data_1ZY3
# 
_entry.id   1ZY3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZY3         
RCSB  RCSB033254   
WWPDB D_1000033254 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1mk3 
_pdbx_database_related.details        'Bcl-w protein' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZY3 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-09 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Denisov, A.Y.' 1 
'Gehring, K.'   2 
# 
_citation.id                        primary 
_citation.title                     
'Structural Model of the BCL-w-BID Peptide Complex and Its Interactions with Phospholipid Micelles.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            45 
_citation.page_first                2250 
_citation.page_last                 2256 
_citation.year                      2006 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16475813 
_citation.pdbx_database_id_DOI      10.1021/bi052332s 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Denisov, A.Y.'   1 
primary 'Chen, G.'        2 
primary 'Sprules, T.'     3 
primary 'Moldoveanu, T.'  4 
primary 'Beauparlant, P.' 5 
primary 'Gehring, K.'     6 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Apoptosis regulator Bcl-W'                                     19659.885 1 ? P116V 'residues 2-171' ? 
2 polymer man 'BH3-peptide from BH3 interacting domain death agonist protein' 2241.615  1 ? R203K ?                ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Bcl-2-like 2 protein' 
2 BID                    
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQ
VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARR
LREGNWASVRLEHHHHHH
;
;ATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQ
VSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEVLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARR
LREGNWASVRLEHHHHHH
;
A ? 
2 'polypeptide(L)' no no IIKNIARHLAQVGDSMDRSI IIKNIARHLAQVGDSMDRSI B ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   THR n 
1 3   PRO n 
1 4   ALA n 
1 5   SER n 
1 6   ALA n 
1 7   PRO n 
1 8   ASP n 
1 9   THR n 
1 10  ARG n 
1 11  ALA n 
1 12  LEU n 
1 13  VAL n 
1 14  ALA n 
1 15  ASP n 
1 16  PHE n 
1 17  VAL n 
1 18  GLY n 
1 19  TYR n 
1 20  LYS n 
1 21  LEU n 
1 22  ARG n 
1 23  GLN n 
1 24  LYS n 
1 25  GLY n 
1 26  TYR n 
1 27  VAL n 
1 28  CYS n 
1 29  GLY n 
1 30  ALA n 
1 31  GLY n 
1 32  PRO n 
1 33  GLY n 
1 34  GLU n 
1 35  GLY n 
1 36  PRO n 
1 37  ALA n 
1 38  ALA n 
1 39  ASP n 
1 40  PRO n 
1 41  LEU n 
1 42  HIS n 
1 43  GLN n 
1 44  ALA n 
1 45  MET n 
1 46  ARG n 
1 47  ALA n 
1 48  ALA n 
1 49  GLY n 
1 50  ASP n 
1 51  GLU n 
1 52  PHE n 
1 53  GLU n 
1 54  THR n 
1 55  ARG n 
1 56  PHE n 
1 57  ARG n 
1 58  ARG n 
1 59  THR n 
1 60  PHE n 
1 61  SER n 
1 62  ASP n 
1 63  LEU n 
1 64  ALA n 
1 65  ALA n 
1 66  GLN n 
1 67  LEU n 
1 68  HIS n 
1 69  VAL n 
1 70  THR n 
1 71  PRO n 
1 72  GLY n 
1 73  SER n 
1 74  ALA n 
1 75  GLN n 
1 76  GLN n 
1 77  ARG n 
1 78  PHE n 
1 79  THR n 
1 80  GLN n 
1 81  VAL n 
1 82  SER n 
1 83  ASP n 
1 84  GLU n 
1 85  LEU n 
1 86  PHE n 
1 87  GLN n 
1 88  GLY n 
1 89  GLY n 
1 90  PRO n 
1 91  ASN n 
1 92  TRP n 
1 93  GLY n 
1 94  ARG n 
1 95  LEU n 
1 96  VAL n 
1 97  ALA n 
1 98  PHE n 
1 99  PHE n 
1 100 VAL n 
1 101 PHE n 
1 102 GLY n 
1 103 ALA n 
1 104 ALA n 
1 105 LEU n 
1 106 CYS n 
1 107 ALA n 
1 108 GLU n 
1 109 SER n 
1 110 VAL n 
1 111 ASN n 
1 112 LYS n 
1 113 GLU n 
1 114 MET n 
1 115 GLU n 
1 116 VAL n 
1 117 LEU n 
1 118 VAL n 
1 119 GLY n 
1 120 GLN n 
1 121 VAL n 
1 122 GLN n 
1 123 GLU n 
1 124 TRP n 
1 125 MET n 
1 126 VAL n 
1 127 ALA n 
1 128 TYR n 
1 129 LEU n 
1 130 GLU n 
1 131 THR n 
1 132 ARG n 
1 133 LEU n 
1 134 ALA n 
1 135 ASP n 
1 136 TRP n 
1 137 ILE n 
1 138 HIS n 
1 139 SER n 
1 140 SER n 
1 141 GLY n 
1 142 GLY n 
1 143 TRP n 
1 144 ALA n 
1 145 GLU n 
1 146 PHE n 
1 147 THR n 
1 148 ALA n 
1 149 LEU n 
1 150 TYR n 
1 151 GLY n 
1 152 ASP n 
1 153 GLY n 
1 154 ALA n 
1 155 LEU n 
1 156 GLU n 
1 157 GLU n 
1 158 ALA n 
1 159 ARG n 
1 160 ARG n 
1 161 LEU n 
1 162 ARG n 
1 163 GLU n 
1 164 GLY n 
1 165 ASN n 
1 166 TRP n 
1 167 ALA n 
1 168 SER n 
1 169 VAL n 
1 170 ARG n 
1 171 LEU n 
1 172 GLU n 
1 173 HIS n 
1 174 HIS n 
1 175 HIS n 
1 176 HIS n 
1 177 HIS n 
1 178 HIS n 
2 1   ILE n 
2 2   ILE n 
2 3   LYS n 
2 4   ASN n 
2 5   ILE n 
2 6   ALA n 
2 7   ARG n 
2 8   HIS n 
2 9   LEU n 
2 10  ALA n 
2 11  GLN n 
2 12  VAL n 
2 13  GLY n 
2 14  ASP n 
2 15  SER n 
2 16  MET n 
2 17  ASP n 
2 18  ARG n 
2 19  SER n 
2 20  ILE n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 
'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? plasmid ? ? ? pET-29b+  ? ? 
2 1 sample ? ? ? human Homo ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli BL21' 511693 Escherichia ? ? 
'Escherichia coli' ? ? BL21 ? ? ? ? ? ? ? plasmid ? ? ? pGEX-6P-1 ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
_struct_ref.pdbx_seq_one_letter_code 
1 UNP BCLW_HUMAN Q92843 1 2  ? ? 
2 UNP BID_HUMAN  P55957 2 82 ? ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 1ZY3 A 1 ? 170 ? Q92843 2  ? 171 ? 1   170 
2 2 1ZY3 B 1 ? 20  ? P55957 82 ? 101 ? 201 220 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 1ZY3 VAL A 116 ? UNP Q92843 PRO 117 ENGINEERED       116 1  
1 1ZY3 LEU A 171 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 171 2  
1 1ZY3 GLU A 172 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 172 3  
1 1ZY3 HIS A 173 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 173 4  
1 1ZY3 HIS A 174 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 174 5  
1 1ZY3 HIS A 175 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 175 6  
1 1ZY3 HIS A 176 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 176 7  
1 1ZY3 HIS A 177 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 177 8  
1 1ZY3 HIS A 178 ? UNP Q92843 ?   ?   'EXPRESSION TAG' 178 9  
2 1ZY3 LYS B 3   ? UNP P55957 ARG 84  ENGINEERED       203 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.solution_id 
1 1 HNCACB             1 
2 1 'CBCA(CO)HN'       1 
3 1 '15N-edited NOESY' 2 
4 1 HNHA               2 
5 1 '15N-edited NOESY' 3 
6 1 '15N-1H HSQC'      3 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id       1 
_pdbx_nmr_exptl_sample_conditions.temperature         303 
_pdbx_nmr_exptl_sample_conditions.pressure            1 
_pdbx_nmr_exptl_sample_conditions.pH                  7.0 
_pdbx_nmr_exptl_sample_conditions.ionic_strength      '10 mM NaCl' 
_pdbx_nmr_exptl_sample_conditions.pressure_units      atm 
_pdbx_nmr_exptl_sample_conditions.temperature_units   K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
1 '0.7 mM Bcl-w U-15N,13C, 0.7 mM Bid BH3-peptide, 20 mM phosphate buffer, 90% H2O, 10% D2O' '90% H2O/10% D2O' 
2 '0.7 mM Bcl-w U-15N, 0.7 mM Bid BH3-peptide, 20 mM phosphate buffer, 90% H2O, 10% D2O'     '90% H2O/10% D2O' 
3 '0.7 mM Bid BH3-peptide U-15N, 0.7 mM Bcl-w, 20 mM phosphate buffer, 90% H2O, 10% D2O'     '90% H2O/10% D2O' 
# 
loop_
_pdbx_nmr_spectrometer.spectrometer_id 
_pdbx_nmr_spectrometer.model 
_pdbx_nmr_spectrometer.manufacturer 
_pdbx_nmr_spectrometer.field_strength 
_pdbx_nmr_spectrometer.type 
1 'Unity Inova' Varian 800 ? 
2 DRX           Bruker 600 ? 
# 
_pdbx_nmr_refine.entry_id           1ZY3 
_pdbx_nmr_refine.method             'Rigid body docking, semi-flexible simulated annealing, refinement using explicit water' 
_pdbx_nmr_refine.details            
;200 conformers were obtained in the rigid body docking and 100 best conformers were selected for semi-flexible simulated annealing following by refinement
;
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_details.entry_id   1ZY3 
_pdbx_nmr_details.text       
'This model structure was obtained using ambigous chemical shift perturbation constraints, NOE distances and hydrogen bonds' 
# 
_pdbx_nmr_ensemble.entry_id                                      1ZY3 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  
'structures with the least restraint violations, structures with the lowest energy' 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             1ZY3 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'lowest energy' 
# 
loop_
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
_pdbx_nmr_software.ordinal 
refinement      HADDOCK 1.2    'Bonvin et al.'   1 
processing      NMRPipe 2.0    'Delargio et al.' 2 
'data analysis' XEASY   1.3.13 'Bartels et al.'  3 
processing      HADDOCK 1.2    'Bonvin et al.'   4 
# 
_exptl.entry_id          1ZY3 
_exptl.method            'SOLUTION NMR' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             ? 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_struct.entry_id                  1ZY3 
_struct.title                     'Structural model of complex of Bcl-w protein with Bid BH3-peptide' 
_struct.pdbx_descriptor           'Apoptosis regulator Bcl-W, BH3-peptide from BH3 interacting domain death agonist protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZY3 
_struct_keywords.pdbx_keywords   APOPTOSIS 
_struct_keywords.text            'Apoptosis, Bcl-w, BH3-peptide' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 8   ? LYS A 24  ? ASP A 8   LYS A 24  1 ? 17 
HELX_P HELX_P2  2  ASP A 39  ? GLY A 49  ? ASP A 39  GLY A 49  1 ? 11 
HELX_P HELX_P3  3  ASP A 50  ? ARG A 57  ? ASP A 50  ARG A 57  1 ? 8  
HELX_P HELX_P4  4  ARG A 58  ? LEU A 67  ? ARG A 58  LEU A 67  1 ? 10 
HELX_P HELX_P5  5  ALA A 74  ? GLN A 87  ? ALA A 74  GLN A 87  1 ? 14 
HELX_P HELX_P6  6  ASN A 91  ? LYS A 112 ? ASN A 91  LYS A 112 1 ? 22 
HELX_P HELX_P7  7  MET A 114 ? GLU A 130 ? MET A 114 GLU A 130 1 ? 17 
HELX_P HELX_P8  8  LEU A 133 ? GLY A 141 ? LEU A 133 GLY A 141 1 ? 9  
HELX_P HELX_P9  9  TRP A 143 ? TYR A 150 ? TRP A 143 TYR A 150 1 ? 8  
HELX_P HELX_P10 10 ILE B 2   ? ARG B 18  ? ILE B 202 ARG B 218 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_database_PDB_matrix.entry_id          1ZY3 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZY3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N    . ALA A 1 1   ? 11.843  22.184  19.684  1.00 0.00 ? 1   ALA A N    1  
ATOM 2     C CA   . ALA A 1 1   ? 11.633  22.053  18.225  1.00 0.00 ? 1   ALA A CA   1  
ATOM 3     C C    . ALA A 1 1   ? 10.462  21.125  17.944  1.00 0.00 ? 1   ALA A C    1  
ATOM 4     O O    . ALA A 1 1   ? 10.584  19.905  18.049  1.00 0.00 ? 1   ALA A O    1  
ATOM 5     C CB   . ALA A 1 1   ? 12.893  21.536  17.547  1.00 0.00 ? 1   ALA A CB   1  
ATOM 6     H H1   . ALA A 1 1   ? 12.666  22.795  19.877  1.00 0.00 ? 1   ALA A H1   1  
ATOM 7     H H2   . ALA A 1 1   ? 12.008  21.246  20.108  1.00 0.00 ? 1   ALA A H2   1  
ATOM 8     H H3   . ALA A 1 1   ? 10.997  22.605  20.129  1.00 0.00 ? 1   ALA A H3   1  
ATOM 9     H HA   . ALA A 1 1   ? 11.410  23.032  17.823  1.00 0.00 ? 1   ALA A HA   1  
ATOM 10    H HB1  . ALA A 1 1   ? 13.723  22.187  17.781  1.00 0.00 ? 1   ALA A HB1  1  
ATOM 11    H HB2  . ALA A 1 1   ? 12.741  21.516  16.477  1.00 0.00 ? 1   ALA A HB2  1  
ATOM 12    H HB3  . ALA A 1 1   ? 13.107  20.537  17.898  1.00 0.00 ? 1   ALA A HB3  1  
ATOM 13    N N    . THR A 1 2   ? 9.324   21.701  17.598  1.00 0.00 ? 2   THR A N    1  
ATOM 14    C CA   . THR A 1 2   ? 8.134   20.915  17.312  1.00 0.00 ? 2   THR A CA   1  
ATOM 15    C C    . THR A 1 2   ? 7.540   21.285  15.953  1.00 0.00 ? 2   THR A C    1  
ATOM 16    O O    . THR A 1 2   ? 6.708   22.189  15.855  1.00 0.00 ? 2   THR A O    1  
ATOM 17    C CB   . THR A 1 2   ? 7.069   21.118  18.408  1.00 0.00 ? 2   THR A CB   1  
ATOM 18    O OG1  . THR A 1 2   ? 7.708   21.286  19.685  1.00 0.00 ? 2   THR A OG1  1  
ATOM 19    C CG2  . THR A 1 2   ? 6.110   19.937  18.458  1.00 0.00 ? 2   THR A CG2  1  
ATOM 20    H H    . THR A 1 2   ? 9.272   22.682  17.543  1.00 0.00 ? 2   THR A H    1  
ATOM 21    H HA   . THR A 1 2   ? 8.416   19.873  17.302  1.00 0.00 ? 2   THR A HA   1  
ATOM 22    H HB   . THR A 1 2   ? 6.504   22.011  18.179  1.00 0.00 ? 2   THR A HB   1  
ATOM 23    H HG1  . THR A 1 2   ? 7.470   20.548  20.269  1.00 0.00 ? 2   THR A HG1  1  
ATOM 24    H HG21 . THR A 1 2   ? 6.665   19.029  18.639  1.00 0.00 ? 2   THR A HG21 1  
ATOM 25    H HG22 . THR A 1 2   ? 5.587   19.856  17.517  1.00 0.00 ? 2   THR A HG22 1  
ATOM 26    H HG23 . THR A 1 2   ? 5.396   20.085  19.254  1.00 0.00 ? 2   THR A HG23 1  
ATOM 27    N N    . PRO A 1 3   ? 7.982   20.604  14.880  1.00 0.00 ? 3   PRO A N    1  
ATOM 28    C CA   . PRO A 1 3   ? 7.488   20.859  13.527  1.00 0.00 ? 3   PRO A CA   1  
ATOM 29    C C    . PRO A 1 3   ? 6.031   20.426  13.366  1.00 0.00 ? 3   PRO A C    1  
ATOM 30    O O    . PRO A 1 3   ? 5.659   19.314  13.749  1.00 0.00 ? 3   PRO A O    1  
ATOM 31    C CB   . PRO A 1 3   ? 8.406   20.010  12.639  1.00 0.00 ? 3   PRO A CB   1  
ATOM 32    C CG   . PRO A 1 3   ? 8.920   18.935  13.532  1.00 0.00 ? 3   PRO A CG   1  
ATOM 33    C CD   . PRO A 1 3   ? 8.997   19.537  14.907  1.00 0.00 ? 3   PRO A CD   1  
ATOM 34    H HA   . PRO A 1 3   ? 7.584   21.900  13.261  1.00 0.00 ? 3   PRO A HA   1  
ATOM 35    H HB2  . PRO A 1 3   ? 7.837   19.600  11.816  1.00 0.00 ? 3   PRO A HB2  1  
ATOM 36    H HB3  . PRO A 1 3   ? 9.209   20.623  12.256  1.00 0.00 ? 3   PRO A HB3  1  
ATOM 37    H HG2  . PRO A 1 3   ? 8.241   18.096  13.529  1.00 0.00 ? 3   PRO A HG2  1  
ATOM 38    H HG3  . PRO A 1 3   ? 9.902   18.625  13.207  1.00 0.00 ? 3   PRO A HG3  1  
ATOM 39    H HD2  . PRO A 1 3   ? 8.757   18.798  15.658  1.00 0.00 ? 3   PRO A HD2  1  
ATOM 40    H HD3  . PRO A 1 3   ? 9.980   19.948  15.082  1.00 0.00 ? 3   PRO A HD3  1  
ATOM 41    N N    . ALA A 1 4   ? 5.213   21.307  12.807  1.00 0.00 ? 4   ALA A N    1  
ATOM 42    C CA   . ALA A 1 4   ? 3.797   21.016  12.608  1.00 0.00 ? 4   ALA A CA   1  
ATOM 43    C C    . ALA A 1 4   ? 3.503   20.692  11.150  1.00 0.00 ? 4   ALA A C    1  
ATOM 44    O O    . ALA A 1 4   ? 4.202   21.155  10.247  1.00 0.00 ? 4   ALA A O    1  
ATOM 45    C CB   . ALA A 1 4   ? 2.948   22.191  13.070  1.00 0.00 ? 4   ALA A CB   1  
ATOM 46    H H    . ALA A 1 4   ? 5.571   22.171  12.510  1.00 0.00 ? 4   ALA A H    1  
ATOM 47    H HA   . ALA A 1 4   ? 3.544   20.160  13.215  1.00 0.00 ? 4   ALA A HA   1  
ATOM 48    H HB1  . ALA A 1 4   ? 3.200   22.441  14.090  1.00 0.00 ? 4   ALA A HB1  1  
ATOM 49    H HB2  . ALA A 1 4   ? 1.902   21.925  13.013  1.00 0.00 ? 4   ALA A HB2  1  
ATOM 50    H HB3  . ALA A 1 4   ? 3.136   23.045  12.434  1.00 0.00 ? 4   ALA A HB3  1  
ATOM 51    N N    . SER A 1 5   ? 2.465   19.899  10.926  1.00 0.00 ? 5   SER A N    1  
ATOM 52    C CA   . SER A 1 5   ? 2.077   19.513  9.580   1.00 0.00 ? 5   SER A CA   1  
ATOM 53    C C    . SER A 1 5   ? 1.210   20.598  8.946   1.00 0.00 ? 5   SER A C    1  
ATOM 54    O O    . SER A 1 5   ? 0.112   20.888  9.429   1.00 0.00 ? 5   SER A O    1  
ATOM 55    C CB   . SER A 1 5   ? 1.318   18.185  9.612   1.00 0.00 ? 5   SER A CB   1  
ATOM 56    O OG   . SER A 1 5   ? 2.083   17.171  10.250  1.00 0.00 ? 5   SER A OG   1  
ATOM 57    H H    . SER A 1 5   ? 1.934   19.573  11.688  1.00 0.00 ? 5   SER A H    1  
ATOM 58    H HA   . SER A 1 5   ? 2.976   19.394  8.993   1.00 0.00 ? 5   SER A HA   1  
ATOM 59    H HB2  . SER A 1 5   ? 0.393   18.315  10.154  1.00 0.00 ? 5   SER A HB2  1  
ATOM 60    H HB3  . SER A 1 5   ? 1.101   17.873  8.599   1.00 0.00 ? 5   SER A HB3  1  
ATOM 61    H HG   . SER A 1 5   ? 2.382   17.487  11.115  1.00 0.00 ? 5   SER A HG   1  
ATOM 62    N N    . ALA A 1 6   ? 1.714   21.202  7.877   1.00 0.00 ? 6   ALA A N    1  
ATOM 63    C CA   . ALA A 1 6   ? 0.985   22.253  7.180   1.00 0.00 ? 6   ALA A CA   1  
ATOM 64    C C    . ALA A 1 6   ? -0.246  21.691  6.456   1.00 0.00 ? 6   ALA A C    1  
ATOM 65    O O    . ALA A 1 6   ? -1.362  22.156  6.697   1.00 0.00 ? 6   ALA A O    1  
ATOM 66    C CB   . ALA A 1 6   ? 1.900   23.006  6.219   1.00 0.00 ? 6   ALA A CB   1  
ATOM 67    H H    . ALA A 1 6   ? 2.602   20.929  7.544   1.00 0.00 ? 6   ALA A H    1  
ATOM 68    H HA   . ALA A 1 6   ? 0.644   22.955  7.928   1.00 0.00 ? 6   ALA A HA   1  
ATOM 69    H HB1  . ALA A 1 6   ? 1.353   23.820  5.764   1.00 0.00 ? 6   ALA A HB1  1  
ATOM 70    H HB2  . ALA A 1 6   ? 2.247   22.333  5.451   1.00 0.00 ? 6   ALA A HB2  1  
ATOM 71    H HB3  . ALA A 1 6   ? 2.747   23.400  6.762   1.00 0.00 ? 6   ALA A HB3  1  
ATOM 72    N N    . PRO A 1 7   ? -0.083  20.686  5.564   1.00 0.00 ? 7   PRO A N    1  
ATOM 73    C CA   . PRO A 1 7   ? -1.203  20.098  4.849   1.00 0.00 ? 7   PRO A CA   1  
ATOM 74    C C    . PRO A 1 7   ? -1.787  18.874  5.559   1.00 0.00 ? 7   PRO A C    1  
ATOM 75    O O    . PRO A 1 7   ? -1.075  18.116  6.226   1.00 0.00 ? 7   PRO A O    1  
ATOM 76    C CB   . PRO A 1 7   ? -0.569  19.696  3.521   1.00 0.00 ? 7   PRO A CB   1  
ATOM 77    C CG   . PRO A 1 7   ? 0.858   19.381  3.843   1.00 0.00 ? 7   PRO A CG   1  
ATOM 78    C CD   . PRO A 1 7   ? 1.188   20.061  5.152   1.00 0.00 ? 7   PRO A CD   1  
ATOM 79    H HA   . PRO A 1 7   ? -1.987  20.821  4.673   1.00 0.00 ? 7   PRO A HA   1  
ATOM 80    H HB2  . PRO A 1 7   ? -1.083  18.832  3.122   1.00 0.00 ? 7   PRO A HB2  1  
ATOM 81    H HB3  . PRO A 1 7   ? -0.642  20.518  2.823   1.00 0.00 ? 7   PRO A HB3  1  
ATOM 82    H HG2  . PRO A 1 7   ? 0.981   18.313  3.941   1.00 0.00 ? 7   PRO A HG2  1  
ATOM 83    H HG3  . PRO A 1 7   ? 1.498   19.757  3.059   1.00 0.00 ? 7   PRO A HG3  1  
ATOM 84    H HD2  . PRO A 1 7   ? 1.512   19.333  5.880   1.00 0.00 ? 7   PRO A HD2  1  
ATOM 85    H HD3  . PRO A 1 7   ? 1.952   20.810  5.002   1.00 0.00 ? 7   PRO A HD3  1  
ATOM 86    N N    . ASP A 1 8   ? -3.095  18.702  5.423   1.00 0.00 ? 8   ASP A N    1  
ATOM 87    C CA   . ASP A 1 8   ? -3.792  17.573  6.026   1.00 0.00 ? 8   ASP A CA   1  
ATOM 88    C C    . ASP A 1 8   ? -3.532  16.309  5.212   1.00 0.00 ? 8   ASP A C    1  
ATOM 89    O O    . ASP A 1 8   ? -3.361  16.375  3.993   1.00 0.00 ? 8   ASP A O    1  
ATOM 90    C CB   . ASP A 1 8   ? -5.296  17.865  6.112   1.00 0.00 ? 8   ASP A CB   1  
ATOM 91    C CG   . ASP A 1 8   ? -6.114  16.659  6.530   1.00 0.00 ? 8   ASP A CG   1  
ATOM 92    O OD1  . ASP A 1 8   ? -6.216  16.385  7.744   1.00 0.00 ? 8   ASP A OD1  1  
ATOM 93    O OD2  . ASP A 1 8   ? -6.664  15.979  5.644   1.00 0.00 ? 8   ASP A OD2  1  
ATOM 94    H H    . ASP A 1 8   ? -3.611  19.357  4.899   1.00 0.00 ? 8   ASP A H    1  
ATOM 95    H HA   . ASP A 1 8   ? -3.401  17.433  7.023   1.00 0.00 ? 8   ASP A HA   1  
ATOM 96    H HB2  . ASP A 1 8   ? -5.461  18.651  6.833   1.00 0.00 ? 8   ASP A HB2  1  
ATOM 97    H HB3  . ASP A 1 8   ? -5.643  18.196  5.143   1.00 0.00 ? 8   ASP A HB3  1  
ATOM 98    N N    . THR A 1 9   ? -3.505  15.167  5.888   1.00 0.00 ? 9   THR A N    1  
ATOM 99    C CA   . THR A 1 9   ? -3.242  13.883  5.248   1.00 0.00 ? 9   THR A CA   1  
ATOM 100   C C    . THR A 1 9   ? -4.168  13.606  4.057   1.00 0.00 ? 9   THR A C    1  
ATOM 101   O O    . THR A 1 9   ? -3.738  13.023  3.062   1.00 0.00 ? 9   THR A O    1  
ATOM 102   C CB   . THR A 1 9   ? -3.366  12.742  6.271   1.00 0.00 ? 9   THR A CB   1  
ATOM 103   O OG1  . THR A 1 9   ? -2.784  13.160  7.513   1.00 0.00 ? 9   THR A OG1  1  
ATOM 104   C CG2  . THR A 1 9   ? -2.667  11.483  5.776   1.00 0.00 ? 9   THR A CG2  1  
ATOM 105   H H    . THR A 1 9   ? -3.657  15.188  6.860   1.00 0.00 ? 9   THR A H    1  
ATOM 106   H HA   . THR A 1 9   ? -2.223  13.897  4.893   1.00 0.00 ? 9   THR A HA   1  
ATOM 107   H HB   . THR A 1 9   ? -4.414  12.521  6.426   1.00 0.00 ? 9   THR A HB   1  
ATOM 108   H HG1  . THR A 1 9   ? -2.093  13.826  7.336   1.00 0.00 ? 9   THR A HG1  1  
ATOM 109   H HG21 . THR A 1 9   ? -2.810  10.687  6.491   1.00 0.00 ? 9   THR A HG21 1  
ATOM 110   H HG22 . THR A 1 9   ? -1.612  11.681  5.664   1.00 0.00 ? 9   THR A HG22 1  
ATOM 111   H HG23 . THR A 1 9   ? -3.082  11.192  4.822   1.00 0.00 ? 9   THR A HG23 1  
ATOM 112   N N    . ARG A 1 10  ? -5.425  14.037  4.143   1.00 0.00 ? 10  ARG A N    1  
ATOM 113   C CA   . ARG A 1 10  ? -6.377  13.810  3.058   1.00 0.00 ? 10  ARG A CA   1  
ATOM 114   C C    . ARG A 1 10  ? -5.931  14.525  1.787   1.00 0.00 ? 10  ARG A C    1  
ATOM 115   O O    . ARG A 1 10  ? -6.144  14.028  0.682   1.00 0.00 ? 10  ARG A O    1  
ATOM 116   C CB   . ARG A 1 10  ? -7.780  14.267  3.458   1.00 0.00 ? 10  ARG A CB   1  
ATOM 117   C CG   . ARG A 1 10  ? -8.559  13.219  4.237   1.00 0.00 ? 10  ARG A CG   1  
ATOM 118   C CD   . ARG A 1 10  ? -9.469  13.854  5.276   1.00 0.00 ? 10  ARG A CD   1  
ATOM 119   N NE   . ARG A 1 10  ? -8.713  14.394  6.406   1.00 0.00 ? 10  ARG A NE   1  
ATOM 120   C CZ   . ARG A 1 10  ? -8.961  14.097  7.680   1.00 0.00 ? 10  ARG A CZ   1  
ATOM 121   N NH1  . ARG A 1 10  ? -9.959  13.277  7.996   1.00 0.00 ? 10  ARG A NH1  1  
ATOM 122   N NH2  . ARG A 1 10  ? -8.217  14.633  8.639   1.00 0.00 ? 10  ARG A NH2  1  
ATOM 123   H H    . ARG A 1 10  ? -5.714  14.533  4.945   1.00 0.00 ? 10  ARG A H    1  
ATOM 124   H HA   . ARG A 1 10  ? -6.400  12.747  2.863   1.00 0.00 ? 10  ARG A HA   1  
ATOM 125   H HB2  . ARG A 1 10  ? -7.698  15.156  4.067   1.00 0.00 ? 10  ARG A HB2  1  
ATOM 126   H HB3  . ARG A 1 10  ? -8.336  14.505  2.562   1.00 0.00 ? 10  ARG A HB3  1  
ATOM 127   H HG2  . ARG A 1 10  ? -9.162  12.647  3.549   1.00 0.00 ? 10  ARG A HG2  1  
ATOM 128   H HG3  . ARG A 1 10  ? -7.861  12.564  4.737   1.00 0.00 ? 10  ARG A HG3  1  
ATOM 129   H HD2  . ARG A 1 10  ? -10.022 14.656  4.811   1.00 0.00 ? 10  ARG A HD2  1  
ATOM 130   H HD3  . ARG A 1 10  ? -10.158 13.106  5.642   1.00 0.00 ? 10  ARG A HD3  1  
ATOM 131   H HE   . ARG A 1 10  ? -7.970  15.016  6.196   1.00 0.00 ? 10  ARG A HE   1  
ATOM 132   H HH11 . ARG A 1 10  ? -10.535 12.874  7.273   1.00 0.00 ? 10  ARG A HH11 1  
ATOM 133   H HH12 . ARG A 1 10  ? -10.147 13.049  8.963   1.00 0.00 ? 10  ARG A HH12 1  
ATOM 134   H HH21 . ARG A 1 10  ? -7.463  15.263  8.402   1.00 0.00 ? 10  ARG A HH21 1  
ATOM 135   H HH22 . ARG A 1 10  ? -8.401  14.419  9.604   1.00 0.00 ? 10  ARG A HH22 1  
ATOM 136   N N    . ALA A 1 11  ? -5.288  15.678  1.952   1.00 0.00 ? 11  ALA A N    1  
ATOM 137   C CA   . ALA A 1 11  ? -4.800  16.449  0.817   1.00 0.00 ? 11  ALA A CA   1  
ATOM 138   C C    . ALA A 1 11  ? -3.694  15.684  0.104   1.00 0.00 ? 11  ALA A C    1  
ATOM 139   O O    . ALA A 1 11  ? -3.606  15.698  -1.125  1.00 0.00 ? 11  ALA A O    1  
ATOM 140   C CB   . ALA A 1 11  ? -4.300  17.816  1.266   1.00 0.00 ? 11  ALA A CB   1  
ATOM 141   H H    . ALA A 1 11  ? -5.131  16.011  2.861   1.00 0.00 ? 11  ALA A H    1  
ATOM 142   H HA   . ALA A 1 11  ? -5.624  16.597  0.132   1.00 0.00 ? 11  ALA A HA   1  
ATOM 143   H HB1  . ALA A 1 11  ? -3.550  17.692  2.034   1.00 0.00 ? 11  ALA A HB1  1  
ATOM 144   H HB2  . ALA A 1 11  ? -5.125  18.393  1.659   1.00 0.00 ? 11  ALA A HB2  1  
ATOM 145   H HB3  . ALA A 1 11  ? -3.868  18.335  0.422   1.00 0.00 ? 11  ALA A HB3  1  
ATOM 146   N N    . LEU A 1 12  ? -2.863  15.003  0.888   1.00 0.00 ? 12  LEU A N    1  
ATOM 147   C CA   . LEU A 1 12  ? -1.771  14.207  0.343   1.00 0.00 ? 12  LEU A CA   1  
ATOM 148   C C    . LEU A 1 12  ? -2.335  13.007  -0.404  1.00 0.00 ? 12  LEU A C    1  
ATOM 149   O O    . LEU A 1 12  ? -1.849  12.645  -1.474  1.00 0.00 ? 12  LEU A O    1  
ATOM 150   C CB   . LEU A 1 12  ? -0.828  13.738  1.452   1.00 0.00 ? 12  LEU A CB   1  
ATOM 151   C CG   . LEU A 1 12  ? 0.241   14.749  1.875   1.00 0.00 ? 12  LEU A CG   1  
ATOM 152   C CD1  . LEU A 1 12  ? -0.321  15.739  2.882   1.00 0.00 ? 12  LEU A CD1  1  
ATOM 153   C CD2  . LEU A 1 12  ? 1.450   14.031  2.449   1.00 0.00 ? 12  LEU A CD2  1  
ATOM 154   H H    . LEU A 1 12  ? -2.986  15.042  1.860   1.00 0.00 ? 12  LEU A H    1  
ATOM 155   H HA   . LEU A 1 12  ? -1.223  14.824  -0.353  1.00 0.00 ? 12  LEU A HA   1  
ATOM 156   H HB2  . LEU A 1 12  ? -1.421  13.491  2.320   1.00 0.00 ? 12  LEU A HB2  1  
ATOM 157   H HB3  . LEU A 1 12  ? -0.328  12.842  1.115   1.00 0.00 ? 12  LEU A HB3  1  
ATOM 158   H HG   . LEU A 1 12  ? 0.563   15.306  1.007   1.00 0.00 ? 12  LEU A HG   1  
ATOM 159   H HD11 . LEU A 1 12  ? 0.430   16.475  3.125   1.00 0.00 ? 12  LEU A HD11 1  
ATOM 160   H HD12 . LEU A 1 12  ? -0.610  15.212  3.779   1.00 0.00 ? 12  LEU A HD12 1  
ATOM 161   H HD13 . LEU A 1 12  ? -1.184  16.232  2.462   1.00 0.00 ? 12  LEU A HD13 1  
ATOM 162   H HD21 . LEU A 1 12  ? 1.144   13.431  3.293   1.00 0.00 ? 12  LEU A HD21 1  
ATOM 163   H HD22 . LEU A 1 12  ? 2.182   14.758  2.771   1.00 0.00 ? 12  LEU A HD22 1  
ATOM 164   H HD23 . LEU A 1 12  ? 1.883   13.393  1.692   1.00 0.00 ? 12  LEU A HD23 1  
ATOM 165   N N    . VAL A 1 13  ? -3.376  12.405  0.167   1.00 0.00 ? 13  VAL A N    1  
ATOM 166   C CA   . VAL A 1 13  ? -4.030  11.261  -0.453  1.00 0.00 ? 13  VAL A CA   1  
ATOM 167   C C    . VAL A 1 13  ? -4.622  11.677  -1.795  1.00 0.00 ? 13  VAL A C    1  
ATOM 168   O O    . VAL A 1 13  ? -4.493  10.968  -2.794  1.00 0.00 ? 13  VAL A O    1  
ATOM 169   C CB   . VAL A 1 13  ? -5.146  10.683  0.449   1.00 0.00 ? 13  VAL A CB   1  
ATOM 170   C CG1  . VAL A 1 13  ? -5.858  9.526   -0.240  1.00 0.00 ? 13  VAL A CG1  1  
ATOM 171   C CG2  . VAL A 1 13  ? -4.575  10.236  1.785   1.00 0.00 ? 13  VAL A CG2  1  
ATOM 172   H H    . VAL A 1 13  ? -3.706  12.738  1.029   1.00 0.00 ? 13  VAL A H    1  
ATOM 173   H HA   . VAL A 1 13  ? -3.286  10.495  -0.615  1.00 0.00 ? 13  VAL A HA   1  
ATOM 174   H HB   . VAL A 1 13  ? -5.871  11.463  0.633   1.00 0.00 ? 13  VAL A HB   1  
ATOM 175   H HG11 . VAL A 1 13  ? -5.148  8.745   -0.461  1.00 0.00 ? 13  VAL A HG11 1  
ATOM 176   H HG12 . VAL A 1 13  ? -6.306  9.875   -1.159  1.00 0.00 ? 13  VAL A HG12 1  
ATOM 177   H HG13 . VAL A 1 13  ? -6.627  9.139   0.411   1.00 0.00 ? 13  VAL A HG13 1  
ATOM 178   H HG21 . VAL A 1 13  ? -5.375  9.872   2.413   1.00 0.00 ? 13  VAL A HG21 1  
ATOM 179   H HG22 . VAL A 1 13  ? -4.090  11.071  2.267   1.00 0.00 ? 13  VAL A HG22 1  
ATOM 180   H HG23 . VAL A 1 13  ? -3.856  9.446   1.623   1.00 0.00 ? 13  VAL A HG23 1  
ATOM 181   N N    . ALA A 1 14  ? -5.252  12.849  -1.807  1.00 0.00 ? 14  ALA A N    1  
ATOM 182   C CA   . ALA A 1 14  ? -5.849  13.387  -3.020  1.00 0.00 ? 14  ALA A CA   1  
ATOM 183   C C    . ALA A 1 14  ? -4.771  13.647  -4.064  1.00 0.00 ? 14  ALA A C    1  
ATOM 184   O O    . ALA A 1 14  ? -4.974  13.404  -5.250  1.00 0.00 ? 14  ALA A O    1  
ATOM 185   C CB   . ALA A 1 14  ? -6.619  14.665  -2.716  1.00 0.00 ? 14  ALA A CB   1  
ATOM 186   H H    . ALA A 1 14  ? -5.322  13.361  -0.970  1.00 0.00 ? 14  ALA A H    1  
ATOM 187   H HA   . ALA A 1 14  ? -6.543  12.654  -3.405  1.00 0.00 ? 14  ALA A HA   1  
ATOM 188   H HB1  . ALA A 1 14  ? -7.440  14.442  -2.050  1.00 0.00 ? 14  ALA A HB1  1  
ATOM 189   H HB2  . ALA A 1 14  ? -7.005  15.081  -3.637  1.00 0.00 ? 14  ALA A HB2  1  
ATOM 190   H HB3  . ALA A 1 14  ? -5.960  15.381  -2.248  1.00 0.00 ? 14  ALA A HB3  1  
ATOM 191   N N    . ASP A 1 15  ? -3.617  14.126  -3.608  1.00 0.00 ? 15  ASP A N    1  
ATOM 192   C CA   . ASP A 1 15  ? -2.497  14.404  -4.502  1.00 0.00 ? 15  ASP A CA   1  
ATOM 193   C C    . ASP A 1 15  ? -1.958  13.107  -5.092  1.00 0.00 ? 15  ASP A C    1  
ATOM 194   O O    . ASP A 1 15  ? -1.598  13.053  -6.266  1.00 0.00 ? 15  ASP A O    1  
ATOM 195   C CB   . ASP A 1 15  ? -1.379  15.147  -3.766  1.00 0.00 ? 15  ASP A CB   1  
ATOM 196   C CG   . ASP A 1 15  ? -0.206  15.482  -4.673  1.00 0.00 ? 15  ASP A CG   1  
ATOM 197   O OD1  . ASP A 1 15  ? -0.357  16.355  -5.556  1.00 0.00 ? 15  ASP A OD1  1  
ATOM 198   O OD2  . ASP A 1 15  ? 0.876   14.883  -4.507  1.00 0.00 ? 15  ASP A OD2  1  
ATOM 199   H H    . ASP A 1 15  ? -3.519  14.305  -2.647  1.00 0.00 ? 15  ASP A H    1  
ATOM 200   H HA   . ASP A 1 15  ? -2.865  15.025  -5.305  1.00 0.00 ? 15  ASP A HA   1  
ATOM 201   H HB2  . ASP A 1 15  ? -1.771  16.068  -3.364  1.00 0.00 ? 15  ASP A HB2  1  
ATOM 202   H HB3  . ASP A 1 15  ? -1.020  14.530  -2.956  1.00 0.00 ? 15  ASP A HB3  1  
ATOM 203   N N    . PHE A 1 16  ? -1.917  12.064  -4.270  1.00 0.00 ? 16  PHE A N    1  
ATOM 204   C CA   . PHE A 1 16  ? -1.439  10.757  -4.706  1.00 0.00 ? 16  PHE A CA   1  
ATOM 205   C C    . PHE A 1 16  ? -2.403  10.153  -5.723  1.00 0.00 ? 16  PHE A C    1  
ATOM 206   O O    . PHE A 1 16  ? -1.989  9.718   -6.798  1.00 0.00 ? 16  PHE A O    1  
ATOM 207   C CB   . PHE A 1 16  ? -1.276  9.817   -3.504  1.00 0.00 ? 16  PHE A CB   1  
ATOM 208   C CG   . PHE A 1 16  ? -0.745  8.455   -3.866  1.00 0.00 ? 16  PHE A CG   1  
ATOM 209   C CD1  . PHE A 1 16  ? 0.517   8.315   -4.423  1.00 0.00 ? 16  PHE A CD1  1  
ATOM 210   C CD2  . PHE A 1 16  ? -1.509  7.317   -3.652  1.00 0.00 ? 16  PHE A CD2  1  
ATOM 211   C CE1  . PHE A 1 16  ? 1.007   7.067   -4.759  1.00 0.00 ? 16  PHE A CE1  1  
ATOM 212   C CE2  . PHE A 1 16  ? -1.023  6.067   -3.987  1.00 0.00 ? 16  PHE A CE2  1  
ATOM 213   C CZ   . PHE A 1 16  ? 0.237   5.943   -4.542  1.00 0.00 ? 16  PHE A CZ   1  
ATOM 214   H H    . PHE A 1 16  ? -2.208  12.182  -3.339  1.00 0.00 ? 16  PHE A H    1  
ATOM 215   H HA   . PHE A 1 16  ? -0.477  10.897  -5.178  1.00 0.00 ? 16  PHE A HA   1  
ATOM 216   H HB2  . PHE A 1 16  ? -0.590  10.261  -2.800  1.00 0.00 ? 16  PHE A HB2  1  
ATOM 217   H HB3  . PHE A 1 16  ? -2.237  9.684   -3.029  1.00 0.00 ? 16  PHE A HB3  1  
ATOM 218   H HD1  . PHE A 1 16  ? 1.121   9.193   -4.591  1.00 0.00 ? 16  PHE A HD1  1  
ATOM 219   H HD2  . PHE A 1 16  ? -2.494  7.413   -3.220  1.00 0.00 ? 16  PHE A HD2  1  
ATOM 220   H HE1  . PHE A 1 16  ? 1.993   6.973   -5.192  1.00 0.00 ? 16  PHE A HE1  1  
ATOM 221   H HE2  . PHE A 1 16  ? -1.628  5.189   -3.814  1.00 0.00 ? 16  PHE A HE2  1  
ATOM 222   H HZ   . PHE A 1 16  ? 0.617   4.969   -4.805  1.00 0.00 ? 16  PHE A HZ   1  
ATOM 223   N N    . VAL A 1 17  ? -3.687  10.136  -5.378  1.00 0.00 ? 17  VAL A N    1  
ATOM 224   C CA   . VAL A 1 17  ? -4.711  9.601   -6.267  1.00 0.00 ? 17  VAL A CA   1  
ATOM 225   C C    . VAL A 1 17  ? -4.753  10.414  -7.556  1.00 0.00 ? 17  VAL A C    1  
ATOM 226   O O    . VAL A 1 17  ? -4.803  9.858   -8.657  1.00 0.00 ? 17  VAL A O    1  
ATOM 227   C CB   . VAL A 1 17  ? -6.105  9.608   -5.597  1.00 0.00 ? 17  VAL A CB   1  
ATOM 228   C CG1  . VAL A 1 17  ? -7.193  9.211   -6.584  1.00 0.00 ? 17  VAL A CG1  1  
ATOM 229   C CG2  . VAL A 1 17  ? -6.119  8.682   -4.390  1.00 0.00 ? 17  VAL A CG2  1  
ATOM 230   H H    . VAL A 1 17  ? -3.951  10.492  -4.499  1.00 0.00 ? 17  VAL A H    1  
ATOM 231   H HA   . VAL A 1 17  ? -4.449  8.580   -6.503  1.00 0.00 ? 17  VAL A HA   1  
ATOM 232   H HB   . VAL A 1 17  ? -6.312  10.612  -5.255  1.00 0.00 ? 17  VAL A HB   1  
ATOM 233   H HG11 . VAL A 1 17  ? -7.005  8.209   -6.946  1.00 0.00 ? 17  VAL A HG11 1  
ATOM 234   H HG12 . VAL A 1 17  ? -7.194  9.899   -7.415  1.00 0.00 ? 17  VAL A HG12 1  
ATOM 235   H HG13 . VAL A 1 17  ? -8.154  9.240   -6.092  1.00 0.00 ? 17  VAL A HG13 1  
ATOM 236   H HG21 . VAL A 1 17  ? -5.855  7.680   -4.698  1.00 0.00 ? 17  VAL A HG21 1  
ATOM 237   H HG22 . VAL A 1 17  ? -7.106  8.676   -3.951  1.00 0.00 ? 17  VAL A HG22 1  
ATOM 238   H HG23 . VAL A 1 17  ? -5.404  9.032   -3.659  1.00 0.00 ? 17  VAL A HG23 1  
ATOM 239   N N    . GLY A 1 18  ? -4.706  11.733  -7.406  1.00 0.00 ? 18  GLY A N    1  
ATOM 240   C CA   . GLY A 1 18  ? -4.715  12.611  -8.555  1.00 0.00 ? 18  GLY A CA   1  
ATOM 241   C C    . GLY A 1 18  ? -3.494  12.398  -9.424  1.00 0.00 ? 18  GLY A C    1  
ATOM 242   O O    . GLY A 1 18  ? -3.591  12.390  -10.650 1.00 0.00 ? 18  GLY A O    1  
ATOM 243   H H    . GLY A 1 18  ? -4.670  12.115  -6.499  1.00 0.00 ? 18  GLY A H    1  
ATOM 244   H HA2  . GLY A 1 18  ? -5.603  12.417  -9.139  1.00 0.00 ? 18  GLY A HA2  1  
ATOM 245   H HA3  . GLY A 1 18  ? -4.731  13.636  -8.217  1.00 0.00 ? 18  GLY A HA3  1  
ATOM 246   N N    . TYR A 1 19  ? -2.343  12.208  -8.784  1.00 0.00 ? 19  TYR A N    1  
ATOM 247   C CA   . TYR A 1 19  ? -1.097  11.979  -9.501  1.00 0.00 ? 19  TYR A CA   1  
ATOM 248   C C    . TYR A 1 19  ? -1.186  10.692  -10.304 1.00 0.00 ? 19  TYR A C    1  
ATOM 249   O O    . TYR A 1 19  ? -0.848  10.669  -11.481 1.00 0.00 ? 19  TYR A O    1  
ATOM 250   C CB   . TYR A 1 19  ? 0.086   11.912  -8.531  1.00 0.00 ? 19  TYR A CB   1  
ATOM 251   C CG   . TYR A 1 19  ? 1.429   12.087  -9.203  1.00 0.00 ? 19  TYR A CG   1  
ATOM 252   C CD1  . TYR A 1 19  ? 1.557   12.871  -10.340 1.00 0.00 ? 19  TYR A CD1  1  
ATOM 253   C CD2  . TYR A 1 19  ? 2.569   11.478  -8.697  1.00 0.00 ? 19  TYR A CD2  1  
ATOM 254   C CE1  . TYR A 1 19  ? 2.778   13.038  -10.960 1.00 0.00 ? 19  TYR A CE1  1  
ATOM 255   C CE2  . TYR A 1 19  ? 3.797   11.641  -9.312  1.00 0.00 ? 19  TYR A CE2  1  
ATOM 256   C CZ   . TYR A 1 19  ? 3.896   12.425  -10.441 1.00 0.00 ? 19  TYR A CZ   1  
ATOM 257   O OH   . TYR A 1 19  ? 5.115   12.595  -11.058 1.00 0.00 ? 19  TYR A OH   1  
ATOM 258   H H    . TYR A 1 19  ? -2.331  12.232  -7.801  1.00 0.00 ? 19  TYR A H    1  
ATOM 259   H HA   . TYR A 1 19  ? -0.949  12.804  -10.182 1.00 0.00 ? 19  TYR A HA   1  
ATOM 260   H HB2  . TYR A 1 19  ? -0.021  12.692  -7.791  1.00 0.00 ? 19  TYR A HB2  1  
ATOM 261   H HB3  . TYR A 1 19  ? 0.083   10.951  -8.038  1.00 0.00 ? 19  TYR A HB3  1  
ATOM 262   H HD1  . TYR A 1 19  ? 0.680   13.352  -10.746 1.00 0.00 ? 19  TYR A HD1  1  
ATOM 263   H HD2  . TYR A 1 19  ? 2.488   10.865  -7.811  1.00 0.00 ? 19  TYR A HD2  1  
ATOM 264   H HE1  . TYR A 1 19  ? 2.854   13.653  -11.844 1.00 0.00 ? 19  TYR A HE1  1  
ATOM 265   H HE2  . TYR A 1 19  ? 4.673   11.158  -8.904  1.00 0.00 ? 19  TYR A HE2  1  
ATOM 266   H HH   . TYR A 1 19  ? 5.230   13.525  -11.281 1.00 0.00 ? 19  TYR A HH   1  
ATOM 267   N N    . LYS A 1 20  ? -1.660  9.628   -9.667  1.00 0.00 ? 20  LYS A N    1  
ATOM 268   C CA   . LYS A 1 20  ? -1.803  8.339   -10.336 1.00 0.00 ? 20  LYS A CA   1  
ATOM 269   C C    . LYS A 1 20  ? -2.760  8.456   -11.521 1.00 0.00 ? 20  LYS A C    1  
ATOM 270   O O    . LYS A 1 20  ? -2.549  7.845   -12.568 1.00 0.00 ? 20  LYS A O    1  
ATOM 271   C CB   . LYS A 1 20  ? -2.301  7.272   -9.357  1.00 0.00 ? 20  LYS A CB   1  
ATOM 272   C CG   . LYS A 1 20  ? -1.240  6.798   -8.373  1.00 0.00 ? 20  LYS A CG   1  
ATOM 273   C CD   . LYS A 1 20  ? -0.087  6.099   -9.079  1.00 0.00 ? 20  LYS A CD   1  
ATOM 274   C CE   . LYS A 1 20  ? -0.537  4.807   -9.741  1.00 0.00 ? 20  LYS A CE   1  
ATOM 275   N NZ   . LYS A 1 20  ? 0.561   4.167   -10.511 1.00 0.00 ? 20  LYS A NZ   1  
ATOM 276   H H    . LYS A 1 20  ? -1.917  9.710   -8.720  1.00 0.00 ? 20  LYS A H    1  
ATOM 277   H HA   . LYS A 1 20  ? -0.829  8.051   -10.705 1.00 0.00 ? 20  LYS A HA   1  
ATOM 278   H HB2  . LYS A 1 20  ? -3.129  7.676   -8.791  1.00 0.00 ? 20  LYS A HB2  1  
ATOM 279   H HB3  . LYS A 1 20  ? -2.646  6.418   -9.920  1.00 0.00 ? 20  LYS A HB3  1  
ATOM 280   H HG2  . LYS A 1 20  ? -0.854  7.652   -7.836  1.00 0.00 ? 20  LYS A HG2  1  
ATOM 281   H HG3  . LYS A 1 20  ? -1.695  6.108   -7.675  1.00 0.00 ? 20  LYS A HG3  1  
ATOM 282   H HD2  . LYS A 1 20  ? 0.309   6.759   -9.836  1.00 0.00 ? 20  LYS A HD2  1  
ATOM 283   H HD3  . LYS A 1 20  ? 0.685   5.875   -8.355  1.00 0.00 ? 20  LYS A HD3  1  
ATOM 284   H HE2  . LYS A 1 20  ? -0.873  4.123   -8.975  1.00 0.00 ? 20  LYS A HE2  1  
ATOM 285   H HE3  . LYS A 1 20  ? -1.357  5.026   -10.411 1.00 0.00 ? 20  LYS A HE3  1  
ATOM 286   H HZ1  . LYS A 1 20  ? 1.170   4.898   -10.941 1.00 0.00 ? 20  LYS A HZ1  1  
ATOM 287   H HZ2  . LYS A 1 20  ? 0.165   3.576   -11.275 1.00 0.00 ? 20  LYS A HZ2  1  
ATOM 288   H HZ3  . LYS A 1 20  ? 1.144   3.566   -9.885  1.00 0.00 ? 20  LYS A HZ3  1  
ATOM 289   N N    . LEU A 1 21  ? -3.803  9.257   -11.346 1.00 0.00 ? 21  LEU A N    1  
ATOM 290   C CA   . LEU A 1 21  ? -4.788  9.483   -12.393 1.00 0.00 ? 21  LEU A CA   1  
ATOM 291   C C    . LEU A 1 21  ? -4.159  10.257  -13.553 1.00 0.00 ? 21  LEU A C    1  
ATOM 292   O O    . LEU A 1 21  ? -4.497  10.042  -14.717 1.00 0.00 ? 21  LEU A O    1  
ATOM 293   C CB   . LEU A 1 21  ? -5.983  10.258  -11.824 1.00 0.00 ? 21  LEU A CB   1  
ATOM 294   C CG   . LEU A 1 21  ? -7.183  10.398  -12.760 1.00 0.00 ? 21  LEU A CG   1  
ATOM 295   C CD1  . LEU A 1 21  ? -7.905  9.068   -12.911 1.00 0.00 ? 21  LEU A CD1  1  
ATOM 296   C CD2  . LEU A 1 21  ? -8.134  11.465  -12.244 1.00 0.00 ? 21  LEU A CD2  1  
ATOM 297   H H    . LEU A 1 21  ? -3.922  9.703   -10.477 1.00 0.00 ? 21  LEU A H    1  
ATOM 298   H HA   . LEU A 1 21  ? -5.125  8.522   -12.752 1.00 0.00 ? 21  LEU A HA   1  
ATOM 299   H HB2  . LEU A 1 21  ? -6.312  9.758   -10.925 1.00 0.00 ? 21  LEU A HB2  1  
ATOM 300   H HB3  . LEU A 1 21  ? -5.646  11.250  -11.559 1.00 0.00 ? 21  LEU A HB3  1  
ATOM 301   H HG   . LEU A 1 21  ? -6.834  10.702  -13.737 1.00 0.00 ? 21  LEU A HG   1  
ATOM 302   H HD11 . LEU A 1 21  ? -8.209  8.710   -11.939 1.00 0.00 ? 21  LEU A HD11 1  
ATOM 303   H HD12 . LEU A 1 21  ? -7.242  8.349   -13.369 1.00 0.00 ? 21  LEU A HD12 1  
ATOM 304   H HD13 . LEU A 1 21  ? -8.775  9.203   -13.534 1.00 0.00 ? 21  LEU A HD13 1  
ATOM 305   H HD21 . LEU A 1 21  ? -7.611  12.405  -12.167 1.00 0.00 ? 21  LEU A HD21 1  
ATOM 306   H HD22 . LEU A 1 21  ? -8.503  11.176  -11.271 1.00 0.00 ? 21  LEU A HD22 1  
ATOM 307   H HD23 . LEU A 1 21  ? -8.963  11.568  -12.928 1.00 0.00 ? 21  LEU A HD23 1  
ATOM 308   N N    . ARG A 1 22  ? -3.233  11.148  -13.224 1.00 0.00 ? 22  ARG A N    1  
ATOM 309   C CA   . ARG A 1 22  ? -2.551  11.956  -14.229 1.00 0.00 ? 22  ARG A CA   1  
ATOM 310   C C    . ARG A 1 22  ? -1.434  11.158  -14.898 1.00 0.00 ? 22  ARG A C    1  
ATOM 311   O O    . ARG A 1 22  ? -1.175  11.317  -16.089 1.00 0.00 ? 22  ARG A O    1  
ATOM 312   C CB   . ARG A 1 22  ? -1.979  13.229  -13.591 1.00 0.00 ? 22  ARG A CB   1  
ATOM 313   C CG   . ARG A 1 22  ? -3.043  14.211  -13.125 1.00 0.00 ? 22  ARG A CG   1  
ATOM 314   C CD   . ARG A 1 22  ? -2.448  15.561  -12.740 1.00 0.00 ? 22  ARG A CD   1  
ATOM 315   N NE   . ARG A 1 22  ? -1.824  15.548  -11.413 1.00 0.00 ? 22  ARG A NE   1  
ATOM 316   C CZ   . ARG A 1 22  ? -2.467  15.833  -10.276 1.00 0.00 ? 22  ARG A CZ   1  
ATOM 317   N NH1  . ARG A 1 22  ? -3.763  16.125  -10.291 1.00 0.00 ? 22  ARG A NH1  1  
ATOM 318   N NH2  . ARG A 1 22  ? -1.810  15.830  -9.122  1.00 0.00 ? 22  ARG A NH2  1  
ATOM 319   H H    . ARG A 1 22  ? -2.999  11.267  -12.276 1.00 0.00 ? 22  ARG A H    1  
ATOM 320   H HA   . ARG A 1 22  ? -3.278  12.235  -14.977 1.00 0.00 ? 22  ARG A HA   1  
ATOM 321   H HB2  . ARG A 1 22  ? -1.380  12.951  -12.736 1.00 0.00 ? 22  ARG A HB2  1  
ATOM 322   H HB3  . ARG A 1 22  ? -1.350  13.729  -14.313 1.00 0.00 ? 22  ARG A HB3  1  
ATOM 323   H HG2  . ARG A 1 22  ? -3.755  14.360  -13.922 1.00 0.00 ? 22  ARG A HG2  1  
ATOM 324   H HG3  . ARG A 1 22  ? -3.548  13.793  -12.264 1.00 0.00 ? 22  ARG A HG3  1  
ATOM 325   H HD2  . ARG A 1 22  ? -1.701  15.827  -13.472 1.00 0.00 ? 22  ARG A HD2  1  
ATOM 326   H HD3  . ARG A 1 22  ? -3.236  16.299  -12.748 1.00 0.00 ? 22  ARG A HD3  1  
ATOM 327   H HE   . ARG A 1 22  ? -0.857  15.338  -11.370 1.00 0.00 ? 22  ARG A HE   1  
ATOM 328   H HH11 . ARG A 1 22  ? -4.273  16.136  -11.160 1.00 0.00 ? 22  ARG A HH11 1  
ATOM 329   H HH12 . ARG A 1 22  ? -4.245  16.342  -9.430  1.00 0.00 ? 22  ARG A HH12 1  
ATOM 330   H HH21 . ARG A 1 22  ? -0.825  15.616  -9.098  1.00 0.00 ? 22  ARG A HH21 1  
ATOM 331   H HH22 . ARG A 1 22  ? -2.290  16.053  -8.264  1.00 0.00 ? 22  ARG A HH22 1  
ATOM 332   N N    . GLN A 1 23  ? -0.802  10.281  -14.126 1.00 0.00 ? 23  GLN A N    1  
ATOM 333   C CA   . GLN A 1 23  ? 0.305   9.454   -14.614 1.00 0.00 ? 23  GLN A CA   1  
ATOM 334   C C    . GLN A 1 23  ? -0.105  8.554   -15.776 1.00 0.00 ? 23  GLN A C    1  
ATOM 335   O O    . GLN A 1 23  ? 0.739   8.128   -16.560 1.00 0.00 ? 23  GLN A O    1  
ATOM 336   C CB   . GLN A 1 23  ? 0.864   8.595   -13.479 1.00 0.00 ? 23  GLN A CB   1  
ATOM 337   C CG   . GLN A 1 23  ? 1.740   9.365   -12.506 1.00 0.00 ? 23  GLN A CG   1  
ATOM 338   C CD   . GLN A 1 23  ? 2.956   9.973   -13.174 1.00 0.00 ? 23  GLN A CD   1  
ATOM 339   O OE1  . GLN A 1 23  ? 2.912   11.100  -13.665 1.00 0.00 ? 23  GLN A OE1  1  
ATOM 340   N NE2  . GLN A 1 23  ? 4.051   9.229   -13.193 1.00 0.00 ? 23  GLN A NE2  1  
ATOM 341   H H    . GLN A 1 23  ? -1.076  10.196  -13.184 1.00 0.00 ? 23  GLN A H    1  
ATOM 342   H HA   . GLN A 1 23  ? 1.083   10.120  -14.954 1.00 0.00 ? 23  GLN A HA   1  
ATOM 343   H HB2  . GLN A 1 23  ? 0.039   8.167   -12.926 1.00 0.00 ? 23  GLN A HB2  1  
ATOM 344   H HB3  . GLN A 1 23  ? 1.451   7.798   -13.906 1.00 0.00 ? 23  GLN A HB3  1  
ATOM 345   H HG2  . GLN A 1 23  ? 1.155   10.160  -12.066 1.00 0.00 ? 23  GLN A HG2  1  
ATOM 346   H HG3  . GLN A 1 23  ? 2.072   8.693   -11.728 1.00 0.00 ? 23  GLN A HG3  1  
ATOM 347   H HE21 . GLN A 1 23  ? 4.017   8.338   -12.783 1.00 0.00 ? 23  GLN A HE21 1  
ATOM 348   H HE22 . GLN A 1 23  ? 4.853   9.601   -13.616 1.00 0.00 ? 23  GLN A HE22 1  
ATOM 349   N N    . LYS A 1 24  ? -1.389  8.253   -15.884 1.00 0.00 ? 24  LYS A N    1  
ATOM 350   C CA   . LYS A 1 24  ? -1.873  7.398   -16.958 1.00 0.00 ? 24  LYS A CA   1  
ATOM 351   C C    . LYS A 1 24  ? -2.417  8.229   -18.117 1.00 0.00 ? 24  LYS A C    1  
ATOM 352   O O    . LYS A 1 24  ? -3.229  7.751   -18.912 1.00 0.00 ? 24  LYS A O    1  
ATOM 353   C CB   . LYS A 1 24  ? -2.948  6.440   -16.438 1.00 0.00 ? 24  LYS A CB   1  
ATOM 354   C CG   . LYS A 1 24  ? -4.205  7.130   -15.941 1.00 0.00 ? 24  LYS A CG   1  
ATOM 355   C CD   . LYS A 1 24  ? -5.316  6.134   -15.675 1.00 0.00 ? 24  LYS A CD   1  
ATOM 356   C CE   . LYS A 1 24  ? -6.624  6.834   -15.368 1.00 0.00 ? 24  LYS A CE   1  
ATOM 357   N NZ   . LYS A 1 24  ? -7.747  5.872   -15.246 1.00 0.00 ? 24  LYS A NZ   1  
ATOM 358   H H    . LYS A 1 24  ? -2.023  8.609   -15.227 1.00 0.00 ? 24  LYS A H    1  
ATOM 359   H HA   . LYS A 1 24  ? -1.036  6.817   -17.317 1.00 0.00 ? 24  LYS A HA   1  
ATOM 360   H HB2  . LYS A 1 24  ? -3.227  5.767   -17.234 1.00 0.00 ? 24  LYS A HB2  1  
ATOM 361   H HB3  . LYS A 1 24  ? -2.535  5.866   -15.623 1.00 0.00 ? 24  LYS A HB3  1  
ATOM 362   H HG2  . LYS A 1 24  ? -3.978  7.653   -15.024 1.00 0.00 ? 24  LYS A HG2  1  
ATOM 363   H HG3  . LYS A 1 24  ? -4.539  7.837   -16.687 1.00 0.00 ? 24  LYS A HG3  1  
ATOM 364   H HD2  . LYS A 1 24  ? -5.449  5.510   -16.548 1.00 0.00 ? 24  LYS A HD2  1  
ATOM 365   H HD3  . LYS A 1 24  ? -5.041  5.520   -14.831 1.00 0.00 ? 24  LYS A HD3  1  
ATOM 366   H HE2  . LYS A 1 24  ? -6.521  7.373   -14.439 1.00 0.00 ? 24  LYS A HE2  1  
ATOM 367   H HE3  . LYS A 1 24  ? -6.841  7.529   -16.165 1.00 0.00 ? 24  LYS A HE3  1  
ATOM 368   H HZ1  . LYS A 1 24  ? -8.536  6.158   -15.866 1.00 0.00 ? 24  LYS A HZ1  1  
ATOM 369   H HZ2  . LYS A 1 24  ? -8.086  5.836   -14.260 1.00 0.00 ? 24  LYS A HZ2  1  
ATOM 370   H HZ3  . LYS A 1 24  ? -7.431  4.916   -15.526 1.00 0.00 ? 24  LYS A HZ3  1  
ATOM 371   N N    . GLY A 1 25  ? -1.970  9.472   -18.211 1.00 0.00 ? 25  GLY A N    1  
ATOM 372   C CA   . GLY A 1 25  ? -2.423  10.338  -19.279 1.00 0.00 ? 25  GLY A CA   1  
ATOM 373   C C    . GLY A 1 25  ? -1.385  11.371  -19.661 1.00 0.00 ? 25  GLY A C    1  
ATOM 374   O O    . GLY A 1 25  ? -0.985  11.461  -20.822 1.00 0.00 ? 25  GLY A O    1  
ATOM 375   H H    . GLY A 1 25  ? -1.323  9.804   -17.552 1.00 0.00 ? 25  GLY A H    1  
ATOM 376   H HA2  . GLY A 1 25  ? -2.650  9.735   -20.145 1.00 0.00 ? 25  GLY A HA2  1  
ATOM 377   H HA3  . GLY A 1 25  ? -3.320  10.846  -18.959 1.00 0.00 ? 25  GLY A HA3  1  
ATOM 378   N N    . TYR A 1 26  ? -0.940  12.137  -18.678 1.00 0.00 ? 26  TYR A N    1  
ATOM 379   C CA   . TYR A 1 26  ? 0.055   13.169  -18.902 1.00 0.00 ? 26  TYR A CA   1  
ATOM 380   C C    . TYR A 1 26  ? 0.879   13.371  -17.641 1.00 0.00 ? 26  TYR A C    1  
ATOM 381   O O    . TYR A 1 26  ? 0.366   13.861  -16.631 1.00 0.00 ? 26  TYR A O    1  
ATOM 382   C CB   . TYR A 1 26  ? -0.628  14.479  -19.300 1.00 0.00 ? 26  TYR A CB   1  
ATOM 383   C CG   . TYR A 1 26  ? 0.243   15.410  -20.113 1.00 0.00 ? 26  TYR A CG   1  
ATOM 384   C CD1  . TYR A 1 26  ? 0.519   15.138  -21.446 1.00 0.00 ? 26  TYR A CD1  1  
ATOM 385   C CD2  . TYR A 1 26  ? 0.778   16.564  -19.553 1.00 0.00 ? 26  TYR A CD2  1  
ATOM 386   C CE1  . TYR A 1 26  ? 1.306   15.986  -22.198 1.00 0.00 ? 26  TYR A CE1  1  
ATOM 387   C CE2  . TYR A 1 26  ? 1.564   17.418  -20.300 1.00 0.00 ? 26  TYR A CE2  1  
ATOM 388   C CZ   . TYR A 1 26  ? 1.824   17.125  -21.623 1.00 0.00 ? 26  TYR A CZ   1  
ATOM 389   O OH   . TYR A 1 26  ? 2.604   17.976  -22.375 1.00 0.00 ? 26  TYR A OH   1  
ATOM 390   H H    . TYR A 1 26  ? -1.286  11.998  -17.767 1.00 0.00 ? 26  TYR A H    1  
ATOM 391   H HA   . TYR A 1 26  ? 0.704   12.846  -19.704 1.00 0.00 ? 26  TYR A HA   1  
ATOM 392   H HB2  . TYR A 1 26  ? -1.505  14.252  -19.886 1.00 0.00 ? 26  TYR A HB2  1  
ATOM 393   H HB3  . TYR A 1 26  ? -0.929  15.003  -18.404 1.00 0.00 ? 26  TYR A HB3  1  
ATOM 394   H HD1  . TYR A 1 26  ? 0.111   14.245  -21.896 1.00 0.00 ? 26  TYR A HD1  1  
ATOM 395   H HD2  . TYR A 1 26  ? 0.573   16.788  -18.516 1.00 0.00 ? 26  TYR A HD2  1  
ATOM 396   H HE1  . TYR A 1 26  ? 1.512   15.757  -23.233 1.00 0.00 ? 26  TYR A HE1  1  
ATOM 397   H HE2  . TYR A 1 26  ? 1.972   18.312  -19.849 1.00 0.00 ? 26  TYR A HE2  1  
ATOM 398   H HH   . TYR A 1 26  ? 2.174   18.123  -23.238 1.00 0.00 ? 26  TYR A HH   1  
ATOM 399   N N    . VAL A 1 27  ? 2.145   12.979  -17.698 1.00 0.00 ? 27  VAL A N    1  
ATOM 400   C CA   . VAL A 1 27  ? 3.042   13.117  -16.559 1.00 0.00 ? 27  VAL A CA   1  
ATOM 401   C C    . VAL A 1 27  ? 3.267   14.590  -16.246 1.00 0.00 ? 27  VAL A C    1  
ATOM 402   O O    . VAL A 1 27  ? 3.862   15.322  -17.042 1.00 0.00 ? 27  VAL A O    1  
ATOM 403   C CB   . VAL A 1 27  ? 4.402   12.431  -16.815 1.00 0.00 ? 27  VAL A CB   1  
ATOM 404   C CG1  . VAL A 1 27  ? 5.339   12.612  -15.629 1.00 0.00 ? 27  VAL A CG1  1  
ATOM 405   C CG2  . VAL A 1 27  ? 4.205   10.953  -17.118 1.00 0.00 ? 27  VAL A CG2  1  
ATOM 406   H H    . VAL A 1 27  ? 2.486   12.591  -18.533 1.00 0.00 ? 27  VAL A H    1  
ATOM 407   H HA   . VAL A 1 27  ? 2.574   12.644  -15.706 1.00 0.00 ? 27  VAL A HA   1  
ATOM 408   H HB   . VAL A 1 27  ? 4.859   12.893  -17.676 1.00 0.00 ? 27  VAL A HB   1  
ATOM 409   H HG11 . VAL A 1 27  ? 4.906   12.152  -14.752 1.00 0.00 ? 27  VAL A HG11 1  
ATOM 410   H HG12 . VAL A 1 27  ? 5.488   13.665  -15.445 1.00 0.00 ? 27  VAL A HG12 1  
ATOM 411   H HG13 . VAL A 1 27  ? 6.288   12.148  -15.847 1.00 0.00 ? 27  VAL A HG13 1  
ATOM 412   H HG21 . VAL A 1 27  ? 3.565   10.848  -17.982 1.00 0.00 ? 27  VAL A HG21 1  
ATOM 413   H HG22 . VAL A 1 27  ? 3.747   10.470  -16.268 1.00 0.00 ? 27  VAL A HG22 1  
ATOM 414   H HG23 . VAL A 1 27  ? 5.162   10.495  -17.321 1.00 0.00 ? 27  VAL A HG23 1  
ATOM 415   N N    . CYS A 1 28  ? 2.772   15.021  -15.100 1.00 0.00 ? 28  CYS A N    1  
ATOM 416   C CA   . CYS A 1 28  ? 2.910   16.403  -14.683 1.00 0.00 ? 28  CYS A CA   1  
ATOM 417   C C    . CYS A 1 28  ? 3.650   16.476  -13.357 1.00 0.00 ? 28  CYS A C    1  
ATOM 418   O O    . CYS A 1 28  ? 3.259   15.833  -12.381 1.00 0.00 ? 28  CYS A O    1  
ATOM 419   C CB   . CYS A 1 28  ? 1.533   17.059  -14.557 1.00 0.00 ? 28  CYS A CB   1  
ATOM 420   S SG   . CYS A 1 28  ? 1.579   18.860  -14.400 1.00 0.00 ? 28  CYS A SG   1  
ATOM 421   H H    . CYS A 1 28  ? 2.307   14.390  -14.513 1.00 0.00 ? 28  CYS A H    1  
ATOM 422   H HA   . CYS A 1 28  ? 3.483   16.925  -15.436 1.00 0.00 ? 28  CYS A HA   1  
ATOM 423   H HB2  . CYS A 1 28  ? 0.948   16.819  -15.433 1.00 0.00 ? 28  CYS A HB2  1  
ATOM 424   H HB3  . CYS A 1 28  ? 1.037   16.666  -13.683 1.00 0.00 ? 28  CYS A HB3  1  
ATOM 425   H HG   . CYS A 1 28  ? 0.576   19.352  -15.119 1.00 0.00 ? 28  CYS A HG   1  
ATOM 426   N N    . GLY A 1 29  ? 4.718   17.256  -13.328 1.00 0.00 ? 29  GLY A N    1  
ATOM 427   C CA   . GLY A 1 29  ? 5.501   17.399  -12.120 1.00 0.00 ? 29  GLY A CA   1  
ATOM 428   C C    . GLY A 1 29  ? 6.977   17.511  -12.419 1.00 0.00 ? 29  GLY A C    1  
ATOM 429   O O    . GLY A 1 29  ? 7.384   18.307  -13.269 1.00 0.00 ? 29  GLY A O    1  
ATOM 430   H H    . GLY A 1 29  ? 4.985   17.741  -14.145 1.00 0.00 ? 29  GLY A H    1  
ATOM 431   H HA2  . GLY A 1 29  ? 5.180   18.289  -11.596 1.00 0.00 ? 29  GLY A HA2  1  
ATOM 432   H HA3  . GLY A 1 29  ? 5.334   16.540  -11.487 1.00 0.00 ? 29  GLY A HA3  1  
ATOM 433   N N    . ALA A 1 30  ? 7.778   16.712  -11.732 1.00 0.00 ? 30  ALA A N    1  
ATOM 434   C CA   . ALA A 1 30  ? 9.219   16.720  -11.930 1.00 0.00 ? 30  ALA A CA   1  
ATOM 435   C C    . ALA A 1 30  ? 9.812   15.375  -11.543 1.00 0.00 ? 30  ALA A C    1  
ATOM 436   O O    . ALA A 1 30  ? 9.090   14.465  -11.132 1.00 0.00 ? 30  ALA A O    1  
ATOM 437   C CB   . ALA A 1 30  ? 9.862   17.834  -11.121 1.00 0.00 ? 30  ALA A CB   1  
ATOM 438   H H    . ALA A 1 30  ? 7.390   16.097  -11.069 1.00 0.00 ? 30  ALA A H    1  
ATOM 439   H HA   . ALA A 1 30  ? 9.413   16.903  -12.975 1.00 0.00 ? 30  ALA A HA   1  
ATOM 440   H HB1  . ALA A 1 30  ? 10.921  17.869  -11.337 1.00 0.00 ? 30  ALA A HB1  1  
ATOM 441   H HB2  . ALA A 1 30  ? 9.716   17.648  -10.066 1.00 0.00 ? 30  ALA A HB2  1  
ATOM 442   H HB3  . ALA A 1 30  ? 9.409   18.780  -11.386 1.00 0.00 ? 30  ALA A HB3  1  
ATOM 443   N N    . GLY A 1 31  ? 11.122  15.249  -11.685 1.00 0.00 ? 31  GLY A N    1  
ATOM 444   C CA   . GLY A 1 31  ? 11.786  14.012  -11.335 1.00 0.00 ? 31  GLY A CA   1  
ATOM 445   C C    . GLY A 1 31  ? 12.713  14.185  -10.149 1.00 0.00 ? 31  GLY A C    1  
ATOM 446   O O    . GLY A 1 31  ? 13.845  14.637  -10.311 1.00 0.00 ? 31  GLY A O    1  
ATOM 447   H H    . GLY A 1 31  ? 11.647  16.006  -12.033 1.00 0.00 ? 31  GLY A H    1  
ATOM 448   H HA2  . GLY A 1 31  ? 11.039  13.268  -11.097 1.00 0.00 ? 31  GLY A HA2  1  
ATOM 449   H HA3  . GLY A 1 31  ? 12.362  13.674  -12.184 1.00 0.00 ? 31  GLY A HA3  1  
ATOM 450   N N    . PRO A 1 32  ? 12.252  13.857  -8.932  1.00 0.00 ? 32  PRO A N    1  
ATOM 451   C CA   . PRO A 1 32  ? 13.058  13.985  -7.714  1.00 0.00 ? 32  PRO A CA   1  
ATOM 452   C C    . PRO A 1 32  ? 14.212  12.992  -7.677  1.00 0.00 ? 32  PRO A C    1  
ATOM 453   O O    . PRO A 1 32  ? 14.001  11.782  -7.595  1.00 0.00 ? 32  PRO A O    1  
ATOM 454   C CB   . PRO A 1 32  ? 12.067  13.688  -6.578  1.00 0.00 ? 32  PRO A CB   1  
ATOM 455   C CG   . PRO A 1 32  ? 10.714  13.722  -7.206  1.00 0.00 ? 32  PRO A CG   1  
ATOM 456   C CD   . PRO A 1 32  ? 10.911  13.338  -8.641  1.00 0.00 ? 32  PRO A CD   1  
ATOM 457   H HA   . PRO A 1 32  ? 13.446  14.987  -7.601  1.00 0.00 ? 32  PRO A HA   1  
ATOM 458   H HB2  . PRO A 1 32  ? 12.284  12.717  -6.157  1.00 0.00 ? 32  PRO A HB2  1  
ATOM 459   H HB3  . PRO A 1 32  ? 12.163  14.443  -5.811  1.00 0.00 ? 32  PRO A HB3  1  
ATOM 460   H HG2  . PRO A 1 32  ? 10.062  13.015  -6.715  1.00 0.00 ? 32  PRO A HG2  1  
ATOM 461   H HG3  . PRO A 1 32  ? 10.307  14.720  -7.139  1.00 0.00 ? 32  PRO A HG3  1  
ATOM 462   H HD2  . PRO A 1 32  ? 10.877  12.264  -8.758  1.00 0.00 ? 32  PRO A HD2  1  
ATOM 463   H HD3  . PRO A 1 32  ? 10.171  13.813  -9.267  1.00 0.00 ? 32  PRO A HD3  1  
ATOM 464   N N    . GLY A 1 33  ? 15.430  13.506  -7.748  1.00 0.00 ? 33  GLY A N    1  
ATOM 465   C CA   . GLY A 1 33  ? 16.597  12.652  -7.716  1.00 0.00 ? 33  GLY A CA   1  
ATOM 466   C C    . GLY A 1 33  ? 17.550  13.038  -6.607  1.00 0.00 ? 33  GLY A C    1  
ATOM 467   O O    . GLY A 1 33  ? 17.254  12.836  -5.428  1.00 0.00 ? 33  GLY A O    1  
ATOM 468   H H    . GLY A 1 33  ? 15.540  14.482  -7.825  1.00 0.00 ? 33  GLY A H    1  
ATOM 469   H HA2  . GLY A 1 33  ? 16.281  11.632  -7.567  1.00 0.00 ? 33  GLY A HA2  1  
ATOM 470   H HA3  . GLY A 1 33  ? 17.113  12.725  -8.662  1.00 0.00 ? 33  GLY A HA3  1  
ATOM 471   N N    . GLU A 1 34  ? 18.688  13.602  -6.985  1.00 0.00 ? 34  GLU A N    1  
ATOM 472   C CA   . GLU A 1 34  ? 19.695  14.026  -6.024  1.00 0.00 ? 34  GLU A CA   1  
ATOM 473   C C    . GLU A 1 34  ? 19.285  15.341  -5.363  1.00 0.00 ? 34  GLU A C    1  
ATOM 474   O O    . GLU A 1 34  ? 19.336  16.405  -5.983  1.00 0.00 ? 34  GLU A O    1  
ATOM 475   C CB   . GLU A 1 34  ? 21.052  14.181  -6.713  1.00 0.00 ? 34  GLU A CB   1  
ATOM 476   C CG   . GLU A 1 34  ? 22.189  14.496  -5.755  1.00 0.00 ? 34  GLU A CG   1  
ATOM 477   C CD   . GLU A 1 34  ? 23.510  14.683  -6.469  1.00 0.00 ? 34  GLU A CD   1  
ATOM 478   O OE1  . GLU A 1 34  ? 24.172  13.673  -6.778  1.00 0.00 ? 34  GLU A OE1  1  
ATOM 479   O OE2  . GLU A 1 34  ? 23.891  15.842  -6.729  1.00 0.00 ? 34  GLU A OE2  1  
ATOM 480   H H    . GLU A 1 34  ? 18.858  13.736  -7.948  1.00 0.00 ? 34  GLU A H    1  
ATOM 481   H HA   . GLU A 1 34  ? 19.771  13.262  -5.265  1.00 0.00 ? 34  GLU A HA   1  
ATOM 482   H HB2  . GLU A 1 34  ? 21.287  13.262  -7.227  1.00 0.00 ? 34  GLU A HB2  1  
ATOM 483   H HB3  . GLU A 1 34  ? 20.986  14.981  -7.436  1.00 0.00 ? 34  GLU A HB3  1  
ATOM 484   H HG2  . GLU A 1 34  ? 21.954  15.407  -5.225  1.00 0.00 ? 34  GLU A HG2  1  
ATOM 485   H HG3  . GLU A 1 34  ? 22.286  13.684  -5.050  1.00 0.00 ? 34  GLU A HG3  1  
ATOM 486   N N    . GLY A 1 35  ? 18.871  15.257  -4.108  1.00 0.00 ? 35  GLY A N    1  
ATOM 487   C CA   . GLY A 1 35  ? 18.456  16.438  -3.378  1.00 0.00 ? 35  GLY A CA   1  
ATOM 488   C C    . GLY A 1 35  ? 17.551  16.085  -2.214  1.00 0.00 ? 35  GLY A C    1  
ATOM 489   O O    . GLY A 1 35  ? 16.332  16.216  -2.318  1.00 0.00 ? 35  GLY A O    1  
ATOM 490   H H    . GLY A 1 35  ? 18.836  14.375  -3.669  1.00 0.00 ? 35  GLY A H    1  
ATOM 491   H HA2  . GLY A 1 35  ? 19.333  16.946  -3.001  1.00 0.00 ? 35  GLY A HA2  1  
ATOM 492   H HA3  . GLY A 1 35  ? 17.925  17.100  -4.047  1.00 0.00 ? 35  GLY A HA3  1  
ATOM 493   N N    . PRO A 1 36  ? 18.132  15.627  -1.092  1.00 0.00 ? 36  PRO A N    1  
ATOM 494   C CA   . PRO A 1 36  ? 17.372  15.231  0.103   1.00 0.00 ? 36  PRO A CA   1  
ATOM 495   C C    . PRO A 1 36  ? 16.406  16.313  0.574   1.00 0.00 ? 36  PRO A C    1  
ATOM 496   O O    . PRO A 1 36  ? 16.810  17.439  0.865   1.00 0.00 ? 36  PRO A O    1  
ATOM 497   C CB   . PRO A 1 36  ? 18.457  14.999  1.153   1.00 0.00 ? 36  PRO A CB   1  
ATOM 498   C CG   . PRO A 1 36  ? 19.678  14.666  0.368   1.00 0.00 ? 36  PRO A CG   1  
ATOM 499   C CD   . PRO A 1 36  ? 19.585  15.471  -0.895  1.00 0.00 ? 36  PRO A CD   1  
ATOM 500   H HA   . PRO A 1 36  ? 16.827  14.312  -0.064  1.00 0.00 ? 36  PRO A HA   1  
ATOM 501   H HB2  . PRO A 1 36  ? 18.593  15.898  1.738   1.00 0.00 ? 36  PRO A HB2  1  
ATOM 502   H HB3  . PRO A 1 36  ? 18.168  14.183  1.797   1.00 0.00 ? 36  PRO A HB3  1  
ATOM 503   H HG2  . PRO A 1 36  ? 20.560  14.941  0.926   1.00 0.00 ? 36  PRO A HG2  1  
ATOM 504   H HG3  . PRO A 1 36  ? 19.692  13.611  0.138   1.00 0.00 ? 36  PRO A HG3  1  
ATOM 505   H HD2  . PRO A 1 36  ? 20.063  16.432  -0.766  1.00 0.00 ? 36  PRO A HD2  1  
ATOM 506   H HD3  . PRO A 1 36  ? 20.029  14.935  -1.720  1.00 0.00 ? 36  PRO A HD3  1  
ATOM 507   N N    . ALA A 1 37  ? 15.132  15.965  0.647   1.00 0.00 ? 37  ALA A N    1  
ATOM 508   C CA   . ALA A 1 37  ? 14.107  16.902  1.074   1.00 0.00 ? 37  ALA A CA   1  
ATOM 509   C C    . ALA A 1 37  ? 13.570  16.519  2.446   1.00 0.00 ? 37  ALA A C    1  
ATOM 510   O O    . ALA A 1 37  ? 13.813  15.414  2.930   1.00 0.00 ? 37  ALA A O    1  
ATOM 511   C CB   . ALA A 1 37  ? 12.979  16.952  0.056   1.00 0.00 ? 37  ALA A CB   1  
ATOM 512   H H    . ALA A 1 37  ? 14.873  15.039  0.427   1.00 0.00 ? 37  ALA A H    1  
ATOM 513   H HA   . ALA A 1 37  ? 14.555  17.883  1.131   1.00 0.00 ? 37  ALA A HA   1  
ATOM 514   H HB1  . ALA A 1 37  ? 12.523  15.975  -0.023  1.00 0.00 ? 37  ALA A HB1  1  
ATOM 515   H HB2  . ALA A 1 37  ? 13.373  17.244  -0.906  1.00 0.00 ? 37  ALA A HB2  1  
ATOM 516   H HB3  . ALA A 1 37  ? 12.238  17.669  0.375   1.00 0.00 ? 37  ALA A HB3  1  
ATOM 517   N N    . ALA A 1 38  ? 12.833  17.430  3.063   1.00 0.00 ? 38  ALA A N    1  
ATOM 518   C CA   . ALA A 1 38  ? 12.260  17.189  4.382   1.00 0.00 ? 38  ALA A CA   1  
ATOM 519   C C    . ALA A 1 38  ? 10.848  16.624  4.272   1.00 0.00 ? 38  ALA A C    1  
ATOM 520   O O    . ALA A 1 38  ? 10.075  16.662  5.232   1.00 0.00 ? 38  ALA A O    1  
ATOM 521   C CB   . ALA A 1 38  ? 12.256  18.476  5.190   1.00 0.00 ? 38  ALA A CB   1  
ATOM 522   H H    . ALA A 1 38  ? 12.668  18.296  2.620   1.00 0.00 ? 38  ALA A H    1  
ATOM 523   H HA   . ALA A 1 38  ? 12.886  16.473  4.892   1.00 0.00 ? 38  ALA A HA   1  
ATOM 524   H HB1  . ALA A 1 38  ? 13.273  18.803  5.353   1.00 0.00 ? 38  ALA A HB1  1  
ATOM 525   H HB2  . ALA A 1 38  ? 11.777  18.301  6.142   1.00 0.00 ? 38  ALA A HB2  1  
ATOM 526   H HB3  . ALA A 1 38  ? 11.716  19.241  4.649   1.00 0.00 ? 38  ALA A HB3  1  
ATOM 527   N N    . ASP A 1 39  ? 10.515  16.102  3.095   1.00 0.00 ? 39  ASP A N    1  
ATOM 528   C CA   . ASP A 1 39  ? 9.198   15.523  2.861   1.00 0.00 ? 39  ASP A CA   1  
ATOM 529   C C    . ASP A 1 39  ? 9.322   14.061  2.454   1.00 0.00 ? 39  ASP A C    1  
ATOM 530   O O    . ASP A 1 39  ? 9.459   13.740  1.272   1.00 0.00 ? 39  ASP A O    1  
ATOM 531   C CB   . ASP A 1 39  ? 8.435   16.294  1.778   1.00 0.00 ? 39  ASP A CB   1  
ATOM 532   C CG   . ASP A 1 39  ? 6.952   15.945  1.743   1.00 0.00 ? 39  ASP A CG   1  
ATOM 533   O OD1  . ASP A 1 39  ? 6.608   14.748  1.588   1.00 0.00 ? 39  ASP A OD1  1  
ATOM 534   O OD2  . ASP A 1 39  ? 6.124   16.878  1.859   1.00 0.00 ? 39  ASP A OD2  1  
ATOM 535   H H    . ASP A 1 39  ? 11.174  16.099  2.373   1.00 0.00 ? 39  ASP A H    1  
ATOM 536   H HA   . ASP A 1 39  ? 8.644   15.578  3.786   1.00 0.00 ? 39  ASP A HA   1  
ATOM 537   H HB2  . ASP A 1 39  ? 8.530   17.353  1.963   1.00 0.00 ? 39  ASP A HB2  1  
ATOM 538   H HB3  . ASP A 1 39  ? 8.862   16.062  0.813   1.00 0.00 ? 39  ASP A HB3  1  
ATOM 539   N N    . PRO A 1 40  ? 9.330   13.152  3.432   1.00 0.00 ? 40  PRO A N    1  
ATOM 540   C CA   . PRO A 1 40  ? 9.405   11.728  3.171   1.00 0.00 ? 40  PRO A CA   1  
ATOM 541   C C    . PRO A 1 40  ? 8.012   11.132  3.017   1.00 0.00 ? 40  PRO A C    1  
ATOM 542   O O    . PRO A 1 40  ? 7.858   9.975   2.637   1.00 0.00 ? 40  PRO A O    1  
ATOM 543   C CB   . PRO A 1 40  ? 10.089  11.197  4.424   1.00 0.00 ? 40  PRO A CB   1  
ATOM 544   C CG   . PRO A 1 40  ? 9.625   12.102  5.518   1.00 0.00 ? 40  PRO A CG   1  
ATOM 545   C CD   . PRO A 1 40  ? 9.308   13.438  4.879   1.00 0.00 ? 40  PRO A CD   1  
ATOM 546   H HA   . PRO A 1 40  ? 10.001  11.508  2.297   1.00 0.00 ? 40  PRO A HA   1  
ATOM 547   H HB2  . PRO A 1 40  ? 9.786   10.174  4.598   1.00 0.00 ? 40  PRO A HB2  1  
ATOM 548   H HB3  . PRO A 1 40  ? 11.161  11.245  4.301   1.00 0.00 ? 40  PRO A HB3  1  
ATOM 549   H HG2  . PRO A 1 40  ? 8.740   11.688  5.982   1.00 0.00 ? 40  PRO A HG2  1  
ATOM 550   H HG3  . PRO A 1 40  ? 10.409  12.217  6.251   1.00 0.00 ? 40  PRO A HG3  1  
ATOM 551   H HD2  . PRO A 1 40  ? 8.331   13.782  5.187   1.00 0.00 ? 40  PRO A HD2  1  
ATOM 552   H HD3  . PRO A 1 40  ? 10.062  14.166  5.137   1.00 0.00 ? 40  PRO A HD3  1  
ATOM 553   N N    . LEU A 1 41  ? 7.002   11.958  3.293   1.00 0.00 ? 41  LEU A N    1  
ATOM 554   C CA   . LEU A 1 41  ? 5.606   11.546  3.216   1.00 0.00 ? 41  LEU A CA   1  
ATOM 555   C C    . LEU A 1 41  ? 5.202   11.244  1.781   1.00 0.00 ? 41  LEU A C    1  
ATOM 556   O O    . LEU A 1 41  ? 4.686   10.165  1.489   1.00 0.00 ? 41  LEU A O    1  
ATOM 557   C CB   . LEU A 1 41  ? 4.696   12.636  3.789   1.00 0.00 ? 41  LEU A CB   1  
ATOM 558   C CG   . LEU A 1 41  ? 4.960   13.019  5.248   1.00 0.00 ? 41  LEU A CG   1  
ATOM 559   C CD1  . LEU A 1 41  ? 4.093   14.202  5.652   1.00 0.00 ? 41  LEU A CD1  1  
ATOM 560   C CD2  . LEU A 1 41  ? 4.702   11.833  6.164   1.00 0.00 ? 41  LEU A CD2  1  
ATOM 561   H H    . LEU A 1 41  ? 7.208   12.882  3.550   1.00 0.00 ? 41  LEU A H    1  
ATOM 562   H HA   . LEU A 1 41  ? 5.492   10.650  3.807   1.00 0.00 ? 41  LEU A HA   1  
ATOM 563   H HB2  . LEU A 1 41  ? 4.808   13.523  3.182   1.00 0.00 ? 41  LEU A HB2  1  
ATOM 564   H HB3  . LEU A 1 41  ? 3.673   12.297  3.711   1.00 0.00 ? 41  LEU A HB3  1  
ATOM 565   H HG   . LEU A 1 41  ? 5.996   13.310  5.356   1.00 0.00 ? 41  LEU A HG   1  
ATOM 566   H HD11 . LEU A 1 41  ? 4.369   14.530  6.645   1.00 0.00 ? 41  LEU A HD11 1  
ATOM 567   H HD12 . LEU A 1 41  ? 3.056   13.906  5.647   1.00 0.00 ? 41  LEU A HD12 1  
ATOM 568   H HD13 . LEU A 1 41  ? 4.240   15.012  4.953   1.00 0.00 ? 41  LEU A HD13 1  
ATOM 569   H HD21 . LEU A 1 41  ? 5.398   11.039  5.933   1.00 0.00 ? 41  LEU A HD21 1  
ATOM 570   H HD22 . LEU A 1 41  ? 3.691   11.478  6.018   1.00 0.00 ? 41  LEU A HD22 1  
ATOM 571   H HD23 . LEU A 1 41  ? 4.832   12.136  7.191   1.00 0.00 ? 41  LEU A HD23 1  
ATOM 572   N N    . HIS A 1 42  ? 5.441   12.195  0.884   1.00 0.00 ? 42  HIS A N    1  
ATOM 573   C CA   . HIS A 1 42  ? 5.090   12.012  -0.520  1.00 0.00 ? 42  HIS A CA   1  
ATOM 574   C C    . HIS A 1 42  ? 5.874   10.851  -1.119  1.00 0.00 ? 42  HIS A C    1  
ATOM 575   O O    . HIS A 1 42  ? 5.344   10.070  -1.910  1.00 0.00 ? 42  HIS A O    1  
ATOM 576   C CB   . HIS A 1 42  ? 5.338   13.295  -1.315  1.00 0.00 ? 42  HIS A CB   1  
ATOM 577   C CG   . HIS A 1 42  ? 4.240   14.306  -1.167  1.00 0.00 ? 42  HIS A CG   1  
ATOM 578   N ND1  . HIS A 1 42  ? 2.990   14.151  -1.725  1.00 0.00 ? 42  HIS A ND1  1  
ATOM 579   C CD2  . HIS A 1 42  ? 4.210   15.489  -0.512  1.00 0.00 ? 42  HIS A CD2  1  
ATOM 580   C CE1  . HIS A 1 42  ? 2.242   15.194  -1.424  1.00 0.00 ? 42  HIS A CE1  1  
ATOM 581   N NE2  . HIS A 1 42  ? 2.956   16.021  -0.687  1.00 0.00 ? 42  HIS A NE2  1  
ATOM 582   H H    . HIS A 1 42  ? 5.861   13.043  1.176   1.00 0.00 ? 42  HIS A H    1  
ATOM 583   H HA   . HIS A 1 42  ? 4.038   11.773  -0.564  1.00 0.00 ? 42  HIS A HA   1  
ATOM 584   H HB2  . HIS A 1 42  ? 6.258   13.748  -0.976  1.00 0.00 ? 42  HIS A HB2  1  
ATOM 585   H HB3  . HIS A 1 42  ? 5.427   13.048  -2.364  1.00 0.00 ? 42  HIS A HB3  1  
ATOM 586   H HD1  . HIS A 1 42  ? 2.692   13.379  -2.268  1.00 0.00 ? 42  HIS A HD1  1  
ATOM 587   H HD2  . HIS A 1 42  ? 5.023   15.937  0.041   1.00 0.00 ? 42  HIS A HD2  1  
ATOM 588   H HE1  . HIS A 1 42  ? 1.216   15.345  -1.730  1.00 0.00 ? 42  HIS A HE1  1  
ATOM 589   H HE2  . HIS A 1 42  ? 2.711   16.960  -0.501  1.00 0.00 ? 42  HIS A HE2  1  
ATOM 590   N N    . GLN A 1 43  ? 7.133   10.727  -0.716  1.00 0.00 ? 43  GLN A N    1  
ATOM 591   C CA   . GLN A 1 43  ? 7.982   9.646   -1.194  1.00 0.00 ? 43  GLN A CA   1  
ATOM 592   C C    . GLN A 1 43  ? 7.481   8.306   -0.663  1.00 0.00 ? 43  GLN A C    1  
ATOM 593   O O    . GLN A 1 43  ? 7.466   7.307   -1.384  1.00 0.00 ? 43  GLN A O    1  
ATOM 594   C CB   . GLN A 1 43  ? 9.435   9.872   -0.771  1.00 0.00 ? 43  GLN A CB   1  
ATOM 595   C CG   . GLN A 1 43  ? 10.256  10.655  -1.785  1.00 0.00 ? 43  GLN A CG   1  
ATOM 596   C CD   . GLN A 1 43  ? 10.245  10.016  -3.160  1.00 0.00 ? 43  GLN A CD   1  
ATOM 597   O OE1  . GLN A 1 43  ? 10.058  8.807   -3.298  1.00 0.00 ? 43  GLN A OE1  1  
ATOM 598   N NE2  . GLN A 1 43  ? 10.462  10.820  -4.182  1.00 0.00 ? 43  GLN A NE2  1  
ATOM 599   H H    . GLN A 1 43  ? 7.497   11.382  -0.084  1.00 0.00 ? 43  GLN A H    1  
ATOM 600   H HA   . GLN A 1 43  ? 7.927   9.637   -2.274  1.00 0.00 ? 43  GLN A HA   1  
ATOM 601   H HB2  . GLN A 1 43  ? 9.445   10.417  0.161   1.00 0.00 ? 43  GLN A HB2  1  
ATOM 602   H HB3  . GLN A 1 43  ? 9.906   8.912   -0.623  1.00 0.00 ? 43  GLN A HB3  1  
ATOM 603   H HG2  . GLN A 1 43  ? 9.849   11.651  -1.868  1.00 0.00 ? 43  GLN A HG2  1  
ATOM 604   H HG3  . GLN A 1 43  ? 11.277  10.711  -1.438  1.00 0.00 ? 43  GLN A HG3  1  
ATOM 605   H HE21 . GLN A 1 43  ? 10.621  11.774  -3.998  1.00 0.00 ? 43  GLN A HE21 1  
ATOM 606   H HE22 . GLN A 1 43  ? 10.454  10.434  -5.087  1.00 0.00 ? 43  GLN A HE22 1  
ATOM 607   N N    . ALA A 1 44  ? 7.062   8.298   0.600   1.00 0.00 ? 44  ALA A N    1  
ATOM 608   C CA   . ALA A 1 44  ? 6.546   7.089   1.230   1.00 0.00 ? 44  ALA A CA   1  
ATOM 609   C C    . ALA A 1 44  ? 5.254   6.647   0.559   1.00 0.00 ? 44  ALA A C    1  
ATOM 610   O O    . ALA A 1 44  ? 5.064   5.466   0.283   1.00 0.00 ? 44  ALA A O    1  
ATOM 611   C CB   . ALA A 1 44  ? 6.317   7.316   2.718   1.00 0.00 ? 44  ALA A CB   1  
ATOM 612   H H    . ALA A 1 44  ? 7.105   9.127   1.126   1.00 0.00 ? 44  ALA A H    1  
ATOM 613   H HA   . ALA A 1 44  ? 7.285   6.310   1.117   1.00 0.00 ? 44  ALA A HA   1  
ATOM 614   H HB1  . ALA A 1 44  ? 5.969   6.399   3.173   1.00 0.00 ? 44  ALA A HB1  1  
ATOM 615   H HB2  . ALA A 1 44  ? 5.576   8.091   2.856   1.00 0.00 ? 44  ALA A HB2  1  
ATOM 616   H HB3  . ALA A 1 44  ? 7.244   7.619   3.183   1.00 0.00 ? 44  ALA A HB3  1  
ATOM 617   N N    . MET A 1 45  ? 4.375   7.608   0.288   1.00 0.00 ? 45  MET A N    1  
ATOM 618   C CA   . MET A 1 45  ? 3.104   7.325   -0.368  1.00 0.00 ? 45  MET A CA   1  
ATOM 619   C C    . MET A 1 45  ? 3.345   6.742   -1.753  1.00 0.00 ? 45  MET A C    1  
ATOM 620   O O    . MET A 1 45  ? 2.677   5.793   -2.159  1.00 0.00 ? 45  MET A O    1  
