.982   0.631  6.080   1.00 0.00 ? 13 GLU A OE2  10 
ATOM 3593 H H    . GLU A 1 13 ? 9.258   -1.174 0.808   1.00 0.00 ? 13 GLU A H    10 
ATOM 3594 H HE2  . GLU A 1 13 ? 7.393   1.371  6.617   1.00 0.00 ? 13 GLU A HE2  10 
ATOM 3595 N N    . LEU A 1 14 ? 6.520   0.059  -0.690  1.00 0.00 ? 14 LEU A N    10 
ATOM 3596 C CA   . LEU A 1 14 ? 5.568   0.656  -1.648  1.00 0.00 ? 14 LEU A CA   10 
ATOM 3597 C C    . LEU A 1 14 ? 4.442   -0.313 -1.990  1.00 0.00 ? 14 LEU A C    10 
ATOM 3598 O O    . LEU A 1 14 ? 3.296   -0.023 -1.675  1.00 0.00 ? 14 LEU A O    10 
ATOM 3599 C CB   . LEU A 1 14 ? 6.202   1.112  -2.973  1.00 0.00 ? 14 LEU A CB   10 
ATOM 3600 C CG   . LEU A 1 14 ? 7.324   2.145  -2.818  1.00 0.00 ? 14 LEU A CG   10 
ATOM 3601 C CD1  . LEU A 1 14 ? 7.846   2.512  -4.197  1.00 0.00 ? 14 LEU A CD1  10 
ATOM 3602 C CD2  . LEU A 1 14 ? 6.913   3.392  -2.025  1.00 0.00 ? 14 LEU A CD2  10 
ATOM 3603 H H    . LEU A 1 14 ? 7.441   -0.091 -1.054  1.00 0.00 ? 14 LEU A H    10 
ATOM 3604 N N    . LEU A 1 15 ? 4.783   -1.480 -2.533  1.00 0.00 ? 15 LEU A N    10 
ATOM 3605 C CA   . LEU A 1 15 ? 3.799   -2.517 -2.916  1.00 0.00 ? 15 LEU A CA   10 
ATOM 3606 C C    . LEU A 1 15 ? 2.975   -2.954 -1.698  1.00 0.00 ? 15 LEU A C    10 
ATOM 3607 O O    . LEU A 1 15 ? 1.756   -2.791 -1.716  1.00 0.00 ? 15 LEU A O    10 
ATOM 3608 C CB   . LEU A 1 15 ? 4.458   -3.749 -3.548  1.00 0.00 ? 15 LEU A CB   10 
ATOM 3609 C CG   . LEU A 1 15 ? 5.553   -3.438 -4.573  1.00 0.00 ? 15 LEU A CG   10 
ATOM 3610 C CD1  . LEU A 1 15 ? 5.982   -4.746 -5.239  1.00 0.00 ? 15 LEU A CD1  10 
ATOM 3611 C CD2  . LEU A 1 15 ? 5.155   -2.422 -5.663  1.00 0.00 ? 15 LEU A CD2  10 
ATOM 3612 H H    . LEU A 1 15 ? 5.729   -1.669 -2.814  1.00 0.00 ? 15 LEU A H    10 
ATOM 3613 N N    . SER A 1 16 ? 3.658   -3.279 -0.613  1.00 0.00 ? 16 SER A N    10 
ATOM 3614 C CA   . SER A 1 16 ? 3.053   -3.608 0.702   1.00 0.00 ? 16 SER A CA   10 
ATOM 3615 C C    . SER A 1 16 ? 2.033   -2.557 1.191   1.00 0.00 ? 16 SER A C    10 
ATOM 3616 O O    . SER A 1 16 ? 0.977   -2.917 1.708   1.00 0.00 ? 16 SER A O    10 
ATOM 3617 C CB   . SER A 1 16 ? 4.161   -3.741 1.750   1.00 0.00 ? 16 SER A CB   10 
ATOM 3618 O OG   . SER A 1 16 ? 5.214   -4.547 1.194   1.00 0.00 ? 16 SER A OG   10 
ATOM 3619 H H    . SER A 1 16 ? 4.650   -3.455 -0.638  1.00 0.00 ? 16 SER A H    10 
ATOM 3620 H HG   . SER A 1 16 ? 5.975   -4.606 1.826   1.00 0.00 ? 16 SER A HG   10 
ATOM 3621 N N    . LYS A 1 17 ? 2.327   -1.287 0.915   1.00 0.00 ? 17 LYS A N    10 
ATOM 3622 C CA   . LYS A 1 17 ? 1.425   -0.150 1.201   1.00 0.00 ? 17 LYS A CA   10 
ATOM 3623 C C    . LYS A 1 17 ? 0.331   0.028  0.152   1.00 0.00 ? 17 LYS A C    10 
ATOM 3624 O O    . LYS A 1 17 ? -0.827  0.125  0.506   1.00 0.00 ? 17 LYS A O    10 
ATOM 3625 C CB   . LYS A 1 17 ? 2.168   1.181  1.351   1.00 0.00 ? 17 LYS A CB   10 
ATOM 3626 C CG   . LYS A 1 17 ? 3.045   1.199  2.602   1.00 0.00 ? 17 LYS A CG   10 
ATOM 3627 C CD   . LYS A 1 17 ? 3.612   2.593  2.868   1.00 0.00 ? 17 LYS A CD   10 
ATOM 3628 C CE   . LYS A 1 17 ? 4.764   2.559  3.873   1.00 0.00 ? 17 LYS A CE   10 
ATOM 3629 N NZ   . LYS A 1 17 ? 4.415   1.785  5.068   1.00 0.00 ? 17 LYS A NZ   10 
ATOM 3630 H H    . LYS A 1 17 ? 3.216   -1.031 0.515   1.00 0.00 ? 17 LYS A H    10 
ATOM 3631 H HZ1  . LYS A 1 17 ? 4.126   0.867  4.791   1.00 0.00 ? 17 LYS A HZ1  10 
ATOM 3632 H HZ2  . LYS A 1 17 ? 5.221   1.695  5.664   1.00 0.00 ? 17 LYS A HZ2  10 
ATOM 3633 H HZ3  . LYS A 1 17 ? 3.683   2.234  5.575   1.00 0.00 ? 17 LYS A HZ3  10 
ATOM 3634 N N    . ASN A 1 18 ? 0.692   0.034  -1.131  1.00 0.00 ? 18 ASN A N    10 
ATOM 3635 C CA   . ASN A 1 18 ? -0.252  0.169  -2.257  1.00 0.00 ? 18 ASN A CA   10 
ATOM 3636 C C    . ASN A 1 18 ? -1.318  -0.945 -2.279  1.00 0.00 ? 18 ASN A C    10 
ATOM 3637 O O    . ASN A 1 18 ? -2.509  -0.654 -2.328  1.00 0.00 ? 18 ASN A O    10 
ATOM 3638 C CB   . ASN A 1 18 ? 0.523   0.224  -3.574  1.00 0.00 ? 18 ASN A CB   10 
ATOM 3639 C CG   . ASN A 1 18 ? -0.282  1.007  -4.619  1.00 0.00 ? 18 ASN A CG   10 
ATOM 3640 O OD1  . ASN A 1 18 ? -0.654  0.505  -5.669  1.00 0.00 ? 18 ASN A OD1  10 
ATOM 3641 N ND2  . ASN A 1 18 ? -0.580  2.254  -4.322  1.00 0.00 ? 18 ASN A ND2  10 
ATOM 3642 H H    . ASN A 1 18 ? 1.672   -0.001 -1.391  1.00 0.00 ? 18 ASN A H    10 
ATOM 3643 H HD21 . ASN A 1 18 ? -0.345  2.633  -3.441  1.00 0.00 ? 18 ASN A HD21 10 
ATOM 3644 H HD22 . ASN A 1 18 ? -1.099  2.761  -5.003  1.00 0.00 ? 18 ASN A HD22 10 
ATOM 3645 N N    . TYR A 1 19 ? -0.864  -2.175 -2.011  1.00 0.00 ? 19 TYR A N    10 
ATOM 3646 C CA   . TYR A 1 19 ? -1.740  -3.346 -1.796  1.00 0.00 ? 19 TYR A CA   10 
ATOM 3647 C C    . TYR A 1 19 ? -2.719  -3.129 -0.617  1.00 0.00 ? 19 TYR A C    10 
ATOM 3648 O O    . TYR A 1 19 ? -3.929  -3.163 -0.809  1.00 0.00 ? 19 TYR A O    10 
ATOM 3649 C CB   . TYR A 1 19 ? -0.914  -4.614 -1.604  1.00 0.00 ? 19 TYR A CB   10 
ATOM 3650 C CG   . TYR A 1 19 ? -0.285  -5.158 -2.902  1.00 0.00 ? 19 TYR A CG   10 
ATOM 3651 C CD1  . TYR A 1 19 ? -1.070  -5.278 -4.060  1.00 0.00 ? 19 TYR A CD1  10 
ATOM 3652 C CD2  . TYR A 1 19 ? 1.063   -5.609 -2.875  1.00 0.00 ? 19 TYR A CD2  10 
ATOM 3653 C CE1  . TYR A 1 19 ? -0.521  -5.852 -5.221  1.00 0.00 ? 19 TYR A CE1  10 
ATOM 3654 C CE2  . TYR A 1 19 ? 1.623   -6.184 -4.036  1.00 0.00 ? 19 TYR A CE2  10 
ATOM 3655 C CZ   . TYR A 1 19 ? 0.818   -6.293 -5.197  1.00 0.00 ? 19 TYR A CZ   10 
ATOM 3656 O OH   . TYR A 1 19 ? 1.353   -6.830 -6.329  1.00 0.00 ? 19 TYR A OH   10 
ATOM 3657 H H    . TYR A 1 19 ? 0.123   -2.365 -1.973  1.00 0.00 ? 19 TYR A H    10 
ATOM 3658 H HH   . TYR A 1 19 ? 2.306   -7.090 -6.162  1.00 0.00 ? 19 TYR A HH   10 
ATOM 3659 N N    . HIS A 1 20 ? -2.179  -2.604 0.489   1.00 0.00 ? 20 HIS A N    10 
ATOM 3660 C CA   . HIS A 1 20 ? -2.950  -2.206 1.686   1.00 0.00 ? 20 HIS A CA   10 
ATOM 3661 C C    . HIS A 1 20 ? -3.921  -1.024 1.421   1.00 0.00 ? 20 HIS A C    10 
ATOM 3662 O O    . HIS A 1 20 ? -5.035  -0.972 1.959   1.00 0.00 ? 20 HIS A O    10 
ATOM 3663 C CB   . HIS A 1 20 ? -1.900  -1.977 2.789   1.00 0.00 ? 20 HIS A CB   10 
ATOM 3664 C CG   . HIS A 1 20 ? -2.119  -0.822 3.769   1.00 0.00 ? 20 HIS A CG   10 
ATOM 3665 N ND1  . HIS A 1 20 ? -2.478  -0.923 5.042   1.00 0.00 ? 20 HIS A ND1  10 
ATOM 3666 C CD2  . HIS A 1 20 ? -2.016  0.469  3.476   1.00 0.00 ? 20 HIS A CD2  10 
ATOM 3667 C CE1  . HIS A 1 20 ? -2.648  0.303  5.533   1.00 0.00 ? 20 HIS A CE1  10 
ATOM 3668 N NE2  . HIS A 1 20 ? -2.373  1.163  4.553   1.00 0.00 ? 20 HIS A NE2  10 
ATOM 3669 H H    . HIS A 1 20 ? -1.200  -2.403 0.551   1.00 0.00 ? 20 HIS A H    10 
ATOM 3670 H HD1  . HIS A 1 20 ? -2.512  -1.762 5.577   1.00 0.00 ? 20 HIS A HD1  10 
ATOM 3671 H HE2  . HIS A 1 20 ? -2.536  2.149  4.577   1.00 0.00 ? 20 HIS A HE2  10 
ATOM 3672 N N    . LEU A 1 21 ? -3.512  -0.118 0.546   1.00 0.00 ? 21 LEU A N    10 
ATOM 3673 C CA   . LEU A 1 21 ? -4.255  1.087  0.116   1.00 0.00 ? 21 LEU A CA   10 
ATOM 3674 C C    . LEU A 1 21 ? -5.473  0.721  -0.730  1.00 0.00 ? 21 LEU A C    10 
ATOM 3675 O O    . LEU A 1 21 ? -6.579  1.206  -0.470  1.00 0.00 ? 21 LEU A O    10 
ATOM 3676 C CB   . LEU A 1 21 ? -3.277  2.015  -0.633  1.00 0.00 ? 21 LEU A CB   10 
ATOM 3677 C CG   . LEU A 1 21 ? -3.945  3.127  -1.453  1.00 0.00 ? 21 LEU A CG   10 
ATOM 3678 C CD1  . LEU A 1 21 ? -4.593  4.209  -0.581  1.00 0.00 ? 21 LEU A CD1  10 
ATOM 3679 C CD2  . LEU A 1 21 ? -2.933  3.731  -2.430  1.00 0.00 ? 21 LEU A CD2  10 
ATOM 3680 H H    . LEU A 1 21 ? -2.586  -0.179 0.161   1.00 0.00 ? 21 LEU A H    10 
ATOM 3681 N N    . GLU A 1 22 ? -5.262  -0.177 -1.688  1.00 0.00 ? 22 GLU A N    10 
ATOM 3682 C CA   . GLU A 1 22 ? -6.360  -0.723 -2.508  1.00 0.00 ? 22 GLU A CA   10 
ATOM 3683 C C    . GLU A 1 22 ? -7.473  -1.399 -1.684  1.00 0.00 ? 22 GLU A C    10 
ATOM 3684 O O    . GLU A 1 22 ? -8.657  -1.170 -1.928  1.00 0.00 ? 22 GLU A O    10 
ATOM 3685 C CB   . GLU A 1 22 ? -5.844  -1.649 -3.616  1.00 0.00 ? 22 GLU A CB   10 
ATOM 3686 C CG   . GLU A 1 22 ? -5.888  -0.942 -4.973  1.00 0.00 ? 22 GLU A CG   10 
ATOM 3687 C CD   . GLU A 1 22 ? -7.289  -0.395 -5.309  1.00 0.00 ? 22 GLU A CD   10 
ATOM 3688 O OE1  . GLU A 1 22 ? -7.454  0.742  -5.749  1.00 0.00 ? 22 GLU A OE1  10 
ATOM 3689 O OE2  . GLU A 1 22 ? -8.343  -1.184 -5.053  1.00 0.00 ? 22 GLU A OE2  10 
ATOM 3690 H H    . GLU A 1 22 ? -4.333  -0.495 -1.938  1.00 0.00 ? 22 GLU A H    10 
ATOM 3691 H HE2  . GLU A 1 22 ? -9.138  -0.596 -5.199  1.00 0.00 ? 22 GLU A HE2  10 
ATOM 3692 N N    . ASN A 1 23 ? -7.055  -1.960 -0.550  1.00 0.00 ? 23 ASN A N    10 
ATOM 3693 C CA   . ASN A 1 23 ? -7.972  -2.554 0.455   1.00 0.00 ? 23 ASN A CA   10 
ATOM 3694 C C    . ASN A 1 23 ? -8.877  -1.486 1.076   1.00 0.00 ? 23 ASN A C    10 
ATOM 3695 O O    . ASN A 1 23 ? -10.104 -1.646 1.128   1.00 0.00 ? 23 ASN A O    10 
ATOM 3696 C CB   . ASN A 1 23 ? -7.192  -3.241 1.580   1.00 0.00 ? 23 ASN A CB   10 
ATOM 3697 C CG   . ASN A 1 23 ? -6.213  -4.333 1.117   1.00 0.00 ? 23 ASN A CG   10 
ATOM 3698 O OD1  . ASN A 1 23 ? -6.123  -4.741 -0.029  1.00 0.00 ? 23 ASN A OD1  10 
ATOM 3699 N ND2  . ASN A 1 23 ? -5.457  -4.851 2.063   1.00 0.00 ? 23 ASN A ND2  10 
ATOM 3700 H H    . ASN A 1 23 ? -6.078  -2.082 -0.352  1.00 0.00 ? 23 ASN A H    10 
ATOM 3701 H HD21 . ASN A 1 23 ? -5.568  -4.593 3.016   1.00 0.00 ? 23 ASN A HD21 10 
ATOM 3702 H HD22 . ASN A 1 23 ? -4.804  -5.533 1.758   1.00 0.00 ? 23 ASN A HD22 10 
ATOM 3703 N N    . GLU A 1 24 ? -8.269  -0.352 1.452   1.00 0.00 ? 24 GLU A N    10 
ATOM 3704 C CA   . GLU A 1 24 ? -9.003  0.792  2.014   1.00 0.00 ? 24 GLU A CA   10 
ATOM 3705 C C    . GLU A 1 24 ? -10.029 1.372  1.041   1.00 0.00 ? 24 GLU A C    10 
ATOM 3706 O O    . GLU A 1 24 ? -11.207 1.359  1.372   1.00 0.00 ? 24 GLU A O    10 
ATOM 3707 C CB   . GLU A 1 24 ? -8.026  1.879  2.497   1.00 0.00 ? 24 GLU A CB   10 
ATOM 3708 C CG   . GLU A 1 24 ? -8.341  2.271  3.939   1.00 0.00 ? 24 GLU A CG   10 
ATOM 3709 C CD   . GLU A 1 24 ? -8.170  1.085  4.895   1.00 0.00 ? 24 GLU A CD   10 
ATOM 3710 O OE1  . GLU A 1 24 ? -7.089  0.524  5.068   1.00 0.00 ? 24 GLU A OE1  10 
ATOM 3711 O OE2  . GLU A 1 24 ? -9.287  0.622  5.493   1.00 0.00 ? 24 GLU A OE2  10 
ATOM 3712 H H    . GLU A 1 24 ? -7.280  -0.241 1.378   1.00 0.00 ? 24 GLU A H    10 
ATOM 3713 H HE2  . GLU A 1 24 ? -8.954  -0.152 6.026   1.00 0.00 ? 24 GLU A HE2  10 
ATOM 3714 N N    . VAL A 1 25 ? -9.602  1.647  -0.191  1.00 0.00 ? 25 VAL A N    10 
ATOM 3715 C CA   . VAL A 1 25 ? -10.466 2.049  -1.335  1.00 0.00 ? 25 VAL A CA   10 
ATOM 3716 C C    . VAL A 1 25 ? -11.741 1.185  -1.428  1.00 0.00 ? 25 VAL A C    10 
ATOM 3717 O O    . VAL A 1 25 ? -12.827 1.742  -1.542  1.00 0.00 ? 25 VAL A O    10 
ATOM 3718 C CB   . VAL A 1 25 ? -9.665  2.058  -2.655  1.00 0.00 ? 25 VAL A CB   10 
ATOM 3719 C CG1  . VAL A 1 25 ? -10.516 2.451  -3.863  1.00 0.00 ? 25 VAL A CG1  10 
ATOM 3720 C CG2  . VAL A 1 25 ? -8.483  3.037  -2.583  1.00 0.00 ? 25 VAL A CG2  10 
ATOM 3721 H H    . VAL A 1 25 ? -8.626  1.724  -0.381  1.00 0.00 ? 25 VAL A H    10 
ATOM 3722 N N    . ALA A 1 26 ? -11.596 -0.119 -1.172  1.00 0.00 ? 26 ALA A N    10 
ATOM 3723 C CA   . ALA A 1 26 ? -12.742 -1.057 -1.112  1.00 0.00 ? 26 ALA A CA   10 
ATOM 3724 C C    . ALA A 1 26 ? -13.683 -0.744 0.060   1.00 0.00 ? 26 ALA A C    10 
ATOM 3725 O O    . ALA A 1 26 ? -14.728 -0.149 -0.179  1.00 0.00 ? 26 ALA A O    10 
ATOM 3726 C CB   . ALA A 1 26 ? -12.237 -2.501 -1.094  1.00 0.00 ? 26 ALA A CB   10 
ATOM 3727 H H    . ALA A 1 26 ? -10.708 -0.513 -0.943  1.00 0.00 ? 26 ALA A H    10 
ATOM 3728 N N    . ARG A 1 27 ? -13.237 -0.949 1.308   1.00 0.00 ? 27 ARG A N    10 
ATOM 3729 C CA   . ARG A 1 27 ? -14.032 -0.620 2.520   1.00 0.00 ? 27 ARG A CA   10 
ATOM 3730 C C    . ARG A 1 27 ? -14.595 0.814  2.526   1.00 0.00 ? 27 ARG A C    10 
ATOM 3731 O O    . ARG A 1 27 ? -15.751 1.042  2.895   1.00 0.00 ? 27 ARG A O    10 
ATOM 3732 C CB   . ARG A 1 27 ? -13.191 -0.927 3.766   1.00 0.00 ? 27 ARG A CB   10 
ATOM 3733 C CG   . ARG A 1 27 ? -14.009 -0.853 5.049   1.00 0.00 ? 27 ARG A CG   10 
ATOM 3734 C CD   . ARG A 1 27 ? -13.333 -1.604 6.196   1.00 0.00 ? 27 ARG A CD   10 
ATOM 3735 N NE   . ARG A 1 27 ? -14.218 -1.605 7.368   1.00 0.00 ? 27 ARG A NE   10 
ATOM 3736 C CZ   . ARG A 1 27 ? -14.108 -2.406 8.424   1.00 0.00 ? 27 ARG A CZ   10 
ATOM 3737 N NH1  . ARG A 1 27 ? -12.923 -2.753 8.882   1.00 0.00 ? 27 ARG A NH1  10 
ATOM 3738 N NH2  . ARG A 1 27 ? -15.136 -2.541 9.266   1.00 0.00 ? 27 ARG A NH2  10 
ATOM 3739 H H    . ARG A 1 27 ? -12.345 -1.360 1.479   1.00 0.00 ? 27 ARG A H    10 
ATOM 3740 H HE   . ARG A 1 27 ? -14.778 -0.777 7.477   1.00 0.00 ? 27 ARG A HE   10 
ATOM 3741 H HH11 . ARG A 1 27 ? -12.113 -2.400 8.424   1.00 0.00 ? 27 ARG A HH11 10 
ATOM 3742 H HH12 . ARG A 1 27 ? -12.833 -3.357 9.679   1.00 0.00 ? 27 ARG A HH12 10 
ATOM 3743 H HH21 . ARG A 1 27 ? -16.027 -2.165 9.023   1.00 0.00 ? 27 ARG A HH21 10 
ATOM 3744 H HH22 . ARG A 1 27 ? -15.032 -3.106 10.075  1.00 0.00 ? 27 ARG A HH22 10 
ATOM 3745 N N    . LEU A 1 28 ? -13.822 1.735  1.953   1.00 0.00 ? 28 LEU A N    10 
ATOM 3746 C CA   . LEU A 1 28 ? -14.184 3.134  1.670   1.00 0.00 ? 28 LEU A CA   10 
ATOM 3747 C C    . LEU A 1 28 ? -15.367 3.251  0.697   1.00 0.00 ? 28 LEU A C    10 
ATOM 3748 O O    . LEU A 1 28 ? -16.376 3.871  1.012   1.00 0.00 ? 28 LEU A O    10 
ATOM 3749 C CB   . LEU A 1 28 ? -12.925 3.868  1.179   1.00 0.00 ? 28 LEU A CB   10 
ATOM 3750 C CG   . LEU A 1 28 ? -13.184 5.145  0.381   1.00 0.00 ? 28 LEU A CG   10 
ATOM 3751 C CD1  . LEU A 1 28 ? -13.717 6.267  1.273   1.00 0.00 ? 28 LEU A CD1  10 
ATOM 3752 C CD2  . LEU A 1 28 ? -11.908 5.592  -0.332  1.00 0.00 ? 28 LEU A CD2  10 
ATOM 3753 H H    . LEU A 1 28 ? -12.891 1.489  1.669   1.00 0.00 ? 28 LEU A H    10 
ATOM 3754 N N    . LYS A 1 29 ? -15.234 2.673  -0.497  1.00 0.00 ? 29 LYS A N    10 
ATOM 3755 C CA   . LYS A 1 29 ? -16.317 2.684  -1.499  1.00 0.00 ? 29 LYS A CA   10 
ATOM 3756 C C    . LYS A 1 29 ? -17.579 1.932  -1.021  1.00 0.00 ? 29 LYS A C    10 
ATOM 3757 O O    . LYS A 1 29 ? -18.691 2.362  -1.305  1.00 0.00 ? 29 LYS A O    10 
ATOM 3758 C CB   . LYS A 1 29 ? -15.761 2.124  -2.813  1.00 0.00 ? 29 LYS A CB   10 
ATOM 3759 C CG   . LYS A 1 29 ? -16.392 2.854  -4.001  1.00 0.00 ? 29 LYS A CG   10 
ATOM 3760 C CD   . LYS A 1 29 ? -15.360 3.098  -5.097  1.00 0.00 ? 29 LYS A CD   10 
ATOM 3761 C CE   . LYS A 1 29 ? -15.948 3.870  -6.289  1.00 0.00 ? 29 LYS A CE   10 
ATOM 3762 N NZ   . LYS A 1 29 ? -16.328 5.234  -5.893  1.00 0.00 ? 29 LYS A NZ   10 
ATOM 3763 H H    . LYS A 1 29 ? -14.379 2.236  -0.790  1.00 0.00 ? 29 LYS A H    10 
ATOM 3764 H HZ1  . LYS A 1 29 ? -16.984 5.209  -5.143  1.00 0.00 ? 29 LYS A HZ1  10 
ATOM 3765 H HZ2  . LYS A 1 29 ? -15.516 5.752  -5.625  1.00 0.00 ? 29 LYS A HZ2  10 
ATOM 3766 H HZ3  . LYS A 1 29 ? -16.751 5.685  -6.682  1.00 0.00 ? 29 LYS A HZ3  10 
ATOM 3767 N N    . LYS A 1 30 ? -17.381 1.000  -0.091  1.00 0.00 ? 30 LYS A N    10 
ATOM 3768 C CA   . LYS A 1 30 ? -18.459 0.322  0.662   1.00 0.00 ? 30 LYS A CA   10 
ATOM 3769 C C    . LYS A 1 30 ? -19.189 1.243  1.656   1.00 0.00 ? 30 LYS A C    10 
ATOM 3770 O O    . LYS A 1 30 ? -20.355 1.014  1.979   1.00 0.00 ? 30 LYS A O    10 
ATOM 3771 C CB   . LYS A 1 30 ? -17.961 -0.924 1.402   1.00 0.00 ? 30 LYS A CB   10 
ATOM 3772 C CG   . LYS A 1 30 ? -17.919 -2.241 0.602   1.00 0.00 ? 30 LYS A CG   10 
ATOM 3773 C CD   . LYS A 1 30 ? -16.775 -2.352 -0.415  1.00 0.00 ? 30 LYS A CD   10 
ATOM 3774 C CE   . LYS A 1 30 ? -16.474 -3.808 -0.823  1.00 0.00 ? 30 LYS A CE   10 
ATOM 3775 N NZ   . LYS A 1 30 ? -15.298 -4.331 -0.111  1.00 0.00 ? 30 LYS A NZ   10 
ATOM 3776 H H    . LYS A 1 30 ? -16.445 0.696  0.144   1.00 0.00 ? 30 LYS A H    10 
ATOM 3777 H HZ1  . LYS A 1 30 ? -15.439 -4.245 0.874   1.00 0.00 ? 30 LYS A HZ1  10 
ATOM 3778 H HZ2  . LYS A 1 30 ? -15.184 -5.294 -0.341  1.00 0.00 ? 30 LYS A HZ2  10 
ATOM 3779 H HZ3  . LYS A 1 30 ? -14.481 -3.837 -0.392  1.00 0.00 ? 30 LYS A HZ3  10 
ATOM 3780 N N    . LEU A 1 31 ? -18.570 2.358  2.062   1.00 0.00 ? 31 LEU A N    10 
ATOM 3781 C CA   . LEU A 1 31 ? -19.213 3.367  2.945   1.00 0.00 ? 31 LEU A CA   10 
ATOM 3782 C C    . LEU A 1 31 ? -20.373 4.100  2.230   1.00 0.00 ? 31 LEU A C    10 
ATOM 3783 O O    . LEU A 1 31 ? -21.388 4.386  2.865   1.00 0.00 ? 31 LEU A O    10 
ATOM 3784 C CB   . LEU A 1 31 ? -18.214 4.403  3.485   1.00 0.00 ? 31 LEU A CB   10 
ATOM 3785 C CG   . LEU A 1 31 ? -17.048 3.781  4.269   1.00 0.00 ? 31 LEU A CG   10 
ATOM 3786 C CD1  . LEU A 1 31 ? -16.032 4.875  4.632   1.00 0.00 ? 31 LEU A CD1  10 
ATOM 3787 C CD2  . LEU A 1 31 ? -17.489 3.041  5.527   1.00 0.00 ? 31 LEU A CD2  10 
ATOM 3788 H H    . LEU A 1 31 ? -17.633 2.578  1.774   1.00 0.00 ? 31 LEU A H    10 
ATOM 3789 N N    . VAL A 1 32 ? -20.284 4.160  0.901   1.00 0.00 ? 32 VAL A N    10 
ATOM 3790 C CA   . VAL A 1 32 ? -21.354 4.698  0.022   1.00 0.00 ? 32 VAL A CA   10 
ATOM 3791 C C    . VAL A 1 32 ? -22.407 3.620  -0.311  1.00 0.00 ? 32 VAL A C    10 
ATOM 3792 O O    . VAL A 1 32 ? -23.315 3.813  -1.112  1.00 0.00 ? 32 VAL A O    10 
ATOM 3793 C CB   . VAL A 1 32 ? -20.699 5.345  -1.231  1.00 0.00 ? 32 VAL A CB   10 
ATOM 3794 C CG1  . VAL A 1 32 ? -21.693 6.030  -2.170  1.00 0.00 ? 32 VAL A CG1  10 
ATOM 3795 C CG2  . VAL A 1 32 ? -19.652 6.404  -0.844  1.00 0.00 ? 32 VAL A CG2  10 
ATOM 3796 H H    . VAL A 1 32 ? -19.494 3.791  0.403   1.00 0.00 ? 32 VAL A H    10 
ATOM 3797 N N    . GLY A 1 33 ? -22.353 2.499  0.428   1.00 0.00 ? 33 GLY A N    10 
ATOM 3798 C CA   . GLY A 1 33 ? -23.304 1.385  0.345   1.00 0.00 ? 33 GLY A CA   10 
ATOM 3799 C C    . GLY A 1 33 ? -24.363 1.403  1.475   1.00 0.00 ? 33 GLY A C    10 
ATOM 3800 O O    . GLY A 1 33 ? -25.402 0.772  1.349   1.00 0.00 ? 33 GLY A O    10 
ATOM 3801 H H    . GLY A 1 33 ? -21.590 2.345  1.050   1.00 0.00 ? 33 GLY A H    10 
ATOM 3802 N N    . GLU A 1 34 ? -24.034 2.083  2.567   1.00 0.00 ? 34 GLU A N    10 
ATOM 3803 C CA   . GLU A 1 34 ? -24.930 2.204  3.736   1.00 0.00 ? 34 GLU A CA   10 
ATOM 3804 C C    . GLU A 1 34 ? -25.589 3.588  3.836   1.00 0.00 ? 34 GLU A C    10 
ATOM 3805 O O    . GLU A 1 34 ? -26.627 3.821  3.223   1.00 0.00 ? 34 GLU A O    10 
ATOM 3806 C CB   . GLU A 1 34 ? -24.224 1.782  5.034   1.00 0.00 ? 34 GLU A CB   10 
ATOM 3807 C CG   . GLU A 1 34 ? -24.079 0.263  5.148   1.00 0.00 ? 34 GLU A CG   10 
ATOM 3808 C CD   . GLU A 1 34 ? -23.730 -0.124 6.587   1.00 0.00 ? 34 GLU A CD   10 
ATOM 3809 O OE1  . GLU A 1 34 ? -24.454 0.142  7.540   1.00 0.00 ? 34 GLU A OE1  10 
ATOM 3810 O OE2  . GLU A 1 34 ? -22.551 -0.747 6.777   1.00 0.00 ? 34 GLU A OE2  10 
ATOM 3811 H H    . GLU A 1 34 ? -23.191 2.627  2.616   1.00 0.00 ? 34 GLU A H    10 
ATOM 3812 H HE2  . GLU A 1 34 ? -22.540 -0.911 7.762   1.00 0.00 ? 34 GLU A HE2  10 
ATOM 3813 N N    . ARG A 1 35 ? -24.926 4.527  4.523   1.00 0.00 ? 35 ARG A N    10 
ATOM 3814 C CA   . ARG A 1 35 ? -25.404 5.909  4.722   1.00 0.00 ? 35 ARG A CA   10 
ATOM 3815 C C    . ARG A 1 35 ? -25.885 6.619  3.434   1.00 0.00 ? 35 ARG A C    10 
ATOM 3816 O O    . ARG A 1 35 ? -25.023 7.037  2.635   1.00 0.00 ? 35 ARG A O    10 
ATOM 3817 C CB   . ARG A 1 35 ? -24.290 6.724  5.387   1.00 0.00 ? 35 ARG A CB   10 
ATOM 3818 C CG   . ARG A 1 35 ? -24.688 7.312  6.744   1.00 0.00 ? 35 ARG A CG   10 
ATOM 3819 C CD   . ARG A 1 35 ? -25.684 8.471  6.662   1.00 0.00 ? 35 ARG A CD   10 
ATOM 3820 N NE   . ARG A 1 35 ? -25.815 8.980  8.033   1.00 0.00 ? 35 ARG A NE   10 
ATOM 3821 C CZ   . ARG A 1 35 ? -26.862 9.606  8.586   1.00 0.00 ? 35 ARG A CZ   10 
ATOM 3822 N NH1  . ARG A 1 35 ? -27.766 10.255 7.876   1.00 0.00 ? 35 ARG A NH1  10 
ATOM 3823 N NH2  . ARG A 1 35 ? -27.231 9.205  9.792   1.00 0.00 ? 35 ARG A NH2  10 
ATOM 3824 O OXT  . ARG A 1 35 ? -27.129 6.744  3.293   1.00 0.00 ? 35 ARG A OXT  10 
ATOM 3825 H H    . ARG A 1 35 ? -24.091 4.288  5.020   1.00 0.00 ? 35 ARG A H    10 
ATOM 3826 H HE   . ARG A 1 35 ? -24.946 9.066  8.514   1.00 0.00 ? 35 ARG A HE   10 
ATOM 3827 H HH11 . ARG A 1 35 ? -27.604 10.433 6.906   1.00 0.00 ? 35 ARG A HH11 10 
ATOM 3828 H HH12 . ARG A 1 35 ? -28.557 10.660 8.334   1.00 0.00 ? 35 ARG A HH12 10 
ATOM 3829 H HH21 . ARG A 1 35 ? -26.768 8.426  10.210  1.00 0.00 ? 35 ARG A HH21 10 
ATOM 3830 H HH22 . ARG A 1 35 ? -28.021 9.628  10.242  1.00 0.00 ? 35 ARG A HH22 10 
ATOM 3831 N N    . LEU A 1 1  ? 19.859  -0.182 -8.882  1.00 0.00 ? 1  LEU A N    11 
ATOM 3832 C CA   . LEU A 1 1  ? 21.343  -0.247 -8.661  1.00 0.00 ? 1  LEU A CA   11 
ATOM 3833 C C    . LEU A 1 1  ? 21.906  0.738  -7.612  1.00 0.00 ? 1  LEU A C    11 
ATOM 3834 O O    . LEU A 1 1  ? 22.787  0.422  -6.815  1.00 0.00 ? 1  LEU A O    11 
ATOM 3835 C CB   . LEU A 1 1  ? 22.125  -0.231 -9.972  1.00 0.00 ? 1  LEU A CB   11 
ATOM 3836 C CG   . LEU A 1 1  ? 22.216  1.070  -10.823 1.00 0.00 ? 1  LEU A CG   11 
ATOM 3837 C CD1  . LEU A 1 1  ? 20.880  1.738  -11.117 1.00 0.00 ? 1  LEU A CD1  11 
ATOM 3838 C CD2  . LEU A 1 1  ? 23.272  2.041  -10.279 1.00 0.00 ? 1  LEU A CD2  11 
ATOM 3839 H H1   . LEU A 1 1  ? 19.352  -0.387 -8.061  1.00 0.00 ? 1  LEU A H1   11 
ATOM 3840 H H2   . LEU A 1 1  ? 19.607  0.714  -9.257  1.00 0.00 ? 1  LEU A H2   11 
ATOM 3841 H H3   . LEU A 1 1  ? 19.631  -0.874 -9.573  1.00 0.00 ? 1  LEU A H3   11 
ATOM 3842 N N    . GLN A 1 2  ? 21.311  1.917  -7.597  1.00 0.00 ? 2  GLN A N    11 
ATOM 3843 C CA   . GLN A 1 2  ? 21.642  2.978  -6.621  1.00 0.00 ? 2  GLN A CA   11 
ATOM 3844 C C    . GLN A 1 2  ? 20.454  3.198  -5.682  1.00 0.00 ? 2  GLN A C    11 
ATOM 3845 O O    . GLN A 1 2  ? 19.482  3.873  -5.990  1.00 0.00 ? 2  GLN A O    11 
ATOM 3846 C CB   . GLN A 1 2  ? 22.085  4.252  -7.336  1.00 0.00 ? 2  GLN A CB   11 
ATOM 3847 C CG   . GLN A 1 2  ? 22.416  5.350  -6.321  1.00 0.00 ? 2  GLN A CG   11 
ATOM 3848 C CD   . GLN A 1 2  ? 23.320  6.453  -6.845  1.00 0.00 ? 2  GLN A CD   11 
ATOM 3849 O OE1  . GLN A 1 2  ? 24.232  6.905  -6.170  1.00 0.00 ? 2  GLN A OE1  11 
ATOM 3850 N NE2  . GLN A 1 2  ? 23.078  6.937  -8.042  1.00 0.00 ? 2  GLN A NE2  11 
ATOM 3851 H H    . GLN A 1 2  ? 20.643  2.153  -8.283  1.00 0.00 ? 2  GLN A H    11 
ATOM 3852 H HE21 . GLN A 1 2  ? 22.307  6.601  -8.587  1.00 0.00 ? 2  GLN A HE21 11 
ATOM 3853 H HE22 . GLN A 1 2  ? 23.693  7.653  -8.359  1.00 0.00 ? 2  GLN A HE22 11 
ATOM 3854 N N    . ARG A 1 3  ? 20.504  2.346  -4.681  1.00 0.00 ? 3  ARG A N    11 
ATOM 3855 C CA   . ARG A 1 3  ? 19.527  2.416  -3.573  1.00 0.00 ? 3  ARG A CA   11 
ATOM 3856 C C    . ARG A 1 3  ? 20.157  2.642  -2.195  1.00 0.00 ? 3  ARG A C    11 
ATOM 3857 O O    . ARG A 1 3  ? 19.435  2.794  -1.221  1.00 0.00 ? 3  ARG A O    11 
ATOM 3858 C CB   . ARG A 1 3  ? 18.651  1.161  -3.621  1.00 0.00 ? 3  ARG A CB   11 
ATOM 3859 C CG   . ARG A 1 3  ? 19.453  -0.119 -3.403  1.00 0.00 ? 3  ARG A CG   11 
ATOM 3860 C CD   . ARG A 1 3  ? 19.039  -1.140 -4.451  1.00 0.00 ? 3  ARG A CD   11 
ATOM 3861 N NE   . ARG A 1 3  ? 19.978  -1.195 -5.562  1.00 0.00 ? 3  ARG A NE   11 
ATOM 3862 C CZ   . ARG A 1 3  ? 20.958  -2.093 -5.615  1.00 0.00 ? 3  ARG A CZ   11 
ATOM 3863 N NH1  . ARG A 1 3  ? 22.113  -1.895 -4.986  1.00 0.00 ? 3  ARG A NH1  11 
ATOM 3864 N NH2  . ARG A 1 3  ? 20.923  -2.984 -6.587  1.00 0.00 ? 3  ARG A NH2  11 
ATOM 3865 H H    . ARG A 1 3  ? 21.051  1.515  -4.727  1.00 0.00 ? 3  ARG A H    11 
ATOM 3866 H HE   . ARG A 1 3  ? 19.951  -0.458 -6.237  1.00 0.00 ? 3  ARG A HE   11 
ATOM 3867 H HH11 . ARG A 1 3  ? 22.298  -1.040 -4.527  1.00 0.00 ? 3  ARG A HH11 11 
ATOM 3868 H HH12 . ARG A 1 3  ? 22.822  -2.587 -5.054  1.00 0.00 ? 3  ARG A HH12 11 
ATOM 3869 H HH21 . ARG A 1 3  ? 20.091  -3.072 -7.131  1.00 0.00 ? 3  ARG A HH21 11 
ATOM 3870 H HH22 . ARG A 1 3  ? 21.662  -3.645 -6.679  1.00 0.00 ? 3  ARG A HH22 11 
ATOM 3871 N N    . MET A 1 4  ? 21.492  2.561  -2.130  1.00 0.00 ? 4  MET A N    11 
ATOM 3872 C CA   . MET A 1 4  ? 22.280  2.618  -0.873  1.00 0.00 ? 4  MET A CA   11 
ATOM 3873 C C    . MET A 1 4  ? 21.768  1.637  0.206   1.00 0.00 ? 4  MET A C    11 
ATOM 3874 O O    . MET A 1 4  ? 21.847  1.900  1.413   1.00 0.00 ? 4  MET A O    11 
ATOM 3875 C CB   . MET A 1 4  ? 22.331  4.050  -0.325  1.00 0.00 ? 4  MET A CB   11 
ATOM 3876 C CG   . MET A 1 4  ? 23.237  5.013  -1.099  1.00 0.00 ? 4  MET A CG   11 
ATOM 3877 S SD   . MET A 1 4  ? 22.794  5.282  -2.854  1.00 0.00 ? 4  MET A SD   11 
ATOM 3878 C CE   . MET A 1 4  ? 21.178  6.006  -2.704  1.00 0.00 ? 4  MET A CE   11 
ATOM 3879 H H    . MET A 1 4  ? 22.041  2.644  -2.959  1.00 0.00 ? 4  MET A H    11 
ATOM 3880 N N    . LYS A 1 5  ? 21.126  0.567  -0.273  1.00 0.00 ? 5  LYS A N    11 
ATOM 3881 C CA   . LYS A 1 5  ? 20.448  -0.490 0.519   1.00 0.00 ? 5  LYS A CA   11 
ATOM 3882 C C    . LYS A 1 5  ? 19.274  0.029  1.378   1.00 0.00 ? 5  LYS A C    11 
ATOM 3883 O O    . LYS A 1 5  ? 18.603  -0.747 2.057   1.00 0.00 ? 5  LYS A O    11 
ATOM 3884 C CB   . LYS A 1 5  ? 21.452  -1.285 1.378   1.00 0.00 ? 5  LYS A CB   11 
ATOM 3885 C CG   . LYS A 1 5  ? 22.610  -1.869 0.544   1.00 0.00 ? 5  LYS A CG   11 
ATOM 3886 C CD   . LYS A 1 5  ? 23.922  -1.121 0.778   1.00 0.00 ? 5  LYS A CD   11 
ATOM 3887 C CE   . LYS A 1 5  ? 24.854  -1.929 1.680   1.00 0.00 ? 5  LYS A CE   11 
ATOM 3888 N NZ   . LYS A 1 5  ? 26.174  -2.012 1.046   1.00 0.00 ? 5  LYS A NZ   11 
ATOM 3889 H H    . LYS A 1 5  ? 21.033  0.459  -1.260  1.00 0.00 ? 5  LYS A H    11 
ATOM 3890 H HZ1  . LYS A 1 5  ? 26.072  -2.313 0.097   1.00 0.00 ? 5  LYS A HZ1  11 
ATOM 3891 H HZ2  . LYS A 1 5  ? 26.619  -1.122 1.084   1.00 0.00 ? 5  LYS A HZ2  11 
ATOM 3892 H HZ3  . LYS A 1 5  ? 26.743  -2.679 1.534   1.00 0.00 ? 5  LYS A HZ3  11 
ATOM 3893 N N    . GLN A 1 6  ? 18.866  1.265  1.108   1.00 0.00 ? 6  GLN A N    11 
ATOM 3894 C CA   . GLN A 1 6  ? 17.812  2.000  1.855   1.00 0.00 ? 6  GLN A CA   11 
ATOM 3895 C C    . GLN A 1 6  ? 16.623  2.423  0.980   1.00 0.00 ? 6  GLN A C    11 
ATOM 3896 O O    . GLN A 1 6  ? 15.487  2.062  1.269   1.00 0.00 ? 6  GLN A O    11 
ATOM 3897 C CB   . GLN A 1 6  ? 18.434  3.192  2.605   1.00 0.00 ? 6  GLN A CB   11 
ATOM 3898 C CG   . GLN A 1 6  ? 19.229  4.138  1.695   1.00 0.00 ? 6  GLN A CG   11 
ATOM 3899 C CD   . GLN A 1 6  ? 19.951  5.253  2.449   1.00 0.00 ? 6  GLN A CD   11 
ATOM 3900 O OE1  . GLN A 1 6  ? 19.399  6.301  2.721   1.00 0.00 ? 6  GLN A OE1  11 
ATOM 3901 N NE2  . GLN A 1 6  ? 21.220  5.064  2.718   1.00 0.00 ? 6  GLN A NE2  11 
ATOM 3902 H H    . GLN A 1 6  ? 19.343  1.807  0.424   1.00 0.00 ? 6  GLN A H    11 
ATOM 3903 H HE21 . GLN A 1 6  ? 21.694  4.213  2.487   1.00 0.00 ? 6  GLN A HE21 11 
ATOM 3904 H HE22 . GLN A 1 6  ? 21.683  5.812  3.191   1.00 0.00 ? 6  GLN A HE22 11 
ATOM 3905 N N    . LEU A 1 7  ? 16.908  2.986  -0.204  1.00 0.00 ? 7  LEU A N    11 
ATOM 3906 C CA   . LEU A 1 7  ? 15.867  3.273  -1.222  1.00 0.00 ? 7  LEU A CA   11 
ATOM 3907 C C    . LEU A 1 7  ? 15.173  1.971  -1.691  1.00 0.00 ? 7  LEU A C    11 
ATOM 3908 O O    . LEU A 1 7  ? 13.963  1.954  -1.854  1.00 0.00 ? 7  LEU A O    11 
ATOM 3909 C CB   . LEU A 1 7  ? 16.380  4.082  -2.409  1.00 0.00 ? 7  LEU A CB   11 
ATOM 3910 C CG   . LEU A 1 7  ? 17.168  5.345  -2.044  1.00 0.00 ? 7  LEU A CG   11 
ATOM 3911 C CD1  . LEU A 1 7  ? 17.581  6.065  -3.329  1.00 0.00 ? 7  LEU A CD1  11 
ATOM 3912 C CD2  . LEU A 1 7  ? 16.413  6.320  -1.129  1.00 0.00 ? 7  LEU A CD2  11 
ATOM 3913 H H    . LEU A 1 7  ? 17.822  3.325  -0.426  1.00 0.00 ? 7  LEU A H    11 
ATOM 3914 N N    . GLU A 1 8  ? 15.907  0.853  -1.622  1.00 0.00 ? 8  GLU A N    11 
ATOM 3915 C CA   . GLU A 1 8  ? 15.335  -0.503 -1.848  1.00 0.00 ? 8  GLU A CA   11 
ATOM 3916 C C    . GLU A 1 8  ? 14.367  -0.897 -0.712  1.00 0.00 ? 8  GLU A C    11 
ATOM 3917 O O    . GLU A 1 8  ? 13.247  -1.289 -0.991  1.00 0.00 ? 8  GLU A O    11 
ATOM 3918 C CB   . GLU A 1 8  ? 16.418  -1.573 -2.004  1.00 0.00 ? 8  GLU A CB   11 
ATOM 3919 C CG   . GLU A 1 8  ? 15.829  -2.940 -2.372  1.00 0.00 ? 8  GLU A CG   11 
ATOM 3920 C CD   . GLU A 1 8  ? 16.758  -3.802 -3.228  1.00 0.00 ? 8  GLU A CD   11 
ATOM 3921 O OE1  . GLU A 1 8  ? 16.967  -3.561 -4.413  1.00 0.00 ? 8  GLU A OE1  11 
ATOM 3922 O OE2  . GLU A 1 8  ? 17.279  -4.898 -2.657  1.00 0.00 ? 8  GLU A OE2  11 
ATOM 3923 H H    . GLU A 1 8  ? 16.869  0.881  -1.384  1.00 0.00 ? 8  GLU A H    11 
ATOM 3924 H HE2  . GLU A 1 8  ? 17.774  -5.343 -3.402  1.00 0.00 ? 8  GLU A HE2  11 
ATOM 3925 N N    . ASP A 1 9  ? 14.796  -0.668 0.525   1.00 0.00 ? 9  ASP A N    11 
ATOM 3926 C CA   . ASP A 1 9  ? 13.975  -0.972 1.726   1.00 0.00 ? 9  ASP A CA   11 
ATOM 3927 C C    . ASP A 1 9  ? 12.666  -0.162 1.746   1.00 0.00 ? 9  ASP A C    11 
ATOM 3928 O O    . ASP A 1 9  ? 11.604  -0.709 2.020   1.00 0.00 ? 9  ASP A O    11 
ATOM 3929 C CB   . ASP A 1 9  ? 14.787  -0.750 3.004   1.00 0.00 ? 9  ASP A CB   11 
ATOM 3930 C CG   . ASP A 1 9  ? 15.359  -2.074 3.535   1.00 0.00 ? 9  ASP A CG   11 
ATOM 3931 O OD1  . ASP A 1 9  ? 14.723  -2.809 4.286   1.00 0.00 ? 9  ASP A OD1  11 
ATOM 3932 O OD2  . ASP A 1 9  ? 16.591  -2.420 3.135   1.00 0.00 ? 9  ASP A OD2  11 
ATOM 3933 H H    . ASP A 1 9  ? 15.615  -0.125 0.724   1.00 0.00 ? 9  ASP A H    11 
ATOM 3934 H HD2  . ASP A 1 9  ? 16.796  -3.239 3.665   1.00 0.00 ? 9  ASP A HD2  11 
ATOM 3935 N N    . LYS A 1 10 ? 12.750  1.080  1.271   1.00 0.00 ? 10 LYS A N    11 
ATOM 3936 C CA   . LYS A 1 10 ? 11.540  1.931  1.132   1.00 0.00 ? 10 LYS A CA   11 
ATOM 3937 C C    . LYS A 1 10 ? 10.644  1.549  -0.068  1.00 0.00 ? 10 LYS A C    11 
ATOM 3938 O O    . LYS A 1 10 ? 9.438   1.738  -0.008  1.00 0.00 ? 10 LYS A O    11 
ATOM 3939 C CB   . LYS A 1 10 ? 11.837  3.427  1.246   1.00 0.00 ? 10 LYS A CB   11 
ATOM 3940 C CG   . LYS A 1 10 ? 12.518  4.157  0.080   1.00 0.00 ? 10 LYS A CG   11 
ATOM 3941 C CD   . LYS A 1 10 ? 11.593  4.376  -1.128  1.00 0.00 ? 10 LYS A CD   11 
ATOM 3942 C CE   . LYS A 1 10 ? 11.751  5.744  -1.775  1.00 0.00 ? 10 LYS A CE   11 
ATOM 3943 N NZ   . LYS A 1 10 ? 11.218  6.761  -0.851  1.00 0.00 ? 10 LYS A NZ   11 
ATOM 3944 H H    . LYS A 1 10 ? 13.619  1.513  1.044   1.00 0.00 ? 10 LYS A H    11 
ATOM 3945 H HZ1  . LYS A 1 10 ? 10.253  6.571  -0.657  1.00 0.00 ? 10 LYS A HZ1  11 
ATOM 3946 H HZ2  . LYS A 1 10 ? 11.747  6.737  0.002   1.00 0.00 ? 10 LYS A HZ2  11 
ATOM 3947 H HZ3  . LYS A 1 10 ? 11.306  7.667  -1.268  1.00 0.00 ? 10 LYS A HZ3  11 
ATOM 3948 N N    . VAL A 1 11 ? 11.250  0.993  -1.123  1.00 0.00 ? 11 VAL A N    11 
ATOM 3949 C CA   . VAL A 1 11 ? 10.507  0.534  -2.327  1.00 0.00 ? 11 VAL A CA   11 
ATOM 3950 C C    . VAL A 1 11 ? 9.434   -0.517 -1.959  1.00 0.00 ? 11 VAL A C    11 
ATOM 3951 O O    . VAL A 1 11 ? 8.278   -0.365 -2.316  1.00 0.00 ? 11 VAL A O    11 
ATOM 3952 C CB   . VAL A 1 11 ? 11.496  0.062  -3.426  1.00 0.00 ? 11 VAL A CB   11 
ATOM 3953 C CG1  . VAL A 1 11 ? 10.881  -0.838 -4.507  1.00 0.00 ? 11 VAL A CG1  11 
ATOM 3954 C CG2  . VAL A 1 11 ? 12.075  1.289  -4.137  1.00 0.00 ? 11 VAL A CG2  11 
ATOM 3955 H H    . VAL A 1 11 ? 12.237  0.911  -1.182  1.00 0.00 ? 11 VAL A H    11 
ATOM 3956 N N    . GLU A 1 12 ? 9.814   -1.488 -1.125  1.00 0.00 ? 12 GLU A N    11 
ATOM 3957 C CA   . GLU A 1 12 ? 8.850   -2.510 -0.649  1.00 0.00 ? 12 GLU A CA   11 
ATOM 3958 C C    . GLU A 1 12 ? 7.795   -1.913 0.307   1.00 0.00 ? 12 GLU A C    11 
ATOM 3959 O O    . GLU A 1 12 ? 6.622   -2.249 0.206   1.00 0.00 ? 12 GLU A O    11 
ATOM 3960 C CB   . GLU A 1 12 ? 9.499   -3.716 0.020   1.00 0.00 ? 12 GLU A CB   11 
ATOM 3961 C CG   . GLU A 1 12 ? 10.515  -4.454 -0.861  1.00 0.00 ? 12 GLU A CG   11 
ATOM 3962 C CD   . GLU A 1 12 ? 11.941  -3.980 -0.603  1.00 0.00 ? 12 GLU A CD   11 
ATOM 3963 O OE1  . GLU A 1 12 ? 12.292  -3.408 0.427   1.00 0.00 ? 12 GLU A OE1  11 
ATOM 3964 O OE2  . GLU A 1 12 ? 12.858  -4.234 -1.559  1.00 0.00 ? 12 GLU A OE2  11 
ATOM 3965 H H    . GLU A 1 12 ? 10.760  -1.568 -0.792  1.00 0.00 ? 12 GLU A H    11 
ATOM 3966 H HE2  . GLU A 1 12 ? 13.688  -3.846 -1.167  1.00 0.00 ? 12 GLU A HE2  11 
ATOM 3967 N N    . GLU A 1 13 ? 8.223   -0.917 1.090   1.00 0.00 ? 13 GLU A N    11 
ATOM 3968 C CA   . GLU A 1 13 ? 7.338   -0.161 2.001   1.00 0.00 ? 13 GLU A CA   11 
ATOM 3969 C C    . GLU A 1 13 ? 6.198   0.548  1.239   1.00 0.00 ? 13 GLU A C    11 
ATOM 3970 O O    . GLU A 1 13 ? 5.102   0.688  1.776   1.00 0.00 ? 13 GLU A O    11 
ATOM 3971 C CB   . GLU A 1 13 ? 8.151   0.862  2.795   1.00 0.00 ? 13 GLU A CB   11 
ATOM 3972 C CG   . GLU A 1 13 ? 7.467   1.202  4.128   1.00 0.00 ? 13 GLU A CG   11 
ATOM 3973 C CD   . GLU A 1 13 ? 8.086   2.424  4.811   1.00 0.00 ? 13 GLU A CD   11 
ATOM 3974 O OE1  . GLU A 1 13 ? 9.290   2.567  5.016   1.00 0.00 ? 13 GLU A OE1  11 
ATOM 3975 O OE2  . GLU A 1 13 ? 7.204   3.367  5.211   1.00 0.00 ? 13 GLU A OE2  11 
ATOM 3976 H H    . GLU A 1 13 ? 9.178   -0.623 1.105   1.00 0.00 ? 13 GLU A H    11 
ATOM 3977 H HE2  . GLU A 1 13 ? 7.787   4.077  5.621   1.00 0.00 ? 13 GLU A HE2  11 
ATOM 3978 N N    . LEU A 1 14 ? 6.422   0.823  -0.050  1.00 0.00 ? 14 LEU A N    11 
ATOM 3979 C CA   . LEU A 1 14 ? 5.386   1.386  -0.949  1.00 0.00 ? 14 LEU A CA   11 
ATOM 3980 C C    . LEU A 1 14 ? 4.253   0.372  -1.117  1.00 0.00 ? 14 LEU A C    11 
ATOM 3981 O O    . LEU A 1 14 ? 3.213   0.595  -0.530  1.00 0.00 ? 14 LEU A O    11 
ATOM 3982 C CB   . LEU A 1 14 ? 5.908   1.805  -2.323  1.00 0.00 ? 14 LEU A CB   11 
ATOM 3983 C CG   . LEU A 1 14 ? 7.116   2.760  -2.284  1.00 0.00 ? 14 LEU A CG   11 
ATOM 3984 C CD1  . LEU A 1 14 ? 7.467   3.135  -3.721  1.00 0.00 ? 14 LEU A CD1  11 
ATOM 3985 C CD2  . LEU A 1 14 ? 6.886   4.016  -1.436  1.00 0.00 ? 14 LEU A CD2  11 
ATOM 3986 H H    . LEU A 1 14 ? 7.306   0.642  -0.481  1.00 0.00 ? 14 LEU A H    11 
ATOM 3987 N N    . LEU A 1 15 ? 4.538   -0.780 -1.716  1.00 0.00 ? 15 LEU A N    11 
ATOM 3988 C CA   . LEU A 1 15 ? 3.521   -1.843 -1.942  1.00 0.00 ? 15 LEU A CA   11 
ATOM 3989 C C    . LEU A 1 15 ? 2.843   -2.269 -0.623  1.00 0.00 ? 15 LEU A C    11 
ATOM 3990 O O    . LEU A 1 15 ? 1.633   -2.119 -0.524  1.00 0.00 ? 15 LEU A O    11 
ATOM 3991 C CB   . LEU A 1 15 ? 4.102   -3.088 -2.616  1.00 0.00 ? 15 LEU A CB   11 
ATOM 3992 C CG   . LEU A 1 15 ? 5.095   -2.803 -3.758  1.00 0.00 ? 15 LEU A CG   11 
ATOM 3993 C CD1  . LEU A 1 15 ? 5.493   -4.122 -4.399  1.00 0.00 ? 15 LEU A CD1  11 
ATOM 3994 C CD2  . LEU A 1 15 ? 4.560   -1.844 -4.827  1.00 0.00 ? 15 LEU A CD2  11 
ATOM 3995 H H    . LEU A 1 15 ? 5.415   -0.946 -2.153  1.00 0.00 ? 15 LEU A H    11 
ATOM 3996 N N    . SER A 1 16 ? 3.636   -2.461 0.428   1.00 0.00 ? 16 SER A N    11 
ATOM 3997 C CA   . SER A 1 16 ? 3.136   -2.766 1.789   1.00 0.00 ? 16 SER A CA   11 
ATOM 3998 C C    . SER A 1 16 ? 2.020   -1.815 2.289   1.00 0.00 ? 16 SER A C    11 
ATOM 3999 O O    . SER A 1 16 ? 1.098   -2.242 2.975   1.00 0.00 ? 16 SER A O    11 
ATOM 4000 C CB   . SER A 1 16 ? 4.323   -2.735 2.758   1.00 0.00 ? 16 SER A CB   11 
ATOM 4001 O OG   . SER A 1 16 ? 4.055   -3.563 3.889   1.00 0.00 ? 16 SER A OG   11 
ATOM 4002 H H    . SER A 1 16 ? 4.632   -2.487 0.317   1.00 0.00 ? 16 SER A H    11 
ATOM 4003 H HG   . SER A 1 16 ? 4.819   -3.532 4.524   1.00 0.00 ? 16 SER A HG   11 
ATOM 4004 N N    . LYS A 1 17 ? 2.065   -0.576 1.802   1.00 0.00 ? 17 LYS A N    11 
ATOM 4005 C CA   . LYS A 1 17 ? 1.052   0.484  2.017   1.00 0.00 ? 17 LYS A CA   11 
ATOM 4006 C C    . LYS A 1 17 ? 0.092   0.682  0.813   1.00 0.00 ? 17 LYS A C    11 
ATOM 4007 O O    . LYS A 1 17 ? -1.102  0.563  0.968   1.00 0.00 ? 17 LYS A O    11 
ATOM 4008 C CB   . LYS A 1 17 ? 1.777   1.789  2.372   1.00 0.00 ? 17 LYS A CB   11 
ATOM 4009 C CG   . LYS A 1 17 ? 2.405   1.730  3.772   1.00 0.00 ? 17 LYS A CG   11 
ATOM 4010 C CD   . LYS A 1 17 ? 1.356   2.007  4.850   1.00 0.00 ? 17 LYS A CD   11 
ATOM 4011 C CE   . LYS A 1 17 ? 1.616   1.279  6.171   1.00 0.00 ? 17 LYS A CE   11 
ATOM 4012 N NZ   . LYS A 1 17 ? 2.801   1.752  6.892   1.00 0.00 ? 17 LYS A NZ   11 
ATOM 4013 H H    . LYS A 1 17 ? 2.821   -0.289 1.215   1.00 0.00 ? 17 LYS A H    11 
ATOM 4014 H HZ1  . LYS A 1 17 ? 2.699   2.727  7.116   1.00 0.00 ? 17 LYS A HZ1  11 
ATOM 4015 H HZ2  . LYS A 1 17 ? 2.884   1.230  7.741   1.00 0.00 ? 17 LYS A HZ2  11 
ATOM 4016 H HZ3  . LYS A 1 17 ? 3.621   1.610  6.339   1.00 0.00 ? 17 LYS A HZ3  11 
ATOM 4017 N N    . ASN A 1 18 ? 0.618   0.884  -0.395  1.00 0.00 ? 18 ASN A N    11 
ATOM 4018 C CA   . ASN A 1 18 ? -0.123  1.090  -1.661  1.00 0.00 ? 18 ASN A CA   11 
ATOM 4019 C C    . ASN A 1 18 ? -1.060  -0.097 -2.043  1.00 0.00 ? 18 ASN A C    11 
ATOM 4020 O O    . ASN A 1 18 ? -2.254  0.099  -2.268  1.00 0.00 ? 18 ASN A O    11 
ATOM 4021 C CB   . ASN A 1 18 ? 0.875   1.366  -2.784  1.00 0.00 ? 18 ASN A CB   11 
ATOM 4022 C CG   . ASN A 1 18 ? 0.208   1.997  -4.005  1.00 0.00 ? 18 ASN A CG   11 
ATOM 4023 O OD1  . ASN A 1 18 ? -0.284  1.336  -4.907  1.00 0.00 ? 18 ASN A OD1  11 
ATOM 4024 N ND2  . ASN A 1 18 ? 0.171   3.312  -4.033  1.00 0.00 ? 18 ASN A ND2  11 
ATOM 4025 H H    . ASN A 1 18 ? 1.622   0.925  -0.487  1.00 0.00 ? 18 ASN A H    11 
ATOM 4026 H HD21 . ASN A 1 18 ? 0.559   3.855  -3.286  1.00 0.00 ? 18 ASN A HD21 11 
ATOM 4027 H HD22 . ASN A 1 18 ? -0.260  3.730  -4.826  1.00 0.00 ? 18 ASN A HD22 11 
ATOM 4028 N N    . TYR A 1 19 ? -0.521  -1.307 -1.953  1.00 0.00 ? 19 TYR A N    11 
ATOM 4029 C CA   . TYR A 1 19 ? -1.256  -2.570 -2.158  1.00 0.00 ? 19 TYR A CA   11 
ATOM 4030 C C    . TYR A 1 19 ? -2.347  -2.766 -1.070  1.00 0.00 ? 19 TYR A C    11 
ATOM 4031 O O    . TYR A 1 19 ? -3.423  -3.271 -1.352  1.00 0.00 ? 19 TYR A O    11 
ATOM 4032 C CB   . TYR A 1 19 ? -0.263  -3.735 -2.087  1.00 0.00 ? 19 TYR A CB   11 
ATOM 4033 C CG   . TYR A 1 19 ? -0.462  -4.887 -3.079  1.00 0.00 ? 19 TYR A CG   11 
ATOM 4034 C CD1  . TYR A 1 19 ? -1.749  -5.216 -3.564  1.00 0.00 ? 19 TYR A CD1  11 
ATOM 4035 C CD2  . TYR A 1 19 ? 0.688   -5.623 -3.455  1.00 0.00 ? 19 TYR A CD2  11 
ATOM 4036 C CE1  . TYR A 1 19 ? -1.885  -6.303 -4.445  1.00 0.00 ? 19 TYR A CE1  11 
ATOM 4037 C CE2  . TYR A 1 19 ? 0.542   -6.708 -4.338  1.00 0.00 ? 19 TYR A CE2  11 
ATOM 4038 C CZ   . TYR A 1 19 ? -0.745  -7.037 -4.822  1.00 0.00 ? 19 TYR A CZ   11 
ATOM 4039 O OH   . TYR A 1 19 ? -0.884  -8.064 -5.690  1.00 0.00 ? 19 TYR A OH   11 
ATOM 4040 H H    . TYR A 1 19 ? 0.434   -1.435 -1.660  1.00 0.00 ? 19 TYR A H    11 
ATOM 4041 H HH   . TYR A 1 19 ? 0.006   -8.504 -5.838  1.00 0.00 ? 19 TYR A HH   11 
ATOM 4042 N N    . HIS A 1 20 ? -2.060  -2.263 0.125   1.00 0.00 ? 20 HIS A N    11 
ATOM 4043 C CA   . HIS A 1 20 ? -2.993  -2.195 1.277   1.00 0.00 ? 20 HIS A CA   11 
ATOM 4044 C C    . HIS A 1 20 ? -4.041  -1.059 1.135   1.00 0.00 ? 20 HIS A C    11 
ATOM 4045 O O    . HIS A 1 20 ? -5.161  -1.162 1.629   1.00 0.00 ? 20 HIS A O    11 
ATOM 4046 C CB   . HIS A 1 20 ? -2.092  -2.095 2.515   1.00 0.00 ? 20 HIS A CB   11 
ATOM 4047 C CG   . HIS A 1 20 ? -2.681  -1.466 3.772   1.00 0.00 ? 20 HIS A CG   11 
ATOM 4048 N ND1  . HIS A 1 20 ? -3.189  -2.094 4.825   1.00 0.00 ? 20 HIS A ND1  11 
ATOM 4049 C CD2  . HIS A 1 20 ? -2.833  -0.155 3.970   1.00 0.00 ? 20 HIS A CD2  11 
ATOM 4050 C CE1  . HIS A 1 20 ? -3.692  -1.181 5.657   1.00 0.00 ? 20 HIS A CE1  11 
ATOM 4051 N NE2  . HIS A 1 20 ? -3.471  0.011  5.118   1.00 0.00 ? 20 HIS A NE2  11 
ATOM 4052 H H    . HIS A 1 20 ? -1.154  -1.881 0.322   1.00 0.00 ? 20 HIS A H    11 
ATOM 4053 H HD1  . HIS A 1 20 ? -3.084  -3.065 5.030   1.00 0.00 ? 20 HIS A HD1  11 
ATOM 4054 H HE2  . HIS A 1 20 ? -3.809  0.883  5.471   1.00 0.00 ? 20 HIS A HE2  11 
ATOM 4055 N N    . LEU A 1 21 ? -3.702  -0.028 0.368   1.00 0.00 ? 21 LEU A N    11 
ATOM 4056 C CA   . LEU A 1 21 ? -4.522  1.178  0.124   1.00 0.00 ? 21 LEU A CA   11 
ATOM 4057 C C    . LEU A 1 21 ? -5.714  0.872  -0.796  1.00 0.00 ? 21 LEU A C    11 
ATOM 4058 O O    . LEU A 1 21 ? -6.840  1.260  -0.485  1.00 0.00 ? 21 LEU A O    11 
ATOM 4059 C CB   . LEU A 1 21 ? -3.616  2.279  -0.467  1.00 0.00 ? 21 LEU A CB   11 
ATOM 4060 C CG   . LEU A 1 21 ? -4.363  3.419  -1.167  1.00 0.00 ? 21 LEU A CG   11 
ATOM 4061 C CD1  . LEU A 1 21 ? -5.078  4.348  -0.183  1.00 0.00 ? 21 LEU A CD1  11 
ATOM 4062 C CD2  . LEU A 1 21 ? -3.420  4.179  -2.108  1.00 0.00 ? 21 LEU A CD2  11 
ATOM 4063 H H    . LEU A 1 21 ? -2.794  -0.003 -0.058  1.00 0.00 ? 21 LEU A H    11 
ATOM 4064 N N    . GLU A 1 22 ? -5.451  0.193  -1.902  1.00 0.00 ? 22 GLU A N    11 
ATOM 4065 C CA   . GLU A 1 22 ? -6.514  -0.259 -2.818  1.00 0.00 ? 22 GLU A CA   11 
ATOM 4066 C C    . GLU A 1 22 ? -7.561  -1.125 -2.084  1.00 0.00 ? 22 GLU A C    11 
ATOM 4067 O O    . GLU A 1 22 ? -8.762  -0.973 -2.307  1.00 0.00 ? 22 GLU A O    11 
ATOM 4068 C CB   . GLU A 1 22 ? -5.897  -1.003 -3.995  1.00 0.00 ? 22 GLU A CB   11 
ATOM 4069 C CG   . GLU A 1 22 ? -6.853  -1.024 -5.201  1.00 0.00 ? 22 GLU A CG   11 
ATOM 4070 C CD   . GLU A 1 22 ? -7.166  -2.431 -5.706  1.00 0.00 ? 22 GLU A CD   11 
ATOM 4071 O OE1  . GLU A 1 22 ? -6.406  -3.384 -5.571  1.00 0.00 ? 22 GLU A OE1  11 
ATOM 4072 O OE2  . GLU A 1 22 ? -8.345  -2.593 -6.337  1.00 0.00 ? 22 GLU A OE2  11 
ATOM 4073 H H    . GLU A 1 22 ? -4.512  0.033  -2.220  1.00 0.00 ? 22 GLU A H    11 
ATOM 4074 H HE2  . GLU A 1 22 ? -8.352  -3.559 -6.585  1.00 0.00 ? 22 GLU A HE2  11 
ATOM 4075 N N    . ASN A 1 23 ? -7.099  -1.836 -1.061  1.00 0.00 ? 23 ASN A N    11 
ATOM 4076 C CA   . ASN A 1 23 ? -7.966  -2.624 -0.170  1.00 0.00 ? 23 ASN A CA   11 
ATOM 4077 C C    . ASN A 1 23 ? -8.913  -1.723 0.653   1.00 0.00 ? 23 ASN A C    11 
ATOM 4078 O O    . ASN A 1 23 ? -10.114 -1.995 0.708   1.00 0.00 ? 23 ASN A O    11 
ATOM 4079 C CB   . ASN A 1 23 ? -7.112  -3.494 0.763   1.00 0.00 ? 23 ASN A CB   11 
ATOM 4080 C CG   . ASN A 1 23 ? -7.800  -4.799 1.156   1.00 0.00 ? 23 ASN A CG   11 
ATOM 4081 O OD1  . ASN A 1 23 ? -7.201  -5.728 1.684   1.00 0.00 ? 23 ASN A OD1  11 
ATOM 4082 N ND2  . ASN A 1 23 ? -9.108  -4.899 0.998   1.00 0.00 ? 23 ASN A ND2  11 
ATOM 4083 H H    . ASN A 1 23 ? -6.125  -1.869 -0.835  1.00 0.00 ? 23 ASN A H    11 
ATOM 4084 H HD21 . ASN A 1 23 ? -9.642  -4.079 0.797   1.00 0.00 ? 23 ASN A HD21 11 
ATOM 4085 H HD22 . ASN A 1 23 ? -9.523  -5.778 1.197   1.00 0.00 ? 23 ASN A HD22 11 
ATOM 4086 N N    . GLU A 1 24 ? -8.370  -0.608 1.149   1.00 0.00 ? 24 GLU A N    11 
ATOM 4087 C CA   . GLU A 1 24 ? -9.142  0.448  1.837   1.00 0.00 ? 24 GLU A CA   11 
ATOM 4088 C C    . GLU A 1 24 ? -10.206 1.098  0.946   1.00 0.00 ? 24 GLU A C    11 
ATOM 4089 O O    . GLU A 1 24 ? -11.384 1.004  1.261   1.00 0.00 ? 24 GLU A O    11 
ATOM 4090 C CB   . GLU A 1 24 ? -8.227  1.511  2.451   1.00 0.00 ? 24 GLU A CB   11 
ATOM 4091 C CG   . GLU A 1 24 ? -7.707  1.097  3.828   1.00 0.00 ? 24 GLU A CG   11 
ATOM 4092 C CD   . GLU A 1 24 ? -8.364  1.937  4.924   1.00 0.00 ? 24 GLU A CD   11 
ATOM 4093 O OE1  . GLU A 1 24 ? -7.983  3.069  5.194   1.00 0.00 ? 24 GLU A OE1  11 
ATOM 4094 O OE2  . GLU A 1 24 ? -9.415  1.391  5.581   1.00 0.00 ? 24 GLU A OE2  11 
ATOM 4095 H H    . GLU A 1 24 ? -7.402  -0.410 1.059   1.00 0.00 ? 24 GLU A H    11 
ATOM 4096 H HE2  . GLU A 1 24 ? -9.682  2.102  6.230   1.00 0.00 ? 24 GLU A HE2  11 
ATOM 4097 N N    . VAL A 1 25 ? -9.793  1.571  -0.232  1.00 0.00 ? 25 VAL A N    11 
ATOM 4098 C CA   . VAL A 1 25 ? -10.702 2.114  -1.285  1.00 0.00 ? 25 VAL A CA   11 
ATOM 4099 C C    . VAL A 1 25 ? -11.928 1.197  -1.525  1.00 0.00 ? 25 VAL A C    11 
ATOM 4100 O O    . VAL A 1 25 ? -13.042 1.698  -1.565  1.00 0.00 ? 25 VAL A O    11 
ATOM 4101 C CB   . VAL A 1 25 ? -9.927  2.410  -2.579  1.00 0.00 ? 25 VAL A CB   11 
ATOM 4102 C CG1  . VAL A 1 25 ? -10.813 3.044  -3.666  1.00 0.00 ? 25 VAL A CG1  11 
ATOM 4103 C CG2  . VAL A 1 25 ? -8.737  3.352  -2.338  1.00 0.00 ? 25 VAL A CG2  11 
ATOM 4104 H H    . VAL A 1 25 ? -8.825  1.747  -0.398  1.00 0.00 ? 25 VAL A H    11 
ATOM 4105 N N    . ALA A 1 26 ? -11.709 -0.113 -1.470  1.00 0.00 ? 26 ALA A N    11 
ATOM 4106 C CA   . ALA A 1 26 ? -12.790 -1.124 -1.579  1.00 0.00 ? 26 ALA A CA   11 
ATOM 4107 C C    . ALA A 1 26 ? -13.751 -1.090 -0.370  1.00 0.00 ? 26 ALA A C    11 
ATOM 4108 O O    . ALA A 1 26 ? -14.901 -0.695 -0.532  1.00 0.00 ? 26 ALA A O    11 
ATOM 4109 C CB   . ALA A 1 26 ? -12.174 -2.513 -1.791  1.00 0.00 ? 26 ALA A CB   11 
ATOM 4110 H H    . ALA A 1 26 ? -10.786 -0.491 -1.349  1.00 0.00 ? 26 ALA A H    11 
ATOM 4111 N N    . ARG A 1 27 ? -13.253 -1.401 0.833   1.00 0.00 ? 27 ARG A N    11 
ATOM 4112 C CA   . ARG A 1 27 ? -14.047 -1.304 2.089   1.00 0.00 ? 27 ARG A CA   11 
ATOM 4113 C C    . ARG A 1 27 ? -14.712 0.068  2.326   1.00 0.00 ? 27 ARG A C    11 
ATOM 4114 O O    . ARG A 1 27 ? -15.790 0.160  2.892   1.00 0.00 ? 27 ARG A O    11 
ATOM 4115 C CB   . ARG A 1 27 ? -13.263 -1.760 3.338   1.00 0.00 ? 27 ARG A CB   11 
ATOM 4116 C CG   . ARG A 1 27 ? -12.015 -0.934 3.656   1.00 0.00 ? 27 ARG A CG   11 
ATOM 4117 C CD   . ARG A 1 27 ? -11.270 -1.346 4.936   1.00 0.00 ? 27 ARG A CD   11 
ATOM 4118 N NE   . ARG A 1 27 ? -10.958 -2.785 4.869   1.00 0.00 ? 27 ARG A NE   11 
ATOM 4119 C CZ   . ARG A 1 27 ? -9.816  -3.364 4.514   1.00 0.00 ? 27 ARG A CZ   11 
ATOM 4120 N NH1  . ARG A 1 27 ? -8.629  -2.764 4.564   1.00 0.00 ? 27 ARG A NH1  11 
ATOM 4121 N NH2  . ARG A 1 27 ? -9.919  -4.361 3.647   1.00 0.00 ? 27 ARG A NH2  11 
ATOM 4122 H H    . ARG A 1 27 ? -12.324 -1.753 0.944   1.00 0.00 ? 27 ARG A H    11 
ATOM 4123 H HE   . ARG A 1 27 ? -11.652 -3.375 5.287   1.00 0.00 ? 27 ARG A HE   11 
ATOM 4124 H HH11 . ARG A 1 27 ? -8.530  -1.902 5.048   1.00 0.00 ? 27 ARG A HH11 11 
ATOM 4125 H HH12 . ARG A 1 27 ? -7.825  -3.245 4.230   1.00 0.00 ? 27 ARG A HH12 11 
ATOM 4126 H HH21 . ARG A 1 27 ? -10.814 -4.574 3.268   1.00 0.00 ? 27 ARG A HH21 11 
ATOM 4127 H HH22 . ARG A 1 27 ? -9.099  -4.818 3.305   1.00 0.00 ? 27 ARG A HH22 11 