ATOM 621   C CB   . MET A 1 45  ? 2.247   8.591   -0.462  1.00 0.00 ? 45  MET A CB   1  
ATOM 622   C CG   . MET A 1 45  ? 1.476   8.892   0.812   1.00 0.00 ? 45  MET A CG   1  
ATOM 623   S SD   . MET A 1 45  ? 0.341   10.278  0.626   1.00 0.00 ? 45  MET A SD   1  
ATOM 624   C CE   . MET A 1 45  ? -0.556  10.171  2.171   1.00 0.00 ? 45  MET A CE   1  
ATOM 625   H H    . MET A 1 45  ? 4.584   8.533   0.547   1.00 0.00 ? 45  MET A H    1  
ATOM 626   H HA   . MET A 1 45  ? 2.581   6.591   0.228   1.00 0.00 ? 45  MET A HA   1  
ATOM 627   H HB2  . MET A 1 45  ? 2.889   9.433   -0.676  1.00 0.00 ? 45  MET A HB2  1  
ATOM 628   H HB3  . MET A 1 45  ? 1.536   8.476   -1.268  1.00 0.00 ? 45  MET A HB3  1  
ATOM 629   H HG2  . MET A 1 45  ? 0.908   8.016   1.090   1.00 0.00 ? 45  MET A HG2  1  
ATOM 630   H HG3  . MET A 1 45  ? 2.181   9.125   1.596   1.00 0.00 ? 45  MET A HG3  1  
ATOM 631   H HE1  . MET A 1 45  ? 0.126   10.332  2.993   1.00 0.00 ? 45  MET A HE1  1  
ATOM 632   H HE2  . MET A 1 45  ? -1.002  9.193   2.259   1.00 0.00 ? 45  MET A HE2  1  
ATOM 633   H HE3  . MET A 1 45  ? -1.329  10.925  2.192   1.00 0.00 ? 45  MET A HE3  1  
ATOM 634   N N    . ARG A 1 46  ? 4.314   7.304   -2.468  1.00 0.00 ? 46  ARG A N    1  
ATOM 635   C CA   . ARG A 1 46  ? 4.658   6.820   -3.794  1.00 0.00 ? 46  ARG A CA   1  
ATOM 636   C C    . ARG A 1 46  ? 5.146   5.382   -3.698  1.00 0.00 ? 46  ARG A C    1  
ATOM 637   O O    . ARG A 1 46  ? 4.665   4.502   -4.406  1.00 0.00 ? 46  ARG A O    1  
ATOM 638   C CB   . ARG A 1 46  ? 5.748   7.705   -4.416  1.00 0.00 ? 46  ARG A CB   1  
ATOM 639   C CG   . ARG A 1 46  ? 6.108   7.352   -5.855  1.00 0.00 ? 46  ARG A CG   1  
ATOM 640   C CD   . ARG A 1 46  ? 7.219   6.306   -5.934  1.00 0.00 ? 46  ARG A CD   1  
ATOM 641   N NE   . ARG A 1 46  ? 8.394   6.674   -5.139  1.00 0.00 ? 46  ARG A NE   1  
ATOM 642   C CZ   . ARG A 1 46  ? 9.364   5.821   -4.792  1.00 0.00 ? 46  ARG A CZ   1  
ATOM 643   N NH1  . ARG A 1 46  ? 9.341   4.556   -5.214  1.00 0.00 ? 46  ARG A NH1  1  
ATOM 644   N NH2  . ARG A 1 46  ? 10.365  6.239   -4.031  1.00 0.00 ? 46  ARG A NH2  1  
ATOM 645   H H    . ARG A 1 46  ? 4.808   8.065   -2.091  1.00 0.00 ? 46  ARG A H    1  
ATOM 646   H HA   . ARG A 1 46  ? 3.771   6.857   -4.410  1.00 0.00 ? 46  ARG A HA   1  
ATOM 647   H HB2  . ARG A 1 46  ? 5.410   8.731   -4.397  1.00 0.00 ? 46  ARG A HB2  1  
ATOM 648   H HB3  . ARG A 1 46  ? 6.642   7.622   -3.814  1.00 0.00 ? 46  ARG A HB3  1  
ATOM 649   H HG2  . ARG A 1 46  ? 5.229   6.960   -6.346  1.00 0.00 ? 46  ARG A HG2  1  
ATOM 650   H HG3  . ARG A 1 46  ? 6.433   8.248   -6.363  1.00 0.00 ? 46  ARG A HG3  1  
ATOM 651   H HD2  . ARG A 1 46  ? 6.834   5.367   -5.570  1.00 0.00 ? 46  ARG A HD2  1  
ATOM 652   H HD3  . ARG A 1 46  ? 7.515   6.196   -6.967  1.00 0.00 ? 46  ARG A HD3  1  
ATOM 653   H HE   . ARG A 1 46  ? 8.459   7.607   -4.836  1.00 0.00 ? 46  ARG A HE   1  
ATOM 654   H HH11 . ARG A 1 46  ? 8.594   4.228   -5.806  1.00 0.00 ? 46  ARG A HH11 1  
ATOM 655   H HH12 . ARG A 1 46  ? 10.077  3.919   -4.951  1.00 0.00 ? 46  ARG A HH12 1  
ATOM 656   H HH21 . ARG A 1 46  ? 10.396  7.198   -3.718  1.00 0.00 ? 46  ARG A HH21 1  
ATOM 657   H HH22 . ARG A 1 46  ? 11.098  5.599   -3.755  1.00 0.00 ? 46  ARG A HH22 1  
ATOM 658   N N    . ALA A 1 47  ? 6.090   5.158   -2.788  1.00 0.00 ? 47  ALA A N    1  
ATOM 659   C CA   . ALA A 1 47  ? 6.674   3.841   -2.575  1.00 0.00 ? 47  ALA A CA   1  
ATOM 660   C C    . ALA A 1 47  ? 5.631   2.824   -2.123  1.00 0.00 ? 47  ALA A C    1  
ATOM 661   O O    . ALA A 1 47  ? 5.675   1.666   -2.537  1.00 0.00 ? 47  ALA A O    1  
ATOM 662   C CB   . ALA A 1 47  ? 7.806   3.925   -1.564  1.00 0.00 ? 47  ALA A CB   1  
ATOM 663   H H    . ALA A 1 47  ? 6.409   5.911   -2.241  1.00 0.00 ? 47  ALA A H    1  
ATOM 664   H HA   . ALA A 1 47  ? 7.091   3.510   -3.515  1.00 0.00 ? 47  ALA A HA   1  
ATOM 665   H HB1  . ALA A 1 47  ? 8.287   2.962   -1.485  1.00 0.00 ? 47  ALA A HB1  1  
ATOM 666   H HB2  . ALA A 1 47  ? 7.411   4.209   -0.599  1.00 0.00 ? 47  ALA A HB2  1  
ATOM 667   H HB3  . ALA A 1 47  ? 8.525   4.662   -1.888  1.00 0.00 ? 47  ALA A HB3  1  
ATOM 668   N N    . ALA A 1 48  ? 4.687   3.265   -1.297  1.00 0.00 ? 48  ALA A N    1  
ATOM 669   C CA   . ALA A 1 48  ? 3.630   2.392   -0.786  1.00 0.00 ? 48  ALA A CA   1  
ATOM 670   C C    . ALA A 1 48  ? 2.895   1.673   -1.916  1.00 0.00 ? 48  ALA A C    1  
ATOM 671   O O    . ALA A 1 48  ? 2.453   0.540   -1.753  1.00 0.00 ? 48  ALA A O    1  
ATOM 672   C CB   . ALA A 1 48  ? 2.647   3.190   0.056   1.00 0.00 ? 48  ALA A CB   1  
ATOM 673   H H    . ALA A 1 48  ? 4.703   4.207   -1.012  1.00 0.00 ? 48  ALA A H    1  
ATOM 674   H HA   . ALA A 1 48  ? 4.092   1.654   -0.147  1.00 0.00 ? 48  ALA A HA   1  
ATOM 675   H HB1  . ALA A 1 48  ? 2.154   3.922   -0.566  1.00 0.00 ? 48  ALA A HB1  1  
ATOM 676   H HB2  . ALA A 1 48  ? 3.179   3.690   0.851   1.00 0.00 ? 48  ALA A HB2  1  
ATOM 677   H HB3  . ALA A 1 48  ? 1.911   2.523   0.479   1.00 0.00 ? 48  ALA A HB3  1  
ATOM 678   N N    . GLY A 1 49  ? 2.779   2.332   -3.060  1.00 0.00 ? 49  GLY A N    1  
ATOM 679   C CA   . GLY A 1 49  ? 2.110   1.727   -4.196  1.00 0.00 ? 49  GLY A CA   1  
ATOM 680   C C    . GLY A 1 49  ? 3.024   1.638   -5.402  1.00 0.00 ? 49  GLY A C    1  
ATOM 681   O O    . GLY A 1 49  ? 2.580   1.792   -6.541  1.00 0.00 ? 49  GLY A O    1  
ATOM 682   H H    . GLY A 1 49  ? 3.149   3.237   -3.134  1.00 0.00 ? 49  GLY A H    1  
ATOM 683   H HA2  . GLY A 1 49  ? 1.786   0.734   -3.925  1.00 0.00 ? 49  GLY A HA2  1  
ATOM 684   H HA3  . GLY A 1 49  ? 1.247   2.322   -4.454  1.00 0.00 ? 49  GLY A HA3  1  
ATOM 685   N N    . ASP A 1 50  ? 4.307   1.390   -5.155  1.00 0.00 ? 50  ASP A N    1  
ATOM 686   C CA   . ASP A 1 50  ? 5.291   1.306   -6.236  1.00 0.00 ? 50  ASP A CA   1  
ATOM 687   C C    . ASP A 1 50  ? 6.451   0.374   -5.877  1.00 0.00 ? 50  ASP A C    1  
ATOM 688   O O    . ASP A 1 50  ? 7.000   -0.310  -6.743  1.00 0.00 ? 50  ASP A O    1  
ATOM 689   C CB   . ASP A 1 50  ? 5.811   2.716   -6.551  1.00 0.00 ? 50  ASP A CB   1  
ATOM 690   C CG   . ASP A 1 50  ? 6.939   2.741   -7.559  1.00 0.00 ? 50  ASP A CG   1  
ATOM 691   O OD1  . ASP A 1 50  ? 6.675   2.560   -8.763  1.00 0.00 ? 50  ASP A OD1  1  
ATOM 692   O OD2  . ASP A 1 50  ? 8.095   2.963   -7.150  1.00 0.00 ? 50  ASP A OD2  1  
ATOM 693   H H    . ASP A 1 50  ? 4.597   1.267   -4.225  1.00 0.00 ? 50  ASP A H    1  
ATOM 694   H HA   . ASP A 1 50  ? 4.791   0.917   -7.107  1.00 0.00 ? 50  ASP A HA   1  
ATOM 695   H HB2  . ASP A 1 50  ? 4.999   3.305   -6.946  1.00 0.00 ? 50  ASP A HB2  1  
ATOM 696   H HB3  . ASP A 1 50  ? 6.163   3.171   -5.637  1.00 0.00 ? 50  ASP A HB3  1  
ATOM 697   N N    . GLU A 1 51  ? 6.810   0.340   -4.597  1.00 0.00 ? 51  GLU A N    1  
ATOM 698   C CA   . GLU A 1 51  ? 7.907   -0.497  -4.110  1.00 0.00 ? 51  GLU A CA   1  
ATOM 699   C C    . GLU A 1 51  ? 7.654   -1.979  -4.373  1.00 0.00 ? 51  GLU A C    1  
ATOM 700   O O    . GLU A 1 51  ? 8.284   -2.578  -5.246  1.00 0.00 ? 51  GLU A O    1  
ATOM 701   C CB   . GLU A 1 51  ? 8.108   -0.275  -2.610  1.00 0.00 ? 51  GLU A CB   1  
ATOM 702   C CG   . GLU A 1 51  ? 9.135   0.793   -2.279  1.00 0.00 ? 51  GLU A CG   1  
ATOM 703   C CD   . GLU A 1 51  ? 10.525  0.220   -2.117  1.00 0.00 ? 51  GLU A CD   1  
ATOM 704   O OE1  . GLU A 1 51  ? 10.769  -0.481  -1.114  1.00 0.00 ? 51  GLU A OE1  1  
ATOM 705   O OE2  . GLU A 1 51  ? 11.377  0.450   -3.001  1.00 0.00 ? 51  GLU A OE2  1  
ATOM 706   H H    . GLU A 1 51  ? 6.326   0.901   -3.953  1.00 0.00 ? 51  GLU A H    1  
ATOM 707   H HA   . GLU A 1 51  ? 8.806   -0.199  -4.628  1.00 0.00 ? 51  GLU A HA   1  
ATOM 708   H HB2  . GLU A 1 51  ? 7.165   0.016   -2.174  1.00 0.00 ? 51  GLU A HB2  1  
ATOM 709   H HB3  . GLU A 1 51  ? 8.430   -1.204  -2.162  1.00 0.00 ? 51  GLU A HB3  1  
ATOM 710   H HG2  . GLU A 1 51  ? 9.151   1.520   -3.077  1.00 0.00 ? 51  GLU A HG2  1  
ATOM 711   H HG3  . GLU A 1 51  ? 8.852   1.277   -1.356  1.00 0.00 ? 51  GLU A HG3  1  
ATOM 712   N N    . PHE A 1 52  ? 6.717   -2.556  -3.624  1.00 0.00 ? 52  PHE A N    1  
ATOM 713   C CA   . PHE A 1 52  ? 6.380   -3.973  -3.750  1.00 0.00 ? 52  PHE A CA   1  
ATOM 714   C C    . PHE A 1 52  ? 5.974   -4.327  -5.178  1.00 0.00 ? 52  PHE A C    1  
ATOM 715   O O    . PHE A 1 52  ? 6.321   -5.390  -5.677  1.00 0.00 ? 52  PHE A O    1  
ATOM 716   C CB   . PHE A 1 52  ? 5.261   -4.351  -2.764  1.00 0.00 ? 52  PHE A CB   1  
ATOM 717   C CG   . PHE A 1 52  ? 3.898   -3.827  -3.136  1.00 0.00 ? 52  PHE A CG   1  
ATOM 718   C CD1  . PHE A 1 52  ? 3.616   -2.469  -3.083  1.00 0.00 ? 52  PHE A CD1  1  
ATOM 719   C CD2  . PHE A 1 52  ? 2.901   -4.696  -3.548  1.00 0.00 ? 52  PHE A CD2  1  
ATOM 720   C CE1  . PHE A 1 52  ? 2.368   -1.993  -3.436  1.00 0.00 ? 52  PHE A CE1  1  
ATOM 721   C CE2  . PHE A 1 52  ? 1.652   -4.224  -3.900  1.00 0.00 ? 52  PHE A CE2  1  
ATOM 722   C CZ   . PHE A 1 52  ? 1.385   -2.871  -3.845  1.00 0.00 ? 52  PHE A CZ   1  
ATOM 723   H H    . PHE A 1 52  ? 6.246   -2.018  -2.956  1.00 0.00 ? 52  PHE A H    1  
ATOM 724   H HA   . PHE A 1 52  ? 7.265   -4.539  -3.500  1.00 0.00 ? 52  PHE A HA   1  
ATOM 725   H HB2  . PHE A 1 52  ? 5.192   -5.428  -2.708  1.00 0.00 ? 52  PHE A HB2  1  
ATOM 726   H HB3  . PHE A 1 52  ? 5.510   -3.964  -1.785  1.00 0.00 ? 52  PHE A HB3  1  
ATOM 727   H HD1  . PHE A 1 52  ? 4.384   -1.780  -2.762  1.00 0.00 ? 52  PHE A HD1  1  
ATOM 728   H HD2  . PHE A 1 52  ? 3.106   -5.756  -3.590  1.00 0.00 ? 52  PHE A HD2  1  
ATOM 729   H HE1  . PHE A 1 52  ? 2.161   -0.934  -3.390  1.00 0.00 ? 52  PHE A HE1  1  
ATOM 730   H HE2  . PHE A 1 52  ? 0.884   -4.912  -4.222  1.00 0.00 ? 52  PHE A HE2  1  
ATOM 731   H HZ   . PHE A 1 52  ? 0.410   -2.499  -4.123  1.00 0.00 ? 52  PHE A HZ   1  
ATOM 732   N N    . GLU A 1 53  ? 5.276   -3.412  -5.841  1.00 0.00 ? 53  GLU A N    1  
ATOM 733   C CA   . GLU A 1 53  ? 4.810   -3.638  -7.202  1.00 0.00 ? 53  GLU A CA   1  
ATOM 734   C C    . GLU A 1 53  ? 5.975   -3.814  -8.176  1.00 0.00 ? 53  GLU A C    1  
ATOM 735   O O    . GLU A 1 53  ? 5.953   -4.702  -9.029  1.00 0.00 ? 53  GLU A O    1  
ATOM 736   C CB   . GLU A 1 53  ? 3.914   -2.480  -7.653  1.00 0.00 ? 53  GLU A CB   1  
ATOM 737   C CG   . GLU A 1 53  ? 3.414   -2.603  -9.086  1.00 0.00 ? 53  GLU A CG   1  
ATOM 738   C CD   . GLU A 1 53  ? 2.530   -3.817  -9.309  1.00 0.00 ? 53  GLU A CD   1  
ATOM 739   O OE1  . GLU A 1 53  ? 3.005   -4.952  -9.106  1.00 0.00 ? 53  GLU A OE1  1  
ATOM 740   O OE2  . GLU A 1 53  ? 1.353   -3.639  -9.695  1.00 0.00 ? 53  GLU A OE2  1  
ATOM 741   H H    . GLU A 1 53  ? 5.071   -2.563  -5.402  1.00 0.00 ? 53  GLU A H    1  
ATOM 742   H HA   . GLU A 1 53  ? 4.225   -4.546  -7.201  1.00 0.00 ? 53  GLU A HA   1  
ATOM 743   H HB2  . GLU A 1 53  ? 3.057   -2.430  -6.999  1.00 0.00 ? 53  GLU A HB2  1  
ATOM 744   H HB3  . GLU A 1 53  ? 4.471   -1.559  -7.569  1.00 0.00 ? 53  GLU A HB3  1  
ATOM 745   H HG2  . GLU A 1 53  ? 2.850   -1.718  -9.334  1.00 0.00 ? 53  GLU A HG2  1  
ATOM 746   H HG3  . GLU A 1 53  ? 4.271   -2.675  -9.742  1.00 0.00 ? 53  GLU A HG3  1  
ATOM 747   N N    . THR A 1 54  ? 7.005   -2.992  -8.032  1.00 0.00 ? 54  THR A N    1  
ATOM 748   C CA   . THR A 1 54  ? 8.153   -3.058  -8.922  1.00 0.00 ? 54  THR A CA   1  
ATOM 749   C C    . THR A 1 54  ? 8.973   -4.333  -8.700  1.00 0.00 ? 54  THR A C    1  
ATOM 750   O O    . THR A 1 54  ? 9.737   -4.749  -9.571  1.00 0.00 ? 54  THR A O    1  
ATOM 751   C CB   . THR A 1 54  ? 9.048   -1.802  -8.776  1.00 0.00 ? 54  THR A CB   1  
ATOM 752   O OG1  . THR A 1 54  ? 9.521   -1.399  -10.065 1.00 0.00 ? 54  THR A OG1  1  
ATOM 753   C CG2  . THR A 1 54  ? 10.235  -2.044  -7.850  1.00 0.00 ? 54  THR A CG2  1  
ATOM 754   H H    . THR A 1 54  ? 6.993   -2.324  -7.311  1.00 0.00 ? 54  THR A H    1  
ATOM 755   H HA   . THR A 1 54  ? 7.774   -3.074  -9.934  1.00 0.00 ? 54  THR A HA   1  
ATOM 756   H HB   . THR A 1 54  ? 8.448   -1.004  -8.362  1.00 0.00 ? 54  THR A HB   1  
ATOM 757   H HG1  . THR A 1 54  ? 9.035   -1.888  -10.750 1.00 0.00 ? 54  THR A HG1  1  
ATOM 758   H HG21 . THR A 1 54  ? 10.891  -2.782  -8.289  1.00 0.00 ? 54  THR A HG21 1  
ATOM 759   H HG22 . THR A 1 54  ? 9.880   -2.402  -6.893  1.00 0.00 ? 54  THR A HG22 1  
ATOM 760   H HG23 . THR A 1 54  ? 10.774  -1.119  -7.709  1.00 0.00 ? 54  THR A HG23 1  
ATOM 761   N N    . ARG A 1 55  ? 8.812   -4.954  -7.540  1.00 0.00 ? 55  ARG A N    1  
ATOM 762   C CA   . ARG A 1 55  ? 9.539   -6.179  -7.236  1.00 0.00 ? 55  ARG A CA   1  
ATOM 763   C C    . ARG A 1 55  ? 8.609   -7.387  -7.312  1.00 0.00 ? 55  ARG A C    1  
ATOM 764   O O    . ARG A 1 55  ? 9.023   -8.526  -7.092  1.00 0.00 ? 55  ARG A O    1  
ATOM 765   C CB   . ARG A 1 55  ? 10.203  -6.083  -5.861  1.00 0.00 ? 55  ARG A CB   1  
ATOM 766   C CG   . ARG A 1 55  ? 11.360  -5.093  -5.828  1.00 0.00 ? 55  ARG A CG   1  
ATOM 767   C CD   . ARG A 1 55  ? 12.024  -5.029  -4.460  1.00 0.00 ? 55  ARG A CD   1  
ATOM 768   N NE   . ARG A 1 55  ? 11.116  -4.531  -3.431  1.00 0.00 ? 55  ARG A NE   1  
ATOM 769   C CZ   . ARG A 1 55  ? 11.127  -3.285  -2.959  1.00 0.00 ? 55  ARG A CZ   1  
ATOM 770   N NH1  . ARG A 1 55  ? 12.007  -2.396  -3.409  1.00 0.00 ? 55  ARG A NH1  1  
ATOM 771   N NH2  . ARG A 1 55  ? 10.260  -2.923  -2.025  1.00 0.00 ? 55  ARG A NH2  1  
ATOM 772   H H    . ARG A 1 55  ? 8.193   -4.581  -6.874  1.00 0.00 ? 55  ARG A H    1  
ATOM 773   H HA   . ARG A 1 55  ? 10.307  -6.293  -7.986  1.00 0.00 ? 55  ARG A HA   1  
ATOM 774   H HB2  . ARG A 1 55  ? 9.465   -5.771  -5.135  1.00 0.00 ? 55  ARG A HB2  1  
ATOM 775   H HB3  . ARG A 1 55  ? 10.579  -7.056  -5.584  1.00 0.00 ? 55  ARG A HB3  1  
ATOM 776   H HG2  . ARG A 1 55  ? 12.096  -5.394  -6.558  1.00 0.00 ? 55  ARG A HG2  1  
ATOM 777   H HG3  . ARG A 1 55  ? 10.984  -4.114  -6.079  1.00 0.00 ? 55  ARG A HG3  1  
ATOM 778   H HD2  . ARG A 1 55  ? 12.354  -6.020  -4.187  1.00 0.00 ? 55  ARG A HD2  1  
ATOM 779   H HD3  . ARG A 1 55  ? 12.878  -4.370  -4.521  1.00 0.00 ? 55  ARG A HD3  1  
ATOM 780   H HE   . ARG A 1 55  ? 10.462  -5.172  -3.058  1.00 0.00 ? 55  ARG A HE   1  
ATOM 781   H HH11 . ARG A 1 55  ? 12.685  -2.656  -4.107  1.00 0.00 ? 55  ARG A HH11 1  
ATOM 782   H HH12 . ARG A 1 55  ? 11.990  -1.449  -3.060  1.00 0.00 ? 55  ARG A HH12 1  
ATOM 783   H HH21 . ARG A 1 55  ? 9.577   -3.585  -1.669  1.00 0.00 ? 55  ARG A HH21 1  
ATOM 784   H HH22 . ARG A 1 55  ? 10.291  -1.985  -1.644  1.00 0.00 ? 55  ARG A HH22 1  
ATOM 785   N N    . PHE A 1 56  ? 7.355   -7.122  -7.654  1.00 0.00 ? 56  PHE A N    1  
ATOM 786   C CA   . PHE A 1 56  ? 6.351   -8.165  -7.774  1.00 0.00 ? 56  PHE A CA   1  
ATOM 787   C C    . PHE A 1 56  ? 6.198   -8.560  -9.237  1.00 0.00 ? 56  PHE A C    1  
ATOM 788   O O    . PHE A 1 56  ? 6.858   -9.487  -9.712  1.00 0.00 ? 56  PHE A O    1  
ATOM 789   C CB   . PHE A 1 56  ? 5.009   -7.669  -7.217  1.00 0.00 ? 56  PHE A CB   1  
ATOM 790   C CG   . PHE A 1 56  ? 4.022   -8.754  -6.874  1.00 0.00 ? 56  PHE A CG   1  
ATOM 791   C CD1  . PHE A 1 56  ? 3.514   -9.595  -7.852  1.00 0.00 ? 56  PHE A CD1  1  
ATOM 792   C CD2  . PHE A 1 56  ? 3.589   -8.919  -5.567  1.00 0.00 ? 56  PHE A CD2  1  
ATOM 793   C CE1  . PHE A 1 56  ? 2.598   -10.577 -7.534  1.00 0.00 ? 56  PHE A CE1  1  
ATOM 794   C CE2  . PHE A 1 56  ? 2.675   -9.902  -5.243  1.00 0.00 ? 56  PHE A CE2  1  
ATOM 795   C CZ   . PHE A 1 56  ? 2.180   -10.733 -6.228  1.00 0.00 ? 56  PHE A CZ   1  
ATOM 796   H H    . PHE A 1 56  ? 7.097   -6.194  -7.835  1.00 0.00 ? 56  PHE A H    1  
ATOM 797   H HA   . PHE A 1 56  ? 6.681   -9.024  -7.207  1.00 0.00 ? 56  PHE A HA   1  
ATOM 798   H HB2  . PHE A 1 56  ? 5.190   -7.101  -6.318  1.00 0.00 ? 56  PHE A HB2  1  
ATOM 799   H HB3  . PHE A 1 56  ? 4.547   -7.023  -7.951  1.00 0.00 ? 56  PHE A HB3  1  
ATOM 800   H HD1  . PHE A 1 56  ? 3.847   -9.478  -8.875  1.00 0.00 ? 56  PHE A HD1  1  
ATOM 801   H HD2  . PHE A 1 56  ? 3.975   -8.269  -4.796  1.00 0.00 ? 56  PHE A HD2  1  
ATOM 802   H HE1  . PHE A 1 56  ? 2.211   -11.224 -8.306  1.00 0.00 ? 56  PHE A HE1  1  
ATOM 803   H HE2  . PHE A 1 56  ? 2.352   -10.022 -4.220  1.00 0.00 ? 56  PHE A HE2  1  
ATOM 804   H HZ   . PHE A 1 56  ? 1.463   -11.503 -5.979  1.00 0.00 ? 56  PHE A HZ   1  
ATOM 805   N N    . ARG A 1 57  ? 5.355   -7.812  -9.946  1.00 0.00 ? 57  ARG A N    1  
ATOM 806   C CA   . ARG A 1 57  ? 5.063   -8.047  -11.359 1.00 0.00 ? 57  ARG A CA   1  
ATOM 807   C C    . ARG A 1 57  ? 3.975   -7.083  -11.793 1.00 0.00 ? 57  ARG A C    1  
ATOM 808   O O    . ARG A 1 57  ? 4.215   -6.128  -12.534 1.00 0.00 ? 57  ARG A O    1  
ATOM 809   C CB   . ARG A 1 57  ? 4.569   -9.482  -11.579 1.00 0.00 ? 57  ARG A CB   1  
ATOM 810   C CG   . ARG A 1 57  ? 5.421   -10.300 -12.535 1.00 0.00 ? 57  ARG A CG   1  
ATOM 811   C CD   . ARG A 1 57  ? 4.903   -11.726 -12.644 1.00 0.00 ? 57  ARG A CD   1  
ATOM 812   N NE   . ARG A 1 57  ? 4.848   -12.389 -11.341 1.00 0.00 ? 57  ARG A NE   1  
ATOM 813   C CZ   . ARG A 1 57  ? 3.721   -12.782 -10.749 1.00 0.00 ? 57  ARG A CZ   1  
ATOM 814   N NH1  . ARG A 1 57  ? 2.548   -12.555 -11.325 1.00 0.00 ? 57  ARG A NH1  1  
ATOM 815   N NH2  . ARG A 1 57  ? 3.773   -13.390 -9.569  1.00 0.00 ? 57  ARG A NH2  1  
ATOM 816   H H    . ARG A 1 57  ? 4.910   -7.057  -9.498  1.00 0.00 ? 57  ARG A H    1  
ATOM 817   H HA   . ARG A 1 57  ? 5.959   -7.871  -11.934 1.00 0.00 ? 57  ARG A HA   1  
ATOM 818   H HB2  . ARG A 1 57  ? 4.552   -9.990  -10.627 1.00 0.00 ? 57  ARG A HB2  1  
ATOM 819   H HB3  . ARG A 1 57  ? 3.563   -9.443  -11.972 1.00 0.00 ? 57  ARG A HB3  1  
ATOM 820   H HG2  . ARG A 1 57  ? 5.394   -9.842  -13.513 1.00 0.00 ? 57  ARG A HG2  1  
ATOM 821   H HG3  . ARG A 1 57  ? 6.436   -10.323 -12.170 1.00 0.00 ? 57  ARG A HG3  1  
ATOM 822   H HD2  . ARG A 1 57  ? 3.910   -11.704 -13.069 1.00 0.00 ? 57  ARG A HD2  1  
ATOM 823   H HD3  . ARG A 1 57  ? 5.560   -12.284 -13.295 1.00 0.00 ? 57  ARG A HD3  1  
ATOM 824   H HE   . ARG A 1 57  ? 5.708   -12.553 -10.879 1.00 0.00 ? 57  ARG A HE   1  
ATOM 825   H HH11 . ARG A 1 57  ? 2.502   -12.083 -12.213 1.00 0.00 ? 57  ARG A HH11 1  
ATOM 826   H HH12 . ARG A 1 57  ? 1.692   -12.854 -10.878 1.00 0.00 ? 57  ARG A HH12 1  
ATOM 827   H HH21 . ARG A 1 57  ? 4.660   -13.555 -9.124  1.00 0.00 ? 57  ARG A HH21 1  
ATOM 828   H HH22 . ARG A 1 57  ? 2.924   -13.690 -9.113  1.00 0.00 ? 57  ARG A HH22 1  
ATOM 829   N N    . ARG A 1 58  ? 2.780   -7.355  -11.296 1.00 0.00 ? 58  ARG A N    1  
ATOM 830   C CA   . ARG A 1 58  ? 1.606   -6.551  -11.566 1.00 0.00 ? 58  ARG A CA   1  
ATOM 831   C C    . ARG A 1 58  ? 0.572   -6.849  -10.492 1.00 0.00 ? 58  ARG A C    1  
ATOM 832   O O    . ARG A 1 58  ? -0.518  -7.331  -10.781 1.00 0.00 ? 58  ARG A O    1  
ATOM 833   C CB   . ARG A 1 58  ? 1.037   -6.846  -12.957 1.00 0.00 ? 58  ARG A CB   1  
ATOM 834   C CG   . ARG A 1 58  ? 1.200   -5.697  -13.940 1.00 0.00 ? 58  ARG A CG   1  
ATOM 835   C CD   . ARG A 1 58  ? 0.214   -4.573  -13.660 1.00 0.00 ? 58  ARG A CD   1  
ATOM 836   N NE   . ARG A 1 58  ? 0.634   -3.714  -12.551 1.00 0.00 ? 58  ARG A NE   1  
ATOM 837   C CZ   . ARG A 1 58  ? 0.924   -2.419  -12.675 1.00 0.00 ? 58  ARG A CZ   1  
ATOM 838   N NH1  . ARG A 1 58  ? 0.932   -1.840  -13.868 1.00 0.00 ? 58  ARG A NH1  1  
ATOM 839   N NH2  . ARG A 1 58  ? 1.239   -1.712  -11.603 1.00 0.00 ? 58  ARG A NH2  1  
ATOM 840   H H    . ARG A 1 58  ? 2.684   -8.136  -10.716 1.00 0.00 ? 58  ARG A H    1  
ATOM 841   H HA   . ARG A 1 58  ? 1.891   -5.510  -11.507 1.00 0.00 ? 58  ARG A HA   1  
ATOM 842   H HB2  . ARG A 1 58  ? 1.535   -7.713  -13.362 1.00 0.00 ? 58  ARG A HB2  1  
ATOM 843   H HB3  . ARG A 1 58  ? -0.018  -7.060  -12.863 1.00 0.00 ? 58  ARG A HB3  1  
ATOM 844   H HG2  . ARG A 1 58  ? 2.205   -5.309  -13.862 1.00 0.00 ? 58  ARG A HG2  1  
ATOM 845   H HG3  . ARG A 1 58  ? 1.033   -6.068  -14.941 1.00 0.00 ? 58  ARG A HG3  1  
ATOM 846   H HD2  . ARG A 1 58  ? 0.119   -3.969  -14.550 1.00 0.00 ? 58  ARG A HD2  1  
ATOM 847   H HD3  . ARG A 1 58  ? -0.745  -5.008  -13.421 1.00 0.00 ? 58  ARG A HD3  1  
ATOM 848   H HE   . ARG A 1 58  ? 0.685   -4.120  -11.653 1.00 0.00 ? 58  ARG A HE   1  
ATOM 849   H HH11 . ARG A 1 58  ? 0.724   -2.374  -14.691 1.00 0.00 ? 58  ARG A HH11 1  
ATOM 850   H HH12 . ARG A 1 58  ? 1.148   -0.863  -13.950 1.00 0.00 ? 58  ARG A HH12 1  
ATOM 851   H HH21 . ARG A 1 58  ? 1.262   -2.155  -10.696 1.00 0.00 ? 58  ARG A HH21 1  
ATOM 852   H HH22 . ARG A 1 58  ? 1.449   -0.729  -11.687 1.00 0.00 ? 58  ARG A HH22 1  
ATOM 853   N N    . THR A 1 59  ? 0.945   -6.559  -9.253  1.00 0.00 ? 59  THR A N    1  
ATOM 854   C CA   . THR A 1 59  ? 0.101   -6.796  -8.086  1.00 0.00 ? 59  THR A CA   1  
ATOM 855   C C    . THR A 1 59  ? -1.301  -6.221  -8.267  1.00 0.00 ? 59  THR A C    1  
ATOM 856   O O    . THR A 1 59  ? -2.278  -6.793  -7.784  1.00 0.00 ? 59  THR A O    1  
ATOM 857   C CB   . THR A 1 59  ? 0.735   -6.185  -6.826  1.00 0.00 ? 59  THR A CB   1  
ATOM 858   O OG1  . THR A 1 59  ? 2.162   -6.194  -6.947  1.00 0.00 ? 59  THR A OG1  1  
ATOM 859   C CG2  . THR A 1 59  ? 0.328   -6.963  -5.589  1.00 0.00 ? 59  THR A CG2  1  
ATOM 860   H H    . THR A 1 59  ? 1.833   -6.142  -9.116  1.00 0.00 ? 59  THR A H    1  
ATOM 861   H HA   . THR A 1 59  ? 0.026   -7.864  -7.942  1.00 0.00 ? 59  THR A HA   1  
ATOM 862   H HB   . THR A 1 59  ? 0.393   -5.166  -6.724  1.00 0.00 ? 59  THR A HB   1  
ATOM 863   H HG1  . THR A 1 59  ? 2.434   -5.586  -7.652  1.00 0.00 ? 59  THR A HG1  1  
ATOM 864   H HG21 . THR A 1 59  ? 0.747   -6.490  -4.714  1.00 0.00 ? 59  THR A HG21 1  
ATOM 865   H HG22 . THR A 1 59  ? 0.699   -7.974  -5.664  1.00 0.00 ? 59  THR A HG22 1  
ATOM 866   H HG23 . THR A 1 59  ? -0.748  -6.979  -5.512  1.00 0.00 ? 59  THR A HG23 1  
ATOM 867   N N    . PHE A 1 60  ? -1.389  -5.101  -8.982  1.00 0.00 ? 60  PHE A N    1  
ATOM 868   C CA   . PHE A 1 60  ? -2.668  -4.440  -9.247  1.00 0.00 ? 60  PHE A CA   1  
ATOM 869   C C    . PHE A 1 60  ? -3.660  -5.392  -9.920  1.00 0.00 ? 60  PHE A C    1  
ATOM 870   O O    . PHE A 1 60  ? -4.872  -5.202  -9.836  1.00 0.00 ? 60  PHE A O    1  
ATOM 871   C CB   . PHE A 1 60  ? -2.460  -3.212  -10.144 1.00 0.00 ? 60  PHE A CB   1  
ATOM 872   C CG   . PHE A 1 60  ? -1.779  -2.047  -9.470  1.00 0.00 ? 60  PHE A CG   1  
ATOM 873   C CD1  . PHE A 1 60  ? -1.314  -2.142  -8.166  1.00 0.00 ? 60  PHE A CD1  1  
ATOM 874   C CD2  . PHE A 1 60  ? -1.604  -0.853  -10.151 1.00 0.00 ? 60  PHE A CD2  1  
ATOM 875   C CE1  . PHE A 1 60  ? -0.689  -1.070  -7.558  1.00 0.00 ? 60  PHE A CE1  1  
ATOM 876   C CE2  . PHE A 1 60  ? -0.980  0.222   -9.548  1.00 0.00 ? 60  PHE A CE2  1  
ATOM 877   C CZ   . PHE A 1 60  ? -0.522  0.114   -8.250  1.00 0.00 ? 60  PHE A CZ   1  
ATOM 878   H H    . PHE A 1 60  ? -0.561  -4.695  -9.329  1.00 0.00 ? 60  PHE A H    1  
ATOM 879   H HA   . PHE A 1 60  ? -3.078  -4.120  -8.302  1.00 0.00 ? 60  PHE A HA   1  
ATOM 880   H HB2  . PHE A 1 60  ? -1.857  -3.497  -10.991 1.00 0.00 ? 60  PHE A HB2  1  
ATOM 881   H HB3  . PHE A 1 60  ? -3.424  -2.872  -10.497 1.00 0.00 ? 60  PHE A HB3  1  
ATOM 882   H HD1  . PHE A 1 60  ? -1.444  -3.068  -7.625  1.00 0.00 ? 60  PHE A HD1  1  
ATOM 883   H HD2  . PHE A 1 60  ? -1.961  -0.768  -11.165 1.00 0.00 ? 60  PHE A HD2  1  
ATOM 884   H HE1  . PHE A 1 60  ? -0.331  -1.157  -6.543  1.00 0.00 ? 60  PHE A HE1  1  
ATOM 885   H HE2  . PHE A 1 60  ? -0.852  1.147   -10.093 1.00 0.00 ? 60  PHE A HE2  1  
ATOM 886   H HZ   . PHE A 1 60  ? -0.035  0.951   -7.776  1.00 0.00 ? 60  PHE A HZ   1  
ATOM 887   N N    . SER A 1 61  ? -3.137  -6.415  -10.585 1.00 0.00 ? 61  SER A N    1  
ATOM 888   C CA   . SER A 1 61  ? -3.970  -7.386  -11.273 1.00 0.00 ? 61  SER A CA   1  
ATOM 889   C C    . SER A 1 61  ? -3.730  -8.804  -10.752 1.00 0.00 ? 61  SER A C    1  
ATOM 890   O O    . SER A 1 61  ? -4.676  -9.567  -10.567 1.00 0.00 ? 61  SER A O    1  
ATOM 891   C CB   . SER A 1 61  ? -3.694  -7.324  -12.776 1.00 0.00 ? 61  SER A CB   1  
ATOM 892   O OG   . SER A 1 61  ? -3.869  -6.005  -13.266 1.00 0.00 ? 61  SER A OG   1  
ATOM 893   H H    . SER A 1 61  ? -2.162  -6.518  -10.612 1.00 0.00 ? 61  SER A H    1  
ATOM 894   H HA   . SER A 1 61  ? -5.002  -7.121  -11.097 1.00 0.00 ? 61  SER A HA   1  
ATOM 895   H HB2  . SER A 1 61  ? -2.678  -7.634  -12.967 1.00 0.00 ? 61  SER A HB2  1  
ATOM 896   H HB3  . SER A 1 61  ? -4.376  -7.980  -13.292 1.00 0.00 ? 61  SER A HB3  1  
ATOM 897   H HG   . SER A 1 61  ? -4.764  -5.700  -13.047 1.00 0.00 ? 61  SER A HG   1  
ATOM 898   N N    . ASP A 1 62  ? -2.468  -9.140  -10.492 1.00 0.00 ? 62  ASP A N    1  
ATOM 899   C CA   . ASP A 1 62  ? -2.102  -10.479 -10.020 1.00 0.00 ? 62  ASP A CA   1  
ATOM 900   C C    . ASP A 1 62  ? -2.727  -10.803 -8.672  1.00 0.00 ? 62  ASP A C    1  
ATOM 901   O O    . ASP A 1 62  ? -3.337  -11.856 -8.509  1.00 0.00 ? 62  ASP A O    1  
ATOM 902   C CB   . ASP A 1 62  ? -0.582  -10.629 -9.918  1.00 0.00 ? 62  ASP A CB   1  
ATOM 903   C CG   . ASP A 1 62  ? -0.171  -12.018 -9.460  1.00 0.00 ? 62  ASP A CG   1  
ATOM 904   O OD1  . ASP A 1 62  ? -0.115  -12.264 -8.237  1.00 0.00 ? 62  ASP A OD1  1  
ATOM 905   O OD2  . ASP A 1 62  ? 0.108   -12.875 -10.328 1.00 0.00 ? 62  ASP A OD2  1  
ATOM 906   H H    . ASP A 1 62  ? -1.757  -8.473  -10.626 1.00 0.00 ? 62  ASP A H    1  
ATOM 907   H HA   . ASP A 1 62  ? -2.469  -11.189 -10.745 1.00 0.00 ? 62  ASP A HA   1  
ATOM 908   H HB2  . ASP A 1 62  ? -0.144  -10.443 -10.886 1.00 0.00 ? 62  ASP A HB2  1  
ATOM 909   H HB3  . ASP A 1 62  ? -0.202  -9.907  -9.209  1.00 0.00 ? 62  ASP A HB3  1  
ATOM 910   N N    . LEU A 1 63  ? -2.580  -9.895  -7.713  1.00 0.00 ? 63  LEU A N    1  
ATOM 911   C CA   . LEU A 1 63  ? -3.121  -10.106 -6.374  1.00 0.00 ? 63  LEU A CA   1  
ATOM 912   C C    . LEU A 1 63  ? -4.632  -10.292 -6.426  1.00 0.00 ? 63  LEU A C    1  
ATOM 913   O O    . LEU A 1 63  ? -5.203  -11.065 -5.661  1.00 0.00 ? 63  LEU A O    1  
ATOM 914   C CB   . LEU A 1 63  ? -2.769  -8.929  -5.462  1.00 0.00 ? 63  LEU A CB   1  
ATOM 915   C CG   . LEU A 1 63  ? -2.685  -9.259  -3.970  1.00 0.00 ? 63  LEU A CG   1  
ATOM 916   C CD1  . LEU A 1 63  ? -1.513  -10.188 -3.694  1.00 0.00 ? 63  LEU A CD1  1  
ATOM 917   C CD2  . LEU A 1 63  ? -2.566  -7.982  -3.148  1.00 0.00 ? 63  LEU A CD2  1  
ATOM 918   H H    . LEU A 1 63  ? -2.099  -9.064  -7.908  1.00 0.00 ? 63  LEU A H    1  
ATOM 919   H HA   . LEU A 1 63  ? -2.675  -11.005 -5.976  1.00 0.00 ? 63  LEU A HA   1  
ATOM 920   H HB2  . LEU A 1 63  ? -1.814  -8.531  -5.775  1.00 0.00 ? 63  LEU A HB2  1  
ATOM 921   H HB3  . LEU A 1 63  ? -3.518  -8.162  -5.596  1.00 0.00 ? 63  LEU A HB3  1  
ATOM 922   H HG   . LEU A 1 63  ? -3.590  -9.768  -3.669  1.00 0.00 ? 63  LEU A HG   1  
ATOM 923   H HD11 . LEU A 1 63  ? -1.451  -10.387 -2.635  1.00 0.00 ? 63  LEU A HD11 1  
ATOM 924   H HD12 . LEU A 1 63  ? -0.598  -9.723  -4.027  1.00 0.00 ? 63  LEU A HD12 1  
ATOM 925   H HD13 . LEU A 1 63  ? -1.658  -11.117 -4.226  1.00 0.00 ? 63  LEU A HD13 1  
ATOM 926   H HD21 . LEU A 1 63  ? -2.491  -8.234  -2.099  1.00 0.00 ? 63  LEU A HD21 1  
ATOM 927   H HD22 . LEU A 1 63  ? -3.440  -7.369  -3.308  1.00 0.00 ? 63  LEU A HD22 1  
ATOM 928   H HD23 . LEU A 1 63  ? -1.684  -7.438  -3.451  1.00 0.00 ? 63  LEU A HD23 1  
ATOM 929   N N    . ALA A 1 64  ? -5.272  -9.597  -7.355  1.00 0.00 ? 64  ALA A N    1  
ATOM 930   C CA   . ALA A 1 64  ? -6.713  -9.684  -7.515  1.00 0.00 ? 64  ALA A CA   1  
ATOM 931   C C    . ALA A 1 64  ? -7.099  -10.938 -8.295  1.00 0.00 ? 64  ALA A C    1  
ATOM 932   O O    . ALA A 1 64  ? -8.242  -11.381 -8.246  1.00 0.00 ? 64  ALA A O    1  
ATOM 933   C CB   . ALA A 1 64  ? -7.236  -8.442  -8.220  1.00 0.00 ? 64  ALA A CB   1  
ATOM 934   H H    . ALA A 1 64  ? -4.760  -9.010  -7.946  1.00 0.00 ? 64  ALA A H    1  
ATOM 935   H HA   . ALA A 1 64  ? -7.160  -9.731  -6.532  1.00 0.00 ? 64  ALA A HA   1  
ATOM 936   H HB1  . ALA A 1 64  ? -8.312  -8.498  -8.298  1.00 0.00 ? 64  ALA A HB1  1  
ATOM 937   H HB2  . ALA A 1 64  ? -6.805  -8.380  -9.208  1.00 0.00 ? 64  ALA A HB2  1  
ATOM 938   H HB3  . ALA A 1 64  ? -6.962  -7.563  -7.652  1.00 0.00 ? 64  ALA A HB3  1  
ATOM 939   N N    . ALA A 1 65  ? -6.134  -11.511 -9.006  1.00 0.00 ? 65  ALA A N    1  
ATOM 940   C CA   . ALA A 1 65  ? -6.375  -12.706 -9.805  1.00 0.00 ? 65  ALA A CA   1  
ATOM 941   C C    . ALA A 1 65  ? -6.131  -13.974 -9.000  1.00 0.00 ? 65  ALA A C    1  
ATOM 942   O O    . ALA A 1 65  ? -6.962  -14.885 -8.998  1.00 0.00 ? 65  ALA A O    1  
ATOM 943   C CB   . ALA A 1 65  ? -5.488  -12.703 -11.040 1.00 0.00 ? 65  ALA A CB   1  
ATOM 944   H H    . ALA A 1 65  ? -5.234  -11.120 -8.991  1.00 0.00 ? 65  ALA A H    1  
ATOM 945   H HA   . ALA A 1 65  ? -7.403  -12.686 -10.131 1.00 0.00 ? 65  ALA A HA   1  
ATOM 946   H HB1  . ALA A 1 65  ? -5.714  -13.569 -11.645 1.00 0.00 ? 65  ALA A HB1  1  
ATOM 947   H HB2  . ALA A 1 65  ? -4.453  -12.736 -10.738 1.00 0.00 ? 65  ALA A HB2  1  
ATOM 948   H HB3  . ALA A 1 65  ? -5.669  -11.807 -11.613 1.00 0.00 ? 65  ALA A HB3  1  
ATOM 949   N N    . GLN A 1 66  ? -5.001  -14.020 -8.302  1.00 0.00 ? 66  GLN A N    1  
ATOM 950   C CA   . GLN A 1 66  ? -4.638  -15.186 -7.501  1.00 0.00 ? 66  GLN A CA   1  
ATOM 951   C C    . GLN A 1 66  ? -5.615  -15.394 -6.346  1.00 0.00 ? 66  GLN A C    1  
ATOM 952   O O    . GLN A 1 66  ? -5.697  -16.483 -5.778  1.00 0.00 ? 66  GLN A O    1  
ATOM 953   C CB   . GLN A 1 66  ? -3.203  -15.063 -6.971  1.00 0.00 ? 66  GLN A CB   1  
ATOM 954   C CG   . GLN A 1 66  ? -2.973  -13.855 -6.076  1.00 0.00 ? 66  GLN A CG   1  
ATOM 955   C CD   . GLN A 1 66  ? -1.702  -13.969 -5.255  1.00 0.00 ? 66  GLN A CD   1  
ATOM 956   O OE1  . GLN A 1 66  ? -1.709  -14.524 -4.154  1.00 0.00 ? 66  GLN A OE1  1  
ATOM 957   N NE2  . GLN A 1 66  ? -0.606  -13.441 -5.778  1.00 0.00 ? 66  GLN A NE2  1  
ATOM 958   H H    . GLN A 1 66  ? -4.389  -13.247 -8.329  1.00 0.00 ? 66  GLN A H    1  
ATOM 959   H HA   . GLN A 1 66  ? -4.693  -16.050 -8.147  1.00 0.00 ? 66  GLN A HA   1  
ATOM 960   H HB2  . GLN A 1 66  ? -2.968  -15.952 -6.403  1.00 0.00 ? 66  GLN A HB2  1  
ATOM 961   H HB3  . GLN A 1 66  ? -2.527  -14.997 -7.810  1.00 0.00 ? 66  GLN A HB3  1  
ATOM 962   H HG2  . GLN A 1 66  ? -2.905  -12.973 -6.694  1.00 0.00 ? 66  GLN A HG2  1  
ATOM 963   H HG3  . GLN A 1 66  ? -3.812  -13.760 -5.403  1.00 0.00 ? 66  GLN A HG3  1  
ATOM 964   H HE21 . GLN A 1 66  ? -0.669  -13.003 -6.665  1.00 0.00 ? 66  GLN A HE21 1  
ATOM 965   H HE22 . GLN A 1 66  ? 0.224   -13.501 -5.266  1.00 0.00 ? 66  GLN A HE22 1  
ATOM 966   N N    . LEU A 1 67  ? -6.347  -14.344 -5.994  1.00 0.00 ? 67  LEU A N    1  
ATOM 967   C CA   . LEU A 1 67  ? -7.330  -14.425 -4.922  1.00 0.00 ? 67  LEU A CA   1  
ATOM 968   C C    . LEU A 1 67  ? -8.747  -14.346 -5.485  1.00 0.00 ? 67  LEU A C    1  
ATOM 969   O O    . LEU A 1 67  ? -9.710  -14.172 -4.743  1.00 0.00 ? 67  LEU A O    1  
ATOM 970   C CB   . LEU A 1 67  ? -7.112  -13.314 -3.886  1.00 0.00 ? 67  LEU A CB   1  
ATOM 971   C CG   . LEU A 1 67  ? -6.063  -13.612 -2.802  1.00 0.00 ? 67  LEU A CG   1  
ATOM 972   C CD1  . LEU A 1 67  ? -5.963  -15.108 -2.537  1.00 0.00 ? 67  LEU A CD1  1  
ATOM 973   C CD2  . LEU A 1 67  ? -4.709  -13.046 -3.191  1.00 0.00 ? 67  LEU A CD2  1  
ATOM 974   H H    . LEU A 1 67  ? -6.217  -13.492 -6.461  1.00 0.00 ? 67  LEU A H    1  
ATOM 975   H HA   . LEU A 1 67  ? -7.205  -15.382 -4.437  1.00 0.00 ? 67  LEU A HA   1  
ATOM 976   H HB2  . LEU A 1 67  ? -6.811  -12.419 -4.409  1.00 0.00 ? 67  LEU A HB2  1  
ATOM 977   H HB3  . LEU A 1 67  ? -8.055  -13.123 -3.397  1.00 0.00 ? 67  LEU A HB3  1  
ATOM 978   H HG   . LEU A 1 67  ? -6.369  -13.135 -1.880  1.00 0.00 ? 67  LEU A HG   1  
ATOM 979   H HD11 . LEU A 1 67  ? -6.909  -15.468 -2.162  1.00 0.00 ? 67  LEU A HD11 1  
ATOM 980   H HD12 . LEU A 1 67  ? -5.192  -15.295 -1.804  1.00 0.00 ? 67  LEU A HD12 1  
ATOM 981   H HD13 . LEU A 1 67  ? -5.720  -15.621 -3.456  1.00 0.00 ? 67  LEU A HD13 1  
ATOM 982   H HD21 . LEU A 1 67  ? -4.796  -11.980 -3.344  1.00 0.00 ? 67  LEU A HD21 1  
ATOM 983   H HD22 . LEU A 1 67  ? -4.369  -13.514 -4.104  1.00 0.00 ? 67  LEU A HD22 1  
ATOM 984   H HD23 . LEU A 1 67  ? -3.998  -13.237 -2.401  1.00 0.00 ? 67  LEU A HD23 1  
ATOM 985   N N    . HIS A 1 68  ? -8.868  -14.508 -6.798  1.00 0.00 ? 68  HIS A N    1  
ATOM 986   C CA   . HIS A 1 68  ? -10.166 -14.451 -7.464  1.00 0.00 ? 68  HIS A CA   1  
ATOM 987   C C    . HIS A 1 68  ? -10.747 -15.856 -7.638  1.00 0.00 ? 68  HIS A C    1  
ATOM 988   O O    . HIS A 1 68  ? -11.734 -16.054 -8.347  1.00 0.00 ? 68  HIS A O    1  
ATOM 989   C CB   . HIS A 1 68  ? -10.029 -13.765 -8.828  1.00 0.00 ? 68  HIS A CB   1  
ATOM 990   C CG   . HIS A 1 68  ? -11.336 -13.430 -9.478  1.00 0.00 ? 68  HIS A CG   1  
ATOM 991   N ND1  . HIS A 1 68  ? -11.596 -13.668 -10.810 1.00 0.00 ? 68  HIS A ND1  1  
ATOM 992   C CD2  . HIS A 1 68  ? -12.464 -12.884 -8.968  1.00 0.00 ? 68  HIS A CD2  1  
ATOM 993   C CE1  . HIS A 1 68  ? -12.825 -13.281 -11.090 1.00 0.00 ? 68  HIS A CE1  1  
ATOM 994   N NE2  . HIS A 1 68  ? -13.371 -12.803 -9.989  1.00 0.00 ? 68  HIS A NE2  1  
ATOM 995   H H    . HIS A 1 68  ? -8.063  -14.671 -7.336  1.00 0.00 ? 68  HIS A H    1  
ATOM 996   H HA   . HIS A 1 68  ? -10.835 -13.872 -6.844  1.00 0.00 ? 68  HIS A HA   1  
ATOM 997   H HB2  . HIS A 1 68  ? -9.480  -12.845 -8.704  1.00 0.00 ? 68  HIS A HB2  1  
ATOM 998   H HB3  . HIS A 1 68  ? -9.484  -14.416 -9.495  1.00 0.00 ? 68  HIS A HB3  1  
ATOM 999   H HD1  . HIS A 1 68  ? -10.961 -14.058 -11.463 1.00 0.00 ? 68  HIS A HD1  1  
ATOM 1000  H HD2  . HIS A 1 68  ? -12.617 -12.568 -7.946  1.00 0.00 ? 68  HIS A HD2  1  
ATOM 1001  H HE1  . HIS A 1 68  ? -13.305 -13.355 -12.053 1.00 0.00 ? 68  HIS A HE1  1  
ATOM 1002  H HE2  . HIS A 1 68  ? -14.266 -12.381 -9.932  1.00 0.00 ? 68  HIS A HE2  1  
ATOM 1003  N N    . VAL A 1 69  ? -10.128 -16.833 -6.998  1.00 0.00 ? 69  VAL A N    1  
ATOM 1004  C CA   . VAL A 1 69  ? -10.593 -18.211 -7.086  1.00 0.00 ? 69  VAL A CA   1  
ATOM 1005  C C    . VAL A 1 69  ? -11.792 -18.420 -6.168  1.00 0.00 ? 69  VAL A C    1  
ATOM 1006  O O    . VAL A 1 69  ? -12.781 -19.055 -6.543  1.00 0.00 ? 69  VAL A O    1  
ATOM 1007  C CB   . VAL A 1 69  ? -9.472  -19.204 -6.723  1.00 0.00 ? 69  VAL A CB   1  
ATOM 1008  C CG1  . VAL A 1 69  ? -9.896  -20.632 -7.028  1.00 0.00 ? 69  VAL A CG1  1  
ATOM 1009  C CG2  . VAL A 1 69  ? -8.194  -18.850 -7.472  1.00 0.00 ? 69  VAL A CG2  1  
ATOM 1010  H H    . VAL A 1 69  ? -9.344  -16.625 -6.447  1.00 0.00 ? 69  VAL A H    1  
ATOM 1011  H HA   . VAL A 1 69  ? -10.896 -18.397 -8.108  1.00 0.00 ? 69  VAL A HA   1  
ATOM 1012  H HB   . VAL A 1 69  ? -9.278  -19.126 -5.664  1.00 0.00 ? 69  VAL A HB   1  
ATOM 1013  H HG11 . VAL A 1 69  ? -10.663 -20.937 -6.332  1.00 0.00 ? 69  VAL A HG11 1  
ATOM 1014  H HG12 . VAL A 1 69  ? -9.044  -21.287 -6.934  1.00 0.00 ? 69  VAL A HG12 1  
ATOM 1015  H HG13 . VAL A 1 69  ? -10.281 -20.686 -8.036  1.00 0.00 ? 69  VAL A HG13 1  
ATOM 1016  H HG21 . VAL A 1 69  ? -7.424  -19.567 -7.231  1.00 0.00 ? 69  VAL A HG21 1  
ATOM 1017  H HG22 . VAL A 1 69  ? -7.870  -17.861 -7.184  1.00 0.00 ? 69  VAL A HG22 1  
ATOM 1018  H HG23 . VAL A 1 69  ? -8.384  -18.869 -8.536  1.00 0.00 ? 69  VAL A HG23 1  
ATOM 1019  N N    . THR A 1 70  ? -11.703 -17.865 -4.971  1.00 0.00 ? 70  THR A N    1  
ATOM 1020  C CA   . THR A 1 70  ? -12.776 -17.964 -3.997  1.00 0.00 ? 70  THR A CA   1  
ATOM 1021  C C    . THR A 1 70  ? -13.787 -16.844 -4.219  1.00 0.00 ? 70  THR A C    1  
ATOM 1022  O O    . THR A 1 70  ? -13.402 -15.689 -4.399  1.00 0.00 ? 70  THR A O    1  
ATOM 1023  C CB   . THR A 1 70  ? -12.217 -17.881 -2.565  1.00 0.00 ? 70  THR A CB   1  
ATOM 1024  O OG1  . THR A 1 70  ? -10.927 -18.506 -2.522  1.00 0.00 ? 70  THR A OG1  1  
ATOM 1025  C CG2  . THR A 1 70  ? -13.144 -18.564 -1.572  1.00 0.00 ? 70  THR A CG2  1  
ATOM 1026  H H    . THR A 1 70  ? -10.888 -17.371 -4.733  1.00 0.00 ? 70  THR A H    1  
ATOM 1027  H HA   . THR A 1 70  ? -13.265 -18.918 -4.122  1.00 0.00 ? 70  THR A HA   1  
ATOM 1028  H HB   . THR A 1 70  ? -12.118 -16.840 -2.291  1.00 0.00 ? 70  THR A HB   1  
ATOM 1029  H HG1  . THR A 1 70  ? -10.934 -19.297 -3.094  1.00 0.00 ? 70  THR A HG1  1  
ATOM 1030  H HG21 . THR A 1 70  ? -12.721 -18.497 -0.580  1.00 0.00 ? 70  THR A HG21 1  
ATOM 1031  H HG22 . THR A 1 70  ? -13.261 -19.602 -1.843  1.00 0.00 ? 70  THR A HG22 1  
ATOM 1032  H HG23 . THR A 1 70  ? -14.109 -18.077 -1.587  1.00 0.00 ? 70  THR A HG23 1  
ATOM 1033  N N    . PRO A 1 71  ? -15.088 -17.182 -4.243  1.00 0.00 ? 71  PRO A N    1  
ATOM 1034  C CA   . PRO A 1 71  ? -16.167 -16.205 -4.452  1.00 0.00 ? 71  PRO A CA   1  
ATOM 1035  C C    . PRO A 1 71  ? -16.073 -15.010 -3.503  1.00 0.00 ? 71  PRO A C    1  
ATOM 1036  O O    . PRO A 1 71  ? -16.307 -15.136 -2.300  1.00 0.00 ? 71  PRO A O    1  
ATOM 1037  C CB   . PRO A 1 71  ? -17.433 -17.015 -4.166  1.00 0.00 ? 71  PRO A CB   1  
ATOM 1038  C CG   . PRO A 1 71  ? -17.052 -18.422 -4.469  1.00 0.00 ? 71  PRO A CG   1  
ATOM 1039  C CD   . PRO A 1 71  ? -15.609 -18.549 -4.075  1.00 0.00 ? 71  PRO A CD   1  
ATOM 1040  H HA   . PRO A 1 71  ? -16.188 -15.851 -5.472  1.00 0.00 ? 71  PRO A HA   1  
ATOM 1041  H HB2  . PRO A 1 71  ? -17.716 -16.894 -3.131  1.00 0.00 ? 71  PRO A HB2  1  
ATOM 1042  H HB3  . PRO A 1 71  ? -18.233 -16.676 -4.806  1.00 0.00 ? 71  PRO A HB3  1  
ATOM 1043  H HG2  . PRO A 1 71  ? -17.662 -19.101 -3.893  1.00 0.00 ? 71  PRO A HG2  1  
ATOM 1044  H HG3  . PRO A 1 71  ? -17.167 -18.614 -5.525  1.00 0.00 ? 71  PRO A HG3  1  
ATOM 1045  H HD2  . PRO A 1 71  ? -15.527 -18.872 -3.047  1.00 0.00 ? 71  PRO A HD2  1  
ATOM 1046  H HD3  . PRO A 1 71  ? -15.098 -19.239 -4.730  1.00 0.00 ? 71  PRO A HD3  1  
ATOM 1047  N N    . GLY A 1 72  ? -15.721 -13.855 -4.050  1.00 0.00 ? 72  GLY A N    1  
ATOM 1048  C CA   . GLY A 1 72  ? -15.598 -12.659 -3.241  1.00 0.00 ? 72  GLY A CA   1  
ATOM 1049  C C    . GLY A 1 72  ? -16.842 -11.790 -3.290  1.00 0.00 ? 72  GLY A C    1  
ATOM 1050  O O    . GLY A 1 72  ? -17.961 -12.296 -3.415  1.00 0.00 ? 72  GLY A O    1  
ATOM 1051  H H    . GLY A 1 72  ? -15.535 -13.813 -5.020  1.00 0.00 ? 72  GLY A H    1  
ATOM 1052  H HA2  . GLY A 1 72  ? -15.417 -12.949 -2.218  1.00 0.00 ? 72  GLY A HA2  1  
ATOM 1053  H HA3  . GLY A 1 72  ? -14.754 -12.083 -3.594  1.00 0.00 ? 72  GLY A HA3  1  
ATOM 1054  N N    . SER A 1 73  ? -16.644 -10.483 -3.204  1.00 0.00 ? 73  SER A N    1  
ATOM 1055  C CA   . SER A 1 73  ? -17.744 -9.522  -3.225  1.00 0.00 ? 73  SER A CA   1  
ATOM 1056  C C    . SER A 1 73  ? -17.263 -8.196  -3.815  1.00 0.00 ? 73  SER A C    1  
ATOM 1057  O O    . SER A 1 73  ? -16.245 -8.160  -4.509  1.00 0.00 ? 73  SER A O    1  
ATOM 1058  C CB   . SER A 1 73  ? -18.291 -9.317  -1.810  1.00 0.00 ? 73  SER A CB   1  
ATOM 1059  O OG   . SER A 1 73  ? -18.654 -10.552 -1.214  1.00 0.00 ? 73  SER A OG   1  
ATOM 1060  H H    . SER A 1 73  ? -15.726 -10.146 -3.144  1.00 0.00 ? 73  SER A H    1  
ATOM 1061  H HA   . SER A 1 73  ? -18.526 -9.922  -3.855  1.00 0.00 ? 73  SER A HA   1  
ATOM 1062  H HB2  . SER A 1 73  ? -17.536 -8.846  -1.197  1.00 0.00 ? 73  SER A HB2  1  
ATOM 1063  H HB3  . SER A 1 73  ? -19.165 -8.682  -1.854  1.00 0.00 ? 73  SER A HB3  1  
ATOM 1064  H HG   . SER A 1 73  ? -18.760 -11.220 -1.902  1.00 0.00 ? 73  SER A HG   1  
ATOM 1065  N N    . ALA A 1 74  ? -17.978 -7.113  -3.532  1.00 0.00 ? 74  ALA A N    1  
ATOM 1066  C CA   . ALA A 1 74  ? -17.615 -5.797  -4.049  1.00 0.00 ? 74  ALA A CA   1  
ATOM 1067  C C    . ALA A 1 74  ? -16.497 -5.150  -3.224  1.00 0.00 ? 74  ALA A C    1  
ATOM 1068  O O    . ALA A 1 74  ? -15.732 -5.839  -2.543  1.00 0.00 ? 74  ALA A O    1  
ATOM 1069  C CB   . ALA A 1 74  ? -18.844 -4.901  -4.082  1.00 0.00 ? 74  ALA A CB   1  
ATOM 1070  H H    . ALA A 1 74  ? -18.774 -7.198  -2.956  1.00 0.00 ? 74  ALA A H    1  
ATOM 1071  H HA   . ALA A 1 74  ? -17.268 -5.924  -5.063  1.00 0.00 ? 74  ALA A HA   1  
ATOM 1072  H HB1  . ALA A 1 74  ? -19.154 -4.677  -3.072  1.00 0.00 ? 74  ALA A HB1  1  
ATOM 1073  H HB2  . ALA A 1 74  ? -19.644 -5.408  -4.599  1.00 0.00 ? 74  ALA A HB2  1  
ATOM 1074  H HB3  . ALA A 1 74  ? -18.604 -3.981  -4.599  1.00 0.00 ? 74  ALA A HB3  1  
ATOM 1075  N N    . GLN A 1 75  ? -16.413 -3.819  -3.291  1.00 0.00 ? 75  GLN A N    1  
ATOM 1076  C CA   . GLN A 1 75  ? -15.396 -3.050  -2.568  1.00 0.00 ? 75  GLN A CA   1  
ATOM 1077  C C    . GLN A 1 75  ? -15.422 -3.358  -1.071  1.00 0.00 ? 75  GLN A C    1  
ATOM 1078  O O    . GLN A 1 75  ? -14.388 -3.330  -0.404  1.00 0.00 ? 75  GLN A O    1  
ATOM 1079  C CB   . GLN A 1 75  ? -15.621 -1.551  -2.789  1.00 0.00 ? 75  GLN A CB   1  
ATOM 1080  C CG   . GLN A 1 75  ? -14.353 -0.773  -3.107  1.00 0.00 ? 75  GLN A CG   1  
ATOM 1081  C CD   . GLN A 1 75  ? -13.255 -0.997  -2.084  1.00 0.00 ? 75  GLN A CD   1  
ATOM 1082  O OE1  . GLN A 1 75  ? -12.408 -1.872  -2.248  1.00 0.00 ? 75  GLN A OE1  1  
ATOM 1083  N NE2  . GLN A 1 75  ? -13.264 -0.215  -1.021  1.00 0.00 ? 75  GLN A NE2  1  
ATOM 1084  H H    . GLN A 1 75  ? -17.053 -3.333  -3.857  1.00 0.00 ? 75  GLN A H    1  
ATOM 1085  H HA   . GLN A 1 75  ? -14.429 -3.320  -2.963  1.00 0.00 ? 75  GLN A HA   1  
ATOM 1086  H HB2  . GLN A 1 75  ? -16.310 -1.424  -3.610  1.00 0.00 ? 75  GLN A HB2  1  
ATOM 1087  H HB3  . GLN A 1 75  ? -16.060 -1.131  -1.895  1.00 0.00 ? 75  GLN A HB3  1  
ATOM 1088  H HG2  . GLN A 1 75  ? -13.990 -1.079  -4.078  1.00 0.00 ? 75  GLN A HG2  1  
ATOM 1089  H HG3  . GLN A 1 75  ? -14.590 0.280   -3.133  1.00 0.00 ? 75  GLN A HG3  1  
ATOM 1090  H HE21 . GLN A 1 75  ? -13.964 0.464   -0.950  1.00 0.00 ? 75  GLN A HE21 1  
ATOM 1091  H HE22 . GLN A 1 75  ? -12.570 -0.359  -0.335  1.00 0.00 ? 75  GLN A HE22 1  
ATOM 1092  N N    . GLN A 1 76  ? -16.604 -3.678  -0.560  1.00 0.00 ? 76  GLN A N    1  
ATOM 1093  C CA   . GLN A 1 76  ? -16.781 -3.987  0.858   1.00 0.00 ? 76  GLN A CA   1  
ATOM 1094  C C    . GLN A 1 76  ? -16.018 -5.251  1.254   1.00 0.00 ? 76  GLN A C    1  
ATOM 1095  O O    . GLN A 1 76  ? -15.888 -5.558  2.436   1.00 0.00 ? 76  GLN A O    1  
ATOM 1096  C CB   . GLN A 1 76  ? -18.269 -4.151  1.189   1.00 0.00 ? 76  GLN A CB   1  
ATOM 1097  C CG   . GLN A 1 76  ? -19.088 -2.872  1.040   1.00 0.00 ? 76  GLN A CG   1  
ATOM 1098  C CD   . GLN A 1 76  ? -19.293 -2.471  -0.409  1.00 0.00 ? 76  GLN A CD   1  
ATOM 1099  O OE1  . GLN A 1 76  ? -19.323 -3.321  -1.300  1.00 0.00 ? 76  GLN A OE1  1  
ATOM 1100  N NE2  . GLN A 1 76  ? -19.432 -1.180  -0.659  1.00 0.00 ? 76  GLN A NE2  1  
ATOM 1101  H H    . GLN A 1 76  ? -17.387 -3.706  -1.155  1.00 0.00 ? 76  GLN A H    1  
ATOM 1102  H HA   . GLN A 1 76  ? -16.387 -3.154  1.425   1.00 0.00 ? 76  GLN A HA   1  
ATOM 1103  H HB2  . GLN A 1 76  ? -18.690 -4.897  0.534   1.00 0.00 ? 76  GLN A HB2  1  
ATOM 1104  H HB3  . GLN A 1 76  ? -18.361 -4.491  2.211   1.00 0.00 ? 76  GLN A HB3  1  
ATOM 1105  H HG2  . GLN A 1 76  ? -20.055 -3.025  1.494   1.00 0.00 ? 76  GLN A HG2  1  
ATOM 1106  H HG3  . GLN A 1 76  ? -18.574 -2.070  1.550   1.00 0.00 ? 76  GLN A HG3  1  
ATOM 1107  H HE21 . GLN A 1 76  ? -19.399 -0.547  0.099   1.00 0.00 ? 76  GLN A HE21 1  
ATOM 1108  H HE22 . GLN A 1 76  ? -19.558 -0.903  -1.592  1.00 0.00 ? 76  GLN A HE22 1  
ATOM 1109  N N    . ARG A 1 77  ? -15.521 -5.983  0.265   1.00 0.00 ? 77  ARG A N    1  
ATOM 1110  C CA   . ARG A 1 77  ? -14.768 -7.201  0.517   1.00 0.00 ? 77  ARG A CA   1  
ATOM 1111  C C    . ARG A 1 77  ? -13.289 -7.006  0.184   1.00 0.00 ? 77  ARG A C    1  
ATOM 1112  O O    . ARG A 1 77  ? -12.426 -7.679  0.743   1.00 0.00 ? 77  ARG A O    1  
ATOM 1113  C CB   . ARG A 1 77  ? -15.342 -8.356  -0.307  1.00 0.00 ? 77  ARG A CB   1  
ATOM 1114  C CG   . ARG A 1 77  ? -14.631 -9.683  -0.089  1.00 0.00 ? 77  ARG A CG   1  
ATOM 1115  C CD   . ARG A 1 77  ? -14.963 -10.280 1.268   1.00 0.00 ? 77  ARG A CD   1  
ATOM 1116  N NE   . ARG A 1 77  ? -16.337 -10.774 1.324   1.00 0.00 ? 77  ARG A NE   1  
ATOM 1117  C CZ   . ARG A 1 77  ? -16.689 -12.029 1.032   1.00 0.00 ? 77  ARG A CZ   1  
ATOM 1118  N NH1  . ARG A 1 77  ? -15.766 -12.913 0.674   1.00 0.00 ? 77  ARG A NH1  1  
ATOM 1119  N NH2  . ARG A 1 77  ? -17.961 -12.397 1.107   1.00 0.00 ? 77  ARG A NH2  1  
ATOM 1120  H H    . ARG A 1 77  ? -15.668 -5.695  -0.663  1.00 0.00 ? 77  ARG A H    1  
ATOM 1121  H HA   . ARG A 1 77  ? -14.860 -7.438  1.566   1.00 0.00 ? 77  ARG A HA   1  
ATOM 1122  H HB2  . ARG A 1 77  ? -16.381 -8.486  -0.047  1.00 0.00 ? 77  ARG A HB2  1  
ATOM 1123  H HB3  . ARG A 1 77  ? -15.274 -8.105  -1.356  1.00 0.00 ? 77  ARG A HB3  1  
ATOM 1124  H HG2  . ARG A 1 77  ? -14.938 -10.376 -0.858  1.00 0.00 ? 77  ARG A HG2  1  
ATOM 1125  H HG3  . ARG A 1 77  ? -13.564 -9.524  -0.151  1.00 0.00 ? 77  ARG A HG3  1  
ATOM 1126  H HD2  . ARG A 1 77  ? -14.288 -11.100 1.461   1.00 0.00 ? 77  ARG A HD2  1  
ATOM 1127  H HD3  . ARG A 1 77  ? -14.831 -9.519  2.023   1.00 0.00 ? 77  ARG A HD3  1  
ATOM 1128  H HE   . ARG A 1 77  ? -17.042 -10.128 1.597   1.00 0.00 ? 77  ARG A HE   1  
ATOM 1129  H HH11 . ARG A 1 77  ? -14.806 -12.647 0.619   1.00 0.00 ? 77  ARG A HH11 1  
ATOM 1130  H HH12 . ARG A 1 77  ? -16.031 -13.868 0.466   1.00 0.00 ? 77  ARG A HH12 1  
ATOM 1131  H HH21 . ARG A 1 77  ? -18.667 -11.734 1.389   1.00 0.00 ? 77  ARG A HH21 1  
ATOM 1132  H HH22 . ARG A 1 77  ? -18.232 -13.338 0.867   1.00 0.00 ? 77  ARG A HH22 1  
ATOM 1133  N N    . PHE A 1 78  ? -13.003 -6.071  -0.715  1.00 0.00 ? 78  PHE A N    1  
ATOM 1134  C CA   . PHE A 1 78  ? -11.630 -5.805  -1.131  1.00 0.00 ? 78  PHE A CA   1  
ATOM 1135  C C    . PHE A 1 78  ? -10.799 -5.250  0.021   1.00 0.00 ? 78  PHE A C    1  
ATOM 1136  O O    . PHE A 1 78  ? -9.821  -5.864  0.435   1.00 0.00 ? 78  PHE A O    1  
ATOM 1137  C CB   . PHE A 1 78  ? -11.601 -4.835  -2.315  1.00 0.00 ? 78  PHE A CB   1  
ATOM 1138  C CG   . PHE A 1 78  ? -12.179 -5.397  -3.585  1.00 0.00 ? 78  PHE A CG   1  
ATOM 1139  C CD1  . PHE A 1 78  ? -12.048 -6.742  -3.889  1.00 0.00 ? 78  PHE A CD1  1  
ATOM 1140  C CD2  . PHE A 1 78  ? -12.853 -4.577  -4.475  1.00 0.00 ? 78  PHE A CD2  1  
ATOM 1141  C CE1  . PHE A 1 78  ? -12.577 -7.259  -5.056  1.00 0.00 ? 78  PHE A CE1  1  
ATOM 1142  C CE2  . PHE A 1 78  ? -13.384 -5.086  -5.645  1.00 0.00 ? 78  PHE A CE2  1  
ATOM 1143  C CZ   . PHE A 1 78  ? -13.247 -6.429  -5.934  1.00 0.00 ? 78  PHE A CZ   1  
ATOM 1144  H H    . PHE A 1 78  ? -13.730 -5.540  -1.102  1.00 0.00 ? 78  PHE A H    1  
ATOM 1145  H HA   . PHE A 1 78  ? -11.197 -6.745  -1.442  1.00 0.00 ? 78  PHE A HA   1  
ATOM 1146  H HB2  . PHE A 1 78  ? -12.166 -3.951  -2.058  1.00 0.00 ? 78  PHE A HB2  1  
ATOM 1147  H HB3  . PHE A 1 78  ? -10.577 -4.553  -2.513  1.00 0.00 ? 78  PHE A HB3  1  
ATOM 1148  H HD1  . PHE A 1 78  ? -11.523 -7.391  -3.203  1.00 0.00 ? 78  PHE A HD1  1  
ATOM 1149  H HD2  . PHE A 1 78  ? -12.960 -3.527  -4.249  1.00 0.00 ? 78  PHE A HD2  1  
ATOM 1150  H HE1  . PHE A 1 78  ? -12.468 -8.310  -5.281  1.00 0.00 ? 78  PHE A HE1  1  
ATOM 1151  H HE2  . PHE A 1 78  ? -13.907 -4.436  -6.331  1.00 0.00 ? 78  PHE A HE2  1  
ATOM 1152  H HZ   . PHE A 1 78  ? -13.662 -6.830  -6.847  1.00 0.00 ? 78  PHE A HZ   1  
ATOM 1153  N N    . THR A 1 79  ? -11.196 -4.100  0.549   1.00 0.00 ? 79  THR A N    1  
ATOM 1154  C CA   . THR A 1 79  ? -10.470 -3.484  1.654   1.00 0.00 ? 79  THR A CA   1  
ATOM 1155  C C    . THR A 1 79  ? -10.633 -4.305  2.933   1.00 0.00 ? 79  THR A C    1  
ATOM 1156  O O    . THR A 1 79  ? -9.819  -4.222  3.855   1.00 0.00 ? 79  THR A O    1  
ATOM 1157  C CB   . THR A 1 79  ? -10.960 -2.044  1.899   1.00 0.00 ? 79  THR A CB   1  
ATOM 1158  O OG1  . THR A 1 79  ? -11.409 -1.470  0.662   1.00 0.00 ? 79  THR A OG1  1  
ATOM 1159  C CG2  . THR A 1 79  ? -9.850  -1.184  2.483   1.00 0.00 ? 79  THR A CG2  1  
ATOM 1160  H H    . THR A 1 79  ? -11.990 -3.649  0.187   1.00 0.00 ? 79  THR A H    1  
ATOM 1161  H HA   . THR A 1 79  ? -9.423  -3.448  1.389   1.00 0.00 ? 79  THR A HA   1  
ATOM 1162  H HB   . THR A 1 79  ? -11.783 -2.070  2.596   1.00 0.00 ? 79  THR A HB   1  
ATOM 1163  H HG1  . THR A 1 79  ? -10.816 -1.738  -0.050  1.00 0.00 ? 79  THR A HG1  1  
ATOM 1164  H HG21 . THR A 1 79  ? -9.489  -1.633  3.397   1.00 0.00 ? 79  THR A HG21 1  
ATOM 1165  H HG22 . THR A 1 79  ? -10.232 -0.195  2.695   1.00 0.00 ? 79  THR A HG22 1  
ATOM 1166  H HG23 . THR A 1 79  ? -9.037  -1.112  1.775   1.00 0.00 ? 79  THR A HG23 1  
ATOM 1167  N N    . GLN A 1 80  ? -11.679 -5.120  2.969   1.00 0.00 ? 80  GLN A N    1  
ATOM 1168  C CA   . GLN A 1 80  ? -11.961 -5.955  4.128   1.00 0.00 ? 80  GLN A CA   1  
ATOM 1169  C C    . GLN A 1 80  ? -11.014 -7.152  4.190   1.00 0.00 ? 80  GLN A C    1  
ATOM 1170  O O    . GLN A 1 80  ? -10.764 -7.698  5.260   1.00 0.00 ? 80  GLN A O    1  
ATOM 1171  C CB   . GLN A 1 80  ? -13.411 -6.437  4.094   1.00 0.00 ? 80  GLN A CB   1  
ATOM 1172  C CG   . GLN A 1 80  ? -14.141 -6.282  5.419   1.00 0.00 ? 80  GLN A CG   1  
ATOM 1173  C CD   . GLN A 1 80  ? -14.185 -4.844  5.910   1.00 0.00 ? 80  GLN A CD   1  
ATOM 1174  O OE1  . GLN A 1 80  ? -15.057 -4.067  5.516   1.00 0.00 ? 80  GLN A OE1  1  
ATOM 1175  N NE2  . GLN A 1 80  ? -13.261 -4.488  6.784   1.00 0.00 ? 80  GLN A NE2  1  
ATOM 1176  H H    . GLN A 1 80  ? -12.277 -5.160  2.195   1.00 0.00 ? 80  GLN A H    1  
ATOM 1177  H HA   . GLN A 1 80  ? -11.814 -5.353  5.011   1.00 0.00 ? 80  GLN A HA   1  
ATOM 1178  H HB2  . GLN A 1 80  ? -13.946 -5.872  3.344   1.00 0.00 ? 80  GLN A HB2  1  
ATOM 1179  H HB3  . GLN A 1 80  ? -13.424 -7.482  3.821   1.00 0.00 ? 80  GLN A HB3  1  
ATOM 1180  H HG2  . GLN A 1 80  ? -15.155 -6.633  5.299   1.00 0.00 ? 80  GLN A HG2  1  
ATOM 1181  H HG3  . GLN A 1 80  ? -13.639 -6.884  6.161   1.00 0.00 ? 80  GLN A HG3  1  
ATOM 1182  H HE21 . GLN A 1 80  ? -12.598 -5.168  7.068   1.00 0.00 ? 80  GLN A HE21 1  
ATOM 1183  H HE22 . GLN A 1 80  ? -13.269 -3.566  7.120   1.00 0.00 ? 80  GLN A HE22 1  
ATOM 1184  N N    . VAL A 1 81  ? -10.479 -7.562  3.044   1.00 0.00 ? 81  VAL A N    1  
ATOM 1185  C CA   . VAL A 1 81  ? -9.564  -8.695  3.016   1.00 0.00 ? 81  VAL A CA   1  
ATOM 1186  C C    . VAL A 1 81  ? -8.207  -8.287  3.591   1.00 0.00 ? 81  VAL A C    1  
ATOM 1187  O O    . VAL A 1 81  ? -7.453  -9.118  4.099   1.00 0.00 ? 81  VAL A O    1  
ATOM 1188  C CB   . VAL A 1 81  ? -9.401  -9.283  1.592   1.00 0.00 ? 81  VAL A CB   1  
ATOM 1189  C CG1  . VAL A 1 81  ? -8.347  -8.538  0.784   1.00 0.00 ? 81  VAL A CG1  1  
ATOM 1190  C CG2  . VAL A 1 81  ? -9.076  -10.766 1.665   1.00 0.00 ? 81  VAL A CG2  1  
ATOM 1191  H H    . VAL A 1 81  ? -10.706 -7.099  2.208   1.00 0.00 ? 81  VAL A H    1  
ATOM 1192  H HA   . VAL A 1 81  ? -9.983  -9.465  3.651   1.00 0.00 ? 81  VAL A HA   1  
ATOM 1193  H HB   . VAL A 1 81  ? -10.346 -9.176  1.077   1.00 0.00 ? 81  VAL A HB   1  
ATOM 1194  H HG11 . VAL A 1 81  ? -8.683  -7.527  0.600   1.00 0.00 ? 81  VAL A HG11 1  
ATOM 1195  H HG12 . VAL A 1 81  ? -8.190  -9.044  -0.158  1.00 0.00 ? 81  VAL A HG12 1  
ATOM 1196  H HG13 . VAL A 1 81  ? -7.420  -8.515  1.338   1.00 0.00 ? 81  VAL A HG13 1  
ATOM 1197  H HG21 . VAL A 1 81  ? -8.131  -10.903 2.171   1.00 0.00 ? 81  VAL A HG21 1  
ATOM 1198  H HG22 . VAL A 1 81  ? -9.010  -11.170 0.666   1.00 0.00 ? 81  VAL A HG22 1  
ATOM 1199  H HG23 . VAL A 1 81  ? -9.854  -11.278 2.211   1.00 0.00 ? 81  VAL A HG23 1  
ATOM 1200  N N    . SER A 1 82  ? -7.912  -6.996  3.529   1.00 0.00 ? 82  SER A N    1  
ATOM 1201  C CA   . SER A 1 82  ? -6.666  -6.477  4.058   1.00 0.00 ? 82  SER A CA   1  
ATOM 1202  C C    . SER A 1 82  ? -6.761  -6.363  5.581   1.00 0.00 ? 82  SER A C    1  
ATOM 1203  O O    . SER A 1 82  ? -5.812  -6.677  6.303   1.00 0.00 ? 82  SER A O    1  
ATOM 1204  C CB   . SER A 1 82  ? -6.366  -5.115  3.434   1.00 0.00 ? 82  SER A CB   1  
ATOM 1205  O OG   . SER A 1 82  ? -7.016  -4.983  2.179   1.00 0.00 ? 82  SER A OG   1  
ATOM 1206  H H    . SER A 1 82  ? -8.544  -6.377  3.107   1.00 0.00 ? 82  SER A H    1  
ATOM 1207  H HA   . SER A 1 82  ? -5.876  -7.171  3.800   1.00 0.00 ? 82  SER A HA   1  
ATOM 1208  H HB2  . SER A 1 82  ? -6.718  -4.334  4.091   1.00 0.00 ? 82  SER A HB2  1  
ATOM 1209  H HB3  . SER A 1 82  ? -5.300  -5.013  3.289   1.00 0.00 ? 82  SER A HB3  1  
ATOM 1210  H HG   . SER A 1 82  ? -6.705  -5.668  1.580   1.00 0.00 ? 82  SER A HG   1  
ATOM 1211  N N    . ASP A 1 83  ? -7.930  -5.932  6.060   1.00 0.00 ? 83  ASP A N    1  
ATOM 1212  C CA   . ASP A 1 83  ? -8.174  -5.788  7.494   1.00 0.00 ? 83  ASP A CA   1  
ATOM 1213  C C    . ASP A 1 83  ? -8.301  -7.162  8.142   1.00 0.00 ? 83  ASP A C    1  
ATOM 1214  O O    . ASP A 1 83  ? -7.974  -7.337  9.314   1.00 0.00 ? 83  ASP A O    1  
ATOM 1215  C CB   . ASP A 1 83  ? -9.435  -4.943  7.747   1.00 0.00 ? 83  ASP A CB   1  
ATOM 1216  C CG   . ASP A 1 83  ? -10.567 -5.714  8.412   1.00 0.00 ? 83  ASP A CG   1  
ATOM 1217  O OD1  . ASP A 1 83  ? -10.601 -5.786  9.658   1.00 0.00 ? 83  ASP A OD1  1  
ATOM 1218  O OD2  . ASP A 1 83  ? -11.440 -6.233  7.689   1.00 0.00 ? 83  ASP A OD2  1  
ATOM 1219  H H    . ASP A 1 83  ? -8.646  -5.700  5.431   1.00 0.00 ? 83  ASP A H    1  
ATOM 1220  H HA   . ASP A 1 83  ? -7.321  -5.281  7.924   1.00 0.00 ? 83  ASP A HA   1  
ATOM 1221  H HB2  . ASP A 1 83  ? -9.176  -4.112  8.385   1.00 0.00 ? 83  ASP A HB2  1  
ATOM 1222  H HB3  . ASP A 1 83  ? -9.795  -4.560  6.804   1.00 0.00 ? 83  ASP A HB3  1  
ATOM 1223  N N    . GLU A 1 84  ? -8.758  -8.132  7.354   1.00 0.00 ? 84  GLU A N    1  
ATOM 1224  C CA   . GLU A 1 84  ? -8.928  -9.505  7.817   1.00 0.00 ? 84  GLU A CA   1  
ATOM 1225  C C    . GLU A 1 84  ? -7.626  -10.040 8.408   1.00 0.00 ? 84  GLU A C    1  
ATOM 1226  O O    . GLU A 1 84  ? -7.611  -10.606 9.503   1.00 0.00 ? 84  GLU A O    1  
ATOM 1227  C CB   . GLU A 1 84  ? -9.374  -10.390 6.651   1.00 0.00 ? 84  GLU A CB   1  
ATOM 1228  C CG   . GLU A 1 84  ? -9.556  -11.851 7.018   1.00 0.00 ? 84  GLU A CG   1  
ATOM 1229  C CD   . GLU A 1 84  ? -10.917 -12.142 7.603   1.00 0.00 ? 84  GLU A CD   1  
ATOM 1230  O OE1  . GLU A 1 84  ? -11.856 -12.394 6.823   1.00 0.00 ? 84  GLU A OE1  1  
ATOM 1231  O OE2  . GLU A 1 84  ? -11.054 -12.130 8.844   1.00 0.00 ? 84  GLU A OE2  1  
ATOM 1232  H H    . GLU A 1 84  ? -9.006  -7.912  6.430   1.00 0.00 ? 84  GLU A H    1  
ATOM 1233  H HA   . GLU A 1 84  ? -9.692  -9.510  8.580   1.00 0.00 ? 84  GLU A HA   1  
ATOM 1234  H HB2  . GLU A 1 84  ? -10.313 -10.017 6.273   1.00 0.00 ? 84  GLU A HB2  1  
ATOM 1235  H HB3  . GLU A 1 84  ? -8.632  -10.329 5.868   1.00 0.00 ? 84  GLU A HB3  1  
ATOM 1236  H HG2  . GLU A 1 84  ? -9.430  -12.451 6.129   1.00 0.00 ? 84  GLU A HG2  1  
ATOM 1237  H HG3  . GLU A 1 84  ? -8.803  -12.123 7.744   1.00 0.00 ? 84  GLU A HG3  1  
ATOM 1238  N N    . LEU A 1 85  ? -6.529  -9.841  7.687   1.00 0.00 ? 85  LEU A N    1  
ATOM 1239  C CA   . LEU A 1 85  ? -5.230  -10.309 8.147   1.00 0.00 ? 85  LEU A CA   1  
ATOM 1240  C C    . LEU A 1 85  ? -4.626  -9.321  9.138   1.00 0.00 ? 85  LEU A C    1  
ATOM 1241  O O    . LEU A 1 85  ? -3.776  -9.686  9.944   1.00 0.00 ? 85  LEU A O    1  
ATOM 1242  C CB   . LEU A 1 85  ? -4.281  -10.533 6.965   1.00 0.00 ? 85  LEU A CB   1  
ATOM 1243  C CG   . LEU A 1 85  ? -3.452  -11.823 7.031   1.00 0.00 ? 85  LEU A CG   1  
ATOM 1244  C CD1  . LEU A 1 85  ? -2.257  -11.653 7.957   1.00 0.00 ? 85  LEU A CD1  1  
ATOM 1245  C CD2  . LEU A 1 85  ? -4.313  -12.988 7.490   1.00 0.00 ? 85  LEU A CD2  1  
ATOM 1246  H H    . LEU A 1 85  ? -6.599  -9.374  6.826   1.00 0.00 ? 85  LEU A H    1  
ATOM 1247  H HA   . LEU A 1 85  ? -5.384  -11.251 8.653   1.00 0.00 ? 85  LEU A HA   1  
ATOM 1248  H HB2  . LEU A 1 85  ? -4.868  -10.553 6.058   1.00 0.00 ? 85  LEU A HB2  1  
ATOM 1249  H HB3  . LEU A 1 85  ? -3.599  -9.699  6.915   1.00 0.00 ? 85  LEU A HB3  1  
ATOM 1250  H HG   . LEU A 1 85  ? -3.078  -12.052 6.044   1.00 0.00 ? 85  LEU A HG   1  
ATOM 1251  H HD11 . LEU A 1 85  ? -1.626  -10.859 7.588   1.00 0.00 ? 85  LEU A HD11 1  
ATOM 1252  H HD12 . LEU A 1 85  ? -1.696  -12.575 7.995   1.00 0.00 ? 85  LEU A HD12 1  
ATOM 1253  H HD13 . LEU A 1 85  ? -2.605  -11.404 8.950   1.00 0.00 ? 85  LEU A HD13 1  
ATOM 1254  H HD21 . LEU A 1 85  ? -4.713  -12.773 8.470   1.00 0.00 ? 85  LEU A HD21 1  
ATOM 1255  H HD22 . LEU A 1 85  ? -3.713  -13.886 7.536   1.00 0.00 ? 85  LEU A HD22 1  
ATOM 1256  H HD23 . LEU A 1 85  ? -5.125  -13.132 6.794   1.00 0.00 ? 85  LEU A HD23 1  
ATOM 1257  N N    . PHE A 1 86  ? -5.086  -8.075  9.085   1.00 0.00 ? 86  PHE A N    1  
ATOM 1258  C CA   . PHE A 1 86  ? -4.605  -7.038  9.993   1.00 0.00 ? 86  PHE A CA   1  
ATOM 1259  C C    . PHE A 1 86  ? -4.958  -7.416  11.427  1.00 0.00 ? 86  PHE A C    1  
ATOM 1260  O O    . PHE A 1 86  ? -4.221  -7.119  12.368  1.00 0.00 ? 86  PHE A O    1  
ATOM 1261  C CB   . PHE A 1 86  ? -5.234  -5.685  9.646   1.00 0.00 ? 86  PHE A CB   1  
ATOM 1262  C CG   . PHE A 1 86  ? -4.240  -4.581  9.425   1.00 0.00 ? 86  PHE A CG   1  
ATOM 1263  C CD1  . PHE A 1 86  ? -3.266  -4.301  10.372  1.00 0.00 ? 86  PHE A CD1  1  
ATOM 1264  C CD2  . PHE A 1 86  ? -4.284  -3.820  8.269   1.00 0.00 ? 86  PHE A CD2  1  
ATOM 1265  C CE1  . PHE A 1 86  ? -2.356  -3.281  10.167  1.00 0.00 ? 86  PHE A CE1  1  
ATOM 1266  C CE2  . PHE A 1 86  ? -3.376  -2.799  8.062   1.00 0.00 ? 86  PHE A CE2  1  
ATOM 1267  C CZ   . PHE A 1 86  ? -2.412  -2.529  9.012   1.00 0.00 ? 86  PHE A CZ   1  
ATOM 1268  H H    . PHE A 1 86  ? -5.770  -7.847  8.419   1.00 0.00 ? 86  PHE A H    1  
ATOM 1269  H HA   . PHE A 1 86  ? -3.531  -6.972  9.894   1.00 0.00 ? 86  PHE A HA   1  
ATOM 1270  H HB2  . PHE A 1 86  ? -5.815  -5.789  8.743   1.00 0.00 ? 86  PHE A HB2  1  
ATOM 1271  H HB3  . PHE A 1 86  ? -5.888  -5.385  10.454  1.00 0.00 ? 86  PHE A HB3  1  
ATOM 1272  H HD1  . PHE A 1 86  ? -3.221  -4.888  11.277  1.00 0.00 ? 86  PHE A HD1  1  
ATOM 1273  H HD2  . PHE A 1 86  ? -5.039  -4.028  7.525   1.00 0.00 ? 86  PHE A HD2  1  
ATOM 1274  H HE1  . PHE A 1 86  ? -1.602  -3.072  10.911  1.00 0.00 ? 86  PHE A HE1  1  
ATOM 1275  H HE2  . PHE A 1 86  ? -3.422  -2.213  7.154   1.00 0.00 ? 86  PHE A HE2  1  
ATOM 1276  H HZ   . PHE A 1 86  ? -1.703  -1.731  8.850   1.00 0.00 ? 86  PHE A HZ   1  
ATOM 1277  N N    . GLN A 1 87  ? -6.093  -8.097  11.568  1.00 0.00 ? 87  GLN A N    1  
ATOM 1278  C CA   . GLN A 1 87  ? -6.588  -8.545  12.863  1.00 0.00 ? 87  GLN A CA   1  
ATOM 1279  C C    . GLN A 1 87  ? -5.642  -9.559  13.501  1.00 0.00 ? 87  GLN A C    1  
ATOM 1280  O O    . GLN A 1 87  ? -5.630  -9.725  14.720  1.00 0.00 ? 87  GLN A O    1  
ATOM 1281  C CB   . GLN A 1 87  ? -7.969  -9.183  12.706  1.00 0.00 ? 87  GLN A CB   1  
ATOM 1282  C CG   . GLN A 1 87  ? -9.026  -8.250  12.138  1.00 0.00 ? 87  GLN A CG   1  
ATOM 1283  C CD   . GLN A 1 87  ? -10.177 -9.005  11.499  1.00 0.00 ? 87  GLN A CD   1  
ATOM 1284  O OE1  . GLN A 1 87  ? -10.468 -10.145 11.865  1.00 0.00 ? 87  GLN A OE1  1  
ATOM 1285  N NE2  . GLN A 1 87  ? -10.839 -8.380  10.538  1.00 0.00 ? 87  GLN A NE2  1  
ATOM 1286  H H    . GLN A 1 87  ? -6.628  -8.290  10.766  1.00 0.00 ? 87  GLN A H    1  
ATOM 1287  H HA   . GLN A 1 87  ? -6.669  -7.682  13.508  1.00 0.00 ? 87  GLN A HA   1  
ATOM 1288  H HB2  . GLN A 1 87  ? -7.884  -10.033 12.047  1.00 0.00 ? 87  GLN A HB2  1  
ATOM 1289  H HB3  . GLN A 1 87  ? -8.304  -9.523  13.675  1.00 0.00 ? 87  GLN A HB3  1  
ATOM 1290  H HG2  . GLN A 1 87  ? -9.417  -7.640  12.939  1.00 0.00 ? 87  GLN A HG2  1  
ATOM 1291  H HG3  . GLN A 1 87  ? -8.568  -7.618  11.393  1.00 0.00 ? 87  GLN A HG3  1  
ATOM 1292  H HE21 . GLN A 1 87  ? -10.552 -7.466  10.287  1.00 0.00 ? 87  GLN A HE21 1  
ATOM 1293  H HE22 . GLN A 1 87  ? -11.588 -8.850  10.113  1.00 0.00 ? 87  GLN A HE22 1  
ATOM 1294  N N    . GLY A 1 88  ? -4.855  -10.239 12.676  1.00 0.00 ? 88  GLY A N    1  
ATOM 1295  C CA   . GLY A 1 88  ? -3.934  -11.232 13.185  1.00 0.00 ? 88  GLY A CA   1  
ATOM 1296  C C    . GLY A 1 88  ? -2.569  -11.144 12.535  1.00 0.00 ? 88  GLY A C    1  
ATOM 1297  O O    . GLY A 1 88  ? -1.999  -12.161 12.137  1.00 0.00 ? 88  GLY A O    1  
ATOM 1298  H H    . GLY A 1 88  ? -4.890  -10.053 11.715  1.00 0.00 ? 88  GLY A H    1  
ATOM 1299  H HA2  . GLY A 1 88  ? -3.825  -11.093 14.251  1.00 0.00 ? 88  GLY A HA2  1  
ATOM 1300  H HA3  . GLY A 1 88  ? -4.345  -12.214 13.003  1.00 0.00 ? 88  GLY A HA3  1  
ATOM 1301  N N    . GLY A 1 89  ? -2.051  -9.929  12.415  1.00 0.00 ? 89  GLY A N    1  
ATOM 1302  C CA   . GLY A 1 89  ? -0.748  -9.739  11.816  1.00 0.00 ? 89  GLY A CA   1  
ATOM 1303  C C    . GLY A 1 89  ? -0.598  -8.376  11.171  1.00 0.00 ? 89  GLY A C    1  
ATOM 1304  O O    . GLY A 1 89  ? -0.625  -8.261  9.943   1.00 0.00 ? 89  GLY A O    1  
ATOM 1305  H H    . GLY A 1 89  ? -2.561  -9.153  12.730  1.00 0.00 ? 89  GLY A H    1  
ATOM 1306  H HA2  . GLY A 1 89  ? 0.004   -9.846  12.584  1.00 0.00 ? 89  GLY A HA2  1  
ATOM 1307  H HA3  . GLY A 1 89  ? -0.591  -10.500 11.065  1.00 0.00 ? 89  GLY A HA3  1  
ATOM 1308  N N    . PRO A 1 90  ? -0.434  -7.313  11.979  1.00 0.00 ? 90  PRO A N    1  
ATOM 1309  C CA   . PRO A 1 90  ? -0.275  -5.943  11.485  1.00 0.00 ? 90  PRO A CA   1  
ATOM 1310  C C    . PRO A 1 90  ? 1.131   -5.688  10.948  1.00 0.00 ? 90  PRO A C    1  
ATOM 1311  O O    . PRO A 1 90  ? 1.794   -4.727  11.338  1.00 0.00 ? 90  PRO A O    1  
ATOM 1312  C CB   . PRO A 1 90  ? -0.539  -5.069  12.725  1.00 0.00 ? 90  PRO A CB   1  
ATOM 1313  C CG   . PRO A 1 90  ? -0.952  -6.010  13.811  1.00 0.00 ? 90  PRO A CG   1  
ATOM 1314  C CD   . PRO A 1 90  ? -0.393  -7.350  13.443  1.00 0.00 ? 90  PRO A CD   1  
ATOM 1315  H HA   . PRO A 1 90  ? -1.001  -5.714  10.717  1.00 0.00 ? 90  PRO A HA   1  
ATOM 1316  H HB2  . PRO A 1 90  ? 0.364   -4.541  12.989  1.00 0.00 ? 90  PRO A HB2  1  
ATOM 1317  H HB3  . PRO A 1 90  ? -1.322  -4.359  12.503  1.00 0.00 ? 90  PRO A HB3  1  
ATOM 1318  H HG2  . PRO A 1 90  ? -0.545  -5.681  14.755  1.00 0.00 ? 90  PRO A HG2  1  
ATOM 1319  H HG3  . PRO A 1 90  ? -2.032  -6.054  13.864  1.00 0.00 ? 90  PRO A HG3  1  
ATOM 1320  H HD2  . PRO A 1 90  ? 0.621   -7.450  13.801  1.00 0.00 ? 90  PRO A HD2  1  
ATOM 1321  H HD3  . PRO A 1 90  ? -1.016  -8.142  13.827  1.00 0.00 ? 90  PRO A HD3  1  
ATOM 1322  N N    . ASN A 1 91  ? 1.576   -6.555  10.052  1.00 0.00 ? 91  ASN A N    1  
ATOM 1323  C CA   . ASN A 1 91  ? 2.902   -6.439  9.458   1.00 0.00 ? 91  ASN A CA   1  
ATOM 1324  C C    . ASN A 1 91  ? 2.954   -5.265  8.485   1.00 0.00 ? 91  ASN A C    1  
ATOM 1325  O O    . ASN A 1 91  ? 1.914   -4.764  8.056   1.00 0.00 ? 91  ASN A O    1  
ATOM 1326  C CB   . ASN A 1 91  ? 3.275   -7.740  8.739   1.00 0.00 ? 91  ASN A CB   1  
ATOM 1327  C CG   . ASN A 1 91  ? 4.774   -7.967  8.693   1.00 0.00 ? 91  ASN A CG   1  
ATOM 1328  O OD1  . ASN A 1 91  ? 5.515   -7.439  9.519   1.00 0.00 ? 91  ASN A OD1  1  
ATOM 1329  N ND2  . ASN A 1 91  ? 5.232   -8.756  7.734   1.00 0.00 ? 91  ASN A ND2  1  
ATOM 1330  H H    . ASN A 1 91  ? 0.993   -7.300  9.784   1.00 0.00 ? 91  ASN A H    1  
ATOM 1331  H HA   . ASN A 1 91  ? 3.608   -6.262  10.254  1.00 0.00 ? 91  ASN A HA   1  
ATOM 1332  H HB2  . ASN A 1 91  ? 2.818   -8.572  9.255   1.00 0.00 ? 91  ASN A HB2  1  
ATOM 1333  H HB3  . ASN A 1 91  ? 2.905   -7.705  7.726   1.00 0.00 ? 91  ASN A HB3  1  
ATOM 1334  H HD21 . ASN A 1 91  ? 4.586   -9.156  7.099   1.00 0.00 ? 91  ASN A HD21 1  
ATOM 1335  H HD22 . ASN A 1 91  ? 6.198   -8.916  7.690   1.00 0.00 ? 91  ASN A HD22 1  
ATOM 1336  N N    . TRP A 1 92  ? 4.163   -4.837  8.139   1.00 0.00 ? 92  TRP A N    1  
ATOM 1337  C CA   . TRP A 1 92  ? 4.356   -3.718  7.217   1.00 0.00 ? 92  TRP A CA   1  
ATOM 1338  C C    . TRP A 1 92  ? 3.594   -3.934  5.912   1.00 0.00 ? 92  TRP A C    1  
ATOM 1339  O O    . TRP A 1 92  ? 2.991   -3.005  5.374   1.00 0.00 ? 92  TRP A O    1  
ATOM 1340  C CB   . TRP A 1 92  ? 5.848   -3.499  6.925   1.00 0.00 ? 92  TRP A CB   1  
ATOM 1341  C CG   . TRP A 1 92  ? 6.724   -4.664  7.288   1.00 0.00 ? 92  TRP A CG   1  
ATOM 1342  C CD1  . TRP A 1 92  ? 7.400   -4.845  8.463   1.00 0.00 ? 92  TRP A CD1  1  
ATOM 1343  C CD2  . TRP A 1 92  ? 7.023   -5.803  6.472   1.00 0.00 ? 92  TRP A CD2  1  
ATOM 1344  N NE1  . TRP A 1 92  ? 8.095   -6.030  8.427   1.00 0.00 ? 92  TRP A NE1  1  
ATOM 1345  C CE2  . TRP A 1 92  ? 7.880   -6.637  7.217   1.00 0.00 ? 92  TRP A CE2  1  
ATOM 1346  C CE3  . TRP A 1 92  ? 6.647   -6.202  5.186   1.00 0.00 ? 92  TRP A CE3  1  
ATOM 1347  C CZ2  . TRP A 1 92  ? 8.363   -7.844  6.718   1.00 0.00 ? 92  TRP A CZ2  1  
ATOM 1348  C CZ3  . TRP A 1 92  ? 7.128   -7.398  4.691   1.00 0.00 ? 92  TRP A CZ3  1  
ATOM 1349  C CH2  . TRP A 1 92  ? 7.979   -8.208  5.456   1.00 0.00 ? 92  TRP A CH2  1  
ATOM 1350  H H    . TRP A 1 92  ? 4.952   -5.274  8.524   1.00 0.00 ? 92  TRP A H    1  
ATOM 1351  H HA   . TRP A 1 92  ? 3.965   -2.833  7.696   1.00 0.00 ? 92  TRP A HA   1  
ATOM 1352  H HB2  . TRP A 1 92  ? 5.975   -3.310  5.868   1.00 0.00 ? 92  TRP A HB2  1  