ATOM 4128 N N    . LEU A 1 28 ? -14.041 1.100  1.834   1.00 0.00 ? 28 LEU A N    11 
ATOM 4129 C CA   . LEU A 1 28 ? -14.514 2.505  1.788   1.00 0.00 ? 28 LEU A CA   11 
ATOM 4130 C C    . LEU A 1 28 ? -15.695 2.686  0.811   1.00 0.00 ? 28 LEU A C    11 
ATOM 4131 O O    . LEU A 1 28 ? -16.743 3.186  1.202   1.00 0.00 ? 28 LEU A O    11 
ATOM 4132 C CB   . LEU A 1 28 ? -13.299 3.382  1.438   1.00 0.00 ? 28 LEU A CB   11 
ATOM 4133 C CG   . LEU A 1 28 ? -13.624 4.755  0.847   1.00 0.00 ? 28 LEU A CG   11 
ATOM 4134 C CD1  . LEU A 1 28 ? -14.218 5.683  1.907   1.00 0.00 ? 28 LEU A CD1  11 
ATOM 4135 C CD2  . LEU A 1 28 ? -12.374 5.381  0.241   1.00 0.00 ? 28 LEU A CD2  11 
ATOM 4136 H H    . LEU A 1 28 ? -13.095 0.985  1.515   1.00 0.00 ? 28 LEU A H    11 
ATOM 4137 N N    . LYS A 1 29 ? -15.508 2.292  -0.450  1.00 0.00 ? 29 LYS A N    11 
ATOM 4138 C CA   . LYS A 1 29 ? -16.567 2.423  -1.461  1.00 0.00 ? 29 LYS A CA   11 
ATOM 4139 C C    . LYS A 1 29 ? -17.825 1.581  -1.130  1.00 0.00 ? 29 LYS A C    11 
ATOM 4140 O O    . LYS A 1 29 ? -18.944 2.008  -1.370  1.00 0.00 ? 29 LYS A O    11 
ATOM 4141 C CB   . LYS A 1 29 ? -15.970 2.084  -2.827  1.00 0.00 ? 29 LYS A CB   11 
ATOM 4142 C CG   . LYS A 1 29 ? -16.657 2.905  -3.928  1.00 0.00 ? 29 LYS A CG   11 
ATOM 4143 C CD   . LYS A 1 29 ? -15.617 3.455  -4.911  1.00 0.00 ? 29 LYS A CD   11 
ATOM 4144 C CE   . LYS A 1 29 ? -16.295 4.298  -5.988  1.00 0.00 ? 29 LYS A CE   11 
ATOM 4145 N NZ   . LYS A 1 29 ? -15.276 4.924  -6.843  1.00 0.00 ? 29 LYS A NZ   11 
ATOM 4146 H H    . LYS A 1 29 ? -14.619 1.986  -0.798  1.00 0.00 ? 29 LYS A H    11 
ATOM 4147 H HZ1  . LYS A 1 29 ? -14.702 4.222  -7.253  1.00 0.00 ? 29 LYS A HZ1  11 
ATOM 4148 H HZ2  . LYS A 1 29 ? -15.735 5.436  -7.570  1.00 0.00 ? 29 LYS A HZ2  11 
ATOM 4149 H HZ3  . LYS A 1 29 ? -14.721 5.557  -6.306  1.00 0.00 ? 29 LYS A HZ3  11 
ATOM 4150 N N    . LYS A 1 30 ? -17.595 0.531  -0.335  1.00 0.00 ? 30 LYS A N    11 
ATOM 4151 C CA   . LYS A 1 30 ? -18.631 -0.299 0.317   1.00 0.00 ? 30 LYS A CA   11 
ATOM 4152 C C    . LYS A 1 30 ? -19.540 0.499  1.285   1.00 0.00 ? 30 LYS A C    11 
ATOM 4153 O O    . LYS A 1 30 ? -20.731 0.224  1.396   1.00 0.00 ? 30 LYS A O    11 
ATOM 4154 C CB   . LYS A 1 30 ? -17.847 -1.448 0.978   1.00 0.00 ? 30 LYS A CB   11 
ATOM 4155 C CG   . LYS A 1 30 ? -18.397 -2.028 2.298   1.00 0.00 ? 30 LYS A CG   11 
ATOM 4156 C CD   . LYS A 1 30 ? -17.345 -2.982 2.866   1.00 0.00 ? 30 LYS A CD   11 
ATOM 4157 C CE   . LYS A 1 30 ? -17.756 -3.549 4.227   1.00 0.00 ? 30 LYS A CE   11 
ATOM 4158 N NZ   . LYS A 1 30 ? -16.662 -4.371 4.740   1.00 0.00 ? 30 LYS A NZ   11 
ATOM 4159 H H    . LYS A 1 30 ? -16.649 0.223  -0.155  1.00 0.00 ? 30 LYS A H    11 
ATOM 4160 H HZ1  . LYS A 1 30 ? -16.291 -4.930 4.003   1.00 0.00 ? 30 LYS A HZ1  11 
ATOM 4161 H HZ2  . LYS A 1 30 ? -15.948 -3.776 5.112   1.00 0.00 ? 30 LYS A HZ2  11 
ATOM 4162 H HZ3  . LYS A 1 30 ? -17.011 -4.957 5.472   1.00 0.00 ? 30 LYS A HZ3  11 
ATOM 4163 N N    . LEU A 1 31 ? -18.984 1.557  1.882   1.00 0.00 ? 31 LEU A N    11 
ATOM 4164 C CA   . LEU A 1 31 ? -19.736 2.440  2.803   1.00 0.00 ? 31 LEU A CA   11 
ATOM 4165 C C    . LEU A 1 31 ? -20.817 3.261  2.048   1.00 0.00 ? 31 LEU A C    11 
ATOM 4166 O O    . LEU A 1 31 ? -21.927 3.398  2.547   1.00 0.00 ? 31 LEU A O    11 
ATOM 4167 C CB   . LEU A 1 31 ? -18.798 3.386  3.574   1.00 0.00 ? 31 LEU A CB   11 
ATOM 4168 C CG   . LEU A 1 31 ? -17.655 2.643  4.289   1.00 0.00 ? 31 LEU A CG   11 
ATOM 4169 C CD1  . LEU A 1 31 ? -16.697 3.667  4.908   1.00 0.00 ? 31 LEU A CD1  11 
ATOM 4170 C CD2  . LEU A 1 31 ? -18.135 1.656  5.352   1.00 0.00 ? 31 LEU A CD2  11 
ATOM 4171 H H    . LEU A 1 31 ? -18.038 1.838  1.710   1.00 0.00 ? 31 LEU A H    11 
ATOM 4172 N N    . VAL A 1 32 ? -20.556 3.526  0.775   1.00 0.00 ? 32 VAL A N    11 
ATOM 4173 C CA   . VAL A 1 32 ? -21.507 4.195  -0.157  1.00 0.00 ? 32 VAL A CA   11 
ATOM 4174 C C    . VAL A 1 32 ? -22.427 3.135  -0.848  1.00 0.00 ? 32 VAL A C    11 
ATOM 4175 O O    . VAL A 1 32 ? -23.207 3.452  -1.742  1.00 0.00 ? 32 VAL A O    11 
ATOM 4176 C CB   . VAL A 1 32 ? -20.719 5.085  -1.137  1.00 0.00 ? 32 VAL A CB   11 
ATOM 4177 C CG1  . VAL A 1 32 ? -21.610 5.916  -2.074  1.00 0.00 ? 32 VAL A CG1  11 
ATOM 4178 C CG2  . VAL A 1 32 ? -19.806 6.084  -0.406  1.00 0.00 ? 32 VAL A CG2  11 
ATOM 4179 H H    . VAL A 1 32 ? -19.685 3.261  0.339   1.00 0.00 ? 32 VAL A H    11 
ATOM 4180 N N    . GLY A 1 33 ? -22.438 1.934  -0.281  1.00 0.00 ? 33 GLY A N    11 
ATOM 4181 C CA   . GLY A 1 33 ? -23.263 0.788  -0.728  1.00 0.00 ? 33 GLY A CA   11 
ATOM 4182 C C    . GLY A 1 33 ? -24.504 0.593  0.165   1.00 0.00 ? 33 GLY A C    11 
ATOM 4183 O O    . GLY A 1 33 ? -25.625 0.562  -0.328  1.00 0.00 ? 33 GLY A O    11 
ATOM 4184 H H    . GLY A 1 33 ? -21.819 1.727  0.472   1.00 0.00 ? 33 GLY A H    11 
ATOM 4185 N N    . GLU A 1 34 ? -24.283 0.653  1.478   1.00 0.00 ? 34 GLU A N    11 
ATOM 4186 C CA   . GLU A 1 34 ? -25.350 0.527  2.501   1.00 0.00 ? 34 GLU A CA   11 
ATOM 4187 C C    . GLU A 1 34 ? -26.070 1.853  2.827   1.00 0.00 ? 34 GLU A C    11 
ATOM 4188 O O    . GLU A 1 34 ? -26.721 1.994  3.859   1.00 0.00 ? 34 GLU A O    11 
ATOM 4189 C CB   . GLU A 1 34 ? -24.756 -0.126 3.761   1.00 0.00 ? 34 GLU A CB   11 
ATOM 4190 C CG   . GLU A 1 34 ? -23.640 0.706  4.406   1.00 0.00 ? 34 GLU A CG   11 
ATOM 4191 C CD   . GLU A 1 34 ? -22.891 -0.053 5.505   1.00 0.00 ? 34 GLU A CD   11 
ATOM 4192 O OE1  . GLU A 1 34 ? -22.397 0.501  6.473   1.00 0.00 ? 34 GLU A OE1  11 
ATOM 4193 O OE2  . GLU A 1 34 ? -22.736 -1.386 5.331   1.00 0.00 ? 34 GLU A OE2  11 
ATOM 4194 H H    . GLU A 1 34 ? -23.361 0.770  1.844   1.00 0.00 ? 34 GLU A H    11 
ATOM 4195 H HE2  . GLU A 1 34 ? -22.198 -1.659 6.125   1.00 0.00 ? 34 GLU A HE2  11 
ATOM 4196 N N    . ARG A 1 35 ? -25.960 2.796  1.884   1.00 0.00 ? 35 ARG A N    11 
ATOM 4197 C CA   . ARG A 1 35 ? -26.581 4.134  2.017   1.00 0.00 ? 35 ARG A CA   11 
ATOM 4198 C C    . ARG A 1 35 ? -27.087 4.632  0.645   1.00 0.00 ? 35 ARG A C    11 
ATOM 4199 O O    . ARG A 1 35 ? -26.331 5.351  -0.047  1.00 0.00 ? 35 ARG A O    11 
ATOM 4200 C CB   . ARG A 1 35 ? -25.565 5.098  2.658   1.00 0.00 ? 35 ARG A CB   11 
ATOM 4201 C CG   . ARG A 1 35 ? -26.189 6.197  3.538   1.00 0.00 ? 35 ARG A CG   11 
ATOM 4202 C CD   . ARG A 1 35 ? -27.140 7.155  2.820   1.00 0.00 ? 35 ARG A CD   11 
ATOM 4203 N NE   . ARG A 1 35 ? -28.543 6.691  2.951   1.00 0.00 ? 35 ARG A NE   11 
ATOM 4204 C CZ   . ARG A 1 35 ? -29.541 6.939  2.107   1.00 0.00 ? 35 ARG A CZ   11 
ATOM 4205 N NH1  . ARG A 1 35 ? -29.345 7.028  0.798   1.00 0.00 ? 35 ARG A NH1  11 
ATOM 4206 N NH2  . ARG A 1 35 ? -30.786 6.710  2.492   1.00 0.00 ? 35 ARG A NH2  11 
ATOM 4207 O OXT  . ARG A 1 35 ? -28.197 4.193  0.271   1.00 0.00 ? 35 ARG A OXT  11 
ATOM 4208 H H    . ARG A 1 35 ? -25.525 2.599  1.017   1.00 0.00 ? 35 ARG A H    11 
ATOM 4209 H HE   . ARG A 1 35 ? -28.700 6.016  3.673   1.00 0.00 ? 35 ARG A HE   11 
ATOM 4210 H HH11 . ARG A 1 35 ? -28.436 6.868  0.416   1.00 0.00 ? 35 ARG A HH11 11 
ATOM 4211 H HH12 . ARG A 1 35 ? -30.109 7.207  0.185   1.00 0.00 ? 35 ARG A HH12 11 
ATOM 4212 H HH21 . ARG A 1 35 ? -30.979 6.486  3.441   1.00 0.00 ? 35 ARG A HH21 11 
ATOM 4213 H HH22 . ARG A 1 35 ? -31.529 6.857  1.848   1.00 0.00 ? 35 ARG A HH22 11 
ATOM 4214 N N    . LEU A 1 1  ? 13.720  4.935  -10.389 1.00 0.00 ? 1  LEU A N    12 
ATOM 4215 C CA   . LEU A 1 1  ? 14.294  3.605  -10.022 1.00 0.00 ? 1  LEU A CA   12 
ATOM 4216 C C    . LEU A 1 1  ? 15.038  3.583  -8.666  1.00 0.00 ? 1  LEU A C    12 
ATOM 4217 O O    . LEU A 1 1  ? 15.935  2.746  -8.423  1.00 0.00 ? 1  LEU A O    12 
ATOM 4218 C CB   . LEU A 1 1  ? 15.162  3.072  -11.174 1.00 0.00 ? 1  LEU A CB   12 
ATOM 4219 C CG   . LEU A 1 1  ? 16.478  3.850  -11.357 1.00 0.00 ? 1  LEU A CG   12 
ATOM 4220 C CD1  . LEU A 1 1  ? 17.658  2.890  -11.186 1.00 0.00 ? 1  LEU A CD1  12 
ATOM 4221 C CD2  . LEU A 1 1  ? 16.520  4.538  -12.713 1.00 0.00 ? 1  LEU A CD2  12 
ATOM 4222 H H1   . LEU A 1 1  ? 14.460  5.620  -10.416 1.00 0.00 ? 1  LEU A H1   12 
ATOM 4223 H H2   . LEU A 1 1  ? 13.324  4.867  -11.303 1.00 0.00 ? 1  LEU A H2   12 
ATOM 4224 H H3   . LEU A 1 1  ? 13.008  5.203  -9.759  1.00 0.00 ? 1  LEU A H3   12 
ATOM 4225 N N    . GLN A 1 2  ? 14.571  4.415  -7.772  1.00 0.00 ? 2  GLN A N    12 
ATOM 4226 C CA   . GLN A 1 2  ? 15.083  4.613  -6.392  1.00 0.00 ? 2  GLN A CA   12 
ATOM 4227 C C    . GLN A 1 2  ? 14.760  3.406  -5.490  1.00 0.00 ? 2  GLN A C    12 
ATOM 4228 O O    . GLN A 1 2  ? 14.106  3.533  -4.434  1.00 0.00 ? 2  GLN A O    12 
ATOM 4229 C CB   . GLN A 1 2  ? 14.573  5.953  -5.815  1.00 0.00 ? 2  GLN A CB   12 
ATOM 4230 C CG   . GLN A 1 2  ? 13.042  6.094  -5.855  1.00 0.00 ? 2  GLN A CG   12 
ATOM 4231 C CD   . GLN A 1 2  ? 12.534  7.030  -4.751  1.00 0.00 ? 2  GLN A CD   12 
ATOM 4232 O OE1  . GLN A 1 2  ? 12.797  6.872  -3.569  1.00 0.00 ? 2  GLN A OE1  12 
ATOM 4233 N NE2  . GLN A 1 2  ? 11.723  7.983  -5.117  1.00 0.00 ? 2  GLN A NE2  12 
ATOM 4234 H H    . GLN A 1 2  ? 13.782  4.991  -7.998  1.00 0.00 ? 2  GLN A H    12 
ATOM 4235 H HE21 . GLN A 1 2  ? 11.452  8.121  -6.064  1.00 0.00 ? 2  GLN A HE21 12 
ATOM 4236 H HE22 . GLN A 1 2  ? 11.376  8.568  -4.381  1.00 0.00 ? 2  GLN A HE22 12 
ATOM 4237 N N    . ARG A 1 3  ? 15.245  2.263  -5.911  1.00 0.00 ? 3  ARG A N    12 
ATOM 4238 C CA   . ARG A 1 3  ? 14.928  0.920  -5.364  1.00 0.00 ? 3  ARG A CA   12 
ATOM 4239 C C    . ARG A 1 3  ? 15.620  -0.275 -6.054  1.00 0.00 ? 3  ARG A C    12 
ATOM 4240 O O    . ARG A 1 3  ? 15.006  -1.142 -6.673  1.00 0.00 ? 3  ARG A O    12 
ATOM 4241 C CB   . ARG A 1 3  ? 13.402  0.738  -5.339  1.00 0.00 ? 3  ARG A CB   12 
ATOM 4242 C CG   . ARG A 1 3  ? 12.723  0.929  -6.691  1.00 0.00 ? 3  ARG A CG   12 
ATOM 4243 C CD   . ARG A 1 3  ? 11.247  0.701  -6.504  1.00 0.00 ? 3  ARG A CD   12 
ATOM 4244 N NE   . ARG A 1 3  ? 10.752  0.060  -7.730  1.00 0.00 ? 3  ARG A NE   12 
ATOM 4245 C CZ   . ARG A 1 3  ? 9.511   0.187  -8.174  1.00 0.00 ? 3  ARG A CZ   12 
ATOM 4246 N NH1  . ARG A 1 3  ? 8.945   1.387  -8.227  1.00 0.00 ? 3  ARG A NH1  12 
ATOM 4247 N NH2  . ARG A 1 3  ? 9.027   -0.751 -8.958  1.00 0.00 ? 3  ARG A NH2  12 
ATOM 4248 H H    . ARG A 1 3  ? 15.745  2.254  -6.790  1.00 0.00 ? 3  ARG A H    12 
ATOM 4249 H HE   . ARG A 1 3  ? 11.461  -0.244 -8.368  1.00 0.00 ? 3  ARG A HE   12 
ATOM 4250 H HH11 . ARG A 1 3  ? 9.470   2.175  -7.932  1.00 0.00 ? 3  ARG A HH11 12 
ATOM 4251 H HH12 . ARG A 1 3  ? 8.011   1.481  -8.560  1.00 0.00 ? 3  ARG A HH12 12 
ATOM 4252 H HH21 . ARG A 1 3  ? 9.532   -1.614 -9.061  1.00 0.00 ? 3  ARG A HH21 12 
ATOM 4253 H HH22 . ARG A 1 3  ? 8.103   -0.671 -9.325  1.00 0.00 ? 3  ARG A HH22 12 
ATOM 4254 N N    . MET A 1 4  ? 16.925  -0.384 -5.807  1.00 0.00 ? 4  MET A N    12 
ATOM 4255 C CA   . MET A 1 4  ? 17.733  -1.504 -6.352  1.00 0.00 ? 4  MET A CA   12 
ATOM 4256 C C    . MET A 1 4  ? 17.986  -2.679 -5.370  1.00 0.00 ? 4  MET A C    12 
ATOM 4257 O O    . MET A 1 4  ? 18.227  -3.800 -5.806  1.00 0.00 ? 4  MET A O    12 
ATOM 4258 C CB   . MET A 1 4  ? 19.061  -0.985 -6.916  1.00 0.00 ? 4  MET A CB   12 
ATOM 4259 C CG   . MET A 1 4  ? 19.948  -0.324 -5.848  1.00 0.00 ? 4  MET A CG   12 
ATOM 4260 S SD   . MET A 1 4  ? 20.485  1.385  -6.249  1.00 0.00 ? 4  MET A SD   12 
ATOM 4261 C CE   . MET A 1 4  ? 18.921  2.215  -6.434  1.00 0.00 ? 4  MET A CE   12 
ATOM 4262 H H    . MET A 1 4  ? 17.443  0.389  -5.465  1.00 0.00 ? 4  MET A H    12 
ATOM 4263 N N    . LYS A 1 5  ? 17.942  -2.344 -4.082  1.00 0.00 ? 5  LYS A N    12 
ATOM 4264 C CA   . LYS A 1 5  ? 18.318  -3.195 -2.926  1.00 0.00 ? 5  LYS A CA   12 
ATOM 4265 C C    . LYS A 1 5  ? 18.306  -2.394 -1.608  1.00 0.00 ? 5  LYS A C    12 
ATOM 4266 O O    . LYS A 1 5  ? 17.675  -2.785 -0.621  1.00 0.00 ? 5  LYS A O    12 
ATOM 4267 C CB   . LYS A 1 5  ? 19.680  -3.872 -3.105  1.00 0.00 ? 5  LYS A CB   12 
ATOM 4268 C CG   . LYS A 1 5  ? 19.974  -4.870 -1.978  1.00 0.00 ? 5  LYS A CG   12 
ATOM 4269 C CD   . LYS A 1 5  ? 21.049  -5.866 -2.371  1.00 0.00 ? 5  LYS A CD   12 
ATOM 4270 C CE   . LYS A 1 5  ? 21.421  -6.719 -1.164  1.00 0.00 ? 5  LYS A CE   12 
ATOM 4271 N NZ   . LYS A 1 5  ? 22.790  -6.368 -0.764  1.00 0.00 ? 5  LYS A NZ   12 
ATOM 4272 H H    . LYS A 1 5  ? 17.384  -1.563 -3.848  1.00 0.00 ? 5  LYS A H    12 
ATOM 4273 H HZ1  . LYS A 1 5  ? 22.851  -5.392 -0.591  1.00 0.00 ? 5  LYS A HZ1  12 
ATOM 4274 H HZ2  . LYS A 1 5  ? 23.024  -6.869 0.082   1.00 0.00 ? 5  LYS A HZ2  12 
ATOM 4275 H HZ3  . LYS A 1 5  ? 23.429  -6.641 -1.488  1.00 0.00 ? 5  LYS A HZ3  12 
ATOM 4276 N N    . GLN A 1 6  ? 18.803  -1.177 -1.723  1.00 0.00 ? 6  GLN A N    12 
ATOM 4277 C CA   . GLN A 1 6  ? 19.002  -0.244 -0.588  1.00 0.00 ? 6  GLN A CA   12 
ATOM 4278 C C    . GLN A 1 6  ? 17.842  0.760  -0.421  1.00 0.00 ? 6  GLN A C    12 
ATOM 4279 O O    . GLN A 1 6  ? 17.090  0.688  0.543   1.00 0.00 ? 6  GLN A O    12 
ATOM 4280 C CB   . GLN A 1 6  ? 20.366  0.450  -0.740  1.00 0.00 ? 6  GLN A CB   12 
ATOM 4281 C CG   . GLN A 1 6  ? 20.653  0.958  -2.158  1.00 0.00 ? 6  GLN A CG   12 
ATOM 4282 C CD   . GLN A 1 6  ? 22.012  1.629  -2.305  1.00 0.00 ? 6  GLN A CD   12 
ATOM 4283 O OE1  . GLN A 1 6  ? 22.449  2.433  -1.502  1.00 0.00 ? 6  GLN A OE1  12 
ATOM 4284 N NE2  . GLN A 1 6  ? 22.689  1.369  -3.414  1.00 0.00 ? 6  GLN A NE2  12 
ATOM 4285 H H    . GLN A 1 6  ? 19.178  -0.870 -2.588  1.00 0.00 ? 6  GLN A H    12 
ATOM 4286 H HE21 . GLN A 1 6  ? 22.377  0.716  -4.094  1.00 0.00 ? 6  GLN A HE21 12 
ATOM 4287 H HE22 . GLN A 1 6  ? 23.562  1.834  -3.489  1.00 0.00 ? 6  GLN A HE22 12 
ATOM 4288 N N    . LEU A 1 7  ? 17.565  1.481  -1.493  1.00 0.00 ? 7  LEU A N    12 
ATOM 4289 C CA   . LEU A 1 7  ? 16.444  2.445  -1.541  1.00 0.00 ? 7  LEU A CA   12 
ATOM 4290 C C    . LEU A 1 7  ? 15.075  1.719  -1.534  1.00 0.00 ? 7  LEU A C    12 
ATOM 4291 O O    . LEU A 1 7  ? 14.148  2.182  -0.881  1.00 0.00 ? 7  LEU A O    12 
ATOM 4292 C CB   . LEU A 1 7  ? 16.616  3.379  -2.743  1.00 0.00 ? 7  LEU A CB   12 
ATOM 4293 C CG   . LEU A 1 7  ? 18.015  4.006  -2.859  1.00 0.00 ? 7  LEU A CG   12 
ATOM 4294 C CD1  . LEU A 1 7  ? 18.106  4.839  -4.136  1.00 0.00 ? 7  LEU A CD1  12 
ATOM 4295 C CD2  . LEU A 1 7  ? 18.378  4.895  -1.663  1.00 0.00 ? 7  LEU A CD2  12 
ATOM 4296 H H    . LEU A 1 7  ? 18.192  1.553  -2.271  1.00 0.00 ? 7  LEU A H    12 
ATOM 4297 N N    . GLU A 1 8  ? 15.086  0.463  -1.982  1.00 0.00 ? 8  GLU A N    12 
ATOM 4298 C CA   . GLU A 1 8  ? 13.904  -0.428 -1.911  1.00 0.00 ? 8  GLU A CA   12 
ATOM 4299 C C    . GLU A 1 8  ? 13.491  -0.717 -0.466  1.00 0.00 ? 8  GLU A C    12 
ATOM 4300 O O    . GLU A 1 8  ? 12.315  -0.685 -0.212  1.00 0.00 ? 8  GLU A O    12 
ATOM 4301 C CB   . GLU A 1 8  ? 14.012  -1.741 -2.714  1.00 0.00 ? 8  GLU A CB   12 
ATOM 4302 C CG   . GLU A 1 8  ? 14.862  -2.828 -2.060  1.00 0.00 ? 8  GLU A CG   12 
ATOM 4303 C CD   . GLU A 1 8  ? 14.823  -4.146 -2.820  1.00 0.00 ? 8  GLU A CD   12 
ATOM 4304 O OE1  . GLU A 1 8  ? 15.271  -4.259 -3.953  1.00 0.00 ? 8  GLU A OE1  12 
ATOM 4305 O OE2  . GLU A 1 8  ? 14.254  -5.183 -2.172  1.00 0.00 ? 8  GLU A OE2  12 
ATOM 4306 H H    . GLU A 1 8  ? 15.906  0.049  -2.358  1.00 0.00 ? 8  GLU A H    12 
ATOM 4307 H HE2  . GLU A 1 8  ? 14.401  -5.960 -2.779  1.00 0.00 ? 8  GLU A HE2  12 
ATOM 4308 N N    . ASP A 1 9  ? 14.445  -0.847 0.452   1.00 0.00 ? 9  ASP A N    12 
ATOM 4309 C CA   . ASP A 1 9  ? 14.130  -1.081 1.872   1.00 0.00 ? 9  ASP A CA   12 
ATOM 4310 C C    . ASP A 1 9  ? 13.209  0.003  2.459   1.00 0.00 ? 9  ASP A C    12 
ATOM 4311 O O    . ASP A 1 9  ? 12.205  -0.300 3.092   1.00 0.00 ? 9  ASP A O    12 
ATOM 4312 C CB   . ASP A 1 9  ? 15.425  -1.208 2.692   1.00 0.00 ? 9  ASP A CB   12 
ATOM 4313 C CG   . ASP A 1 9  ? 16.272  -2.440 2.329   1.00 0.00 ? 9  ASP A CG   12 
ATOM 4314 O OD1  . ASP A 1 9  ? 17.472  -2.479 2.532   1.00 0.00 ? 9  ASP A OD1  12 
ATOM 4315 O OD2  . ASP A 1 9  ? 15.625  -3.492 1.775   1.00 0.00 ? 9  ASP A OD2  12 
ATOM 4316 H H    . ASP A 1 9  ? 15.423  -0.830 0.229   1.00 0.00 ? 9  ASP A H    12 
ATOM 4317 H HD2  . ASP A 1 9  ? 16.353  -4.168 1.631   1.00 0.00 ? 9  ASP A HD2  12 
ATOM 4318 N N    . LYS A 1 10 ? 13.419  1.218  1.972   1.00 0.00 ? 10 LYS A N    12 
ATOM 4319 C CA   . LYS A 1 10 ? 12.629  2.419  2.342   1.00 0.00 ? 10 LYS A CA   12 
ATOM 4320 C C    . LYS A 1 10 ? 11.313  2.488  1.548   1.00 0.00 ? 10 LYS A C    12 
ATOM 4321 O O    . LYS A 1 10 ? 10.235  2.474  2.129   1.00 0.00 ? 10 LYS A O    12 
ATOM 4322 C CB   . LYS A 1 10 ? 13.493  3.671  2.130   1.00 0.00 ? 10 LYS A CB   12 
ATOM 4323 C CG   . LYS A 1 10 ? 14.781  3.562  2.946   1.00 0.00 ? 10 LYS A CG   12 
ATOM 4324 C CD   . LYS A 1 10 ? 15.762  4.686  2.632   1.00 0.00 ? 10 LYS A CD   12 
ATOM 4325 C CE   . LYS A 1 10 ? 17.149  4.393  3.212   1.00 0.00 ? 10 LYS A CE   12 
ATOM 4326 N NZ   . LYS A 1 10 ? 17.756  3.241  2.520   1.00 0.00 ? 10 LYS A NZ   12 
ATOM 4327 H H    . LYS A 1 10 ? 14.136  1.392  1.304   1.00 0.00 ? 10 LYS A H    12 
ATOM 4328 H HZ1  . LYS A 1 10 ? 17.772  3.418  1.540   1.00 0.00 ? 10 LYS A HZ1  12 
ATOM 4329 H HZ2  . LYS A 1 10 ? 18.694  3.116  2.852   1.00 0.00 ? 10 LYS A HZ2  12 
ATOM 4330 H HZ3  . LYS A 1 10 ? 17.238  2.415  2.716   1.00 0.00 ? 10 LYS A HZ3  12 
ATOM 4331 N N    . VAL A 1 11 ? 11.429  2.339  0.231   1.00 0.00 ? 11 VAL A N    12 
ATOM 4332 C CA   . VAL A 1 11 ? 10.280  2.300  -0.713  1.00 0.00 ? 11 VAL A CA   12 
ATOM 4333 C C    . VAL A 1 11 ? 9.365   1.064  -0.490  1.00 0.00 ? 11 VAL A C    12 
ATOM 4334 O O    . VAL A 1 11 ? 8.187   1.075  -0.868  1.00 0.00 ? 11 VAL A O    12 
ATOM 4335 C CB   . VAL A 1 11 ? 10.784  2.426  -2.168  1.00 0.00 ? 11 VAL A CB   12 
ATOM 4336 C CG1  . VAL A 1 11 ? 9.634   2.537  -3.184  1.00 0.00 ? 11 VAL A CG1  12 
ATOM 4337 C CG2  . VAL A 1 11 ? 11.668  3.668  -2.363  1.00 0.00 ? 11 VAL A CG2  12 
ATOM 4338 H H    . VAL A 1 11 ? 12.326  2.332  -0.219  1.00 0.00 ? 11 VAL A H    12 
ATOM 4339 N N    . GLU A 1 12 ? 9.865   0.075  0.240   1.00 0.00 ? 12 GLU A N    12 
ATOM 4340 C CA   . GLU A 1 12 ? 9.133   -1.152 0.644   1.00 0.00 ? 12 GLU A CA   12 
ATOM 4341 C C    . GLU A 1 12 ? 7.917   -0.791 1.509   1.00 0.00 ? 12 GLU A C    12 
ATOM 4342 O O    . GLU A 1 12 ? 6.822   -1.180 1.148   1.00 0.00 ? 12 GLU A O    12 
ATOM 4343 C CB   . GLU A 1 12 ? 10.027  -2.091 1.456   1.00 0.00 ? 12 GLU A CB   12 
ATOM 4344 C CG   . GLU A 1 12 ? 10.233  -3.459 0.788   1.00 0.00 ? 12 GLU A CG   12 
ATOM 4345 C CD   . GLU A 1 12 ? 11.364  -3.460 -0.237  1.00 0.00 ? 12 GLU A CD   12 
ATOM 4346 O OE1  . GLU A 1 12 ? 12.539  -3.595 0.078   1.00 0.00 ? 12 GLU A OE1  12 
ATOM 4347 O OE2  . GLU A 1 12 ? 11.033  -3.321 -1.538  1.00 0.00 ? 12 GLU A OE2  12 
ATOM 4348 H H    . GLU A 1 12 ? 10.845  0.036  0.433   1.00 0.00 ? 12 GLU A H    12 
ATOM 4349 H HE2  . GLU A 1 12 ? 11.902  -3.417 -1.999  1.00 0.00 ? 12 GLU A HE2  12 
ATOM 4350 N N    . GLU A 1 13 ? 8.144   0.115  2.462   1.00 0.00 ? 13 GLU A N    12 
ATOM 4351 C CA   . GLU A 1 13 ? 7.075   0.655  3.336   1.00 0.00 ? 13 GLU A CA   12 
ATOM 4352 C C    . GLU A 1 13 ? 5.992   1.388  2.513   1.00 0.00 ? 13 GLU A C    12 
ATOM 4353 O O    . GLU A 1 13 ? 4.805   1.274  2.817   1.00 0.00 ? 13 GLU A O    12 
ATOM 4354 C CB   . GLU A 1 13 ? 7.691   1.569  4.386   1.00 0.00 ? 13 GLU A CB   12 
ATOM 4355 C CG   . GLU A 1 13 ? 7.022   1.407  5.767   1.00 0.00 ? 13 GLU A CG   12 
ATOM 4356 C CD   . GLU A 1 13 ? 5.727   2.197  5.997   1.00 0.00 ? 13 GLU A CD   12 
ATOM 4357 O OE1  . GLU A 1 13 ? 5.111   2.807  5.131   1.00 0.00 ? 13 GLU A OE1  12 
ATOM 4358 O OE2  . GLU A 1 13 ? 5.335   2.288  7.286   1.00 0.00 ? 13 GLU A OE2  12 
ATOM 4359 H H    . GLU A 1 13 ? 9.044   0.507  2.618   1.00 0.00 ? 13 GLU A H    12 
ATOM 4360 H HE2  . GLU A 1 13 ? 4.505   2.841  7.237   1.00 0.00 ? 13 GLU A HE2  12 
ATOM 4361 N N    . LEU A 1 14 ? 6.403   1.936  1.376   1.00 0.00 ? 14 LEU A N    12 
ATOM 4362 C CA   . LEU A 1 14 ? 5.466   2.580  0.428   1.00 0.00 ? 14 LEU A CA   12 
ATOM 4363 C C    . LEU A 1 14 ? 4.601   1.522  -0.272  1.00 0.00 ? 14 LEU A C    12 
ATOM 4364 O O    . LEU A 1 14 ? 3.419   1.537  -0.094  1.00 0.00 ? 14 LEU A O    12 
ATOM 4365 C CB   . LEU A 1 14 ? 6.145   3.458  -0.620  1.00 0.00 ? 14 LEU A CB   12 
ATOM 4366 C CG   . LEU A 1 14 ? 7.122   4.499  -0.053  1.00 0.00 ? 14 LEU A CG   12 
ATOM 4367 C CD1  . LEU A 1 14 ? 7.660   5.333  -1.209  1.00 0.00 ? 14 LEU A CD1  12 
ATOM 4368 C CD2  . LEU A 1 14 ? 6.496   5.402  1.007   1.00 0.00 ? 14 LEU A CD2  12 
ATOM 4369 H H    . LEU A 1 14 ? 7.338   1.848  1.044   1.00 0.00 ? 14 LEU A H    12 
ATOM 4370 N N    . LEU A 1 15 ? 5.246   0.587  -0.992  1.00 0.00 ? 15 LEU A N    12 
ATOM 4371 C CA   . LEU A 1 15 ? 4.534   -0.482 -1.717  1.00 0.00 ? 15 LEU A CA   12 
ATOM 4372 C C    . LEU A 1 15 ? 3.652   -1.345 -0.797  1.00 0.00 ? 15 LEU A C    12 
ATOM 4373 O O    . LEU A 1 15 ? 2.444   -1.383 -0.992  1.00 0.00 ? 15 LEU A O    12 
ATOM 4374 C CB   . LEU A 1 15 ? 5.480   -1.401 -2.502  1.00 0.00 ? 15 LEU A CB   12 
ATOM 4375 C CG   . LEU A 1 15 ? 6.574   -0.661 -3.301  1.00 0.00 ? 15 LEU A CG   12 
ATOM 4376 C CD1  . LEU A 1 15 ? 7.332   -1.677 -4.148  1.00 0.00 ? 15 LEU A CD1  12 
ATOM 4377 C CD2  . LEU A 1 15 ? 6.055   0.473  -4.191  1.00 0.00 ? 15 LEU A CD2  12 
ATOM 4378 H H    . LEU A 1 15 ? 6.226   0.644  -1.180  1.00 0.00 ? 15 LEU A H    12 
ATOM 4379 N N    . SER A 1 16 ? 4.223   -1.812 0.320   1.00 0.00 ? 16 SER A N    12 
ATOM 4380 C CA   . SER A 1 16 ? 3.491   -2.569 1.365   1.00 0.00 ? 16 SER A CA   12 
ATOM 4381 C C    . SER A 1 16 ? 2.206   -1.848 1.825   1.00 0.00 ? 16 SER A C    12 
ATOM 4382 O O    . SER A 1 16 ? 1.170   -2.484 2.012   1.00 0.00 ? 16 SER A O    12 
ATOM 4383 C CB   . SER A 1 16 ? 4.386   -2.836 2.576   1.00 0.00 ? 16 SER A CB   12 
ATOM 4384 O OG   . SER A 1 16 ? 4.748   -1.599 3.183   1.00 0.00 ? 16 SER A OG   12 
ATOM 4385 H H    . SER A 1 16 ? 5.190   -1.611 0.537   1.00 0.00 ? 16 SER A H    12 
ATOM 4386 H HG   . SER A 1 16 ? 5.500   -1.720 3.837   1.00 0.00 ? 16 SER A HG   12 
ATOM 4387 N N    . LYS A 1 17 ? 2.279   -0.524 1.856   1.00 0.00 ? 17 LYS A N    12 
ATOM 4388 C CA   . LYS A 1 17 ? 1.129   0.362  2.068   1.00 0.00 ? 17 LYS A CA   12 
ATOM 4389 C C    . LYS A 1 17 ? 0.265   0.599  0.813   1.00 0.00 ? 17 LYS A C    12 
ATOM 4390 O O    . LYS A 1 17 ? -0.945  0.428  0.883   1.00 0.00 ? 17 LYS A O    12 
ATOM 4391 C CB   . LYS A 1 17 ? 1.605   1.677  2.683   1.00 0.00 ? 17 LYS A CB   12 
ATOM 4392 C CG   . LYS A 1 17 ? 0.524   2.761  2.770   1.00 0.00 ? 17 LYS A CG   12 
ATOM 4393 C CD   . LYS A 1 17 ? 0.807   3.950  1.857   1.00 0.00 ? 17 LYS A CD   12 
ATOM 4394 C CE   . LYS A 1 17 ? 2.100   4.697  2.206   1.00 0.00 ? 17 LYS A CE   12 
ATOM 4395 N NZ   . LYS A 1 17 ? 2.134   4.933  3.659   1.00 0.00 ? 17 LYS A NZ   12 
ATOM 4396 H H    . LYS A 1 17 ? 3.175   -0.054 1.816   1.00 0.00 ? 17 LYS A H    12 
ATOM 4397 H HZ1  . LYS A 1 17 ? 1.313   5.416  3.949   1.00 0.00 ? 17 LYS A HZ1  12 
ATOM 4398 H HZ2  . LYS A 1 17 ? 2.183   4.030  4.115   1.00 0.00 ? 17 LYS A HZ2  12 
ATOM 4399 H HZ3  . LYS A 1 17 ? 2.949   5.461  3.895   1.00 0.00 ? 17 LYS A HZ3  12 
ATOM 4400 N N    . ASN A 1 18 ? 0.831   1.065  -0.276  1.00 0.00 ? 18 ASN A N    12 
ATOM 4401 C CA   . ASN A 1 18 ? 0.143   1.332  -1.557  1.00 0.00 ? 18 ASN A CA   12 
ATOM 4402 C C    . ASN A 1 18 ? -0.731  0.138  -1.999  1.00 0.00 ? 18 ASN A C    12 
ATOM 4403 O O    . ASN A 1 18 ? -1.893  0.309  -2.378  1.00 0.00 ? 18 ASN A O    12 
ATOM 4404 C CB   . ASN A 1 18 ? 1.199   1.689  -2.611  1.00 0.00 ? 18 ASN A CB   12 
ATOM 4405 C CG   . ASN A 1 18 ? 0.662   2.733  -3.584  1.00 0.00 ? 18 ASN A CG   12 
ATOM 4406 O OD1  . ASN A 1 18 ? -0.152  2.478  -4.459  1.00 0.00 ? 18 ASN A OD1  12 
ATOM 4407 N ND2  . ASN A 1 18 ? 1.097   3.983  -3.426  1.00 0.00 ? 18 ASN A ND2  12 
ATOM 4408 H H    . ASN A 1 18 ? 1.822   1.309  -0.263  1.00 0.00 ? 18 ASN A H    12 
ATOM 4409 H HD21 . ASN A 1 18 ? 1.736   4.216  -2.700  1.00 0.00 ? 18 ASN A HD21 12 
ATOM 4410 H HD22 . ASN A 1 18 ? 0.742   4.643  -4.060  1.00 0.00 ? 18 ASN A HD22 12 
ATOM 4411 N N    . TYR A 1 19 ? -0.244  -1.045 -1.662  1.00 0.00 ? 19 TYR A N    12 
ATOM 4412 C CA   . TYR A 1 19 ? -0.930  -2.350 -1.826  1.00 0.00 ? 19 TYR A CA   12 
ATOM 4413 C C    . TYR A 1 19 ? -2.140  -2.513 -0.871  1.00 0.00 ? 19 TYR A C    12 
ATOM 4414 O O    . TYR A 1 19 ? -3.225  -2.863 -1.325  1.00 0.00 ? 19 TYR A O    12 
ATOM 4415 C CB   . TYR A 1 19 ? 0.080   -3.485 -1.659  1.00 0.00 ? 19 TYR A CB   12 
ATOM 4416 C CG   . TYR A 1 19 ? 1.057   -3.687 -2.840  1.00 0.00 ? 19 TYR A CG   12 
ATOM 4417 C CD1  . TYR A 1 19 ? 1.602   -2.597 -3.557  1.00 0.00 ? 19 TYR A CD1  12 
ATOM 4418 C CD2  . TYR A 1 19 ? 1.390   -5.013 -3.168  1.00 0.00 ? 19 TYR A CD2  12 
ATOM 4419 C CE1  . TYR A 1 19 ? 2.509   -2.831 -4.602  1.00 0.00 ? 19 TYR A CE1  12 
ATOM 4420 C CE2  . TYR A 1 19 ? 2.287   -5.264 -4.225  1.00 0.00 ? 19 TYR A CE2  12 
ATOM 4421 C CZ   . TYR A 1 19 ? 2.828   -4.162 -4.930  1.00 0.00 ? 19 TYR A CZ   12 
ATOM 4422 O OH   . TYR A 1 19 ? 3.698   -4.395 -5.955  1.00 0.00 ? 19 TYR A OH   12 
ATOM 4423 H H    . TYR A 1 19 ? 0.692   -1.120 -1.296  1.00 0.00 ? 19 TYR A H    12 
ATOM 4424 H HH   . TYR A 1 19 ? 3.747   -5.383 -6.124  1.00 0.00 ? 19 TYR A HH   12 
ATOM 4425 N N    . HIS A 1 20 ? -1.971  -2.144 0.399   1.00 0.00 ? 20 HIS A N    12 
ATOM 4426 C CA   . HIS A 1 20 ? -3.092  -2.136 1.379   1.00 0.00 ? 20 HIS A CA   12 
ATOM 4427 C C    . HIS A 1 20 ? -4.029  -0.907 1.266   1.00 0.00 ? 20 HIS A C    12 
ATOM 4428 O O    . HIS A 1 20 ? -5.111  -0.868 1.851   1.00 0.00 ? 20 HIS A O    12 
ATOM 4429 C CB   . HIS A 1 20 ? -2.606  -2.384 2.820   1.00 0.00 ? 20 HIS A CB   12 
ATOM 4430 C CG   . HIS A 1 20 ? -1.903  -1.263 3.599   1.00 0.00 ? 20 HIS A CG   12 
ATOM 4431 N ND1  . HIS A 1 20 ? -0.981  -1.443 4.547   1.00 0.00 ? 20 HIS A ND1  12 
ATOM 4432 C CD2  . HIS A 1 20 ? -2.202  0.040  3.600   1.00 0.00 ? 20 HIS A CD2  12 
ATOM 4433 C CE1  . HIS A 1 20 ? -0.697  -0.269 5.101   1.00 0.00 ? 20 HIS A CE1  12 
ATOM 4434 N NE2  . HIS A 1 20 ? -1.430  0.653  4.489   1.00 0.00 ? 20 HIS A NE2  12 
ATOM 4435 H H    . HIS A 1 20 ? -1.106  -1.791 0.750   1.00 0.00 ? 20 HIS A H    12 
ATOM 4436 H HD1  . HIS A 1 20 ? -0.571  -2.315 4.792   1.00 0.00 ? 20 HIS A HD1  12 
ATOM 4437 H HE2  . HIS A 1 20 ? -1.220  1.626  4.470   1.00 0.00 ? 20 HIS A HE2  12 
ATOM 4438 N N    . LEU A 1 21 ? -3.608  0.080  0.489   1.00 0.00 ? 21 LEU A N    12 
ATOM 4439 C CA   . LEU A 1 21 ? -4.342  1.349  0.239   1.00 0.00 ? 21 LEU A CA   12 
ATOM 4440 C C    . LEU A 1 21 ? -5.597  1.122  -0.624  1.00 0.00 ? 21 LEU A C    12 
ATOM 4441 O O    . LEU A 1 21 ? -6.702  1.457  -0.207  1.00 0.00 ? 21 LEU A O    12 
ATOM 4442 C CB   . LEU A 1 21 ? -3.365  2.353  -0.383  1.00 0.00 ? 21 LEU A CB   12 
ATOM 4443 C CG   . LEU A 1 21 ? -4.025  3.580  -1.034  1.00 0.00 ? 21 LEU A CG   12 
ATOM 4444 C CD1  . LEU A 1 21 ? -4.643  4.533  -0.013  1.00 0.00 ? 21 LEU A CD1  12 
ATOM 4445 C CD2  . LEU A 1 21 ? -3.013  4.300  -1.938  1.00 0.00 ? 21 LEU A CD2  12 
ATOM 4446 H H    . LEU A 1 21 ? -2.681  0.065  0.106   1.00 0.00 ? 21 LEU A H    12 
ATOM 4447 N N    . GLU A 1 22 ? -5.386  0.467  -1.767  1.00 0.00 ? 22 GLU A N    12 
ATOM 4448 C CA   . GLU A 1 22 ? -6.490  0.053  -2.657  1.00 0.00 ? 22 GLU A CA   12 
ATOM 4449 C C    . GLU A 1 22 ? -7.527  -0.828 -1.908  1.00 0.00 ? 22 GLU A C    12 
ATOM 4450 O O    . GLU A 1 22 ? -8.721  -0.730 -2.151  1.00 0.00 ? 22 GLU A O    12 
ATOM 4451 C CB   . GLU A 1 22 ? -5.874  -0.606 -3.894  1.00 0.00 ? 22 GLU A CB   12 
ATOM 4452 C CG   . GLU A 1 22 ? -6.882  -1.063 -4.962  1.00 0.00 ? 22 GLU A CG   12 
ATOM 4453 C CD   . GLU A 1 22 ? -7.603  -2.363 -4.558  1.00 0.00 ? 22 GLU A CD   12 
ATOM 4454 O OE1  . GLU A 1 22 ? -7.023  -3.297 -4.032  1.00 0.00 ? 22 GLU A OE1  12 
ATOM 4455 O OE2  . GLU A 1 22 ? -8.927  -2.425 -4.807  1.00 0.00 ? 22 GLU A OE2  12 
ATOM 4456 H H    . GLU A 1 22 ? -4.465  0.275  -2.100  1.00 0.00 ? 22 GLU A H    12 
ATOM 4457 H HE2  . GLU A 1 22 ? -9.184  -3.308 -4.424  1.00 0.00 ? 22 GLU A HE2  12 
ATOM 4458 N N    . ASN A 1 23 ? -7.042  -1.546 -0.893  1.00 0.00 ? 23 ASN A N    12 
ATOM 4459 C CA   . ASN A 1 23 ? -7.888  -2.393 -0.019  1.00 0.00 ? 23 ASN A CA   12 
ATOM 4460 C C    . ASN A 1 23 ? -8.948  -1.555 0.745   1.00 0.00 ? 23 ASN A C    12 
ATOM 4461 O O    . ASN A 1 23 ? -10.133 -1.856 0.669   1.00 0.00 ? 23 ASN A O    12 
ATOM 4462 C CB   . ASN A 1 23 ? -6.999  -3.124 0.968   1.00 0.00 ? 23 ASN A CB   12 
ATOM 4463 C CG   . ASN A 1 23 ? -7.452  -4.567 1.173   1.00 0.00 ? 23 ASN A CG   12 
ATOM 4464 O OD1  . ASN A 1 23 ? -8.522  -4.856 1.679   1.00 0.00 ? 23 ASN A OD1  12 
ATOM 4465 N ND2  . ASN A 1 23 ? -6.639  -5.482 0.717   1.00 0.00 ? 23 ASN A ND2  12 
ATOM 4466 H H    . ASN A 1 23 ? -6.085  -1.516 -0.642  1.00 0.00 ? 23 ASN A H    12 
ATOM 4467 H HD21 . ASN A 1 23 ? -5.775  -5.238 0.274   1.00 0.00 ? 23 ASN A HD21 12 
ATOM 4468 H HD22 . ASN A 1 23 ? -6.919  -6.431 0.824   1.00 0.00 ? 23 ASN A HD22 12 
ATOM 4469 N N    . GLU A 1 24 ? -8.513  -0.439 1.320   1.00 0.00 ? 24 GLU A N    12 
ATOM 4470 C CA   . GLU A 1 24 ? -9.411  0.505  2.028   1.00 0.00 ? 24 GLU A CA   12 
ATOM 4471 C C    . GLU A 1 24 ? -10.506 1.067  1.088   1.00 0.00 ? 24 GLU A C    12 
ATOM 4472 O O    . GLU A 1 24 ? -11.672 1.047  1.438   1.00 0.00 ? 24 GLU A O    12 
ATOM 4473 C CB   . GLU A 1 24 ? -8.594  1.655  2.630   1.00 0.00 ? 24 GLU A CB   12 
ATOM 4474 C CG   . GLU A 1 24 ? -9.449  2.502  3.582   1.00 0.00 ? 24 GLU A CG   12 
ATOM 4475 C CD   . GLU A 1 24 ? -8.899  2.528  5.011   1.00 0.00 ? 24 GLU A CD   12 
ATOM 4476 O OE1  . GLU A 1 24 ? -9.002  3.509  5.729   1.00 0.00 ? 24 GLU A OE1  12 
ATOM 4477 O OE2  . GLU A 1 24 ? -8.284  1.406  5.460   1.00 0.00 ? 24 GLU A OE2  12 
ATOM 4478 H H    . GLU A 1 24 ? -7.542  -0.197 1.355   1.00 0.00 ? 24 GLU A H    12 
ATOM 4479 H HE2  . GLU A 1 24 ? -7.987  1.656  6.380   1.00 0.00 ? 24 GLU A HE2  12 
ATOM 4480 N N    . VAL A 1 25 ? -10.066 1.556  -0.073  1.00 0.00 ? 25 VAL A N    12 
ATOM 4481 C CA   . VAL A 1 25 ? -10.956 1.965  -1.190  1.00 0.00 ? 25 VAL A CA   12 
ATOM 4482 C C    . VAL A 1 25 ? -12.099 0.940  -1.416  1.00 0.00 ? 25 VAL A C    12 
ATOM 4483 O O    . VAL A 1 25 ? -13.213 1.363  -1.457  1.00 0.00 ? 25 VAL A O    12 
ATOM 4484 C CB   . VAL A 1 25 ? -10.157 2.262  -2.473  1.00 0.00 ? 25 VAL A CB   12 
ATOM 4485 C CG1  . VAL A 1 25 ? -11.043 2.565  -3.684  1.00 0.00 ? 25 VAL A CG1  12 
ATOM 4486 C CG2  . VAL A 1 25 ? -9.242  3.471  -2.250  1.00 0.00 ? 25 VAL A CG2  12 
ATOM 4487 H H    . VAL A 1 25 ? -9.122  1.843  -0.191  1.00 0.00 ? 25 VAL A H    12 
ATOM 4488 N N    . ALA A 1 26 ? -11.787 -0.362 -1.324  1.00 0.00 ? 26 ALA A N    12 
ATOM 4489 C CA   . ALA A 1 26 ? -12.810 -1.425 -1.434  1.00 0.00 ? 26 ALA A CA   12 
ATOM 4490 C C    . ALA A 1 26 ? -13.815 -1.430 -0.254  1.00 0.00 ? 26 ALA A C    12 
ATOM 4491 O O    . ALA A 1 26 ? -15.005 -1.267 -0.511  1.00 0.00 ? 26 ALA A O    12 
ATOM 4492 C CB   . ALA A 1 26 ? -12.135 -2.790 -1.592  1.00 0.00 ? 26 ALA A CB   12 
ATOM 4493 H H    . ALA A 1 26 ? -10.857 -0.675 -1.149  1.00 0.00 ? 26 ALA A H    12 
ATOM 4494 N N    . ARG A 1 27 ? -13.339 -1.504 0.985   1.00 0.00 ? 27 ARG A N    12 
ATOM 4495 C CA   . ARG A 1 27 ? -14.200 -1.383 2.191   1.00 0.00 ? 27 ARG A CA   12 
ATOM 4496 C C    . ARG A 1 27 ? -15.086 -0.098 2.146   1.00 0.00 ? 27 ARG A C    12 
ATOM 4497 O O    . ARG A 1 27 ? -16.279 -0.182 2.394   1.00 0.00 ? 27 ARG A O    12 
ATOM 4498 C CB   . ARG A 1 27 ? -13.366 -1.498 3.464   1.00 0.00 ? 27 ARG A CB   12 
ATOM 4499 C CG   . ARG A 1 27 ? -14.116 -1.372 4.801   1.00 0.00 ? 27 ARG A CG   12 
ATOM 4500 C CD   . ARG A 1 27 ? -15.348 -2.275 4.960   1.00 0.00 ? 27 ARG A CD   12 
ATOM 4501 N NE   . ARG A 1 27 ? -16.508 -1.365 5.044   1.00 0.00 ? 27 ARG A NE   12 
ATOM 4502 C CZ   . ARG A 1 27 ? -17.443 -1.335 5.994   1.00 0.00 ? 27 ARG A CZ   12 
ATOM 4503 N NH1  . ARG A 1 27 ? -17.752 -2.383 6.741   1.00 0.00 ? 27 ARG A NH1  12 
ATOM 4504 N NH2  . ARG A 1 27 ? -17.852 -0.151 6.422   1.00 0.00 ? 27 ARG A NH2  12 
ATOM 4505 H H    . ARG A 1 27 ? -12.374 -1.724 1.178   1.00 0.00 ? 27 ARG A H    12 
ATOM 4506 H HE   . ARG A 1 27 ? -16.676 -0.837 4.208   1.00 0.00 ? 27 ARG A HE   12 
ATOM 4507 H HH11 . ARG A 1 27 ? -17.431 -3.287 6.465   1.00 0.00 ? 27 ARG A HH11 12 
ATOM 4508 H HH12 . ARG A 1 27 ? -18.420 -2.294 7.480   1.00 0.00 ? 27 ARG A HH12 12 
ATOM 4509 H HH21 . ARG A 1 27 ? -17.427 0.672  6.060   1.00 0.00 ? 27 ARG A HH21 12 
ATOM 4510 H HH22 . ARG A 1 27 ? -18.542 -0.086 7.136   1.00 0.00 ? 27 ARG A HH22 12 
ATOM 4511 N N    . LEU A 1 28 ? -14.516 0.983  1.655   1.00 0.00 ? 28 LEU A N    12 
ATOM 4512 C CA   . LEU A 1 28 ? -15.216 2.261  1.383   1.00 0.00 ? 28 LEU A CA   12 
ATOM 4513 C C    . LEU A 1 28 ? -16.232 2.131  0.221   1.00 0.00 ? 28 LEU A C    12 
ATOM 4514 O O    . LEU A 1 28 ? -17.415 2.472  0.391   1.00 0.00 ? 28 LEU A O    12 
ATOM 4515 C CB   . LEU A 1 28 ? -14.110 3.301  1.115   1.00 0.00 ? 28 LEU A CB   12 
ATOM 4516 C CG   . LEU A 1 28 ? -14.526 4.487  0.231   1.00 0.00 ? 28 LEU A CG   12 
ATOM 4517 C CD1  . LEU A 1 28 ? -15.459 5.447  0.979   1.00 0.00 ? 28 LEU A CD1  12 
ATOM 4518 C CD2  . LEU A 1 28 ? -13.284 5.226  -0.271  1.00 0.00 ? 28 LEU A CD2  12 
ATOM 4519 H H    . LEU A 1 28 ? -13.534 0.991  1.434   1.00 0.00 ? 28 LEU A H    12 
ATOM 4520 N N    . LYS A 1 29 ? -15.782 1.689  -0.918  1.00 0.00 ? 29 LYS A N    12 
ATOM 4521 C CA   . LYS A 1 29 ? -16.560 1.516  -2.155  1.00 0.00 ? 29 LYS A CA   12 
ATOM 4522 C C    . LYS A 1 29 ? -17.741 0.553  -1.904  1.00 0.00 ? 29 LYS A C    12 
ATOM 4523 O O    . LYS A 1 29 ? -18.811 0.819  -2.417  1.00 0.00 ? 29 LYS A O    12 
ATOM 4524 C CB   . LYS A 1 29 ? -15.692 0.986  -3.293  1.00 0.00 ? 29 LYS A CB   12 
ATOM 4525 C CG   . LYS A 1 29 ? -16.042 1.547  -4.687  1.00 0.00 ? 29 LYS A CG   12 
ATOM 4526 C CD   . LYS A 1 29 ? -17.505 1.327  -5.071  1.00 0.00 ? 29 LYS A CD   12 
ATOM 4527 C CE   . LYS A 1 29 ? -17.900 1.780  -6.479  1.00 0.00 ? 29 LYS A CE   12 
ATOM 4528 N NZ   . LYS A 1 29 ? -17.533 3.187  -6.700  1.00 0.00 ? 29 LYS A NZ   12 
ATOM 4529 H H    . LYS A 1 29 ? -14.777 1.526  -1.061  1.00 0.00 ? 29 LYS A H    12 
ATOM 4530 H HZ1  . LYS A 1 29 ? -17.909 3.768  -5.977  1.00 0.00 ? 29 LYS A HZ1  12 
ATOM 4531 H HZ2  . LYS A 1 29 ? -16.528 3.249  -6.700  1.00 0.00 ? 29 LYS A HZ2  12 
ATOM 4532 H HZ3  . LYS A 1 29 ? -17.888 3.481  -7.578  1.00 0.00 ? 29 LYS A HZ3  12 
ATOM 4533 N N    . LYS A 1 30 ? -17.603 -0.411 -1.009  1.00 0.00 ? 30 LYS A N    12 
ATOM 4534 C CA   . LYS A 1 30 ? -18.735 -1.282 -0.617  1.00 0.00 ? 30 LYS A CA   12 
ATOM 4535 C C    . LYS A 1 30 ? -19.973 -0.446 -0.165  1.00 0.00 ? 30 LYS A C    12 
ATOM 4536 O O    . LYS A 1 30 ? -21.070 -0.686 -0.642  1.00 0.00 ? 30 LYS A O    12 
ATOM 4537 C CB   . LYS A 1 30 ? -18.247 -2.381 0.345   1.00 0.00 ? 30 LYS A CB   12 
ATOM 4538 C CG   . LYS A 1 30 ? -18.521 -2.265 1.854   1.00 0.00 ? 30 LYS A CG   12 
ATOM 4539 C CD   . LYS A 1 30 ? -19.979 -2.597 2.192   1.00 0.00 ? 30 LYS A CD   12 
ATOM 4540 C CE   . LYS A 1 30 ? -20.199 -2.995 3.647   1.00 0.00 ? 30 LYS A CE   12 
ATOM 4541 N NZ   . LYS A 1 30 ? -19.900 -1.900 4.585   1.00 0.00 ? 30 LYS A NZ   12 
ATOM 4542 H H    . LYS A 1 30 ? -16.699 -0.682 -0.634  1.00 0.00 ? 30 LYS A H    12 
ATOM 4543 H HZ1  . LYS A 1 30 ? -18.946 -1.613 4.502   1.00 0.00 ? 30 LYS A HZ1  12 
ATOM 4544 H HZ2  . LYS A 1 30 ? -20.514 -1.134 4.424   1.00 0.00 ? 30 LYS A HZ2  12 
ATOM 4545 H HZ3  . LYS A 1 30 ? -20.028 -2.227 5.521   1.00 0.00 ? 30 LYS A HZ3  12 
ATOM 4546 N N    . LEU A 1 31 ? -19.689 0.683  0.492   1.00 0.00 ? 31 LEU A N    12 
ATOM 4547 C CA   . LEU A 1 31 ? -20.716 1.656  0.897   1.00 0.00 ? 31 LEU A CA   12 
ATOM 4548 C C    . LEU A 1 31 ? -21.300 2.427  -0.310  1.00 0.00 ? 31 LEU A C    12 
ATOM 4549 O O    . LEU A 1 31 ? -22.510 2.460  -0.469  1.00 0.00 ? 31 LEU A O    12 
ATOM 4550 C CB   . LEU A 1 31 ? -20.195 2.663  1.942   1.00 0.00 ? 31 LEU A CB   12 
ATOM 4551 C CG   . LEU A 1 31 ? -19.911 1.992  3.299   1.00 0.00 ? 31 LEU A CG   12 
ATOM 4552 C CD1  . LEU A 1 31 ? -18.454 1.555  3.418   1.00 0.00 ? 31 LEU A CD1  12 
ATOM 4553 C CD2  . LEU A 1 31 ? -20.250 2.946  4.438   1.00 0.00 ? 31 LEU A CD2  12 
ATOM 4554 H H    . LEU A 1 31 ? -18.743 0.975  0.661   1.00 0.00 ? 31 LEU A H    12 
ATOM 4555 N N    . VAL A 1 32 ? -20.446 2.817  -1.244  1.00 0.00 ? 32 VAL A N    12 
ATOM 4556 C CA   . VAL A 1 32 ? -20.854 3.489  -2.523  1.00 0.00 ? 32 VAL A CA   12 
ATOM 4557 C C    . VAL A 1 32 ? -21.298 2.452  -3.597  1.00 0.00 ? 32 VAL A C    12 
ATOM 4558 O O    . VAL A 1 32 ? -21.676 2.829  -4.716  1.00 0.00 ? 32 VAL A O    12 
ATOM 4559 C CB   . VAL A 1 32 ? -19.711 4.418  -2.977  1.00 0.00 ? 32 VAL A CB   12 
ATOM 4560 C CG1  . VAL A 1 32 ? -19.991 5.189  -4.275  1.00 0.00 ? 32 VAL A CG1  12 
ATOM 4561 C CG2  . VAL A 1 32 ? -19.391 5.483  -1.903  1.00 0.00 ? 32 VAL A CG2  12 
ATOM 4562 H H    . VAL A 1 32 ? -19.468 2.619  -1.185  1.00 0.00 ? 32 VAL A H    12 
ATOM 4563 N N    . GLY A 1 33 ? -21.386 1.198  -3.210  1.00 0.00 ? 33 GLY A N    12 
ATOM 4564 C CA   . GLY A 1 33 ? -21.795 0.064  -4.076  1.00 0.00 ? 33 GLY A CA   12 
ATOM 4565 C C    . GLY A 1 33 ? -23.314 -0.153 -4.022  1.00 0.00 ? 33 GLY A C    12 
ATOM 4566 O O    . GLY A 1 33 ? -23.932 -0.490 -5.029  1.00 0.00 ? 33 GLY A O    12 
ATOM 4567 H H    . GLY A 1 33 ? -21.012 0.913  -2.326  1.00 0.00 ? 33 GLY A H    12 
ATOM 4568 N N    . GLU A 1 34 ? -23.838 -0.064 -2.813  1.00 0.00 ? 34 GLU A N    12 
ATOM 4569 C CA   . GLU A 1 34 ? -25.294 -0.170 -2.549  1.00 0.00 ? 34 GLU A CA   12 
ATOM 4570 C C    . GLU A 1 34 ? -25.919 0.955  -1.686  1.00 0.00 ? 34 GLU A C    12 
ATOM 4571 O O    . GLU A 1 34 ? -27.080 0.868  -1.301  1.00 0.00 ? 34 GLU A O    12 
ATOM 4572 C CB   . GLU A 1 34 ? -25.625 -1.529 -1.949  1.00 0.00 ? 34 GLU A CB   12 
ATOM 4573 C CG   . GLU A 1 34 ? -25.939 -2.552 -3.039  1.00 0.00 ? 34 GLU A CG   12 
ATOM 4574 C CD   . GLU A 1 34 ? -26.970 -3.578 -2.578  1.00 0.00 ? 34 GLU A CD   12 
ATOM 4575 O OE1  . GLU A 1 34 ? -26.928 -4.753 -2.905  1.00 0.00 ? 34 GLU A OE1  12 
ATOM 4576 O OE2  . GLU A 1 34 ? -27.980 -3.132 -1.800  1.00 0.00 ? 34 GLU A OE2  12 
ATOM 4577 H H    . GLU A 1 34 ? -23.265 -0.002 -1.996  1.00 0.00 ? 34 GLU A H    12 
ATOM 4578 H HE2  . GLU A 1 34 ? -28.525 -3.949 -1.614  1.00 0.00 ? 34 GLU A HE2  12 
ATOM 4579 N N    . ARG A 1 35 ? -25.167 2.031  -1.482  1.00 0.00 ? 35 ARG A N    12 
ATOM 4580 C CA   . ARG A 1 35 ? -25.556 3.224  -0.680  1.00 0.00 ? 35 ARG A CA   12 
ATOM 4581 C C    . ARG A 1 35 ? -26.270 2.870  0.644   1.00 0.00 ? 35 ARG A C    12 
ATOM 4582 O O    . ARG A 1 35 ? -25.528 2.526  1.610   1.00 0.00 ? 35 ARG A O    12 
ATOM 4583 C CB   . ARG A 1 35 ? -26.350 4.284  -1.465  1.00 0.00 ? 35 ARG A CB   12 
ATOM 4584 C CG   . ARG A 1 35 ? -25.995 4.500  -2.946  1.00 0.00 ? 35 ARG A CG   12 
ATOM 4585 C CD   . ARG A 1 35 ? -26.829 3.533  -3.794  1.00 0.00 ? 35 ARG A CD   12 
ATOM 4586 N NE   . ARG A 1 35 ? -26.720 3.623  -5.260  1.00 0.00 ? 35 ARG A NE   12 
ATOM 4587 C CZ   . ARG A 1 35 ? -25.645 3.509  -6.040  1.00 0.00 ? 35 ARG A CZ   12 
ATOM 4588 N NH1  . ARG A 1 35 ? -24.410 3.736  -5.616  1.00 0.00 ? 35 ARG A NH1  12 
ATOM 4589 N NH2  . ARG A 1 35 ? -25.741 2.719  -7.101  1.00 0.00 ? 35 ARG A NH2  12 
ATOM 4590 O OXT  . ARG A 1 35 ? -27.512 2.925  0.705   1.00 0.00 ? 35 ARG A OXT  12 
ATOM 4591 H H    . ARG A 1 35 ? -24.238 2.077  -1.841  1.00 0.00 ? 35 ARG A H    12 
ATOM 4592 H HE   . ARG A 1 35 ? -27.574 3.865  -5.716  1.00 0.00 ? 35 ARG A HE   12 
ATOM 4593 H HH11 . ARG A 1 35 ? -24.271 4.180  -4.729  1.00 0.00 ? 35 ARG A HH11 12 
ATOM 4594 H HH12 . ARG A 1 35 ? -23.625 3.559  -6.206  1.00 0.00 ? 35 ARG A HH12 12 
ATOM 4595 H HH21 . ARG A 1 35 ? -26.571 2.183  -7.242  1.00 0.00 ? 35 ARG A HH21 12 
ATOM 4596 H HH22 . ARG A 1 35 ? -24.950 2.587  -7.693  1.00 0.00 ? 35 ARG A HH22 12 
ATOM 4597 N N    . LEU A 1 1  ? 18.235  9.469  2.660   1.00 0.00 ? 1  LEU A N    13 
ATOM 4598 C CA   . LEU A 1 1  ? 18.091  8.219  1.894   1.00 0.00 ? 1  LEU A CA   13 
ATOM 4599 C C    . LEU A 1 1  ? 19.173  8.062  0.793   1.00 0.00 ? 1  LEU A C    13 
ATOM 4600 O O    . LEU A 1 1  ? 19.493  8.997  0.057   1.00 0.00 ? 1  LEU A O    13 
ATOM 4601 C CB   . LEU A 1 1  ? 16.657  8.076  1.343   1.00 0.00 ? 1  LEU A CB   13 
ATOM 4602 C CG   . LEU A 1 1  ? 16.339  8.838  0.045   1.00 0.00 ? 1  LEU A CG   13 
ATOM 4603 C CD1  . LEU A 1 1  ? 15.073  8.272  -0.593  1.00 0.00 ? 1  LEU A CD1  13 
ATOM 4604 C CD2  . LEU A 1 1  ? 16.181  10.349 0.241   1.00 0.00 ? 1  LEU A CD2  13 
ATOM 4605 H H1   . LEU A 1 1  ? 18.169  10.245 2.034   1.00 0.00 ? 1  LEU A H1   13 
ATOM 4606 H H2   . LEU A 1 1  ? 17.497  9.525  3.341   1.00 0.00 ? 1  LEU A H2   13 
ATOM 4607 H H3   . LEU A 1 1  ? 19.114  9.487  3.132   1.00 0.00 ? 1  LEU A H3   13 
ATOM 4608 N N    . GLN A 1 2  ? 19.802  6.893  0.810   1.00 0.00 ? 2  GLN A N    13 
ATOM 4609 C CA   . GLN A 1 2  ? 20.884  6.531  -0.135  1.00 0.00 ? 2  GLN A CA   13 
ATOM 4610 C C    . GLN A 1 2  ? 20.957  4.997  -0.246  1.00 0.00 ? 2  GLN A C    13 
ATOM 4611 O O    . GLN A 1 2  ? 20.248  4.296  0.488   1.00 0.00 ? 2  GLN A O    13 
ATOM 4612 C CB   . GLN A 1 2  ? 22.209  7.118  0.365   1.00 0.00 ? 2  GLN A CB   13 
ATOM 4613 C CG   . GLN A 1 2  ? 23.344  6.996  -0.671  1.00 0.00 ? 2  GLN A CG   13 
ATOM 4614 C CD   . GLN A 1 2  ? 24.697  7.515  -0.201  1.00 0.00 ? 2  GLN A CD   13 
ATOM 4615 O OE1  . GLN A 1 2  ? 25.625  7.669  -0.984  1.00 0.00 ? 2  GLN A OE1  13 
ATOM 4616 N NE2  . GLN A 1 2  ? 24.896  7.720  1.091   1.00 0.00 ? 2  GLN A NE2  13 
ATOM 4617 H H    . GLN A 1 2  ? 19.527  6.153  1.418   1.00 0.00 ? 2  GLN A H    13 
ATOM 4618 H HE21 . GLN A 1 2  ? 24.160  7.502  1.742   1.00 0.00 ? 2  GLN A HE21 13 
ATOM 4619 H HE22 . GLN A 1 2  ? 25.766  8.077  1.361   1.00 0.00 ? 2  GLN A HE22 13 
ATOM 4620 N N    . ARG A 1 3  ? 21.575  4.563  -1.350  1.00 0.00 ? 3  ARG A N    13 
ATOM 4621 C CA   . ARG A 1 3  ? 21.975  3.168  -1.663  1.00 0.00 ? 3  ARG A CA   13 
ATOM 4622 C C    . ARG A 1 3  ? 20.817  2.454  -2.381  1.00 0.00 ? 3  ARG A C    13 
ATOM 4623 O O    . ARG A 1 3  ? 19.737  2.368  -1.813  1.00 0.00 ? 3  ARG A O    13 
ATOM 4624 C CB   . ARG A 1 3  ? 22.380  2.416  -0.388  1.00 0.00 ? 3  ARG A CB   13 
ATOM 4625 C CG   . ARG A 1 3  ? 23.325  1.239  -0.598  1.00 0.00 ? 3  ARG A CG   13 
ATOM 4626 C CD   . ARG A 1 3  ? 24.668  1.729  -1.137  1.00 0.00 ? 3  ARG A CD   13 
ATOM 4627 N NE   . ARG A 1 3  ? 24.765  1.451  -2.579  1.00 0.00 ? 3  ARG A NE   13 
ATOM 4628 C CZ   . ARG A 1 3  ? 25.098  0.262  -3.108  1.00 0.00 ? 3  ARG A CZ   13 
ATOM 4629 N NH1  . ARG A 1 3  ? 25.173  -0.830 -2.361  1.00 0.00 ? 3  ARG A NH1  13 
ATOM 4630 N NH2  . ARG A 1 3  ? 25.659  0.225  -4.301  1.00 0.00 ? 3  ARG A NH2  13 
ATOM 4631 H H    . ARG A 1 3  ? 21.798  5.219  -2.059  1.00 0.00 ? 3  ARG A H    13 
ATOM 4632 H HE   . ARG A 1 3  ? 24.548  2.201  -3.193  1.00 0.00 ? 3  ARG A HE   13 
ATOM 4633 H HH11 . ARG A 1 3  ? 24.925  -0.770 -1.389  1.00 0.00 ? 3  ARG A HH11 13 
ATOM 4634 H HH12 . ARG A 1 3  ? 25.464  -1.696 -2.750  1.00 0.00 ? 3  ARG A HH12 13 
ATOM 4635 H HH21 . ARG A 1 3  ? 25.864  1.072  -4.786  1.00 0.00 ? 3  ARG A HH21 13 
ATOM 4636 H HH22 . ARG A 1 3  ? 25.935  -0.656 -4.678  1.00 0.00 ? 3  ARG A HH22 13 
ATOM 4637 N N    . MET A 1 4  ? 21.026  1.993  -3.597  1.00 0.00 ? 4  MET A N    13 
ATOM 4638 C CA   . MET A 1 4  ? 19.940  1.307  -4.365  1.00 0.00 ? 4  MET A CA   13 
ATOM 4639 C C    . MET A 1 4  ? 19.350  0.080  -3.645  1.00 0.00 ? 4  MET A C    13 
ATOM 4640 O O    . MET A 1 4  ? 18.137  -0.110 -3.691  1.00 0.00 ? 4  MET A O    13 
ATOM 4641 C CB   . MET A 1 4  ? 20.392  0.967  -5.788  1.00 0.00 ? 4  MET A CB   13 
ATOM 4642 C CG   . MET A 1 4  ? 20.904  2.187  -6.574  1.00 0.00 ? 4  MET A CG   13 
ATOM 4643 S SD   . MET A 1 4  ? 19.826  3.660  -6.535  1.00 0.00 ? 4  MET A SD   13 
ATOM 4644 C CE   . MET A 1 4  ? 20.817  4.749  -5.526  1.00 0.00 ? 4  MET A CE   13 
ATOM 4645 H H    . MET A 1 4  ? 21.842  2.201  -4.132  1.00 0.00 ? 4  MET A H    13 
ATOM 4646 N N    . LYS A 1 5  ? 20.205  -0.551 -2.844  1.00 0.00 ? 5  LYS A N    13 
ATOM 4647 C CA   . LYS A 1 5  ? 19.851  -1.648 -1.913  1.00 0.00 ? 5  LYS A CA   13 
ATOM 4648 C C    . LYS A 1 5  ? 19.073  -1.182 -0.653  1.00 0.00 ? 5  LYS A C    13 
ATOM 4649 O O    . LYS A 1 5  ? 18.390  -1.985 -0.014  1.00 0.00 ? 5  LYS A O    13 
ATOM 4650 C CB   . LYS A 1 5  ? 21.157  -2.383 -1.580  1.00 0.00 ? 5  LYS A CB   13 
ATOM 4651 C CG   . LYS A 1 5  ? 20.974  -3.596 -0.663  1.00 0.00 ? 5  LYS A CG   13 
ATOM 4652 C CD   . LYS A 1 5  ? 21.128  -3.239 0.827   1.00 0.00 ? 5  LYS A CD   13 
ATOM 4653 C CE   . LYS A 1 5  ? 22.590  -3.161 1.258   1.00 0.00 ? 5  LYS A CE   13 
ATOM 4654 N NZ   . LYS A 1 5  ? 23.120  -4.531 1.169   1.00 0.00 ? 5  LYS A NZ   13 
ATOM 4655 H H    . LYS A 1 5  ? 21.168  -0.306 -2.857  1.00 0.00 ? 5  LYS A H    13 
ATOM 4656 H HZ1  . LYS A 1 5  ? 23.030  -4.848 0.221   1.00 0.00 ? 5  LYS A HZ1  13 
ATOM 4657 H HZ2  . LYS A 1 5  ? 24.082  -4.540 1.437   1.00 0.00 ? 5  LYS A HZ2  13 
ATOM 4658 H HZ3  . LYS A 1 5  ? 22.591  -5.124 1.779   1.00 0.00 ? 5  LYS A HZ3  13 
ATOM 4659 N N    . GLN A 1 6  ? 19.041  0.122  -0.437  1.00 0.00 ? 6  GLN A N    13 
ATOM 4660 C CA   . GLN A 1 6  ? 18.260  0.739  0.662   1.00 0.00 ? 6  GLN A CA   13 
ATOM 4661 C C    . GLN A 1 6  ? 17.081  1.610  0.174   1.00 0.00 ? 6  GLN A C    13 
ATOM 4662 O O    . GLN A 1 6  ? 16.000  1.564  0.752   1.00 0.00 ? 6  GLN A O    13 
ATOM 4663 C CB   . GLN A 1 6  ? 19.169  1.526  1.595   1.00 0.00 ? 6  GLN A CB   13 
ATOM 4664 C CG   . GLN A 1 6  ? 20.235  0.627  2.228   1.00 0.00 ? 6  GLN A CG   13 
ATOM 4665 C CD   . GLN A 1 6  ? 20.994  1.360  3.321   1.00 0.00 ? 6  GLN A CD   13 
ATOM 4666 O OE1  . GLN A 1 6  ? 21.998  2.023  3.114   1.00 0.00 ? 6  GLN A OE1  13 
ATOM 4667 N NE2  . GLN A 1 6  ? 20.487  1.237  4.532   1.00 0.00 ? 6  GLN A NE2  13 
ATOM 4668 H H    . GLN A 1 6  ? 19.539  0.770  -1.012  1.00 0.00 ? 6  GLN A H    13 
ATOM 4669 H HE21 . GLN A 1 6  ? 19.663  0.698  4.670   1.00 0.00 ? 6  GLN A HE21 13 
ATOM 4670 H HE22 . GLN A 1 6  ? 20.969  1.697  5.270   1.00 0.00 ? 6  GLN A HE22 13 
ATOM 4671 N N    . LEU A 1 7  ? 17.260  2.324  -0.929  1.00 0.00 ? 7  LEU A N    13 
ATOM 4672 C CA   . LEU A 1 7  ? 16.193  3.131  -1.565  1.00 0.00 ? 7  LEU A CA   13 
ATOM 4673 C C    . LEU A 1 7  ? 14.942  2.328  -1.934  1.00 0.00 ? 7  LEU A C    13 
ATOM 4674 O O    . LEU A 1 7  ? 13.854  2.654  -1.494  1.00 0.00 ? 7  LEU A O    13 
ATOM 4675 C CB   . LEU A 1 7  ? 16.696  3.908  -2.797  1.00 0.00 ? 7  LEU A CB   13 
ATOM 4676 C CG   . LEU A 1 7  ? 17.833  4.876  -2.456  1.00 0.00 ? 7  LEU A CG   13 
ATOM 4677 C CD1  . LEU A 1 7  ? 18.067  5.860  -3.600  1.00 0.00 ? 7  LEU A CD1  13 
ATOM 4678 C CD2  . LEU A 1 7  ? 17.571  5.668  -1.190  1.00 0.00 ? 7  LEU A CD2  13 
ATOM 4679 H H    . LEU A 1 7  ? 18.182  2.477  -1.299  1.00 0.00 ? 7  LEU A H    13 
ATOM 4680 N N    . GLU A 1 8  ? 15.189  1.156  -2.507  1.00 0.00 ? 8  GLU A N    13 
ATOM 4681 C CA   . GLU A 1 8  ? 14.118  0.176  -2.806  1.00 0.00 ? 8  GLU A CA   13 
ATOM 4682 C C    . GLU A 1 8  ? 13.482  -0.391 -1.513  1.00 0.00 ? 8  GLU A C    13 
ATOM 4683 O O    . GLU A 1 8  ? 12.286  -0.621 -1.496  1.00 0.00 ? 8  GLU A O    13 
ATOM 4684 C CB   . GLU A 1 8  ? 14.640  -0.900 -3.777  1.00 0.00 ? 8  GLU A CB   13 
ATOM 4685 C CG   . GLU A 1 8  ? 15.136  -2.247 -3.203  1.00 0.00 ? 8  GLU A CG   13 
ATOM 4686 C CD   . GLU A 1 8  ? 16.171  -2.141 -2.075  1.00 0.00 ? 8  GLU A CD   13 
ATOM 4687 O OE1  . GLU A 1 8  ? 16.653  -1.068 -1.736  1.00 0.00 ? 8  GLU A OE1  13 
ATOM 4688 O OE2  . GLU A 1 8  ? 16.360  -3.223 -1.299  1.00 0.00 ? 8  GLU A OE2  13 
ATOM 4689 H H    . GLU A 1 8  ? 16.121  0.838  -2.688  1.00 0.00 ? 8  GLU A H    13 
ATOM 4690 H HE2  . GLU A 1 8  ? 17.072  -2.915 -0.650  1.00 0.00 ? 8  GLU A HE2  13 
ATOM 4691 N N    . ASP A 1 9  ? 14.258  -0.487 -0.421  1.00 0.00 ? 9  ASP A N    13 
ATOM 4692 C CA   . ASP A 1 9  ? 13.765  -0.963 0.892   1.00 0.00 ? 9  ASP A CA   13 
ATOM 4693 C C    . ASP A 1 9  ? 12.780  0.056  1.493   1.00 0.00 ? 9  ASP A C    13 
ATOM 4694 O O    . ASP A 1 9  ? 11.667  -0.290 1.893   1.00 0.00 ? 9  ASP A O    13 
ATOM 4695 C CB   . ASP A 1 9  ? 14.925  -1.322 1.856   1.00 0.00 ? 9  ASP A CB   13 
ATOM 4696 C CG   . ASP A 1 9  ? 15.335  -0.313 2.942   1.00 0.00 ? 9  ASP A CG   13 
ATOM 4697 O OD1  . ASP A 1 9  ? 16.487  0.068  3.123   1.00 0.00 ? 9  ASP A OD1  13 
ATOM 4698 O OD2  . ASP A 1 9  ? 14.375  0.100  3.801   1.00 0.00 ? 9  ASP A OD2  13 
ATOM 4699 H H    . ASP A 1 9  ? 15.230  -0.257 -0.451  1.00 0.00 ? 9  ASP A H    13 
ATOM 4700 H HD2  . ASP A 1 9  ? 14.837  0.775  4.374   1.00 0.00 ? 9  ASP A HD2  13 
ATOM 4701 N N    . LYS A 1 10 ? 13.154  1.325  1.338   1.00 0.00 ? 10 LYS A N    13 
ATOM 4702 C CA   . LYS A 1 10 ? 12.333  2.483  1.725   1.00 0.00 ? 10 LYS A CA   13 
ATOM 4703 C C    . LYS A 1 10 ? 11.070  2.562  0.856   1.00 0.00 ? 10 LYS A C    13 
ATOM 4704 O O    . LYS A 1 10 ? 9.963   2.649  1.372   1.00 0.00 ? 10 LYS A O    13 
ATOM 4705 C CB   . LYS A 1 10 ? 13.275  3.703  1.664   1.00 0.00 ? 10 LYS A CB   13 
ATOM 4706 C CG   . LYS A 1 10 ? 12.637  5.093  1.752   1.00 0.00 ? 10 LYS A CG   13 
ATOM 4707 C CD   . LYS A 1 10 ? 12.199  5.565  0.366   1.00 0.00 ? 10 LYS A CD   13 
ATOM 4708 C CE   . LYS A 1 10 ? 11.765  7.032  0.319   1.00 0.00 ? 10 LYS A CE   13 
ATOM 4709 N NZ   . LYS A 1 10 ? 10.576  7.291  1.152   1.00 0.00 ? 10 LYS A NZ   13 
ATOM 4710 H H    . LYS A 1 10 ? 14.045  1.551  0.932   1.00 0.00 ? 10 LYS A H    13 
ATOM 4711 H HZ1  . LYS A 1 10 ? 10.777  7.055  2.095   1.00 0.00 ? 10 LYS A HZ1  13 
ATOM 4712 H HZ2  . LYS A 1 10 ? 10.359  8.259  1.093   1.00 0.00 ? 10 LYS A HZ2  13 
ATOM 4713 H HZ3  . LYS A 1 10 ? 9.804   6.755  0.819   1.00 0.00 ? 10 LYS A HZ3  13 
ATOM 4714 N N    . VAL A 1 11 ? 11.219  2.339  -0.454  1.00 0.00 ? 11 VAL A N    13 
ATOM 4715 C CA   . VAL A 1 11 ? 10.076  2.284  -1.393  1.00 0.00 ? 11 VAL A CA   13 
ATOM 4716 C C    . VAL A 1 11 ? 9.158   1.072  -1.126  1.00 0.00 ? 11 VAL A C    13 
ATOM 4717 O O    . VAL A 1 11 ? 7.946   1.169  -1.249  1.00 0.00 ? 11 VAL A O    13 
ATOM 4718 C CB   . VAL A 1 11 ? 10.597  2.372  -2.850  1.00 0.00 ? 11 VAL A CB   13 
ATOM 4719 C CG1  . VAL A 1 11 ? 9.529   2.105  -3.909  1.00 0.00 ? 11 VAL A CG1  13 
ATOM 4720 C CG2  . VAL A 1 11 ? 11.175  3.770  -3.112  1.00 0.00 ? 11 VAL A CG2  13 
ATOM 4721 H H    . VAL A 1 11 ? 12.126  2.269  -0.876  1.00 0.00 ? 11 VAL A H    13 
ATOM 4722 N N    . GLU A 1 12 ? 9.754   -0.033 -0.702  1.00 0.00 ? 12 GLU A N    13 
ATOM 4723 C CA   . GLU A 1 12 ? 9.011   -1.274 -0.379  1.00 0.00 ? 12 GLU A CA   13 
ATOM 4724 C C    . GLU A 1 12 ? 7.974   -1.045 0.746   1.00 0.00 ? 12 GLU A C    13 
ATOM 4725 O O    . GLU A 1 12 ? 6.840   -1.481 0.574   1.00 0.00 ? 12 GLU A O    13 
ATOM 4726 C CB   . GLU A 1 12 ? 9.968   -2.396 -0.015  1.00 0.00 ? 12 GLU A CB   13 
ATOM 4727 C CG   . GLU A 1 12 ? 9.362   -3.752 -0.370  1.00 0.00 ? 12 GLU A CG   13 
ATOM 4728 C CD   . GLU A 1 12 ? 10.192  -4.914 0.165   1.00 0.00 ? 12 GLU A CD   13 
ATOM 4729 O OE1  . GLU A 1 12 ? 10.445  -5.055 1.354   1.00 0.00 ? 12 GLU A OE1  13 
ATOM 4730 O OE2  . GLU A 1 12 ? 10.586  -5.846 -0.733  1.00 0.00 ? 12 GLU A OE2  13 
ATOM 4731 H H    . GLU A 1 12 ? 10.748  -0.153 -0.718  1.00 0.00 ? 12 GLU A H    13 
ATOM 4732 H HE2  . GLU A 1 12 ? 11.062  -6.518 -0.172  1.00 0.00 ? 12 GLU A HE2  13 
ATOM 4733 N N    . GLU A 1 13 ? 8.317   -0.195 1.721   1.00 0.00 ? 13 GLU A N    13 
ATOM 4734 C CA   . GLU A 1 13 ? 7.383   0.243  2.795   1.00 0.00 ? 13 GLU A CA   13 
ATOM 4735 C C    . GLU A 1 13 ? 6.075   0.825  2.219   1.00 0.00 ? 13 GLU A C    13 
ATOM 4736 O O    . GLU A 1 13 ? 4.991   0.497  2.681   1.00 0.00 ? 13 GLU A O    13 
ATOM 4737 C CB   . GLU A 1 13 ? 8.115   1.209  3.753   1.00 0.00 ? 13 GLU A CB   13 
ATOM 4738 C CG   . GLU A 1 13 ? 7.868   2.711  3.545   1.00 0.00 ? 13 GLU A CG   13 
ATOM 4739 C CD   . GLU A 1 13 ? 9.008   3.615  4.037   1.00 0.00 ? 13 GLU A CD   13 
ATOM 4740 O OE1  . GLU A 1 13 ? 9.669   3.384  5.033   1.00 0.00 ? 13 GLU A OE1  13 
ATOM 4741 O OE2  . GLU A 1 13 ? 9.207   4.754  3.326   1.00 0.00 ? 13 GLU A OE2  13 
ATOM 4742 H H    . GLU A 1 13 ? 9.251   0.147  1.813   1.00 0.00 ? 13 GLU A H    13 
ATOM 4743 H HE2  . GLU A 1 13 ? 9.998   5.155  3.788   1.00 0.00 ? 13 GLU A HE2  13 
ATOM 4744 N N    . LEU A 1 14 ? 6.222   1.525  1.090   1.00 0.00 ? 14 LEU A N    13 
ATOM 4745 C CA   . LEU A 1 14 ? 5.095   2.175  0.381   1.00 0.00 ? 14 LEU A CA   13 
ATOM 4746 C C    . LEU A 1 14 ? 4.203   1.089  -0.236  1.00 0.00 ? 14 LEU A C    13 
ATOM 4747 O O    . LEU A 1 14 ? 3.111   0.913  0.247   1.00 0.00 ? 14 LEU A O    13 
ATOM 4748 C CB   . LEU A 1 14 ? 5.535   3.134  -0.721  1.00 0.00 ? 14 LEU A CB   13 
ATOM 4749 C CG   . LEU A 1 14 ? 6.560   4.186  -0.290  1.00 0.00 ? 14 LEU A CG   13 
ATOM 4750 C CD1  . LEU A 1 14 ? 6.879   5.071  -1.491  1.00 0.00 ? 14 LEU A CD1  13 
ATOM 4751 C CD2  . LEU A 1 14 ? 6.093   5.042  0.887   1.00 0.00 ? 14 LEU A CD2  13 
ATOM 4752 H H    . LEU A 1 14 ? 7.098   1.566  0.605   1.00 0.00 ? 14 LEU A H    13 
ATOM 4753 N N    . LEU A 1 15 ? 4.755   0.273  -1.120  1.00 0.00 ? 15 LEU A N    13 
ATOM 4754 C CA   . LEU A 1 15 ? 4.005   -0.834 -1.765  1.00 0.00 ? 15 LEU A CA   13 
ATOM 4755 C C    . LEU A 1 15 ? 3.376   -1.788 -0.735  1.00 0.00 ? 15 LEU A C    13 
ATOM 4756 O O    . LEU A 1 15 ? 2.160   -1.938 -0.748  1.00 0.00 ? 15 LEU A O    13 
ATOM 4757 C CB   . LEU A 1 15 ? 4.879   -1.630 -2.743  1.00 0.00 ? 15 LEU A CB   13 
ATOM 4758 C CG   . LEU A 1 15 ? 5.774   -0.769 -3.651  1.00 0.00 ? 15 LEU A CG   13 
ATOM 4759 C CD1  . LEU A 1 15 ? 6.439   -1.682 -4.666  1.00 0.00 ? 15 LEU A CD1  13 
ATOM 4760 C CD2  . LEU A 1 15 ? 5.037   0.364  -4.389  1.00 0.00 ? 15 LEU A CD2  13 
ATOM 4761 H H    . LEU A 1 15 ? 5.663   0.448  -1.504  1.00 0.00 ? 15 LEU A H    13 
ATOM 4762 N N    . SER A 1 16 ? 4.163   -2.198 0.250   1.00 0.00 ? 16 SER A N    13 
ATOM 4763 C CA   . SER A 1 16 ? 3.718   -3.020 1.401   1.00 0.00 ? 16 SER A CA   13 
ATOM 4764 C C    . SER A 1 16 ? 2.437   -2.458 2.077   1.00 0.00 ? 16 SER A C    13 
ATOM 4765 O O    . SER A 1 16 ? 1.479   -3.191 2.291   1.00 0.00 ? 16 SER A O    13 
ATOM 4766 C CB   . SER A 1 16 ? 4.853   -3.106 2.425   1.00 0.00 ? 16 SER A CB   13 
ATOM 4767 O OG   . SER A 1 16 ? 4.554   -4.060 3.455   1.00 0.00 ? 16 SER A OG   13 
ATOM 4768 H H    . SER A 1 16 ? 5.140   -1.975 0.252   1.00 0.00 ? 16 SER A H    13 
ATOM 4769 H HG   . SER A 1 16 ? 5.338   -4.125 4.081   1.00 0.00 ? 16 SER A HG   13 
ATOM 4770 N N    . LYS A 1 17 ? 2.383   -1.128 2.152   1.00 0.00 ? 17 LYS A N    13 
ATOM 4771 C CA   . LYS A 1 17 ? 1.167   -0.408 2.614   1.00 0.00 ? 17 LYS A CA   13 
ATOM 4772 C C    . LYS A 1 17 ? 0.134   -0.139 1.502   1.00 0.00 ? 17 LYS A C    13 
ATOM 4773 O O    . LYS A 1 17 ? -1.050  -0.384 1.686   1.00 0.00 ? 17 LYS A O    13 
ATOM 4774 C CB   . LYS A 1 17 ? 1.506   0.860  3.430   1.00 0.00 ? 17 LYS A CB   13 
ATOM 4775 C CG   . LYS A 1 17 ? 1.649   2.179  2.665   1.00 0.00 ? 17 LYS A CG   13 
ATOM 4776 C CD   . LYS A 1 17 ? 1.653   3.412  3.566   1.00 0.00 ? 17 LYS A CD   13 
ATOM 4777 C CE   . LYS A 1 17 ? 0.304   3.674  4.239   1.00 0.00 ? 17 LYS A CE   13 
ATOM 4778 N NZ   . LYS A 1 17 ? 0.466   3.558  5.699   1.00 0.00 ? 17 LYS A NZ   13 
ATOM 4779 H H    . LYS A 1 17 ? 3.155   -0.545 1.911   1.00 0.00 ? 17 LYS A H    13 
ATOM 4780 H HZ1  . LYS A 1 17 ? 1.198   4.174  5.986   1.00 0.00 ? 17 LYS A HZ1  13 
ATOM 4781 H HZ2  . LYS A 1 17 ? -0.391  3.813  6.150   1.00 0.00 ? 17 LYS A HZ2  13 
ATOM 4782 H HZ3  . LYS A 1 17 ? 0.705   2.621  5.941   1.00 0.00 ? 17 LYS A HZ3  13 
ATOM 4783 N N    . ASN A 1 18 ? 0.558   0.313  0.334   1.00 0.00 ? 18 ASN A N    13 
ATOM 4784 C CA   . ASN A 1 18 ? -0.293  0.595  -0.837  1.00 0.00 ? 18 ASN A CA   13 
ATOM 4785 C C    . ASN A 1 18 ? -1.141  -0.626 -1.252  1.00 0.00 ? 18 ASN A C    13 
ATOM 4786 O O    . ASN A 1 18 ? -2.345  -0.500 -1.508  1.00 0.00 ? 18 ASN A O    13 
ATOM 4787 C CB   . ASN A 1 18 ? 0.585   1.105  -1.982  1.00 0.00 ? 18 ASN A CB   13 
ATOM 4788 C CG   . ASN A 1 18 ? -0.106  2.174  -2.825  1.00 0.00 ? 18 ASN A CG   13 
ATOM 4789 O OD1  . ASN A 1 18 ? -0.092  2.164  -4.038  1.00 0.00 ? 18 ASN A OD1  13 
ATOM 4790 N ND2  . ASN A 1 18 ? -0.689  3.165  -2.178  1.00 0.00 ? 18 ASN A ND2  13 
ATOM 4791 H H    . ASN A 1 18 ? 1.539   0.554  0.219   1.00 0.00 ? 18 ASN A H    13 
ATOM 4792 H HD21 . ASN A 1 18 ? -0.709  3.197  -1.185  1.00 0.00 ? 18 ASN A HD21 13 
ATOM 4793 H HD22 . ASN A 1 18 ? -1.142  3.855  -2.735  1.00 0.00 ? 18 ASN A HD22 13 
ATOM 4794 N N    . TYR A 1 19 ? -0.551  -1.800 -1.050  1.00 0.00 ? 19 TYR A N    13 
ATOM 4795 C CA   . TYR A 1 19 ? -1.202  -3.126 -1.179  1.00 0.00 ? 19 TYR A CA   13 
ATOM 4796 C C    . TYR A 1 19 ? -2.300  -3.380 -0.129  1.00 0.00 ? 19 TYR A C    13 
ATOM 4797 O O    . TYR A 1 19 ? -3.345  -3.937 -0.462  1.00 0.00 ? 19 TYR A O    13 
ATOM 4798 C CB   . TYR A 1 19 ? -0.167  -4.258 -1.127  1.00 0.00 ? 19 TYR A CB   13 
ATOM 4799 C CG   . TYR A 1 19 ? 0.687   -4.397 -2.393  1.00 0.00 ? 19 TYR A CG   13 
ATOM 4800 C CD1  . TYR A 1 19 ? 0.071   -4.438 -3.663  1.00 0.00 ? 19 TYR A CD1  13 
ATOM 4801 C CD2  . TYR A 1 19 ? 2.086   -4.532 -2.263  1.00 0.00 ? 19 TYR A CD2  13 
ATOM 4802 C CE1  . TYR A 1 19 ? 0.857   -4.604 -4.819  1.00 0.00 ? 19 TYR A CE1  13 
ATOM 4803 C CE2  . TYR A 1 19 ? 2.883   -4.692 -3.413  1.00 0.00 ? 19 TYR A CE2  13 
ATOM 4804 C CZ   . TYR A 1 19 ? 2.259   -4.722 -4.679  1.00 0.00 ? 19 TYR A CZ   13 
ATOM 4805 O OH   . TYR A 1 19 ? 3.036   -4.820 -5.789  1.00 0.00 ? 19 TYR A OH   13 
ATOM 4806 H H    . TYR A 1 19 ? 0.427   -1.846 -0.823  1.00 0.00 ? 19 TYR A H    13 
ATOM 4807 H HH   . TYR A 1 19 ? 3.993   -4.850 -5.522  1.00 0.00 ? 19 TYR A HH   13 
ATOM 4808 N N    . HIS A 1 20 ? -2.081  -2.965 1.119   1.00 0.00 ? 20 HIS A N    13 
ATOM 4809 C CA   . HIS A 1 20 ? -3.134  -3.022 2.157   1.00 0.00 ? 20 HIS A CA   13 
ATOM 4810 C C    . HIS A 1 20 ? -4.160  -1.859 2.089   1.00 0.00 ? 20 HIS A C    13 
ATOM 4811 O O    . HIS A 1 20 ? -5.264  -1.938 2.609   1.00 0.00 ? 20 HIS A O    13 
ATOM 4812 C CB   . HIS A 1 20 ? -2.555  -3.228 3.564   1.00 0.00 ? 20 HIS A CB   13 
ATOM 4813 C CG   . HIS A 1 20 ? -1.827  -2.060 4.271   1.00 0.00 ? 20 HIS A CG   13 
ATOM 4814 N ND1  . HIS A 1 20 ? -0.799  -2.190 5.099   1.00 0.00 ? 20 HIS A ND1  13 
ATOM 4815 C CD2  . HIS A 1 20 ? -2.212  -0.789 4.326   1.00 0.00 ? 20 HIS A CD2  13 
ATOM 4816 C CE1  . HIS A 1 20 ? -0.551  -1.017 5.662   1.00 0.00 ? 20 HIS A CE1  13 
ATOM 4817 N NE2  . HIS A 1 20 ? -1.403  -0.125 5.139   1.00 0.00 ? 20 HIS A NE2  13 
ATOM 4818 H H    . HIS A 1 20 ? -1.213  -2.564 1.412   1.00 0.00 ? 20 HIS A H    13 
ATOM 4819 H HD1  . HIS A 1 20 ? -0.257  -3.019 5.221   1.00 0.00 ? 20 HIS A HD1  13 
ATOM 4820 H HE2  . HIS A 1 20 ? -1.249  0.856  5.107   1.00 0.00 ? 20 HIS A HE2  13 
ATOM 4821 N N    . LEU A 1 21 ? -3.784  -0.809 1.356   1.00 0.00 ? 21 LEU A N    13 
ATOM 4822 C CA   . LEU A 1 21 ? -4.587  0.418  1.149   1.00 0.00 ? 21 LEU A CA   13 
ATOM 4823 C C    . LEU A 1 21 ? -5.718  0.213  0.144   1.00 0.00 ? 21 LEU A C    13 
ATOM 4824 O O    . LEU A 1 21 ? -6.858  0.600  0.410   1.00 0.00 ? 21 LEU A O    13 
ATOM 4825 C CB   . LEU A 1 21 ? -3.652  1.561  0.734   1.00 0.00 ? 21 LEU A CB   13 
ATOM 4826 C CG   . LEU A 1 21 ? -4.379  2.831  0.244   1.00 0.00 ? 21 LEU A CG   13 
ATOM 4827 C CD1  . LEU A 1 21 ? -5.111  3.546  1.381   1.00 0.00 ? 21 LEU A CD1  13 
ATOM 4828 C CD2  . LEU A 1 21 ? -3.403  3.769  -0.457  1.00 0.00 ? 21 LEU A CD2  13 
ATOM 4829 H H    . LEU A 1 21 ? -2.864  -0.769 0.961   1.00 0.00 ? 21 LEU A H    13 
ATOM 4830 N N    . GLU A 1 22 ? -5.400  -0.419 -0.990  1.00 0.00 ? 22 GLU A N    13 
ATOM 4831 C CA   . GLU A 1 22 ? -6.405  -0.804 -2.006  1.00 0.00 ? 22 GLU A CA   13 
ATOM 4832 C C    . GLU A 1 22 ? -7.604  -1.585 -1.408  1.00 0.00 ? 22 GLU A C    13 
ATOM 4833 O O    . GLU A 1 22 ? -8.748  -1.325 -1.775  1.00 0.00 ? 22 GLU A O    13 
ATOM 4834 C CB   . GLU A 1 22 ? -5.788  -1.583 -3.179  1.00 0.00 ? 22 GLU A CB   13 
ATOM 4835 C CG   . GLU A 1 22 ? -4.961  -2.787 -2.713  1.00 0.00 ? 22 GLU A CG   13 
ATOM 4836 C CD   . GLU A 1 22 ? -4.965  -3.960 -3.697  1.00 0.00 ? 22 GLU A CD   13 
ATOM 4837 O OE1  . GLU A 1 22 ? -5.996  -4.426 -4.174  1.00 0.00 ? 22 GLU A OE1  13 
ATOM 4838 O OE2  . GLU A 1 22 ? -3.780  -4.547 -3.933  1.00 0.00 ? 22 GLU A OE2  13 
ATOM 4839 H H    . GLU A 1 22 ? -4.437  -0.584 -1.244  1.00 0.00 ? 22 GLU A H    13 
ATOM 4840 H HE2  . GLU A 1 22 ? -4.016  -5.313 -4.518  1.00 0.00 ? 22 GLU A HE2  13 
ATOM 4841 N N    . ASN A 1 23 ? -7.328  -2.353 -0.353  1.00 0.00 ? 23 ASN A N    13 
ATOM 4842 C CA   . ASN A 1 23 ? -8.369  -3.042 0.443   1.00 0.00 ? 23 ASN A CA   13 
ATOM 4843 C C    . ASN A 1 23 ? -9.388  -2.038 1.041   1.00 0.00 ? 23 ASN A C    13 
ATOM 4844 O O    . ASN A 1 23 ? -10.578 -2.130 0.753   1.00 0.00 ? 23 ASN A O    13 
ATOM 4845 C CB   . ASN A 1 23 ? -7.737  -3.905 1.535   1.00 0.00 ? 23 ASN A CB   13 
ATOM 4846 C CG   . ASN A 1 23 ? -8.774  -4.574 2.458   1.00 0.00 ? 23 ASN A CG   13 
ATOM 4847 O OD1  . ASN A 1 23 ? -8.657  -4.576 3.669   1.00 0.00 ? 23 ASN A OD1  13 
ATOM 4848 N ND2  . ASN A 1 23 ? -9.881  -5.000 1.893   1.00 0.00 ? 23 ASN A ND2  13 
ATOM 4849 H H    . ASN A 1 23 ? -6.398  -2.477 -0.015  1.00 0.00 ? 23 ASN A H    13 
ATOM 4850 H HD21 . ASN A 1 23 ? -10.075 -4.825 0.932   1.00 0.00 ? 23 ASN A HD21 13 
ATOM 4851 H HD22 . ASN A 1 23 ? -10.556 -5.418 2.508   1.00 0.00 ? 23 ASN A HD22 13 
ATOM 4852 N N    . GLU A 1 24 ? -8.856  -1.047 1.751   1.00 0.00 ? 24 GLU A N    13 
ATOM 4853 C CA   . GLU A 1 24 ? -9.672  0.036  2.352   1.00 0.00 ? 24 GLU A CA   13 
ATOM 4854 C C    . GLU A 1 24 ? -10.428 0.807  1.255   1.00 0.00 ? 24 GLU A C    13 
ATOM 4855 O O    . GLU A 1 24 ? -11.637 0.749  1.281   1.00 0.00 ? 24 GLU A O    13 
ATOM 4856 C CB   . GLU A 1 24 ? -8.790  0.917  3.250   1.00 0.00 ? 24 GLU A CB   13 
ATOM 4857 C CG   . GLU A 1 24 ? -9.446  2.212  3.756   1.00 0.00 ? 24 GLU A CG   13 
ATOM 4858 C CD   . GLU A 1 24 ? -9.185  3.403  2.832   1.00 0.00 ? 24 GLU A CD   13 
ATOM 4859 O OE1  . GLU A 1 24 ? -8.184  3.500  2.127   1.00 0.00 ? 24 GLU A OE1  13 
ATOM 4860 O OE2  . GLU A 1 24 ? -10.114 4.378  2.799   1.00 0.00 ? 24 GLU A OE2  13 
ATOM 4861 H H    . GLU A 1 24 ? -7.875  -0.945 1.862   1.00 0.00 ? 24 GLU A H    13 
ATOM 4862 H HE2  . GLU A 1 24 ? -9.719  5.055  2.183   1.00 0.00 ? 24 GLU A HE2  13 
ATOM 4863 N N    . VAL A 1 25 ? -9.714  1.332  0.256   1.00 0.00 ? 25 VAL A N    13 
ATOM 4864 C CA   . VAL A 1 25 ? -10.290 1.999  -0.939  1.00 0.00 ? 25 VAL A CA   13 
ATOM 4865 C C    . VAL A 1 25 ? -11.504 1.234  -1.510  1.00 0.00 ? 25 VAL A C    13 
ATOM 4866 O O    . VAL A 1 25 ? -12.534 1.858  -1.753  1.00 0.00 ? 25 VAL A O    13 
ATOM 4867 C CB   . VAL A 1 25 ? -9.204  2.288  -1.985  1.00 0.00 ? 25 VAL A CB   13 
ATOM 4868 C CG1  . VAL A 1 25 ? -9.744  2.884  -3.292  1.00 0.00 ? 25 VAL A CG1  13 
ATOM 4869 C CG2  . VAL A 1 25 ? -8.174  3.277  -1.425  1.00 0.00 ? 25 VAL A CG2  13 
ATOM 4870 H H    . VAL A 1 25 ? -8.721  1.428  0.332   1.00 0.00 ? 25 VAL A H    13 
ATOM 4871 N N    . ALA A 1 26 ? -11.433 -0.092 -1.534  1.00 0.00 ? 26 ALA A N    13 
ATOM 4872 C CA   . ALA A 1 26 ? -12.542 -0.970 -1.959  1.00 0.00 ? 26 ALA A CA   13 
ATOM 4873 C C    . ALA A 1 26 ? -13.750 -0.925 -0.991  1.00 0.00 ? 26 ALA A C    13 
ATOM 4874 O O    . ALA A 1 26 ? -14.787 -0.372 -1.353  1.00 0.00 ? 26 ALA A O    13 
ATOM 4875 C CB   . ALA A 1 26 ? -12.025 -2.400 -2.164  1.00 0.00 ? 26 ALA A CB   13 
ATOM 4876 H H    . ALA A 1 26 ? -10.601 -0.577 -1.248  1.00 0.00 ? 26 ALA A H    13 
ATOM 4877 N N    . ARG A 1 27 ? -13.578 -1.403 0.243   1.00 0.00 ? 27 ARG A N    13 
ATOM 4878 C CA   . ARG A 1 27 ? -14.613 -1.319 1.314   1.00 0.00 ? 27 ARG A CA   13 
ATOM 4879 C C    . ARG A 1 27 ? -15.143 0.109  1.549   1.00 0.00 ? 27 ARG A C    13 
ATOM 4880 O O    . ARG A 1 27 ? -16.325 0.308  1.810   1.00 0.00 ? 27 ARG A O    13 
ATOM 4881 C CB   . ARG A 1 27 ? -14.065 -1.938 2.598   1.00 0.00 ? 27 ARG A CB   13 
ATOM 4882 C CG   . ARG A 1 27 ? -14.597 -3.356 2.860   1.00 0.00 ? 27 ARG A CG   13 
ATOM 4883 C CD   . ARG A 1 27 ? -15.846 -3.381 3.759   1.00 0.00 ? 27 ARG A CD   13 
ATOM 4884 N NE   . ARG A 1 27 ? -15.554 -2.723 5.047   1.00 0.00 ? 27 ARG A NE   13 
ATOM 4885 C CZ   . ARG A 1 27 ? -14.782 -3.198 6.029   1.00 0.00 ? 27 ARG A CZ   13 
ATOM 4886 N NH1  . ARG A 1 27 ? -14.670 -4.498 6.293   1.00 0.00 ? 27 ARG A NH1  13 
ATOM 4887 N NH2  . ARG A 1 27 ? -13.720 -2.474 6.350   1.00 0.00 ? 27 ARG A NH2  13 
ATOM 4888 H H    . ARG A 1 27 ? -12.727 -1.850 0.518   1.00 0.00 ? 27 ARG A H    13 
ATOM 4889 H HE   . ARG A 1 27 ? -16.112 -1.926 5.251   1.00 0.00 ? 27 ARG A HE   13 
ATOM 4890 H HH11 . ARG A 1 27 ? -15.326 -5.139 5.905   1.00 0.00 ? 27 ARG A HH11 13 
ATOM 4891 H HH12 . ARG A 1 27 ? -14.019 -4.807 6.980   1.00 0.00 ? 27 ARG A HH12 13 
ATOM 4892 H HH21 . ARG A 1 27 ? -13.545 -1.638 5.831   1.00 0.00 ? 27 ARG A HH21 13 
ATOM 4893 H HH22 . ARG A 1 27 ? -13.079 -2.781 7.037   1.00 0.00 ? 27 ARG A HH22 13 
ATOM 4894 N N    . LEU A 1 28 ? -14.280 1.102  1.338   1.00 0.00 ? 28 LEU A N    13 
ATOM 4895 C CA   . LEU A 1 28 ? -14.598 2.541  1.301   1.00 0.00 ? 28 LEU A CA   13 
ATOM 4896 C C    . LEU A 1 28 ? -15.524 2.895  0.130   1.00 0.00 ? 28 LEU A C    13 
ATOM 4897 O O    . LEU A 1 28 ? -16.622 3.400  0.341   1.00 0.00 ? 28 LEU A O    13 
ATOM 4898 C CB   . LEU A 1 28 ? -13.274 3.322  1.259   1.00 0.00 ? 28 LEU A CB   13 
ATOM 4899 C CG   . LEU A 1 28 ? -13.386 4.766  0.783   1.00 0.00 ? 28 LEU A CG   13 
ATOM 4900 C CD1  . LEU A 1 28 ? -13.988 5.666  1.862   1.00 0.00 ? 28 LEU A CD1  13 
ATOM 4901 C CD2  . LEU A 1 28 ? -12.027 5.316  0.337   1.00 0.00 ? 28 LEU A CD2  13 
ATOM 4902 H H    . LEU A 1 28 ? -13.307 0.895  1.214   1.00 0.00 ? 28 LEU A H    13 
ATOM 4903 N N    . LYS A 1 29 ? -15.096 2.616  -1.104  1.00 0.00 ? 29 LYS A N    13 
ATOM 4904 C CA   . LYS A 1 29 ? -15.892 2.896  -2.310  1.00 0.00 ? 29 LYS A CA   13 
ATOM 4905 C C    . LYS A 1 29 ? -17.215 2.096  -2.335  1.00 0.00 ? 29 LYS A C    13 
ATOM 4906 O O    . LYS A 1 29 ? -18.220 2.590  -2.849  1.00 0.00 ? 29 LYS A O    13 
ATOM 4907 C CB   . LYS A 1 29 ? -15.029 2.638  -3.533  1.00 0.00 ? 29 LYS A CB   13 
ATOM 4908 C CG   . LYS A 1 29 ? -15.400 3.587  -4.673  1.00 0.00 ? 29 LYS A CG   13 
ATOM 4909 C CD   . LYS A 1 29 ? -14.143 4.218  -5.271  1.00 0.00 ? 29 LYS A CD   13 
ATOM 4910 C CE   . LYS A 1 29 ? -14.507 5.214  -6.373  1.00 0.00 ? 29 LYS A CE   13 
ATOM 4911 N NZ   . LYS A 1 29 ? -13.310 5.977  -6.774  1.00 0.00 ? 29 LYS A NZ   13 
ATOM 4912 H H    . LYS A 1 29 ? -14.161 2.269  -1.277  1.00 0.00 ? 29 LYS A H    13 
ATOM 4913 H HZ1  . LYS A 1 29 ? -12.602 5.345  -7.089  1.00 0.00 ? 29 LYS A HZ1  13 
ATOM 4914 H HZ2  . LYS A 1 29 ? -13.564 6.600  -7.521  1.00 0.00 ? 29 LYS A HZ2  13 
ATOM 4915 H HZ3  . LYS A 1 29 ? -12.980 6.510  -5.994  1.00 0.00 ? 29 LYS A HZ3  13 
ATOM 4916 N N    . LYS A 1 30 ? -17.263 1.008  -1.577  1.00 0.00 ? 30 LYS A N    13 
ATOM 4917 C CA   . LYS A 1 30 ? -18.508 0.266  -1.279  1.00 0.00 ? 30 LYS A CA   13 
ATOM 4918 C C    . LYS A 1 30 ? -19.531 1.109  -0.480  1.00 0.00 ? 30 LYS A C    13 
ATOM 4919 O O    . LYS A 1 30 ? -20.735 1.047  -0.755  1.00 0.00 ? 30 LYS A O    13 
ATOM 4920 C CB   . LYS A 1 30 ? -18.087 -1.060 -0.617  1.00 0.00 ? 30 LYS A CB   13 
ATOM 4921 C CG   . LYS A 1 30 ? -19.119 -1.765 0.265   1.00 0.00 ? 30 LYS A CG   13 
ATOM 4922 C CD   . LYS A 1 30 ? -18.979 -1.302 1.717   1.00 0.00 ? 30 LYS A CD   13 
ATOM 4923 C CE   . LYS A 1 30 ? -20.318 -0.997 2.393   1.00 0.00 ? 30 LYS A CE   13 
ATOM 4924 N NZ   . LYS A 1 30 ? -21.056 -2.252 2.617   1.00 0.00 ? 30 LYS A NZ   13 
ATOM 4925 H H    . LYS A 1 30 ? -16.423 0.591  -1.207  1.00 0.00 ? 30 LYS A H    13 
ATOM 4926 H HZ1  . LYS A 1 30 ? -21.223 -2.697 1.733   1.00 0.00 ? 30 LYS A HZ1  13 
ATOM 4927 H HZ2  . LYS A 1 30 ? -20.511 -2.831 3.218   1.00 0.00 ? 30 LYS A HZ2  13 
ATOM 4928 H HZ3  . LYS A 1 30 ? -21.931 -2.034 3.056   1.00 0.00 ? 30 LYS A HZ3  13 
ATOM 4929 N N    . LEU A 1 31 ? -19.053 1.975  0.406   1.00 0.00 ? 31 LEU A N    13 
ATOM 4930 C CA   . LEU A 1 31 ? -19.901 2.899  1.192   1.00 0.00 ? 31 LEU A CA   13 
ATOM 4931 C C    . LEU A 1 31 ? -19.865 4.369  0.727   1.00 0.00 ? 31 LEU A C    13 
ATOM 4932 O O    . LEU A 1 31 ? -20.442 5.250  1.364   1.00 0.00 ? 31 LEU A O    13 
ATOM 4933 C CB   . LEU A 1 31 ? -19.631 2.734  2.706   1.00 0.00 ? 31 LEU A CB   13 
ATOM 4934 C CG   . LEU A 1 31 ? -18.154 2.778  3.110   1.00 0.00 ? 31 LEU A CG   13 
ATOM 4935 C CD1  . LEU A 1 31 ? -17.654 4.210  3.345   1.00 0.00 ? 31 LEU A CD1  13 
ATOM 4936 C CD2  . LEU A 1 31 ? -17.898 1.897  4.331   1.00 0.00 ? 31 LEU A CD2  13 
ATOM 4937 H H    . LEU A 1 31 ? -18.064 2.048  0.584   1.00 0.00 ? 31 LEU A H    13 
ATOM 4938 N N    . VAL A 1 32 ? -19.218 4.591  -0.413  1.00 0.00 ? 32 VAL A N    13 
ATOM 4939 C CA   . VAL A 1 32 ? -19.094 5.910  -1.089  1.00 0.00 ? 32 VAL A CA   13 
ATOM 4940 C C    . VAL A 1 32 ? -19.517 5.861  -2.588  1.00 0.00 ? 32 VAL A C    13 
ATOM 4941 O O    . VAL A 1 32 ? -19.512 6.869  -3.294  1.00 0.00 ? 32 VAL A O    13 
ATOM 4942 C CB   . VAL A 1 32 ? -17.657 6.444  -0.836  1.00 0.00 ? 32 VAL A CB   13 
ATOM 4943 C CG1  . VAL A 1 32 ? -17.288 7.726  -1.585  1.00 0.00 ? 32 VAL A CG1  13 
ATOM 4944 C CG2  . VAL A 1 32 ? -17.462 6.751  0.648   1.00 0.00 ? 32 VAL A CG2  13 
ATOM 4945 H H    . VAL A 1 32 ? -18.625 3.878  -0.795  1.00 0.00 ? 32 VAL A H    13 
ATOM 4946 N N    . GLY A 1 33 ? -19.999 4.702  -3.020  1.00 0.00 ? 33 GLY A N    13 
ATOM 4947 C CA   . GLY A 1 33 ? -20.444 4.460  -4.418  1.00 0.00 ? 33 GLY A CA   13 
ATOM 4948 C C    . GLY A 1 33 ? -21.947 4.183  -4.549  1.00 0.00 ? 33 GLY A C    13 
ATOM 4949 O O    . GLY A 1 33 ? -22.551 4.471  -5.583  1.00 0.00 ? 33 GLY A O    13 
ATOM 4950 H H    . GLY A 1 33 ? -19.896 3.876  -2.482  1.00 0.00 ? 33 GLY A H    13 
ATOM 4951 N N    . GLU A 1 34 ? -22.502 3.551  -3.515  1.00 0.00 ? 34 GLU A N    13 
ATOM 4952 C CA   . GLU A 1 34 ? -23.933 3.166  -3.458  1.00 0.00 ? 34 GLU A CA   13 
ATOM 4953 C C    . GLU A 1 34 ? -24.666 3.847  -2.281  1.00 0.00 ? 34 GLU A C    13 
ATOM 4954 O O    . GLU A 1 34 ? -25.114 4.982  -2.438  1.00 0.00 ? 34 GLU A O    13 
ATOM 4955 C CB   . GLU A 1 34 ? -24.101 1.641  -3.511  1.00 0.00 ? 34 GLU A CB   13 
ATOM 4956 C CG   . GLU A 1 34 ? -23.075 0.877  -2.653  1.00 0.00 ? 34 GLU A CG   13 
ATOM 4957 C CD   . GLU A 1 34 ? -23.552 -0.495 -2.182  1.00 0.00 ? 34 GLU A CD   13 
ATOM 4958 O OE1  . GLU A 1 34 ? -24.675 -0.676 -1.721  1.00 0.00 ? 34 GLU A OE1  13 
ATOM 4959 O OE2  . GLU A 1 34 ? -22.624 -1.473 -2.163  1.00 0.00 ? 34 GLU A OE2  13 
ATOM 4960 H H    . GLU A 1 34 ? -21.983 3.352  -2.694  1.00 0.00 ? 34 GLU A H    13 
ATOM 4961 H HE2  . GLU A 1 34 ? -23.103 -2.245 -1.765  1.00 0.00 ? 34 GLU A HE2  13 
ATOM 4962 N N    . ARG A 1 35 ? -24.706 3.172  -1.127  1.00 0.00 ? 35 ARG A N    13 
ATOM 4963 C CA   . ARG A 1 35 ? -25.302 3.634  0.146   1.00 0.00 ? 35 ARG A CA   13 
ATOM 4964 C C    . ARG A 1 35 ? -26.842 3.648  0.129   1.00 0.00 ? 35 ARG A C    13 
ATOM 4965 O O    . ARG A 1 35 ? -27.406 2.605  0.560   1.00 0.00 ? 35 ARG A O    13 
ATOM 4966 C CB   . ARG A 1 35 ? -24.706 5.000  0.528   1.00 0.00 ? 35 ARG A CB   13 
ATOM 4967 C CG   . ARG A 1 35 ? -24.810 5.351  2.007   1.00 0.00 ? 35 ARG A CG   13 
ATOM 4968 C CD   . ARG A 1 35 ? -23.610 4.827  2.799   1.00 0.00 ? 35 ARG A CD   13 
ATOM 4969 N NE   . ARG A 1 35 ? -23.253 5.843  3.807   1.00 0.00 ? 35 ARG A NE   13 
ATOM 4970 C CZ   . ARG A 1 35 ? -24.013 6.249  4.821   1.00 0.00 ? 35 ARG A CZ   13 
ATOM 4971 N NH1  . ARG A 1 35 ? -25.095 5.581  5.204   1.00 0.00 ? 35 ARG A NH1  13 
ATOM 4972 N NH2  . ARG A 1 35 ? -23.645 7.295  5.548   1.00 0.00 ? 35 ARG A NH2  13 
ATOM 4973 O OXT  . ARG A 1 35 ? -27.439 4.624  -0.376  1.00 0.00 ? 35 ARG A OXT  13 
ATOM 4974 H H    . ARG A 1 35 ? -24.367 2.233  -1.096  1.00 0.00 ? 35 ARG A H    13 
ATOM 4975 H HE   . ARG A 1 35 ? -22.339 6.245  3.696   1.00 0.00 ? 35 ARG A HE   13 
ATOM 4976 H HH11 . ARG A 1 35 ? -25.347 4.769  4.684   1.00 0.00 ? 35 ARG A HH11 13 
ATOM 4977 H HH12 . ARG A 1 35 ? -25.656 5.901  5.960   1.00 0.00 ? 35 ARG A HH12 13 
ATOM 4978 H HH21 . ARG A 1 35 ? -22.842 7.826  5.286   1.00 0.00 ? 35 ARG A HH21 13 
ATOM 4979 H HH22 . ARG A 1 35 ? -24.222 7.591  6.311   1.00 0.00 ? 35 ARG A HH22 13 
ATOM 4980 N N    . LEU A 1 1  ? 12.296  4.650  -9.578  1.00 0.00 ? 1  LEU A N    14 
ATOM 4981 C CA   . LEU A 1 1  ? 13.736  4.284  -9.589  1.00 0.00 ? 1  LEU A CA   14 
ATOM 4982 C C    . LEU A 1 1  ? 14.394  4.350  -8.199  1.00 0.00 ? 1  LEU A C    14 
ATOM 4983 O O    . LEU A 1 1  ? 13.721  4.589  -7.190  1.00 0.00 ? 1  LEU A O    14 
ATOM 4984 C CB   . LEU A 1 1  ? 14.504  5.145  -10.608 1.00 0.00 ? 1  LEU A CB   14 
ATOM 4985 C CG   . LEU A 1 1  ? 14.756  4.457  -11.963 1.00 0.00 ? 1  LEU A CG   14 
ATOM 4986 C CD1  . LEU A 1 1  ? 15.482  3.119  -11.832 1.00 0.00 ? 1  LEU A CD1  14 
ATOM 4987 C CD2  . LEU A 1 1  ? 13.468  4.349  -12.797 1.00 0.00 ? 1  LEU A CD2  14 
ATOM 4988 H H1   . LEU A 1 1  ? 12.198  5.570  -9.185  1.00 0.00 ? 1  LEU A H1   14 
ATOM 4989 H H2   . LEU A 1 1  ? 11.923  4.632  -10.504 1.00 0.00 ? 1  LEU A H2   14 
ATOM 4990 H H3   . LEU A 1 1  ? 11.806  3.995  -9.010  1.00 0.00 ? 1  LEU A H3   14 
ATOM 4991 N N    . GLN A 1 2  ? 15.695  4.030  -8.169  1.00 0.00 ? 2  GLN A N    14 
ATOM 4992 C CA   . GLN A 1 2  ? 16.532  4.007  -6.948  1.00 0.00 ? 2  GLN A CA   14 
ATOM 4993 C C    . GLN A 1 2  ? 16.061  2.946  -5.933  1.00 0.00 ? 2  GLN A C    14 
ATOM 4994 O O    . GLN A 1 2  ? 15.175  3.163  -5.121  1.00 0.00 ? 2  GLN A O    14 
ATOM 4995 C CB   . GLN A 1 2  ? 16.591  5.385  -6.272  1.00 0.00 ? 2  GLN A CB   14 
ATOM 4996 C CG   . GLN A 1 2  ? 17.464  6.415  -7.013  1.00 0.00 ? 2  GLN A CG   14 
ATOM 4997 C CD   . GLN A 1 2  ? 17.668  7.647  -6.132  1.00 0.00 ? 2  GLN A CD   14 
ATOM 4998 O OE1  . GLN A 1 2  ? 16.766  8.198  -5.503  1.00 0.00 ? 2  GLN A OE1  14 
ATOM 4999 N NE2  . GLN A 1 2  ? 18.901  8.083  -6.008  1.00 0.00 ? 2  GLN A NE2  14 
ATOM 5000 H H    . GLN A 1 2  ? 16.158  3.768  -9.010  1.00 0.00 ? 2  GLN A H    14 
ATOM 5001 H HE21 . GLN A 1 2  ? 19.666  7.656  -6.466  1.00 0.00 ? 2  GLN A HE21 14 
ATOM 5002 H HE22 . GLN A 1 2  ? 19.007  8.890  -5.432  1.00 0.00 ? 2  GLN A HE22 14 
ATOM 5003 N N    . ARG A 1 3  ? 16.739  1.806  -6.025  1.00 0.00 ? 3  ARG A N    14 
ATOM 5004 C CA   . ARG A 1 3  ? 16.410  0.583  -5.239  1.00 0.00 ? 3  ARG A CA   14 
ATOM 5005 C C    . ARG A 1 3  ? 17.410  -0.582 -5.390  1.00 0.00 ? 3  ARG A C    14 
ATOM 5006 O O    . ARG A 1 3  ? 17.132  -1.615 -6.002  1.00 0.00 ? 3  ARG A O    14 
ATOM 5007 C CB   . ARG A 1 3  ? 14.964  0.093  -5.473  1.00 0.00 ? 3  ARG A CB   14 
ATOM 5008 C CG   . ARG A 1 3  ? 14.505  -0.135 -6.911  1.00 0.00 ? 3  ARG A CG   14 
ATOM 5009 C CD   . ARG A 1 3  ? 13.608  1.047  -7.284  1.00 0.00 ? 3  ARG A CD   14 
ATOM 5010 N NE   . ARG A 1 3  ? 12.557  0.586  -8.196  1.00 0.00 ? 3  ARG A NE   14 
ATOM 5011 C CZ   . ARG A 1 3  ? 11.441  1.267  -8.483  1.00 0.00 ? 3  ARG A CZ   14 
ATOM 5012 N NH1  . ARG A 1 3  ? 11.084  2.360  -7.816  1.00 0.00 ? 3  ARG A NH1  14 
ATOM 5013 N NH2  . ARG A 1 3  ? 10.610  0.768  -9.377  1.00 0.00 ? 3  ARG A NH2  14 
ATOM 5014 H H    . ARG A 1 3  ? 17.538  1.721  -6.611  1.00 0.00 ? 3  ARG A H    14 
ATOM 5015 H HE   . ARG A 1 3  ? 12.635  -0.354 -8.509  1.00 0.00 ? 3  ARG A HE   14 
ATOM 5016 H HH11 . ARG A 1 3  ? 11.686  2.698  -7.087  1.00 0.00 ? 3  ARG A HH11 14 
ATOM 5017 H HH12 . ARG A 1 3  ? 10.237  2.830  -8.033  1.00 0.00 ? 3  ARG A HH12 14 
ATOM 5018 H HH21 . ARG A 1 3  ? 10.834  -0.090 -9.839  1.00 0.00 ? 3  ARG A HH21 14 
ATOM 5019 H HH22 . ARG A 1 3  ? 9.766   1.245  -9.589  1.00 0.00 ? 3  ARG A HH22 14 
ATOM 5020 N N    . MET A 1 4  ? 18.544  -0.408 -4.729  1.00 0.00 ? 4  MET A N    14 
ATOM 5021 C CA   . MET A 1 4  ? 19.603  -1.448 -4.740  1.00 0.00 ? 4  MET A CA   14 
ATOM 5022 C C    . MET A 1 4  ? 19.551  -2.418 -3.552  1.00 0.00 ? 4  MET A C    14 
ATOM 5023 O O    . MET A 1 4  ? 19.822  -3.599 -3.749  1.00 0.00 ? 4  MET A O    14 
ATOM 5024 C CB   . MET A 1 4  ? 21.007  -0.838 -4.882  1.00 0.00 ? 4  MET A CB   14 
ATOM 5025 C CG   . MET A 1 4  ? 21.377  0.127  -3.752  1.00 0.00 ? 4  MET A CG   14 
ATOM 5026 S SD   . MET A 1 4  ? 21.846  1.803  -4.317  1.00 0.00 ? 4  MET A SD   14 
ATOM 5027 C CE   . MET A 1 4  ? 20.412  2.307  -5.234  1.00 0.00 ? 4  MET A CE   14 
ATOM 5028 H H    . MET A 1 4  ? 18.799  0.470  -4.344  1.00 0.00 ? 4  MET A H    14 
ATOM 5029 N N    . LYS A 1 5  ? 19.050  -1.903 -2.429  1.00 0.00 ? 5  LYS A N    14 
ATOM 5030 C CA   . LYS A 1 5  ? 18.997  -2.491 -1.065  1.00 0.00 ? 5  LYS A CA   14 
ATOM 5031 C C    . LYS A 1 5  ? 18.605  -1.478 0.032   1.00 0.00 ? 5  LYS A C    14 
ATOM 5032 O O    . LYS A 1 5  ? 17.867  -1.801 0.949   1.00 0.00 ? 5  LYS A O    14 
ATOM 5033 C CB   . LYS A 1 5  ? 20.242  -3.273 -0.653  1.00 0.00 ? 5  LYS A CB   14 
ATOM 5034 C CG   . LYS A 1 5  ? 20.069  -4.760 -0.982  1.00 0.00 ? 5  LYS A CG   14 
ATOM 5035 C CD   . LYS A 1 5  ? 21.343  -5.316 -1.630  1.00 0.00 ? 5  LYS A CD   14 
ATOM 5036 C CE   . LYS A 1 5  ? 21.960  -6.455 -0.808  1.00 0.00 ? 5  LYS A CE   14 
ATOM 5037 N NZ   . LYS A 1 5  ? 22.312  -5.947 0.523   1.00 0.00 ? 5  LYS A NZ   14 
ATOM 5038 H H    . LYS A 1 5  ? 18.478  -1.094 -2.532  1.00 0.00 ? 5  LYS A H    14 
ATOM 5039 H HZ1  . LYS A 1 5  ? 22.966  -5.201 0.436   1.00 0.00 ? 5  LYS A HZ1  14 
ATOM 5040 H HZ2  . LYS A 1 5  ? 21.480  -5.645 0.981   1.00 0.00 ? 5  LYS A HZ2  14 
ATOM 5041 H HZ3  . LYS A 1 5  ? 22.723  -6.691 1.053   1.00 0.00 ? 5  LYS A HZ3  14 
ATOM 5042 N N    . GLN A 1 6  ? 18.966  -0.216 -0.197  1.00 0.00 ? 6  GLN A N    14 
ATOM 5043 C CA   . GLN A 1 6  ? 18.702  0.889  0.767   1.00 0.00 ? 6  GLN A CA   14 
ATOM 5044 C C    . GLN A 1 6  ? 17.483  1.724  0.355   1.00 0.00 ? 6  GLN A C    14 
ATOM 5045 O O    . GLN A 1 6  ? 16.463  1.734  1.041   1.00 0.00 ? 6  GLN A O    14 
ATOM 5046 C CB   . GLN A 1 6  ? 19.957  1.761  0.914   1.00 0.00 ? 6  GLN A CB   14 
ATOM 5047 C CG   . GLN A 1 6  ? 21.071  1.117  1.740   1.00 0.00 ? 6  GLN A CG   14 
ATOM 5048 C CD   . GLN A 1 6  ? 21.482  -0.280 1.245   1.00 0.00 ? 6  GLN A CD   14 
ATOM 5049 O OE1  . GLN A 1 6  ? 21.893  -0.487 0.116   1.00 0.00 ? 6  GLN A OE1  14 
ATOM 5050 N NE2  . GLN A 1 6  ? 21.108  -1.286 2.008   1.00 0.00 ? 6  GLN A NE2  14 
ATOM 5051 H H    . GLN A 1 6  ? 19.680  -0.020 -0.864  1.00 0.00 ? 6  GLN A H    14 
ATOM 5052 H HE21 . GLN A 1 6  ? 20.581  -1.135 2.845   1.00 0.00 ? 6  GLN A HE21 14 
ATOM 5053 H HE22 . GLN A 1 6  ? 21.341  -2.202 1.710   1.00 0.00 ? 6  GLN A HE22 14 
ATOM 5054 N N    . LEU A 1 7  ? 17.546  2.199  -0.878  1.00 0.00 ? 7  LEU A N    14 
ATOM 5055 C CA   . LEU A 1 7  ? 16.432  2.956  -1.494  1.00 0.00 ? 7  LEU A CA   14 
ATOM 5056 C C    . LEU A 1 7  ? 15.190  2.059  -1.761  1.00 0.00 ? 7  LEU A C    14 
ATOM 5057 O O    . LEU A 1 7  ? 14.063  2.508  -1.567  1.00 0.00 ? 7  LEU A O    14 
ATOM 5058 C CB   . LEU A 1 7  ? 16.985  3.680  -2.721  1.00 0.00 ? 7  LEU A CB   14 
ATOM 5059 C CG   . LEU A 1 7  ? 18.260  4.492  -2.397  1.00 0.00 ? 7  LEU A CG   14 
ATOM 5060 C CD1  . LEU A 1 7  ? 18.927  5.009  -3.671  1.00 0.00 ? 7  LEU A CD1  14 
ATOM 5061 C CD2  . LEU A 1 7  ? 17.968  5.701  -1.501  1.00 0.00 ? 7  LEU A CD2  14 
ATOM 5062 H H    . LEU A 1 7  ? 18.403  2.255  -1.384  1.00 0.00 ? 7  LEU A H    14 
ATOM 5063 N N    . GLU A 1 8  ? 15.423  0.744  -1.845  1.00 0.00 ? 8  GLU A N    14 
ATOM 5064 C CA   . GLU A 1 8  ? 14.350  -0.275 -1.937  1.00 0.00 ? 8  GLU A CA   14 
ATOM 5065 C C    . GLU A 1 8  ? 13.492  -0.403 -0.664  1.00 0.00 ? 8  GLU A C    14 
ATOM 5066 O O    . GLU A 1 8  ? 12.317  -0.724 -0.747  1.00 0.00 ? 8  GLU A O    14 
ATOM 5067 C CB   . GLU A 1 8  ? 14.842  -1.668 -2.365  1.00 0.00 ? 8  GLU A CB   14 
ATOM 5068 C CG   . GLU A 1 8  ? 15.424  -2.547 -1.256  1.00 0.00 ? 8  GLU A CG   14 
ATOM 5069 C CD   . GLU A 1 8  ? 15.895  -3.924 -1.735  1.00 0.00 ? 8  GLU A CD   14 
ATOM 5070 O OE1  . GLU A 1 8  ? 16.163  -4.813 -0.941  1.00 0.00 ? 8  GLU A OE1  14 
ATOM 5071 O OE2  . GLU A 1 8  ? 16.171  -4.066 -3.047  1.00 0.00 ? 8  GLU A OE2  14 
ATOM 5072 H H    . GLU A 1 8  ? 16.351  0.398  -1.921  1.00 0.00 ? 8  GLU A H    14 
ATOM 5073 H HE2  . GLU A 1 8  ? 16.455  -5.023 -3.118  1.00 0.00 ? 8  GLU A HE2  14 
ATOM 5074 N N    . ASP A 1 9  ? 14.116  -0.161 0.491   1.00 0.00 ? 9  ASP A N    14 
ATOM 5075 C CA   . ASP A 1 9  ? 13.400  -0.126 1.783   1.00 0.00 ? 9  ASP A CA   14 
ATOM 5076 C C    . ASP A 1 9  ? 12.221  0.874  1.746   1.00 0.00 ? 9  ASP A C    14 
ATOM 5077 O O    . ASP A 1 9  ? 11.093  0.518  2.057   1.00 0.00 ? 9  ASP A O    14 
ATOM 5078 C CB   . ASP A 1 9  ? 14.344  0.215  2.919   1.00 0.00 ? 9  ASP A CB   14 
ATOM 5079 C CG   . ASP A 1 9  ? 14.799  -1.036 3.694   1.00 0.00 ? 9  ASP A CG   14 
ATOM 5080 O OD1  . ASP A 1 9  ? 14.068  -2.000 3.852   1.00 0.00 ? 9  ASP A OD1  14 
ATOM 5081 O OD2  . ASP A 1 9  ? 16.016  -0.981 4.265   1.00 0.00 ? 9  ASP A OD2  14 
ATOM 5082 H H    . ASP A 1 9  ? 15.087  0.078  0.542   1.00 0.00 ? 9  ASP A H    14 
ATOM 5083 H HD2  . ASP A 1 9  ? 16.062  -1.852 4.745   1.00 0.00 ? 9  ASP A HD2  14 
ATOM 5084 N N    . LYS A 1 10 ? 12.481  1.948  1.016   1.00 0.00 ? 10 LYS A N    14 
ATOM 5085 C CA   . LYS A 1 10 ? 11.543  3.073  0.830   1.00 0.00 ? 10 LYS A CA   14 
ATOM 5086 C C    . LYS A 1 10 ? 10.410  2.718  -0.166  1.00 0.00 ? 10 LYS A C    14 
ATOM 5087 O O    . LYS A 1 10 ? 9.316   3.242  -0.064  1.00 0.00 ? 10 LYS A O    14 
ATOM 5088 C CB   . LYS A 1 10 ? 12.301  4.335  0.387   1.00 0.00 ? 10 LYS A CB   14 
ATOM 5089 C CG   . LYS A 1 10 ? 13.623  4.629  1.126   1.00 0.00 ? 10 LYS A CG   14 
ATOM 5090 C CD   . LYS A 1 10 ? 13.512  4.410  2.641   1.00 0.00 ? 10 LYS A CD   14 
ATOM 5091 C CE   . LYS A 1 10 ? 14.766  4.775  3.441   1.00 0.00 ? 10 LYS A CE   14 
ATOM 5092 N NZ   . LYS A 1 10 ? 14.545  4.292  4.809   1.00 0.00 ? 10 LYS A NZ   14 
ATOM 5093 H H    . LYS A 1 10 ? 13.354  2.084  0.549   1.00 0.00 ? 10 LYS A H    14 
ATOM 5094 H HZ1  . LYS A 1 10 ? 13.578  4.372  5.048   1.00 0.00 ? 10 LYS A HZ1  14 
ATOM 5095 H HZ2  . LYS A 1 10 ? 14.828  3.329  4.864   1.00 0.00 ? 10 LYS A HZ2  14 
ATOM 5096 H HZ3  . LYS A 1 10 ? 15.099  4.816  5.448   1.00 0.00 ? 10 LYS A HZ3  14 
ATOM 5097 N N    . VAL A 1 11 ? 10.656  1.677  -0.950  1.00 0.00 ? 11 VAL A N    14 
ATOM 5098 C CA   . VAL A 1 11 ? 9.714   1.118  -1.962  1.00 0.00 ? 11 VAL A CA   14 
ATOM 5099 C C    . VAL A 1 11 ? 8.840   0.007  -1.306  1.00 0.00 ? 11 VAL A C    14 
ATOM 5100 O O    . VAL A 1 11 ? 7.636   -0.014 -1.513  1.00 0.00 ? 11 VAL A O    14 
ATOM 5101 C CB   . VAL A 1 11 ? 10.461  0.587  -3.191  1.00 0.00 ? 11 VAL A CB   14 
ATOM 5102 C CG1  . VAL A 1 11 ? 9.497   0.208  -4.317  1.00 0.00 ? 11 VAL A CG1  14 
ATOM 5103 C CG2  . VAL A 1 11 ? 11.488  1.584  -3.751  1.00 0.00 ? 11 VAL A CG2  14 
ATOM 5104 H H    . VAL A 1 11 ? 11.532  1.187  -0.908  1.00 0.00 ? 11 VAL A H    14 
ATOM 5105 N N    . GLU A 1 12 ? 9.449   -0.836 -0.479  1.00 0.00 ? 12 GLU A N    14 
ATOM 5106 C CA   . GLU A 1 12 ? 8.727   -1.858 0.303   1.00 0.00 ? 12 GLU A CA   14 
ATOM 5107 C C    . GLU A 1 12 ? 7.706   -1.219 1.282   1.00 0.00 ? 12 GLU A C    14 
ATOM 5108 O O    . GLU A 1 12 ? 6.570   -1.667 1.336   1.00 0.00 ? 12 GLU A O    14 
ATOM 5109 C CB   . GLU A 1 12 ? 9.720   -2.779 1.008   1.00 0.00 ? 12 GLU A CB   14 
ATOM 5110 C CG   . GLU A 1 12 ? 9.094   -4.059 1.581   1.00 0.00 ? 12 GLU A CG   14 
ATOM 5111 C CD   . GLU A 1 12 ? 8.528   -3.945 3.016   1.00 0.00 ? 12 GLU A CD   14 
ATOM 5112 O OE1  . GLU A 1 12 ? 8.064   -4.913 3.594   1.00 0.00 ? 12 GLU A OE1  14 
ATOM 5113 O OE2  . GLU A 1 12 ? 8.621   -2.767 3.655   1.00 0.00 ? 12 GLU A OE2  14 
ATOM 5114 H H    . GLU A 1 12 ? 10.450  -0.867 -0.391  1.00 0.00 ? 12 GLU A H    14 
ATOM 5115 H HE2  . GLU A 1 12 ? 8.240   -2.964 4.550   1.00 0.00 ? 12 GLU A HE2  14 
ATOM 5116 N N    . GLU A 1 13 ? 8.096   -0.075 1.854   1.00 0.00 ? 13 GLU A N    14 
ATOM 5117 C CA   . GLU A 1 13 ? 7.206   0.783  2.672   1.00 0.00 ? 13 GLU A CA   14 
ATOM 5118 C C    . GLU A 1 13 ? 5.990   1.314  1.885   1.00 0.00 ? 13 GLU A C    14 
ATOM 5119 O O    . GLU A 1 13 ? 4.952   1.624  2.460   1.00 0.00 ? 13 GLU A O    14 
ATOM 5120 C CB   . GLU A 1 13 ? 8.009   1.926  3.313   1.00 0.00 ? 13 GLU A CB   14 
ATOM 5121 C CG   . GLU A 1 13 ? 7.116   2.838  4.165   1.00 0.00 ? 13 GLU A CG   14 
ATOM 5122 C CD   . GLU A 1 13 ? 7.836   3.758  5.156   1.00 0.00 ? 13 GLU A CD   14 
ATOM 5123 O OE1  . GLU A 1 13 ? 8.863   4.369  4.888   1.00 0.00 ? 13 GLU A OE1  14 
ATOM 5124 O OE2  . GLU A 1 13 ? 7.238   3.869  6.363   1.00 0.00 ? 13 GLU A OE2  14 
ATOM 5125 H H    . GLU A 1 13 ? 9.058   0.229  1.827   1.00 0.00 ? 13 GLU A H    14 
ATOM 5126 H HE2  . GLU A 1 13 ? 7.820   4.506  6.851   1.00 0.00 ? 13 GLU A HE2  14 
ATOM 5127 N N    . LEU A 1 14 ? 6.154   1.434  0.572   1.00 0.00 ? 14 LEU A N    14 
ATOM 5128 C CA   . LEU A 1 14 ? 5.039   1.872  -0.299  1.00 0.00 ? 14 LEU A CA   14 
ATOM 5129 C C    . LEU A 1 14 ? 4.039   0.713  -0.425  1.00 0.00 ? 14 LEU A C    14 
ATOM 5130 O O    . LEU A 1 14 ? 3.044   0.776  0.260   1.00 0.00 ? 14 LEU A O    14 
ATOM 5131 C CB   . LEU A 1 14 ? 5.473   2.372  -1.674  1.00 0.00 ? 14 LEU A CB   14 
ATOM 5132 C CG   . LEU A 1 14 ? 6.547   3.471  -1.590  1.00 0.00 ? 14 LEU A CG   14 
ATOM 5133 C CD1  . LEU A 1 14 ? 6.875   3.945  -3.002  1.00 0.00 ? 14 LEU A CD1  14 
ATOM 5134 C CD2  . LEU A 1 14 ? 6.175   4.656  -0.692  1.00 0.00 ? 14 LEU A CD2  14 
ATOM 5135 H H    . LEU A 1 14 ? 6.971   1.124  0.096   1.00 0.00 ? 14 LEU A H    14 
ATOM 5136 N N    . LEU A 1 15 ? 4.475   -0.382 -1.016  1.00 0.00 ? 15 LEU A N    14 
ATOM 5137 C CA   . LEU A 1 15 ? 3.622   -1.576 -1.244  1.00 0.00 ? 15 LEU A CA   14 
ATOM 5138 C C    . LEU A 1 15 ? 2.923   -2.065 0.044   1.00 0.00 ? 15 LEU A C    14 
ATOM 5139 O O    . LEU A 1 15 ? 1.706   -2.055 0.066   1.00 0.00 ? 15 LEU A O    14 
ATOM 5140 C CB   . LEU A 1 15 ? 4.367   -2.743 -1.889  1.00 0.00 ? 15 LEU A CB   14 
ATOM 5141 C CG   . LEU A 1 15 ? 5.320   -2.333 -3.016  1.00 0.00 ? 15 LEU A CG   14 
ATOM 5142 C CD1  . LEU A 1 15 ? 5.905   -3.590 -3.647  1.00 0.00 ? 15 LEU A CD1  14 
ATOM 5143 C CD2  . LEU A 1 15 ? 4.673   -1.465 -4.114  1.00 0.00 ? 15 LEU A CD2  14 
ATOM 5144 H H    . LEU A 1 15 ? 5.381   -0.438 -1.433  1.00 0.00 ? 15 LEU A H    14 
ATOM 5145 N N    . SER A 1 16 ? 3.652   -2.172 1.146   1.00 0.00 ? 16 SER A N    14 
ATOM 5146 C CA   . SER A 1 16 ? 3.070   -2.517 2.474   1.00 0.00 ? 16 SER A CA   14 
ATOM 5147 C C    . SER A 1 16 ? 1.779   -1.743 2.831   1.00 0.00 ? 16 SER A C    14 
ATOM 5148 O O    . SER A 1 16 ? 0.857   -2.305 3.408   1.00 0.00 ? 16 SER A O    14 
ATOM 5149 C CB   . SER A 1 16 ? 4.098   -2.272 3.582   1.00 0.00 ? 16 SER A CB   14 
ATOM 5150 O OG   . SER A 1 16 ? 4.491   -0.912 3.509   1.00 0.00 ? 16 SER A OG   14 
ATOM 5151 H H    . SER A 1 16 ? 4.631   -1.966 1.166   1.00 0.00 ? 16 SER A H    14 
ATOM 5152 H HG   . SER A 1 16 ? 5.121   -0.663 4.245   1.00 0.00 ? 16 SER A HG   14 
ATOM 5153 N N    . LYS A 1 17 ? 1.727   -0.493 2.360   1.00 0.00 ? 17 LYS A N    14 
ATOM 5154 C CA   . LYS A 1 17 ? 0.556   0.399  2.410   1.00 0.00 ? 17 LYS A CA   14 
ATOM 5155 C C    . LYS A 1 17 ? -0.211  0.556  1.078   1.00 0.00 ? 17 LYS A C    14 
ATOM 5156 O O    . LYS A 1 17 ? -1.355  0.160  0.997   1.00 0.00 ? 17 LYS A O    14 
ATOM 5157 C CB   . LYS A 1 17 ? 0.955   1.749  3.004   1.00 0.00 ? 17 LYS A CB   14 
ATOM 5158 C CG   . LYS A 1 17 ? 1.196   1.490  4.489   1.00 0.00 ? 17 LYS A CG   14 
ATOM 5159 C CD   . LYS A 1 17 ? 2.298   2.337  5.102   1.00 0.00 ? 17 LYS A CD   14 
ATOM 5160 C CE   . LYS A 1 17 ? 2.944   1.471  6.177   1.00 0.00 ? 17 LYS A CE   14 
ATOM 5161 N NZ   . LYS A 1 17 ? 3.644   2.335  7.132   1.00 0.00 ? 17 LYS A NZ   14 
ATOM 5162 H H    . LYS A 1 17 ? 2.537   -0.081 1.939   1.00 0.00 ? 17 LYS A H    14 
ATOM 5163 H HZ1  . LYS A 1 17 ? 4.267   2.953  6.646   1.00 0.00 ? 17 LYS A HZ1  14 
ATOM 5164 H HZ2  . LYS A 1 17 ? 2.955   2.862  7.646   1.00 0.00 ? 17 LYS A HZ2  14 
ATOM 5165 H HZ3  . LYS A 1 17 ? 4.155   1.764  7.765   1.00 0.00 ? 17 LYS A HZ3  14 
ATOM 5166 N N    . ASN A 1 18 ? 0.461   0.950  0.010   1.00 0.00 ? 18 ASN A N    14 
ATOM 5167 C CA   . ASN A 1 18 ? -0.117  1.119  -1.346  1.00 0.00 ? 18 ASN A CA   14 
ATOM 5168 C C    . ASN A 1 18 ? -0.891  -0.148 -1.849  1.00 0.00 ? 18 ASN A C    14 
ATOM 5169 O O    . ASN A 1 18 ? -1.964  -0.024 -2.428  1.00 0.00 ? 18 ASN A O    14 
ATOM 5170 C CB   . ASN A 1 18 ? 0.994   1.487  -2.322  1.00 0.00 ? 18 ASN A CB   14 
ATOM 5171 C CG   . ASN A 1 18 ? 0.501   2.305  -3.519  1.00 0.00 ? 18 ASN A CG   14 
ATOM 5172 O OD1  . ASN A 1 18 ? 1.034   3.362  -3.849  1.00 0.00 ? 18 ASN A OD1  14 
ATOM 5173 N ND2  . ASN A 1 18 ? -0.563  1.894  -4.156  1.00 0.00 ? 18 ASN A ND2  14 
ATOM 5174 H H    . ASN A 1 18 ? 1.450   1.140  0.069   1.00 0.00 ? 18 ASN A H    14 
ATOM 5175 H HD21 . ASN A 1 18 ? -1.186  1.221  -3.739  1.00 0.00 ? 18 ASN A HD21 14 
ATOM 5176 H HD22 . ASN A 1 18 ? -0.860  2.452  -4.920  1.00 0.00 ? 18 ASN A HD22 14 
ATOM 5177 N N    . TYR A 1 19 ? -0.358  -1.306 -1.529  1.00 0.00 ? 19 TYR A N    14 
ATOM 5178 C CA   . TYR A 1 19 ? -0.963  -2.630 -1.841  1.00 0.00 ? 19 TYR A CA   14 
ATOM 5179 C C    . TYR A 1 19 ? -2.198  -2.895 -0.941  1.00 0.00 ? 19 TYR A C    14 
ATOM 5180 O O    . TYR A 1 19 ? -3.222  -3.316 -1.451  1.00 0.00 ? 19 TYR A O    14 
ATOM 5181 C CB   . TYR A 1 19 ? 0.083   -3.721 -1.612  1.00 0.00 ? 19 TYR A CB   14 
ATOM 5182 C CG   . TYR A 1 19 ? -0.005  -5.001 -2.443  1.00 0.00 ? 19 TYR A CG   14 
ATOM 5183 C CD1  . TYR A 1 19 ? -1.157  -5.320 -3.194  1.00 0.00 ? 19 TYR A CD1  14 
ATOM 5184 C CD2  . TYR A 1 19 ? 1.147   -5.831 -2.445  1.00 0.00 ? 19 TYR A CD2  14 
ATOM 5185 C CE1  . TYR A 1 19 ? -1.157  -6.491 -3.973  1.00 0.00 ? 19 TYR A CE1  14 
ATOM 5186 C CE2  . TYR A 1 19 ? 1.137   -7.004 -3.215  1.00 0.00 ? 19 TYR A CE2  14 
ATOM 5187 C CZ   . TYR A 1 19 ? -0.015  -7.318 -3.975  1.00 0.00 ? 19 TYR A CZ   14 
ATOM 5188 O OH   . TYR A 1 19 ? -0.039  -8.437 -4.724  1.00 0.00 ? 19 TYR A OH   14 
ATOM 5189 H H    . TYR A 1 19 ? 0.494   -1.384 -0.999  1.00 0.00 ? 19 TYR A H    14 
ATOM 5190 H HH   . TYR A 1 19 ? -0.936  -8.513 -5.164  1.00 0.00 ? 19 TYR A HH   14 
ATOM 5191 N N    . HIS A 1 20 ? -2.106  -2.512 0.338   1.00 0.00 ? 20 HIS A N    14 
ATOM 5192 C CA   . HIS A 1 20 ? -3.288  -2.592 1.249   1.00 0.00 ? 20 HIS A CA   14 
ATOM 5193 C C    . HIS A 1 20 ? -4.301  -1.459 1.014   1.00 0.00 ? 20 HIS A C    14 
ATOM 5194 O O    . HIS A 1 20 ? -5.446  -1.543 1.432   1.00 0.00 ? 20 HIS A O    14 
ATOM 5195 C CB   . HIS A 1 20 ? -2.894  -2.751 2.727   1.00 0.00 ? 20 HIS A CB   14 
ATOM 5196 C CG   . HIS A 1 20 ? -2.463  -1.523 3.589   1.00 0.00 ? 20 HIS A CG   14 
ATOM 5197 N ND1  . HIS A 1 20 ? -1.735  -1.590 4.668   1.00 0.00 ? 20 HIS A ND1  14 
ATOM 5198 C CD2  . HIS A 1 20 ? -2.906  -0.265 3.490   1.00 0.00 ? 20 HIS A CD2  14 
ATOM 5199 C CE1  . HIS A 1 20 ? -1.696  -0.400 5.262   1.00 0.00 ? 20 HIS A CE1  14 