ATOM 1353  H HB3  . TRP A 1 92  ? 6.191   -2.641  7.481   1.00 0.00 ? 92  TRP A HB3  1  
ATOM 1354  H HD1  . TRP A 1 92  ? 7.381   -4.151  9.290   1.00 0.00 ? 92  TRP A HD1  1  
ATOM 1355  H HE1  . TRP A 1 92  ? 8.657   -6.387  9.160   1.00 0.00 ? 92  TRP A HE1  1  
ATOM 1356  H HE3  . TRP A 1 92  ? 5.992   -5.591  4.582   1.00 0.00 ? 92  TRP A HE3  1  
ATOM 1357  H HZ2  . TRP A 1 92  ? 9.020   -8.478  7.294   1.00 0.00 ? 92  TRP A HZ2  1  
ATOM 1358  H HZ3  . TRP A 1 92  ? 6.848   -7.723  3.700   1.00 0.00 ? 92  TRP A HZ3  1  
ATOM 1359  H HH2  . TRP A 1 92  ? 8.331   -9.133  5.028   1.00 0.00 ? 92  TRP A HH2  1  
ATOM 1360  N N    . GLY A 1 93  ? 3.604   -5.168  5.426   1.00 0.00 ? 93  GLY A N    1  
ATOM 1361  C CA   . GLY A 1 93  ? 2.915   -5.492  4.193   1.00 0.00 ? 93  GLY A CA   1  
ATOM 1362  C C    . GLY A 1 93  ? 1.410   -5.332  4.306   1.00 0.00 ? 93  GLY A C    1  
ATOM 1363  O O    . GLY A 1 93  ? 0.728   -5.120  3.307   1.00 0.00 ? 93  GLY A O    1  
ATOM 1364  H H    . GLY A 1 93  ? 4.096   -5.868  5.905   1.00 0.00 ? 93  GLY A H    1  
ATOM 1365  H HA2  . GLY A 1 93  ? 3.276   -4.842  3.412   1.00 0.00 ? 93  GLY A HA2  1  
ATOM 1366  H HA3  . GLY A 1 93  ? 3.137   -6.516  3.927   1.00 0.00 ? 93  GLY A HA3  1  
ATOM 1367  N N    . ARG A 1 94  ? 0.886   -5.434  5.523   1.00 0.00 ? 94  ARG A N    1  
ATOM 1368  C CA   . ARG A 1 94  ? -0.550  -5.293  5.743   1.00 0.00 ? 94  ARG A CA   1  
ATOM 1369  C C    . ARG A 1 94  ? -0.940  -3.829  5.643   1.00 0.00 ? 94  ARG A C    1  
ATOM 1370  O O    . ARG A 1 94  ? -1.976  -3.490  5.072   1.00 0.00 ? 94  ARG A O    1  
ATOM 1371  C CB   . ARG A 1 94  ? -0.959  -5.866  7.104   1.00 0.00 ? 94  ARG A CB   1  
ATOM 1372  C CG   . ARG A 1 94  ? -1.950  -7.021  7.012   1.00 0.00 ? 94  ARG A CG   1  
ATOM 1373  C CD   . ARG A 1 94  ? -1.266  -8.336  6.652   1.00 0.00 ? 94  ARG A CD   1  
ATOM 1374  N NE   . ARG A 1 94  ? -0.613  -8.281  5.344   1.00 0.00 ? 94  ARG A NE   1  
ATOM 1375  C CZ   . ARG A 1 94  ? 0.657   -8.628  5.130   1.00 0.00 ? 94  ARG A CZ   1  
ATOM 1376  N NH1  . ARG A 1 94  ? 1.384   -9.146  6.114   1.00 0.00 ? 94  ARG A NH1  1  
ATOM 1377  N NH2  . ARG A 1 94  ? 1.195   -8.472  3.928   1.00 0.00 ? 94  ARG A NH2  1  
ATOM 1378  H H    . ARG A 1 94  ? 1.479   -5.595  6.290   1.00 0.00 ? 94  ARG A H    1  
ATOM 1379  H HA   . ARG A 1 94  ? -1.057  -5.841  4.962   1.00 0.00 ? 94  ARG A HA   1  
ATOM 1380  H HB2  . ARG A 1 94  ? -0.075  -6.219  7.614   1.00 0.00 ? 94  ARG A HB2  1  
ATOM 1381  H HB3  . ARG A 1 94  ? -1.411  -5.080  7.690   1.00 0.00 ? 94  ARG A HB3  1  
ATOM 1382  H HG2  . ARG A 1 94  ? -2.443  -7.139  7.967   1.00 0.00 ? 94  ARG A HG2  1  
ATOM 1383  H HG3  . ARG A 1 94  ? -2.684  -6.789  6.254   1.00 0.00 ? 94  ARG A HG3  1  
ATOM 1384  H HD2  . ARG A 1 94  ? -0.523  -8.557  7.403   1.00 0.00 ? 94  ARG A HD2  1  
ATOM 1385  H HD3  . ARG A 1 94  ? -2.008  -9.122  6.640   1.00 0.00 ? 94  ARG A HD3  1  
ATOM 1386  H HE   . ARG A 1 94  ? -1.144  -7.942  4.594   1.00 0.00 ? 94  ARG A HE   1  
ATOM 1387  H HH11 . ARG A 1 94  ? 0.985   -9.280  7.022   1.00 0.00 ? 94  ARG A HH11 1  
ATOM 1388  H HH12 . ARG A 1 94  ? 2.351   -9.416  5.945   1.00 0.00 ? 94  ARG A HH12 1  
ATOM 1389  H HH21 . ARG A 1 94  ? 0.656   -8.101  3.172   1.00 0.00 ? 94  ARG A HH21 1  
ATOM 1390  H HH22 . ARG A 1 94  ? 2.171   -8.714  3.774   1.00 0.00 ? 94  ARG A HH22 1  
ATOM 1391  N N    . LEU A 1 95  ? -0.089  -2.969  6.190   1.00 0.00 ? 95  LEU A N    1  
ATOM 1392  C CA   . LEU A 1 95  ? -0.317  -1.532  6.155   1.00 0.00 ? 95  LEU A CA   1  
ATOM 1393  C C    . LEU A 1 95  ? -0.270  -1.050  4.711   1.00 0.00 ? 95  LEU A C    1  
ATOM 1394  O O    . LEU A 1 95  ? -1.101  -0.249  4.279   1.00 0.00 ? 95  LEU A O    1  
ATOM 1395  C CB   . LEU A 1 95  ? 0.741   -0.810  6.996   1.00 0.00 ? 95  LEU A CB   1  
ATOM 1396  C CG   . LEU A 1 95  ? 0.555   0.702   7.136   1.00 0.00 ? 95  LEU A CG   1  
ATOM 1397  C CD1  . LEU A 1 95  ? -0.709  1.020   7.922   1.00 0.00 ? 95  LEU A CD1  1  
ATOM 1398  C CD2  . LEU A 1 95  ? 1.769   1.324   7.811   1.00 0.00 ? 95  LEU A CD2  1  
ATOM 1399  H H    . LEU A 1 95  ? 0.716   -3.314  6.634   1.00 0.00 ? 95  LEU A H    1  
ATOM 1400  H HA   . LEU A 1 95  ? -1.296  -1.334  6.563   1.00 0.00 ? 95  LEU A HA   1  
ATOM 1401  H HB2  . LEU A 1 95  ? 0.739   -1.243  7.987   1.00 0.00 ? 95  LEU A HB2  1  
ATOM 1402  H HB3  . LEU A 1 95  ? 1.707   -0.989  6.548   1.00 0.00 ? 95  LEU A HB3  1  
ATOM 1403  H HG   . LEU A 1 95  ? 0.457   1.139   6.152   1.00 0.00 ? 95  LEU A HG   1  
ATOM 1404  H HD11 . LEU A 1 95  ? -0.813  2.091   8.019   1.00 0.00 ? 95  LEU A HD11 1  
ATOM 1405  H HD12 . LEU A 1 95  ? -0.645  0.573   8.903   1.00 0.00 ? 95  LEU A HD12 1  
ATOM 1406  H HD13 . LEU A 1 95  ? -1.567  0.621   7.401   1.00 0.00 ? 95  LEU A HD13 1  
ATOM 1407  H HD21 . LEU A 1 95  ? 1.654   2.396   7.843   1.00 0.00 ? 95  LEU A HD21 1  
ATOM 1408  H HD22 . LEU A 1 95  ? 2.660   1.072   7.255   1.00 0.00 ? 95  LEU A HD22 1  
ATOM 1409  H HD23 . LEU A 1 95  ? 1.855   0.942   8.818   1.00 0.00 ? 95  LEU A HD23 1  
ATOM 1410  N N    . VAL A 1 96  ? 0.703   -1.568  3.971   1.00 0.00 ? 96  VAL A N    1  
ATOM 1411  C CA   . VAL A 1 96  ? 0.875   -1.226  2.568   1.00 0.00 ? 96  VAL A CA   1  
ATOM 1412  C C    . VAL A 1 96  ? -0.314  -1.725  1.750   1.00 0.00 ? 96  VAL A C    1  
ATOM 1413  O O    . VAL A 1 96  ? -0.882  -0.983  0.948   1.00 0.00 ? 96  VAL A O    1  
ATOM 1414  C CB   . VAL A 1 96  ? 2.186   -1.826  2.010   1.00 0.00 ? 96  VAL A CB   1  
ATOM 1415  C CG1  . VAL A 1 96  ? 2.248   -1.705  0.495   1.00 0.00 ? 96  VAL A CG1  1  
ATOM 1416  C CG2  . VAL A 1 96  ? 3.392   -1.151  2.648   1.00 0.00 ? 96  VAL A CG2  1  
ATOM 1417  H H    . VAL A 1 96  ? 1.336   -2.194  4.388   1.00 0.00 ? 96  VAL A H    1  
ATOM 1418  H HA   . VAL A 1 96  ? 0.931   -0.149  2.489   1.00 0.00 ? 96  VAL A HA   1  
ATOM 1419  H HB   . VAL A 1 96  ? 2.214   -2.876  2.266   1.00 0.00 ? 96  VAL A HB   1  
ATOM 1420  H HG11 . VAL A 1 96  ? 1.415   -2.235  0.059   1.00 0.00 ? 96  VAL A HG11 1  
ATOM 1421  H HG12 . VAL A 1 96  ? 3.173   -2.132  0.137   1.00 0.00 ? 96  VAL A HG12 1  
ATOM 1422  H HG13 . VAL A 1 96  ? 2.199   -0.662  0.214   1.00 0.00 ? 96  VAL A HG13 1  
ATOM 1423  H HG21 . VAL A 1 96  ? 4.299   -1.576  2.242   1.00 0.00 ? 96  VAL A HG21 1  
ATOM 1424  H HG22 . VAL A 1 96  ? 3.367   -1.306  3.716   1.00 0.00 ? 96  VAL A HG22 1  
ATOM 1425  H HG23 . VAL A 1 96  ? 3.365   -0.092  2.437   1.00 0.00 ? 96  VAL A HG23 1  
ATOM 1426  N N    . ALA A 1 97  ? -0.700  -2.979  1.983   1.00 0.00 ? 97  ALA A N    1  
ATOM 1427  C CA   . ALA A 1 97  ? -1.818  -3.592  1.272   1.00 0.00 ? 97  ALA A CA   1  
ATOM 1428  C C    . ALA A 1 97  ? -3.117  -2.837  1.528   1.00 0.00 ? 97  ALA A C    1  
ATOM 1429  O O    . ALA A 1 97  ? -3.902  -2.616  0.611   1.00 0.00 ? 97  ALA A O    1  
ATOM 1430  C CB   . ALA A 1 97  ? -1.971  -5.054  1.669   1.00 0.00 ? 97  ALA A CB   1  
ATOM 1431  H H    . ALA A 1 97  ? -0.213  -3.509  2.652   1.00 0.00 ? 97  ALA A H    1  
ATOM 1432  H HA   . ALA A 1 97  ? -1.597  -3.554  0.215   1.00 0.00 ? 97  ALA A HA   1  
ATOM 1433  H HB1  . ALA A 1 97  ? -1.044  -5.576  1.488   1.00 0.00 ? 97  ALA A HB1  1  
ATOM 1434  H HB2  . ALA A 1 97  ? -2.759  -5.506  1.084   1.00 0.00 ? 97  ALA A HB2  1  
ATOM 1435  H HB3  . ALA A 1 97  ? -2.222  -5.118  2.719   1.00 0.00 ? 97  ALA A HB3  1  
ATOM 1436  N N    . PHE A 1 98  ? -3.335  -2.439  2.775   1.00 0.00 ? 98  PHE A N    1  
ATOM 1437  C CA   . PHE A 1 98  ? -4.540  -1.707  3.146   1.00 0.00 ? 98  PHE A CA   1  
ATOM 1438  C C    . PHE A 1 98  ? -4.603  -0.368  2.415   1.00 0.00 ? 98  PHE A C    1  
ATOM 1439  O O    . PHE A 1 98  ? -5.659  0.042   1.924   1.00 0.00 ? 98  PHE A O    1  
ATOM 1440  C CB   . PHE A 1 98  ? -4.571  -1.482  4.660   1.00 0.00 ? 98  PHE A CB   1  
ATOM 1441  C CG   . PHE A 1 98  ? -5.945  -1.202  5.211   1.00 0.00 ? 98  PHE A CG   1  
ATOM 1442  C CD1  . PHE A 1 98  ? -6.761  -2.242  5.631   1.00 0.00 ? 98  PHE A CD1  1  
ATOM 1443  C CD2  . PHE A 1 98  ? -6.418  0.098   5.316   1.00 0.00 ? 98  PHE A CD2  1  
ATOM 1444  C CE1  . PHE A 1 98  ? -8.021  -1.991  6.142   1.00 0.00 ? 98  PHE A CE1  1  
ATOM 1445  C CE2  . PHE A 1 98  ? -7.677  0.355   5.827   1.00 0.00 ? 98  PHE A CE2  1  
ATOM 1446  C CZ   . PHE A 1 98  ? -8.479  -0.693  6.240   1.00 0.00 ? 98  PHE A CZ   1  
ATOM 1447  H H    . PHE A 1 98  ? -2.668  -2.647  3.468   1.00 0.00 ? 98  PHE A H    1  
ATOM 1448  H HA   . PHE A 1 98  ? -5.394  -2.302  2.860   1.00 0.00 ? 98  PHE A HA   1  
ATOM 1449  H HB2  . PHE A 1 98  ? -4.190  -2.364  5.154   1.00 0.00 ? 98  PHE A HB2  1  
ATOM 1450  H HB3  . PHE A 1 98  ? -3.938  -0.640  4.904   1.00 0.00 ? 98  PHE A HB3  1  
ATOM 1451  H HD1  . PHE A 1 98  ? -6.405  -3.259  5.555   1.00 0.00 ? 98  PHE A HD1  1  
ATOM 1452  H HD2  . PHE A 1 98  ? -5.793  0.917   4.991   1.00 0.00 ? 98  PHE A HD2  1  
ATOM 1453  H HE1  . PHE A 1 98  ? -8.647  -2.810  6.463   1.00 0.00 ? 98  PHE A HE1  1  
ATOM 1454  H HE2  . PHE A 1 98  ? -8.034  1.372   5.902   1.00 0.00 ? 98  PHE A HE2  1  
ATOM 1455  H HZ   . PHE A 1 98  ? -9.462  -0.497  6.641   1.00 0.00 ? 98  PHE A HZ   1  
ATOM 1456  N N    . PHE A 1 99  ? -3.460  0.298   2.330   1.00 0.00 ? 99  PHE A N    1  
ATOM 1457  C CA   . PHE A 1 99  ? -3.375  1.592   1.670   1.00 0.00 ? 99  PHE A CA   1  
ATOM 1458  C C    . PHE A 1 99  ? -3.513  1.455   0.155   1.00 0.00 ? 99  PHE A C    1  
ATOM 1459  O O    . PHE A 1 99  ? -4.307  2.164   -0.465  1.00 0.00 ? 99  PHE A O    1  
ATOM 1460  C CB   . PHE A 1 99  ? -2.049  2.278   2.015   1.00 0.00 ? 99  PHE A CB   1  
ATOM 1461  C CG   . PHE A 1 99  ? -1.882  3.630   1.377   1.00 0.00 ? 99  PHE A CG   1  
ATOM 1462  C CD1  . PHE A 1 99  ? -2.595  4.723   1.843   1.00 0.00 ? 99  PHE A CD1  1  
ATOM 1463  C CD2  . PHE A 1 99  ? -1.012  3.808   0.312   1.00 0.00 ? 99  PHE A CD2  1  
ATOM 1464  C CE1  . PHE A 1 99  ? -2.443  5.968   1.260   1.00 0.00 ? 99  PHE A CE1  1  
ATOM 1465  C CE2  . PHE A 1 99  ? -0.856  5.050   -0.274  1.00 0.00 ? 99  PHE A CE2  1  
ATOM 1466  C CZ   . PHE A 1 99  ? -1.573  6.131   0.198   1.00 0.00 ? 99  PHE A CZ   1  
ATOM 1467  H H    . PHE A 1 99  ? -2.649  -0.093  2.721   1.00 0.00 ? 99  PHE A H    1  
ATOM 1468  H HA   . PHE A 1 99  ? -4.185  2.203   2.038   1.00 0.00 ? 99  PHE A HA   1  
ATOM 1469  H HB2  . PHE A 1 99  ? -1.986  2.406   3.084   1.00 0.00 ? 99  PHE A HB2  1  
ATOM 1470  H HB3  . PHE A 1 99  ? -1.232  1.651   1.685   1.00 0.00 ? 99  PHE A HB3  1  
ATOM 1471  H HD1  . PHE A 1 99  ? -3.277  4.598   2.671   1.00 0.00 ? 99  PHE A HD1  1  
ATOM 1472  H HD2  . PHE A 1 99  ? -0.452  2.963   -0.060  1.00 0.00 ? 99  PHE A HD2  1  
ATOM 1473  H HE1  . PHE A 1 99  ? -3.007  6.811   1.630   1.00 0.00 ? 99  PHE A HE1  1  
ATOM 1474  H HE2  . PHE A 1 99  ? -0.175  5.174   -1.102  1.00 0.00 ? 99  PHE A HE2  1  
ATOM 1475  H HZ   . PHE A 1 99  ? -1.450  7.101   -0.259  1.00 0.00 ? 99  PHE A HZ   1  
ATOM 1476  N N    . VAL A 1 100 ? -2.752  0.537   -0.437  1.00 0.00 ? 100 VAL A N    1  
ATOM 1477  C CA   . VAL A 1 100 ? -2.785  0.339   -1.883  1.00 0.00 ? 100 VAL A CA   1  
ATOM 1478  C C    . VAL A 1 100 ? -4.155  -0.152  -2.359  1.00 0.00 ? 100 VAL A C    1  
ATOM 1479  O O    . VAL A 1 100 ? -4.620  0.251   -3.425  1.00 0.00 ? 100 VAL A O    1  
ATOM 1480  C CB   . VAL A 1 100 ? -1.665  -0.622  -2.365  1.00 0.00 ? 100 VAL A CB   1  
ATOM 1481  C CG1  . VAL A 1 100 ? -1.941  -2.064  -1.967  1.00 0.00 ? 100 VAL A CG1  1  
ATOM 1482  C CG2  . VAL A 1 100 ? -1.479  -0.511  -3.870  1.00 0.00 ? 100 VAL A CG2  1  
ATOM 1483  H H    . VAL A 1 100 ? -2.154  -0.021  0.113   1.00 0.00 ? 100 VAL A H    1  
ATOM 1484  H HA   . VAL A 1 100 ? -2.601  1.303   -2.337  1.00 0.00 ? 100 VAL A HA   1  
ATOM 1485  H HB   . VAL A 1 100 ? -0.742  -0.319  -1.892  1.00 0.00 ? 100 VAL A HB   1  
ATOM 1486  H HG11 . VAL A 1 100 ? -1.154  -2.700  -2.347  1.00 0.00 ? 100 VAL A HG11 1  
ATOM 1487  H HG12 . VAL A 1 100 ? -2.889  -2.377  -2.380  1.00 0.00 ? 100 VAL A HG12 1  
ATOM 1488  H HG13 . VAL A 1 100 ? -1.975  -2.138  -0.889  1.00 0.00 ? 100 VAL A HG13 1  
ATOM 1489  H HG21 . VAL A 1 100 ? -1.211  0.504   -4.124  1.00 0.00 ? 100 VAL A HG21 1  
ATOM 1490  H HG22 . VAL A 1 100 ? -2.399  -0.776  -4.369  1.00 0.00 ? 100 VAL A HG22 1  
ATOM 1491  H HG23 . VAL A 1 100 ? -0.692  -1.180  -4.188  1.00 0.00 ? 100 VAL A HG23 1  
ATOM 1492  N N    . PHE A 1 101 ? -4.809  -0.997  -1.563  1.00 0.00 ? 101 PHE A N    1  
ATOM 1493  C CA   . PHE A 1 101 ? -6.127  -1.513  -1.921  1.00 0.00 ? 101 PHE A CA   1  
ATOM 1494  C C    . PHE A 1 101 ? -7.128  -0.372  -2.021  1.00 0.00 ? 101 PHE A C    1  
ATOM 1495  O O    . PHE A 1 101 ? -7.847  -0.245  -3.014  1.00 0.00 ? 101 PHE A O    1  
ATOM 1496  C CB   . PHE A 1 101 ? -6.609  -2.536  -0.891  1.00 0.00 ? 101 PHE A CB   1  
ATOM 1497  C CG   . PHE A 1 101 ? -6.741  -3.926  -1.445  1.00 0.00 ? 101 PHE A CG   1  
ATOM 1498  C CD1  . PHE A 1 101 ? -7.840  -4.277  -2.213  1.00 0.00 ? 101 PHE A CD1  1  
ATOM 1499  C CD2  . PHE A 1 101 ? -5.770  -4.881  -1.199  1.00 0.00 ? 101 PHE A CD2  1  
ATOM 1500  C CE1  . PHE A 1 101 ? -7.965  -5.552  -2.727  1.00 0.00 ? 101 PHE A CE1  1  
ATOM 1501  C CE2  . PHE A 1 101 ? -5.890  -6.159  -1.710  1.00 0.00 ? 101 PHE A CE2  1  
ATOM 1502  C CZ   . PHE A 1 101 ? -6.990  -6.496  -2.476  1.00 0.00 ? 101 PHE A CZ   1  
ATOM 1503  H H    . PHE A 1 101 ? -4.393  -1.287  -0.720  1.00 0.00 ? 101 PHE A H    1  
ATOM 1504  H HA   . PHE A 1 101 ? -6.046  -1.993  -2.884  1.00 0.00 ? 101 PHE A HA   1  
ATOM 1505  H HB2  . PHE A 1 101 ? -5.907  -2.571  -0.072  1.00 0.00 ? 101 PHE A HB2  1  
ATOM 1506  H HB3  . PHE A 1 101 ? -7.576  -2.232  -0.518  1.00 0.00 ? 101 PHE A HB3  1  
ATOM 1507  H HD1  . PHE A 1 101 ? -8.603  -3.539  -2.413  1.00 0.00 ? 101 PHE A HD1  1  
ATOM 1508  H HD2  . PHE A 1 101 ? -4.910  -4.620  -0.602  1.00 0.00 ? 101 PHE A HD2  1  
ATOM 1509  H HE1  . PHE A 1 101 ? -8.827  -5.813  -3.325  1.00 0.00 ? 101 PHE A HE1  1  
ATOM 1510  H HE2  . PHE A 1 101 ? -5.125  -6.894  -1.511  1.00 0.00 ? 101 PHE A HE2  1  
ATOM 1511  H HZ   . PHE A 1 101 ? -7.088  -7.495  -2.876  1.00 0.00 ? 101 PHE A HZ   1  
ATOM 1512  N N    . GLY A 1 102 ? -7.151  0.464   -0.991  1.00 0.00 ? 102 GLY A N    1  
ATOM 1513  C CA   . GLY A 1 102 ? -8.058  1.590   -0.973  1.00 0.00 ? 102 GLY A CA   1  
ATOM 1514  C C    . GLY A 1 102 ? -7.728  2.602   -2.050  1.00 0.00 ? 102 GLY A C    1  
ATOM 1515  O O    . GLY A 1 102 ? -8.608  3.037   -2.788  1.00 0.00 ? 102 GLY A O    1  
ATOM 1516  H H    . GLY A 1 102 ? -6.543  0.314   -0.235  1.00 0.00 ? 102 GLY A H    1  
ATOM 1517  H HA2  . GLY A 1 102 ? -9.066  1.231   -1.124  1.00 0.00 ? 102 GLY A HA2  1  
ATOM 1518  H HA3  . GLY A 1 102 ? -7.999  2.073   -0.008  1.00 0.00 ? 102 GLY A HA3  1  
ATOM 1519  N N    . ALA A 1 103 ? -6.450  2.950   -2.158  1.00 0.00 ? 103 ALA A N    1  
ATOM 1520  C CA   . ALA A 1 103 ? -5.994  3.923   -3.145  1.00 0.00 ? 103 ALA A CA   1  
ATOM 1521  C C    . ALA A 1 103 ? -6.334  3.486   -4.568  1.00 0.00 ? 103 ALA A C    1  
ATOM 1522  O O    . ALA A 1 103 ? -6.852  4.277   -5.356  1.00 0.00 ? 103 ALA A O    1  
ATOM 1523  C CB   . ALA A 1 103 ? -4.495  4.158   -3.007  1.00 0.00 ? 103 ALA A CB   1  
ATOM 1524  H H    . ALA A 1 103 ? -5.794  2.540   -1.554  1.00 0.00 ? 103 ALA A H    1  
ATOM 1525  H HA   . ALA A 1 103 ? -6.496  4.860   -2.941  1.00 0.00 ? 103 ALA A HA   1  
ATOM 1526  H HB1  . ALA A 1 103 ? -4.279  4.536   -2.018  1.00 0.00 ? 103 ALA A HB1  1  
ATOM 1527  H HB2  . ALA A 1 103 ? -4.173  4.877   -3.745  1.00 0.00 ? 103 ALA A HB2  1  
ATOM 1528  H HB3  . ALA A 1 103 ? -3.969  3.226   -3.159  1.00 0.00 ? 103 ALA A HB3  1  
ATOM 1529  N N    . ALA A 1 104 ? -6.061  2.224   -4.885  1.00 0.00 ? 104 ALA A N    1  
ATOM 1530  C CA   . ALA A 1 104 ? -6.332  1.692   -6.217  1.00 0.00 ? 104 ALA A CA   1  
ATOM 1531  C C    . ALA A 1 104 ? -7.822  1.727   -6.533  1.00 0.00 ? 104 ALA A C    1  
ATOM 1532  O O    . ALA A 1 104 ? -8.229  2.189   -7.600  1.00 0.00 ? 104 ALA A O    1  
ATOM 1533  C CB   . ALA A 1 104 ? -5.798  0.273   -6.344  1.00 0.00 ? 104 ALA A CB   1  
ATOM 1534  H H    . ALA A 1 104 ? -5.664  1.633   -4.205  1.00 0.00 ? 104 ALA A H    1  
ATOM 1535  H HA   . ALA A 1 104 ? -5.810  2.312   -6.934  1.00 0.00 ? 104 ALA A HA   1  
ATOM 1536  H HB1  . ALA A 1 104 ? -5.896  -0.058  -7.368  1.00 0.00 ? 104 ALA A HB1  1  
ATOM 1537  H HB2  . ALA A 1 104 ? -6.362  -0.382  -5.697  1.00 0.00 ? 104 ALA A HB2  1  
ATOM 1538  H HB3  . ALA A 1 104 ? -4.758  0.252   -6.057  1.00 0.00 ? 104 ALA A HB3  1  
ATOM 1539  N N    . LEU A 1 105 ? -8.635  1.251   -5.596  1.00 0.00 ? 105 LEU A N    1  
ATOM 1540  C CA   . LEU A 1 105 ? -10.081 1.227   -5.786  1.00 0.00 ? 105 LEU A CA   1  
ATOM 1541  C C    . LEU A 1 105 ? -10.646 2.640   -5.860  1.00 0.00 ? 105 LEU A C    1  
ATOM 1542  O O    . LEU A 1 105 ? -11.523 2.921   -6.677  1.00 0.00 ? 105 LEU A O    1  
ATOM 1543  C CB   . LEU A 1 105 ? -10.765 0.437   -4.669  1.00 0.00 ? 105 LEU A CB   1  
ATOM 1544  C CG   . LEU A 1 105 ? -11.133 -1.008  -5.022  1.00 0.00 ? 105 LEU A CG   1  
ATOM 1545  C CD1  . LEU A 1 105 ? -12.035 -1.049  -6.249  1.00 0.00 ? 105 LEU A CD1  1  
ATOM 1546  C CD2  . LEU A 1 105 ? -9.881  -1.843  -5.252  1.00 0.00 ? 105 LEU A CD2  1  
ATOM 1547  H H    . LEU A 1 105 ? -8.255  0.906   -4.758  1.00 0.00 ? 105 LEU A H    1  
ATOM 1548  H HA   . LEU A 1 105 ? -10.273 0.732   -6.727  1.00 0.00 ? 105 LEU A HA   1  
ATOM 1549  H HB2  . LEU A 1 105 ? -10.106 0.420   -3.813  1.00 0.00 ? 105 LEU A HB2  1  
ATOM 1550  H HB3  . LEU A 1 105 ? -11.672 0.955   -4.393  1.00 0.00 ? 105 LEU A HB3  1  
ATOM 1551  H HG   . LEU A 1 105 ? -11.676 -1.443  -4.195  1.00 0.00 ? 105 LEU A HG   1  
ATOM 1552  H HD11 . LEU A 1 105 ? -12.938 -0.491  -6.051  1.00 0.00 ? 105 LEU A HD11 1  
ATOM 1553  H HD12 . LEU A 1 105 ? -12.289 -2.074  -6.476  1.00 0.00 ? 105 LEU A HD12 1  
ATOM 1554  H HD13 . LEU A 1 105 ? -11.518 -0.611  -7.091  1.00 0.00 ? 105 LEU A HD13 1  
ATOM 1555  H HD21 . LEU A 1 105 ? -9.286  -1.854  -4.352  1.00 0.00 ? 105 LEU A HD21 1  
ATOM 1556  H HD22 . LEU A 1 105 ? -9.306  -1.412  -6.057  1.00 0.00 ? 105 LEU A HD22 1  
ATOM 1557  H HD23 . LEU A 1 105 ? -10.164 -2.854  -5.511  1.00 0.00 ? 105 LEU A HD23 1  
ATOM 1558  N N    . CYS A 1 106 ? -10.143 3.527   -5.012  1.00 0.00 ? 106 CYS A N    1  
ATOM 1559  C CA   . CYS A 1 106 ? -10.600 4.910   -5.003  1.00 0.00 ? 106 CYS A CA   1  
ATOM 1560  C C    . CYS A 1 106 ? -10.249 5.598   -6.317  1.00 0.00 ? 106 CYS A C    1  
ATOM 1561  O O    . CYS A 1 106 ? -11.096 6.250   -6.924  1.00 0.00 ? 106 CYS A O    1  
ATOM 1562  C CB   . CYS A 1 106 ? -9.998  5.673   -3.822  1.00 0.00 ? 106 CYS A CB   1  
ATOM 1563  S SG   . CYS A 1 106 ? -10.750 5.269   -2.227  1.00 0.00 ? 106 CYS A SG   1  
ATOM 1564  H H    . CYS A 1 106 ? -9.457  3.242   -4.363  1.00 0.00 ? 106 CYS A H    1  
ATOM 1565  H HA   . CYS A 1 106 ? -11.675 4.898   -4.899  1.00 0.00 ? 106 CYS A HA   1  
ATOM 1566  H HB2  . CYS A 1 106 ? -8.945  5.444   -3.755  1.00 0.00 ? 106 CYS A HB2  1  
ATOM 1567  H HB3  . CYS A 1 106 ? -10.121 6.733   -3.986  1.00 0.00 ? 106 CYS A HB3  1  
ATOM 1568  H HG   . CYS A 1 106 ? -10.922 6.407   -1.558  1.00 0.00 ? 106 CYS A HG   1  
ATOM 1569  N N    . ALA A 1 107 ? -9.005  5.430   -6.765  1.00 0.00 ? 107 ALA A N    1  
ATOM 1570  C CA   . ALA A 1 107 ? -8.552  6.031   -8.017  1.00 0.00 ? 107 ALA A CA   1  
ATOM 1571  C C    . ALA A 1 107 ? -9.407  5.548   -9.182  1.00 0.00 ? 107 ALA A C    1  
ATOM 1572  O O    . ALA A 1 107 ? -9.718  6.309   -10.102 1.00 0.00 ? 107 ALA A O    1  
ATOM 1573  C CB   . ALA A 1 107 ? -7.085  5.711   -8.263  1.00 0.00 ? 107 ALA A CB   1  
ATOM 1574  H H    . ALA A 1 107 ? -8.374  4.890   -6.237  1.00 0.00 ? 107 ALA A H    1  
ATOM 1575  H HA   . ALA A 1 107 ? -8.653  7.104   -7.929  1.00 0.00 ? 107 ALA A HA   1  
ATOM 1576  H HB1  . ALA A 1 107 ? -6.753  6.208   -9.160  1.00 0.00 ? 107 ALA A HB1  1  
ATOM 1577  H HB2  . ALA A 1 107 ? -6.964  4.644   -8.376  1.00 0.00 ? 107 ALA A HB2  1  
ATOM 1578  H HB3  . ALA A 1 107 ? -6.498  6.051   -7.424  1.00 0.00 ? 107 ALA A HB3  1  
ATOM 1579  N N    . GLU A 1 108 ? -9.780  4.278   -9.132  1.00 0.00 ? 108 GLU A N    1  
ATOM 1580  C CA   . GLU A 1 108 ? -10.613 3.682   -10.161 1.00 0.00 ? 108 GLU A CA   1  
ATOM 1581  C C    . GLU A 1 108 ? -12.028 4.250   -10.088 1.00 0.00 ? 108 GLU A C    1  
ATOM 1582  O O    . GLU A 1 108 ? -12.606 4.648   -11.100 1.00 0.00 ? 108 GLU A O    1  
ATOM 1583  C CB   . GLU A 1 108 ? -10.639 2.163   -9.988  1.00 0.00 ? 108 GLU A CB   1  
ATOM 1584  C CG   . GLU A 1 108 ? -11.527 1.451   -10.988 1.00 0.00 ? 108 GLU A CG   1  
ATOM 1585  C CD   . GLU A 1 108 ? -12.315 0.323   -10.362 1.00 0.00 ? 108 GLU A CD   1  
ATOM 1586  O OE1  . GLU A 1 108 ? -13.255 0.608   -9.589  1.00 0.00 ? 108 GLU A OE1  1  
ATOM 1587  O OE2  . GLU A 1 108 ? -12.015 -0.853  -10.654 1.00 0.00 ? 108 GLU A OE2  1  
ATOM 1588  H H    . GLU A 1 108 ? -9.475  3.719   -8.385  1.00 0.00 ? 108 GLU A H    1  
ATOM 1589  H HA   . GLU A 1 108 ? -10.185 3.921   -11.123 1.00 0.00 ? 108 GLU A HA   1  
ATOM 1590  H HB2  . GLU A 1 108 ? -9.634  1.784   -10.097 1.00 0.00 ? 108 GLU A HB2  1  
ATOM 1591  H HB3  . GLU A 1 108 ? -10.995 1.931   -8.993  1.00 0.00 ? 108 GLU A HB3  1  
ATOM 1592  H HG2  . GLU A 1 108 ? -12.220 2.165   -11.406 1.00 0.00 ? 108 GLU A HG2  1  
ATOM 1593  H HG3  . GLU A 1 108 ? -10.908 1.046   -11.775 1.00 0.00 ? 108 GLU A HG3  1  
ATOM 1594  N N    . SER A 1 109 ? -12.567 4.312   -8.876  1.00 0.00 ? 109 SER A N    1  
ATOM 1595  C CA   . SER A 1 109 ? -13.910 4.828   -8.654  1.00 0.00 ? 109 SER A CA   1  
ATOM 1596  C C    . SER A 1 109 ? -14.008 6.299   -9.055  1.00 0.00 ? 109 SER A C    1  
ATOM 1597  O O    . SER A 1 109 ? -15.040 6.742   -9.552  1.00 0.00 ? 109 SER A O    1  
ATOM 1598  C CB   . SER A 1 109 ? -14.309 4.641   -7.189  1.00 0.00 ? 109 SER A CB   1  
ATOM 1599  O OG   . SER A 1 109 ? -14.161 3.287   -6.795  1.00 0.00 ? 109 SER A OG   1  
ATOM 1600  H H    . SER A 1 109 ? -12.047 3.993   -8.106  1.00 0.00 ? 109 SER A H    1  
ATOM 1601  H HA   . SER A 1 109 ? -14.587 4.259   -9.274  1.00 0.00 ? 109 SER A HA   1  
ATOM 1602  H HB2  . SER A 1 109 ? -13.680 5.256   -6.563  1.00 0.00 ? 109 SER A HB2  1  
ATOM 1603  H HB3  . SER A 1 109 ? -15.340 4.931   -7.060  1.00 0.00 ? 109 SER A HB3  1  
ATOM 1604  H HG   . SER A 1 109 ? -13.222 3.092   -6.662  1.00 0.00 ? 109 SER A HG   1  
ATOM 1605  N N    . VAL A 1 110 ? -12.931 7.051   -8.845  1.00 0.00 ? 110 VAL A N    1  
ATOM 1606  C CA   . VAL A 1 110 ? -12.906 8.464   -9.205  1.00 0.00 ? 110 VAL A CA   1  
ATOM 1607  C C    . VAL A 1 110 ? -13.066 8.621   -10.715 1.00 0.00 ? 110 VAL A C    1  
ATOM 1608  O O    . VAL A 1 110 ? -13.783 9.502   -11.190 1.00 0.00 ? 110 VAL A O    1  
ATOM 1609  C CB   . VAL A 1 110 ? -11.599 9.151   -8.737  1.00 0.00 ? 110 VAL A CB   1  
ATOM 1610  C CG1  . VAL A 1 110 ? -11.423 10.514  -9.391  1.00 0.00 ? 110 VAL A CG1  1  
ATOM 1611  C CG2  . VAL A 1 110 ? -11.584 9.292   -7.221  1.00 0.00 ? 110 VAL A CG2  1  
ATOM 1612  H H    . VAL A 1 110 ? -12.134 6.647   -8.434  1.00 0.00 ? 110 VAL A H    1  
ATOM 1613  H HA   . VAL A 1 110 ? -13.740 8.947   -8.712  1.00 0.00 ? 110 VAL A HA   1  
ATOM 1614  H HB   . VAL A 1 110 ? -10.765 8.527   -9.025  1.00 0.00 ? 110 VAL A HB   1  
ATOM 1615  H HG11 . VAL A 1 110 ? -12.277 11.136  -9.164  1.00 0.00 ? 110 VAL A HG11 1  
ATOM 1616  H HG12 . VAL A 1 110 ? -11.340 10.392  -10.460 1.00 0.00 ? 110 VAL A HG12 1  
ATOM 1617  H HG13 . VAL A 1 110 ? -10.526 10.982  -9.011  1.00 0.00 ? 110 VAL A HG13 1  
ATOM 1618  H HG21 . VAL A 1 110 ? -10.687 9.808   -6.917  1.00 0.00 ? 110 VAL A HG21 1  
ATOM 1619  H HG22 . VAL A 1 110 ? -11.607 8.312   -6.770  1.00 0.00 ? 110 VAL A HG22 1  
ATOM 1620  H HG23 . VAL A 1 110 ? -12.449 9.855   -6.904  1.00 0.00 ? 110 VAL A HG23 1  
ATOM 1621  N N    . ASN A 1 111 ? -12.419 7.736   -11.466 1.00 0.00 ? 111 ASN A N    1  
ATOM 1622  C CA   . ASN A 1 111 ? -12.498 7.769   -12.923 1.00 0.00 ? 111 ASN A CA   1  
ATOM 1623  C C    . ASN A 1 111 ? -13.862 7.274   -13.388 1.00 0.00 ? 111 ASN A C    1  
ATOM 1624  O O    . ASN A 1 111 ? -14.363 7.683   -14.435 1.00 0.00 ? 111 ASN A O    1  
ATOM 1625  C CB   . ASN A 1 111 ? -11.393 6.911   -13.534 1.00 0.00 ? 111 ASN A CB   1  
ATOM 1626  C CG   . ASN A 1 111 ? -11.321 7.033   -15.046 1.00 0.00 ? 111 ASN A CG   1  
ATOM 1627  O OD1  . ASN A 1 111 ? -10.807 8.021   -15.574 1.00 0.00 ? 111 ASN A OD1  1  
ATOM 1628  N ND2  . ASN A 1 111 ? -11.813 6.022   -15.750 1.00 0.00 ? 111 ASN A ND2  1  
ATOM 1629  H H    . ASN A 1 111 ? -11.873 7.045   -11.030 1.00 0.00 ? 111 ASN A H    1  
ATOM 1630  H HA   . ASN A 1 111 ? -12.369 8.793   -13.240 1.00 0.00 ? 111 ASN A HA   1  
ATOM 1631  H HB2  . ASN A 1 111 ? -10.442 7.214   -13.125 1.00 0.00 ? 111 ASN A HB2  1  
ATOM 1632  H HB3  . ASN A 1 111 ? -11.573 5.874   -13.284 1.00 0.00 ? 111 ASN A HB3  1  
ATOM 1633  H HD21 . ASN A 1 111 ? -12.191 5.257   -15.266 1.00 0.00 ? 111 ASN A HD21 1  
ATOM 1634  H HD22 . ASN A 1 111 ? -11.775 6.079   -16.727 1.00 0.00 ? 111 ASN A HD22 1  
ATOM 1635  N N    . LYS A 1 112 ? -14.462 6.407   -12.582 1.00 0.00 ? 112 LYS A N    1  
ATOM 1636  C CA   . LYS A 1 112 ? -15.774 5.844   -12.876 1.00 0.00 ? 112 LYS A CA   1  
ATOM 1637  C C    . LYS A 1 112 ? -16.882 6.768   -12.381 1.00 0.00 ? 112 LYS A C    1  
ATOM 1638  O O    . LYS A 1 112 ? -18.053 6.393   -12.381 1.00 0.00 ? 112 LYS A O    1  
ATOM 1639  C CB   . LYS A 1 112 ? -15.917 4.466   -12.213 1.00 0.00 ? 112 LYS A CB   1  
ATOM 1640  C CG   . LYS A 1 112 ? -15.310 3.334   -13.024 1.00 0.00 ? 112 LYS A CG   1  
ATOM 1641  C CD   . LYS A 1 112 ? -14.887 2.163   -12.149 1.00 0.00 ? 112 LYS A CD   1  
ATOM 1642  C CE   . LYS A 1 112 ? -16.069 1.515   -11.443 1.00 0.00 ? 112 LYS A CE   1  
ATOM 1643  N NZ   . LYS A 1 112 ? -15.652 0.336   -10.639 1.00 0.00 ? 112 LYS A NZ   1  
ATOM 1644  H H    . LYS A 1 112 ? -14.006 6.136   -11.756 1.00 0.00 ? 112 LYS A H    1  
ATOM 1645  H HA   . LYS A 1 112 ? -15.861 5.731   -13.946 1.00 0.00 ? 112 LYS A HA   1  
ATOM 1646  H HB2  . LYS A 1 112 ? -15.428 4.488   -11.250 1.00 0.00 ? 112 LYS A HB2  1  
ATOM 1647  H HB3  . LYS A 1 112 ? -16.966 4.256   -12.070 1.00 0.00 ? 112 LYS A HB3  1  
ATOM 1648  H HG2  . LYS A 1 112 ? -16.040 2.985   -13.741 1.00 0.00 ? 112 LYS A HG2  1  
ATOM 1649  H HG3  . LYS A 1 112 ? -14.444 3.712   -13.549 1.00 0.00 ? 112 LYS A HG3  1  
ATOM 1650  H HD2  . LYS A 1 112 ? -14.404 1.423   -12.768 1.00 0.00 ? 112 LYS A HD2  1  
ATOM 1651  H HD3  . LYS A 1 112 ? -14.188 2.521   -11.407 1.00 0.00 ? 112 LYS A HD3  1  
ATOM 1652  H HE2  . LYS A 1 112 ? -16.524 2.243   -10.789 1.00 0.00 ? 112 LYS A HE2  1  
ATOM 1653  H HE3  . LYS A 1 112 ? -16.788 1.199   -12.185 1.00 0.00 ? 112 LYS A HE3  1  
ATOM 1654  H HZ1  . LYS A 1 112 ? -14.796 0.564   -10.081 1.00 0.00 ? 112 LYS A HZ1  1  
ATOM 1655  H HZ2  . LYS A 1 112 ? -15.432 -0.470  -11.261 1.00 0.00 ? 112 LYS A HZ2  1  
ATOM 1656  H HZ3  . LYS A 1 112 ? -16.410 0.054   -9.984  1.00 0.00 ? 112 LYS A HZ3  1  
ATOM 1657  N N    . GLU A 1 113 ? -16.496 7.976   -11.961 1.00 0.00 ? 113 GLU A N    1  
ATOM 1658  C CA   . GLU A 1 113 ? -17.435 8.971   -11.442 1.00 0.00 ? 113 GLU A CA   1  
ATOM 1659  C C    . GLU A 1 113 ? -18.256 8.380   -10.299 1.00 0.00 ? 113 GLU A C    1  
ATOM 1660  O O    . GLU A 1 113 ? -19.487 8.471   -10.273 1.00 0.00 ? 113 GLU A O    1  
ATOM 1661  C CB   . GLU A 1 113 ? -18.350 9.502   -12.551 1.00 0.00 ? 113 GLU A CB   1  
ATOM 1662  C CG   . GLU A 1 113 ? -18.728 10.967  -12.370 1.00 0.00 ? 113 GLU A CG   1  
ATOM 1663  C CD   . GLU A 1 113 ? -19.593 11.497  -13.494 1.00 0.00 ? 113 GLU A CD   1  
ATOM 1664  O OE1  . GLU A 1 113 ? -19.064 11.723  -14.605 1.00 0.00 ? 113 GLU A OE1  1  
ATOM 1665  O OE2  . GLU A 1 113 ? -20.809 11.688  -13.275 1.00 0.00 ? 113 GLU A OE2  1  
ATOM 1666  H H    . GLU A 1 113 ? -15.544 8.207   -12.004 1.00 0.00 ? 113 GLU A H    1  
ATOM 1667  H HA   . GLU A 1 113 ? -16.851 9.791   -11.051 1.00 0.00 ? 113 GLU A HA   1  
ATOM 1668  H HB2  . GLU A 1 113 ? -17.846 9.396   -13.500 1.00 0.00 ? 113 GLU A HB2  1  
ATOM 1669  H HB3  . GLU A 1 113 ? -19.258 8.916   -12.567 1.00 0.00 ? 113 GLU A HB3  1  
ATOM 1670  H HG2  . GLU A 1 113 ? -19.269 11.073  -11.443 1.00 0.00 ? 113 GLU A HG2  1  
ATOM 1671  H HG3  . GLU A 1 113 ? -17.822 11.555  -12.327 1.00 0.00 ? 113 GLU A HG3  1  
ATOM 1672  N N    . MET A 1 114 ? -17.559 7.755   -9.360  1.00 0.00 ? 114 MET A N    1  
ATOM 1673  C CA   . MET A 1 114 ? -18.197 7.145   -8.210  1.00 0.00 ? 114 MET A CA   1  
ATOM 1674  C C    . MET A 1 114 ? -17.624 7.720   -6.920  1.00 0.00 ? 114 MET A C    1  
ATOM 1675  O O    . MET A 1 114 ? -17.158 6.983   -6.048  1.00 0.00 ? 114 MET A O    1  
ATOM 1676  C CB   . MET A 1 114 ? -18.011 5.628   -8.242  1.00 0.00 ? 114 MET A CB   1  
ATOM 1677  C CG   . MET A 1 114 ? -19.294 4.848   -8.007  1.00 0.00 ? 114 MET A CG   1  
ATOM 1678  S SD   . MET A 1 114 ? -20.140 5.340   -6.494  1.00 0.00 ? 114 MET A SD   1  
ATOM 1679  C CE   . MET A 1 114 ? -21.534 4.215   -6.514  1.00 0.00 ? 114 MET A CE   1  
ATOM 1680  H H    . MET A 1 114 ? -16.582 7.698   -9.451  1.00 0.00 ? 114 MET A H    1  
ATOM 1681  H HA   . MET A 1 114 ? -19.252 7.370   -8.258  1.00 0.00 ? 114 MET A HA   1  
ATOM 1682  H HB2  . MET A 1 114 ? -17.618 5.347   -9.208  1.00 0.00 ? 114 MET A HB2  1  
ATOM 1683  H HB3  . MET A 1 114 ? -17.299 5.348   -7.480  1.00 0.00 ? 114 MET A HB3  1  
ATOM 1684  H HG2  . MET A 1 114 ? -19.958 5.012   -8.842  1.00 0.00 ? 114 MET A HG2  1  
ATOM 1685  H HG3  . MET A 1 114 ? -19.052 3.797   -7.943  1.00 0.00 ? 114 MET A HG3  1  
ATOM 1686  H HE1  . MET A 1 114 ? -21.176 3.199   -6.583  1.00 0.00 ? 114 MET A HE1  1  
ATOM 1687  H HE2  . MET A 1 114 ? -22.162 4.434   -7.365  1.00 0.00 ? 114 MET A HE2  1  
ATOM 1688  H HE3  . MET A 1 114 ? -22.105 4.334   -5.607  1.00 0.00 ? 114 MET A HE3  1  
ATOM 1689  N N    . GLU A 1 115 ? -17.653 9.045   -6.814  1.00 0.00 ? 115 GLU A N    1  
ATOM 1690  C CA   . GLU A 1 115 ? -17.158 9.743   -5.631  1.00 0.00 ? 115 GLU A CA   1  
ATOM 1691  C C    . GLU A 1 115 ? -17.949 9.303   -4.405  1.00 0.00 ? 115 GLU A C    1  
ATOM 1692  O O    . GLU A 1 115 ? -17.441 9.310   -3.282  1.00 0.00 ? 115 GLU A O    1  
ATOM 1693  C CB   . GLU A 1 115 ? -17.284 11.255  -5.823  1.00 0.00 ? 115 GLU A CB   1  
ATOM 1694  C CG   . GLU A 1 115 ? -16.736 12.078  -4.669  1.00 0.00 ? 115 GLU A CG   1  
ATOM 1695  C CD   . GLU A 1 115 ? -15.234 12.233  -4.730  1.00 0.00 ? 115 GLU A CD   1  
ATOM 1696  O OE1  . GLU A 1 115 ? -14.740 12.896  -5.666  1.00 0.00 ? 115 GLU A OE1  1  
ATOM 1697  O OE2  . GLU A 1 115 ? -14.542 11.705  -3.839  1.00 0.00 ? 115 GLU A OE2  1  
ATOM 1698  H H    . GLU A 1 115 ? -18.021 9.574   -7.558  1.00 0.00 ? 115 GLU A H    1  
ATOM 1699  H HA   . GLU A 1 115 ? -16.120 9.483   -5.495  1.00 0.00 ? 115 GLU A HA   1  
ATOM 1700  H HB2  . GLU A 1 115 ? -16.751 11.537  -6.719  1.00 0.00 ? 115 GLU A HB2  1  
ATOM 1701  H HB3  . GLU A 1 115 ? -18.328 11.502  -5.946  1.00 0.00 ? 115 GLU A HB3  1  
ATOM 1702  H HG2  . GLU A 1 115 ? -17.185 13.059  -4.697  1.00 0.00 ? 115 GLU A HG2  1  
ATOM 1703  H HG3  . GLU A 1 115 ? -16.996 11.588  -3.740  1.00 0.00 ? 115 GLU A HG3  1  
ATOM 1704  N N    . VAL A 1 116 ? -19.200 8.910   -4.638  1.00 0.00 ? 116 VAL A N    1  
ATOM 1705  C CA   . VAL A 1 116 ? -20.075 8.439   -3.572  1.00 0.00 ? 116 VAL A CA   1  
ATOM 1706  C C    . VAL A 1 116 ? -19.432 7.266   -2.835  1.00 0.00 ? 116 VAL A C    1  
ATOM 1707  O O    . VAL A 1 116 ? -19.412 7.227   -1.604  1.00 0.00 ? 116 VAL A O    1  
ATOM 1708  C CB   . VAL A 1 116 ? -21.448 8.004   -4.130  1.00 0.00 ? 116 VAL A CB   1  
ATOM 1709  C CG1  . VAL A 1 116 ? -22.391 7.613   -3.005  1.00 0.00 ? 116 VAL A CG1  1  
ATOM 1710  C CG2  . VAL A 1 116 ? -22.051 9.110   -4.980  1.00 0.00 ? 116 VAL A CG2  1  
ATOM 1711  H H    . VAL A 1 116 ? -19.543 8.945   -5.557  1.00 0.00 ? 116 VAL A H    1  
ATOM 1712  H HA   . VAL A 1 116 ? -20.229 9.254   -2.878  1.00 0.00 ? 116 VAL A HA   1  
ATOM 1713  H HB   . VAL A 1 116 ? -21.299 7.139   -4.759  1.00 0.00 ? 116 VAL A HB   1  
ATOM 1714  H HG11 . VAL A 1 116 ? -22.567 8.468   -2.370  1.00 0.00 ? 116 VAL A HG11 1  
ATOM 1715  H HG12 . VAL A 1 116 ? -21.947 6.819   -2.425  1.00 0.00 ? 116 VAL A HG12 1  
ATOM 1716  H HG13 . VAL A 1 116 ? -23.326 7.275   -3.422  1.00 0.00 ? 116 VAL A HG13 1  
ATOM 1717  H HG21 . VAL A 1 116 ? -22.981 8.768   -5.408  1.00 0.00 ? 116 VAL A HG21 1  
ATOM 1718  H HG22 . VAL A 1 116 ? -21.363 9.368   -5.772  1.00 0.00 ? 116 VAL A HG22 1  
ATOM 1719  H HG23 . VAL A 1 116 ? -22.233 9.977   -4.364  1.00 0.00 ? 116 VAL A HG23 1  
ATOM 1720  N N    . LEU A 1 117 ? -18.888 6.325   -3.598  1.00 0.00 ? 117 LEU A N    1  
ATOM 1721  C CA   . LEU A 1 117 ? -18.232 5.158   -3.024  1.00 0.00 ? 117 LEU A CA   1  
ATOM 1722  C C    . LEU A 1 117 ? -16.902 5.553   -2.394  1.00 0.00 ? 117 LEU A C    1  
ATOM 1723  O O    . LEU A 1 117 ? -16.565 5.096   -1.304  1.00 0.00 ? 117 LEU A O    1  
ATOM 1724  C CB   . LEU A 1 117 ? -18.001 4.088   -4.094  1.00 0.00 ? 117 LEU A CB   1  
ATOM 1725  C CG   . LEU A 1 117 ? -17.354 2.796   -3.592  1.00 0.00 ? 117 LEU A CG   1  
ATOM 1726  C CD1  . LEU A 1 117 ? -18.323 2.014   -2.722  1.00 0.00 ? 117 LEU A CD1  1  
ATOM 1727  C CD2  . LEU A 1 117 ? -16.877 1.950   -4.762  1.00 0.00 ? 117 LEU A CD2  1  
ATOM 1728  H H    . LEU A 1 117 ? -18.930 6.418   -4.574  1.00 0.00 ? 117 LEU A H    1  
ATOM 1729  H HA   . LEU A 1 117 ? -18.877 4.756   -2.255  1.00 0.00 ? 117 LEU A HA   1  
ATOM 1730  H HB2  . LEU A 1 117 ? -18.956 3.839   -4.536  1.00 0.00 ? 117 LEU A HB2  1  
ATOM 1731  H HB3  . LEU A 1 117 ? -17.365 4.504   -4.862  1.00 0.00 ? 117 LEU A HB3  1  
ATOM 1732  H HG   . LEU A 1 117 ? -16.493 3.045   -2.987  1.00 0.00 ? 117 LEU A HG   1  
ATOM 1733  H HD11 . LEU A 1 117 ? -18.598 2.612   -1.865  1.00 0.00 ? 117 LEU A HD11 1  
ATOM 1734  H HD12 . LEU A 1 117 ? -17.852 1.102   -2.388  1.00 0.00 ? 117 LEU A HD12 1  
ATOM 1735  H HD13 . LEU A 1 117 ? -19.209 1.775   -3.292  1.00 0.00 ? 117 LEU A HD13 1  
ATOM 1736  H HD21 . LEU A 1 117 ? -16.246 2.549   -5.401  1.00 0.00 ? 117 LEU A HD21 1  
ATOM 1737  H HD22 . LEU A 1 117 ? -17.728 1.597   -5.325  1.00 0.00 ? 117 LEU A HD22 1  
ATOM 1738  H HD23 . LEU A 1 117 ? -16.313 1.107   -4.391  1.00 0.00 ? 117 LEU A HD23 1  
ATOM 1739  N N    . VAL A 1 118 ? -16.161 6.417   -3.085  1.00 0.00 ? 118 VAL A N    1  
ATOM 1740  C CA   . VAL A 1 118 ? -14.864 6.887   -2.599  1.00 0.00 ? 118 VAL A CA   1  
ATOM 1741  C C    . VAL A 1 118 ? -15.001 7.491   -1.204  1.00 0.00 ? 118 VAL A C    1  
ATOM 1742  O O    . VAL A 1 118 ? -14.224 7.177   -0.299  1.00 0.00 ? 118 VAL A O    1  
ATOM 1743  C CB   . VAL A 1 118 ? -14.246 7.935   -3.552  1.00 0.00 ? 118 VAL A CB   1  
ATOM 1744  C CG1  . VAL A 1 118 ? -12.888 8.395   -3.044  1.00 0.00 ? 118 VAL A CG1  1  
ATOM 1745  C CG2  . VAL A 1 118 ? -14.124 7.375   -4.959  1.00 0.00 ? 118 VAL A CG2  1  
ATOM 1746  H H    . VAL A 1 118 ? -16.496 6.746   -3.948  1.00 0.00 ? 118 VAL A H    1  
ATOM 1747  H HA   . VAL A 1 118 ? -14.199 6.036   -2.548  1.00 0.00 ? 118 VAL A HA   1  
ATOM 1748  H HB   . VAL A 1 118 ? -14.902 8.793   -3.586  1.00 0.00 ? 118 VAL A HB   1  
ATOM 1749  H HG11 . VAL A 1 118 ? -12.491 9.144   -3.712  1.00 0.00 ? 118 VAL A HG11 1  
ATOM 1750  H HG12 . VAL A 1 118 ? -12.213 7.552   -3.005  1.00 0.00 ? 118 VAL A HG12 1  
ATOM 1751  H HG13 . VAL A 1 118 ? -12.997 8.816   -2.056  1.00 0.00 ? 118 VAL A HG13 1  
ATOM 1752  H HG21 . VAL A 1 118 ? -13.812 8.159   -5.633  1.00 0.00 ? 118 VAL A HG21 1  
ATOM 1753  H HG22 . VAL A 1 118 ? -15.080 6.986   -5.275  1.00 0.00 ? 118 VAL A HG22 1  
ATOM 1754  H HG23 . VAL A 1 118 ? -13.392 6.581   -4.968  1.00 0.00 ? 118 VAL A HG23 1  
ATOM 1755  N N    . GLY A 1 119 ? -16.008 8.340   -1.035  1.00 0.00 ? 119 GLY A N    1  
ATOM 1756  C CA   . GLY A 1 119 ? -16.249 8.968   0.249   1.00 0.00 ? 119 GLY A CA   1  
ATOM 1757  C C    . GLY A 1 119 ? -16.537 7.950   1.335   1.00 0.00 ? 119 GLY A C    1  
ATOM 1758  O O    . GLY A 1 119 ? -16.140 8.129   2.486   1.00 0.00 ? 119 GLY A O    1  
ATOM 1759  H H    . GLY A 1 119 ? -16.590 8.552   -1.798  1.00 0.00 ? 119 GLY A H    1  
ATOM 1760  H HA2  . GLY A 1 119 ? -15.376 9.541   0.528   1.00 0.00 ? 119 GLY A HA2  1  
ATOM 1761  H HA3  . GLY A 1 119 ? -17.094 9.634   0.160   1.00 0.00 ? 119 GLY A HA3  1  
ATOM 1762  N N    . GLN A 1 120 ? -17.228 6.877   0.963   1.00 0.00 ? 120 GLN A N    1  
ATOM 1763  C CA   . GLN A 1 120 ? -17.560 5.814   1.903   1.00 0.00 ? 120 GLN A CA   1  
ATOM 1764  C C    . GLN A 1 120 ? -16.302 5.046   2.297   1.00 0.00 ? 120 GLN A C    1  
ATOM 1765  O O    . GLN A 1 120 ? -16.079 4.763   3.475   1.00 0.00 ? 120 GLN A O    1  
ATOM 1766  C CB   . GLN A 1 120 ? -18.586 4.862   1.287   1.00 0.00 ? 120 GLN A CB   1  
ATOM 1767  C CG   . GLN A 1 120 ? -19.952 5.493   1.070   1.00 0.00 ? 120 GLN A CG   1  
ATOM 1768  C CD   . GLN A 1 120 ? -20.860 4.635   0.211   1.00 0.00 ? 120 GLN A CD   1  
ATOM 1769  O OE1  . GLN A 1 120 ? -20.741 3.409   0.188   1.00 0.00 ? 120 GLN A OE1  1  
ATOM 1770  N NE2  . GLN A 1 120 ? -21.778 5.272   -0.494  1.00 0.00 ? 120 GLN A NE2  1  
ATOM 1771  H H    . GLN A 1 120 ? -17.519 6.799   0.030   1.00 0.00 ? 120 GLN A H    1  
ATOM 1772  H HA   . GLN A 1 120 ? -17.983 6.269   2.784   1.00 0.00 ? 120 GLN A HA   1  
ATOM 1773  H HB2  . GLN A 1 120 ? -18.215 4.521   0.332   1.00 0.00 ? 120 GLN A HB2  1  
ATOM 1774  H HB3  . GLN A 1 120 ? -18.707 4.011   1.940   1.00 0.00 ? 120 GLN A HB3  1  
ATOM 1775  H HG2  . GLN A 1 120 ? -20.425 5.641   2.030   1.00 0.00 ? 120 GLN A HG2  1  
ATOM 1776  H HG3  . GLN A 1 120 ? -19.820 6.448   0.584   1.00 0.00 ? 120 GLN A HG3  1  
ATOM 1777  H HE21 . GLN A 1 120 ? -21.821 6.252   -0.422  1.00 0.00 ? 120 GLN A HE21 1  
ATOM 1778  H HE22 . GLN A 1 120 ? -22.379 4.742   -1.061  1.00 0.00 ? 120 GLN A HE22 1  
ATOM 1779  N N    . VAL A 1 121 ? -15.481 4.723   1.301   1.00 0.00 ? 121 VAL A N    1  
ATOM 1780  C CA   . VAL A 1 121 ? -14.238 3.997   1.532   1.00 0.00 ? 121 VAL A CA   1  
ATOM 1781  C C    . VAL A 1 121 ? -13.306 4.793   2.436   1.00 0.00 ? 121 VAL A C    1  
ATOM 1782  O O    . VAL A 1 121 ? -12.776 4.265   3.415   1.00 0.00 ? 121 VAL A O    1  
ATOM 1783  C CB   . VAL A 1 121 ? -13.514 3.677   0.205   1.00 0.00 ? 121 VAL A CB   1  
ATOM 1784  C CG1  . VAL A 1 121 ? -12.228 2.908   0.462   1.00 0.00 ? 121 VAL A CG1  1  
ATOM 1785  C CG2  . VAL A 1 121 ? -14.424 2.893   -0.728  1.00 0.00 ? 121 VAL A CG2  1  
ATOM 1786  H H    . VAL A 1 121 ? -15.724 4.978   0.383   1.00 0.00 ? 121 VAL A H    1  
ATOM 1787  H HA   . VAL A 1 121 ? -14.483 3.064   2.019   1.00 0.00 ? 121 VAL A HA   1  
ATOM 1788  H HB   . VAL A 1 121 ? -13.260 4.608   -0.276  1.00 0.00 ? 121 VAL A HB   1  
ATOM 1789  H HG11 . VAL A 1 121 ? -11.556 3.516   1.051   1.00 0.00 ? 121 VAL A HG11 1  
ATOM 1790  H HG12 . VAL A 1 121 ? -11.762 2.664   -0.479  1.00 0.00 ? 121 VAL A HG12 1  
ATOM 1791  H HG13 . VAL A 1 121 ? -12.454 1.999   0.998   1.00 0.00 ? 121 VAL A HG13 1  
ATOM 1792  H HG21 . VAL A 1 121 ? -13.903 2.696   -1.656  1.00 0.00 ? 121 VAL A HG21 1  
ATOM 1793  H HG22 . VAL A 1 121 ? -15.316 3.467   -0.929  1.00 0.00 ? 121 VAL A HG22 1  
ATOM 1794  H HG23 . VAL A 1 121 ? -14.695 1.957   -0.263  1.00 0.00 ? 121 VAL A HG23 1  
ATOM 1795  N N    . GLN A 1 122 ? -13.123 6.069   2.114   1.00 0.00 ? 122 GLN A N    1  
ATOM 1796  C CA   . GLN A 1 122 ? -12.259 6.938   2.902   1.00 0.00 ? 122 GLN A CA   1  
ATOM 1797  C C    . GLN A 1 122 ? -12.791 7.077   4.321   1.00 0.00 ? 122 GLN A C    1  
ATOM 1798  O O    . GLN A 1 122 ? -12.028 7.039   5.287   1.00 0.00 ? 122 GLN A O    1  
ATOM 1799  C CB   . GLN A 1 122 ? -12.137 8.312   2.240   1.00 0.00 ? 122 GLN A CB   1  
ATOM 1800  C CG   . GLN A 1 122 ? -10.775 8.564   1.610   1.00 0.00 ? 122 GLN A CG   1  
ATOM 1801  C CD   . GLN A 1 122 ? -10.451 7.581   0.501   1.00 0.00 ? 122 GLN A CD   1  
ATOM 1802  O OE1  . GLN A 1 122 ? -10.762 7.816   -0.663  1.00 0.00 ? 122 GLN A OE1  1  
ATOM 1803  N NE2  . GLN A 1 122 ? -9.824  6.468   0.852   1.00 0.00 ? 122 GLN A NE2  1  
ATOM 1804  H H    . GLN A 1 122 ? -13.580 6.435   1.320   1.00 0.00 ? 122 GLN A H    1  
ATOM 1805  H HA   . GLN A 1 122 ? -11.281 6.481   2.942   1.00 0.00 ? 122 GLN A HA   1  
ATOM 1806  H HB2  . GLN A 1 122 ? -12.888 8.392   1.466   1.00 0.00 ? 122 GLN A HB2  1  
ATOM 1807  H HB3  . GLN A 1 122 ? -12.313 9.076   2.984   1.00 0.00 ? 122 GLN A HB3  1  
ATOM 1808  H HG2  . GLN A 1 122 ? -10.763 9.562   1.198   1.00 0.00 ? 122 GLN A HG2  1  
ATOM 1809  H HG3  . GLN A 1 122 ? -10.018 8.484   2.375   1.00 0.00 ? 122 GLN A HG3  1  
ATOM 1810  H HE21 . GLN A 1 122 ? -9.602  6.336   1.797   1.00 0.00 ? 122 GLN A HE21 1  
ATOM 1811  H HE22 . GLN A 1 122 ? -9.605  5.821   0.149   1.00 0.00 ? 122 GLN A HE22 1  
ATOM 1812  N N    . GLU A 1 123 ? -14.107 7.215   4.439   1.00 0.00 ? 123 GLU A N    1  
ATOM 1813  C CA   . GLU A 1 123 ? -14.757 7.348   5.735   1.00 0.00 ? 123 GLU A CA   1  
ATOM 1814  C C    . GLU A 1 123 ? -14.472 6.122   6.597   1.00 0.00 ? 123 GLU A C    1  
ATOM 1815  O O    . GLU A 1 123 ? -14.124 6.242   7.775   1.00 0.00 ? 123 GLU A O    1  
ATOM 1816  C CB   . GLU A 1 123 ? -16.263 7.517   5.545   1.00 0.00 ? 123 GLU A CB   1  
ATOM 1817  C CG   . GLU A 1 123 ? -17.018 7.866   6.813   1.00 0.00 ? 123 GLU A CG   1  
ATOM 1818  C CD   . GLU A 1 123 ? -18.514 7.784   6.619   1.00 0.00 ? 123 GLU A CD   1  
ATOM 1819  O OE1  . GLU A 1 123 ? -19.110 8.770   6.135   1.00 0.00 ? 123 GLU A OE1  1  
ATOM 1820  O OE2  . GLU A 1 123 ? -19.101 6.729   6.933   1.00 0.00 ? 123 GLU A OE2  1  
ATOM 1821  H H    . GLU A 1 123 ? -14.661 7.227   3.625   1.00 0.00 ? 123 GLU A H    1  
ATOM 1822  H HA   . GLU A 1 123 ? -14.361 8.226   6.225   1.00 0.00 ? 123 GLU A HA   1  
ATOM 1823  H HB2  . GLU A 1 123 ? -16.436 8.302   4.824   1.00 0.00 ? 123 GLU A HB2  1  
ATOM 1824  H HB3  . GLU A 1 123 ? -16.667 6.594   5.157   1.00 0.00 ? 123 GLU A HB3  1  
ATOM 1825  H HG2  . GLU A 1 123 ? -16.730 7.176   7.593   1.00 0.00 ? 123 GLU A HG2  1  
ATOM 1826  H HG3  . GLU A 1 123 ? -16.760 8.872   7.107   1.00 0.00 ? 123 GLU A HG3  1  
ATOM 1827  N N    . TRP A 1 124 ? -14.603 4.947   5.990   1.00 0.00 ? 124 TRP A N    1  
ATOM 1828  C CA   . TRP A 1 124 ? -14.360 3.691   6.684   1.00 0.00 ? 124 TRP A CA   1  
ATOM 1829  C C    . TRP A 1 124 ? -12.888 3.554   7.058   1.00 0.00 ? 124 TRP A C    1  
ATOM 1830  O O    . TRP A 1 124 ? -12.563 3.101   8.157   1.00 0.00 ? 124 TRP A O    1  
ATOM 1831  C CB   . TRP A 1 124 ? -14.790 2.507   5.816   1.00 0.00 ? 124 TRP A CB   1  
ATOM 1832  C CG   . TRP A 1 124 ? -16.215 2.092   6.032   1.00 0.00 ? 124 TRP A CG   1  
ATOM 1833  C CD1  . TRP A 1 124 ? -17.059 2.529   7.012   1.00 0.00 ? 124 TRP A CD1  1  
ATOM 1834  C CD2  . TRP A 1 124 ? -16.958 1.148   5.254   1.00 0.00 ? 124 TRP A CD2  1  
ATOM 1835  N NE1  . TRP A 1 124 ? -18.281 1.913   6.892   1.00 0.00 ? 124 TRP A NE1  1  
ATOM 1836  C CE2  . TRP A 1 124 ? -18.243 1.059   5.820   1.00 0.00 ? 124 TRP A CE2  1  
ATOM 1837  C CE3  . TRP A 1 124 ? -16.658 0.363   4.136   1.00 0.00 ? 124 TRP A CE3  1  
ATOM 1838  C CZ2  . TRP A 1 124 ? -19.228 0.222   5.301   1.00 0.00 ? 124 TRP A CZ2  1  
ATOM 1839  C CZ3  . TRP A 1 124 ? -17.635 -0.464  3.621   1.00 0.00 ? 124 TRP A CZ3  1  
ATOM 1840  C CH2  . TRP A 1 124 ? -18.907 -0.533  4.205   1.00 0.00 ? 124 TRP A CH2  1  
ATOM 1841  H H    . TRP A 1 124 ? -14.871 4.925   5.044   1.00 0.00 ? 124 TRP A H    1  
ATOM 1842  H HA   . TRP A 1 124 ? -14.948 3.695   7.589   1.00 0.00 ? 124 TRP A HA   1  
ATOM 1843  H HB2  . TRP A 1 124 ? -14.675 2.773   4.776   1.00 0.00 ? 124 TRP A HB2  1  
ATOM 1844  H HB3  . TRP A 1 124 ? -14.157 1.660   6.038   1.00 0.00 ? 124 TRP A HB3  1  
ATOM 1845  H HD1  . TRP A 1 124 ? -16.791 3.253   7.766   1.00 0.00 ? 124 TRP A HD1  1  
ATOM 1846  H HE1  . TRP A 1 124 ? -19.053 2.061   7.479   1.00 0.00 ? 124 TRP A HE1  1  
ATOM 1847  H HE3  . TRP A 1 124 ? -15.684 0.403   3.671   1.00 0.00 ? 124 TRP A HE3  1  
ATOM 1848  H HZ2  . TRP A 1 124 ? -20.212 0.159   5.740   1.00 0.00 ? 124 TRP A HZ2  1  
ATOM 1849  H HZ3  . TRP A 1 124 ? -17.421 -1.075  2.758   1.00 0.00 ? 124 TRP A HZ3  1  
ATOM 1850  H HH2  . TRP A 1 124 ? -19.640 -1.197  3.770   1.00 0.00 ? 124 TRP A HH2  1  
ATOM 1851  N N    . MET A 1 125 ? -12.006 3.950   6.144   1.00 0.00 ? 125 MET A N    1  
ATOM 1852  C CA   . MET A 1 125 ? -10.567 3.872   6.382   1.00 0.00 ? 125 MET A CA   1  
ATOM 1853  C C    . MET A 1 125 ? -10.174 4.711   7.590   1.00 0.00 ? 125 MET A C    1  
ATOM 1854  O O    . MET A 1 125 ? -9.509  4.223   8.503   1.00 0.00 ? 125 MET A O    1  
ATOM 1855  C CB   . MET A 1 125 ? -9.778  4.342   5.154   1.00 0.00 ? 125 MET A CB   1  
ATOM 1856  C CG   . MET A 1 125 ? -9.766  3.345   4.005   1.00 0.00 ? 125 MET A CG   1  
ATOM 1857  S SD   . MET A 1 125 ? -8.673  3.851   2.661   1.00 0.00 ? 125 MET A SD   1  
ATOM 1858  C CE   . MET A 1 125 ? -7.067  3.531   3.389   1.00 0.00 ? 125 MET A CE   1  
ATOM 1859  H H    . MET A 1 125 ? -12.332 4.302   5.286   1.00 0.00 ? 125 MET A H    1  
ATOM 1860  H HA   . MET A 1 125 ? -10.321 2.840   6.582   1.00 0.00 ? 125 MET A HA   1  
ATOM 1861  H HB2  . MET A 1 125 ? -10.210 5.263   4.796   1.00 0.00 ? 125 MET A HB2  1  
ATOM 1862  H HB3  . MET A 1 125 ? -8.755  4.528   5.450   1.00 0.00 ? 125 MET A HB3  1  
ATOM 1863  H HG2  . MET A 1 125 ? -9.435  2.388   4.377   1.00 0.00 ? 125 MET A HG2  1  
ATOM 1864  H HG3  . MET A 1 125 ? -10.769 3.253   3.617   1.00 0.00 ? 125 MET A HG3  1  
ATOM 1865  H HE1  . MET A 1 125 ? -6.959  2.469   3.573   1.00 0.00 ? 125 MET A HE1  1  
ATOM 1866  H HE2  . MET A 1 125 ? -6.982  4.068   4.322   1.00 0.00 ? 125 MET A HE2  1  
ATOM 1867  H HE3  . MET A 1 125 ? -6.292  3.858   2.711   1.00 0.00 ? 125 MET A HE3  1  
ATOM 1868  N N    . VAL A 1 126 ? -10.603 5.970   7.593   1.00 0.00 ? 126 VAL A N    1  
ATOM 1869  C CA   . VAL A 1 126 ? -10.301 6.881   8.690   1.00 0.00 ? 126 VAL A CA   1  
ATOM 1870  C C    . VAL A 1 126 ? -10.850 6.333   10.003  1.00 0.00 ? 126 VAL A C    1  
ATOM 1871  O O    . VAL A 1 126 ? -10.156 6.317   11.022  1.00 0.00 ? 126 VAL A O    1  
ATOM 1872  C CB   . VAL A 1 126 ? -10.883 8.290   8.434   1.00 0.00 ? 126 VAL A CB   1  
ATOM 1873  C CG1  . VAL A 1 126 ? -10.702 9.195   9.648   1.00 0.00 ? 126 VAL A CG1  1  
ATOM 1874  C CG2  . VAL A 1 126 ? -10.244 8.917   7.206   1.00 0.00 ? 126 VAL A CG2  1  
ATOM 1875  H H    . VAL A 1 126 ? -11.138 6.294   6.834   1.00 0.00 ? 126 VAL A H    1  
ATOM 1876  H HA   . VAL A 1 126 ? -9.227  6.961   8.766   1.00 0.00 ? 126 VAL A HA   1  
ATOM 1877  H HB   . VAL A 1 126 ? -11.944 8.188   8.245   1.00 0.00 ? 126 VAL A HB   1  
ATOM 1878  H HG11 . VAL A 1 126 ? -11.200 8.756   10.501  1.00 0.00 ? 126 VAL A HG11 1  
ATOM 1879  H HG12 . VAL A 1 126 ? -11.130 10.163  9.439   1.00 0.00 ? 126 VAL A HG12 1  
ATOM 1880  H HG13 . VAL A 1 126 ? -9.648  9.304   9.862   1.00 0.00 ? 126 VAL A HG13 1  
ATOM 1881  H HG21 . VAL A 1 126 ? -10.485 8.325   6.333   1.00 0.00 ? 126 VAL A HG21 1  
ATOM 1882  H HG22 . VAL A 1 126 ? -9.172  8.947   7.334   1.00 0.00 ? 126 VAL A HG22 1  
ATOM 1883  H HG23 . VAL A 1 126 ? -10.620 9.920   7.075   1.00 0.00 ? 126 VAL A HG23 1  
ATOM 1884  N N    . ALA A 1 127 ? -12.089 5.858   9.962   1.00 0.00 ? 127 ALA A N    1  
ATOM 1885  C CA   . ALA A 1 127 ? -12.741 5.304   11.140  1.00 0.00 ? 127 ALA A CA   1  
ATOM 1886  C C    . ALA A 1 127 ? -11.963 4.113   11.684  1.00 0.00 ? 127 ALA A C    1  
ATOM 1887  O O    . ALA A 1 127 ? -11.674 4.045   12.874  1.00 0.00 ? 127 ALA A O    1  
ATOM 1888  C CB   . ALA A 1 127 ? -14.170 4.893   10.816  1.00 0.00 ? 127 ALA A CB   1  
ATOM 1889  H H    . ALA A 1 127 ? -12.580 5.884   9.113   1.00 0.00 ? 127 ALA A H    1  
ATOM 1890  H HA   . ALA A 1 127 ? -12.776 6.075   11.897  1.00 0.00 ? 127 ALA A HA   1  
ATOM 1891  H HB1  . ALA A 1 127 ? -14.657 4.548   11.716  1.00 0.00 ? 127 ALA A HB1  1  
ATOM 1892  H HB2  . ALA A 1 127 ? -14.162 4.097   10.085  1.00 0.00 ? 127 ALA A HB2  1  
ATOM 1893  H HB3  . ALA A 1 127 ? -14.709 5.740   10.419  1.00 0.00 ? 127 ALA A HB3  1  
ATOM 1894  N N    . TYR A 1 128 ? -11.605 3.190   10.801  1.00 0.00 ? 128 TYR A N    1  
ATOM 1895  C CA   . TYR A 1 128 ? -10.866 1.994   11.192  1.00 0.00 ? 128 TYR A CA   1  
ATOM 1896  C C    . TYR A 1 128 ? -9.504  2.356   11.785  1.00 0.00 ? 128 TYR A C    1  
ATOM 1897  O O    . TYR A 1 128 ? -9.094  1.802   12.811  1.00 0.00 ? 128 TYR A O    1  
ATOM 1898  C CB   . TYR A 1 128 ? -10.687 1.067   9.987   1.00 0.00 ? 128 TYR A CB   1  
ATOM 1899  C CG   . TYR A 1 128 ? -10.314 -0.352  10.354  1.00 0.00 ? 128 TYR A CG   1  
ATOM 1900  C CD1  . TYR A 1 128 ? -11.291 -1.274  10.712  1.00 0.00 ? 128 TYR A CD1  1  
ATOM 1901  C CD2  . TYR A 1 128 ? -8.990  -0.771  10.344  1.00 0.00 ? 128 TYR A CD2  1  
ATOM 1902  C CE1  . TYR A 1 128 ? -10.957 -2.571  11.049  1.00 0.00 ? 128 TYR A CE1  1  
ATOM 1903  C CE2  . TYR A 1 128 ? -8.650  -2.066  10.681  1.00 0.00 ? 128 TYR A CE2  1  
ATOM 1904  C CZ   . TYR A 1 128 ? -9.636  -2.960  11.033  1.00 0.00 ? 128 TYR A CZ   1  
ATOM 1905  O OH   . TYR A 1 128 ? -9.301  -4.249  11.368  1.00 0.00 ? 128 TYR A OH   1  
ATOM 1906  H H    . TYR A 1 128 ? -11.843 3.317   9.853   1.00 0.00 ? 128 TYR A H    1  
ATOM 1907  H HA   . TYR A 1 128 ? -11.447 1.481   11.945  1.00 0.00 ? 128 TYR A HA   1  
ATOM 1908  H HB2  . TYR A 1 128 ? -11.610 1.031   9.428   1.00 0.00 ? 128 TYR A HB2  1  
ATOM 1909  H HB3  . TYR A 1 128 ? -9.905  1.461   9.354   1.00 0.00 ? 128 TYR A HB3  1  
ATOM 1910  H HD1  . TYR A 1 128 ? -12.326 -0.965  10.722  1.00 0.00 ? 128 TYR A HD1  1  
ATOM 1911  H HD2  . TYR A 1 128 ? -8.219  -0.067  10.070  1.00 0.00 ? 128 TYR A HD2  1  
ATOM 1912  H HE1  . TYR A 1 128 ? -11.729 -3.272  11.325  1.00 0.00 ? 128 TYR A HE1  1  
ATOM 1913  H HE2  . TYR A 1 128 ? -7.613  -2.373  10.668  1.00 0.00 ? 128 TYR A HE2  1  
ATOM 1914  H HH   . TYR A 1 128 ? -9.768  -4.866  10.777  1.00 0.00 ? 128 TYR A HH   1  
ATOM 1915  N N    . LEU A 1 129 ? -8.821  3.300   11.148  1.00 0.00 ? 129 LEU A N    1  
ATOM 1916  C CA   . LEU A 1 129 ? -7.501  3.738   11.595  1.00 0.00 ? 129 LEU A CA   1  
ATOM 1917  C C    . LEU A 1 129 ? -7.557  4.399   12.971  1.00 0.00 ? 129 LEU A C    1  
ATOM 1918  O O    . LEU A 1 129 ? -6.587  4.357   13.724  1.00 0.00 ? 129 LEU A O    1  
ATOM 1919  C CB   . LEU A 1 129 ? -6.891  4.712   10.583  1.00 0.00 ? 129 LEU A CB   1  
ATOM 1920  C CG   . LEU A 1 129 ? -6.371  4.074   9.293   1.00 0.00 ? 129 LEU A CG   1  
ATOM 1921  C CD1  . LEU A 1 129 ? -5.910  5.145   8.319   1.00 0.00 ? 129 LEU A CD1  1  
ATOM 1922  C CD2  . LEU A 1 129 ? -5.233  3.111   9.594   1.00 0.00 ? 129 LEU A CD2  1  
ATOM 1923  H H    . LEU A 1 129 ? -9.213  3.715   10.345  1.00 0.00 ? 129 LEU A H    1  
ATOM 1924  H HA   . LEU A 1 129 ? -6.869  2.865   11.659  1.00 0.00 ? 129 LEU A HA   1  
ATOM 1925  H HB2  . LEU A 1 129 ? -7.644  5.440   10.320  1.00 0.00 ? 129 LEU A HB2  1  
ATOM 1926  H HB3  . LEU A 1 129 ? -6.069  5.225   11.061  1.00 0.00 ? 129 LEU A HB3  1  
ATOM 1927  H HG   . LEU A 1 129 ? -7.169  3.516   8.828   1.00 0.00 ? 129 LEU A HG   1  
ATOM 1928  H HD11 . LEU A 1 129 ? -5.169  5.769   8.795   1.00 0.00 ? 129 LEU A HD11 1  
ATOM 1929  H HD12 . LEU A 1 129 ? -6.755  5.750   8.022   1.00 0.00 ? 129 LEU A HD12 1  
ATOM 1930  H HD13 . LEU A 1 129 ? -5.479  4.675   7.447   1.00 0.00 ? 129 LEU A HD13 1  
ATOM 1931  H HD21 . LEU A 1 129 ? -4.446  3.636   10.116  1.00 0.00 ? 129 LEU A HD21 1  
ATOM 1932  H HD22 . LEU A 1 129 ? -4.845  2.712   8.669   1.00 0.00 ? 129 LEU A HD22 1  
ATOM 1933  H HD23 . LEU A 1 129 ? -5.599  2.302   10.210  1.00 0.00 ? 129 LEU A HD23 1  
ATOM 1934  N N    . GLU A 1 130 ? -8.688  5.004   13.299  1.00 0.00 ? 130 GLU A N    1  
ATOM 1935  C CA   . GLU A 1 130 ? -8.841  5.677   14.583  1.00 0.00 ? 130 GLU A CA   1  
ATOM 1936  C C    . GLU A 1 130 ? -9.642  4.836   15.576  1.00 0.00 ? 130 GLU A C    1  
ATOM 1937  O O    . GLU A 1 130 ? -9.988  5.305   16.661  1.00 0.00 ? 130 GLU A O    1  
ATOM 1938  C CB   . GLU A 1 130 ? -9.511  7.035   14.387  1.00 0.00 ? 130 GLU A CB   1  
ATOM 1939  C CG   . GLU A 1 130 ? -8.703  7.992   13.523  1.00 0.00 ? 130 GLU A CG   1  
ATOM 1940  C CD   . GLU A 1 130 ? -8.708  9.409   14.059  1.00 0.00 ? 130 GLU A CD   1  
ATOM 1941  O OE1  . GLU A 1 130 ? -9.509  9.700   14.974  1.00 0.00 ? 130 GLU A OE1  1  
ATOM 1942  O OE2  . GLU A 1 130 ? -7.909  10.242  13.572  1.00 0.00 ? 130 GLU A OE2  1  
ATOM 1943  H H    . GLU A 1 130 ? -9.431  5.017   12.656  1.00 0.00 ? 130 GLU A H    1  
ATOM 1944  H HA   . GLU A 1 130 ? -7.852  5.834   14.988  1.00 0.00 ? 130 GLU A HA   1  
ATOM 1945  H HB2  . GLU A 1 130 ? -10.471 6.884   13.916  1.00 0.00 ? 130 GLU A HB2  1  
ATOM 1946  H HB3  . GLU A 1 130 ? -9.659  7.495   15.352  1.00 0.00 ? 130 GLU A HB3  1  
ATOM 1947  H HG2  . GLU A 1 130 ? -7.681  7.644   13.479  1.00 0.00 ? 130 GLU A HG2  1  
ATOM 1948  H HG3  . GLU A 1 130 ? -9.124  7.997   12.528  1.00 0.00 ? 130 GLU A HG3  1  
ATOM 1949  N N    . THR A 1 131 ? -9.931  3.594   15.214  1.00 0.00 ? 131 THR A N    1  
ATOM 1950  C CA   . THR A 1 131 ? -10.686 2.715   16.094  1.00 0.00 ? 131 THR A CA   1  
ATOM 1951  C C    . THR A 1 131 ? -9.899  1.448   16.426  1.00 0.00 ? 131 THR A C    1  
ATOM 1952  O O    . THR A 1 131 ? -9.423  1.280   17.550  1.00 0.00 ? 131 THR A O    1  
ATOM 1953  C CB   . THR A 1 131 ? -12.050 2.332   15.479  1.00 0.00 ? 131 THR A CB   1  
ATOM 1954  O OG1  . THR A 1 131 ? -12.789 3.517   15.159  1.00 0.00 ? 131 THR A OG1  1  
ATOM 1955  C CG2  . THR A 1 131 ? -12.860 1.464   16.435  1.00 0.00 ? 131 THR A CG2  1  
ATOM 1956  H H    . THR A 1 131 ? -9.635  3.265   14.339  1.00 0.00 ? 131 THR A H    1  
ATOM 1957  H HA   . THR A 1 131 ? -10.873 3.254   17.011  1.00 0.00 ? 131 THR A HA   1  
ATOM 1958  H HB   . THR A 1 131 ? -11.873 1.774   14.573  1.00 0.00 ? 131 THR A HB   1  
ATOM 1959  H HG1  . THR A 1 131 ? -12.406 3.922   14.366  1.00 0.00 ? 131 THR A HG1  1  
ATOM 1960  H HG21 . THR A 1 131 ? -13.806 1.209   15.979  1.00 0.00 ? 131 THR A HG21 1  
ATOM 1961  H HG22 . THR A 1 131 ? -13.039 2.007   17.351  1.00 0.00 ? 131 THR A HG22 1  
ATOM 1962  H HG23 . THR A 1 131 ? -12.312 0.561   16.655  1.00 0.00 ? 131 THR A HG23 1  
ATOM 1963  N N    . ARG A 1 132 ? -9.730  0.575   15.441  1.00 0.00 ? 132 ARG A N    1  
ATOM 1964  C CA   . ARG A 1 132 ? -9.025  -0.680  15.665  1.00 0.00 ? 132 ARG A CA   1  
ATOM 1965  C C    . ARG A 1 132 ? -7.517  -0.523  15.510  1.00 0.00 ? 132 ARG A C    1  
ATOM 1966  O O    . ARG A 1 132 ? -6.749  -1.110  16.268  1.00 0.00 ? 132 ARG A O    1  
ATOM 1967  C CB   . ARG A 1 132 ? -9.542  -1.759  14.712  1.00 0.00 ? 132 ARG A CB   1  
ATOM 1968  C CG   . ARG A 1 132 ? -9.214  -3.171  15.164  1.00 0.00 ? 132 ARG A CG   1  
ATOM 1969  C CD   . ARG A 1 132 ? -10.138 -4.192  14.526  1.00 0.00 ? 132 ARG A CD   1  
ATOM 1970  N NE   . ARG A 1 132 ? -10.033 -5.497  15.174  1.00 0.00 ? 132 ARG A NE   1  
ATOM 1971  C CZ   . ARG A 1 132 ? -10.940 -5.985  16.018  1.00 0.00 ? 132 ARG A CZ   1  
ATOM 1972  N NH1  . ARG A 1 132 ? -12.006 -5.267  16.343  1.00 0.00 ? 132 ARG A NH1  1  
ATOM 1973  N NH2  . ARG A 1 132 ? -10.767 -7.189  16.551  1.00 0.00 ? 132 ARG A NH2  1  
ATOM 1974  H H    . ARG A 1 132 ? -10.080 0.778   14.548  1.00 0.00 ? 132 ARG A H    1  
ATOM 1975  H HA   . ARG A 1 132 ? -9.231  -0.990  16.679  1.00 0.00 ? 132 ARG A HA   1  
ATOM 1976  H HB2  . ARG A 1 132 ? -10.616 -1.667  14.632  1.00 0.00 ? 132 ARG A HB2  1  
ATOM 1977  H HB3  . ARG A 1 132 ? -9.103  -1.604  13.737  1.00 0.00 ? 132 ARG A HB3  1  
ATOM 1978  H HG2  . ARG A 1 132 ? -8.197  -3.400  14.886  1.00 0.00 ? 132 ARG A HG2  1  
ATOM 1979  H HG3  . ARG A 1 132 ? -9.316  -3.226  16.239  1.00 0.00 ? 132 ARG A HG3  1  
ATOM 1980  H HD2  . ARG A 1 132 ? -11.154 -3.840  14.607  1.00 0.00 ? 132 ARG A HD2  1  
ATOM 1981  H HD3  . ARG A 1 132 ? -9.875  -4.295  13.482  1.00 0.00 ? 132 ARG A HD3  1  
ATOM 1982  H HE   . ARG A 1 132 ? -9.236  -6.041  14.964  1.00 0.00 ? 132 ARG A HE   1  
ATOM 1983  H HH11 . ARG A 1 132 ? -12.136 -4.347  15.954  1.00 0.00 ? 132 ARG A HH11 1  
ATOM 1984  H HH12 . ARG A 1 132 ? -12.694 -5.639  16.982  1.00 0.00 ? 132 ARG A HH12 1  
ATOM 1985  H HH21 . ARG A 1 132 ? -9.957  -7.731  16.315  1.00 0.00 ? 132 ARG A HH21 1  
ATOM 1986  H HH22 . ARG A 1 132 ? -11.441 -7.559  17.201  1.00 0.00 ? 132 ARG A HH22 1  
ATOM 1987  N N    . LEU A 1 133 ? -7.092  0.279   14.545  1.00 0.00 ? 133 LEU A N    1  
ATOM 1988  C CA   . LEU A 1 133 ? -5.667  0.476   14.307  1.00 0.00 ? 133 LEU A CA   1  
ATOM 1989  C C    . LEU A 1 133 ? -5.137  1.715   15.023  1.00 0.00 ? 133 LEU A C    1  
ATOM 1990  O O    . LEU A 1 133 ? -4.011  2.140   14.780  1.00 0.00 ? 133 LEU A O    1  
ATOM 1991  C CB   . LEU A 1 133 ? -5.386  0.589   12.808  1.00 0.00 ? 133 LEU A CB   1  
ATOM 1992  C CG   . LEU A 1 133 ? -5.718  -0.655  11.983  1.00 0.00 ? 133 LEU A CG   1  
ATOM 1993  C CD1  . LEU A 1 133 ? -5.332  -0.445  10.528  1.00 0.00 ? 133 LEU A CD1  1  
ATOM 1994  C CD2  . LEU A 1 133 ? -5.014  -1.881  12.546  1.00 0.00 ? 133 LEU A CD2  1  
ATOM 1995  H H    . LEU A 1 133 ? -7.746  0.742   13.975  1.00 0.00 ? 133 LEU A H    1  
ATOM 1996  H HA   . LEU A 1 133 ? -5.149  -0.388  14.692  1.00 0.00 ? 133 LEU A HA   1  
ATOM 1997  H HB2  . LEU A 1 133 ? -5.957  1.419   12.418  1.00 0.00 ? 133 LEU A HB2  1  
ATOM 1998  H HB3  . LEU A 1 133 ? -4.337  0.806   12.679  1.00 0.00 ? 133 LEU A HB3  1  
ATOM 1999  H HG   . LEU A 1 133 ? -6.783  -0.832  12.024  1.00 0.00 ? 133 LEU A HG   1  
ATOM 2000  H HD11 . LEU A 1 133 ? -5.875  0.399   10.130  1.00 0.00 ? 133 LEU A HD11 1  
ATOM 2001  H HD12 . LEU A 1 133 ? -5.574  -1.331  9.960   1.00 0.00 ? 133 LEU A HD12 1  
ATOM 2002  H HD13 . LEU A 1 133 ? -4.271  -0.252  10.463  1.00 0.00 ? 133 LEU A HD13 1  
ATOM 2003  H HD21 . LEU A 1 133 ? -5.237  -2.739  11.930  1.00 0.00 ? 133 LEU A HD21 1  
ATOM 2004  H HD22 . LEU A 1 133 ? -5.358  -2.062  13.554  1.00 0.00 ? 133 LEU A HD22 1  
ATOM 2005  H HD23 . LEU A 1 133 ? -3.948  -1.711  12.554  1.00 0.00 ? 133 LEU A HD23 1  
ATOM 2006  N N    . ALA A 1 134 ? -5.941  2.272   15.920  1.00 0.00 ? 134 ALA A N    1  
ATOM 2007  C CA   . ALA A 1 134 ? -5.551  3.470   16.659  1.00 0.00 ? 134 ALA A CA   1  
ATOM 2008  C C    . ALA A 1 134 ? -4.279  3.232   17.467  1.00 0.00 ? 134 ALA A C    1  
ATOM 2009  O O    . ALA A 1 134 ? -3.307  3.982   17.350  1.00 0.00 ? 134 ALA A O    1  
ATOM 2010  C CB   . ALA A 1 134 ? -6.680  3.927   17.569  1.00 0.00 ? 134 ALA A CB   1  
ATOM 2011  H H    . ALA A 1 134 ? -6.812  1.865   16.096  1.00 0.00 ? 134 ALA A H    1  
ATOM 2012  H HA   . ALA A 1 134 ? -5.362  4.255   15.940  1.00 0.00 ? 134 ALA A HA   1  
ATOM 2013  H HB1  . ALA A 1 134 ? -7.578  4.067   16.987  1.00 0.00 ? 134 ALA A HB1  1  
ATOM 2014  H HB2  . ALA A 1 134 ? -6.408  4.861   18.039  1.00 0.00 ? 134 ALA A HB2  1  
ATOM 2015  H HB3  . ALA A 1 134 ? -6.855  3.181   18.330  1.00 0.00 ? 134 ALA A HB3  1  
ATOM 2016  N N    . ASP A 1 135 ? -4.284  2.176   18.271  1.00 0.00 ? 135 ASP A N    1  
ATOM 2017  C CA   . ASP A 1 135 ? -3.132  1.833   19.102  1.00 0.00 ? 135 ASP A CA   1  
ATOM 2018  C C    . ASP A 1 135 ? -1.912  1.514   18.244  1.00 0.00 ? 135 ASP A C    1  
ATOM 2019  O O    . ASP A 1 135 ? -0.788  1.895   18.573  1.00 0.00 ? 135 ASP A O    1  
ATOM 2020  C CB   . ASP A 1 135 ? -3.457  0.636   19.995  1.00 0.00 ? 135 ASP A CB   1  
ATOM 2021  C CG   . ASP A 1 135 ? -2.248  0.137   20.756  1.00 0.00 ? 135 ASP A CG   1  
ATOM 2022  O OD1  . ASP A 1 135 ? -1.913  0.730   21.804  1.00 0.00 ? 135 ASP A OD1  1  
ATOM 2023  O OD2  . ASP A 1 135 ? -1.632  -0.855  20.317  1.00 0.00 ? 135 ASP A OD2  1  
ATOM 2024  H H    . ASP A 1 135 ? -5.093  1.615   18.319  1.00 0.00 ? 135 ASP A H    1  
ATOM 2025  H HA   . ASP A 1 135 ? -2.906  2.684   19.727  1.00 0.00 ? 135 ASP A HA   1  
ATOM 2026  H HB2  . ASP A 1 135 ? -4.216  0.922   20.708  1.00 0.00 ? 135 ASP A HB2  1  
ATOM 2027  H HB3  . ASP A 1 135 ? -3.831  -0.171  19.382  1.00 0.00 ? 135 ASP A HB3  1  
ATOM 2028  N N    . TRP A 1 136 ? -2.148  0.823   17.137  1.00 0.00 ? 136 TRP A N    1  
ATOM 2029  C CA   . TRP A 1 136 ? -1.077  0.446   16.224  1.00 0.00 ? 136 TRP A CA   1  
ATOM 2030  C C    . TRP A 1 136 ? -0.417  1.684   15.632  1.00 0.00 ? 136 TRP A C    1  
ATOM 2031  O O    . TRP A 1 136 ? 0.808   1.808   15.645  1.00 0.00 ? 136 TRP A O    1  
ATOM 2032  C CB   . TRP A 1 136 ? -1.612  -0.458  15.115  1.00 0.00 ? 136 TRP A CB   1  
ATOM 2033  C CG   . TRP A 1 136 ? -2.278  -1.693  15.637  1.00 0.00 ? 136 TRP A CG   1  
ATOM 2034  C CD1  . TRP A 1 136 ? -3.617  -1.939  15.695  1.00 0.00 ? 136 TRP A CD1  1  
ATOM 2035  C CD2  . TRP A 1 136 ? -1.633  -2.850  16.184  1.00 0.00 ? 136 TRP A CD2  1  
ATOM 2036  N NE1  . TRP A 1 136 ? -3.847  -3.177  16.240  1.00 0.00 ? 136 TRP A NE1  1  
ATOM 2037  C CE2  . TRP A 1 136 ? -2.644  -3.756  16.548  1.00 0.00 ? 136 TRP A CE2  1  
ATOM 2038  C CE3  . TRP A 1 136 ? -0.301  -3.208  16.396  1.00 0.00 ? 136 TRP A CE3  1  
ATOM 2039  C CZ2  . TRP A 1 136 ? -2.365  -4.999  17.112  1.00 0.00 ? 136 TRP A CZ2  1  
ATOM 2040  C CZ3  . TRP A 1 136 ? -0.024  -4.439  16.960  1.00 0.00 ? 136 TRP A CZ3  1  
ATOM 2041  C CH2  . TRP A 1 136 ? -1.052  -5.321  17.313  1.00 0.00 ? 136 TRP A CH2  1  
ATOM 2042  H H    . TRP A 1 136 ? -3.067  0.562   16.927  1.00 0.00 ? 136 TRP A H    1  
ATOM 2043  H HA   . TRP A 1 136 ? -0.337  -0.099  16.795  1.00 0.00 ? 136 TRP A HA   1  
ATOM 2044  H HB2  . TRP A 1 136 ? -2.332  0.089   14.527  1.00 0.00 ? 136 TRP A HB2  1  
ATOM 2045  H HB3  . TRP A 1 136 ? -0.792  -0.762  14.481  1.00 0.00 ? 136 TRP A HB3  1  
ATOM 2046  H HD1  . TRP A 1 136 ? -4.378  -1.250  15.359  1.00 0.00 ? 136 TRP A HD1  1  
ATOM 2047  H HE1  . TRP A 1 136 ? -4.739  -3.584  16.384  1.00 0.00 ? 136 TRP A HE1  1  
ATOM 2048  H HE3  . TRP A 1 136 ? 0.506   -2.538  16.133  1.00 0.00 ? 136 TRP A HE3  1  
ATOM 2049  H HZ2  . TRP A 1 136 ? -3.148  -5.690  17.392  1.00 0.00 ? 136 TRP A HZ2  1  
ATOM 2050  H HZ3  . TRP A 1 136 ? 1.000   -4.731  17.135  1.00 0.00 ? 136 TRP A HZ3  1  
ATOM 2051  H HH2  . TRP A 1 136 ? -0.790  -6.271  17.750  1.00 0.00 ? 136 TRP A HH2  1  
ATOM 2052  N N    . ILE A 1 137 ? -1.233  2.609   15.133  1.00 0.00 ? 137 ILE A N    1  
ATOM 2053  C CA   . ILE A 1 137 ? -0.720  3.846   14.555  1.00 0.00 ? 137 ILE A CA   1  
ATOM 2054  C C    . ILE A 1 137 ? 0.038   4.638   15.617  1.00 0.00 ? 137 ILE A C    1  
ATOM 2055  O O    . ILE A 1 137 ? 1.075   5.240   15.340  1.00 0.00 ? 137 ILE A O    1  
ATOM 2056  C CB   . ILE A 1 137 ? -1.856  4.717   13.961  1.00 0.00 ? 137 ILE A CB   1  
ATOM 2057  C CG1  . ILE A 1 137 ? -2.556  3.978   12.815  1.00 0.00 ? 137 ILE A CG1  1  
ATOM 2058  C CG2  . ILE A 1 137 ? -1.325  6.060   13.477  1.00 0.00 ? 137 ILE A CG2  1  
ATOM 2059  C CD1  . ILE A 1 137 ? -1.625  3.559   11.694  1.00 0.00 ? 137 ILE A CD1  1  
ATOM 2060  H H    . ILE A 1 137 ? -2.204  2.452   15.145  1.00 0.00 ? 137 ILE A H    1  
ATOM 2061  H HA   . ILE A 1 137 ? -0.036  3.583   13.759  1.00 0.00 ? 137 ILE A HA   1  
ATOM 2062  H HB   . ILE A 1 137 ? -2.575  4.907   14.744  1.00 0.00 ? 137 ILE A HB   1  
ATOM 2063  H HG12 . ILE A 1 137 ? -3.023  3.087   13.205  1.00 0.00 ? 137 ILE A HG12 1  
ATOM 2064  H HG13 . ILE A 1 137 ? -3.314  4.622   12.394  1.00 0.00 ? 137 ILE A HG13 1  
ATOM 2065  H HG21 . ILE A 1 137 ? -0.568  5.896   12.725  1.00 0.00 ? 137 ILE A HG21 1  
ATOM 2066  H HG22 . ILE A 1 137 ? -0.895  6.599   14.310  1.00 0.00 ? 137 ILE A HG22 1  
ATOM 2067  H HG23 . ILE A 1 137 ? -2.135  6.638   13.053  1.00 0.00 ? 137 ILE A HG23 1  
ATOM 2068  H HD11 . ILE A 1 137 ? -0.832  2.947   12.096  1.00 0.00 ? 137 ILE A HD11 1  
ATOM 2069  H HD12 . ILE A 1 137 ? -1.204  4.437   11.227  1.00 0.00 ? 137 ILE A HD12 1  
ATOM 2070  H HD13 . ILE A 1 137 ? -2.180  2.993   10.961  1.00 0.00 ? 137 ILE A HD13 1  
ATOM 2071  N N    . HIS A 1 138 ? -0.472  4.603   16.842  1.00 0.00 ? 138 HIS A N    1  
ATOM 2072  C CA   . HIS A 1 138 ? 0.150   5.302   17.958  1.00 0.00 ? 138 HIS A CA   1  
ATOM 2073  C C    . HIS A 1 138 ? 1.509   4.686   18.294  1.00 0.00 ? 138 HIS A C    1  
ATOM 2074  O O    . HIS A 1 138 ? 2.427   5.382   18.721  1.00 0.00 ? 138 HIS A O    1  
ATOM 2075  C CB   . HIS A 1 138 ? -0.772  5.262   19.179  1.00 0.00 ? 138 HIS A CB   1  
ATOM 2076  C CG   . HIS A 1 138 ? -0.229  5.980   20.380  1.00 0.00 ? 138 HIS A CG   1  
ATOM 2077  N ND1  . HIS A 1 138 ? 0.071   5.342   21.562  1.00 0.00 ? 138 HIS A ND1  1  
ATOM 2078  C CD2  . HIS A 1 138 ? 0.067   7.289   20.580  1.00 0.00 ? 138 HIS A CD2  1  
ATOM 2079  C CE1  . HIS A 1 138 ? 0.528   6.221   22.433  1.00 0.00 ? 138 HIS A CE1  1  
ATOM 2080  N NE2  . HIS A 1 138 ? 0.534   7.409   21.864  1.00 0.00 ? 138 HIS A NE2  1  
ATOM 2081  H H    . HIS A 1 138 ? -1.301  4.097   16.998  1.00 0.00 ? 138 HIS A H    1  
ATOM 2082  H HA   . HIS A 1 138 ? 0.299   6.330   17.666  1.00 0.00 ? 138 HIS A HA   1  
ATOM 2083  H HB2  . HIS A 1 138 ? -1.717  5.713   18.921  1.00 0.00 ? 138 HIS A HB2  1  
ATOM 2084  H HB3  . HIS A 1 138 ? -0.937  4.230   19.457  1.00 0.00 ? 138 HIS A HB3  1  
ATOM 2085  H HD1  . HIS A 1 138 ? -0.031  4.371   21.738  1.00 0.00 ? 138 HIS A HD1  1  