ATOM 5200 N NE2  . HIS A 1 20 ? -2.394  0.440  4.485   1.00 0.00 ? 20 HIS A NE2  14 
ATOM 5201 H H    . HIS A 1 20 ? -1.314  -2.054 0.721   1.00 0.00 ? 20 HIS A H    14 
ATOM 5202 H HD1  . HIS A 1 20 ? -1.127  -2.357 4.918   1.00 0.00 ? 20 HIS A HD1  14 
ATOM 5203 H HE2  . HIS A 1 20 ? -2.308  1.429  4.500   1.00 0.00 ? 20 HIS A HE2  14 
ATOM 5204 N N    . LEU A 1 21 ? -3.873  -0.445 0.250   1.00 0.00 ? 21 LEU A N    14 
ATOM 5205 C CA   . LEU A 1 21 ? -4.626  0.782  -0.059  1.00 0.00 ? 21 LEU A CA   14 
ATOM 5206 C C    . LEU A 1 21 ? -5.700  0.509  -1.117  1.00 0.00 ? 21 LEU A C    14 
ATOM 5207 O O    . LEU A 1 21 ? -6.869  0.621  -0.781  1.00 0.00 ? 21 LEU A O    14 
ATOM 5208 C CB   . LEU A 1 21 ? -3.658  1.896  -0.481  1.00 0.00 ? 21 LEU A CB   14 
ATOM 5209 C CG   . LEU A 1 21 ? -4.352  3.168  -0.969  1.00 0.00 ? 21 LEU A CG   14 
ATOM 5210 C CD1  . LEU A 1 21 ? -4.928  3.991  0.196   1.00 0.00 ? 21 LEU A CD1  14 
ATOM 5211 C CD2  . LEU A 1 21 ? -3.391  3.991  -1.819  1.00 0.00 ? 21 LEU A CD2  14 
ATOM 5212 H H    . LEU A 1 21 ? -2.922  -0.417 -0.054  1.00 0.00 ? 21 LEU A H    14 
ATOM 5213 N N    . GLU A 1 22 ? -5.289  -0.020 -2.267  1.00 0.00 ? 22 GLU A N    14 
ATOM 5214 C CA   . GLU A 1 22 ? -6.251  -0.453 -3.309  1.00 0.00 ? 22 GLU A CA   14 
ATOM 5215 C C    . GLU A 1 22 ? -7.306  -1.467 -2.785  1.00 0.00 ? 22 GLU A C    14 
ATOM 5216 O O    . GLU A 1 22 ? -8.445  -1.464 -3.255  1.00 0.00 ? 22 GLU A O    14 
ATOM 5217 C CB   . GLU A 1 22 ? -5.557  -1.025 -4.544  1.00 0.00 ? 22 GLU A CB   14 
ATOM 5218 C CG   . GLU A 1 22 ? -5.126  0.069  -5.530  1.00 0.00 ? 22 GLU A CG   14 
ATOM 5219 C CD   . GLU A 1 22 ? -3.677  0.503  -5.307  1.00 0.00 ? 22 GLU A CD   14 
ATOM 5220 O OE1  . GLU A 1 22 ? -3.374  1.433  -4.568  1.00 0.00 ? 22 GLU A OE1  14 
ATOM 5221 O OE2  . GLU A 1 22 ? -2.742  -0.214 -5.965  1.00 0.00 ? 22 GLU A OE2  14 
ATOM 5222 H H    . GLU A 1 22 ? -4.319  -0.092 -2.502  1.00 0.00 ? 22 GLU A H    14 
ATOM 5223 H HE2  . GLU A 1 22 ? -1.873  0.198  -5.744  1.00 0.00 ? 22 GLU A HE2  14 
ATOM 5224 N N    . ASN A 1 23 ? -6.925  -2.187 -1.736  1.00 0.00 ? 23 ASN A N    14 
ATOM 5225 C CA   . ASN A 1 23 ? -7.824  -3.114 -1.028  1.00 0.00 ? 23 ASN A CA   14 
ATOM 5226 C C    . ASN A 1 23 ? -8.721  -2.384 -0.007  1.00 0.00 ? 23 ASN A C    14 
ATOM 5227 O O    . ASN A 1 23 ? -9.942  -2.557 -0.026  1.00 0.00 ? 23 ASN A O    14 
ATOM 5228 C CB   . ASN A 1 23 ? -6.988  -4.205 -0.358  1.00 0.00 ? 23 ASN A CB   14 
ATOM 5229 C CG   . ASN A 1 23 ? -7.822  -5.470 -0.159  1.00 0.00 ? 23 ASN A CG   14 
ATOM 5230 O OD1  . ASN A 1 23 ? -7.767  -6.419 -0.926  1.00 0.00 ? 23 ASN A OD1  14 
ATOM 5231 N ND2  . ASN A 1 23 ? -8.654  -5.500 0.872   1.00 0.00 ? 23 ASN A ND2  14 
ATOM 5232 H H    . ASN A 1 23 ? -6.003  -2.118 -1.358  1.00 0.00 ? 23 ASN A H    14 
ATOM 5233 H HD21 . ASN A 1 23 ? -8.762  -4.721 1.471   1.00 0.00 ? 23 ASN A HD21 14 
ATOM 5234 H HD22 . ASN A 1 23 ? -9.186  -6.335 0.973   1.00 0.00 ? 23 ASN A HD22 14 
ATOM 5235 N N    . GLU A 1 24 ? -8.135  -1.563 0.866   1.00 0.00 ? 24 GLU A N    14 
ATOM 5236 C CA   . GLU A 1 24 ? -8.895  -0.783 1.870   1.00 0.00 ? 24 GLU A CA   14 
ATOM 5237 C C    . GLU A 1 24 ? -9.884  0.202  1.217   1.00 0.00 ? 24 GLU A C    14 
ATOM 5238 O O    . GLU A 1 24 ? -11.059 0.154  1.537   1.00 0.00 ? 24 GLU A O    14 
ATOM 5239 C CB   . GLU A 1 24 ? -8.002  -0.082 2.918   1.00 0.00 ? 24 GLU A CB   14 
ATOM 5240 C CG   . GLU A 1 24 ? -7.274  1.166  2.417   1.00 0.00 ? 24 GLU A CG   14 
ATOM 5241 C CD   . GLU A 1 24 ? -6.491  1.917  3.485   1.00 0.00 ? 24 GLU A CD   14 
ATOM 5242 O OE1  . GLU A 1 24 ? -5.289  2.088  3.421   1.00 0.00 ? 24 GLU A OE1  14 
ATOM 5243 O OE2  . GLU A 1 24 ? -7.229  2.535  4.440   1.00 0.00 ? 24 GLU A OE2  14 
ATOM 5244 H H    . GLU A 1 24 ? -7.132  -1.482 0.952   1.00 0.00 ? 24 GLU A H    14 
ATOM 5245 H HE2  . GLU A 1 24 ? -6.537  2.983  5.009   1.00 0.00 ? 24 GLU A HE2  14 
ATOM 5246 N N    . VAL A 1 25 ? -9.415  0.932  0.198   1.00 0.00 ? 25 VAL A N    14 
ATOM 5247 C CA   . VAL A 1 25 ? -10.209 1.857  -0.640  1.00 0.00 ? 25 VAL A CA   14 
ATOM 5248 C C    . VAL A 1 25 ? -11.469 1.167  -1.182  1.00 0.00 ? 25 VAL A C    14 
ATOM 5249 O O    . VAL A 1 25 ? -12.525 1.775  -1.155  1.00 0.00 ? 25 VAL A O    14 
ATOM 5250 C CB   . VAL A 1 25 ? -9.357  2.498  -1.764  1.00 0.00 ? 25 VAL A CB   14 
ATOM 5251 C CG1  . VAL A 1 25 ? -10.160 3.363  -2.735  1.00 0.00 ? 25 VAL A CG1  14 
ATOM 5252 C CG2  . VAL A 1 25 ? -8.289  3.406  -1.151  1.00 0.00 ? 25 VAL A CG2  14 
ATOM 5253 H H    . VAL A 1 25 ? -8.439  0.945  -0.018  1.00 0.00 ? 25 VAL A H    14 
ATOM 5254 N N    . ALA A 1 26 ? -11.356 -0.131 -1.477  1.00 0.00 ? 26 ALA A N    14 
ATOM 5255 C CA   . ALA A 1 26 ? -12.499 -0.972 -1.866  1.00 0.00 ? 26 ALA A CA   14 
ATOM 5256 C C    . ALA A 1 26 ? -13.552 -1.039 -0.736  1.00 0.00 ? 26 ALA A C    14 
ATOM 5257 O O    . ALA A 1 26 ? -14.511 -0.283 -0.798  1.00 0.00 ? 26 ALA A O    14 
ATOM 5258 C CB   . ALA A 1 26 ? -12.038 -2.347 -2.344  1.00 0.00 ? 26 ALA A CB   14 
ATOM 5259 H H    . ALA A 1 26 ? -10.484 -0.615 -1.384  1.00 0.00 ? 26 ALA A H    14 
ATOM 5260 N N    . ARG A 1 27 ? -13.216 -1.686 0.377   1.00 0.00 ? 27 ARG A N    14 
ATOM 5261 C CA   . ARG A 1 27 ? -14.079 -1.732 1.583   1.00 0.00 ? 27 ARG A CA   14 
ATOM 5262 C C    . ARG A 1 27 ? -14.574 -0.333 2.062   1.00 0.00 ? 27 ARG A C    14 
ATOM 5263 O O    . ARG A 1 27 ? -15.738 -0.159 2.377   1.00 0.00 ? 27 ARG A O    14 
ATOM 5264 C CB   . ARG A 1 27 ? -13.359 -2.528 2.684   1.00 0.00 ? 27 ARG A CB   14 
ATOM 5265 C CG   . ARG A 1 27 ? -14.038 -2.498 4.058   1.00 0.00 ? 27 ARG A CG   14 
ATOM 5266 C CD   . ARG A 1 27 ? -15.495 -2.990 4.046   1.00 0.00 ? 27 ARG A CD   14 
ATOM 5267 N NE   . ARG A 1 27 ? -15.594 -4.459 3.899   1.00 0.00 ? 27 ARG A NE   14 
ATOM 5268 C CZ   . ARG A 1 27 ? -15.288 -5.340 4.853   1.00 0.00 ? 27 ARG A CZ   14 
ATOM 5269 N NH1  . ARG A 1 27 ? -15.038 -4.940 6.098   1.00 0.00 ? 27 ARG A NH1  14 
ATOM 5270 N NH2  . ARG A 1 27 ? -14.985 -6.584 4.525   1.00 0.00 ? 27 ARG A NH2  14 
ATOM 5271 H H    . ARG A 1 27 ? -12.358 -2.211 0.444   1.00 0.00 ? 27 ARG A H    14 
ATOM 5272 H HE   . ARG A 1 27 ? -16.092 -4.769 3.090   1.00 0.00 ? 27 ARG A HE   14 
ATOM 5273 H HH11 . ARG A 1 27 ? -15.161 -3.972 6.295   1.00 0.00 ? 27 ARG A HH11 14 
ATOM 5274 H HH12 . ARG A 1 27 ? -14.781 -5.584 6.806   1.00 0.00 ? 27 ARG A HH12 14 
ATOM 5275 H HH21 . ARG A 1 27 ? -15.021 -6.877 3.577   1.00 0.00 ? 27 ARG A HH21 14 
ATOM 5276 H HH22 . ARG A 1 27 ? -14.726 -7.225 5.247   1.00 0.00 ? 27 ARG A HH22 14 
ATOM 5277 N N    . LEU A 1 28 ? -13.687 0.645  1.972   1.00 0.00 ? 28 LEU A N    14 
ATOM 5278 C CA   . LEU A 1 28 ? -13.964 2.067  2.259   1.00 0.00 ? 28 LEU A CA   14 
ATOM 5279 C C    . LEU A 1 28 ? -15.057 2.640  1.320   1.00 0.00 ? 28 LEU A C    14 
ATOM 5280 O O    . LEU A 1 28 ? -16.166 2.890  1.758   1.00 0.00 ? 28 LEU A O    14 
ATOM 5281 C CB   . LEU A 1 28 ? -12.616 2.791  2.181   1.00 0.00 ? 28 LEU A CB   14 
ATOM 5282 C CG   . LEU A 1 28 ? -12.682 4.307  1.979   1.00 0.00 ? 28 LEU A CG   14 
ATOM 5283 C CD1  . LEU A 1 28 ? -13.166 5.013  3.256   1.00 0.00 ? 28 LEU A CD1  14 
ATOM 5284 C CD2  . LEU A 1 28 ? -11.329 4.863  1.563   1.00 0.00 ? 28 LEU A CD2  14 
ATOM 5285 H H    . LEU A 1 28 ? -12.745 0.454  1.686   1.00 0.00 ? 28 LEU A H    14 
ATOM 5286 N N    . LYS A 1 29 ? -14.768 2.717  0.026   1.00 0.00 ? 29 LYS A N    14 
ATOM 5287 C CA   . LYS A 1 29 ? -15.727 3.260  -0.956  1.00 0.00 ? 29 LYS A CA   14 
ATOM 5288 C C    . LYS A 1 29 ? -17.002 2.391  -1.115  1.00 0.00 ? 29 LYS A C    14 
ATOM 5289 O O    . LYS A 1 29 ? -18.065 2.905  -1.440  1.00 0.00 ? 29 LYS A O    14 
ATOM 5290 C CB   . LYS A 1 29 ? -15.020 3.669  -2.258  1.00 0.00 ? 29 LYS A CB   14 
ATOM 5291 C CG   . LYS A 1 29 ? -15.298 2.854  -3.536  1.00 0.00 ? 29 LYS A CG   14 
ATOM 5292 C CD   . LYS A 1 29 ? -14.790 1.417  -3.424  1.00 0.00 ? 29 LYS A CD   14 
ATOM 5293 C CE   . LYS A 1 29 ? -14.760 0.632  -4.741  1.00 0.00 ? 29 LYS A CE   14 
ATOM 5294 N NZ   . LYS A 1 29 ? -16.104 0.373  -5.271  1.00 0.00 ? 29 LYS A NZ   14 
ATOM 5295 H H    . LYS A 1 29 ? -13.897 2.384  -0.365  1.00 0.00 ? 29 LYS A H    14 
ATOM 5296 H HZ1  . LYS A 1 29 ? -16.570 1.240  -5.424  1.00 0.00 ? 29 LYS A HZ1  14 
ATOM 5297 H HZ2  . LYS A 1 29 ? -16.011 -0.115 -6.140  1.00 0.00 ? 29 LYS A HZ2  14 
ATOM 5298 H HZ3  . LYS A 1 29 ? -16.618 -0.206 -4.635  1.00 0.00 ? 29 LYS A HZ3  14 
ATOM 5299 N N    . LYS A 1 30 ? -16.897 1.131  -0.716  1.00 0.00 ? 30 LYS A N    14 
ATOM 5300 C CA   . LYS A 1 30 ? -18.029 0.174  -0.623  1.00 0.00 ? 30 LYS A CA   14 
ATOM 5301 C C    . LYS A 1 30 ? -19.163 0.698  0.288   1.00 0.00 ? 30 LYS A C    14 
ATOM 5302 O O    . LYS A 1 30 ? -20.333 0.547  -0.044  1.00 0.00 ? 30 LYS A O    14 
ATOM 5303 C CB   . LYS A 1 30 ? -17.413 -1.168 -0.196  1.00 0.00 ? 30 LYS A CB   14 
ATOM 5304 C CG   . LYS A 1 30 ? -18.253 -2.245 0.483   1.00 0.00 ? 30 LYS A CG   14 
ATOM 5305 C CD   . LYS A 1 30 ? -18.485 -1.930 1.965   1.00 0.00 ? 30 LYS A CD   14 
ATOM 5306 C CE   . LYS A 1 30 ? -18.849 -3.148 2.821   1.00 0.00 ? 30 LYS A CE   14 
ATOM 5307 N NZ   . LYS A 1 30 ? -20.069 -3.795 2.344   1.00 0.00 ? 30 LYS A NZ   14 
ATOM 5308 H H    . LYS A 1 30 ? -16.006 0.734  -0.462  1.00 0.00 ? 30 LYS A H    14 
ATOM 5309 H HZ1  . LYS A 1 30 ? -19.949 -4.049 1.386   1.00 0.00 ? 30 LYS A HZ1  14 
ATOM 5310 H HZ2  . LYS A 1 30 ? -20.232 -4.615 2.897   1.00 0.00 ? 30 LYS A HZ2  14 
ATOM 5311 H HZ3  . LYS A 1 30 ? -20.853 -3.172 2.450   1.00 0.00 ? 30 LYS A HZ3  14 
ATOM 5312 N N    . LEU A 1 31 ? -18.774 1.436  1.316   1.00 0.00 ? 31 LEU A N    14 
ATOM 5313 C CA   . LEU A 1 31 ? -19.740 2.106  2.236   1.00 0.00 ? 31 LEU A CA   14 
ATOM 5314 C C    . LEU A 1 31 ? -19.892 3.622  2.003   1.00 0.00 ? 31 LEU A C    14 
ATOM 5315 O O    . LEU A 1 31 ? -20.589 4.309  2.732   1.00 0.00 ? 31 LEU A O    14 
ATOM 5316 C CB   . LEU A 1 31 ? -19.446 1.713  3.690   1.00 0.00 ? 31 LEU A CB   14 
ATOM 5317 C CG   . LEU A 1 31 ? -17.976 1.828  4.107   1.00 0.00 ? 31 LEU A CG   14 
ATOM 5318 C CD1  . LEU A 1 31 ? -17.594 3.238  4.560   1.00 0.00 ? 31 LEU A CD1  14 
ATOM 5319 C CD2  . LEU A 1 31 ? -17.632 0.784  5.177   1.00 0.00 ? 31 LEU A CD2  14 
ATOM 5320 H H    . LEU A 1 31 ? -17.811 1.586  1.548   1.00 0.00 ? 31 LEU A H    14 
ATOM 5321 N N    . VAL A 1 32 ? -19.369 4.066  0.860   1.00 0.00 ? 32 VAL A N    14 
ATOM 5322 C CA   . VAL A 1 32 ? -19.470 5.477  0.378   1.00 0.00 ? 32 VAL A CA   14 
ATOM 5323 C C    . VAL A 1 32 ? -20.242 5.548  -0.973  1.00 0.00 ? 32 VAL A C    14 
ATOM 5324 O O    . VAL A 1 32 ? -20.710 6.601  -1.376  1.00 0.00 ? 32 VAL A O    14 
ATOM 5325 C CB   . VAL A 1 32 ? -18.064 6.115  0.287   1.00 0.00 ? 32 VAL A CB   14 
ATOM 5326 C CG1  . VAL A 1 32 ? -18.109 7.605  -0.059  1.00 0.00 ? 32 VAL A CG1  14 
ATOM 5327 C CG2  . VAL A 1 32 ? -17.273 5.976  1.598   1.00 0.00 ? 32 VAL A CG2  14 
ATOM 5328 H H    . VAL A 1 32 ? -18.772 3.486  0.306   1.00 0.00 ? 32 VAL A H    14 
ATOM 5329 N N    . GLY A 1 33 ? -20.444 4.386  -1.599  1.00 0.00 ? 33 GLY A N    14 
ATOM 5330 C CA   . GLY A 1 33 ? -21.173 4.224  -2.878  1.00 0.00 ? 33 GLY A CA   14 
ATOM 5331 C C    . GLY A 1 33 ? -22.698 4.152  -2.661  1.00 0.00 ? 33 GLY A C    14 
ATOM 5332 O O    . GLY A 1 33 ? -23.445 4.912  -3.268  1.00 0.00 ? 33 GLY A O    14 
ATOM 5333 H H    . GLY A 1 33 ? -20.005 3.554  -1.274  1.00 0.00 ? 33 GLY A H    14 
ATOM 5334 N N    . GLU A 1 34 ? -23.090 3.344  -1.696  1.00 0.00 ? 34 GLU A N    14 
ATOM 5335 C CA   . GLU A 1 34 ? -24.533 3.158  -1.366  1.00 0.00 ? 34 GLU A CA   14 
ATOM 5336 C C    . GLU A 1 34 ? -25.038 4.101  -0.251  1.00 0.00 ? 34 GLU A C    14 
ATOM 5337 O O    . GLU A 1 34 ? -26.157 3.945  0.207   1.00 0.00 ? 34 GLU A O    14 
ATOM 5338 C CB   . GLU A 1 34 ? -24.764 1.664  -1.057  1.00 0.00 ? 34 GLU A CB   14 
ATOM 5339 C CG   . GLU A 1 34 ? -24.349 1.170  0.334   1.00 0.00 ? 34 GLU A CG   14 
ATOM 5340 C CD   . GLU A 1 34 ? -25.565 1.069  1.277   1.00 0.00 ? 34 GLU A CD   14 
ATOM 5341 O OE1  . GLU A 1 34 ? -25.551 1.478  2.424   1.00 0.00 ? 34 GLU A OE1  14 
ATOM 5342 O OE2  . GLU A 1 34 ? -26.651 0.422  0.787   1.00 0.00 ? 34 GLU A OE2  14 
ATOM 5343 H H    . GLU A 1 34 ? -22.457 2.792  -1.159  1.00 0.00 ? 34 GLU A H    14 
ATOM 5344 H HE2  . GLU A 1 34 ? -27.325 0.532  1.517   1.00 0.00 ? 34 GLU A HE2  14 
ATOM 5345 N N    . ARG A 1 35 ? -24.261 5.172  -0.022  1.00 0.00 ? 35 ARG A N    14 
ATOM 5346 C CA   . ARG A 1 35 ? -24.411 6.150  1.097   1.00 0.00 ? 35 ARG A CA   14 
ATOM 5347 C C    . ARG A 1 35 ? -23.290 7.211  1.137   1.00 0.00 ? 35 ARG A C    14 
ATOM 5348 O O    . ARG A 1 35 ? -22.273 6.993  1.853   1.00 0.00 ? 35 ARG A O    14 
ATOM 5349 C CB   . ARG A 1 35 ? -24.537 5.453  2.459   1.00 0.00 ? 35 ARG A CB   14 
ATOM 5350 C CG   . ARG A 1 35 ? -25.980 5.392  2.960   1.00 0.00 ? 35 ARG A CG   14 
ATOM 5351 C CD   . ARG A 1 35 ? -26.473 6.749  3.483   1.00 0.00 ? 35 ARG A CD   14 
ATOM 5352 N NE   . ARG A 1 35 ? -25.697 7.183  4.663   1.00 0.00 ? 35 ARG A NE   14 
ATOM 5353 C CZ   . ARG A 1 35 ? -25.784 6.695  5.909   1.00 0.00 ? 35 ARG A CZ   14 
ATOM 5354 N NH1  . ARG A 1 35 ? -26.425 5.567  6.197   1.00 0.00 ? 35 ARG A NH1  14 
ATOM 5355 N NH2  . ARG A 1 35 ? -25.447 7.474  6.922   1.00 0.00 ? 35 ARG A NH2  14 
ATOM 5356 O OXT  . ARG A 1 35 ? -23.446 8.215  0.412   1.00 0.00 ? 35 ARG A OXT  14 
ATOM 5357 H H    . ARG A 1 35 ? -23.611 5.445  -0.718  1.00 0.00 ? 35 ARG A H    14 
ATOM 5358 H HE   . ARG A 1 35 ? -24.914 7.762  4.460   1.00 0.00 ? 35 ARG A HE   14 
ATOM 5359 H HH11 . ARG A 1 35 ? -26.744 4.989  5.438   1.00 0.00 ? 35 ARG A HH11 14 
ATOM 5360 H HH12 . ARG A 1 35 ? -26.499 5.256  7.141   1.00 0.00 ? 35 ARG A HH12 14 
ATOM 5361 H HH21 . ARG A 1 35 ? -25.153 8.414  6.748   1.00 0.00 ? 35 ARG A HH21 14 
ATOM 5362 H HH22 . ARG A 1 35 ? -25.521 7.132  7.859   1.00 0.00 ? 35 ARG A HH22 14 
ATOM 5363 N N    . LEU A 1 1  ? 13.757  9.615  -4.721  1.00 0.00 ? 1  LEU A N    15 
ATOM 5364 C CA   . LEU A 1 1  ? 14.443  10.263 -5.883  1.00 0.00 ? 1  LEU A CA   15 
ATOM 5365 C C    . LEU A 1 1  ? 15.973  10.060 -5.993  1.00 0.00 ? 1  LEU A C    15 
ATOM 5366 O O    . LEU A 1 1  ? 16.522  9.831  -7.070  1.00 0.00 ? 1  LEU A O    15 
ATOM 5367 C CB   . LEU A 1 1  ? 14.014  11.733 -6.031  1.00 0.00 ? 1  LEU A CB   15 
ATOM 5368 C CG   . LEU A 1 1  ? 14.456  12.786 -4.976  1.00 0.00 ? 1  LEU A CG   15 
ATOM 5369 C CD1  . LEU A 1 1  ? 14.200  12.417 -3.516  1.00 0.00 ? 1  LEU A CD1  15 
ATOM 5370 C CD2  . LEU A 1 1  ? 15.878  13.298 -5.220  1.00 0.00 ? 1  LEU A CD2  15 
ATOM 5371 H H1   . LEU A 1 1  ? 13.913  8.634  -4.722  1.00 0.00 ? 1  LEU A H1   15 
ATOM 5372 H H2   . LEU A 1 1  ? 14.078  10.030 -3.860  1.00 0.00 ? 1  LEU A H2   15 
ATOM 5373 H H3   . LEU A 1 1  ? 12.776  9.789  -4.792  1.00 0.00 ? 1  LEU A H3   15 
ATOM 5374 N N    . GLN A 1 2  ? 16.610  10.109 -4.835  1.00 0.00 ? 2  GLN A N    15 
ATOM 5375 C CA   . GLN A 1 2  ? 18.055  9.878  -4.650  1.00 0.00 ? 2  GLN A CA   15 
ATOM 5376 C C    . GLN A 1 2  ? 18.225  8.796  -3.585  1.00 0.00 ? 2  GLN A C    15 
ATOM 5377 O O    . GLN A 1 2  ? 17.497  8.755  -2.586  1.00 0.00 ? 2  GLN A O    15 
ATOM 5378 C CB   . GLN A 1 2  ? 18.756  11.178 -4.222  1.00 0.00 ? 2  GLN A CB   15 
ATOM 5379 C CG   . GLN A 1 2  ? 20.262  10.989 -3.953  1.00 0.00 ? 2  GLN A CG   15 
ATOM 5380 C CD   . GLN A 1 2  ? 21.125  11.933 -4.797  1.00 0.00 ? 2  GLN A CD   15 
ATOM 5381 O OE1  . GLN A 1 2  ? 21.356  13.085 -4.460  1.00 0.00 ? 2  GLN A OE1  15 
ATOM 5382 N NE2  . GLN A 1 2  ? 21.638  11.440 -5.904  1.00 0.00 ? 2  GLN A NE2  15 
ATOM 5383 H H    . GLN A 1 2  ? 16.092  10.268 -3.991  1.00 0.00 ? 2  GLN A H    15 
ATOM 5384 H HE21 . GLN A 1 2  ? 21.457  10.516 -6.221  1.00 0.00 ? 2  GLN A HE21 15 
ATOM 5385 H HE22 . GLN A 1 2  ? 22.204  12.082 -6.417  1.00 0.00 ? 2  GLN A HE22 15 
ATOM 5386 N N    . ARG A 1 3  ? 19.256  7.995  -3.837  1.00 0.00 ? 3  ARG A N    15 
ATOM 5387 C CA   . ARG A 1 3  ? 19.733  6.842  -3.052  1.00 0.00 ? 3  ARG A CA   15 
ATOM 5388 C C    . ARG A 1 3  ? 18.859  5.605  -3.320  1.00 0.00 ? 3  ARG A C    15 
ATOM 5389 O O    . ARG A 1 3  ? 18.269  5.055  -2.403  1.00 0.00 ? 3  ARG A O    15 
ATOM 5390 C CB   . ARG A 1 3  ? 19.830  7.175  -1.557  1.00 0.00 ? 3  ARG A CB   15 
ATOM 5391 C CG   . ARG A 1 3  ? 21.009  6.440  -0.926  1.00 0.00 ? 3  ARG A CG   15 
ATOM 5392 C CD   . ARG A 1 3  ? 22.309  7.237  -1.087  1.00 0.00 ? 3  ARG A CD   15 
ATOM 5393 N NE   . ARG A 1 3  ? 22.451  8.175  0.059   1.00 0.00 ? 3  ARG A NE   15 
ATOM 5394 C CZ   . ARG A 1 3  ? 22.772  7.828  1.305   1.00 0.00 ? 3  ARG A CZ   15 
ATOM 5395 N NH1  . ARG A 1 3  ? 23.175  6.606  1.613   1.00 0.00 ? 3  ARG A NH1  15 
ATOM 5396 N NH2  . ARG A 1 3  ? 22.402  8.608  2.311   1.00 0.00 ? 3  ARG A NH2  15 
ATOM 5397 H H    . ARG A 1 3  ? 19.817  8.195  -4.640  1.00 0.00 ? 3  ARG A H    15 
ATOM 5398 H HE   . ARG A 1 3  ? 22.426  9.145  -0.170  1.00 0.00 ? 3  ARG A HE   15 
ATOM 5399 H HH11 . ARG A 1 3  ? 23.307  5.942  0.882   1.00 0.00 ? 3  ARG A HH11 15 
ATOM 5400 H HH12 . ARG A 1 3  ? 23.383  6.363  2.564   1.00 0.00 ? 3  ARG A HH12 15 
ATOM 5401 H HH21 . ARG A 1 3  ? 21.868  9.441  2.145   1.00 0.00 ? 3  ARG A HH21 15 
ATOM 5402 H HH22 . ARG A 1 3  ? 22.641  8.345  3.243   1.00 0.00 ? 3  ARG A HH22 15 
ATOM 5403 N N    . MET A 1 4  ? 18.931  5.100  -4.548  1.00 0.00 ? 4  MET A N    15 
ATOM 5404 C CA   . MET A 1 4  ? 18.201  3.874  -4.957  1.00 0.00 ? 4  MET A CA   15 
ATOM 5405 C C    . MET A 1 4  ? 18.397  2.687  -4.000  1.00 0.00 ? 4  MET A C    15 
ATOM 5406 O O    . MET A 1 4  ? 17.411  2.124  -3.556  1.00 0.00 ? 4  MET A O    15 
ATOM 5407 C CB   . MET A 1 4  ? 18.540  3.447  -6.393  1.00 0.00 ? 4  MET A CB   15 
ATOM 5408 C CG   . MET A 1 4  ? 17.665  4.115  -7.460  1.00 0.00 ? 4  MET A CG   15 
ATOM 5409 S SD   . MET A 1 4  ? 18.121  5.824  -7.924  1.00 0.00 ? 4  MET A SD   15 
ATOM 5410 C CE   . MET A 1 4  ? 17.117  6.776  -6.809  1.00 0.00 ? 4  MET A CE   15 
ATOM 5411 H H    . MET A 1 4  ? 19.384  5.586  -5.296  1.00 0.00 ? 4  MET A H    15 
ATOM 5412 N N    . LYS A 1 5  ? 19.608  2.605  -3.452  1.00 0.00 ? 5  LYS A N    15 
ATOM 5413 C CA   . LYS A 1 5  ? 20.019  1.606  -2.449  1.00 0.00 ? 5  LYS A CA   15 
ATOM 5414 C C    . LYS A 1 5  ? 19.139  1.706  -1.171  1.00 0.00 ? 5  LYS A C    15 
ATOM 5415 O O    . LYS A 1 5  ? 18.415  0.776  -0.876  1.00 0.00 ? 5  LYS A O    15 
ATOM 5416 C CB   . LYS A 1 5  ? 21.504  1.812  -2.117  1.00 0.00 ? 5  LYS A CB   15 
ATOM 5417 C CG   . LYS A 1 5  ? 22.413  1.781  -3.362  1.00 0.00 ? 5  LYS A CG   15 
ATOM 5418 C CD   . LYS A 1 5  ? 22.837  0.384  -3.807  1.00 0.00 ? 5  LYS A CD   15 
ATOM 5419 C CE   . LYS A 1 5  ? 23.492  0.366  -5.192  1.00 0.00 ? 5  LYS A CE   15 
ATOM 5420 N NZ   . LYS A 1 5  ? 24.625  1.299  -5.299  1.00 0.00 ? 5  LYS A NZ   15 
ATOM 5421 H H    . LYS A 1 5  ? 20.317  3.246  -3.705  1.00 0.00 ? 5  LYS A H    15 
ATOM 5422 H HZ1  . LYS A 1 5  ? 25.330  1.057  -4.625  1.00 0.00 ? 5  LYS A HZ1  15 
ATOM 5423 H HZ2  . LYS A 1 5  ? 25.015  1.236  -6.220  1.00 0.00 ? 5  LYS A HZ2  15 
ATOM 5424 H HZ3  . LYS A 1 5  ? 24.310  2.243  -5.152  1.00 0.00 ? 5  LYS A HZ3  15 
ATOM 5425 N N    . GLN A 1 6  ? 19.017  2.935  -0.644  1.00 0.00 ? 6  GLN A N    15 
ATOM 5426 C CA   . GLN A 1 6  ? 18.171  3.265  0.527   1.00 0.00 ? 6  GLN A CA   15 
ATOM 5427 C C    . GLN A 1 6  ? 16.673  3.350  0.190   1.00 0.00 ? 6  GLN A C    15 
ATOM 5428 O O    . GLN A 1 6  ? 15.842  2.847  0.940   1.00 0.00 ? 6  GLN A O    15 
ATOM 5429 C CB   . GLN A 1 6  ? 18.681  4.552  1.193   1.00 0.00 ? 6  GLN A CB   15 
ATOM 5430 C CG   . GLN A 1 6  ? 17.786  5.179  2.272   1.00 0.00 ? 6  GLN A CG   15 
ATOM 5431 C CD   . GLN A 1 6  ? 17.386  4.233  3.424   1.00 0.00 ? 6  GLN A CD   15 
ATOM 5432 O OE1  . GLN A 1 6  ? 18.024  3.242  3.736   1.00 0.00 ? 6  GLN A OE1  15 
ATOM 5433 N NE2  . GLN A 1 6  ? 16.313  4.569  4.116   1.00 0.00 ? 6  GLN A NE2  15 
ATOM 5434 H H    . GLN A 1 6  ? 19.414  3.733  -1.096  1.00 0.00 ? 6  GLN A H    15 
ATOM 5435 H HE21 . GLN A 1 6  ? 15.792  5.380  3.899   1.00 0.00 ? 6  GLN A HE21 15 
ATOM 5436 H HE22 . GLN A 1 6  ? 16.071  3.946  4.856   1.00 0.00 ? 6  GLN A HE22 15 
ATOM 5437 N N    . LEU A 1 7  ? 16.326  3.999  -0.918  1.00 0.00 ? 7  LEU A N    15 
ATOM 5438 C CA   . LEU A 1 7  ? 14.928  4.058  -1.398  1.00 0.00 ? 7  LEU A CA   15 
ATOM 5439 C C    . LEU A 1 7  ? 14.314  2.653  -1.545  1.00 0.00 ? 7  LEU A C    15 
ATOM 5440 O O    . LEU A 1 7  ? 13.219  2.441  -1.042  1.00 0.00 ? 7  LEU A O    15 
ATOM 5441 C CB   . LEU A 1 7  ? 14.788  4.846  -2.703  1.00 0.00 ? 7  LEU A CB   15 
ATOM 5442 C CG   . LEU A 1 7  ? 15.285  6.286  -2.586  1.00 0.00 ? 7  LEU A CG   15 
ATOM 5443 C CD1  . LEU A 1 7  ? 15.255  6.894  -3.968  1.00 0.00 ? 7  LEU A CD1  15 
ATOM 5444 C CD2  . LEU A 1 7  ? 14.428  7.175  -1.669  1.00 0.00 ? 7  LEU A CD2  15 
ATOM 5445 H H    . LEU A 1 7  ? 16.995  4.508  -1.467  1.00 0.00 ? 7  LEU A H    15 
ATOM 5446 N N    . GLU A 1 8  ? 15.157  1.697  -1.922  1.00 0.00 ? 8  GLU A N    15 
ATOM 5447 C CA   . GLU A 1 8  ? 14.815  0.253  -1.991  1.00 0.00 ? 8  GLU A CA   15 
ATOM 5448 C C    . GLU A 1 8  ? 14.444  -0.391 -0.651  1.00 0.00 ? 8  GLU A C    15 
ATOM 5449 O O    . GLU A 1 8  ? 13.662  -1.343 -0.635  1.00 0.00 ? 8  GLU A O    15 
ATOM 5450 C CB   . GLU A 1 8  ? 15.941  -0.520 -2.676  1.00 0.00 ? 8  GLU A CB   15 
ATOM 5451 C CG   . GLU A 1 8  ? 15.776  -0.550 -4.199  1.00 0.00 ? 8  GLU A CG   15 
ATOM 5452 C CD   . GLU A 1 8  ? 15.048  -1.818 -4.638  1.00 0.00 ? 8  GLU A CD   15 
ATOM 5453 O OE1  . GLU A 1 8  ? 15.593  -2.918 -4.648  1.00 0.00 ? 8  GLU A OE1  15 
ATOM 5454 O OE2  . GLU A 1 8  ? 13.767  -1.697 -5.034  1.00 0.00 ? 8  GLU A OE2  15 
ATOM 5455 H H    . GLU A 1 8  ? 16.090  1.917  -2.224  1.00 0.00 ? 8  GLU A H    15 
ATOM 5456 H HE2  . GLU A 1 8  ? 13.507  -2.639 -5.253  1.00 0.00 ? 8  GLU A HE2  15 
ATOM 5457 N N    . ASP A 1 9  ? 14.876  0.220  0.450   1.00 0.00 ? 9  ASP A N    15 
ATOM 5458 C CA   . ASP A 1 9  ? 14.526  -0.207 1.826   1.00 0.00 ? 9  ASP A CA   15 
ATOM 5459 C C    . ASP A 1 9  ? 13.050  0.125  2.130   1.00 0.00 ? 9  ASP A C    15 
ATOM 5460 O O    . ASP A 1 9  ? 12.292  -0.710 2.619   1.00 0.00 ? 9  ASP A O    15 
ATOM 5461 C CB   . ASP A 1 9  ? 15.409  0.479  2.891   1.00 0.00 ? 9  ASP A CB   15 
ATOM 5462 C CG   . ASP A 1 9  ? 16.918  0.300  2.710   1.00 0.00 ? 9  ASP A CG   15 
ATOM 5463 O OD1  . ASP A 1 9  ? 17.476  0.218  1.621   1.00 0.00 ? 9  ASP A OD1  15 
ATOM 5464 O OD2  . ASP A 1 9  ? 17.655  0.257  3.839   1.00 0.00 ? 9  ASP A OD2  15 
ATOM 5465 H H    . ASP A 1 9  ? 15.468  1.023  0.406   1.00 0.00 ? 9  ASP A H    15 
ATOM 5466 H HD2  . ASP A 1 9  ? 18.595  0.289  3.491   1.00 0.00 ? 9  ASP A HD2  15 
ATOM 5467 N N    . LYS A 1 10 ? 12.632  1.309  1.688   1.00 0.00 ? 10 LYS A N    15 
ATOM 5468 C CA   . LYS A 1 10 ? 11.232  1.753  1.815   1.00 0.00 ? 10 LYS A CA   15 
ATOM 5469 C C    . LYS A 1 10 ? 10.302  1.378  0.654   1.00 0.00 ? 10 LYS A C    15 
ATOM 5470 O O    . LYS A 1 10 ? 9.122   1.176  0.892   1.00 0.00 ? 10 LYS A O    15 
ATOM 5471 C CB   . LYS A 1 10 ? 11.041  3.233  2.195   1.00 0.00 ? 10 LYS A CB   15 
ATOM 5472 C CG   . LYS A 1 10 ? 11.800  4.264  1.364   1.00 0.00 ? 10 LYS A CG   15 
ATOM 5473 C CD   . LYS A 1 10 ? 13.181  4.514  1.965   1.00 0.00 ? 10 LYS A CD   15 
ATOM 5474 C CE   . LYS A 1 10 ? 13.685  5.929  1.666   1.00 0.00 ? 10 LYS A CE   15 
ATOM 5475 N NZ   . LYS A 1 10 ? 12.835  6.904  2.361   1.00 0.00 ? 10 LYS A NZ   15 
ATOM 5476 H H    . LYS A 1 10 ? 13.250  1.946  1.209   1.00 0.00 ? 10 LYS A H    15 
ATOM 5477 H HZ1  . LYS A 1 10 ? 11.872  6.737  2.144   1.00 0.00 ? 10 LYS A HZ1  15 
ATOM 5478 H HZ2  . LYS A 1 10 ? 12.986  6.832  3.350   1.00 0.00 ? 10 LYS A HZ2  15 
ATOM 5479 H HZ3  . LYS A 1 10 ? 13.077  7.825  2.058   1.00 0.00 ? 10 LYS A HZ3  15 
ATOM 5480 N N    . VAL A 1 11 ? 10.846  1.187  -0.552  1.00 0.00 ? 11 VAL A N    15 
ATOM 5481 C CA   . VAL A 1 11 ? 10.093  0.658  -1.721  1.00 0.00 ? 11 VAL A CA   15 
ATOM 5482 C C    . VAL A 1 11 ? 9.229   -0.571 -1.379  1.00 0.00 ? 11 VAL A C    15 
ATOM 5483 O O    . VAL A 1 11 ? 8.047   -0.598 -1.687  1.00 0.00 ? 11 VAL A O    15 
ATOM 5484 C CB   . VAL A 1 11 ? 11.067  0.439  -2.900  1.00 0.00 ? 11 VAL A CB   15 
ATOM 5485 C CG1  . VAL A 1 11 ? 10.542  -0.457 -4.032  1.00 0.00 ? 11 VAL A CG1  15 
ATOM 5486 C CG2  . VAL A 1 11 ? 11.422  1.788  -3.541  1.00 0.00 ? 11 VAL A CG2  15 
ATOM 5487 H H    . VAL A 1 11 ? 11.763  1.533  -0.767  1.00 0.00 ? 11 VAL A H    15 
ATOM 5488 N N    . GLU A 1 12 ? 9.796   -1.453 -0.560  1.00 0.00 ? 12 GLU A N    15 
ATOM 5489 C CA   . GLU A 1 12 ? 9.077   -2.634 -0.030  1.00 0.00 ? 12 GLU A CA   15 
ATOM 5490 C C    . GLU A 1 12 ? 7.936   -2.288 0.946   1.00 0.00 ? 12 GLU A C    15 
ATOM 5491 O O    . GLU A 1 12 ? 6.796   -2.684 0.718   1.00 0.00 ? 12 GLU A O    15 
ATOM 5492 C CB   . GLU A 1 12 ? 10.065  -3.600 0.619   1.00 0.00 ? 12 GLU A CB   15 
ATOM 5493 C CG   . GLU A 1 12 ? 10.465  -4.657 -0.416  1.00 0.00 ? 12 GLU A CG   15 
ATOM 5494 C CD   . GLU A 1 12 ? 11.984  -4.824 -0.454  1.00 0.00 ? 12 GLU A CD   15 
ATOM 5495 O OE1  . GLU A 1 12 ? 12.620  -5.369 0.445   1.00 0.00 ? 12 GLU A OE1  15 
ATOM 5496 O OE2  . GLU A 1 12 ? 12.595  -4.340 -1.559  1.00 0.00 ? 12 GLU A OE2  15 
ATOM 5497 H H    . GLU A 1 12 ? 10.754  -1.372 -0.288  1.00 0.00 ? 12 GLU A H    15 
ATOM 5498 H HE2  . GLU A 1 12 ? 13.556  -4.507 -1.375  1.00 0.00 ? 12 GLU A HE2  15 
ATOM 5499 N N    . GLU A 1 13 ? 8.251   -1.426 1.912   1.00 0.00 ? 13 GLU A N    15 
ATOM 5500 C CA   . GLU A 1 13 ? 7.275   -0.856 2.878   1.00 0.00 ? 13 GLU A CA   15 
ATOM 5501 C C    . GLU A 1 13 ? 6.105   -0.149 2.155   1.00 0.00 ? 13 GLU A C    15 
ATOM 5502 O O    . GLU A 1 13 ? 4.982   -0.119 2.660   1.00 0.00 ? 13 GLU A O    15 
ATOM 5503 C CB   . GLU A 1 13 ? 7.974   0.153  3.785   1.00 0.00 ? 13 GLU A CB   15 
ATOM 5504 C CG   . GLU A 1 13 ? 9.054   -0.481 4.678   1.00 0.00 ? 13 GLU A CG   15 
ATOM 5505 C CD   . GLU A 1 13 ? 10.171  0.496  5.075   1.00 0.00 ? 13 GLU A CD   15 
ATOM 5506 O OE1  . GLU A 1 13 ? 11.267  0.114  5.455   1.00 0.00 ? 13 GLU A OE1  15 
ATOM 5507 O OE2  . GLU A 1 13 ? 9.922   1.822  4.985   1.00 0.00 ? 13 GLU A OE2  15 
ATOM 5508 H H    . GLU A 1 13 ? 9.176   -1.067 2.007   1.00 0.00 ? 13 GLU A H    15 
ATOM 5509 H HE2  . GLU A 1 13 ? 10.799  2.223  5.231   1.00 0.00 ? 13 GLU A HE2  15 
ATOM 5510 N N    . LEU A 1 14 ? 6.379   0.388  0.972   1.00 0.00 ? 14 LEU A N    15 
ATOM 5511 C CA   . LEU A 1 14 ? 5.360   1.007  0.114   1.00 0.00 ? 14 LEU A CA   15 
ATOM 5512 C C    . LEU A 1 14 ? 4.385   -0.063 -0.378  1.00 0.00 ? 14 LEU A C    15 
ATOM 5513 O O    . LEU A 1 14 ? 3.262   -0.057 0.079   1.00 0.00 ? 14 LEU A O    15 
ATOM 5514 C CB   . LEU A 1 14 ? 5.916   1.762  -1.098  1.00 0.00 ? 14 LEU A CB   15 
ATOM 5515 C CG   . LEU A 1 14 ? 6.964   2.837  -0.761  1.00 0.00 ? 14 LEU A CG   15 
ATOM 5516 C CD1  . LEU A 1 14 ? 7.355   3.560  -2.043  1.00 0.00 ? 14 LEU A CD1  15 
ATOM 5517 C CD2  . LEU A 1 14 ? 6.520   3.828  0.318   1.00 0.00 ? 14 LEU A CD2  15 
ATOM 5518 H H    . LEU A 1 14 ? 7.321   0.401  0.617   1.00 0.00 ? 14 LEU A H    15 
ATOM 5519 N N    . LEU A 1 15 ? 4.869   -1.037 -1.142  1.00 0.00 ? 15 LEU A N    15 
ATOM 5520 C CA   . LEU A 1 15 ? 4.049   -2.140 -1.682  1.00 0.00 ? 15 LEU A CA   15 
ATOM 5521 C C    . LEU A 1 15 ? 3.283   -2.914 -0.592  1.00 0.00 ? 15 LEU A C    15 
ATOM 5522 O O    . LEU A 1 15 ? 2.059   -2.979 -0.673  1.00 0.00 ? 15 LEU A O    15 
ATOM 5523 C CB   . LEU A 1 15 ? 4.862   -3.134 -2.511  1.00 0.00 ? 15 LEU A CB   15 
ATOM 5524 C CG   . LEU A 1 15 ? 5.860   -2.496 -3.491  1.00 0.00 ? 15 LEU A CG   15 
ATOM 5525 C CD1  . LEU A 1 15 ? 6.477   -3.594 -4.355  1.00 0.00 ? 15 LEU A CD1  15 
ATOM 5526 C CD2  . LEU A 1 15 ? 5.261   -1.402 -4.397  1.00 0.00 ? 15 LEU A CD2  15 
ATOM 5527 H H    . LEU A 1 15 ? 5.813   -1.001 -1.498  1.00 0.00 ? 15 LEU A H    15 
ATOM 5528 N N    . SER A 1 16 ? 3.963   -3.256 0.505   1.00 0.00 ? 16 SER A N    15 
ATOM 5529 C CA   . SER A 1 16 ? 3.340   -3.929 1.674   1.00 0.00 ? 16 SER A CA   15 
ATOM 5530 C C    . SER A 1 16 ? 2.081   -3.192 2.171   1.00 0.00 ? 16 SER A C    15 
ATOM 5531 O O    . SER A 1 16 ? 1.056   -3.811 2.461   1.00 0.00 ? 16 SER A O    15 
ATOM 5532 C CB   . SER A 1 16 ? 4.309   -4.102 2.844   1.00 0.00 ? 16 SER A CB   15 
ATOM 5533 O OG   . SER A 1 16 ? 4.546   -2.864 3.524   1.00 0.00 ? 16 SER A OG   15 
ATOM 5534 H H    . SER A 1 16 ? 4.957   -3.100 0.564   1.00 0.00 ? 16 SER A H    15 
ATOM 5535 H HG   . SER A 1 16 ? 4.901   -3.029 4.449   1.00 0.00 ? 16 SER A HG   15 
ATOM 5536 N N    . LYS A 1 17 ? 2.145   -1.869 2.074   1.00 0.00 ? 17 LYS A N    15 
ATOM 5537 C CA   . LYS A 1 17 ? 1.033   -0.961 2.408   1.00 0.00 ? 17 LYS A CA   15 
ATOM 5538 C C    . LYS A 1 17 ? 0.105   -0.615 1.228   1.00 0.00 ? 17 LYS A C    15 
ATOM 5539 O O    . LYS A 1 17 ? -1.106  -0.692 1.353   1.00 0.00 ? 17 LYS A O    15 
ATOM 5540 C CB   . LYS A 1 17 ? 1.577   0.311  3.072   1.00 0.00 ? 17 LYS A CB   15 
ATOM 5541 C CG   . LYS A 1 17 ? 2.182   -0.007 4.444   1.00 0.00 ? 17 LYS A CG   15 
ATOM 5542 C CD   . LYS A 1 17 ? 2.256   1.247  5.328   1.00 0.00 ? 17 LYS A CD   15 
ATOM 5543 C CE   . LYS A 1 17 ? 3.589   1.995  5.282   1.00 0.00 ? 17 LYS A CE   15 
ATOM 5544 N NZ   . LYS A 1 17 ? 3.972   2.331  3.903   1.00 0.00 ? 17 LYS A NZ   15 
ATOM 5545 H H    . LYS A 1 17 ? 3.009   -1.413 1.859   1.00 0.00 ? 17 LYS A H    15 
ATOM 5546 H HZ1  . LYS A 1 17 ? 3.213   2.795  3.448   1.00 0.00 ? 17 LYS A HZ1  15 
ATOM 5547 H HZ2  . LYS A 1 17 ? 4.772   2.925  3.924   1.00 0.00 ? 17 LYS A HZ2  15 
ATOM 5548 H HZ3  . LYS A 1 17 ? 4.203   1.480  3.422   1.00 0.00 ? 17 LYS A HZ3  15 
ATOM 5549 N N    . ASN A 1 18 ? 0.653   -0.333 0.061   1.00 0.00 ? 18 ASN A N    15 
ATOM 5550 C CA   . ASN A 1 18 ? -0.113  -0.098 -1.187  1.00 0.00 ? 18 ASN A CA   15 
ATOM 5551 C C    . ASN A 1 18 ? -1.071  -1.263 -1.509  1.00 0.00 ? 18 ASN A C    15 
ATOM 5552 O O    . ASN A 1 18 ? -2.223  -1.040 -1.892  1.00 0.00 ? 18 ASN A O    15 
ATOM 5553 C CB   . ASN A 1 18 ? 0.879   0.149  -2.336  1.00 0.00 ? 18 ASN A CB   15 
ATOM 5554 C CG   . ASN A 1 18 ? 0.333   1.144  -3.358  1.00 0.00 ? 18 ASN A CG   15 
ATOM 5555 O OD1  . ASN A 1 18 ? 0.356   0.925  -4.563  1.00 0.00 ? 18 ASN A OD1  15 
ATOM 5556 N ND2  . ASN A 1 18 ? -0.127  2.279  -2.893  1.00 0.00 ? 18 ASN A ND2  15 
ATOM 5557 H H    . ASN A 1 18 ? 1.657   -0.208 -0.021  1.00 0.00 ? 18 ASN A H    15 
ATOM 5558 H HD21 . ASN A 1 18 ? -0.166  2.463  -1.915  1.00 0.00 ? 18 ASN A HD21 15 
ATOM 5559 H HD22 . ASN A 1 18 ? -0.478  2.926  -3.572  1.00 0.00 ? 18 ASN A HD22 15 
ATOM 5560 N N    . TYR A 1 19 ? -0.650  -2.459 -1.120  1.00 0.00 ? 19 TYR A N    15 
ATOM 5561 C CA   . TYR A 1 19 ? -1.430  -3.710 -1.167  1.00 0.00 ? 19 TYR A CA   15 
ATOM 5562 C C    . TYR A 1 19 ? -2.598  -3.743 -0.174  1.00 0.00 ? 19 TYR A C    15 
ATOM 5563 O O    . TYR A 1 19 ? -3.703  -4.122 -0.545  1.00 0.00 ? 19 TYR A O    15 
ATOM 5564 C CB   . TYR A 1 19 ? -0.503  -4.919 -0.960  1.00 0.00 ? 19 TYR A CB   15 
ATOM 5565 C CG   . TYR A 1 19 ? 0.395   -5.297 -2.151  1.00 0.00 ? 19 TYR A CG   15 
ATOM 5566 C CD1  . TYR A 1 19 ? 0.857   -4.328 -3.083  1.00 0.00 ? 19 TYR A CD1  15 
ATOM 5567 C CD2  . TYR A 1 19 ? 0.762   -6.645 -2.266  1.00 0.00 ? 19 TYR A CD2  15 
ATOM 5568 C CE1  . TYR A 1 19 ? 1.708   -4.727 -4.127  1.00 0.00 ? 19 TYR A CE1  15 
ATOM 5569 C CE2  . TYR A 1 19 ? 1.614   -7.052 -3.313  1.00 0.00 ? 19 TYR A CE2  15 
ATOM 5570 C CZ   . TYR A 1 19 ? 2.077   -6.092 -4.224  1.00 0.00 ? 19 TYR A CZ   15 
ATOM 5571 O OH   . TYR A 1 19 ? 2.928   -6.465 -5.220  1.00 0.00 ? 19 TYR A OH   15 
ATOM 5572 H H    . TYR A 1 19 ? 0.312   -2.583 -0.820  1.00 0.00 ? 19 TYR A H    15 
ATOM 5573 H HH   . TYR A 1 19 ? 3.145   -5.665 -5.783  1.00 0.00 ? 19 TYR A HH   15 
ATOM 5574 N N    . HIS A 1 20 ? -2.394  -3.269 1.054   1.00 0.00 ? 20 HIS A N    15 
ATOM 5575 C CA   . HIS A 1 20 ? -3.501  -3.109 2.021   1.00 0.00 ? 20 HIS A CA   15 
ATOM 5576 C C    . HIS A 1 20 ? -4.410  -1.888 1.732   1.00 0.00 ? 20 HIS A C    15 
ATOM 5577 O O    . HIS A 1 20 ? -5.587  -1.854 2.091   1.00 0.00 ? 20 HIS A O    15 
ATOM 5578 C CB   . HIS A 1 20 ? -3.022  -3.169 3.486   1.00 0.00 ? 20 HIS A CB   15 
ATOM 5579 C CG   . HIS A 1 20 ? -2.218  -1.996 4.063   1.00 0.00 ? 20 HIS A CG   15 
ATOM 5580 N ND1  . HIS A 1 20 ? -1.283  -2.109 5.003   1.00 0.00 ? 20 HIS A ND1  15 
ATOM 5581 C CD2  . HIS A 1 20 ? -2.454  -0.692 3.920   1.00 0.00 ? 20 HIS A CD2  15 
ATOM 5582 C CE1  . HIS A 1 20 ? -0.986  -0.895 5.461   1.00 0.00 ? 20 HIS A CE1  15 
ATOM 5583 N NE2  . HIS A 1 20 ? -1.662  -0.011 4.734   1.00 0.00 ? 20 HIS A NE2  15 
ATOM 5584 H H    . HIS A 1 20 ? -1.489  -2.968 1.377   1.00 0.00 ? 20 HIS A H    15 
ATOM 5585 H HD1  . HIS A 1 20 ? -0.798  -2.948 5.250   1.00 0.00 ? 20 HIS A HD1  15 
ATOM 5586 H HE2  . HIS A 1 20 ? -1.367  0.929  4.574   1.00 0.00 ? 20 HIS A HE2  15 
ATOM 5587 N N    . LEU A 1 21 ? -3.863  -0.951 0.947   1.00 0.00 ? 21 LEU A N    15 
ATOM 5588 C CA   . LEU A 1 21 ? -4.527  0.300  0.537   1.00 0.00 ? 21 LEU A CA   15 
ATOM 5589 C C    . LEU A 1 21 ? -5.664  0.047  -0.464  1.00 0.00 ? 21 LEU A C    15 
ATOM 5590 O O    . LEU A 1 21 ? -6.770  0.549  -0.253  1.00 0.00 ? 21 LEU A O    15 
ATOM 5591 C CB   . LEU A 1 21 ? -3.477  1.274  -0.023  1.00 0.00 ? 21 LEU A CB   15 
ATOM 5592 C CG   . LEU A 1 21 ? -4.081  2.506  -0.725  1.00 0.00 ? 21 LEU A CG   15 
ATOM 5593 C CD1  . LEU A 1 21 ? -4.738  3.474  0.265   1.00 0.00 ? 21 LEU A CD1  15 
ATOM 5594 C CD2  . LEU A 1 21 ? -3.030  3.203  -1.580  1.00 0.00 ? 21 LEU A CD2  15 
ATOM 5595 H H    . LEU A 1 21 ? -2.927  -1.048 0.623   1.00 0.00 ? 21 LEU A H    15 
ATOM 5596 N N    . GLU A 1 22 ? -5.388  -0.735 -1.505  1.00 0.00 ? 22 GLU A N    15 
ATOM 5597 C CA   . GLU A 1 22 ? -6.411  -1.137 -2.495  1.00 0.00 ? 22 GLU A CA   15 
ATOM 5598 C C    . GLU A 1 22 ? -7.669  -1.763 -1.828  1.00 0.00 ? 22 GLU A C    15 
ATOM 5599 O O    . GLU A 1 22 ? -8.794  -1.456 -2.219  1.00 0.00 ? 22 GLU A O    15 
ATOM 5600 C CB   . GLU A 1 22 ? -5.865  -2.078 -3.574  1.00 0.00 ? 22 GLU A CB   15 
ATOM 5601 C CG   . GLU A 1 22 ? -5.217  -3.356 -3.016  1.00 0.00 ? 22 GLU A CG   15 
ATOM 5602 C CD   . GLU A 1 22 ? -5.233  -4.571 -3.951  1.00 0.00 ? 22 GLU A CD   15 
ATOM 5603 O OE1  . GLU A 1 22 ? -4.968  -5.696 -3.557  1.00 0.00 ? 22 GLU A OE1  15 
ATOM 5604 O OE2  . GLU A 1 22 ? -5.566  -4.379 -5.249  1.00 0.00 ? 22 GLU A OE2  15 
ATOM 5605 H H    . GLU A 1 22 ? -4.444  -1.027 -1.711  1.00 0.00 ? 22 GLU A H    15 
ATOM 5606 H HE2  . GLU A 1 22 ? -5.533  -5.303 -5.620  1.00 0.00 ? 22 GLU A HE2  15 
ATOM 5607 N N    . ASN A 1 23 ? -7.427  -2.441 -0.712  1.00 0.00 ? 23 ASN A N    15 
ATOM 5608 C CA   . ASN A 1 23 ? -8.512  -3.031 0.104   1.00 0.00 ? 23 ASN A CA   15 
ATOM 5609 C C    . ASN A 1 23 ? -9.354  -1.932 0.788   1.00 0.00 ? 23 ASN A C    15 
ATOM 5610 O O    . ASN A 1 23 ? -10.579 -1.958 0.688   1.00 0.00 ? 23 ASN A O    15 
ATOM 5611 C CB   . ASN A 1 23 ? -7.910  -3.983 1.149   1.00 0.00 ? 23 ASN A CB   15 
ATOM 5612 C CG   . ASN A 1 23 ? -8.919  -4.985 1.716   1.00 0.00 ? 23 ASN A CG   15 
ATOM 5613 O OD1  . ASN A 1 23 ? -8.574  -6.055 2.199   1.00 0.00 ? 23 ASN A OD1  15 
ATOM 5614 N ND2  . ASN A 1 23 ? -10.209 -4.688 1.649   1.00 0.00 ? 23 ASN A ND2  15 
ATOM 5615 H H    . ASN A 1 23 ? -6.504  -2.583 -0.354  1.00 0.00 ? 23 ASN A H    15 
ATOM 5616 H HD21 . ASN A 1 23 ? -10.523 -3.830 1.253   1.00 0.00 ? 23 ASN A HD21 15 
ATOM 5617 H HD22 . ASN A 1 23 ? -10.834 -5.353 2.028   1.00 0.00 ? 23 ASN A HD22 15 
ATOM 5618 N N    . GLU A 1 24 ? -8.673  -0.987 1.428   1.00 0.00 ? 24 GLU A N    15 
ATOM 5619 C CA   . GLU A 1 24 ? -9.318  0.189  2.050   1.00 0.00 ? 24 GLU A CA   15 
ATOM 5620 C C    . GLU A 1 24 ? -10.119 1.018  1.045   1.00 0.00 ? 24 GLU A C    15 
ATOM 5621 O O    . GLU A 1 24 ? -11.333 1.045  1.180   1.00 0.00 ? 24 GLU A O    15 
ATOM 5622 C CB   . GLU A 1 24 ? -8.284  1.067  2.759   1.00 0.00 ? 24 GLU A CB   15 
ATOM 5623 C CG   . GLU A 1 24 ? -7.736  0.367  4.001   1.00 0.00 ? 24 GLU A CG   15 
ATOM 5624 C CD   . GLU A 1 24 ? -6.519  1.127  4.528   1.00 0.00 ? 24 GLU A CD   15 
ATOM 5625 O OE1  . GLU A 1 24 ? -6.618  2.132  5.228   1.00 0.00 ? 24 GLU A OE1  15 
ATOM 5626 O OE2  . GLU A 1 24 ? -5.322  0.697  4.082   1.00 0.00 ? 24 GLU A OE2  15 
ATOM 5627 H H    . GLU A 1 24 ? -7.678  -1.017 1.523   1.00 0.00 ? 24 GLU A H    15 
ATOM 5628 H HE2  . GLU A 1 24 ? -4.669  1.272  4.576   1.00 0.00 ? 24 GLU A HE2  15 
ATOM 5629 N N    . VAL A 1 25 ? -9.472  1.448  -0.043  1.00 0.00 ? 25 VAL A N    15 
ATOM 5630 C CA   . VAL A 1 25 ? -10.092 2.138  -1.204  1.00 0.00 ? 25 VAL A CA   15 
ATOM 5631 C C    . VAL A 1 25 ? -11.414 1.469  -1.644  1.00 0.00 ? 25 VAL A C    15 
ATOM 5632 O O    . VAL A 1 25 ? -12.402 2.166  -1.839  1.00 0.00 ? 25 VAL A O    15 
ATOM 5633 C CB   . VAL A 1 25 ? -9.089  2.282  -2.359  1.00 0.00 ? 25 VAL A CB   15 
ATOM 5634 C CG1  . VAL A 1 25 ? -9.684  2.971  -3.593  1.00 0.00 ? 25 VAL A CG1  15 
ATOM 5635 C CG2  . VAL A 1 25 ? -7.868  3.112  -1.930  1.00 0.00 ? 25 VAL A CG2  15 
ATOM 5636 H H    . VAL A 1 25 ? -8.475  1.411  -0.071  1.00 0.00 ? 25 VAL A H    15 
ATOM 5637 N N    . ALA A 1 26 ? -11.444 0.135  -1.620  1.00 0.00 ? 26 ALA A N    15 
ATOM 5638 C CA   . ALA A 1 26 ? -12.649 -0.656 -1.915  1.00 0.00 ? 26 ALA A CA   15 
ATOM 5639 C C    . ALA A 1 26 ? -13.754 -0.433 -0.858  1.00 0.00 ? 26 ALA A C    15 
ATOM 5640 O O    . ALA A 1 26 ? -14.690 0.315  -1.137  1.00 0.00 ? 26 ALA A O    15 
ATOM 5641 C CB   . ALA A 1 26 ? -12.279 -2.141 -2.066  1.00 0.00 ? 26 ALA A CB   15 
ATOM 5642 H H    . ALA A 1 26 ? -10.640 -0.400 -1.356  1.00 0.00 ? 26 ALA A H    15 
ATOM 5643 N N    . ARG A 1 27 ? -13.548 -0.910 0.369   1.00 0.00 ? 27 ARG A N    15 
ATOM 5644 C CA   . ARG A 1 27 ? -14.461 -0.669 1.515   1.00 0.00 ? 27 ARG A CA   15 
ATOM 5645 C C    . ARG A 1 27 ? -14.871 0.806  1.702   1.00 0.00 ? 27 ARG A C    15 
ATOM 5646 O O    . ARG A 1 27 ? -16.028 1.098  1.962   1.00 0.00 ? 27 ARG A O    15 
ATOM 5647 C CB   . ARG A 1 27 ? -13.812 -1.178 2.809   1.00 0.00 ? 27 ARG A CB   15 
ATOM 5648 C CG   . ARG A 1 27 ? -14.120 -2.656 3.041   1.00 0.00 ? 27 ARG A CG   15 
ATOM 5649 C CD   . ARG A 1 27 ? -12.883 -3.549 3.003   1.00 0.00 ? 27 ARG A CD   15 
ATOM 5650 N NE   . ARG A 1 27 ? -13.261 -4.732 3.793   1.00 0.00 ? 27 ARG A NE   15 
ATOM 5651 C CZ   . ARG A 1 27 ? -13.818 -5.843 3.329   1.00 0.00 ? 27 ARG A CZ   15 
ATOM 5652 N NH1  . ARG A 1 27 ? -13.186 -6.658 2.493   1.00 0.00 ? 27 ARG A NH1  15 
ATOM 5653 N NH2  . ARG A 1 27 ? -14.732 -6.418 4.089   1.00 0.00 ? 27 ARG A NH2  15 
ATOM 5654 H H    . ARG A 1 27 ? -12.740 -1.468 0.577   1.00 0.00 ? 27 ARG A H    15 
ATOM 5655 H HE   . ARG A 1 27 ? -12.930 -4.734 4.733   1.00 0.00 ? 27 ARG A HE   15 
ATOM 5656 H HH11 . ARG A 1 27 ? -12.251 -6.479 2.210   1.00 0.00 ? 27 ARG A HH11 15 
ATOM 5657 H HH12 . ARG A 1 27 ? -13.647 -7.492 2.190   1.00 0.00 ? 27 ARG A HH12 15 
ATOM 5658 H HH21 . ARG A 1 27 ? -15.124 -5.893 4.848   1.00 0.00 ? 27 ARG A HH21 15 
ATOM 5659 H HH22 . ARG A 1 27 ? -15.153 -7.279 3.817   1.00 0.00 ? 27 ARG A HH22 15 
ATOM 5660 N N    . LEU A 1 28 ? -13.916 1.699  1.431   1.00 0.00 ? 28 LEU A N    15 
ATOM 5661 C CA   . LEU A 1 28 ? -14.072 3.160  1.363   1.00 0.00 ? 28 LEU A CA   15 
ATOM 5662 C C    . LEU A 1 28 ? -15.097 3.566  0.296   1.00 0.00 ? 28 LEU A C    15 
ATOM 5663 O O    . LEU A 1 28 ? -16.162 4.052  0.652   1.00 0.00 ? 28 LEU A O    15 
ATOM 5664 C CB   . LEU A 1 28 ? -12.689 3.769  1.133   1.00 0.00 ? 28 LEU A CB   15 
ATOM 5665 C CG   . LEU A 1 28 ? -12.687 5.226  0.658   1.00 0.00 ? 28 LEU A CG   15 
ATOM 5666 C CD1  . LEU A 1 28 ? -13.056 6.168  1.811   1.00 0.00 ? 28 LEU A CD1  15 
ATOM 5667 C CD2  . LEU A 1 28 ? -11.324 5.615  0.089   1.00 0.00 ? 28 LEU A CD2  15 
ATOM 5668 H H    . LEU A 1 28 ? -12.978 1.382  1.259   1.00 0.00 ? 28 LEU A H    15 
ATOM 5669 N N    . LYS A 1 29 ? -14.827 3.246  -0.968  1.00 0.00 ? 29 LYS A N    15 
ATOM 5670 C CA   . LYS A 1 29 ? -15.718 3.585  -2.085  1.00 0.00 ? 29 LYS A CA   15 
ATOM 5671 C C    . LYS A 1 29 ? -17.128 2.950  -1.940  1.00 0.00 ? 29 LYS A C    15 
ATOM 5672 O O    . LYS A 1 29 ? -18.126 3.546  -2.330  1.00 0.00 ? 29 LYS A O    15 
ATOM 5673 C CB   . LYS A 1 29 ? -15.015 3.193  -3.378  1.00 0.00 ? 29 LYS A CB   15 
ATOM 5674 C CG   . LYS A 1 29 ? -15.360 4.181  -4.498  1.00 0.00 ? 29 LYS A CG   15 
ATOM 5675 C CD   . LYS A 1 29 ? -14.145 4.401  -5.395  1.00 0.00 ? 29 LYS A CD   15 
ATOM 5676 C CE   . LYS A 1 29 ? -14.461 5.411  -6.504  1.00 0.00 ? 29 LYS A CE   15 
ATOM 5677 N NZ   . LYS A 1 29 ? -13.268 5.678  -7.306  1.00 0.00 ? 29 LYS A NZ   15 
ATOM 5678 H H    . LYS A 1 29 ? -13.982 2.777  -1.231  1.00 0.00 ? 29 LYS A H    15 
ATOM 5679 H HZ1  . LYS A 1 29 ? -12.932 4.822  -7.704  1.00 0.00 ? 29 LYS A HZ1  15 
ATOM 5680 H HZ2  . LYS A 1 29 ? -13.511 6.311  -8.048  1.00 0.00 ? 29 LYS A HZ2  15 
ATOM 5681 H HZ3  . LYS A 1 29 ? -12.560 6.097  -6.749  1.00 0.00 ? 29 LYS A HZ3  15 
ATOM 5682 N N    . LYS A 1 30 ? -17.180 1.852  -1.181  1.00 0.00 ? 30 LYS A N    15 
ATOM 5683 C CA   . LYS A 1 30 ? -18.437 1.174  -0.801  1.00 0.00 ? 30 LYS A CA   15 
ATOM 5684 C C    . LYS A 1 30 ? -19.170 1.892  0.361   1.00 0.00 ? 30 LYS A C    15 
ATOM 5685 O O    . LYS A 1 30 ? -20.390 2.056  0.303   1.00 0.00 ? 30 LYS A O    15 
ATOM 5686 C CB   . LYS A 1 30 ? -18.163 -0.303 -0.443  1.00 0.00 ? 30 LYS A CB   15 
ATOM 5687 C CG   . LYS A 1 30 ? -17.399 -1.077 -1.532  1.00 0.00 ? 30 LYS A CG   15 
ATOM 5688 C CD   . LYS A 1 30 ? -18.145 -1.345 -2.844  1.00 0.00 ? 30 LYS A CD   15 
ATOM 5689 C CE   . LYS A 1 30 ? -18.782 -2.732 -2.873  1.00 0.00 ? 30 LYS A CE   15 
ATOM 5690 N NZ   . LYS A 1 30 ? -20.075 -2.727 -2.174  1.00 0.00 ? 30 LYS A NZ   15 
ATOM 5691 H H    . LYS A 1 30 ? -16.334 1.397  -0.884  1.00 0.00 ? 30 LYS A H    15 
ATOM 5692 H HZ1  . LYS A 1 30 ? -19.981 -2.307 -1.277  1.00 0.00 ? 30 LYS A HZ1  15 
ATOM 5693 H HZ2  . LYS A 1 30 ? -20.743 -2.232 -2.727  1.00 0.00 ? 30 LYS A HZ2  15 
ATOM 5694 H HZ3  . LYS A 1 30 ? -20.387 -3.670 -2.072  1.00 0.00 ? 30 LYS A HZ3  15 
ATOM 5695 N N    . LEU A 1 31 ? -18.415 2.478  1.294   1.00 0.00 ? 31 LEU A N    15 
ATOM 5696 C CA   . LEU A 1 31 ? -18.965 3.300  2.401   1.00 0.00 ? 31 LEU A CA   15 
ATOM 5697 C C    . LEU A 1 31 ? -19.154 4.786  2.028   1.00 0.00 ? 31 LEU A C    15 
ATOM 5698 O O    . LEU A 1 31 ? -19.720 5.562  2.793   1.00 0.00 ? 31 LEU A O    15 
ATOM 5699 C CB   . LEU A 1 31 ? -18.154 3.066  3.694   1.00 0.00 ? 31 LEU A CB   15 
ATOM 5700 C CG   . LEU A 1 31 ? -16.988 4.018  4.009   1.00 0.00 ? 31 LEU A CG   15 
ATOM 5701 C CD1  . LEU A 1 31 ? -17.434 5.152  4.935   1.00 0.00 ? 31 LEU A CD1  15 
ATOM 5702 C CD2  . LEU A 1 31 ? -15.824 3.266  4.648   1.00 0.00 ? 31 LEU A CD2  15 
ATOM 5703 H H    . LEU A 1 31 ? -17.411 2.397  1.298   1.00 0.00 ? 31 LEU A H    15 
ATOM 5704 N N    . VAL A 1 32 ? -18.832 5.128  0.779   1.00 0.00 ? 32 VAL A N    15 
ATOM 5705 C CA   . VAL A 1 32 ? -18.995 6.491  0.229   1.00 0.00 ? 32 VAL A CA   15 
ATOM 5706 C C    . VAL A 1 32 ? -20.063 6.536  -0.903  1.00 0.00 ? 32 VAL A C    15 
ATOM 5707 O O    . VAL A 1 32 ? -20.392 7.590  -1.421  1.00 0.00 ? 32 VAL A O    15 
ATOM 5708 C CB   . VAL A 1 32 ? -17.617 7.057  -0.203  1.00 0.00 ? 32 VAL A CB   15 
ATOM 5709 C CG1  . VAL A 1 32 ? -17.658 8.506  -0.702  1.00 0.00 ? 32 VAL A CG1  15 
ATOM 5710 C CG2  . VAL A 1 32 ? -16.615 7.056  0.954   1.00 0.00 ? 32 VAL A CG2  15 
ATOM 5711 H H    . VAL A 1 32 ? -18.338 4.487  0.196   1.00 0.00 ? 32 VAL A H    15 
ATOM 5712 N N    . GLY A 1 33 ? -20.708 5.390  -1.114  1.00 0.00 ? 33 GLY A N    15 
ATOM 5713 C CA   . GLY A 1 33 ? -21.829 5.242  -2.071  1.00 0.00 ? 33 GLY A CA   15 
ATOM 5714 C C    . GLY A 1 33 ? -23.196 5.460  -1.395  1.00 0.00 ? 33 GLY A C    15 
ATOM 5715 O O    . GLY A 1 33 ? -24.120 6.005  -1.989  1.00 0.00 ? 33 GLY A O    15 
ATOM 5716 H H    . GLY A 1 33 ? -20.429 4.550  -0.666  1.00 0.00 ? 33 GLY A H    15 
ATOM 5717 N N    . GLU A 1 34 ? -23.301 4.945  -0.168  1.00 0.00 ? 34 GLU A N    15 
ATOM 5718 C CA   . GLU A 1 34 ? -24.535 5.003  0.643   1.00 0.00 ? 34 GLU A CA   15 
ATOM 5719 C C    . GLU A 1 34 ? -24.310 5.174  2.163   1.00 0.00 ? 34 GLU A C    15 
ATOM 5720 O O    . GLU A 1 34 ? -25.219 4.937  2.949   1.00 0.00 ? 34 GLU A O    15 
ATOM 5721 C CB   . GLU A 1 34 ? -25.406 3.776  0.322   1.00 0.00 ? 34 GLU A CB   15 
ATOM 5722 C CG   . GLU A 1 34 ? -24.727 2.409  0.530   1.00 0.00 ? 34 GLU A CG   15 
ATOM 5723 C CD   . GLU A 1 34 ? -24.850 1.879  1.958   1.00 0.00 ? 34 GLU A CD   15 
ATOM 5724 O OE1  . GLU A 1 34 ? -25.921 1.543  2.452   1.00 0.00 ? 34 GLU A OE1  15 
ATOM 5725 O OE2  . GLU A 1 34 ? -23.689 1.699  2.629   1.00 0.00 ? 34 GLU A OE2  15 
ATOM 5726 H H    . GLU A 1 34 ? -22.556 4.406  0.222   1.00 0.00 ? 34 GLU A H    15 
ATOM 5727 H HE2  . GLU A 1 34 ? -23.993 1.326  3.512   1.00 0.00 ? 34 GLU A HE2  15 
ATOM 5728 N N    . ARG A 1 35 ? -23.132 5.668  2.550   1.00 0.00 ? 35 ARG A N    15 
ATOM 5729 C CA   . ARG A 1 35 ? -22.688 5.830  3.956   1.00 0.00 ? 35 ARG A CA   15 
ATOM 5730 C C    . ARG A 1 35 ? -23.117 4.677  4.903   1.00 0.00 ? 35 ARG A C    15 
ATOM 5731 O O    . ARG A 1 35 ? -22.368 3.667  4.911   1.00 0.00 ? 35 ARG A O    15 
ATOM 5732 C CB   . ARG A 1 35 ? -23.078 7.246  4.450   1.00 0.00 ? 35 ARG A CB   15 
ATOM 5733 C CG   . ARG A 1 35 ? -22.536 7.569  5.844   1.00 0.00 ? 35 ARG A CG   15 
ATOM 5734 C CD   . ARG A 1 35 ? -22.984 8.944  6.364   1.00 0.00 ? 35 ARG A CD   15 
ATOM 5735 N NE   . ARG A 1 35 ? -23.106 8.788  7.831   1.00 0.00 ? 35 ARG A NE   15 
ATOM 5736 C CZ   . ARG A 1 35 ? -24.269 8.682  8.482   1.00 0.00 ? 35 ARG A CZ   15 
ATOM 5737 N NH1  . ARG A 1 35 ? -25.288 9.498  8.242   1.00 0.00 ? 35 ARG A NH1  15 
ATOM 5738 N NH2  . ARG A 1 35 ? -24.601 7.465  8.870   1.00 0.00 ? 35 ARG A NH2  15 
ATOM 5739 O OXT  . ARG A 1 35 ? -24.163 4.786  5.576   1.00 0.00 ? 35 ARG A OXT  15 
ATOM 5740 H H    . ARG A 1 35 ? -22.487 6.045  1.881   1.00 0.00 ? 35 ARG A H    15 
ATOM 5741 H HE   . ARG A 1 35 ? -22.289 8.998  8.358   1.00 0.00 ? 35 ARG A HE   15 
ATOM 5742 H HH11 . ARG A 1 35 ? -25.125 10.350 7.749   1.00 0.00 ? 35 ARG A HH11 15 
ATOM 5743 H HH12 . ARG A 1 35 ? -26.166 9.321  8.686   1.00 0.00 ? 35 ARG A HH12 15 
ATOM 5744 H HH21 . ARG A 1 35 ? -23.984 6.704  8.653   1.00 0.00 ? 35 ARG A HH21 15 
ATOM 5745 H HH22 . ARG A 1 35 ? -25.475 7.291  9.305   1.00 0.00 ? 35 ARG A HH22 15 
ATOM 5746 N N    . LEU A 1 1  ? 17.329  10.678 -3.304  1.00 0.00 ? 1  LEU A N    16 
ATOM 5747 C CA   . LEU A 1 1  ? 17.889  9.351  -3.635  1.00 0.00 ? 1  LEU A CA   16 
ATOM 5748 C C    . LEU A 1 1  ? 19.058  8.929  -2.721  1.00 0.00 ? 1  LEU A C    16 
ATOM 5749 O O    . LEU A 1 1  ? 19.778  9.772  -2.172  1.00 0.00 ? 1  LEU A O    16 
ATOM 5750 C CB   . LEU A 1 1  ? 18.327  9.323  -5.110  1.00 0.00 ? 1  LEU A CB   16 
ATOM 5751 C CG   . LEU A 1 1  ? 17.169  9.113  -6.106  1.00 0.00 ? 1  LEU A CG   16 
ATOM 5752 C CD1  . LEU A 1 1  ? 16.196  10.296 -6.188  1.00 0.00 ? 1  LEU A CD1  16 
ATOM 5753 C CD2  . LEU A 1 1  ? 17.738  8.799  -7.490  1.00 0.00 ? 1  LEU A CD2  16 
ATOM 5754 H H1   . LEU A 1 1  ? 18.060  11.359 -3.374  1.00 0.00 ? 1  LEU A H1   16 
ATOM 5755 H H2   . LEU A 1 1  ? 16.599  10.906 -3.945  1.00 0.00 ? 1  LEU A H2   16 
ATOM 5756 H H3   . LEU A 1 1  ? 16.959  10.676 -2.373  1.00 0.00 ? 1  LEU A H3   16 
ATOM 5757 N N    . GLN A 1 2  ? 19.173  7.623  -2.516  1.00 0.00 ? 2  GLN A N    16 
ATOM 5758 C CA   . GLN A 1 2  ? 20.199  7.022  -1.624  1.00 0.00 ? 2  GLN A CA   16 
ATOM 5759 C C    . GLN A 1 2  ? 20.539  5.557  -1.981  1.00 0.00 ? 2  GLN A C    16 
ATOM 5760 O O    . GLN A 1 2  ? 20.637  4.699  -1.101  1.00 0.00 ? 2  GLN A O    16 
ATOM 5761 C CB   . GLN A 1 2  ? 19.803  7.181  -0.144  1.00 0.00 ? 2  GLN A CB   16 
ATOM 5762 C CG   . GLN A 1 2  ? 18.437  6.558  0.185   1.00 0.00 ? 2  GLN A CG   16 
ATOM 5763 C CD   . GLN A 1 2  ? 18.326  5.996  1.607   1.00 0.00 ? 2  GLN A CD   16 
ATOM 5764 O OE1  . GLN A 1 2  ? 17.287  6.045  2.239   1.00 0.00 ? 2  GLN A OE1  16 
ATOM 5765 N NE2  . GLN A 1 2  ? 19.360  5.314  2.057   1.00 0.00 ? 2  GLN A NE2  16 
ATOM 5766 H H    . GLN A 1 2  ? 18.503  6.985  -2.886  1.00 0.00 ? 2  GLN A H    16 
ATOM 5767 H HE21 . GLN A 1 2  ? 20.147  5.143  1.477   1.00 0.00 ? 2  GLN A HE21 16 
ATOM 5768 H HE22 . GLN A 1 2  ? 19.294  4.930  2.972   1.00 0.00 ? 2  GLN A HE22 16 
ATOM 5769 N N    . ARG A 1 3  ? 20.759  5.329  -3.278  1.00 0.00 ? 3  ARG A N    16 
ATOM 5770 C CA   . ARG A 1 3  ? 21.057  4.028  -3.941  1.00 0.00 ? 3  ARG A CA   16 
ATOM 5771 C C    . ARG A 1 3  ? 19.792  3.170  -4.040  1.00 0.00 ? 3  ARG A C    16 
ATOM 5772 O O    . ARG A 1 3  ? 19.066  3.045  -3.055  1.00 0.00 ? 3  ARG A O    16 
ATOM 5773 C CB   . ARG A 1 3  ? 22.105  3.124  -3.263  1.00 0.00 ? 3  ARG A CB   16 
ATOM 5774 C CG   . ARG A 1 3  ? 23.244  3.765  -2.480  1.00 0.00 ? 3  ARG A CG   16 
ATOM 5775 C CD   . ARG A 1 3  ? 24.586  3.965  -3.190  1.00 0.00 ? 3  ARG A CD   16 
ATOM 5776 N NE   . ARG A 1 3  ? 25.421  4.648  -2.191  1.00 0.00 ? 3  ARG A NE   16 
ATOM 5777 C CZ   . ARG A 1 3  ? 25.260  5.922  -1.824  1.00 0.00 ? 3  ARG A CZ   16 
ATOM 5778 N NH1  . ARG A 1 3  ? 24.898  6.846  -2.703  1.00 0.00 ? 3  ARG A NH1  16 
ATOM 5779 N NH2  . ARG A 1 3  ? 25.734  6.352  -0.659  1.00 0.00 ? 3  ARG A NH2  16 
ATOM 5780 H H    . ARG A 1 3  ? 20.708  6.098  -3.903  1.00 0.00 ? 3  ARG A H    16 
ATOM 5781 H HE   . ARG A 1 3  ? 26.224  4.162  -1.855  1.00 0.00 ? 3  ARG A HE   16 
ATOM 5782 H HH11 . ARG A 1 3  ? 24.776  6.571  -3.661  1.00 0.00 ? 3  ARG A HH11 16 
ATOM 5783 H HH12 . ARG A 1 3  ? 24.777  7.788  -2.425  1.00 0.00 ? 3  ARG A HH12 16 
ATOM 5784 H HH21 . ARG A 1 3  ? 26.060  5.690  0.022   1.00 0.00 ? 3  ARG A HH21 16 
ATOM 5785 H HH22 . ARG A 1 3  ? 25.638  7.308  -0.412  1.00 0.00 ? 3  ARG A HH22 16 
ATOM 5786 N N    . MET A 1 4  ? 19.610  2.469  -5.151  1.00 0.00 ? 4  MET A N    16 
ATOM 5787 C CA   . MET A 1 4  ? 18.422  1.608  -5.382  1.00 0.00 ? 4  MET A CA   16 
ATOM 5788 C C    . MET A 1 4  ? 18.216  0.521  -4.318  1.00 0.00 ? 4  MET A C    16 
ATOM 5789 O O    . MET A 1 4  ? 17.182  0.527  -3.674  1.00 0.00 ? 4  MET A O    16 
ATOM 5790 C CB   . MET A 1 4  ? 18.404  0.993  -6.774  1.00 0.00 ? 4  MET A CB   16 
ATOM 5791 C CG   . MET A 1 4  ? 18.418  2.040  -7.892  1.00 0.00 ? 4  MET A CG   16 
ATOM 5792 S SD   . MET A 1 4  ? 17.163  3.362  -7.724  1.00 0.00 ? 4  MET A SD   16 
ATOM 5793 C CE   . MET A 1 4  ? 18.228  4.734  -7.304  1.00 0.00 ? 4  MET A CE   16 
ATOM 5794 H H    . MET A 1 4  ? 20.173  2.614  -5.960  1.00 0.00 ? 4  MET A H    16 
ATOM 5795 N N    . LYS A 1 5  ? 19.289  -0.177 -3.988  1.00 0.00 ? 5  LYS A N    16 
ATOM 5796 C CA   . LYS A 1 5  ? 19.329  -1.164 -2.876  1.00 0.00 ? 5  LYS A CA   16 
ATOM 5797 C C    . LYS A 1 5  ? 18.892  -0.614 -1.501  1.00 0.00 ? 5  LYS A C    16 
ATOM 5798 O O    . LYS A 1 5  ? 18.397  -1.343 -0.652  1.00 0.00 ? 5  LYS A O    16 
ATOM 5799 C CB   . LYS A 1 5  ? 20.718  -1.814 -2.779  1.00 0.00 ? 5  LYS A CB   16 
ATOM 5800 C CG   . LYS A 1 5  ? 21.847  -0.786 -2.780  1.00 0.00 ? 5  LYS A CG   16 
ATOM 5801 C CD   . LYS A 1 5  ? 22.751  -0.996 -4.002  1.00 0.00 ? 5  LYS A CD   16 
ATOM 5802 C CE   . LYS A 1 5  ? 23.801  0.113  -4.164  1.00 0.00 ? 5  LYS A CE   16 
ATOM 5803 N NZ   . LYS A 1 5  ? 24.474  0.380  -2.886  1.00 0.00 ? 5  LYS A NZ   16 
ATOM 5804 H H    . LYS A 1 5  ? 20.137  -0.099 -4.494  1.00 0.00 ? 5  LYS A H    16 
ATOM 5805 H HZ1  . LYS A 1 5  ? 24.841  -0.474 -2.516  1.00 0.00 ? 5  LYS A HZ1  16 
ATOM 5806 H HZ2  . LYS A 1 5  ? 25.219  1.037  -3.022  1.00 0.00 ? 5  LYS A HZ2  16 
ATOM 5807 H HZ3  . LYS A 1 5  ? 23.829  0.774  -2.235  1.00 0.00 ? 5  LYS A HZ3  16 
ATOM 5808 N N    . GLN A 1 6  ? 19.018  0.707  -1.345  1.00 0.00 ? 6  GLN A N    16 
ATOM 5809 C CA   . GLN A 1 6  ? 18.506  1.387  -0.155  1.00 0.00 ? 6  GLN A CA   16 
ATOM 5810 C C    . GLN A 1 6  ? 17.125  2.051  -0.362  1.00 0.00 ? 6  GLN A C    16 
ATOM 5811 O O    . GLN A 1 6  ? 16.220  1.784  0.407   1.00 0.00 ? 6  GLN A O    16 
ATOM 5812 C CB   . GLN A 1 6  ? 19.564  2.351  0.374   1.00 0.00 ? 6  GLN A CB   16 
ATOM 5813 C CG   . GLN A 1 6  ? 20.022  1.949  1.784   1.00 0.00 ? 6  GLN A CG   16 
ATOM 5814 C CD   . GLN A 1 6  ? 19.122  2.479  2.905   1.00 0.00 ? 6  GLN A CD   16 
ATOM 5815 O OE1  . GLN A 1 6  ? 19.564  3.039  3.901   1.00 0.00 ? 6  GLN A OE1  16 
ATOM 5816 N NE2  . GLN A 1 6  ? 17.808  2.405  2.754   1.00 0.00 ? 6  GLN A NE2  16 
ATOM 5817 H H    . GLN A 1 6  ? 19.455  1.297  -2.016  1.00 0.00 ? 6  GLN A H    16 
ATOM 5818 H HE21 . GLN A 1 6  ? 17.402  1.968  1.947   1.00 0.00 ? 6  GLN A HE21 16 
ATOM 5819 H HE22 . GLN A 1 6  ? 17.230  2.858  3.426   1.00 0.00 ? 6  GLN A HE22 16 
ATOM 5820 N N    . LEU A 1 7  ? 16.929  2.707  -1.508  1.00 0.00 ? 7  LEU A N    16 
ATOM 5821 C CA   . LEU A 1 7  ? 15.617  3.248  -1.907  1.00 0.00 ? 7  LEU A CA   16 
ATOM 5822 C C    . LEU A 1 7  ? 14.523  2.168  -1.960  1.00 0.00 ? 7  LEU A C    16 
ATOM 5823 O O    . LEU A 1 7  ? 13.477  2.361  -1.366  1.00 0.00 ? 7  LEU A O    16 
ATOM 5824 C CB   . LEU A 1 7  ? 15.637  3.940  -3.267  1.00 0.00 ? 7  LEU A CB   16 
ATOM 5825 C CG   . LEU A 1 7  ? 16.410  5.255  -3.240  1.00 0.00 ? 7  LEU A CG   16 
ATOM 5826 C CD1  . LEU A 1 7  ? 16.330  5.859  -4.632  1.00 0.00 ? 7  LEU A CD1  16 
ATOM 5827 C CD2  . LEU A 1 7  ? 15.802  6.280  -2.268  1.00 0.00 ? 7  LEU A CD2  16 
ATOM 5828 H H    . LEU A 1 7  ? 17.688  2.900  -2.139  1.00 0.00 ? 7  LEU A H    16 
ATOM 5829 N N    . GLU A 1 8  ? 14.857  1.005  -2.503  1.00 0.00 ? 8  GLU A N    16 
ATOM 5830 C CA   . GLU A 1 8  ? 13.954  -0.170 -2.533  1.00 0.00 ? 8  GLU A CA   16 
ATOM 5831 C C    . GLU A 1 8  ? 13.472  -0.569 -1.122  1.00 0.00 ? 8  GLU A C    16 
ATOM 5832 O O    . GLU A 1 8  ? 12.278  -0.688 -0.958  1.00 0.00 ? 8  GLU A O    16 
ATOM 5833 C CB   . GLU A 1 8  ? 14.523  -1.360 -3.323  1.00 0.00 ? 8  GLU A CB   16 
ATOM 5834 C CG   . GLU A 1 8  ? 15.703  -2.134 -2.711  1.00 0.00 ? 8  GLU A CG   16 
ATOM 5835 C CD   . GLU A 1 8  ? 15.342  -3.045 -1.539  1.00 0.00 ? 8  GLU A CD   16 
ATOM 5836 O OE1  . GLU A 1 8  ? 14.221  -3.517 -1.369  1.00 0.00 ? 8  GLU A OE1  16 
ATOM 5837 O OE2  . GLU A 1 8  ? 16.315  -3.290 -0.645  1.00 0.00 ? 8  GLU A OE2  16 
ATOM 5838 H H    . GLU A 1 8  ? 15.727  0.893  -2.982  1.00 0.00 ? 8  GLU A H    16 
ATOM 5839 H HE2  . GLU A 1 8  ? 15.903  -3.893 0.022   1.00 0.00 ? 8  GLU A HE2  16 
ATOM 5840 N N    . ASP A 1 9  ? 14.332  -0.445 -0.114  1.00 0.00 ? 9  ASP A N    16 
ATOM 5841 C CA   . ASP A 1 9  ? 13.931  -0.669 1.296   1.00 0.00 ? 9  ASP A CA   16 
ATOM 5842 C C    . ASP A 1 9  ? 12.806  0.283  1.756   1.00 0.00 ? 9  ASP A C    16 
ATOM 5843 O O    . ASP A 1 9  ? 11.854  -0.155 2.402   1.00 0.00 ? 9  ASP A O    16 
ATOM 5844 C CB   . ASP A 1 9  ? 15.123  -0.513 2.239   1.00 0.00 ? 9  ASP A CB   16 
ATOM 5845 C CG   . ASP A 1 9  ? 15.763  -1.835 2.654   1.00 0.00 ? 9  ASP A CG   16 
ATOM 5846 O OD1  . ASP A 1 9  ? 15.173  -2.906 2.603   1.00 0.00 ? 9  ASP A OD1  16 
ATOM 5847 O OD2  . ASP A 1 9  ? 17.016  -1.761 3.138   1.00 0.00 ? 9  ASP A OD2  16 
ATOM 5848 H H    . ASP A 1 9  ? 15.261  -0.086 -0.238  1.00 0.00 ? 9  ASP A H    16 
ATOM 5849 H HD2  . ASP A 1 9  ? 17.225  -2.699 3.411   1.00 0.00 ? 9  ASP A HD2  16 
ATOM 5850 N N    . LYS A 1 10 ? 12.851  1.483  1.210   1.00 0.00 ? 10 LYS A N    16 
ATOM 5851 C CA   . LYS A 1 10 ? 11.918  2.590  1.519   1.00 0.00 ? 10 LYS A CA   16 
ATOM 5852 C C    . LYS A 1 10 ? 10.661  2.511  0.627   1.00 0.00 ? 10 LYS A C    16 
ATOM 5853 O O    . LYS A 1 10 ? 9.567   2.850  1.057   1.00 0.00 ? 10 LYS A O    16 
ATOM 5854 C CB   . LYS A 1 10 ? 12.598  3.957  1.352   1.00 0.00 ? 10 LYS A CB   16 
ATOM 5855 C CG   . LYS A 1 10 ? 14.051  4.132  1.859   1.00 0.00 ? 10 LYS A CG   16 
ATOM 5856 C CD   . LYS A 1 10 ? 14.381  3.315  3.116   1.00 0.00 ? 10 LYS A CD   16 
ATOM 5857 C CE   . LYS A 1 10 ? 15.493  3.898  3.984   1.00 0.00 ? 10 LYS A CE   16 
ATOM 5858 N NZ   . LYS A 1 10 ? 15.950  2.854  4.915   1.00 0.00 ? 10 LYS A NZ   16 
ATOM 5859 H H    . LYS A 1 10 ? 13.547  1.730  0.534   1.00 0.00 ? 10 LYS A H    16 
ATOM 5860 H HZ1  . LYS A 1 10 ? 15.154  2.405  5.325   1.00 0.00 ? 10 LYS A HZ1  16 
ATOM 5861 H HZ2  . LYS A 1 10 ? 16.515  2.162  4.460   1.00 0.00 ? 10 LYS A HZ2  16 
ATOM 5862 H HZ3  . LYS A 1 10 ? 16.493  3.275  5.642   1.00 0.00 ? 10 LYS A HZ3  16 
ATOM 5863 N N    . VAL A 1 11 ? 10.841  1.975  -0.582  1.00 0.00 ? 11 VAL A N    16 
ATOM 5864 C CA   . VAL A 1 11 ? 9.772   1.719  -1.577  1.00 0.00 ? 11 VAL A CA   16 
ATOM 5865 C C    . VAL A 1 11 ? 8.987   0.416  -1.254  1.00 0.00 ? 11 VAL A C    16 
ATOM 5866 O O    . VAL A 1 11 ? 7.787   0.325  -1.513  1.00 0.00 ? 11 VAL A O    16 
ATOM 5867 C CB   . VAL A 1 11 ? 10.316  1.727  -3.017  1.00 0.00 ? 11 VAL A CB   16 
ATOM 5868 C CG1  . VAL A 1 11 ? 9.176   1.745  -4.051  1.00 0.00 ? 11 VAL A CG1  16 
ATOM 5869 C CG2  . VAL A 1 11 ? 11.202  2.952  -3.324  1.00 0.00 ? 11 VAL A CG2  16 
ATOM 5870 H H    . VAL A 1 11 ? 11.766  1.786  -0.907  1.00 0.00 ? 11 VAL A H    16 
ATOM 5871 N N    . GLU A 1 12 ? 9.655   -0.526 -0.608  1.00 0.00 ? 12 GLU A N    16 
ATOM 5872 C CA   . GLU A 1 12 ? 9.081   -1.802 -0.143  1.00 0.00 ? 12 GLU A CA   16 
ATOM 5873 C C    . GLU A 1 12 ? 8.014   -1.606 0.944   1.00 0.00 ? 12 GLU A C    16 
ATOM 5874 O O    . GLU A 1 12 ? 6.867   -2.005 0.762   1.00 0.00 ? 12 GLU A O    16 
ATOM 5875 C CB   . GLU A 1 12 ? 10.173  -2.745 0.371   1.00 0.00 ? 12 GLU A CB   16 
ATOM 5876 C CG   . GLU A 1 12 ? 10.864  -3.508 -0.763  1.00 0.00 ? 12 GLU A CG   16 
ATOM 5877 C CD   . GLU A 1 12 ? 9.894   -4.407 -1.536  1.00 0.00 ? 12 GLU A CD   16 
ATOM 5878 O OE1  . GLU A 1 12 ? 9.824   -4.410 -2.762  1.00 0.00 ? 12 GLU A OE1  16 
ATOM 5879 O OE2  . GLU A 1 12 ? 9.054   -5.168 -0.803  1.00 0.00 ? 12 GLU A OE2  16 
ATOM 5880 H H    . GLU A 1 12 ? 10.657  -0.475 -0.516  1.00 0.00 ? 12 GLU A H    16 
ATOM 5881 H HE2  . GLU A 1 12 ? 8.481   -5.619 -1.480  1.00 0.00 ? 12 GLU A HE2  16 
ATOM 5882 N N    . GLU A 1 13 ? 8.375   -0.769 1.923   1.00 0.00 ? 13 GLU A N    16 
ATOM 5883 C CA   . GLU A 1 13 ? 7.466   -0.319 3.001   1.00 0.00 ? 13 GLU A CA   16 
ATOM 5884 C C    . GLU A 1 13 ? 6.217   0.384  2.427   1.00 0.00 ? 13 GLU A C    16 
ATOM 5885 O O    . GLU A 1 13 ? 5.118   0.210  2.959   1.00 0.00 ? 13 GLU A O    16 
ATOM 5886 C CB   . GLU A 1 13 ? 8.222   0.620  3.929   1.00 0.00 ? 13 GLU A CB   16 
ATOM 5887 C CG   . GLU A 1 13 ? 9.352   -0.101 4.677   1.00 0.00 ? 13 GLU A CG   16 
ATOM 5888 C CD   . GLU A 1 13 ? 10.384  0.883  5.222   1.00 0.00 ? 13 GLU A CD   16 
ATOM 5889 O OE1  . GLU A 1 13 ? 10.933  1.737  4.529   1.00 0.00 ? 13 GLU A OE1  16 
ATOM 5890 O OE2  . GLU A 1 13 ? 10.708  0.770  6.522   1.00 0.00 ? 13 GLU A OE2  16 
ATOM 5891 H H    . GLU A 1 13 ? 9.310   -0.424 1.989   1.00 0.00 ? 13 GLU A H    16 
ATOM 5892 H HE2  . GLU A 1 13 ? 11.373  1.500  6.641   1.00 0.00 ? 13 GLU A HE2  16 
ATOM 5893 N N    . LEU A 1 14 ? 6.383   1.026  1.277   1.00 0.00 ? 14 LEU A N    16 
ATOM 5894 C CA   . LEU A 1 14 ? 5.280   1.668  0.543   1.00 0.00 ? 14 LEU A CA   16 
ATOM 5895 C C    . LEU A 1 14 ? 4.301   0.596  0.039   1.00 0.00 ? 14 LEU A C    16 
ATOM 5896 O O    . LEU A 1 14 ? 3.212   0.521  0.575   1.00 0.00 ? 14 LEU A O    16 
ATOM 5897 C CB   . LEU A 1 14 ? 5.704   2.548  -0.641  1.00 0.00 ? 14 LEU A CB   16 
ATOM 5898 C CG   . LEU A 1 14 ? 6.761   3.605  -0.312  1.00 0.00 ? 14 LEU A CG   16 
ATOM 5899 C CD1  . LEU A 1 14 ? 7.001   4.451  -1.561  1.00 0.00 ? 14 LEU A CD1  16 
ATOM 5900 C CD2  . LEU A 1 14 ? 6.421   4.499  0.882   1.00 0.00 ? 14 LEU A CD2  16 
ATOM 5901 H H    . LEU A 1 14 ? 7.273   1.047  0.807   1.00 0.00 ? 14 LEU A H    16 
ATOM 5902 N N    . LEU A 1 15 ? 4.761   -0.306 -0.814  1.00 0.00 ? 15 LEU A N    16 
ATOM 5903 C CA   . LEU A 1 15 ? 3.915   -1.405 -1.348  1.00 0.00 ? 15 LEU A CA   16 
ATOM 5904 C C    . LEU A 1 15 ? 3.225   -2.227 -0.235  1.00 0.00 ? 15 LEU A C    16 
ATOM 5905 O O    . LEU A 1 15 ? 2.006   -2.378 -0.277  1.00 0.00 ? 15 LEU A O    16 
ATOM 5906 C CB   . LEU A 1 15 ? 4.684   -2.333 -2.283  1.00 0.00 ? 15 LEU A CB   16 
ATOM 5907 C CG   . LEU A 1 15 ? 5.604   -1.612 -3.276  1.00 0.00 ? 15 LEU A CG   16 
ATOM 5908 C CD1  . LEU A 1 15 ? 6.184   -2.646 -4.246  1.00 0.00 ? 15 LEU A CD1  16 
ATOM 5909 C CD2  . LEU A 1 15 ? 4.948   -0.478 -4.066  1.00 0.00 ? 15 LEU A CD2  16 
ATOM 5910 H H    . LEU A 1 15 ? 5.655   -0.228 -1.245  1.00 0.00 ? 15 LEU A H    16 
ATOM 5911 N N    . SER A 1 16 ? 3.973   -2.523 0.831   1.00 0.00 ? 16 SER A N    16 
ATOM 5912 C CA   . SER A 1 16 ? 3.439   -3.187 2.043   1.00 0.00 ? 16 SER A CA   16 
ATOM 5913 C C    . SER A 1 16 ? 2.171   -2.516 2.618   1.00 0.00 ? 16 SER A C    16 
ATOM 5914 O O    . SER A 1 16 ? 1.172   -3.184 2.844   1.00 0.00 ? 16 SER A O    16 
ATOM 5915 C CB   . SER A 1 16 ? 4.503   -3.252 3.139   1.00 0.00 ? 16 SER A CB   16 
ATOM 5916 O OG   . SER A 1 16 ? 5.631   -3.989 2.672   1.00 0.00 ? 16 SER A OG   16 
ATOM 5917 H H    . SER A 1 16 ? 4.971   -2.419 0.810   1.00 0.00 ? 16 SER A H    16 
ATOM 5918 H HG   . SER A 1 16 ? 6.293   -4.088 3.413   1.00 0.00 ? 16 SER A HG   16 
ATOM 5919 N N    . LYS A 1 17 ? 2.205   -1.187 2.695   1.00 0.00 ? 17 LYS A N    16 
ATOM 5920 C CA   . LYS A 1 17 ? 1.023   -0.392 3.107   1.00 0.00 ? 17 LYS A CA   16 
ATOM 5921 C C    . LYS A 1 17 ? 0.077   -0.061 1.927   1.00 0.00 ? 17 LYS A C    16 
ATOM 5922 O O    . LYS A 1 17 ? -1.117  -0.079 2.118   1.00 0.00 ? 17 LYS A O    16 
ATOM 5923 C CB   . LYS A 1 17 ? 1.355   0.879  3.893   1.00 0.00 ? 17 LYS A CB   16 
ATOM 5924 C CG   . LYS A 1 17 ? 2.235   1.864  3.120   1.00 0.00 ? 17 LYS A CG   16 
ATOM 5925 C CD   . LYS A 1 17 ? 2.341   3.225  3.796   1.00 0.00 ? 17 LYS A CD   16 
ATOM 5926 C CE   . LYS A 1 17 ? 3.548   4.000  3.256   1.00 0.00 ? 17 LYS A CE   16 
ATOM 5927 N NZ   . LYS A 1 17 ? 4.776   3.343  3.728   1.00 0.00 ? 17 LYS A NZ   16 
ATOM 5928 H H    . LYS A 1 17 ? 3.004   -0.657 2.420   1.00 0.00 ? 17 LYS A H    16 
ATOM 5929 H HZ1  . LYS A 1 17 ? 4.781   2.393  3.411   1.00 0.00 ? 17 LYS A HZ1  16 
ATOM 5930 H HZ2  . LYS A 1 17 ? 5.577   3.816  3.361   1.00 0.00 ? 17 LYS A HZ2  16 
ATOM 5931 H HZ3  . LYS A 1 17 ? 4.803   3.366  4.728   1.00 0.00 ? 17 LYS A HZ3  16 
ATOM 5932 N N    . ASN A 1 18 ? 0.613   0.183  0.739   1.00 0.00 ? 18 ASN A N    16 
ATOM 5933 C CA   . ASN A 1 18 ? -0.157  0.514  -0.482  1.00 0.00 ? 18 ASN A CA   16 
ATOM 5934 C C    . ASN A 1 18 ? -1.119  -0.624 -0.897  1.00 0.00 ? 18 ASN A C    16 
ATOM 5935 O O    . ASN A 1 18 ? -2.280  -0.357 -1.174  1.00 0.00 ? 18 ASN A O    16 
ATOM 5936 C CB   . ASN A 1 18 ? 0.789   0.868  -1.629  1.00 0.00 ? 18 ASN A CB   16 
ATOM 5937 C CG   . ASN A 1 18 ? 0.192   1.761  -2.720  1.00 0.00 ? 18 ASN A CG   16 
ATOM 5938 O OD1  . ASN A 1 18 ? 0.883   2.470  -3.423  1.00 0.00 ? 18 ASN A OD1  16 
ATOM 5939 N ND2  . ASN A 1 18 ? -1.118  1.729  -2.915  1.00 0.00 ? 18 ASN A ND2  16 
ATOM 5940 H H    . ASN A 1 18 ? 1.611   0.271  0.644   1.00 0.00 ? 18 ASN A H    16 
ATOM 5941 H HD21 . ASN A 1 18 ? -1.706  1.121  -2.392  1.00 0.00 ? 18 ASN A HD21 16 
ATOM 5942 H HD22 . ASN A 1 18 ? -1.460  2.338  -3.623  1.00 0.00 ? 18 ASN A HD22 16 
ATOM 5943 N N    . TYR A 1 19 ? -0.619  -1.852 -0.848  1.00 0.00 ? 19 TYR A N    16 
ATOM 5944 C CA   . TYR A 1 19 ? -1.436  -3.091 -1.010  1.00 0.00 ? 19 TYR A CA   16 
ATOM 5945 C C    . TYR A 1 19 ? -2.558  -3.183 0.047   1.00 0.00 ? 19 TYR A C    16 
ATOM 5946 O O    . TYR A 1 19 ? -3.704  -3.489 -0.283  1.00 0.00 ? 19 TYR A O    16 
ATOM 5947 C CB   . TYR A 1 19 ? -0.541  -4.334 -0.960  1.00 0.00 ? 19 TYR A CB   16 
ATOM 5948 C CG   . TYR A 1 19 ? 0.102   -4.674 -2.316  1.00 0.00 ? 19 TYR A CG   16 
ATOM 5949 C CD1  . TYR A 1 19 ? -0.699  -5.321 -3.282  1.00 0.00 ? 19 TYR A CD1  16 
ATOM 5950 C CD2  . TYR A 1 19 ? 1.472   -4.425 -2.531  1.00 0.00 ? 19 TYR A CD2  16 
ATOM 5951 C CE1  . TYR A 1 19 ? -0.106  -5.737 -4.491  1.00 0.00 ? 19 TYR A CE1  16 
ATOM 5952 C CE2  . TYR A 1 19 ? 2.065   -4.841 -3.740  1.00 0.00 ? 19 TYR A CE2  16 
ATOM 5953 C CZ   . TYR A 1 19 ? 1.264   -5.488 -4.707  1.00 0.00 ? 19 TYR A CZ   16 
ATOM 5954 O OH   . TYR A 1 19 ? 1.822   -5.889 -5.888  1.00 0.00 ? 19 TYR A OH   16 
ATOM 5955 H H    . TYR A 1 19 ? 0.356   -2.026 -0.686  1.00 0.00 ? 19 TYR A H    16 
ATOM 5956 H HH   . TYR A 1 19 ? 2.792   -5.635 -5.902  1.00 0.00 ? 19 TYR A HH   16 
ATOM 5957 N N    . HIS A 1 20 ? -2.235  -2.701 1.248   1.00 0.00 ? 20 HIS A N    16 
ATOM 5958 C CA   . HIS A 1 20 ? -3.150  -2.568 2.409   1.00 0.00 ? 20 HIS A CA   16 
ATOM 5959 C C    . HIS A 1 20 ? -3.917  -1.211 2.474   1.00 0.00 ? 20 HIS A C    16 
ATOM 5960 O O    . HIS A 1 20 ? -4.745  -0.985 3.354   1.00 0.00 ? 20 HIS A O    16 
ATOM 5961 C CB   . HIS A 1 20 ? -2.281  -2.879 3.632   1.00 0.00 ? 20 HIS A CB   16 
ATOM 5962 C CG   . HIS A 1 20 ? -2.710  -2.265 4.965   1.00 0.00 ? 20 HIS A CG   16 
ATOM 5963 N ND1  . HIS A 1 20 ? -3.602  -2.747 5.820   1.00 0.00 ? 20 HIS A ND1  16 
ATOM 5964 C CD2  . HIS A 1 20 ? -2.417  -1.021 5.344   1.00 0.00 ? 20 HIS A CD2  16 
ATOM 5965 C CE1  . HIS A 1 20 ? -3.907  -1.799 6.692   1.00 0.00 ? 20 HIS A CE1  16 
ATOM 5966 N NE2  . HIS A 1 20 ? -3.193  -0.726 6.392   1.00 0.00 ? 20 HIS A NE2  16 
ATOM 5967 H H    . HIS A 1 20 ? -1.313  -2.386 1.444   1.00 0.00 ? 20 HIS A H    16 
ATOM 5968 H HD1  . HIS A 1 20 ? -3.921  -3.697 5.859   1.00 0.00 ? 20 HIS A HD1  16 
ATOM 5969 H HE2  . HIS A 1 20 ? -3.342  0.191  6.751   1.00 0.00 ? 20 HIS A HE2  16 
ATOM 5970 N N    . LEU A 1 21 ? -3.750  -0.389 1.444   1.00 0.00 ? 21 LEU A N    16 
ATOM 5971 C CA   . LEU A 1 21 ? -4.393  0.943  1.347   1.00 0.00 ? 21 LEU A CA   16 
ATOM 5972 C C    . LEU A 1 21 ? -5.458  0.945  0.241   1.00 0.00 ? 21 LEU A C    16 
ATOM 5973 O O    . LEU A 1 21 ? -6.638  1.217  0.497   1.00 0.00 ? 21 LEU A O    16 
ATOM 5974 C CB   . LEU A 1 21 ? -3.284  1.981  1.096   1.00 0.00 ? 21 LEU A CB   16 
ATOM 5975 C CG   . LEU A 1 21 ? -3.758  3.387  0.736   1.00 0.00 ? 21 LEU A CG   16 
ATOM 5976 C CD1  . LEU A 1 21 ? -4.488  4.080  1.893   1.00 0.00 ? 21 LEU A CD1  16 
ATOM 5977 C CD2  . LEU A 1 21 ? -2.554  4.219  0.277   1.00 0.00 ? 21 LEU A CD2  16 
ATOM 5978 H H    . LEU A 1 21 ? -3.015  -0.543 0.801   1.00 0.00 ? 21 LEU A H    16 
ATOM 5979 N N    . GLU A 1 22 ? -5.055  0.472  -0.934  1.00 0.00 ? 22 GLU A N    16 
ATOM 5980 C CA   . GLU A 1 22 ? -5.952  0.302  -2.088  1.00 0.00 ? 22 GLU A CA   16 
ATOM 5981 C C    . GLU A 1 22 ? -7.005  -0.812 -1.855  1.00 0.00 ? 22 GLU A C    16 
ATOM 5982 O O    . GLU A 1 22 ? -8.147  -0.667 -2.297  1.00 0.00 ? 22 GLU A O    16 
ATOM 5983 C CB   . GLU A 1 22 ? -5.085  0.106  -3.334  1.00 0.00 ? 22 GLU A CB   16 
ATOM 5984 C CG   . GLU A 1 22 ? -5.868  0.069  -4.654  1.00 0.00 ? 22 GLU A CG   16 
ATOM 5985 C CD   . GLU A 1 22 ? -6.071  -1.372 -5.137  1.00 0.00 ? 22 GLU A CD   16 
ATOM 5986 O OE1  . GLU A 1 22 ? -5.132  -2.124 -5.340  1.00 0.00 ? 22 GLU A OE1  16 
ATOM 5987 O OE2  . GLU A 1 22 ? -7.332  -1.782 -5.338  1.00 0.00 ? 22 GLU A OE2  16 
ATOM 5988 H H    . GLU A 1 22 ? -4.100  0.196  -1.092  1.00 0.00 ? 22 GLU A H    16 
ATOM 5989 H HE2  . GLU A 1 22 ? -7.222  -2.723 -5.635  1.00 0.00 ? 22 GLU A HE2  16 
ATOM 5990 N N    . ASN A 1 23 ? -6.696  -1.766 -0.965  1.00 0.00 ? 23 ASN A N    16 
ATOM 5991 C CA   . ASN A 1 23 ? -7.656  -2.810 -0.559  1.00 0.00 ? 23 ASN A CA   16 
ATOM 5992 C C    . ASN A 1 23 ? -8.790  -2.256 0.339   1.00 0.00 ? 23 ASN A C    16 
ATOM 5993 O O    . ASN A 1 23 ? -9.935  -2.705 0.250   1.00 0.00 ? 23 ASN A O    16 
ATOM 5994 C CB   . ASN A 1 23 ? -6.946  -4.002 0.123   1.00 0.00 ? 23 ASN A CB   16 
ATOM 5995 C CG   . ASN A 1 23 ? -6.480  -3.714 1.562   1.00 0.00 ? 23 ASN A CG   16 
ATOM 5996 O OD1  . ASN A 1 23 ? -6.245  -2.584 1.940   1.00 0.00 ? 23 ASN A OD1  16 
ATOM 5997 N ND2  . ASN A 1 23 ? -6.448  -4.697 2.430   1.00 0.00 ? 23 ASN A ND2  16 
ATOM 5998 H H    . ASN A 1 23 ? -5.817  -1.778 -0.480  1.00 0.00 ? 23 ASN A H    16 
ATOM 5999 H HD21 . ASN A 1 23 ? -6.643  -5.635 2.170   1.00 0.00 ? 23 ASN A HD21 16 
ATOM 6000 H HD22 . ASN A 1 23 ? -6.177  -4.433 3.358   1.00 0.00 ? 23 ASN A HD22 16 
ATOM 6001 N N    . GLU A 1 24 ? -8.457  -1.269 1.161   1.00 0.00 ? 24 GLU A N    16 
ATOM 6002 C CA   . GLU A 1 24 ? -9.376  -0.617 2.120   1.00 0.00 ? 24 GLU A CA   16 
ATOM 6003 C C    . GLU A 1 24 ? -10.291 0.394  1.434   1.00 0.00 ? 24 GLU A C    16 
ATOM 6004 O O    . GLU A 1 24 ? -11.511 0.346  1.572   1.00 0.00 ? 24 GLU A O    16 
ATOM 6005 C CB   . GLU A 1 24 ? -8.612  0.108  3.227   1.00 0.00 ? 24 GLU A CB   16 
ATOM 6006 C CG   . GLU A 1 24 ? -8.246  -0.800 4.404   1.00 0.00 ? 24 GLU A CG   16 
ATOM 6007 C CD   . GLU A 1 24 ? -8.307  -0.024 5.719   1.00 0.00 ? 24 GLU A CD   16 
ATOM 6008 O OE1  . GLU A 1 24 ? -8.788  -0.505 6.739   1.00 0.00 ? 24 GLU A OE1  16 
ATOM 6009 O OE2  . GLU A 1 24 ? -7.917  1.263  5.716   1.00 0.00 ? 24 GLU A OE2  16 
ATOM 6010 H H    . GLU A 1 24 ? -7.499  -0.986 1.256   1.00 0.00 ? 24 GLU A H    16 
ATOM 6011 H HE2  . GLU A 1 24 ? -8.091  1.566  6.652   1.00 0.00 ? 24 GLU A HE2  16 
ATOM 6012 N N    . VAL A 1 25 ? -9.682  1.273  0.656   1.00 0.00 ? 25 VAL A N    16 
ATOM 6013 C CA   . VAL A 1 25 ? -10.389 2.182  -0.256  1.00 0.00 ? 25 VAL A CA   16 
ATOM 6014 C C    . VAL A 1 25 ? -11.464 1.432  -1.085  1.00 0.00 ? 25 VAL A C    16 
ATOM 6015 O O    . VAL A 1 25 ? -12.576 1.943  -1.176  1.00 0.00 ? 25 VAL A O    16 
ATOM 6016 C CB   . VAL A 1 25 ? -9.366  2.977  -1.087  1.00 0.00 ? 25 VAL A CB   16 
ATOM 6017 C CG1  . VAL A 1 25 ? -10.031 3.898  -2.104  1.00 0.00 ? 25 VAL A CG1  16 
ATOM 6018 C CG2  . VAL A 1 25 ? -8.525  3.880  -0.165  1.00 0.00 ? 25 VAL A CG2  16 
ATOM 6019 H H    . VAL A 1 25 ? -8.721  1.524  0.806   1.00 0.00 ? 25 VAL A H    16 
ATOM 6020 N N    . ALA A 1 26 ? -11.239 0.162  -1.428  1.00 0.00 ? 26 ALA A N    16 
ATOM 6021 C CA   . ALA A 1 26 ? -12.254 -0.702 -2.067  1.00 0.00 ? 26 ALA A CA   16 
ATOM 6022 C C    . ALA A 1 26 ? -13.534 -0.874 -1.238  1.00 0.00 ? 26 ALA A C    16 
ATOM 6023 O O    . ALA A 1 26 ? -14.577 -0.339 -1.609  1.00 0.00 ? 26 ALA A O    16 
ATOM 6024 C CB   . ALA A 1 26 ? -11.624 -2.054 -2.431  1.00 0.00 ? 26 ALA A CB   16 
ATOM 6025 H H    . ALA A 1 26 ? -10.343 -0.258 -1.276  1.00 0.00 ? 26 ALA A H    16 
ATOM 6026 N N    . ARG A 1 27 ? -13.434 -1.483 -0.053  1.00 0.00 ? 27 ARG A N    16 
ATOM 6027 C CA   . ARG A 1 27 ? -14.566 -1.632 0.895   1.00 0.00 ? 27 ARG A CA   16 
ATOM 6028 C C    . ARG A 1 27 ? -15.245 -0.288 1.273   1.00 0.00 ? 27 ARG A C    16 
ATOM 6029 O O    . ARG A 1 27 ? -16.426 -0.254 1.593   1.00 0.00 ? 27 ARG A O    16 
ATOM 6030 C CB   . ARG A 1 27 ? -14.162 -2.417 2.158   1.00 0.00 ? 27 ARG A CB   16 
ATOM 6031 C CG   . ARG A 1 27 ? -13.116 -1.670 3.010   1.00 0.00 ? 27 ARG A CG   16 
ATOM 6032 C CD   . ARG A 1 27 ? -13.289 -1.831 4.514   1.00 0.00 ? 27 ARG A CD   16 
ATOM 6033 N NE   . ARG A 1 27 ? -14.674 -1.514 4.914   1.00 0.00 ? 27 ARG A NE   16 
ATOM 6034 C CZ   . ARG A 1 27 ? -15.296 -2.006 5.980   1.00 0.00 ? 27 ARG A CZ   16 
ATOM 6035 N NH1  . ARG A 1 27 ? -14.636 -2.706 6.901   1.00 0.00 ? 27 ARG A NH1  16 
ATOM 6036 N NH2  . ARG A 1 27 ? -16.616 -2.061 5.996   1.00 0.00 ? 27 ARG A NH2  16 
ATOM 6037 H H    . ARG A 1 27 ? -12.571 -1.901 0.246   1.00 0.00 ? 27 ARG A H    16 
ATOM 6038 H HE   . ARG A 1 27 ? -15.169 -0.861 4.334   1.00 0.00 ? 27 ARG A HE   16 
ATOM 6039 H HH11 . ARG A 1 27 ? -13.648 -2.775 6.822   1.00 0.00 ? 27 ARG A HH11 16 
ATOM 6040 H HH12 . ARG A 1 27 ? -15.116 -3.107 7.679   1.00 0.00 ? 27 ARG A HH12 16 
ATOM 6041 H HH21 . ARG A 1 27 ? -17.148 -1.722 5.217   1.00 0.00 ? 27 ARG A HH21 16 
ATOM 6042 H HH22 . ARG A 1 27 ? -17.086 -2.461 6.784   1.00 0.00 ? 27 ARG A HH22 16 
ATOM 6043 N N    . LEU A 1 28 ? -14.446 0.777  1.257   1.00 0.00 ? 28 LEU A N    16 
ATOM 6044 C CA   . LEU A 1 28 ? -14.892 2.178  1.444   1.00 0.00 ? 28 LEU A CA   16 
ATOM 6045 C C    . LEU A 1 28 ? -15.735 2.673  0.247   1.00 0.00 ? 28 LEU A C    16 
ATOM 6046 O O    . LEU A 1 28 ? -16.886 3.067  0.418   1.00 0.00 ? 28 LEU A O    16 
ATOM 6047 C CB   . LEU A 1 28 ? -13.634 3.024  1.705   1.00 0.00 ? 28 LEU A CB   16 
ATOM 6048 C CG   . LEU A 1 28 ? -13.735 4.503  1.292   1.00 0.00 ? 28 LEU A CG   16 
ATOM 6049 C CD1  . LEU A 1 28 ? -14.691 5.287  2.174   1.00 0.00 ? 28 LEU A CD1  16 
ATOM 6050 C CD2  . LEU A 1 28 ? -12.356 5.158  1.304   1.00 0.00 ? 28 LEU A CD2  16 
ATOM 6051 H H    . LEU A 1 28 ? -13.460 0.667  1.112   1.00 0.00 ? 28 LEU A H    16 
ATOM 6052 N N    . LYS A 1 29 ? -15.152 2.613  -0.944  1.00 0.00 ? 29 LYS A N    16 
ATOM 6053 C CA   . LYS A 1 29 ? -15.805 3.029  -2.196  1.00 0.00 ? 29 LYS A CA   16 
ATOM 6054 C C    . LYS A 1 29 ? -17.085 2.240  -2.506  1.00 0.00 ? 29 LYS A C    16 
ATOM 6055 O O    . LYS A 1 29 ? -17.952 2.753  -3.187  1.00 0.00 ? 29 LYS A O    16 
ATOM 6056 C CB   . LYS A 1 29 ? -14.851 2.966  -3.381  1.00 0.00 ? 29 LYS A CB   16 
ATOM 6057 C CG   . LYS A 1 29 ? -13.760 4.036  -3.278  1.00 0.00 ? 29 LYS A CG   16 
ATOM 6058 C CD   . LYS A 1 29 ? -13.304 4.447  -4.684  1.00 0.00 ? 29 LYS A CD   16 
ATOM 6059 C CE   . LYS A 1 29 ? -12.124 5.421  -4.658  1.00 0.00 ? 29 LYS A CE   16 
ATOM 6060 N NZ   . LYS A 1 29 ? -10.899 4.696  -5.033  1.00 0.00 ? 29 LYS A NZ   16 
ATOM 6061 H H    . LYS A 1 29 ? -14.194 2.338  -1.051  1.00 0.00 ? 29 LYS A H    16 
ATOM 6062 H HZ1  . LYS A 1 29 ? -10.828 3.846  -4.505  1.00 0.00 ? 29 LYS A HZ1  16 
ATOM 6063 H HZ2  . LYS A 1 29 ? -10.940 4.493  -6.009  1.00 0.00 ? 29 LYS A HZ2  16 
ATOM 6064 H HZ3  . LYS A 1 29 ? -10.106 5.273  -4.852  1.00 0.00 ? 29 LYS A HZ3  16 
ATOM 6065 N N    . LYS A 1 30 ? -17.251 1.072  -1.879  1.00 0.00 ? 30 LYS A N    16 
ATOM 6066 C CA   . LYS A 1 30 ? -18.527 0.337  -1.865  1.00 0.00 ? 30 LYS A CA   16 
ATOM 6067 C C    . LYS A 1 30 ? -19.710 1.160  -1.326  1.00 0.00 ? 30 LYS A C    16 
ATOM 6068 O O    . LYS A 1 30 ? -20.760 1.211  -1.957  1.00 0.00 ? 30 LYS A O    16 
ATOM 6069 C CB   . LYS A 1 30 ? -18.354 -0.962 -1.064  1.00 0.00 ? 30 LYS A CB   16 
ATOM 6070 C CG   . LYS A 1 30 ? -18.106 -2.191 -1.954  1.00 0.00 ? 30 LYS A CG   16 
ATOM 6071 C CD   . LYS A 1 30 ? -16.972 -1.997 -2.966  1.00 0.00 ? 30 LYS A CD   16 
ATOM 6072 C CE   . LYS A 1 30 ? -16.350 -3.312 -3.415  1.00 0.00 ? 30 LYS A CE   16 
ATOM 6073 N NZ   . LYS A 1 30 ? -15.683 -3.919 -2.256  1.00 0.00 ? 30 LYS A NZ   16 
ATOM 6074 H H    . LYS A 1 30 ? -16.467 0.596  -1.468  1.00 0.00 ? 30 LYS A H    16 
ATOM 6075 H HZ1  . LYS A 1 30 ? -15.040 -3.260 -1.870  1.00 0.00 ? 30 LYS A HZ1  16 
ATOM 6076 H HZ2  . LYS A 1 30 ? -16.380 -4.165 -1.580  1.00 0.00 ? 30 LYS A HZ2  16 
ATOM 6077 H HZ3  . LYS A 1 30 ? -15.200 -4.744 -2.548  1.00 0.00 ? 30 LYS A HZ3  16 
ATOM 6078 N N    . LEU A 1 31 ? -19.422 1.967  -0.313  1.00 0.00 ? 31 LEU A N    16 
ATOM 6079 C CA   . LEU A 1 31 ? -20.424 2.891  0.271   1.00 0.00 ? 31 LEU A CA   16 
ATOM 6080 C C    . LEU A 1 31 ? -20.600 4.151  -0.606  1.00 0.00 ? 31 LEU A C    16 
ATOM 6081 O O    . LEU A 1 31 ? -21.716 4.625  -0.784  1.00 0.00 ? 31 LEU A O    16 
ATOM 6082 C CB   . LEU A 1 31 ? -20.035 3.284  1.706   1.00 0.00 ? 31 LEU A CB   16 
ATOM 6083 C CG   . LEU A 1 31 ? -19.718 2.175  2.744   1.00 0.00 ? 31 LEU A CG   16 
ATOM 6084 C CD1  . LEU A 1 31 ? -20.189 0.747  2.418   1.00 0.00 ? 31 LEU A CD1  16 
ATOM 6085 C CD2  . LEU A 1 31 ? -18.250 2.217  3.136   1.00 0.00 ? 31 LEU A CD2  16 
ATOM 6086 H H    . LEU A 1 31 ? -18.521 2.007  0.106   1.00 0.00 ? 31 LEU A H    16 
ATOM 6087 N N    . VAL A 1 32 ? -19.539 4.537  -1.303  1.00 0.00 ? 32 VAL A N    16 
ATOM 6088 C CA   . VAL A 1 32 ? -19.519 5.663  -2.267  1.00 0.00 ? 32 VAL A CA   16 
ATOM 6089 C C    . VAL A 1 32 ? -19.865 5.169  -3.713  1.00 0.00 ? 32 VAL A C    16 
ATOM 6090 O O    . VAL A 1 32 ? -19.832 5.935  -4.674  1.00 0.00 ? 32 VAL A O    16 
ATOM 6091 C CB   . VAL A 1 32 ? -18.141 6.366  -2.176  1.00 0.00 ? 32 VAL A CB   16 
ATOM 6092 C CG1  . VAL A 1 32 ? -17.978 7.581  -3.092  1.00 0.00 ? 32 VAL A CG1  16 
ATOM 6093 C CG2  . VAL A 1 32 ? -17.857 6.854  -0.745  1.00 0.00 ? 32 VAL A CG2  16 
ATOM 6094 H H    . VAL A 1 32 ? -18.667 4.048  -1.221  1.00 0.00 ? 32 VAL A H    16 
ATOM 6095 N N    . GLY A 1 33 ? -20.377 3.947  -3.797  1.00 0.00 ? 33 GLY A N    16 
ATOM 6096 C CA   . GLY A 1 33 ? -20.758 3.303  -5.079  1.00 0.00 ? 33 GLY A CA   16 
ATOM 6097 C C    . GLY A 1 33 ? -22.263 3.435  -5.336  1.00 0.00 ? 33 GLY A C    16 
ATOM 6098 O O    . GLY A 1 33 ? -22.693 3.682  -6.459  1.00 0.00 ? 33 GLY A O    16 
ATOM 6099 H H    . GLY A 1 33 ? -20.364 3.326  -3.011  1.00 0.00 ? 33 GLY A H    16 
ATOM 6100 N N    . GLU A 1 34 ? -23.024 3.240  -4.267  1.00 0.00 ? 34 GLU A N    16 
ATOM 6101 C CA   . GLU A 1 34 ? -24.502 3.310  -4.273  1.00 0.00 ? 34 GLU A CA   16 
ATOM 6102 C C    . GLU A 1 34 ? -25.109 4.028  -3.045  1.00 0.00 ? 34 GLU A C    16 
ATOM 6103 O O    . GLU A 1 34 ? -26.257 3.777  -2.683  1.00 0.00 ? 34 GLU A O    16 
ATOM 6104 C CB   . GLU A 1 34 ? -25.052 1.893  -4.456  1.00 0.00 ? 34 GLU A CB   16 
ATOM 6105 C CG   . GLU A 1 34 ? -24.498 0.893  -3.428  1.00 0.00 ? 34 GLU A CG   16 
ATOM 6106 C CD   . GLU A 1 34 ? -25.021 -0.538 -3.606  1.00 0.00 ? 34 GLU A CD   16 
ATOM 6107 O OE1  . GLU A 1 34 ? -25.534 -0.953 -4.641  1.00 0.00 ? 34 GLU A OE1  16 
ATOM 6108 O OE2  . GLU A 1 34 ? -24.861 -1.358 -2.553  1.00 0.00 ? 34 GLU A OE2  16 
ATOM 6109 H H    . GLU A 1 34 ? -22.622 2.929  -3.407  1.00 0.00 ? 34 GLU A H    16 
ATOM 6110 H HE2  . GLU A 1 34 ? -25.267 -2.213 -2.866  1.00 0.00 ? 34 GLU A HE2  16 
ATOM 6111 N N    . ARG A 1 35 ? -24.341 4.955  -2.468  1.00 0.00 ? 35 ARG A N    16 
ATOM 6112 C CA   . ARG A 1 35 ? -24.707 5.715  -1.231  1.00 0.00 ? 35 ARG A CA   16 
ATOM 6113 C C    . ARG A 1 35 ? -25.394 4.884  -0.120  1.00 0.00 ? 35 ARG A C    16 
ATOM 6114 O O    . ARG A 1 35 ? -25.028 3.695  0.002   1.00 0.00 ? 35 ARG A O    16 
ATOM 6115 C CB   . ARG A 1 35 ? -25.427 7.038  -1.565  1.00 0.00 ? 35 ARG A CB   16 
ATOM 6116 C CG   . ARG A 1 35 ? -26.830 6.854  -2.161  1.00 0.00 ? 35 ARG A CG   16 
ATOM 6117 C CD   . ARG A 1 35 ? -27.544 8.170  -2.456  1.00 0.00 ? 35 ARG A CD   16 
ATOM 6118 N NE   . ARG A 1 35 ? -27.982 8.096  -3.853  1.00 0.00 ? 35 ARG A NE   16 
ATOM 6119 C CZ   . ARG A 1 35 ? -29.071 7.468  -4.293  1.00 0.00 ? 35 ARG A CZ   16 
ATOM 6120 N NH1  . ARG A 1 35 ? -30.262 8.049  -4.272  1.00 0.00 ? 35 ARG A NH1  16 
ATOM 6121 N NH2  . ARG A 1 35 ? -28.914 6.411  -5.063  1.00 0.00 ? 35 ARG A NH2  16 
ATOM 6122 O OXT  . ARG A 1 35 ? -26.178 5.473  0.670   1.00 0.00 ? 35 ARG A OXT  16 
ATOM 6123 H H    . ARG A 1 35 ? -23.425 5.149  -2.801  1.00 0.00 ? 35 ARG A H    16 
ATOM 6124 H HE   . ARG A 1 35 ? -27.460 8.655  -4.499  1.00 0.00 ? 35 ARG A HE   16 
ATOM 6125 H HH11 . ARG A 1 35 ? -30.368 8.944  -3.840  1.00 0.00 ? 35 ARG A HH11 16 
ATOM 6126 H HH12 . ARG A 1 35 ? -31.047 7.569  -4.653  1.00 0.00 ? 35 ARG A HH12 16 
ATOM 6127 H HH21 . ARG A 1 35 ? -28.016 5.978  -5.117  1.00 0.00 ? 35 ARG A HH21 16 
ATOM 6128 H HH22 . ARG A 1 35 ? -29.703 5.941  -5.452  1.00 0.00 ? 35 ARG A HH22 16 
ATOM 6129 N N    . LEU A 1 1  ? 23.593  0.811  -2.835  1.00 0.00 ? 1  LEU A N    17 
ATOM 6130 C CA   . LEU A 1 1  ? 23.534  2.125  -3.524  1.00 0.00 ? 1  LEU A CA   17 
ATOM 6131 C C    . LEU A 1 1  ? 22.117  2.629  -3.879  1.00 0.00 ? 1  LEU A C    17 
ATOM 6132 O O    . LEU A 1 1  ? 21.152  1.872  -3.857  1.00 0.00 ? 1  LEU A O    17 
ATOM 6133 C CB   . LEU A 1 1  ? 24.414  2.088  -4.793  1.00 0.00 ? 1  LEU A CB   17 
ATOM 6134 C CG   . LEU A 1 1  ? 25.823  2.676  -4.632  1.00 0.00 ? 1  LEU A CG   17 
ATOM 6135 C CD1  . LEU A 1 1  ? 25.795  4.135  -4.164  1.00 0.00 ? 1  LEU A CD1  17 
ATOM 6136 C CD2  . LEU A 1 1  ? 26.732  1.812  -3.757  1.00 0.00 ? 1  LEU A CD2  17 
ATOM 6137 H H1   . LEU A 1 1  ? 23.091  0.865  -1.977  1.00 0.00 ? 1  LEU A H1   17 
ATOM 6138 H H2   . LEU A 1 1  ? 23.183  0.100  -3.431  1.00 0.00 ? 1  LEU A H2   17 
ATOM 6139 H H3   . LEU A 1 1  ? 24.538  0.560  -2.654  1.00 0.00 ? 1  LEU A H3   17 
ATOM 6140 N N    . GLN A 1 2  ? 22.034  3.863  -4.388  1.00 0.00 ? 2  GLN A N    17 
ATOM 6141 C CA   . GLN A 1 2  ? 20.759  4.509  -4.786  1.00 0.00 ? 2  GLN A CA   17 
ATOM 6142 C C    . GLN A 1 2  ? 20.247  3.907  -6.120  1.00 0.00 ? 2  GLN A C    17 
ATOM 6143 O O    . GLN A 1 2  ? 20.663  4.293  -7.199  1.00 0.00 ? 2  GLN A O    17 
ATOM 6144 C CB   . GLN A 1 2  ? 20.987  6.022  -4.892  1.00 0.00 ? 2  GLN A CB   17 
ATOM 6145 C CG   . GLN A 1 2  ? 19.764  6.847  -5.306  1.00 0.00 ? 2  GLN A CG   17 
ATOM 6146 C CD   . GLN A 1 2  ? 18.960  7.465  -4.158  1.00 0.00 ? 2  GLN A CD   17 
ATOM 6147 O OE1  . GLN A 1 2  ? 19.355  7.544  -3.002  1.00 0.00 ? 2  GLN A OE1  17 
ATOM 6148 N NE2  . GLN A 1 2  ? 17.750  7.913  -4.456  1.00 0.00 ? 2  GLN A NE2  17 
ATOM 6149 H H    . GLN A 1 2  ? 22.864  4.361  -4.640  1.00 0.00 ? 2  GLN A H    17 
ATOM 6150 H HE21 . GLN A 1 2  ? 17.354  7.767  -5.354  1.00 0.00 ? 2  GLN A HE21 17 
ATOM 6151 H HE22 . GLN A 1 2  ? 17.254  8.354  -3.714  1.00 0.00 ? 2  GLN A HE22 17 
ATOM 6152 N N    . ARG A 1 3  ? 19.451  2.860  -5.973  1.00 0.00 ? 3  ARG A N    17 
ATOM 6153 C CA   . ARG A 1 3  ? 18.835  2.149  -7.123  1.00 0.00 ? 3  ARG A CA   17 
ATOM 6154 C C    . ARG A 1 3  ? 17.439  1.610  -6.758  1.00 0.00 ? 3  ARG A C    17 
ATOM 6155 O O    . ARG A 1 3  ? 17.189  1.370  -5.592  1.00 0.00 ? 3  ARG A O    17 
ATOM 6156 C CB   . ARG A 1 3  ? 19.747  1.011  -7.607  1.00 0.00 ? 3  ARG A CB   17 
ATOM 6157 C CG   . ARG A 1 3  ? 20.005  -0.032 -6.519  1.00 0.00 ? 3  ARG A CG   17 
ATOM 6158 C CD   . ARG A 1 3  ? 21.496  -0.322 -6.383  1.00 0.00 ? 3  ARG A CD   17 
ATOM 6159 N NE   . ARG A 1 3  ? 21.699  -0.861 -5.027  1.00 0.00 ? 3  ARG A NE   17 
ATOM 6160 C CZ   . ARG A 1 3  ? 22.634  -1.726 -4.645  1.00 0.00 ? 3  ARG A CZ   17 
ATOM 6161 N NH1  . ARG A 1 3  ? 23.662  -2.045 -5.423  1.00 0.00 ? 3  ARG A NH1  17 
ATOM 6162 N NH2  . ARG A 1 3  ? 22.437  -2.446 -3.556  1.00 0.00 ? 3  ARG A NH2  17 
ATOM 6163 H H    . ARG A 1 3  ? 19.337  2.432  -5.081  1.00 0.00 ? 3  ARG A H    17 
ATOM 6164 H HE   . ARG A 1 3  ? 21.205  -0.366 -4.310  1.00 0.00 ? 3  ARG A HE   17 
ATOM 6165 H HH11 . ARG A 1 3  ? 23.771  -1.577 -6.302  1.00 0.00 ? 3  ARG A HH11 17 
ATOM 6166 H HH12 . ARG A 1 3  ? 24.332  -2.714 -5.113  1.00 0.00 ? 3  ARG A HH12 17 
ATOM 6167 H HH21 . ARG A 1 3  ? 21.565  -2.390 -3.068  1.00 0.00 ? 3  ARG A HH21 17 
ATOM 6168 H HH22 . ARG A 1 3  ? 23.129  -3.100 -3.258  1.00 0.00 ? 3  ARG A HH22 17 
ATOM 6169 N N    . MET A 1 4  ? 16.663  1.257  -7.768  1.00 0.00 ? 4  MET A N    17 
ATOM 6170 C CA   . MET A 1 4  ? 15.315  0.656  -7.554  1.00 0.00 ? 4  MET A CA   17 
ATOM 6171 C C    . MET A 1 4  ? 15.333  -0.601 -6.653  1.00 0.00 ? 4  MET A C    17 
ATOM 6172 O O    . MET A 1 4  ? 14.507  -0.681 -5.769  1.00 0.00 ? 4  MET A O    17 
ATOM 6173 C CB   . MET A 1 4  ? 14.589  0.409  -8.875  1.00 0.00 ? 4  MET A CB   17 
ATOM 6174 C CG   . MET A 1 4  ? 14.431  1.699  -9.714  1.00 0.00 ? 4  MET A CG   17 
ATOM 6175 S SD   . MET A 1 4  ? 13.717  3.140  -8.834  1.00 0.00 ? 4  MET A SD   17 
ATOM 6176 C CE   . MET A 1 4  ? 15.178  4.126  -8.576  1.00 0.00 ? 4  MET A CE   17 
ATOM 6177 H H    . MET A 1 4  ? 16.842  1.534  -8.719  1.00 0.00 ? 4  MET A H    17 
ATOM 6178 N N    . LYS A 1 5  ? 16.454  -1.308 -6.652  1.00 0.00 ? 5  LYS A N    17 
ATOM 6179 C CA   . LYS A 1 5  ? 16.666  -2.491 -5.771  1.00 0.00 ? 5  LYS A CA   17 
ATOM 6180 C C    . LYS A 1 5  ? 16.873  -2.126 -4.276  1.00 0.00 ? 5  LYS A C    17 
ATOM 6181 O O    . LYS A 1 5  ? 16.475  -2.868 -3.387  1.00 0.00 ? 5  LYS A O    17 
ATOM 6182 C CB   . LYS A 1 5  ? 17.868  -3.279 -6.291  1.00 0.00 ? 5  LYS A CB   17 
ATOM 6183 C CG   . LYS A 1 5  ? 17.637  -4.788 -6.175  1.00 0.00 ? 5  LYS A CG   17 
ATOM 6184 C CD   . LYS A 1 5  ? 17.361  -5.452 -7.533  1.00 0.00 ? 5  LYS A CD   17 
ATOM 6185 C CE   . LYS A 1 5  ? 18.616  -5.491 -8.409  1.00 0.00 ? 5  LYS A CE   17 
ATOM 6186 N NZ   . LYS A 1 5  ? 18.350  -6.241 -9.643  1.00 0.00 ? 5  LYS A NZ   17 
ATOM 6187 H H    . LYS A 1 5  ? 17.231  -1.061 -7.230  1.00 0.00 ? 5  LYS A H    17 
ATOM 6188 H HZ1  . LYS A 1 5  ? 18.087  -7.175 -9.436  1.00 0.00 ? 5  LYS A HZ1  17 
ATOM 6189 H HZ2  . LYS A 1 5  ? 17.632  -5.784 -10.172 1.00 0.00 ? 5  LYS A HZ2  17 
ATOM 6190 H HZ3  . LYS A 1 5  ? 19.194  -6.263 -10.201 1.00 0.00 ? 5  LYS A HZ3  17 
ATOM 6191 N N    . GLN A 1 6  ? 17.472  -0.960 -4.042  1.00 0.00 ? 6  GLN A N    17 
ATOM 6192 C CA   . GLN A 1 6  ? 17.705  -0.425 -2.679  1.00 0.00 ? 6  GLN A CA   17 
ATOM 6193 C C    . GLN A 1 6  ? 16.634  0.585  -2.219  1.00 0.00 ? 6  GLN A C    17 
ATOM 6194 O O    . GLN A 1 6  ? 16.166  0.507  -1.097  1.00 0.00 ? 6  GLN A O    17 
ATOM 6195 C CB   . GLN A 1 6  ? 19.115  0.172  -2.567  1.00 0.00 ? 6  GLN A CB   17 
ATOM 6196 C CG   . GLN A 1 6  ? 19.338  1.031  -1.316  1.00 0.00 ? 6  GLN A CG   17 
ATOM 6197 C CD   . GLN A 1 6  ? 20.743  0.891  -0.751  1.00 0.00 ? 6  GLN A CD   17 
ATOM 6198 O OE1  . GLN A 1 6  ? 21.546  1.810  -0.699  1.00 0.00 ? 6  GLN A OE1  17 
ATOM 6199 N NE2  . GLN A 1 6  ? 21.029  -0.295 -0.247  1.00 0.00 ? 6  GLN A NE2  17 
ATOM 6200 H H    . GLN A 1 6  ? 17.743  -0.342 -4.779  1.00 0.00 ? 6  GLN A H    17 
ATOM 6201 H HE21 . GLN A 1 6  ? 20.328  -1.005 -0.224  1.00 0.00 ? 6  GLN A HE21 17 
ATOM 6202 H HE22 . GLN A 1 6  ? 21.937  -0.413 0.146   1.00 0.00 ? 6  GLN A HE22 17 
ATOM 6203 N N    . LEU A 1 7  ? 16.294  1.524  -3.086  1.00 0.00 ? 7  LEU A N    17 
ATOM 6204 C CA   . LEU A 1 7  ? 15.221  2.509  -2.798  1.00 0.00 ? 7  LEU A CA   17 
ATOM 6205 C C    . LEU A 1 7  ? 13.900  1.792  -2.477  1.00 0.00 ? 7  LEU A C    17 
ATOM 6206 O O    . LEU A 1 7  ? 13.293  2.127  -1.473  1.00 0.00 ? 7  LEU A O    17 
ATOM 6207 C CB   . LEU A 1 7  ? 15.032  3.509  -3.950  1.00 0.00 ? 7  LEU A CB   17 
ATOM 6208 C CG   . LEU A 1 7  ? 16.339  4.244  -4.306  1.00 0.00 ? 7  LEU A CG   17 
ATOM 6209 C CD1  . LEU A 1 7  ? 16.033  5.301  -5.368  1.00 0.00 ? 7  LEU A CD1  17 
ATOM 6210 C CD2  . LEU A 1 7  ? 17.031  4.888  -3.105  1.00 0.00 ? 7  LEU A CD2  17 
ATOM 6211 H H    . LEU A 1 7  ? 16.738  1.646  -3.975  1.00 0.00 ? 7  LEU A H    17 
ATOM 6212 N N    . GLU A 1 8  ? 13.680  0.657  -3.140  1.00 0.00 ? 8  GLU A N    17 
ATOM 6213 C CA   . GLU A 1 8  ? 12.583  -0.262 -2.789  1.00 0.00 ? 8  GLU A CA   17 
ATOM 6214 C C    . GLU A 1 8  ? 12.627  -0.753 -1.338  1.00 0.00 ? 8  GLU A C    17 
ATOM 6215 O O    . GLU A 1 8  ? 11.565  -0.798 -0.747  1.00 0.00 ? 8  GLU A O    17 
ATOM 6216 C CB   . GLU A 1 8  ? 12.476  -1.484 -3.701  1.00 0.00 ? 8  GLU A CB   17 
ATOM 6217 C CG   . GLU A 1 8  ? 11.633  -1.207 -4.949  1.00 0.00 ? 8  GLU A CG   17 
ATOM 6218 C CD   . GLU A 1 8  ? 10.143  -1.017 -4.638  1.00 0.00 ? 8  GLU A CD   17 
ATOM 6219 O OE1  . GLU A 1 8  ? 9.402   -1.949 -4.361  1.00 0.00 ? 8  GLU A OE1  17 
ATOM 6220 O OE2  . GLU A 1 8  ? 9.677   0.248  -4.680  1.00 0.00 ? 8  GLU A OE2  17 
ATOM 6221 H H    . GLU A 1 8  ? 14.236  0.379  -3.933  1.00 0.00 ? 8  GLU A H    17 
ATOM 6222 H HE2  . GLU A 1 8  ? 8.699   0.134  -4.490  1.00 0.00 ? 8  GLU A HE2  17 
ATOM 6223 N N    . ASP A 1 9  ? 13.798  -0.920 -0.728  1.00 0.00 ? 9  ASP A N    17 
ATOM 6224 C CA   . ASP A 1 9  ? 13.921  -1.301 0.703   1.00 0.00 ? 9  ASP A CA   17 
ATOM 6225 C C    . ASP A 1 9  ? 13.258  -0.242 1.619   1.00 0.00 ? 9  ASP A C    17 
ATOM 6226 O O    . ASP A 1 9  ? 12.541  -0.574 2.560   1.00 0.00 ? 9  ASP A O    17 
ATOM 6227 C CB   . ASP A 1 9  ? 15.378  -1.471 1.136   1.00 0.00 ? 9  ASP A CB   17 
ATOM 6228 C CG   . ASP A 1 9  ? 16.235  -2.361 0.212   1.00 0.00 ? 9  ASP A CG   17 
ATOM 6229 O OD1  . ASP A 1 9  ? 17.442  -2.171 0.079   1.00 0.00 ? 9  ASP A OD1  17 
ATOM 6230 O OD2  . ASP A 1 9  ? 15.608  -3.330 -0.476  1.00 0.00 ? 9  ASP A OD2  17 
ATOM 6231 H H    . ASP A 1 9  ? 14.665  -0.784 -1.208  1.00 0.00 ? 9  ASP A H    17 
ATOM 6232 H HD2  . ASP A 1 9  ? 16.314  -3.721 -1.075  1.00 0.00 ? 9  ASP A HD2  17 
ATOM 6233 N N    . LYS A 1 10 ? 13.386  1.024  1.217   1.00 0.00 ? 10 LYS A N    17 
ATOM 6234 C CA   . LYS A 1 10 ? 12.840  2.198  1.938   1.00 0.00 ? 10 LYS A CA   17 
ATOM 6235 C C    . LYS A 1 10 ? 11.357  2.405  1.560   1.00 0.00 ? 10 LYS A C    17 
ATOM 6236 O O    . LYS A 1 10 ? 10.487  2.313  2.415   1.00 0.00 ? 10 LYS A O    17 
ATOM 6237 C CB   . LYS A 1 10 ? 13.633  3.470  1.637   1.00 0.00 ? 10 LYS A CB   17 
ATOM 6238 C CG   . LYS A 1 10 ? 15.136  3.188  1.578   1.00 0.00 ? 10 LYS A CG   17 
ATOM 6239 C CD   . LYS A 1 10 ? 16.033  4.385  1.897   1.00 0.00 ? 10 LYS A CD   17 
ATOM 6240 C CE   . LYS A 1 10 ? 17.513  4.013  1.739   1.00 0.00 ? 10 LYS A CE   17 
ATOM 6241 N NZ   . LYS A 1 10 ? 17.838  2.743  2.418   1.00 0.00 ? 10 LYS A NZ   17 
ATOM 6242 H H    . LYS A 1 10 ? 13.901  1.250  0.389   1.00 0.00 ? 10 LYS A H    17 
ATOM 6243 H HZ1  . LYS A 1 10 ? 17.544  2.766  3.367   1.00 0.00 ? 10 LYS A HZ1  17 
ATOM 6244 H HZ2  . LYS A 1 10 ? 17.386  1.996  1.931   1.00 0.00 ? 10 LYS A HZ2  17 
ATOM 6245 H HZ3  . LYS A 1 10 ? 18.833  2.596  2.380   1.00 0.00 ? 10 LYS A HZ3  17 
ATOM 6246 N N    . VAL A 1 11 ? 11.093  2.405  0.251   1.00 0.00 ? 11 VAL A N    17 
ATOM 6247 C CA   . VAL A 1 11 ? 9.725   2.503  -0.330  1.00 0.00 ? 11 VAL A CA   17 
ATOM 6248 C C    . VAL A 1 11 ? 8.847   1.286  0.060   1.00 0.00 ? 11 VAL A C    17 
ATOM 6249 O O    . VAL A 1 11 ? 7.628   1.340  -0.018  1.00 0.00 ? 11 VAL A O    17 
ATOM 6250 C CB   . VAL A 1 11 ? 9.806   2.673  -1.869  1.00 0.00 ? 11 VAL A CB   17 
ATOM 6251 C CG1  . VAL A 1 11 ? 8.449   3.019  -2.486  1.00 0.00 ? 11 VAL A CG1  17 
ATOM 6252 C CG2  . VAL A 1 11 ? 10.790  3.760  -2.317  1.00 0.00 ? 11 VAL A CG2  17 
ATOM 6253 H H    . VAL A 1 11 ? 11.839  2.387  -0.424  1.00 0.00 ? 11 VAL A H    17 
ATOM 6254 N N    . GLU A 1 12 ? 9.476   0.226  0.547   1.00 0.00 ? 12 GLU A N    17 
ATOM 6255 C CA   . GLU A 1 12 ? 8.821   -1.002 1.045   1.00 0.00 ? 12 GLU A CA   17 
ATOM 6256 C C    . GLU A 1 12 ? 7.923   -0.693 2.259   1.00 0.00 ? 12 GLU A C    17 
ATOM 6257 O O    . GLU A 1 12 ? 6.777   -1.109 2.243   1.00 0.00 ? 12 GLU A O    17 
ATOM 6258 C CB   . GLU A 1 12 ? 9.863   -2.057 1.430   1.00 0.00 ? 12 GLU A CB   17 
ATOM 6259 C CG   . GLU A 1 12 ? 9.247   -3.452 1.575   1.00 0.00 ? 12 GLU A CG   17 
ATOM 6260 C CD   . GLU A 1 12 ? 9.459   -4.000 2.984   1.00 0.00 ? 12 GLU A CD   17 
ATOM 6261 O OE1  . GLU A 1 12 ? 8.898   -3.522 3.965   1.00 0.00 ? 12 GLU A OE1  17 
ATOM 6262 O OE2  . GLU A 1 12 ? 10.293  -5.054 3.099   1.00 0.00 ? 12 GLU A OE2  17 
ATOM 6263 H H    . GLU A 1 12 ? 10.472  0.125  0.442   1.00 0.00 ? 12 GLU A H    17 
ATOM 6264 H HE2  . GLU A 1 12 ? 10.288  -5.259 4.072   1.00 0.00 ? 12 GLU A HE2  17 
ATOM 6265 N N    . GLU A 1 13 ? 8.403   0.191  3.132   1.00 0.00 ? 13 GLU A N    17 
ATOM 6266 C CA   . GLU A 1 13 ? 7.618   0.716  4.272   1.00 0.00 ? 13 GLU A CA   17 
ATOM 6267 C C    . GLU A 1 13 ? 6.297   1.382  3.796   1.00 0.00 ? 13 GLU A C    17 
ATOM 6268 O O    . GLU A 1 13 ? 5.381   1.548  4.584   1.00 0.00 ? 13 GLU A O    17 
ATOM 6269 C CB   . GLU A 1 13 ? 8.445   1.708  5.115   1.00 0.00 ? 13 GLU A CB   17 
ATOM 6270 C CG   . GLU A 1 13 ? 8.509   3.124  4.534   1.00 0.00 ? 13 GLU A CG   17 
ATOM 6271 C CD   . GLU A 1 13 ? 9.530   4.048  5.174   1.00 0.00 ? 13 GLU A CD   17 