ATOM 2086  H HD2  . HIS A 1 138 ? -0.040  8.089   19.860  1.00 0.00 ? 138 HIS A HD2  1  
ATOM 2087  H HE1  . HIS A 1 138 ? 0.839   6.003   23.444  1.00 0.00 ? 138 HIS A HE1  1  
ATOM 2088  H HE2  . HIS A 1 138 ? 0.997   8.205   22.231  1.00 0.00 ? 138 HIS A HE2  1  
ATOM 2089  N N    . SER A 1 139 ? 1.638   3.382   18.089  1.00 0.00 ? 139 SER A N    1  
ATOM 2090  C CA   . SER A 1 139 ? 2.889   2.689   18.372  1.00 0.00 ? 139 SER A CA   1  
ATOM 2091  C C    . SER A 1 139 ? 3.907   2.936   17.260  1.00 0.00 ? 139 SER A C    1  
ATOM 2092  O O    . SER A 1 139 ? 5.100   3.089   17.515  1.00 0.00 ? 139 SER A O    1  
ATOM 2093  C CB   . SER A 1 139 ? 2.635   1.192   18.533  1.00 0.00 ? 139 SER A CB   1  
ATOM 2094  O OG   . SER A 1 139 ? 1.648   0.948   19.523  1.00 0.00 ? 139 SER A OG   1  
ATOM 2095  H H    . SER A 1 139 ? 0.876   2.872   17.739  1.00 0.00 ? 139 SER A H    1  
ATOM 2096  H HA   . SER A 1 139 ? 3.285   3.081   19.298  1.00 0.00 ? 139 SER A HA   1  
ATOM 2097  H HB2  . SER A 1 139 ? 2.292   0.784   17.593  1.00 0.00 ? 139 SER A HB2  1  
ATOM 2098  H HB3  . SER A 1 139 ? 3.554   0.702   18.827  1.00 0.00 ? 139 SER A HB3  1  
ATOM 2099  H HG   . SER A 1 139 ? 0.855   1.471   19.324  1.00 0.00 ? 139 SER A HG   1  
ATOM 2100  N N    . SER A 1 140 ? 3.421   2.981   16.026  1.00 0.00 ? 140 SER A N    1  
ATOM 2101  C CA   . SER A 1 140 ? 4.275   3.214   14.871  1.00 0.00 ? 140 SER A CA   1  
ATOM 2102  C C    . SER A 1 140 ? 4.563   4.700   14.691  1.00 0.00 ? 140 SER A C    1  
ATOM 2103  O O    . SER A 1 140 ? 5.379   5.083   13.848  1.00 0.00 ? 140 SER A O    1  
ATOM 2104  C CB   . SER A 1 140 ? 3.604   2.660   13.612  1.00 0.00 ? 140 SER A CB   1  
ATOM 2105  O OG   . SER A 1 140 ? 3.291   1.288   13.769  1.00 0.00 ? 140 SER A OG   1  
ATOM 2106  H H    . SER A 1 140 ? 2.460   2.833   15.883  1.00 0.00 ? 140 SER A H    1  
ATOM 2107  H HA   . SER A 1 140 ? 5.207   2.693   15.032  1.00 0.00 ? 140 SER A HA   1  
ATOM 2108  H HB2  . SER A 1 140 ? 2.691   3.205   13.422  1.00 0.00 ? 140 SER A HB2  1  
ATOM 2109  H HB3  . SER A 1 140 ? 4.271   2.770   12.771  1.00 0.00 ? 140 SER A HB3  1  
ATOM 2110  H HG   . SER A 1 140 ? 4.097   0.762   13.622  1.00 0.00 ? 140 SER A HG   1  
ATOM 2111  N N    . GLY A 1 141 ? 3.896   5.529   15.493  1.00 0.00 ? 141 GLY A N    1  
ATOM 2112  C CA   . GLY A 1 141 ? 4.070   6.965   15.400  1.00 0.00 ? 141 GLY A CA   1  
ATOM 2113  C C    . GLY A 1 141 ? 3.595   7.485   14.062  1.00 0.00 ? 141 GLY A C    1  
ATOM 2114  O O    . GLY A 1 141 ? 4.229   8.347   13.455  1.00 0.00 ? 141 GLY A O    1  
ATOM 2115  H H    . GLY A 1 141 ? 3.276   5.157   16.154  1.00 0.00 ? 141 GLY A H    1  
ATOM 2116  H HA2  . GLY A 1 141 ? 3.506   7.442   16.189  1.00 0.00 ? 141 GLY A HA2  1  
ATOM 2117  H HA3  . GLY A 1 141 ? 5.117   7.202   15.519  1.00 0.00 ? 141 GLY A HA3  1  
ATOM 2118  N N    . GLY A 1 142 ? 2.467   6.959   13.607  1.00 0.00 ? 142 GLY A N    1  
ATOM 2119  C CA   . GLY A 1 142 ? 1.933   7.349   12.323  1.00 0.00 ? 142 GLY A CA   1  
ATOM 2120  C C    . GLY A 1 142 ? 2.637   6.612   11.205  1.00 0.00 ? 142 GLY A C    1  
ATOM 2121  O O    . GLY A 1 142 ? 2.359   5.441   10.951  1.00 0.00 ? 142 GLY A O    1  
ATOM 2122  H H    . GLY A 1 142 ? 1.992   6.294   14.154  1.00 0.00 ? 142 GLY A H    1  
ATOM 2123  H HA2  . GLY A 1 142 ? 0.877   7.118   12.292  1.00 0.00 ? 142 GLY A HA2  1  
ATOM 2124  H HA3  . GLY A 1 142 ? 2.071   8.410   12.187  1.00 0.00 ? 142 GLY A HA3  1  
ATOM 2125  N N    . TRP A 1 143 ? 3.567   7.290   10.555  1.00 0.00 ? 143 TRP A N    1  
ATOM 2126  C CA   . TRP A 1 143 ? 4.336   6.692   9.475   1.00 0.00 ? 143 TRP A CA   1  
ATOM 2127  C C    . TRP A 1 143 ? 5.815   6.735   9.828   1.00 0.00 ? 143 TRP A C    1  
ATOM 2128  O O    . TRP A 1 143 ? 6.678   6.500   8.984   1.00 0.00 ? 143 TRP A O    1  
ATOM 2129  C CB   . TRP A 1 143 ? 4.080   7.430   8.157   1.00 0.00 ? 143 TRP A CB   1  
ATOM 2130  C CG   . TRP A 1 143 ? 2.629   7.516   7.795   1.00 0.00 ? 143 TRP A CG   1  
ATOM 2131  C CD1  . TRP A 1 143 ? 1.785   8.560   8.043   1.00 0.00 ? 143 TRP A CD1  1  
ATOM 2132  C CD2  . TRP A 1 143 ? 1.847   6.521   7.121   1.00 0.00 ? 143 TRP A CD2  1  
ATOM 2133  N NE1  . TRP A 1 143 ? 0.529   8.278   7.566   1.00 0.00 ? 143 TRP A NE1  1  
ATOM 2134  C CE2  . TRP A 1 143 ? 0.542   7.031   6.995   1.00 0.00 ? 143 TRP A CE2  1  
ATOM 2135  C CE3  . TRP A 1 143 ? 2.124   5.247   6.611   1.00 0.00 ? 143 TRP A CE3  1  
ATOM 2136  C CZ2  . TRP A 1 143 ? -0.483  6.314   6.383   1.00 0.00 ? 143 TRP A CZ2  1  
ATOM 2137  C CZ3  . TRP A 1 143 ? 1.106   4.539   6.002   1.00 0.00 ? 143 TRP A CZ3  1  
ATOM 2138  C CH2  . TRP A 1 143 ? -0.183  5.073   5.893   1.00 0.00 ? 143 TRP A CH2  1  
ATOM 2139  H H    . TRP A 1 143 ? 3.742   8.229   10.804  1.00 0.00 ? 143 TRP A H    1  
ATOM 2140  H HA   . TRP A 1 143 ? 4.029   5.663   9.375   1.00 0.00 ? 143 TRP A HA   1  
ATOM 2141  H HB2  . TRP A 1 143 ? 4.464   8.435   8.234   1.00 0.00 ? 143 TRP A HB2  1  
ATOM 2142  H HB3  . TRP A 1 143 ? 4.592   6.914   7.359   1.00 0.00 ? 143 TRP A HB3  1  
ATOM 2143  H HD1  . TRP A 1 143 ? 2.076   9.472   8.544   1.00 0.00 ? 143 TRP A HD1  1  
ATOM 2144  H HE1  . TRP A 1 143 ? -0.249  8.872   7.627   1.00 0.00 ? 143 TRP A HE1  1  
ATOM 2145  H HE3  . TRP A 1 143 ? 3.112   4.818   6.686   1.00 0.00 ? 143 TRP A HE3  1  
ATOM 2146  H HZ2  . TRP A 1 143 ? -1.482  6.713   6.286   1.00 0.00 ? 143 TRP A HZ2  1  
ATOM 2147  H HZ3  . TRP A 1 143 ? 1.301   3.553   5.604   1.00 0.00 ? 143 TRP A HZ3  1  
ATOM 2148  H HH2  . TRP A 1 143 ? -0.949  4.484   5.409   1.00 0.00 ? 143 TRP A HH2  1  
ATOM 2149  N N    . ALA A 1 144 ? 6.086   7.019   11.100  1.00 0.00 ? 144 ALA A N    1  
ATOM 2150  C CA   . ALA A 1 144 ? 7.449   7.121   11.613  1.00 0.00 ? 144 ALA A CA   1  
ATOM 2151  C C    . ALA A 1 144 ? 8.290   5.897   11.265  1.00 0.00 ? 144 ALA A C    1  
ATOM 2152  O O    . ALA A 1 144 ? 9.246   5.999   10.494  1.00 0.00 ? 144 ALA A O    1  
ATOM 2153  C CB   . ALA A 1 144 ? 7.431   7.333   13.117  1.00 0.00 ? 144 ALA A CB   1  
ATOM 2154  H H    . ALA A 1 144 ? 5.337   7.169   11.716  1.00 0.00 ? 144 ALA A H    1  
ATOM 2155  H HA   . ALA A 1 144 ? 7.904   7.992   11.163  1.00 0.00 ? 144 ALA A HA   1  
ATOM 2156  H HB1  . ALA A 1 144 ? 8.436   7.502   13.470  1.00 0.00 ? 144 ALA A HB1  1  
ATOM 2157  H HB2  . ALA A 1 144 ? 7.023   6.457   13.598  1.00 0.00 ? 144 ALA A HB2  1  
ATOM 2158  H HB3  . ALA A 1 144 ? 6.818   8.190   13.352  1.00 0.00 ? 144 ALA A HB3  1  
ATOM 2159  N N    . GLU A 1 145 ? 7.927   4.740   11.811  1.00 0.00 ? 145 GLU A N    1  
ATOM 2160  C CA   . GLU A 1 145 ? 8.683   3.514   11.555  1.00 0.00 ? 145 GLU A CA   1  
ATOM 2161  C C    . GLU A 1 145 ? 8.560   3.083   10.095  1.00 0.00 ? 145 GLU A C    1  
ATOM 2162  O O    . GLU A 1 145 ? 9.435   2.396   9.570   1.00 0.00 ? 145 GLU A O    1  
ATOM 2163  C CB   . GLU A 1 145 ? 8.236   2.384   12.492  1.00 0.00 ? 145 GLU A CB   1  
ATOM 2164  C CG   . GLU A 1 145 ? 6.911   1.737   12.117  1.00 0.00 ? 145 GLU A CG   1  
ATOM 2165  C CD   . GLU A 1 145 ? 6.703   0.403   12.810  1.00 0.00 ? 145 GLU A CD   1  
ATOM 2166  O OE1  . GLU A 1 145 ? 7.667   -0.386  12.892  1.00 0.00 ? 145 GLU A OE1  1  
ATOM 2167  O OE2  . GLU A 1 145 ? 5.574   0.132   13.275  1.00 0.00 ? 145 GLU A OE2  1  
ATOM 2168  H H    . GLU A 1 145 ? 7.138   4.707   12.399  1.00 0.00 ? 145 GLU A H    1  
ATOM 2169  H HA   . GLU A 1 145 ? 9.722   3.734   11.754  1.00 0.00 ? 145 GLU A HA   1  
ATOM 2170  H HB2  . GLU A 1 145 ? 8.995   1.614   12.490  1.00 0.00 ? 145 GLU A HB2  1  
ATOM 2171  H HB3  . GLU A 1 145 ? 8.147   2.780   13.493  1.00 0.00 ? 145 GLU A HB3  1  
ATOM 2172  H HG2  . GLU A 1 145 ? 6.108   2.402   12.398  1.00 0.00 ? 145 GLU A HG2  1  
ATOM 2173  H HG3  . GLU A 1 145 ? 6.890   1.579   11.049  1.00 0.00 ? 145 GLU A HG3  1  
ATOM 2174  N N    . PHE A 1 146 ? 7.488   3.520   9.438   1.00 0.00 ? 146 PHE A N    1  
ATOM 2175  C CA   . PHE A 1 146 ? 7.247   3.183   8.039   1.00 0.00 ? 146 PHE A CA   1  
ATOM 2176  C C    . PHE A 1 146 ? 8.366   3.729   7.156   1.00 0.00 ? 146 PHE A C    1  
ATOM 2177  O O    . PHE A 1 146 ? 8.768   3.087   6.182   1.00 0.00 ? 146 PHE A O    1  
ATOM 2178  C CB   . PHE A 1 146 ? 5.887   3.729   7.586   1.00 0.00 ? 146 PHE A CB   1  
ATOM 2179  C CG   . PHE A 1 146 ? 5.536   3.391   6.162   1.00 0.00 ? 146 PHE A CG   1  
ATOM 2180  C CD1  . PHE A 1 146 ? 5.361   2.072   5.770   1.00 0.00 ? 146 PHE A CD1  1  
ATOM 2181  C CD2  . PHE A 1 146 ? 5.379   4.391   5.216   1.00 0.00 ? 146 PHE A CD2  1  
ATOM 2182  C CE1  . PHE A 1 146 ? 5.039   1.759   4.464   1.00 0.00 ? 146 PHE A CE1  1  
ATOM 2183  C CE2  . PHE A 1 146 ? 5.058   4.083   3.907   1.00 0.00 ? 146 PHE A CE2  1  
ATOM 2184  C CZ   . PHE A 1 146 ? 4.887   2.767   3.530   1.00 0.00 ? 146 PHE A CZ   1  
ATOM 2185  H H    . PHE A 1 146 ? 6.846   4.091   9.907   1.00 0.00 ? 146 PHE A H    1  
ATOM 2186  H HA   . PHE A 1 146 ? 7.236   2.108   7.957   1.00 0.00 ? 146 PHE A HA   1  
ATOM 2187  H HB2  . PHE A 1 146 ? 5.116   3.321   8.223   1.00 0.00 ? 146 PHE A HB2  1  
ATOM 2188  H HB3  . PHE A 1 146 ? 5.891   4.807   7.681   1.00 0.00 ? 146 PHE A HB3  1  
ATOM 2189  H HD1  . PHE A 1 146 ? 5.479   1.284   6.498   1.00 0.00 ? 146 PHE A HD1  1  
ATOM 2190  H HD2  . PHE A 1 146 ? 5.514   5.423   5.510   1.00 0.00 ? 146 PHE A HD2  1  
ATOM 2191  H HE1  . PHE A 1 146 ? 4.906   0.728   4.172   1.00 0.00 ? 146 PHE A HE1  1  
ATOM 2192  H HE2  . PHE A 1 146 ? 4.938   4.872   3.179   1.00 0.00 ? 146 PHE A HE2  1  
ATOM 2193  H HZ   . PHE A 1 146 ? 4.635   2.524   2.509   1.00 0.00 ? 146 PHE A HZ   1  
ATOM 2194  N N    . THR A 1 147 ? 8.885   4.898   7.521   1.00 0.00 ? 147 THR A N    1  
ATOM 2195  C CA   . THR A 1 147 ? 9.967   5.532   6.775   1.00 0.00 ? 147 THR A CA   1  
ATOM 2196  C C    . THR A 1 147 ? 11.212  4.642   6.745   1.00 0.00 ? 147 THR A C    1  
ATOM 2197  O O    . THR A 1 147 ? 11.978  4.657   5.782   1.00 0.00 ? 147 THR A O    1  
ATOM 2198  C CB   . THR A 1 147 ? 10.337  6.899   7.386   1.00 0.00 ? 147 THR A CB   1  
ATOM 2199  O OG1  . THR A 1 147 ? 9.200   7.465   8.053   1.00 0.00 ? 147 THR A OG1  1  
ATOM 2200  C CG2  . THR A 1 147 ? 10.824  7.856   6.310   1.00 0.00 ? 147 THR A CG2  1  
ATOM 2201  H H    . THR A 1 147 ? 8.519   5.355   8.307   1.00 0.00 ? 147 THR A H    1  
ATOM 2202  H HA   . THR A 1 147 ? 9.625   5.693   5.764   1.00 0.00 ? 147 THR A HA   1  
ATOM 2203  H HB   . THR A 1 147 ? 11.132  6.752   8.103   1.00 0.00 ? 147 THR A HB   1  
ATOM 2204  H HG1  . THR A 1 147 ? 9.097   7.053   8.923   1.00 0.00 ? 147 THR A HG1  1  
ATOM 2205  H HG21 . THR A 1 147 ? 11.709  7.452   5.843   1.00 0.00 ? 147 THR A HG21 1  
ATOM 2206  H HG22 . THR A 1 147 ? 11.056  8.812   6.756   1.00 0.00 ? 147 THR A HG22 1  
ATOM 2207  H HG23 . THR A 1 147 ? 10.050  7.984   5.567   1.00 0.00 ? 147 THR A HG23 1  
ATOM 2208  N N    . ALA A 1 148 ? 11.396  3.855   7.796   1.00 0.00 ? 148 ALA A N    1  
ATOM 2209  C CA   . ALA A 1 148 ? 12.544  2.963   7.886   1.00 0.00 ? 148 ALA A CA   1  
ATOM 2210  C C    . ALA A 1 148 ? 12.216  1.590   7.313   1.00 0.00 ? 148 ALA A C    1  
ATOM 2211  O O    . ALA A 1 148 ? 13.107  0.772   7.080   1.00 0.00 ? 148 ALA A O    1  
ATOM 2212  C CB   . ALA A 1 148 ? 13.002  2.843   9.331   1.00 0.00 ? 148 ALA A CB   1  
ATOM 2213  H H    . ALA A 1 148 ? 10.743  3.869   8.529   1.00 0.00 ? 148 ALA A H    1  
ATOM 2214  H HA   . ALA A 1 148 ? 13.348  3.398   7.312   1.00 0.00 ? 148 ALA A HA   1  
ATOM 2215  H HB1  . ALA A 1 148 ? 13.269  3.819   9.705   1.00 0.00 ? 148 ALA A HB1  1  
ATOM 2216  H HB2  . ALA A 1 148 ? 13.861  2.190   9.384   1.00 0.00 ? 148 ALA A HB2  1  
ATOM 2217  H HB3  . ALA A 1 148 ? 12.203  2.434   9.931   1.00 0.00 ? 148 ALA A HB3  1  
ATOM 2218  N N    . LEU A 1 149 ? 10.934  1.348   7.072   1.00 0.00 ? 149 LEU A N    1  
ATOM 2219  C CA   . LEU A 1 149 ? 10.483  0.070   6.534   1.00 0.00 ? 149 LEU A CA   1  
ATOM 2220  C C    . LEU A 1 149 ? 10.684  0.003   5.023   1.00 0.00 ? 149 LEU A C    1  
ATOM 2221  O O    . LEU A 1 149 ? 11.021  -1.052  4.484   1.00 0.00 ? 149 LEU A O    1  
ATOM 2222  C CB   . LEU A 1 149 ? 9.008   -0.166  6.881   1.00 0.00 ? 149 LEU A CB   1  
ATOM 2223  C CG   . LEU A 1 149 ? 8.722   -0.397  8.368   1.00 0.00 ? 149 LEU A CG   1  
ATOM 2224  C CD1  . LEU A 1 149 ? 7.228   -0.552  8.614   1.00 0.00 ? 149 LEU A CD1  1  
ATOM 2225  C CD2  . LEU A 1 149 ? 9.478   -1.617  8.871   1.00 0.00 ? 149 LEU A CD2  1  
ATOM 2226  H H    . LEU A 1 149 ? 10.273  2.047   7.258   1.00 0.00 ? 149 LEU A H    1  
ATOM 2227  H HA   . LEU A 1 149 ? 11.077  -0.707  6.995   1.00 0.00 ? 149 LEU A HA   1  
ATOM 2228  H HB2  . LEU A 1 149 ? 8.442   0.694   6.554   1.00 0.00 ? 149 LEU A HB2  1  
ATOM 2229  H HB3  . LEU A 1 149 ? 8.664   -1.030  6.335   1.00 0.00 ? 149 LEU A HB3  1  
ATOM 2230  H HG   . LEU A 1 149 ? 9.063   0.460   8.930   1.00 0.00 ? 149 LEU A HG   1  
ATOM 2231  H HD11 . LEU A 1 149 ? 6.856   -1.399  8.057   1.00 0.00 ? 149 LEU A HD11 1  
ATOM 2232  H HD12 . LEU A 1 149 ? 6.716   0.344   8.293   1.00 0.00 ? 149 LEU A HD12 1  
ATOM 2233  H HD13 . LEU A 1 149 ? 7.051   -0.708  9.669   1.00 0.00 ? 149 LEU A HD13 1  
ATOM 2234  H HD21 . LEU A 1 149 ? 9.275   -1.757  9.923   1.00 0.00 ? 149 LEU A HD21 1  
ATOM 2235  H HD22 . LEU A 1 149 ? 10.537  -1.470  8.726   1.00 0.00 ? 149 LEU A HD22 1  
ATOM 2236  H HD23 . LEU A 1 149 ? 9.158   -2.491  8.322   1.00 0.00 ? 149 LEU A HD23 1  
ATOM 2237  N N    . TYR A 1 150 ? 10.495  1.127   4.342   1.00 0.00 ? 150 TYR A N    1  
ATOM 2238  C CA   . TYR A 1 150 ? 10.656  1.161   2.889   1.00 0.00 ? 150 TYR A CA   1  
ATOM 2239  C C    . TYR A 1 150 ? 12.030  1.710   2.501   1.00 0.00 ? 150 TYR A C    1  
ATOM 2240  O O    . TYR A 1 150 ? 12.261  2.089   1.351   1.00 0.00 ? 150 TYR A O    1  
ATOM 2241  C CB   . TYR A 1 150 ? 9.525   1.976   2.232   1.00 0.00 ? 150 TYR A CB   1  
ATOM 2242  C CG   . TYR A 1 150 ? 9.716   3.484   2.254   1.00 0.00 ? 150 TYR A CG   1  
ATOM 2243  C CD1  . TYR A 1 150 ? 9.537   4.215   3.420   1.00 0.00 ? 150 TYR A CD1  1  
ATOM 2244  C CD2  . TYR A 1 150 ? 10.068  4.174   1.099   1.00 0.00 ? 150 TYR A CD2  1  
ATOM 2245  C CE1  . TYR A 1 150 ? 9.702   5.588   3.436   1.00 0.00 ? 150 TYR A CE1  1  
ATOM 2246  C CE2  . TYR A 1 150 ? 10.237  5.545   1.109   1.00 0.00 ? 150 TYR A CE2  1  
ATOM 2247  C CZ   . TYR A 1 150 ? 10.053  6.247   2.279   1.00 0.00 ? 150 TYR A CZ   1  
ATOM 2248  O OH   . TYR A 1 150 ? 10.215  7.615   2.291   1.00 0.00 ? 150 TYR A OH   1  
ATOM 2249  H H    . TYR A 1 150 ? 10.239  1.944   4.820   1.00 0.00 ? 150 TYR A H    1  
ATOM 2250  H HA   . TYR A 1 150 ? 10.591  0.141   2.539   1.00 0.00 ? 150 TYR A HA   1  
ATOM 2251  H HB2  . TYR A 1 150 ? 9.435   1.674   1.200   1.00 0.00 ? 150 TYR A HB2  1  
ATOM 2252  H HB3  . TYR A 1 150 ? 8.598   1.752   2.743   1.00 0.00 ? 150 TYR A HB3  1  
ATOM 2253  H HD1  . TYR A 1 150 ? 9.265   3.696   4.326   1.00 0.00 ? 150 TYR A HD1  1  
ATOM 2254  H HD2  . TYR A 1 150 ? 10.211  3.623   0.180   1.00 0.00 ? 150 TYR A HD2  1  
ATOM 2255  H HE1  . TYR A 1 150 ? 9.558   6.137   4.354   1.00 0.00 ? 150 TYR A HE1  1  
ATOM 2256  H HE2  . TYR A 1 150 ? 10.515  6.060   0.201   1.00 0.00 ? 150 TYR A HE2  1  
ATOM 2257  H HH   . TYR A 1 150 ? 9.437   8.028   1.903   1.00 0.00 ? 150 TYR A HH   1  
ATOM 2258  N N    . GLY A 1 151 ? 12.943  1.732   3.467   1.00 0.00 ? 151 GLY A N    1  
ATOM 2259  C CA   . GLY A 1 151 ? 14.285  2.225   3.216   1.00 0.00 ? 151 GLY A CA   1  
ATOM 2260  C C    . GLY A 1 151 ? 15.014  1.375   2.197   1.00 0.00 ? 151 GLY A C    1  
ATOM 2261  O O    . GLY A 1 151 ? 15.618  1.894   1.258   1.00 0.00 ? 151 GLY A O    1  
ATOM 2262  H H    . GLY A 1 151 ? 12.706  1.399   4.358   1.00 0.00 ? 151 GLY A H    1  
ATOM 2263  H HA2  . GLY A 1 151 ? 14.226  3.239   2.851   1.00 0.00 ? 151 GLY A HA2  1  
ATOM 2264  H HA3  . GLY A 1 151 ? 14.842  2.215   4.141   1.00 0.00 ? 151 GLY A HA3  1  
ATOM 2265  N N    . ASP A 1 152 ? 14.949  0.067   2.381   1.00 0.00 ? 152 ASP A N    1  
ATOM 2266  C CA   . ASP A 1 152 ? 15.589  -0.866  1.469   1.00 0.00 ? 152 ASP A CA   1  
ATOM 2267  C C    . ASP A 1 152 ? 14.531  -1.772  0.845   1.00 0.00 ? 152 ASP A C    1  
ATOM 2268  O O    . ASP A 1 152 ? 13.335  -1.563  1.050   1.00 0.00 ? 152 ASP A O    1  
ATOM 2269  C CB   . ASP A 1 152 ? 16.647  -1.698  2.204   1.00 0.00 ? 152 ASP A CB   1  
ATOM 2270  C CG   . ASP A 1 152 ? 17.784  -2.120  1.295   1.00 0.00 ? 152 ASP A CG   1  
ATOM 2271  O OD1  . ASP A 1 152 ? 17.589  -3.046  0.475   1.00 0.00 ? 152 ASP A OD1  1  
ATOM 2272  O OD2  . ASP A 1 152 ? 18.878  -1.528  1.391   1.00 0.00 ? 152 ASP A OD2  1  
ATOM 2273  H H    . ASP A 1 152 ? 14.449  -0.286  3.155   1.00 0.00 ? 152 ASP A H    1  
ATOM 2274  H HA   . ASP A 1 152 ? 16.067  -0.294  0.688   1.00 0.00 ? 152 ASP A HA   1  
ATOM 2275  H HB2  . ASP A 1 152 ? 17.057  -1.114  3.013   1.00 0.00 ? 152 ASP A HB2  1  
ATOM 2276  H HB3  . ASP A 1 152 ? 16.182  -2.587  2.606   1.00 0.00 ? 152 ASP A HB3  1  
ATOM 2277  N N    . GLY A 1 153 ? 14.969  -2.777  0.105   1.00 0.00 ? 153 GLY A N    1  
ATOM 2278  C CA   . GLY A 1 153 ? 14.041  -3.689  -0.535  1.00 0.00 ? 153 GLY A CA   1  
ATOM 2279  C C    . GLY A 1 153 ? 14.612  -5.083  -0.665  1.00 0.00 ? 153 GLY A C    1  
ATOM 2280  O O    . GLY A 1 153 ? 13.887  -6.071  -0.566  1.00 0.00 ? 153 GLY A O    1  
ATOM 2281  H H    . GLY A 1 153 ? 15.940  -2.911  0.002   1.00 0.00 ? 153 GLY A H    1  
ATOM 2282  H HA2  . GLY A 1 153 ? 13.134  -3.734  0.050   1.00 0.00 ? 153 GLY A HA2  1  
ATOM 2283  H HA3  . GLY A 1 153 ? 13.805  -3.314  -1.520  1.00 0.00 ? 153 GLY A HA3  1  
ATOM 2284  N N    . ALA A 1 154 ? 15.919  -5.168  -0.874  1.00 0.00 ? 154 ALA A N    1  
ATOM 2285  C CA   . ALA A 1 154 ? 16.584  -6.454  -1.023  1.00 0.00 ? 154 ALA A CA   1  
ATOM 2286  C C    . ALA A 1 154 ? 17.172  -6.918  0.302   1.00 0.00 ? 154 ALA A C    1  
ATOM 2287  O O    . ALA A 1 154 ? 17.547  -8.082  0.457   1.00 0.00 ? 154 ALA A O    1  
ATOM 2288  C CB   . ALA A 1 154 ? 17.669  -6.369  -2.085  1.00 0.00 ? 154 ALA A CB   1  
ATOM 2289  H H    . ALA A 1 154 ? 16.451  -4.347  -0.922  1.00 0.00 ? 154 ALA A H    1  
ATOM 2290  H HA   . ALA A 1 154 ? 15.847  -7.174  -1.350  1.00 0.00 ? 154 ALA A HA   1  
ATOM 2291  H HB1  . ALA A 1 154 ? 17.222  -6.115  -3.035  1.00 0.00 ? 154 ALA A HB1  1  
ATOM 2292  H HB2  . ALA A 1 154 ? 18.172  -7.321  -2.164  1.00 0.00 ? 154 ALA A HB2  1  
ATOM 2293  H HB3  . ALA A 1 154 ? 18.383  -5.605  -1.808  1.00 0.00 ? 154 ALA A HB3  1  
ATOM 2294  N N    . LEU A 1 155 ? 17.251  -6.000  1.251   1.00 0.00 ? 155 LEU A N    1  
ATOM 2295  C CA   . LEU A 1 155 ? 17.794  -6.302  2.566   1.00 0.00 ? 155 LEU A CA   1  
ATOM 2296  C C    . LEU A 1 155 ? 16.747  -6.989  3.440   1.00 0.00 ? 155 LEU A C    1  
ATOM 2297  O O    . LEU A 1 155 ? 15.840  -6.341  3.968   1.00 0.00 ? 155 LEU A O    1  
ATOM 2298  C CB   . LEU A 1 155 ? 18.281  -5.016  3.243   1.00 0.00 ? 155 LEU A CB   1  
ATOM 2299  C CG   . LEU A 1 155 ? 18.912  -5.194  4.626   1.00 0.00 ? 155 LEU A CG   1  
ATOM 2300  C CD1  . LEU A 1 155 ? 20.121  -6.112  4.550   1.00 0.00 ? 155 LEU A CD1  1  
ATOM 2301  C CD2  . LEU A 1 155 ? 19.299  -3.841  5.206   1.00 0.00 ? 155 LEU A CD2  1  
ATOM 2302  H H    . LEU A 1 155 ? 16.938  -5.090  1.061   1.00 0.00 ? 155 LEU A H    1  
ATOM 2303  H HA   . LEU A 1 155 ? 18.633  -6.970  2.433   1.00 0.00 ? 155 LEU A HA   1  
ATOM 2304  H HB2  . LEU A 1 155 ? 19.011  -4.552  2.597   1.00 0.00 ? 155 LEU A HB2  1  
ATOM 2305  H HB3  . LEU A 1 155 ? 17.438  -4.346  3.342   1.00 0.00 ? 155 LEU A HB3  1  
ATOM 2306  H HG   . LEU A 1 155 ? 18.189  -5.647  5.288   1.00 0.00 ? 155 LEU A HG   1  
ATOM 2307  H HD11 . LEU A 1 155 ? 20.843  -5.702  3.860   1.00 0.00 ? 155 LEU A HD11 1  
ATOM 2308  H HD12 . LEU A 1 155 ? 19.811  -7.087  4.207   1.00 0.00 ? 155 LEU A HD12 1  
ATOM 2309  H HD13 . LEU A 1 155 ? 20.569  -6.200  5.529   1.00 0.00 ? 155 LEU A HD13 1  
ATOM 2310  H HD21 . LEU A 1 155 ? 20.023  -3.366  4.558   1.00 0.00 ? 155 LEU A HD21 1  
ATOM 2311  H HD22 . LEU A 1 155 ? 19.729  -3.978  6.188   1.00 0.00 ? 155 LEU A HD22 1  
ATOM 2312  H HD23 . LEU A 1 155 ? 18.421  -3.218  5.281   1.00 0.00 ? 155 LEU A HD23 1  
ATOM 2313  N N    . GLU A 1 156 ? 16.873  -8.302  3.574   1.00 0.00 ? 156 GLU A N    1  
ATOM 2314  C CA   . GLU A 1 156 ? 15.959  -9.092  4.387   1.00 0.00 ? 156 GLU A CA   1  
ATOM 2315  C C    . GLU A 1 156 ? 16.568  -10.457 4.665   1.00 0.00 ? 156 GLU A C    1  
ATOM 2316  O O    . GLU A 1 156 ? 17.043  -11.129 3.750   1.00 0.00 ? 156 GLU A O    1  
ATOM 2317  C CB   . GLU A 1 156 ? 14.605  -9.254  3.691   1.00 0.00 ? 156 GLU A CB   1  
ATOM 2318  C CG   . GLU A 1 156 ? 13.487  -9.667  4.637   1.00 0.00 ? 156 GLU A CG   1  
ATOM 2319  C CD   . GLU A 1 156 ? 12.940  -11.047 4.335   1.00 0.00 ? 156 GLU A CD   1  
ATOM 2320  O OE1  . GLU A 1 156 ? 13.656  -12.046 4.570   1.00 0.00 ? 156 GLU A OE1  1  
ATOM 2321  O OE2  . GLU A 1 156 ? 11.788  -11.139 3.872   1.00 0.00 ? 156 GLU A OE2  1  
ATOM 2322  H H    . GLU A 1 156 ? 17.609  -8.760  3.108   1.00 0.00 ? 156 GLU A H    1  
ATOM 2323  H HA   . GLU A 1 156 ? 15.817  -8.574  5.325   1.00 0.00 ? 156 GLU A HA   1  
ATOM 2324  H HB2  . GLU A 1 156 ? 14.334  -8.314  3.232   1.00 0.00 ? 156 GLU A HB2  1  
ATOM 2325  H HB3  . GLU A 1 156 ? 14.696  -10.008 2.923   1.00 0.00 ? 156 GLU A HB3  1  
ATOM 2326  H HG2  . GLU A 1 156 ? 13.870  -9.664  5.647   1.00 0.00 ? 156 GLU A HG2  1  
ATOM 2327  H HG3  . GLU A 1 156 ? 12.682  -8.948  4.557   1.00 0.00 ? 156 GLU A HG3  1  
ATOM 2328  N N    . GLU A 1 157 ? 16.571  -10.856 5.925   1.00 0.00 ? 157 GLU A N    1  
ATOM 2329  C CA   . GLU A 1 157 ? 17.128  -12.142 6.319   1.00 0.00 ? 157 GLU A CA   1  
ATOM 2330  C C    . GLU A 1 157 ? 16.132  -12.914 7.176   1.00 0.00 ? 157 GLU A C    1  
ATOM 2331  O O    . GLU A 1 157 ? 16.507  -13.578 8.146   1.00 0.00 ? 157 GLU A O    1  
ATOM 2332  C CB   . GLU A 1 157 ? 18.438  -11.936 7.083   1.00 0.00 ? 157 GLU A CB   1  
ATOM 2333  C CG   . GLU A 1 157 ? 19.577  -11.414 6.218   1.00 0.00 ? 157 GLU A CG   1  
ATOM 2334  C CD   . GLU A 1 157 ? 20.074  -12.446 5.225   1.00 0.00 ? 157 GLU A CD   1  
ATOM 2335  O OE1  . GLU A 1 157 ? 20.963  -13.241 5.586   1.00 0.00 ? 157 GLU A OE1  1  
ATOM 2336  O OE2  . GLU A 1 157 ? 19.582  -12.470 4.077   1.00 0.00 ? 157 GLU A OE2  1  
ATOM 2337  H H    . GLU A 1 157 ? 16.186  -10.270 6.617   1.00 0.00 ? 157 GLU A H    1  
ATOM 2338  H HA   . GLU A 1 157 ? 17.329  -12.708 5.421   1.00 0.00 ? 157 GLU A HA   1  
ATOM 2339  H HB2  . GLU A 1 157 ? 18.267  -11.229 7.881   1.00 0.00 ? 157 GLU A HB2  1  
ATOM 2340  H HB3  . GLU A 1 157 ? 18.744  -12.880 7.512   1.00 0.00 ? 157 GLU A HB3  1  
ATOM 2341  H HG2  . GLU A 1 157 ? 19.230  -10.548 5.672   1.00 0.00 ? 157 GLU A HG2  1  
ATOM 2342  H HG3  . GLU A 1 157 ? 20.396  -11.129 6.861   1.00 0.00 ? 157 GLU A HG3  1  
ATOM 2343  N N    . ALA A 1 158 ? 14.862  -12.823 6.816   1.00 0.00 ? 158 ALA A N    1  
ATOM 2344  C CA   . ALA A 1 158 ? 13.808  -13.511 7.545   1.00 0.00 ? 158 ALA A CA   1  
ATOM 2345  C C    . ALA A 1 158 ? 13.382  -14.764 6.794   1.00 0.00 ? 158 ALA A C    1  
ATOM 2346  O O    . ALA A 1 158 ? 13.391  -15.868 7.348   1.00 0.00 ? 158 ALA A O    1  
ATOM 2347  C CB   . ALA A 1 158 ? 12.618  -12.587 7.764   1.00 0.00 ? 158 ALA A CB   1  
ATOM 2348  H H    . ALA A 1 158 ? 14.623  -12.287 6.021   1.00 0.00 ? 158 ALA A H    1  
ATOM 2349  H HA   . ALA A 1 158 ? 14.198  -13.794 8.511   1.00 0.00 ? 158 ALA A HA   1  
ATOM 2350  H HB1  . ALA A 1 158 ? 12.224  -12.276 6.808   1.00 0.00 ? 158 ALA A HB1  1  
ATOM 2351  H HB2  . ALA A 1 158 ? 12.931  -11.719 8.324   1.00 0.00 ? 158 ALA A HB2  1  
ATOM 2352  H HB3  . ALA A 1 158 ? 11.851  -13.112 8.314   1.00 0.00 ? 158 ALA A HB3  1  
ATOM 2353  N N    . ARG A 1 159 ? 13.026  -14.593 5.528   1.00 0.00 ? 159 ARG A N    1  
ATOM 2354  C CA   . ARG A 1 159 ? 12.602  -15.711 4.696   1.00 0.00 ? 159 ARG A CA   1  
ATOM 2355  C C    . ARG A 1 159 ? 13.026  -15.510 3.247   1.00 0.00 ? 159 ARG A C    1  
ATOM 2356  O O    . ARG A 1 159 ? 12.623  -16.271 2.367   1.00 0.00 ? 159 ARG A O    1  
ATOM 2357  C CB   . ARG A 1 159 ? 11.079  -15.914 4.784   1.00 0.00 ? 159 ARG A CB   1  
ATOM 2358  C CG   . ARG A 1 159 ? 10.252  -14.647 4.599   1.00 0.00 ? 159 ARG A CG   1  
ATOM 2359  C CD   . ARG A 1 159 ? 9.974   -14.353 3.134   1.00 0.00 ? 159 ARG A CD   1  
ATOM 2360  N NE   . ARG A 1 159 ? 10.717  -13.189 2.668   1.00 0.00 ? 159 ARG A NE   1  
ATOM 2361  C CZ   . ARG A 1 159 ? 11.191  -13.037 1.436   1.00 0.00 ? 159 ARG A CZ   1  
ATOM 2362  N NH1  . ARG A 1 159 ? 11.028  -13.989 0.521   1.00 0.00 ? 159 ARG A NH1  1  
ATOM 2363  N NH2  . ARG A 1 159 ? 11.853  -11.935 1.134   1.00 0.00 ? 159 ARG A NH2  1  
ATOM 2364  H H    . ARG A 1 159 ? 13.052  -13.683 5.140   1.00 0.00 ? 159 ARG A H    1  
ATOM 2365  H HA   . ARG A 1 159 ? 13.090  -16.598 5.074   1.00 0.00 ? 159 ARG A HA   1  
ATOM 2366  H HB2  . ARG A 1 159 ? 10.781  -16.618 4.021   1.00 0.00 ? 159 ARG A HB2  1  
ATOM 2367  H HB3  . ARG A 1 159 ? 10.843  -16.331 5.752   1.00 0.00 ? 159 ARG A HB3  1  
ATOM 2368  H HG2  . ARG A 1 159 ? 9.310   -14.768 5.113   1.00 0.00 ? 159 ARG A HG2  1  
ATOM 2369  H HG3  . ARG A 1 159 ? 10.790  -13.814 5.027   1.00 0.00 ? 159 ARG A HG3  1  
ATOM 2370  H HD2  . ARG A 1 159 ? 10.260  -15.211 2.546   1.00 0.00 ? 159 ARG A HD2  1  
ATOM 2371  H HD3  . ARG A 1 159 ? 8.917   -14.166 3.009   1.00 0.00 ? 159 ARG A HD3  1  
ATOM 2372  H HE   . ARG A 1 159 ? 10.884  -12.461 3.327   1.00 0.00 ? 159 ARG A HE   1  
ATOM 2373  H HH11 . ARG A 1 159 ? 10.544  -14.841 0.757   1.00 0.00 ? 159 ARG A HH11 1  
ATOM 2374  H HH12 . ARG A 1 159 ? 11.388  -13.864 -0.407  1.00 0.00 ? 159 ARG A HH12 1  
ATOM 2375  H HH21 . ARG A 1 159 ? 11.990  -11.226 1.836   1.00 0.00 ? 159 ARG A HH21 1  
ATOM 2376  H HH22 . ARG A 1 159 ? 12.223  -11.797 0.207   1.00 0.00 ? 159 ARG A HH22 1  
ATOM 2377  N N    . ARG A 1 160 ? 13.840  -14.483 3.008   1.00 0.00 ? 160 ARG A N    1  
ATOM 2378  C CA   . ARG A 1 160 ? 14.324  -14.174 1.665   1.00 0.00 ? 160 ARG A CA   1  
ATOM 2379  C C    . ARG A 1 160 ? 15.003  -15.386 1.034   1.00 0.00 ? 160 ARG A C    1  
ATOM 2380  O O    . ARG A 1 160 ? 15.696  -16.146 1.717   1.00 0.00 ? 160 ARG A O    1  
ATOM 2381  C CB   . ARG A 1 160 ? 15.293  -12.992 1.710   1.00 0.00 ? 160 ARG A CB   1  
ATOM 2382  C CG   . ARG A 1 160 ? 15.651  -12.444 0.338   1.00 0.00 ? 160 ARG A CG   1  
ATOM 2383  C CD   . ARG A 1 160 ? 16.690  -11.340 0.431   1.00 0.00 ? 160 ARG A CD   1  
ATOM 2384  N NE   . ARG A 1 160 ? 17.855  -11.756 1.211   1.00 0.00 ? 160 ARG A NE   1  
ATOM 2385  C CZ   . ARG A 1 160 ? 18.980  -12.232 0.677   1.00 0.00 ? 160 ARG A CZ   1  
ATOM 2386  N NH1  . ARG A 1 160 ? 19.096  -12.357 -0.641  1.00 0.00 ? 160 ARG A NH1  1  
ATOM 2387  N NH2  . ARG A 1 160 ? 19.994  -12.578 1.462   1.00 0.00 ? 160 ARG A NH2  1  
ATOM 2388  H H    . ARG A 1 160 ? 14.110  -13.904 3.754   1.00 0.00 ? 160 ARG A H    1  
ATOM 2389  H HA   . ARG A 1 160 ? 13.468  -13.904 1.063   1.00 0.00 ? 160 ARG A HA   1  
ATOM 2390  H HB2  . ARG A 1 160 ? 14.841  -12.197 2.286   1.00 0.00 ? 160 ARG A HB2  1  
ATOM 2391  H HB3  . ARG A 1 160 ? 16.203  -13.306 2.198   1.00 0.00 ? 160 ARG A HB3  1  
ATOM 2392  H HG2  . ARG A 1 160 ? 16.046  -13.245 -0.267  1.00 0.00 ? 160 ARG A HG2  1  
ATOM 2393  H HG3  . ARG A 1 160 ? 14.760  -12.045 -0.126  1.00 0.00 ? 160 ARG A HG3  1  
ATOM 2394  H HD2  . ARG A 1 160 ? 17.009  -11.079 -0.567  1.00 0.00 ? 160 ARG A HD2  1  
ATOM 2395  H HD3  . ARG A 1 160 ? 16.240  -10.478 0.903   1.00 0.00 ? 160 ARG A HD3  1  
ATOM 2396  H HE   . ARG A 1 160 ? 17.791  -11.669 2.196   1.00 0.00 ? 160 ARG A HE   1  
ATOM 2397  H HH11 . ARG A 1 160 ? 18.335  -12.091 -1.248  1.00 0.00 ? 160 ARG A HH11 1  
ATOM 2398  H HH12 . ARG A 1 160 ? 19.944  -12.711 -1.038  1.00 0.00 ? 160 ARG A HH12 1  
ATOM 2399  H HH21 . ARG A 1 160 ? 19.914  -12.480 2.467   1.00 0.00 ? 160 ARG A HH21 1  
ATOM 2400  H HH22 . ARG A 1 160 ? 20.845  -12.934 1.061   1.00 0.00 ? 160 ARG A HH22 1  
ATOM 2401  N N    . LEU A 1 161 ? 14.790  -15.554 -0.268  1.00 0.00 ? 161 LEU A N    1  
ATOM 2402  C CA   . LEU A 1 161 ? 15.352  -16.671 -1.016  1.00 0.00 ? 161 LEU A CA   1  
ATOM 2403  C C    . LEU A 1 161 ? 16.859  -16.786 -0.834  1.00 0.00 ? 161 LEU A C    1  
ATOM 2404  O O    . LEU A 1 161 ? 17.601  -15.818 -1.006  1.00 0.00 ? 161 LEU A O    1  
ATOM 2405  C CB   . LEU A 1 161 ? 15.036  -16.527 -2.505  1.00 0.00 ? 161 LEU A CB   1  
ATOM 2406  C CG   . LEU A 1 161 ? 15.583  -17.648 -3.392  1.00 0.00 ? 161 LEU A CG   1  
ATOM 2407  C CD1  . LEU A 1 161 ? 14.755  -18.913 -3.225  1.00 0.00 ? 161 LEU A CD1  1  
ATOM 2408  C CD2  . LEU A 1 161 ? 15.609  -17.211 -4.846  1.00 0.00 ? 161 LEU A CD2  1  
ATOM 2409  H H    . LEU A 1 161 ? 14.231  -14.903 -0.744  1.00 0.00 ? 161 LEU A H    1  
ATOM 2410  H HA   . LEU A 1 161 ? 14.891  -17.575 -0.651  1.00 0.00 ? 161 LEU A HA   1  
ATOM 2411  H HB2  . LEU A 1 161 ? 13.963  -16.493 -2.621  1.00 0.00 ? 161 LEU A HB2  1  
ATOM 2412  H HB3  . LEU A 1 161 ? 15.448  -15.590 -2.850  1.00 0.00 ? 161 LEU A HB3  1  
ATOM 2413  H HG   . LEU A 1 161 ? 16.597  -17.872 -3.092  1.00 0.00 ? 161 LEU A HG   1  
ATOM 2414  H HD11 . LEU A 1 161 ? 14.757  -19.212 -2.187  1.00 0.00 ? 161 LEU A HD11 1  
ATOM 2415  H HD12 . LEU A 1 161 ? 15.178  -19.702 -3.828  1.00 0.00 ? 161 LEU A HD12 1  
ATOM 2416  H HD13 . LEU A 1 161 ? 13.739  -18.723 -3.544  1.00 0.00 ? 161 LEU A HD13 1  
ATOM 2417  H HD21 . LEU A 1 161 ? 14.609  -16.948 -5.160  1.00 0.00 ? 161 LEU A HD21 1  
ATOM 2418  H HD22 . LEU A 1 161 ? 15.977  -18.022 -5.458  1.00 0.00 ? 161 LEU A HD22 1  
ATOM 2419  H HD23 . LEU A 1 161 ? 16.258  -16.355 -4.954  1.00 0.00 ? 161 LEU A HD23 1  
ATOM 2420  N N    . ARG A 1 162 ? 17.296  -17.983 -0.478  1.00 0.00 ? 162 ARG A N    1  
ATOM 2421  C CA   . ARG A 1 162 ? 18.708  -18.265 -0.300  1.00 0.00 ? 162 ARG A CA   1  
ATOM 2422  C C    . ARG A 1 162 ? 19.284  -18.712 -1.636  1.00 0.00 ? 162 ARG A C    1  
ATOM 2423  O O    . ARG A 1 162 ? 19.042  -19.836 -2.076  1.00 0.00 ? 162 ARG A O    1  
ATOM 2424  C CB   . ARG A 1 162 ? 18.904  -19.356 0.757   1.00 0.00 ? 162 ARG A CB   1  
ATOM 2425  C CG   . ARG A 1 162 ? 19.463  -18.848 2.077   1.00 0.00 ? 162 ARG A CG   1  
ATOM 2426  C CD   . ARG A 1 162 ? 18.574  -17.785 2.705   1.00 0.00 ? 162 ARG A CD   1  
ATOM 2427  N NE   . ARG A 1 162 ? 19.112  -17.326 3.985   1.00 0.00 ? 162 ARG A NE   1  
ATOM 2428  C CZ   . ARG A 1 162 ? 19.372  -16.052 4.273   1.00 0.00 ? 162 ARG A CZ   1  
ATOM 2429  N NH1  . ARG A 1 162 ? 19.093  -15.095 3.396   1.00 0.00 ? 162 ARG A NH1  1  
ATOM 2430  N NH2  . ARG A 1 162 ? 19.891  -15.730 5.449   1.00 0.00 ? 162 ARG A NH2  1  
ATOM 2431  H H    . ARG A 1 162 ? 16.644  -18.707 -0.338  1.00 0.00 ? 162 ARG A H    1  
ATOM 2432  H HA   . ARG A 1 162 ? 19.201  -17.357 0.019   1.00 0.00 ? 162 ARG A HA   1  
ATOM 2433  H HB2  . ARG A 1 162 ? 17.950  -19.825 0.952   1.00 0.00 ? 162 ARG A HB2  1  
ATOM 2434  H HB3  . ARG A 1 162 ? 19.585  -20.099 0.364   1.00 0.00 ? 162 ARG A HB3  1  
ATOM 2435  H HG2  . ARG A 1 162 ? 19.545  -19.678 2.761   1.00 0.00 ? 162 ARG A HG2  1  
ATOM 2436  H HG3  . ARG A 1 162 ? 20.441  -18.427 1.902   1.00 0.00 ? 162 ARG A HG3  1  
ATOM 2437  H HD2  . ARG A 1 162 ? 18.505  -16.943 2.032   1.00 0.00 ? 162 ARG A HD2  1  
ATOM 2438  H HD3  . ARG A 1 162 ? 17.592  -18.201 2.867   1.00 0.00 ? 162 ARG A HD3  1  
ATOM 2439  H HE   . ARG A 1 162 ? 19.302  -18.020 4.668   1.00 0.00 ? 162 ARG A HE   1  
ATOM 2440  H HH11 . ARG A 1 162 ? 18.682  -15.324 2.511   1.00 0.00 ? 162 ARG A HH11 1  
ATOM 2441  H HH12 . ARG A 1 162 ? 19.292  -14.131 3.621   1.00 0.00 ? 162 ARG A HH12 1  
ATOM 2442  H HH21 . ARG A 1 162 ? 20.080  -16.446 6.138   1.00 0.00 ? 162 ARG A HH21 1  
ATOM 2443  H HH22 . ARG A 1 162 ? 20.118  -14.768 5.658   1.00 0.00 ? 162 ARG A HH22 1  
ATOM 2444  N N    . GLU A 1 163 ? 20.023  -17.829 -2.290  1.00 0.00 ? 163 GLU A N    1  
ATOM 2445  C CA   . GLU A 1 163 ? 20.598  -18.144 -3.591  1.00 0.00 ? 163 GLU A CA   1  
ATOM 2446  C C    . GLU A 1 163 ? 22.036  -17.659 -3.703  1.00 0.00 ? 163 GLU A C    1  
ATOM 2447  O O    . GLU A 1 163 ? 22.517  -16.903 -2.855  1.00 0.00 ? 163 GLU A O    1  
ATOM 2448  C CB   . GLU A 1 163 ? 19.751  -17.501 -4.691  1.00 0.00 ? 163 GLU A CB   1  
ATOM 2449  C CG   . GLU A 1 163 ? 19.199  -18.490 -5.700  1.00 0.00 ? 163 GLU A CG   1  
ATOM 2450  C CD   . GLU A 1 163 ? 20.199  -18.848 -6.777  1.00 0.00 ? 163 GLU A CD   1  
ATOM 2451  O OE1  . GLU A 1 163 ? 21.155  -19.594 -6.484  1.00 0.00 ? 163 GLU A OE1  1  
ATOM 2452  O OE2  . GLU A 1 163 ? 20.028  -18.395 -7.925  1.00 0.00 ? 163 GLU A OE2  1  
ATOM 2453  H H    . GLU A 1 163 ? 20.185  -16.942 -1.892  1.00 0.00 ? 163 GLU A H    1  
ATOM 2454  H HA   . GLU A 1 163 ? 20.577  -19.217 -3.716  1.00 0.00 ? 163 GLU A HA   1  
ATOM 2455  H HB2  . GLU A 1 163 ? 18.920  -16.986 -4.236  1.00 0.00 ? 163 GLU A HB2  1  
ATOM 2456  H HB3  . GLU A 1 163 ? 20.361  -16.783 -5.221  1.00 0.00 ? 163 GLU A HB3  1  
ATOM 2457  H HG2  . GLU A 1 163 ? 18.914  -19.392 -5.182  1.00 0.00 ? 163 GLU A HG2  1  
ATOM 2458  H HG3  . GLU A 1 163 ? 18.330  -18.055 -6.170  1.00 0.00 ? 163 GLU A HG3  1  
ATOM 2459  N N    . GLY A 1 164 ? 22.712  -18.119 -4.753  1.00 0.00 ? 164 GLY A N    1  
ATOM 2460  C CA   . GLY A 1 164 ? 24.083  -17.729 -5.018  1.00 0.00 ? 164 GLY A CA   1  
ATOM 2461  C C    . GLY A 1 164 ? 25.044  -18.070 -3.896  1.00 0.00 ? 164 GLY A C    1  
ATOM 2462  O O    . GLY A 1 164 ? 25.383  -19.235 -3.692  1.00 0.00 ? 164 GLY A O    1  
ATOM 2463  H H    . GLY A 1 164 ? 22.260  -18.744 -5.370  1.00 0.00 ? 164 GLY A H    1  
ATOM 2464  H HA2  . GLY A 1 164 ? 24.414  -18.226 -5.917  1.00 0.00 ? 164 GLY A HA2  1  
ATOM 2465  H HA3  . GLY A 1 164 ? 24.112  -16.662 -5.186  1.00 0.00 ? 164 GLY A HA3  1  
ATOM 2466  N N    . ASN A 1 165 ? 25.477  -17.040 -3.178  1.00 0.00 ? 165 ASN A N    1  
ATOM 2467  C CA   . ASN A 1 165 ? 26.422  -17.186 -2.071  1.00 0.00 ? 165 ASN A CA   1  
ATOM 2468  C C    . ASN A 1 165 ? 25.889  -18.123 -0.991  1.00 0.00 ? 165 ASN A C    1  
ATOM 2469  O O    . ASN A 1 165 ? 26.595  -19.022 -0.534  1.00 0.00 ? 165 ASN A O    1  
ATOM 2470  C CB   . ASN A 1 165 ? 26.732  -15.809 -1.466  1.00 0.00 ? 165 ASN A CB   1  
ATOM 2471  C CG   . ASN A 1 165 ? 27.635  -15.885 -0.250  1.00 0.00 ? 165 ASN A CG   1  
ATOM 2472  O OD1  . ASN A 1 165 ? 27.167  -16.020 0.881   1.00 0.00 ? 165 ASN A OD1  1  
ATOM 2473  N ND2  . ASN A 1 165 ? 28.934  -15.798 -0.473  1.00 0.00 ? 165 ASN A ND2  1  
ATOM 2474  H H    . ASN A 1 165 ? 25.147  -16.138 -3.404  1.00 0.00 ? 165 ASN A H    1  
ATOM 2475  H HA   . ASN A 1 165 ? 27.335  -17.602 -2.469  1.00 0.00 ? 165 ASN A HA   1  
ATOM 2476  H HB2  . ASN A 1 165 ? 27.220  -15.199 -2.212  1.00 0.00 ? 165 ASN A HB2  1  
ATOM 2477  H HB3  . ASN A 1 165 ? 25.804  -15.336 -1.174  1.00 0.00 ? 165 ASN A HB3  1  
ATOM 2478  H HD21 . ASN A 1 165 ? 29.238  -15.697 -1.401  1.00 0.00 ? 165 ASN A HD21 1  
ATOM 2479  H HD22 . ASN A 1 165 ? 29.543  -15.830 0.300   1.00 0.00 ? 165 ASN A HD22 1  
ATOM 2480  N N    . TRP A 1 166 ? 24.637  -17.923 -0.604  1.00 0.00 ? 166 TRP A N    1  
ATOM 2481  C CA   . TRP A 1 166 ? 24.020  -18.735 0.435   1.00 0.00 ? 166 TRP A CA   1  
ATOM 2482  C C    . TRP A 1 166 ? 23.825  -20.177 -0.015  1.00 0.00 ? 166 TRP A C    1  
ATOM 2483  O O    . TRP A 1 166 ? 24.641  -21.050 0.285   1.00 0.00 ? 166 TRP A O    1  
ATOM 2484  C CB   . TRP A 1 166 ? 22.679  -18.133 0.849   1.00 0.00 ? 166 TRP A CB   1  
ATOM 2485  C CG   . TRP A 1 166 ? 22.794  -17.139 1.962   1.00 0.00 ? 166 TRP A CG   1  
ATOM 2486  C CD1  . TRP A 1 166 ? 22.531  -15.804 1.896   1.00 0.00 ? 166 TRP A CD1  1  
ATOM 2487  C CD2  . TRP A 1 166 ? 23.204  -17.402 3.307   1.00 0.00 ? 166 TRP A CD2  1  
ATOM 2488  N NE1  . TRP A 1 166 ? 22.755  -15.219 3.118   1.00 0.00 ? 166 TRP A NE1  1  
ATOM 2489  C CE2  . TRP A 1 166 ? 23.167  -16.178 4.001   1.00 0.00 ? 166 TRP A CE2  1  
ATOM 2490  C CE3  . TRP A 1 166 ? 23.596  -18.553 3.992   1.00 0.00 ? 166 TRP A CE3  1  
ATOM 2491  C CZ2  . TRP A 1 166 ? 23.509  -16.075 5.346   1.00 0.00 ? 166 TRP A CZ2  1  
ATOM 2492  C CZ3  . TRP A 1 166 ? 23.934  -18.450 5.327   1.00 0.00 ? 166 TRP A CZ3  1  
ATOM 2493  C CH2  . TRP A 1 166 ? 23.889  -17.219 5.993   1.00 0.00 ? 166 TRP A CH2  1  
ATOM 2494  H H    . TRP A 1 166 ? 24.111  -17.218 -1.036  1.00 0.00 ? 166 TRP A H    1  
ATOM 2495  H HA   . TRP A 1 166 ? 24.679  -18.728 1.290   1.00 0.00 ? 166 TRP A HA   1  
ATOM 2496  H HB2  . TRP A 1 166 ? 22.239  -17.635 -0.002  1.00 0.00 ? 166 TRP A HB2  1  
ATOM 2497  H HB3  . TRP A 1 166 ? 22.022  -18.927 1.176   1.00 0.00 ? 166 TRP A HB3  1  
ATOM 2498  H HD1  . TRP A 1 166 ? 22.200  -15.293 1.005   1.00 0.00 ? 166 TRP A HD1  1  
ATOM 2499  H HE1  . TRP A 1 166 ? 22.637  -14.263 3.325   1.00 0.00 ? 166 TRP A HE1  1  
ATOM 2500  H HE3  . TRP A 1 166 ? 23.638  -19.510 3.497   1.00 0.00 ? 166 TRP A HE3  1  
ATOM 2501  H HZ2  . TRP A 1 166 ? 23.479  -15.132 5.875   1.00 0.00 ? 166 TRP A HZ2  1  
ATOM 2502  H HZ3  . TRP A 1 166 ? 24.239  -19.328 5.873   1.00 0.00 ? 166 TRP A HZ3  1  
ATOM 2503  H HH2  . TRP A 1 166 ? 24.161  -17.186 7.039   1.00 0.00 ? 166 TRP A HH2  1  
ATOM 2504  N N    . ALA A 1 167 ? 22.743  -20.422 -0.733  1.00 0.00 ? 167 ALA A N    1  
ATOM 2505  C CA   . ALA A 1 167 ? 22.440  -21.756 -1.214  1.00 0.00 ? 167 ALA A CA   1  
ATOM 2506  C C    . ALA A 1 167 ? 22.629  -21.831 -2.718  1.00 0.00 ? 167 ALA A C    1  
ATOM 2507  O O    . ALA A 1 167 ? 21.814  -21.312 -3.483  1.00 0.00 ? 167 ALA A O    1  
ATOM 2508  C CB   . ALA A 1 167 ? 21.023  -22.150 -0.830  1.00 0.00 ? 167 ALA A CB   1  
ATOM 2509  H H    . ALA A 1 167 ? 22.137  -19.686 -0.958  1.00 0.00 ? 167 ALA A H    1  
ATOM 2510  H HA   . ALA A 1 167 ? 23.124  -22.445 -0.738  1.00 0.00 ? 167 ALA A HA   1  
ATOM 2511  H HB1  . ALA A 1 167 ? 20.826  -23.158 -1.163  1.00 0.00 ? 167 ALA A HB1  1  
ATOM 2512  H HB2  . ALA A 1 167 ? 20.322  -21.474 -1.299  1.00 0.00 ? 167 ALA A HB2  1  
ATOM 2513  H HB3  . ALA A 1 167 ? 20.911  -22.096 0.242   1.00 0.00 ? 167 ALA A HB3  1  
ATOM 2514  N N    . SER A 1 168 ? 23.711  -22.464 -3.134  1.00 0.00 ? 168 SER A N    1  
ATOM 2515  C CA   . SER A 1 168 ? 24.021  -22.609 -4.544  1.00 0.00 ? 168 SER A CA   1  
ATOM 2516  C C    . SER A 1 168 ? 23.445  -23.914 -5.076  1.00 0.00 ? 168 SER A C    1  
ATOM 2517  O O    . SER A 1 168 ? 23.008  -23.999 -6.223  1.00 0.00 ? 168 SER A O    1  
ATOM 2518  C CB   . SER A 1 168 ? 25.535  -22.575 -4.731  1.00 0.00 ? 168 SER A CB   1  
ATOM 2519  O OG   . SER A 1 168 ? 26.136  -21.763 -3.734  1.00 0.00 ? 168 SER A OG   1  
ATOM 2520  H H    . SER A 1 168 ? 24.322  -22.857 -2.468  1.00 0.00 ? 168 SER A H    1  
ATOM 2521  H HA   . SER A 1 168 ? 23.576  -21.781 -5.075  1.00 0.00 ? 168 SER A HA   1  
ATOM 2522  H HB2  . SER A 1 168 ? 25.929  -23.579 -4.655  1.00 0.00 ? 168 SER A HB2  1  
ATOM 2523  H HB3  . SER A 1 168 ? 25.770  -22.168 -5.703  1.00 0.00 ? 168 SER A HB3  1  
ATOM 2524  H HG   . SER A 1 168 ? 25.676  -20.910 -3.698  1.00 0.00 ? 168 SER A HG   1  
ATOM 2525  N N    . VAL A 1 169 ? 23.434  -24.931 -4.229  1.00 0.00 ? 169 VAL A N    1  
ATOM 2526  C CA   . VAL A 1 169 ? 22.908  -26.227 -4.612  1.00 0.00 ? 169 VAL A CA   1  
ATOM 2527  C C    . VAL A 1 169 ? 21.584  -26.497 -3.911  1.00 0.00 ? 169 VAL A C    1  
ATOM 2528  O O    . VAL A 1 169 ? 21.373  -26.071 -2.772  1.00 0.00 ? 169 VAL A O    1  
ATOM 2529  C CB   . VAL A 1 169 ? 23.902  -27.365 -4.300  1.00 0.00 ? 169 VAL A CB   1  
ATOM 2530  C CG1  . VAL A 1 169 ? 25.067  -27.333 -5.279  1.00 0.00 ? 169 VAL A CG1  1  
ATOM 2531  C CG2  . VAL A 1 169 ? 24.406  -27.275 -2.867  1.00 0.00 ? 169 VAL A CG2  1  
ATOM 2532  H H    . VAL A 1 169 ? 23.781  -24.801 -3.319  1.00 0.00 ? 169 VAL A H    1  
ATOM 2533  H HA   . VAL A 1 169 ? 22.738  -26.210 -5.678  1.00 0.00 ? 169 VAL A HA   1  
ATOM 2534  H HB   . VAL A 1 169 ? 23.386  -28.307 -4.420  1.00 0.00 ? 169 VAL A HB   1  
ATOM 2535  H HG11 . VAL A 1 169 ? 25.719  -28.175 -5.089  1.00 0.00 ? 169 VAL A HG11 1  
ATOM 2536  H HG12 . VAL A 1 169 ? 25.621  -26.414 -5.150  1.00 0.00 ? 169 VAL A HG12 1  
ATOM 2537  H HG13 . VAL A 1 169 ? 24.691  -27.389 -6.290  1.00 0.00 ? 169 VAL A HG13 1  
ATOM 2538  H HG21 . VAL A 1 169 ? 23.588  -27.457 -2.184  1.00 0.00 ? 169 VAL A HG21 1  
ATOM 2539  H HG22 . VAL A 1 169 ? 24.810  -26.288 -2.688  1.00 0.00 ? 169 VAL A HG22 1  
ATOM 2540  H HG23 . VAL A 1 169 ? 25.178  -28.014 -2.710  1.00 0.00 ? 169 VAL A HG23 1  
ATOM 2541  N N    . ARG A 1 170 ? 20.694  -27.206 -4.585  1.00 0.00 ? 170 ARG A N    1  
ATOM 2542  C CA   . ARG A 1 170 ? 19.388  -27.521 -4.028  1.00 0.00 ? 170 ARG A CA   1  
ATOM 2543  C C    . ARG A 1 170 ? 18.851  -28.819 -4.615  1.00 0.00 ? 170 ARG A C    1  
ATOM 2544  O O    . ARG A 1 170 ? 19.072  -29.071 -5.819  1.00 0.00 ? 170 ARG A O    1  
ATOM 2545  C CB   . ARG A 1 170 ? 18.408  -26.373 -4.280  1.00 0.00 ? 170 ARG A CB   1  
ATOM 2546  C CG   . ARG A 1 170 ? 18.250  -26.008 -5.747  1.00 0.00 ? 170 ARG A CG   1  
ATOM 2547  C CD   . ARG A 1 170 ? 17.675  -24.614 -5.912  1.00 0.00 ? 170 ARG A CD   1  
ATOM 2548  N NE   . ARG A 1 170 ? 18.571  -23.589 -5.383  1.00 0.00 ? 170 ARG A NE   1  
ATOM 2549  C CZ   . ARG A 1 170 ? 19.224  -22.708 -6.137  1.00 0.00 ? 170 ARG A CZ   1  
ATOM 2550  N NH1  . ARG A 1 170 ? 19.052  -22.688 -7.454  1.00 0.00 ? 170 ARG A NH1  1  
ATOM 2551  N NH2  . ARG A 1 170 ? 20.042  -21.835 -5.568  1.00 0.00 ? 170 ARG A NH2  1  
ATOM 2552  H H    . ARG A 1 170 ? 20.924  -27.539 -5.483  1.00 0.00 ? 170 ARG A H    1  
ATOM 2553  H HA   . ARG A 1 170 ? 19.509  -27.648 -2.964  1.00 0.00 ? 170 ARG A HA   1  
ATOM 2554  H HB2  . ARG A 1 170 ? 17.440  -26.654 -3.895  1.00 0.00 ? 170 ARG A HB2  1  
ATOM 2555  H HB3  . ARG A 1 170 ? 18.756  -25.500 -3.750  1.00 0.00 ? 170 ARG A HB3  1  
ATOM 2556  H HG2  . ARG A 1 170 ? 19.218  -26.044 -6.223  1.00 0.00 ? 170 ARG A HG2  1  
ATOM 2557  H HG3  . ARG A 1 170 ? 17.588  -26.720 -6.217  1.00 0.00 ? 170 ARG A HG3  1  
ATOM 2558  H HD2  . ARG A 1 170 ? 17.512  -24.428 -6.964  1.00 0.00 ? 170 ARG A HD2  1  
ATOM 2559  H HD3  . ARG A 1 170 ? 16.732  -24.562 -5.388  1.00 0.00 ? 170 ARG A HD3  1  
ATOM 2560  H HE   . ARG A 1 170 ? 18.700  -23.563 -4.404  1.00 0.00 ? 170 ARG A HE   1  
ATOM 2561  H HH11 . ARG A 1 170 ? 18.423  -23.344 -7.897  1.00 0.00 ? 170 ARG A HH11 1  
ATOM 2562  H HH12 . ARG A 1 170 ? 19.548  -22.017 -8.021  1.00 0.00 ? 170 ARG A HH12 1  
ATOM 2563  H HH21 . ARG A 1 170 ? 20.175  -21.841 -4.570  1.00 0.00 ? 170 ARG A HH21 1  
ATOM 2564  H HH22 . ARG A 1 170 ? 20.535  -21.153 -6.129  1.00 0.00 ? 170 ARG A HH22 1  
ATOM 2565  N N    . ILE B 2 1   ? -14.040 -13.523 7.672   1.00 0.00 ? 201 ILE B N    1  
ATOM 2566  C CA   . ILE B 2 1   ? -14.647 -13.910 6.379   1.00 0.00 ? 201 ILE B CA   1  
ATOM 2567  C C    . ILE B 2 1   ? -13.789 -14.962 5.683   1.00 0.00 ? 201 ILE B C    1  
ATOM 2568  O O    . ILE B 2 1   ? -14.197 -16.117 5.539   1.00 0.00 ? 201 ILE B O    1  
ATOM 2569  C CB   . ILE B 2 1   ? -14.793 -12.695 5.437   1.00 0.00 ? 201 ILE B CB   1  
ATOM 2570  C CG1  . ILE B 2 1   ? -15.473 -11.527 6.156   1.00 0.00 ? 201 ILE B CG1  1  
ATOM 2571  C CG2  . ILE B 2 1   ? -15.579 -13.082 4.192   1.00 0.00 ? 201 ILE B CG2  1  
ATOM 2572  C CD1  . ILE B 2 1   ? -15.394 -10.219 5.396   1.00 0.00 ? 201 ILE B CD1  1  
ATOM 2573  H H1   . ILE B 2 1   ? -13.164 -12.978 7.507   1.00 0.00 ? 201 ILE B H1   1  
ATOM 2574  H H2   . ILE B 2 1   ? -13.801 -14.375 8.224   1.00 0.00 ? 201 ILE B H2   1  
ATOM 2575  H H3   . ILE B 2 1   ? -14.704 -12.938 8.226   1.00 0.00 ? 201 ILE B H3   1  
ATOM 2576  H HA   . ILE B 2 1   ? -15.627 -14.323 6.568   1.00 0.00 ? 201 ILE B HA   1  
ATOM 2577  H HB   . ILE B 2 1   ? -13.805 -12.389 5.125   1.00 0.00 ? 201 ILE B HB   1  
ATOM 2578  H HG12 . ILE B 2 1   ? -16.517 -11.761 6.301   1.00 0.00 ? 201 ILE B HG12 1  
ATOM 2579  H HG13 . ILE B 2 1   ? -15.004 -11.383 7.116   1.00 0.00 ? 201 ILE B HG13 1  
ATOM 2580  H HG21 . ILE B 2 1   ? -15.784 -12.199 3.607   1.00 0.00 ? 201 ILE B HG21 1  
ATOM 2581  H HG22 . ILE B 2 1   ? -16.510 -13.546 4.483   1.00 0.00 ? 201 ILE B HG22 1  
ATOM 2582  H HG23 . ILE B 2 1   ? -15.001 -13.777 3.603   1.00 0.00 ? 201 ILE B HG23 1  
ATOM 2583  H HD11 . ILE B 2 1   ? -14.358 -9.941  5.265   1.00 0.00 ? 201 ILE B HD11 1  
ATOM 2584  H HD12 . ILE B 2 1   ? -15.906 -9.448  5.952   1.00 0.00 ? 201 ILE B HD12 1  
ATOM 2585  H HD13 . ILE B 2 1   ? -15.860 -10.336 4.429   1.00 0.00 ? 201 ILE B HD13 1  
ATOM 2586  N N    . ILE B 2 2   ? -12.592 -14.558 5.271   1.00 0.00 ? 202 ILE B N    1  
ATOM 2587  C CA   . ILE B 2 2   ? -11.672 -15.451 4.577   1.00 0.00 ? 202 ILE B CA   1  
ATOM 2588  C C    . ILE B 2 2   ? -10.233 -15.156 4.981   1.00 0.00 ? 202 ILE B C    1  
ATOM 2589  O O    . ILE B 2 2   ? -9.477  -14.541 4.228   1.00 0.00 ? 202 ILE B O    1  
ATOM 2590  C CB   . ILE B 2 2   ? -11.800 -15.347 3.036   1.00 0.00 ? 202 ILE B CB   1  
ATOM 2591  C CG1  . ILE B 2 2   ? -12.143 -13.910 2.614   1.00 0.00 ? 202 ILE B CG1  1  
ATOM 2592  C CG2  . ILE B 2 2   ? -12.844 -16.328 2.521   1.00 0.00 ? 202 ILE B CG2  1  
ATOM 2593  C CD1  . ILE B 2 2   ? -12.194 -13.711 1.114   1.00 0.00 ? 202 ILE B CD1  1  
ATOM 2594  H H    . ILE B 2 2   ? -12.307 -13.632 5.462   1.00 0.00 ? 202 ILE B H    1  
ATOM 2595  H HA   . ILE B 2 2   ? -11.913 -16.464 4.868   1.00 0.00 ? 202 ILE B HA   1  
ATOM 2596  H HB   . ILE B 2 2   ? -10.848 -15.620 2.606   1.00 0.00 ? 202 ILE B HB   1  
ATOM 2597  H HG12 . ILE B 2 2   ? -13.109 -13.643 3.016   1.00 0.00 ? 202 ILE B HG12 1  
ATOM 2598  H HG13 . ILE B 2 2   ? -11.396 -13.239 3.013   1.00 0.00 ? 202 ILE B HG13 1  
ATOM 2599  H HG21 . ILE B 2 2   ? -12.556 -17.332 2.792   1.00 0.00 ? 202 ILE B HG21 1  
ATOM 2600  H HG22 . ILE B 2 2   ? -12.912 -16.251 1.445   1.00 0.00 ? 202 ILE B HG22 1  
ATOM 2601  H HG23 . ILE B 2 2   ? -13.805 -16.097 2.961   1.00 0.00 ? 202 ILE B HG23 1  
ATOM 2602  H HD11 . ILE B 2 2   ? -12.954 -14.352 0.692   1.00 0.00 ? 202 ILE B HD11 1  
ATOM 2603  H HD12 . ILE B 2 2   ? -11.235 -13.959 0.684   1.00 0.00 ? 202 ILE B HD12 1  
ATOM 2604  H HD13 . ILE B 2 2   ? -12.432 -12.680 0.895   1.00 0.00 ? 202 ILE B HD13 1  
ATOM 2605  N N    . LYS B 2 3   ? -9.857  -15.593 6.179   1.00 0.00 ? 203 LYS B N    1  
ATOM 2606  C CA   . LYS B 2 3   ? -8.507  -15.370 6.682   1.00 0.00 ? 203 LYS B CA   1  
ATOM 2607  C C    . LYS B 2 3   ? -7.481  -16.116 5.836   1.00 0.00 ? 203 LYS B C    1  
ATOM 2608  O O    . LYS B 2 3   ? -6.361  -15.645 5.662   1.00 0.00 ? 203 LYS B O    1  
ATOM 2609  C CB   . LYS B 2 3   ? -8.394  -15.771 8.154   1.00 0.00 ? 203 LYS B CB   1  
ATOM 2610  C CG   . LYS B 2 3   ? -9.082  -14.790 9.088   1.00 0.00 ? 203 LYS B CG   1  
ATOM 2611  C CD   . LYS B 2 3   ? -8.344  -14.652 10.407  1.00 0.00 ? 203 LYS B CD   1  
ATOM 2612  C CE   . LYS B 2 3   ? -8.548  -13.271 11.015  1.00 0.00 ? 203 LYS B CE   1  
ATOM 2613  N NZ   . LYS B 2 3   ? -9.988  -12.920 11.146  1.00 0.00 ? 203 LYS B NZ   1  
ATOM 2614  H H    . LYS B 2 3   ? -10.504 -16.079 6.739   1.00 0.00 ? 203 LYS B H    1  
ATOM 2615  H HA   . LYS B 2 3   ? -8.304  -14.312 6.599   1.00 0.00 ? 203 LYS B HA   1  
ATOM 2616  H HB2  . LYS B 2 3   ? -8.844  -16.745 8.291   1.00 0.00 ? 203 LYS B HB2  1  
ATOM 2617  H HB3  . LYS B 2 3   ? -7.351  -15.821 8.426   1.00 0.00 ? 203 LYS B HB3  1  
ATOM 2618  H HG2  . LYS B 2 3   ? -9.122  -13.824 8.609   1.00 0.00 ? 203 LYS B HG2  1  
ATOM 2619  H HG3  . LYS B 2 3   ? -10.086 -15.138 9.281   1.00 0.00 ? 203 LYS B HG3  1  
ATOM 2620  H HD2  . LYS B 2 3   ? -8.715  -15.396 11.097  1.00 0.00 ? 203 LYS B HD2  1  
ATOM 2621  H HD3  . LYS B 2 3   ? -7.290  -14.810 10.237  1.00 0.00 ? 203 LYS B HD3  1  
ATOM 2622  H HE2  . LYS B 2 3   ? -8.093  -13.253 11.994  1.00 0.00 ? 203 LYS B HE2  1  
ATOM 2623  H HE3  . LYS B 2 3   ? -8.065  -12.541 10.382  1.00 0.00 ? 203 LYS B HE3  1  
ATOM 2624  H HZ1  . LYS B 2 3   ? -10.508 -13.706 11.590  1.00 0.00 ? 203 LYS B HZ1  1  
ATOM 2625  H HZ2  . LYS B 2 3   ? -10.401 -12.729 10.204  1.00 0.00 ? 203 LYS B HZ2  1  
ATOM 2626  H HZ3  . LYS B 2 3   ? -10.098 -12.070 11.738  1.00 0.00 ? 203 LYS B HZ3  1  
ATOM 2627  N N    . ASN B 2 4   ? -7.866  -17.275 5.314   1.00 0.00 ? 204 ASN B N    1  
ATOM 2628  C CA   . ASN B 2 4   ? -6.972  -18.063 4.467   1.00 0.00 ? 204 ASN B CA   1  
ATOM 2629  C C    . ASN B 2 4   ? -6.600  -17.261 3.223   1.00 0.00 ? 204 ASN B C    1  
ATOM 2630  O O    . ASN B 2 4   ? -5.439  -17.230 2.810   1.00 0.00 ? 204 ASN B O    1  
ATOM 2631  C CB   . ASN B 2 4   ? -7.633  -19.388 4.071   1.00 0.00 ? 204 ASN B CB   1  
ATOM 2632  C CG   . ASN B 2 4   ? -7.011  -20.016 2.835   1.00 0.00 ? 204 ASN B CG   1  
ATOM 2633  O OD1  . ASN B 2 4   ? -5.926  -20.590 2.896   1.00 0.00 ? 204 ASN B OD1  1  
ATOM 2634  N ND2  . ASN B 2 4   ? -7.706  -19.927 1.710   1.00 0.00 ? 204 ASN B ND2  1  
ATOM 2635  H H    . ASN B 2 4   ? -8.773  -17.610 5.498   1.00 0.00 ? 204 ASN B H    1  
ATOM 2636  H HA   . ASN B 2 4   ? -6.074  -18.268 5.031   1.00 0.00 ? 204 ASN B HA   1  
ATOM 2637  H HB2  . ASN B 2 4   ? -7.537  -20.086 4.889   1.00 0.00 ? 204 ASN B HB2  1  
ATOM 2638  H HB3  . ASN B 2 4   ? -8.683  -19.213 3.876   1.00 0.00 ? 204 ASN B HB3  1  
ATOM 2639  H HD21 . ASN B 2 4   ? -8.576  -19.464 1.737   1.00 0.00 ? 204 ASN B HD21 1  
ATOM 2640  H HD22 . ASN B 2 4   ? -7.330  -20.327 0.897   1.00 0.00 ? 204 ASN B HD22 1  
ATOM 2641  N N    . ILE B 2 5   ? -7.591  -16.596 2.649   1.00 0.00 ? 205 ILE B N    1  
ATOM 2642  C CA   . ILE B 2 5   ? -7.381  -15.780 1.461   1.00 0.00 ? 205 ILE B CA   1  
ATOM 2643  C C    . ILE B 2 5   ? -6.546  -14.551 1.810   1.00 0.00 ? 205 ILE B C    1  
ATOM 2644  O O    . ILE B 2 5   ? -5.623  -14.181 1.078   1.00 0.00 ? 205 ILE B O    1  
ATOM 2645  C CB   . ILE B 2 5   ? -8.730  -15.357 0.832   1.00 0.00 ? 205 ILE B CB   1  
ATOM 2646  C CG1  . ILE B 2 5   ? -9.388  -16.560 0.151   1.00 0.00 ? 205 ILE B CG1  1  
ATOM 2647  C CG2  . ILE B 2 5   ? -8.550  -14.213 -0.158  1.00 0.00 ? 205 ILE B CG2  1  
ATOM 2648  C CD1  . ILE B 2 5   ? -8.448  -17.343 -0.743  1.00 0.00 ? 205 ILE B CD1  1  
ATOM 2649  H H    . ILE B 2 5   ? -8.490  -16.653 3.038   1.00 0.00 ? 205 ILE B H    1  
ATOM 2650  H HA   . ILE B 2 5   ? -6.839  -16.377 0.741   1.00 0.00 ? 205 ILE B HA   1  
ATOM 2651  H HB   . ILE B 2 5   ? -9.376  -15.011 1.624   1.00 0.00 ? 205 ILE B HB   1  
ATOM 2652  H HG12 . ILE B 2 5   ? -9.761  -17.235 0.906   1.00 0.00 ? 205 ILE B HG12 1  
ATOM 2653  H HG13 . ILE B 2 5   ? -10.213 -16.215 -0.456  1.00 0.00 ? 205 ILE B HG13 1  
ATOM 2654  H HG21 . ILE B 2 5   ? -9.517  -13.905 -0.532  1.00 0.00 ? 205 ILE B HG21 1  
ATOM 2655  H HG22 . ILE B 2 5   ? -7.934  -14.544 -0.983  1.00 0.00 ? 205 ILE B HG22 1  
ATOM 2656  H HG23 . ILE B 2 5   ? -8.073  -13.381 0.338   1.00 0.00 ? 205 ILE B HG23 1  
ATOM 2657  H HD11 . ILE B 2 5   ? -9.004  -18.101 -1.273  1.00 0.00 ? 205 ILE B HD11 1  
ATOM 2658  H HD12 . ILE B 2 5   ? -7.687  -17.811 -0.138  1.00 0.00 ? 205 ILE B HD12 1  
ATOM 2659  H HD13 . ILE B 2 5   ? -7.983  -16.674 -1.453  1.00 0.00 ? 205 ILE B HD13 1  
ATOM 2660  N N    . ALA B 2 6   ? -6.865  -13.939 2.945   1.00 0.00 ? 206 ALA B N    1  
ATOM 2661  C CA   . ALA B 2 6   ? -6.143  -12.767 3.415   1.00 0.00 ? 206 ALA B CA   1  
ATOM 2662  C C    . ALA B 2 6   ? -4.686  -13.116 3.686   1.00 0.00 ? 206 ALA B C    1  
ATOM 2663  O O    . ALA B 2 6   ? -3.783  -12.327 3.410   1.00 0.00 ? 206 ALA B O    1  
ATOM 2664  C CB   . ALA B 2 6   ? -6.798  -12.208 4.666   1.00 0.00 ? 206 ALA B CB   1  
ATOM 2665  H H    . ALA B 2 6   ? -7.618  -14.281 3.475   1.00 0.00 ? 206 ALA B H    1  
ATOM 2666  H HA   . ALA B 2 6   ? -6.188  -12.014 2.643   1.00 0.00 ? 206 ALA B HA   1  
ATOM 2667  H HB1  . ALA B 2 6   ? -6.259  -11.331 4.995   1.00 0.00 ? 206 ALA B HB1  1  
ATOM 2668  H HB2  . ALA B 2 6   ? -6.783  -12.953 5.448   1.00 0.00 ? 206 ALA B HB2  1  
ATOM 2669  H HB3  . ALA B 2 6   ? -7.819  -11.940 4.446   1.00 0.00 ? 206 ALA B HB3  1  
ATOM 2670  N N    . ARG B 2 7   ? -4.469  -14.310 4.219   1.00 0.00 ? 207 ARG B N    1  
ATOM 2671  C CA   . ARG B 2 7   ? -3.128  -14.784 4.518   1.00 0.00 ? 207 ARG B CA   1  
ATOM 2672  C C    . ARG B 2 7   ? -2.339  -14.984 3.232   1.00 0.00 ? 207 ARG B C    1  
ATOM 2673  O O    . ARG B 2 7   ? -1.132  -14.753 3.197   1.00 0.00 ? 207 ARG B O    1  
ATOM 2674  C CB   . ARG B 2 7   ? -3.184  -16.092 5.310   1.00 0.00 ? 207 ARG B CB   1  
ATOM 2675  C CG   . ARG B 2 7   ? -1.829  -16.533 5.838   1.00 0.00 ? 207 ARG B CG   1  
ATOM 2676  C CD   . ARG B 2 7   ? -1.873  -17.954 6.373   1.00 0.00 ? 207 ARG B CD   1  
ATOM 2677  N NE   . ARG B 2 7   ? -2.828  -18.105 7.473   1.00 0.00 ? 207 ARG B NE   1  
ATOM 2678  C CZ   . ARG B 2 7   ? -3.636  -19.157 7.619   1.00 0.00 ? 207 ARG B CZ   1  
ATOM 2679  N NH1  . ARG B 2 7   ? -3.623  -20.135 6.725   1.00 0.00 ? 207 ARG B NH1  1  
ATOM 2680  N NH2  . ARG B 2 7   ? -4.467  -19.224 8.655   1.00 0.00 ? 207 ARG B NH2  1  
ATOM 2681  H H    . ARG B 2 7   ? -5.237  -14.888 4.425   1.00 0.00 ? 207 ARG B H    1  
ATOM 2682  H HA   . ARG B 2 7   ? -2.635  -14.031 5.116   1.00 0.00 ? 207 ARG B HA   1  
ATOM 2683  H HB2  . ARG B 2 7   ? -3.851  -15.965 6.151   1.00 0.00 ? 207 ARG B HB2  1  
ATOM 2684  H HB3  . ARG B 2 7   ? -3.568  -16.872 4.670   1.00 0.00 ? 207 ARG B HB3  1  
ATOM 2685  H HG2  . ARG B 2 7   ? -1.109  -16.483 5.035   1.00 0.00 ? 207 ARG B HG2  1  
ATOM 2686  H HG3  . ARG B 2 7   ? -1.533  -15.867 6.633   1.00 0.00 ? 207 ARG B HG3  1  
ATOM 2687  H HD2  . ARG B 2 7   ? -2.157  -18.616 5.569   1.00 0.00 ? 207 ARG B HD2  1  
ATOM 2688  H HD3  . ARG B 2 7   ? -0.888  -18.221 6.726   1.00 0.00 ? 207 ARG B HD3  1  
ATOM 2689  H HE   . ARG B 2 7   ? -2.864  -17.379 8.145   1.00 0.00 ? 207 ARG B HE   1  
ATOM 2690  H HH11 . ARG B 2 7   ? -3.004  -20.088 5.929   1.00 0.00 ? 207 ARG B HH11 1  
ATOM 2691  H HH12 . ARG B 2 7   ? -4.238  -20.930 6.830   1.00 0.00 ? 207 ARG B HH12 1  
ATOM 2692  H HH21 . ARG B 2 7   ? -4.499  -18.478 9.331   1.00 0.00 ? 207 ARG B HH21 1  
ATOM 2693  H HH22 . ARG B 2 7   ? -5.061  -20.030 8.775   1.00 0.00 ? 207 ARG B HH22 1  
ATOM 2694  N N    . HIS B 2 8   ? -3.029  -15.407 2.177   1.00 0.00 ? 208 HIS B N    1  
ATOM 2695  C CA   . HIS B 2 8   ? -2.386  -15.633 0.888   1.00 0.00 ? 208 HIS B CA   1  
ATOM 2696  C C    . HIS B 2 8   ? -1.756  -14.345 0.375   1.00 0.00 ? 208 HIS B C    1  
ATOM 2697  O O    . HIS B 2 8   ? -0.555  -14.294 0.122   1.00 0.00 ? 208 HIS B O    1  
ATOM 2698  C CB   . HIS B 2 8   ? -3.389  -16.163 -0.137  1.00 0.00 ? 208 HIS B CB   1  
ATOM 2699  C CG   . HIS B 2 8   ? -2.776  -17.079 -1.149  1.00 0.00 ? 208 HIS B CG   1  
ATOM 2700  N ND1  . HIS B 2 8   ? -2.280  -16.652 -2.363  1.00 0.00 ? 208 HIS B ND1  1  
ATOM 2701  C CD2  . HIS B 2 8   ? -2.575  -18.416 -1.116  1.00 0.00 ? 208 HIS B CD2  1  
ATOM 2702  C CE1  . HIS B 2 8   ? -1.804  -17.687 -3.028  1.00 0.00 ? 208 HIS B CE1  1  
ATOM 2703  N NE2  . HIS B 2 8   ? -1.969  -18.770 -2.295  1.00 0.00 ? 208 HIS B NE2  1  
ATOM 2704  H H    . HIS B 2 8   ? -3.992  -15.571 2.268   1.00 0.00 ? 208 HIS B H    1  
ATOM 2705  H HA   . HIS B 2 8   ? -1.609  -16.368 1.031   1.00 0.00 ? 208 HIS B HA   1  
ATOM 2706  H HB2  . HIS B 2 8   ? -4.167  -16.707 0.378   1.00 0.00 ? 208 HIS B HB2  1  
ATOM 2707  H HB3  . HIS B 2 8   ? -3.829  -15.329 -0.663  1.00 0.00 ? 208 HIS B HB3  1  
ATOM 2708  H HD1  . HIS B 2 8   ? -2.265  -15.722 -2.688  1.00 0.00 ? 208 HIS B HD1  1  
ATOM 2709  H HD2  . HIS B 2 8   ? -2.844  -19.084 -0.310  1.00 0.00 ? 208 HIS B HD2  1  
ATOM 2710  H HE1  . HIS B 2 8   ? -1.355  -17.653 -4.009  1.00 0.00 ? 208 HIS B HE1  1  
ATOM 2711  H HE2  . HIS B 2 8   ? -1.476  -19.619 -2.433  1.00 0.00 ? 208 HIS B HE2  1  
ATOM 2712  N N    . LEU B 2 9   ? -2.565  -13.297 0.248   1.00 0.00 ? 209 LEU B N    1  
ATOM 2713  C CA   . LEU B 2 9   ? -2.067  -12.011 -0.231  1.00 0.00 ? 209 LEU B CA   1  
ATOM 2714  C C    . LEU B 2 9   ? -1.039  -11.446 0.743   1.00 0.00 ? 209 LEU B C    1  
ATOM 2715  O O    . LEU B 2 9   ? -0.086  -10.780 0.338   1.00 0.00 ? 209 LEU B O    1  
ATOM 2716  C CB   . LEU B 2 9   ? -3.214  -11.012 -0.453  1.00 0.00 ? 209 LEU B CB   1  
ATOM 2717  C CG   . LEU B 2 9   ? -4.133  -10.769 0.744   1.00 0.00 ? 209 LEU B CG   1  
ATOM 2718  C CD1  . LEU B 2 9   ? -3.914  -9.375  1.316   1.00 0.00 ? 209 LEU B CD1  1  
ATOM 2719  C CD2  . LEU B 2 9   ? -5.584  -10.959 0.336   1.00 0.00 ? 209 LEU B CD2  1  
ATOM 2720  H H    . LEU B 2 9   ? -3.515  -13.387 0.491   1.00 0.00 ? 209 LEU B H    1  
ATOM 2721  H HA   . LEU B 2 9   ? -1.575  -12.188 -1.176  1.00 0.00 ? 209 LEU B HA   1  
ATOM 2722  H HB2  . LEU B 2 9   ? -2.785  -10.064 -0.741  1.00 0.00 ? 209 LEU B HB2  1  
ATOM 2723  H HB3  . LEU B 2 9   ? -3.821  -11.373 -1.272  1.00 0.00 ? 209 LEU B HB3  1  
ATOM 2724  H HG   . LEU B 2 9   ? -3.904  -11.490 1.517   1.00 0.00 ? 209 LEU B HG   1  
ATOM 2725  H HD11 . LEU B 2 9   ? -2.906  -9.292  1.691   1.00 0.00 ? 209 LEU B HD11 1  
ATOM 2726  H HD12 . LEU B 2 9   ? -4.612  -9.200  2.123   1.00 0.00 ? 209 LEU B HD12 1  
ATOM 2727  H HD13 . LEU B 2 9   ? -4.071  -8.640  0.542   1.00 0.00 ? 209 LEU B HD13 1  
ATOM 2728  H HD21 . LEU B 2 9   ? -5.819  -10.294 -0.481  1.00 0.00 ? 209 LEU B HD21 1  
ATOM 2729  H HD22 . LEU B 2 9   ? -6.227  -10.739 1.175   1.00 0.00 ? 209 LEU B HD22 1  
ATOM 2730  H HD23 . LEU B 2 9   ? -5.740  -11.982 0.023   1.00 0.00 ? 209 LEU B HD23 1  
ATOM 2731  N N    . ALA B 2 10  ? -1.238  -11.720 2.026   1.00 0.00 ? 210 ALA B N    1  
ATOM 2732  C CA   . ALA B 2 10  ? -0.337  -11.250 3.063   1.00 0.00 ? 210 ALA B CA   1  
ATOM 2733  C C    . ALA B 2 10  ? 1.061   -11.844 2.911   1.00 0.00 ? 210 ALA B C    1  
ATOM 2734  O O    . ALA B 2 10  ? 2.037   -11.114 2.742   1.00 0.00 ? 210 ALA B O    1  
ATOM 2735  C CB   . ALA B 2 10  ? -0.899  -11.588 4.433   1.00 0.00 ? 210 ALA B CB   1  
ATOM 2736  H H    . ALA B 2 10  ? -2.022  -12.254 2.283   1.00 0.00 ? 210 ALA B H    1  
ATOM 2737  H HA   . ALA B 2 10  ? -0.270  -10.175 2.986   1.00 0.00 ? 210 ALA B HA   1  
ATOM 2738  H HB1  . ALA B 2 10  ? -1.895  -11.181 4.525   1.00 0.00 ? 210 ALA B HB1  1  
ATOM 2739  H HB2  . ALA B 2 10  ? -0.264  -11.163 5.196   1.00 0.00 ? 210 ALA B HB2  1  
ATOM 2740  H HB3  . ALA B 2 10  ? -0.935  -12.660 4.551   1.00 0.00 ? 210 ALA B HB3  1  
ATOM 2741  N N    . GLN B 2 11  ? 1.147   -13.170 2.955   1.00 0.00 ? 211 GLN B N    1  
ATOM 2742  C CA   . GLN B 2 11  ? 2.427   -13.864 2.851   1.00 0.00 ? 211 GLN B CA   1  
ATOM 2743  C C    . GLN B 2 11  ? 3.087   -13.628 1.496   1.00 0.00 ? 211 GLN B C    1  
ATOM 2744  O O    . GLN B 2 11  ? 4.293   -13.395 1.422   1.00 0.00 ? 211 GLN B O    1  
ATOM 2745  C CB   . GLN B 2 11  ? 2.245   -15.363 3.094   1.00 0.00 ? 211 GLN B CB   1  
ATOM 2746  C CG   . GLN B 2 11  ? 1.715   -15.692 4.479   1.00 0.00 ? 211 GLN B CG   1  
ATOM 2747  C CD   . GLN B 2 11  ? 1.666   -17.184 4.745   1.00 0.00 ? 211 GLN B CD   1  
ATOM 2748  O OE1  . GLN B 2 11  ? 1.555   -17.990 3.822   1.00 0.00 ? 211 GLN B OE1  1  
ATOM 2749  N NE2  . GLN B 2 11  ? 1.742   -17.562 6.010   1.00 0.00 ? 211 GLN B NE2  1  
ATOM 2750  H H    . GLN B 2 11  ? 0.321   -13.699 3.056   1.00 0.00 ? 211 GLN B H    1  
ATOM 2751  H HA   . GLN B 2 11  ? 3.075   -13.466 3.620   1.00 0.00 ? 211 GLN B HA   1  
ATOM 2752  H HB2  . GLN B 2 11  ? 1.551   -15.752 2.364   1.00 0.00 ? 211 GLN B HB2  1  
ATOM 2753  H HB3  . GLN B 2 11  ? 3.198   -15.854 2.971   1.00 0.00 ? 211 GLN B HB3  1  
ATOM 2754  H HG2  . GLN B 2 11  ? 2.357   -15.230 5.216   1.00 0.00 ? 211 GLN B HG2  1  
ATOM 2755  H HG3  . GLN B 2 11  ? 0.716   -15.294 4.571   1.00 0.00 ? 211 GLN B HG3  1  
ATOM 2756  H HE21 . GLN B 2 11  ? 1.826   -16.862 6.701   1.00 0.00 ? 211 GLN B HE21 1  
ATOM 2757  H HE22 . GLN B 2 11  ? 1.718   -18.522 6.210   1.00 0.00 ? 211 GLN B HE22 1  
ATOM 2758  N N    . VAL B 2 12  ? 2.297   -13.690 0.430   1.00 0.00 ? 212 VAL B N    1  
ATOM 2759  C CA   . VAL B 2 12  ? 2.819   -13.477 -0.916  1.00 0.00 ? 212 VAL B CA   1  
ATOM 2760  C C    . VAL B 2 12  ? 3.352   -12.053 -1.069  1.00 0.00 ? 212 VAL B C    1  
ATOM 2761  O O    . VAL B 2 12  ? 4.432   -11.842 -1.620  1.00 0.00 ? 212 VAL B O    1  
ATOM 2762  C CB   . VAL B 2 12  ? 1.745   -13.759 -1.995  1.00 0.00 ? 212 VAL B CB   1  
ATOM 2763  C CG1  . VAL B 2 12  ? 2.203   -13.284 -3.367  1.00 0.00 ? 212 VAL B CG1  1  
ATOM 2764  C CG2  . VAL B 2 12  ? 1.414   -15.245 -2.037  1.00 0.00 ? 212 VAL B CG2  1  
ATOM 2765  H H    . VAL B 2 12  ? 1.340   -13.889 0.550   1.00 0.00 ? 212 VAL B H    1  
ATOM 2766  H HA   . VAL B 2 12  ? 3.636   -14.171 -1.065  1.00 0.00 ? 212 VAL B HA   1  
ATOM 2767  H HB   . VAL B 2 12  ? 0.846   -13.219 -1.733  1.00 0.00 ? 212 VAL B HB   1  
ATOM 2768  H HG11 . VAL B 2 12  ? 2.517   -12.253 -3.306  1.00 0.00 ? 212 VAL B HG11 1  
ATOM 2769  H HG12 . VAL B 2 12  ? 1.386   -13.368 -4.068  1.00 0.00 ? 212 VAL B HG12 1  
ATOM 2770  H HG13 . VAL B 2 12  ? 3.029   -13.893 -3.702  1.00 0.00 ? 212 VAL B HG13 1  
ATOM 2771  H HG21 . VAL B 2 12  ? 2.298   -15.803 -2.312  1.00 0.00 ? 212 VAL B HG21 1  
ATOM 2772  H HG22 . VAL B 2 12  ? 0.636   -15.421 -2.768  1.00 0.00 ? 212 VAL B HG22 1  
ATOM 2773  H HG23 . VAL B 2 12  ? 1.074   -15.566 -1.064  1.00 0.00 ? 212 VAL B HG23 1  
ATOM 2774  N N    . GLY B 2 13  ? 2.602   -11.086 -0.550  1.00 0.00 ? 213 GLY B N    1  
ATOM 2775  C CA   . GLY B 2 13  ? 3.014   -9.701  -0.637  1.00 0.00 ? 213 GLY B CA   1  
ATOM 2776  C C    . GLY B 2 13  ? 4.244   -9.419  0.200   1.00 0.00 ? 213 GLY B C    1  
ATOM 2777  O O    . GLY B 2 13  ? 5.174   -8.762  -0.259  1.00 0.00 ? 213 GLY B O    1  
ATOM 2778  H H    . GLY B 2 13  ? 1.759   -11.315 -0.104  1.00 0.00 ? 213 GLY B H    1  
ATOM 2779  H HA2  . GLY B 2 13  ? 3.230   -9.464  -1.669  1.00 0.00 ? 213 GLY B HA2  1  
ATOM 2780  H HA3  . GLY B 2 13  ? 2.206   -9.073  -0.294  1.00 0.00 ? 213 GLY B HA3  1  
ATOM 2781  N N    . ASP B 2 14  ? 4.253   -9.944  1.422   1.00 0.00 ? 214 ASP B N    1  
ATOM 2782  C CA   . ASP B 2 14  ? 5.371   -9.745  2.343   1.00 0.00 ? 214 ASP B CA   1  
ATOM 2783  C C    . ASP B 2 14  ? 6.669   -10.294 1.765   1.00 0.00 ? 214 ASP B C    1  
ATOM 2784  O O    . ASP B 2 14  ? 7.706   -9.629  1.793   1.00 0.00 ? 214 ASP B O    1  
ATOM 2785  C CB   . ASP B 2 14  ? 5.091   -10.424 3.688   1.00 0.00 ? 214 ASP B CB   1  
ATOM 2786  C CG   . ASP B 2 14  ? 4.215   -9.590  4.601   1.00 0.00 ? 214 ASP B CG   1  
ATOM 2787  O OD1  . ASP B 2 14  ? 3.812   -8.484  4.204   1.00 0.00 ? 214 ASP B OD1  1  
ATOM 2788  O OD2  . ASP B 2 14  ? 3.909   -10.045 5.726   1.00 0.00 ? 214 ASP B OD2  1  
ATOM 2789  H H    . ASP B 2 14  ? 3.482   -10.476 1.720   1.00 0.00 ? 214 ASP B H    1  
ATOM 2790  H HA   . ASP B 2 14  ? 5.481   -8.684  2.503   1.00 0.00 ? 214 ASP B HA   1  
ATOM 2791  H HB2  . ASP B 2 14  ? 4.594   -11.365 3.511   1.00 0.00 ? 214 ASP B HB2  1  
ATOM 2792  H HB3  . ASP B 2 14  ? 6.029   -10.609 4.192   1.00 0.00 ? 214 ASP B HB3  1  
ATOM 2793  N N    . SER B 2 15  ? 6.604   -11.503 1.223   1.00 0.00 ? 215 SER B N    1  
ATOM 2794  C CA   . SER B 2 15  ? 7.781   -12.147 0.661   1.00 0.00 ? 215 SER B CA   1  
ATOM 2795  C C    . SER B 2 15  ? 8.242   -11.469 -0.625  1.00 0.00 ? 215 SER B C    1  
ATOM 2796  O O    . SER B 2 15  ? 9.426   -11.179 -0.783  1.00 0.00 ? 215 SER B O    1  
ATOM 2797  C CB   . SER B 2 15  ? 7.503   -13.633 0.410   1.00 0.00 ? 215 SER B CB   1  
ATOM 2798  O OG   . SER B 2 15  ? 6.269   -13.822 -0.264  1.00 0.00 ? 215 SER B OG   1  
ATOM 2799  H H    . SER B 2 15  ? 5.742   -11.972 1.197   1.00 0.00 ? 215 SER B H    1  
ATOM 2800  H HA   . SER B 2 15  ? 8.571   -12.065 1.391   1.00 0.00 ? 215 SER B HA   1  
ATOM 2801  H HB2  . SER B 2 15  ? 8.295   -14.048 -0.195  1.00 0.00 ? 215 SER B HB2  1  
ATOM 2802  H HB3  . SER B 2 15  ? 7.465   -14.155 1.357   1.00 0.00 ? 215 SER B HB3  1  
ATOM 2803  H HG   . SER B 2 15  ? 5.543   -13.774 0.376   1.00 0.00 ? 215 SER B HG   1  
ATOM 2804  N N    . MET B 2 16  ? 7.304   -11.199 -1.525  1.00 0.00 ? 216 MET B N    1  
ATOM 2805  C CA   . MET B 2 16  ? 7.625   -10.581 -2.808  1.00 0.00 ? 216 MET B CA   1  
ATOM 2806  C C    . MET B 2 16  ? 8.215   -9.186  -2.640  1.00 0.00 ? 216 MET B C    1  
ATOM 2807  O O    . MET B 2 16  ? 9.190   -8.838  -3.308  1.00 0.00 ? 216 MET B O    1  
ATOM 2808  C CB   . MET B 2 16  ? 6.384   -10.507 -3.689  1.00 0.00 ? 216 MET B CB   1  
ATOM 2809  C CG   . MET B 2 16  ? 6.700   -10.369 -5.167  1.00 0.00 ? 216 MET B CG   1  
ATOM 2810  S SD   . MET B 2 16  ? 6.884   -11.963 -5.993  1.00 0.00 ? 216 MET B SD   1  
ATOM 2811  C CE   . MET B 2 16  ? 5.295   -12.710 -5.635  1.00 0.00 ? 216 MET B CE   1  
ATOM 2812  H H    . MET B 2 16  ? 6.368   -11.419 -1.322  1.00 0.00 ? 216 MET B H    1  
ATOM 2813  H HA   . MET B 2 16  ? 8.357   -11.206 -3.296  1.00 0.00 ? 216 MET B HA   1  
ATOM 2814  H HB2  . MET B 2 16  ? 5.802   -11.405 -3.549  1.00 0.00 ? 216 MET B HB2  1  
ATOM 2815  H HB3  . MET B 2 16  ? 5.794   -9.655  -3.389  1.00 0.00 ? 216 MET B HB3  1  
ATOM 2816  H HG2  . MET B 2 16  ? 5.899   -9.823  -5.643  1.00 0.00 ? 216 MET B HG2  1  
ATOM 2817  H HG3  . MET B 2 16  ? 7.622   -9.817  -5.271  1.00 0.00 ? 216 MET B HG3  1  