ATOM 6272 O OE1  . GLU A 1 13 ? 10.293  4.740  4.505   1.00 0.00 ? 13 GLU A OE1  17 
ATOM 6273 O OE2  . GLU A 1 13 ? 9.533   4.130  6.524   1.00 0.00 ? 13 GLU A OE2  17 
ATOM 6274 H H    . GLU A 1 13 ? 9.343   0.547  3.079   1.00 0.00 ? 13 GLU A H    17 
ATOM 6275 H HE2  . GLU A 1 13 ? 10.253  4.803  6.706   1.00 0.00 ? 13 GLU A HE2  17 
ATOM 6276 N N    . LEU A 1 14 ? 6.350   1.926  2.582   1.00 0.00 ? 14 LEU A N    17 
ATOM 6277 C CA   . LEU A 1 14 ? 5.183   2.552  1.937   1.00 0.00 ? 14 LEU A CA   17 
ATOM 6278 C C    . LEU A 1 14 ? 4.287   1.430  1.401   1.00 0.00 ? 14 LEU A C    17 
ATOM 6279 O O    . LEU A 1 14 ? 3.289   1.169  2.054   1.00 0.00 ? 14 LEU A O    17 
ATOM 6280 C CB   . LEU A 1 14 ? 5.536   3.522  0.802   1.00 0.00 ? 14 LEU A CB   17 
ATOM 6281 C CG   . LEU A 1 14 ? 6.547   4.601  1.206   1.00 0.00 ? 14 LEU A CG   17 
ATOM 6282 C CD1  . LEU A 1 14 ? 6.753   5.534  0.006   1.00 0.00 ? 14 LEU A CD1  17 
ATOM 6283 C CD2  . LEU A 1 14 ? 6.123   5.419  2.425   1.00 0.00 ? 14 LEU A CD2  17 
ATOM 6284 H H    . LEU A 1 14 ? 7.167   1.880  2.018   1.00 0.00 ? 14 LEU A H    17 
ATOM 6285 N N    . LEU A 1 15 ? 4.788   0.619  0.483   1.00 0.00 ? 15 LEU A N    17 
ATOM 6286 C CA   . LEU A 1 15 ? 4.025   -0.505 -0.097  1.00 0.00 ? 15 LEU A CA   17 
ATOM 6287 C C    . LEU A 1 15 ? 3.397   -1.424 0.965   1.00 0.00 ? 15 LEU A C    17 
ATOM 6288 O O    . LEU A 1 15 ? 2.184   -1.496 0.995   1.00 0.00 ? 15 LEU A O    17 
ATOM 6289 C CB   . LEU A 1 15 ? 4.832   -1.340 -1.095  1.00 0.00 ? 15 LEU A CB   17 
ATOM 6290 C CG   . LEU A 1 15 ? 5.694   -0.517 -2.063  1.00 0.00 ? 15 LEU A CG   17 
ATOM 6291 C CD1  . LEU A 1 15 ? 6.355   -1.457 -3.059  1.00 0.00 ? 15 LEU A CD1  17 
ATOM 6292 C CD2  . LEU A 1 15 ? 4.944   0.592  -2.809  1.00 0.00 ? 15 LEU A CD2  17 
ATOM 6293 H H    . LEU A 1 15 ? 5.689   0.784  0.067   1.00 0.00 ? 15 LEU A H    17 
ATOM 6294 N N    . SER A 1 16 ? 4.151   -1.800 1.999   1.00 0.00 ? 16 SER A N    17 
ATOM 6295 C CA   . SER A 1 16 ? 3.658   -2.593 3.150   1.00 0.00 ? 16 SER A CA   17 
ATOM 6296 C C    . SER A 1 16 ? 2.296   -2.123 3.713   1.00 0.00 ? 16 SER A C    17 
ATOM 6297 O O    . SER A 1 16 ? 1.437   -2.947 4.022   1.00 0.00 ? 16 SER A O    17 
ATOM 6298 C CB   . SER A 1 16 ? 4.673   -2.564 4.308   1.00 0.00 ? 16 SER A CB   17 
ATOM 6299 O OG   . SER A 1 16 ? 4.784   -1.233 4.793   1.00 0.00 ? 16 SER A OG   17 
ATOM 6300 H H    . SER A 1 16 ? 5.123   -1.523 2.060   1.00 0.00 ? 16 SER A H    17 
ATOM 6301 H HG   . SER A 1 16 ? 5.395   -1.187 5.588   1.00 0.00 ? 16 SER A HG   17 
ATOM 6302 N N    . LYS A 1 17 ? 2.121   -0.804 3.686   1.00 0.00 ? 17 LYS A N    17 
ATOM 6303 C CA   . LYS A 1 17 ? 0.875   -0.093 4.015   1.00 0.00 ? 17 LYS A CA   17 
ATOM 6304 C C    . LYS A 1 17 ? 0.080   0.484  2.818   1.00 0.00 ? 17 LYS A C    17 
ATOM 6305 O O    . LYS A 1 17 ? -1.061  0.106  2.626   1.00 0.00 ? 17 LYS A O    17 
ATOM 6306 C CB   . LYS A 1 17 ? 1.096   0.942  5.125   1.00 0.00 ? 17 LYS A CB   17 
ATOM 6307 C CG   . LYS A 1 17 ? 2.314   1.834  4.887   1.00 0.00 ? 17 LYS A CG   17 
ATOM 6308 C CD   . LYS A 1 17 ? 2.582   2.810  6.037   1.00 0.00 ? 17 LYS A CD   17 
ATOM 6309 C CE   . LYS A 1 17 ? 1.573   3.952  6.028   1.00 0.00 ? 17 LYS A CE   17 
ATOM 6310 N NZ   . LYS A 1 17 ? 0.974   4.032  7.360   1.00 0.00 ? 17 LYS A NZ   17 
ATOM 6311 H H    . LYS A 1 17 ? 2.891   -0.211 3.441   1.00 0.00 ? 17 LYS A H    17 
ATOM 6312 H HZ1  . LYS A 1 17 ? 0.526   3.169  7.589   1.00 0.00 ? 17 LYS A HZ1  17 
ATOM 6313 H HZ2  . LYS A 1 17 ? 1.704   4.228  8.035   1.00 0.00 ? 17 LYS A HZ2  17 
ATOM 6314 H HZ3  . LYS A 1 17 ? 0.301   4.773  7.367   1.00 0.00 ? 17 LYS A HZ3  17 
ATOM 6315 N N    . ASN A 1 18 ? 0.694   1.229  1.926   1.00 0.00 ? 18 ASN A N    17 
ATOM 6316 C CA   . ASN A 1 18 ? 0.071   1.797  0.698   1.00 0.00 ? 18 ASN A CA   17 
ATOM 6317 C C    . ASN A 1 18 ? -0.619  0.709  -0.177  1.00 0.00 ? 18 ASN A C    17 
ATOM 6318 O O    . ASN A 1 18 ? -1.716  0.917  -0.673  1.00 0.00 ? 18 ASN A O    17 
ATOM 6319 C CB   . ASN A 1 18 ? 1.139   2.536  -0.109  1.00 0.00 ? 18 ASN A CB   17 
ATOM 6320 C CG   . ASN A 1 18 ? 0.564   3.668  -0.957  1.00 0.00 ? 18 ASN A CG   17 
ATOM 6321 O OD1  . ASN A 1 18 ? 0.829   4.844  -0.745  1.00 0.00 ? 18 ASN A OD1  17 
ATOM 6322 N ND2  . ASN A 1 18 ? -0.253  3.352  -1.938  1.00 0.00 ? 18 ASN A ND2  17 
ATOM 6323 H H    . ASN A 1 18 ? 1.680   1.452  2.039   1.00 0.00 ? 18 ASN A H    17 
ATOM 6324 H HD21 . ASN A 1 18 ? -0.576  2.418  -2.064  1.00 0.00 ? 18 ASN A HD21 17 
ATOM 6325 H HD22 . ASN A 1 18 ? -0.598  4.108  -2.491  1.00 0.00 ? 18 ASN A HD22 17 
ATOM 6326 N N    . TYR A 1 19 ? 0.012   -0.457 -0.266  1.00 0.00 ? 19 TYR A N    17 
ATOM 6327 C CA   . TYR A 1 19 ? -0.513  -1.655 -0.966  1.00 0.00 ? 19 TYR A CA   17 
ATOM 6328 C C    . TYR A 1 19 ? -1.724  -2.239 -0.214  1.00 0.00 ? 19 TYR A C    17 
ATOM 6329 O O    . TYR A 1 19 ? -2.733  -2.529 -0.846  1.00 0.00 ? 19 TYR A O    17 
ATOM 6330 C CB   . TYR A 1 19 ? 0.602   -2.702 -1.055  1.00 0.00 ? 19 TYR A CB   17 
ATOM 6331 C CG   . TYR A 1 19 ? 0.582   -3.599 -2.281  1.00 0.00 ? 19 TYR A CG   17 
ATOM 6332 C CD1  . TYR A 1 19 ? -0.342  -4.671 -2.337  1.00 0.00 ? 19 TYR A CD1  17 
ATOM 6333 C CD2  . TYR A 1 19 ? 1.567   -3.398 -3.273  1.00 0.00 ? 19 TYR A CD2  17 
ATOM 6334 C CE1  . TYR A 1 19 ? -0.279  -5.554 -3.434  1.00 0.00 ? 19 TYR A CE1  17 
ATOM 6335 C CE2  . TYR A 1 19 ? 1.630   -4.290 -4.366  1.00 0.00 ? 19 TYR A CE2  17 
ATOM 6336 C CZ   . TYR A 1 19 ? 0.697   -5.344 -4.433  1.00 0.00 ? 19 TYR A CZ   17 
ATOM 6337 O OH   . TYR A 1 19 ? 0.701   -6.165 -5.519  1.00 0.00 ? 19 TYR A OH   17 
ATOM 6338 H H    . TYR A 1 19 ? 0.883   -0.628 0.222   1.00 0.00 ? 19 TYR A H    17 
ATOM 6339 H HH   . TYR A 1 19 ? 1.433   -5.880 -6.137  1.00 0.00 ? 19 TYR A HH   17 
ATOM 6340 N N    . HIS A 1 20 ? -1.667  -2.278 1.117   1.00 0.00 ? 20 HIS A N    17 
ATOM 6341 C CA   . HIS A 1 20 ? -2.806  -2.732 1.962   1.00 0.00 ? 20 HIS A CA   17 
ATOM 6342 C C    . HIS A 1 20 ? -3.917  -1.663 2.121   1.00 0.00 ? 20 HIS A C    17 
ATOM 6343 O O    . HIS A 1 20 ? -5.039  -1.966 2.512   1.00 0.00 ? 20 HIS A O    17 
ATOM 6344 C CB   . HIS A 1 20 ? -2.350  -3.327 3.309   1.00 0.00 ? 20 HIS A CB   17 
ATOM 6345 C CG   . HIS A 1 20 ? -1.973  -2.425 4.499   1.00 0.00 ? 20 HIS A CG   17 
ATOM 6346 N ND1  . HIS A 1 20 ? -1.148  -2.781 5.485   1.00 0.00 ? 20 HIS A ND1  17 
ATOM 6347 C CD2  . HIS A 1 20 ? -2.487  -1.253 4.842   1.00 0.00 ? 20 HIS A CD2  17 
ATOM 6348 C CE1  . HIS A 1 20 ? -1.147  -1.837 6.410   1.00 0.00 ? 20 HIS A CE1  17 
ATOM 6349 N NE2  . HIS A 1 20 ? -1.938  -0.852 5.987   1.00 0.00 ? 20 HIS A NE2  17 
ATOM 6350 H H    . HIS A 1 20 ? -0.873  -1.935 1.635   1.00 0.00 ? 20 HIS A H    17 
ATOM 6351 H HD1  . HIS A 1 20 ? -0.532  -3.567 5.473   1.00 0.00 ? 20 HIS A HD1  17 
ATOM 6352 H HE2  . HIS A 1 20 ? -1.905  0.093  6.306   1.00 0.00 ? 20 HIS A HE2  17 
ATOM 6353 N N    . LEU A 1 21 ? -3.592  -0.426 1.762   1.00 0.00 ? 21 LEU A N    17 
ATOM 6354 C CA   . LEU A 1 21 ? -4.470  0.756  1.847   1.00 0.00 ? 21 LEU A CA   17 
ATOM 6355 C C    . LEU A 1 21 ? -5.468  0.782  0.690   1.00 0.00 ? 21 LEU A C    17 
ATOM 6356 O O    . LEU A 1 21 ? -6.671  0.937  0.921   1.00 0.00 ? 21 LEU A O    17 
ATOM 6357 C CB   . LEU A 1 21 ? -3.586  2.018  1.881   1.00 0.00 ? 21 LEU A CB   17 
ATOM 6358 C CG   . LEU A 1 21 ? -4.330  3.339  1.684   1.00 0.00 ? 21 LEU A CG   17 
ATOM 6359 C CD1  . LEU A 1 21 ? -5.244  3.671  2.871   1.00 0.00 ? 21 LEU A CD1  17 
ATOM 6360 C CD2  . LEU A 1 21 ? -3.338  4.465  1.412   1.00 0.00 ? 21 LEU A CD2  17 
ATOM 6361 H H    . LEU A 1 21 ? -2.640  -0.214 1.519   1.00 0.00 ? 21 LEU A H    17 
ATOM 6362 N N    . GLU A 1 22 ? -4.957  0.514  -0.507  1.00 0.00 ? 22 GLU A N    17 
ATOM 6363 C CA   . GLU A 1 22 ? -5.800  0.419  -1.725  1.00 0.00 ? 22 GLU A CA   17 
ATOM 6364 C C    . GLU A 1 22 ? -6.905  -0.647 -1.568  1.00 0.00 ? 22 GLU A C    17 
ATOM 6365 O O    . GLU A 1 22 ? -8.037  -0.403 -1.965  1.00 0.00 ? 22 GLU A O    17 
ATOM 6366 C CB   . GLU A 1 22 ? -4.905  0.239  -2.968  1.00 0.00 ? 22 GLU A CB   17 
ATOM 6367 C CG   . GLU A 1 22 ? -4.548  -1.199 -3.395  1.00 0.00 ? 22 GLU A CG   17 
ATOM 6368 C CD   . GLU A 1 22 ? -5.648  -1.880 -4.228  1.00 0.00 ? 22 GLU A CD   17 
ATOM 6369 O OE1  . GLU A 1 22 ? -6.633  -1.292 -4.661  1.00 0.00 ? 22 GLU A OE1  17 
ATOM 6370 O OE2  . GLU A 1 22 ? -5.483  -3.187 -4.483  1.00 0.00 ? 22 GLU A OE2  17 
ATOM 6371 H H    . GLU A 1 22 ? -3.972  0.445  -0.664  1.00 0.00 ? 22 GLU A H    17 
ATOM 6372 H HE2  . GLU A 1 22 ? -6.273  -3.412 -5.057  1.00 0.00 ? 22 GLU A HE2  17 
ATOM 6373 N N    . ASN A 1 23 ? -6.613  -1.675 -0.774  1.00 0.00 ? 23 ASN A N    17 
ATOM 6374 C CA   . ASN A 1 23 ? -7.576  -2.733 -0.426  1.00 0.00 ? 23 ASN A CA   17 
ATOM 6375 C C    . ASN A 1 23 ? -8.807  -2.147 0.297   1.00 0.00 ? 23 ASN A C    17 
ATOM 6376 O O    . ASN A 1 23 ? -9.938  -2.409 -0.119  1.00 0.00 ? 23 ASN A O    17 
ATOM 6377 C CB   . ASN A 1 23 ? -6.909  -3.809 0.453   1.00 0.00 ? 23 ASN A CB   17 
ATOM 6378 C CG   . ASN A 1 23 ? -7.706  -5.111 0.598   1.00 0.00 ? 23 ASN A CG   17 
ATOM 6379 O OD1  . ASN A 1 23 ? -7.165  -6.175 0.836   1.00 0.00 ? 23 ASN A OD1  17 
ATOM 6380 N ND2  . ASN A 1 23 ? -9.019  -5.081 0.439   1.00 0.00 ? 23 ASN A ND2  17 
ATOM 6381 H H    . ASN A 1 23 ? -5.702  -1.780 -0.353  1.00 0.00 ? 23 ASN A H    17 
ATOM 6382 H HD21 . ASN A 1 23 ? -9.503  -4.236 0.207   1.00 0.00 ? 23 ASN A HD21 17 
ATOM 6383 H HD22 . ASN A 1 23 ? -9.499  -5.949 0.537   1.00 0.00 ? 23 ASN A HD22 17 
ATOM 6384 N N    . GLU A 1 24 ? -8.569  -1.333 1.312   1.00 0.00 ? 24 GLU A N    17 
ATOM 6385 C CA   . GLU A 1 24 ? -9.657  -0.665 2.055   1.00 0.00 ? 24 GLU A CA   17 
ATOM 6386 C C    . GLU A 1 24 ? -10.414 0.324  1.149   1.00 0.00 ? 24 GLU A C    17 
ATOM 6387 O O    . GLU A 1 24 ? -11.608 0.112  0.954   1.00 0.00 ? 24 GLU A O    17 
ATOM 6388 C CB   . GLU A 1 24 ? -9.148  0.019  3.328   1.00 0.00 ? 24 GLU A CB   17 
ATOM 6389 C CG   . GLU A 1 24 ? -10.327 0.554  4.157   1.00 0.00 ? 24 GLU A CG   17 
ATOM 6390 C CD   . GLU A 1 24 ? -10.231 0.090  5.598   1.00 0.00 ? 24 GLU A CD   17 
ATOM 6391 O OE1  . GLU A 1 24 ? -10.711 -0.971 5.992   1.00 0.00 ? 24 GLU A OE1  17 
ATOM 6392 O OE2  . GLU A 1 24 ? -9.555  0.899  6.443   1.00 0.00 ? 24 GLU A OE2  17 
ATOM 6393 H H    . GLU A 1 24 ? -7.636  -1.098 1.611   1.00 0.00 ? 24 GLU A H    17 
ATOM 6394 H HE2  . GLU A 1 24 ? -9.598  0.414  7.312   1.00 0.00 ? 24 GLU A HE2  17 
ATOM 6395 N N    . VAL A 1 25 ? -9.695  1.271  0.551   1.00 0.00 ? 25 VAL A N    17 
ATOM 6396 C CA   . VAL A 1 25 ? -10.225 2.234  -0.443  1.00 0.00 ? 25 VAL A CA   17 
ATOM 6397 C C    . VAL A 1 25 ? -11.161 1.541  -1.457  1.00 0.00 ? 25 VAL A C    17 
ATOM 6398 O O    . VAL A 1 25 ? -12.263 2.032  -1.702  1.00 0.00 ? 25 VAL A O    17 
ATOM 6399 C CB   . VAL A 1 25 ? -9.069  2.987  -1.143  1.00 0.00 ? 25 VAL A CB   17 
ATOM 6400 C CG1  . VAL A 1 25 ? -9.576  4.050  -2.134  1.00 0.00 ? 25 VAL A CG1  17 
ATOM 6401 C CG2  . VAL A 1 25 ? -8.165  3.700  -0.136  1.00 0.00 ? 25 VAL A CG2  17 
ATOM 6402 H H    . VAL A 1 25 ? -8.771  1.465  0.856   1.00 0.00 ? 25 VAL A H    17 
ATOM 6403 N N    . ALA A 1 26 ? -10.785 0.324  -1.859  1.00 0.00 ? 26 ALA A N    17 
ATOM 6404 C CA   . ALA A 1 26 ? -11.623 -0.552 -2.692  1.00 0.00 ? 26 ALA A CA   17 
ATOM 6405 C C    . ALA A 1 26 ? -12.948 -0.942 -2.004  1.00 0.00 ? 26 ALA A C    17 
ATOM 6406 O O    . ALA A 1 26 ? -13.953 -0.290 -2.279  1.00 0.00 ? 26 ALA A O    17 
ATOM 6407 C CB   . ALA A 1 26 ? -10.821 -1.771 -3.165  1.00 0.00 ? 26 ALA A CB   17 
ATOM 6408 H H    . ALA A 1 26 ? -9.898  -0.050 -1.611  1.00 0.00 ? 26 ALA A H    17 
ATOM 6409 N N    . ARG A 1 27 ? -12.900 -1.817 -0.994  1.00 0.00 ? 27 ARG A N    17 
ATOM 6410 C CA   . ARG A 1 27 ? -14.080 -2.251 -0.203  1.00 0.00 ? 27 ARG A CA   17 
ATOM 6411 C C    . ARG A 1 27 ? -14.952 -1.064 0.269   1.00 0.00 ? 27 ARG A C    17 
ATOM 6412 O O    . ARG A 1 27 ? -16.164 -1.089 0.094   1.00 0.00 ? 27 ARG A O    17 
ATOM 6413 C CB   . ARG A 1 27 ? -13.562 -3.077 0.986   1.00 0.00 ? 27 ARG A CB   17 
ATOM 6414 C CG   . ARG A 1 27 ? -14.587 -4.040 1.626   1.00 0.00 ? 27 ARG A CG   17 
ATOM 6415 C CD   . ARG A 1 27 ? -14.579 -5.440 1.000   1.00 0.00 ? 27 ARG A CD   17 
ATOM 6416 N NE   . ARG A 1 27 ? -15.385 -5.452 -0.226  1.00 0.00 ? 27 ARG A NE   17 
ATOM 6417 C CZ   . ARG A 1 27 ? -16.249 -6.407 -0.595  1.00 0.00 ? 27 ARG A CZ   17 
ATOM 6418 N NH1  . ARG A 1 27 ? -15.893 -7.684 -0.655  1.00 0.00 ? 27 ARG A NH1  17 
ATOM 6419 N NH2  . ARG A 1 27 ? -17.250 -6.054 -1.386  1.00 0.00 ? 27 ARG A NH2  17 
ATOM 6420 H H    . ARG A 1 27 ? -12.032 -2.241 -0.738  1.00 0.00 ? 27 ARG A H    17 
ATOM 6421 H HE   . ARG A 1 27 ? -15.092 -4.819 -0.931  1.00 0.00 ? 27 ARG A HE   17 
ATOM 6422 H HH11 . ARG A 1 27 ? -14.963 -7.956 -0.400  1.00 0.00 ? 27 ARG A HH11 17 
ATOM 6423 H HH12 . ARG A 1 27 ? -16.553 -8.364 -0.967  1.00 0.00 ? 27 ARG A HH12 17 
ATOM 6424 H HH21 . ARG A 1 27 ? -17.451 -5.077 -1.506  1.00 0.00 ? 27 ARG A HH21 17 
ATOM 6425 H HH22 . ARG A 1 27 ? -17.884 -6.736 -1.723  1.00 0.00 ? 27 ARG A HH22 17 
ATOM 6426 N N    . LEU A 1 28 ? -14.290 0.042  0.616   1.00 0.00 ? 28 LEU A N    17 
ATOM 6427 C CA   . LEU A 1 28 ? -14.874 1.356  0.953   1.00 0.00 ? 28 LEU A CA   17 
ATOM 6428 C C    . LEU A 1 28 ? -15.682 1.985  -0.204  1.00 0.00 ? 28 LEU A C    17 
ATOM 6429 O O    . LEU A 1 28 ? -16.858 2.291  -0.050  1.00 0.00 ? 28 LEU A O    17 
ATOM 6430 C CB   . LEU A 1 28 ? -13.730 2.269  1.459   1.00 0.00 ? 28 LEU A CB   17 
ATOM 6431 C CG   . LEU A 1 28 ? -13.956 3.778  1.317   1.00 0.00 ? 28 LEU A CG   17 
ATOM 6432 C CD1  . LEU A 1 28 ? -15.063 4.282  2.248   1.00 0.00 ? 28 LEU A CD1  17 
ATOM 6433 C CD2  . LEU A 1 28 ? -12.657 4.544  1.592   1.00 0.00 ? 28 LEU A CD2  17 
ATOM 6434 H H    . LEU A 1 28 ? -13.279 0.026  0.645   1.00 0.00 ? 28 LEU A H    17 
ATOM 6435 N N    . LYS A 1 29 ? -15.029 2.229  -1.336  1.00 0.00 ? 29 LYS A N    17 
ATOM 6436 C CA   . LYS A 1 29 ? -15.700 2.793  -2.530  1.00 0.00 ? 29 LYS A CA   17 
ATOM 6437 C C    . LYS A 1 29 ? -16.798 1.871  -3.100  1.00 0.00 ? 29 LYS A C    17 
ATOM 6438 O O    . LYS A 1 29 ? -17.838 2.361  -3.533  1.00 0.00 ? 29 LYS A O    17 
ATOM 6439 C CB   . LYS A 1 29 ? -14.696 3.225  -3.593  1.00 0.00 ? 29 LYS A CB   17 
ATOM 6440 C CG   . LYS A 1 29 ? -13.949 4.476  -3.122  1.00 0.00 ? 29 LYS A CG   17 
ATOM 6441 C CD   . LYS A 1 29 ? -13.044 5.009  -4.236  1.00 0.00 ? 29 LYS A CD   17 
ATOM 6442 C CE   . LYS A 1 29 ? -12.293 6.259  -3.787  1.00 0.00 ? 29 LYS A CE   17 
ATOM 6443 N NZ   . LYS A 1 29 ? -11.538 6.808  -4.925  1.00 0.00 ? 29 LYS A NZ   17 
ATOM 6444 H H    . LYS A 1 29 ? -14.031 2.098  -1.438  1.00 0.00 ? 29 LYS A H    17 
ATOM 6445 H HZ1  . LYS A 1 29 ? -10.955 6.105  -5.326  1.00 0.00 ? 29 LYS A HZ1  17 
ATOM 6446 H HZ2  . LYS A 1 29 ? -12.183 7.156  -5.610  1.00 0.00 ? 29 LYS A HZ2  17 
ATOM 6447 H HZ3  . LYS A 1 29 ? -10.967 7.570  -4.607  1.00 0.00 ? 29 LYS A HZ3  17 
ATOM 6448 N N    . LYS A 1 30 ? -16.656 0.565  -2.837  1.00 0.00 ? 30 LYS A N    17 
ATOM 6449 C CA   . LYS A 1 30 ? -17.717 -0.439 -3.086  1.00 0.00 ? 30 LYS A CA   17 
ATOM 6450 C C    . LYS A 1 30 ? -18.964 -0.224 -2.212  1.00 0.00 ? 30 LYS A C    17 
ATOM 6451 O O    . LYS A 1 30 ? -20.054 -0.677 -2.561  1.00 0.00 ? 30 LYS A O    17 
ATOM 6452 C CB   . LYS A 1 30 ? -17.185 -1.867 -2.915  1.00 0.00 ? 30 LYS A CB   17 
ATOM 6453 C CG   . LYS A 1 30 ? -16.572 -2.508 -4.169  1.00 0.00 ? 30 LYS A CG   17 
ATOM 6454 C CD   . LYS A 1 30 ? -15.108 -2.143 -4.455  1.00 0.00 ? 30 LYS A CD   17 
ATOM 6455 C CE   . LYS A 1 30 ? -14.931 -0.995 -5.459  1.00 0.00 ? 30 LYS A CE   17 
ATOM 6456 N NZ   . LYS A 1 30 ? -13.629 -0.358 -5.246  1.00 0.00 ? 30 LYS A NZ   17 
ATOM 6457 H H    . LYS A 1 30 ? -15.802 0.205  -2.445  1.00 0.00 ? 30 LYS A H    17 
ATOM 6458 H HZ1  . LYS A 1 30 ? -12.903 -1.046 -5.323  1.00 0.00 ? 30 LYS A HZ1  17 
ATOM 6459 H HZ2  . LYS A 1 30 ? -13.483 0.361  -5.917  1.00 0.00 ? 30 LYS A HZ2  17 
ATOM 6460 H HZ3  . LYS A 1 30 ? -13.606 0.040  -4.327  1.00 0.00 ? 30 LYS A HZ3  17 
ATOM 6461 N N    . LEU A 1 31 ? -18.798 0.515  -1.123  1.00 0.00 ? 31 LEU A N    17 
ATOM 6462 C CA   . LEU A 1 31 ? -19.891 0.926  -0.224  1.00 0.00 ? 31 LEU A CA   17 
ATOM 6463 C C    . LEU A 1 31 ? -20.563 2.247  -0.653  1.00 0.00 ? 31 LEU A C    17 
ATOM 6464 O O    . LEU A 1 31 ? -21.784 2.324  -0.777  1.00 0.00 ? 31 LEU A O    17 
ATOM 6465 C CB   . LEU A 1 31 ? -19.409 1.022  1.231   1.00 0.00 ? 31 LEU A CB   17 
ATOM 6466 C CG   . LEU A 1 31 ? -18.731 -0.273 1.717   1.00 0.00 ? 31 LEU A CG   17 
ATOM 6467 C CD1  . LEU A 1 31 ? -17.887 0.029  2.951   1.00 0.00 ? 31 LEU A CD1  17 
ATOM 6468 C CD2  . LEU A 1 31 ? -19.730 -1.387 2.060   1.00 0.00 ? 31 LEU A CD2  17 
ATOM 6469 H H    . LEU A 1 31 ? -17.887 0.821  -0.841  1.00 0.00 ? 31 LEU A H    17 
ATOM 6470 N N    . VAL A 1 32 ? -19.712 3.193  -1.057  1.00 0.00 ? 32 VAL A N    17 
ATOM 6471 C CA   . VAL A 1 32 ? -20.113 4.510  -1.596  1.00 0.00 ? 32 VAL A CA   17 
ATOM 6472 C C    . VAL A 1 32 ? -20.817 4.432  -2.980  1.00 0.00 ? 32 VAL A C    17 
ATOM 6473 O O    . VAL A 1 32 ? -21.550 5.335  -3.362  1.00 0.00 ? 32 VAL A O    17 
ATOM 6474 C CB   . VAL A 1 32 ? -18.876 5.441  -1.563  1.00 0.00 ? 32 VAL A CB   17 
ATOM 6475 C CG1  . VAL A 1 32 ? -18.996 6.755  -2.348  1.00 0.00 ? 32 VAL A CG1  17 
ATOM 6476 C CG2  . VAL A 1 32 ? -18.558 5.806  -0.108  1.00 0.00 ? 32 VAL A CG2  17 
ATOM 6477 H H    . VAL A 1 32 ? -18.726 3.054  -1.010  1.00 0.00 ? 32 VAL A H    17 
ATOM 6478 N N    . GLY A 1 33 ? -20.691 3.266  -3.619  1.00 0.00 ? 33 GLY A N    17 
ATOM 6479 C CA   . GLY A 1 33 ? -21.290 2.971  -4.941  1.00 0.00 ? 33 GLY A CA   17 
ATOM 6480 C C    . GLY A 1 33 ? -22.080 1.657  -4.915  1.00 0.00 ? 33 GLY A C    17 
ATOM 6481 O O    . GLY A 1 33 ? -21.776 0.758  -5.704  1.00 0.00 ? 33 GLY A O    17 
ATOM 6482 H H    . GLY A 1 33 ? -20.157 2.517  -3.226  1.00 0.00 ? 33 GLY A H    17 
ATOM 6483 N N    . GLU A 1 34 ? -23.008 1.577  -3.944  1.00 0.00 ? 34 GLU A N    17 
ATOM 6484 C CA   . GLU A 1 34 ? -23.980 0.489  -3.685  1.00 0.00 ? 34 GLU A CA   17 
ATOM 6485 C C    . GLU A 1 34 ? -23.426 -0.557 -2.678  1.00 0.00 ? 34 GLU A C    17 
ATOM 6486 O O    . GLU A 1 34 ? -22.998 -1.654 -3.034  1.00 0.00 ? 34 GLU A O    17 
ATOM 6487 C CB   . GLU A 1 34 ? -24.496 -0.181 -4.977  1.00 0.00 ? 34 GLU A CB   17 
ATOM 6488 C CG   . GLU A 1 34 ? -25.850 -0.902 -4.878  1.00 0.00 ? 34 GLU A CG   17 
ATOM 6489 C CD   . GLU A 1 34 ? -25.898 -1.969 -3.789  1.00 0.00 ? 34 GLU A CD   17 
ATOM 6490 O OE1  . GLU A 1 34 ? -26.384 -1.738 -2.693  1.00 0.00 ? 34 GLU A OE1  17 
ATOM 6491 O OE2  . GLU A 1 34 ? -25.440 -3.199 -4.096  1.00 0.00 ? 34 GLU A OE2  17 
ATOM 6492 H H    . GLU A 1 34 ? -23.036 2.312  -3.278  1.00 0.00 ? 34 GLU A H    17 
ATOM 6493 H HE2  . GLU A 1 34 ? -25.436 -3.668 -3.211  1.00 0.00 ? 34 GLU A HE2  17 
ATOM 6494 N N    . ARG A 1 35 ? -23.551 -0.215 -1.395  1.00 0.00 ? 35 ARG A N    17 
ATOM 6495 C CA   . ARG A 1 35 ? -23.143 -1.121 -0.288  1.00 0.00 ? 35 ARG A CA   17 
ATOM 6496 C C    . ARG A 1 35 ? -24.008 -2.371 -0.038  1.00 0.00 ? 35 ARG A C    17 
ATOM 6497 O O    . ARG A 1 35 ? -23.460 -3.327 0.549   1.00 0.00 ? 35 ARG A O    17 
ATOM 6498 C CB   . ARG A 1 35 ? -22.935 -0.309 1.005   1.00 0.00 ? 35 ARG A CB   17 
ATOM 6499 C CG   . ARG A 1 35 ? -24.148 0.071  1.854   1.00 0.00 ? 35 ARG A CG   17 
ATOM 6500 C CD   . ARG A 1 35 ? -23.832 1.415  2.522   1.00 0.00 ? 35 ARG A CD   17 
ATOM 6501 N NE   . ARG A 1 35 ? -24.341 2.441  1.593   1.00 0.00 ? 35 ARG A NE   17 
ATOM 6502 C CZ   . ARG A 1 35 ? -24.601 3.709  1.876   1.00 0.00 ? 35 ARG A CZ   17 
ATOM 6503 N NH1  . ARG A 1 35 ? -23.958 4.380  2.824   1.00 0.00 ? 35 ARG A NH1  17 
ATOM 6504 N NH2  . ARG A 1 35 ? -25.824 4.133  1.597   1.00 0.00 ? 35 ARG A NH2  17 
ATOM 6505 O OXT  . ARG A 1 35 ? -25.225 -2.301 -0.316  1.00 0.00 ? 35 ARG A OXT  17 
ATOM 6506 H H    . ARG A 1 35 ? -23.703 0.735  -1.125  1.00 0.00 ? 35 ARG A H    17 
ATOM 6507 H HE   . ARG A 1 35 ? -24.303 2.196  0.628   1.00 0.00 ? 35 ARG A HE   17 
ATOM 6508 H HH11 . ARG A 1 35 ? -23.131 3.986  3.214   1.00 0.00 ? 35 ARG A HH11 17 
ATOM 6509 H HH12 . ARG A 1 35 ? -24.232 5.311  3.048   1.00 0.00 ? 35 ARG A HH12 17 
ATOM 6510 H HH21 . ARG A 1 35 ? -26.484 3.481  1.227   1.00 0.00 ? 35 ARG A HH21 17 
ATOM 6511 H HH22 . ARG A 1 35 ? -26.105 5.069  1.806   1.00 0.00 ? 35 ARG A HH22 17 
ATOM 6512 N N    . LEU A 1 1  ? 23.375  -0.660 4.810   1.00 0.00 ? 1  LEU A N    18 
ATOM 6513 C CA   . LEU A 1 1  ? 24.502  0.123  4.248   1.00 0.00 ? 1  LEU A CA   18 
ATOM 6514 C C    . LEU A 1 1  ? 24.129  1.237  3.238   1.00 0.00 ? 1  LEU A C    18 
ATOM 6515 O O    . LEU A 1 1  ? 24.919  1.659  2.389   1.00 0.00 ? 1  LEU A O    18 
ATOM 6516 C CB   . LEU A 1 1  ? 25.567  -0.846 3.683   1.00 0.00 ? 1  LEU A CB   18 
ATOM 6517 C CG   . LEU A 1 1  ? 25.138  -1.552 2.393   1.00 0.00 ? 1  LEU A CG   18 
ATOM 6518 C CD1  . LEU A 1 1  ? 26.058  -1.158 1.239   1.00 0.00 ? 1  LEU A CD1  18 
ATOM 6519 C CD2  . LEU A 1 1  ? 25.138  -3.077 2.580   1.00 0.00 ? 1  LEU A CD2  18 
ATOM 6520 H H1   . LEU A 1 1  ? 22.873  -1.114 4.060   1.00 0.00 ? 1  LEU A H1   18 
ATOM 6521 H H2   . LEU A 1 1  ? 23.741  -1.370 5.406   1.00 0.00 ? 1  LEU A H2   18 
ATOM 6522 H H3   . LEU A 1 1  ? 22.758  -0.097 5.345   1.00 0.00 ? 1  LEU A H3   18 
ATOM 6523 N N    . GLN A 1 2  ? 22.924  1.778  3.445   1.00 0.00 ? 2  GLN A N    18 
ATOM 6524 C CA   . GLN A 1 2  ? 22.300  2.833  2.605   1.00 0.00 ? 2  GLN A CA   18 
ATOM 6525 C C    . GLN A 1 2  ? 22.059  2.264  1.193   1.00 0.00 ? 2  GLN A C    18 
ATOM 6526 O O    . GLN A 1 2  ? 21.950  1.047  1.030   1.00 0.00 ? 2  GLN A O    18 
ATOM 6527 C CB   . GLN A 1 2  ? 23.130  4.129  2.580   1.00 0.00 ? 2  GLN A CB   18 
ATOM 6528 C CG   . GLN A 1 2  ? 23.729  4.564  3.935   1.00 0.00 ? 2  GLN A CG   18 
ATOM 6529 C CD   . GLN A 1 2  ? 22.678  4.853  5.001   1.00 0.00 ? 2  GLN A CD   18 
ATOM 6530 O OE1  . GLN A 1 2  ? 22.157  5.953  5.114   1.00 0.00 ? 2  GLN A OE1  18 
ATOM 6531 N NE2  . GLN A 1 2  ? 22.326  3.866  5.803   1.00 0.00 ? 2  GLN A NE2  18 
ATOM 6532 H H    . GLN A 1 2  ? 22.329  1.369  4.131   1.00 0.00 ? 2  GLN A H    18 
ATOM 6533 H HE21 . GLN A 1 2  ? 22.887  3.038  5.866   1.00 0.00 ? 2  GLN A HE21 18 
ATOM 6534 H HE22 . GLN A 1 2  ? 21.620  4.059  6.475   1.00 0.00 ? 2  GLN A HE22 18 
ATOM 6535 N N    . ARG A 1 3  ? 21.763  3.121  0.201   1.00 0.00 ? 3  ARG A N    18 
ATOM 6536 C CA   . ARG A 1 3  ? 21.609  2.688  -1.224  1.00 0.00 ? 3  ARG A CA   18 
ATOM 6537 C C    . ARG A 1 3  ? 20.433  1.707  -1.345  1.00 0.00 ? 3  ARG A C    18 
ATOM 6538 O O    . ARG A 1 3  ? 19.517  1.806  -0.541  1.00 0.00 ? 3  ARG A O    18 
ATOM 6539 C CB   . ARG A 1 3  ? 22.915  2.068  -1.758  1.00 0.00 ? 3  ARG A CB   18 
ATOM 6540 C CG   . ARG A 1 3  ? 24.179  2.927  -1.609  1.00 0.00 ? 3  ARG A CG   18 
ATOM 6541 C CD   . ARG A 1 3  ? 24.037  4.280  -2.315  1.00 0.00 ? 3  ARG A CD   18 
ATOM 6542 N NE   . ARG A 1 3  ? 23.751  5.308  -1.309  1.00 0.00 ? 3  ARG A NE   18 
ATOM 6543 C CZ   . ARG A 1 3  ? 23.855  6.626  -1.519  1.00 0.00 ? 3  ARG A CZ   18 
ATOM 6544 N NH1  . ARG A 1 3  ? 23.585  7.133  -2.705  1.00 0.00 ? 3  ARG A NH1  18 
ATOM 6545 N NH2  . ARG A 1 3  ? 23.891  7.453  -0.490  1.00 0.00 ? 3  ARG A NH2  18 
ATOM 6546 H H    . ARG A 1 3  ? 21.452  4.046  0.401   1.00 0.00 ? 3  ARG A H    18 
ATOM 6547 H HE   . ARG A 1 3  ? 23.310  5.007  -0.470  1.00 0.00 ? 3  ARG A HE   18 
ATOM 6548 H HH11 . ARG A 1 3  ? 23.280  6.530  -3.445  1.00 0.00 ? 3  ARG A HH11 18 
ATOM 6549 H HH12 . ARG A 1 3  ? 23.683  8.120  -2.876  1.00 0.00 ? 3  ARG A HH12 18 
ATOM 6550 H HH21 . ARG A 1 3  ? 23.964  7.104  0.448   1.00 0.00 ? 3  ARG A HH21 18 
ATOM 6551 H HH22 . ARG A 1 3  ? 23.951  8.440  -0.661  1.00 0.00 ? 3  ARG A HH22 18 
ATOM 6552 N N    . MET A 1 4  ? 20.487  0.748  -2.268  1.00 0.00 ? 4  MET A N    18 
ATOM 6553 C CA   . MET A 1 4  ? 19.484  -0.327 -2.383  1.00 0.00 ? 4  MET A CA   18 
ATOM 6554 C C    . MET A 1 4  ? 19.112  -0.993 -1.052  1.00 0.00 ? 4  MET A C    18 
ATOM 6555 O O    . MET A 1 4  ? 17.936  -0.998 -0.742  1.00 0.00 ? 4  MET A O    18 
ATOM 6556 C CB   . MET A 1 4  ? 19.911  -1.374 -3.410  1.00 0.00 ? 4  MET A CB   18 
ATOM 6557 C CG   . MET A 1 4  ? 18.851  -1.527 -4.512  1.00 0.00 ? 4  MET A CG   18 
ATOM 6558 S SD   . MET A 1 4  ? 19.060  -0.458 -5.991  1.00 0.00 ? 4  MET A SD   18 
ATOM 6559 C CE   . MET A 1 4  ? 18.654  1.175  -5.404  1.00 0.00 ? 4  MET A CE   18 
ATOM 6560 H H    . MET A 1 4  ? 21.169  0.775  -3.001  1.00 0.00 ? 4  MET A H    18 
ATOM 6561 N N    . LYS A 1 5  ? 20.073  -1.065 -0.139  1.00 0.00 ? 5  LYS A N    18 
ATOM 6562 C CA   . LYS A 1 5  ? 19.846  -1.619 1.219   1.00 0.00 ? 5  LYS A CA   18 
ATOM 6563 C C    . LYS A 1 5  ? 18.807  -0.809 2.044   1.00 0.00 ? 5  LYS A C    18 
ATOM 6564 O O    . LYS A 1 5  ? 18.174  -1.356 2.932   1.00 0.00 ? 5  LYS A O    18 
ATOM 6565 C CB   . LYS A 1 5  ? 21.162  -1.709 1.976   1.00 0.00 ? 5  LYS A CB   18 
ATOM 6566 C CG   . LYS A 1 5  ? 21.104  -2.795 3.046   1.00 0.00 ? 5  LYS A CG   18 
ATOM 6567 C CD   . LYS A 1 5  ? 21.270  -4.164 2.396   1.00 0.00 ? 5  LYS A CD   18 
ATOM 6568 C CE   . LYS A 1 5  ? 20.448  -5.216 3.129   1.00 0.00 ? 5  LYS A CE   18 
ATOM 6569 N NZ   . LYS A 1 5  ? 20.910  -6.543 2.716   1.00 0.00 ? 5  LYS A NZ   18 
ATOM 6570 H H    . LYS A 1 5  ? 20.967  -0.646 -0.292  1.00 0.00 ? 5  LYS A H    18 
ATOM 6571 H HZ1  . LYS A 1 5  ? 20.966  -6.609 1.725   1.00 0.00 ? 5  LYS A HZ1  18 
ATOM 6572 H HZ2  . LYS A 1 5  ? 21.816  -6.700 3.118   1.00 0.00 ? 5  LYS A HZ2  18 
ATOM 6573 H HZ3  . LYS A 1 5  ? 20.277  -7.235 3.077   1.00 0.00 ? 5  LYS A HZ3  18 
ATOM 6574 N N    . GLN A 1 6  ? 18.733  0.494  1.809   1.00 0.00 ? 6  GLN A N    18 
ATOM 6575 C CA   . GLN A 1 6  ? 17.688  1.370  2.377   1.00 0.00 ? 6  GLN A CA   18 
ATOM 6576 C C    . GLN A 1 6  ? 16.552  1.722  1.399   1.00 0.00 ? 6  GLN A C    18 
ATOM 6577 O O    . GLN A 1 6  ? 15.378  1.730  1.759   1.00 0.00 ? 6  GLN A O    18 
ATOM 6578 C CB   . GLN A 1 6  ? 18.243  2.666  2.967   1.00 0.00 ? 6  GLN A CB   18 
ATOM 6579 C CG   . GLN A 1 6  ? 18.439  2.537  4.474   1.00 0.00 ? 6  GLN A CG   18 
ATOM 6580 C CD   . GLN A 1 6  ? 18.473  3.936  5.106   1.00 0.00 ? 6  GLN A CD   18 
ATOM 6581 O OE1  . GLN A 1 6  ? 17.511  4.439  5.659   1.00 0.00 ? 6  GLN A OE1  18 
ATOM 6582 N NE2  . GLN A 1 6  ? 19.594  4.589  5.022   1.00 0.00 ? 6  GLN A NE2  18 
ATOM 6583 H H    . GLN A 1 6  ? 19.368  0.939  1.177   1.00 0.00 ? 6  GLN A H    18 
ATOM 6584 H HE21 . GLN A 1 6  ? 20.431  4.220  4.622   1.00 0.00 ? 6  GLN A HE21 18 
ATOM 6585 H HE22 . GLN A 1 6  ? 19.600  5.522  5.406   1.00 0.00 ? 6  GLN A HE22 18 
ATOM 6586 N N    . LEU A 1 7  ? 16.920  1.916  0.145   1.00 0.00 ? 7  LEU A N    18 
ATOM 6587 C CA   . LEU A 1 7  ? 15.958  2.187  -0.948  1.00 0.00 ? 7  LEU A CA   18 
ATOM 6588 C C    . LEU A 1 7  ? 14.974  1.018  -1.146  1.00 0.00 ? 7  LEU A C    18 
ATOM 6589 O O    . LEU A 1 7  ? 13.796  1.279  -1.341  1.00 0.00 ? 7  LEU A O    18 
ATOM 6590 C CB   . LEU A 1 7  ? 16.660  2.552  -2.261  1.00 0.00 ? 7  LEU A CB   18 
ATOM 6591 C CG   . LEU A 1 7  ? 17.550  3.792  -2.090  1.00 0.00 ? 7  LEU A CG   18 
ATOM 6592 C CD1  . LEU A 1 7  ? 18.412  4.020  -3.319  1.00 0.00 ? 7  LEU A CD1  18 
ATOM 6593 C CD2  . LEU A 1 7  ? 16.735  5.065  -1.808  1.00 0.00 ? 7  LEU A CD2  18 
ATOM 6594 H H    . LEU A 1 7  ? 17.880  1.918  -0.147  1.00 0.00 ? 7  LEU A H    18 
ATOM 6595 N N    . GLU A 1 8  ? 15.394  -0.213 -0.856  1.00 0.00 ? 8  GLU A N    18 
ATOM 6596 C CA   . GLU A 1 8  ? 14.514  -1.400 -0.849  1.00 0.00 ? 8  GLU A CA   18 
ATOM 6597 C C    . GLU A 1 8  ? 13.393  -1.295 0.203   1.00 0.00 ? 8  GLU A C    18 
ATOM 6598 O O    . GLU A 1 8  ? 12.246  -1.474 -0.157  1.00 0.00 ? 8  GLU A O    18 
ATOM 6599 C CB   . GLU A 1 8  ? 15.288  -2.695 -0.640  1.00 0.00 ? 8  GLU A CB   18 
ATOM 6600 C CG   . GLU A 1 8  ? 16.021  -3.121 -1.928  1.00 0.00 ? 8  GLU A CG   18 
ATOM 6601 C CD   . GLU A 1 8  ? 17.161  -4.109 -1.688  1.00 0.00 ? 8  GLU A CD   18 
ATOM 6602 O OE1  . GLU A 1 8  ? 17.576  -4.846 -2.572  1.00 0.00 ? 8  GLU A OE1  18 
ATOM 6603 O OE2  . GLU A 1 8  ? 17.823  -4.047 -0.502  1.00 0.00 ? 8  GLU A OE2  18 
ATOM 6604 H H    . GLU A 1 8  ? 16.371  -0.410 -0.684  1.00 0.00 ? 8  GLU A H    18 
ATOM 6605 H HE2  . GLU A 1 8  ? 18.498  -4.771 -0.573  1.00 0.00 ? 8  GLU A HE2  18 
ATOM 6606 N N    . ASP A 1 9  ? 13.717  -0.784 1.385   1.00 0.00 ? 9  ASP A N    18 
ATOM 6607 C CA   . ASP A 1 9  ? 12.722  -0.519 2.460   1.00 0.00 ? 9  ASP A CA   18 
ATOM 6608 C C    . ASP A 1 9  ? 11.841  0.722  2.190   1.00 0.00 ? 9  ASP A C    18 
ATOM 6609 O O    . ASP A 1 9  ? 10.694  0.735  2.616   1.00 0.00 ? 9  ASP A O    18 
ATOM 6610 C CB   . ASP A 1 9  ? 13.313  -0.476 3.877   1.00 0.00 ? 9  ASP A CB   18 
ATOM 6611 C CG   . ASP A 1 9  ? 14.793  -0.106 3.981   1.00 0.00 ? 9  ASP A CG   18 
ATOM 6612 O OD1  . ASP A 1 9  ? 15.203  0.878  4.577   1.00 0.00 ? 9  ASP A OD1  18 
ATOM 6613 O OD2  . ASP A 1 9  ? 15.618  -0.929 3.304   1.00 0.00 ? 9  ASP A OD2  18 
ATOM 6614 H H    . ASP A 1 9  ? 14.665  -0.598 1.648   1.00 0.00 ? 9  ASP A H    18 
ATOM 6615 H HD2  . ASP A 1 9  ? 16.565  -0.651 3.494   1.00 0.00 ? 9  ASP A HD2  18 
ATOM 6616 N N    . LYS A 1 10 ? 12.361  1.670  1.427   1.00 0.00 ? 10 LYS A N    18 
ATOM 6617 C CA   . LYS A 1 10 ? 11.603  2.856  0.968   1.00 0.00 ? 10 LYS A CA   18 
ATOM 6618 C C    . LYS A 1 10 ? 10.671  2.522  -0.234  1.00 0.00 ? 10 LYS A C    18 
ATOM 6619 O O    . LYS A 1 10 ? 9.478   2.799  -0.192  1.00 0.00 ? 10 LYS A O    18 
ATOM 6620 C CB   . LYS A 1 10 ? 12.602  3.973  0.658   1.00 0.00 ? 10 LYS A CB   18 
ATOM 6621 C CG   . LYS A 1 10 ? 11.920  5.241  0.146   1.00 0.00 ? 10 LYS A CG   18 
ATOM 6622 C CD   . LYS A 1 10 ? 12.928  6.363  -0.083  1.00 0.00 ? 10 LYS A CD   18 
ATOM 6623 C CE   . LYS A 1 10 ? 12.363  7.407  -1.058  1.00 0.00 ? 10 LYS A CE   18 
ATOM 6624 N NZ   . LYS A 1 10 ? 12.305  6.811  -2.406  1.00 0.00 ? 10 LYS A NZ   18 
ATOM 6625 H H    . LYS A 1 10 ? 13.336  1.669  1.195   1.00 0.00 ? 10 LYS A H    18 
ATOM 6626 H HZ1  . LYS A 1 10 ? 13.211  6.521  -2.685  1.00 0.00 ? 10 LYS A HZ1  18 
ATOM 6627 H HZ2  . LYS A 1 10 ? 11.674  6.024  -2.391  1.00 0.00 ? 10 LYS A HZ2  18 
ATOM 6628 H HZ3  . LYS A 1 10 ? 11.964  7.489  -3.047  1.00 0.00 ? 10 LYS A HZ3  18 
ATOM 6629 N N    . VAL A 1 11 ? 11.227  1.860  -1.233  1.00 0.00 ? 11 VAL A N    18 
ATOM 6630 C CA   . VAL A 1 11 ? 10.528  1.411  -2.466  1.00 0.00 ? 11 VAL A CA   18 
ATOM 6631 C C    . VAL A 1 11 ? 9.526   0.280  -2.184  1.00 0.00 ? 11 VAL A C    18 
ATOM 6632 O O    . VAL A 1 11 ? 8.370   0.377  -2.577  1.00 0.00 ? 11 VAL A O    18 
ATOM 6633 C CB   . VAL A 1 11 ? 11.558  1.051  -3.564  1.00 0.00 ? 11 VAL A CB   18 
ATOM 6634 C CG1  . VAL A 1 11 ? 10.963  0.337  -4.788  1.00 0.00 ? 11 VAL A CG1  18 
ATOM 6635 C CG2  . VAL A 1 11 ? 12.252  2.319  -4.064  1.00 0.00 ? 11 VAL A CG2  18 
ATOM 6636 H H    . VAL A 1 11 ? 12.227  1.676  -1.243  1.00 0.00 ? 11 VAL A H    18 
ATOM 6637 N N    . GLU A 1 12 ? 9.965   -0.772 -1.498  1.00 0.00 ? 12 GLU A N    18 
ATOM 6638 C CA   . GLU A 1 12 ? 9.050   -1.872 -1.090  1.00 0.00 ? 12 GLU A CA   18 
ATOM 6639 C C    . GLU A 1 12 ? 7.941   -1.315 -0.178  1.00 0.00 ? 12 GLU A C    18 
ATOM 6640 O O    . GLU A 1 12 ? 6.788   -1.649 -0.429  1.00 0.00 ? 12 GLU A O    18 
ATOM 6641 C CB   . GLU A 1 12 ? 9.793   -3.007 -0.400  1.00 0.00 ? 12 GLU A CB   18 
ATOM 6642 C CG   . GLU A 1 12 ? 8.929   -4.240 -0.088  1.00 0.00 ? 12 GLU A CG   18 
ATOM 6643 C CD   . GLU A 1 12 ? 9.634   -5.080 0.971   1.00 0.00 ? 12 GLU A CD   18 
ATOM 6644 O OE1  . GLU A 1 12 ? 10.231  -6.123 0.713   1.00 0.00 ? 12 GLU A OE1  18 
ATOM 6645 O OE2  . GLU A 1 12 ? 9.591   -4.594 2.224   1.00 0.00 ? 12 GLU A OE2  18 
ATOM 6646 H H    . GLU A 1 12 ? 10.918  -0.900 -1.204  1.00 0.00 ? 12 GLU A H    18 
ATOM 6647 H HE2  . GLU A 1 12 ? 10.128  -5.246 2.752   1.00 0.00 ? 12 GLU A HE2  18 
ATOM 6648 N N    . GLU A 1 13 ? 8.266   -0.312 0.645   1.00 0.00 ? 13 GLU A N    18 
ATOM 6649 C CA   . GLU A 1 13 ? 7.260   0.413  1.456   1.00 0.00 ? 13 GLU A CA   18 
ATOM 6650 C C    . GLU A 1 13 ? 6.127   0.944  0.558   1.00 0.00 ? 13 GLU A C    18 
ATOM 6651 O O    . GLU A 1 13 ? 4.982   0.664  0.872   1.00 0.00 ? 13 GLU A O    18 
ATOM 6652 C CB   . GLU A 1 13 ? 7.851   1.591  2.241   1.00 0.00 ? 13 GLU A CB   18 
ATOM 6653 C CG   . GLU A 1 13 ? 6.855   2.218  3.219   1.00 0.00 ? 13 GLU A CG   18 
ATOM 6654 C CD   . GLU A 1 13 ? 7.479   3.404  3.949   1.00 0.00 ? 13 GLU A CD   18 
ATOM 6655 O OE1  . GLU A 1 13 ? 7.170   4.574  3.711   1.00 0.00 ? 13 GLU A OE1  18 
ATOM 6656 O OE2  . GLU A 1 13 ? 8.367   3.122  4.918   1.00 0.00 ? 13 GLU A OE2  18 
ATOM 6657 H H    . GLU A 1 13 ? 9.204   0.007  0.787   1.00 0.00 ? 13 GLU A H    18 
ATOM 6658 H HE2  . GLU A 1 13 ? 8.642   4.010  5.256   1.00 0.00 ? 13 GLU A HE2  18 
ATOM 6659 N N    . LEU A 1 14 ? 6.450   1.416  -0.643  1.00 0.00 ? 14 LEU A N    18 
ATOM 6660 C CA   . LEU A 1 14 ? 5.455   1.984  -1.572  1.00 0.00 ? 14 LEU A CA   18 
ATOM 6661 C C    . LEU A 1 14 ? 4.440   0.912  -2.015  1.00 0.00 ? 14 LEU A C    18 
ATOM 6662 O O    . LEU A 1 14 ? 3.263   1.035  -1.699  1.00 0.00 ? 14 LEU A O    18 
ATOM 6663 C CB   . LEU A 1 14 ? 6.078   2.606  -2.826  1.00 0.00 ? 14 LEU A CB   18 
ATOM 6664 C CG   . LEU A 1 14 ? 7.204   3.605  -2.543  1.00 0.00 ? 14 LEU A CG   18 
ATOM 6665 C CD1  . LEU A 1 14 ? 7.716   4.145  -3.872  1.00 0.00 ? 14 LEU A CD1  18 
ATOM 6666 C CD2  . LEU A 1 14 ? 6.799   4.747  -1.618  1.00 0.00 ? 14 LEU A CD2  18 
ATOM 6667 H H    . LEU A 1 14 ? 7.368   1.297  -1.025  1.00 0.00 ? 14 LEU A H    18 
ATOM 6668 N N    . LEU A 1 15 ? 4.927   -0.155 -2.629  1.00 0.00 ? 15 LEU A N    18 
ATOM 6669 C CA   . LEU A 1 15 ? 4.084   -1.274 -3.087  1.00 0.00 ? 15 LEU A CA   18 
ATOM 6670 C C    . LEU A 1 15 ? 3.330   -1.918 -1.903  1.00 0.00 ? 15 LEU A C    18 
ATOM 6671 O O    . LEU A 1 15 ? 2.109   -1.870 -1.900  1.00 0.00 ? 15 LEU A O    18 
ATOM 6672 C CB   . LEU A 1 15 ? 4.890   -2.345 -3.836  1.00 0.00 ? 15 LEU A CB   18 
ATOM 6673 C CG   . LEU A 1 15 ? 5.878   -1.791 -4.874  1.00 0.00 ? 15 LEU A CG   18 
ATOM 6674 C CD1  . LEU A 1 15 ? 6.465   -2.962 -5.659  1.00 0.00 ? 15 LEU A CD1  18 
ATOM 6675 C CD2  . LEU A 1 15 ? 5.275   -0.771 -5.853  1.00 0.00 ? 15 LEU A CD2  18 
ATOM 6676 H H    . LEU A 1 15 ? 5.889   -0.199 -2.923  1.00 0.00 ? 15 LEU A H    18 
ATOM 6677 N N    . SER A 1 16 ? 4.052   -2.277 -0.853  1.00 0.00 ? 16 SER A N    18 
ATOM 6678 C CA   . SER A 1 16 ? 3.492   -2.813 0.406   1.00 0.00 ? 16 SER A CA   18 
ATOM 6679 C C    . SER A 1 16 ? 2.407   -1.903 1.043   1.00 0.00 ? 16 SER A C    18 
ATOM 6680 O O    . SER A 1 16 ? 1.414   -2.405 1.557   1.00 0.00 ? 16 SER A O    18 
ATOM 6681 C CB   . SER A 1 16 ? 4.604   -3.074 1.426   1.00 0.00 ? 16 SER A CB   18 
ATOM 6682 O OG   . SER A 1 16 ? 5.577   -3.970 0.865   1.00 0.00 ? 16 SER A OG   18 
ATOM 6683 H H    . SER A 1 16 ? 5.063   -2.255 -0.866  1.00 0.00 ? 16 SER A H    18 
ATOM 6684 H HG   . SER A 1 16 ? 6.379   -4.002 1.457   1.00 0.00 ? 16 SER A HG   18 
ATOM 6685 N N    . LYS A 1 17 ? 2.563   -0.599 0.873   1.00 0.00 ? 17 LYS A N    18 
ATOM 6686 C CA   . LYS A 1 17 ? 1.600   0.443  1.293   1.00 0.00 ? 17 LYS A CA   18 
ATOM 6687 C C    . LYS A 1 17 ? 0.405   0.548  0.321   1.00 0.00 ? 17 LYS A C    18 
ATOM 6688 O O    . LYS A 1 17 ? -0.733  0.485  0.749   1.00 0.00 ? 17 LYS A O    18 
ATOM 6689 C CB   . LYS A 1 17 ? 2.311   1.796  1.413   1.00 0.00 ? 17 LYS A CB   18 
ATOM 6690 C CG   . LYS A 1 17 ? 1.440   3.001  1.812   1.00 0.00 ? 17 LYS A CG   18 
ATOM 6691 C CD   . LYS A 1 17 ? 0.761   2.862  3.178   1.00 0.00 ? 17 LYS A CD   18 
ATOM 6692 C CE   . LYS A 1 17 ? 1.748   2.795  4.349   1.00 0.00 ? 17 LYS A CE   18 
ATOM 6693 N NZ   . LYS A 1 17 ? 0.990   2.561  5.578   1.00 0.00 ? 17 LYS A NZ   18 
ATOM 6694 H H    . LYS A 1 17 ? 3.427   -0.223 0.513   1.00 0.00 ? 17 LYS A H    18 
ATOM 6695 H HZ1  . LYS A 1 17 ? 0.465   1.709  5.486   1.00 0.00 ? 17 LYS A HZ1  18 
ATOM 6696 H HZ2  . LYS A 1 17 ? 1.627   2.476  6.342   1.00 0.00 ? 17 LYS A HZ2  18 
ATOM 6697 H HZ3  . LYS A 1 17 ? 0.379   3.336  5.746   1.00 0.00 ? 17 LYS A HZ3  18 
ATOM 6698 N N    . ASN A 1 18 ? 0.689   0.714  -0.964  1.00 0.00 ? 18 ASN A N    18 
ATOM 6699 C CA   . ASN A 1 18 ? -0.349  0.809  -2.017  1.00 0.00 ? 18 ASN A CA   18 
ATOM 6700 C C    . ASN A 1 18 ? -1.222  -0.456 -2.071  1.00 0.00 ? 18 ASN A C    18 
ATOM 6701 O O    . ASN A 1 18 ? -2.451  -0.355 -2.151  1.00 0.00 ? 18 ASN A O    18 
ATOM 6702 C CB   . ASN A 1 18 ? 0.292   1.077  -3.375  1.00 0.00 ? 18 ASN A CB   18 
ATOM 6703 C CG   . ASN A 1 18 ? -0.704  1.738  -4.345  1.00 0.00 ? 18 ASN A CG   18 
ATOM 6704 O OD1  . ASN A 1 18 ? -0.573  2.896  -4.713  1.00 0.00 ? 18 ASN A OD1  18 
ATOM 6705 N ND2  . ASN A 1 18 ? -1.749  1.035  -4.716  1.00 0.00 ? 18 ASN A ND2  18 
ATOM 6706 H H    . ASN A 1 18 ? 1.637   0.884  -1.276  1.00 0.00 ? 18 ASN A H    18 
ATOM 6707 H HD21 . ASN A 1 18 ? -1.974  0.148  -4.330  1.00 0.00 ? 18 ASN A HD21 18 
ATOM 6708 H HD22 . ASN A 1 18 ? -2.363  1.498  -5.362  1.00 0.00 ? 18 ASN A HD22 18 
ATOM 6709 N N    . TYR A 1 19 ? -0.597  -1.620 -1.905  1.00 0.00 ? 19 TYR A N    18 
ATOM 6710 C CA   . TYR A 1 19 ? -1.288  -2.912 -1.733  1.00 0.00 ? 19 TYR A CA   18 
ATOM 6711 C C    . TYR A 1 19 ? -2.260  -2.915 -0.525  1.00 0.00 ? 19 TYR A C    18 
ATOM 6712 O O    . TYR A 1 19 ? -3.406  -3.338 -0.632  1.00 0.00 ? 19 TYR A O    18 
ATOM 6713 C CB   . TYR A 1 19 ? -0.289  -4.070 -1.648  1.00 0.00 ? 19 TYR A CB   18 
ATOM 6714 C CG   . TYR A 1 19 ? 0.419   -4.406 -2.978  1.00 0.00 ? 19 TYR A CG   18 
ATOM 6715 C CD1  . TYR A 1 19 ? -0.294  -4.407 -4.193  1.00 0.00 ? 19 TYR A CD1  18 
ATOM 6716 C CD2  . TYR A 1 19 ? 1.793   -4.770 -2.934  1.00 0.00 ? 19 TYR A CD2  18 
ATOM 6717 C CE1  . TYR A 1 19 ? 0.360   -4.763 -5.394  1.00 0.00 ? 19 TYR A CE1  18 
ATOM 6718 C CE2  . TYR A 1 19 ? 2.451   -5.125 -4.125  1.00 0.00 ? 19 TYR A CE2  18 
ATOM 6719 C CZ   . TYR A 1 19 ? 1.727   -5.108 -5.340  1.00 0.00 ? 19 TYR A CZ   18 
ATOM 6720 O OH   . TYR A 1 19 ? 2.378   -5.373 -6.506  1.00 0.00 ? 19 TYR A OH   18 
ATOM 6721 H H    . TYR A 1 19 ? 0.413   -1.668 -1.903  1.00 0.00 ? 19 TYR A H    18 
ATOM 6722 H HH   . TYR A 1 19 ? 3.329   -5.597 -6.319  1.00 0.00 ? 19 TYR A HH   18 
ATOM 6723 N N    . HIS A 1 20 ? -1.858  -2.168 0.508   1.00 0.00 ? 20 HIS A N    18 
ATOM 6724 C CA   . HIS A 1 20 ? -2.641  -1.879 1.722   1.00 0.00 ? 20 HIS A CA   18 
ATOM 6725 C C    . HIS A 1 20 ? -3.531  -0.596 1.629   1.00 0.00 ? 20 HIS A C    18 
ATOM 6726 O O    . HIS A 1 20 ? -4.277  -0.261 2.543   1.00 0.00 ? 20 HIS A O    18 
ATOM 6727 C CB   . HIS A 1 20 ? -1.615  -1.886 2.868   1.00 0.00 ? 20 HIS A CB   18 
ATOM 6728 C CG   . HIS A 1 20 ? -1.900  -0.998 4.074   1.00 0.00 ? 20 HIS A CG   18 
ATOM 6729 N ND1  . HIS A 1 20 ? -2.597  -1.314 5.161   1.00 0.00 ? 20 HIS A ND1  18 
ATOM 6730 C CD2  . HIS A 1 20 ? -1.686  0.320  4.107   1.00 0.00 ? 20 HIS A CD2  18 
ATOM 6731 C CE1  . HIS A 1 20 ? -2.860  -0.203 5.831   1.00 0.00 ? 20 HIS A CE1  18 
ATOM 6732 N NE2  . HIS A 1 20 ? -2.317  0.807  5.177   1.00 0.00 ? 20 HIS A NE2  18 
ATOM 6733 H H    . HIS A 1 20 ? -0.961  -1.723 0.509   1.00 0.00 ? 20 HIS A H    18 
ATOM 6734 H HD1  . HIS A 1 20 ? -2.769  -2.251 5.486   1.00 0.00 ? 20 HIS A HD1  18 
ATOM 6735 H HE2  . HIS A 1 20 ? -2.490  1.770  5.345   1.00 0.00 ? 20 HIS A HE2  18 
ATOM 6736 N N    . LEU A 1 21 ? -3.564  0.023  0.450   1.00 0.00 ? 21 LEU A N    18 
ATOM 6737 C CA   . LEU A 1 21 ? -4.385  1.218  0.170   1.00 0.00 ? 21 LEU A CA   18 
ATOM 6738 C C    . LEU A 1 21 ? -5.573  0.881  -0.744  1.00 0.00 ? 21 LEU A C    18 
ATOM 6739 O O    . LEU A 1 21 ? -6.710  1.241  -0.437  1.00 0.00 ? 21 LEU A O    18 
ATOM 6740 C CB   . LEU A 1 21 ? -3.466  2.308  -0.409  1.00 0.00 ? 21 LEU A CB   18 
ATOM 6741 C CG   . LEU A 1 21 ? -4.185  3.516  -1.003  1.00 0.00 ? 21 LEU A CG   18 
ATOM 6742 C CD1  . LEU A 1 21 ? -4.919  4.352  0.060   1.00 0.00 ? 21 LEU A CD1  18 
ATOM 6743 C CD2  . LEU A 1 21 ? -3.175  4.379  -1.769  1.00 0.00 ? 21 LEU A CD2  18 
ATOM 6744 H H    . LEU A 1 21 ? -2.892  -0.203 -0.258  1.00 0.00 ? 21 LEU A H    18 
ATOM 6745 N N    . GLU A 1 22 ? -5.306  0.076  -1.769  1.00 0.00 ? 22 GLU A N    18 
ATOM 6746 C CA   . GLU A 1 22 ? -6.361  -0.425 -2.693  1.00 0.00 ? 22 GLU A CA   18 
ATOM 6747 C C    . GLU A 1 22 ? -7.463  -1.227 -1.963  1.00 0.00 ? 22 GLU A C    18 
ATOM 6748 O O    . GLU A 1 22 ? -8.636  -1.081 -2.275  1.00 0.00 ? 22 GLU A O    18 
ATOM 6749 C CB   . GLU A 1 22 ? -5.713  -1.220 -3.834  1.00 0.00 ? 22 GLU A CB   18 
ATOM 6750 C CG   . GLU A 1 22 ? -5.149  -2.584 -3.403  1.00 0.00 ? 22 GLU A CG   18 
ATOM 6751 C CD   . GLU A 1 22 ? -3.978  -3.055 -4.256  1.00 0.00 ? 22 GLU A CD   18 
ATOM 6752 O OE1  . GLU A 1 22 ? -3.866  -4.210 -4.654  1.00 0.00 ? 22 GLU A OE1  18 
ATOM 6753 O OE2  . GLU A 1 22 ? -2.976  -2.172 -4.487  1.00 0.00 ? 22 GLU A OE2  18 
ATOM 6754 H H    . GLU A 1 22 ? -4.367  -0.134 -2.032  1.00 0.00 ? 22 GLU A H    18 
ATOM 6755 H HE2  . GLU A 1 22 ? -2.312  -2.728 -4.964  1.00 0.00 ? 22 GLU A HE2  18 
ATOM 6756 N N    . ASN A 1 23 ? -7.058  -1.934 -0.888  1.00 0.00 ? 23 ASN A N    18 
ATOM 6757 C CA   . ASN A 1 23 ? -8.000  -2.707 -0.045  1.00 0.00 ? 23 ASN A CA   18 
ATOM 6758 C C    . ASN A 1 23 ? -8.996  -1.765 0.665   1.00 0.00 ? 23 ASN A C    18 
ATOM 6759 O O    . ASN A 1 23 ? -10.202 -1.967 0.617   1.00 0.00 ? 23 ASN A O    18 
ATOM 6760 C CB   . ASN A 1 23 ? -7.277  -3.606 0.977   1.00 0.00 ? 23 ASN A CB   18 
ATOM 6761 C CG   . ASN A 1 23 ? -6.860  -2.919 2.296   1.00 0.00 ? 23 ASN A CG   18 
ATOM 6762 O OD1  . ASN A 1 23 ? -7.650  -2.542 3.141   1.00 0.00 ? 23 ASN A OD1  18 
ATOM 6763 N ND2  . ASN A 1 23 ? -5.606  -2.722 2.500   1.00 0.00 ? 23 ASN A ND2  18 
ATOM 6764 H H    . ASN A 1 23 ? -6.109  -1.959 -0.603  1.00 0.00 ? 23 ASN A H    18 
ATOM 6765 H HD21 . ASN A 1 23 ? -4.887  -3.082 1.911   1.00 0.00 ? 23 ASN A HD21 18 
ATOM 6766 H HD22 . ASN A 1 23 ? -5.374  -2.175 3.308   1.00 0.00 ? 23 ASN A HD22 18 
ATOM 6767 N N    . GLU A 1 24 ? -8.440  -0.646 1.130   1.00 0.00 ? 24 GLU A N    18 
ATOM 6768 C CA   . GLU A 1 24 ? -9.176  0.339  1.917   1.00 0.00 ? 24 GLU A CA   18 
ATOM 6769 C C    . GLU A 1 24 ? -10.158 1.103  1.029   1.00 0.00 ? 24 GLU A C    18 
ATOM 6770 O O    . GLU A 1 24 ? -11.330 0.971  1.289   1.00 0.00 ? 24 GLU A O    18 
ATOM 6771 C CB   . GLU A 1 24 ? -8.189  1.243  2.651   1.00 0.00 ? 24 GLU A CB   18 
ATOM 6772 C CG   . GLU A 1 24 ? -8.831  1.808  3.912   1.00 0.00 ? 24 GLU A CG   18 
ATOM 6773 C CD   . GLU A 1 24 ? -7.774  1.995  4.998   1.00 0.00 ? 24 GLU A CD   18 
ATOM 6774 O OE1  . GLU A 1 24 ? -7.846  1.441  6.090   1.00 0.00 ? 24 GLU A OE1  18 
ATOM 6775 O OE2  . GLU A 1 24 ? -6.713  2.762  4.685   1.00 0.00 ? 24 GLU A OE2  18 
ATOM 6776 H H    . GLU A 1 24 ? -7.465  -0.446 1.028   1.00 0.00 ? 24 GLU A H    18 
ATOM 6777 H HE2  . GLU A 1 24 ? -6.136  2.688  5.499   1.00 0.00 ? 24 GLU A HE2  18 
ATOM 6778 N N    . VAL A 1 25 ? -9.693  1.616  -0.108  1.00 0.00 ? 25 VAL A N    18 
ATOM 6779 C CA   . VAL A 1 25 ? -10.557 2.194  -1.179  1.00 0.00 ? 25 VAL A CA   18 
ATOM 6780 C C    . VAL A 1 25 ? -11.807 1.318  -1.458  1.00 0.00 ? 25 VAL A C    18 
ATOM 6781 O O    . VAL A 1 25 ? -12.920 1.831  -1.447  1.00 0.00 ? 25 VAL A O    18 
ATOM 6782 C CB   . VAL A 1 25 ? -9.725  2.485  -2.444  1.00 0.00 ? 25 VAL A CB   18 
ATOM 6783 C CG1  . VAL A 1 25 ? -10.558 3.093  -3.573  1.00 0.00 ? 25 VAL A CG1  18 
ATOM 6784 C CG2  . VAL A 1 25 ? -8.567  3.446  -2.142  1.00 0.00 ? 25 VAL A CG2  18 
ATOM 6785 H H    . VAL A 1 25 ? -8.725  1.788  -0.235  1.00 0.00 ? 25 VAL A H    18 
ATOM 6786 N N    . ALA A 1 26 ? -11.598 0.003  -1.468  1.00 0.00 ? 26 ALA A N    18 
ATOM 6787 C CA   . ALA A 1 26 ? -12.678 -1.003 -1.604  1.00 0.00 ? 26 ALA A CA   18 
ATOM 6788 C C    . ALA A 1 26 ? -13.604 -1.059 -0.368  1.00 0.00 ? 26 ALA A C    18 
ATOM 6789 O O    . ALA A 1 26 ? -14.754 -0.640 -0.454  1.00 0.00 ? 26 ALA A O    18 
ATOM 6790 C CB   . ALA A 1 26 ? -12.081 -2.375 -1.944  1.00 0.00 ? 26 ALA A CB   18 
ATOM 6791 H H    . ALA A 1 26 ? -10.688 -0.388 -1.320  1.00 0.00 ? 26 ALA A H    18 
ATOM 6792 N N    . ARG A 1 27 ? -13.074 -1.454 0.795   1.00 0.00 ? 27 ARG A N    18 
ATOM 6793 C CA   . ARG A 1 27 ? -13.824 -1.437 2.076   1.00 0.00 ? 27 ARG A CA   18 
ATOM 6794 C C    . ARG A 1 27 ? -14.457 -0.075 2.462   1.00 0.00 ? 27 ARG A C    18 
ATOM 6795 O O    . ARG A 1 27 ? -15.460 -0.005 3.172   1.00 0.00 ? 27 ARG A O    18 
ATOM 6796 C CB   . ARG A 1 27 ? -12.981 -1.979 3.232   1.00 0.00 ? 27 ARG A CB   18 
ATOM 6797 C CG   . ARG A 1 27 ? -13.214 -3.483 3.405   1.00 0.00 ? 27 ARG A CG   18 
ATOM 6798 C CD   . ARG A 1 27 ? -12.695 -3.989 4.756   1.00 0.00 ? 27 ARG A CD   18 
ATOM 6799 N NE   . ARG A 1 27 ? -11.339 -4.565 4.668   1.00 0.00 ? 27 ARG A NE   18 
ATOM 6800 C CZ   . ARG A 1 27 ? -10.177 -3.921 4.745   1.00 0.00 ? 27 ARG A CZ   18 
ATOM 6801 N NH1  . ARG A 1 27 ? -10.092 -2.600 4.830   1.00 0.00 ? 27 ARG A NH1  18 
ATOM 6802 N NH2  . ARG A 1 27 ? -9.048  -4.600 4.710   1.00 0.00 ? 27 ARG A NH2  18 
ATOM 6803 H H    . ARG A 1 27 ? -12.147 -1.822 0.847   1.00 0.00 ? 27 ARG A H    18 
ATOM 6804 H HE   . ARG A 1 27 ? -11.311 -5.546 4.487   1.00 0.00 ? 27 ARG A HE   18 
ATOM 6805 H HH11 . ARG A 1 27 ? -10.925 -2.044 4.826   1.00 0.00 ? 27 ARG A HH11 18 
ATOM 6806 H HH12 . ARG A 1 27 ? -9.192  -2.164 4.853   1.00 0.00 ? 27 ARG A HH12 18 
ATOM 6807 H HH21 . ARG A 1 27 ? -9.044  -5.596 4.679   1.00 0.00 ? 27 ARG A HH21 18 