ATOM 2818  H HE1  . MET B 2 16  ? 5.259   -13.700 -6.066  1.00 0.00 ? 216 MET B HE1  1  
ATOM 2819  H HE2  . MET B 2 16  ? 4.508   -12.103 -6.062  1.00 0.00 ? 216 MET B HE2  1  
ATOM 2820  H HE3  . MET B 2 16  ? 5.159   -12.775 -4.565  1.00 0.00 ? 216 MET B HE3  1  
ATOM 2821  N N    . ASP B 2 17  ? 7.623   -8.390  -1.755  1.00 0.00 ? 217 ASP B N    1  
ATOM 2822  C CA   . ASP B 2 17  ? 8.098   -7.030  -1.519  1.00 0.00 ? 217 ASP B CA   1  
ATOM 2823  C C    . ASP B 2 17  ? 9.539   -7.035  -1.033  1.00 0.00 ? 217 ASP B C    1  
ATOM 2824  O O    . ASP B 2 17  ? 10.402  -6.396  -1.628  1.00 0.00 ? 217 ASP B O    1  
ATOM 2825  C CB   . ASP B 2 17  ? 7.214   -6.305  -0.505  1.00 0.00 ? 217 ASP B CB   1  
ATOM 2826  C CG   . ASP B 2 17  ? 7.809   -4.979  -0.073  1.00 0.00 ? 217 ASP B CG   1  
ATOM 2827  O OD1  . ASP B 2 17  ? 8.179   -4.170  -0.950  1.00 0.00 ? 217 ASP B OD1  1  
ATOM 2828  O OD2  . ASP B 2 17  ? 7.921   -4.747  1.147   1.00 0.00 ? 217 ASP B OD2  1  
ATOM 2829  H H    . ASP B 2 17  ? 6.852   -8.725  -1.242  1.00 0.00 ? 217 ASP B H    1  
ATOM 2830  H HA   . ASP B 2 17  ? 8.054   -6.501  -2.460  1.00 0.00 ? 217 ASP B HA   1  
ATOM 2831  H HB2  . ASP B 2 17  ? 6.247   -6.118  -0.947  1.00 0.00 ? 217 ASP B HB2  1  
ATOM 2832  H HB3  . ASP B 2 17  ? 7.096   -6.928  0.368   1.00 0.00 ? 217 ASP B HB3  1  
ATOM 2833  N N    . ARG B 2 18  ? 9.802   -7.772  0.038   1.00 0.00 ? 218 ARG B N    1  
ATOM 2834  C CA   . ARG B 2 18  ? 11.146  -7.858  0.605   1.00 0.00 ? 218 ARG B CA   1  
ATOM 2835  C C    . ARG B 2 18  ? 12.044  -8.783  -0.221  1.00 0.00 ? 218 ARG B C    1  
ATOM 2836  O O    . ARG B 2 18  ? 12.942  -9.426  0.323   1.00 0.00 ? 218 ARG B O    1  
ATOM 2837  C CB   . ARG B 2 18  ? 11.077  -8.354  2.051   1.00 0.00 ? 218 ARG B CB   1  
ATOM 2838  C CG   . ARG B 2 18  ? 10.285  -7.444  2.977   1.00 0.00 ? 218 ARG B CG   1  
ATOM 2839  C CD   . ARG B 2 18  ? 10.933  -6.075  3.120   1.00 0.00 ? 218 ARG B CD   1  
ATOM 2840  N NE   . ARG B 2 18  ? 10.303  -5.075  2.256   1.00 0.00 ? 218 ARG B NE   1  
ATOM 2841  C CZ   . ARG B 2 18  ? 10.880  -3.936  1.881   1.00 0.00 ? 218 ARG B CZ   1  
ATOM 2842  N NH1  . ARG B 2 18  ? 12.083  -3.608  2.338   1.00 0.00 ? 218 ARG B NH1  1  
ATOM 2843  N NH2  . ARG B 2 18  ? 10.237  -3.115  1.058   1.00 0.00 ? 218 ARG B NH2  1  
ATOM 2844  H H    . ARG B 2 18  ? 9.075   -8.284  0.456   1.00 0.00 ? 218 ARG B H    1  
ATOM 2845  H HA   . ARG B 2 18  ? 11.571  -6.864  0.598   1.00 0.00 ? 218 ARG B HA   1  
ATOM 2846  H HB2  . ARG B 2 18  ? 10.617  -9.332  2.063   1.00 0.00 ? 218 ARG B HB2  1  
ATOM 2847  H HB3  . ARG B 2 18  ? 12.082  -8.437  2.438   1.00 0.00 ? 218 ARG B HB3  1  
ATOM 2848  H HG2  . ARG B 2 18  ? 9.290   -7.319  2.575   1.00 0.00 ? 218 ARG B HG2  1  
ATOM 2849  H HG3  . ARG B 2 18  ? 10.223  -7.905  3.951   1.00 0.00 ? 218 ARG B HG3  1  
ATOM 2850  H HD2  . ARG B 2 18  ? 10.846  -5.753  4.146   1.00 0.00 ? 218 ARG B HD2  1  
ATOM 2851  H HD3  . ARG B 2 18  ? 11.977  -6.157  2.856   1.00 0.00 ? 218 ARG B HD3  1  
ATOM 2852  H HE   . ARG B 2 18  ? 9.388   -5.273  1.921   1.00 0.00 ? 218 ARG B HE   1  
ATOM 2853  H HH11 . ARG B 2 18  ? 12.570  -4.218  2.977   1.00 0.00 ? 218 ARG B HH11 1  
ATOM 2854  H HH12 . ARG B 2 18  ? 12.518  -2.747  2.047   1.00 0.00 ? 218 ARG B HH12 1  
ATOM 2855  H HH21 . ARG B 2 18  ? 9.313   -3.359  0.724   1.00 0.00 ? 218 ARG B HH21 1  
ATOM 2856  H HH22 . ARG B 2 18  ? 10.664  -2.254  0.757   1.00 0.00 ? 218 ARG B HH22 1  
ATOM 2857  N N    . SER B 2 19  ? 11.800  -8.832  -1.532  1.00 0.00 ? 219 SER B N    1  
ATOM 2858  C CA   . SER B 2 19  ? 12.561  -9.673  -2.455  1.00 0.00 ? 219 SER B CA   1  
ATOM 2859  C C    . SER B 2 19  ? 12.292  -11.152 -2.186  1.00 0.00 ? 219 SER B C    1  
ATOM 2860  O O    . SER B 2 19  ? 12.938  -11.777 -1.341  1.00 0.00 ? 219 SER B O    1  
ATOM 2861  C CB   . SER B 2 19  ? 14.060  -9.362  -2.370  1.00 0.00 ? 219 SER B CB   1  
ATOM 2862  O OG   . SER B 2 19  ? 14.288  -7.967  -2.489  1.00 0.00 ? 219 SER B OG   1  
ATOM 2863  H H    . SER B 2 19  ? 11.074  -8.278  -1.893  1.00 0.00 ? 219 SER B H    1  
ATOM 2864  H HA   . SER B 2 19  ? 12.218  -9.444  -3.454  1.00 0.00 ? 219 SER B HA   1  
ATOM 2865  H HB2  . SER B 2 19  ? 14.444  -9.699  -1.419  1.00 0.00 ? 219 SER B HB2  1  
ATOM 2866  H HB3  . SER B 2 19  ? 14.578  -9.870  -3.169  1.00 0.00 ? 219 SER B HB3  1  
ATOM 2867  H HG   . SER B 2 19  ? 13.966  -7.522  -1.692  1.00 0.00 ? 219 SER B HG   1  
ATOM 2868  N N    . ILE B 2 20  ? 11.320  -11.699 -2.902  1.00 0.00 ? 220 ILE B N    1  
ATOM 2869  C CA   . ILE B 2 20  ? 10.938  -13.096 -2.750  1.00 0.00 ? 220 ILE B CA   1  
ATOM 2870  C C    . ILE B 2 20  ? 12.114  -14.027 -3.038  1.00 0.00 ? 220 ILE B C    1  
ATOM 2871  O O    . ILE B 2 20  ? 12.322  -14.970 -2.249  1.00 0.00 ? 220 ILE B O    1  
ATOM 2872  C CB   . ILE B 2 20  ? 9.735   -13.452 -3.654  1.00 0.00 ? 220 ILE B CB   1  
ATOM 2873  C CG1  . ILE B 2 20  ? 9.345   -14.924 -3.479  1.00 0.00 ? 220 ILE B CG1  1  
ATOM 2874  C CG2  . ILE B 2 20  ? 10.048  -13.144 -5.112  1.00 0.00 ? 220 ILE B CG2  1  
ATOM 2875  C CD1  . ILE B 2 20  ? 8.018   -15.283 -4.113  1.00 0.00 ? 220 ILE B CD1  1  
ATOM 2876  O OXT  . ILE B 2 20  ? 12.834  -13.799 -4.034  1.00 0.00 ? 220 ILE B OXT  1  
ATOM 2877  H H    . ILE B 2 20  ? 10.842  -11.144 -3.552  1.00 0.00 ? 220 ILE B H    1  
ATOM 2878  H HA   . ILE B 2 20  ? 10.636  -13.236 -1.722  1.00 0.00 ? 220 ILE B HA   1  
ATOM 2879  H HB   . ILE B 2 20  ? 8.901   -12.833 -3.357  1.00 0.00 ? 220 ILE B HB   1  
ATOM 2880  H HG12 . ILE B 2 20  ? 10.105  -15.544 -3.929  1.00 0.00 ? 220 ILE B HG12 1  
ATOM 2881  H HG13 . ILE B 2 20  ? 9.282   -15.150 -2.424  1.00 0.00 ? 220 ILE B HG13 1  
ATOM 2882  H HG21 . ILE B 2 20  ? 10.926  -13.692 -5.414  1.00 0.00 ? 220 ILE B HG21 1  
ATOM 2883  H HG22 . ILE B 2 20  ? 10.228  -12.083 -5.225  1.00 0.00 ? 220 ILE B HG22 1  
ATOM 2884  H HG23 . ILE B 2 20  ? 9.211   -13.435 -5.729  1.00 0.00 ? 220 ILE B HG23 1  
ATOM 2885  H HD11 . ILE B 2 20  ? 8.061   -15.087 -5.175  1.00 0.00 ? 220 ILE B HD11 1  
ATOM 2886  H HD12 . ILE B 2 20  ? 7.233   -14.688 -3.669  1.00 0.00 ? 220 ILE B HD12 1  
ATOM 2887  H HD13 . ILE B 2 20  ? 7.812   -16.330 -3.949  1.00 0.00 ? 220 ILE B HD13 1  
ATOM 2888  N N    . ALA A 1 1   ? 10.963  20.355  19.843  1.00 0.00 ? 1   ALA A N    2  
ATOM 2889  C CA   . ALA A 1 1   ? 10.290  21.055  18.725  1.00 0.00 ? 1   ALA A CA   2  
ATOM 2890  C C    . ALA A 1 1   ? 9.566   20.062  17.826  1.00 0.00 ? 1   ALA A C    2  
ATOM 2891  O O    . ALA A 1 1   ? 10.180  19.148  17.272  1.00 0.00 ? 1   ALA A O    2  
ATOM 2892  C CB   . ALA A 1 1   ? 11.298  21.860  17.918  1.00 0.00 ? 1   ALA A CB   2  
ATOM 2893  H H1   . ALA A 1 1   ? 11.447  21.043  20.460  1.00 0.00 ? 1   ALA A H1   2  
ATOM 2894  H H2   . ALA A 1 1   ? 11.664  19.682  19.478  1.00 0.00 ? 1   ALA A H2   2  
ATOM 2895  H H3   . ALA A 1 1   ? 10.259  19.831  20.412  1.00 0.00 ? 1   ALA A H3   2  
ATOM 2896  H HA   . ALA A 1 1   ? 9.568   21.741  19.141  1.00 0.00 ? 1   ALA A HA   2  
ATOM 2897  H HB1  . ALA A 1 1   ? 11.784  22.578  18.563  1.00 0.00 ? 1   ALA A HB1  2  
ATOM 2898  H HB2  . ALA A 1 1   ? 10.787  22.380  17.121  1.00 0.00 ? 1   ALA A HB2  2  
ATOM 2899  H HB3  . ALA A 1 1   ? 12.037  21.194  17.500  1.00 0.00 ? 1   ALA A HB3  2  
ATOM 2900  N N    . THR A 1 2   ? 8.261   20.246  17.684  1.00 0.00 ? 2   THR A N    2  
ATOM 2901  C CA   . THR A 1 2   ? 7.449   19.371  16.854  1.00 0.00 ? 2   THR A CA   2  
ATOM 2902  C C    . THR A 1 2   ? 6.894   20.136  15.655  1.00 0.00 ? 2   THR A C    2  
ATOM 2903  O O    . THR A 1 2   ? 6.289   21.198  15.814  1.00 0.00 ? 2   THR A O    2  
ATOM 2904  C CB   . THR A 1 2   ? 6.281   18.772  17.660  1.00 0.00 ? 2   THR A CB   2  
ATOM 2905  O OG1  . THR A 1 2   ? 6.691   18.529  19.015  1.00 0.00 ? 2   THR A OG1  2  
ATOM 2906  C CG2  . THR A 1 2   ? 5.799   17.472  17.033  1.00 0.00 ? 2   THR A CG2  2  
ATOM 2907  H H    . THR A 1 2   ? 7.826   20.995  18.153  1.00 0.00 ? 2   THR A H    2  
ATOM 2908  H HA   . THR A 1 2   ? 8.075   18.563  16.503  1.00 0.00 ? 2   THR A HA   2  
ATOM 2909  H HB   . THR A 1 2   ? 5.462   19.480  17.661  1.00 0.00 ? 2   THR A HB   2  
ATOM 2910  H HG1  . THR A 1 2   ? 6.016   18.883  19.618  1.00 0.00 ? 2   THR A HG1  2  
ATOM 2911  H HG21 . THR A 1 2   ? 6.599   16.748  17.049  1.00 0.00 ? 2   THR A HG21 2  
ATOM 2912  H HG22 . THR A 1 2   ? 5.501   17.655  16.012  1.00 0.00 ? 2   THR A HG22 2  
ATOM 2913  H HG23 . THR A 1 2   ? 4.955   17.092  17.591  1.00 0.00 ? 2   THR A HG23 2  
ATOM 2914  N N    . PRO A 1 3   ? 7.122   19.626  14.438  1.00 0.00 ? 3   PRO A N    2  
ATOM 2915  C CA   . PRO A 1 3   ? 6.635   20.258  13.219  1.00 0.00 ? 3   PRO A CA   2  
ATOM 2916  C C    . PRO A 1 3   ? 5.159   19.960  12.967  1.00 0.00 ? 3   PRO A C    2  
ATOM 2917  O O    . PRO A 1 3   ? 4.784   18.822  12.668  1.00 0.00 ? 3   PRO A O    2  
ATOM 2918  C CB   . PRO A 1 3   ? 7.514   19.642  12.129  1.00 0.00 ? 3   PRO A CB   2  
ATOM 2919  C CG   . PRO A 1 3   ? 7.913   18.302  12.655  1.00 0.00 ? 3   PRO A CG   2  
ATOM 2920  C CD   . PRO A 1 3   ? 7.889   18.397  14.159  1.00 0.00 ? 3   PRO A CD   2  
ATOM 2921  H HA   . PRO A 1 3   ? 6.784   21.329  13.245  1.00 0.00 ? 3   PRO A HA   2  
ATOM 2922  H HB2  . PRO A 1 3   ? 6.947   19.554  11.214  1.00 0.00 ? 3   PRO A HB2  2  
ATOM 2923  H HB3  . PRO A 1 3   ? 8.376   20.271  11.963  1.00 0.00 ? 3   PRO A HB3  2  
ATOM 2924  H HG2  . PRO A 1 3   ? 7.210   17.555  12.319  1.00 0.00 ? 3   PRO A HG2  2  
ATOM 2925  H HG3  . PRO A 1 3   ? 8.909   18.060  12.316  1.00 0.00 ? 3   PRO A HG3  2  
ATOM 2926  H HD2  . PRO A 1 3   ? 7.395   17.534  14.582  1.00 0.00 ? 3   PRO A HD2  2  
ATOM 2927  H HD3  . PRO A 1 3   ? 8.893   18.479  14.545  1.00 0.00 ? 3   PRO A HD3  2  
ATOM 2928  N N    . ALA A 1 4   ? 4.322   20.980  13.113  1.00 0.00 ? 4   ALA A N    2  
ATOM 2929  C CA   . ALA A 1 4   ? 2.888   20.833  12.902  1.00 0.00 ? 4   ALA A CA   2  
ATOM 2930  C C    . ALA A 1 4   ? 2.575   20.619  11.426  1.00 0.00 ? 4   ALA A C    2  
ATOM 2931  O O    . ALA A 1 4   ? 2.843   21.487  10.591  1.00 0.00 ? 4   ALA A O    2  
ATOM 2932  C CB   . ALA A 1 4   ? 2.146   22.050  13.432  1.00 0.00 ? 4   ALA A CB   2  
ATOM 2933  H H    . ALA A 1 4   ? 4.678   21.858  13.371  1.00 0.00 ? 4   ALA A H    2  
ATOM 2934  H HA   . ALA A 1 4   ? 2.558   19.967  13.459  1.00 0.00 ? 4   ALA A HA   2  
ATOM 2935  H HB1  . ALA A 1 4   ? 2.399   22.203  14.472  1.00 0.00 ? 4   ALA A HB1  2  
ATOM 2936  H HB2  . ALA A 1 4   ? 1.083   21.889  13.340  1.00 0.00 ? 4   ALA A HB2  2  
ATOM 2937  H HB3  . ALA A 1 4   ? 2.430   22.922  12.862  1.00 0.00 ? 4   ALA A HB3  2  
ATOM 2938  N N    . SER A 1 5   ? 2.011   19.461  11.117  1.00 0.00 ? 5   SER A N    2  
ATOM 2939  C CA   . SER A 1 5   ? 1.663   19.107  9.749   1.00 0.00 ? 5   SER A CA   2  
ATOM 2940  C C    . SER A 1 5   ? 0.552   20.007  9.210   1.00 0.00 ? 5   SER A C    2  
ATOM 2941  O O    . SER A 1 5   ? -0.538  20.083  9.784   1.00 0.00 ? 5   SER A O    2  
ATOM 2942  C CB   . SER A 1 5   ? 1.241   17.639  9.692   1.00 0.00 ? 5   SER A CB   2  
ATOM 2943  O OG   . SER A 1 5   ? 2.201   16.817  10.335  1.00 0.00 ? 5   SER A OG   2  
ATOM 2944  H H    . SER A 1 5   ? 1.812   18.824  11.835  1.00 0.00 ? 5   SER A H    2  
ATOM 2945  H HA   . SER A 1 5   ? 2.543   19.243  9.139   1.00 0.00 ? 5   SER A HA   2  
ATOM 2946  H HB2  . SER A 1 5   ? 0.290   17.519  10.189  1.00 0.00 ? 5   SER A HB2  2  
ATOM 2947  H HB3  . SER A 1 5   ? 1.150   17.329  8.661   1.00 0.00 ? 5   SER A HB3  2  
ATOM 2948  H HG   . SER A 1 5   ? 3.059   16.921  9.890   1.00 0.00 ? 5   SER A HG   2  
ATOM 2949  N N    . ALA A 1 6   ? 0.847   20.694  8.115   1.00 0.00 ? 6   ALA A N    2  
ATOM 2950  C CA   . ALA A 1 6   ? -0.111  21.593  7.488   1.00 0.00 ? 6   ALA A CA   2  
ATOM 2951  C C    . ALA A 1 6   ? -1.090  20.847  6.569   1.00 0.00 ? 6   ALA A C    2  
ATOM 2952  O O    . ALA A 1 6   ? -2.304  21.026  6.696   1.00 0.00 ? 6   ALA A O    2  
ATOM 2953  C CB   . ALA A 1 6   ? 0.615   22.695  6.726   1.00 0.00 ? 6   ALA A CB   2  
ATOM 2954  H H    . ALA A 1 6   ? 1.744   20.599  7.719   1.00 0.00 ? 6   ALA A H    2  
ATOM 2955  H HA   . ALA A 1 6   ? -0.677  22.063  8.281   1.00 0.00 ? 6   ALA A HA   2  
ATOM 2956  H HB1  . ALA A 1 6   ? -0.103  23.407  6.348   1.00 0.00 ? 6   ALA A HB1  2  
ATOM 2957  H HB2  . ALA A 1 6   ? 1.161   22.262  5.902   1.00 0.00 ? 6   ALA A HB2  2  
ATOM 2958  H HB3  . ALA A 1 6   ? 1.305   23.195  7.389   1.00 0.00 ? 6   ALA A HB3  2  
ATOM 2959  N N    . PRO A 1 7   ? -0.606  20.007  5.621   1.00 0.00 ? 7   PRO A N    2  
ATOM 2960  C CA   . PRO A 1 7   ? -1.488  19.270  4.710   1.00 0.00 ? 7   PRO A CA   2  
ATOM 2961  C C    . PRO A 1 7   ? -2.317  18.209  5.425   1.00 0.00 ? 7   PRO A C    2  
ATOM 2962  O O    . PRO A 1 7   ? -1.839  17.540  6.347   1.00 0.00 ? 7   PRO A O    2  
ATOM 2963  C CB   . PRO A 1 7   ? -0.530  18.605  3.710   1.00 0.00 ? 7   PRO A CB   2  
ATOM 2964  C CG   . PRO A 1 7   ? 0.782   19.285  3.906   1.00 0.00 ? 7   PRO A CG   2  
ATOM 2965  C CD   . PRO A 1 7   ? 0.810   19.711  5.342   1.00 0.00 ? 7   PRO A CD   2  
ATOM 2966  H HA   . PRO A 1 7   ? -2.151  19.940  4.181   1.00 0.00 ? 7   PRO A HA   2  
ATOM 2967  H HB2  . PRO A 1 7   ? -0.462  17.549  3.923   1.00 0.00 ? 7   PRO A HB2  2  
ATOM 2968  H HB3  . PRO A 1 7   ? -0.901  18.751  2.707   1.00 0.00 ? 7   PRO A HB3  2  
ATOM 2969  H HG2  . PRO A 1 7   ? 1.587   18.595  3.701   1.00 0.00 ? 7   PRO A HG2  2  
ATOM 2970  H HG3  . PRO A 1 7   ? 0.850   20.147  3.258   1.00 0.00 ? 7   PRO A HG3  2  
ATOM 2971  H HD2  . PRO A 1 7   ? 1.170   18.908  5.969   1.00 0.00 ? 7   PRO A HD2  2  
ATOM 2972  H HD3  . PRO A 1 7   ? 1.420   20.592  5.465   1.00 0.00 ? 7   PRO A HD3  2  
ATOM 2973  N N    . ASP A 1 8   ? -3.561  18.069  5.003   1.00 0.00 ? 8   ASP A N    2  
ATOM 2974  C CA   . ASP A 1 8   ? -4.464  17.087  5.580   1.00 0.00 ? 8   ASP A CA   2  
ATOM 2975  C C    . ASP A 1 8   ? -4.285  15.735  4.892   1.00 0.00 ? 8   ASP A C    2  
ATOM 2976  O O    . ASP A 1 8   ? -3.848  15.671  3.741   1.00 0.00 ? 8   ASP A O    2  
ATOM 2977  C CB   . ASP A 1 8   ? -5.913  17.562  5.453   1.00 0.00 ? 8   ASP A CB   2  
ATOM 2978  C CG   . ASP A 1 8   ? -6.911  16.483  5.815   1.00 0.00 ? 8   ASP A CG   2  
ATOM 2979  O OD1  . ASP A 1 8   ? -6.966  16.089  6.997   1.00 0.00 ? 8   ASP A OD1  2  
ATOM 2980  O OD2  . ASP A 1 8   ? -7.632  16.008  4.913   1.00 0.00 ? 8   ASP A OD2  2  
ATOM 2981  H H    . ASP A 1 8   ? -3.889  18.656  4.279   1.00 0.00 ? 8   ASP A H    2  
ATOM 2982  H HA   . ASP A 1 8   ? -4.217  16.983  6.626   1.00 0.00 ? 8   ASP A HA   2  
ATOM 2983  H HB2  . ASP A 1 8   ? -6.069  18.404  6.112   1.00 0.00 ? 8   ASP A HB2  2  
ATOM 2984  H HB3  . ASP A 1 8   ? -6.096  17.871  4.433   1.00 0.00 ? 8   ASP A HB3  2  
ATOM 2985  N N    . THR A 1 9   ? -4.618  14.665  5.604   1.00 0.00 ? 9   THR A N    2  
ATOM 2986  C CA   . THR A 1 9   ? -4.494  13.312  5.076   1.00 0.00 ? 9   THR A CA   2  
ATOM 2987  C C    . THR A 1 9   ? -5.239  13.146  3.748   1.00 0.00 ? 9   THR A C    2  
ATOM 2988  O O    . THR A 1 9   ? -4.711  12.553  2.807   1.00 0.00 ? 9   THR A O    2  
ATOM 2989  C CB   . THR A 1 9   ? -5.029  12.284  6.090   1.00 0.00 ? 9   THR A CB   2  
ATOM 2990  O OG1  . THR A 1 9   ? -4.646  12.671  7.418   1.00 0.00 ? 9   THR A OG1  2  
ATOM 2991  C CG2  . THR A 1 9   ? -4.496  10.890  5.782   1.00 0.00 ? 9   THR A CG2  2  
ATOM 2992  H H    . THR A 1 9   ? -4.962  14.787  6.518   1.00 0.00 ? 9   THR A H    2  
ATOM 2993  H HA   . THR A 1 9   ? -3.446  13.113  4.917   1.00 0.00 ? 9   THR A HA   2  
ATOM 2994  H HB   . THR A 1 9   ? -6.109  12.263  6.025   1.00 0.00 ? 9   THR A HB   2  
ATOM 2995  H HG1  . THR A 1 9   ? -4.526  11.876  7.962   1.00 0.00 ? 9   THR A HG1  2  
ATOM 2996  H HG21 . THR A 1 9   ? -4.845  10.195  6.534   1.00 0.00 ? 9   THR A HG21 2  
ATOM 2997  H HG22 . THR A 1 9   ? -3.416  10.908  5.783   1.00 0.00 ? 9   THR A HG22 2  
ATOM 2998  H HG23 . THR A 1 9   ? -4.851  10.576  4.812   1.00 0.00 ? 9   THR A HG23 2  
ATOM 2999  N N    . ARG A 1 10  ? -6.446  13.697  3.660   1.00 0.00 ? 10  ARG A N    2  
ATOM 3000  C CA   . ARG A 1 10  ? -7.250  13.584  2.446   1.00 0.00 ? 10  ARG A CA   2  
ATOM 3001  C C    . ARG A 1 10  ? -6.601  14.332  1.286   1.00 0.00 ? 10  ARG A C    2  
ATOM 3002  O O    . ARG A 1 10  ? -6.670  13.887  0.142   1.00 0.00 ? 10  ARG A O    2  
ATOM 3003  C CB   . ARG A 1 10  ? -8.666  14.107  2.681   1.00 0.00 ? 10  ARG A CB   2  
ATOM 3004  C CG   . ARG A 1 10  ? -9.587  13.092  3.335   1.00 0.00 ? 10  ARG A CG   2  
ATOM 3005  C CD   . ARG A 1 10  ? -10.337 13.694  4.512   1.00 0.00 ? 10  ARG A CD   2  
ATOM 3006  N NE   . ARG A 1 10  ? -9.427  14.137  5.565   1.00 0.00 ? 10  ARG A NE   2  
ATOM 3007  C CZ   . ARG A 1 10  ? -9.316  13.546  6.753   1.00 0.00 ? 10  ARG A CZ   2  
ATOM 3008  N NH1  . ARG A 1 10  ? -10.056 12.486  7.050   1.00 0.00 ? 10  ARG A NH1  2  
ATOM 3009  N NH2  . ARG A 1 10  ? -8.462  14.016  7.650   1.00 0.00 ? 10  ARG A NH2  2  
ATOM 3010  H H    . ARG A 1 10  ? -6.800  14.205  4.427   1.00 0.00 ? 10  ARG A H    2  
ATOM 3011  H HA   . ARG A 1 10  ? -7.307  12.537  2.189   1.00 0.00 ? 10  ARG A HA   2  
ATOM 3012  H HB2  . ARG A 1 10  ? -8.614  14.979  3.318   1.00 0.00 ? 10  ARG A HB2  2  
ATOM 3013  H HB3  . ARG A 1 10  ? -9.095  14.393  1.730   1.00 0.00 ? 10  ARG A HB3  2  
ATOM 3014  H HG2  . ARG A 1 10  ? -10.304 12.748  2.605   1.00 0.00 ? 10  ARG A HG2  2  
ATOM 3015  H HG3  . ARG A 1 10  ? -8.999  12.257  3.685   1.00 0.00 ? 10  ARG A HG3  2  
ATOM 3016  H HD2  . ARG A 1 10  ? -10.911 14.541  4.165   1.00 0.00 ? 10  ARG A HD2  2  
ATOM 3017  H HD3  . ARG A 1 10  ? -11.005 12.948  4.917   1.00 0.00 ? 10  ARG A HD3  2  
ATOM 3018  H HE   . ARG A 1 10  ? -8.862  14.930  5.372   1.00 0.00 ? 10  ARG A HE   2  
ATOM 3019  H HH11 . ARG A 1 10  ? -10.712 12.116  6.377   1.00 0.00 ? 10  ARG A HH11 2  
ATOM 3020  H HH12 . ARG A 1 10  ? -9.975  12.052  7.950   1.00 0.00 ? 10  ARG A HH12 2  
ATOM 3021  H HH21 . ARG A 1 10  ? -7.894  14.829  7.438   1.00 0.00 ? 10  ARG A HH21 2  
ATOM 3022  H HH22 . ARG A 1 10  ? -8.369  13.564  8.548   1.00 0.00 ? 10  ARG A HH22 2  
ATOM 3023  N N    . ALA A 1 11  ? -5.955  15.454  1.588   1.00 0.00 ? 11  ALA A N    2  
ATOM 3024  C CA   . ALA A 1 11  ? -5.294  16.253  0.563   1.00 0.00 ? 11  ALA A CA   2  
ATOM 3025  C C    . ALA A 1 11  ? -4.120  15.490  -0.035  1.00 0.00 ? 11  ALA A C    2  
ATOM 3026  O O    . ALA A 1 11  ? -3.865  15.561  -1.239  1.00 0.00 ? 11  ALA A O    2  
ATOM 3027  C CB   . ALA A 1 11  ? -4.825  17.579  1.140   1.00 0.00 ? 11  ALA A CB   2  
ATOM 3028  H H    . ALA A 1 11  ? -5.915  15.748  2.523   1.00 0.00 ? 11  ALA A H    2  
ATOM 3029  H HA   . ALA A 1 11  ? -6.015  16.459  -0.216  1.00 0.00 ? 11  ALA A HA   2  
ATOM 3030  H HB1  . ALA A 1 11  ? -4.054  17.399  1.876   1.00 0.00 ? 11  ALA A HB1  2  
ATOM 3031  H HB2  . ALA A 1 11  ? -5.658  18.082  1.608   1.00 0.00 ? 11  ALA A HB2  2  
ATOM 3032  H HB3  . ALA A 1 11  ? -4.429  18.197  0.348   1.00 0.00 ? 11  ALA A HB3  2  
ATOM 3033  N N    . LEU A 1 12  ? -3.414  14.752  0.814   1.00 0.00 ? 12  LEU A N    2  
ATOM 3034  C CA   . LEU A 1 12  ? -2.275  13.962  0.378   1.00 0.00 ? 12  LEU A CA   2  
ATOM 3035  C C    . LEU A 1 12  ? -2.748  12.812  -0.506  1.00 0.00 ? 12  LEU A C    2  
ATOM 3036  O O    . LEU A 1 12  ? -2.169  12.547  -1.561  1.00 0.00 ? 12  LEU A O    2  
ATOM 3037  C CB   . LEU A 1 12  ? -1.508  13.420  1.586   1.00 0.00 ? 12  LEU A CB   2  
ATOM 3038  C CG   . LEU A 1 12  ? 0.008   13.318  1.402   1.00 0.00 ? 12  LEU A CG   2  
ATOM 3039  C CD1  . LEU A 1 12  ? 0.630   14.703  1.308   1.00 0.00 ? 12  LEU A CD1  2  
ATOM 3040  C CD2  . LEU A 1 12  ? 0.629   12.526  2.541   1.00 0.00 ? 12  LEU A CD2  2  
ATOM 3041  H H    . LEU A 1 12  ? -3.667  14.745  1.764   1.00 0.00 ? 12  LEU A H    2  
ATOM 3042  H HA   . LEU A 1 12  ? -1.625  14.605  -0.198  1.00 0.00 ? 12  LEU A HA   2  
ATOM 3043  H HB2  . LEU A 1 12  ? -1.706  14.063  2.432   1.00 0.00 ? 12  LEU A HB2  2  
ATOM 3044  H HB3  . LEU A 1 12  ? -1.886  12.433  1.811   1.00 0.00 ? 12  LEU A HB3  2  
ATOM 3045  H HG   . LEU A 1 12  ? 0.216   12.798  0.479   1.00 0.00 ? 12  LEU A HG   2  
ATOM 3046  H HD11 . LEU A 1 12  ? 1.703   14.610  1.227   1.00 0.00 ? 12  LEU A HD11 2  
ATOM 3047  H HD12 . LEU A 1 12  ? 0.381   15.272  2.191   1.00 0.00 ? 12  LEU A HD12 2  
ATOM 3048  H HD13 . LEU A 1 12  ? 0.246   15.208  0.433   1.00 0.00 ? 12  LEU A HD13 2  
ATOM 3049  H HD21 . LEU A 1 12  ? 0.335   12.961  3.485   1.00 0.00 ? 12  LEU A HD21 2  
ATOM 3050  H HD22 . LEU A 1 12  ? 1.705   12.550  2.452   1.00 0.00 ? 12  LEU A HD22 2  
ATOM 3051  H HD23 . LEU A 1 12  ? 0.286   11.504  2.494   1.00 0.00 ? 12  LEU A HD23 2  
ATOM 3052  N N    . VAL A 1 13  ? -3.817  12.145  -0.076  1.00 0.00 ? 13  VAL A N    2  
ATOM 3053  C CA   . VAL A 1 13  ? -4.383  11.033  -0.831  1.00 0.00 ? 13  VAL A CA   2  
ATOM 3054  C C    . VAL A 1 13  ? -4.889  11.515  -2.190  1.00 0.00 ? 13  VAL A C    2  
ATOM 3055  O O    . VAL A 1 13  ? -4.629  10.890  -3.219  1.00 0.00 ? 13  VAL A O    2  
ATOM 3056  C CB   . VAL A 1 13  ? -5.540  10.352  -0.063  1.00 0.00 ? 13  VAL A CB   2  
ATOM 3057  C CG1  . VAL A 1 13  ? -6.157  9.229   -0.887  1.00 0.00 ? 13  VAL A CG1  2  
ATOM 3058  C CG2  . VAL A 1 13  ? -5.050  9.818   1.273   1.00 0.00 ? 13  VAL A CG2  2  
ATOM 3059  H H    . VAL A 1 13  ? -4.231  12.405  0.775   1.00 0.00 ? 13  VAL A H    2  
ATOM 3060  H HA   . VAL A 1 13  ? -3.600  10.302  -0.987  1.00 0.00 ? 13  VAL A HA   2  
ATOM 3061  H HB   . VAL A 1 13  ? -6.304  11.092  0.128   1.00 0.00 ? 13  VAL A HB   2  
ATOM 3062  H HG11 . VAL A 1 13  ? -5.413  8.469   -1.073  1.00 0.00 ? 13  VAL A HG11 2  
ATOM 3063  H HG12 . VAL A 1 13  ? -6.511  9.625   -1.828  1.00 0.00 ? 13  VAL A HG12 2  
ATOM 3064  H HG13 . VAL A 1 13  ? -6.986  8.799   -0.344  1.00 0.00 ? 13  VAL A HG13 2  
ATOM 3065  H HG21 . VAL A 1 13  ? -5.872  9.353   1.796   1.00 0.00 ? 13  VAL A HG21 2  
ATOM 3066  H HG22 . VAL A 1 13  ? -4.661  10.631  1.865   1.00 0.00 ? 13  VAL A HG22 2  
ATOM 3067  H HG23 . VAL A 1 13  ? -4.271  9.088   1.105   1.00 0.00 ? 13  VAL A HG23 2  
ATOM 3068  N N    . ALA A 1 14  ? -5.593  12.646  -2.186  1.00 0.00 ? 14  ALA A N    2  
ATOM 3069  C CA   . ALA A 1 14  ? -6.128  13.221  -3.415  1.00 0.00 ? 14  ALA A CA   2  
ATOM 3070  C C    . ALA A 1 14  ? -5.003  13.589  -4.376  1.00 0.00 ? 14  ALA A C    2  
ATOM 3071  O O    . ALA A 1 14  ? -5.169  13.521  -5.595  1.00 0.00 ? 14  ALA A O    2  
ATOM 3072  C CB   . ALA A 1 14  ? -6.979  14.442  -3.101  1.00 0.00 ? 14  ALA A CB   2  
ATOM 3073  H H    . ALA A 1 14  ? -5.763  13.102  -1.332  1.00 0.00 ? 14  ALA A H    2  
ATOM 3074  H HA   . ALA A 1 14  ? -6.760  12.479  -3.883  1.00 0.00 ? 14  ALA A HA   2  
ATOM 3075  H HB1  . ALA A 1 14  ? -7.795  14.154  -2.457  1.00 0.00 ? 14  ALA A HB1  2  
ATOM 3076  H HB2  . ALA A 1 14  ? -7.373  14.852  -4.021  1.00 0.00 ? 14  ALA A HB2  2  
ATOM 3077  H HB3  . ALA A 1 14  ? -6.373  15.184  -2.606  1.00 0.00 ? 14  ALA A HB3  2  
ATOM 3078  N N    . ASP A 1 15  ? -3.858  13.966  -3.812  1.00 0.00 ? 15  ASP A N    2  
ATOM 3079  C CA   . ASP A 1 15  ? -2.691  14.338  -4.605  1.00 0.00 ? 15  ASP A CA   2  
ATOM 3080  C C    . ASP A 1 15  ? -2.169  13.123  -5.360  1.00 0.00 ? 15  ASP A C    2  
ATOM 3081  O O    . ASP A 1 15  ? -1.861  13.201  -6.547  1.00 0.00 ? 15  ASP A O    2  
ATOM 3082  C CB   . ASP A 1 15  ? -1.592  14.912  -3.705  1.00 0.00 ? 15  ASP A CB   2  
ATOM 3083  C CG   . ASP A 1 15  ? -0.483  15.580  -4.492  1.00 0.00 ? 15  ASP A CG   2  
ATOM 3084  O OD1  . ASP A 1 15  ? 0.498   14.897  -4.859  1.00 0.00 ? 15  ASP A OD1  2  
ATOM 3085  O OD2  . ASP A 1 15  ? -0.579  16.800  -4.741  1.00 0.00 ? 15  ASP A OD2  2  
ATOM 3086  H H    . ASP A 1 15  ? -3.796  13.989  -2.833  1.00 0.00 ? 15  ASP A H    2  
ATOM 3087  H HA   . ASP A 1 15  ? -2.996  15.091  -5.318  1.00 0.00 ? 15  ASP A HA   2  
ATOM 3088  H HB2  . ASP A 1 15  ? -2.027  15.642  -3.041  1.00 0.00 ? 15  ASP A HB2  2  
ATOM 3089  H HB3  . ASP A 1 15  ? -1.161  14.111  -3.119  1.00 0.00 ? 15  ASP A HB3  2  
ATOM 3090  N N    . PHE A 1 16  ? -2.100  11.994  -4.660  1.00 0.00 ? 16  PHE A N    2  
ATOM 3091  C CA   . PHE A 1 16  ? -1.630  10.749  -5.255  1.00 0.00 ? 16  PHE A CA   2  
ATOM 3092  C C    . PHE A 1 16  ? -2.573  10.312  -6.372  1.00 0.00 ? 16  PHE A C    2  
ATOM 3093  O O    . PHE A 1 16  ? -2.132  9.977   -7.473  1.00 0.00 ? 16  PHE A O    2  
ATOM 3094  C CB   . PHE A 1 16  ? -1.538  9.655   -4.187  1.00 0.00 ? 16  PHE A CB   2  
ATOM 3095  C CG   . PHE A 1 16  ? -1.025  8.338   -4.705  1.00 0.00 ? 16  PHE A CG   2  
ATOM 3096  C CD1  . PHE A 1 16  ? 0.321   8.164   -4.983  1.00 0.00 ? 16  PHE A CD1  2  
ATOM 3097  C CD2  . PHE A 1 16  ? -1.890  7.274   -4.909  1.00 0.00 ? 16  PHE A CD2  2  
ATOM 3098  C CE1  . PHE A 1 16  ? 0.796   6.955   -5.456  1.00 0.00 ? 16  PHE A CE1  2  
ATOM 3099  C CE2  . PHE A 1 16  ? -1.420  6.062   -5.381  1.00 0.00 ? 16  PHE A CE2  2  
ATOM 3100  C CZ   . PHE A 1 16  ? -0.075  5.904   -5.656  1.00 0.00 ? 16  PHE A CZ   2  
ATOM 3101  H H    . PHE A 1 16  ? -2.377  11.997  -3.717  1.00 0.00 ? 16  PHE A H    2  
ATOM 3102  H HA   . PHE A 1 16  ? -0.647  10.925  -5.670  1.00 0.00 ? 16  PHE A HA   2  
ATOM 3103  H HB2  . PHE A 1 16  ? -0.872  9.983   -3.404  1.00 0.00 ? 16  PHE A HB2  2  
ATOM 3104  H HB3  . PHE A 1 16  ? -2.520  9.489   -3.770  1.00 0.00 ? 16  PHE A HB3  2  
ATOM 3105  H HD1  . PHE A 1 16  ? 1.006   8.984   -4.827  1.00 0.00 ? 16  PHE A HD1  2  
ATOM 3106  H HD2  . PHE A 1 16  ? -2.943  7.398   -4.698  1.00 0.00 ? 16  PHE A HD2  2  
ATOM 3107  H HE1  . PHE A 1 16  ? 1.847   6.835   -5.671  1.00 0.00 ? 16  PHE A HE1  2  
ATOM 3108  H HE2  . PHE A 1 16  ? -2.104  5.241   -5.535  1.00 0.00 ? 16  PHE A HE2  2  
ATOM 3109  H HZ   . PHE A 1 16  ? 0.293   4.957   -6.024  1.00 0.00 ? 16  PHE A HZ   2  
ATOM 3110  N N    . VAL A 1 17  ? -3.872  10.333  -6.083  1.00 0.00 ? 17  VAL A N    2  
ATOM 3111  C CA   . VAL A 1 17  ? -4.885  9.947   -7.060  1.00 0.00 ? 17  VAL A CA   2  
ATOM 3112  C C    . VAL A 1 17  ? -4.803  10.847  -8.291  1.00 0.00 ? 17  VAL A C    2  
ATOM 3113  O O    . VAL A 1 17  ? -4.805  10.365  -9.426  1.00 0.00 ? 17  VAL A O    2  
ATOM 3114  C CB   . VAL A 1 17  ? -6.310  10.016  -6.462  1.00 0.00 ? 17  VAL A CB   2  
ATOM 3115  C CG1  . VAL A 1 17  ? -7.359  9.683   -7.517  1.00 0.00 ? 17  VAL A CG1  2  
ATOM 3116  C CG2  . VAL A 1 17  ? -6.441  9.076   -5.270  1.00 0.00 ? 17  VAL A CG2  2  
ATOM 3117  H H    . VAL A 1 17  ? -4.156  10.613  -5.182  1.00 0.00 ? 17  VAL A H    2  
ATOM 3118  H HA   . VAL A 1 17  ? -4.689  8.927   -7.358  1.00 0.00 ? 17  VAL A HA   2  
ATOM 3119  H HB   . VAL A 1 17  ? -6.487  11.025  -6.118  1.00 0.00 ? 17  VAL A HB   2  
ATOM 3120  H HG11 . VAL A 1 17  ? -7.309  10.409  -8.314  1.00 0.00 ? 17  VAL A HG11 2  
ATOM 3121  H HG12 . VAL A 1 17  ? -8.342  9.708   -7.068  1.00 0.00 ? 17  VAL A HG12 2  
ATOM 3122  H HG13 . VAL A 1 17  ? -7.170  8.697   -7.914  1.00 0.00 ? 17  VAL A HG13 2  
ATOM 3123  H HG21 . VAL A 1 17  ? -7.436  9.153   -4.859  1.00 0.00 ? 17  VAL A HG21 2  
ATOM 3124  H HG22 . VAL A 1 17  ? -5.719  9.351   -4.516  1.00 0.00 ? 17  VAL A HG22 2  
ATOM 3125  H HG23 . VAL A 1 17  ? -6.259  8.062   -5.591  1.00 0.00 ? 17  VAL A HG23 2  
ATOM 3126  N N    . GLY A 1 18  ? -4.703  12.153  -8.049  1.00 0.00 ? 18  GLY A N    2  
ATOM 3127  C CA   . GLY A 1 18  ? -4.607  13.107  -9.137  1.00 0.00 ? 18  GLY A CA   2  
ATOM 3128  C C    . GLY A 1 18  ? -3.353  12.891  -9.959  1.00 0.00 ? 18  GLY A C    2  
ATOM 3129  O O    . GLY A 1 18  ? -3.401  12.894  -11.188 1.00 0.00 ? 18  GLY A O    2  
ATOM 3130  H H    . GLY A 1 18  ? -4.689  12.470  -7.119  1.00 0.00 ? 18  GLY A H    2  
ATOM 3131  H HA2  . GLY A 1 18  ? -5.472  13.003  -9.777  1.00 0.00 ? 18  GLY A HA2  2  
ATOM 3132  H HA3  . GLY A 1 18  ? -4.590  14.105  -8.727  1.00 0.00 ? 18  GLY A HA3  2  
ATOM 3133  N N    . TYR A 1 19  ? -2.231  12.690  -9.275  1.00 0.00 ? 19  TYR A N    2  
ATOM 3134  C CA   . TYR A 1 19  ? -0.954  12.457  -9.936  1.00 0.00 ? 19  TYR A CA   2  
ATOM 3135  C C    . TYR A 1 19  ? -1.036  11.230  -10.840 1.00 0.00 ? 19  TYR A C    2  
ATOM 3136  O O    . TYR A 1 19  ? -0.667  11.283  -12.010 1.00 0.00 ? 19  TYR A O    2  
ATOM 3137  C CB   . TYR A 1 19  ? 0.151   12.268  -8.892  1.00 0.00 ? 19  TYR A CB   2  
ATOM 3138  C CG   . TYR A 1 19  ? 1.556   12.317  -9.450  1.00 0.00 ? 19  TYR A CG   2  
ATOM 3139  C CD1  . TYR A 1 19  ? 1.946   13.327  -10.320 1.00 0.00 ? 19  TYR A CD1  2  
ATOM 3140  C CD2  . TYR A 1 19  ? 2.498   11.358  -9.095  1.00 0.00 ? 19  TYR A CD2  2  
ATOM 3141  C CE1  . TYR A 1 19  ? 3.232   13.380  -10.821 1.00 0.00 ? 19  TYR A CE1  2  
ATOM 3142  C CE2  . TYR A 1 19  ? 3.786   11.403  -9.594  1.00 0.00 ? 19  TYR A CE2  2  
ATOM 3143  C CZ   . TYR A 1 19  ? 4.148   12.416  -10.456 1.00 0.00 ? 19  TYR A CZ   2  
ATOM 3144  O OH   . TYR A 1 19  ? 5.433   12.472  -10.950 1.00 0.00 ? 19  TYR A OH   2  
ATOM 3145  H H    . TYR A 1 19  ? -2.262  12.708  -8.291  1.00 0.00 ? 19  TYR A H    2  
ATOM 3146  H HA   . TYR A 1 19  ? -0.727  13.326  -10.540 1.00 0.00 ? 19  TYR A HA   2  
ATOM 3147  H HB2  . TYR A 1 19  ? 0.068   13.047  -8.149  1.00 0.00 ? 19  TYR A HB2  2  
ATOM 3148  H HB3  . TYR A 1 19  ? 0.018   11.309  -8.413  1.00 0.00 ? 19  TYR A HB3  2  
ATOM 3149  H HD1  . TYR A 1 19  ? 1.228   14.079  -10.606 1.00 0.00 ? 19  TYR A HD1  2  
ATOM 3150  H HD2  . TYR A 1 19  ? 2.210   10.566  -8.420  1.00 0.00 ? 19  TYR A HD2  2  
ATOM 3151  H HE1  . TYR A 1 19  ? 3.516   14.175  -11.496 1.00 0.00 ? 19  TYR A HE1  2  
ATOM 3152  H HE2  . TYR A 1 19  ? 4.503   10.647  -9.308  1.00 0.00 ? 19  TYR A HE2  2  
ATOM 3153  H HH   . TYR A 1 19  ? 5.711   11.591  -11.223 1.00 0.00 ? 19  TYR A HH   2  
ATOM 3154  N N    . LYS A 1 20  ? -1.545  10.133  -10.289 1.00 0.00 ? 20  LYS A N    2  
ATOM 3155  C CA   . LYS A 1 20  ? -1.682  8.889   -11.039 1.00 0.00 ? 20  LYS A CA   2  
ATOM 3156  C C    . LYS A 1 20  ? -2.624  9.070   -12.226 1.00 0.00 ? 20  LYS A C    2  
ATOM 3157  O O    . LYS A 1 20  ? -2.406  8.507   -13.300 1.00 0.00 ? 20  LYS A O    2  
ATOM 3158  C CB   . LYS A 1 20  ? -2.199  7.775   -10.122 1.00 0.00 ? 20  LYS A CB   2  
ATOM 3159  C CG   . LYS A 1 20  ? -1.193  7.344   -9.064  1.00 0.00 ? 20  LYS A CG   2  
ATOM 3160  C CD   . LYS A 1 20  ? -0.047  6.547   -9.668  1.00 0.00 ? 20  LYS A CD   2  
ATOM 3161  C CE   . LYS A 1 20  ? -0.538  5.231   -10.248 1.00 0.00 ? 20  LYS A CE   2  
ATOM 3162  N NZ   . LYS A 1 20  ? 0.577   4.403   -10.775 1.00 0.00 ? 20  LYS A NZ   2  
ATOM 3163  H H    . LYS A 1 20  ? -1.836  10.160  -9.351  1.00 0.00 ? 20  LYS A H    2  
ATOM 3164  H HA   . LYS A 1 20  ? -0.703  8.613   -11.408 1.00 0.00 ? 20  LYS A HA   2  
ATOM 3165  H HB2  . LYS A 1 20  ? -3.091  8.123   -9.621  1.00 0.00 ? 20  LYS A HB2  2  
ATOM 3166  H HB3  . LYS A 1 20  ? -2.448  6.913   -10.725 1.00 0.00 ? 20  LYS A HB3  2  
ATOM 3167  H HG2  . LYS A 1 20  ? -0.790  8.225   -8.585  1.00 0.00 ? 20  LYS A HG2  2  
ATOM 3168  H HG3  . LYS A 1 20  ? -1.699  6.733   -8.331  1.00 0.00 ? 20  LYS A HG3  2  
ATOM 3169  H HD2  . LYS A 1 20  ? 0.410   7.130   -10.456 1.00 0.00 ? 20  LYS A HD2  2  
ATOM 3170  H HD3  . LYS A 1 20  ? 0.681   6.343   -8.898  1.00 0.00 ? 20  LYS A HD3  2  
ATOM 3171  H HE2  . LYS A 1 20  ? -1.049  4.679   -9.474  1.00 0.00 ? 20  LYS A HE2  2  
ATOM 3172  H HE3  . LYS A 1 20  ? -1.228  5.443   -11.052 1.00 0.00 ? 20  LYS A HE3  2  
ATOM 3173  H HZ1  . LYS A 1 20  ? 1.030   4.880   -11.582 1.00 0.00 ? 20  LYS A HZ1  2  
ATOM 3174  H HZ2  . LYS A 1 20  ? 0.212   3.477   -11.093 1.00 0.00 ? 20  LYS A HZ2  2  
ATOM 3175  H HZ3  . LYS A 1 20  ? 1.292   4.245   -10.031 1.00 0.00 ? 20  LYS A HZ3  2  
ATOM 3176  N N    . LEU A 1 21  ? -3.661  9.878   -12.029 1.00 0.00 ? 21  LEU A N    2  
ATOM 3177  C CA   . LEU A 1 21  ? -4.642  10.149  -13.073 1.00 0.00 ? 21  LEU A CA   2  
ATOM 3178  C C    . LEU A 1 21  ? -4.011  10.953  -14.207 1.00 0.00 ? 21  LEU A C    2  
ATOM 3179  O O    . LEU A 1 21  ? -4.446  10.878  -15.356 1.00 0.00 ? 21  LEU A O    2  
ATOM 3180  C CB   . LEU A 1 21  ? -5.837  10.918  -12.491 1.00 0.00 ? 21  LEU A CB   2  
ATOM 3181  C CG   . LEU A 1 21  ? -7.096  10.928  -13.358 1.00 0.00 ? 21  LEU A CG   2  
ATOM 3182  C CD1  . LEU A 1 21  ? -7.921  9.672   -13.122 1.00 0.00 ? 21  LEU A CD1  2  
ATOM 3183  C CD2  . LEU A 1 21  ? -7.919  12.174  -13.075 1.00 0.00 ? 21  LEU A CD2  2  
ATOM 3184  H H    . LEU A 1 21  ? -3.771  10.306  -11.151 1.00 0.00 ? 21  LEU A H    2  
ATOM 3185  H HA   . LEU A 1 21  ? -4.987  9.202   -13.462 1.00 0.00 ? 21  LEU A HA   2  
ATOM 3186  H HB2  . LEU A 1 21  ? -6.089  10.480  -11.536 1.00 0.00 ? 21  LEU A HB2  2  
ATOM 3187  H HB3  . LEU A 1 21  ? -5.534  11.942  -12.327 1.00 0.00 ? 21  LEU A HB3  2  
ATOM 3188  H HG   . LEU A 1 21  ? -6.806  10.947  -14.398 1.00 0.00 ? 21  LEU A HG   2  
ATOM 3189  H HD11 . LEU A 1 21  ? -8.197  9.612   -12.079 1.00 0.00 ? 21  LEU A HD11 2  
ATOM 3190  H HD12 . LEU A 1 21  ? -7.339  8.802   -13.390 1.00 0.00 ? 21  LEU A HD12 2  
ATOM 3191  H HD13 . LEU A 1 21  ? -8.814  9.709   -13.726 1.00 0.00 ? 21  LEU A HD13 2  
ATOM 3192  H HD21 . LEU A 1 21  ? -7.347  13.049  -13.345 1.00 0.00 ? 21  LEU A HD21 2  
ATOM 3193  H HD22 . LEU A 1 21  ? -8.162  12.211  -12.023 1.00 0.00 ? 21  LEU A HD22 2  
ATOM 3194  H HD23 . LEU A 1 21  ? -8.830  12.146  -13.655 1.00 0.00 ? 21  LEU A HD23 2  
ATOM 3195  N N    . ARG A 1 22  ? -2.977  11.714  -13.880 1.00 0.00 ? 22  ARG A N    2  
ATOM 3196  C CA   . ARG A 1 22  ? -2.291  12.535  -14.867 1.00 0.00 ? 22  ARG A CA   2  
ATOM 3197  C C    . ARG A 1 22  ? -1.134  11.780  -15.514 1.00 0.00 ? 22  ARG A C    2  
ATOM 3198  O O    . ARG A 1 22  ? -0.837  11.985  -16.687 1.00 0.00 ? 22  ARG A O    2  
ATOM 3199  C CB   . ARG A 1 22  ? -1.786  13.828  -14.229 1.00 0.00 ? 22  ARG A CB   2  
ATOM 3200  C CG   . ARG A 1 22  ? -2.906  14.713  -13.709 1.00 0.00 ? 22  ARG A CG   2  
ATOM 3201  C CD   . ARG A 1 22  ? -2.391  16.060  -13.242 1.00 0.00 ? 22  ARG A CD   2  
ATOM 3202  N NE   . ARG A 1 22  ? -1.617  15.966  -12.004 1.00 0.00 ? 22  ARG A NE   2  
ATOM 3203  C CZ   . ARG A 1 22  ? -2.119  16.192  -10.793 1.00 0.00 ? 22  ARG A CZ   2  
ATOM 3204  N NH1  . ARG A 1 22  ? -3.403  16.496  -10.654 1.00 0.00 ? 22  ARG A NH1  2  
ATOM 3205  N NH2  . ARG A 1 22  ? -1.334  16.111  -9.724  1.00 0.00 ? 22  ARG A NH2  2  
ATOM 3206  H H    . ARG A 1 22  ? -2.670  11.729  -12.948 1.00 0.00 ? 22  ARG A H    2  
ATOM 3207  H HA   . ARG A 1 22  ? -3.008  12.784  -15.635 1.00 0.00 ? 22  ARG A HA   2  
ATOM 3208  H HB2  . ARG A 1 22  ? -1.135  13.581  -13.403 1.00 0.00 ? 22  ARG A HB2  2  
ATOM 3209  H HB3  . ARG A 1 22  ? -1.226  14.386  -14.963 1.00 0.00 ? 22  ARG A HB3  2  
ATOM 3210  H HG2  . ARG A 1 22  ? -3.623  14.870  -14.500 1.00 0.00 ? 22  ARG A HG2  2  
ATOM 3211  H HG3  . ARG A 1 22  ? -3.386  14.215  -12.880 1.00 0.00 ? 22  ARG A HG3  2  
ATOM 3212  H HD2  . ARG A 1 22  ? -1.762  16.477  -14.014 1.00 0.00 ? 22  ARG A HD2  2  
ATOM 3213  H HD3  . ARG A 1 22  ? -3.235  16.713  -13.078 1.00 0.00 ? 22  ARG A HD3  2  
ATOM 3214  H HE   . ARG A 1 22  ? -0.658  15.736  -12.086 1.00 0.00 ? 22  ARG A HE   2  
ATOM 3215  H HH11 . ARG A 1 22  ? -3.997  16.553  -11.458 1.00 0.00 ? 22  ARG A HH11 2  
ATOM 3216  H HH12 . ARG A 1 22  ? -3.785  16.681  -9.740  1.00 0.00 ? 22  ARG A HH12 2  
ATOM 3217  H HH21 . ARG A 1 22  ? -0.363  15.878  -9.830  1.00 0.00 ? 22  ARG A HH21 2  
ATOM 3218  H HH22 . ARG A 1 22  ? -1.706  16.283  -8.800  1.00 0.00 ? 22  ARG A HH22 2  
ATOM 3219  N N    . GLN A 1 23  ? -0.495  10.897  -14.755 1.00 0.00 ? 23  GLN A N    2  
ATOM 3220  C CA   . GLN A 1 23  ? 0.635   10.119  -15.268 1.00 0.00 ? 23  GLN A CA   2  
ATOM 3221  C C    . GLN A 1 23  ? 0.209   9.211   -16.416 1.00 0.00 ? 23  GLN A C    2  
ATOM 3222  O O    . GLN A 1 23  ? 1.014   8.879   -17.288 1.00 0.00 ? 23  GLN A O    2  
ATOM 3223  C CB   . GLN A 1 23  ? 1.271   9.286   -14.156 1.00 0.00 ? 23  GLN A CB   2  
ATOM 3224  C CG   . GLN A 1 23  ? 1.987   10.120  -13.104 1.00 0.00 ? 23  GLN A CG   2  
ATOM 3225  C CD   . GLN A 1 23  ? 3.029   11.049  -13.698 1.00 0.00 ? 23  GLN A CD   2  
ATOM 3226  O OE1  . GLN A 1 23  ? 2.750   12.211  -13.997 1.00 0.00 ? 23  GLN A OE1  2  
ATOM 3227  N NE2  . GLN A 1 23  ? 4.236   10.541  -13.878 1.00 0.00 ? 23  GLN A NE2  2  
ATOM 3228  H H    . GLN A 1 23  ? -0.781  10.770  -13.823 1.00 0.00 ? 23  GLN A H    2  
ATOM 3229  H HA   . GLN A 1 23  ? 1.370   10.820  -15.639 1.00 0.00 ? 23  GLN A HA   2  
ATOM 3230  H HB2  . GLN A 1 23  ? 0.500   8.710   -13.667 1.00 0.00 ? 23  GLN A HB2  2  
ATOM 3231  H HB3  . GLN A 1 23  ? 1.990   8.609   -14.594 1.00 0.00 ? 23  GLN A HB3  2  
ATOM 3232  H HG2  . GLN A 1 23  ? 1.258   10.717  -12.578 1.00 0.00 ? 23  GLN A HG2  2  
ATOM 3233  H HG3  . GLN A 1 23  ? 2.475   9.453   -12.408 1.00 0.00 ? 23  GLN A HG3  2  
ATOM 3234  H HE21 . GLN A 1 23  ? 4.390   9.601   -13.622 1.00 0.00 ? 23  GLN A HE21 2  
ATOM 3235  H HE22 . GLN A 1 23  ? 4.926   11.116  -14.262 1.00 0.00 ? 23  GLN A HE22 2  
ATOM 3236  N N    . LYS A 1 24  ? -1.058  8.821   -16.421 1.00 0.00 ? 24  LYS A N    2  
ATOM 3237  C CA   . LYS A 1 24  ? -1.586  7.956   -17.475 1.00 0.00 ? 24  LYS A CA   2  
ATOM 3238  C C    . LYS A 1 24  ? -2.103  8.788   -18.652 1.00 0.00 ? 24  LYS A C    2  
ATOM 3239  O O    . LYS A 1 24  ? -2.876  8.305   -19.484 1.00 0.00 ? 24  LYS A O    2  
ATOM 3240  C CB   . LYS A 1 24  ? -2.702  7.057   -16.932 1.00 0.00 ? 24  LYS A CB   2  
ATOM 3241  C CG   . LYS A 1 24  ? -3.847  7.825   -16.301 1.00 0.00 ? 24  LYS A CG   2  
ATOM 3242  C CD   . LYS A 1 24  ? -5.109  6.984   -16.219 1.00 0.00 ? 24  LYS A CD   2  
ATOM 3243  C CE   . LYS A 1 24  ? -6.306  7.833   -15.828 1.00 0.00 ? 24  LYS A CE   2  
ATOM 3244  N NZ   . LYS A 1 24  ? -7.595  7.126   -16.051 1.00 0.00 ? 24  LYS A NZ   2  
ATOM 3245  H H    . LYS A 1 24  ? -1.652  9.119   -15.698 1.00 0.00 ? 24  LYS A H    2  
ATOM 3246  H HA   . LYS A 1 24  ? -0.777  7.335   -17.823 1.00 0.00 ? 24  LYS A HA   2  
ATOM 3247  H HB2  . LYS A 1 24  ? -3.099  6.465   -17.744 1.00 0.00 ? 24  LYS A HB2  2  
ATOM 3248  H HB3  . LYS A 1 24  ? -2.285  6.394   -16.187 1.00 0.00 ? 24  LYS A HB3  2  
ATOM 3249  H HG2  . LYS A 1 24  ? -3.561  8.122   -15.303 1.00 0.00 ? 24  LYS A HG2  2  
ATOM 3250  H HG3  . LYS A 1 24  ? -4.046  8.704   -16.896 1.00 0.00 ? 24  LYS A HG3  2  
ATOM 3251  H HD2  . LYS A 1 24  ? -5.296  6.534   -17.181 1.00 0.00 ? 24  LYS A HD2  2  
ATOM 3252  H HD3  . LYS A 1 24  ? -4.970  6.211   -15.476 1.00 0.00 ? 24  LYS A HD3  2  
ATOM 3253  H HE2  . LYS A 1 24  ? -6.224  8.087   -14.782 1.00 0.00 ? 24  LYS A HE2  2  
ATOM 3254  H HE3  . LYS A 1 24  ? -6.296  8.740   -16.416 1.00 0.00 ? 24  LYS A HE3  2  
ATOM 3255  H HZ1  . LYS A 1 24  ? -7.781  6.460   -15.272 1.00 0.00 ? 24  LYS A HZ1  2  
ATOM 3256  H HZ2  . LYS A 1 24  ? -7.561  6.589   -16.947 1.00 0.00 ? 24  LYS A HZ2  2  
ATOM 3257  H HZ3  . LYS A 1 24  ? -8.377  7.814   -16.105 1.00 0.00 ? 24  LYS A HZ3  2  
ATOM 3258  N N    . GLY A 1 25  ? -1.675  10.042  -18.711 1.00 0.00 ? 25  GLY A N    2  
ATOM 3259  C CA   . GLY A 1 25  ? -2.082  10.924  -19.787 1.00 0.00 ? 25  GLY A CA   2  
ATOM 3260  C C    . GLY A 1 25  ? -0.993  11.920  -20.129 1.00 0.00 ? 25  GLY A C    2  
ATOM 3261  O O    . GLY A 1 25  ? -0.299  11.775  -21.136 1.00 0.00 ? 25  GLY A O    2  
ATOM 3262  H H    . GLY A 1 25  ? -1.074  10.376  -18.009 1.00 0.00 ? 25  GLY A H    2  
ATOM 3263  H HA2  . GLY A 1 25  ? -2.308  10.331  -20.661 1.00 0.00 ? 25  GLY A HA2  2  
ATOM 3264  H HA3  . GLY A 1 25  ? -2.969  11.462  -19.486 1.00 0.00 ? 25  GLY A HA3  2  
ATOM 3265  N N    . TYR A 1 26  ? -0.824  12.915  -19.274 1.00 0.00 ? 26  TYR A N    2  
ATOM 3266  C CA   . TYR A 1 26  ? 0.189   13.937  -19.476 1.00 0.00 ? 26  TYR A CA   2  
ATOM 3267  C C    . TYR A 1 26  ? 1.049   14.066  -18.227 1.00 0.00 ? 26  TYR A C    2  
ATOM 3268  O O    . TYR A 1 26  ? 0.635   14.671  -17.235 1.00 0.00 ? 26  TYR A O    2  
ATOM 3269  C CB   . TYR A 1 26  ? -0.457  15.280  -19.811 1.00 0.00 ? 26  TYR A CB   2  
ATOM 3270  C CG   . TYR A 1 26  ? 0.518   16.314  -20.333 1.00 0.00 ? 26  TYR A CG   2  
ATOM 3271  C CD1  . TYR A 1 26  ? 1.208   17.154  -19.467 1.00 0.00 ? 26  TYR A CD1  2  
ATOM 3272  C CD2  . TYR A 1 26  ? 0.740   16.455  -21.694 1.00 0.00 ? 26  TYR A CD2  2  
ATOM 3273  C CE1  . TYR A 1 26  ? 2.088   18.104  -19.946 1.00 0.00 ? 26  TYR A CE1  2  
ATOM 3274  C CE2  . TYR A 1 26  ? 1.620   17.399  -22.180 1.00 0.00 ? 26  TYR A CE2  2  
ATOM 3275  C CZ   . TYR A 1 26  ? 2.291   18.223  -21.305 1.00 0.00 ? 26  TYR A CZ   2  
ATOM 3276  O OH   . TYR A 1 26  ? 3.158   19.175  -21.794 1.00 0.00 ? 26  TYR A OH   2  
ATOM 3277  H H    . TYR A 1 26  ? -1.385  12.955  -18.469 1.00 0.00 ? 26  TYR A H    2  
ATOM 3278  H HA   . TYR A 1 26  ? 0.815   13.628  -20.303 1.00 0.00 ? 26  TYR A HA   2  
ATOM 3279  H HB2  . TYR A 1 26  ? -1.214  15.128  -20.567 1.00 0.00 ? 26  TYR A HB2  2  
ATOM 3280  H HB3  . TYR A 1 26  ? -0.921  15.680  -18.920 1.00 0.00 ? 26  TYR A HB3  2  
ATOM 3281  H HD1  . TYR A 1 26  ? 1.046   17.059  -18.404 1.00 0.00 ? 26  TYR A HD1  2  
ATOM 3282  H HD2  . TYR A 1 26  ? 0.211   15.810  -22.380 1.00 0.00 ? 26  TYR A HD2  2  
ATOM 3283  H HE1  . TYR A 1 26  ? 2.618   18.747  -19.257 1.00 0.00 ? 26  TYR A HE1  2  
ATOM 3284  H HE2  . TYR A 1 26  ? 1.778   17.492  -23.244 1.00 0.00 ? 26  TYR A HE2  2  
ATOM 3285  H HH   . TYR A 1 26  ? 2.684   19.742  -22.425 1.00 0.00 ? 26  TYR A HH   2  
ATOM 3286  N N    . VAL A 1 27  ? 2.233   13.475  -18.277 1.00 0.00 ? 27  VAL A N    2  
ATOM 3287  C CA   . VAL A 1 27  ? 3.159   13.514  -17.157 1.00 0.00 ? 27  VAL A CA   2  
ATOM 3288  C C    . VAL A 1 27  ? 3.575   14.952  -16.846 1.00 0.00 ? 27  VAL A C    2  
ATOM 3289  O O    . VAL A 1 27  ? 4.106   15.659  -17.706 1.00 0.00 ? 27  VAL A O    2  
ATOM 3290  C CB   . VAL A 1 27  ? 4.417   12.664  -17.438 1.00 0.00 ? 27  VAL A CB   2  
ATOM 3291  C CG1  . VAL A 1 27  ? 5.379   12.703  -16.257 1.00 0.00 ? 27  VAL A CG1  2  
ATOM 3292  C CG2  . VAL A 1 27  ? 4.030   11.229  -17.760 1.00 0.00 ? 27  VAL A CG2  2  
ATOM 3293  H H    . VAL A 1 27  ? 2.492   12.996  -19.097 1.00 0.00 ? 27  VAL A H    2  
ATOM 3294  H HA   . VAL A 1 27  ? 2.656   13.100  -16.297 1.00 0.00 ? 27  VAL A HA   2  
ATOM 3295  H HB   . VAL A 1 27  ? 4.920   13.079  -18.300 1.00 0.00 ? 27  VAL A HB   2  
ATOM 3296  H HG11 . VAL A 1 27  ? 4.847   12.442  -15.353 1.00 0.00 ? 27  VAL A HG11 2  
ATOM 3297  H HG12 . VAL A 1 27  ? 5.790   13.696  -16.159 1.00 0.00 ? 27  VAL A HG12 2  
ATOM 3298  H HG13 . VAL A 1 27  ? 6.180   11.996  -16.419 1.00 0.00 ? 27  VAL A HG13 2  
ATOM 3299  H HG21 . VAL A 1 27  ? 3.426   11.212  -18.656 1.00 0.00 ? 27  VAL A HG21 2  
ATOM 3300  H HG22 . VAL A 1 27  ? 3.466   10.815  -16.938 1.00 0.00 ? 27  VAL A HG22 2  
ATOM 3301  H HG23 . VAL A 1 27  ? 4.924   10.643  -17.916 1.00 0.00 ? 27  VAL A HG23 2  
ATOM 3302  N N    . CYS A 1 28  ? 3.322   15.381  -15.620 1.00 0.00 ? 28  CYS A N    2  
ATOM 3303  C CA   . CYS A 1 28  ? 3.664   16.725  -15.194 1.00 0.00 ? 28  CYS A CA   2  
ATOM 3304  C C    . CYS A 1 28  ? 4.129   16.703  -13.746 1.00 0.00 ? 28  CYS A C    2  
ATOM 3305  O O    . CYS A 1 28  ? 3.565   15.984  -12.922 1.00 0.00 ? 28  CYS A O    2  
ATOM 3306  C CB   . CYS A 1 28  ? 2.457   17.650  -15.350 1.00 0.00 ? 28  CYS A CB   2  
ATOM 3307  S SG   . CYS A 1 28  ? 2.860   19.411  -15.272 1.00 0.00 ? 28  CYS A SG   2  
ATOM 3308  H H    . CYS A 1 28  ? 2.893   14.774  -14.979 1.00 0.00 ? 28  CYS A H    2  
ATOM 3309  H HA   . CYS A 1 28  ? 4.470   17.081  -15.818 1.00 0.00 ? 28  CYS A HA   2  
ATOM 3310  H HB2  . CYS A 1 28  ? 1.992   17.463  -16.307 1.00 0.00 ? 28  CYS A HB2  2  
ATOM 3311  H HB3  . CYS A 1 28  ? 1.748   17.439  -14.564 1.00 0.00 ? 28  CYS A HB3  2  
ATOM 3312  H HG   . CYS A 1 28  ? 4.181   19.528  -15.379 1.00 0.00 ? 28  CYS A HG   2  
ATOM 3313  N N    . GLY A 1 29  ? 5.163   17.469  -13.443 1.00 0.00 ? 29  GLY A N    2  
ATOM 3314  C CA   . GLY A 1 29  ? 5.677   17.515  -12.092 1.00 0.00 ? 29  GLY A CA   2  
ATOM 3315  C C    . GLY A 1 29  ? 7.188   17.546  -12.060 1.00 0.00 ? 29  GLY A C    2  
ATOM 3316  O O    . GLY A 1 29  ? 7.817   18.225  -12.874 1.00 0.00 ? 29  GLY A O    2  
ATOM 3317  H H    . GLY A 1 29  ? 5.589   18.010  -14.146 1.00 0.00 ? 29  GLY A H    2  
ATOM 3318  H HA2  . GLY A 1 29  ? 5.297   18.401  -11.602 1.00 0.00 ? 29  GLY A HA2  2  
ATOM 3319  H HA3  . GLY A 1 29  ? 5.332   16.645  -11.556 1.00 0.00 ? 29  GLY A HA3  2  
ATOM 3320  N N    . ALA A 1 30  ? 7.774   16.804  -11.134 1.00 0.00 ? 30  ALA A N    2  
ATOM 3321  C CA   . ALA A 1 30  ? 9.220   16.754  -10.998 1.00 0.00 ? 30  ALA A CA   2  
ATOM 3322  C C    . ALA A 1 30  ? 9.657   15.401  -10.460 1.00 0.00 ? 30  ALA A C    2  
ATOM 3323  O O    . ALA A 1 30  ? 8.963   14.797  -9.641  1.00 0.00 ? 30  ALA A O    2  
ATOM 3324  C CB   . ALA A 1 30  ? 9.709   17.867  -10.087 1.00 0.00 ? 30  ALA A CB   2  
ATOM 3325  H H    . ALA A 1 30  ? 7.217   16.259  -10.527 1.00 0.00 ? 30  ALA A H    2  
ATOM 3326  H HA   . ALA A 1 30  ? 9.655   16.901  -11.978 1.00 0.00 ? 30  ALA A HA   2  
ATOM 3327  H HB1  . ALA A 1 30  ? 10.789  17.862  -10.061 1.00 0.00 ? 30  ALA A HB1  2  
ATOM 3328  H HB2  . ALA A 1 30  ? 9.325   17.713  -9.089  1.00 0.00 ? 30  ALA A HB2  2  
ATOM 3329  H HB3  . ALA A 1 30  ? 9.364   18.819  -10.463 1.00 0.00 ? 30  ALA A HB3  2  
ATOM 3330  N N    . GLY A 1 31  ? 10.806  14.933  -10.916 1.00 0.00 ? 31  GLY A N    2  
ATOM 3331  C CA   . GLY A 1 31  ? 11.311  13.651  -10.473 1.00 0.00 ? 31  GLY A CA   2  
ATOM 3332  C C    . GLY A 1 31  ? 12.465  13.793  -9.501  1.00 0.00 ? 31  GLY A C    2  
ATOM 3333  O O    . GLY A 1 31  ? 13.582  14.115  -9.909  1.00 0.00 ? 31  GLY A O    2  
ATOM 3334  H H    . GLY A 1 31  ? 11.326  15.470  -11.560 1.00 0.00 ? 31  GLY A H    2  
ATOM 3335  H HA2  . GLY A 1 31  ? 10.510  13.106  -9.994  1.00 0.00 ? 31  GLY A HA2  2  
ATOM 3336  H HA3  . GLY A 1 31  ? 11.646  13.094  -11.335 1.00 0.00 ? 31  GLY A HA3  2  
ATOM 3337  N N    . PRO A 1 32  ? 12.225  13.579  -8.198  1.00 0.00 ? 32  PRO A N    2  
ATOM 3338  C CA   . PRO A 1 32  ? 13.265  13.677  -7.175  1.00 0.00 ? 32  PRO A CA   2  
ATOM 3339  C C    . PRO A 1 32  ? 14.256  12.522  -7.275  1.00 0.00 ? 32  PRO A C    2  
ATOM 3340  O O    . PRO A 1 32  ? 13.861  11.351  -7.304  1.00 0.00 ? 32  PRO A O    2  
ATOM 3341  C CB   . PRO A 1 32  ? 12.494  13.604  -5.850  1.00 0.00 ? 32  PRO A CB   2  
ATOM 3342  C CG   . PRO A 1 32  ? 11.054  13.755  -6.215  1.00 0.00 ? 32  PRO A CG   2  
ATOM 3343  C CD   . PRO A 1 32  ? 10.926  13.232  -7.613  1.00 0.00 ? 32  PRO A CD   2  
ATOM 3344  H HA   . PRO A 1 32  ? 13.797  14.614  -7.238  1.00 0.00 ? 32  PRO A HA   2  
ATOM 3345  H HB2  . PRO A 1 32  ? 12.681  12.651  -5.376  1.00 0.00 ? 32  PRO A HB2  2  
ATOM 3346  H HB3  . PRO A 1 32  ? 12.822  14.403  -5.201  1.00 0.00 ? 32  PRO A HB3  2  
ATOM 3347  H HG2  . PRO A 1 32  ? 10.440  13.177  -5.542  1.00 0.00 ? 32  PRO A HG2  2  
ATOM 3348  H HG3  . PRO A 1 32  ? 10.773  14.797  -6.180  1.00 0.00 ? 32  PRO A HG3  2  
ATOM 3349  H HD2  . PRO A 1 32  ? 10.777  12.162  -7.605  1.00 0.00 ? 32  PRO A HD2  2  
ATOM 3350  H HD3  . PRO A 1 32  ? 10.122  13.727  -8.136  1.00 0.00 ? 32  PRO A HD3  2  
ATOM 3351  N N    . GLY A 1 33  ? 15.534  12.853  -7.327  1.00 0.00 ? 33  GLY A N    2  
ATOM 3352  C CA   . GLY A 1 33  ? 16.552  11.832  -7.434  1.00 0.00 ? 33  GLY A CA   2  
ATOM 3353  C C    . GLY A 1 33  ? 17.552  11.901  -6.305  1.00 0.00 ? 33  GLY A C    2  
ATOM 3354  O O    . GLY A 1 33  ? 17.760  10.921  -5.592  1.00 0.00 ? 33  GLY A O    2  
ATOM 3355  H H    . GLY A 1 33  ? 15.793  13.805  -7.285  1.00 0.00 ? 33  GLY A H    2  
ATOM 3356  H HA2  . GLY A 1 33  ? 16.075  10.863  -7.422  1.00 0.00 ? 33  GLY A HA2  2  
ATOM 3357  H HA3  . GLY A 1 33  ? 17.074  11.953  -8.372  1.00 0.00 ? 33  GLY A HA3  2  
ATOM 3358  N N    . GLU A 1 34  ? 18.170  13.058  -6.145  1.00 0.00 ? 34  GLU A N    2  
ATOM 3359  C CA   . GLU A 1 34  ? 19.157  13.259  -5.095  1.00 0.00 ? 34  GLU A CA   2  
ATOM 3360  C C    . GLU A 1 34  ? 18.775  14.460  -4.236  1.00 0.00 ? 34  GLU A C    2  
ATOM 3361  O O    . GLU A 1 34  ? 19.627  15.094  -3.611  1.00 0.00 ? 34  GLU A O    2  
ATOM 3362  C CB   . GLU A 1 34  ? 20.542  13.463  -5.711  1.00 0.00 ? 34  GLU A CB   2  
ATOM 3363  C CG   . GLU A 1 34  ? 21.683  13.062  -4.797  1.00 0.00 ? 34  GLU A CG   2  
ATOM 3364  C CD   . GLU A 1 34  ? 23.037  13.377  -5.390  1.00 0.00 ? 34  GLU A CD   2  
ATOM 3365  O OE1  . GLU A 1 34  ? 23.501  14.524  -5.246  1.00 0.00 ? 34  GLU A OE1  2  
ATOM 3366  O OE2  . GLU A 1 34  ? 23.648  12.476  -6.002  1.00 0.00 ? 34  GLU A OE2  2  
ATOM 3367  H H    . GLU A 1 34  ? 17.970  13.799  -6.762  1.00 0.00 ? 34  GLU A H    2  
ATOM 3368  H HA   . GLU A 1 34  ? 19.168  12.375  -4.476  1.00 0.00 ? 34  GLU A HA   2  
ATOM 3369  H HB2  . GLU A 1 34  ? 20.612  12.873  -6.614  1.00 0.00 ? 34  GLU A HB2  2  
ATOM 3370  H HB3  . GLU A 1 34  ? 20.661  14.506  -5.964  1.00 0.00 ? 34  GLU A HB3  2  
ATOM 3371  H HG2  . GLU A 1 34  ? 21.586  13.592  -3.861  1.00 0.00 ? 34  GLU A HG2  2  
ATOM 3372  H HG3  . GLU A 1 34  ? 21.625  11.997  -4.616  1.00 0.00 ? 34  GLU A HG3  2  
ATOM 3373  N N    . GLY A 1 35  ? 17.488  14.770  -4.211  1.00 0.00 ? 35  GLY A N    2  
ATOM 3374  C CA   . GLY A 1 35  ? 17.013  15.892  -3.432  1.00 0.00 ? 35  GLY A CA   2  
ATOM 3375  C C    . GLY A 1 35  ? 16.297  15.451  -2.173  1.00 0.00 ? 35  GLY A C    2  
ATOM 3376  O O    . GLY A 1 35  ? 15.155  14.988  -2.239  1.00 0.00 ? 35  GLY A O    2  
ATOM 3377  H H    . GLY A 1 35  ? 16.853  14.231  -4.725  1.00 0.00 ? 35  GLY A H    2  
ATOM 3378  H HA2  . GLY A 1 35  ? 17.856  16.508  -3.159  1.00 0.00 ? 35  GLY A HA2  2  
ATOM 3379  H HA3  . GLY A 1 35  ? 16.333  16.474  -4.036  1.00 0.00 ? 35  GLY A HA3  2  
ATOM 3380  N N    . PRO A 1 36  ? 16.950  15.577  -1.008  1.00 0.00 ? 36  PRO A N    2  
ATOM 3381  C CA   . PRO A 1 36  ? 16.368  15.187  0.274   1.00 0.00 ? 36  PRO A CA   2  
ATOM 3382  C C    . PRO A 1 36  ? 15.226  16.108  0.680   1.00 0.00 ? 36  PRO A C    2  
ATOM 3383  O O    . PRO A 1 36  ? 15.383  17.331  0.719   1.00 0.00 ? 36  PRO A O    2  
ATOM 3384  C CB   . PRO A 1 36  ? 17.533  15.309  1.270   1.00 0.00 ? 36  PRO A CB   2  
ATOM 3385  C CG   . PRO A 1 36  ? 18.759  15.465  0.434   1.00 0.00 ? 36  PRO A CG   2  
ATOM 3386  C CD   . PRO A 1 36  ? 18.310  16.107  -0.844  1.00 0.00 ? 36  PRO A CD   2  
ATOM 3387  H HA   . PRO A 1 36  ? 16.014  14.167  0.254   1.00 0.00 ? 36  PRO A HA   2  
ATOM 3388  H HB2  . PRO A 1 36  ? 17.377  16.171  1.904   1.00 0.00 ? 36  PRO A HB2  2  
ATOM 3389  H HB3  . PRO A 1 36  ? 17.583  14.418  1.877   1.00 0.00 ? 36  PRO A HB3  2  
ATOM 3390  H HG2  . PRO A 1 36  ? 19.472  16.099  0.941   1.00 0.00 ? 36  PRO A HG2  2  
ATOM 3391  H HG3  . PRO A 1 36  ? 19.193  14.496  0.234   1.00 0.00 ? 36  PRO A HG3  2  
ATOM 3392  H HD2  . PRO A 1 36  ? 18.298  17.184  -0.747  1.00 0.00 ? 36  PRO A HD2  2  
ATOM 3393  H HD3  . PRO A 1 36  ? 18.942  15.804  -1.663  1.00 0.00 ? 36  PRO A HD3  2  
ATOM 3394  N N    . ALA A 1 37  ? 14.081  15.525  0.976   1.00 0.00 ? 37  ALA A N    2  
ATOM 3395  C CA   . ALA A 1 37  ? 12.922  16.302  1.375   1.00 0.00 ? 37  ALA A CA   2  
ATOM 3396  C C    . ALA A 1 37  ? 12.671  16.149  2.867   1.00 0.00 ? 37  ALA A C    2  
ATOM 3397  O O    . ALA A 1 37  ? 13.065  15.146  3.466   1.00 0.00 ? 37  ALA A O    2  
ATOM 3398  C CB   . ALA A 1 37  ? 11.702  15.868  0.583   1.00 0.00 ? 37  ALA A CB   2  
ATOM 3399  H H    . ALA A 1 37  ? 14.012  14.544  0.931   1.00 0.00 ? 37  ALA A H    2  
ATOM 3400  H HA   . ALA A 1 37  ? 13.121  17.341  1.151   1.00 0.00 ? 37  ALA A HA   2  
ATOM 3401  H HB1  . ALA A 1 37  ? 11.484  14.833  0.801   1.00 0.00 ? 37  ALA A HB1  2  
ATOM 3402  H HB2  . ALA A 1 37  ? 11.899  15.978  -0.473  1.00 0.00 ? 37  ALA A HB2  2  
ATOM 3403  H HB3  . ALA A 1 37  ? 10.858  16.480  0.859   1.00 0.00 ? 37  ALA A HB3  2  
ATOM 3404  N N    . ALA A 1 38  ? 12.025  17.138  3.469   1.00 0.00 ? 38  ALA A N    2  
ATOM 3405  C CA   . ALA A 1 38  ? 11.725  17.089  4.894   1.00 0.00 ? 38  ALA A CA   2  
ATOM 3406  C C    . ALA A 1 38  ? 10.607  16.096  5.173   1.00 0.00 ? 38  ALA A C    2  
ATOM 3407  O O    . ALA A 1 38  ? 10.565  15.472  6.235   1.00 0.00 ? 38  ALA A O    2  
ATOM 3408  C CB   . ALA A 1 38  ? 11.351  18.469  5.411   1.00 0.00 ? 38  ALA A CB   2  
ATOM 3409  H H    . ALA A 1 38  ? 11.740  17.920  2.942   1.00 0.00 ? 38  ALA A H    2  
ATOM 3410  H HA   . ALA A 1 38  ? 12.618  16.766  5.411   1.00 0.00 ? 38  ALA A HA   2  
ATOM 3411  H HB1  . ALA A 1 38  ? 12.129  19.173  5.153   1.00 0.00 ? 38  ALA A HB1  2  
ATOM 3412  H HB2  . ALA A 1 38  ? 11.240  18.433  6.484   1.00 0.00 ? 38  ALA A HB2  2  
ATOM 3413  H HB3  . ALA A 1 38  ? 10.419  18.781  4.962   1.00 0.00 ? 38  ALA A HB3  2  
ATOM 3414  N N    . ASP A 1 39  ? 9.701   15.953  4.217   1.00 0.00 ? 39  ASP A N    2  
ATOM 3415  C CA   . ASP A 1 39  ? 8.588   15.028  4.359   1.00 0.00 ? 39  ASP A CA   2  
ATOM 3416  C C    . ASP A 1 39  ? 8.822   13.777  3.521   1.00 0.00 ? 39  ASP A C    2  
ATOM 3417  O O    . ASP A 1 39  ? 9.220   13.855  2.355   1.00 0.00 ? 39  ASP A O    2  
ATOM 3418  C CB   . ASP A 1 39  ? 7.255   15.693  3.960   1.00 0.00 ? 39  ASP A CB   2  
ATOM 3419  C CG   . ASP A 1 39  ? 6.826   15.388  2.532   1.00 0.00 ? 39  ASP A CG   2  
ATOM 3420  O OD1  . ASP A 1 39  ? 6.168   14.345  2.306   1.00 0.00 ? 39  ASP A OD1  2  
ATOM 3421  O OD2  . ASP A 1 39  ? 7.141   16.194  1.628   1.00 0.00 ? 39  ASP A OD2  2  
ATOM 3422  H H    . ASP A 1 39  ? 9.782   16.490  3.393   1.00 0.00 ? 39  ASP A H    2  
ATOM 3423  H HA   . ASP A 1 39  ? 8.535   14.740  5.398   1.00 0.00 ? 39  ASP A HA   2  
ATOM 3424  H HB2  . ASP A 1 39  ? 6.479   15.347  4.623   1.00 0.00 ? 39  ASP A HB2  2  
ATOM 3425  H HB3  . ASP A 1 39  ? 7.354   16.765  4.063   1.00 0.00 ? 39  ASP A HB3  2  
ATOM 3426  N N    . PRO A 1 40  ? 8.659   12.599  4.131   1.00 0.00 ? 40  PRO A N    2  
ATOM 3427  C CA   . PRO A 1 40  ? 8.796   11.330  3.444   1.00 0.00 ? 40  PRO A CA   2  
ATOM 3428  C C    . PRO A 1 40  ? 7.433   10.776  3.037   1.00 0.00 ? 40  PRO A C    2  
ATOM 3429  O O    . PRO A 1 40  ? 7.334   9.711   2.436   1.00 0.00 ? 40  PRO A O    2  
ATOM 3430  C CB   . PRO A 1 40  ? 9.435   10.458  4.521   1.00 0.00 ? 40  PRO A CB   2  
ATOM 3431  C CG   . PRO A 1 40  ? 8.898   10.985  5.821   1.00 0.00 ? 40  PRO A CG   2  
ATOM 3432  C CD   . PRO A 1 40  ? 8.403   12.396  5.566   1.00 0.00 ? 40  PRO A CD   2  
ATOM 3433  H HA   . PRO A 1 40  ? 9.445   11.399  2.584   1.00 0.00 ? 40  PRO A HA   2  
ATOM 3434  H HB2  . PRO A 1 40  ? 9.154   9.427   4.366   1.00 0.00 ? 40  PRO A HB2  2  
ATOM 3435  H HB3  . PRO A 1 40  ? 10.510  10.554  4.473   1.00 0.00 ? 40  PRO A HB3  2  
ATOM 3436  H HG2  . PRO A 1 40  ? 8.081   10.362  6.154   1.00 0.00 ? 40  PRO A HG2  2  
ATOM 3437  H HG3  . PRO A 1 40  ? 9.685   10.995  6.561   1.00 0.00 ? 40  PRO A HG3  2  
ATOM 3438  H HD2  . PRO A 1 40  ? 7.348   12.470  5.782   1.00 0.00 ? 40  PRO A HD2  2  
ATOM 3439  H HD3  . PRO A 1 40  ? 8.961   13.104  6.161   1.00 0.00 ? 40  PRO A HD3  2  
ATOM 3440  N N    . LEU A 1 41  ? 6.390   11.539  3.346   1.00 0.00 ? 41  LEU A N    2  
ATOM 3441  C CA   . LEU A 1 41  ? 5.015   11.144  3.063   1.00 0.00 ? 41  LEU A CA   2  
ATOM 3442  C C    . LEU A 1 41  ? 4.754   11.035  1.567   1.00 0.00 ? 41  LEU A C    2  
ATOM 3443  O O    . LEU A 1 41  ? 4.181   10.049  1.103   1.00 0.00 ? 41  LEU A O    2  
ATOM 3444  C CB   . LEU A 1 41  ? 4.041   12.150  3.681   1.00 0.00 ? 41  LEU A CB   2  
ATOM 3445  C CG   . LEU A 1 41  ? 4.249   12.436  5.171   1.00 0.00 ? 41  LEU A CG   2  
ATOM 3446  C CD1  . LEU A 1 41  ? 3.330   13.554  5.635   1.00 0.00 ? 41  LEU A CD1  2  
ATOM 3447  C CD2  . LEU A 1 41  ? 4.007   11.181  5.997   1.00 0.00 ? 41  LEU A CD2  2  
ATOM 3448  H H    . LEU A 1 41  ? 6.552   12.407  3.770   1.00 0.00 ? 41  LEU A H    2  
ATOM 3449  H HA   . LEU A 1 41  ? 4.848   10.178  3.514   1.00 0.00 ? 41  LEU A HA   2  
ATOM 3450  H HB2  . LEU A 1 41  ? 4.130   13.084  3.143   1.00 0.00 ? 41  LEU A HB2  2  
ATOM 3451  H HB3  . LEU A 1 41  ? 3.038   11.773  3.547   1.00 0.00 ? 41  LEU A HB3  2  
ATOM 3452  H HG   . LEU A 1 41  ? 5.270   12.753  5.331   1.00 0.00 ? 41  LEU A HG   2  
ATOM 3453  H HD11 . LEU A 1 41  ? 3.434   13.685  6.702   1.00 0.00 ? 41  LEU A HD11 2  
ATOM 3454  H HD12 . LEU A 1 41  ? 2.306   13.298  5.401   1.00 0.00 ? 41  LEU A HD12 2  
ATOM 3455  H HD13 . LEU A 1 41  ? 3.596   14.471  5.131   1.00 0.00 ? 41  LEU A HD13 2  
ATOM 3456  H HD21 . LEU A 1 41  ? 4.139   11.412  7.043   1.00 0.00 ? 41  LEU A HD21 2  
ATOM 3457  H HD22 . LEU A 1 41  ? 4.709   10.415  5.705   1.00 0.00 ? 41  LEU A HD22 2  
ATOM 3458  H HD23 . LEU A 1 41  ? 2.999   10.828  5.831   1.00 0.00 ? 41  LEU A HD23 2  
ATOM 3459  N N    . HIS A 1 42  ? 5.180   12.045  0.815   1.00 0.00 ? 42  HIS A N    2  
ATOM 3460  C CA   . HIS A 1 42  ? 4.975   12.051  -0.636  1.00 0.00 ? 42  HIS A CA   2  
ATOM 3461  C C    . HIS A 1 42  ? 5.626   10.838  -1.296  1.00 0.00 ? 42  HIS A C    2  
ATOM 3462  O O    . HIS A 1 42  ? 5.079   10.258  -2.233  1.00 0.00 ? 42  HIS A O    2  
ATOM 3463  C CB   . HIS A 1 42  ? 5.523   13.334  -1.263  1.00 0.00 ? 42  HIS A CB   2  
ATOM 3464  C CG   . HIS A 1 42  ? 4.631   14.524  -1.089  1.00 0.00 ? 42  HIS A CG   2  
ATOM 3465  N ND1  . HIS A 1 42  ? 3.482   14.726  -1.827  1.00 0.00 ? 42  HIS A ND1  2  
ATOM 3466  C CD2  . HIS A 1 42  ? 4.722   15.580  -0.249  1.00 0.00 ? 42  HIS A CD2  2  
ATOM 3467  C CE1  . HIS A 1 42  ? 2.912   15.855  -1.450  1.00 0.00 ? 42  HIS A CE1  2  
ATOM 3468  N NE2  . HIS A 1 42  ? 3.646   16.390  -0.495  1.00 0.00 ? 42  HIS A NE2  2  
ATOM 3469  H H    . HIS A 1 42  ? 5.635   12.809  1.248   1.00 0.00 ? 42  HIS A H    2  
ATOM 3470  H HA   . HIS A 1 42  ? 3.911   12.008  -0.814  1.00 0.00 ? 42  HIS A HA   2  
ATOM 3471  H HB2  . HIS A 1 42  ? 6.476   13.568  -0.812  1.00 0.00 ? 42  HIS A HB2  2  
ATOM 3472  H HB3  . HIS A 1 42  ? 5.663   13.175  -2.323  1.00 0.00 ? 42  HIS A HB3  2  
ATOM 3473  H HD1  . HIS A 1 42  ? 3.126   14.121  -2.525  1.00 0.00 ? 42  HIS A HD1  2  
ATOM 3474  H HD2  . HIS A 1 42  ? 5.501   15.751  0.482   1.00 0.00 ? 42  HIS A HD2  2  
ATOM 3475  H HE1  . HIS A 1 42  ? 2.001   16.268  -1.854  1.00 0.00 ? 42  HIS A HE1  2  
ATOM 3476  H HE2  . HIS A 1 42  ? 3.458   17.249  -0.041  1.00 0.00 ? 42  HIS A HE2  2  
ATOM 3477  N N    . GLN A 1 43  ? 6.788   10.451  -0.792  1.00 0.00 ? 43  GLN A N    2  
ATOM 3478  C CA   . GLN A 1 43  ? 7.508   9.309   -1.338  1.00 0.00 ? 43  GLN A CA   2  
ATOM 3479  C C    . GLN A 1 43  ? 6.933   8.001   -0.812  1.00 0.00 ? 43  GLN A C    2  
ATOM 3480  O O    . GLN A 1 43  ? 6.829   7.025   -1.551  1.00 0.00 ? 43  GLN A O    2  
ATOM 3481  C CB   . GLN A 1 43  ? 9.000   9.405   -1.014  1.00 0.00 ? 43  GLN A CB   2  
ATOM 3482  C CG   . GLN A 1 43  ? 9.717   10.496  -1.798  1.00 0.00 ? 43  GLN A CG   2  
ATOM 3483  C CD   . GLN A 1 43  ? 9.519   10.358  -3.297  1.00 0.00 ? 43  GLN A CD   2  
ATOM 3484  O OE1  . GLN A 1 43  ? 9.424   9.247   -3.830  1.00 0.00 ? 43  GLN A OE1  2  
ATOM 3485  N NE2  . GLN A 1 43  ? 9.447   11.484  -3.989  1.00 0.00 ? 43  GLN A NE2  2  
ATOM 3486  H H    . GLN A 1 43  ? 7.168   10.941  -0.036  1.00 0.00 ? 43  GLN A H    2  
ATOM 3487  H HA   . GLN A 1 43  ? 7.384   9.328   -2.409  1.00 0.00 ? 43  GLN A HA   2  
ATOM 3488  H HB2  . GLN A 1 43  ? 9.119   9.608   0.041   1.00 0.00 ? 43  GLN A HB2  2  
ATOM 3489  H HB3  . GLN A 1 43  ? 9.470   8.459   -1.245  1.00 0.00 ? 43  GLN A HB3  2  
ATOM 3490  H HG2  . GLN A 1 43  ? 9.331   11.456  -1.486  1.00 0.00 ? 43  GLN A HG2  2  
ATOM 3491  H HG3  . GLN A 1 43  ? 10.772  10.445  -1.579  1.00 0.00 ? 43  GLN A HG3  2  
ATOM 3492  H HE21 . GLN A 1 43  ? 9.514   12.339  -3.501  1.00 0.00 ? 43  GLN A HE21 2  
ATOM 3493  H HE22 . GLN A 1 43  ? 9.320   11.425  -4.956  1.00 0.00 ? 43  GLN A HE22 2  
ATOM 3494  N N    . ALA A 1 44  ? 6.543   7.993   0.458   1.00 0.00 ? 44  ALA A N    2  
ATOM 3495  C CA   . ALA A 1 44  ? 5.974   6.804   1.082   1.00 0.00 ? 44  ALA A CA   2  
ATOM 3496  C C    . ALA A 1 44  ? 4.688   6.386   0.386   1.00 0.00 ? 44  ALA A C    2  
ATOM 3497  O O    . ALA A 1 44  ? 4.455   5.200   0.156   1.00 0.00 ? 44  ALA A O    2  
ATOM 3498  C CB   . ALA A 1 44  ? 5.713   7.051   2.559   1.00 0.00 ? 44  ALA A CB   2  
ATOM 3499  H H    . ALA A 1 44  ? 6.647   8.809   0.996   1.00 0.00 ? 44  ALA A H    2  
ATOM 3500  H HA   . ALA A 1 44  ? 6.695   6.005   0.996   1.00 0.00 ? 44  ALA A HA   2  
ATOM 3501  H HB1  . ALA A 1 44  ? 5.361   6.141   3.019   1.00 0.00 ? 44  ALA A HB1  2  
ATOM 3502  H HB2  . ALA A 1 44  ? 4.965   7.822   2.667   1.00 0.00 ? 44  ALA A HB2  2  
ATOM 3503  H HB3  . ALA A 1 44  ? 6.628   7.367   3.038   1.00 0.00 ? 44  ALA A HB3  2  
ATOM 3504  N N    . MET A 1 45  ? 3.860   7.369   0.050   1.00 0.00 ? 45  MET A N    2  
ATOM 3505  C CA   . MET A 1 45  ? 2.596   7.109   -0.629  1.00 0.00 ? 45  MET A CA   2  
ATOM 3506  C C    . MET A 1 45  ? 2.843   6.444   -1.979  1.00 0.00 ? 45  MET A C    2  
ATOM 3507  O O    . MET A 1 45  ? 2.125   5.525   -2.375  1.00 0.00 ? 45  MET A O    2  
ATOM 3508  C CB   . MET A 1 45  ? 1.822   8.412   -0.811  1.00 0.00 ? 45  MET A CB   2  
ATOM 3509  C CG   . MET A 1 45  ? 0.378   8.217   -1.234  1.00 0.00 ? 45  MET A CG   2  
ATOM 3510  S SD   . MET A 1 45  ? -0.668  9.608   -0.769  1.00 0.00 ? 45  MET A SD   2  
ATOM 3511  C CE   . MET A 1 45  ? -0.683  9.442   1.014   1.00 0.00 ? 45  MET A CE   2  
ATOM 3512  H H    . MET A 1 45  ? 4.101   8.297   0.276   1.00 0.00 ? 45  MET A H    2  
ATOM 3513  H HA   . MET A 1 45  ? 2.019   6.439   -0.010  1.00 0.00 ? 45  MET A HA   2  
ATOM 3514  H HB2  . MET A 1 45  ? 1.830   8.955   0.122   1.00 0.00 ? 45  MET A HB2  2  
ATOM 3515  H HB3  . MET A 1 45  ? 2.315   9.006   -1.565  1.00 0.00 ? 45  MET A HB3  2  
ATOM 3516  H HG2  . MET A 1 45  ? 0.341   8.101   -2.307  1.00 0.00 ? 45  MET A HG2  2  
ATOM 3517  H HG3  . MET A 1 45  ? -0.004  7.322   -0.762  1.00 0.00 ? 45  MET A HG3  2  
ATOM 3518  H HE1  . MET A 1 45  ? -1.258  10.249  1.446   1.00 0.00 ? 45  MET A HE1  2  
ATOM 3519  H HE2  . MET A 1 45  ? 0.328   9.481   1.390   1.00 0.00 ? 45  MET A HE2  2  
ATOM 3520  H HE3  . MET A 1 45  ? -1.132  8.497   1.283   1.00 0.00 ? 45  MET A HE3  2  
ATOM 3521  N N    . ARG A 1 46  ? 3.871   6.911   -2.676  1.00 0.00 ? 46  ARG A N    2  
ATOM 3522  C CA   . ARG A 1 46  ? 4.232   6.356   -3.970  1.00 0.00 ? 46  ARG A CA   2  
ATOM 3523  C C    . ARG A 1 46  ? 4.834   4.968   -3.779  1.00 0.00 ? 46  ARG A C    2  
ATOM 3524  O O    . ARG A 1 46  ? 4.491   4.029   -4.489  1.00 0.00 ? 46  ARG A O    2  
ATOM 3525  C CB   . ARG A 1 46  ? 5.232   7.281   -4.685  1.00 0.00 ? 46  ARG A CB   2  
ATOM 3526  C CG   . ARG A 1 46  ? 5.554   6.869   -6.120  1.00 0.00 ? 46  ARG A CG   2  
ATOM 3527  C CD   . ARG A 1 46  ? 6.798   5.990   -6.197  1.00 0.00 ? 46  ARG A CD   2  
ATOM 3528  N NE   . ARG A 1 46  ? 7.937   6.584   -5.498  1.00 0.00 ? 46  ARG A NE   2  
ATOM 3529  C CZ   . ARG A 1 46  ? 9.091   5.951   -5.279  1.00 0.00 ? 46  ARG A CZ   2  
ATOM 3530  N NH1  . ARG A 1 46  ? 9.298   4.727   -5.755  1.00 0.00 ? 46  ARG A NH1  2  
ATOM 3531  N NH2  . ARG A 1 46  ? 10.055  6.555   -4.596  1.00 0.00 ? 46  ARG A NH2  2  
ATOM 3532  H H    . ARG A 1 46  ? 4.399   7.649   -2.306  1.00 0.00 ? 46  ARG A H    2  
ATOM 3533  H HA   . ARG A 1 46  ? 3.334   6.275   -4.564  1.00 0.00 ? 46  ARG A HA   2  
ATOM 3534  H HB2  . ARG A 1 46  ? 4.826   8.281   -4.705  1.00 0.00 ? 46  ARG A HB2  2  
ATOM 3535  H HB3  . ARG A 1 46  ? 6.154   7.291   -4.124  1.00 0.00 ? 46  ARG A HB3  2  
ATOM 3536  H HG2  . ARG A 1 46  ? 4.716   6.320   -6.519  1.00 0.00 ? 46  ARG A HG2  2  
ATOM 3537  H HG3  . ARG A 1 46  ? 5.716   7.757   -6.711  1.00 0.00 ? 46  ARG A HG3  2  
ATOM 3538  H HD2  . ARG A 1 46  ? 6.573   5.034   -5.749  1.00 0.00 ? 46  ARG A HD2  2  
ATOM 3539  H HD3  . ARG A 1 46  ? 7.059   5.847   -7.235  1.00 0.00 ? 46  ARG A HD3  2  
ATOM 3540  H HE   . ARG A 1 46  ? 7.829   7.501   -5.161  1.00 0.00 ? 46  ARG A HE   2  
ATOM 3541  H HH11 . ARG A 1 46  ? 8.584   4.254   -6.296  1.00 0.00 ? 46  ARG A HH11 2  
ATOM 3542  H HH12 . ARG A 1 46  ? 10.170  4.260   -5.577  1.00 0.00 ? 46  ARG A HH12 2  
ATOM 3543  H HH21 . ARG A 1 46  ? 9.922   7.490   -4.244  1.00 0.00 ? 46  ARG A HH21 2  
ATOM 3544  H HH22 . ARG A 1 46  ? 10.923  6.079   -4.423  1.00 0.00 ? 46  ARG A HH22 2  
ATOM 3545  N N    . ALA A 1 47  ? 5.717   4.855   -2.795  1.00 0.00 ? 47  ALA A N    2  
ATOM 3546  C CA   . ALA A 1 47  ? 6.395   3.601   -2.487  1.00 0.00 ? 47  ALA A CA   2  
ATOM 3547  C C    . ALA A 1 47  ? 5.414   2.485   -2.140  1.00 0.00 ? 47  ALA A C    2  
ATOM 3548  O O    . ALA A 1 47  ? 5.558   1.357   -2.614  1.00 0.00 ? 47  ALA A O    2  
ATOM 3549  C CB   . ALA A 1 47  ? 7.374   3.811   -1.345  1.00 0.00 ? 47  ALA A CB   2  
ATOM 3550  H H    . ALA A 1 47  ? 5.925   5.649   -2.251  1.00 0.00 ? 47  ALA A H    2  
ATOM 3551  H HA   . ALA A 1 47  ? 6.961   3.308   -3.359  1.00 0.00 ? 47  ALA A HA   2  
ATOM 3552  H HB1  . ALA A 1 47  ? 7.935   2.903   -1.179  1.00 0.00 ? 47  ALA A HB1  2  
ATOM 3553  H HB2  . ALA A 1 47  ? 6.832   4.068   -0.448  1.00 0.00 ? 47  ALA A HB2  2  
ATOM 3554  H HB3  . ALA A 1 47  ? 8.052   4.612   -1.597  1.00 0.00 ? 47  ALA A HB3  2  
ATOM 3555  N N    . ALA A 1 48  ? 4.411   2.810   -1.329  1.00 0.00 ? 48  ALA A N    2  
ATOM 3556  C CA   . ALA A 1 48  ? 3.406   1.837   -0.905  1.00 0.00 ? 48  ALA A CA   2  
ATOM 3557  C C    . ALA A 1 48  ? 2.685   1.195   -2.090  1.00 0.00 ? 48  ALA A C    2  
ATOM 3558  O O    . ALA A 1 48  ? 2.110   0.118   -1.965  1.00 0.00 ? 48  ALA A O    2  
ATOM 3559  C CB   . ALA A 1 48  ? 2.403   2.494   0.027   1.00 0.00 ? 48  ALA A CB   2  
ATOM 3560  H H    . ALA A 1 48  ? 4.350   3.733   -0.994  1.00 0.00 ? 48  ALA A H    2  
ATOM 3561  H HA   . ALA A 1 48  ? 3.912   1.062   -0.348  1.00 0.00 ? 48  ALA A HA   2  
ATOM 3562  H HB1  . ALA A 1 48  ? 1.835   3.231   -0.521  1.00 0.00 ? 48  ALA A HB1  2  
ATOM 3563  H HB2  . ALA A 1 48  ? 2.927   2.975   0.840   1.00 0.00 ? 48  ALA A HB2  2  
ATOM 3564  H HB3  . ALA A 1 48  ? 1.734   1.745   0.423   1.00 0.00 ? 48  ALA A HB3  2  
ATOM 3565  N N    . GLY A 1 49  ? 2.717   1.858   -3.238  1.00 0.00 ? 49  GLY A N    2  
ATOM 3566  C CA   . GLY A 1 49  ? 2.076   1.319   -4.417  1.00 0.00 ? 49  GLY A CA   2  
ATOM 3567  C C    . GLY A 1 49  ? 3.031   1.225   -5.590  1.00 0.00 ? 49  GLY A C    2  
ATOM 3568  O O    . GLY A 1 49  ? 2.610   1.257   -6.745  1.00 0.00 ? 49  GLY A O    2  
ATOM 3569  H H    . GLY A 1 49  ? 3.183   2.720   -3.285  1.00 0.00 ? 49  GLY A H    2  
ATOM 3570  H HA2  . GLY A 1 49  ? 1.696   0.333   -4.188  1.00 0.00 ? 49  GLY A HA2  2  
ATOM 3571  H HA3  . GLY A 1 49  ? 1.249   1.958   -4.691  1.00 0.00 ? 49  GLY A HA3  2  
ATOM 3572  N N    . ASP A 1 50  ? 4.322   1.107   -5.297  1.00 0.00 ? 50  ASP A N    2  
ATOM 3573  C CA   . ASP A 1 50  ? 5.337   1.030   -6.347  1.00 0.00 ? 50  ASP A CA   2  
ATOM 3574  C C    . ASP A 1 50  ? 6.504   0.131   -5.937  1.00 0.00 ? 50  ASP A C    2  
ATOM 3575  O O    . ASP A 1 50  ? 6.927   -0.731  -6.705  1.00 0.00 ? 50  ASP A O    2  
ATOM 3576  C CB   . ASP A 1 50  ? 5.841   2.436   -6.684  1.00 0.00 ? 50  ASP A CB   2  
ATOM 3577  C CG   . ASP A 1 50  ? 6.971   2.444   -7.694  1.00 0.00 ? 50  ASP A CG   2  
ATOM 3578  O OD1  . ASP A 1 50  ? 6.767   1.974   -8.830  1.00 0.00 ? 50  ASP A OD1  2  
ATOM 3579  O OD2  . ASP A 1 50  ? 8.060   2.948   -7.361  1.00 0.00 ? 50  ASP A OD2  2  
ATOM 3580  H H    . ASP A 1 50  ? 4.599   1.077   -4.353  1.00 0.00 ? 50  ASP A H    2  
ATOM 3581  H HA   . ASP A 1 50  ? 4.870   0.608   -7.223  1.00 0.00 ? 50  ASP A HA   2  
ATOM 3582  H HB2  . ASP A 1 50  ? 5.024   3.013   -7.091  1.00 0.00 ? 50  ASP A HB2  2  
ATOM 3583  H HB3  . ASP A 1 50  ? 6.191   2.910   -5.778  1.00 0.00 ? 50  ASP A HB3  2  
ATOM 3584  N N    . GLU A 1 51  ? 6.998   0.317   -4.716  1.00 0.00 ? 51  GLU A N    2  
ATOM 3585  C CA   . GLU A 1 51  ? 8.124   -0.465  -4.204  1.00 0.00 ? 51  GLU A CA   2  
ATOM 3586  C C    . GLU A 1 51  ? 7.811   -1.959  -4.212  1.00 0.00 ? 51  GLU A C    2  
ATOM 3587  O O    . GLU A 1 51  ? 8.541   -2.753  -4.804  1.00 0.00 ? 51  GLU A O    2  
ATOM 3588  C CB   . GLU A 1 51  ? 8.478   -0.017  -2.783  1.00 0.00 ? 51  GLU A CB   2  
ATOM 3589  C CG   . GLU A 1 51  ? 9.313   1.254   -2.724  1.00 0.00 ? 51  GLU A CG   2  
ATOM 3590  C CD   . GLU A 1 51  ? 10.805  0.992   -2.824  1.00 0.00 ? 51  GLU A CD   2  
ATOM 3591  O OE1  . GLU A 1 51  ? 11.341  0.213   -2.008  1.00 0.00 ? 51  GLU A OE1  2  
ATOM 3592  O OE2  . GLU A 1 51  ? 11.456  1.576   -3.716  1.00 0.00 ? 51  GLU A OE2  2  
ATOM 3593  H H    . GLU A 1 51  ? 6.588   0.993   -4.135  1.00 0.00 ? 51  GLU A H    2  
ATOM 3594  H HA   . GLU A 1 51  ? 8.971   -0.282  -4.849  1.00 0.00 ? 51  GLU A HA   2  
ATOM 3595  H HB2  . GLU A 1 51  ? 7.563   0.154   -2.236  1.00 0.00 ? 51  GLU A HB2  2  
ATOM 3596  H HB3  . GLU A 1 51  ? 9.030   -0.809  -2.297  1.00 0.00 ? 51  GLU A HB3  2  
ATOM 3597  H HG2  . GLU A 1 51  ? 9.022   1.898   -3.541  1.00 0.00 ? 51  GLU A HG2  2  
ATOM 3598  H HG3  . GLU A 1 51  ? 9.113   1.754   -1.787  1.00 0.00 ? 51  GLU A HG3  2  
ATOM 3599  N N    . PHE A 1 52  ? 6.715   -2.333  -3.564  1.00 0.00 ? 52  PHE A N    2  
ATOM 3600  C CA   . PHE A 1 52  ? 6.315   -3.733  -3.496  1.00 0.00 ? 52  PHE A CA   2  
ATOM 3601  C C    . PHE A 1 52  ? 5.913   -4.259  -4.875  1.00 0.00 ? 52  PHE A C    2  
ATOM 3602  O O    . PHE A 1 52  ? 6.072   -5.442  -5.166  1.00 0.00 ? 52  PHE A O    2  
ATOM 3603  C CB   . PHE A 1 52  ? 5.169   -3.919  -2.485  1.00 0.00 ? 52  PHE A CB   2  
ATOM 3604  C CG   . PHE A 1 52  ? 3.789   -3.694  -3.048  1.00 0.00 ? 52  PHE A CG   2  
ATOM 3605  C CD1  . PHE A 1 52  ? 3.394   -2.441  -3.489  1.00 0.00 ? 52  PHE A CD1  2  
ATOM 3606  C CD2  . PHE A 1 52  ? 2.887   -4.744  -3.134  1.00 0.00 ? 52  PHE A CD2  2  
ATOM 3607  C CE1  . PHE A 1 52  ? 2.129   -2.242  -4.007  1.00 0.00 ? 52  PHE A CE1  2  
ATOM 3608  C CE2  . PHE A 1 52  ? 1.621   -4.547  -3.649  1.00 0.00 ? 52  PHE A CE2  2  
ATOM 3609  C CZ   . PHE A 1 52  ? 1.244   -3.296  -4.087  1.00 0.00 ? 52  PHE A CZ   2  
ATOM 3610  H H    . PHE A 1 52  ? 6.174   -1.656  -3.106  1.00 0.00 ? 52  PHE A H    2  
ATOM 3611  H HA   . PHE A 1 52  ? 7.171   -4.297  -3.153  1.00 0.00 ? 52  PHE A HA   2  
ATOM 3612  H HB2  . PHE A 1 52  ? 5.206   -4.928  -2.102  1.00 0.00 ? 52  PHE A HB2  2  
ATOM 3613  H HB3  . PHE A 1 52  ? 5.309   -3.229  -1.665  1.00 0.00 ? 52  PHE A HB3  2  
ATOM 3614  H HD1  . PHE A 1 52  ? 4.086   -1.614  -3.427  1.00 0.00 ? 52  PHE A HD1  2  
ATOM 3615  H HD2  . PHE A 1 52  ? 3.181   -5.725  -2.792  1.00 0.00 ? 52  PHE A HD2  2  
ATOM 3616  H HE1  . PHE A 1 52  ? 1.832   -1.262  -4.348  1.00 0.00 ? 52  PHE A HE1  2  
ATOM 3617  H HE2  . PHE A 1 52  ? 0.927   -5.374  -3.710  1.00 0.00 ? 52  PHE A HE2  2  
ATOM 3618  H HZ   . PHE A 1 52  ? 0.254   -3.140  -4.490  1.00 0.00 ? 52  PHE A HZ   2  
ATOM 3619  N N    . GLU A 1 53  ? 5.417   -3.367  -5.728  1.00 0.00 ? 53  GLU A N    2  
ATOM 3620  C CA   . GLU A 1 53  ? 4.990   -3.744  -7.069  1.00 0.00 ? 53  GLU A CA   2  
ATOM 3621  C C    . GLU A 1 53  ? 6.199   -4.063  -7.942  1.00 0.00 ? 53  GLU A C    2  
ATOM 3622  O O    . GLU A 1 53  ? 6.218   -5.070  -8.650  1.00 0.00 ? 53  GLU A O    2  
ATOM 3623  C CB   . GLU A 1 53  ? 4.153   -2.625  -7.702  1.00 0.00 ? 53  GLU A CB   2  
ATOM 3624  C CG   . GLU A 1 53  ? 3.585   -2.977  -9.070  1.00 0.00 ? 53  GLU A CG   2  
ATOM 3625  C CD   . GLU A 1 53  ? 2.636   -4.158  -9.029  1.00 0.00 ? 53  GLU A CD   2  
ATOM 3626  O OE1  . GLU A 1 53  ? 3.073   -5.264  -8.657  1.00 0.00 ? 53  GLU A OE1  2  
ATOM 3627  O OE2  . GLU A 1 53  ? 1.446   -3.989  -9.373  1.00 0.00 ? 53  GLU A OE2  2  
ATOM 3628  H H    . GLU A 1 53  ? 5.342   -2.432  -5.447  1.00 0.00 ? 53  GLU A H    2  
ATOM 3629  H HA   . GLU A 1 53  ? 4.382   -4.632  -6.985  1.00 0.00 ? 53  GLU A HA   2  
ATOM 3630  H HB2  . GLU A 1 53  ? 3.326   -2.396  -7.044  1.00 0.00 ? 53  GLU A HB2  2  
ATOM 3631  H HB3  . GLU A 1 53  ? 4.770   -1.745  -7.808  1.00 0.00 ? 53  GLU A HB3  2  
ATOM 3632  H HG2  . GLU A 1 53  ? 3.049   -2.120  -9.453  1.00 0.00 ? 53  GLU A HG2  2  
ATOM 3633  H HG3  . GLU A 1 53  ? 4.403   -3.213  -9.734  1.00 0.00 ? 53  GLU A HG3  2  
ATOM 3634  N N    . THR A 1 54  ? 7.219   -3.220  -7.865  1.00 0.00 ? 54  THR A N    2  
ATOM 3635  C CA   . THR A 1 54  ? 8.428   -3.415  -8.649  1.00 0.00 ? 54  THR A CA   2  
ATOM 3636  C C    . THR A 1 54  ? 9.237   -4.593  -8.107  1.00 0.00 ? 54  THR A C    2  
ATOM 3637  O O    . THR A 1 54  ? 10.216  -5.018  -8.714  1.00 0.00 ? 54  THR A O    2  
ATOM 3638  C CB   . THR A 1 54  ? 9.296   -2.131  -8.683  1.00 0.00 ? 54  THR A CB   2  
ATOM 3639  O OG1  . THR A 1 54  ? 10.123  -2.121  -9.856  1.00 0.00 ? 54  THR A OG1  2  
ATOM 3640  C CG2  . THR A 1 54  ? 10.176  -2.013  -7.445  1.00 0.00 ? 54  THR A CG2  2  
ATOM 3641  H H    . THR A 1 54  ? 7.156   -2.441  -7.267  1.00 0.00 ? 54  THR A H    2  
ATOM 3642  H HA   . THR A 1 54  ? 8.125   -3.644  -9.661  1.00 0.00 ? 54  THR A HA   2  
ATOM 3643  H HB   . THR A 1 54  ? 8.637   -1.274  -8.717  1.00 0.00 ? 54  THR A HB   2  
ATOM 3644  H HG1  . THR A 1 54  ? 10.631  -2.943  -9.899  1.00 0.00 ? 54  THR A HG1  2  
ATOM 3645  H HG21 . THR A 1 54  ? 10.820  -2.876  -7.376  1.00 0.00 ? 54  THR A HG21 2  
ATOM 3646  H HG22 . THR A 1 54  ? 9.553   -1.958  -6.562  1.00 0.00 ? 54  THR A HG22 2  
ATOM 3647  H HG23 . THR A 1 54  ? 10.779  -1.121  -7.516  1.00 0.00 ? 54  THR A HG23 2  
ATOM 3648  N N    . ARG A 1 55  ? 8.823   -5.117  -6.961  1.00 0.00 ? 55  ARG A N    2  
ATOM 3649  C CA   . ARG A 1 55  ? 9.502   -6.251  -6.359  1.00 0.00 ? 55  ARG A CA   2  
ATOM 3650  C C    . ARG A 1 55  ? 8.630   -7.495  -6.453  1.00 0.00 ? 55  ARG A C    2  
ATOM 3651  O O    . ARG A 1 55  ? 8.974   -8.558  -5.935  1.00 0.00 ? 55  ARG A O    2  
ATOM 3652  C CB   . ARG A 1 55  ? 9.867   -5.953  -4.904  1.00 0.00 ? 55  ARG A CB   2  
ATOM 3653  C CG   . ARG A 1 55  ? 11.167  -5.185  -4.764  1.00 0.00 ? 55  ARG A CG   2  
ATOM 3654  C CD   . ARG A 1 55  ? 11.657  -5.168  -3.327  1.00 0.00 ? 55  ARG A CD   2  
ATOM 3655  N NE   . ARG A 1 55  ? 10.849  -4.293  -2.477  1.00 0.00 ? 55  ARG A NE   2  
ATOM 3656  C CZ   . ARG A 1 55  ? 11.094  -2.993  -2.309  1.00 0.00 ? 55  ARG A CZ   2  
ATOM 3657  N NH1  . ARG A 1 55  ? 12.113  -2.421  -2.938  1.00 0.00 ? 55  ARG A NH1  2  
ATOM 3658  N NH2  . ARG A 1 55  ? 10.325  -2.257  -1.514  1.00 0.00 ? 55  ARG A NH2  2  
ATOM 3659  H H    . ARG A 1 55  ? 8.045   -4.728  -6.508  1.00 0.00 ? 55  ARG A H    2  
ATOM 3660  H HA   . ARG A 1 55  ? 10.409  -6.424  -6.919  1.00 0.00 ? 55  ARG A HA   2  
ATOM 3661  H HB2  . ARG A 1 55  ? 9.076   -5.365  -4.459  1.00 0.00 ? 55  ARG A HB2  2  
ATOM 3662  H HB3  . ARG A 1 55  ? 9.962   -6.884  -4.365  1.00 0.00 ? 55  ARG A HB3  2  
ATOM 3663  H HG2  . ARG A 1 55  ? 11.919  -5.651  -5.385  1.00 0.00 ? 55  ARG A HG2  2  
ATOM 3664  H HG3  . ARG A 1 55  ? 11.010  -4.168  -5.092  1.00 0.00 ? 55  ARG A HG3  2  
ATOM 3665  H HD2  . ARG A 1 55  ? 11.614  -6.174  -2.937  1.00 0.00 ? 55  ARG A HD2  2  
ATOM 3666  H HD3  . ARG A 1 55  ? 12.680  -4.822  -3.315  1.00 0.00 ? 55  ARG A HD3  2  
ATOM 3667  H HE   . ARG A 1 55  ? 10.091  -4.702  -2.003  1.00 0.00 ? 55  ARG A HE   2  
ATOM 3668  H HH11 . ARG A 1 55  ? 12.709  -2.963  -3.543  1.00 0.00 ? 55  ARG A HH11 2  
ATOM 3669  H HH12 . ARG A 1 55  ? 12.288  -1.440  -2.816  1.00 0.00 ? 55  ARG A HH12 2  
ATOM 3670  H HH21 . ARG A 1 55  ? 9.541   -2.666  -1.025  1.00 0.00 ? 55  ARG A HH21 2  
ATOM 3671  H HH22 . ARG A 1 55  ? 10.524  -1.275  -1.397  1.00 0.00 ? 55  ARG A HH22 2  
ATOM 3672  N N    . PHE A 1 56  ? 7.503   -7.355  -7.133  1.00 0.00 ? 56  PHE A N    2  
ATOM 3673  C CA   . PHE A 1 56  ? 6.581   -8.458  -7.316  1.00 0.00 ? 56  PHE A CA   2  
ATOM 3674  C C    . PHE A 1 56  ? 6.431   -8.761  -8.801  1.00 0.00 ? 56  PHE A C    2  
ATOM 3675  O O    . PHE A 1 56  ? 7.162   -9.590  -9.346  1.00 0.00 ? 56  PHE A O    2  
ATOM 3676  C CB   . PHE A 1 56  ? 5.215   -8.130  -6.695  1.00 0.00 ? 56  PHE A CB   2  
ATOM 3677  C CG   . PHE A 1 56  ? 4.247   -9.286  -6.685  1.00 0.00 ? 56  PHE A CG   2  
ATOM 3678  C CD1  . PHE A 1 56  ? 4.258   -10.209 -5.654  1.00 0.00 ? 56  PHE A CD1  2  
ATOM 3679  C CD2  . PHE A 1 56  ? 3.323   -9.444  -7.708  1.00 0.00 ? 56  PHE A CD2  2  
ATOM 3680  C CE1  . PHE A 1 56  ? 3.370   -11.267 -5.643  1.00 0.00 ? 56  PHE A CE1  2  
ATOM 3681  C CE2  . PHE A 1 56  ? 2.433   -10.499 -7.703  1.00 0.00 ? 56  PHE A CE2  2  
ATOM 3682  C CZ   . PHE A 1 56  ? 2.456   -11.412 -6.669  1.00 0.00 ? 56  PHE A CZ   2  
ATOM 3683  H H    . PHE A 1 56  ? 7.288   -6.481  -7.525  1.00 0.00 ? 56  PHE A H    2  
ATOM 3684  H HA   . PHE A 1 56  ? 6.995   -9.325  -6.823  1.00 0.00 ? 56  PHE A HA   2  
ATOM 3685  H HB2  . PHE A 1 56  ? 5.360   -7.814  -5.674  1.00 0.00 ? 56  PHE A HB2  2  
ATOM 3686  H HB3  . PHE A 1 56  ? 4.762   -7.323  -7.252  1.00 0.00 ? 56  PHE A HB3  2  
ATOM 3687  H HD1  . PHE A 1 56  ? 4.972   -10.097 -4.851  1.00 0.00 ? 56  PHE A HD1  2  
ATOM 3688  H HD2  . PHE A 1 56  ? 3.306   -8.730  -8.519  1.00 0.00 ? 56  PHE A HD2  2  
ATOM 3689  H HE1  . PHE A 1 56  ? 3.391   -11.979 -4.831  1.00 0.00 ? 56  PHE A HE1  2  
ATOM 3690  H HE2  . PHE A 1 56  ? 1.721   -10.612 -8.506  1.00 0.00 ? 56  PHE A HE2  2  
ATOM 3691  H HZ   . PHE A 1 56  ? 1.758   -12.237 -6.664  1.00 0.00 ? 56  PHE A HZ   2  
ATOM 3692  N N    . ARG A 1 57  ? 5.519   -8.040  -9.452  1.00 0.00 ? 57  ARG A N    2  
ATOM 3693  C CA   . ARG A 1 57  ? 5.232   -8.219  -10.872 1.00 0.00 ? 57  ARG A CA   2  
ATOM 3694  C C    . ARG A 1 57  ? 4.072   -7.316  -11.268 1.00 0.00 ? 57  ARG A C    2  
ATOM 3695  O O    . ARG A 1 57  ? 4.247   -6.304  -11.947 1.00 0.00 ? 57  ARG A O    2  
ATOM 3696  C CB   . ARG A 1 57  ? 4.862   -9.684  -11.163 1.00 0.00 ? 57  ARG A CB   2  
ATOM 3697  C CG   . ARG A 1 57  ? 4.483   -9.962  -12.612 1.00 0.00 ? 57  ARG A CG   2  
ATOM 3698  C CD   . ARG A 1 57  ? 3.341   -10.965 -12.705 1.00 0.00 ? 57  ARG A CD   2  
ATOM 3699  N NE   . ARG A 1 57  ? 3.552   -12.126 -11.834 1.00 0.00 ? 57  ARG A NE   2  
ATOM 3700  C CZ   . ARG A 1 57  ? 2.634   -12.605 -10.991 1.00 0.00 ? 57  ARG A CZ   2  
ATOM 3701  N NH1  . ARG A 1 57  ? 1.421   -12.067 -10.950 1.00 0.00 ? 57  ARG A NH1  2  
ATOM 3702  N NH2  . ARG A 1 57  ? 2.923   -13.638 -10.205 1.00 0.00 ? 57  ARG A NH2  2  
ATOM 3703  H H    . ARG A 1 57  ? 5.027   -7.345  -8.958  1.00 0.00 ? 57  ARG A H    2  
ATOM 3704  H HA   . ARG A 1 57  ? 6.110   -7.948  -11.437 1.00 0.00 ? 57  ARG A HA   2  
ATOM 3705  H HB2  . ARG A 1 57  ? 5.707   -10.308 -10.912 1.00 0.00 ? 57  ARG A HB2  2  
ATOM 3706  H HB3  . ARG A 1 57  ? 4.026   -9.960  -10.537 1.00 0.00 ? 57  ARG A HB3  2  
ATOM 3707  H HG2  . ARG A 1 57  ? 4.175   -9.037  -13.078 1.00 0.00 ? 57  ARG A HG2  2  
ATOM 3708  H HG3  . ARG A 1 57  ? 5.343   -10.359 -13.130 1.00 0.00 ? 57  ARG A HG3  2  
ATOM 3709  H HD2  . ARG A 1 57  ? 2.425   -10.473 -12.415 1.00 0.00 ? 57  ARG A HD2  2  
ATOM 3710  H HD3  . ARG A 1 57  ? 3.256   -11.304 -13.728 1.00 0.00 ? 57  ARG A HD3  2  
ATOM 3711  H HE   . ARG A 1 57  ? 4.440   -12.563 -11.877 1.00 0.00 ? 57  ARG A HE   2  
ATOM 3712  H HH11 . ARG A 1 57  ? 1.185   -11.303 -11.563 1.00 0.00 ? 57  ARG A HH11 2  
ATOM 3713  H HH12 . ARG A 1 57  ? 0.729   -12.412 -10.297 1.00 0.00 ? 57  ARG A HH12 2  
ATOM 3714  H HH21 . ARG A 1 57  ? 3.834   -14.068 -10.240 1.00 0.00 ? 57  ARG A HH21 2  
ATOM 3715  H HH22 . ARG A 1 57  ? 2.229   -14.001 -9.567  1.00 0.00 ? 57  ARG A HH22 2  
ATOM 3716  N N    . ARG A 1 58  ? 2.887   -7.698  -10.813 1.00 0.00 ? 58  ARG A N    2  
ATOM 3717  C CA   . ARG A 1 58  ? 1.668   -6.958  -11.084 1.00 0.00 ? 58  ARG A CA   2  
ATOM 3718  C C    . ARG A 1 58  ? 0.657   -7.236  -9.983  1.00 0.00 ? 58  ARG A C    2  
ATOM 3719  O O    . ARG A 1 58  ? -0.424  -7.755  -10.240 1.00 0.00 ? 58  ARG A O    2  
ATOM 3720  C CB   . ARG A 1 58  ? 1.086   -7.344  -12.449 1.00 0.00 ? 58  ARG A CB   2  
ATOM 3721  C CG   . ARG A 1 58  ? 1.485   -6.402  -13.572 1.00 0.00 ? 58  ARG A CG   2  
ATOM 3722  C CD   . ARG A 1 58  ? 0.613   -5.156  -13.604 1.00 0.00 ? 58  ARG A CD   2  
ATOM 3723  N NE   . ARG A 1 58  ? 0.805   -4.309  -12.427 1.00 0.00 ? 58  ARG A NE   2  
ATOM 3724  C CZ   . ARG A 1 58  ? 0.629   -2.992  -12.421 1.00 0.00 ? 58  ARG A CZ   2  
ATOM 3725  N NH1  . ARG A 1 58  ? 0.325   -2.350  -13.541 1.00 0.00 ? 58  ARG A NH1  2  
ATOM 3726  N NH2  . ARG A 1 58  ? 0.782   -2.316  -11.293 1.00 0.00 ? 58  ARG A NH2  2  
ATOM 3727  H H    . ARG A 1 58  ? 2.832   -8.508  -10.266 1.00 0.00 ? 58  ARG A H    2  
ATOM 3728  H HA   . ARG A 1 58  ? 1.908   -5.905  -11.082 1.00 0.00 ? 58  ARG A HA   2  
ATOM 3729  H HB2  . ARG A 1 58  ? 1.425   -8.337  -12.705 1.00 0.00 ? 58  ARG A HB2  2  
ATOM 3730  H HB3  . ARG A 1 58  ? 0.008   -7.349  -12.379 1.00 0.00 ? 58  ARG A HB3  2  
ATOM 3731  H HG2  . ARG A 1 58  ? 2.512   -6.103  -13.430 1.00 0.00 ? 58  ARG A HG2  2  
ATOM 3732  H HG3  . ARG A 1 58  ? 1.388   -6.923  -14.514 1.00 0.00 ? 58  ARG A HG3  2  
ATOM 3733  H HD2  . ARG A 1 58  ? 0.858   -4.585  -14.486 1.00 0.00 ? 58  ARG A HD2  2  
ATOM 3734  H HD3  . ARG A 1 58  ? -0.423  -5.460  -13.650 1.00 0.00 ? 58  ARG A HD3  2  
ATOM 3735  H HE   . ARG A 1 58  ? 1.070   -4.750  -11.590 1.00 0.00 ? 58  ARG A HE   2  
ATOM 3736  H HH11 . ARG A 1 58  ? 0.234   -2.854  -14.409 1.00 0.00 ? 58  ARG A HH11 2  
ATOM 3737  H HH12 . ARG A 1 58  ? 0.170   -1.354  -13.528 1.00 0.00 ? 58  ARG A HH12 2  
ATOM 3738  H HH21 . ARG A 1 58  ? 1.025   -2.804  -10.440 1.00 0.00 ? 58  ARG A HH21 2  
ATOM 3739  H HH22 . ARG A 1 58  ? 0.681   -1.311  -11.282 1.00 0.00 ? 58  ARG A HH22 2  
ATOM 3740  N N    . THR A 1 59  ? 1.028   -6.887  -8.759  1.00 0.00 ? 59  THR A N    2  
ATOM 3741  C CA   . THR A 1 59  ? 0.182   -7.098  -7.593  1.00 0.00 ? 59  THR A CA   2  
ATOM 3742  C C    . THR A 1 59  ? -1.162  -6.398  -7.762  1.00 0.00 ? 59  THR A C    2  
ATOM 3743  O O    . THR A 1 59  ? -2.185  -6.878  -7.273  1.00 0.00 ? 59  THR A O    2  
ATOM 3744  C CB   . THR A 1 59  ? 0.866   -6.590  -6.309  1.00 0.00 ? 59  THR A CB   2  
ATOM 3745  O OG1  . THR A 1 59  ? 2.289   -6.552  -6.492  1.00 0.00 ? 59  THR A OG1  2  
ATOM 3746  C CG2  . THR A 1 59  ? 0.533   -7.498  -5.134  1.00 0.00 ? 59  THR A CG2  2  
ATOM 3747  H H    . THR A 1 59  ? 1.904   -6.447  -8.636  1.00 0.00 ? 59  THR A H    2  
ATOM 3748  H HA   . THR A 1 59  ? 0.013   -8.160  -7.489  1.00 0.00 ? 59  THR A HA   2  
ATOM 3749  H HB   . THR A 1 59  ? 0.507   -5.596  -6.090  1.00 0.00 ? 59  THR A HB   2  
ATOM 3750  H HG1  . THR A 1 59  ? 2.513   -5.914  -7.189  1.00 0.00 ? 59  THR A HG1  2  
ATOM 3751  H HG21 . THR A 1 59  ? 0.980   -7.102  -4.234  1.00 0.00 ? 59  THR A HG21 2  
ATOM 3752  H HG22 . THR A 1 59  ? 0.922   -8.487  -5.323  1.00 0.00 ? 59  THR A HG22 2  
ATOM 3753  H HG23 . THR A 1 59  ? -0.540  -7.549  -5.009  1.00 0.00 ? 59  THR A HG23 2  
ATOM 3754  N N    . PHE A 1 60  ? -1.152  -5.272  -8.470  1.00 0.00 ? 60  PHE A N    2  
ATOM 3755  C CA   . PHE A 1 60  ? -2.374  -4.518  -8.731  1.00 0.00 ? 60  PHE A CA   2  
ATOM 3756  C C    . PHE A 1 60  ? -3.395  -5.394  -9.457  1.00 0.00 ? 60  PHE A C    2  
ATOM 3757  O O    . PHE A 1 60  ? -4.600  -5.297  -9.220  1.00 0.00 ? 60  PHE A O    2  
ATOM 3758  C CB   . PHE A 1 60  ? -2.068  -3.281  -9.578  1.00 0.00 ? 60  PHE A CB   2  
ATOM 3759  C CG   . PHE A 1 60  ? -1.810  -2.036  -8.776  1.00 0.00 ? 60  PHE A CG   2  
ATOM 3760  C CD1  . PHE A 1 60  ? -0.644  -1.894  -8.041  1.00 0.00 ? 60  PHE A CD1  2  
ATOM 3761  C CD2  . PHE A 1 60  ? -2.733  -1.005  -8.767  1.00 0.00 ? 60  PHE A CD2  2  
ATOM 3762  C CE1  . PHE A 1 60  ? -0.404  -0.746  -7.310  1.00 0.00 ? 60  PHE A CE1  2  
ATOM 3763  C CE2  . PHE A 1 60  ? -2.499  0.146   -8.039  1.00 0.00 ? 60  PHE A CE2  2  
ATOM 3764  C CZ   . PHE A 1 60  ? -1.333  0.275   -7.309  1.00 0.00 ? 60  PHE A CZ   2  
ATOM 3765  H H    . PHE A 1 60  ? -0.292  -4.930  -8.814  1.00 0.00 ? 60  PHE A H    2  
ATOM 3766  H HA   . PHE A 1 60  ? -2.785  -4.208  -7.782  1.00 0.00 ? 60  PHE A HA   2  
ATOM 3767  H HB2  . PHE A 1 60  ? -1.190  -3.475  -10.176 1.00 0.00 ? 60  PHE A HB2  2  
ATOM 3768  H HB3  . PHE A 1 60  ? -2.905  -3.088  -10.232 1.00 0.00 ? 60  PHE A HB3  2  
ATOM 3769  H HD1  . PHE A 1 60  ? 0.082   -2.693  -8.039  1.00 0.00 ? 60  PHE A HD1  2  
ATOM 3770  H HD2  . PHE A 1 60  ? -3.646  -1.105  -9.336  1.00 0.00 ? 60  PHE A HD2  2  
ATOM 3771  H HE1  . PHE A 1 60  ? 0.508   -0.647  -6.740  1.00 0.00 ? 60  PHE A HE1  2  
ATOM 3772  H HE2  . PHE A 1 60  ? -3.226  0.945   -8.042  1.00 0.00 ? 60  PHE A HE2  2  
ATOM 3773  H HZ   . PHE A 1 60  ? -1.148  1.173   -6.740  1.00 0.00 ? 60  PHE A HZ   2  
ATOM 3774  N N    . SER A 1 61  ? -2.898  -6.252  -10.333 1.00 0.00 ? 61  SER A N    2  
ATOM 3775  C CA   . SER A 1 61  ? -3.747  -7.145  -11.099 1.00 0.00 ? 61  SER A CA   2  
ATOM 3776  C C    . SER A 1 61  ? -3.877  -8.501  -10.404 1.00 0.00 ? 61  SER A C    2  
ATOM 3777  O O    . SER A 1 61  ? -4.943  -9.118  -10.418 1.00 0.00 ? 61  SER A O    2  
ATOM 3778  C CB   . SER A 1 61  ? -3.157  -7.329  -12.498 1.00 0.00 ? 61  SER A CB   2  
ATOM 3779  O OG   . SER A 1 61  ? -2.422  -6.179  -12.889 1.00 0.00 ? 61  SER A OG   2  
ATOM 3780  H H    . SER A 1 61  ? -1.927  -6.284  -10.472 1.00 0.00 ? 61  SER A H    2  
ATOM 3781  H HA   . SER A 1 61  ? -4.724  -6.694  -11.184 1.00 0.00 ? 61  SER A HA   2  
ATOM 3782  H HB2  . SER A 1 61  ? -2.496  -8.184  -12.499 1.00 0.00 ? 61  SER A HB2  2  
ATOM 3783  H HB3  . SER A 1 61  ? -3.956  -7.490  -13.207 1.00 0.00 ? 61  SER A HB3  2  
ATOM 3784  H HG   . SER A 1 61  ? -3.037  -5.452  -13.080 1.00 0.00 ? 61  SER A HG   2  
ATOM 3785  N N    . ASP A 1 62  ? -2.786  -8.940  -9.784  1.00 0.00 ? 62  ASP A N    2  
ATOM 3786  C CA   . ASP A 1 62  ? -2.737  -10.224 -9.087  1.00 0.00 ? 62  ASP A CA   2  
ATOM 3787  C C    . ASP A 1 62  ? -3.770  -10.294 -7.966  1.00 0.00 ? 62  ASP A C    2  
ATOM 3788  O O    . ASP A 1 62  ? -4.414  -11.324 -7.764  1.00 0.00 ? 62  ASP A O    2  
ATOM 3789  C CB   . ASP A 1 62  ? -1.336  -10.460 -8.515  1.00 0.00 ? 62  ASP A CB   2  
ATOM 3790  C CG   . ASP A 1 62  ? -1.063  -11.919 -8.220  1.00 0.00 ? 62  ASP A CG   2  
ATOM 3791  O OD1  . ASP A 1 62  ? -1.541  -12.421 -7.188  1.00 0.00 ? 62  ASP A OD1  2  
ATOM 3792  O OD2  . ASP A 1 62  ? -0.364  -12.573 -9.025  1.00 0.00 ? 62  ASP A OD2  2  
ATOM 3793  H H    . ASP A 1 62  ? -1.975  -8.383  -9.805  1.00 0.00 ? 62  ASP A H    2  
ATOM 3794  H HA   . ASP A 1 62  ? -2.954  -10.999 -9.807  1.00 0.00 ? 62  ASP A HA   2  
ATOM 3795  H HB2  . ASP A 1 62  ? -0.600  -10.111 -9.226  1.00 0.00 ? 62  ASP A HB2  2  
ATOM 3796  H HB3  . ASP A 1 62  ? -1.232  -9.900  -7.596  1.00 0.00 ? 62  ASP A HB3  2  
ATOM 3797  N N    . LEU A 1 63  ? -3.928  -9.189  -7.242  1.00 0.00 ? 63  LEU A N    2  
ATOM 3798  C CA   . LEU A 1 63  ? -4.889  -9.124  -6.146  1.00 0.00 ? 63  LEU A CA   2  
ATOM 3799  C C    . LEU A 1 63  ? -6.315  -9.291  -6.663  1.00 0.00 ? 63  LEU A C    2  
ATOM 3800  O O    . LEU A 1 63  ? -7.180  -9.831  -5.976  1.00 0.00 ? 63  LEU A O    2  
ATOM 3801  C CB   . LEU A 1 63  ? -4.749  -7.799  -5.392  1.00 0.00 ? 63  LEU A CB   2  
ATOM 3802  C CG   . LEU A 1 63  ? -3.993  -7.881  -4.059  1.00 0.00 ? 63  LEU A CG   2  
ATOM 3803  C CD1  . LEU A 1 63  ? -2.763  -8.767  -4.180  1.00 0.00 ? 63  LEU A CD1  2  
ATOM 3804  C CD2  . LEU A 1 63  ? -3.596  -6.492  -3.591  1.00 0.00 ? 63  LEU A CD2  2  
ATOM 3805  H H    . LEU A 1 63  ? -3.374  -8.402  -7.441  1.00 0.00 ? 63  LEU A H    2  
ATOM 3806  H HA   . LEU A 1 63  ? -4.672  -9.937  -5.468  1.00 0.00 ? 63  LEU A HA   2  
ATOM 3807  H HB2  . LEU A 1 63  ? -4.234  -7.096  -6.033  1.00 0.00 ? 63  LEU A HB2  2  
ATOM 3808  H HB3  . LEU A 1 63  ? -5.740  -7.416  -5.193  1.00 0.00 ? 63  LEU A HB3  2  
ATOM 3809  H HG   . LEU A 1 63  ? -4.642  -8.314  -3.311  1.00 0.00 ? 63  LEU A HG   2  
ATOM 3810  H HD11 . LEU A 1 63  ? -2.135  -8.404  -4.981  1.00 0.00 ? 63  LEU A HD11 2  
ATOM 3811  H HD12 . LEU A 1 63  ? -3.066  -9.781  -4.391  1.00 0.00 ? 63  LEU A HD12 2  
ATOM 3812  H HD13 . LEU A 1 63  ? -2.212  -8.742  -3.251  1.00 0.00 ? 63  LEU A HD13 2  
ATOM 3813  H HD21 . LEU A 1 63  ? -3.038  -6.568  -2.667  1.00 0.00 ? 63  LEU A HD21 2  
ATOM 3814  H HD22 . LEU A 1 63  ? -4.483  -5.899  -3.427  1.00 0.00 ? 63  LEU A HD22 2  
ATOM 3815  H HD23 . LEU A 1 63  ? -2.981  -6.021  -4.344  1.00 0.00 ? 63  LEU A HD23 2  
ATOM 3816  N N    . ALA A 1 64  ? -6.550  -8.846  -7.892  1.00 0.00 ? 64  ALA A N    2  
ATOM 3817  C CA   . ALA A 1 64  ? -7.863  -8.961  -8.500  1.00 0.00 ? 64  ALA A CA   2  
ATOM 3818  C C    . ALA A 1 64  ? -8.064  -10.367 -9.061  1.00 0.00 ? 64  ALA A C    2  
ATOM 3819  O O    . ALA A 1 64  ? -9.185  -10.864 -9.132  1.00 0.00 ? 64  ALA A O    2  
ATOM 3820  C CB   . ALA A 1 64  ? -8.033  -7.918  -9.592  1.00 0.00 ? 64  ALA A CB   2  
ATOM 3821  H H    . ALA A 1 64  ? -5.820  -8.437  -8.401  1.00 0.00 ? 64  ALA A H    2  
ATOM 3822  H HA   . ALA A 1 64  ? -8.606  -8.777  -7.736  1.00 0.00 ? 64  ALA A HA   2  
ATOM 3823  H HB1  . ALA A 1 64  ? -8.999  -8.039  -10.057 1.00 0.00 ? 64  ALA A HB1  2  
ATOM 3824  H HB2  . ALA A 1 64  ? -7.258  -8.045  -10.333 1.00 0.00 ? 64  ALA A HB2  2  
ATOM 3825  H HB3  . ALA A 1 64  ? -7.962  -6.930  -9.162  1.00 0.00 ? 64  ALA A HB3  2  
ATOM 3826  N N    . ALA A 1 65  ? -6.961  -11.004 -9.441  1.00 0.00 ? 65  ALA A N    2  
ATOM 3827  C CA   . ALA A 1 65  ? -6.998  -12.352 -9.992  1.00 0.00 ? 65  ALA A CA   2  
ATOM 3828  C C    . ALA A 1 65  ? -7.436  -13.358 -8.935  1.00 0.00 ? 65  ALA A C    2  
ATOM 3829  O O    . ALA A 1 65  ? -8.345  -14.158 -9.164  1.00 0.00 ? 65  ALA A O    2  
ATOM 3830  C CB   . ALA A 1 65  ? -5.638  -12.735 -10.555 1.00 0.00 ? 65  ALA A CB   2  
ATOM 3831  H H    . ALA A 1 65  ? -6.095  -10.550 -9.352  1.00 0.00 ? 65  ALA A H    2  
ATOM 3832  H HA   . ALA A 1 65  ? -7.713  -12.362 -10.801 1.00 0.00 ? 65  ALA A HA   2  
ATOM 3833  H HB1  . ALA A 1 65  ? -5.708  -13.696 -11.046 1.00 0.00 ? 65  ALA A HB1  2  
ATOM 3834  H HB2  . ALA A 1 65  ? -4.919  -12.794 -9.753  1.00 0.00 ? 65  ALA A HB2  2  
ATOM 3835  H HB3  . ALA A 1 65  ? -5.321  -11.990 -11.269 1.00 0.00 ? 65  ALA A HB3  2  
ATOM 3836  N N    . GLN A 1 66  ? -6.810  -13.298 -7.764  1.00 0.00 ? 66  GLN A N    2  
ATOM 3837  C CA   . GLN A 1 66  ? -7.149  -14.215 -6.681  1.00 0.00 ? 66  GLN A CA   2  
ATOM 3838  C C    . GLN A 1 66  ? -8.558  -13.934 -6.163  1.00 0.00 ? 66  GLN A C    2  
ATOM 3839  O O    . GLN A 1 66  ? -9.214  -14.815 -5.613  1.00 0.00 ? 66  GLN A O    2  
ATOM 3840  C CB   . GLN A 1 66  ? -6.124  -14.132 -5.545  1.00 0.00 ? 66  GLN A CB   2  
ATOM 3841  C CG   . GLN A 1 66  ? -5.887  -12.730 -5.011  1.00 0.00 ? 66  GLN A CG   2  
ATOM 3842  C CD   . GLN A 1 66  ? -4.552  -12.606 -4.299  1.00 0.00 ? 66  GLN A CD   2  
ATOM 3843  O OE1  . GLN A 1 66  ? -4.444  -12.861 -3.100  1.00 0.00 ? 66  GLN A OE1  2  
ATOM 3844  N NE2  . GLN A 1 66  ? -3.520  -12.226 -5.035  1.00 0.00 ? 66  GLN A NE2  2  
ATOM 3845  H H    . GLN A 1 66  ? -6.103  -12.628 -7.629  1.00 0.00 ? 66  GLN A H    2  
ATOM 3846  H HA   . GLN A 1 66  ? -7.131  -15.215 -7.090  1.00 0.00 ? 66  GLN A HA   2  
ATOM 3847  H HB2  . GLN A 1 66  ? -6.467  -14.747 -4.728  1.00 0.00 ? 66  GLN A HB2  2  
ATOM 3848  H HB3  . GLN A 1 66  ? -5.180  -14.521 -5.901  1.00 0.00 ? 66  GLN A HB3  2  
ATOM 3849  H HG2  . GLN A 1 66  ? -5.907  -12.033 -5.836  1.00 0.00 ? 66  GLN A HG2  2  
ATOM 3850  H HG3  . GLN A 1 66  ? -6.675  -12.487 -4.314  1.00 0.00 ? 66  GLN A HG3  2  
ATOM 3851  H HE21 . GLN A 1 66  ? -3.668  -12.049 -5.992  1.00 0.00 ? 66  GLN A HE21 2  
ATOM 3852  H HE22 . GLN A 1 66  ? -2.642  -12.137 -4.598  1.00 0.00 ? 66  GLN A HE22 2  
ATOM 3853  N N    . LEU A 1 67  ? -9.024  -12.708 -6.368  1.00 0.00 ? 67  LEU A N    2  
ATOM 3854  C CA   . LEU A 1 67  ? -10.362 -12.320 -5.944  1.00 0.00 ? 67  LEU A CA   2  
ATOM 3855  C C    . LEU A 1 67  ? -11.383 -12.704 -7.012  1.00 0.00 ? 67  LEU A C    2  
ATOM 3856  O O    . LEU A 1 67  ? -12.582 -12.480 -6.855  1.00 0.00 ? 67  LEU A O    2  
ATOM 3857  C CB   . LEU A 1 67  ? -10.427 -10.814 -5.663  1.00 0.00 ? 67  LEU A CB   2  
ATOM 3858  C CG   . LEU A 1 67  ? -10.495 -10.425 -4.182  1.00 0.00 ? 67  LEU A CG   2  
ATOM 3859  C CD1  . LEU A 1 67  ? -11.743 -11.002 -3.530  1.00 0.00 ? 67  LEU A CD1  2  
ATOM 3860  C CD2  . LEU A 1 67  ? -9.244  -10.882 -3.443  1.00 0.00 ? 67  LEU A CD2  2  
ATOM 3861  H H    . LEU A 1 67  ? -8.451  -12.046 -6.811  1.00 0.00 ? 67  LEU A H    2  
ATOM 3862  H HA   . LEU A 1 67  ? -10.591 -12.860 -5.035  1.00 0.00 ? 67  LEU A HA   2  
ATOM 3863  H HB2  . LEU A 1 67  ? -9.551  -10.353 -6.096  1.00 0.00 ? 67  LEU A HB2  2  
ATOM 3864  H HB3  . LEU A 1 67  ? -11.302 -10.418 -6.156  1.00 0.00 ? 67  LEU A HB3  2  
ATOM 3865  H HG   . LEU A 1 67  ? -10.551 -9.346  -4.106  1.00 0.00 ? 67  LEU A HG   2  
ATOM 3866  H HD11 . LEU A 1 67  ? -12.621 -10.614 -4.026  1.00 0.00 ? 67  LEU A HD11 2  
ATOM 3867  H HD12 . LEU A 1 67  ? -11.766 -10.726 -2.486  1.00 0.00 ? 67  LEU A HD12 2  
ATOM 3868  H HD13 . LEU A 1 67  ? -11.729 -12.078 -3.616  1.00 0.00 ? 67  LEU A HD13 2  
ATOM 3869  H HD21 . LEU A 1 67  ? -8.380  -10.381 -3.853  1.00 0.00 ? 67  LEU A HD21 2  
ATOM 3870  H HD22 . LEU A 1 67  ? -9.130  -11.949 -3.557  1.00 0.00 ? 67  LEU A HD22 2  
ATOM 3871  H HD23 . LEU A 1 67  ? -9.337  -10.640 -2.395  1.00 0.00 ? 67  LEU A HD23 2  
ATOM 3872  N N    . HIS A 1 68  ? -10.887 -13.266 -8.110  1.00 0.00 ? 68  HIS A N    2  
ATOM 3873  C CA   . HIS A 1 68  ? -11.743 -13.700 -9.205  1.00 0.00 ? 68  HIS A CA   2  
ATOM 3874  C C    . HIS A 1 68  ? -11.882 -15.214 -9.185  1.00 0.00 ? 68  HIS A C    2  
ATOM 3875  O O    . HIS A 1 68  ? -12.970 -15.749 -9.395  1.00 0.00 ? 68  HIS A O    2  
ATOM 3876  C CB   . HIS A 1 68  ? -11.181 -13.242 -10.550 1.00 0.00 ? 68  HIS A CB   2  
ATOM 3877  C CG   . HIS A 1 68  ? -11.888 -12.054 -11.119 1.00 0.00 ? 68  HIS A CG   2  
ATOM 3878  N ND1  . HIS A 1 68  ? -12.962 -12.157 -11.976 1.00 0.00 ? 68  HIS A ND1  2  
ATOM 3879  C CD2  . HIS A 1 68  ? -11.670 -10.731 -10.949 1.00 0.00 ? 68  HIS A CD2  2  
ATOM 3880  C CE1  . HIS A 1 68  ? -13.370 -10.949 -12.311 1.00 0.00 ? 68  HIS A CE1  2  
ATOM 3881  N NE2  . HIS A 1 68  ? -12.604 -10.067 -11.700 1.00 0.00 ? 68  HIS A NE2  2  
ATOM 3882  H H    . HIS A 1 68  ? -9.916  -13.391 -8.185  1.00 0.00 ? 68  HIS A H    2  
ATOM 3883  H HA   . HIS A 1 68  ? -12.720 -13.259 -9.061  1.00 0.00 ? 68  HIS A HA   2  
ATOM 3884  H HB2  . HIS A 1 68  ? -10.141 -12.982 -10.426 1.00 0.00 ? 68  HIS A HB2  2  
ATOM 3885  H HB3  . HIS A 1 68  ? -11.262 -14.052 -11.260 1.00 0.00 ? 68  HIS A HB3  2  
ATOM 3886  H HD1  . HIS A 1 68  ? -13.369 -13.002 -12.295 1.00 0.00 ? 68  HIS A HD1  2  
ATOM 3887  H HD2  . HIS A 1 68  ? -10.902 -10.282 -10.336 1.00 0.00 ? 68  HIS A HD2  2  
ATOM 3888  H HE1  . HIS A 1 68  ? -14.194 -10.721 -12.971 1.00 0.00 ? 68  HIS A HE1  2  
ATOM 3889  H HE2  . HIS A 1 68  ? -12.748 -9.091  -11.697 1.00 0.00 ? 68  HIS A HE2  2  
ATOM 3890  N N    . VAL A 1 69  ? -10.766 -15.899 -8.947  1.00 0.00 ? 69  VAL A N    2  
ATOM 3891  C CA   . VAL A 1 69  ? -10.759 -17.354 -8.873  1.00 0.00 ? 69  VAL A CA   2  
ATOM 3892  C C    . VAL A 1 69  ? -11.621 -17.799 -7.701  1.00 0.00 ? 69  VAL A C    2  
ATOM 3893  O O    . VAL A 1 69  ? -12.500 -18.651 -7.838  1.00 0.00 ? 69  VAL A O    2  
ATOM 3894  C CB   . VAL A 1 69  ? -9.328  -17.907 -8.696  1.00 0.00 ? 69  VAL A CB   2  
ATOM 3895  C CG1  . VAL A 1 69  ? -9.340  -19.426 -8.595  1.00 0.00 ? 69  VAL A CG1  2  
ATOM 3896  C CG2  . VAL A 1 69  ? -8.431  -17.452 -9.836  1.00 0.00 ? 69  VAL A CG2  2  
ATOM 3897  H H    . VAL A 1 69  ? -9.924  -15.410 -8.824  1.00 0.00 ? 69  VAL A H    2  
ATOM 3898  H HA   . VAL A 1 69  ? -11.174 -17.743 -9.791  1.00 0.00 ? 69  VAL A HA   2  
ATOM 3899  H HB   . VAL A 1 69  ? -8.926  -17.515 -7.774  1.00 0.00 ? 69  VAL A HB   2  
ATOM 3900  H HG11 . VAL A 1 69  ? -9.984  -19.726 -7.780  1.00 0.00 ? 69  VAL A HG11 2  
ATOM 3901  H HG12 . VAL A 1 69  ? -8.337  -19.784 -8.412  1.00 0.00 ? 69  VAL A HG12 2  
ATOM 3902  H HG13 . VAL A 1 69  ? -9.710  -19.845 -9.519  1.00 0.00 ? 69  VAL A HG13 2  
ATOM 3903  H HG21 . VAL A 1 69  ? -7.435  -17.845 -9.689  1.00 0.00 ? 69  VAL A HG21 2  
ATOM 3904  H HG22 . VAL A 1 69  ? -8.392  -16.373 -9.855  1.00 0.00 ? 69  VAL A HG22 2  
ATOM 3905  H HG23 . VAL A 1 69  ? -8.826  -17.815 -10.773 1.00 0.00 ? 69  VAL A HG23 2  
ATOM 3906  N N    . THR A 1 70  ? -11.357 -17.204 -6.550  1.00 0.00 ? 70  THR A N    2  
ATOM 3907  C CA   . THR A 1 70  ? -12.110 -17.488 -5.347  1.00 0.00 ? 70  THR A CA   2  
ATOM 3908  C C    . THR A 1 70  ? -13.333 -16.576 -5.305  1.00 0.00 ? 70  THR A C    2  
ATOM 3909  O O    . THR A 1 70  ? -13.255 -15.423 -5.733  1.00 0.00 ? 70  THR A O    2  
ATOM 3910  C CB   . THR A 1 70  ? -11.241 -17.267 -4.091  1.00 0.00 ? 70  THR A CB   2  
ATOM 3911  O OG1  . THR A 1 70  ? -9.859  -17.151 -4.469  1.00 0.00 ? 70  THR A OG1  2  
ATOM 3912  C CG2  . THR A 1 70  ? -11.398 -18.419 -3.110  1.00 0.00 ? 70  THR A CG2  2  
ATOM 3913  H H    . THR A 1 70  ? -10.629 -16.551 -6.508  1.00 0.00 ? 70  THR A H    2  
ATOM 3914  H HA   . THR A 1 70  ? -12.431 -18.520 -5.378  1.00 0.00 ? 70  THR A HA   2  
ATOM 3915  H HB   . THR A 1 70  ? -11.554 -16.353 -3.608  1.00 0.00 ? 70  THR A HB   2  
ATOM 3916  H HG1  . THR A 1 70  ? -9.664  -16.231 -4.702  1.00 0.00 ? 70  THR A HG1  2  
ATOM 3917  H HG21 . THR A 1 70  ? -11.135 -19.346 -3.597  1.00 0.00 ? 70  THR A HG21 2  
ATOM 3918  H HG22 . THR A 1 70  ? -12.424 -18.467 -2.775  1.00 0.00 ? 70  THR A HG22 2  
ATOM 3919  H HG23 . THR A 1 70  ? -10.749 -18.262 -2.260  1.00 0.00 ? 70  THR A HG23 2  
ATOM 3920  N N    . PRO A 1 71  ? -14.482 -17.083 -4.828  1.00 0.00 ? 71  PRO A N    2  
ATOM 3921  C CA   . PRO A 1 71  ? -15.724 -16.302 -4.748  1.00 0.00 ? 71  PRO A CA   2  
ATOM 3922  C C    . PRO A 1 71  ? -15.547 -14.983 -4.000  1.00 0.00 ? 71  PRO A C    2  
ATOM 3923  O O    . PRO A 1 71  ? -15.422 -14.962 -2.773  1.00 0.00 ? 71  PRO A O    2  
ATOM 3924  C CB   . PRO A 1 71  ? -16.676 -17.223 -3.986  1.00 0.00 ? 71  PRO A CB   2  
ATOM 3925  C CG   . PRO A 1 71  ? -16.159 -18.595 -4.241  1.00 0.00 ? 71  PRO A CG   2  
ATOM 3926  C CD   . PRO A 1 71  ? -14.668 -18.462 -4.341  1.00 0.00 ? 71  PRO A CD   2  
ATOM 3927  H HA   . PRO A 1 71  ? -16.127 -16.102 -5.731  1.00 0.00 ? 71  PRO A HA   2  
ATOM 3928  H HB2  . PRO A 1 71  ? -16.653 -16.978 -2.935  1.00 0.00 ? 71  PRO A HB2  2  
ATOM 3929  H HB3  . PRO A 1 71  ? -17.680 -17.104 -4.369  1.00 0.00 ? 71  PRO A HB3  2  
ATOM 3930  H HG2  . PRO A 1 71  ? -16.426 -19.246 -3.423  1.00 0.00 ? 71  PRO A HG2  2  
ATOM 3931  H HG3  . PRO A 1 71  ? -16.564 -18.972 -5.169  1.00 0.00 ? 71  PRO A HG3  2  
ATOM 3932  H HD2  . PRO A 1 71  ? -14.210 -18.592 -3.370  1.00 0.00 ? 71  PRO A HD2  2  
ATOM 3933  H HD3  . PRO A 1 71  ? -14.271 -19.178 -5.046  1.00 0.00 ? 71  PRO A HD3  2  
ATOM 3934  N N    . GLY A 1 72  ? -15.539 -13.890 -4.746  1.00 0.00 ? 72  GLY A N    2  
ATOM 3935  C CA   . GLY A 1 72  ? -15.381 -12.583 -4.153  1.00 0.00 ? 72  GLY A CA   2  
ATOM 3936  C C    . GLY A 1 72  ? -16.678 -11.808 -4.153  1.00 0.00 ? 72  GLY A C    2  
ATOM 3937  O O    . GLY A 1 72  ? -17.736 -12.359 -4.462  1.00 0.00 ? 72  GLY A O    2  
ATOM 3938  H H    . GLY A 1 72  ? -15.648 -13.974 -5.720  1.00 0.00 ? 72  GLY A H    2  
ATOM 3939  H HA2  . GLY A 1 72  ? -15.038 -12.699 -3.136  1.00 0.00 ? 72  GLY A HA2  2  
ATOM 3940  H HA3  . GLY A 1 72  ? -14.640 -12.031 -4.713  1.00 0.00 ? 72  GLY A HA3  2  
ATOM 3941  N N    . SER A 1 73  ? -16.598 -10.530 -3.825  1.00 0.00 ? 73  SER A N    2  
ATOM 3942  C CA   . SER A 1 73  ? -17.772 -9.674  -3.778  1.00 0.00 ? 73  SER A CA   2  
ATOM 3943  C C    . SER A 1 73  ? -17.403 -8.248  -4.190  1.00 0.00 ? 73  SER A C    2  
ATOM 3944  O O    . SER A 1 73  ? -16.402 -8.035  -4.880  1.00 0.00 ? 73  SER A O    2  
ATOM 3945  C CB   . SER A 1 73  ? -18.374 -9.689  -2.368  1.00 0.00 ? 73  SER A CB   2  
ATOM 3946  O OG   . SER A 1 73  ? -18.784 -10.996 -1.994  1.00 0.00 ? 73  SER A OG   2  
ATOM 3947  H H    . SER A 1 73  ? -15.724 -10.144 -3.621  1.00 0.00 ? 73  SER A H    2  
ATOM 3948  H HA   . SER A 1 73  ? -18.498 -10.065 -4.475  1.00 0.00 ? 73  SER A HA   2  
ATOM 3949  H HB2  . SER A 1 73  ? -17.636 -9.345  -1.660  1.00 0.00 ? 73  SER A HB2  2  
ATOM 3950  H HB3  . SER A 1 73  ? -19.233 -9.034  -2.339  1.00 0.00 ? 73  SER A HB3  2  
ATOM 3951  H HG   . SER A 1 73  ? -19.757 -11.033 -1.983  1.00 0.00 ? 73  SER A HG   2  
ATOM 3952  N N    . ALA A 1 74  ? -18.210 -7.281  -3.763  1.00 0.00 ? 74  ALA A N    2  
ATOM 3953  C CA   . ALA A 1 74  ? -17.978 -5.876  -4.083  1.00 0.00 ? 74  ALA A CA   2  
ATOM 3954  C C    . ALA A 1 74  ? -16.784 -5.304  -3.314  1.00 0.00 ? 74  ALA A C    2  
ATOM 3955  O O    . ALA A 1 74  ? -16.014 -6.046  -2.698  1.00 0.00 ? 74  ALA A O    2  
ATOM 3956  C CB   . ALA A 1 74  ? -19.234 -5.073  -3.785  1.00 0.00 ? 74  ALA A CB   2  
ATOM 3957  H H    . ALA A 1 74  ? -18.996 -7.518  -3.221  1.00 0.00 ? 74  ALA A H    2  
ATOM 3958  H HA   . ALA A 1 74  ? -17.779 -5.805  -5.144  1.00 0.00 ? 74  ALA A HA   2  
ATOM 3959  H HB1  . ALA A 1 74  ? -19.446 -5.118  -2.728  1.00 0.00 ? 74  ALA A HB1  2  
ATOM 3960  H HB2  . ALA A 1 74  ? -20.068 -5.487  -4.336  1.00 0.00 ? 74  ALA A HB2  2  
ATOM 3961  H HB3  . ALA A 1 74  ? -19.083 -4.045  -4.079  1.00 0.00 ? 74  ALA A HB3  2  
ATOM 3962  N N    . GLN A 1 75  ? -16.658 -3.976  -3.339  1.00 0.00 ? 75  GLN A N    2  
ATOM 3963  C CA   . GLN A 1 75  ? -15.565 -3.265  -2.671  1.00 0.00 ? 75  GLN A CA   2  
ATOM 3964  C C    . GLN A 1 75  ? -15.401 -3.686  -1.213  1.00 0.00 ? 75  GLN A C    2  
ATOM 3965  O O    . GLN A 1 75  ? -14.280 -3.820  -0.723  1.00 0.00 ? 75  GLN A O    2  
ATOM 3966  C CB   . GLN A 1 75  ? -15.812 -1.760  -2.729  1.00 0.00 ? 75  GLN A CB   2  
ATOM 3967  C CG   . GLN A 1 75  ? -14.914 -1.024  -3.705  1.00 0.00 ? 75  GLN A CG   2  
ATOM 3968  C CD   . GLN A 1 75  ? -13.933 -0.103  -3.006  1.00 0.00 ? 75  GLN A CD   2  
ATOM 3969  O OE1  . GLN A 1 75  ? -13.444 -0.404  -1.918  1.00 0.00 ? 75  GLN A OE1  2  
ATOM 3970  N NE2  . GLN A 1 75  ? -13.650 1.037   -3.620  1.00 0.00 ? 75  GLN A NE2  2  
ATOM 3971  H H    . GLN A 1 75  ? -17.332 -3.447  -3.827  1.00 0.00 ? 75  GLN A H    2  
ATOM 3972  H HA   . GLN A 1 75  ? -14.653 -3.487  -3.201  1.00 0.00 ? 75  GLN A HA   2  
ATOM 3973  H HB2  . GLN A 1 75  ? -16.838 -1.587  -3.017  1.00 0.00 ? 75  GLN A HB2  2  
ATOM 3974  H HB3  . GLN A 1 75  ? -15.650 -1.346  -1.745  1.00 0.00 ? 75  GLN A HB3  2  
ATOM 3975  H HG2  . GLN A 1 75  ? -14.358 -1.750  -4.279  1.00 0.00 ? 75  GLN A HG2  2  
ATOM 3976  H HG3  . GLN A 1 75  ? -15.530 -0.435  -4.370  1.00 0.00 ? 75  GLN A HG3  2  
ATOM 3977  H HE21 . GLN A 1 75  ? -14.083 1.220   -4.481  1.00 0.00 ? 75  GLN A HE21 2  
ATOM 3978  H HE22 . GLN A 1 75  ? -13.016 1.647   -3.189  1.00 0.00 ? 75  GLN A HE22 2  
ATOM 3979  N N    . GLN A 1 76  ? -16.524 -3.905  -0.534  1.00 0.00 ? 76  GLN A N    2  
ATOM 3980  C CA   . GLN A 1 76  ? -16.520 -4.294  0.873   1.00 0.00 ? 76  GLN A CA   2  
ATOM 3981  C C    . GLN A 1 76  ? -15.724 -5.580  1.100   1.00 0.00 ? 76  GLN A C    2  
ATOM 3982  O O    . GLN A 1 76  ? -15.119 -5.758  2.153   1.00 0.00 ? 76  GLN A O    2  
ATOM 3983  C CB   . GLN A 1 76  ? -17.951 -4.467  1.392   1.00 0.00 ? 76  GLN A CB   2  
ATOM 3984  C CG   . GLN A 1 76  ? -18.717 -3.157  1.530   1.00 0.00 ? 76  GLN A CG   2  
ATOM 3985  C CD   . GLN A 1 76  ? -19.123 -2.566  0.194   1.00 0.00 ? 76  GLN A CD   2  
ATOM 3986  O OE1  . GLN A 1 76  ? -19.352 -3.288  -0.776  1.00 0.00 ? 76  GLN A OE1  2  
ATOM 3987  N NE2  . GLN A 1 76  ? -19.209 -1.249  0.134   1.00 0.00 ? 76  GLN A NE2  2  
ATOM 3988  H H    . GLN A 1 76  ? -17.385 -3.796  -0.993  1.00 0.00 ? 76  GLN A H    2  
ATOM 3989  H HA   . GLN A 1 76  ? -16.046 -3.500  1.428   1.00 0.00 ? 76  GLN A HA   2  
ATOM 3990  H HB2  . GLN A 1 76  ? -18.494 -5.106  0.710   1.00 0.00 ? 76  GLN A HB2  2  
ATOM 3991  H HB3  . GLN A 1 76  ? -17.915 -4.940  2.361   1.00 0.00 ? 76  GLN A HB3  2  
ATOM 3992  H HG2  . GLN A 1 76  ? -19.611 -3.335  2.108   1.00 0.00 ? 76  GLN A HG2  2  
ATOM 3993  H HG3  . GLN A 1 76  ? -18.090 -2.444  2.048   1.00 0.00 ? 76  GLN A HG3  2  
ATOM 3994  H HE21 . GLN A 1 76  ? -19.008 -0.729  0.951   1.00 0.00 ? 76  GLN A HE21 2  
ATOM 3995  H HE22 . GLN A 1 76  ? -19.469 -0.841  -0.716  1.00 0.00 ? 76  GLN A HE22 2  
ATOM 3996  N N    . ARG A 1 77  ? -15.711 -6.462  0.106   1.00 0.00 ? 77  ARG A N    2  
ATOM 3997  C CA   . ARG A 1 77  ? -14.981 -7.720  0.218   1.00 0.00 ? 77  ARG A CA   2  
ATOM 3998  C C    . ARG A 1 77  ? -13.479 -7.466  0.135   1.00 0.00 ? 77  ARG A C    2  
ATOM 3999  O O    . ARG A 1 77  ? -12.680 -8.203  0.711   1.00 0.00 ? 77  ARG A O    2  
ATOM 4000  C CB   . ARG A 1 77  ? -15.417 -8.691  -0.881  1.00 0.00 ? 77  ARG A CB   2  
ATOM 4001  C CG   . ARG A 1 77  ? -14.785 -10.074 -0.776  1.00 0.00 ? 77  ARG A CG   2  
ATOM 4002  C CD   . ARG A 1 77  ? -15.120 -10.758 0.542   1.00 0.00 ? 77  ARG A CD   2  
ATOM 4003  N NE   . ARG A 1 77  ? -16.550 -11.041 0.675   1.00 0.00 ? 77  ARG A NE   2  
ATOM 4004  C CZ   . ARG A 1 77  ? -17.065 -12.271 0.715   1.00 0.00 ? 77  ARG A CZ   2  
ATOM 4005  N NH1  . ARG A 1 77  ? -16.272 -13.329 0.595   1.00 0.00 ? 77  ARG A NH1  2  
ATOM 4006  N NH2  . ARG A 1 77  ? -18.372 -12.442 0.869   1.00 0.00 ? 77  ARG A NH2  2  
ATOM 4007  H H    . ARG A 1 77  ? -16.191 -6.257  -0.726  1.00 0.00 ? 77  ARG A H    2  
ATOM 4008  H HA   . ARG A 1 77  ? -15.211 -8.150  1.181   1.00 0.00 ? 77  ARG A HA   2  
ATOM 4009  H HB2  . ARG A 1 77  ? -16.489 -8.808  -0.838  1.00 0.00 ? 77  ARG A HB2  2  
ATOM 4010  H HB3  . ARG A 1 77  ? -15.149 -8.271  -1.840  1.00 0.00 ? 77  ARG A HB3  2  
ATOM 4011  H HG2  . ARG A 1 77  ? -15.152 -10.686 -1.585  1.00 0.00 ? 77  ARG A HG2  2  
ATOM 4012  H HG3  . ARG A 1 77  ? -13.712 -9.973  -0.856  1.00 0.00 ? 77  ARG A HG3  2  
ATOM 4013  H HD2  . ARG A 1 77  ? -14.573 -11.687 0.598   1.00 0.00 ? 77  ARG A HD2  2  
ATOM 4014  H HD3  . ARG A 1 77  ? -14.813 -10.114 1.353   1.00 0.00 ? 77  ARG A HD3  2  
ATOM 4015  H HE   . ARG A 1 77  ? -17.160 -10.264 0.752   1.00 0.00 ? 77  ARG A HE   2  
ATOM 4016  H HH11 . ARG A 1 77  ? -15.288 -13.208 0.479   1.00 0.00 ? 77  ARG A HH11 2  
ATOM 4017  H HH12 . ARG A 1 77  ? -16.658 -14.260 0.612   1.00 0.00 ? 77  ARG A HH12 2  
ATOM 4018  H HH21 . ARG A 1 77  ? -18.984 -11.646 0.954   1.00 0.00 ? 77  ARG A HH21 2  
ATOM 4019  H HH22 . ARG A 1 77  ? -18.759 -13.374 0.909   1.00 0.00 ? 77  ARG A HH22 2  
ATOM 4020  N N    . PHE A 1 78  ? -13.106 -6.412  -0.576  1.00 0.00 ? 78  PHE A N    2  
ATOM 4021  C CA   . PHE A 1 78  ? -11.703 -6.050  -0.736  1.00 0.00 ? 78  PHE A CA   2  
ATOM 4022  C C    . PHE A 1 78  ? -11.162 -5.443  0.550   1.00 0.00 ? 78  PHE A C    2  
ATOM 4023  O O    . PHE A 1 78  ? -10.086 -5.814  1.017   1.00 0.00 ? 78  PHE A O    2  
ATOM 4024  C CB   . PHE A 1 78  ? -11.527 -5.067  -1.892  1.00 0.00 ? 78  PHE A CB   2  
ATOM 4025  C CG   . PHE A 1 78  ? -11.702 -5.697  -3.246  1.00 0.00 ? 78  PHE A CG   2  
ATOM 4026  C CD1  . PHE A 1 78  ? -10.661 -6.398  -3.836  1.00 0.00 ? 78  PHE A CD1  2  
ATOM 4027  C CD2  . PHE A 1 78  ? -12.904 -5.591  -3.926  1.00 0.00 ? 78  PHE A CD2  2  
ATOM 4028  C CE1  . PHE A 1 78  ? -10.816 -6.978  -5.080  1.00 0.00 ? 78  PHE A CE1  2  
ATOM 4029  C CE2  . PHE A 1 78  ? -13.066 -6.170  -5.171  1.00 0.00 ? 78  PHE A CE2  2  
ATOM 4030  C CZ   . PHE A 1 78  ? -12.019 -6.864  -5.747  1.00 0.00 ? 78  PHE A CZ   2  
ATOM 4031  H H    . PHE A 1 78  ? -13.794 -5.851  -0.998  1.00 0.00 ? 78  PHE A H    2  
ATOM 4032  H HA   . PHE A 1 78  ? -11.153 -6.951  -0.954  1.00 0.00 ? 78  PHE A HA   2  
ATOM 4033  H HB2  . PHE A 1 78  ? -12.257 -4.276  -1.798  1.00 0.00 ? 78  PHE A HB2  2  
ATOM 4034  H HB3  . PHE A 1 78  ? -10.536 -4.642  -1.847  1.00 0.00 ? 78  PHE A HB3  2  
ATOM 4035  H HD1  . PHE A 1 78  ? -9.719  -6.488  -3.315  1.00 0.00 ? 78  PHE A HD1  2  
ATOM 4036  H HD2  . PHE A 1 78  ? -13.722 -5.047  -3.475  1.00 0.00 ? 78  PHE A HD2  2  
ATOM 4037  H HE1  . PHE A 1 78  ? -9.998  -7.521  -5.528  1.00 0.00 ? 78  PHE A HE1  2  
ATOM 4038  H HE2  . PHE A 1 78  ? -14.007 -6.080  -5.691  1.00 0.00 ? 78  PHE A HE2  2  
ATOM 4039  H HZ   . PHE A 1 78  ? -12.142 -7.317  -6.718  1.00 0.00 ? 78  PHE A HZ   2  
ATOM 4040  N N    . THR A 1 79  ? -11.918 -4.518  1.127   1.00 0.00 ? 79  THR A N    2  
ATOM 4041  C CA   . THR A 1 79  ? -11.514 -3.869  2.364   1.00 0.00 ? 79  THR A CA   2  
ATOM 4042  C C    . THR A 1 79  ? -11.544 -4.857  3.526   1.00 0.00 ? 79  THR A C    2  
ATOM 4043  O O    . THR A 1 79  ? -10.707 -4.807  4.431   1.00 0.00 ? 79  THR A O    2  
ATOM 4044  C CB   . THR A 1 79  ? -12.432 -2.672  2.681   1.00 0.00 ? 79  THR A CB   2  
ATOM 4045  O OG1  . THR A 1 79  ? -13.347 -2.457  1.595   1.00 0.00 ? 79  THR A OG1  2  
ATOM 4046  C CG2  . THR A 1 79  ? -11.613 -1.413  2.916   1.00 0.00 ? 79  THR A CG2  2  
ATOM 4047  H H    . THR A 1 79  ? -12.770 -4.258  0.705   1.00 0.00 ? 79  THR A H    2  
ATOM 4048  H HA   . THR A 1 79  ? -10.505 -3.503  2.238   1.00 0.00 ? 79  THR A HA   2  
ATOM 4049  H HB   . THR A 1 79  ? -12.994 -2.893  3.577   1.00 0.00 ? 79  THR A HB   2  
ATOM 4050  H HG1  . THR A 1 79  ? -12.921 -1.928  0.914   1.00 0.00 ? 79  THR A HG1  2  
ATOM 4051  H HG21 . THR A 1 79  ? -10.873 -1.603  3.682   1.00 0.00 ? 79  THR A HG21 2  
ATOM 4052  H HG22 . THR A 1 79  ? -12.265 -0.614  3.236   1.00 0.00 ? 79  THR A HG22 2  
ATOM 4053  H HG23 . THR A 1 79  ? -11.118 -1.130  1.999   1.00 0.00 ? 79  THR A HG23 2  
ATOM 4054  N N    . GLN A 1 80  ? -12.505 -5.771  3.481   1.00 0.00 ? 80  GLN A N    2  
ATOM 4055  C CA   . GLN A 1 80  ? -12.652 -6.773  4.523   1.00 0.00 ? 80  GLN A CA   2  
ATOM 4056  C C    . GLN A 1 80  ? -11.498 -7.768  4.493   1.00 0.00 ? 80  GLN A C    2  
ATOM 4057  O O    . GLN A 1 80  ? -11.039 -8.218  5.541   1.00 0.00 ? 80  GLN A O    2  
ATOM 4058  C CB   . GLN A 1 80  ? -13.987 -7.515  4.375   1.00 0.00 ? 80  GLN A CB   2  
ATOM 4059  C CG   . GLN A 1 80  ? -14.284 -8.469  5.523   1.00 0.00 ? 80  GLN A CG   2  
ATOM 4060  C CD   . GLN A 1 80  ? -14.230 -7.786  6.878   1.00 0.00 ? 80  GLN A CD   2  
ATOM 4061  O OE1  . GLN A 1 80  ? -15.238 -7.285  7.377   1.00 0.00 ? 80  GLN A OE1  2  
ATOM 4062  N NE2  . GLN A 1 80  ? -13.048 -7.751  7.474   1.00 0.00 ? 80  GLN A NE2  2  
ATOM 4063  H H    . GLN A 1 80  ? -13.141 -5.761  2.732   1.00 0.00 ? 80  GLN A H    2  
ATOM 4064  H HA   . GLN A 1 80  ? -12.642 -6.260  5.472   1.00 0.00 ? 80  GLN A HA   2  
ATOM 4065  H HB2  . GLN A 1 80  ? -14.786 -6.788  4.324   1.00 0.00 ? 80  GLN A HB2  2  
ATOM 4066  H HB3  . GLN A 1 80  ? -13.970 -8.083  3.457   1.00 0.00 ? 80  GLN A HB3  2  
ATOM 4067  H HG2  . GLN A 1 80  ? -15.271 -8.885  5.383   1.00 0.00 ? 80  GLN A HG2  2  
ATOM 4068  H HG3  . GLN A 1 80  ? -13.555 -9.264  5.507   1.00 0.00 ? 80  GLN A HG3  2  
ATOM 4069  H HE21 . GLN A 1 80  ? -12.282 -8.163  7.012   1.00 0.00 ? 80  GLN A HE21 2  
ATOM 4070  H HE22 . GLN A 1 80  ? -12.975 -7.307  8.350   1.00 0.00 ? 80  GLN A HE22 2  
ATOM 4071  N N    . VAL A 1 81  ? -11.015 -8.090  3.300   1.00 0.00 ? 81  VAL A N    2  
ATOM 4072  C CA   . VAL A 1 81  ? -9.925  -9.046  3.161   1.00 0.00 ? 81  VAL A CA   2  
ATOM 4073  C C    . VAL A 1 81  ? -8.606  -8.469  3.693   1.00 0.00 ? 81  VAL A C    2  
ATOM 4074  O O    . VAL A 1 81  ? -7.720  -9.212  4.113   1.00 0.00 ? 81  VAL A O    2  
ATOM 4075  C CB   . VAL A 1 81  ? -9.771  -9.528  1.697   1.00 0.00 ? 81  VAL A CB   2  
ATOM 4076  C CG1  . VAL A 1 81  ? -8.860  -8.617  0.892   1.00 0.00 ? 81  VAL A CG1  2  
ATOM 4077  C CG2  . VAL A 1 81  ? -9.265  -10.964 1.661   1.00 0.00 ? 81  VAL A CG2  2  
ATOM 4078  H H    . VAL A 1 81  ? -11.400 -7.680  2.496   1.00 0.00 ? 81  VAL A H    2  
ATOM 4079  H HA   . VAL A 1 81  ? -10.182 -9.906  3.765   1.00 0.00 ? 81  VAL A HA   2  
ATOM 4080  H HB   . VAL A 1 81  ? -10.749 -9.509  1.236   1.00 0.00 ? 81  VAL A HB   2  
ATOM 4081  H HG11 . VAL A 1 81  ? -9.270  -7.617  0.880   1.00 0.00 ? 81  VAL A HG11 2  
ATOM 4082  H HG12 . VAL A 1 81  ? -8.783  -8.987  -0.119  1.00 0.00 ? 81  VAL A HG12 2  
ATOM 4083  H HG13 . VAL A 1 81  ? -7.880  -8.597  1.345   1.00 0.00 ? 81  VAL A HG13 2  
ATOM 4084  H HG21 . VAL A 1 81  ? -8.364  -11.043 2.251   1.00 0.00 ? 81  VAL A HG21 2  
ATOM 4085  H HG22 . VAL A 1 81  ? -9.053  -11.246 0.640   1.00 0.00 ? 81  VAL A HG22 2  
ATOM 4086  H HG23 . VAL A 1 81  ? -10.018 -11.623 2.067   1.00 0.00 ? 81  VAL A HG23 2  
ATOM 4087  N N    . SER A 1 82  ? -8.479  -7.144  3.699   1.00 0.00 ? 82  SER A N    2  
ATOM 4088  C CA   . SER A 1 82  ? -7.270  -6.513  4.206   1.00 0.00 ? 82  SER A CA   2  
ATOM 4089  C C    . SER A 1 82  ? -7.277  -6.552  5.733   1.00 0.00 ? 82  SER A C    2  
ATOM 4090  O O    . SER A 1 82  ? -6.295  -6.947  6.365   1.00 0.00 ? 82  SER A O    2  
ATOM 4091  C CB   . SER A 1 82  ? -7.170  -5.072  3.703   1.00 0.00 ? 82  SER A CB   2  
ATOM 4092  O OG   . SER A 1 82  ? -8.148  -4.811  2.709   1.00 0.00 ? 82  SER A OG   2  
ATOM 4093  H H    . SER A 1 82  ? -9.208  -6.582  3.356   1.00 0.00 ? 82  SER A H    2  
ATOM 4094  H HA   . SER A 1 82  ? -6.421  -7.076  3.845   1.00 0.00 ? 82  SER A HA   2  
ATOM 4095  H HB2  . SER A 1 82  ? -7.320  -4.393  4.528   1.00 0.00 ? 82  SER A HB2  2  
ATOM 4096  H HB3  . SER A 1 82  ? -6.191  -4.908  3.277   1.00 0.00 ? 82  SER A HB3  2  
ATOM 4097  H HG   . SER A 1 82  ? -8.051  -5.441  1.985   1.00 0.00 ? 82  SER A HG   2  
ATOM 4098  N N    . ASP A 1 83  ? -8.414  -6.172  6.313   1.00 0.00 ? 83  ASP A N    2  
ATOM 4099  C CA   . ASP A 1 83  ? -8.591  -6.167  7.766   1.00 0.00 ? 83  ASP A CA   2  
ATOM 4100  C C    . ASP A 1 83  ? -8.546  -7.597  8.305   1.00 0.00 ? 83  ASP A C    2  
ATOM 4101  O O    . ASP A 1 83  ? -8.096  -7.846  9.427   1.00 0.00 ? 83  ASP A O    2  
ATOM 4102  C CB   . ASP A 1 83  ? -9.923  -5.491  8.119   1.00 0.00 ? 83  ASP A CB   2  
ATOM 4103  C CG   . ASP A 1 83  ? -10.487 -5.919  9.463   1.00 0.00 ? 83  ASP A CG   2  
ATOM 4104  O OD1  . ASP A 1 83  ? -9.944  -5.506  10.505  1.00 0.00 ? 83  ASP A OD1  2  
ATOM 4105  O OD2  . ASP A 1 83  ? -11.499 -6.656  9.477   1.00 0.00 ? 83  ASP A OD2  2  
ATOM 4106  H H    . ASP A 1 83  ? -9.160  -5.879  5.744   1.00 0.00 ? 83  ASP A H    2  
ATOM 4107  H HA   . ASP A 1 83  ? -7.779  -5.602  8.201   1.00 0.00 ? 83  ASP A HA   2  
ATOM 4108  H HB2  . ASP A 1 83  ? -9.777  -4.421  8.143   1.00 0.00 ? 83  ASP A HB2  2  
ATOM 4109  H HB3  . ASP A 1 83  ? -10.650 -5.729  7.355   1.00 0.00 ? 83  ASP A HB3  2  
ATOM 4110  N N    . GLU A 1 84  ? -8.984  -8.527  7.463   1.00 0.00 ? 84  GLU A N    2  
ATOM 4111  C CA   . GLU A 1 84  ? -9.017  -9.951  7.784   1.00 0.00 ? 84  GLU A CA   2  
ATOM 4112  C C    . GLU A 1 84  ? -7.672  -10.442 8.320   1.00 0.00 ? 84  GLU A C    2  
ATOM 4113  O O    . GLU A 1 84  ? -7.614  -11.125 9.344   1.00 0.00 ? 84  GLU A O    2  
ATOM 4114  C CB   . GLU A 1 84  ? -9.387  -10.740 6.527   1.00 0.00 ? 84  GLU A CB   2  
ATOM 4115  C CG   . GLU A 1 84  ? -9.573  -12.226 6.758   1.00 0.00 ? 84  GLU A CG   2  
ATOM 4116  C CD   . GLU A 1 84  ? -10.987 -12.571 7.145   1.00 0.00 ? 84  GLU A CD   2  
ATOM 4117  O OE1  . GLU A 1 84  ? -11.847 -12.665 6.244   1.00 0.00 ? 84  GLU A OE1  2  
ATOM 4118  O OE2  . GLU A 1 84  ? -11.249 -12.756 8.351   1.00 0.00 ? 84  GLU A OE2  2  
ATOM 4119  H H    . GLU A 1 84  ? -9.314  -8.241  6.584   1.00 0.00 ? 84  GLU A H    2  
ATOM 4120  H HA   . GLU A 1 84  ? -9.774  -10.109 8.535   1.00 0.00 ? 84  GLU A HA   2  
ATOM 4121  H HB2  . GLU A 1 84  ? -10.312 -10.346 6.129   1.00 0.00 ? 84  GLU A HB2  2  
ATOM 4122  H HB3  . GLU A 1 84  ? -8.608  -10.606 5.791   1.00 0.00 ? 84  GLU A HB3  2  
ATOM 4123  H HG2  . GLU A 1 84  ? -9.322  -12.756 5.850   1.00 0.00 ? 84  GLU A HG2  2  
ATOM 4124  H HG3  . GLU A 1 84  ? -8.912  -12.539 7.551   1.00 0.00 ? 84  GLU A HG3  2  
ATOM 4125  N N    . LEU A 1 85  ? -6.596  -10.093 7.627   1.00 0.00 ? 85  LEU A N    2  
ATOM 4126  C CA   . LEU A 1 85  ? -5.264  -10.513 8.038   1.00 0.00 ? 85  LEU A CA   2  
ATOM 4127  C C    . LEU A 1 85  ? -4.563  -9.416  8.831   1.00 0.00 ? 85  LEU A C    2  
ATOM 4128  O O    . LEU A 1 85  ? -3.470  -9.622  9.359   1.00 0.00 ? 85  LEU A O    2  
ATOM 4129  C CB   . LEU A 1 85  ? -4.427  -10.915 6.822   1.00 0.00 ? 85  LEU A CB   2  
ATOM 4130  C CG   . LEU A 1 85  ? -3.863  -12.342 6.862   1.00 0.00 ? 85  LEU A CG   2  
ATOM 4131  C CD1  . LEU A 1 85  ? -2.629  -12.411 7.744   1.00 0.00 ? 85  LEU A CD1  2  
ATOM 4132  C CD2  . LEU A 1 85  ? -4.920  -13.327 7.350   1.00 0.00 ? 85  LEU A CD2  2  
ATOM 4133  H H    . LEU A 1 85  ? -6.701  -9.541  6.822   1.00 0.00 ? 85  LEU A H    2  
ATOM 4134  H HA   . LEU A 1 85  ? -5.379  -11.376 8.678   1.00 0.00 ? 85  LEU A HA   2  
ATOM 4135  H HB2  . LEU A 1 85  ? -5.044  -10.816 5.940   1.00 0.00 ? 85  LEU A HB2  2  
ATOM 4136  H HB3  . LEU A 1 85  ? -3.598  -10.227 6.739   1.00 0.00 ? 85  LEU A HB3  2  
ATOM 4137  H HG   . LEU A 1 85  ? -3.572  -12.634 5.865   1.00 0.00 ? 85  LEU A HG   2  
ATOM 4138  H HD11 . LEU A 1 85  ? -1.899  -11.693 7.398   1.00 0.00 ? 85  LEU A HD11 2  
ATOM 4139  H HD12 . LEU A 1 85  ? -2.208  -13.404 7.697   1.00 0.00 ? 85  LEU A HD12 2  
ATOM 4140  H HD13 . LEU A 1 85  ? -2.902  -12.183 8.763   1.00 0.00 ? 85  LEU A HD13 2  
ATOM 4141  H HD21 . LEU A 1 85  ? -5.268  -13.026 8.328   1.00 0.00 ? 85  LEU A HD21 2  
ATOM 4142  H HD22 . LEU A 1 85  ? -4.490  -14.316 7.411   1.00 0.00 ? 85  LEU A HD22 2  
ATOM 4143  H HD23 . LEU A 1 85  ? -5.750  -13.337 6.660   1.00 0.00 ? 85  LEU A HD23 2  
ATOM 4144  N N    . PHE A 1 86  ? -5.189  -8.252  8.909   1.00 0.00 ? 86  PHE A N    2  
ATOM 4145  C CA   . PHE A 1 86  ? -4.626  -7.138  9.657   1.00 0.00 ? 86  PHE A CA   2  
ATOM 4146  C C    . PHE A 1 86  ? -4.775  -7.408  11.147  1.00 0.00 ? 86  PHE A C    2  
ATOM 4147  O O    . PHE A 1 86  ? -3.862  -7.159  11.935  1.00 0.00 ? 86  PHE A O    2  
ATOM 4148  C CB   . PHE A 1 86  ? -5.323  -5.825  9.286   1.00 0.00 ? 86  PHE A CB   2  
ATOM 4149  C CG   . PHE A 1 86  ? -4.403  -4.635  9.282   1.00 0.00 ? 86  PHE A CG   2  
ATOM 4150  C CD1  . PHE A 1 86  ? -3.720  -4.261  10.431  1.00 0.00 ? 86  PHE A CD1  2  
ATOM 4151  C CD2  . PHE A 1 86  ? -4.217  -3.892  8.128   1.00 0.00 ? 86  PHE A CD2  2  
ATOM 4152  C CE1  . PHE A 1 86  ? -2.872  -3.169  10.425  1.00 0.00 ? 86  PHE A CE1  2  
ATOM 4153  C CE2  . PHE A 1 86  ? -3.372  -2.798  8.119   1.00 0.00 ? 86  PHE A CE2  2  
ATOM 4154  C CZ   . PHE A 1 86  ? -2.698  -2.436  9.267   1.00 0.00 ? 86  PHE A CZ   2  
ATOM 4155  H H    . PHE A 1 86  ? -6.053  -8.137  8.455   1.00 0.00 ? 86  PHE A H    2  
ATOM 4156  H HA   . PHE A 1 86  ? -3.576  -7.066  9.416   1.00 0.00 ? 86  PHE A HA   2  
ATOM 4157  H HB2  . PHE A 1 86  ? -5.751  -5.919  8.299   1.00 0.00 ? 86  PHE A HB2  2  
ATOM 4158  H HB3  . PHE A 1 86  ? -6.113  -5.634  9.997   1.00 0.00 ? 86  PHE A HB3  2  
ATOM 4159  H HD1  . PHE A 1 86  ? -3.856  -4.832  11.339  1.00 0.00 ? 86  PHE A HD1  2  
ATOM 4160  H HD2  . PHE A 1 86  ? -4.743  -4.173  7.228   1.00 0.00 ? 86  PHE A HD2  2  
ATOM 4161  H HE1  . PHE A 1 86  ? -2.347  -2.888  11.325  1.00 0.00 ? 86  PHE A HE1  2  
ATOM 4162  H HE2  . PHE A 1 86  ? -3.237  -2.229  7.211   1.00 0.00 ? 86  PHE A HE2  2  
ATOM 4163  H HZ   . PHE A 1 86  ? -2.037  -1.583  9.261   1.00 0.00 ? 86  PHE A HZ   2  
ATOM 4164  N N    . GLN A 1 87  ? -5.932  -7.947  11.514  1.00 0.00 ? 87  GLN A N    2  
ATOM 4165  C CA   . GLN A 1 87  ? -6.227  -8.278  12.902  1.00 0.00 ? 87  GLN A CA   2  
ATOM 4166  C C    . GLN A 1 87  ? -5.323  -9.399  13.398  1.00 0.00 ? 87  GLN A C    2  
ATOM 4167  O O    . GLN A 1 87  ? -5.007  -9.474  14.587  1.00 0.00 ? 87  GLN A O    2  
ATOM 4168  C CB   . GLN A 1 87  ? -7.686  -8.699  13.047  1.00 0.00 ? 87  GLN A CB   2  
ATOM 4169  C CG   . GLN A 1 87  ? -8.671  -7.573  12.814  1.00 0.00 ? 87  GLN A CG   2  
ATOM 4170  C CD   . GLN A 1 87  ? -10.108 -8.023  12.968  1.00 0.00 ? 87  GLN A CD   2  
ATOM 4171  O OE1  . GLN A 1 87  ? -10.403 -8.979  13.688  1.00 0.00 ? 87  GLN A OE1  2  
ATOM 4172  N NE2  . GLN A 1 87  ? -11.013 -7.342  12.290  1.00 0.00 ? 87  GLN A NE2  2  
ATOM 4173  H H    . GLN A 1 87  ? -6.617  -8.117  10.827  1.00 0.00 ? 87  GLN A H    2  
ATOM 4174  H HA   . GLN A 1 87  ? -6.054  -7.396  13.499  1.00 0.00 ? 87  GLN A HA   2  
ATOM 4175  H HB2  . GLN A 1 87  ? -7.895  -9.483  12.335  1.00 0.00 ? 87  GLN A HB2  2  
ATOM 4176  H HB3  . GLN A 1 87  ? -7.839  -9.081  14.045  1.00 0.00 ? 87  GLN A HB3  2  
ATOM 4177  H HG2  . GLN A 1 87  ? -8.477  -6.786  13.527  1.00 0.00 ? 87  GLN A HG2  2  
ATOM 4178  H HG3  . GLN A 1 87  ? -8.534  -7.192  11.812  1.00 0.00 ? 87  GLN A HG3  2  
ATOM 4179  H HE21 . GLN A 1 87  ? -10.703 -6.587  11.726  1.00 0.00 ? 87  GLN A HE21 2  
ATOM 4180  H HE22 . GLN A 1 87  ? -11.952 -7.610  12.368  1.00 0.00 ? 87  GLN A HE22 2  
ATOM 4181  N N    . GLY A 1 88  ? -4.909  -10.268 12.480  1.00 0.00 ? 88  GLY A N    2  
ATOM 4182  C CA   . GLY A 1 88  ? -4.047  -11.379 12.842  1.00 0.00 ? 88  GLY A CA   2  
ATOM 4183  C C    . GLY A 1 88  ? -2.633  -10.930 13.148  1.00 0.00 ? 88  GLY A C    2  
ATOM 4184  O O    . GLY A 1 88  ? -1.916  -11.579 13.911  1.00 0.00 ? 88  GLY A O    2  
ATOM 4185  H H    . GLY A 1 88  ? -5.192  -10.154 11.549  1.00 0.00 ? 88  GLY A H    2  
ATOM 4186  H HA2  . GLY A 1 88  ? -4.456  -11.866 13.714  1.00 0.00 ? 88  GLY A HA2  2  
ATOM 4187  H HA3  . GLY A 1 88  ? -4.020  -12.085 12.025  1.00 0.00 ? 88  GLY A HA3  2  
ATOM 4188  N N    . GLY A 1 89  ? -2.236  -9.816  12.557  1.00 0.00 ? 89  GLY A N    2  
ATOM 4189  C CA   . GLY A 1 89  ? -0.908  -9.293  12.777  1.00 0.00 ? 89  GLY A CA   2  
ATOM 4190  C C    . GLY A 1 89  ? -0.639  -8.054  11.952  1.00 0.00 ? 89  GLY A C    2  
ATOM 4191  O O    . GLY A 1 89  ? -0.494  -8.139  10.734  1.00 0.00 ? 89  GLY A O    2  
ATOM 4192  H H    . GLY A 1 89  ? -2.854  -9.338  11.967  1.00 0.00 ? 89  GLY A H    2  
ATOM 4193  H HA2  . GLY A 1 89  ? -0.797  -9.048  13.824  1.00 0.00 ? 89  GLY A HA2  2  
ATOM 4194  H HA3  . GLY A 1 89  ? -0.186  -10.052 12.515  1.00 0.00 ? 89  GLY A HA3  2  
ATOM 4195  N N    . PRO A 1 90  ? -0.585  -6.879  12.590  1.00 0.00 ? 90  PRO A N    2  
ATOM 4196  C CA   . PRO A 1 90  ? -0.320  -5.613  11.903  1.00 0.00 ? 90  PRO A CA   2  
ATOM 4197  C C    . PRO A 1 90  ? 1.160   -5.462  11.548  1.00 0.00 ? 90  PRO A C    2  
ATOM 4198  O O    . PRO A 1 90  ? 1.825   -4.519  11.981  1.00 0.00 ? 90  PRO A O    2  
ATOM 4199  C CB   . PRO A 1 90  ? -0.742  -4.563  12.931  1.00 0.00 ? 90  PRO A CB   2  
ATOM 4200  C CG   . PRO A 1 90  ? -0.539  -5.220  14.251  1.00 0.00 ? 90  PRO A CG   2  
ATOM 4201  C CD   . PRO A 1 90  ? -0.787  -6.690  14.038  1.00 0.00 ? 90  PRO A CD   2  
ATOM 4202  H HA   . PRO A 1 90  ? -0.919  -5.513  11.010  1.00 0.00 ? 90  PRO A HA   2  
ATOM 4203  H HB2  . PRO A 1 90  ? -0.124  -3.684  12.828  1.00 0.00 ? 90  PRO A HB2  2  
ATOM 4204  H HB3  . PRO A 1 90  ? -1.780  -4.301  12.778  1.00 0.00 ? 90  PRO A HB3  2  
ATOM 4205  H HG2  . PRO A 1 90  ? 0.474   -5.058  14.587  1.00 0.00 ? 90  PRO A HG2  2  
ATOM 4206  H HG3  . PRO A 1 90  ? -1.242  -4.824  14.969  1.00 0.00 ? 90  PRO A HG3  2  
ATOM 4207  H HD2  . PRO A 1 90  ? -0.079  -7.277  14.602  1.00 0.00 ? 90  PRO A HD2  2  
ATOM 4208  H HD3  . PRO A 1 90  ? -1.797  -6.945  14.321  1.00 0.00 ? 90  PRO A HD3  2  
ATOM 4209  N N    . ASN A 1 91  ? 1.663   -6.403  10.759  1.00 0.00 ? 91  ASN A N    2  
ATOM 4210  C CA   . ASN A 1 91  ? 3.061   -6.403  10.346  1.00 0.00 ? 91  ASN A CA   2  
ATOM 4211  C C    . ASN A 1 91  ? 3.352   -5.273  9.361   1.00 0.00 ? 91  ASN A C    2  
ATOM 4212  O O    . ASN A 1 91  ? 2.449   -4.545  8.944   1.00 0.00 ? 91  ASN A O    2  
ATOM 4213  C CB   . ASN A 1 91  ? 3.427   -7.752  9.722   1.00 0.00 ? 91  ASN A CB   2  
ATOM 4214  C CG   . ASN A 1 91  ? 4.915   -8.045  9.788   1.00 0.00 ? 91  ASN A CG   2  
ATOM 4215  O OD1  . ASN A 1 91  ? 5.594   -7.671  10.744  1.00 0.00 ? 91  ASN A OD1  2  
ATOM 4216  N ND2  . ASN A 1 91  ? 5.435   -8.690  8.760   1.00 0.00 ? 91  ASN A ND2  2  
ATOM 4217  H H    . ASN A 1 91  ? 1.073   -7.126  10.449  1.00 0.00 ? 91  ASN A H    2  
ATOM 4218  H HA   . ASN A 1 91  ? 3.664   -6.255  11.229  1.00 0.00 ? 91  ASN A HA   2  
ATOM 4219  H HB2  . ASN A 1 91  ? 2.903   -8.537  10.245  1.00 0.00 ? 91  ASN A HB2  2  
ATOM 4220  H HB3  . ASN A 1 91  ? 3.125   -7.753  8.685   1.00 0.00 ? 91  ASN A HB3  2  
ATOM 4221  H HD21 . ASN A 1 91  ? 4.835   -8.938  8.016   1.00 0.00 ? 91  ASN A HD21 2  
ATOM 4222  H HD22 . ASN A 1 91  ? 6.392   -8.896  8.775   1.00 0.00 ? 91  ASN A HD22 2  
ATOM 4223  N N    . TRP A 1 92  ? 4.617   -5.155  8.984   1.00 0.00 ? 92  TRP A N    2  
ATOM 4224  C CA   . TRP A 1 92  ? 5.082   -4.116  8.069   1.00 0.00 ? 92  TRP A CA   2  
ATOM 4225  C C    . TRP A 1 92  ? 4.280   -4.078  6.768   1.00 0.00 ? 92  TRP A C    2  
ATOM 4226  O O    . TRP A 1 92  ? 3.692   -3.055  6.421   1.00 0.00 ? 92  TRP A O    2  
ATOM 4227  C CB   . TRP A 1 92  ? 6.561   -4.341  7.750   1.00 0.00 ? 92  TRP A CB   2  
ATOM 4228  C CG   . TRP A 1 92  ? 7.384   -4.722  8.947   1.00 0.00 ? 92  TRP A CG   2  
ATOM 4229  C CD1  . TRP A 1 92  ? 7.565   -3.990  10.085  1.00 0.00 ? 92  TRP A CD1  2  
ATOM 4230  C CD2  . TRP A 1 92  ? 8.140   -5.929  9.126   1.00 0.00 ? 92  TRP A CD2  2  
ATOM 4231  N NE1  . TRP A 1 92  ? 8.385   -4.664  10.956  1.00 0.00 ? 92  TRP A NE1  2  
ATOM 4232  C CE2  . TRP A 1 92  ? 8.750   -5.856  10.392  1.00 0.00 ? 92  TRP A CE2  2  
ATOM 4233  C CE3  . TRP A 1 92  ? 8.359   -7.065  8.339   1.00 0.00 ? 92  TRP A CE3  2  
ATOM 4234  C CZ2  . TRP A 1 92  ? 9.566   -6.872  10.889  1.00 0.00 ? 92  TRP A CZ2  2  
ATOM 4235  C CZ3  . TRP A 1 92  ? 9.167   -8.073  8.834   1.00 0.00 ? 92  TRP A CZ3  2  
ATOM 4236  C CH2  . TRP A 1 92  ? 9.761   -7.970  10.098  1.00 0.00 ? 92  TRP A CH2  2  
ATOM 4237  H H    . TRP A 1 92  ? 5.272   -5.796  9.336   1.00 0.00 ? 92  TRP A H    2  
ATOM 4238  H HA   . TRP A 1 92  ? 4.977   -3.167  8.570   1.00 0.00 ? 92  TRP A HA   2  
ATOM 4239  H HB2  . TRP A 1 92  ? 6.648   -5.134  7.021   1.00 0.00 ? 92  TRP A HB2  2  
ATOM 4240  H HB3  . TRP A 1 92  ? 6.972   -3.432  7.336   1.00 0.00 ? 92  TRP A HB3  2  
ATOM 4241  H HD1  . TRP A 1 92  ? 7.123   -3.020  10.262  1.00 0.00 ? 92  TRP A HD1  2  
ATOM 4242  H HE1  . TRP A 1 92  ? 8.667   -4.340  11.845  1.00 0.00 ? 92  TRP A HE1  2  
ATOM 4243  H HE3  . TRP A 1 92  ? 7.909   -7.163  7.363   1.00 0.00 ? 92  TRP A HE3  2  
ATOM 4244  H HZ2  . TRP A 1 92  ? 10.029  -6.808  11.862  1.00 0.00 ? 92  TRP A HZ2  2  
ATOM 4245  H HZ3  . TRP A 1 92  ? 9.348   -8.956  8.239   1.00 0.00 ? 92  TRP A HZ3  2  
ATOM 4246  H HH2  . TRP A 1 92  ? 10.387  -8.781  10.443  1.00 0.00 ? 92  TRP A HH2  2  
ATOM 4247  N N    . GLY A 1 93  ? 4.247   -5.200  6.060   1.00 0.00 ? 93  GLY A N    2  
ATOM 4248  C CA   . GLY A 1 93  ? 3.536   -5.264  4.794   1.00 0.00 ? 93  GLY A CA   2  
ATOM 4249  C C    . GLY A 1 93  ? 2.028   -5.205  4.935   1.00 0.00 ? 93  GLY A C    2  
ATOM 4250  O O    . GLY A 1 93  ? 1.320   -5.019  3.944   1.00 0.00 ? 93  GLY A O    2  
ATOM 4251  H H    . GLY A 1 93  ? 4.708   -6.002  6.400   1.00 0.00 ? 93  GLY A H    2  
ATOM 4252  H HA2  . GLY A 1 93  ? 3.855   -4.435  4.180   1.00 0.00 ? 93  GLY A HA2  2  
ATOM 4253  H HA3  . GLY A 1 93  ? 3.803   -6.185  4.296   1.00 0.00 ? 93  GLY A HA3  2  
ATOM 4254  N N    . ARG A 1 94  ? 1.529   -5.354  6.155   1.00 0.00 ? 94  ARG A N    2  
ATOM 4255  C CA   . ARG A 1 94  ? 0.094   -5.309  6.394   1.00 0.00 ? 94  ARG A CA   2  
ATOM 4256  C C    . ARG A 1 94  ? -0.444  -3.921  6.079   1.00 0.00 ? 94  ARG A C    2  
ATOM 4257  O O    . ARG A 1 94  ? -1.513  -3.778  5.486   1.00 0.00 ? 94  ARG A O    2  
ATOM 4258  C CB   . ARG A 1 94  ? -0.225  -5.690  7.839   1.00 0.00 ? 94  ARG A CB   2  
ATOM 4259  C CG   . ARG A 1 94  ? -1.421  -6.621  7.973   1.00 0.00 ? 94  ARG A CG   2  
ATOM 4260  C CD   . ARG A 1 94  ? -1.274  -7.858  7.095   1.00 0.00 ? 94  ARG A CD   2  
ATOM 4261  N NE   . ARG A 1 94  ? 0.095   -8.377  7.092   1.00 0.00 ? 94  ARG A NE   2  
ATOM 4262  C CZ   . ARG A 1 94  ? 0.492   -9.452  7.775   1.00 0.00 ? 94  ARG A CZ   2  
ATOM 4263  N NH1  . ARG A 1 94  ? -0.370  -10.118 8.532   1.00 0.00 ? 94  ARG A NH1  2  
ATOM 4264  N NH2  . ARG A 1 94  ? 1.758   -9.847  7.708   1.00 0.00 ? 94  ARG A NH2  2  
ATOM 4265  H H    . ARG A 1 94  ? 2.142   -5.485  6.912   1.00 0.00 ? 94  ARG A H    2  
ATOM 4266  H HA   . ARG A 1 94  ? -0.372  -6.020  5.732   1.00 0.00 ? 94  ARG A HA   2  
ATOM 4267  H HB2  . ARG A 1 94  ? 0.636   -6.181  8.267   1.00 0.00 ? 94  ARG A HB2  2  
ATOM 4268  H HB3  . ARG A 1 94  ? -0.431  -4.789  8.400   1.00 0.00 ? 94  ARG A HB3  2  
ATOM 4269  H HG2  . ARG A 1 94  ? -1.506  -6.933  9.003   1.00 0.00 ? 94  ARG A HG2  2  
ATOM 4270  H HG3  . ARG A 1 94  ? -2.313  -6.087  7.681   1.00 0.00 ? 94  ARG A HG3  2  
ATOM 4271  H HD2  . ARG A 1 94  ? -1.937  -8.626  7.466   1.00 0.00 ? 94  ARG A HD2  2  
ATOM 4272  H HD3  . ARG A 1 94  ? -1.556  -7.602  6.083   1.00 0.00 ? 94  ARG A HD3  2  
ATOM 4273  H HE   . ARG A 1 94  ? 0.757   -7.897  6.544   1.00 0.00 ? 94  ARG A HE   2  
ATOM 4274  H HH11 . ARG A 1 94  ? -1.324  -9.822  8.596   1.00 0.00 ? 94  ARG A HH11 2  
ATOM 4275  H HH12 . ARG A 1 94  ? -0.063  -10.929 9.057   1.00 0.00 ? 94  ARG A HH12 2  
ATOM 4276  H HH21 . ARG A 1 94  ? 2.427   -9.333  7.144   1.00 0.00 ? 94  ARG A HH21 2  
ATOM 4277  H HH22 . ARG A 1 94  ? 2.061   -10.660 8.215   1.00 0.00 ? 94  ARG A HH22 2  
ATOM 4278  N N    . LEU A 1 95  ? 0.320   -2.901  6.451   1.00 0.00 ? 95  LEU A N    2  
ATOM 4279  C CA   . LEU A 1 95  ? -0.078  -1.526  6.197   1.00 0.00 ? 95  LEU A CA   2  
ATOM 4280  C C    . LEU A 1 95  ? 0.038   -1.219  4.709   1.00 0.00 ? 95  LEU A C    2  
ATOM 4281  O O    . LEU A 1 95  ? -0.787  -0.506  4.146   1.00 0.00 ? 95  LEU A O    2  
ATOM 4282  C CB   . LEU A 1 95  ? 0.785   -0.557  7.011   1.00 0.00 ? 95  LEU A CB   2  