ATOM 6808 H HH22 . ARG A 1 27 ? -8.182  -4.091 4.729   1.00 0.00 ? 27 ARG A HH22 18 
ATOM 6809 N N    . LEU A 1 28 ? -13.847 1.001  1.987   1.00 0.00 ? 28 LEU A N    18 
ATOM 6810 C CA   . LEU A 1 28 ? -14.359 2.389  2.038   1.00 0.00 ? 28 LEU A CA   18 
ATOM 6811 C C    . LEU A 1 28 ? -15.632 2.529  1.192   1.00 0.00 ? 28 LEU A C    18 
ATOM 6812 O O    . LEU A 1 28 ? -16.703 2.790  1.734   1.00 0.00 ? 28 LEU A O    18 
ATOM 6813 C CB   . LEU A 1 28 ? -13.209 3.292  1.551   1.00 0.00 ? 28 LEU A CB   18 
ATOM 6814 C CG   . LEU A 1 28 ? -13.640 4.668  1.042   1.00 0.00 ? 28 LEU A CG   18 
ATOM 6815 C CD1  . LEU A 1 28 ? -13.978 5.606  2.202   1.00 0.00 ? 28 LEU A CD1  18 
ATOM 6816 C CD2  . LEU A 1 28 ? -12.543 5.289  0.169   1.00 0.00 ? 28 LEU A CD2  18 
ATOM 6817 H H    . LEU A 1 28 ? -12.930 0.917  1.597   1.00 0.00 ? 28 LEU A H    18 
ATOM 6818 N N    . LYS A 1 29 ? -15.526 2.257  -0.105  1.00 0.00 ? 29 LYS A N    18 
ATOM 6819 C CA   . LYS A 1 29 ? -16.705 2.337  -0.991  1.00 0.00 ? 29 LYS A CA   18 
ATOM 6820 C C    . LYS A 1 29 ? -17.826 1.333  -0.632  1.00 0.00 ? 29 LYS A C    18 
ATOM 6821 O O    . LYS A 1 29 ? -18.977 1.539  -1.006  1.00 0.00 ? 29 LYS A O    18 
ATOM 6822 C CB   . LYS A 1 29 ? -16.369 2.404  -2.487  1.00 0.00 ? 29 LYS A CB   18 
ATOM 6823 C CG   . LYS A 1 29 ? -15.709 1.175  -3.134  1.00 0.00 ? 29 LYS A CG   18 
ATOM 6824 C CD   . LYS A 1 29 ? -16.626 -0.046 -3.118  1.00 0.00 ? 29 LYS A CD   18 
ATOM 6825 C CE   . LYS A 1 29 ? -16.101 -1.266 -3.884  1.00 0.00 ? 29 LYS A CE   18 
ATOM 6826 N NZ   . LYS A 1 29 ? -16.735 -2.450 -3.303  1.00 0.00 ? 29 LYS A NZ   18 
ATOM 6827 H H    . LYS A 1 29 ? -14.652 2.052  -0.562  1.00 0.00 ? 29 LYS A H    18 
ATOM 6828 H HZ1  . LYS A 1 29 ? -17.704 -2.258 -3.102  1.00 0.00 ? 29 LYS A HZ1  18 
ATOM 6829 H HZ2  . LYS A 1 29 ? -16.681 -3.208 -3.957  1.00 0.00 ? 29 LYS A HZ2  18 
ATOM 6830 H HZ3  . LYS A 1 29 ? -16.264 -2.707 -2.471  1.00 0.00 ? 29 LYS A HZ3  18 
ATOM 6831 N N    . LYS A 1 30 ? -17.481 0.282  0.127   1.00 0.00 ? 30 LYS A N    18 
ATOM 6832 C CA   . LYS A 1 30 ? -18.461 -0.681 0.657   1.00 0.00 ? 30 LYS A CA   18 
ATOM 6833 C C    . LYS A 1 30 ? -19.580 0.034  1.454   1.00 0.00 ? 30 LYS A C    18 
ATOM 6834 O O    . LYS A 1 30 ? -20.751 -0.346 1.379   1.00 0.00 ? 30 LYS A O    18 
ATOM 6835 C CB   . LYS A 1 30 ? -17.735 -1.790 1.454   1.00 0.00 ? 30 LYS A CB   18 
ATOM 6836 C CG   . LYS A 1 30 ? -17.960 -1.813 2.980   1.00 0.00 ? 30 LYS A CG   18 
ATOM 6837 C CD   . LYS A 1 30 ? -17.014 -2.765 3.726   1.00 0.00 ? 30 LYS A CD   18 
ATOM 6838 C CE   . LYS A 1 30 ? -17.644 -4.124 4.052   1.00 0.00 ? 30 LYS A CE   18 
ATOM 6839 N NZ   . LYS A 1 30 ? -18.710 -3.951 5.040   1.00 0.00 ? 30 LYS A NZ   18 
ATOM 6840 H H    . LYS A 1 30 ? -16.520 0.064  0.287   1.00 0.00 ? 30 LYS A H    18 
ATOM 6841 H HZ1  . LYS A 1 30 ? -18.336 -3.517 5.868   1.00 0.00 ? 30 LYS A HZ1  18 
ATOM 6842 H HZ2  . LYS A 1 30 ? -19.423 -3.371 4.638   1.00 0.00 ? 30 LYS A HZ2  18 
ATOM 6843 H HZ3  . LYS A 1 30 ? -19.090 -4.841 5.273   1.00 0.00 ? 30 LYS A HZ3  18 
ATOM 6844 N N    . LEU A 1 31 ? -19.199 1.129  2.110   1.00 0.00 ? 31 LEU A N    18 
ATOM 6845 C CA   . LEU A 1 31 ? -20.097 2.002  2.888   1.00 0.00 ? 31 LEU A CA   18 
ATOM 6846 C C    . LEU A 1 31 ? -20.849 2.966  1.947   1.00 0.00 ? 31 LEU A C    18 
ATOM 6847 O O    . LEU A 1 31 ? -22.062 3.090  2.071   1.00 0.00 ? 31 LEU A O    18 
ATOM 6848 C CB   . LEU A 1 31 ? -19.299 2.828  3.904   1.00 0.00 ? 31 LEU A CB   18 
ATOM 6849 C CG   . LEU A 1 31 ? -18.154 2.045  4.571   1.00 0.00 ? 31 LEU A CG   18 
ATOM 6850 C CD1  . LEU A 1 31 ? -17.078 3.038  5.011   1.00 0.00 ? 31 LEU A CD1  18 
ATOM 6851 C CD2  . LEU A 1 31 ? -18.608 1.198  5.752   1.00 0.00 ? 31 LEU A CD2  18 
ATOM 6852 H H    . LEU A 1 31 ? -18.231 1.407  2.123   1.00 0.00 ? 31 LEU A H    18 
ATOM 6853 N N    . VAL A 1 32 ? -20.179 3.418  0.874   1.00 0.00 ? 32 VAL A N    18 
ATOM 6854 C CA   . VAL A 1 32 ? -20.748 4.317  -0.167  1.00 0.00 ? 32 VAL A CA   18 
ATOM 6855 C C    . VAL A 1 32 ? -21.991 3.702  -0.856  1.00 0.00 ? 32 VAL A C    18 
ATOM 6856 O O    . VAL A 1 32 ? -22.906 4.440  -1.214  1.00 0.00 ? 32 VAL A O    18 
ATOM 6857 C CB   . VAL A 1 32 ? -19.639 4.758  -1.146  1.00 0.00 ? 32 VAL A CB   18 
ATOM 6858 C CG1  . VAL A 1 32 ? -20.120 5.393  -2.460  1.00 0.00 ? 32 VAL A CG1  18 
ATOM 6859 C CG2  . VAL A 1 32 ? -18.720 5.762  -0.453  1.00 0.00 ? 32 VAL A CG2  18 
ATOM 6860 H H    . VAL A 1 32 ? -19.286 3.038  0.639   1.00 0.00 ? 32 VAL A H    18 
ATOM 6861 N N    . GLY A 1 33 ? -22.060 2.368  -0.868  1.00 0.00 ? 33 GLY A N    18 
ATOM 6862 C CA   . GLY A 1 33 ? -23.207 1.589  -1.372  1.00 0.00 ? 33 GLY A CA   18 
ATOM 6863 C C    . GLY A 1 33 ? -24.547 1.980  -0.694  1.00 0.00 ? 33 GLY A C    18 
ATOM 6864 O O    . GLY A 1 33 ? -25.584 1.983  -1.342  1.00 0.00 ? 33 GLY A O    18 
ATOM 6865 H H    . GLY A 1 33 ? -21.305 1.813  -0.506  1.00 0.00 ? 33 GLY A H    18 
ATOM 6866 N N    . GLU A 1 34 ? -24.476 2.290  0.602   1.00 0.00 ? 34 GLU A N    18 
ATOM 6867 C CA   . GLU A 1 34 ? -25.663 2.715  1.384   1.00 0.00 ? 34 GLU A CA   18 
ATOM 6868 C C    . GLU A 1 34 ? -25.337 3.814  2.422   1.00 0.00 ? 34 GLU A C    18 
ATOM 6869 O O    . GLU A 1 34 ? -26.009 3.948  3.450   1.00 0.00 ? 34 GLU A O    18 
ATOM 6870 C CB   . GLU A 1 34 ? -26.250 1.455  2.051   1.00 0.00 ? 34 GLU A CB   18 
ATOM 6871 C CG   . GLU A 1 34 ? -27.758 1.621  2.273   1.00 0.00 ? 34 GLU A CG   18 
ATOM 6872 C CD   . GLU A 1 34 ? -28.183 1.463  3.731   1.00 0.00 ? 34 GLU A CD   18 
ATOM 6873 O OE1  . GLU A 1 34 ? -27.472 1.754  4.693   1.00 0.00 ? 34 GLU A OE1  18 
ATOM 6874 O OE2  . GLU A 1 34 ? -29.417 0.964  3.938   1.00 0.00 ? 34 GLU A OE2  18 
ATOM 6875 H H    . GLU A 1 34 ? -23.609 2.274  1.105   1.00 0.00 ? 34 GLU A H    18 
ATOM 6876 H HE2  . GLU A 1 34 ? -29.487 0.974  4.934   1.00 0.00 ? 34 GLU A HE2  18 
ATOM 6877 N N    . ARG A 1 35 ? -24.372 4.663  2.092   1.00 0.00 ? 35 ARG A N    18 
ATOM 6878 C CA   . ARG A 1 35 ? -23.843 5.733  2.985   1.00 0.00 ? 35 ARG A CA   18 
ATOM 6879 C C    . ARG A 1 35 ? -23.627 5.277  4.456   1.00 0.00 ? 35 ARG A C    18 
ATOM 6880 O O    . ARG A 1 35 ? -22.543 4.689  4.695   1.00 0.00 ? 35 ARG A O    18 
ATOM 6881 C CB   . ARG A 1 35 ? -24.744 6.963  2.852   1.00 0.00 ? 35 ARG A CB   18 
ATOM 6882 C CG   . ARG A 1 35 ? -24.111 8.190  3.518   1.00 0.00 ? 35 ARG A CG   18 
ATOM 6883 C CD   . ARG A 1 35 ? -25.143 8.946  4.341   1.00 0.00 ? 35 ARG A CD   18 
ATOM 6884 N NE   . ARG A 1 35 ? -24.608 10.171 4.985   1.00 0.00 ? 35 ARG A NE   18 
ATOM 6885 C CZ   . ARG A 1 35 ? -23.666 10.970 4.480   1.00 0.00 ? 35 ARG A CZ   18 
ATOM 6886 N NH1  . ARG A 1 35 ? -22.385 10.690 4.656   1.00 0.00 ? 35 ARG A NH1  18 
ATOM 6887 N NH2  . ARG A 1 35 ? -24.003 11.919 3.632   1.00 0.00 ? 35 ARG A NH2  18 
ATOM 6888 O OXT  . ARG A 1 35 ? -24.484 5.554  5.322   1.00 0.00 ? 35 ARG A OXT  18 
ATOM 6889 H H    . ARG A 1 35 ? -23.914 4.599  1.216   1.00 0.00 ? 35 ARG A H    18 
ATOM 6890 H HE   . ARG A 1 35 ? -25.005 10.390 5.874   1.00 0.00 ? 35 ARG A HE   18 
ATOM 6891 H HH11 . ARG A 1 35 ? -22.121 9.870  5.157   1.00 0.00 ? 35 ARG A HH11 18 
ATOM 6892 H HH12 . ARG A 1 35 ? -21.683 11.283 4.261   1.00 0.00 ? 35 ARG A HH12 18 
ATOM 6893 H HH21 . ARG A 1 35 ? -24.962 12.009 3.358   1.00 0.00 ? 35 ARG A HH21 18 
ATOM 6894 H HH22 . ARG A 1 35 ? -23.301 12.513 3.237   1.00 0.00 ? 35 ARG A HH22 18 
ATOM 6895 N N    . LEU A 1 1  ? 27.935  4.664  4.037   1.00 0.00 ? 1  LEU A N    19 
ATOM 6896 C CA   . LEU A 1 1  ? 26.990  5.183  3.019   1.00 0.00 ? 1  LEU A CA   19 
ATOM 6897 C C    . LEU A 1 1  ? 25.511  4.810  3.287   1.00 0.00 ? 1  LEU A C    19 
ATOM 6898 O O    . LEU A 1 1  ? 25.209  4.039  4.209   1.00 0.00 ? 1  LEU A O    19 
ATOM 6899 C CB   . LEU A 1 1  ? 27.459  4.746  1.623   1.00 0.00 ? 1  LEU A CB   19 
ATOM 6900 C CG   . LEU A 1 1  ? 27.235  3.264  1.314   1.00 0.00 ? 1  LEU A CG   19 
ATOM 6901 C CD1  . LEU A 1 1  ? 26.053  3.090  0.352   1.00 0.00 ? 1  LEU A CD1  19 
ATOM 6902 C CD2  . LEU A 1 1  ? 28.498  2.634  0.727   1.00 0.00 ? 1  LEU A CD2  19 
ATOM 6903 H H1   . LEU A 1 1  ? 27.853  3.671  4.089   1.00 0.00 ? 1  LEU A H1   19 
ATOM 6904 H H2   . LEU A 1 1  ? 28.872  4.918  3.804   1.00 0.00 ? 1  LEU A H2   19 
ATOM 6905 H H3   . LEU A 1 1  ? 27.714  5.052  4.938   1.00 0.00 ? 1  LEU A H3   19 
ATOM 6906 N N    . GLN A 1 2  ? 24.611  5.366  2.476   1.00 0.00 ? 2  GLN A N    19 
ATOM 6907 C CA   . GLN A 1 2  ? 23.151  5.138  2.622   1.00 0.00 ? 2  GLN A CA   19 
ATOM 6908 C C    . GLN A 1 2  ? 22.321  5.390  1.342   1.00 0.00 ? 2  GLN A C    19 
ATOM 6909 O O    . GLN A 1 2  ? 21.167  5.806  1.378   1.00 0.00 ? 2  GLN A O    19 
ATOM 6910 C CB   . GLN A 1 2  ? 22.641  5.904  3.846   1.00 0.00 ? 2  GLN A CB   19 
ATOM 6911 C CG   . GLN A 1 2  ? 22.874  7.420  3.818   1.00 0.00 ? 2  GLN A CG   19 
ATOM 6912 C CD   . GLN A 1 2  ? 21.642  8.159  3.290   1.00 0.00 ? 2  GLN A CD   19 
ATOM 6913 O OE1  . GLN A 1 2  ? 21.650  8.835  2.282   1.00 0.00 ? 2  GLN A OE1  19 
ATOM 6914 N NE2  . GLN A 1 2  ? 20.556  8.025  4.016   1.00 0.00 ? 2  GLN A NE2  19 
ATOM 6915 H H    . GLN A 1 2  ? 24.896  5.984  1.754   1.00 0.00 ? 2  GLN A H    19 
ATOM 6916 H HE21 . GLN A 1 2  ? 20.601  7.511  4.870   1.00 0.00 ? 2  GLN A HE21 19 
ATOM 6917 H HE22 . GLN A 1 2  ? 19.736  8.509  3.701   1.00 0.00 ? 2  GLN A HE22 19 
ATOM 6918 N N    . ARG A 1 3  ? 22.839  4.838  0.251   1.00 0.00 ? 3  ARG A N    19 
ATOM 6919 C CA   . ARG A 1 3  ? 22.215  4.930  -1.086  1.00 0.00 ? 3  ARG A CA   19 
ATOM 6920 C C    . ARG A 1 3  ? 22.115  3.524  -1.682  1.00 0.00 ? 3  ARG A C    19 
ATOM 6921 O O    . ARG A 1 3  ? 22.960  2.680  -1.394  1.00 0.00 ? 3  ARG A O    19 
ATOM 6922 C CB   . ARG A 1 3  ? 23.100  5.802  -1.988  1.00 0.00 ? 3  ARG A CB   19 
ATOM 6923 C CG   . ARG A 1 3  ? 22.340  6.212  -3.243  1.00 0.00 ? 3  ARG A CG   19 
ATOM 6924 C CD   . ARG A 1 3  ? 23.327  6.374  -4.403  1.00 0.00 ? 3  ARG A CD   19 
ATOM 6925 N NE   . ARG A 1 3  ? 22.964  7.557  -5.205  1.00 0.00 ? 3  ARG A NE   19 
ATOM 6926 C CZ   . ARG A 1 3  ? 23.229  8.824  -4.873  1.00 0.00 ? 3  ARG A CZ   19 
ATOM 6927 N NH1  . ARG A 1 3  ? 23.822  9.156  -3.736  1.00 0.00 ? 3  ARG A NH1  19 
ATOM 6928 N NH2  . ARG A 1 3  ? 22.946  9.806  -5.720  1.00 0.00 ? 3  ARG A NH2  19 
ATOM 6929 H H    . ARG A 1 3  ? 23.600  4.195  0.308   1.00 0.00 ? 3  ARG A H    19 
ATOM 6930 H HE   . ARG A 1 3  ? 22.483  7.382  -6.059  1.00 0.00 ? 3  ARG A HE   19 
ATOM 6931 H HH11 . ARG A 1 3  ? 24.063  8.426  -3.086  1.00 0.00 ? 3  ARG A HH11 19 
ATOM 6932 H HH12 . ARG A 1 3  ? 24.020  10.107 -3.514  1.00 0.00 ? 3  ARG A HH12 19 
ATOM 6933 H HH21 . ARG A 1 3  ? 22.540  9.605  -6.607  1.00 0.00 ? 3  ARG A HH21 19 
ATOM 6934 H HH22 . ARG A 1 3  ? 23.145  10.749 -5.461  1.00 0.00 ? 3  ARG A HH22 19 
ATOM 6935 N N    . MET A 1 4  ? 20.954  3.247  -2.282  1.00 0.00 ? 4  MET A N    19 
ATOM 6936 C CA   . MET A 1 4  ? 20.578  1.950  -2.900  1.00 0.00 ? 4  MET A CA   19 
ATOM 6937 C C    . MET A 1 4  ? 20.287  0.824  -1.908  1.00 0.00 ? 4  MET A C    19 
ATOM 6938 O O    . MET A 1 4  ? 19.601  -0.142 -2.225  1.00 0.00 ? 4  MET A O    19 
ATOM 6939 C CB   . MET A 1 4  ? 21.619  1.515  -3.942  1.00 0.00 ? 4  MET A CB   19 
ATOM 6940 C CG   . MET A 1 4  ? 20.978  1.115  -5.270  1.00 0.00 ? 4  MET A CG   19 
ATOM 6941 S SD   . MET A 1 4  ? 19.827  2.348  -5.998  1.00 0.00 ? 4  MET A SD   19 
ATOM 6942 C CE   . MET A 1 4  ? 20.764  3.868  -5.948  1.00 0.00 ? 4  MET A CE   19 
ATOM 6943 H H    . MET A 1 4  ? 20.277  3.975  -2.392  1.00 0.00 ? 4  MET A H    19 
ATOM 6944 N N    . LYS A 1 5  ? 20.705  1.089  -0.675  1.00 0.00 ? 5  LYS A N    19 
ATOM 6945 C CA   . LYS A 1 5  ? 20.544  0.223  0.513   1.00 0.00 ? 5  LYS A CA   19 
ATOM 6946 C C    . LYS A 1 5  ? 19.305  0.547  1.353   1.00 0.00 ? 5  LYS A C    19 
ATOM 6947 O O    . LYS A 1 5  ? 18.694  -0.343 1.936   1.00 0.00 ? 5  LYS A O    19 
ATOM 6948 C CB   . LYS A 1 5  ? 21.798  0.370  1.359   1.00 0.00 ? 5  LYS A CB   19 
ATOM 6949 C CG   . LYS A 1 5  ? 22.986  -0.273 0.646   1.00 0.00 ? 5  LYS A CG   19 
ATOM 6950 C CD   . LYS A 1 5  ? 24.305  -0.089 1.403   1.00 0.00 ? 5  LYS A CD   19 
ATOM 6951 C CE   . LYS A 1 5  ? 24.236  -0.658 2.823   1.00 0.00 ? 5  LYS A CE   19 
ATOM 6952 N NZ   . LYS A 1 5  ? 25.592  -0.919 3.289   1.00 0.00 ? 5  LYS A NZ   19 
ATOM 6953 H H    . LYS A 1 5  ? 21.364  1.834  -0.563  1.00 0.00 ? 5  LYS A H    19 
ATOM 6954 H HZ1  . LYS A 1 5  ? 26.137  -0.086 3.233   1.00 0.00 ? 5  LYS A HZ1  19 
ATOM 6955 H HZ2  . LYS A 1 5  ? 25.550  -1.224 4.239   1.00 0.00 ? 5  LYS A HZ2  19 
ATOM 6956 H HZ3  . LYS A 1 5  ? 25.993  -1.647 2.733   1.00 0.00 ? 5  LYS A HZ3  19 
ATOM 6957 N N    . GLN A 1 6  ? 18.815  1.770  1.193   1.00 0.00 ? 6  GLN A N    19 
ATOM 6958 C CA   . GLN A 1 6  ? 17.508  2.172  1.738   1.00 0.00 ? 6  GLN A CA   19 
ATOM 6959 C C    . GLN A 1 6  ? 16.464  2.439  0.656   1.00 0.00 ? 6  GLN A C    19 
ATOM 6960 O O    . GLN A 1 6  ? 15.282  2.259  0.934   1.00 0.00 ? 6  GLN A O    19 
ATOM 6961 C CB   . GLN A 1 6  ? 17.631  3.394  2.637   1.00 0.00 ? 6  GLN A CB   19 
ATOM 6962 C CG   . GLN A 1 6  ? 18.424  3.090  3.907   1.00 0.00 ? 6  GLN A CG   19 
ATOM 6963 C CD   . GLN A 1 6  ? 18.660  4.353  4.734   1.00 0.00 ? 6  GLN A CD   19 
ATOM 6964 O OE1  . GLN A 1 6  ? 18.578  4.367  5.955   1.00 0.00 ? 6  GLN A OE1  19 
ATOM 6965 N NE2  . GLN A 1 6  ? 18.979  5.455  4.084   1.00 0.00 ? 6  GLN A NE2  19 
ATOM 6966 H H    . GLN A 1 6  ? 19.362  2.496  0.787   1.00 0.00 ? 6  GLN A H    19 
ATOM 6967 H HE21 . GLN A 1 6  ? 19.135  5.459  3.106   1.00 0.00 ? 6  GLN A HE21 19 
ATOM 6968 H HE22 . GLN A 1 6  ? 19.077  6.271  4.639   1.00 0.00 ? 6  GLN A HE22 19 
ATOM 6969 N N    . LEU A 1 7  ? 16.881  2.736  -0.565  1.00 0.00 ? 7  LEU A N    19 
ATOM 6970 C CA   . LEU A 1 7  ? 15.932  2.964  -1.676  1.00 0.00 ? 7  LEU A CA   19 
ATOM 6971 C C    . LEU A 1 7  ? 14.990  1.774  -1.898  1.00 0.00 ? 7  LEU A C    19 
ATOM 6972 O O    . LEU A 1 7  ? 13.810  1.934  -1.640  1.00 0.00 ? 7  LEU A O    19 
ATOM 6973 C CB   . LEU A 1 7  ? 16.647  3.416  -2.964  1.00 0.00 ? 7  LEU A CB   19 
ATOM 6974 C CG   . LEU A 1 7  ? 17.466  4.697  -2.746  1.00 0.00 ? 7  LEU A CG   19 
ATOM 6975 C CD1  . LEU A 1 7  ? 18.098  5.136  -4.055  1.00 0.00 ? 7  LEU A CD1  19 
ATOM 6976 C CD2  . LEU A 1 7  ? 16.636  5.877  -2.201  1.00 0.00 ? 7  LEU A CD2  19 
ATOM 6977 H H    . LEU A 1 7  ? 17.834  2.911  -0.797  1.00 0.00 ? 7  LEU A H    19 
ATOM 6978 N N    . GLU A 1 8  ? 15.538  0.565  -1.891  1.00 0.00 ? 8  GLU A N    19 
ATOM 6979 C CA   . GLU A 1 8  ? 14.752  -0.683 -1.979  1.00 0.00 ? 8  GLU A CA   19 
ATOM 6980 C C    . GLU A 1 8  ? 13.938  -0.999 -0.693  1.00 0.00 ? 8  GLU A C    19 
ATOM 6981 O O    . GLU A 1 8  ? 12.806  -1.458 -0.783  1.00 0.00 ? 8  GLU A O    19 
ATOM 6982 C CB   . GLU A 1 8  ? 15.689  -1.830 -2.414  1.00 0.00 ? 8  GLU A CB   19 
ATOM 6983 C CG   . GLU A 1 8  ? 16.399  -2.674 -1.344  1.00 0.00 ? 8  GLU A CG   19 
ATOM 6984 C CD   . GLU A 1 8  ? 17.049  -1.927 -0.177  1.00 0.00 ? 8  GLU A CD   19 
ATOM 6985 O OE1  . GLU A 1 8  ? 16.944  -2.319 0.976   1.00 0.00 ? 8  GLU A OE1  19 
ATOM 6986 O OE2  . GLU A 1 8  ? 17.482  -0.664 -0.362  1.00 0.00 ? 8  GLU A OE2  19 
ATOM 6987 H H    . GLU A 1 8  ? 16.524  0.432  -1.739  1.00 0.00 ? 8  GLU A H    19 
ATOM 6988 H HE2  . GLU A 1 8  ? 17.916  -0.523 0.555   1.00 0.00 ? 8  GLU A HE2  19 
ATOM 6989 N N    . ASP A 1 9  ? 14.443  -0.540 0.457   1.00 0.00 ? 9  ASP A N    19 
ATOM 6990 C CA   . ASP A 1 9  ? 13.792  -0.692 1.780   1.00 0.00 ? 9  ASP A CA   19 
ATOM 6991 C C    . ASP A 1 9  ? 12.624  0.294  1.957   1.00 0.00 ? 9  ASP A C    19 
ATOM 6992 O O    . ASP A 1 9  ? 11.652  0.003  2.660   1.00 0.00 ? 9  ASP A O    19 
ATOM 6993 C CB   . ASP A 1 9  ? 14.826  -0.473 2.886   1.00 0.00 ? 9  ASP A CB   19 
ATOM 6994 C CG   . ASP A 1 9  ? 15.005  -1.689 3.807   1.00 0.00 ? 9  ASP A CG   19 
ATOM 6995 O OD1  . ASP A 1 9  ? 16.014  -1.853 4.483   1.00 0.00 ? 9  ASP A OD1  19 
ATOM 6996 O OD2  . ASP A 1 9  ? 13.971  -2.548 3.917   1.00 0.00 ? 9  ASP A OD2  19 
ATOM 6997 H H    . ASP A 1 9  ? 15.284  0.002  0.467   1.00 0.00 ? 9  ASP A H    19 
ATOM 6998 H HD2  . ASP A 1 9  ? 14.293  -3.222 4.571   1.00 0.00 ? 9  ASP A HD2  19 
ATOM 6999 N N    . LYS A 1 10 ? 12.715  1.420  1.255   1.00 0.00 ? 10 LYS A N    19 
ATOM 7000 C CA   . LYS A 1 10 ? 11.673  2.451  1.226   1.00 0.00 ? 10 LYS A CA   19 
ATOM 7001 C C    . LYS A 1 10 ? 10.706  2.294  0.027   1.00 0.00 ? 10 LYS A C    19 
ATOM 7002 O O    . LYS A 1 10 ? 9.545   2.649  0.134   1.00 0.00 ? 10 LYS A O    19 
ATOM 7003 C CB   . LYS A 1 10 ? 12.284  3.854  1.400   1.00 0.00 ? 10 LYS A CB   19 
ATOM 7004 C CG   . LYS A 1 10 ? 12.930  4.535  0.190   1.00 0.00 ? 10 LYS A CG   19 
ATOM 7005 C CD   . LYS A 1 10 ? 11.866  5.200  -0.681  1.00 0.00 ? 10 LYS A CD   19 
ATOM 7006 C CE   . LYS A 1 10 ? 12.425  5.687  -2.018  1.00 0.00 ? 10 LYS A CE   19 
ATOM 7007 N NZ   . LYS A 1 10 ? 11.292  5.772  -2.954  1.00 0.00 ? 10 LYS A NZ   19 
ATOM 7008 H H    . LYS A 1 10 ? 13.582  1.681  0.817   1.00 0.00 ? 10 LYS A H    19 
ATOM 7009 H HZ1  . LYS A 1 10 ? 10.603  6.389  -2.582  1.00 0.00 ? 10 LYS A HZ1  19 
ATOM 7010 H HZ2  . LYS A 1 10 ? 11.606  6.126  -3.838  1.00 0.00 ? 10 LYS A HZ2  19 
ATOM 7011 H HZ3  . LYS A 1 10 ? 10.898  4.863  -3.091  1.00 0.00 ? 10 LYS A HZ3  19 
ATOM 7012 N N    . VAL A 1 11 ? 11.178  1.695  -1.065  1.00 0.00 ? 11 VAL A N    19 
ATOM 7013 C CA   . VAL A 1 11 ? 10.354  1.349  -2.243  1.00 0.00 ? 11 VAL A CA   19 
ATOM 7014 C C    . VAL A 1 11 ? 9.417   0.175  -1.903  1.00 0.00 ? 11 VAL A C    19 
ATOM 7015 O O    . VAL A 1 11 ? 8.226   0.228  -2.208  1.00 0.00 ? 11 VAL A O    19 
ATOM 7016 C CB   . VAL A 1 11 ? 11.259  1.085  -3.460  1.00 0.00 ? 11 VAL A CB   19 
ATOM 7017 C CG1  . VAL A 1 11 ? 10.571  0.389  -4.640  1.00 0.00 ? 11 VAL A CG1  19 
ATOM 7018 C CG2  . VAL A 1 11 ? 11.818  2.413  -3.995  1.00 0.00 ? 11 VAL A CG2  19 
ATOM 7019 H H    . VAL A 1 11 ? 12.167  1.550  -1.187  1.00 0.00 ? 11 VAL A H    19 
ATOM 7020 N N    . GLU A 1 12 ? 9.938   -0.801 -1.166  1.00 0.00 ? 12 GLU A N    19 
ATOM 7021 C CA   . GLU A 1 12 ? 9.140   -1.953 -0.733  1.00 0.00 ? 12 GLU A CA   19 
ATOM 7022 C C    . GLU A 1 12 ? 8.009   -1.554 0.224   1.00 0.00 ? 12 GLU A C    19 
ATOM 7023 O O    . GLU A 1 12 ? 6.851   -1.832 -0.099  1.00 0.00 ? 12 GLU A O    19 
ATOM 7024 C CB   . GLU A 1 12 ? 9.989   -3.098 -0.158  1.00 0.00 ? 12 GLU A CB   19 
ATOM 7025 C CG   . GLU A 1 12 ? 9.169   -4.341 0.189   1.00 0.00 ? 12 GLU A CG   19 
ATOM 7026 C CD   . GLU A 1 12 ? 8.497   -5.099 -0.980  1.00 0.00 ? 12 GLU A CD   19 
ATOM 7027 O OE1  . GLU A 1 12 ? 8.128   -6.254 -0.847  1.00 0.00 ? 12 GLU A OE1  19 
ATOM 7028 O OE2  . GLU A 1 12 ? 8.335   -4.485 -2.174  1.00 0.00 ? 12 GLU A OE2  19 
ATOM 7029 H H    . GLU A 1 12 ? 10.916  -0.839 -0.915  1.00 0.00 ? 12 GLU A H    19 
ATOM 7030 H HE2  . GLU A 1 12 ? 7.880   -5.179 -2.735  1.00 0.00 ? 12 GLU A HE2  19 
ATOM 7031 N N    . GLU A 1 13 ? 8.347   -0.755 1.242   1.00 0.00 ? 13 GLU A N    19 
ATOM 7032 C CA   . GLU A 1 13 ? 7.385   -0.231 2.224   1.00 0.00 ? 13 GLU A CA   19 
ATOM 7033 C C    . GLU A 1 13 ? 6.132   0.364  1.541   1.00 0.00 ? 13 GLU A C    19 
ATOM 7034 O O    . GLU A 1 13 ? 5.014   -0.046 1.870   1.00 0.00 ? 13 GLU A O    19 
ATOM 7035 C CB   . GLU A 1 13 ? 8.081   0.768  3.178   1.00 0.00 ? 13 GLU A CB   19 
ATOM 7036 C CG   . GLU A 1 13 ? 7.980   2.251  2.820   1.00 0.00 ? 13 GLU A CG   19 
ATOM 7037 C CD   . GLU A 1 13 ? 9.094   3.147  3.363   1.00 0.00 ? 13 GLU A CD   19 
ATOM 7038 O OE1  . GLU A 1 13 ? 9.788   2.866  4.334   1.00 0.00 ? 13 GLU A OE1  19 
ATOM 7039 O OE2  . GLU A 1 13 ? 9.319   4.278  2.678   1.00 0.00 ? 13 GLU A OE2  19 
ATOM 7040 H H    . GLU A 1 13 ? 9.302   -0.558 1.453   1.00 0.00 ? 13 GLU A H    19 
ATOM 7041 H HE2  . GLU A 1 13 ? 10.141  4.658  3.094   1.00 0.00 ? 13 GLU A HE2  19 
ATOM 7042 N N    . LEU A 1 14 ? 6.359   1.006  0.391   1.00 0.00 ? 14 LEU A N    19 
ATOM 7043 C CA   . LEU A 1 14 ? 5.298   1.619  -0.426  1.00 0.00 ? 14 LEU A CA   19 
ATOM 7044 C C    . LEU A 1 14 ? 4.346   0.546  -0.930  1.00 0.00 ? 14 LEU A C    19 
ATOM 7045 O O    . LEU A 1 14 ? 3.221   0.514  -0.439  1.00 0.00 ? 14 LEU A O    19 
ATOM 7046 C CB   . LEU A 1 14 ? 5.835   2.400  -1.634  1.00 0.00 ? 14 LEU A CB   19 
ATOM 7047 C CG   . LEU A 1 14 ? 6.888   3.459  -1.291  1.00 0.00 ? 14 LEU A CG   19 
ATOM 7048 C CD1  . LEU A 1 14 ? 7.289   4.184  -2.569  1.00 0.00 ? 14 LEU A CD1  19 
ATOM 7049 C CD2  . LEU A 1 14 ? 6.455   4.449  -0.209  1.00 0.00 ? 14 LEU A CD2  19 
ATOM 7050 H H    . LEU A 1 14 ? 7.270   1.023  -0.015  1.00 0.00 ? 14 LEU A H    19 
ATOM 7051 N N    . LEU A 1 15 ? 4.839   -0.407 -1.721  1.00 0.00 ? 15 LEU A N    19 
ATOM 7052 C CA   . LEU A 1 15 ? 4.040   -1.526 -2.262  1.00 0.00 ? 15 LEU A CA   19 
ATOM 7053 C C    . LEU A 1 15 ? 3.317   -2.312 -1.155  1.00 0.00 ? 15 LEU A C    19 
ATOM 7054 O O    . LEU A 1 15 ? 2.094   -2.364 -1.181  1.00 0.00 ? 15 LEU A O    19 
ATOM 7055 C CB   . LEU A 1 15 ? 4.882   -2.485 -3.092  1.00 0.00 ? 15 LEU A CB   19 
ATOM 7056 C CG   . LEU A 1 15 ? 5.872   -1.806 -4.055  1.00 0.00 ? 15 LEU A CG   19 
ATOM 7057 C CD1  . LEU A 1 15 ? 6.511   -2.886 -4.921  1.00 0.00 ? 15 LEU A CD1  19 
ATOM 7058 C CD2  . LEU A 1 15 ? 5.245   -0.730 -4.960  1.00 0.00 ? 15 LEU A CD2  19 
ATOM 7059 H H    . LEU A 1 15 ? 5.777   -0.362 -2.050  1.00 0.00 ? 15 LEU A H    19 
ATOM 7060 N N    . SER A 1 16 ? 4.058   -2.700 -0.111  1.00 0.00 ? 16 SER A N    19 
ATOM 7061 C CA   . SER A 1 16 ? 3.526   -3.372 1.107   1.00 0.00 ? 16 SER A CA   19 
ATOM 7062 C C    . SER A 1 16 ? 2.251   -2.694 1.644   1.00 0.00 ? 16 SER A C    19 
ATOM 7063 O O    . SER A 1 16 ? 1.265   -3.346 2.004   1.00 0.00 ? 16 SER A O    19 
ATOM 7064 C CB   . SER A 1 16 ? 4.561   -3.333 2.231   1.00 0.00 ? 16 SER A CB   19 
ATOM 7065 O OG   . SER A 1 16 ? 5.859   -3.699 1.768   1.00 0.00 ? 16 SER A OG   19 
ATOM 7066 H H    . SER A 1 16 ? 5.060   -2.592 -0.111  1.00 0.00 ? 16 SER A H    19 
ATOM 7067 H HG   . SER A 1 16 ? 6.534   -3.381 2.425   1.00 0.00 ? 16 SER A HG   19 
ATOM 7068 N N    . LYS A 1 17 ? 2.278   -1.364 1.577   1.00 0.00 ? 17 LYS A N    19 
ATOM 7069 C CA   . LYS A 1 17 ? 1.174   -0.466 1.962   1.00 0.00 ? 17 LYS A CA   19 
ATOM 7070 C C    . LYS A 1 17 ? 0.173   -0.186 0.837   1.00 0.00 ? 17 LYS A C    19 
ATOM 7071 O O    . LYS A 1 17 ? -1.023  -0.395 1.000   1.00 0.00 ? 17 LYS A O    19 
ATOM 7072 C CB   . LYS A 1 17 ? 1.774   0.832  2.523   1.00 0.00 ? 17 LYS A CB   19 
ATOM 7073 C CG   . LYS A 1 17 ? 2.572   0.525  3.800   1.00 0.00 ? 17 LYS A CG   19 
ATOM 7074 C CD   . LYS A 1 17 ? 3.539   1.636  4.212   1.00 0.00 ? 17 LYS A CD   19 
ATOM 7075 C CE   . LYS A 1 17 ? 2.835   2.821  4.880   1.00 0.00 ? 17 LYS A CE   19 
ATOM 7076 N NZ   . LYS A 1 17 ? 3.878   3.648  5.486   1.00 0.00 ? 17 LYS A NZ   19 
ATOM 7077 H H    . LYS A 1 17 ? 3.108   -0.895 1.277   1.00 0.00 ? 17 LYS A H    19 
ATOM 7078 H HZ1  . LYS A 1 17 ? 4.445   3.080  6.077   1.00 0.00 ? 17 LYS A HZ1  19 
ATOM 7079 H HZ2  . LYS A 1 17 ? 4.437   4.055  4.764   1.00 0.00 ? 17 LYS A HZ2  19 
ATOM 7080 H HZ3  . LYS A 1 17 ? 3.451   4.375  6.021   1.00 0.00 ? 17 LYS A HZ3  19 
ATOM 7081 N N    . ASN A 1 18 ? 0.645   0.152  -0.352  1.00 0.00 ? 18 ASN A N    19 
ATOM 7082 C CA   . ASN A 1 18 ? -0.168  0.360  -1.571  1.00 0.00 ? 18 ASN A CA   19 
ATOM 7083 C C    . ASN A 1 18 ? -1.076  -0.847 -1.886  1.00 0.00 ? 18 ASN A C    19 
ATOM 7084 O O    . ASN A 1 18 ? -2.258  -0.673 -2.206  1.00 0.00 ? 18 ASN A O    19 
ATOM 7085 C CB   . ASN A 1 18 ? 0.778   0.678  -2.728  1.00 0.00 ? 18 ASN A CB   19 
ATOM 7086 C CG   . ASN A 1 18 ? 0.149   1.676  -3.700  1.00 0.00 ? 18 ASN A CG   19 
ATOM 7087 O OD1  . ASN A 1 18 ? -0.116  1.386  -4.862  1.00 0.00 ? 18 ASN A OD1  19 
ATOM 7088 N ND2  . ASN A 1 18 ? -0.058  2.892  -3.244  1.00 0.00 ? 18 ASN A ND2  19 
ATOM 7089 H H    . ASN A 1 18 ? 1.638   0.321  -0.467  1.00 0.00 ? 18 ASN A H    19 
ATOM 7090 H HD21 . ASN A 1 18 ? 0.143   3.131  -2.308  1.00 0.00 ? 18 ASN A HD21 19 
ATOM 7091 H HD22 . ASN A 1 18 ? -0.476  3.537  -3.890  1.00 0.00 ? 18 ASN A HD22 19 
ATOM 7092 N N    . TYR A 1 19 ? -0.580  -2.035 -1.560  1.00 0.00 ? 19 TYR A N    19 
ATOM 7093 C CA   . TYR A 1 19 ? -1.333  -3.312 -1.593  1.00 0.00 ? 19 TYR A CA   19 
ATOM 7094 C C    . TYR A 1 19 ? -2.504  -3.337 -0.587  1.00 0.00 ? 19 TYR A C    19 
ATOM 7095 O O    . TYR A 1 19 ? -3.651  -3.522 -0.996  1.00 0.00 ? 19 TYR A O    19 
ATOM 7096 C CB   . TYR A 1 19 ? -0.393  -4.505 -1.369  1.00 0.00 ? 19 TYR A CB   19 
ATOM 7097 C CG   . TYR A 1 19 ? 0.484   -4.852 -2.579  1.00 0.00 ? 19 TYR A CG   19 
ATOM 7098 C CD1  . TYR A 1 19 ? -0.096  -4.967 -3.866  1.00 0.00 ? 19 TYR A CD1  19 
ATOM 7099 C CD2  . TYR A 1 19 ? 1.858   -5.093 -2.383  1.00 0.00 ? 19 TYR A CD2  19 
ATOM 7100 C CE1  . TYR A 1 19 ? 0.707   -5.320 -4.962  1.00 0.00 ? 19 TYR A CE1  19 
ATOM 7101 C CE2  . TYR A 1 19 ? 2.675   -5.438 -3.473  1.00 0.00 ? 19 TYR A CE2  19 
ATOM 7102 C CZ   . TYR A 1 19 ? 2.081   -5.543 -4.756  1.00 0.00 ? 19 TYR A CZ   19 
ATOM 7103 O OH   . TYR A 1 19 ? 2.869   -5.833 -5.821  1.00 0.00 ? 19 TYR A OH   19 
ATOM 7104 H H    . TYR A 1 19 ? 0.386   -2.134 -1.303  1.00 0.00 ? 19 TYR A H    19 
ATOM 7105 H HH   . TYR A 1 19 ? 2.293   -5.950 -6.637  1.00 0.00 ? 19 TYR A HH   19 
ATOM 7106 N N    . HIS A 1 20 ? -2.240  -2.950 0.669   1.00 0.00 ? 20 HIS A N    19 
ATOM 7107 C CA   . HIS A 1 20 ? -3.298  -2.837 1.696   1.00 0.00 ? 20 HIS A CA   19 
ATOM 7108 C C    . HIS A 1 20 ? -4.238  -1.635 1.477   1.00 0.00 ? 20 HIS A C    19 
ATOM 7109 O O    . HIS A 1 20 ? -5.373  -1.608 1.965   1.00 0.00 ? 20 HIS A O    19 
ATOM 7110 C CB   . HIS A 1 20 ? -2.736  -2.892 3.131   1.00 0.00 ? 20 HIS A CB   19 
ATOM 7111 C CG   . HIS A 1 20 ? -1.974  -1.695 3.716   1.00 0.00 ? 20 HIS A CG   19 
ATOM 7112 N ND1  . HIS A 1 20 ? -0.974  -1.770 4.585   1.00 0.00 ? 20 HIS A ND1  19 
ATOM 7113 C CD2  . HIS A 1 20 ? -2.289  -0.400 3.618   1.00 0.00 ? 20 HIS A CD2  19 
ATOM 7114 C CE1  . HIS A 1 20 ? -0.682  -0.542 5.013   1.00 0.00 ? 20 HIS A CE1  19 
ATOM 7115 N NE2  . HIS A 1 20 ? -1.460  0.304  4.363   1.00 0.00 ? 20 HIS A NE2  19 
ATOM 7116 H H    . HIS A 1 20 ? -1.337  -2.629 0.945   1.00 0.00 ? 20 HIS A H    19 
ATOM 7117 H HD1  . HIS A 1 20 ? -0.481  -2.599 4.836   1.00 0.00 ? 20 HIS A HD1  19 
ATOM 7118 H HE2  . HIS A 1 20 ? -1.252  1.277  4.225   1.00 0.00 ? 20 HIS A HE2  19 
ATOM 7119 N N    . LEU A 1 21 ? -3.791  -0.667 0.679   1.00 0.00 ? 21 LEU A N    19 
ATOM 7120 C CA   . LEU A 1 21 ? -4.539  0.554  0.326   1.00 0.00 ? 21 LEU A CA   19 
ATOM 7121 C C    . LEU A 1 21 ? -5.745  0.245  -0.575  1.00 0.00 ? 21 LEU A C    19 
ATOM 7122 O O    . LEU A 1 21 ? -6.849  0.712  -0.316  1.00 0.00 ? 21 LEU A O    19 
ATOM 7123 C CB   . LEU A 1 21 ? -3.576  1.561  -0.318  1.00 0.00 ? 21 LEU A CB   19 
ATOM 7124 C CG   . LEU A 1 21 ? -4.258  2.733  -1.044  1.00 0.00 ? 21 LEU A CG   19 
ATOM 7125 C CD1  . LEU A 1 21 ? -4.927  3.708  -0.068  1.00 0.00 ? 21 LEU A CD1  19 
ATOM 7126 C CD2  . LEU A 1 21 ? -3.260  3.433  -1.961  1.00 0.00 ? 21 LEU A CD2  19 
ATOM 7127 H H    . LEU A 1 21 ? -2.866  -0.718 0.296   1.00 0.00 ? 21 LEU A H    19 
ATOM 7128 N N    . GLU A 1 22 ? -5.503  -0.604 -1.566  1.00 0.00 ? 22 GLU A N    19 
ATOM 7129 C CA   . GLU A 1 22 ? -6.550  -1.081 -2.488  1.00 0.00 ? 22 GLU A CA   19 
ATOM 7130 C C    . GLU A 1 22 ? -7.714  -1.762 -1.761  1.00 0.00 ? 22 GLU A C    19 
ATOM 7131 O O    . GLU A 1 22 ? -8.883  -1.545 -2.096  1.00 0.00 ? 22 GLU A O    19 
ATOM 7132 C CB   . GLU A 1 22 ? -5.954  -1.986 -3.577  1.00 0.00 ? 22 GLU A CB   19 
ATOM 7133 C CG   . GLU A 1 22 ? -4.884  -1.244 -4.377  1.00 0.00 ? 22 GLU A CG   19 
ATOM 7134 C CD   . GLU A 1 22 ? -4.642  -1.801 -5.788  1.00 0.00 ? 22 GLU A CD   19 
ATOM 7135 O OE1  . GLU A 1 22 ? -5.235  -2.774 -6.255  1.00 0.00 ? 22 GLU A OE1  19 
ATOM 7136 O OE2  . GLU A 1 22 ? -3.781  -1.096 -6.548  1.00 0.00 ? 22 GLU A OE2  19 
ATOM 7137 H H    . GLU A 1 22 ? -4.570  -0.895 -1.800  1.00 0.00 ? 22 GLU A H    19 
ATOM 7138 H HE2  . GLU A 1 22 ? -3.791  -1.581 -7.421  1.00 0.00 ? 22 GLU A HE2  19 
ATOM 7139 N N    . ASN A 1 23 ? -7.386  -2.396 -0.630  1.00 0.00 ? 23 ASN A N    19 
ATOM 7140 C CA   . ASN A 1 23 ? -8.372  -2.968 0.302   1.00 0.00 ? 23 ASN A CA   19 
ATOM 7141 C C    . ASN A 1 23 ? -9.257  -1.875 0.944   1.00 0.00 ? 23 ASN A C    19 
ATOM 7142 O O    . ASN A 1 23 ? -10.487 -1.950 0.856   1.00 0.00 ? 23 ASN A O    19 
ATOM 7143 C CB   . ASN A 1 23 ? -7.662  -3.804 1.376   1.00 0.00 ? 23 ASN A CB   19 
ATOM 7144 C CG   . ASN A 1 23 ? -8.647  -4.390 2.397   1.00 0.00 ? 23 ASN A CG   19 
ATOM 7145 O OD1  . ASN A 1 23 ? -8.563  -4.156 3.595   1.00 0.00 ? 23 ASN A OD1  19 
ATOM 7146 N ND2  . ASN A 1 23 ? -9.678  -5.050 1.924   1.00 0.00 ? 23 ASN A ND2  19 
ATOM 7147 H H    . ASN A 1 23 ? -6.431  -2.460 -0.332  1.00 0.00 ? 23 ASN A H    19 
ATOM 7148 H HD21 . ASN A 1 23 ? -9.822  -5.150 0.942   1.00 0.00 ? 23 ASN A HD21 19 
ATOM 7149 H HD22 . ASN A 1 23 ? -10.321 -5.402 2.604   1.00 0.00 ? 23 ASN A HD22 19 
ATOM 7150 N N    . GLU A 1 24 ? -8.616  -0.830 1.450   1.00 0.00 ? 24 GLU A N    19 
ATOM 7151 C CA   . GLU A 1 24 ? -9.312  0.322  2.052   1.00 0.00 ? 24 GLU A CA   19 
ATOM 7152 C C    . GLU A 1 24 ? -10.205 1.036  1.051   1.00 0.00 ? 24 GLU A C    19 
ATOM 7153 O O    . GLU A 1 24 ? -11.410 0.962  1.236   1.00 0.00 ? 24 GLU A O    19 
ATOM 7154 C CB   . GLU A 1 24 ? -8.376  1.335  2.732   1.00 0.00 ? 24 GLU A CB   19 
ATOM 7155 C CG   . GLU A 1 24 ? -7.879  0.825  4.081   1.00 0.00 ? 24 GLU A CG   19 
ATOM 7156 C CD   . GLU A 1 24 ? -6.375  0.556  4.057   1.00 0.00 ? 24 GLU A CD   19 
ATOM 7157 O OE1  . GLU A 1 24 ? -5.565  1.350  3.596   1.00 0.00 ? 24 GLU A OE1  19 
ATOM 7158 O OE2  . GLU A 1 24 ? -5.964  -0.582 4.648   1.00 0.00 ? 24 GLU A OE2  19 
ATOM 7159 H H    . GLU A 1 24 ? -7.619  -0.731 1.380   1.00 0.00 ? 24 GLU A H    19 
ATOM 7160 H HE2  . GLU A 1 24 ? -4.997  -0.629 4.428   1.00 0.00 ? 24 GLU A HE2  19 
ATOM 7161 N N    . VAL A 1 25 ? -9.649  1.517  -0.063  1.00 0.00 ? 25 VAL A N    19 
ATOM 7162 C CA   . VAL A 1 25 ? -10.379 2.124  -1.198  1.00 0.00 ? 25 VAL A CA   19 
ATOM 7163 C C    . VAL A 1 25 ? -11.661 1.348  -1.568  1.00 0.00 ? 25 VAL A C    19 
ATOM 7164 O O    . VAL A 1 25 ? -12.721 1.967  -1.698  1.00 0.00 ? 25 VAL A O    19 
ATOM 7165 C CB   . VAL A 1 25 ? -9.425  2.323  -2.409  1.00 0.00 ? 25 VAL A CB   19 
ATOM 7166 C CG1  . VAL A 1 25 ? -10.135 2.828  -3.670  1.00 0.00 ? 25 VAL A CG1  19 
ATOM 7167 C CG2  . VAL A 1 25 ? -8.340  3.344  -2.057  1.00 0.00 ? 25 VAL A CG2  19 
ATOM 7168 H H    . VAL A 1 25 ? -8.649  1.588  -0.123  1.00 0.00 ? 25 VAL A H    19 
ATOM 7169 N N    . ALA A 1 26 ? -11.593 0.022  -1.505  1.00 0.00 ? 26 ALA A N    19 
ATOM 7170 C CA   . ALA A 1 26 ? -12.755 -0.873 -1.714  1.00 0.00 ? 26 ALA A CA   19 
ATOM 7171 C C    . ALA A 1 26 ? -13.811 -0.749 -0.599  1.00 0.00 ? 26 ALA A C    19 
ATOM 7172 O O    . ALA A 1 26 ? -14.883 -0.202 -0.828  1.00 0.00 ? 26 ALA A O    19 
ATOM 7173 C CB   . ALA A 1 26 ? -12.266 -2.313 -1.890  1.00 0.00 ? 26 ALA A CB   19 
ATOM 7174 H H    . ALA A 1 26 ? -10.740 -0.436 -1.259  1.00 0.00 ? 26 ALA A H    19 
ATOM 7175 N N    . ARG A 1 27 ? -13.455 -1.161 0.624   1.00 0.00 ? 27 ARG A N    19 
ATOM 7176 C CA   . ARG A 1 27 ? -14.316 -1.029 1.835   1.00 0.00 ? 27 ARG A CA   19 
ATOM 7177 C C    . ARG A 1 27 ? -14.838 0.409  2.037   1.00 0.00 ? 27 ARG A C    19 
ATOM 7178 O O    . ARG A 1 27 ? -16.016 0.610  2.302   1.00 0.00 ? 27 ARG A O    19 
ATOM 7179 C CB   . ARG A 1 27 ? -13.591 -1.492 3.104   1.00 0.00 ? 27 ARG A CB   19 
ATOM 7180 C CG   . ARG A 1 27 ? -13.165 -2.964 3.005   1.00 0.00 ? 27 ARG A CG   19 
ATOM 7181 C CD   . ARG A 1 27 ? -13.651 -3.832 4.166   1.00 0.00 ? 27 ARG A CD   19 
ATOM 7182 N NE   . ARG A 1 27 ? -13.840 -5.153 3.535   1.00 0.00 ? 27 ARG A NE   19 
ATOM 7183 C CZ   . ARG A 1 27 ? -13.270 -6.314 3.856   1.00 0.00 ? 27 ARG A CZ   19 
ATOM 7184 N NH1  . ARG A 1 27 ? -13.051 -6.701 5.094   1.00 0.00 ? 27 ARG A NH1  19 
ATOM 7185 N NH2  . ARG A 1 27 ? -12.495 -6.856 2.922   1.00 0.00 ? 27 ARG A NH2  19 
ATOM 7186 H H    . ARG A 1 27 ? -12.569 -1.601 0.796   1.00 0.00 ? 27 ARG A H    19 
ATOM 7187 H HE   . ARG A 1 27 ? -14.653 -5.196 2.953   1.00 0.00 ? 27 ARG A HE   19 
ATOM 7188 H HH11 . ARG A 1 27 ? -13.496 -6.218 5.852   1.00 0.00 ? 27 ARG A HH11 19 
ATOM 7189 H HH12 . ARG A 1 27 ? -12.570 -7.559 5.270   1.00 0.00 ? 27 ARG A HH12 19 
ATOM 7190 H HH21 . ARG A 1 27 ? -12.404 -6.394 2.041   1.00 0.00 ? 27 ARG A HH21 19 
ATOM 7191 H HH22 . ARG A 1 27 ? -12.009 -7.709 3.110   1.00 0.00 ? 27 ARG A HH22 19 
ATOM 7192 N N    . LEU A 1 28 ? -13.968 1.372  1.726   1.00 0.00 ? 28 LEU A N    19 
ATOM 7193 C CA   . LEU A 1 28 ? -14.249 2.815  1.649   1.00 0.00 ? 28 LEU A CA   19 
ATOM 7194 C C    . LEU A 1 28 ? -15.367 3.136  0.656   1.00 0.00 ? 28 LEU A C    19 
ATOM 7195 O O    . LEU A 1 28 ? -16.410 3.593  1.083   1.00 0.00 ? 28 LEU A O    19 
ATOM 7196 C CB   . LEU A 1 28 ? -12.939 3.557  1.322   1.00 0.00 ? 28 LEU A CB   19 
ATOM 7197 C CG   . LEU A 1 28 ? -13.110 4.997  0.831   1.00 0.00 ? 28 LEU A CG   19 
ATOM 7198 C CD1  . LEU A 1 28 ? -13.491 5.929  1.981   1.00 0.00 ? 28 LEU A CD1  19 
ATOM 7199 C CD2  . LEU A 1 28 ? -11.836 5.494  0.154   1.00 0.00 ? 28 LEU A CD2  19 
ATOM 7200 H H    . LEU A 1 28 ? -13.020 1.132  1.505   1.00 0.00 ? 28 LEU A H    19 
ATOM 7201 N N    . LYS A 1 29 ? -15.190 2.766  -0.618  1.00 0.00 ? 29 LYS A N    19 
ATOM 7202 C CA   . LYS A 1 29 ? -16.205 3.023  -1.659  1.00 0.00 ? 29 LYS A CA   19 
ATOM 7203 C C    . LYS A 1 29 ? -17.556 2.325  -1.373  1.00 0.00 ? 29 LYS A C    19 
ATOM 7204 O O    . LYS A 1 29 ? -18.606 2.817  -1.773  1.00 0.00 ? 29 LYS A O    19 
ATOM 7205 C CB   . LYS A 1 29 ? -15.597 2.631  -3.006  1.00 0.00 ? 29 LYS A CB   19 
ATOM 7206 C CG   . LYS A 1 29 ? -16.163 3.513  -4.119  1.00 0.00 ? 29 LYS A CG   19 
ATOM 7207 C CD   . LYS A 1 29 ? -15.040 3.957  -5.062  1.00 0.00 ? 29 LYS A CD   19 
ATOM 7208 C CE   . LYS A 1 29 ? -15.560 4.876  -6.180  1.00 0.00 ? 29 LYS A CE   19 
ATOM 7209 N NZ   . LYS A 1 29 ? -16.084 6.131  -5.638  1.00 0.00 ? 29 LYS A NZ   19 
ATOM 7210 H H    . LYS A 1 29 ? -14.330 2.367  -0.948  1.00 0.00 ? 29 LYS A H    19 
ATOM 7211 H HZ1  . LYS A 1 29 ? -16.819 5.943  -4.992  1.00 0.00 ? 29 LYS A HZ1  19 
ATOM 7212 H HZ2  . LYS A 1 29 ? -15.340 6.635  -5.178  1.00 0.00 ? 29 LYS A HZ2  19 
ATOM 7213 H HZ3  . LYS A 1 29 ? -16.428 6.696  -6.386  1.00 0.00 ? 29 LYS A HZ3  19 
ATOM 7214 N N    . LYS A 1 30 ? -17.502 1.284  -0.550  1.00 0.00 ? 30 LYS A N    19 
ATOM 7215 C CA   . LYS A 1 30 ? -18.690 0.579  -0.011  1.00 0.00 ? 30 LYS A CA   19 
ATOM 7216 C C    . LYS A 1 30 ? -19.300 1.208  1.252   1.00 0.00 ? 30 LYS A C    19 
ATOM 7217 O O    . LYS A 1 30 ? -20.509 1.130  1.467   1.00 0.00 ? 30 LYS A O    19 
ATOM 7218 C CB   . LYS A 1 30 ? -18.324 -0.892 0.205   1.00 0.00 ? 30 LYS A CB   19 
ATOM 7219 C CG   . LYS A 1 30 ? -18.288 -1.632 -1.146  1.00 0.00 ? 30 LYS A CG   19 
ATOM 7220 C CD   . LYS A 1 30 ? -17.195 -2.692 -1.230  1.00 0.00 ? 30 LYS A CD   19 
ATOM 7221 C CE   . LYS A 1 30 ? -17.358 -3.854 -0.251  1.00 0.00 ? 30 LYS A CE   19 
ATOM 7222 N NZ   . LYS A 1 30 ? -16.174 -4.710 -0.331  1.00 0.00 ? 30 LYS A NZ   19 
ATOM 7223 H H    . LYS A 1 30 ? -16.626 0.879  -0.295  1.00 0.00 ? 30 LYS A H    19 
ATOM 7224 H HZ1  . LYS A 1 30 ? -15.357 -4.155 -0.155  1.00 0.00 ? 30 LYS A HZ1  19 
ATOM 7225 H HZ2  . LYS A 1 30 ? -16.246 -5.440 0.352   1.00 0.00 ? 30 LYS A HZ2  19 
ATOM 7226 H HZ3  . LYS A 1 30 ? -16.118 -5.131 -1.238  1.00 0.00 ? 30 LYS A HZ3  19 
ATOM 7227 N N    . LEU A 1 31 ? -18.479 1.894  2.052   1.00 0.00 ? 31 LEU A N    19 
ATOM 7228 C CA   . LEU A 1 31 ? -18.896 2.672  3.234   1.00 0.00 ? 31 LEU A CA   19 
ATOM 7229 C C    . LEU A 1 31 ? -19.276 4.132  2.912   1.00 0.00 ? 31 LEU A C    19 
ATOM 7230 O O    . LEU A 1 31 ? -20.071 4.748  3.623   1.00 0.00 ? 31 LEU A O    19 
ATOM 7231 C CB   . LEU A 1 31 ? -17.829 2.476  4.334   1.00 0.00 ? 31 LEU A CB   19 
ATOM 7232 C CG   . LEU A 1 31 ? -16.919 3.666  4.681   1.00 0.00 ? 31 LEU A CG   19 
ATOM 7233 C CD1  . LEU A 1 31 ? -17.543 4.522  5.795   1.00 0.00 ? 31 LEU A CD1  19 
ATOM 7234 C CD2  . LEU A 1 31 ? -15.540 3.175  5.133   1.00 0.00 ? 31 LEU A CD2  19 
ATOM 7235 H H    . LEU A 1 31 ? -17.484 1.831  1.926   1.00 0.00 ? 31 LEU A H    19 
ATOM 7236 N N    . VAL A 1 32 ? -18.813 4.614  1.750   1.00 0.00 ? 32 VAL A N    19 
ATOM 7237 C CA   . VAL A 1 32 ? -19.133 5.938  1.154   1.00 0.00 ? 32 VAL A CA   19 
ATOM 7238 C C    . VAL A 1 32 ? -20.617 6.058  0.777   1.00 0.00 ? 32 VAL A C    19 
ATOM 7239 O O    . VAL A 1 32 ? -21.151 7.163  0.773   1.00 0.00 ? 32 VAL A O    19 
ATOM 7240 C CB   . VAL A 1 32 ? -18.179 6.214  -0.031  1.00 0.00 ? 32 VAL A CB   19 
ATOM 7241 C CG1  . VAL A 1 32 ? -18.622 7.326  -0.999  1.00 0.00 ? 32 VAL A CG1  19 
ATOM 7242 C CG2  . VAL A 1 32 ? -16.822 6.638  0.511   1.00 0.00 ? 32 VAL A CG2  19 
ATOM 7243 H H    . VAL A 1 32 ? -18.120 4.092  1.243   1.00 0.00 ? 32 VAL A H    19 
ATOM 7244 N N    . GLY A 1 33 ? -21.246 4.910  0.486   1.00 0.00 ? 33 GLY A N    19 
ATOM 7245 C CA   . GLY A 1 33 ? -22.693 4.812  0.201   1.00 0.00 ? 33 GLY A CA   19 
ATOM 7246 C C    . GLY A 1 33 ? -23.533 5.623  1.203   1.00 0.00 ? 33 GLY A C    19 
ATOM 7247 O O    . GLY A 1 33 ? -24.504 6.285  0.827   1.00 0.00 ? 33 GLY A O    19 
ATOM 7248 H H    . GLY A 1 33 ? -20.742 4.054  0.448   1.00 0.00 ? 33 GLY A H    19 
ATOM 7249 N N    . GLU A 1 34 ? -23.104 5.557  2.463   1.00 0.00 ? 34 GLU A N    19 
ATOM 7250 C CA   . GLU A 1 34 ? -23.691 6.361  3.548   1.00 0.00 ? 34 GLU A CA   19 
ATOM 7251 C C    . GLU A 1 34 ? -22.572 7.207  4.186   1.00 0.00 ? 34 GLU A C    19 
ATOM 7252 O O    . GLU A 1 34 ? -22.005 8.045  3.486   1.00 0.00 ? 34 GLU A O    19 
ATOM 7253 C CB   . GLU A 1 34 ? -24.456 5.463  4.546   1.00 0.00 ? 34 GLU A CB   19 
ATOM 7254 C CG   . GLU A 1 34 ? -25.668 4.725  3.958   1.00 0.00 ? 34 GLU A CG   19 
ATOM 7255 C CD   . GLU A 1 34 ? -25.273 3.619  2.985   1.00 0.00 ? 34 GLU A CD   19 
ATOM 7256 O OE1  . GLU A 1 34 ? -24.458 2.743  3.268   1.00 0.00 ? 34 GLU A OE1  19 
ATOM 7257 O OE2  . GLU A 1 34 ? -25.839 3.651  1.764   1.00 0.00 ? 34 GLU A OE2  19 
ATOM 7258 H H    . GLU A 1 34 ? -22.241 5.108  2.692   1.00 0.00 ? 34 GLU A H    19 
ATOM 7259 H HE2  . GLU A 1 34 ? -25.374 2.916  1.264   1.00 0.00 ? 34 GLU A HE2  19 
ATOM 7260 N N    . ARG A 1 35 ? -22.155 6.856  5.404   1.00 0.00 ? 35 ARG A N    19 
ATOM 7261 C CA   . ARG A 1 35 ? -21.173 7.547  6.284   1.00 0.00 ? 35 ARG A CA   19 
ATOM 7262 C C    . ARG A 1 35 ? -21.298 7.147  7.769   1.00 0.00 ? 35 ARG A C    19 
ATOM 7263 O O    . ARG A 1 35 ? -22.290 6.446  8.094   1.00 0.00 ? 35 ARG A O    19 
ATOM 7264 C CB   . ARG A 1 35 ? -21.222 9.089  6.179   1.00 0.00 ? 35 ARG A CB   19 
ATOM 7265 C CG   . ARG A 1 35 ? -22.606 9.685  6.400   1.00 0.00 ? 35 ARG A CG   19 
ATOM 7266 C CD   . ARG A 1 35 ? -22.749 10.965 5.552   1.00 0.00 ? 35 ARG A CD   19 
ATOM 7267 N NE   . ARG A 1 35 ? -24.080 11.611 5.574   1.00 0.00 ? 35 ARG A NE   19 
ATOM 7268 C CZ   . ARG A 1 35 ? -25.000 11.621 6.546   1.00 0.00 ? 35 ARG A CZ   19 
ATOM 7269 N NH1  . ARG A 1 35 ? -24.709 11.460 7.828   1.00 0.00 ? 35 ARG A NH1  19 
ATOM 7270 N NH2  . ARG A 1 35 ? -26.254 11.373 6.206   1.00 0.00 ? 35 ARG A NH2  19 
ATOM 7271 O OXT  . ARG A 1 35 ? -20.389 7.490  8.555   1.00 0.00 ? 35 ARG A OXT  19 
ATOM 7272 H H    . ARG A 1 35 ? -22.490 5.985  5.770   1.00 0.00 ? 35 ARG A H    19 
ATOM 7273 H HE   . ARG A 1 35 ? -24.161 12.352 4.910   1.00 0.00 ? 35 ARG A HE   19 
ATOM 7274 H HH11 . ARG A 1 35 ? -23.739 11.437 8.093   1.00 0.00 ? 35 ARG A HH11 19 
ATOM 7275 H HH12 . ARG A 1 35 ? -25.425 11.432 8.515   1.00 0.00 ? 35 ARG A HH12 19 
ATOM 7276 H HH21 . ARG A 1 35 ? -26.465 11.157 5.248   1.00 0.00 ? 35 ARG A HH21 19 
ATOM 7277 H HH22 . ARG A 1 35 ? -26.971 11.345 6.893   1.00 0.00 ? 35 ARG A HH22 19 
ATOM 7278 N N    . LEU A 1 1  ? 26.198  5.862  5.622   1.00 0.00 ? 1  LEU A N    20 
ATOM 7279 C CA   . LEU A 1 1  ? 25.665  4.829  4.685   1.00 0.00 ? 1  LEU A CA   20 
ATOM 7280 C C    . LEU A 1 1  ? 24.127  4.812  4.517   1.00 0.00 ? 1  LEU A C    20 
ATOM 7281 O O    . LEU A 1 1  ? 23.498  3.850  4.069   1.00 0.00 ? 1  LEU A O    20 
ATOM 7282 C CB   . LEU A 1 1  ? 26.220  3.443  5.063   1.00 0.00 ? 1  LEU A CB   20 
ATOM 7283 C CG   . LEU A 1 1  ? 25.669  2.913  6.395   1.00 0.00 ? 1  LEU A CG   20 
ATOM 7284 C CD1  . LEU A 1 1  ? 25.032  1.543  6.165   1.00 0.00 ? 1  LEU A CD1  20 
ATOM 7285 C CD2  . LEU A 1 1  ? 26.785  2.798  7.439   1.00 0.00 ? 1  LEU A CD2  20 
ATOM 7286 H H1   . LEU A 1 1  ? 25.805  5.725  6.540   1.00 0.00 ? 1  LEU A H1   20 
ATOM 7287 H H2   . LEU A 1 1  ? 27.182  5.751  5.687   1.00 0.00 ? 1  LEU A H2   20 
ATOM 7288 H H3   . LEU A 1 1  ? 26.014  6.784  5.301   1.00 0.00 ? 1  LEU A H3   20 
ATOM 7289 N N    . GLN A 1 2  ? 23.565  6.009  4.695   1.00 0.00 ? 2  GLN A N    20 
ATOM 7290 C CA   . GLN A 1 2  ? 22.124  6.295  4.612   1.00 0.00 ? 2  GLN A CA   20 
ATOM 7291 C C    . GLN A 1 2  ? 21.689  6.523  3.149   1.00 0.00 ? 2  GLN A C    20 
ATOM 7292 O O    . GLN A 1 2  ? 20.906  7.414  2.826   1.00 0.00 ? 2  GLN A O    20 
ATOM 7293 C CB   . GLN A 1 2  ? 21.832  7.531  5.464   1.00 0.00 ? 2  GLN A CB   20 
ATOM 7294 C CG   . GLN A 1 2  ? 22.105  7.312  6.960   1.00 0.00 ? 2  GLN A CG   20 
ATOM 7295 C CD   . GLN A 1 2  ? 21.978  8.640  7.708   1.00 0.00 ? 2  GLN A CD   20 
ATOM 7296 O OE1  . GLN A 1 2  ? 22.930  9.177  8.255   1.00 0.00 ? 2  GLN A OE1  20 
ATOM 7297 N NE2  . GLN A 1 2  ? 20.806  9.238  7.666   1.00 0.00 ? 2  GLN A NE2  20 
ATOM 7298 H H    . GLN A 1 2  ? 24.137  6.791  4.914   1.00 0.00 ? 2  GLN A H    20 
ATOM 7299 H HE21 . GLN A 1 2  ? 20.067  8.870  7.128   1.00 0.00 ? 2  GLN A HE21 20 
ATOM 7300 H HE22 . GLN A 1 2  ? 20.732  10.103 8.156   1.00 0.00 ? 2  GLN A HE22 20 
ATOM 7301 N N    . ARG A 1 3  ? 22.035  5.532  2.341   1.00 0.00 ? 3  ARG A N    20 
ATOM 7302 C CA   . ARG A 1 3  ? 21.782  5.467  0.890   1.00 0.00 ? 3  ARG A CA   20 
ATOM 7303 C C    . ARG A 1 3  ? 21.810  4.001  0.460   1.00 0.00 ? 3  ARG A C    20 
ATOM 7304 O O    . ARG A 1 3  ? 22.550  3.210  1.054   1.00 0.00 ? 3  ARG A O    20 
ATOM 7305 C CB   . ARG A 1 3  ? 22.849  6.277  0.126   1.00 0.00 ? 3  ARG A CB   20 
ATOM 7306 C CG   . ARG A 1 3  ? 24.280  5.761  0.337   1.00 0.00 ? 3  ARG A CG   20 
ATOM 7307 C CD   . ARG A 1 3  ? 25.146  6.050  -0.898  1.00 0.00 ? 3  ARG A CD   20 
ATOM 7308 N NE   . ARG A 1 3  ? 26.037  7.196  -0.640  1.00 0.00 ? 3  ARG A NE   20 
ATOM 7309 C CZ   . ARG A 1 3  ? 25.679  8.477  -0.544  1.00 0.00 ? 3  ARG A CZ   20 
ATOM 7310 N NH1  . ARG A 1 3  ? 24.544  8.944  -1.043  1.00 0.00 ? 3  ARG A NH1  20 
ATOM 7311 N NH2  . ARG A 1 3  ? 26.200  9.171  0.455   1.00 0.00 ? 3  ARG A NH2  20 
ATOM 7312 H H    . ARG A 1 3  ? 22.581  4.763  2.698   1.00 0.00 ? 3  ARG A H    20 
ATOM 7313 H HE   . ARG A 1 3  ? 27.010  7.000  -0.760  1.00 0.00 ? 3  ARG A HE   20 
ATOM 7314 H HH11 . ARG A 1 3  ? 23.995  8.352  -1.620  1.00 0.00 ? 3  ARG A HH11 20 
ATOM 7315 H HH12 . ARG A 1 3  ? 24.285  9.896  -0.901  1.00 0.00 ? 3  ARG A HH12 20 
ATOM 7316 H HH21 . ARG A 1 3  ? 26.825  8.719  1.097   1.00 0.00 ? 3  ARG A HH21 20 
ATOM 7317 H HH22 . ARG A 1 3  ? 25.948  10.126 0.591   1.00 0.00 ? 3  ARG A HH22 20 
ATOM 7318 N N    . MET A 1 4  ? 20.790  3.630  -0.310  1.00 0.00 ? 4  MET A N    20 
ATOM 7319 C CA   . MET A 1 4  ? 20.572  2.259  -0.831  1.00 0.00 ? 4  MET A CA   20 
ATOM 7320 C C    . MET A 1 4  ? 20.062  1.245  0.208   1.00 0.00 ? 4  MET A C    20 
ATOM 7321 O O    . MET A 1 4  ? 19.297  0.349  -0.140  1.00 0.00 ? 4  MET A O    20 
ATOM 7322 C CB   . MET A 1 4  ? 21.819  1.717  -1.559  1.00 0.00 ? 4  MET A CB   20 
ATOM 7323 C CG   . MET A 1 4  ? 21.491  1.168  -2.943  1.00 0.00 ? 4  MET A CG   20 
ATOM 7324 S SD   . MET A 1 4  ? 20.526  2.284  -4.046  1.00 0.00 ? 4  MET A SD   20 
ATOM 7325 C CE   . MET A 1 4  ? 21.407  3.837  -3.934  1.00 0.00 ? 4  MET A CE   20 
ATOM 7326 H H    . MET A 1 4  ? 20.078  4.288  -0.542  1.00 0.00 ? 4  MET A H    20 
ATOM 7327 N N    . LYS A 1 5  ? 20.296  1.566  1.468   1.00 0.00 ? 5  LYS A N    20 
ATOM 7328 C CA   . LYS A 1 5  ? 19.818  0.772  2.623   1.00 0.00 ? 5  LYS A CA   20 
ATOM 7329 C C    . LYS A 1 5  ? 18.346  1.084  2.971   1.00 0.00 ? 5  LYS A C    20 
ATOM 7330 O O    . LYS A 1 5  ? 17.574  0.167  3.240   1.00 0.00 ? 5  LYS A O    20 
ATOM 7331 C CB   . LYS A 1 5  ? 20.778  1.009  3.798   1.00 0.00 ? 5  LYS A CB   20 
ATOM 7332 C CG   . LYS A 1 5  ? 20.430  0.111  4.996   1.00 0.00 ? 5  LYS A CG   20 
ATOM 7333 C CD   . LYS A 1 5  ? 20.084  0.970  6.212   1.00 0.00 ? 5  LYS A CD   20 
ATOM 7334 C CE   . LYS A 1 5  ? 21.348  1.371  6.975   1.00 0.00 ? 5  LYS A CE   20 
ATOM 7335 N NZ   . LYS A 1 5  ? 21.109  2.611  7.719   1.00 0.00 ? 5  LYS A NZ   20 
ATOM 7336 H H    . LYS A 1 5  ? 20.937  2.302  1.676   1.00 0.00 ? 5  LYS A H    20 
ATOM 7337 H HZ1  . LYS A 1 5  ? 20.266  2.539  8.245   1.00 0.00 ? 5  LYS A HZ1  20 
ATOM 7338 H HZ2  . LYS A 1 5  ? 21.886  2.759  8.348   1.00 0.00 ? 5  LYS A HZ2  20 
ATOM 7339 H HZ3  . LYS A 1 5  ? 21.065  3.377  7.080   1.00 0.00 ? 5  LYS A HZ3  20 
ATOM 7340 N N    . GLN A 1 6  ? 17.961  2.355  2.853   1.00 0.00 ? 6  GLN A N    20 
ATOM 7341 C CA   . GLN A 1 6  ? 16.544  2.745  3.038   1.00 0.00 ? 6  GLN A CA   20 
ATOM 7342 C C    . GLN A 1 6  ? 15.781  2.773  1.703   1.00 0.00 ? 6  GLN A C    20 
ATOM 7343 O O    . GLN A 1 6  ? 14.581  2.546  1.715   1.00 0.00 ? 6  GLN A O    20 