ATOM 4283  C CG   . LEU A 1 95  ? 0.311   0.898   7.007   1.00 0.00 ? 95  LEU A CG   2  
ATOM 4284  C CD1  . LEU A 1 95  ? -1.100  1.007   7.566   1.00 0.00 ? 95  LEU A CD1  2  
ATOM 4285  C CD2  . LEU A 1 95  ? 1.268   1.767   7.807   1.00 0.00 ? 95  LEU A CD2  2  
ATOM 4286  H H    . LEU A 1 95  ? 1.173   -3.079  6.900   1.00 0.00 ? 95  LEU A H    2  
ATOM 4287  H HA   . LEU A 1 95  ? -1.111  -1.418  6.495   1.00 0.00 ? 95  LEU A HA   2  
ATOM 4288  H HB2  . LEU A 1 95  ? 0.809   -0.903  8.034   1.00 0.00 ? 95  LEU A HB2  2  
ATOM 4289  H HB3  . LEU A 1 95  ? 1.791   -0.586  6.618   1.00 0.00 ? 95  LEU A HB3  2  
ATOM 4290  H HG   . LEU A 1 95  ? 0.296   1.263   5.990   1.00 0.00 ? 95  LEU A HG   2  
ATOM 4291  H HD11 . LEU A 1 95  ? -1.416  2.039   7.550   1.00 0.00 ? 95  LEU A HD11 2  
ATOM 4292  H HD12 . LEU A 1 95  ? -1.114  0.641   8.582   1.00 0.00 ? 95  LEU A HD12 2  
ATOM 4293  H HD13 . LEU A 1 95  ? -1.772  0.416   6.962   1.00 0.00 ? 95  LEU A HD13 2  
ATOM 4294  H HD21 . LEU A 1 95  ? 0.919   2.789   7.798   1.00 0.00 ? 95  LEU A HD21 2  
ATOM 4295  H HD22 . LEU A 1 95  ? 2.251   1.718   7.365   1.00 0.00 ? 95  LEU A HD22 2  
ATOM 4296  H HD23 . LEU A 1 95  ? 1.311   1.410   8.826   1.00 0.00 ? 95  LEU A HD23 2  
ATOM 4297  N N    . VAL A 1 96  ? 1.063   -1.788  4.080   1.00 0.00 ? 96  VAL A N    2  
ATOM 4298  C CA   . VAL A 1 96  ? 1.294   -1.597  2.651   1.00 0.00 ? 96  VAL A CA   2  
ATOM 4299  C C    . VAL A 1 96  ? 0.119   -2.144  1.844   1.00 0.00 ? 96  VAL A C    2  
ATOM 4300  O O    . VAL A 1 96  ? -0.441  -1.449  0.994   1.00 0.00 ? 96  VAL A O    2  
ATOM 4301  C CB   . VAL A 1 96  ? 2.592   -2.298  2.190   1.00 0.00 ? 96  VAL A CB   2  
ATOM 4302  C CG1  . VAL A 1 96  ? 2.877   -2.002  0.727   1.00 0.00 ? 96  VAL A CG1  2  
ATOM 4303  C CG2  . VAL A 1 96  ? 3.768   -1.878  3.058   1.00 0.00 ? 96  VAL A CG2  2  
ATOM 4304  H H    . VAL A 1 96  ? 1.682   -2.348  4.590   1.00 0.00 ? 96  VAL A H    2  
ATOM 4305  H HA   . VAL A 1 96  ? 1.389   -0.536  2.464   1.00 0.00 ? 96  VAL A HA   2  
ATOM 4306  H HB   . VAL A 1 96  ? 2.458   -3.366  2.297   1.00 0.00 ? 96  VAL A HB   2  
ATOM 4307  H HG11 . VAL A 1 96  ? 2.046   -2.338  0.124   1.00 0.00 ? 96  VAL A HG11 2  
ATOM 4308  H HG12 . VAL A 1 96  ? 3.774   -2.520  0.424   1.00 0.00 ? 96  VAL A HG12 2  
ATOM 4309  H HG13 . VAL A 1 96  ? 3.012   -0.939  0.594   1.00 0.00 ? 96  VAL A HG13 2  
ATOM 4310  H HG21 . VAL A 1 96  ? 4.637   -2.464  2.794   1.00 0.00 ? 96  VAL A HG21 2  
ATOM 4311  H HG22 . VAL A 1 96  ? 3.526   -2.041  4.098   1.00 0.00 ? 96  VAL A HG22 2  
ATOM 4312  H HG23 . VAL A 1 96  ? 3.979   -0.831  2.898   1.00 0.00 ? 96  VAL A HG23 2  
ATOM 4313  N N    . ALA A 1 97  ? -0.263  -3.383  2.143   1.00 0.00 ? 97  ALA A N    2  
ATOM 4314  C CA   . ALA A 1 97  ? -1.370  -4.040  1.455   1.00 0.00 ? 97  ALA A CA   2  
ATOM 4315  C C    . ALA A 1 97  ? -2.681  -3.297  1.687   1.00 0.00 ? 97  ALA A C    2  
ATOM 4316  O O    . ALA A 1 97  ? -3.464  -3.107  0.760   1.00 0.00 ? 97  ALA A O    2  
ATOM 4317  C CB   . ALA A 1 97  ? -1.494  -5.485  1.914   1.00 0.00 ? 97  ALA A CB   2  
ATOM 4318  H H    . ALA A 1 97  ? 0.217   -3.873  2.845   1.00 0.00 ? 97  ALA A H    2  
ATOM 4319  H HA   . ALA A 1 97  ? -1.151  -4.042  0.396   1.00 0.00 ? 97  ALA A HA   2  
ATOM 4320  H HB1  . ALA A 1 97  ? -0.564  -6.002  1.732   1.00 0.00 ? 97  ALA A HB1  2  
ATOM 4321  H HB2  . ALA A 1 97  ? -2.289  -5.972  1.366   1.00 0.00 ? 97  ALA A HB2  2  
ATOM 4322  H HB3  . ALA A 1 97  ? -1.719  -5.509  2.970   1.00 0.00 ? 97  ALA A HB3  2  
ATOM 4323  N N    . PHE A 1 98  ? -2.909  -2.871  2.923   1.00 0.00 ? 98  PHE A N    2  
ATOM 4324  C CA   . PHE A 1 98  ? -4.126  -2.145  3.272   1.00 0.00 ? 98  PHE A CA   2  
ATOM 4325  C C    . PHE A 1 98  ? -4.189  -0.804  2.544   1.00 0.00 ? 98  PHE A C    2  
ATOM 4326  O O    . PHE A 1 98  ? -5.237  -0.408  2.028   1.00 0.00 ? 98  PHE A O    2  
ATOM 4327  C CB   . PHE A 1 98  ? -4.183  -1.930  4.789   1.00 0.00 ? 98  PHE A CB   2  
ATOM 4328  C CG   . PHE A 1 98  ? -5.343  -1.088  5.251   1.00 0.00 ? 98  PHE A CG   2  
ATOM 4329  C CD1  . PHE A 1 98  ? -6.643  -1.560  5.158   1.00 0.00 ? 98  PHE A CD1  2  
ATOM 4330  C CD2  . PHE A 1 98  ? -5.128  0.173   5.784   1.00 0.00 ? 98  PHE A CD2  2  
ATOM 4331  C CE1  . PHE A 1 98  ? -7.707  -0.785  5.586   1.00 0.00 ? 98  PHE A CE1  2  
ATOM 4332  C CE2  . PHE A 1 98  ? -6.187  0.951   6.213   1.00 0.00 ? 98  PHE A CE2  2  
ATOM 4333  C CZ   . PHE A 1 98  ? -7.478  0.470   6.113   1.00 0.00 ? 98  PHE A CZ   2  
ATOM 4334  H H    . PHE A 1 98  ? -2.244  -3.051  3.621   1.00 0.00 ? 98  PHE A H    2  
ATOM 4335  H HA   . PHE A 1 98  ? -4.970  -2.746  2.971   1.00 0.00 ? 98  PHE A HA   2  
ATOM 4336  H HB2  . PHE A 1 98  ? -4.260  -2.891  5.275   1.00 0.00 ? 98  PHE A HB2  2  
ATOM 4337  H HB3  . PHE A 1 98  ? -3.273  -1.445  5.108   1.00 0.00 ? 98  PHE A HB3  2  
ATOM 4338  H HD1  . PHE A 1 98  ? -6.824  -2.541  4.746   1.00 0.00 ? 98  PHE A HD1  2  
ATOM 4339  H HD2  . PHE A 1 98  ? -4.119  0.552   5.862   1.00 0.00 ? 98  PHE A HD2  2  
ATOM 4340  H HE1  . PHE A 1 98  ? -8.716  -1.161  5.508   1.00 0.00 ? 98  PHE A HE1  2  
ATOM 4341  H HE2  . PHE A 1 98  ? -6.004  1.931   6.626   1.00 0.00 ? 98  PHE A HE2  2  
ATOM 4342  H HZ   . PHE A 1 98  ? -8.308  1.075   6.448   1.00 0.00 ? 98  PHE A HZ   2  
ATOM 4343  N N    . PHE A 1 99  ? -3.055  -0.118  2.496   1.00 0.00 ? 99  PHE A N    2  
ATOM 4344  C CA   . PHE A 1 99  ? -2.972  1.178   1.842   1.00 0.00 ? 99  PHE A CA   2  
ATOM 4345  C C    . PHE A 1 99  ? -3.142  1.048   0.331   1.00 0.00 ? 99  PHE A C    2  
ATOM 4346  O O    . PHE A 1 99  ? -3.938  1.772   -0.270  1.00 0.00 ? 99  PHE A O    2  
ATOM 4347  C CB   . PHE A 1 99  ? -1.641  1.862   2.166   1.00 0.00 ? 99  PHE A CB   2  
ATOM 4348  C CG   . PHE A 1 99  ? -1.603  3.311   1.778   1.00 0.00 ? 99  PHE A CG   2  
ATOM 4349  C CD1  . PHE A 1 99  ? -2.441  4.227   2.389   1.00 0.00 ? 99  PHE A CD1  2  
ATOM 4350  C CD2  . PHE A 1 99  ? -0.728  3.756   0.802   1.00 0.00 ? 99  PHE A CD2  2  
ATOM 4351  C CE1  . PHE A 1 99  ? -2.410  5.560   2.033   1.00 0.00 ? 99  PHE A CE1  2  
ATOM 4352  C CE2  . PHE A 1 99  ? -0.691  5.086   0.442   1.00 0.00 ? 99  PHE A CE2  2  
ATOM 4353  C CZ   . PHE A 1 99  ? -1.533  5.992   1.059   1.00 0.00 ? 99  PHE A CZ   2  
ATOM 4354  H H    . PHE A 1 99  ? -2.250  -0.495  2.915   1.00 0.00 ? 99  PHE A H    2  
ATOM 4355  H HA   . PHE A 1 99  ? -3.776  1.789   2.225   1.00 0.00 ? 99  PHE A HA   2  
ATOM 4356  H HB2  . PHE A 1 99  ? -1.460  1.799   3.229   1.00 0.00 ? 99  PHE A HB2  2  
ATOM 4357  H HB3  . PHE A 1 99  ? -0.845  1.356   1.640   1.00 0.00 ? 99  PHE A HB3  2  
ATOM 4358  H HD1  . PHE A 1 99  ? -3.129  3.889   3.151   1.00 0.00 ? 99  PHE A HD1  2  
ATOM 4359  H HD2  . PHE A 1 99  ? -0.071  3.049   0.320   1.00 0.00 ? 99  PHE A HD2  2  
ATOM 4360  H HE1  . PHE A 1 99  ? -3.071  6.265   2.517   1.00 0.00 ? 99  PHE A HE1  2  
ATOM 4361  H HE2  . PHE A 1 99  ? -0.003  5.422   -0.321  1.00 0.00 ? 99  PHE A HE2  2  
ATOM 4362  H HZ   . PHE A 1 99  ? -1.505  7.033   0.780   1.00 0.00 ? 99  PHE A HZ   2  
ATOM 4363  N N    . VAL A 1 100 ? -2.412  0.115   -0.277  1.00 0.00 ? 100 VAL A N    2  
ATOM 4364  C CA   . VAL A 1 100 ? -2.496  -0.082  -1.719  1.00 0.00 ? 100 VAL A CA   2  
ATOM 4365  C C    . VAL A 1 100 ? -3.882  -0.579  -2.127  1.00 0.00 ? 100 VAL A C    2  
ATOM 4366  O O    . VAL A 1 100 ? -4.375  -0.234  -3.200  1.00 0.00 ? 100 VAL A O    2  
ATOM 4367  C CB   . VAL A 1 100 ? -1.402  -1.044  -2.249  1.00 0.00 ? 100 VAL A CB   2  
ATOM 4368  C CG1  . VAL A 1 100 ? -1.683  -2.489  -1.868  1.00 0.00 ? 100 VAL A CG1  2  
ATOM 4369  C CG2  . VAL A 1 100 ? -1.260  -0.903  -3.756  1.00 0.00 ? 100 VAL A CG2  2  
ATOM 4370  H H    . VAL A 1 100 ? -1.800  -0.447  0.253   1.00 0.00 ? 100 VAL A H    2  
ATOM 4371  H HA   . VAL A 1 100 ? -2.337  0.882   -2.182  1.00 0.00 ? 100 VAL A HA   2  
ATOM 4372  H HB   . VAL A 1 100 ? -0.462  -0.759  -1.798  1.00 0.00 ? 100 VAL A HB   2  
ATOM 4373  H HG11 . VAL A 1 100 ? -0.958  -3.134  -2.342  1.00 0.00 ? 100 VAL A HG11 2  
ATOM 4374  H HG12 . VAL A 1 100 ? -2.676  -2.761  -2.197  1.00 0.00 ? 100 VAL A HG12 2  
ATOM 4375  H HG13 . VAL A 1 100 ? -1.617  -2.598  -0.795  1.00 0.00 ? 100 VAL A HG13 2  
ATOM 4376  H HG21 . VAL A 1 100 ? -0.967  0.109   -3.997  1.00 0.00 ? 100 VAL A HG21 2  
ATOM 4377  H HG22 . VAL A 1 100 ? -2.205  -1.126  -4.229  1.00 0.00 ? 100 VAL A HG22 2  
ATOM 4378  H HG23 . VAL A 1 100 ? -0.507  -1.591  -4.113  1.00 0.00 ? 100 VAL A HG23 2  
ATOM 4379  N N    . PHE A 1 101 ? -4.516  -1.372  -1.264  1.00 0.00 ? 101 PHE A N    2  
ATOM 4380  C CA   . PHE A 1 101 ? -5.852  -1.885  -1.545  1.00 0.00 ? 101 PHE A CA   2  
ATOM 4381  C C    . PHE A 1 101 ? -6.825  -0.728  -1.675  1.00 0.00 ? 101 PHE A C    2  
ATOM 4382  O O    . PHE A 1 101 ? -7.556  -0.621  -2.661  1.00 0.00 ? 101 PHE A O    2  
ATOM 4383  C CB   . PHE A 1 101 ? -6.316  -2.827  -0.436  1.00 0.00 ? 101 PHE A CB   2  
ATOM 4384  C CG   . PHE A 1 101 ? -6.510  -4.246  -0.891  1.00 0.00 ? 101 PHE A CG   2  
ATOM 4385  C CD1  . PHE A 1 101 ? -7.391  -4.545  -1.917  1.00 0.00 ? 101 PHE A CD1  2  
ATOM 4386  C CD2  . PHE A 1 101 ? -5.815  -5.280  -0.286  1.00 0.00 ? 101 PHE A CD2  2  
ATOM 4387  C CE1  . PHE A 1 101 ? -7.575  -5.850  -2.333  1.00 0.00 ? 101 PHE A CE1  2  
ATOM 4388  C CE2  . PHE A 1 101 ? -5.994  -6.586  -0.697  1.00 0.00 ? 101 PHE A CE2  2  
ATOM 4389  C CZ   . PHE A 1 101 ? -6.874  -6.872  -1.720  1.00 0.00 ? 101 PHE A CZ   2  
ATOM 4390  H H    . PHE A 1 101 ? -4.071  -1.624  -0.425  1.00 0.00 ? 101 PHE A H    2  
ATOM 4391  H HA   . PHE A 1 101 ? -5.815  -2.424  -2.480  1.00 0.00 ? 101 PHE A HA   2  
ATOM 4392  H HB2  . PHE A 1 101 ? -5.581  -2.831  0.353   1.00 0.00 ? 101 PHE A HB2  2  
ATOM 4393  H HB3  . PHE A 1 101 ? -7.259  -2.473  -0.042  1.00 0.00 ? 101 PHE A HB3  2  
ATOM 4394  H HD1  . PHE A 1 101 ? -7.937  -3.746  -2.398  1.00 0.00 ? 101 PHE A HD1  2  
ATOM 4395  H HD2  . PHE A 1 101 ? -5.125  -5.058  0.515   1.00 0.00 ? 101 PHE A HD2  2  
ATOM 4396  H HE1  . PHE A 1 101 ? -8.264  -6.069  -3.134  1.00 0.00 ? 101 PHE A HE1  2  
ATOM 4397  H HE2  . PHE A 1 101 ? -5.447  -7.383  -0.218  1.00 0.00 ? 101 PHE A HE2  2  
ATOM 4398  H HZ   . PHE A 1 101 ? -7.015  -7.893  -2.042  1.00 0.00 ? 101 PHE A HZ   2  
ATOM 4399  N N    . GLY A 1 102 ? -6.811  0.149   -0.676  1.00 0.00 ? 102 GLY A N    2  
ATOM 4400  C CA   . GLY A 1 102 ? -7.684  1.301   -0.689  1.00 0.00 ? 102 GLY A CA   2  
ATOM 4401  C C    . GLY A 1 102 ? -7.385  2.218   -1.852  1.00 0.00 ? 102 GLY A C    2  
ATOM 4402  O O    . GLY A 1 102 ? -8.297  2.660   -2.541  1.00 0.00 ? 102 GLY A O    2  
ATOM 4403  H H    . GLY A 1 102 ? -6.200  0.007   0.080   1.00 0.00 ? 102 GLY A H    2  
ATOM 4404  H HA2  . GLY A 1 102 ? -8.707  0.965   -0.761  1.00 0.00 ? 102 GLY A HA2  2  
ATOM 4405  H HA3  . GLY A 1 102 ? -7.556  1.851   0.232   1.00 0.00 ? 102 GLY A HA3  2  
ATOM 4406  N N    . ALA A 1 103 ? -6.100  2.484   -2.087  1.00 0.00 ? 103 ALA A N    2  
ATOM 4407  C CA   . ALA A 1 103 ? -5.680  3.356   -3.178  1.00 0.00 ? 103 ALA A CA   2  
ATOM 4408  C C    . ALA A 1 103 ? -6.136  2.813   -4.531  1.00 0.00 ? 103 ALA A C    2  
ATOM 4409  O O    . ALA A 1 103 ? -6.720  3.541   -5.334  1.00 0.00 ? 103 ALA A O    2  
ATOM 4410  C CB   . ALA A 1 103 ? -4.167  3.536   -3.164  1.00 0.00 ? 103 ALA A CB   2  
ATOM 4411  H H    . ALA A 1 103 ? -5.416  2.082   -1.505  1.00 0.00 ? 103 ALA A H    2  
ATOM 4412  H HA   . ALA A 1 103 ? -6.134  4.324   -3.023  1.00 0.00 ? 103 ALA A HA   2  
ATOM 4413  H HB1  . ALA A 1 103 ? -3.863  3.970   -2.224  1.00 0.00 ? 103 ALA A HB1  2  
ATOM 4414  H HB2  . ALA A 1 103 ? -3.875  4.190   -3.974  1.00 0.00 ? 103 ALA A HB2  2  
ATOM 4415  H HB3  . ALA A 1 103 ? -3.689  2.576   -3.290  1.00 0.00 ? 103 ALA A HB3  2  
ATOM 4416  N N    . ALA A 1 104 ? -5.887  1.529   -4.765  1.00 0.00 ? 104 ALA A N    2  
ATOM 4417  C CA   . ALA A 1 104 ? -6.261  0.890   -6.022  1.00 0.00 ? 104 ALA A CA   2  
ATOM 4418  C C    . ALA A 1 104 ? -7.771  0.880   -6.220  1.00 0.00 ? 104 ALA A C    2  
ATOM 4419  O O    . ALA A 1 104 ? -8.268  1.210   -7.299  1.00 0.00 ? 104 ALA A O    2  
ATOM 4420  C CB   . ALA A 1 104 ? -5.715  -0.529  -6.082  1.00 0.00 ? 104 ALA A CB   2  
ATOM 4421  H H    . ALA A 1 104 ? -5.439  0.993   -4.069  1.00 0.00 ? 104 ALA A H    2  
ATOM 4422  H HA   . ALA A 1 104 ? -5.810  1.455   -6.824  1.00 0.00 ? 104 ALA A HA   2  
ATOM 4423  H HB1  . ALA A 1 104 ? -5.869  -0.934  -7.073  1.00 0.00 ? 104 ALA A HB1  2  
ATOM 4424  H HB2  . ALA A 1 104 ? -6.230  -1.146  -5.359  1.00 0.00 ? 104 ALA A HB2  2  
ATOM 4425  H HB3  . ALA A 1 104 ? -4.658  -0.520  -5.858  1.00 0.00 ? 104 ALA A HB3  2  
ATOM 4426  N N    . LEU A 1 105 ? -8.500  0.513   -5.176  1.00 0.00 ? 105 LEU A N    2  
ATOM 4427  C CA   . LEU A 1 105 ? -9.954  0.456   -5.247  1.00 0.00 ? 105 LEU A CA   2  
ATOM 4428  C C    . LEU A 1 105 ? -10.551 1.852   -5.386  1.00 0.00 ? 105 LEU A C    2  
ATOM 4429  O O    . LEU A 1 105 ? -11.522 2.049   -6.123  1.00 0.00 ? 105 LEU A O    2  
ATOM 4430  C CB   . LEU A 1 105 ? -10.531 -0.254  -4.017  1.00 0.00 ? 105 LEU A CB   2  
ATOM 4431  C CG   . LEU A 1 105 ? -10.836 -1.746  -4.203  1.00 0.00 ? 105 LEU A CG   2  
ATOM 4432  C CD1  . LEU A 1 105 ? -11.765 -1.960  -5.389  1.00 0.00 ? 105 LEU A CD1  2  
ATOM 4433  C CD2  . LEU A 1 105 ? -9.553  -2.544  -4.383  1.00 0.00 ? 105 LEU A CD2  2  
ATOM 4434  H H    . LEU A 1 105 ? -8.049  0.271   -4.334  1.00 0.00 ? 105 LEU A H    2  
ATOM 4435  H HA   . LEU A 1 105 ? -10.213 -0.114  -6.128  1.00 0.00 ? 105 LEU A HA   2  
ATOM 4436  H HB2  . LEU A 1 105 ? -9.826  -0.149  -3.206  1.00 0.00 ? 105 LEU A HB2  2  
ATOM 4437  H HB3  . LEU A 1 105 ? -11.448 0.245   -3.741  1.00 0.00 ? 105 LEU A HB3  2  
ATOM 4438  H HG   . LEU A 1 105 ? -11.337 -2.114  -3.319  1.00 0.00 ? 105 LEU A HG   2  
ATOM 4439  H HD11 . LEU A 1 105 ? -12.661 -1.374  -5.255  1.00 0.00 ? 105 LEU A HD11 2  
ATOM 4440  H HD12 . LEU A 1 105 ? -12.026 -3.006  -5.458  1.00 0.00 ? 105 LEU A HD12 2  
ATOM 4441  H HD13 . LEU A 1 105 ? -11.267 -1.653  -6.296  1.00 0.00 ? 105 LEU A HD13 2  
ATOM 4442  H HD21 . LEU A 1 105 ? -9.789  -3.595  -4.459  1.00 0.00 ? 105 LEU A HD21 2  
ATOM 4443  H HD22 . LEU A 1 105 ? -8.905  -2.379  -3.535  1.00 0.00 ? 105 LEU A HD22 2  
ATOM 4444  H HD23 . LEU A 1 105 ? -9.054  -2.221  -5.284  1.00 0.00 ? 105 LEU A HD23 2  
ATOM 4445  N N    . CYS A 1 106 ? -9.972  2.820   -4.686  1.00 0.00 ? 106 CYS A N    2  
ATOM 4446  C CA   . CYS A 1 106 ? -10.447 4.192   -4.757  1.00 0.00 ? 106 CYS A CA   2  
ATOM 4447  C C    . CYS A 1 106 ? -10.222 4.756   -6.152  1.00 0.00 ? 106 CYS A C    2  
ATOM 4448  O O    . CYS A 1 106 ? -11.132 5.329   -6.741  1.00 0.00 ? 106 CYS A O    2  
ATOM 4449  C CB   . CYS A 1 106 ? -9.761  5.069   -3.709  1.00 0.00 ? 106 CYS A CB   2  
ATOM 4450  S SG   . CYS A 1 106 ? -10.477 4.922   -2.055  1.00 0.00 ? 106 CYS A SG   2  
ATOM 4451  H H    . CYS A 1 106 ? -9.212  2.603   -4.096  1.00 0.00 ? 106 CYS A H    2  
ATOM 4452  H HA   . CYS A 1 106 ? -11.510 4.181   -4.559  1.00 0.00 ? 106 CYS A HA   2  
ATOM 4453  H HB2  . CYS A 1 106 ? -8.719  4.790   -3.641  1.00 0.00 ? 106 CYS A HB2  2  
ATOM 4454  H HB3  . CYS A 1 106 ? -9.832  6.104   -4.010  1.00 0.00 ? 106 CYS A HB3  2  
ATOM 4455  H HG   . CYS A 1 106 ? -10.459 6.129   -1.501  1.00 0.00 ? 106 CYS A HG   2  
ATOM 4456  N N    . ALA A 1 107 ? -9.016  4.568   -6.687  1.00 0.00 ? 107 ALA A N    2  
ATOM 4457  C CA   . ALA A 1 107 ? -8.687  5.055   -8.025  1.00 0.00 ? 107 ALA A CA   2  
ATOM 4458  C C    . ALA A 1 107 ? -9.624  4.445   -9.062  1.00 0.00 ? 107 ALA A C    2  
ATOM 4459  O O    . ALA A 1 107 ? -10.105 5.133   -9.966  1.00 0.00 ? 107 ALA A O    2  
ATOM 4460  C CB   . ALA A 1 107 ? -7.237  4.743   -8.369  1.00 0.00 ? 107 ALA A CB   2  
ATOM 4461  H H    . ALA A 1 107 ? -8.326  4.097   -6.166  1.00 0.00 ? 107 ALA A H    2  
ATOM 4462  H HA   . ALA A 1 107 ? -8.812  6.128   -8.029  1.00 0.00 ? 107 ALA A HA   2  
ATOM 4463  H HB1  . ALA A 1 107 ? -7.000  5.162   -9.334  1.00 0.00 ? 107 ALA A HB1  2  
ATOM 4464  H HB2  . ALA A 1 107 ? -7.093  3.673   -8.396  1.00 0.00 ? 107 ALA A HB2  2  
ATOM 4465  H HB3  . ALA A 1 107 ? -6.589  5.174   -7.619  1.00 0.00 ? 107 ALA A HB3  2  
ATOM 4466  N N    . GLU A 1 108 ? -9.888  3.152   -8.909  1.00 0.00 ? 108 GLU A N    2  
ATOM 4467  C CA   . GLU A 1 108 ? -10.778 2.428   -9.807  1.00 0.00 ? 108 GLU A CA   2  
ATOM 4468  C C    . GLU A 1 108 ? -12.170 3.048   -9.771  1.00 0.00 ? 108 GLU A C    2  
ATOM 4469  O O    . GLU A 1 108 ? -12.832 3.196   -10.802 1.00 0.00 ? 108 GLU A O    2  
ATOM 4470  C CB   . GLU A 1 108 ? -10.839 0.954   -9.389  1.00 0.00 ? 108 GLU A CB   2  
ATOM 4471  C CG   . GLU A 1 108 ? -11.235 0.003   -10.505 1.00 0.00 ? 108 GLU A CG   2  
ATOM 4472  C CD   . GLU A 1 108 ? -12.735 -0.173  -10.629 1.00 0.00 ? 108 GLU A CD   2  
ATOM 4473  O OE1  . GLU A 1 108 ? -13.440 -0.126  -9.599  1.00 0.00 ? 108 GLU A OE1  2  
ATOM 4474  O OE2  . GLU A 1 108 ? -13.218 -0.381  -11.758 1.00 0.00 ? 108 GLU A OE2  2  
ATOM 4475  H H    . GLU A 1 108 ? -9.462  2.666   -8.169  1.00 0.00 ? 108 GLU A H    2  
ATOM 4476  H HA   . GLU A 1 108 ? -10.381 2.500   -10.809 1.00 0.00 ? 108 GLU A HA   2  
ATOM 4477  H HB2  . GLU A 1 108 ? -9.868  0.658   -9.024  1.00 0.00 ? 108 GLU A HB2  2  
ATOM 4478  H HB3  . GLU A 1 108 ? -11.558 0.851   -8.589  1.00 0.00 ? 108 GLU A HB3  2  
ATOM 4479  H HG2  . GLU A 1 108 ? -10.858 0.393   -11.440 1.00 0.00 ? 108 GLU A HG2  2  
ATOM 4480  H HG3  . GLU A 1 108 ? -10.787 -0.961  -10.314 1.00 0.00 ? 108 GLU A HG3  2  
ATOM 4481  N N    . SER A 1 109 ? -12.596 3.432   -8.575  1.00 0.00 ? 109 SER A N    2  
ATOM 4482  C CA   . SER A 1 109 ? -13.901 4.042   -8.384  1.00 0.00 ? 109 SER A CA   2  
ATOM 4483  C C    . SER A 1 109 ? -13.906 5.489   -8.885  1.00 0.00 ? 109 SER A C    2  
ATOM 4484  O O    . SER A 1 109 ? -14.873 5.930   -9.499  1.00 0.00 ? 109 SER A O    2  
ATOM 4485  C CB   . SER A 1 109 ? -14.293 3.981   -6.906  1.00 0.00 ? 109 SER A CB   2  
ATOM 4486  O OG   . SER A 1 109 ? -14.138 2.666   -6.392  1.00 0.00 ? 109 SER A OG   2  
ATOM 4487  H H    . SER A 1 109 ? -12.013 3.300   -7.798  1.00 0.00 ? 109 SER A H    2  
ATOM 4488  H HA   . SER A 1 109 ? -14.617 3.474   -8.959  1.00 0.00 ? 109 SER A HA   2  
ATOM 4489  H HB2  . SER A 1 109 ? -13.664 4.653   -6.339  1.00 0.00 ? 109 SER A HB2  2  
ATOM 4490  H HB3  . SER A 1 109 ? -15.327 4.279   -6.797  1.00 0.00 ? 109 SER A HB3  2  
ATOM 4491  H HG   . SER A 1 109 ? -13.194 2.474   -6.279  1.00 0.00 ? 109 SER A HG   2  
ATOM 4492  N N    . VAL A 1 110 ? -12.815 6.213   -8.635  1.00 0.00 ? 110 VAL A N    2  
ATOM 4493  C CA   . VAL A 1 110 ? -12.692 7.606   -9.068  1.00 0.00 ? 110 VAL A CA   2  
ATOM 4494  C C    . VAL A 1 110 ? -12.828 7.711   -10.585 1.00 0.00 ? 110 VAL A C    2  
ATOM 4495  O O    . VAL A 1 110 ? -13.582 8.541   -11.096 1.00 0.00 ? 110 VAL A O    2  
ATOM 4496  C CB   . VAL A 1 110 ? -11.342 8.225   -8.628  1.00 0.00 ? 110 VAL A CB   2  
ATOM 4497  C CG1  . VAL A 1 110 ? -11.103 9.566   -9.311  1.00 0.00 ? 110 VAL A CG1  2  
ATOM 4498  C CG2  . VAL A 1 110 ? -11.295 8.391   -7.117  1.00 0.00 ? 110 VAL A CG2  2  
ATOM 4499  H H    . VAL A 1 110 ? -12.070 5.800   -8.140  1.00 0.00 ? 110 VAL A H    2  
ATOM 4500  H HA   . VAL A 1 110 ? -13.491 8.170   -8.607  1.00 0.00 ? 110 VAL A HA   2  
ATOM 4501  H HB   . VAL A 1 110 ? -10.547 7.553   -8.919  1.00 0.00 ? 110 VAL A HB   2  
ATOM 4502  H HG11 . VAL A 1 110 ? -11.888 10.256  -9.035  1.00 0.00 ? 110 VAL A HG11 2  
ATOM 4503  H HG12 . VAL A 1 110 ? -11.105 9.429   -10.383 1.00 0.00 ? 110 VAL A HG12 2  
ATOM 4504  H HG13 . VAL A 1 110 ? -10.149 9.964   -9.002  1.00 0.00 ? 110 VAL A HG13 2  
ATOM 4505  H HG21 . VAL A 1 110 ? -11.465 7.434   -6.645  1.00 0.00 ? 110 VAL A HG21 2  
ATOM 4506  H HG22 . VAL A 1 110 ? -12.062 9.087   -6.807  1.00 0.00 ? 110 VAL A HG22 2  
ATOM 4507  H HG23 . VAL A 1 110 ? -10.326 8.769   -6.824  1.00 0.00 ? 110 VAL A HG23 2  
ATOM 4508  N N    . ASN A 1 111 ? -12.112 6.848   -11.299 1.00 0.00 ? 111 ASN A N    2  
ATOM 4509  C CA   . ASN A 1 111 ? -12.163 6.837   -12.759 1.00 0.00 ? 111 ASN A CA   2  
ATOM 4510  C C    . ASN A 1 111 ? -13.557 6.439   -13.244 1.00 0.00 ? 111 ASN A C    2  
ATOM 4511  O O    . ASN A 1 111 ? -13.993 6.844   -14.322 1.00 0.00 ? 111 ASN A O    2  
ATOM 4512  C CB   . ASN A 1 111 ? -11.105 5.879   -13.320 1.00 0.00 ? 111 ASN A CB   2  
ATOM 4513  C CG   . ASN A 1 111 ? -11.198 5.728   -14.827 1.00 0.00 ? 111 ASN A CG   2  
ATOM 4514  O OD1  . ASN A 1 111 ? -10.931 6.668   -15.576 1.00 0.00 ? 111 ASN A OD1  2  
ATOM 4515  N ND2  . ASN A 1 111 ? -11.553 4.535   -15.277 1.00 0.00 ? 111 ASN A ND2  2  
ATOM 4516  H H    . ASN A 1 111 ? -11.528 6.207   -10.832 1.00 0.00 ? 111 ASN A H    2  
ATOM 4517  H HA   . ASN A 1 111 ? -11.949 7.837   -13.105 1.00 0.00 ? 111 ASN A HA   2  
ATOM 4518  H HB2  . ASN A 1 111 ? -10.124 6.255   -13.076 1.00 0.00 ? 111 ASN A HB2  2  
ATOM 4519  H HB3  . ASN A 1 111 ? -11.235 4.905   -12.869 1.00 0.00 ? 111 ASN A HB3  2  
ATOM 4520  H HD21 . ASN A 1 111 ? -11.730 3.823   -14.619 1.00 0.00 ? 111 ASN A HD21 2  
ATOM 4521  H HD22 . ASN A 1 111 ? -11.638 4.410   -16.249 1.00 0.00 ? 111 ASN A HD22 2  
ATOM 4522  N N    . LYS A 1 112 ? -14.260 5.668   -12.424 1.00 0.00 ? 112 LYS A N    2  
ATOM 4523  C CA   . LYS A 1 112 ? -15.607 5.219   -12.754 1.00 0.00 ? 112 LYS A CA   2  
ATOM 4524  C C    . LYS A 1 112 ? -16.652 6.211   -12.244 1.00 0.00 ? 112 LYS A C    2  
ATOM 4525  O O    . LYS A 1 112 ? -17.849 5.926   -12.253 1.00 0.00 ? 112 LYS A O    2  
ATOM 4526  C CB   . LYS A 1 112 ? -15.856 3.829   -12.164 1.00 0.00 ? 112 LYS A CB   2  
ATOM 4527  C CG   . LYS A 1 112 ? -16.236 2.788   -13.204 1.00 0.00 ? 112 LYS A CG   2  
ATOM 4528  C CD   . LYS A 1 112 ? -15.814 1.390   -12.781 1.00 0.00 ? 112 LYS A CD   2  
ATOM 4529  C CE   . LYS A 1 112 ? -16.491 0.966   -11.488 1.00 0.00 ? 112 LYS A CE   2  
ATOM 4530  N NZ   . LYS A 1 112 ? -15.940 -0.310  -10.961 1.00 0.00 ? 112 LYS A NZ   2  
ATOM 4531  H H    . LYS A 1 112 ? -13.862 5.395   -11.571 1.00 0.00 ? 112 LYS A H    2  
ATOM 4532  H HA   . LYS A 1 112 ? -15.681 5.162   -13.830 1.00 0.00 ? 112 LYS A HA   2  
ATOM 4533  H HB2  . LYS A 1 112 ? -14.957 3.497   -11.666 1.00 0.00 ? 112 LYS A HB2  2  
ATOM 4534  H HB3  . LYS A 1 112 ? -16.656 3.892   -11.440 1.00 0.00 ? 112 LYS A HB3  2  
ATOM 4535  H HG2  . LYS A 1 112 ? -17.307 2.803   -13.336 1.00 0.00 ? 112 LYS A HG2  2  
ATOM 4536  H HG3  . LYS A 1 112 ? -15.753 3.034   -14.138 1.00 0.00 ? 112 LYS A HG3  2  
ATOM 4537  H HD2  . LYS A 1 112 ? -16.085 0.694   -13.560 1.00 0.00 ? 112 LYS A HD2  2  
ATOM 4538  H HD3  . LYS A 1 112 ? -14.742 1.374   -12.640 1.00 0.00 ? 112 LYS A HD3  2  
ATOM 4539  H HE2  . LYS A 1 112 ? -16.348 1.741   -10.750 1.00 0.00 ? 112 LYS A HE2  2  
ATOM 4540  H HE3  . LYS A 1 112 ? -17.547 0.840   -11.676 1.00 0.00 ? 112 LYS A HE3  2  
ATOM 4541  H HZ1  . LYS A 1 112 ? -14.914 -0.214  -10.778 1.00 0.00 ? 112 LYS A HZ1  2  
ATOM 4542  H HZ2  . LYS A 1 112 ? -16.085 -1.079  -11.650 1.00 0.00 ? 112 LYS A HZ2  2  
ATOM 4543  H HZ3  . LYS A 1 112 ? -16.419 -0.565  -10.070 1.00 0.00 ? 112 LYS A HZ3  2  
ATOM 4544  N N    . GLU A 1 113 ? -16.173 7.374   -11.793 1.00 0.00 ? 113 GLU A N    2  
ATOM 4545  C CA   . GLU A 1 113 ? -17.027 8.447   -11.283 1.00 0.00 ? 113 GLU A CA   2  
ATOM 4546  C C    . GLU A 1 113 ? -17.841 8.002   -10.064 1.00 0.00 ? 113 GLU A C    2  
ATOM 4547  O O    . GLU A 1 113 ? -18.962 8.463   -9.846  1.00 0.00 ? 113 GLU A O    2  
ATOM 4548  C CB   . GLU A 1 113 ? -17.957 8.961   -12.387 1.00 0.00 ? 113 GLU A CB   2  
ATOM 4549  C CG   . GLU A 1 113 ? -18.274 10.441  -12.271 1.00 0.00 ? 113 GLU A CG   2  
ATOM 4550  C CD   . GLU A 1 113 ? -19.127 10.948  -13.412 1.00 0.00 ? 113 GLU A CD   2  
ATOM 4551  O OE1  . GLU A 1 113 ? -20.293 10.519  -13.526 1.00 0.00 ? 113 GLU A OE1  2  
ATOM 4552  O OE2  . GLU A 1 113 ? -18.642 11.794  -14.189 1.00 0.00 ? 113 GLU A OE2  2  
ATOM 4553  H H    . GLU A 1 113 ? -15.203 7.513   -11.805 1.00 0.00 ? 113 GLU A H    2  
ATOM 4554  H HA   . GLU A 1 113 ? -16.377 9.256   -10.978 1.00 0.00 ? 113 GLU A HA   2  
ATOM 4555  H HB2  . GLU A 1 113 ? -17.489 8.788   -13.347 1.00 0.00 ? 113 GLU A HB2  2  
ATOM 4556  H HB3  . GLU A 1 113 ? -18.885 8.411   -12.345 1.00 0.00 ? 113 GLU A HB3  2  
ATOM 4557  H HG2  . GLU A 1 113 ? -18.803 10.609  -11.346 1.00 0.00 ? 113 GLU A HG2  2  
ATOM 4558  H HG3  . GLU A 1 113 ? -17.345 10.994  -12.261 1.00 0.00 ? 113 GLU A HG3  2  
ATOM 4559  N N    . MET A 1 114 ? -17.265 7.123   -9.258  1.00 0.00 ? 114 MET A N    2  
ATOM 4560  C CA   . MET A 1 114 ? -17.933 6.627   -8.064  1.00 0.00 ? 114 MET A CA   2  
ATOM 4561  C C    . MET A 1 114 ? -17.339 7.281   -6.818  1.00 0.00 ? 114 MET A C    2  
ATOM 4562  O O    . MET A 1 114 ? -16.788 6.605   -5.950  1.00 0.00 ? 114 MET A O    2  
ATOM 4563  C CB   . MET A 1 114 ? -17.806 5.105   -7.971  1.00 0.00 ? 114 MET A CB   2  
ATOM 4564  C CG   . MET A 1 114 ? -19.080 4.414   -7.515  1.00 0.00 ? 114 MET A CG   2  
ATOM 4565  S SD   . MET A 1 114 ? -19.833 5.203   -6.077  1.00 0.00 ? 114 MET A SD   2  
ATOM 4566  C CE   . MET A 1 114 ? -21.158 4.052   -5.720  1.00 0.00 ? 114 MET A CE   2  
ATOM 4567  H H    . MET A 1 114 ? -16.362 6.796   -9.473  1.00 0.00 ? 114 MET A H    2  
ATOM 4568  H HA   . MET A 1 114 ? -18.978 6.890   -8.133  1.00 0.00 ? 114 MET A HA   2  
ATOM 4569  H HB2  . MET A 1 114 ? -17.541 4.718   -8.945  1.00 0.00 ? 114 MET A HB2  2  
ATOM 4570  H HB3  . MET A 1 114 ? -17.020 4.865   -7.271  1.00 0.00 ? 114 MET A HB3  2  
ATOM 4571  H HG2  . MET A 1 114 ? -19.792 4.431   -8.329  1.00 0.00 ? 114 MET A HG2  2  
ATOM 4572  H HG3  . MET A 1 114 ? -18.848 3.390   -7.266  1.00 0.00 ? 114 MET A HG3  2  
ATOM 4573  H HE1  . MET A 1 114 ? -20.748 3.060   -5.596  1.00 0.00 ? 114 MET A HE1  2  
ATOM 4574  H HE2  . MET A 1 114 ? -21.863 4.051   -6.537  1.00 0.00 ? 114 MET A HE2  2  
ATOM 4575  H HE3  . MET A 1 114 ? -21.660 4.350   -4.811  1.00 0.00 ? 114 MET A HE3  2  
ATOM 4576  N N    . GLU A 1 115 ? -17.463 8.601   -6.740  1.00 0.00 ? 115 GLU A N    2  
ATOM 4577  C CA   . GLU A 1 115 ? -16.935 9.365   -5.614  1.00 0.00 ? 115 GLU A CA   2  
ATOM 4578  C C    . GLU A 1 115 ? -17.631 8.978   -4.311  1.00 0.00 ? 115 GLU A C    2  
ATOM 4579  O O    . GLU A 1 115 ? -17.031 9.038   -3.235  1.00 0.00 ? 115 GLU A O    2  
ATOM 4580  C CB   . GLU A 1 115 ? -17.106 10.863  -5.874  1.00 0.00 ? 115 GLU A CB   2  
ATOM 4581  C CG   . GLU A 1 115 ? -16.231 11.742  -4.997  1.00 0.00 ? 115 GLU A CG   2  
ATOM 4582  C CD   . GLU A 1 115 ? -14.754 11.451  -5.167  1.00 0.00 ? 115 GLU A CD   2  
ATOM 4583  O OE1  . GLU A 1 115 ? -14.236 11.608  -6.294  1.00 0.00 ? 115 GLU A OE1  2  
ATOM 4584  O OE2  . GLU A 1 115 ? -14.099 11.079  -4.173  1.00 0.00 ? 115 GLU A OE2  2  
ATOM 4585  H H    . GLU A 1 115 ? -17.922 9.077   -7.464  1.00 0.00 ? 115 GLU A H    2  
ATOM 4586  H HA   . GLU A 1 115 ? -15.883 9.143   -5.525  1.00 0.00 ? 115 GLU A HA   2  
ATOM 4587  H HB2  . GLU A 1 115 ? -16.858 11.065  -6.907  1.00 0.00 ? 115 GLU A HB2  2  
ATOM 4588  H HB3  . GLU A 1 115 ? -18.138 11.131  -5.702  1.00 0.00 ? 115 GLU A HB3  2  
ATOM 4589  H HG2  . GLU A 1 115 ? -16.410 12.774  -5.253  1.00 0.00 ? 115 GLU A HG2  2  
ATOM 4590  H HG3  . GLU A 1 115 ? -16.499 11.575  -3.965  1.00 0.00 ? 115 GLU A HG3  2  
ATOM 4591  N N    . VAL A 1 116 ? -18.891 8.567   -4.417  1.00 0.00 ? 116 VAL A N    2  
ATOM 4592  C CA   . VAL A 1 116 ? -19.673 8.165   -3.251  1.00 0.00 ? 116 VAL A CA   2  
ATOM 4593  C C    . VAL A 1 116 ? -19.000 7.002   -2.530  1.00 0.00 ? 116 VAL A C    2  
ATOM 4594  O O    . VAL A 1 116 ? -18.857 7.009   -1.308  1.00 0.00 ? 116 VAL A O    2  
ATOM 4595  C CB   . VAL A 1 116 ? -21.108 7.747   -3.645  1.00 0.00 ? 116 VAL A CB   2  
ATOM 4596  C CG1  . VAL A 1 116 ? -21.968 7.514   -2.410  1.00 0.00 ? 116 VAL A CG1  2  
ATOM 4597  C CG2  . VAL A 1 116 ? -21.742 8.791   -4.548  1.00 0.00 ? 116 VAL A CG2  2  
ATOM 4598  H H    . VAL A 1 116 ? -19.304 8.531   -5.305  1.00 0.00 ? 116 VAL A H    2  
ATOM 4599  H HA   . VAL A 1 116 ? -19.733 9.010   -2.580  1.00 0.00 ? 116 VAL A HA   2  
ATOM 4600  H HB   . VAL A 1 116 ? -21.051 6.817   -4.195  1.00 0.00 ? 116 VAL A HB   2  
ATOM 4601  H HG11 . VAL A 1 116 ? -22.014 8.421   -1.825  1.00 0.00 ? 116 VAL A HG11 2  
ATOM 4602  H HG12 . VAL A 1 116 ? -21.540 6.722   -1.814  1.00 0.00 ? 116 VAL A HG12 2  
ATOM 4603  H HG13 . VAL A 1 116 ? -22.966 7.234   -2.715  1.00 0.00 ? 116 VAL A HG13 2  
ATOM 4604  H HG21 . VAL A 1 116 ? -22.734 8.471   -4.827  1.00 0.00 ? 116 VAL A HG21 2  
ATOM 4605  H HG22 . VAL A 1 116 ? -21.141 8.913   -5.436  1.00 0.00 ? 116 VAL A HG22 2  
ATOM 4606  H HG23 . VAL A 1 116 ? -21.803 9.732   -4.022  1.00 0.00 ? 116 VAL A HG23 2  
ATOM 4607  N N    . LEU A 1 117 ? -18.567 6.012   -3.304  1.00 0.00 ? 117 LEU A N    2  
ATOM 4608  C CA   . LEU A 1 117 ? -17.908 4.836   -2.755  1.00 0.00 ? 117 LEU A CA   2  
ATOM 4609  C C    . LEU A 1 117 ? -16.530 5.200   -2.217  1.00 0.00 ? 117 LEU A C    2  
ATOM 4610  O O    . LEU A 1 117 ? -16.120 4.719   -1.163  1.00 0.00 ? 117 LEU A O    2  
ATOM 4611  C CB   . LEU A 1 117 ? -17.785 3.753   -3.829  1.00 0.00 ? 117 LEU A CB   2  
ATOM 4612  C CG   . LEU A 1 117 ? -17.518 2.339   -3.312  1.00 0.00 ? 117 LEU A CG   2  
ATOM 4613  C CD1  . LEU A 1 117 ? -18.637 1.887   -2.386  1.00 0.00 ? 117 LEU A CD1  2  
ATOM 4614  C CD2  . LEU A 1 117 ? -17.369 1.380   -4.482  1.00 0.00 ? 117 LEU A CD2  2  
ATOM 4615  H H    . LEU A 1 117 ? -18.698 6.076   -4.277  1.00 0.00 ? 117 LEU A H    2  
ATOM 4616  H HA   . LEU A 1 117 ? -18.516 4.463   -1.942  1.00 0.00 ? 117 LEU A HA   2  
ATOM 4617  H HB2  . LEU A 1 117 ? -18.702 3.734   -4.396  1.00 0.00 ? 117 LEU A HB2  2  
ATOM 4618  H HB3  . LEU A 1 117 ? -16.978 4.024   -4.493  1.00 0.00 ? 117 LEU A HB3  2  
ATOM 4619  H HG   . LEU A 1 117 ? -16.593 2.331   -2.751  1.00 0.00 ? 117 LEU A HG   2  
ATOM 4620  H HD11 . LEU A 1 117 ? -18.703 2.562   -1.545  1.00 0.00 ? 117 LEU A HD11 2  
ATOM 4621  H HD12 . LEU A 1 117 ? -18.431 0.889   -2.028  1.00 0.00 ? 117 LEU A HD12 2  
ATOM 4622  H HD13 . LEU A 1 117 ? -19.572 1.891   -2.923  1.00 0.00 ? 117 LEU A HD13 2  
ATOM 4623  H HD21 . LEU A 1 117 ? -18.287 1.360   -5.049  1.00 0.00 ? 117 LEU A HD21 2  
ATOM 4624  H HD22 . LEU A 1 117 ? -17.152 0.388   -4.114  1.00 0.00 ? 117 LEU A HD22 2  
ATOM 4625  H HD23 . LEU A 1 117 ? -16.561 1.711   -5.118  1.00 0.00 ? 117 LEU A HD23 2  
ATOM 4626  N N    . VAL A 1 118 ? -15.831 6.068   -2.944  1.00 0.00 ? 118 VAL A N    2  
ATOM 4627  C CA   . VAL A 1 118 ? -14.494 6.505   -2.549  1.00 0.00 ? 118 VAL A CA   2  
ATOM 4628  C C    . VAL A 1 118 ? -14.524 7.175   -1.180  1.00 0.00 ? 118 VAL A C    2  
ATOM 4629  O O    . VAL A 1 118 ? -13.691 6.887   -0.319  1.00 0.00 ? 118 VAL A O    2  
ATOM 4630  C CB   . VAL A 1 118 ? -13.894 7.487   -3.579  1.00 0.00 ? 118 VAL A CB   2  
ATOM 4631  C CG1  . VAL A 1 118 ? -12.508 7.943   -3.154  1.00 0.00 ? 118 VAL A CG1  2  
ATOM 4632  C CG2  . VAL A 1 118 ? -13.842 6.855   -4.958  1.00 0.00 ? 118 VAL A CG2  2  
ATOM 4633  H H    . VAL A 1 118 ? -16.227 6.425   -3.768  1.00 0.00 ? 118 VAL A H    2  
ATOM 4634  H HA   . VAL A 1 118 ? -13.859 5.632   -2.499  1.00 0.00 ? 118 VAL A HA   2  
ATOM 4635  H HB   . VAL A 1 118 ? -14.534 8.357   -3.630  1.00 0.00 ? 118 VAL A HB   2  
ATOM 4636  H HG11 . VAL A 1 118 ? -12.135 8.667   -3.861  1.00 0.00 ? 118 VAL A HG11 2  
ATOM 4637  H HG12 . VAL A 1 118 ? -11.843 7.092   -3.125  1.00 0.00 ? 118 VAL A HG12 2  
ATOM 4638  H HG13 . VAL A 1 118 ? -12.561 8.389   -2.172  1.00 0.00 ? 118 VAL A HG13 2  
ATOM 4639  H HG21 . VAL A 1 118 ? -13.376 7.540   -5.649  1.00 0.00 ? 118 VAL A HG21 2  
ATOM 4640  H HG22 . VAL A 1 118 ? -14.847 6.636   -5.292  1.00 0.00 ? 118 VAL A HG22 2  
ATOM 4641  H HG23 . VAL A 1 118 ? -13.269 5.940   -4.913  1.00 0.00 ? 118 VAL A HG23 2  
ATOM 4642  N N    . GLY A 1 119 ? -15.497 8.058   -0.984  1.00 0.00 ? 119 GLY A N    2  
ATOM 4643  C CA   . GLY A 1 119 ? -15.624 8.756   0.281   1.00 0.00 ? 119 GLY A CA   2  
ATOM 4644  C C    . GLY A 1 119 ? -15.861 7.811   1.437   1.00 0.00 ? 119 GLY A C    2  
ATOM 4645  O O    . GLY A 1 119 ? -15.287 7.977   2.512   1.00 0.00 ? 119 GLY A O    2  
ATOM 4646  H H    . GLY A 1 119 ? -16.135 8.240   -1.711  1.00 0.00 ? 119 GLY A H    2  
ATOM 4647  H HA2  . GLY A 1 119 ? -14.718 9.315   0.466   1.00 0.00 ? 119 GLY A HA2  2  
ATOM 4648  H HA3  . GLY A 1 119 ? -16.454 9.444   0.218   1.00 0.00 ? 119 GLY A HA3  2  
ATOM 4649  N N    . GLN A 1 120 ? -16.697 6.809   1.208   1.00 0.00 ? 120 GLN A N    2  
ATOM 4650  C CA   . GLN A 1 120 ? -17.013 5.824   2.230   1.00 0.00 ? 120 GLN A CA   2  
ATOM 4651  C C    . GLN A 1 120 ? -15.773 5.017   2.604   1.00 0.00 ? 120 GLN A C    2  
ATOM 4652  O O    . GLN A 1 120 ? -15.477 4.826   3.785   1.00 0.00 ? 120 GLN A O    2  
ATOM 4653  C CB   . GLN A 1 120 ? -18.120 4.892   1.736   1.00 0.00 ? 120 GLN A CB   2  
ATOM 4654  C CG   . GLN A 1 120 ? -19.464 5.582   1.574   1.00 0.00 ? 120 GLN A CG   2  
ATOM 4655  C CD   . GLN A 1 120 ? -20.491 4.723   0.864   1.00 0.00 ? 120 GLN A CD   2  
ATOM 4656  O OE1  . GLN A 1 120 ? -20.430 3.496   0.913   1.00 0.00 ? 120 GLN A OE1  2  
ATOM 4657  N NE2  . GLN A 1 120 ? -21.448 5.365   0.213   1.00 0.00 ? 120 GLN A NE2  2  
ATOM 4658  H H    . GLN A 1 120 ? -17.115 6.730   0.324   1.00 0.00 ? 120 GLN A H    2  
ATOM 4659  H HA   . GLN A 1 120 ? -17.362 6.354   3.103   1.00 0.00 ? 120 GLN A HA   2  
ATOM 4660  H HB2  . GLN A 1 120 ? -17.832 4.484   0.780   1.00 0.00 ? 120 GLN A HB2  2  
ATOM 4661  H HB3  . GLN A 1 120 ? -18.237 4.084   2.445   1.00 0.00 ? 120 GLN A HB3  2  
ATOM 4662  H HG2  . GLN A 1 120 ? -19.844 5.836   2.553   1.00 0.00 ? 120 GLN A HG2  2  
ATOM 4663  H HG3  . GLN A 1 120 ? -19.321 6.488   1.003   1.00 0.00 ? 120 GLN A HG3  2  
ATOM 4664  H HE21 . GLN A 1 120 ? -21.437 6.349   0.230   1.00 0.00 ? 120 GLN A HE21 2  
ATOM 4665  H HE22 . GLN A 1 120 ? -22.130 4.837   -0.256  1.00 0.00 ? 120 GLN A HE22 2  
ATOM 4666  N N    . VAL A 1 121 ? -15.041 4.564   1.593   1.00 0.00 ? 121 VAL A N    2  
ATOM 4667  C CA   . VAL A 1 121 ? -13.832 3.781   1.813   1.00 0.00 ? 121 VAL A CA   2  
ATOM 4668  C C    . VAL A 1 121 ? -12.770 4.614   2.528   1.00 0.00 ? 121 VAL A C    2  
ATOM 4669  O O    . VAL A 1 121 ? -12.158 4.157   3.495   1.00 0.00 ? 121 VAL A O    2  
ATOM 4670  C CB   . VAL A 1 121 ? -13.257 3.235   0.487   1.00 0.00 ? 121 VAL A CB   2  
ATOM 4671  C CG1  . VAL A 1 121 ? -11.975 2.451   0.732   1.00 0.00 ? 121 VAL A CG1  2  
ATOM 4672  C CG2  . VAL A 1 121 ? -14.284 2.367   -0.223  1.00 0.00 ? 121 VAL A CG2  2  
ATOM 4673  H H    . VAL A 1 121 ? -15.322 4.760   0.672   1.00 0.00 ? 121 VAL A H    2  
ATOM 4674  H HA   . VAL A 1 121 ? -14.093 2.941   2.441   1.00 0.00 ? 121 VAL A HA   2  
ATOM 4675  H HB   . VAL A 1 121 ? -13.023 4.072   -0.153  1.00 0.00 ? 121 VAL A HB   2  
ATOM 4676  H HG11 . VAL A 1 121 ? -11.237 3.102   1.175   1.00 0.00 ? 121 VAL A HG11 2  
ATOM 4677  H HG12 . VAL A 1 121 ? -11.602 2.069   -0.206  1.00 0.00 ? 121 VAL A HG12 2  
ATOM 4678  H HG13 . VAL A 1 121 ? -12.179 1.630   1.401   1.00 0.00 ? 121 VAL A HG13 2  
ATOM 4679  H HG21 . VAL A 1 121 ? -13.846 1.958   -1.122  1.00 0.00 ? 121 VAL A HG21 2  
ATOM 4680  H HG22 . VAL A 1 121 ? -15.144 2.966   -0.481  1.00 0.00 ? 121 VAL A HG22 2  
ATOM 4681  H HG23 . VAL A 1 121 ? -14.588 1.562   0.428   1.00 0.00 ? 121 VAL A HG23 2  
ATOM 4682  N N    . GLN A 1 122 ? -12.568 5.843   2.061   1.00 0.00 ? 122 GLN A N    2  
ATOM 4683  C CA   . GLN A 1 122 ? -11.581 6.734   2.660   1.00 0.00 ? 122 GLN A CA   2  
ATOM 4684  C C    . GLN A 1 122 ? -11.922 7.012   4.117   1.00 0.00 ? 122 GLN A C    2  
ATOM 4685  O O    . GLN A 1 122 ? -11.053 6.962   4.990   1.00 0.00 ? 122 GLN A O    2  
ATOM 4686  C CB   . GLN A 1 122 ? -11.504 8.052   1.885   1.00 0.00 ? 122 GLN A CB   2  
ATOM 4687  C CG   . GLN A 1 122 ? -10.112 8.364   1.364   1.00 0.00 ? 122 GLN A CG   2  
ATOM 4688  C CD   . GLN A 1 122 ? -9.691  7.429   0.247   1.00 0.00 ? 122 GLN A CD   2  
ATOM 4689  O OE1  . GLN A 1 122 ? -9.916  7.713   -0.928  1.00 0.00 ? 122 GLN A OE1  2  
ATOM 4690  N NE2  . GLN A 1 122 ? -9.095  6.302   0.605   1.00 0.00 ? 122 GLN A NE2  2  
ATOM 4691  H H    . GLN A 1 122 ? -13.095 6.156   1.290   1.00 0.00 ? 122 GLN A H    2  
ATOM 4692  H HA   . GLN A 1 122 ? -10.622 6.242   2.615   1.00 0.00 ? 122 GLN A HA   2  
ATOM 4693  H HB2  . GLN A 1 122 ? -12.179 8.002   1.044   1.00 0.00 ? 122 GLN A HB2  2  
ATOM 4694  H HB3  . GLN A 1 122 ? -11.812 8.857   2.536   1.00 0.00 ? 122 GLN A HB3  2  
ATOM 4695  H HG2  . GLN A 1 122 ? -10.103 9.377   0.989   1.00 0.00 ? 122 GLN A HG2  2  
ATOM 4696  H HG3  . GLN A 1 122 ? -9.406  8.272   2.176   1.00 0.00 ? 122 GLN A HG3  2  
ATOM 4697  H HE21 . GLN A 1 122 ? -8.958  6.132   1.561   1.00 0.00 ? 122 GLN A HE21 2  
ATOM 4698  H HE22 . GLN A 1 122 ? -8.821  5.678   -0.100  1.00 0.00 ? 122 GLN A HE22 2  
ATOM 4699  N N    . GLU A 1 123 ? -13.192 7.293   4.370   1.00 0.00 ? 123 GLU A N    2  
ATOM 4700  C CA   . GLU A 1 123 ? -13.666 7.571   5.715   1.00 0.00 ? 123 GLU A CA   2  
ATOM 4701  C C    . GLU A 1 123 ? -13.418 6.377   6.629   1.00 0.00 ? 123 GLU A C    2  
ATOM 4702  O O    . GLU A 1 123 ? -12.920 6.532   7.748   1.00 0.00 ? 123 GLU A O    2  
ATOM 4703  C CB   . GLU A 1 123 ? -15.155 7.905   5.679   1.00 0.00 ? 123 GLU A CB   2  
ATOM 4704  C CG   . GLU A 1 123 ? -15.748 8.223   7.038   1.00 0.00 ? 123 GLU A CG   2  
ATOM 4705  C CD   . GLU A 1 123 ? -17.197 8.645   6.945   1.00 0.00 ? 123 GLU A CD   2  
ATOM 4706  O OE1  . GLU A 1 123 ? -18.079 7.765   6.928   1.00 0.00 ? 123 GLU A OE1  2  
ATOM 4707  O OE2  . GLU A 1 123 ? -17.464 9.861   6.887   1.00 0.00 ? 123 GLU A OE2  2  
ATOM 4708  H H    . GLU A 1 123 ? -13.832 7.328   3.622   1.00 0.00 ? 123 GLU A H    2  
ATOM 4709  H HA   . GLU A 1 123 ? -13.120 8.422   6.092   1.00 0.00 ? 123 GLU A HA   2  
ATOM 4710  H HB2  . GLU A 1 123 ? -15.303 8.763   5.038   1.00 0.00 ? 123 GLU A HB2  2  
ATOM 4711  H HB3  . GLU A 1 123 ? -15.689 7.064   5.263   1.00 0.00 ? 123 GLU A HB3  2  
ATOM 4712  H HG2  . GLU A 1 123 ? -15.684 7.343   7.663   1.00 0.00 ? 123 GLU A HG2  2  
ATOM 4713  H HG3  . GLU A 1 123 ? -15.183 9.026   7.487   1.00 0.00 ? 123 GLU A HG3  2  
ATOM 4714  N N    . TRP A 1 124 ? -13.748 5.190   6.133   1.00 0.00 ? 124 TRP A N    2  
ATOM 4715  C CA   . TRP A 1 124 ? -13.571 3.958   6.893   1.00 0.00 ? 124 TRP A CA   2  
ATOM 4716  C C    . TRP A 1 124 ? -12.100 3.707   7.196   1.00 0.00 ? 124 TRP A C    2  
ATOM 4717  O O    . TRP A 1 124 ? -11.745 3.335   8.315   1.00 0.00 ? 124 TRP A O    2  
ATOM 4718  C CB   . TRP A 1 124 ? -14.153 2.769   6.125   1.00 0.00 ? 124 TRP A CB   2  
ATOM 4719  C CG   . TRP A 1 124 ? -15.635 2.614   6.293   1.00 0.00 ? 124 TRP A CG   2  
ATOM 4720  C CD1  . TRP A 1 124 ? -16.518 3.558   6.735   1.00 0.00 ? 124 TRP A CD1  2  
ATOM 4721  C CD2  . TRP A 1 124 ? -16.408 1.440   6.020   1.00 0.00 ? 124 TRP A CD2  2  
ATOM 4722  N NE1  . TRP A 1 124 ? -17.788 3.040   6.762   1.00 0.00 ? 124 TRP A NE1  2  
ATOM 4723  C CE2  . TRP A 1 124 ? -17.748 1.742   6.324   1.00 0.00 ? 124 TRP A CE2  2  
ATOM 4724  C CE3  . TRP A 1 124 ? -16.096 0.161   5.548   1.00 0.00 ? 124 TRP A CE3  2  
ATOM 4725  C CZ2  . TRP A 1 124 ? -18.774 0.813   6.173   1.00 0.00 ? 124 TRP A CZ2  2  
ATOM 4726  C CZ3  . TRP A 1 124 ? -17.115 -0.761  5.396   1.00 0.00 ? 124 TRP A CZ3  2  
ATOM 4727  C CH2  . TRP A 1 124 ? -18.441 -0.431  5.709   1.00 0.00 ? 124 TRP A CH2  2  
ATOM 4728  H H    . TRP A 1 124 ? -14.127 5.141   5.228   1.00 0.00 ? 124 TRP A H    2  
ATOM 4729  H HA   . TRP A 1 124 ? -14.104 4.065   7.826   1.00 0.00 ? 124 TRP A HA   2  
ATOM 4730  H HB2  . TRP A 1 124 ? -13.948 2.895   5.072   1.00 0.00 ? 124 TRP A HB2  2  
ATOM 4731  H HB3  . TRP A 1 124 ? -13.680 1.860   6.471   1.00 0.00 ? 124 TRP A HB3  2  
ATOM 4732  H HD1  . TRP A 1 124 ? -16.240 4.560   7.025   1.00 0.00 ? 124 TRP A HD1  2  
ATOM 4733  H HE1  . TRP A 1 124 ? -18.597 3.526   7.049   1.00 0.00 ? 124 TRP A HE1  2  
ATOM 4734  H HE3  . TRP A 1 124 ? -15.082 -0.112  5.302   1.00 0.00 ? 124 TRP A HE3  2  
ATOM 4735  H HZ2  . TRP A 1 124 ? -19.802 1.050   6.406   1.00 0.00 ? 124 TRP A HZ2  2  
ATOM 4736  H HZ3  . TRP A 1 124 ? -16.893 -1.754  5.034   1.00 0.00 ? 124 TRP A HZ3  2  
ATOM 4737  H HH2  . TRP A 1 124 ? -19.206 -1.183  5.576   1.00 0.00 ? 124 TRP A HH2  2  
ATOM 4738  N N    . MET A 1 125 ? -11.246 3.916   6.197   1.00 0.00 ? 125 MET A N    2  
ATOM 4739  C CA   . MET A 1 125 ? -9.809  3.716   6.360   1.00 0.00 ? 125 MET A CA   2  
ATOM 4740  C C    . MET A 1 125 ? -9.269  4.589   7.487   1.00 0.00 ? 125 MET A C    2  
ATOM 4741  O O    . MET A 1 125 ? -8.588  4.105   8.390   1.00 0.00 ? 125 MET A O    2  
ATOM 4742  C CB   . MET A 1 125 ? -9.060  4.034   5.059   1.00 0.00 ? 125 MET A CB   2  
ATOM 4743  C CG   . MET A 1 125 ? -9.277  3.012   3.953   1.00 0.00 ? 125 MET A CG   2  
ATOM 4744  S SD   . MET A 1 125 ? -8.346  3.401   2.456   1.00 0.00 ? 125 MET A SD   2  
ATOM 4745  C CE   . MET A 1 125 ? -6.673  3.044   2.992   1.00 0.00 ? 125 MET A CE   2  
ATOM 4746  H H    . MET A 1 125 ? -11.593 4.213   5.326   1.00 0.00 ? 125 MET A H    2  
ATOM 4747  H HA   . MET A 1 125 ? -9.646  2.680   6.618   1.00 0.00 ? 125 MET A HA   2  
ATOM 4748  H HB2  . MET A 1 125 ? -9.388  4.995   4.694   1.00 0.00 ? 125 MET A HB2  2  
ATOM 4749  H HB3  . MET A 1 125 ? -8.001  4.082   5.271   1.00 0.00 ? 125 MET A HB3  2  
ATOM 4750  H HG2  . MET A 1 125 ? -8.966  2.040   4.311   1.00 0.00 ? 125 MET A HG2  2  
ATOM 4751  H HG3  . MET A 1 125 ? -10.329 2.985   3.709   1.00 0.00 ? 125 MET A HG3  2  
ATOM 4752  H HE1  . MET A 1 125 ? -5.993  3.183   2.165   1.00 0.00 ? 125 MET A HE1  2  
ATOM 4753  H HE2  . MET A 1 125 ? -6.615  2.023   3.337   1.00 0.00 ? 125 MET A HE2  2  
ATOM 4754  H HE3  . MET A 1 125 ? -6.402  3.712   3.797   1.00 0.00 ? 125 MET A HE3  2  
ATOM 4755  N N    . VAL A 1 126 ? -9.607  5.873   7.439   1.00 0.00 ? 126 VAL A N    2  
ATOM 4756  C CA   . VAL A 1 126 ? -9.158  6.823   8.448   1.00 0.00 ? 126 VAL A CA   2  
ATOM 4757  C C    . VAL A 1 126 ? -9.745  6.481   9.818   1.00 0.00 ? 126 VAL A C    2  
ATOM 4758  O O    . VAL A 1 126 ? -9.048  6.541   10.834  1.00 0.00 ? 126 VAL A O    2  
ATOM 4759  C CB   . VAL A 1 126 ? -9.541  8.271   8.063   1.00 0.00 ? 126 VAL A CB   2  
ATOM 4760  C CG1  . VAL A 1 126 ? -9.123  9.251   9.145   1.00 0.00 ? 126 VAL A CG1  2  
ATOM 4761  C CG2  . VAL A 1 126 ? -8.916  8.654   6.728   1.00 0.00 ? 126 VAL A CG2  2  
ATOM 4762  H H    . VAL A 1 126 ? -10.180 6.190   6.705   1.00 0.00 ? 126 VAL A H    2  
ATOM 4763  H HA   . VAL A 1 126 ? -8.080  6.762   8.505   1.00 0.00 ? 126 VAL A HA   2  
ATOM 4764  H HB   . VAL A 1 126 ? -10.615 8.320   7.960   1.00 0.00 ? 126 VAL A HB   2  
ATOM 4765  H HG11 . VAL A 1 126 ? -9.680  9.048   10.048  1.00 0.00 ? 126 VAL A HG11 2  
ATOM 4766  H HG12 . VAL A 1 126 ? -9.327  10.259  8.816   1.00 0.00 ? 126 VAL A HG12 2  
ATOM 4767  H HG13 . VAL A 1 126 ? -8.067  9.144   9.343   1.00 0.00 ? 126 VAL A HG13 2  
ATOM 4768  H HG21 . VAL A 1 126 ? -9.258  7.976   5.963   1.00 0.00 ? 126 VAL A HG21 2  
ATOM 4769  H HG22 . VAL A 1 126 ? -7.840  8.598   6.804   1.00 0.00 ? 126 VAL A HG22 2  
ATOM 4770  H HG23 . VAL A 1 126 ? -9.204  9.663   6.470   1.00 0.00 ? 126 VAL A HG23 2  
ATOM 4771  N N    . ALA A 1 127 ? -11.022 6.102   9.836   1.00 0.00 ? 127 ALA A N    2  
ATOM 4772  C CA   . ALA A 1 127 ? -11.699 5.745   11.078  1.00 0.00 ? 127 ALA A CA   2  
ATOM 4773  C C    . ALA A 1 127 ? -11.019 4.553   11.734  1.00 0.00 ? 127 ALA A C    2  
ATOM 4774  O O    . ALA A 1 127 ? -10.753 4.562   12.935  1.00 0.00 ? 127 ALA A O    2  
ATOM 4775  C CB   . ALA A 1 127 ? -13.167 5.436   10.821  1.00 0.00 ? 127 ALA A CB   2  
ATOM 4776  H H    . ALA A 1 127 ? -11.524 6.065   8.993   1.00 0.00 ? 127 ALA A H    2  
ATOM 4777  H HA   . ALA A 1 127 ? -11.644 6.593   11.746  1.00 0.00 ? 127 ALA A HA   2  
ATOM 4778  H HB1  . ALA A 1 127 ? -13.663 5.237   11.759  1.00 0.00 ? 127 ALA A HB1  2  
ATOM 4779  H HB2  . ALA A 1 127 ? -13.245 4.567   10.183  1.00 0.00 ? 127 ALA A HB2  2  
ATOM 4780  H HB3  . ALA A 1 127 ? -13.635 6.281   10.338  1.00 0.00 ? 127 ALA A HB3  2  
ATOM 4781  N N    . TYR A 1 128 ? -10.727 3.537   10.931  1.00 0.00 ? 128 TYR A N    2  
ATOM 4782  C CA   . TYR A 1 128 ? -10.067 2.331   11.413  1.00 0.00 ? 128 TYR A CA   2  
ATOM 4783  C C    . TYR A 1 128 ? -8.708  2.680   12.017  1.00 0.00 ? 128 TYR A C    2  
ATOM 4784  O O    . TYR A 1 128 ? -8.340  2.183   13.087  1.00 0.00 ? 128 TYR A O    2  
ATOM 4785  C CB   . TYR A 1 128 ? -9.896  1.339   10.258  1.00 0.00 ? 128 TYR A CB   2  
ATOM 4786  C CG   . TYR A 1 128 ? -9.490  -0.052  10.688  1.00 0.00 ? 128 TYR A CG   2  
ATOM 4787  C CD1  . TYR A 1 128 ? -10.435 -0.959  11.148  1.00 0.00 ? 128 TYR A CD1  2  
ATOM 4788  C CD2  . TYR A 1 128 ? -8.164  -0.459  10.627  1.00 0.00 ? 128 TYR A CD2  2  
ATOM 4789  C CE1  . TYR A 1 128 ? -10.069 -2.232  11.537  1.00 0.00 ? 128 TYR A CE1  2  
ATOM 4790  C CE2  . TYR A 1 128 ? -7.790  -1.731  11.014  1.00 0.00 ? 128 TYR A CE2  2  
ATOM 4791  C CZ   . TYR A 1 128 ? -8.746  -2.612  11.469  1.00 0.00 ? 128 TYR A CZ   2  
ATOM 4792  O OH   . TYR A 1 128 ? -8.376  -3.877  11.858  1.00 0.00 ? 128 TYR A OH   2  
ATOM 4793  H H    . TYR A 1 128 ? -10.968 3.597   9.976   1.00 0.00 ? 128 TYR A H    2  
ATOM 4794  H HA   . TYR A 1 128 ? -10.690 1.888   12.175  1.00 0.00 ? 128 TYR A HA   2  
ATOM 4795  H HB2  . TYR A 1 128 ? -10.831 1.257   9.725   1.00 0.00 ? 128 TYR A HB2  2  
ATOM 4796  H HB3  . TYR A 1 128 ? -9.137  1.712   9.585   1.00 0.00 ? 128 TYR A HB3  2  
ATOM 4797  H HD1  . TYR A 1 128 ? -11.470 -0.658  11.196  1.00 0.00 ? 128 TYR A HD1  2  
ATOM 4798  H HD2  . TYR A 1 128 ? -7.417  0.236   10.271  1.00 0.00 ? 128 TYR A HD2  2  
ATOM 4799  H HE1  . TYR A 1 128 ? -10.818 -2.924  11.892  1.00 0.00 ? 128 TYR A HE1  2  
ATOM 4800  H HE2  . TYR A 1 128 ? -6.755  -2.030  10.958  1.00 0.00 ? 128 TYR A HE2  2  
ATOM 4801  H HH   . TYR A 1 128 ? -8.914  -4.533  11.377  1.00 0.00 ? 128 TYR A HH   2  
ATOM 4802  N N    . LEU A 1 129 ? -7.980  3.555   11.333  1.00 0.00 ? 129 LEU A N    2  
ATOM 4803  C CA   . LEU A 1 129 ? -6.664  3.988   11.783  1.00 0.00 ? 129 LEU A CA   2  
ATOM 4804  C C    . LEU A 1 129 ? -6.755  4.740   13.110  1.00 0.00 ? 129 LEU A C    2  
ATOM 4805  O O    . LEU A 1 129 ? -5.885  4.609   13.965  1.00 0.00 ? 129 LEU A O    2  
ATOM 4806  C CB   . LEU A 1 129 ? -6.008  4.886   10.729  1.00 0.00 ? 129 LEU A CB   2  
ATOM 4807  C CG   . LEU A 1 129 ? -5.645  4.197   9.412   1.00 0.00 ? 129 LEU A CG   2  
ATOM 4808  C CD1  . LEU A 1 129 ? -5.390  5.230   8.327   1.00 0.00 ? 129 LEU A CD1  2  
ATOM 4809  C CD2  . LEU A 1 129 ? -4.427  3.304   9.592   1.00 0.00 ? 129 LEU A CD2  2  
ATOM 4810  H H    . LEU A 1 129 ? -8.340  3.920   10.492  1.00 0.00 ? 129 LEU A H    2  
ATOM 4811  H HA   . LEU A 1 129 ? -6.056  3.107   11.921  1.00 0.00 ? 129 LEU A HA   2  
ATOM 4812  H HB2  . LEU A 1 129 ? -6.687  5.698   10.508  1.00 0.00 ? 129 LEU A HB2  2  
ATOM 4813  H HB3  . LEU A 1 129 ? -5.105  5.302   11.153  1.00 0.00 ? 129 LEU A HB3  2  
ATOM 4814  H HG   . LEU A 1 129 ? -6.472  3.577   9.097   1.00 0.00 ? 129 LEU A HG   2  
ATOM 4815  H HD11 . LEU A 1 129 ? -4.581  5.877   8.629   1.00 0.00 ? 129 LEU A HD11 2  
ATOM 4816  H HD12 . LEU A 1 129 ? -6.283  5.818   8.173   1.00 0.00 ? 129 LEU A HD12 2  
ATOM 4817  H HD13 . LEU A 1 129 ? -5.125  4.728   7.408   1.00 0.00 ? 129 LEU A HD13 2  
ATOM 4818  H HD21 . LEU A 1 129 ? -4.203  2.810   8.659   1.00 0.00 ? 129 LEU A HD21 2  
ATOM 4819  H HD22 . LEU A 1 129 ? -4.630  2.564   10.353  1.00 0.00 ? 129 LEU A HD22 2  
ATOM 4820  H HD23 . LEU A 1 129 ? -3.580  3.904   9.891   1.00 0.00 ? 129 LEU A HD23 2  
ATOM 4821  N N    . GLU A 1 130 ? -7.820  5.511   13.283  1.00 0.00 ? 130 GLU A N    2  
ATOM 4822  C CA   . GLU A 1 130 ? -8.005  6.296   14.499  1.00 0.00 ? 130 GLU A CA   2  
ATOM 4823  C C    . GLU A 1 130 ? -8.769  5.531   15.579  1.00 0.00 ? 130 GLU A C    2  
ATOM 4824  O O    . GLU A 1 130 ? -9.085  6.090   16.631  1.00 0.00 ? 130 GLU A O    2  
ATOM 4825  C CB   . GLU A 1 130 ? -8.738  7.598   14.182  1.00 0.00 ? 130 GLU A CB   2  
ATOM 4826  C CG   . GLU A 1 130 ? -7.841  8.675   13.601  1.00 0.00 ? 130 GLU A CG   2  
ATOM 4827  C CD   . GLU A 1 130 ? -8.573  9.982   13.381  1.00 0.00 ? 130 GLU A CD   2  
ATOM 4828  O OE1  . GLU A 1 130 ? -8.777  10.729  14.360  1.00 0.00 ? 130 GLU A OE1  2  
ATOM 4829  O OE2  . GLU A 1 130 ? -8.950  10.271  12.228  1.00 0.00 ? 130 GLU A OE2  2  
ATOM 4830  H H    . GLU A 1 130 ? -8.494  5.565   12.571  1.00 0.00 ? 130 GLU A H    2  
ATOM 4831  H HA   . GLU A 1 130 ? -7.027  6.539   14.880  1.00 0.00 ? 130 GLU A HA   2  
ATOM 4832  H HB2  . GLU A 1 130 ? -9.522  7.392   13.469  1.00 0.00 ? 130 GLU A HB2  2  
ATOM 4833  H HB3  . GLU A 1 130 ? -9.180  7.979   15.091  1.00 0.00 ? 130 GLU A HB3  2  
ATOM 4834  H HG2  . GLU A 1 130 ? -7.021  8.851   14.281  1.00 0.00 ? 130 GLU A HG2  2  
ATOM 4835  H HG3  . GLU A 1 130 ? -7.455  8.330   12.652  1.00 0.00 ? 130 GLU A HG3  2  
ATOM 4836  N N    . THR A 1 131 ? -9.072  4.266   15.340  1.00 0.00 ? 131 THR A N    2  
ATOM 4837  C CA   . THR A 1 131 ? -9.795  3.487   16.332  1.00 0.00 ? 131 THR A CA   2  
ATOM 4838  C C    . THR A 1 131 ? -9.040  2.210   16.711  1.00 0.00 ? 131 THR A C    2  
ATOM 4839  O O    . THR A 1 131 ? -8.389  2.159   17.756  1.00 0.00 ? 131 THR A O    2  
ATOM 4840  C CB   . THR A 1 131 ? -11.222 3.145   15.848  1.00 0.00 ? 131 THR A CB   2  
ATOM 4841  O OG1  . THR A 1 131 ? -11.847 4.322   15.316  1.00 0.00 ? 131 THR A OG1  2  
ATOM 4842  C CG2  . THR A 1 131 ? -12.072 2.598   16.983  1.00 0.00 ? 131 THR A CG2  2  
ATOM 4843  H H    . THR A 1 131 ? -8.812  3.855   14.486  1.00 0.00 ? 131 THR A H    2  
ATOM 4844  H HA   . THR A 1 131 ? -9.886  4.099   17.217  1.00 0.00 ? 131 THR A HA   2  
ATOM 4845  H HB   . THR A 1 131 ? -11.155 2.399   15.071  1.00 0.00 ? 131 THR A HB   2  
ATOM 4846  H HG1  . THR A 1 131 ? -11.447 4.536   14.458  1.00 0.00 ? 131 THR A HG1  2  
ATOM 4847  H HG21 . THR A 1 131 ? -13.039 2.303   16.601  1.00 0.00 ? 131 THR A HG21 2  
ATOM 4848  H HG22 . THR A 1 131 ? -12.201 3.360   17.736  1.00 0.00 ? 131 THR A HG22 2  
ATOM 4849  H HG23 . THR A 1 131 ? -11.581 1.740   17.420  1.00 0.00 ? 131 THR A HG23 2  
ATOM 4850  N N    . ARG A 1 132 ? -9.089  1.198   15.851  1.00 0.00 ? 132 ARG A N    2  
ATOM 4851  C CA   . ARG A 1 132 ? -8.427  -0.070  16.134  1.00 0.00 ? 132 ARG A CA   2  
ATOM 4852  C C    . ARG A 1 132 ? -6.914  0.029   15.958  1.00 0.00 ? 132 ARG A C    2  
ATOM 4853  O O    . ARG A 1 132 ? -6.165  -0.753  16.545  1.00 0.00 ? 132 ARG A O    2  
ATOM 4854  C CB   . ARG A 1 132 ? -8.993  -1.184  15.250  1.00 0.00 ? 132 ARG A CB   2  
ATOM 4855  C CG   . ARG A 1 132 ? -8.623  -2.577  15.731  1.00 0.00 ? 132 ARG A CG   2  
ATOM 4856  C CD   . ARG A 1 132 ? -9.438  -3.654  15.036  1.00 0.00 ? 132 ARG A CD   2  
ATOM 4857  N NE   . ARG A 1 132 ? -9.088  -4.990  15.513  1.00 0.00 ? 132 ARG A NE   2  
ATOM 4858  C CZ   . ARG A 1 132 ? -9.973  -5.949  15.776  1.00 0.00 ? 132 ARG A CZ   2  
ATOM 4859  N NH1  . ARG A 1 132 ? -11.271 -5.735  15.595  1.00 0.00 ? 132 ARG A NH1  2  
ATOM 4860  N NH2  . ARG A 1 132 ? -9.555  -7.130  16.217  1.00 0.00 ? 132 ARG A NH2  2  
ATOM 4861  H H    . ARG A 1 132 ? -9.578  1.304   15.004  1.00 0.00 ? 132 ARG A H    2  
ATOM 4862  H HA   . ARG A 1 132 ? -8.631  -0.316  17.165  1.00 0.00 ? 132 ARG A HA   2  
ATOM 4863  H HB2  . ARG A 1 132 ? -10.072 -1.107  15.235  1.00 0.00 ? 132 ARG A HB2  2  
ATOM 4864  H HB3  . ARG A 1 132 ? -8.616  -1.061  14.247  1.00 0.00 ? 132 ARG A HB3  2  
ATOM 4865  H HG2  . ARG A 1 132 ? -7.576  -2.747  15.530  1.00 0.00 ? 132 ARG A HG2  2  
ATOM 4866  H HG3  . ARG A 1 132 ? -8.800  -2.635  16.796  1.00 0.00 ? 132 ARG A HG3  2  
ATOM 4867  H HD2  . ARG A 1 132 ? -10.486 -3.478  15.226  1.00 0.00 ? 132 ARG A HD2  2  
ATOM 4868  H HD3  . ARG A 1 132 ? -9.250  -3.601  13.974  1.00 0.00 ? 132 ARG A HD3  2  
ATOM 4869  H HE   . ARG A 1 132 ? -8.124  -5.182  15.649  1.00 0.00 ? 132 ARG A HE   2  
ATOM 4870  H HH11 . ARG A 1 132 ? -11.596 -4.842  15.256  1.00 0.00 ? 132 ARG A HH11 2  
ATOM 4871  H HH12 . ARG A 1 132 ? -11.933 -6.461  15.790  1.00 0.00 ? 132 ARG A HH12 2  
ATOM 4872  H HH21 . ARG A 1 132 ? -8.574  -7.301  16.352  1.00 0.00 ? 132 ARG A HH21 2  
ATOM 4873  H HH22 . ARG A 1 132 ? -10.219 -7.865  16.415  1.00 0.00 ? 132 ARG A HH22 2  
ATOM 4874  N N    . LEU A 1 133 ? -6.462  0.988   15.161  1.00 0.00 ? 133 LEU A N    2  
ATOM 4875  C CA   . LEU A 1 133 ? -5.031  1.163   14.926  1.00 0.00 ? 133 LEU A CA   2  
ATOM 4876  C C    . LEU A 1 133 ? -4.511  2.437   15.587  1.00 0.00 ? 133 LEU A C    2  
ATOM 4877  O O    . LEU A 1 133 ? -3.394  2.875   15.307  1.00 0.00 ? 133 LEU A O    2  
ATOM 4878  C CB   . LEU A 1 133 ? -4.737  1.208   13.421  1.00 0.00 ? 133 LEU A CB   2  
ATOM 4879  C CG   . LEU A 1 133 ? -5.031  -0.082  12.654  1.00 0.00 ? 133 LEU A CG   2  
ATOM 4880  C CD1  . LEU A 1 133 ? -4.678  0.090   11.187  1.00 0.00 ? 133 LEU A CD1  2  
ATOM 4881  C CD2  . LEU A 1 133 ? -4.262  -1.252  13.254  1.00 0.00 ? 133 LEU A CD2  2  
ATOM 4882  H H    . LEU A 1 133 ? -7.100  1.584   14.712  1.00 0.00 ? 133 LEU A H    2  
ATOM 4883  H HA   . LEU A 1 133 ? -4.520  0.316   15.358  1.00 0.00 ? 133 LEU A HA   2  
ATOM 4884  H HB2  . LEU A 1 133 ? -5.326  2.002   12.986  1.00 0.00 ? 133 LEU A HB2  2  
ATOM 4885  H HB3  . LEU A 1 133 ? -3.693  1.445   13.287  1.00 0.00 ? 133 LEU A HB3  2  
ATOM 4886  H HG   . LEU A 1 133 ? -6.087  -0.302  12.717  1.00 0.00 ? 133 LEU A HG   2  
ATOM 4887  H HD11 . LEU A 1 133 ? -5.344  0.813   10.738  1.00 0.00 ? 133 LEU A HD11 2  
ATOM 4888  H HD12 . LEU A 1 133 ? -4.778  -0.856  10.677  1.00 0.00 ? 133 LEU A HD12 2  
ATOM 4889  H HD13 . LEU A 1 133 ? -3.660  0.438   11.102  1.00 0.00 ? 133 LEU A HD13 2  
ATOM 4890  H HD21 . LEU A 1 133 ? -4.500  -2.155  12.711  1.00 0.00 ? 133 LEU A HD21 2  
ATOM 4891  H HD22 . LEU A 1 133 ? -4.541  -1.373  14.291  1.00 0.00 ? 133 LEU A HD22 2  
ATOM 4892  H HD23 . LEU A 1 133 ? -3.203  -1.058  13.186  1.00 0.00 ? 133 LEU A HD23 2  
ATOM 4893  N N    . ALA A 1 134 ? -5.307  3.008   16.482  1.00 0.00 ? 134 ALA A N    2  
ATOM 4894  C CA   . ALA A 1 134 ? -4.938  4.245   17.168  1.00 0.00 ? 134 ALA A CA   2  
ATOM 4895  C C    . ALA A 1 134 ? -3.616  4.106   17.918  1.00 0.00 ? 134 ALA A C    2  
ATOM 4896  O O    . ALA A 1 134 ? -2.764  4.996   17.863  1.00 0.00 ? 134 ALA A O    2  
ATOM 4897  C CB   . ALA A 1 134 ? -6.043  4.666   18.120  1.00 0.00 ? 134 ALA A CB   2  
ATOM 4898  H H    . ALA A 1 134 ? -6.162  2.581   16.698  1.00 0.00 ? 134 ALA A H    2  
ATOM 4899  H HA   . ALA A 1 134 ? -4.832  5.018   16.419  1.00 0.00 ? 134 ALA A HA   2  
ATOM 4900  H HB1  . ALA A 1 134 ? -6.615  3.797   18.411  1.00 0.00 ? 134 ALA A HB1  2  
ATOM 4901  H HB2  . ALA A 1 134 ? -6.692  5.375   17.628  1.00 0.00 ? 134 ALA A HB2  2  
ATOM 4902  H HB3  . ALA A 1 134 ? -5.610  5.122   18.997  1.00 0.00 ? 134 ALA A HB3  2  
ATOM 4903  N N    . ASP A 1 135 ? -3.448  2.993   18.619  1.00 0.00 ? 135 ASP A N    2  
ATOM 4904  C CA   . ASP A 1 135 ? -2.223  2.750   19.374  1.00 0.00 ? 135 ASP A CA   2  
ATOM 4905  C C    . ASP A 1 135 ? -1.093  2.321   18.446  1.00 0.00 ? 135 ASP A C    2  
ATOM 4906  O O    . ASP A 1 135 ? 0.052   2.739   18.612  1.00 0.00 ? 135 ASP A O    2  
ATOM 4907  C CB   . ASP A 1 135 ? -2.449  1.679   20.439  1.00 0.00 ? 135 ASP A CB   2  
ATOM 4908  C CG   . ASP A 1 135 ? -1.175  1.315   21.177  1.00 0.00 ? 135 ASP A CG   2  
ATOM 4909  O OD1  . ASP A 1 135 ? -0.699  2.136   21.985  1.00 0.00 ? 135 ASP A OD1  2  
ATOM 4910  O OD2  . ASP A 1 135 ? -0.642  0.208   20.953  1.00 0.00 ? 135 ASP A OD2  2  
ATOM 4911  H H    . ASP A 1 135 ? -4.168  2.320   18.636  1.00 0.00 ? 135 ASP A H    2  
ATOM 4912  H HA   . ASP A 1 135 ? -1.943  3.674   19.858  1.00 0.00 ? 135 ASP A HA   2  
ATOM 4913  H HB2  . ASP A 1 135 ? -3.169  2.041   21.157  1.00 0.00 ? 135 ASP A HB2  2  
ATOM 4914  H HB3  . ASP A 1 135 ? -2.836  0.788   19.967  1.00 0.00 ? 135 ASP A HB3  2  
ATOM 4915  N N    . TRP A 1 136 ? -1.429  1.498   17.460  1.00 0.00 ? 136 TRP A N    2  
ATOM 4916  C CA   . TRP A 1 136 ? -0.451  0.995   16.504  1.00 0.00 ? 136 TRP A CA   2  
ATOM 4917  C C    . TRP A 1 136 ? 0.202   2.134   15.730  1.00 0.00 ? 136 TRP A C    2  
ATOM 4918  O O    . TRP A 1 136 ? 1.428   2.223   15.661  1.00 0.00 ? 136 TRP A O    2  
ATOM 4919  C CB   . TRP A 1 136 ? -1.113  0.013   15.539  1.00 0.00 ? 136 TRP A CB   2  
ATOM 4920  C CG   . TRP A 1 136 ? -1.673  -1.197  16.223  1.00 0.00 ? 136 TRP A CG   2  
ATOM 4921  C CD1  . TRP A 1 136 ? -2.985  -1.451  16.495  1.00 0.00 ? 136 TRP A CD1  2  
ATOM 4922  C CD2  . TRP A 1 136 ? -0.934  -2.315  16.728  1.00 0.00 ? 136 TRP A CD2  2  
ATOM 4923  N NE1  . TRP A 1 136 ? -3.108  -2.660  17.131  1.00 0.00 ? 136 TRP A NE1  2  
ATOM 4924  C CE2  . TRP A 1 136 ? -1.865  -3.209  17.287  1.00 0.00 ? 136 TRP A CE2  2  
ATOM 4925  C CE3  . TRP A 1 136 ? 0.423   -2.647  16.759  1.00 0.00 ? 136 TRP A CE3  2  
ATOM 4926  C CZ2  . TRP A 1 136 ? -1.482  -4.413  17.870  1.00 0.00 ? 136 TRP A CZ2  2  
ATOM 4927  C CZ3  . TRP A 1 136 ? 0.801   -3.843  17.339  1.00 0.00 ? 136 TRP A CZ3  2  
ATOM 4928  C CH2  . TRP A 1 136 ? -0.148  -4.713  17.889  1.00 0.00 ? 136 TRP A CH2  2  
ATOM 4929  H H    . TRP A 1 136 ? -2.363  1.220   17.374  1.00 0.00 ? 136 TRP A H    2  
ATOM 4930  H HA   . TRP A 1 136 ? 0.314   0.473   17.061  1.00 0.00 ? 136 TRP A HA   2  
ATOM 4931  H HB2  . TRP A 1 136 ? -1.920  0.511   15.024  1.00 0.00 ? 136 TRP A HB2  2  
ATOM 4932  H HB3  . TRP A 1 136 ? -0.383  -0.320  14.814  1.00 0.00 ? 136 TRP A HB3  2  
ATOM 4933  H HD1  . TRP A 1 136 ? -3.798  -0.790  16.236  1.00 0.00 ? 136 TRP A HD1  2  
ATOM 4934  H HE1  . TRP A 1 136 ? -3.958  -3.069  17.426  1.00 0.00 ? 136 TRP A HE1  2  
ATOM 4935  H HE3  . TRP A 1 136 ? 1.171   -1.988  16.340  1.00 0.00 ? 136 TRP A HE3  2  
ATOM 4936  H HZ2  . TRP A 1 136 ? -2.202  -5.095  18.300  1.00 0.00 ? 136 TRP A HZ2  2  
ATOM 4937  H HZ3  . TRP A 1 136 ? 1.845   -4.116  17.377  1.00 0.00 ? 136 TRP A HZ3  2  
ATOM 4938  H HH2  . TRP A 1 136 ? 0.193   -5.634  18.335  1.00 0.00 ? 136 TRP A HH2  2  
ATOM 4939  N N    . ILE A 1 137 ? -0.618  3.019   15.171  1.00 0.00 ? 137 ILE A N    2  
ATOM 4940  C CA   . ILE A 1 137 ? -0.111  4.154   14.412  1.00 0.00 ? 137 ILE A CA   2  
ATOM 4941  C C    . ILE A 1 137 ? 0.737   5.054   15.307  1.00 0.00 ? 137 ILE A C    2  
ATOM 4942  O O    . ILE A 1 137 ? 1.764   5.580   14.882  1.00 0.00 ? 137 ILE A O    2  
ATOM 4943  C CB   . ILE A 1 137 ? -1.262  4.971   13.776  1.00 0.00 ? 137 ILE A CB   2  
ATOM 4944  C CG1  . ILE A 1 137 ? -2.009  4.116   12.745  1.00 0.00 ? 137 ILE A CG1  2  
ATOM 4945  C CG2  . ILE A 1 137 ? -0.735  6.247   13.126  1.00 0.00 ? 137 ILE A CG2  2  
ATOM 4946  C CD1  . ILE A 1 137 ? -1.128  3.576   11.637  1.00 0.00 ? 137 ILE A CD1  2  
ATOM 4947  H H    . ILE A 1 137 ? -1.591  2.906   15.272  1.00 0.00 ? 137 ILE A H    2  
ATOM 4948  H HA   . ILE A 1 137 ? 0.511   3.768   13.616  1.00 0.00 ? 137 ILE A HA   2  
ATOM 4949  H HB   . ILE A 1 137 ? -1.947  5.253   14.559  1.00 0.00 ? 137 ILE A HB   2  
ATOM 4950  H HG12 . ILE A 1 137 ? -2.459  3.273   13.248  1.00 0.00 ? 137 ILE A HG12 2  
ATOM 4951  H HG13 . ILE A 1 137 ? -2.787  4.712   12.291  1.00 0.00 ? 137 ILE A HG13 2  
ATOM 4952  H HG21 . ILE A 1 137 ? 0.025   5.996   12.402  1.00 0.00 ? 137 ILE A HG21 2  
ATOM 4953  H HG22 . ILE A 1 137 ? -0.311  6.888   13.885  1.00 0.00 ? 137 ILE A HG22 2  
ATOM 4954  H HG23 . ILE A 1 137 ? -1.546  6.762   12.635  1.00 0.00 ? 137 ILE A HG23 2  
ATOM 4955  H HD11 . ILE A 1 137 ? -0.368  2.936   12.061  1.00 0.00 ? 137 ILE A HD11 2  
ATOM 4956  H HD12 . ILE A 1 137 ? -0.657  4.399   11.119  1.00 0.00 ? 137 ILE A HD12 2  
ATOM 4957  H HD13 . ILE A 1 137 ? -1.730  3.010   10.942  1.00 0.00 ? 137 ILE A HD13 2  
ATOM 4958  N N    . HIS A 1 138 ? 0.318   5.200   16.558  1.00 0.00 ? 138 HIS A N    2  
ATOM 4959  C CA   . HIS A 1 138 ? 1.044   6.026   17.514  1.00 0.00 ? 138 HIS A CA   2  
ATOM 4960  C C    . HIS A 1 138 ? 2.399   5.400   17.852  1.00 0.00 ? 138 HIS A C    2  
ATOM 4961  O O    . HIS A 1 138 ? 3.386   6.108   18.035  1.00 0.00 ? 138 HIS A O    2  
ATOM 4962  C CB   . HIS A 1 138 ? 0.212   6.222   18.785  1.00 0.00 ? 138 HIS A CB   2  
ATOM 4963  C CG   . HIS A 1 138 ? 0.797   7.209   19.749  1.00 0.00 ? 138 HIS A CG   2  
ATOM 4964  N ND1  . HIS A 1 138 ? 0.811   7.006   21.108  1.00 0.00 ? 138 HIS A ND1  2  
ATOM 4965  C CD2  . HIS A 1 138 ? 1.385   8.413   19.542  1.00 0.00 ? 138 HIS A CD2  2  
ATOM 4966  C CE1  . HIS A 1 138 ? 1.381   8.036   21.700  1.00 0.00 ? 138 HIS A CE1  2  
ATOM 4967  N NE2  . HIS A 1 138 ? 1.741   8.904   20.774  1.00 0.00 ? 138 HIS A NE2  2  
ATOM 4968  H H    . HIS A 1 138 ? -0.503  4.744   16.844  1.00 0.00 ? 138 HIS A H    2  
ATOM 4969  H HA   . HIS A 1 138 ? 1.213   6.990   17.054  1.00 0.00 ? 138 HIS A HA   2  
ATOM 4970  H HB2  . HIS A 1 138 ? -0.772  6.572   18.513  1.00 0.00 ? 138 HIS A HB2  2  
ATOM 4971  H HB3  . HIS A 1 138 ? 0.120   5.275   19.298  1.00 0.00 ? 138 HIS A HB3  2  
ATOM 4972  H HD1  . HIS A 1 138 ? 0.445   6.213   21.576  1.00 0.00 ? 138 HIS A HD1  2  
ATOM 4973  H HD2  . HIS A 1 138 ? 1.549   8.891   18.587  1.00 0.00 ? 138 HIS A HD2  2  
ATOM 4974  H HE1  . HIS A 1 138 ? 1.532   8.149   22.764  1.00 0.00 ? 138 HIS A HE1  2  
ATOM 4975  H HE2  . HIS A 1 138 ? 2.328   9.688   20.929  1.00 0.00 ? 138 HIS A HE2  2  
ATOM 4976  N N    . SER A 1 139 ? 2.442   4.077   17.918  1.00 0.00 ? 139 SER A N    2  
ATOM 4977  C CA   . SER A 1 139 ? 3.675   3.365   18.232  1.00 0.00 ? 139 SER A CA   2  
ATOM 4978  C C    . SER A 1 139 ? 4.655   3.437   17.059  1.00 0.00 ? 139 SER A C    2  
ATOM 4979  O O    . SER A 1 139 ? 5.857   3.624   17.248  1.00 0.00 ? 139 SER A O    2  
ATOM 4980  C CB   . SER A 1 139 ? 3.368   1.907   18.580  1.00 0.00 ? 139 SER A CB   2  
ATOM 4981  O OG   . SER A 1 139 ? 2.385   1.822   19.606  1.00 0.00 ? 139 SER A OG   2  
ATOM 4982  H H    . SER A 1 139 ? 1.622   3.564   17.754  1.00 0.00 ? 139 SER A H    2  
ATOM 4983  H HA   . SER A 1 139 ? 4.124   3.845   19.090  1.00 0.00 ? 139 SER A HA   2  
ATOM 4984  H HB2  . SER A 1 139 ? 3.000   1.399   17.702  1.00 0.00 ? 139 SER A HB2  2  
ATOM 4985  H HB3  . SER A 1 139 ? 4.271   1.423   18.925  1.00 0.00 ? 139 SER A HB3  2  
ATOM 4986  H HG   . SER A 1 139 ? 1.549   2.188   19.279  1.00 0.00 ? 139 SER A HG   2  
ATOM 4987  N N    . SER A 1 140 ? 4.128   3.303   15.849  1.00 0.00 ? 140 SER A N    2  
ATOM 4988  C CA   . SER A 1 140 ? 4.943   3.362   14.642  1.00 0.00 ? 140 SER A CA   2  
ATOM 4989  C C    . SER A 1 140 ? 5.282   4.804   14.277  1.00 0.00 ? 140 SER A C    2  
ATOM 4990  O O    . SER A 1 140 ? 6.064   5.054   13.353  1.00 0.00 ? 140 SER A O    2  
ATOM 4991  C CB   . SER A 1 140 ? 4.200   2.690   13.487  1.00 0.00 ? 140 SER A CB   2  
ATOM 4992  O OG   . SER A 1 140 ? 3.987   1.317   13.756  1.00 0.00 ? 140 SER A OG   2  
ATOM 4993  H H    . SER A 1 140 ? 3.163   3.142   15.762  1.00 0.00 ? 140 SER A H    2  
ATOM 4994  H HA   . SER A 1 140 ? 5.860   2.823   14.831  1.00 0.00 ? 140 SER A HA   2  
ATOM 4995  H HB2  . SER A 1 140 ? 3.242   3.169   13.348  1.00 0.00 ? 140 SER A HB2  2  
ATOM 4996  H HB3  . SER A 1 140 ? 4.784   2.780   12.584  1.00 0.00 ? 140 SER A HB3  2  
ATOM 4997  H HG   . SER A 1 140 ? 4.838   0.848   13.690  1.00 0.00 ? 140 SER A HG   2  
ATOM 4998  N N    . GLY A 1 141 ? 4.696   5.746   15.011  1.00 0.00 ? 141 GLY A N    2  
ATOM 4999  C CA   . GLY A 1 141 ? 4.933   7.150   14.747  1.00 0.00 ? 141 GLY A CA   2  
ATOM 5000  C C    . GLY A 1 141 ? 4.413   7.550   13.386  1.00 0.00 ? 141 GLY A C    2  
ATOM 5001  O O    . GLY A 1 141 ? 5.060   8.305   12.657  1.00 0.00 ? 141 GLY A O    2  
ATOM 5002  H H    . GLY A 1 141 ? 4.097   5.482   15.742  1.00 0.00 ? 141 GLY A H    2  
ATOM 5003  H HA2  . GLY A 1 141 ? 4.437   7.739   15.503  1.00 0.00 ? 141 GLY A HA2  2  
ATOM 5004  H HA3  . GLY A 1 141 ? 5.994   7.343   14.787  1.00 0.00 ? 141 GLY A HA3  2  
ATOM 5005  N N    . GLY A 1 142 ? 3.241   7.030   13.043  1.00 0.00 ? 142 GLY A N    2  
ATOM 5006  C CA   . GLY A 1 142 ? 2.650   7.317   11.758  1.00 0.00 ? 142 GLY A CA   2  
ATOM 5007  C C    . GLY A 1 142 ? 3.324   6.533   10.656  1.00 0.00 ? 142 GLY A C    2  
ATOM 5008  O O    . GLY A 1 142 ? 3.217   5.308   10.598  1.00 0.00 ? 142 GLY A O    2  
ATOM 5009  H H    . GLY A 1 142 ? 2.772   6.440   13.675  1.00 0.00 ? 142 GLY A H    2  
ATOM 5010  H HA2  . GLY A 1 142 ? 1.602   7.059   11.785  1.00 0.00 ? 142 GLY A HA2  2  
ATOM 5011  H HA3  . GLY A 1 142 ? 2.752   8.371   11.551  1.00 0.00 ? 142 GLY A HA3  2  
ATOM 5012  N N    . TRP A 1 143 ? 4.037   7.236   9.797   1.00 0.00 ? 143 TRP A N    2  
ATOM 5013  C CA   . TRP A 1 143 ? 4.741   6.604   8.694   1.00 0.00 ? 143 TRP A CA   2  
ATOM 5014  C C    . TRP A 1 143 ? 6.243   6.654   8.945   1.00 0.00 ? 143 TRP A C    2  