ATOM 7344 C CB   . GLN A 1 6  ? 16.357  4.081  3.773   1.00 0.00 ? 6  GLN A CB   20 
ATOM 7345 C CG   . GLN A 1 6  ? 16.759  5.345  2.974   1.00 0.00 ? 6  GLN A CG   20 
ATOM 7346 C CD   . GLN A 1 6  ? 18.219  5.307  2.524   1.00 0.00 ? 6  GLN A CD   20 
ATOM 7347 O OE1  . GLN A 1 6  ? 18.535  5.137  1.359   1.00 0.00 ? 6  GLN A OE1  20 
ATOM 7348 N NE2  . GLN A 1 6  ? 19.106  5.036  3.457   1.00 0.00 ? 6  GLN A NE2  20 
ATOM 7349 H H    . GLN A 1 6  ? 18.597  3.090  2.650   1.00 0.00 ? 6  GLN A H    20 
ATOM 7350 H HE21 . GLN A 1 6  ? 18.812  4.862  4.402   1.00 0.00 ? 6  GLN A HE21 20 
ATOM 7351 H HE22 . GLN A 1 6  ? 20.059  5.110  3.196   1.00 0.00 ? 6  GLN A HE22 20 
ATOM 7352 N N    . LEU A 1 7  ? 16.477  3.005  0.583   1.00 0.00 ? 7  LEU A N    20 
ATOM 7353 C CA   . LEU A 1 7  ? 15.811  2.999  -0.741  1.00 0.00 ? 7  LEU A CA   20 
ATOM 7354 C C    . LEU A 1 7  ? 15.038  1.702  -1.006  1.00 0.00 ? 7  LEU A C    20 
ATOM 7355 O O    . LEU A 1 7  ? 13.824  1.767  -1.134  1.00 0.00 ? 7  LEU A O    20 
ATOM 7356 C CB   . LEU A 1 7  ? 16.766  3.365  -1.881  1.00 0.00 ? 7  LEU A CB   20 
ATOM 7357 C CG   . LEU A 1 7  ? 17.413  4.742  -1.681  1.00 0.00 ? 7  LEU A CG   20 
ATOM 7358 C CD1  . LEU A 1 7  ? 18.284  5.087  -2.886  1.00 0.00 ? 7  LEU A CD1  20 
ATOM 7359 C CD2  . LEU A 1 7  ? 16.407  5.887  -1.473  1.00 0.00 ? 7  LEU A CD2  20 
ATOM 7360 H H    . LEU A 1 7  ? 17.390  3.382  0.582   1.00 0.00 ? 7  LEU A H    20 
ATOM 7361 N N    . GLU A 1 8  ? 15.654  0.580  -0.642  1.00 0.00 ? 8  GLU A N    20 
ATOM 7362 C CA   . GLU A 1 8  ? 14.983  -0.749 -0.680  1.00 0.00 ? 8  GLU A CA   20 
ATOM 7363 C C    . GLU A 1 8  ? 13.783  -0.864 0.287   1.00 0.00 ? 8  GLU A C    20 
ATOM 7364 O O    . GLU A 1 8  ? 12.676  -1.178 -0.156  1.00 0.00 ? 8  GLU A O    20 
ATOM 7365 C CB   . GLU A 1 8  ? 16.010  -1.870 -0.494  1.00 0.00 ? 8  GLU A CB   20 
ATOM 7366 C CG   . GLU A 1 8  ? 16.767  -1.804 0.847   1.00 0.00 ? 8  GLU A CG   20 
ATOM 7367 C CD   . GLU A 1 8  ? 18.085  -2.575 0.828   1.00 0.00 ? 8  GLU A CD   20 
ATOM 7368 O OE1  . GLU A 1 8  ? 18.486  -3.220 1.782   1.00 0.00 ? 8  GLU A OE1  20 
ATOM 7369 O OE2  . GLU A 1 8  ? 18.822  -2.500 -0.306  1.00 0.00 ? 8  GLU A OE2  20 
ATOM 7370 H H    . GLU A 1 8  ? 16.611  0.573  -0.349  1.00 0.00 ? 8  GLU A H    20 
ATOM 7371 H HE2  . GLU A 1 8  ? 19.673  -2.959 -0.066  1.00 0.00 ? 8  GLU A HE2  20 
ATOM 7372 N N    . ASP A 1 9  ? 13.935  -0.270 1.463   1.00 0.00 ? 9  ASP A N    20 
ATOM 7373 C CA   . ASP A 1 9  ? 12.906  -0.281 2.533   1.00 0.00 ? 9  ASP A CA   20 
ATOM 7374 C C    . ASP A 1 9  ? 11.770  0.746  2.282   1.00 0.00 ? 9  ASP A C    20 
ATOM 7375 O O    . ASP A 1 9  ? 10.710  0.651  2.906   1.00 0.00 ? 9  ASP A O    20 
ATOM 7376 C CB   . ASP A 1 9  ? 13.623  -0.010 3.863   1.00 0.00 ? 9  ASP A CB   20 
ATOM 7377 C CG   . ASP A 1 9  ? 13.003  -0.764 5.039   1.00 0.00 ? 9  ASP A CG   20 
ATOM 7378 O OD1  . ASP A 1 9  ? 12.456  -1.853 4.921   1.00 0.00 ? 9  ASP A OD1  20 
ATOM 7379 O OD2  . ASP A 1 9  ? 13.174  -0.217 6.259   1.00 0.00 ? 9  ASP A OD2  20 
ATOM 7380 H H    . ASP A 1 9  ? 14.723  0.314  1.665   1.00 0.00 ? 9  ASP A H    20 
ATOM 7381 H HD2  . ASP A 1 9  ? 12.730  -0.867 6.866   1.00 0.00 ? 9  ASP A HD2  20 
ATOM 7382 N N    . LYS A 1 10 ? 12.009  1.692  1.385   1.00 0.00 ? 10 LYS A N    20 
ATOM 7383 C CA   . LYS A 1 10 ? 11.014  2.705  0.957   1.00 0.00 ? 10 LYS A CA   20 
ATOM 7384 C C    . LYS A 1 10 ? 10.346  2.346  -0.391  1.00 0.00 ? 10 LYS A C    20 
ATOM 7385 O O    . LYS A 1 10 ? 9.167   2.602  -0.579  1.00 0.00 ? 10 LYS A O    20 
ATOM 7386 C CB   . LYS A 1 10 ? 11.642  4.115  1.017   1.00 0.00 ? 10 LYS A CB   20 
ATOM 7387 C CG   . LYS A 1 10 ? 12.371  4.615  -0.236  1.00 0.00 ? 10 LYS A CG   20 
ATOM 7388 C CD   . LYS A 1 10 ? 11.416  5.395  -1.133  1.00 0.00 ? 10 LYS A CD   20 
ATOM 7389 C CE   . LYS A 1 10 ? 11.859  5.406  -2.598  1.00 0.00 ? 10 LYS A CE   20 
ATOM 7390 N NZ   . LYS A 1 10 ? 10.835  6.099  -3.394  1.00 0.00 ? 10 LYS A NZ   20 
ATOM 7391 H H    . LYS A 1 10 ? 12.942  1.872  1.074   1.00 0.00 ? 10 LYS A H    20 
ATOM 7392 H HZ1  . LYS A 1 10 ? 9.925   5.766  -3.158  1.00 0.00 ? 10 LYS A HZ1  20 
ATOM 7393 H HZ2  . LYS A 1 10 ? 10.905  7.079  -3.231  1.00 0.00 ? 10 LYS A HZ2  20 
ATOM 7394 H HZ3  . LYS A 1 10 ? 11.007  5.918  -4.367  1.00 0.00 ? 10 LYS A HZ3  20 
ATOM 7395 N N    . VAL A 1 11 ? 11.098  1.687  -1.278  1.00 0.00 ? 11 VAL A N    20 
ATOM 7396 C CA   . VAL A 1 11 ? 10.619  1.149  -2.572  1.00 0.00 ? 11 VAL A CA   20 
ATOM 7397 C C    . VAL A 1 11 ? 9.674   -0.054 -2.339  1.00 0.00 ? 11 VAL A C    20 
ATOM 7398 O O    . VAL A 1 11 ? 8.594   -0.124 -2.916  1.00 0.00 ? 11 VAL A O    20 
ATOM 7399 C CB   . VAL A 1 11 ? 11.817  0.787  -3.483  1.00 0.00 ? 11 VAL A CB   20 
ATOM 7400 C CG1  . VAL A 1 11 ? 11.448  -0.033 -4.728  1.00 0.00 ? 11 VAL A CG1  20 
ATOM 7401 C CG2  . VAL A 1 11 ? 12.500  2.065  -3.983  1.00 0.00 ? 11 VAL A CG2  20 
ATOM 7402 H H    . VAL A 1 11 ? 12.106  1.625  -1.152  1.00 0.00 ? 11 VAL A H    20 
ATOM 7403 N N    . GLU A 1 12 ? 10.076  -0.949 -1.449  1.00 0.00 ? 12 GLU A N    20 
ATOM 7404 C CA   . GLU A 1 12 ? 9.255   -2.118 -1.073  1.00 0.00 ? 12 GLU A CA   20 
ATOM 7405 C C    . GLU A 1 12 ? 7.988   -1.724 -0.294  1.00 0.00 ? 12 GLU A C    20 
ATOM 7406 O O    . GLU A 1 12 ? 6.905   -2.252 -0.566  1.00 0.00 ? 12 GLU A O    20 
ATOM 7407 C CB   . GLU A 1 12 ? 10.081  -3.112 -0.269  1.00 0.00 ? 12 GLU A CB   20 
ATOM 7408 C CG   . GLU A 1 12 ? 11.160  -3.772 -1.149  1.00 0.00 ? 12 GLU A CG   20 
ATOM 7409 C CD   . GLU A 1 12 ? 12.212  -4.449 -0.273  1.00 0.00 ? 12 GLU A CD   20 
ATOM 7410 O OE1  . GLU A 1 12 ? 13.413  -4.225 -0.391  1.00 0.00 ? 12 GLU A OE1  20 
ATOM 7411 O OE2  . GLU A 1 12 ? 11.765  -5.290 0.683   1.00 0.00 ? 12 GLU A OE2  20 
ATOM 7412 H H    . GLU A 1 12 ? 10.982  -0.903 -1.018  1.00 0.00 ? 12 GLU A H    20 
ATOM 7413 H HE2  . GLU A 1 12 ? 12.597  -5.583 1.157   1.00 0.00 ? 12 GLU A HE2  20 
ATOM 7414 N N    . GLU A 1 13 ? 8.138   -0.670 0.513   1.00 0.00 ? 13 GLU A N    20 
ATOM 7415 C CA   . GLU A 1 13 ? 7.022   -0.059 1.258   1.00 0.00 ? 13 GLU A CA   20 
ATOM 7416 C C    . GLU A 1 13 ? 5.919   0.500  0.335   1.00 0.00 ? 13 GLU A C    20 
ATOM 7417 O O    . GLU A 1 13 ? 4.766   0.584  0.747   1.00 0.00 ? 13 GLU A O    20 
ATOM 7418 C CB   . GLU A 1 13 ? 7.561   1.038  2.184   1.00 0.00 ? 13 GLU A CB   20 
ATOM 7419 C CG   . GLU A 1 13 ? 6.864   1.003  3.557   1.00 0.00 ? 13 GLU A CG   20 
ATOM 7420 C CD   . GLU A 1 13 ? 7.107   -0.283 4.349   1.00 0.00 ? 13 GLU A CD   20 
ATOM 7421 O OE1  . GLU A 1 13 ? 8.082   -1.023 4.200   1.00 0.00 ? 13 GLU A OE1  20 
ATOM 7422 O OE2  . GLU A 1 13 ? 6.137   -0.653 5.214   1.00 0.00 ? 13 GLU A OE2  20 
ATOM 7423 H H    . GLU A 1 13 ? 9.026   -0.281 0.717   1.00 0.00 ? 13 GLU A H    20 
ATOM 7424 H HE2  . GLU A 1 13 ? 6.520   -1.458 5.658   1.00 0.00 ? 13 GLU A HE2  20 
ATOM 7425 N N    . LEU A 1 14 ? 6.269   0.755  -0.922  1.00 0.00 ? 14 LEU A N    20 
ATOM 7426 C CA   . LEU A 1 14 ? 5.309   1.192  -1.947  1.00 0.00 ? 14 LEU A CA   20 
ATOM 7427 C C    . LEU A 1 14 ? 4.349   0.051  -2.304  1.00 0.00 ? 14 LEU A C    20 
ATOM 7428 O O    . LEU A 1 14 ? 3.162   0.191  -2.069  1.00 0.00 ? 14 LEU A O    20 
ATOM 7429 C CB   . LEU A 1 14 ? 5.973   1.694  -3.236  1.00 0.00 ? 14 LEU A CB   20 
ATOM 7430 C CG   . LEU A 1 14 ? 7.015   2.790  -3.008  1.00 0.00 ? 14 LEU A CG   20 
ATOM 7431 C CD1  . LEU A 1 14 ? 7.580   3.209  -4.362  1.00 0.00 ? 14 LEU A CD1  20 
ATOM 7432 C CD2  . LEU A 1 14 ? 6.496   4.006  -2.234  1.00 0.00 ? 14 LEU A CD2  20 
ATOM 7433 H H    . LEU A 1 14 ? 7.205   0.627  -1.245  1.00 0.00 ? 14 LEU A H    20 
ATOM 7434 N N    . LEU A 1 15 ? 4.878   -1.076 -2.787  1.00 0.00 ? 15 LEU A N    20 
ATOM 7435 C CA   . LEU A 1 15 ? 4.063   -2.259 -3.149  1.00 0.00 ? 15 LEU A CA   20 
ATOM 7436 C C    . LEU A 1 15 ? 3.267   -2.783 -1.948  1.00 0.00 ? 15 LEU A C    20 
ATOM 7437 O O    . LEU A 1 15 ? 2.047   -2.760 -2.009  1.00 0.00 ? 15 LEU A O    20 
ATOM 7438 C CB   . LEU A 1 15 ? 4.901   -3.384 -3.763  1.00 0.00 ? 15 LEU A CB   20 
ATOM 7439 C CG   . LEU A 1 15 ? 5.936   -2.916 -4.804  1.00 0.00 ? 15 LEU A CG   20 
ATOM 7440 C CD1  . LEU A 1 15 ? 6.564   -4.154 -5.445  1.00 0.00 ? 15 LEU A CD1  20 
ATOM 7441 C CD2  . LEU A 1 15 ? 5.383   -2.000 -5.902  1.00 0.00 ? 15 LEU A CD2  20 
ATOM 7442 H H    . LEU A 1 15 ? 5.835   -1.115 -3.080  1.00 0.00 ? 15 LEU A H    20 
ATOM 7443 N N    . SER A 1 16 ? 3.937   -2.976 -0.812  1.00 0.00 ? 16 SER A N    20 
ATOM 7444 C CA   . SER A 1 16 ? 3.266   -3.394 0.447   1.00 0.00 ? 16 SER A CA   20 
ATOM 7445 C C    . SER A 1 16 ? 2.094   -2.466 0.838   1.00 0.00 ? 16 SER A C    20 
ATOM 7446 O O    . SER A 1 16 ? 1.055   -2.942 1.284   1.00 0.00 ? 16 SER A O    20 
ATOM 7447 C CB   . SER A 1 16 ? 4.254   -3.498 1.619   1.00 0.00 ? 16 SER A CB   20 
ATOM 7448 O OG   . SER A 1 16 ? 4.764   -2.209 1.954   1.00 0.00 ? 16 SER A OG   20 
ATOM 7449 H H    . SER A 1 16 ? 4.933   -2.853 -0.751  1.00 0.00 ? 16 SER A H    20 
ATOM 7450 H HG   . SER A 1 16 ? 5.149   -2.223 2.874   1.00 0.00 ? 16 SER A HG   20 
ATOM 7451 N N    . LYS A 1 17 ? 2.250   -1.183 0.517   1.00 0.00 ? 17 LYS A N    20 
ATOM 7452 C CA   . LYS A 1 17 ? 1.180   -0.167 0.631   1.00 0.00 ? 17 LYS A CA   20 
ATOM 7453 C C    . LYS A 1 17 ? 0.137   -0.235 -0.493  1.00 0.00 ? 17 LYS A C    20 
ATOM 7454 O O    . LYS A 1 17 ? -1.048  -0.389 -0.221  1.00 0.00 ? 17 LYS A O    20 
ATOM 7455 C CB   . LYS A 1 17 ? 1.779   1.254  0.756   1.00 0.00 ? 17 LYS A CB   20 
ATOM 7456 C CG   . LYS A 1 17 ? 0.713   2.353  0.821   1.00 0.00 ? 17 LYS A CG   20 
ATOM 7457 C CD   . LYS A 1 17 ? 1.144   3.531  1.703   1.00 0.00 ? 17 LYS A CD   20 
ATOM 7458 C CE   . LYS A 1 17 ? 1.892   4.631  0.948   1.00 0.00 ? 17 LYS A CE   20 
ATOM 7459 N NZ   . LYS A 1 17 ? 0.934   5.478  0.230   1.00 0.00 ? 17 LYS A NZ   20 
ATOM 7460 H H    . LYS A 1 17 ? 3.141   -0.825 0.228   1.00 0.00 ? 17 LYS A H    20 
ATOM 7461 H HZ1  . LYS A 1 17 ? 0.287   5.871  0.880   1.00 0.00 ? 17 LYS A HZ1  20 
ATOM 7462 H HZ2  . LYS A 1 17 ? 1.433   6.229  -0.215  1.00 0.00 ? 17 LYS A HZ2  20 
ATOM 7463 H HZ3  . LYS A 1 17 ? 0.455   4.962  -0.467  1.00 0.00 ? 17 LYS A HZ3  20 
ATOM 7464 N N    . ASN A 1 18 ? 0.557   -0.095 -1.744  1.00 0.00 ? 18 ASN A N    20 
ATOM 7465 C CA   . ASN A 1 18 ? -0.321  -0.137 -2.928  1.00 0.00 ? 18 ASN A CA   20 
ATOM 7466 C C    . ASN A 1 18 ? -1.224  -1.389 -2.960  1.00 0.00 ? 18 ASN A C    20 
ATOM 7467 O O    . ASN A 1 18 ? -2.418  -1.311 -3.272  1.00 0.00 ? 18 ASN A O    20 
ATOM 7468 C CB   . ASN A 1 18 ? 0.546   -0.016 -4.176  1.00 0.00 ? 18 ASN A CB   20 
ATOM 7469 C CG   . ASN A 1 18 ? -0.179  0.792  -5.260  1.00 0.00 ? 18 ASN A CG   20 
ATOM 7470 O OD1  . ASN A 1 18 ? -0.572  0.288  -6.298  1.00 0.00 ? 18 ASN A OD1  20 
ATOM 7471 N ND2  . ASN A 1 18 ? -0.362  2.067  -5.015  1.00 0.00 ? 18 ASN A ND2  20 
ATOM 7472 H H    . ASN A 1 18 ? 1.538   0.063  -1.924  1.00 0.00 ? 18 ASN A H    20 
ATOM 7473 H HD21 . ASN A 1 18 ? -0.070  2.485  -4.165  1.00 0.00 ? 18 ASN A HD21 20 
ATOM 7474 H HD22 . ASN A 1 18 ? -0.839  2.579  -5.732  1.00 0.00 ? 18 ASN A HD22 20 
ATOM 7475 N N    . TYR A 1 19 ? -0.697  -2.466 -2.383  1.00 0.00 ? 19 TYR A N    20 
ATOM 7476 C CA   . TYR A 1 19 ? -1.411  -3.734 -2.135  1.00 0.00 ? 19 TYR A CA   20 
ATOM 7477 C C    . TYR A 1 19 ? -2.477  -3.619 -1.033  1.00 0.00 ? 19 TYR A C    20 
ATOM 7478 O O    . TYR A 1 19 ? -3.632  -3.988 -1.263  1.00 0.00 ? 19 TYR A O    20 
ATOM 7479 C CB   . TYR A 1 19 ? -0.399  -4.836 -1.821  1.00 0.00 ? 19 TYR A CB   20 
ATOM 7480 C CG   . TYR A 1 19 ? 0.429   -5.343 -3.014  1.00 0.00 ? 19 TYR A CG   20 
ATOM 7481 C CD1  . TYR A 1 19 ? 0.810   -4.501 -4.082  1.00 0.00 ? 19 TYR A CD1  20 
ATOM 7482 C CD2  . TYR A 1 19 ? 0.823   -6.694 -2.983  1.00 0.00 ? 19 TYR A CD2  20 
ATOM 7483 C CE1  . TYR A 1 19 ? 1.605   -5.011 -5.129  1.00 0.00 ? 19 TYR A CE1  20 
ATOM 7484 C CE2  . TYR A 1 19 ? 1.608   -7.214 -4.030  1.00 0.00 ? 19 TYR A CE2  20 
ATOM 7485 C CZ   . TYR A 1 19 ? 1.985   -6.368 -5.085  1.00 0.00 ? 19 TYR A CZ   20 
ATOM 7486 O OH   . TYR A 1 19 ? 2.762   -6.869 -6.086  1.00 0.00 ? 19 TYR A OH   20 
ATOM 7487 H H    . TYR A 1 19 ? 0.278   -2.483 -2.135  1.00 0.00 ? 19 TYR A H    20 
ATOM 7488 H HH   . TYR A 1 19 ? 2.835   -7.859 -5.985  1.00 0.00 ? 19 TYR A HH   20 
ATOM 7489 N N    . HIS A 1 20 ? -2.154  -2.977 0.086   1.00 0.00 ? 20 HIS A N    20 
ATOM 7490 C CA   . HIS A 1 20 ? -3.155  -2.680 1.140   1.00 0.00 ? 20 HIS A CA   20 
ATOM 7491 C C    . HIS A 1 20 ? -4.153  -1.576 0.736   1.00 0.00 ? 20 HIS A C    20 
ATOM 7492 O O    . HIS A 1 20 ? -5.263  -1.489 1.253   1.00 0.00 ? 20 HIS A O    20 
ATOM 7493 C CB   . HIS A 1 20 ? -2.523  -2.434 2.522   1.00 0.00 ? 20 HIS A CB   20 
ATOM 7494 C CG   . HIS A 1 20 ? -1.781  -1.116 2.794   1.00 0.00 ? 20 HIS A CG   20 
ATOM 7495 N ND1  . HIS A 1 20 ? -0.724  -0.985 3.600   1.00 0.00 ? 20 HIS A ND1  20 
ATOM 7496 C CD2  . HIS A 1 20 ? -2.161  0.123  2.472   1.00 0.00 ? 20 HIS A CD2  20 
ATOM 7497 C CE1  . HIS A 1 20 ? -0.467  0.305  3.764   1.00 0.00 ? 20 HIS A CE1  20 
ATOM 7498 N NE2  . HIS A 1 20 ? -1.327  0.990  3.029   1.00 0.00 ? 20 HIS A NE2  20 
ATOM 7499 H H    . HIS A 1 20 ? -1.254  -2.561 0.238   1.00 0.00 ? 20 HIS A H    20 
ATOM 7500 H HD1  . HIS A 1 20 ? -0.192  -1.740 3.980   1.00 0.00 ? 20 HIS A HD1  20 
ATOM 7501 H HE2  . HIS A 1 20 ? -1.194  1.931  2.713   1.00 0.00 ? 20 HIS A HE2  20 
ATOM 7502 N N    . LEU A 1 21 ? -3.763  -0.800 -0.277  1.00 0.00 ? 21 LEU A N    20 
ATOM 7503 C CA   . LEU A 1 21 ? -4.554  0.295  -0.863  1.00 0.00 ? 21 LEU A CA   20 
ATOM 7504 C C    . LEU A 1 21 ? -5.811  -0.228 -1.554  1.00 0.00 ? 21 LEU A C    20 
ATOM 7505 O O    . LEU A 1 21 ? -6.906  0.164  -1.156  1.00 0.00 ? 21 LEU A O    20 
ATOM 7506 C CB   . LEU A 1 21 ? -3.674  1.133  -1.794  1.00 0.00 ? 21 LEU A CB   20 
ATOM 7507 C CG   . LEU A 1 21 ? -4.418  2.225  -2.559  1.00 0.00 ? 21 LEU A CG   20 
ATOM 7508 C CD1  . LEU A 1 21 ? -4.788  3.410  -1.659  1.00 0.00 ? 21 LEU A CD1  20 
ATOM 7509 C CD2  . LEU A 1 21 ? -3.597  2.676  -3.767  1.00 0.00 ? 21 LEU A CD2  20 
ATOM 7510 H H    . LEU A 1 21 ? -2.845  -0.893 -0.664  1.00 0.00 ? 21 LEU A H    20 
ATOM 7511 N N    . GLU A 1 22 ? -5.664  -1.264 -2.376  1.00 0.00 ? 22 GLU A N    20 
ATOM 7512 C CA   . GLU A 1 22 ? -6.833  -1.910 -3.031  1.00 0.00 ? 22 GLU A CA   20 
ATOM 7513 C C    . GLU A 1 22 ? -7.854  -2.501 -2.031  1.00 0.00 ? 22 GLU A C    20 
ATOM 7514 O O    . GLU A 1 22 ? -9.050  -2.547 -2.310  1.00 0.00 ? 22 GLU A O    20 
ATOM 7515 C CB   . GLU A 1 22 ? -6.390  -2.964 -4.068  1.00 0.00 ? 22 GLU A CB   20 
ATOM 7516 C CG   . GLU A 1 22 ? -5.763  -4.234 -3.458  1.00 0.00 ? 22 GLU A CG   20 
ATOM 7517 C CD   . GLU A 1 22 ? -5.431  -5.328 -4.476  1.00 0.00 ? 22 GLU A CD   20 
ATOM 7518 O OE1  . GLU A 1 22 ? -5.004  -6.424 -4.132  1.00 0.00 ? 22 GLU A OE1  20 
ATOM 7519 O OE2  . GLU A 1 22 ? -5.622  -5.064 -5.792  1.00 0.00 ? 22 GLU A OE2  20 
ATOM 7520 H H    . GLU A 1 22 ? -4.769  -1.606 -2.642  1.00 0.00 ? 22 GLU A H    20 
ATOM 7521 H HE2  . GLU A 1 22 ? -5.327  -5.905 -6.239  1.00 0.00 ? 22 GLU A HE2  20 
ATOM 7522 N N    . ASN A 1 23 ? -7.352  -2.843 -0.850  1.00 0.00 ? 23 ASN A N    20 
ATOM 7523 C CA   . ASN A 1 23 ? -8.165  -3.365 0.260   1.00 0.00 ? 23 ASN A CA   20 
ATOM 7524 C C    . ASN A 1 23 ? -8.847  -2.218 1.046   1.00 0.00 ? 23 ASN A C    20 
ATOM 7525 O O    . ASN A 1 23 ? -10.070 -2.213 1.183   1.00 0.00 ? 23 ASN A O    20 
ATOM 7526 C CB   . ASN A 1 23 ? -7.268  -4.216 1.170   1.00 0.00 ? 23 ASN A CB   20 
ATOM 7527 C CG   . ASN A 1 23 ? -8.105  -5.177 2.015   1.00 0.00 ? 23 ASN A CG   20 
ATOM 7528 O OD1  . ASN A 1 23 ? -8.822  -4.816 2.925   1.00 0.00 ? 23 ASN A OD1  20 
ATOM 7529 N ND2  . ASN A 1 23 ? -8.042  -6.448 1.678   1.00 0.00 ? 23 ASN A ND2  20 
ATOM 7530 H H    . ASN A 1 23 ? -6.384  -2.737 -0.645  1.00 0.00 ? 23 ASN A H    20 
ATOM 7531 H HD21 . ASN A 1 23 ? -7.466  -6.756 0.932   1.00 0.00 ? 23 ASN A HD21 20 
ATOM 7532 H HD22 . ASN A 1 23 ? -8.604  -7.076 2.218   1.00 0.00 ? 23 ASN A HD22 20 
ATOM 7533 N N    . GLU A 1 24 ? -8.071  -1.185 1.391   1.00 0.00 ? 24 GLU A N    20 
ATOM 7534 C CA   . GLU A 1 24 ? -8.603  0.012  2.082   1.00 0.00 ? 24 GLU A CA   20 
ATOM 7535 C C    . GLU A 1 24 ? -9.620  0.784  1.224   1.00 0.00 ? 24 GLU A C    20 
ATOM 7536 O O    . GLU A 1 24 ? -10.734 0.981  1.696   1.00 0.00 ? 24 GLU A O    20 
ATOM 7537 C CB   . GLU A 1 24 ? -7.510  0.924  2.657   1.00 0.00 ? 24 GLU A CB   20 
ATOM 7538 C CG   . GLU A 1 24 ? -6.759  1.754  1.604   1.00 0.00 ? 24 GLU A CG   20 
ATOM 7539 C CD   . GLU A 1 24 ? -5.802  2.787  2.167   1.00 0.00 ? 24 GLU A CD   20 
ATOM 7540 O OE1  . GLU A 1 24 ? -4.864  2.509  2.909   1.00 0.00 ? 24 GLU A OE1  20 
ATOM 7541 O OE2  . GLU A 1 24 ? -5.953  4.046  1.698   1.00 0.00 ? 24 GLU A OE2  20 
ATOM 7542 H H    . GLU A 1 24 ? -7.071  -1.209 1.269   1.00 0.00 ? 24 GLU A H    20 
ATOM 7543 H HE2  . GLU A 1 24 ? -5.231  4.555  2.161   1.00 0.00 ? 24 GLU A HE2  20 
ATOM 7544 N N    . VAL A 1 25 ? -9.299  1.027  -0.053  1.00 0.00 ? 25 VAL A N    20 
ATOM 7545 C CA   . VAL A 1 25 ? -10.170 1.664  -1.063  1.00 0.00 ? 25 VAL A CA   20 
ATOM 7546 C C    . VAL A 1 25 ? -11.552 0.989  -1.122  1.00 0.00 ? 25 VAL A C    20 
ATOM 7547 O O    . VAL A 1 25 ? -12.561 1.684  -1.208  1.00 0.00 ? 25 VAL A O    20 
ATOM 7548 C CB   . VAL A 1 25 ? -9.481  1.735  -2.442  1.00 0.00 ? 25 VAL A CB   20 
ATOM 7549 C CG1  . VAL A 1 25 ? -10.390 2.197  -3.584  1.00 0.00 ? 25 VAL A CG1  20 
ATOM 7550 C CG2  . VAL A 1 25 ? -8.326  2.726  -2.386  1.00 0.00 ? 25 VAL A CG2  20 
ATOM 7551 H H    . VAL A 1 25 ? -8.365  0.862  -0.381  1.00 0.00 ? 25 VAL A H    20 
ATOM 7552 N N    . ALA A 1 26 ? -11.566 -0.325 -0.909  1.00 0.00 ? 26 ALA A N    20 
ATOM 7553 C CA   . ALA A 1 26 ? -12.806 -1.101 -0.791  1.00 0.00 ? 26 ALA A CA   20 
ATOM 7554 C C    . ALA A 1 26 ? -13.627 -0.618 0.428   1.00 0.00 ? 26 ALA A C    20 
ATOM 7555 O O    . ALA A 1 26 ? -14.531 0.196  0.233   1.00 0.00 ? 26 ALA A O    20 
ATOM 7556 C CB   . ALA A 1 26 ? -12.506 -2.598 -0.756  1.00 0.00 ? 26 ALA A CB   20 
ATOM 7557 H H    . ALA A 1 26 ? -10.729 -0.831 -0.720  1.00 0.00 ? 26 ALA A H    20 
ATOM 7558 N N    . ARG A 1 27 ? -13.185 -0.902 1.648   1.00 0.00 ? 27 ARG A N    20 
ATOM 7559 C CA   . ARG A 1 27 ? -13.850 -0.423 2.876   1.00 0.00 ? 27 ARG A CA   20 
ATOM 7560 C C    . ARG A 1 27 ? -14.152 1.087  2.891   1.00 0.00 ? 27 ARG A C    20 
ATOM 7561 O O    . ARG A 1 27 ? -15.234 1.515  3.273   1.00 0.00 ? 27 ARG A O    20 
ATOM 7562 C CB   . ARG A 1 27 ? -13.014 -0.850 4.093   1.00 0.00 ? 27 ARG A CB   20 
ATOM 7563 C CG   . ARG A 1 27 ? -13.722 -0.601 5.431   1.00 0.00 ? 27 ARG A CG   20 
ATOM 7564 C CD   . ARG A 1 27 ? -15.042 -1.377 5.556   1.00 0.00 ? 27 ARG A CD   20 
ATOM 7565 N NE   . ARG A 1 27 ? -15.150 -1.733 6.974   1.00 0.00 ? 27 ARG A NE   20 
ATOM 7566 C CZ   . ARG A 1 27 ? -16.251 -2.042 7.655   1.00 0.00 ? 27 ARG A CZ   20 
ATOM 7567 N NH1  . ARG A 1 27 ? -17.393 -2.367 7.081   1.00 0.00 ? 27 ARG A NH1  20 
ATOM 7568 N NH2  . ARG A 1 27 ? -16.315 -1.610 8.911   1.00 0.00 ? 27 ARG A NH2  20 
ATOM 7569 H H    . ARG A 1 27 ? -12.407 -1.520 1.786   1.00 0.00 ? 27 ARG A H    20 
ATOM 7570 H HE   . ARG A 1 27 ? -14.277 -1.970 7.395   1.00 0.00 ? 27 ARG A HE   20 
ATOM 7571 H HH11 . ARG A 1 27 ? -17.425 -2.490 6.089   1.00 0.00 ? 27 ARG A HH11 20 
ATOM 7572 H HH12 . ARG A 1 27 ? -18.198 -2.553 7.641   1.00 0.00 ? 27 ARG A HH12 20 
ATOM 7573 H HH21 . ARG A 1 27 ? -15.587 -1.012 9.254   1.00 0.00 ? 27 ARG A HH21 20 
ATOM 7574 H HH22 . ARG A 1 27 ? -17.110 -1.815 9.473   1.00 0.00 ? 27 ARG A HH22 20 
ATOM 7575 N N    . LEU A 1 28 ? -13.225 1.852  2.309   1.00 0.00 ? 28 LEU A N    20 
ATOM 7576 C CA   . LEU A 1 28 ? -13.354 3.293  2.034   1.00 0.00 ? 28 LEU A CA   20 
ATOM 7577 C C    . LEU A 1 28 ? -14.596 3.624  1.183   1.00 0.00 ? 28 LEU A C    20 
ATOM 7578 O O    . LEU A 1 28 ? -15.513 4.290  1.661   1.00 0.00 ? 28 LEU A O    20 
ATOM 7579 C CB   . LEU A 1 28 ? -12.033 3.785  1.422   1.00 0.00 ? 28 LEU A CB   20 
ATOM 7580 C CG   . LEU A 1 28 ? -12.127 5.095  0.644   1.00 0.00 ? 28 LEU A CG   20 
ATOM 7581 C CD1  . LEU A 1 28 ? -12.348 6.286  1.579   1.00 0.00 ? 28 LEU A CD1  20 
ATOM 7582 C CD2  . LEU A 1 28 ? -10.865 5.332  -0.190  1.00 0.00 ? 28 LEU A CD2  20 
ATOM 7583 H H    . LEU A 1 28 ? -12.348 1.458  2.016   1.00 0.00 ? 28 LEU A H    20 
ATOM 7584 N N    . LYS A 1 29 ? -14.664 3.115  -0.049  1.00 0.00 ? 29 LYS A N    20 
ATOM 7585 C CA   . LYS A 1 29 ? -15.834 3.356  -0.911  1.00 0.00 ? 29 LYS A CA   20 
ATOM 7586 C C    . LYS A 1 29 ? -17.130 2.730  -0.347  1.00 0.00 ? 29 LYS A C    20 
ATOM 7587 O O    . LYS A 1 29 ? -18.213 3.244  -0.591  1.00 0.00 ? 29 LYS A O    20 
ATOM 7588 C CB   . LYS A 1 29 ? -15.520 3.049  -2.381  1.00 0.00 ? 29 LYS A CB   20 
ATOM 7589 C CG   . LYS A 1 29 ? -16.270 1.891  -3.056  1.00 0.00 ? 29 LYS A CG   20 
ATOM 7590 C CD   . LYS A 1 29 ? -15.773 0.558  -2.504  1.00 0.00 ? 29 LYS A CD   20 
ATOM 7591 C CE   . LYS A 1 29 ? -16.313 -0.658 -3.244  1.00 0.00 ? 29 LYS A CE   20 
ATOM 7592 N NZ   . LYS A 1 29 ? -15.188 -1.606 -3.271  1.00 0.00 ? 29 LYS A NZ   20 
ATOM 7593 H H    . LYS A 1 29 ? -13.930 2.550  -0.445  1.00 0.00 ? 29 LYS A H    20 
ATOM 7594 H HZ1  . LYS A 1 29 ? -14.403 -1.159 -3.691  1.00 0.00 ? 29 LYS A HZ1  20 
ATOM 7595 H HZ2  . LYS A 1 29 ? -14.959 -1.861 -2.319  1.00 0.00 ? 29 LYS A HZ2  20 
ATOM 7596 H HZ3  . LYS A 1 29 ? -15.438 -2.416 -3.786  1.00 0.00 ? 29 LYS A HZ3  20 
ATOM 7597 N N    . LYS A 1 30 ? -16.993 1.715  0.517   1.00 0.00 ? 30 LYS A N    20 
ATOM 7598 C CA   . LYS A 1 30 ? -18.131 1.140  1.267   1.00 0.00 ? 30 LYS A CA   20 
ATOM 7599 C C    . LYS A 1 30 ? -18.826 2.148  2.204   1.00 0.00 ? 30 LYS A C    20 
ATOM 7600 O O    . LYS A 1 30 ? -20.021 2.005  2.484   1.00 0.00 ? 30 LYS A O    20 
ATOM 7601 C CB   . LYS A 1 30 ? -17.756 -0.106 2.079   1.00 0.00 ? 30 LYS A CB   20 
ATOM 7602 C CG   . LYS A 1 30 ? -17.947 -1.451 1.356   1.00 0.00 ? 30 LYS A CG   20 
ATOM 7603 C CD   . LYS A 1 30 ? -16.678 -1.905 0.629   1.00 0.00 ? 30 LYS A CD   20 
ATOM 7604 C CE   . LYS A 1 30 ? -16.560 -3.429 0.477   1.00 0.00 ? 30 LYS A CE   20 
ATOM 7605 N NZ   . LYS A 1 30 ? -16.933 -3.846 -0.878  1.00 0.00 ? 30 LYS A NZ   20 
ATOM 7606 H H    . LYS A 1 30 ? -16.094 1.308  0.708   1.00 0.00 ? 30 LYS A H    20 
ATOM 7607 H HZ1  . LYS A 1 30 ? -17.861 -3.548 -1.089  1.00 0.00 ? 30 LYS A HZ1  20 
ATOM 7608 H HZ2  . LYS A 1 30 ? -16.284 -3.473 -1.532  1.00 0.00 ? 30 LYS A HZ2  20 
ATOM 7609 H HZ3  . LYS A 1 30 ? -16.903 -4.848 -0.919  1.00 0.00 ? 30 LYS A HZ3  20 
ATOM 7610 N N    . LEU A 1 31 ? -18.141 3.230  2.551   1.00 0.00 ? 31 LEU A N    20 
ATOM 7611 C CA   . LEU A 1 31 ? -18.747 4.380  3.267   1.00 0.00 ? 31 LEU A CA   20 
ATOM 7612 C C    . LEU A 1 31 ? -19.851 5.101  2.445   1.00 0.00 ? 31 LEU A C    20 
ATOM 7613 O O    . LEU A 1 31 ? -20.811 5.605  3.017   1.00 0.00 ? 31 LEU A O    20 
ATOM 7614 C CB   . LEU A 1 31 ? -17.669 5.354  3.762   1.00 0.00 ? 31 LEU A CB   20 
ATOM 7615 C CG   . LEU A 1 31 ? -16.958 4.722  4.969   1.00 0.00 ? 31 LEU A CG   20 
ATOM 7616 C CD1  . LEU A 1 31 ? -15.468 4.455  4.705   1.00 0.00 ? 31 LEU A CD1  20 
ATOM 7617 C CD2  . LEU A 1 31 ? -17.054 5.635  6.181   1.00 0.00 ? 31 LEU A CD2  20 
ATOM 7618 H H    . LEU A 1 31 ? -17.155 3.333  2.353   1.00 0.00 ? 31 LEU A H    20 
ATOM 7619 N N    . VAL A 1 32 ? -19.825 4.891  1.127   1.00 0.00 ? 32 VAL A N    20 
ATOM 7620 C CA   . VAL A 1 32 ? -20.863 5.375  0.179   1.00 0.00 ? 32 VAL A CA   20 
ATOM 7621 C C    . VAL A 1 32 ? -22.023 4.346  0.025   1.00 0.00 ? 32 VAL A C    20 
ATOM 7622 O O    . VAL A 1 32 ? -22.970 4.563  -0.722  1.00 0.00 ? 32 VAL A O    20 
ATOM 7623 C CB   . VAL A 1 32 ? -20.178 5.736  -1.165  1.00 0.00 ? 32 VAL A CB   20 
ATOM 7624 C CG1  . VAL A 1 32 ? -21.129 6.301  -2.230  1.00 0.00 ? 32 VAL A CG1  20 
ATOM 7625 C CG2  . VAL A 1 32 ? -19.076 6.785  -0.959  1.00 0.00 ? 32 VAL A CG2  20 
ATOM 7626 H H    . VAL A 1 32 ? -19.100 4.352  0.689   1.00 0.00 ? 32 VAL A H    20 
ATOM 7627 N N    . GLY A 1 33 ? -21.994 3.307  0.858   1.00 0.00 ? 33 GLY A N    20 
ATOM 7628 C CA   . GLY A 1 33 ? -23.052 2.265  0.910   1.00 0.00 ? 33 GLY A CA   20 
ATOM 7629 C C    . GLY A 1 33 ? -24.089 2.567  2.006   1.00 0.00 ? 33 GLY A C    20 
ATOM 7630 O O    . GLY A 1 33 ? -25.286 2.514  1.768   1.00 0.00 ? 33 GLY A O    20 
ATOM 7631 H H    . GLY A 1 33 ? -21.216 3.149  1.456   1.00 0.00 ? 33 GLY A H    20 
ATOM 7632 N N    . GLU A 1 34 ? -23.571 2.888  3.197   1.00 0.00 ? 34 GLU A N    20 
ATOM 7633 C CA   . GLU A 1 34 ? -24.361 3.124  4.429   1.00 0.00 ? 34 GLU A CA   20 
ATOM 7634 C C    . GLU A 1 34 ? -23.528 3.748  5.570   1.00 0.00 ? 34 GLU A C    20 
ATOM 7635 O O    . GLU A 1 34 ? -23.374 3.177  6.649   1.00 0.00 ? 34 GLU A O    20 
ATOM 7636 C CB   . GLU A 1 34 ? -25.068 1.828  4.866   1.00 0.00 ? 34 GLU A CB   20 
ATOM 7637 C CG   . GLU A 1 34 ? -24.117 0.621  4.995   1.00 0.00 ? 34 GLU A CG   20 
ATOM 7638 C CD   . GLU A 1 34 ? -24.886 -0.687 5.123   1.00 0.00 ? 34 GLU A CD   20 
ATOM 7639 O OE1  . GLU A 1 34 ? -24.960 -1.315 6.167   1.00 0.00 ? 34 GLU A OE1  20 
ATOM 7640 O OE2  . GLU A 1 34 ? -25.432 -1.174 3.993   1.00 0.00 ? 34 GLU A OE2  20 
ATOM 7641 H H    . GLU A 1 34 ? -22.579 2.918  3.319   1.00 0.00 ? 34 GLU A H    20 
ATOM 7642 H HE2  . GLU A 1 34 ? -25.890 -2.009 4.292   1.00 0.00 ? 34 GLU A HE2  20 
ATOM 7643 N N    . ARG A 1 35 ? -22.982 4.932  5.322   1.00 0.00 ? 35 ARG A N    20 
ATOM 7644 C CA   . ARG A 1 35 ? -22.138 5.648  6.319   1.00 0.00 ? 35 ARG A CA   20 
ATOM 7645 C C    . ARG A 1 35 ? -22.809 5.766  7.712   1.00 0.00 ? 35 ARG A C    20 
ATOM 7646 O O    . ARG A 1 35 ? -23.939 6.278  7.765   1.00 0.00 ? 35 ARG A O    20 
ATOM 7647 C CB   . ARG A 1 35 ? -21.759 7.042  5.781   1.00 0.00 ? 35 ARG A CB   20 
ATOM 7648 C CG   . ARG A 1 35 ? -20.727 7.749  6.653   1.00 0.00 ? 35 ARG A CG   20 
ATOM 7649 C CD   . ARG A 1 35 ? -20.287 9.049  5.971   1.00 0.00 ? 35 ARG A CD   20 
ATOM 7650 N NE   . ARG A 1 35 ? -19.274 9.857  6.687   1.00 0.00 ? 35 ARG A NE   20 
ATOM 7651 C CZ   . ARG A 1 35 ? -18.007 9.529  6.964   1.00 0.00 ? 35 ARG A CZ   20 
ATOM 7652 N NH1  . ARG A 1 35 ? -17.649 8.346  7.409   1.00 0.00 ? 35 ARG A NH1  20 
ATOM 7653 N NH2  . ARG A 1 35 ? -17.062 10.197 6.326   1.00 0.00 ? 35 ARG A NH2  20 
ATOM 7654 O OXT  . ARG A 1 35 ? -22.141 5.354  8.687   1.00 0.00 ? 35 ARG A OXT  20 
ATOM 7655 H H    . ARG A 1 35 ? -23.043 5.381  4.419   1.00 0.00 ? 35 ARG A H    20 
ATOM 7656 H HE   . ARG A 1 35 ? -19.636 10.655 7.151   1.00 0.00 ? 35 ARG A HE   20 
ATOM 7657 H HH11 . ARG A 1 35 ? -18.350 7.686  7.684   1.00 0.00 ? 35 ARG A HH11 20 
ATOM 7658 H HH12 . ARG A 1 35 ? -16.686 8.129  7.541   1.00 0.00 ? 35 ARG A HH12 20 
ATOM 7659 H HH21 . ARG A 1 35 ? -17.315 10.908 5.674   1.00 0.00 ? 35 ARG A HH21 20 
ATOM 7660 H HH22 . ARG A 1 35 ? -16.098 9.950  6.461   1.00 0.00 ? 35 ARG A HH22 20 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  LEU 1  1  1  LEU LEU A . n 
A 1 2  GLN 2  2  2  GLN GLN A . n 
A 1 3  ARG 3  3  3  ARG ARG A . n 
A 1 4  MET 4  4  4  MET MET A . n 
A 1 5  LYS 5  5  5  LYS LYS A . n 
A 1 6  GLN 6  6  6  GLN GLN A . n 
A 1 7  LEU 7  7  7  LEU LEU A . n 
A 1 8  GLU 8  8  8  GLU GLU A . n 
A 1 9  ASP 9  9  9  ASP ASP A . n 
A 1 10 LYS 10 10 10 LYS LYS A . n 
A 1 11 VAL 11 11 11 VAL VAL A . n 
A 1 12 GLU 12 12 12 GLU GLU A . n 
A 1 13 GLU 13 13 13 GLU GLU A . n 
A 1 14 LEU 14 14 14 LEU LEU A . n 
A 1 15 LEU 15 15 15 LEU LEU A . n 
A 1 16 SER 16 16 16 SER SER A . n 
A 1 17 LYS 17 17 17 LYS LYS A . n 
A 1 18 ASN 18 18 18 ASN ASN A . n 
A 1 19 TYR 19 19 19 TYR TYR A . n 
A 1 20 HIS 20 20 20 HIS HIS A . n 
A 1 21 LEU 21 21 21 LEU LEU A . n 
A 1 22 GLU 22 22 22 GLU GLU A . n 
A 1 23 ASN 23 23 23 ASN ASN A . n 
A 1 24 GLU 24 24 24 GLU GLU A . n 
A 1 25 VAL 25 25 25 VAL VAL A . n 
A 1 26 ALA 26 26 26 ALA ALA A . n 
A 1 27 ARG 27 27 27 ARG ARG A . n 
A 1 28 LEU 28 28 28 LEU LEU A . n 
A 1 29 LYS 29 29 29 LYS LYS A . n 
A 1 30 LYS 30 30 30 LYS LYS A . n 
A 1 31 LEU 31 31 31 LEU LEU A . n 
A 1 32 VAL 32 32 32 VAL VAL A . n 
A 1 33 GLY 33 33 33 GLY GLY A . n 
A 1 34 GLU 34 34 34 GLU GLU A . n 
A 1 35 ARG 35 35 35 ARG ARG A . n 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1993-04-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 4  O A LEU 14 ? ? H   A ASN 18 ? ? 1.59 
2 19 O A LEU 14 ? ? H   A ASN 18 ? ? 1.59 
3 19 O A LYS 5  ? ? HE2 A GLU 8  ? ? 1.60 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1   1  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.355 1.252 0.103 0.011 N 
2   1  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.354 1.252 0.102 0.011 N 
3   1  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.350 1.252 0.098 0.011 N 
4   1  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.352 1.252 0.100 0.011 N 
5   1  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.355 1.252 0.103 0.011 N 
6   1  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.351 1.252 0.099 0.011 N 
7   2  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.347 1.252 0.095 0.011 N 
8   2  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.345 1.252 0.093 0.011 N 
9   2  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.338 1.252 0.086 0.011 N 
10  2  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.339 1.252 0.087 0.011 N 
11  2  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.341 1.252 0.089 0.011 N 
12  2  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.351 1.252 0.099 0.011 N 
13  3  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.351 1.252 0.099 0.011 N 
14  3  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.346 1.252 0.094 0.011 N 
15  3  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.349 1.252 0.097 0.011 N 
16  3  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.350 1.252 0.098 0.011 N 
17  3  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.349 1.252 0.097 0.011 N 
18  3  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.345 1.252 0.093 0.011 N 
19  4  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.343 1.252 0.091 0.011 N 
20  4  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.351 1.252 0.099 0.011 N 
21  4  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.349 1.252 0.097 0.011 N 
22  4  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.343 1.252 0.091 0.011 N 
23  4  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.353 1.252 0.101 0.011 N 
24  4  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.350 1.252 0.098 0.011 N 
25  5  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.347 1.252 0.095 0.011 N 
26  5  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.339 1.252 0.087 0.011 N 
27  5  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.343 1.252 0.091 0.011 N 
28  5  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.344 1.252 0.092 0.011 N 
29  5  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.346 1.252 0.094 0.011 N 
30  5  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.351 1.252 0.099 0.011 N 
31  6  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.354 1.252 0.102 0.011 N 
32  6  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.354 1.252 0.102 0.011 N 
33  6  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.355 1.252 0.103 0.011 N 
34  6  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.349 1.252 0.097 0.011 N 
35  6  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.345 1.252 0.093 0.011 N 
36  6  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.352 1.252 0.100 0.011 N 
37  7  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.356 1.252 0.104 0.011 N 
38  7  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.350 1.252 0.098 0.011 N 
39  7  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.343 1.252 0.091 0.011 N 
40  7  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.350 1.252 0.098 0.011 N 
41  7  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.347 1.252 0.095 0.011 N 
42  7  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.349 1.252 0.097 0.011 N 
43  8  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.361 1.252 0.109 0.011 N 
44  8  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.367 1.252 0.115 0.011 N 
45  8  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.357 1.252 0.105 0.011 N 
46  8  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.358 1.252 0.106 0.011 N 
47  8  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.346 1.252 0.094 0.011 N 
48  8  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.354 1.252 0.102 0.011 N 
49  9  CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.355 1.252 0.103 0.011 N 
50  9  CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.352 1.252 0.100 0.011 N 
51  9  CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.343 1.252 0.091 0.011 N 
52  9  CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.351 1.252 0.099 0.011 N 
53  9  CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.350 1.252 0.098 0.011 N 
54  9  CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.347 1.252 0.095 0.011 N 
55  10 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.340 1.252 0.088 0.011 N 
56  10 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.348 1.252 0.096 0.011 N 
57  10 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.353 1.252 0.101 0.011 N 
58  10 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.341 1.252 0.089 0.011 N 
59  10 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.349 1.252 0.097 0.011 N 
60  10 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.347 1.252 0.095 0.011 N 
61  11 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.341 1.252 0.089 0.011 N 
62  11 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.349 1.252 0.097 0.011 N 
63  11 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.352 1.252 0.100 0.011 N 
64  11 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.347 1.252 0.095 0.011 N 
65  11 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.354 1.252 0.102 0.011 N 
66  11 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.353 1.252 0.101 0.011 N 
67  12 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.349 1.252 0.097 0.011 N 
68  12 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.350 1.252 0.098 0.011 N 
69  12 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.350 1.252 0.098 0.011 N 
70  12 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.349 1.252 0.097 0.011 N 
71  12 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.356 1.252 0.104 0.011 N 
72  12 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.351 1.252 0.099 0.011 N 
73  13 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.345 1.252 0.093 0.011 N 
74  13 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.353 1.252 0.101 0.011 N 
75  13 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.357 1.252 0.105 0.011 N 
76  13 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.343 1.252 0.091 0.011 N 
77  13 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.347 1.252 0.095 0.011 N 
78  13 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.348 1.252 0.096 0.011 N 
79  14 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.348 1.252 0.096 0.011 N 
80  14 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.343 1.252 0.091 0.011 N 
81  14 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.352 1.252 0.100 0.011 N 
82  14 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.350 1.252 0.098 0.011 N 
83  14 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.356 1.252 0.104 0.011 N 
84  14 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.356 1.252 0.104 0.011 N 
85  15 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.346 1.252 0.094 0.011 N 
86  15 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.352 1.252 0.100 0.011 N 
87  15 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.352 1.252 0.100 0.011 N 
88  15 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.354 1.252 0.102 0.011 N 
89  15 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.348 1.252 0.096 0.011 N 
90  15 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.353 1.252 0.101 0.011 N 
91  16 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.344 1.252 0.092 0.011 N 
92  16 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.350 1.252 0.098 0.011 N 
93  16 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.345 1.252 0.093 0.011 N 
94  16 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.341 1.252 0.089 0.011 N 
95  16 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.345 1.252 0.093 0.011 N 
96  16 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.344 1.252 0.092 0.011 N 
97  17 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.349 1.252 0.097 0.011 N 
98  17 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.349 1.252 0.097 0.011 N 
99  17 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.352 1.252 0.100 0.011 N 
100 17 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.342 1.252 0.090 0.011 N 
101 17 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.351 1.252 0.099 0.011 N 
102 17 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.348 1.252 0.096 0.011 N 
103 18 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.360 1.252 0.108 0.011 N 
104 18 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.345 1.252 0.093 0.011 N 
105 18 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.344 1.252 0.092 0.011 N 
106 18 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.355 1.252 0.103 0.011 N 
107 18 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.346 1.252 0.094 0.011 N 
108 18 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.347 1.252 0.095 0.011 N 
109 19 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.348 1.252 0.096 0.011 N 
110 19 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.352 1.252 0.100 0.011 N 
111 19 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.341 1.252 0.089 0.011 N 
112 19 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.348 1.252 0.096 0.011 N 
113 19 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.347 1.252 0.095 0.011 N 
114 19 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.346 1.252 0.094 0.011 N 
115 20 CD A GLU 8  ? ? OE2 A GLU 8  ? ? 1.355 1.252 0.103 0.011 N 
116 20 CD A GLU 12 ? ? OE2 A GLU 12 ? ? 1.349 1.252 0.097 0.011 N 
117 20 CD A GLU 13 ? ? OE2 A GLU 13 ? ? 1.351 1.252 0.099 0.011 N 
118 20 CD A GLU 22 ? ? OE2 A GLU 22 ? ? 1.356 1.252 0.104 0.011 N 
119 20 CD A GLU 24 ? ? OE2 A GLU 24 ? ? 1.352 1.252 0.100 0.011 N 
120 20 CD A GLU 34 ? ? OE2 A GLU 34 ? ? 1.346 1.252 0.094 0.011 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1  NE A ARG 3  ? ? CZ A ARG 3  ? ? NH2 A ARG 3  ? ? 115.66 120.30 -4.64 0.50 N 
2  1  CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 123.74 118.30 5.44  0.90 N 
3  1  NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 117.12 120.30 -3.18 0.50 N 
4  4  NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 116.51 120.30 -3.79 0.50 N 
5  7  NE A ARG 3  ? ? CZ A ARG 3  ? ? NH1 A ARG 3  ? ? 124.12 120.30 3.82  0.50 N 
6  7  NE A ARG 3  ? ? CZ A ARG 3  ? ? NH2 A ARG 3  ? ? 117.09 120.30 -3.21 0.50 N 
7  8  CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 123.80 118.30 5.50  0.90 N 
8  8  NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.59 120.30 3.29  0.50 N 
9  8  NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 116.51 120.30 -3.79 0.50 N 
10 10 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 116.91 120.30 -3.39 0.50 N 
11 11 CB A TYR 19 ? ? CG A TYR 19 ? ? CD2 A TYR 19 ? ? 117.19 121.00 -3.81 0.60 N 
12 11 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 124.06 120.30 3.76  0.50 N 
13 11 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH2 A ARG 27 ? ? 115.84 120.30 -4.46 0.50 N 
14 12 CB A TYR 19 ? ? CG A TYR 19 ? ? CD2 A TYR 19 ? ? 116.82 121.00 -4.18 0.60 N 
15 12 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.34 120.30 3.04  0.50 N 
16 13 CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 123.93 118.30 5.63  0.90 N 
17 13 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH2 A ARG 27 ? ? 116.54 120.30 -3.76 0.50 N 
18 14 CB A TYR 19 ? ? CG A TYR 19 ? ? CD2 A TYR 19 ? ? 116.33 121.00 -4.67 0.60 N 
19 15 CB A ASP 9  ? ? CG A ASP 9  ? ? OD1 A ASP 9  ? ? 124.16 118.30 5.86  0.90 N 
20 15 CB A TYR 19 ? ? CG A TYR 19 ? ? CD2 A TYR 19 ? ? 116.90 121.00 -4.10 0.60 N 
21 15 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH2 A ARG 27 ? ? 117.00 120.30 -3.30 0.50 N 
22 15 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 115.79 120.30 -4.51 0.50 N 
23 17 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 116.28 120.30 -4.02 0.50 N 
24 19 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.66 120.30 3.36  0.50 N 
25 19 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH2 A ARG 27 ? ? 115.81 120.30 -4.49 0.50 N 
26 19 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.44 120.30 3.14  0.50 N 
27 20 NE A ARG 3  ? ? CZ A ARG 3  ? ? NH2 A ARG 3  ? ? 116.90 120.30 -3.40 0.50 N 
28 20 CB A TYR 19 ? ? CG A TYR 19 ? ? CD2 A TYR 19 ? ? 116.74 121.00 -4.26 0.60 N 
29 20 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH1 A ARG 27 ? ? 123.42 120.30 3.12  0.50 N 
30 20 NE A ARG 27 ? ? CZ A ARG 27 ? ? NH2 A ARG 27 ? ? 116.59 120.30 -3.71 0.50 N 
31 20 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH1 A ARG 35 ? ? 123.30 120.30 3.00  0.50 N 
32 20 NE A ARG 35 ? ? CZ A ARG 35 ? ? NH2 A ARG 35 ? ? 116.96 120.30 -3.34 0.50 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  ARG A 3  ? ? 60.73   79.72   
2  1  LYS A 5  ? ? 165.04  -32.16  
3  1  GLN A 6  ? ? -90.98  -62.93  
4  1  GLU A 34 ? ? -173.41 87.64   
5  3  ALA A 26 ? ? -65.64  -71.98  
6  3  GLU A 34 ? ? -175.74 81.69   
7  4  GLN A 2  ? ? 46.69   -164.81 
8  4  ARG A 3  ? ? -146.49 -145.75 
9  4  GLU A 34 ? ? -177.68 81.68   
10 5  GLN A 2  ? ? 60.25   114.25  
11 5  GLU A 34 ? ? -143.68 17.66   
12 7  GLN A 2  ? ? 37.73   41.27   
13 7  ARG A 3  ? ? -80.15  48.97   
14 7  GLU A 34 ? ? -174.95 70.96   
15 8  GLU A 34 ? ? -93.98  38.40   
16 9  GLN A 2  ? ? -61.56  96.15   
17 9  ALA A 26 ? ? -60.49  -71.98  
18 10 GLN A 2  ? ? 68.20   95.80   
19 10 ARG A 3  ? ? -173.73 137.45  
20 10 MET A 4  ? ? 75.34   -29.49  
21 10 GLU A 34 ? ? -104.92 -89.20  
22 12 ARG A 3  ? ? 179.13  72.04   
23 12 LYS A 5  ? ? 172.54  -40.48  
24 13 ARG A 3  ? ? 89.08   119.50  
25 13 GLU A 34 ? ? -118.88 -91.77  
26 14 GLN A 2  ? ? 63.81   96.51   
27 14 ARG A 3  ? ? -173.99 75.53   
28 14 LYS A 5  ? ? 167.99  -30.12  
29 15 ARG A 3  ? ? 78.84   66.89   
30 15 GLU A 34 ? ? -144.68 20.70   
31 16 GLN A 2  ? ? -155.59 46.99   
32 16 ARG A 3  ? ? 74.75   140.87  
33 17 ALA A 26 ? ? -62.09  -72.76  
34 17 GLU A 34 ? ? 92.31   82.19   
35 18 GLN A 2  ? ? 64.21   -166.39 
36 18 ARG A 3  ? ? 62.67   -148.17 
37 18 GLU A 34 ? ? -142.83 32.03   
38 19 GLN A 2  ? ? -157.76 46.60   
39 19 MET A 4  ? ? 72.45   -14.42  
40 19 GLU A 34 ? ? -122.38 -107.92 
41 20 MET A 4  ? ? 74.83   -21.36  
42 20 ALA A 26 ? ? -62.38  -71.52  
43 20 GLU A 34 ? ? -168.50 60.49   
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  2  LEU A 7 ? ? -10.52 
2  3  GLU A 8 ? ? -10.13 
3  4  MET A 4 ? ? -10.40 
4  4  GLU A 8 ? ? -10.93 
5  5  ARG A 3 ? ? -11.38 
6  6  LEU A 7 ? ? -10.83 
7  7  LEU A 7 ? ? -10.60 
8  9  LEU A 7 ? ? -10.17 
9  10 LEU A 7 ? ? -13.34 
10 17 MET A 4 ? ? -10.13 
11 18 MET A 4 ? ? -13.12 
12 19 LEU A 7 ? ? -12.67 
13 20 LEU A 7 ? ? -11.69 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1  1  ARG A 3  ? ? 0.248 'SIDE CHAIN' 
2  1  ARG A 27 ? ? 0.106 'SIDE CHAIN' 
3  1  ARG A 35 ? ? 0.215 'SIDE CHAIN' 
4  2  ARG A 3  ? ? 0.105 'SIDE CHAIN' 
5  2  ARG A 35 ? ? 0.293 'SIDE CHAIN' 
6  4  ARG A 3  ? ? 0.209 'SIDE CHAIN' 
7  4  ARG A 27 ? ? 0.164 'SIDE CHAIN' 
8  4  ARG A 35 ? ? 0.255 'SIDE CHAIN' 
9  5  ARG A 27 ? ? 0.173 'SIDE CHAIN' 
10 5  ARG A 35 ? ? 0.147 'SIDE CHAIN' 
11 6  ARG A 3  ? ? 0.122 'SIDE CHAIN' 
12 7  ARG A 3  ? ? 0.175 'SIDE CHAIN' 
13 7  ARG A 27 ? ? 0.104 'SIDE CHAIN' 
14 7  ARG A 35 ? ? 0.167 'SIDE CHAIN' 
15 8  ARG A 3  ? ? 0.157 'SIDE CHAIN' 
16 8  ARG A 27 ? ? 0.097 'SIDE CHAIN' 
17 8  ARG A 35 ? ? 0.296 'SIDE CHAIN' 
18 9  ARG A 3  ? ? 0.116 'SIDE CHAIN' 
19 9  ARG A 35 ? ? 0.073 'SIDE CHAIN' 
20 10 ARG A 3  ? ? 0.162 'SIDE CHAIN' 
21 10 ARG A 27 ? ? 0.108 'SIDE CHAIN' 
22 10 ARG A 35 ? ? 0.197 'SIDE CHAIN' 
23 11 ARG A 3  ? ? 0.263 'SIDE CHAIN' 
24 11 ARG A 27 ? ? 0.206 'SIDE CHAIN' 
25 11 ARG A 35 ? ? 0.099 'SIDE CHAIN' 
26 12 ARG A 3  ? ? 0.146 'SIDE CHAIN' 
27 12 ARG A 27 ? ? 0.181 'SIDE CHAIN' 
28 12 ARG A 35 ? ? 0.203 'SIDE CHAIN' 
29 13 ARG A 3  ? ? 0.121 'SIDE CHAIN' 
30 13 ARG A 27 ? ? 0.261 'SIDE CHAIN' 
31 14 ARG A 27 ? ? 0.101 'SIDE CHAIN' 
32 14 ARG A 35 ? ? 0.116 'SIDE CHAIN' 
33 15 ARG A 3  ? ? 0.113 'SIDE CHAIN' 
34 15 ARG A 27 ? ? 0.186 'SIDE CHAIN' 
35 15 ARG A 35 ? ? 0.319 'SIDE CHAIN' 
36 16 ARG A 3  ? ? 0.124 'SIDE CHAIN' 
37 16 ARG A 27 ? ? 0.111 'SIDE CHAIN' 
38 16 ARG A 35 ? ? 0.252 'SIDE CHAIN' 
39 17 ARG A 3  ? ? 0.101 'SIDE CHAIN' 
40 17 ARG A 27 ? ? 0.152 'SIDE CHAIN' 
41 17 ARG A 35 ? ? 0.239 'SIDE CHAIN' 
42 18 ARG A 3  ? ? 0.105 'SIDE CHAIN' 
43 18 ARG A 35 ? ? 0.311 'SIDE CHAIN' 
44 19 ARG A 27 ? ? 0.259 'SIDE CHAIN' 
45 19 ARG A 35 ? ? 0.198 'SIDE CHAIN' 
46 20 ARG A 3  ? ? 0.198 'SIDE CHAIN' 
47 20 ARG A 27 ? ? 0.164 'SIDE CHAIN' 
48 20 ARG A 35 ? ? 0.280 'SIDE CHAIN' 
#