ATOM 5015  O O    . TRP A 1 143 ? 7.046   6.412   8.042   1.00 0.00 ? 143 TRP A O    2  
ATOM 5016  C CB   . TRP A 1 143 ? 4.398   7.308   7.378   1.00 0.00 ? 143 TRP A CB   2  
ATOM 5017  C CG   . TRP A 1 143 ? 2.925   7.353   7.094   1.00 0.00 ? 143 TRP A CG   2  
ATOM 5018  C CD1  . TRP A 1 143 ? 2.040   8.321   7.482   1.00 0.00 ? 143 TRP A CD1  2  
ATOM 5019  C CD2  . TRP A 1 143 ? 2.162   6.384   6.366   1.00 0.00 ? 143 TRP A CD2  2  
ATOM 5020  N NE1  . TRP A 1 143 ? 0.777   8.011   7.040   1.00 0.00 ? 143 TRP A NE1  2  
ATOM 5021  C CE2  . TRP A 1 143 ? 0.825   6.827   6.352   1.00 0.00 ? 143 TRP A CE2  2  
ATOM 5022  C CE3  . TRP A 1 143 ? 2.480   5.184   5.724   1.00 0.00 ? 143 TRP A CE3  2  
ATOM 5023  C CZ2  . TRP A 1 143 ? -0.188  6.111   5.720   1.00 0.00 ? 143 TRP A CZ2  2  
ATOM 5024  C CZ3  . TRP A 1 143 ? 1.472   4.475   5.096   1.00 0.00 ? 143 TRP A CZ3  2  
ATOM 5025  C CH2  . TRP A 1 143 ? 0.153   4.940   5.100   1.00 0.00 ? 143 TRP A CH2  2  
ATOM 5026  H H    . TRP A 1 143 ? 4.088   8.215   9.903   1.00 0.00 ? 143 TRP A H    2  
ATOM 5027  H HA   . TRP A 1 143 ? 4.424   5.573   8.640   1.00 0.00 ? 143 TRP A HA   2  
ATOM 5028  H HB2  . TRP A 1 143 ? 4.764   8.324   7.415   1.00 0.00 ? 143 TRP A HB2  2  
ATOM 5029  H HB3  . TRP A 1 143 ? 4.881   6.786   6.565   1.00 0.00 ? 143 TRP A HB3  2  
ATOM 5030  H HD1  . TRP A 1 143 ? 2.307   9.196   8.055   1.00 0.00 ? 143 TRP A HD1  2  
ATOM 5031  H HE1  . TRP A 1 143 ? -0.034  8.552   7.192   1.00 0.00 ? 143 TRP A HE1  2  
ATOM 5032  H HE3  . TRP A 1 143 ? 3.493   4.807   5.710   1.00 0.00 ? 143 TRP A HE3  2  
ATOM 5033  H HZ2  . TRP A 1 143 ? -1.210  6.456   5.714   1.00 0.00 ? 143 TRP A HZ2  2  
ATOM 5034  H HZ3  . TRP A 1 143 ? 1.700   3.544   4.596   1.00 0.00 ? 143 TRP A HZ3  2  
ATOM 5035  H HH2  . TRP A 1 143 ? -0.604  4.355   4.600   1.00 0.00 ? 143 TRP A HH2  2  
ATOM 5036  N N    . ALA A 1 144 ? 6.606   6.951   10.192  1.00 0.00 ? 144 ALA A N    2  
ATOM 5037  C CA   . ALA A 1 144 ? 8.001   7.061   10.598  1.00 0.00 ? 144 ALA A CA   2  
ATOM 5038  C C    . ALA A 1 144 ? 8.783   5.778   10.337  1.00 0.00 ? 144 ALA A C    2  
ATOM 5039  O O    . ALA A 1 144 ? 9.730   5.773   9.550   1.00 0.00 ? 144 ALA A O    2  
ATOM 5040  C CB   . ALA A 1 144 ? 8.093   7.447   12.065  1.00 0.00 ? 144 ALA A CB   2  
ATOM 5041  H H    . ALA A 1 144 ? 5.904   7.105   10.862  1.00 0.00 ? 144 ALA A H    2  
ATOM 5042  H HA   . ALA A 1 144 ? 8.447   7.857   10.020  1.00 0.00 ? 144 ALA A HA   2  
ATOM 5043  H HB1  . ALA A 1 144 ? 9.124   7.644   12.323  1.00 0.00 ? 144 ALA A HB1  2  
ATOM 5044  H HB2  . ALA A 1 144 ? 7.720   6.636   12.673  1.00 0.00 ? 144 ALA A HB2  2  
ATOM 5045  H HB3  . ALA A 1 144 ? 7.501   8.332   12.241  1.00 0.00 ? 144 ALA A HB3  2  
ATOM 5046  N N    . GLU A 1 145 ? 8.389   4.685   10.985  1.00 0.00 ? 145 GLU A N    2  
ATOM 5047  C CA   . GLU A 1 145 ? 9.088   3.418   10.801  1.00 0.00 ? 145 GLU A CA   2  
ATOM 5048  C C    . GLU A 1 145 ? 8.815   2.847   9.411   1.00 0.00 ? 145 GLU A C    2  
ATOM 5049  O O    . GLU A 1 145 ? 9.589   2.038   8.900   1.00 0.00 ? 145 GLU A O    2  
ATOM 5050  C CB   . GLU A 1 145 ? 8.707   2.409   11.893  1.00 0.00 ? 145 GLU A CB   2  
ATOM 5051  C CG   . GLU A 1 145 ? 7.362   1.728   11.694  1.00 0.00 ? 145 GLU A CG   2  
ATOM 5052  C CD   . GLU A 1 145 ? 7.243   0.450   12.502  1.00 0.00 ? 145 GLU A CD   2  
ATOM 5053  O OE1  . GLU A 1 145 ? 8.012   -0.495  12.239  1.00 0.00 ? 145 GLU A OE1  2  
ATOM 5054  O OE2  . GLU A 1 145 ? 6.389   0.389   13.411  1.00 0.00 ? 145 GLU A OE2  2  
ATOM 5055  H H    . GLU A 1 145 ? 7.623   4.733   11.598  1.00 0.00 ? 145 GLU A H    2  
ATOM 5056  H HA   . GLU A 1 145 ? 10.146  3.625   10.877  1.00 0.00 ? 145 GLU A HA   2  
ATOM 5057  H HB2  . GLU A 1 145 ? 9.464   1.641   11.929  1.00 0.00 ? 145 GLU A HB2  2  
ATOM 5058  H HB3  . GLU A 1 145 ? 8.687   2.922   12.843  1.00 0.00 ? 145 GLU A HB3  2  
ATOM 5059  H HG2  . GLU A 1 145 ? 6.578   2.405   12.001  1.00 0.00 ? 145 GLU A HG2  2  
ATOM 5060  H HG3  . GLU A 1 145 ? 7.243   1.489   10.649  1.00 0.00 ? 145 GLU A HG3  2  
ATOM 5061  N N    . PHE A 1 146 ? 7.735   3.309   8.793   1.00 0.00 ? 146 PHE A N    2  
ATOM 5062  C CA   . PHE A 1 146 ? 7.349   2.855   7.463   1.00 0.00 ? 146 PHE A CA   2  
ATOM 5063  C C    . PHE A 1 146 ? 8.441   3.170   6.444   1.00 0.00 ? 146 PHE A C    2  
ATOM 5064  O O    . PHE A 1 146 ? 8.730   2.360   5.563   1.00 0.00 ? 146 PHE A O    2  
ATOM 5065  C CB   . PHE A 1 146 ? 6.030   3.512   7.045   1.00 0.00 ? 146 PHE A CB   2  
ATOM 5066  C CG   . PHE A 1 146 ? 5.509   3.049   5.714   1.00 0.00 ? 146 PHE A CG   2  
ATOM 5067  C CD1  . PHE A 1 146 ? 5.014   1.765   5.559   1.00 0.00 ? 146 PHE A CD1  2  
ATOM 5068  C CD2  . PHE A 1 146 ? 5.511   3.901   4.622   1.00 0.00 ? 146 PHE A CD2  2  
ATOM 5069  C CE1  . PHE A 1 146 ? 4.530   1.338   4.337   1.00 0.00 ? 146 PHE A CE1  2  
ATOM 5070  C CE2  . PHE A 1 146 ? 5.028   3.479   3.399   1.00 0.00 ? 146 PHE A CE2  2  
ATOM 5071  C CZ   . PHE A 1 146 ? 4.537   2.196   3.256   1.00 0.00 ? 146 PHE A CZ   2  
ATOM 5072  H H    . PHE A 1 146 ? 7.179   3.976   9.247   1.00 0.00 ? 146 PHE A H    2  
ATOM 5073  H HA   . PHE A 1 146 ? 7.210   1.786   7.505   1.00 0.00 ? 146 PHE A HA   2  
ATOM 5074  H HB2  . PHE A 1 146 ? 5.279   3.290   7.787   1.00 0.00 ? 146 PHE A HB2  2  
ATOM 5075  H HB3  . PHE A 1 146 ? 6.170   4.582   6.993   1.00 0.00 ? 146 PHE A HB3  2  
ATOM 5076  H HD1  . PHE A 1 146 ? 5.009   1.093   6.403   1.00 0.00 ? 146 PHE A HD1  2  
ATOM 5077  H HD2  . PHE A 1 146 ? 5.896   4.903   4.732   1.00 0.00 ? 146 PHE A HD2  2  
ATOM 5078  H HE1  . PHE A 1 146 ? 4.147   0.334   4.227   1.00 0.00 ? 146 PHE A HE1  2  
ATOM 5079  H HE2  . PHE A 1 146 ? 5.035   4.153   2.556   1.00 0.00 ? 146 PHE A HE2  2  
ATOM 5080  H HZ   . PHE A 1 146 ? 4.160   1.865   2.301   1.00 0.00 ? 146 PHE A HZ   2  
ATOM 5081  N N    . THR A 1 147 ? 9.069   4.331   6.589   1.00 0.00 ? 147 THR A N    2  
ATOM 5082  C CA   . THR A 1 147 ? 10.127  4.749   5.676   1.00 0.00 ? 147 THR A CA   2  
ATOM 5083  C C    . THR A 1 147 ? 11.321  3.790   5.724   1.00 0.00 ? 147 THR A C    2  
ATOM 5084  O O    . THR A 1 147 ? 12.050  3.641   4.741   1.00 0.00 ? 147 THR A O    2  
ATOM 5085  C CB   . THR A 1 147 ? 10.614  6.170   6.009   1.00 0.00 ? 147 THR A CB   2  
ATOM 5086  O OG1  . THR A 1 147 ? 9.552   6.921   6.619   1.00 0.00 ? 147 THR A OG1  2  
ATOM 5087  C CG2  . THR A 1 147 ? 11.098  6.888   4.758   1.00 0.00 ? 147 THR A CG2  2  
ATOM 5088  H H    . THR A 1 147 ? 8.818   4.923   7.332   1.00 0.00 ? 147 THR A H    2  
ATOM 5089  H HA   . THR A 1 147 ? 9.720   4.755   4.674   1.00 0.00 ? 147 THR A HA   2  
ATOM 5090  H HB   . THR A 1 147 ? 11.436  6.095   6.705   1.00 0.00 ? 147 THR A HB   2  
ATOM 5091  H HG1  . THR A 1 147 ? 8.704   6.596   6.299   1.00 0.00 ? 147 THR A HG1  2  
ATOM 5092  H HG21 . THR A 1 147 ? 11.889  6.317   4.295   1.00 0.00 ? 147 THR A HG21 2  
ATOM 5093  H HG22 . THR A 1 147 ? 11.470  7.866   5.026   1.00 0.00 ? 147 THR A HG22 2  
ATOM 5094  H HG23 . THR A 1 147 ? 10.278  6.993   4.064   1.00 0.00 ? 147 THR A HG23 2  
ATOM 5095  N N    . ALA A 1 148 ? 11.509  3.134   6.863   1.00 0.00 ? 148 ALA A N    2  
ATOM 5096  C CA   . ALA A 1 148 ? 12.617  2.203   7.034   1.00 0.00 ? 148 ALA A CA   2  
ATOM 5097  C C    . ALA A 1 148 ? 12.240  0.789   6.599   1.00 0.00 ? 148 ALA A C    2  
ATOM 5098  O O    . ALA A 1 148 ? 13.111  -0.062  6.410   1.00 0.00 ? 148 ALA A O    2  
ATOM 5099  C CB   . ALA A 1 148 ? 13.081  2.202   8.483   1.00 0.00 ? 148 ALA A CB   2  
ATOM 5100  H H    . ALA A 1 148 ? 10.885  3.278   7.607   1.00 0.00 ? 148 ALA A H    2  
ATOM 5101  H HA   . ALA A 1 148 ? 13.437  2.547   6.423   1.00 0.00 ? 148 ALA A HA   2  
ATOM 5102  H HB1  . ALA A 1 148 ? 13.428  3.189   8.750   1.00 0.00 ? 148 ALA A HB1  2  
ATOM 5103  H HB2  . ALA A 1 148 ? 13.887  1.492   8.602   1.00 0.00 ? 148 ALA A HB2  2  
ATOM 5104  H HB3  . ALA A 1 148 ? 12.259  1.922   9.125   1.00 0.00 ? 148 ALA A HB3  2  
ATOM 5105  N N    . LEU A 1 149 ? 10.946  0.547   6.416   1.00 0.00 ? 149 LEU A N    2  
ATOM 5106  C CA   . LEU A 1 149 ? 10.463  -0.771  6.011   1.00 0.00 ? 149 LEU A CA   2  
ATOM 5107  C C    . LEU A 1 149 ? 10.892  -1.093  4.585   1.00 0.00 ? 149 LEU A C    2  
ATOM 5108  O O    . LEU A 1 149 ? 11.188  -2.245  4.266   1.00 0.00 ? 149 LEU A O    2  
ATOM 5109  C CB   . LEU A 1 149 ? 8.937   -0.848  6.133   1.00 0.00 ? 149 LEU A CB   2  
ATOM 5110  C CG   . LEU A 1 149 ? 8.380   -0.529  7.524   1.00 0.00 ? 149 LEU A CG   2  
ATOM 5111  C CD1  . LEU A 1 149 ? 6.876   -0.754  7.561   1.00 0.00 ? 149 LEU A CD1  2  
ATOM 5112  C CD2  . LEU A 1 149 ? 9.074   -1.367  8.585   1.00 0.00 ? 149 LEU A CD2  2  
ATOM 5113  H H    . LEU A 1 149 ? 10.298  1.271   6.552   1.00 0.00 ? 149 LEU A H    2  
ATOM 5114  H HA   . LEU A 1 149 ? 10.903  -1.504  6.675   1.00 0.00 ? 149 LEU A HA   2  
ATOM 5115  H HB2  . LEU A 1 149 ? 8.506   -0.152  5.428   1.00 0.00 ? 149 LEU A HB2  2  
ATOM 5116  H HB3  . LEU A 1 149 ? 8.624   -1.848  5.866   1.00 0.00 ? 149 LEU A HB3  2  
ATOM 5117  H HG   . LEU A 1 149 ? 8.564   0.514   7.747   1.00 0.00 ? 149 LEU A HG   2  
ATOM 5118  H HD11 . LEU A 1 149 ? 6.402   -0.145  6.806   1.00 0.00 ? 149 LEU A HD11 2  
ATOM 5119  H HD12 . LEU A 1 149 ? 6.494   -0.484  8.535   1.00 0.00 ? 149 LEU A HD12 2  
ATOM 5120  H HD13 . LEU A 1 149 ? 6.664   -1.795  7.369   1.00 0.00 ? 149 LEU A HD13 2  
ATOM 5121  H HD21 . LEU A 1 149 ? 8.702   -1.093  9.560   1.00 0.00 ? 149 LEU A HD21 2  
ATOM 5122  H HD22 . LEU A 1 149 ? 10.139  -1.194  8.543   1.00 0.00 ? 149 LEU A HD22 2  
ATOM 5123  H HD23 . LEU A 1 149 ? 8.873   -2.414  8.403   1.00 0.00 ? 149 LEU A HD23 2  
ATOM 5124  N N    . TYR A 1 150 ? 10.928  -0.076  3.737   1.00 0.00 ? 150 TYR A N    2  
ATOM 5125  C CA   . TYR A 1 150 ? 11.338  -0.258  2.351   1.00 0.00 ? 150 TYR A CA   2  
ATOM 5126  C C    . TYR A 1 150 ? 12.691  0.401   2.111   1.00 0.00 ? 150 TYR A C    2  
ATOM 5127  O O    . TYR A 1 150 ? 13.062  0.696   0.975   1.00 0.00 ? 150 TYR A O    2  
ATOM 5128  C CB   . TYR A 1 150 ? 10.284  0.307   1.387   1.00 0.00 ? 150 TYR A CB   2  
ATOM 5129  C CG   . TYR A 1 150 ? 9.912   1.755   1.641   1.00 0.00 ? 150 TYR A CG   2  
ATOM 5130  C CD1  . TYR A 1 150 ? 10.700  2.795   1.157   1.00 0.00 ? 150 TYR A CD1  2  
ATOM 5131  C CD2  . TYR A 1 150 ? 8.768   2.082   2.357   1.00 0.00 ? 150 TYR A CD2  2  
ATOM 5132  C CE1  . TYR A 1 150 ? 10.359  4.115   1.383   1.00 0.00 ? 150 TYR A CE1  2  
ATOM 5133  C CE2  . TYR A 1 150 ? 8.422   3.401   2.585   1.00 0.00 ? 150 TYR A CE2  2  
ATOM 5134  C CZ   . TYR A 1 150 ? 9.221   4.412   2.096   1.00 0.00 ? 150 TYR A CZ   2  
ATOM 5135  O OH   . TYR A 1 150 ? 8.882   5.725   2.323   1.00 0.00 ? 150 TYR A OH   2  
ATOM 5136  H H    . TYR A 1 150 ? 10.667  0.816   4.046   1.00 0.00 ? 150 TYR A H    2  
ATOM 5137  H HA   . TYR A 1 150 ? 11.437  -1.320  2.176   1.00 0.00 ? 150 TYR A HA   2  
ATOM 5138  H HB2  . TYR A 1 150 ? 10.660  0.239   0.376   1.00 0.00 ? 150 TYR A HB2  2  
ATOM 5139  H HB3  . TYR A 1 150 ? 9.383   -0.284  1.466   1.00 0.00 ? 150 TYR A HB3  2  
ATOM 5140  H HD1  . TYR A 1 150 ? 11.592  2.561   0.597   1.00 0.00 ? 150 TYR A HD1  2  
ATOM 5141  H HD2  . TYR A 1 150 ? 8.144   1.289   2.741   1.00 0.00 ? 150 TYR A HD2  2  
ATOM 5142  H HE1  . TYR A 1 150 ? 10.985  4.907   1.001   1.00 0.00 ? 150 TYR A HE1  2  
ATOM 5143  H HE2  . TYR A 1 150 ? 7.528   3.634   3.146   1.00 0.00 ? 150 TYR A HE2  2  
ATOM 5144  H HH   . TYR A 1 150 ? 9.113   6.250   1.553   1.00 0.00 ? 150 TYR A HH   2  
ATOM 5145  N N    . GLY A 1 151 ? 13.428  0.626   3.193   1.00 0.00 ? 151 GLY A N    2  
ATOM 5146  C CA   . GLY A 1 151 ? 14.734  1.252   3.087   1.00 0.00 ? 151 GLY A CA   2  
ATOM 5147  C C    . GLY A 1 151 ? 15.779  0.289   2.562   1.00 0.00 ? 151 GLY A C    2  
ATOM 5148  O O    . GLY A 1 151 ? 16.830  0.698   2.061   1.00 0.00 ? 151 GLY A O    2  
ATOM 5149  H H    . GLY A 1 151 ? 13.085  0.359   4.070   1.00 0.00 ? 151 GLY A H    2  
ATOM 5150  H HA2  . GLY A 1 151 ? 14.665  2.095   2.416   1.00 0.00 ? 151 GLY A HA2  2  
ATOM 5151  H HA3  . GLY A 1 151 ? 15.036  1.598   4.063   1.00 0.00 ? 151 GLY A HA3  2  
ATOM 5152  N N    . ASP A 1 152 ? 15.484  -0.997  2.673   1.00 0.00 ? 152 ASP A N    2  
ATOM 5153  C CA   . ASP A 1 152 ? 16.392  -2.030  2.204   1.00 0.00 ? 152 ASP A CA   2  
ATOM 5154  C C    . ASP A 1 152 ? 15.975  -2.494  0.817   1.00 0.00 ? 152 ASP A C    2  
ATOM 5155  O O    . ASP A 1 152 ? 14.784  -2.607  0.524   1.00 0.00 ? 152 ASP A O    2  
ATOM 5156  C CB   . ASP A 1 152 ? 16.412  -3.209  3.175   1.00 0.00 ? 152 ASP A CB   2  
ATOM 5157  C CG   . ASP A 1 152 ? 17.509  -4.206  2.863   1.00 0.00 ? 152 ASP A CG   2  
ATOM 5158  O OD1  . ASP A 1 152 ? 18.599  -3.785  2.418   1.00 0.00 ? 152 ASP A OD1  2  
ATOM 5159  O OD2  . ASP A 1 152 ? 17.289  -5.415  3.069   1.00 0.00 ? 152 ASP A OD2  2  
ATOM 5160  H H    . ASP A 1 152 ? 14.628  -1.256  3.069   1.00 0.00 ? 152 ASP A H    2  
ATOM 5161  H HA   . ASP A 1 152 ? 17.382  -1.601  2.146   1.00 0.00 ? 152 ASP A HA   2  
ATOM 5162  H HB2  . ASP A 1 152 ? 16.564  -2.838  4.178   1.00 0.00 ? 152 ASP A HB2  2  
ATOM 5163  H HB3  . ASP A 1 152 ? 15.462  -3.721  3.125   1.00 0.00 ? 152 ASP A HB3  2  
ATOM 5164  N N    . GLY A 1 153 ? 16.956  -2.743  -0.037  1.00 0.00 ? 153 GLY A N    2  
ATOM 5165  C CA   . GLY A 1 153 ? 16.675  -3.171  -1.390  1.00 0.00 ? 153 GLY A CA   2  
ATOM 5166  C C    . GLY A 1 153 ? 16.650  -4.676  -1.547  1.00 0.00 ? 153 GLY A C    2  
ATOM 5167  O O    . GLY A 1 153 ? 15.642  -5.237  -1.970  1.00 0.00 ? 153 GLY A O    2  
ATOM 5168  H H    . GLY A 1 153 ? 17.886  -2.635  0.257   1.00 0.00 ? 153 GLY A H    2  
ATOM 5169  H HA2  . GLY A 1 153 ? 15.713  -2.776  -1.686  1.00 0.00 ? 153 GLY A HA2  2  
ATOM 5170  H HA3  . GLY A 1 153 ? 17.431  -2.765  -2.044  1.00 0.00 ? 153 GLY A HA3  2  
ATOM 5171  N N    . ALA A 1 154 ? 17.746  -5.339  -1.202  1.00 0.00 ? 154 ALA A N    2  
ATOM 5172  C CA   . ALA A 1 154 ? 17.826  -6.788  -1.346  1.00 0.00 ? 154 ALA A CA   2  
ATOM 5173  C C    . ALA A 1 154 ? 18.372  -7.465  -0.093  1.00 0.00 ? 154 ALA A C    2  
ATOM 5174  O O    . ALA A 1 154 ? 19.333  -6.992  0.516   1.00 0.00 ? 154 ALA A O    2  
ATOM 5175  C CB   . ALA A 1 154 ? 18.681  -7.142  -2.551  1.00 0.00 ? 154 ALA A CB   2  
ATOM 5176  H H    . ALA A 1 154 ? 18.514  -4.848  -0.835  1.00 0.00 ? 154 ALA A H    2  
ATOM 5177  H HA   . ALA A 1 154 ? 16.827  -7.153  -1.532  1.00 0.00 ? 154 ALA A HA   2  
ATOM 5178  H HB1  . ALA A 1 154 ? 18.304  -6.630  -3.425  1.00 0.00 ? 154 ALA A HB1  2  
ATOM 5179  H HB2  . ALA A 1 154 ? 18.647  -8.209  -2.717  1.00 0.00 ? 154 ALA A HB2  2  
ATOM 5180  H HB3  . ALA A 1 154 ? 19.702  -6.839  -2.369  1.00 0.00 ? 154 ALA A HB3  2  
ATOM 5181  N N    . LEU A 1 155 ? 17.762  -8.587  0.260   1.00 0.00 ? 155 LEU A N    2  
ATOM 5182  C CA   . LEU A 1 155 ? 18.160  -9.363  1.429   1.00 0.00 ? 155 LEU A CA   2  
ATOM 5183  C C    . LEU A 1 155 ? 18.071  -10.857 1.127   1.00 0.00 ? 155 LEU A C    2  
ATOM 5184  O O    . LEU A 1 155 ? 18.694  -11.678 1.800   1.00 0.00 ? 155 LEU A O    2  
ATOM 5185  C CB   . LEU A 1 155 ? 17.272  -9.024  2.632   1.00 0.00 ? 155 LEU A CB   2  
ATOM 5186  C CG   . LEU A 1 155 ? 18.016  -8.637  3.915   1.00 0.00 ? 155 LEU A CG   2  
ATOM 5187  C CD1  . LEU A 1 155 ? 17.040  -8.507  5.070   1.00 0.00 ? 155 LEU A CD1  2  
ATOM 5188  C CD2  . LEU A 1 155 ? 19.101  -9.653  4.249   1.00 0.00 ? 155 LEU A CD2  2  
ATOM 5189  H H    . LEU A 1 155 ? 17.022  -8.921  -0.307  1.00 0.00 ? 155 LEU A H    2  
ATOM 5190  H HA   . LEU A 1 155 ? 19.184  -9.112  1.663   1.00 0.00 ? 155 LEU A HA   2  
ATOM 5191  H HB2  . LEU A 1 155 ? 16.627  -8.203  2.355   1.00 0.00 ? 155 LEU A HB2  2  
ATOM 5192  H HB3  . LEU A 1 155 ? 16.655  -9.884  2.848   1.00 0.00 ? 155 LEU A HB3  2  
ATOM 5193  H HG   . LEU A 1 155 ? 18.490  -7.678  3.770   1.00 0.00 ? 155 LEU A HG   2  
ATOM 5194  H HD11 . LEU A 1 155 ? 16.331  -7.720  4.855   1.00 0.00 ? 155 LEU A HD11 2  
ATOM 5195  H HD12 . LEU A 1 155 ? 17.581  -8.266  5.973   1.00 0.00 ? 155 LEU A HD12 2  
ATOM 5196  H HD13 . LEU A 1 155 ? 16.512  -9.440  5.205   1.00 0.00 ? 155 LEU A HD13 2  
ATOM 5197  H HD21 . LEU A 1 155 ? 19.528  -9.419  5.215   1.00 0.00 ? 155 LEU A HD21 2  
ATOM 5198  H HD22 . LEU A 1 155 ? 19.873  -9.616  3.497   1.00 0.00 ? 155 LEU A HD22 2  
ATOM 5199  H HD23 . LEU A 1 155 ? 18.670  -10.644 4.277   1.00 0.00 ? 155 LEU A HD23 2  
ATOM 5200  N N    . GLU A 1 156 ? 17.298  -11.205 0.110   1.00 0.00 ? 156 GLU A N    2  
ATOM 5201  C CA   . GLU A 1 156 ? 17.129  -12.594 -0.279  1.00 0.00 ? 156 GLU A CA   2  
ATOM 5202  C C    . GLU A 1 156 ? 17.964  -12.884 -1.518  1.00 0.00 ? 156 GLU A C    2  
ATOM 5203  O O    . GLU A 1 156 ? 18.806  -12.073 -1.910  1.00 0.00 ? 156 GLU A O    2  
ATOM 5204  C CB   . GLU A 1 156 ? 15.650  -12.894 -0.537  1.00 0.00 ? 156 GLU A CB   2  
ATOM 5205  C CG   . GLU A 1 156 ? 15.143  -14.131 0.189   1.00 0.00 ? 156 GLU A CG   2  
ATOM 5206  C CD   . GLU A 1 156 ? 15.002  -15.329 -0.725  1.00 0.00 ? 156 GLU A CD   2  
ATOM 5207  O OE1  . GLU A 1 156 ? 16.037  -15.868 -1.169  1.00 0.00 ? 156 GLU A OE1  2  
ATOM 5208  O OE2  . GLU A 1 156 ? 13.857  -15.739 -1.004  1.00 0.00 ? 156 GLU A OE2  2  
ATOM 5209  H H    . GLU A 1 156 ? 16.840  -10.505 -0.414  1.00 0.00 ? 156 GLU A H    2  
ATOM 5210  H HA   . GLU A 1 156 ? 17.480  -13.214 0.533   1.00 0.00 ? 156 GLU A HA   2  
ATOM 5211  H HB2  . GLU A 1 156 ? 15.062  -12.047 -0.217  1.00 0.00 ? 156 GLU A HB2  2  
ATOM 5212  H HB3  . GLU A 1 156 ? 15.506  -13.040 -1.597  1.00 0.00 ? 156 GLU A HB3  2  
ATOM 5213  H HG2  . GLU A 1 156 ? 15.837  -14.380 0.977   1.00 0.00 ? 156 GLU A HG2  2  
ATOM 5214  H HG3  . GLU A 1 156 ? 14.177  -13.909 0.621   1.00 0.00 ? 156 GLU A HG3  2  
ATOM 5215  N N    . GLU A 1 157 ? 17.747  -14.039 -2.119  1.00 0.00 ? 157 GLU A N    2  
ATOM 5216  C CA   . GLU A 1 157 ? 18.480  -14.424 -3.309  1.00 0.00 ? 157 GLU A CA   2  
ATOM 5217  C C    . GLU A 1 157 ? 17.537  -15.027 -4.340  1.00 0.00 ? 157 GLU A C    2  
ATOM 5218  O O    . GLU A 1 157 ? 17.651  -14.753 -5.531  1.00 0.00 ? 157 GLU A O    2  
ATOM 5219  C CB   . GLU A 1 157 ? 19.578  -15.428 -2.955  1.00 0.00 ? 157 GLU A CB   2  
ATOM 5220  C CG   . GLU A 1 157 ? 20.906  -15.160 -3.645  1.00 0.00 ? 157 GLU A CG   2  
ATOM 5221  C CD   . GLU A 1 157 ? 20.826  -15.284 -5.154  1.00 0.00 ? 157 GLU A CD   2  
ATOM 5222  O OE1  . GLU A 1 157 ? 20.589  -16.403 -5.653  1.00 0.00 ? 157 GLU A OE1  2  
ATOM 5223  O OE2  . GLU A 1 157 ? 21.012  -14.263 -5.851  1.00 0.00 ? 157 GLU A OE2  2  
ATOM 5224  H H    . GLU A 1 157 ? 17.077  -14.656 -1.746  1.00 0.00 ? 157 GLU A H    2  
ATOM 5225  H HA   . GLU A 1 157 ? 18.934  -13.538 -3.724  1.00 0.00 ? 157 GLU A HA   2  
ATOM 5226  H HB2  . GLU A 1 157 ? 19.741  -15.402 -1.889  1.00 0.00 ? 157 GLU A HB2  2  
ATOM 5227  H HB3  . GLU A 1 157 ? 19.246  -16.417 -3.235  1.00 0.00 ? 157 GLU A HB3  2  
ATOM 5228  H HG2  . GLU A 1 157 ? 21.226  -14.158 -3.400  1.00 0.00 ? 157 GLU A HG2  2  
ATOM 5229  H HG3  . GLU A 1 157 ? 21.635  -15.868 -3.278  1.00 0.00 ? 157 GLU A HG3  2  
ATOM 5230  N N    . ALA A 1 158 ? 16.592  -15.832 -3.875  1.00 0.00 ? 158 ALA A N    2  
ATOM 5231  C CA   . ALA A 1 158 ? 15.642  -16.482 -4.767  1.00 0.00 ? 158 ALA A CA   2  
ATOM 5232  C C    . ALA A 1 158 ? 14.559  -15.513 -5.229  1.00 0.00 ? 158 ALA A C    2  
ATOM 5233  O O    . ALA A 1 158 ? 14.021  -15.649 -6.329  1.00 0.00 ? 158 ALA A O    2  
ATOM 5234  C CB   . ALA A 1 158 ? 15.023  -17.691 -4.088  1.00 0.00 ? 158 ALA A CB   2  
ATOM 5235  H H    . ALA A 1 158 ? 16.528  -15.994 -2.903  1.00 0.00 ? 158 ALA A H    2  
ATOM 5236  H HA   . ALA A 1 158 ? 16.188  -16.830 -5.633  1.00 0.00 ? 158 ALA A HA   2  
ATOM 5237  H HB1  . ALA A 1 158 ? 14.354  -18.188 -4.774  1.00 0.00 ? 158 ALA A HB1  2  
ATOM 5238  H HB2  . ALA A 1 158 ? 14.472  -17.372 -3.214  1.00 0.00 ? 158 ALA A HB2  2  
ATOM 5239  H HB3  . ALA A 1 158 ? 15.805  -18.374 -3.788  1.00 0.00 ? 158 ALA A HB3  2  
ATOM 5240  N N    . ARG A 1 159 ? 14.248  -14.530 -4.395  1.00 0.00 ? 159 ARG A N    2  
ATOM 5241  C CA   . ARG A 1 159 ? 13.226  -13.545 -4.731  1.00 0.00 ? 159 ARG A CA   2  
ATOM 5242  C C    . ARG A 1 159 ? 13.778  -12.461 -5.650  1.00 0.00 ? 159 ARG A C    2  
ATOM 5243  O O    . ARG A 1 159 ? 13.014  -11.754 -6.307  1.00 0.00 ? 159 ARG A O    2  
ATOM 5244  C CB   . ARG A 1 159 ? 12.651  -12.910 -3.465  1.00 0.00 ? 159 ARG A CB   2  
ATOM 5245  C CG   . ARG A 1 159 ? 11.585  -13.757 -2.785  1.00 0.00 ? 159 ARG A CG   2  
ATOM 5246  C CD   . ARG A 1 159 ? 10.658  -12.907 -1.931  1.00 0.00 ? 159 ARG A CD   2  
ATOM 5247  N NE   . ARG A 1 159 ? 11.345  -12.336 -0.773  1.00 0.00 ? 159 ARG A NE   2  
ATOM 5248  C CZ   . ARG A 1 159 ? 11.495  -11.027 -0.561  1.00 0.00 ? 159 ARG A CZ   2  
ATOM 5249  N NH1  . ARG A 1 159 ? 11.046  -10.153 -1.452  1.00 0.00 ? 159 ARG A NH1  2  
ATOM 5250  N NH2  . ARG A 1 159 ? 12.104  -10.592 0.536   1.00 0.00 ? 159 ARG A NH2  2  
ATOM 5251  H H    . ARG A 1 159 ? 14.708  -14.469 -3.533  1.00 0.00 ? 159 ARG A H    2  
ATOM 5252  H HA   . ARG A 1 159 ? 12.432  -14.063 -5.249  1.00 0.00 ? 159 ARG A HA   2  
ATOM 5253  H HB2  . ARG A 1 159 ? 13.455  -12.746 -2.760  1.00 0.00 ? 159 ARG A HB2  2  
ATOM 5254  H HB3  . ARG A 1 159 ? 12.212  -11.957 -3.724  1.00 0.00 ? 159 ARG A HB3  2  
ATOM 5255  H HG2  . ARG A 1 159 ? 11.002  -14.260 -3.541  1.00 0.00 ? 159 ARG A HG2  2  
ATOM 5256  H HG3  . ARG A 1 159 ? 12.070  -14.491 -2.154  1.00 0.00 ? 159 ARG A HG3  2  
ATOM 5257  H HD2  . ARG A 1 159 ? 10.267  -12.103 -2.538  1.00 0.00 ? 159 ARG A HD2  2  
ATOM 5258  H HD3  . ARG A 1 159 ? 9.843   -13.525 -1.585  1.00 0.00 ? 159 ARG A HD3  2  
ATOM 5259  H HE   . ARG A 1 159 ? 11.707  -12.972 -0.109  1.00 0.00 ? 159 ARG A HE   2  
ATOM 5260  H HH11 . ARG A 1 159 ? 10.595  -10.467 -2.285  1.00 0.00 ? 159 ARG A HH11 2  
ATOM 5261  H HH12 . ARG A 1 159 ? 11.164  -9.161  -1.291  1.00 0.00 ? 159 ARG A HH12 2  
ATOM 5262  H HH21 . ARG A 1 159 ? 12.462  -11.247 1.214   1.00 0.00 ? 159 ARG A HH21 2  
ATOM 5263  H HH22 . ARG A 1 159 ? 12.199  -9.605  0.702   1.00 0.00 ? 159 ARG A HH22 2  
ATOM 5264  N N    . ARG A 1 160 ? 15.102  -12.343 -5.700  1.00 0.00 ? 160 ARG A N    2  
ATOM 5265  C CA   . ARG A 1 160 ? 15.754  -11.340 -6.534  1.00 0.00 ? 160 ARG A CA   2  
ATOM 5266  C C    . ARG A 1 160 ? 15.487  -11.592 -8.014  1.00 0.00 ? 160 ARG A C    2  
ATOM 5267  O O    . ARG A 1 160 ? 15.072  -12.684 -8.405  1.00 0.00 ? 160 ARG A O    2  
ATOM 5268  C CB   . ARG A 1 160 ? 17.261  -11.317 -6.272  1.00 0.00 ? 160 ARG A CB   2  
ATOM 5269  C CG   . ARG A 1 160 ? 17.622  -10.929 -4.847  1.00 0.00 ? 160 ARG A CG   2  
ATOM 5270  C CD   . ARG A 1 160 ? 19.000  -10.297 -4.767  1.00 0.00 ? 160 ARG A CD   2  
ATOM 5271  N NE   . ARG A 1 160 ? 20.071  -11.282 -4.926  1.00 0.00 ? 160 ARG A NE   2  
ATOM 5272  C CZ   . ARG A 1 160 ? 21.253  -11.201 -4.316  1.00 0.00 ? 160 ARG A CZ   2  
ATOM 5273  N NH1  . ARG A 1 160 ? 21.544  -10.142 -3.567  1.00 0.00 ? 160 ARG A NH1  2  
ATOM 5274  N NH2  . ARG A 1 160 ? 22.147  -12.171 -4.475  1.00 0.00 ? 160 ARG A NH2  2  
ATOM 5275  H H    . ARG A 1 160 ? 15.650  -12.940 -5.158  1.00 0.00 ? 160 ARG A H    2  
ATOM 5276  H HA   . ARG A 1 160 ? 15.342  -10.378 -6.271  1.00 0.00 ? 160 ARG A HA   2  
ATOM 5277  H HB2  . ARG A 1 160 ? 17.666  -12.298 -6.472  1.00 0.00 ? 160 ARG A HB2  2  
ATOM 5278  H HB3  . ARG A 1 160 ? 17.720  -10.605 -6.943  1.00 0.00 ? 160 ARG A HB3  2  
ATOM 5279  H HG2  . ARG A 1 160 ? 16.892  -10.223 -4.482  1.00 0.00 ? 160 ARG A HG2  2  
ATOM 5280  H HG3  . ARG A 1 160 ? 17.608  -11.816 -4.229  1.00 0.00 ? 160 ARG A HG3  2  
ATOM 5281  H HD2  . ARG A 1 160 ? 19.088  -9.555  -5.549  1.00 0.00 ? 160 ARG A HD2  2  
ATOM 5282  H HD3  . ARG A 1 160 ? 19.105  -9.816  -3.805  1.00 0.00 ? 160 ARG A HD3  2  
ATOM 5283  H HE   . ARG A 1 160 ? 19.888  -12.054 -5.509  1.00 0.00 ? 160 ARG A HE   2  
ATOM 5284  H HH11 . ARG A 1 160 ? 20.875  -9.402  -3.462  1.00 0.00 ? 160 ARG A HH11 2  
ATOM 5285  H HH12 . ARG A 1 160 ? 22.432  -10.072 -3.102  1.00 0.00 ? 160 ARG A HH12 2  
ATOM 5286  H HH21 . ARG A 1 160 ? 21.927  -12.969 -5.055  1.00 0.00 ? 160 ARG A HH21 2  
ATOM 5287  H HH22 . ARG A 1 160 ? 23.041  -12.119 -4.014  1.00 0.00 ? 160 ARG A HH22 2  
ATOM 5288  N N    . LEU A 1 161 ? 15.742  -10.582 -8.832  1.00 0.00 ? 161 LEU A N    2  
ATOM 5289  C CA   . LEU A 1 161 ? 15.513  -10.674 -10.268 1.00 0.00 ? 161 LEU A CA   2  
ATOM 5290  C C    . LEU A 1 161 ? 16.665  -11.388 -10.965 1.00 0.00 ? 161 LEU A C    2  
ATOM 5291  O O    . LEU A 1 161 ? 17.823  -11.261 -10.566 1.00 0.00 ? 161 LEU A O    2  
ATOM 5292  C CB   . LEU A 1 161 ? 15.345  -9.277  -10.878 1.00 0.00 ? 161 LEU A CB   2  
ATOM 5293  C CG   . LEU A 1 161 ? 14.231  -8.419  -10.273 1.00 0.00 ? 161 LEU A CG   2  
ATOM 5294  C CD1  . LEU A 1 161 ? 14.782  -7.533  -9.167  1.00 0.00 ? 161 LEU A CD1  2  
ATOM 5295  C CD2  . LEU A 1 161 ? 13.560  -7.579  -11.348 1.00 0.00 ? 161 LEU A CD2  2  
ATOM 5296  H H    . LEU A 1 161 ? 16.109  -9.749  -8.460  1.00 0.00 ? 161 LEU A H    2  
ATOM 5297  H HA   . LEU A 1 161 ? 14.605  -11.237 -10.423 1.00 0.00 ? 161 LEU A HA   2  
ATOM 5298  H HB2  . LEU A 1 161 ? 16.278  -8.746  -10.764 1.00 0.00 ? 161 LEU A HB2  2  
ATOM 5299  H HB3  . LEU A 1 161 ? 15.146  -9.393  -11.933 1.00 0.00 ? 161 LEU A HB3  2  
ATOM 5300  H HG   . LEU A 1 161 ? 13.484  -9.068  -9.839  1.00 0.00 ? 161 LEU A HG   2  
ATOM 5301  H HD11 . LEU A 1 161 ? 13.983  -6.933  -8.757  1.00 0.00 ? 161 LEU A HD11 2  
ATOM 5302  H HD12 . LEU A 1 161 ? 15.547  -6.888  -9.571  1.00 0.00 ? 161 LEU A HD12 2  
ATOM 5303  H HD13 . LEU A 1 161 ? 15.205  -8.150  -8.387  1.00 0.00 ? 161 LEU A HD13 2  
ATOM 5304  H HD21 . LEU A 1 161 ? 14.295  -6.945  -11.822 1.00 0.00 ? 161 LEU A HD21 2  
ATOM 5305  H HD22 . LEU A 1 161 ? 12.793  -6.967  -10.899 1.00 0.00 ? 161 LEU A HD22 2  
ATOM 5306  H HD23 . LEU A 1 161 ? 13.114  -8.229  -12.090 1.00 0.00 ? 161 LEU A HD23 2  
ATOM 5307  N N    . ARG A 1 162 ? 16.344  -12.139 -12.010 1.00 0.00 ? 162 ARG A N    2  
ATOM 5308  C CA   . ARG A 1 162 ? 17.357  -12.853 -12.778 1.00 0.00 ? 162 ARG A CA   2  
ATOM 5309  C C    . ARG A 1 162 ? 17.578  -12.154 -14.111 1.00 0.00 ? 162 ARG A C    2  
ATOM 5310  O O    . ARG A 1 162 ? 18.563  -12.398 -14.809 1.00 0.00 ? 162 ARG A O    2  
ATOM 5311  C CB   . ARG A 1 162 ? 16.938  -14.303 -13.008 1.00 0.00 ? 162 ARG A CB   2  
ATOM 5312  C CG   . ARG A 1 162 ? 17.860  -15.314 -12.343 1.00 0.00 ? 162 ARG A CG   2  
ATOM 5313  C CD   . ARG A 1 162 ? 17.761  -15.242 -10.828 1.00 0.00 ? 162 ARG A CD   2  
ATOM 5314  N NE   . ARG A 1 162 ? 18.887  -15.899 -10.163 1.00 0.00 ? 162 ARG A NE   2  
ATOM 5315  C CZ   . ARG A 1 162 ? 19.016  -15.979 -8.842  1.00 0.00 ? 162 ARG A CZ   2  
ATOM 5316  N NH1  . ARG A 1 162 ? 18.042  -15.553 -8.056  1.00 0.00 ? 162 ARG A NH1  2  
ATOM 5317  N NH2  . ARG A 1 162 ? 20.105  -16.521 -8.313  1.00 0.00 ? 162 ARG A NH2  2  
ATOM 5318  H H    . ARG A 1 162 ? 15.400  -12.215 -12.273 1.00 0.00 ? 162 ARG A H    2  
ATOM 5319  H HA   . ARG A 1 162 ? 18.278  -12.834 -12.215 1.00 0.00 ? 162 ARG A HA   2  
ATOM 5320  H HB2  . ARG A 1 162 ? 15.939  -14.442 -12.616 1.00 0.00 ? 162 ARG A HB2  2  
ATOM 5321  H HB3  . ARG A 1 162 ? 16.927  -14.500 -14.070 1.00 0.00 ? 162 ARG A HB3  2  
ATOM 5322  H HG2  . ARG A 1 162 ? 17.582  -16.307 -12.663 1.00 0.00 ? 162 ARG A HG2  2  
ATOM 5323  H HG3  . ARG A 1 162 ? 18.878  -15.108 -12.640 1.00 0.00 ? 162 ARG A HG3  2  
ATOM 5324  H HD2  . ARG A 1 162 ? 17.743  -14.202 -10.534 1.00 0.00 ? 162 ARG A HD2  2  
ATOM 5325  H HD3  . ARG A 1 162 ? 16.842  -15.717 -10.516 1.00 0.00 ? 162 ARG A HD3  2  
ATOM 5326  H HE   . ARG A 1 162 ? 19.597  -16.278 -10.738 1.00 0.00 ? 162 ARG A HE   2  
ATOM 5327  H HH11 . ARG A 1 162 ? 17.198  -15.176 -8.455  1.00 0.00 ? 162 ARG A HH11 2  
ATOM 5328  H HH12 . ARG A 1 162 ? 18.140  -15.593 -7.054  1.00 0.00 ? 162 ARG A HH12 2  
ATOM 5329  H HH21 . ARG A 1 162 ? 20.829  -16.876 -8.909  1.00 0.00 ? 162 ARG A HH21 2  
ATOM 5330  H HH22 . ARG A 1 162 ? 20.216  -16.567 -7.308  1.00 0.00 ? 162 ARG A HH22 2  
ATOM 5331  N N    . GLU A 1 163 ? 16.638  -11.288 -14.453 1.00 0.00 ? 163 GLU A N    2  
ATOM 5332  C CA   . GLU A 1 163 ? 16.693  -10.521 -15.688 1.00 0.00 ? 163 GLU A CA   2  
ATOM 5333  C C    . GLU A 1 163 ? 16.792  -9.032  -15.378 1.00 0.00 ? 163 GLU A C    2  
ATOM 5334  O O    . GLU A 1 163 ? 17.619  -8.319  -15.947 1.00 0.00 ? 163 GLU A O    2  
ATOM 5335  C CB   . GLU A 1 163 ? 15.460  -10.797 -16.560 1.00 0.00 ? 163 GLU A CB   2  
ATOM 5336  C CG   . GLU A 1 163 ? 14.333  -11.531 -15.844 1.00 0.00 ? 163 GLU A CG   2  
ATOM 5337  C CD   . GLU A 1 163 ? 13.699  -10.709 -14.742 1.00 0.00 ? 163 GLU A CD   2  
ATOM 5338  O OE1  . GLU A 1 163 ? 12.749  -9.957  -15.029 1.00 0.00 ? 163 GLU A OE1  2  
ATOM 5339  O OE2  . GLU A 1 163 ? 14.154  -10.816 -13.583 1.00 0.00 ? 163 GLU A OE2  2  
ATOM 5340  H H    . GLU A 1 163 ? 15.866  -11.167 -13.853 1.00 0.00 ? 163 GLU A H    2  
ATOM 5341  H HA   . GLU A 1 163 ? 17.580  -10.824 -16.224 1.00 0.00 ? 163 GLU A HA   2  
ATOM 5342  H HB2  . GLU A 1 163 ? 15.073  -9.857  -16.920 1.00 0.00 ? 163 GLU A HB2  2  
ATOM 5343  H HB3  . GLU A 1 163 ? 15.766  -11.396 -17.406 1.00 0.00 ? 163 GLU A HB3  2  
ATOM 5344  H HG2  . GLU A 1 163 ? 13.571  -11.783 -16.566 1.00 0.00 ? 163 GLU A HG2  2  
ATOM 5345  H HG3  . GLU A 1 163 ? 14.730  -12.437 -15.414 1.00 0.00 ? 163 GLU A HG3  2  
ATOM 5346  N N    . GLY A 1 164 ? 15.945  -8.568  -14.468 1.00 0.00 ? 164 GLY A N    2  
ATOM 5347  C CA   . GLY A 1 164 ? 15.960  -7.171  -14.089 1.00 0.00 ? 164 GLY A CA   2  
ATOM 5348  C C    . GLY A 1 164 ? 14.945  -6.341  -14.850 1.00 0.00 ? 164 GLY A C    2  
ATOM 5349  O O    . GLY A 1 164 ? 15.134  -5.139  -15.026 1.00 0.00 ? 164 GLY A O    2  
ATOM 5350  H H    . GLY A 1 164 ? 15.299  -9.181  -14.052 1.00 0.00 ? 164 GLY A H    2  
ATOM 5351  H HA2  . GLY A 1 164 ? 15.750  -7.097  -13.032 1.00 0.00 ? 164 GLY A HA2  2  
ATOM 5352  H HA3  . GLY A 1 164 ? 16.946  -6.771  -14.275 1.00 0.00 ? 164 GLY A HA3  2  
ATOM 5353  N N    . ASN A 1 165 ? 13.867  -6.968  -15.305 1.00 0.00 ? 165 ASN A N    2  
ATOM 5354  C CA   . ASN A 1 165 ? 12.829  -6.246  -16.037 1.00 0.00 ? 165 ASN A CA   2  
ATOM 5355  C C    . ASN A 1 165 ? 11.948  -5.469  -15.068 1.00 0.00 ? 165 ASN A C    2  
ATOM 5356  O O    . ASN A 1 165 ? 11.951  -4.238  -15.049 1.00 0.00 ? 165 ASN A O    2  
ATOM 5357  C CB   . ASN A 1 165 ? 11.977  -7.215  -16.868 1.00 0.00 ? 165 ASN A CB   2  
ATOM 5358  C CG   . ASN A 1 165 ? 10.675  -6.595  -17.355 1.00 0.00 ? 165 ASN A CG   2  
ATOM 5359  O OD1  . ASN A 1 165 ? 9.615   -6.791  -16.754 1.00 0.00 ? 165 ASN A OD1  2  
ATOM 5360  N ND2  . ASN A 1 165 ? 10.744  -5.843  -18.441 1.00 0.00 ? 165 ASN A ND2  2  
ATOM 5361  H H    . ASN A 1 165 ? 13.763  -7.932  -15.143 1.00 0.00 ? 165 ASN A H    2  
ATOM 5362  H HA   . ASN A 1 165 ? 13.317  -5.546  -16.701 1.00 0.00 ? 165 ASN A HA   2  
ATOM 5363  H HB2  . ASN A 1 165 ? 12.545  -7.532  -17.730 1.00 0.00 ? 165 ASN A HB2  2  
ATOM 5364  H HB3  . ASN A 1 165 ? 11.739  -8.078  -16.265 1.00 0.00 ? 165 ASN A HB3  2  
ATOM 5365  H HD21 . ASN A 1 165 ? 11.621  -5.727  -18.872 1.00 0.00 ? 165 ASN A HD21 2  
ATOM 5366  H HD22 . ASN A 1 165 ? 9.918   -5.429  -18.769 1.00 0.00 ? 165 ASN A HD22 2  
ATOM 5367  N N    . TRP A 1 166 ? 11.220  -6.205  -14.247 1.00 0.00 ? 166 TRP A N    2  
ATOM 5368  C CA   . TRP A 1 166 ? 10.327  -5.623  -13.258 1.00 0.00 ? 166 TRP A CA   2  
ATOM 5369  C C    . TRP A 1 166 ? 9.944   -6.700  -12.265 1.00 0.00 ? 166 TRP A C    2  
ATOM 5370  O O    . TRP A 1 166 ? 10.205  -6.582  -11.067 1.00 0.00 ? 166 TRP A O    2  
ATOM 5371  C CB   . TRP A 1 166 ? 9.070   -5.043  -13.930 1.00 0.00 ? 166 TRP A CB   2  
ATOM 5372  C CG   . TRP A 1 166 ? 8.099   -4.413  -12.973 1.00 0.00 ? 166 TRP A CG   2  
ATOM 5373  C CD1  . TRP A 1 166 ? 7.235   -5.061  -12.138 1.00 0.00 ? 166 TRP A CD1  2  
ATOM 5374  C CD2  . TRP A 1 166 ? 7.885   -3.012  -12.763 1.00 0.00 ? 166 TRP A CD2  2  
ATOM 5375  N NE1  . TRP A 1 166 ? 6.504   -4.151  -11.418 1.00 0.00 ? 166 TRP A NE1  2  
ATOM 5376  C CE2  . TRP A 1 166 ? 6.883   -2.886  -11.782 1.00 0.00 ? 166 TRP A CE2  2  
ATOM 5377  C CE3  . TRP A 1 166 ? 8.443   -1.851  -13.308 1.00 0.00 ? 166 TRP A CE3  2  
ATOM 5378  C CZ2  . TRP A 1 166 ? 6.432   -1.650  -11.333 1.00 0.00 ? 166 TRP A CZ2  2  
ATOM 5379  C CZ3  . TRP A 1 166 ? 7.993   -0.624  -12.860 1.00 0.00 ? 166 TRP A CZ3  2  
ATOM 5380  C CH2  . TRP A 1 166 ? 6.996   -0.531  -11.881 1.00 0.00 ? 166 TRP A CH2  2  
ATOM 5381  H H    . TRP A 1 166 ? 11.293  -7.181  -14.299 1.00 0.00 ? 166 TRP A H    2  
ATOM 5382  H HA   . TRP A 1 166 ? 10.859  -4.835  -12.744 1.00 0.00 ? 166 TRP A HA   2  
ATOM 5383  H HB2  . TRP A 1 166 ? 9.366   -4.286  -14.639 1.00 0.00 ? 166 TRP A HB2  2  
ATOM 5384  H HB3  . TRP A 1 166 ? 8.553   -5.835  -14.454 1.00 0.00 ? 166 TRP A HB3  2  
ATOM 5385  H HD1  . TRP A 1 166 ? 7.151   -6.134  -12.063 1.00 0.00 ? 166 TRP A HD1  2  
ATOM 5386  H HE1  . TRP A 1 166 ? 5.819   -4.375  -10.745 1.00 0.00 ? 166 TRP A HE1  2  
ATOM 5387  H HE3  . TRP A 1 166 ? 9.214   -1.902  -14.063 1.00 0.00 ? 166 TRP A HE3  2  
ATOM 5388  H HZ2  . TRP A 1 166 ? 5.665   -1.563  -10.577 1.00 0.00 ? 166 TRP A HZ2  2  
ATOM 5389  H HZ3  . TRP A 1 166 ? 8.413   0.283   -13.267 1.00 0.00 ? 166 TRP A HZ3  2  
ATOM 5390  H HH2  . TRP A 1 166 ? 6.674   0.447   -11.561 1.00 0.00 ? 166 TRP A HH2  2  
ATOM 5391  N N    . ALA A 1 167 ? 9.342   -7.760  -12.786 1.00 0.00 ? 167 ALA A N    2  
ATOM 5392  C CA   . ALA A 1 167 ? 8.926   -8.883  -11.970 1.00 0.00 ? 167 ALA A CA   2  
ATOM 5393  C C    . ALA A 1 167 ? 10.137  -9.532  -11.319 1.00 0.00 ? 167 ALA A C    2  
ATOM 5394  O O    . ALA A 1 167 ? 11.005  -10.069 -12.003 1.00 0.00 ? 167 ALA A O    2  
ATOM 5395  C CB   . ALA A 1 167 ? 8.171   -9.897  -12.814 1.00 0.00 ? 167 ALA A CB   2  
ATOM 5396  H H    . ALA A 1 167 ? 9.174   -7.784  -13.751 1.00 0.00 ? 167 ALA A H    2  
ATOM 5397  H HA   . ALA A 1 167 ? 8.262   -8.516  -11.202 1.00 0.00 ? 167 ALA A HA   2  
ATOM 5398  H HB1  . ALA A 1 167 ? 7.853   -10.718 -12.189 1.00 0.00 ? 167 ALA A HB1  2  
ATOM 5399  H HB2  . ALA A 1 167 ? 8.815   -10.269 -13.597 1.00 0.00 ? 167 ALA A HB2  2  
ATOM 5400  H HB3  . ALA A 1 167 ? 7.305   -9.425  -13.254 1.00 0.00 ? 167 ALA A HB3  2  
ATOM 5401  N N    . SER A 1 168 ? 10.206  -9.449  -10.006 1.00 0.00 ? 168 SER A N    2  
ATOM 5402  C CA   . SER A 1 168 ? 11.312  -10.032 -9.273  1.00 0.00 ? 168 SER A CA   2  
ATOM 5403  C C    . SER A 1 168 ? 11.009  -11.490 -8.959  1.00 0.00 ? 168 SER A C    2  
ATOM 5404  O O    . SER A 1 168 ? 11.885  -12.356 -9.025  1.00 0.00 ? 168 SER A O    2  
ATOM 5405  C CB   . SER A 1 168 ? 11.551  -9.236  -7.996  1.00 0.00 ? 168 SER A CB   2  
ATOM 5406  O OG   . SER A 1 168 ? 11.471  -7.841  -8.258  1.00 0.00 ? 168 SER A OG   2  
ATOM 5407  H H    . SER A 1 168 ? 9.494   -8.984  -9.516  1.00 0.00 ? 168 SER A H    2  
ATOM 5408  H HA   . SER A 1 168 ? 12.192  -9.981  -9.895  1.00 0.00 ? 168 SER A HA   2  
ATOM 5409  H HB2  . SER A 1 168 ? 10.803  -9.496  -7.263  1.00 0.00 ? 168 SER A HB2  2  
ATOM 5410  H HB3  . SER A 1 168 ? 12.534  -9.461  -7.608  1.00 0.00 ? 168 SER A HB3  2  
ATOM 5411  H HG   . SER A 1 168 ? 11.241  -7.704  -9.185  1.00 0.00 ? 168 SER A HG   2  
ATOM 5412  N N    . VAL A 1 169 ? 9.751   -11.753 -8.646  1.00 0.00 ? 169 VAL A N    2  
ATOM 5413  C CA   . VAL A 1 169 ? 9.298   -13.094 -8.332  1.00 0.00 ? 169 VAL A CA   2  
ATOM 5414  C C    . VAL A 1 169 ? 8.370   -13.591 -9.430  1.00 0.00 ? 169 VAL A C    2  
ATOM 5415  O O    . VAL A 1 169 ? 7.886   -12.804 -10.245 1.00 0.00 ? 169 VAL A O    2  
ATOM 5416  C CB   . VAL A 1 169 ? 8.563   -13.141 -6.977  1.00 0.00 ? 169 VAL A CB   2  
ATOM 5417  C CG1  . VAL A 1 169 ? 9.532   -12.881 -5.833  1.00 0.00 ? 169 VAL A CG1  2  
ATOM 5418  C CG2  . VAL A 1 169 ? 7.421   -12.136 -6.953  1.00 0.00 ? 169 VAL A CG2  2  
ATOM 5419  H H    . VAL A 1 169 ? 9.100   -11.020 -8.641  1.00 0.00 ? 169 VAL A H    2  
ATOM 5420  H HA   . VAL A 1 169 ? 10.164  -13.740 -8.281  1.00 0.00 ? 169 VAL A HA   2  
ATOM 5421  H HB   . VAL A 1 169 ? 8.148   -14.131 -6.849  1.00 0.00 ? 169 VAL A HB   2  
ATOM 5422  H HG11 . VAL A 1 169 ? 9.932   -11.882 -5.921  1.00 0.00 ? 169 VAL A HG11 2  
ATOM 5423  H HG12 . VAL A 1 169 ? 10.339  -13.597 -5.873  1.00 0.00 ? 169 VAL A HG12 2  
ATOM 5424  H HG13 . VAL A 1 169 ? 9.012   -12.978 -4.891  1.00 0.00 ? 169 VAL A HG13 2  
ATOM 5425  H HG21 . VAL A 1 169 ? 6.938   -12.162 -5.986  1.00 0.00 ? 169 VAL A HG21 2  
ATOM 5426  H HG22 . VAL A 1 169 ? 6.704   -12.388 -7.720  1.00 0.00 ? 169 VAL A HG22 2  
ATOM 5427  H HG23 . VAL A 1 169 ? 7.811   -11.146 -7.135  1.00 0.00 ? 169 VAL A HG23 2  
ATOM 5428  N N    . ARG A 1 170 ? 8.127   -14.887 -9.460  1.00 0.00 ? 170 ARG A N    2  
ATOM 5429  C CA   . ARG A 1 170 ? 7.258   -15.469 -10.466 1.00 0.00 ? 170 ARG A CA   2  
ATOM 5430  C C    . ARG A 1 170 ? 6.084   -16.176 -9.806  1.00 0.00 ? 170 ARG A C    2  
ATOM 5431  O O    . ARG A 1 170 ? 4.959   -15.631 -9.857  1.00 0.00 ? 170 ARG A O    2  
ATOM 5432  C CB   . ARG A 1 170 ? 8.036   -16.436 -11.366 1.00 0.00 ? 170 ARG A CB   2  
ATOM 5433  C CG   . ARG A 1 170 ? 8.562   -15.791 -12.644 1.00 0.00 ? 170 ARG A CG   2  
ATOM 5434  C CD   . ARG A 1 170 ? 9.710   -14.825 -12.376 1.00 0.00 ? 170 ARG A CD   2  
ATOM 5435  N NE   . ARG A 1 170 ? 9.808   -13.793 -13.408 1.00 0.00 ? 170 ARG A NE   2  
ATOM 5436  C CZ   . ARG A 1 170 ? 10.759  -12.855 -13.447 1.00 0.00 ? 170 ARG A CZ   2  
ATOM 5437  N NH1  . ARG A 1 170 ? 11.725  -12.831 -12.537 1.00 0.00 ? 170 ARG A NH1  2  
ATOM 5438  N NH2  . ARG A 1 170 ? 10.750  -11.940 -14.409 1.00 0.00 ? 170 ARG A NH2  2  
ATOM 5439  H H    . ARG A 1 170 ? 8.529   -15.469 -8.775  1.00 0.00 ? 170 ARG A H    2  
ATOM 5440  H HA   . ARG A 1 170 ? 6.874   -14.661 -11.072 1.00 0.00 ? 170 ARG A HA   2  
ATOM 5441  H HB2  . ARG A 1 170 ? 8.877   -16.829 -10.812 1.00 0.00 ? 170 ARG A HB2  2  
ATOM 5442  H HB3  . ARG A 1 170 ? 7.386   -17.252 -11.641 1.00 0.00 ? 170 ARG A HB3  2  
ATOM 5443  H HG2  . ARG A 1 170 ? 8.911   -16.569 -13.307 1.00 0.00 ? 170 ARG A HG2  2  
ATOM 5444  H HG3  . ARG A 1 170 ? 7.755   -15.253 -13.118 1.00 0.00 ? 170 ARG A HG3  2  
ATOM 5445  H HD2  . ARG A 1 170 ? 9.547   -14.349 -11.421 1.00 0.00 ? 170 ARG A HD2  2  
ATOM 5446  H HD3  . ARG A 1 170 ? 10.633  -15.381 -12.348 1.00 0.00 ? 170 ARG A HD3  2  
ATOM 5447  H HE   . ARG A 1 170 ? 9.111   -13.791 -14.106 1.00 0.00 ? 170 ARG A HE   2  
ATOM 5448  H HH11 . ARG A 1 170 ? 11.754  -13.520 -11.809 1.00 0.00 ? 170 ARG A HH11 2  
ATOM 5449  H HH12 . ARG A 1 170 ? 12.430  -12.116 -12.570 1.00 0.00 ? 170 ARG A HH12 2  
ATOM 5450  H HH21 . ARG A 1 170 ? 10.028  -11.950 -15.109 1.00 0.00 ? 170 ARG A HH21 2  
ATOM 5451  H HH22 . ARG A 1 170 ? 11.460  -11.225 -14.436 1.00 0.00 ? 170 ARG A HH22 2  
ATOM 5452  N N    . ILE B 2 1   ? -14.294 -13.461 6.426   1.00 0.00 ? 201 ILE B N    2  
ATOM 5453  C CA   . ILE B 2 1   ? -14.061 -14.715 7.175   1.00 0.00 ? 201 ILE B CA   2  
ATOM 5454  C C    . ILE B 2 1   ? -13.277 -15.713 6.321   1.00 0.00 ? 201 ILE B C    2  
ATOM 5455  O O    . ILE B 2 1   ? -13.550 -16.913 6.326   1.00 0.00 ? 201 ILE B O    2  
ATOM 5456  C CB   . ILE B 2 1   ? -15.390 -15.357 7.633   1.00 0.00 ? 201 ILE B CB   2  
ATOM 5457  C CG1  . ILE B 2 1   ? -16.439 -14.275 7.903   1.00 0.00 ? 201 ILE B CG1  2  
ATOM 5458  C CG2  . ILE B 2 1   ? -15.163 -16.201 8.880   1.00 0.00 ? 201 ILE B CG2  2  
ATOM 5459  C CD1  . ILE B 2 1   ? -17.826 -14.823 8.144   1.00 0.00 ? 201 ILE B CD1  2  
ATOM 5460  H H1   . ILE B 2 1   ? -13.379 -13.032 6.158   1.00 0.00 ? 201 ILE B H1   2  
ATOM 5461  H H2   . ILE B 2 1   ? -14.816 -12.780 7.018   1.00 0.00 ? 201 ILE B H2   2  
ATOM 5462  H H3   . ILE B 2 1   ? -14.845 -13.650 5.564   1.00 0.00 ? 201 ILE B H3   2  
ATOM 5463  H HA   . ILE B 2 1   ? -13.479 -14.481 8.054   1.00 0.00 ? 201 ILE B HA   2  
ATOM 5464  H HB   . ILE B 2 1   ? -15.745 -16.006 6.846   1.00 0.00 ? 201 ILE B HB   2  
ATOM 5465  H HG12 . ILE B 2 1   ? -16.150 -13.709 8.776   1.00 0.00 ? 201 ILE B HG12 2  
ATOM 5466  H HG13 . ILE B 2 1   ? -16.489 -13.613 7.053   1.00 0.00 ? 201 ILE B HG13 2  
ATOM 5467  H HG21 . ILE B 2 1   ? -14.389 -16.930 8.687   1.00 0.00 ? 201 ILE B HG21 2  
ATOM 5468  H HG22 . ILE B 2 1   ? -16.079 -16.710 9.143   1.00 0.00 ? 201 ILE B HG22 2  
ATOM 5469  H HG23 . ILE B 2 1   ? -14.860 -15.562 9.696   1.00 0.00 ? 201 ILE B HG23 2  
ATOM 5470  H HD11 . ILE B 2 1   ? -17.815 -15.456 9.018   1.00 0.00 ? 201 ILE B HD11 2  
ATOM 5471  H HD12 . ILE B 2 1   ? -18.141 -15.400 7.286   1.00 0.00 ? 201 ILE B HD12 2  
ATOM 5472  H HD13 . ILE B 2 1   ? -18.514 -14.006 8.300   1.00 0.00 ? 201 ILE B HD13 2  
ATOM 5473  N N    . ILE B 2 2   ? -12.298 -15.207 5.576   1.00 0.00 ? 202 ILE B N    2  
ATOM 5474  C CA   . ILE B 2 2   ? -11.466 -16.045 4.722   1.00 0.00 ? 202 ILE B CA   2  
ATOM 5475  C C    . ILE B 2 2   ? -10.000 -15.696 4.925   1.00 0.00 ? 202 ILE B C    2  
ATOM 5476  O O    . ILE B 2 2   ? -9.441  -14.864 4.208   1.00 0.00 ? 202 ILE B O    2  
ATOM 5477  C CB   . ILE B 2 2   ? -11.809 -15.895 3.223   1.00 0.00 ? 202 ILE B CB   2  
ATOM 5478  C CG1  . ILE B 2 2   ? -13.322 -15.823 3.008   1.00 0.00 ? 202 ILE B CG1  2  
ATOM 5479  C CG2  . ILE B 2 2   ? -11.222 -17.057 2.439   1.00 0.00 ? 202 ILE B CG2  2  
ATOM 5480  C CD1  . ILE B 2 2   ? -13.718 -15.362 1.619   1.00 0.00 ? 202 ILE B CD1  2  
ATOM 5481  H H    . ILE B 2 2   ? -12.111 -14.236 5.617   1.00 0.00 ? 202 ILE B H    2  
ATOM 5482  H HA   . ILE B 2 2   ? -11.624 -17.075 5.008   1.00 0.00 ? 202 ILE B HA   2  
ATOM 5483  H HB   . ILE B 2 2   ? -11.353 -14.984 2.865   1.00 0.00 ? 202 ILE B HB   2  
ATOM 5484  H HG12 . ILE B 2 2   ? -13.747 -16.802 3.162   1.00 0.00 ? 202 ILE B HG12 2  
ATOM 5485  H HG13 . ILE B 2 2   ? -13.747 -15.132 3.723   1.00 0.00 ? 202 ILE B HG13 2  
ATOM 5486  H HG21 . ILE B 2 2   ? -11.474 -16.949 1.395   1.00 0.00 ? 202 ILE B HG21 2  
ATOM 5487  H HG22 . ILE B 2 2   ? -11.628 -17.985 2.813   1.00 0.00 ? 202 ILE B HG22 2  
ATOM 5488  H HG23 . ILE B 2 2   ? -10.148 -17.063 2.551   1.00 0.00 ? 202 ILE B HG23 2  
ATOM 5489  H HD11 . ILE B 2 2   ? -14.792 -15.399 1.522   1.00 0.00 ? 202 ILE B HD11 2  
ATOM 5490  H HD12 . ILE B 2 2   ? -13.267 -16.010 0.881   1.00 0.00 ? 202 ILE B HD12 2  
ATOM 5491  H HD13 . ILE B 2 2   ? -13.377 -14.349 1.463   1.00 0.00 ? 202 ILE B HD13 2  
ATOM 5492  N N    . LYS B 2 3   ? -9.386  -16.330 5.911   1.00 0.00 ? 203 LYS B N    2  
ATOM 5493  C CA   . LYS B 2 3   ? -7.984  -16.086 6.227   1.00 0.00 ? 203 LYS B CA   2  
ATOM 5494  C C    . LYS B 2 3   ? -7.073  -16.520 5.083   1.00 0.00 ? 203 LYS B C    2  
ATOM 5495  O O    . LYS B 2 3   ? -6.041  -15.900 4.846   1.00 0.00 ? 203 LYS B O    2  
ATOM 5496  C CB   . LYS B 2 3   ? -7.581  -16.812 7.516   1.00 0.00 ? 203 LYS B CB   2  
ATOM 5497  C CG   . LYS B 2 3   ? -8.390  -16.402 8.738   1.00 0.00 ? 203 LYS B CG   2  
ATOM 5498  C CD   . LYS B 2 3   ? -8.340  -14.899 8.974   1.00 0.00 ? 203 LYS B CD   2  
ATOM 5499  C CE   . LYS B 2 3   ? -9.064  -14.515 10.256  1.00 0.00 ? 203 LYS B CE   2  
ATOM 5500  N NZ   . LYS B 2 3   ? -9.434  -13.074 10.280  1.00 0.00 ? 203 LYS B NZ   2  
ATOM 5501  H H    . LYS B 2 3   ? -9.891  -16.984 6.445   1.00 0.00 ? 203 LYS B H    2  
ATOM 5502  H HA   . LYS B 2 3   ? -7.866  -15.025 6.376   1.00 0.00 ? 203 LYS B HA   2  
ATOM 5503  H HB2  . LYS B 2 3   ? -7.706  -17.875 7.370   1.00 0.00 ? 203 LYS B HB2  2  
ATOM 5504  H HB3  . LYS B 2 3   ? -6.539  -16.607 7.718   1.00 0.00 ? 203 LYS B HB3  2  
ATOM 5505  H HG2  . LYS B 2 3   ? -9.421  -16.696 8.589   1.00 0.00 ? 203 LYS B HG2  2  
ATOM 5506  H HG3  . LYS B 2 3   ? -7.993  -16.908 9.605   1.00 0.00 ? 203 LYS B HG3  2  
ATOM 5507  H HD2  . LYS B 2 3   ? -7.308  -14.589 9.047   1.00 0.00 ? 203 LYS B HD2  2  
ATOM 5508  H HD3  . LYS B 2 3   ? -8.811  -14.396 8.140   1.00 0.00 ? 203 LYS B HD3  2  
ATOM 5509  H HE2  . LYS B 2 3   ? -9.961  -15.108 10.337  1.00 0.00 ? 203 LYS B HE2  2  
ATOM 5510  H HE3  . LYS B 2 3   ? -8.418  -14.724 11.097  1.00 0.00 ? 203 LYS B HE3  2  
ATOM 5511  H HZ1  . LYS B 2 3   ? -9.905  -12.837 11.180  1.00 0.00 ? 203 LYS B HZ1  2  
ATOM 5512  H HZ2  . LYS B 2 3   ? -10.094 -12.861 9.497   1.00 0.00 ? 203 LYS B HZ2  2  
ATOM 5513  H HZ3  . LYS B 2 3   ? -8.586  -12.478 10.177  1.00 0.00 ? 203 LYS B HZ3  2  
ATOM 5514  N N    . ASN B 2 4   ? -7.462  -17.581 4.382   1.00 0.00 ? 204 ASN B N    2  
ATOM 5515  C CA   . ASN B 2 4   ? -6.670  -18.115 3.271   1.00 0.00 ? 204 ASN B CA   2  
ATOM 5516  C C    . ASN B 2 4   ? -6.326  -17.046 2.232   1.00 0.00 ? 204 ASN B C    2  
ATOM 5517  O O    . ASN B 2 4   ? -5.153  -16.838 1.911   1.00 0.00 ? 204 ASN B O    2  
ATOM 5518  C CB   . ASN B 2 4   ? -7.410  -19.267 2.591   1.00 0.00 ? 204 ASN B CB   2  
ATOM 5519  C CG   . ASN B 2 4   ? -6.541  -19.983 1.575   1.00 0.00 ? 204 ASN B CG   2  
ATOM 5520  O OD1  . ASN B 2 4   ? -5.358  -20.229 1.815   1.00 0.00 ? 204 ASN B OD1  2  
ATOM 5521  N ND2  . ASN B 2 4   ? -7.115  -20.310 0.433   1.00 0.00 ? 204 ASN B ND2  2  
ATOM 5522  H H    . ASN B 2 4   ? -8.308  -18.025 4.620   1.00 0.00 ? 204 ASN B H    2  
ATOM 5523  H HA   . ASN B 2 4   ? -5.750  -18.495 3.685   1.00 0.00 ? 204 ASN B HA   2  
ATOM 5524  H HB2  . ASN B 2 4   ? -7.721  -19.981 3.339   1.00 0.00 ? 204 ASN B HB2  2  
ATOM 5525  H HB3  . ASN B 2 4   ? -8.281  -18.877 2.085   1.00 0.00 ? 204 ASN B HB3  2  
ATOM 5526  H HD21 . ASN B 2 4   ? -8.065  -20.075 0.306   1.00 0.00 ? 204 ASN B HD21 2  
ATOM 5527  H HD22 . ASN B 2 4   ? -6.571  -20.768 -0.249  1.00 0.00 ? 204 ASN B HD22 2  
ATOM 5528  N N    . ILE B 2 5   ? -7.342  -16.372 1.704   1.00 0.00 ? 205 ILE B N    2  
ATOM 5529  C CA   . ILE B 2 5   ? -7.127  -15.338 0.695   1.00 0.00 ? 205 ILE B CA   2  
ATOM 5530  C C    . ILE B 2 5   ? -6.363  -14.154 1.281   1.00 0.00 ? 205 ILE B C    2  
ATOM 5531  O O    . ILE B 2 5   ? -5.387  -13.679 0.696   1.00 0.00 ? 205 ILE B O    2  
ATOM 5532  C CB   . ILE B 2 5   ? -8.458  -14.829 0.104   1.00 0.00 ? 205 ILE B CB   2  
ATOM 5533  C CG1  . ILE B 2 5   ? -9.279  -15.990 -0.461  1.00 0.00 ? 205 ILE B CG1  2  
ATOM 5534  C CG2  . ILE B 2 5   ? -8.200  -13.788 -0.981  1.00 0.00 ? 205 ILE B CG2  2  
ATOM 5535  C CD1  . ILE B 2 5   ? -10.663 -15.581 -0.916  1.00 0.00 ? 205 ILE B CD1  2  
ATOM 5536  H H    . ILE B 2 5   ? -8.254  -16.570 2.000   1.00 0.00 ? 205 ILE B H    2  
ATOM 5537  H HA   . ILE B 2 5   ? -6.543  -15.769 -0.107  1.00 0.00 ? 205 ILE B HA   2  
ATOM 5538  H HB   . ILE B 2 5   ? -9.018  -14.353 0.896   1.00 0.00 ? 205 ILE B HB   2  
ATOM 5539  H HG12 . ILE B 2 5   ? -8.761  -16.405 -1.313  1.00 0.00 ? 205 ILE B HG12 2  
ATOM 5540  H HG13 . ILE B 2 5   ? -9.387  -16.753 0.298   1.00 0.00 ? 205 ILE B HG13 2  
ATOM 5541  H HG21 . ILE B 2 5   ? -7.695  -14.255 -1.813  1.00 0.00 ? 205 ILE B HG21 2  
ATOM 5542  H HG22 . ILE B 2 5   ? -7.583  -12.998 -0.584  1.00 0.00 ? 205 ILE B HG22 2  
ATOM 5543  H HG23 . ILE B 2 5   ? -9.142  -13.378 -1.318  1.00 0.00 ? 205 ILE B HG23 2  
ATOM 5544  H HD11 . ILE B 2 5   ? -10.584 -14.784 -1.643  1.00 0.00 ? 205 ILE B HD11 2  
ATOM 5545  H HD12 . ILE B 2 5   ? -11.234 -15.235 -0.066  1.00 0.00 ? 205 ILE B HD12 2  
ATOM 5546  H HD13 . ILE B 2 5   ? -11.161 -16.428 -1.364  1.00 0.00 ? 205 ILE B HD13 2  
ATOM 5547  N N    . ALA B 2 6   ? -6.807  -13.699 2.446   1.00 0.00 ? 206 ALA B N    2  
ATOM 5548  C CA   . ALA B 2 6   ? -6.188  -12.566 3.124   1.00 0.00 ? 206 ALA B CA   2  
ATOM 5549  C C    . ALA B 2 6   ? -4.706  -12.807 3.375   1.00 0.00 ? 206 ALA B C    2  
ATOM 5550  O O    . ALA B 2 6   ? -3.874  -11.936 3.129   1.00 0.00 ? 206 ALA B O    2  
ATOM 5551  C CB   . ALA B 2 6   ? -6.909  -12.289 4.432   1.00 0.00 ? 206 ALA B CB   2  
ATOM 5552  H H    . ALA B 2 6   ? -7.574  -14.141 2.866   1.00 0.00 ? 206 ALA B H    2  
ATOM 5553  H HA   . ALA B 2 6   ? -6.299  -11.698 2.490   1.00 0.00 ? 206 ALA B HA   2  
ATOM 5554  H HB1  . ALA B 2 6   ? -7.957  -12.120 4.236   1.00 0.00 ? 206 ALA B HB1  2  
ATOM 5555  H HB2  . ALA B 2 6   ? -6.486  -11.409 4.898   1.00 0.00 ? 206 ALA B HB2  2  
ATOM 5556  H HB3  . ALA B 2 6   ? -6.796  -13.135 5.093   1.00 0.00 ? 206 ALA B HB3  2  
ATOM 5557  N N    . ARG B 2 7   ? -4.382  -13.998 3.856   1.00 0.00 ? 207 ARG B N    2  
ATOM 5558  C CA   . ARG B 2 7   ? -2.999  -14.359 4.139   1.00 0.00 ? 207 ARG B CA   2  
ATOM 5559  C C    . ARG B 2 7   ? -2.162  -14.329 2.869   1.00 0.00 ? 207 ARG B C    2  
ATOM 5560  O O    . ARG B 2 7   ? -1.007  -13.922 2.892   1.00 0.00 ? 207 ARG B O    2  
ATOM 5561  C CB   . ARG B 2 7   ? -2.922  -15.750 4.776   1.00 0.00 ? 207 ARG B CB   2  
ATOM 5562  C CG   . ARG B 2 7   ? -1.504  -16.204 5.093   1.00 0.00 ? 207 ARG B CG   2  
ATOM 5563  C CD   . ARG B 2 7   ? -1.371  -17.714 4.983   1.00 0.00 ? 207 ARG B CD   2  
ATOM 5564  N NE   . ARG B 2 7   ? -1.609  -18.189 3.620   1.00 0.00 ? 207 ARG B NE   2  
ATOM 5565  C CZ   . ARG B 2 7   ? -2.670  -18.910 3.254   1.00 0.00 ? 207 ARG B CZ   2  
ATOM 5566  N NH1  . ARG B 2 7   ? -3.595  -19.249 4.148   1.00 0.00 ? 207 ARG B NH1  2  
ATOM 5567  N NH2  . ARG B 2 7   ? -2.805  -19.302 1.995   1.00 0.00 ? 207 ARG B NH2  2  
ATOM 5568  H H    . ARG B 2 7   ? -5.093  -14.654 4.033   1.00 0.00 ? 207 ARG B H    2  
ATOM 5569  H HA   . ARG B 2 7   ? -2.606  -13.634 4.837   1.00 0.00 ? 207 ARG B HA   2  
ATOM 5570  H HB2  . ARG B 2 7   ? -3.489  -15.744 5.695   1.00 0.00 ? 207 ARG B HB2  2  
ATOM 5571  H HB3  . ARG B 2 7   ? -3.362  -16.467 4.098   1.00 0.00 ? 207 ARG B HB3  2  
ATOM 5572  H HG2  . ARG B 2 7   ? -0.821  -15.740 4.395   1.00 0.00 ? 207 ARG B HG2  2  
ATOM 5573  H HG3  . ARG B 2 7   ? -1.255  -15.902 6.099   1.00 0.00 ? 207 ARG B HG3  2  
ATOM 5574  H HD2  . ARG B 2 7   ? -0.372  -17.997 5.281   1.00 0.00 ? 207 ARG B HD2  2  
ATOM 5575  H HD3  . ARG B 2 7   ? -2.089  -18.177 5.644   1.00 0.00 ? 207 ARG B HD3  2  
ATOM 5576  H HE   . ARG B 2 7   ? -0.932  -17.954 2.936   1.00 0.00 ? 207 ARG B HE   2  
ATOM 5577  H HH11 . ARG B 2 7   ? -3.505  -18.964 5.113   1.00 0.00 ? 207 ARG B HH11 2  
ATOM 5578  H HH12 . ARG B 2 7   ? -4.386  -19.793 3.865   1.00 0.00 ? 207 ARG B HH12 2  
ATOM 5579  H HH21 . ARG B 2 7   ? -2.105  -19.064 1.309   1.00 0.00 ? 207 ARG B HH21 2  
ATOM 5580  H HH22 . ARG B 2 7   ? -3.617  -19.829 1.716   1.00 0.00 ? 207 ARG B HH22 2  
ATOM 5581  N N    . HIS B 2 8   ? -2.760  -14.744 1.761   1.00 0.00 ? 208 HIS B N    2  
ATOM 5582  C CA   . HIS B 2 8   ? -2.060  -14.773 0.486   1.00 0.00 ? 208 HIS B CA   2  
ATOM 5583  C C    . HIS B 2 8   ? -1.599  -13.376 0.074   1.00 0.00 ? 208 HIS B C    2  
ATOM 5584  O O    . HIS B 2 8   ? -0.409  -13.153 -0.152  1.00 0.00 ? 208 HIS B O    2  
ATOM 5585  C CB   . HIS B 2 8   ? -2.950  -15.371 -0.605  1.00 0.00 ? 208 HIS B CB   2  
ATOM 5586  C CG   . HIS B 2 8   ? -2.224  -15.602 -1.892  1.00 0.00 ? 208 HIS B CG   2  
ATOM 5587  N ND1  . HIS B 2 8   ? -2.477  -14.885 -3.040  1.00 0.00 ? 208 HIS B ND1  2  
ATOM 5588  C CD2  . HIS B 2 8   ? -1.231  -16.468 -2.202  1.00 0.00 ? 208 HIS B CD2  2  
ATOM 5589  C CE1  . HIS B 2 8   ? -1.669  -15.298 -4.000  1.00 0.00 ? 208 HIS B CE1  2  
ATOM 5590  N NE2  . HIS B 2 8   ? -0.905  -16.257 -3.515  1.00 0.00 ? 208 HIS B NE2  2  
ATOM 5591  H H    . HIS B 2 8   ? -3.697  -15.041 1.802   1.00 0.00 ? 208 HIS B H    2  
ATOM 5592  H HA   . HIS B 2 8   ? -1.189  -15.399 0.607   1.00 0.00 ? 208 HIS B HA   2  
ATOM 5593  H HB2  . HIS B 2 8   ? -3.338  -16.320 -0.266  1.00 0.00 ? 208 HIS B HB2  2  
ATOM 5594  H HB3  . HIS B 2 8   ? -3.772  -14.698 -0.800  1.00 0.00 ? 208 HIS B HB3  2  
ATOM 5595  H HD1  . HIS B 2 8   ? -3.155  -14.173 -3.139  1.00 0.00 ? 208 HIS B HD1  2  
ATOM 5596  H HD2  . HIS B 2 8   ? -0.784  -17.196 -1.540  1.00 0.00 ? 208 HIS B HD2  2  
ATOM 5597  H HE1  . HIS B 2 8   ? -1.643  -14.922 -5.011  1.00 0.00 ? 208 HIS B HE1  2  
ATOM 5598  H HE2  . HIS B 2 8   ? -0.197  -16.734 -4.014  1.00 0.00 ? 208 HIS B HE2  2  
ATOM 5599  N N    . LEU B 2 9   ? -2.542  -12.440 -0.004  1.00 0.00 ? 209 LEU B N    2  
ATOM 5600  C CA   . LEU B 2 9   ? -2.227  -11.070 -0.405  1.00 0.00 ? 209 LEU B CA   2  
ATOM 5601  C C    . LEU B 2 9   ? -1.335  -10.378 0.622   1.00 0.00 ? 209 LEU B C    2  
ATOM 5602  O O    . LEU B 2 9   ? -0.463  -9.583  0.264   1.00 0.00 ? 209 LEU B O    2  
ATOM 5603  C CB   . LEU B 2 9   ? -3.511  -10.259 -0.636  1.00 0.00 ? 209 LEU B CB   2  
ATOM 5604  C CG   . LEU B 2 9   ? -4.532  -10.284 0.504   1.00 0.00 ? 209 LEU B CG   2  
ATOM 5605  C CD1  . LEU B 2 9   ? -4.453  -9.006  1.331   1.00 0.00 ? 209 LEU B CD1  2  
ATOM 5606  C CD2  . LEU B 2 9   ? -5.934  -10.479 -0.051  1.00 0.00 ? 209 LEU B CD2  2  
ATOM 5607  H H    . LEU B 2 9   ? -3.470  -12.675 0.213   1.00 0.00 ? 209 LEU B H    2  
ATOM 5608  H HA   . LEU B 2 9   ? -1.686  -11.128 -1.338  1.00 0.00 ? 209 LEU B HA   2  
ATOM 5609  H HB2  . LEU B 2 9   ? -3.230  -9.232  -0.814  1.00 0.00 ? 209 LEU B HB2  2  
ATOM 5610  H HB3  . LEU B 2 9   ? -3.993  -10.640 -1.526  1.00 0.00 ? 209 LEU B HB3  2  
ATOM 5611  H HG   . LEU B 2 9   ? -4.313  -11.114 1.158   1.00 0.00 ? 209 LEU B HG   2  
ATOM 5612  H HD11 . LEU B 2 9   ? -4.611  -8.151  0.690   1.00 0.00 ? 209 LEU B HD11 2  
ATOM 5613  H HD12 . LEU B 2 9   ? -3.478  -8.934  1.790   1.00 0.00 ? 209 LEU B HD12 2  
ATOM 5614  H HD13 . LEU B 2 9   ? -5.213  -9.024  2.100   1.00 0.00 ? 209 LEU B HD13 2  
ATOM 5615  H HD21 . LEU B 2 9   ? -6.152  -9.698  -0.765  1.00 0.00 ? 209 LEU B HD21 2  
ATOM 5616  H HD22 . LEU B 2 9   ? -6.651  -10.437 0.757   1.00 0.00 ? 209 LEU B HD22 2  
ATOM 5617  H HD23 . LEU B 2 9   ? -5.997  -11.440 -0.538  1.00 0.00 ? 209 LEU B HD23 2  
ATOM 5618  N N    . ALA B 2 10  ? -1.540  -10.693 1.890   1.00 0.00 ? 210 ALA B N    2  
ATOM 5619  C CA   . ALA B 2 10  ? -0.749  -10.094 2.951   1.00 0.00 ? 210 ALA B CA   2  
ATOM 5620  C C    . ALA B 2 10  ? 0.685   -10.600 2.917   1.00 0.00 ? 210 ALA B C    2  
ATOM 5621  O O    . ALA B 2 10  ? 1.626   -9.823  3.049   1.00 0.00 ? 210 ALA B O    2  
ATOM 5622  C CB   . ALA B 2 10  ? -1.377  -10.378 4.308   1.00 0.00 ? 210 ALA B CB   2  
ATOM 5623  H H    . ALA B 2 10  ? -2.244  -11.339 2.119   1.00 0.00 ? 210 ALA B H    2  
ATOM 5624  H HA   . ALA B 2 10  ? -0.747  -9.024  2.800   1.00 0.00 ? 210 ALA B HA   2  
ATOM 5625  H HB1  . ALA B 2 10  ? -2.391  -10.013 4.318   1.00 0.00 ? 210 ALA B HB1  2  
ATOM 5626  H HB2  . ALA B 2 10  ? -0.807  -9.881  5.079   1.00 0.00 ? 210 ALA B HB2  2  
ATOM 5627  H HB3  . ALA B 2 10  ? -1.375  -11.444 4.490   1.00 0.00 ? 210 ALA B HB3  2  
ATOM 5628  N N    . GLN B 2 11  ? 0.841   -11.901 2.711   1.00 0.00 ? 211 GLN B N    2  
ATOM 5629  C CA   . GLN B 2 11  ? 2.156   -12.524 2.681   1.00 0.00 ? 211 GLN B CA   2  
ATOM 5630  C C    . GLN B 2 11  ? 2.989   -12.032 1.502   1.00 0.00 ? 211 GLN B C    2  
ATOM 5631  O O    . GLN B 2 11  ? 4.146   -11.646 1.677   1.00 0.00 ? 211 GLN B O    2  
ATOM 5632  C CB   . GLN B 2 11  ? 2.029   -14.045 2.620   1.00 0.00 ? 211 GLN B CB   2  
ATOM 5633  C CG   . GLN B 2 11  ? 2.937   -14.766 3.598   1.00 0.00 ? 211 GLN B CG   2  
ATOM 5634  C CD   . GLN B 2 11  ? 2.944   -16.266 3.390   1.00 0.00 ? 211 GLN B CD   2  
ATOM 5635  O OE1  . GLN B 2 11  ? 2.130   -16.989 3.963   1.00 0.00 ? 211 GLN B OE1  2  
ATOM 5636  N NE2  . GLN B 2 11  ? 3.861   -16.743 2.569   1.00 0.00 ? 211 GLN B NE2  2  
ATOM 5637  H H    . GLN B 2 11  ? 0.043   -12.463 2.577   1.00 0.00 ? 211 GLN B H    2  
ATOM 5638  H HA   . GLN B 2 11  ? 2.665   -12.257 3.595   1.00 0.00 ? 211 GLN B HA   2  
ATOM 5639  H HB2  . GLN B 2 11  ? 1.007   -14.319 2.842   1.00 0.00 ? 211 GLN B HB2  2  
ATOM 5640  H HB3  . GLN B 2 11  ? 2.273   -14.377 1.623   1.00 0.00 ? 211 GLN B HB3  2  
ATOM 5641  H HG2  . GLN B 2 11  ? 3.945   -14.398 3.472   1.00 0.00 ? 211 GLN B HG2  2  
ATOM 5642  H HG3  . GLN B 2 11  ? 2.602   -14.558 4.604   1.00 0.00 ? 211 GLN B HG3  2  
ATOM 5643  H HE21 . GLN B 2 11  ? 4.481   -16.106 2.141   1.00 0.00 ? 211 GLN B HE21 2  
ATOM 5644  H HE22 . GLN B 2 11  ? 3.889   -17.712 2.416   1.00 0.00 ? 211 GLN B HE22 2  
ATOM 5645  N N    . VAL B 2 12  ? 2.408   -12.041 0.304   1.00 0.00 ? 212 VAL B N    2  
ATOM 5646  C CA   . VAL B 2 12  ? 3.137   -11.603 -0.884  1.00 0.00 ? 212 VAL B CA   2  
ATOM 5647  C C    . VAL B 2 12  ? 3.529   -10.131 -0.786  1.00 0.00 ? 212 VAL B C    2  
ATOM 5648  O O    . VAL B 2 12  ? 4.664   -9.772  -1.077  1.00 0.00 ? 212 VAL B O    2  
ATOM 5649  C CB   . VAL B 2 12  ? 2.348   -11.852 -2.194  1.00 0.00 ? 212 VAL B CB   2  
ATOM 5650  C CG1  . VAL B 2 12  ? 2.188   -13.345 -2.445  1.00 0.00 ? 212 VAL B CG1  2  
ATOM 5651  C CG2  . VAL B 2 12  ? 0.991   -11.164 -2.169  1.00 0.00 ? 212 VAL B CG2  2  
ATOM 5652  H H    . VAL B 2 12  ? 1.478   -12.347 0.216   1.00 0.00 ? 212 VAL B H    2  
ATOM 5653  H HA   . VAL B 2 12  ? 4.046   -12.187 -0.933  1.00 0.00 ? 212 VAL B HA   2  
ATOM 5654  H HB   . VAL B 2 12  ? 2.919   -11.438 -3.012  1.00 0.00 ? 212 VAL B HB   2  
ATOM 5655  H HG11 . VAL B 2 12  ? 1.625   -13.499 -3.353  1.00 0.00 ? 212 VAL B HG11 2  
ATOM 5656  H HG12 . VAL B 2 12  ? 1.665   -13.795 -1.616  1.00 0.00 ? 212 VAL B HG12 2  
ATOM 5657  H HG13 . VAL B 2 12  ? 3.164   -13.799 -2.545  1.00 0.00 ? 212 VAL B HG13 2  
ATOM 5658  H HG21 . VAL B 2 12  ? 0.405   -11.552 -1.350  1.00 0.00 ? 212 VAL B HG21 2  
ATOM 5659  H HG22 . VAL B 2 12  ? 0.475   -11.349 -3.099  1.00 0.00 ? 212 VAL B HG22 2  
ATOM 5660  H HG23 . VAL B 2 12  ? 1.129   -10.099 -2.040  1.00 0.00 ? 212 VAL B HG23 2  
ATOM 5661  N N    . GLY B 2 13  ? 2.603   -9.290  -0.345  1.00 0.00 ? 213 GLY B N    2  
ATOM 5662  C CA   . GLY B 2 13  ? 2.891   -7.874  -0.225  1.00 0.00 ? 213 GLY B CA   2  
ATOM 5663  C C    . GLY B 2 13  ? 3.895   -7.580  0.871   1.00 0.00 ? 213 GLY B C    2  
ATOM 5664  O O    . GLY B 2 13  ? 4.766   -6.727  0.715   1.00 0.00 ? 213 GLY B O    2  
ATOM 5665  H H    . GLY B 2 13  ? 1.716   -9.634  -0.098  1.00 0.00 ? 213 GLY B H    2  
ATOM 5666  H HA2  . GLY B 2 13  ? 3.284   -7.517  -1.165  1.00 0.00 ? 213 GLY B HA2  2  
ATOM 5667  H HA3  . GLY B 2 13  ? 1.971   -7.350  -0.008  1.00 0.00 ? 213 GLY B HA3  2  
ATOM 5668  N N    . ASP B 2 14  ? 3.782   -8.303  1.977   1.00 0.00 ? 214 ASP B N    2  
ATOM 5669  C CA   . ASP B 2 14  ? 4.674   -8.117  3.115   1.00 0.00 ? 214 ASP B CA   2  
ATOM 5670  C C    . ASP B 2 14  ? 6.099   -8.534  2.776   1.00 0.00 ? 214 ASP B C    2  
ATOM 5671  O O    . ASP B 2 14  ? 7.044   -7.777  2.987   1.00 0.00 ? 214 ASP B O    2  
ATOM 5672  C CB   . ASP B 2 14  ? 4.185   -8.937  4.311   1.00 0.00 ? 214 ASP B CB   2  
ATOM 5673  C CG   . ASP B 2 14  ? 4.502   -8.285  5.639   1.00 0.00 ? 214 ASP B CG   2  
ATOM 5674  O OD1  . ASP B 2 14  ? 5.611   -7.727  5.789   1.00 0.00 ? 214 ASP B OD1  2  
ATOM 5675  O OD2  . ASP B 2 14  ? 3.636   -8.320  6.538   1.00 0.00 ? 214 ASP B OD2  2  
ATOM 5676  H H    . ASP B 2 14  ? 3.070   -8.977  2.035   1.00 0.00 ? 214 ASP B H    2  
ATOM 5677  H HA   . ASP B 2 14  ? 4.667   -7.070  3.382   1.00 0.00 ? 214 ASP B HA   2  
ATOM 5678  H HB2  . ASP B 2 14  ? 3.115   -9.061  4.240   1.00 0.00 ? 214 ASP B HB2  2  
ATOM 5679  H HB3  . ASP B 2 14  ? 4.656   -9.909  4.286   1.00 0.00 ? 214 ASP B HB3  2  
ATOM 5680  N N    . SER B 2 15  ? 6.239   -9.734  2.229   1.00 0.00 ? 215 SER B N    2  
ATOM 5681  C CA   . SER B 2 15  ? 7.551   -10.274 1.889   1.00 0.00 ? 215 SER B CA   2  
ATOM 5682  C C    . SER B 2 15  ? 8.200   -9.545  0.714   1.00 0.00 ? 215 SER B C    2  
ATOM 5683  O O    . SER B 2 15  ? 9.357   -9.139  0.801   1.00 0.00 ? 215 SER B O    2  
ATOM 5684  C CB   . SER B 2 15  ? 7.438   -11.765 1.566   1.00 0.00 ? 215 SER B CB   2  
ATOM 5685  O OG   . SER B 2 15  ? 6.565   -12.421 2.474   1.00 0.00 ? 215 SER B OG   2  
ATOM 5686  H H    . SER B 2 15  ? 5.436   -10.270 2.047   1.00 0.00 ? 215 SER B H    2  
ATOM 5687  H HA   . SER B 2 15  ? 8.183   -10.158 2.756   1.00 0.00 ? 215 SER B HA   2  
ATOM 5688  H HB2  . SER B 2 15  ? 7.052   -11.886 0.565   1.00 0.00 ? 215 SER B HB2  2  
ATOM 5689  H HB3  . SER B 2 15  ? 8.416   -12.220 1.633   1.00 0.00 ? 215 SER B HB3  2  
ATOM 5690  H HG   . SER B 2 15  ? 5.661   -12.092 2.344   1.00 0.00 ? 215 SER B HG   2  
ATOM 5691  N N    . MET B 2 16  ? 7.453   -9.365  -0.372  1.00 0.00 ? 216 MET B N    2  
ATOM 5692  C CA   . MET B 2 16  ? 7.983   -8.717  -1.574  1.00 0.00 ? 216 MET B CA   2  
ATOM 5693  C C    . MET B 2 16  ? 8.452   -7.293  -1.302  1.00 0.00 ? 216 MET B C    2  
ATOM 5694  O O    . MET B 2 16  ? 9.456   -6.856  -1.859  1.00 0.00 ? 216 MET B O    2  
ATOM 5695  C CB   . MET B 2 16  ? 6.947   -8.727  -2.698  1.00 0.00 ? 216 MET B CB   2  
ATOM 5696  C CG   . MET B 2 16  ? 6.963   -10.004 -3.531  1.00 0.00 ? 216 MET B CG   2  
ATOM 5697  S SD   . MET B 2 16  ? 6.994   -11.508 -2.528  1.00 0.00 ? 216 MET B SD   2  
ATOM 5698  C CE   . MET B 2 16  ? 6.274   -12.695 -3.659  1.00 0.00 ? 216 MET B CE   2  
ATOM 5699  H H    . MET B 2 16  ? 6.520   -9.675  -0.370  1.00 0.00 ? 216 MET B H    2  
ATOM 5700  H HA   . MET B 2 16  ? 8.838   -9.295  -1.896  1.00 0.00 ? 216 MET B HA   2  
ATOM 5701  H HB2  . MET B 2 16  ? 5.962   -8.615  -2.268  1.00 0.00 ? 216 MET B HB2  2  
ATOM 5702  H HB3  . MET B 2 16  ? 7.139   -7.892  -3.355  1.00 0.00 ? 216 MET B HB3  2  
ATOM 5703  H HG2  . MET B 2 16  ? 6.079   -10.024 -4.152  1.00 0.00 ? 216 MET B HG2  2  
ATOM 5704  H HG3  . MET B 2 16  ? 7.840   -9.991  -4.161  1.00 0.00 ? 216 MET B HG3  2  
ATOM 5705  H HE1  . MET B 2 16  ? 5.272   -12.384 -3.917  1.00 0.00 ? 216 MET B HE1  2  
ATOM 5706  H HE2  . MET B 2 16  ? 6.238   -13.667 -3.188  1.00 0.00 ? 216 MET B HE2  2  
ATOM 5707  H HE3  . MET B 2 16  ? 6.876   -12.751 -4.555  1.00 0.00 ? 216 MET B HE3  2  
ATOM 5708  N N    . ASP B 2 17  ? 7.735   -6.566  -0.460  1.00 0.00 ? 217 ASP B N    2  
ATOM 5709  C CA   . ASP B 2 17  ? 8.129   -5.199  -0.145  1.00 0.00 ? 217 ASP B CA   2  
ATOM 5710  C C    . ASP B 2 17  ? 9.324   -5.194  0.800   1.00 0.00 ? 217 ASP B C    2  
ATOM 5711  O O    . ASP B 2 17  ? 10.187  -4.318  0.723   1.00 0.00 ? 217 ASP B O    2  
ATOM 5712  C CB   . ASP B 2 17  ? 6.971   -4.411  0.464   1.00 0.00 ? 217 ASP B CB   2  
ATOM 5713  C CG   . ASP B 2 17  ? 7.318   -2.945  0.637   1.00 0.00 ? 217 ASP B CG   2  
ATOM 5714  O OD1  . ASP B 2 17  ? 7.807   -2.332  -0.336  1.00 0.00 ? 217 ASP B OD1  2  
ATOM 5715  O OD2  . ASP B 2 17  ? 7.110   -2.411  1.750   1.00 0.00 ? 217 ASP B OD2  2  
ATOM 5716  H H    . ASP B 2 17  ? 6.928   -6.948  -0.049  1.00 0.00 ? 217 ASP B H    2  
ATOM 5717  H HA   . ASP B 2 17  ? 8.422   -4.725  -1.069  1.00 0.00 ? 217 ASP B HA   2  
ATOM 5718  H HB2  . ASP B 2 17  ? 6.109   -4.488  -0.184  1.00 0.00 ? 217 ASP B HB2  2  
ATOM 5719  H HB3  . ASP B 2 17  ? 6.728   -4.822  1.433   1.00 0.00 ? 217 ASP B HB3  2  
ATOM 5720  N N    . ARG B 2 18  ? 9.373   -6.182  1.688   1.00 0.00 ? 218 ARG B N    2  
ATOM 5721  C CA   . ARG B 2 18  ? 10.468  -6.302  2.646   1.00 0.00 ? 218 ARG B CA   2  
ATOM 5722  C C    . ARG B 2 18  ? 11.723  -6.821  1.952   1.00 0.00 ? 218 ARG B C    2  
ATOM 5723  O O    . ARG B 2 18  ? 12.108  -7.983  2.126   1.00 0.00 ? 218 ARG B O    2  
ATOM 5724  C CB   . ARG B 2 18  ? 10.075  -7.236  3.796   1.00 0.00 ? 218 ARG B CB   2  
ATOM 5725  C CG   . ARG B 2 18  ? 10.413  -6.685  5.174   1.00 0.00 ? 218 ARG B CG   2  
ATOM 5726  C CD   . ARG B 2 18  ? 9.783   -5.318  5.404   1.00 0.00 ? 218 ARG B CD   2  
ATOM 5727  N NE   . ARG B 2 18  ? 8.380   -5.283  4.993   1.00 0.00 ? 218 ARG B NE   2  
ATOM 5728  C CZ   . ARG B 2 18  ? 7.883   -4.390  4.137   1.00 0.00 ? 218 ARG B CZ   2  
ATOM 5729  N NH1  . ARG B 2 18  ? 8.654   -3.441  3.627   1.00 0.00 ? 218 ARG B NH1  2  
ATOM 5730  N NH2  . ARG B 2 18  ? 6.614   -4.447  3.778   1.00 0.00 ? 218 ARG B NH2  2  
ATOM 5731  H H    . ARG B 2 18  ? 8.660   -6.853  1.694   1.00 0.00 ? 218 ARG B H    2  
ATOM 5732  H HA   . ARG B 2 18  ? 10.669  -5.318  3.047   1.00 0.00 ? 218 ARG B HA   2  
ATOM 5733  H HB2  . ARG B 2 18  ? 9.009   -7.411  3.754   1.00 0.00 ? 218 ARG B HB2  2  
ATOM 5734  H HB3  . ARG B 2 18  ? 10.590  -8.178  3.670   1.00 0.00 ? 218 ARG B HB3  2  
ATOM 5735  H HG2  . ARG B 2 18  ? 10.047  -7.370  5.925   1.00 0.00 ? 218 ARG B HG2  2  
ATOM 5736  H HG3  . ARG B 2 18  ? 11.485  -6.596  5.261   1.00 0.00 ? 218 ARG B HG3  2  
ATOM 5737  H HD2  . ARG B 2 18  ? 9.845   -5.076  6.456   1.00 0.00 ? 218 ARG B HD2  2  
ATOM 5738  H HD3  . ARG B 2 18  ? 10.334  -4.583  4.834   1.00 0.00 ? 218 ARG B HD3  2  
ATOM 5739  H HE   . ARG B 2 18  ? 7.781   -5.976  5.359   1.00 0.00 ? 218 ARG B HE   2  
ATOM 5740  H HH11 . ARG B 2 18  ? 9.622   -3.376  3.881   1.00 0.00 ? 218 ARG B HH11 2  
ATOM 5741  H HH12 . ARG B 2 18  ? 8.266   -2.787  2.954   1.00 0.00 ? 218 ARG B HH12 2  
ATOM 5742  H HH21 . ARG B 2 18  ? 6.015   -5.161  4.143   1.00 0.00 ? 218 ARG B HH21 2  
ATOM 5743  H HH22 . ARG B 2 18  ? 6.248   -3.768  3.128   1.00 0.00 ? 218 ARG B HH22 2  
ATOM 5744  N N    . SER B 2 19  ? 12.345  -5.950  1.162   1.00 0.00 ? 219 SER B N    2  
ATOM 5745  C CA   . SER B 2 19  ? 13.550  -6.279  0.409   1.00 0.00 ? 219 SER B CA   2  
ATOM 5746  C C    . SER B 2 19  ? 13.246  -7.330  -0.658  1.00 0.00 ? 219 SER B C    2  
ATOM 5747  O O    . SER B 2 19  ? 12.112  -7.795  -0.786  1.00 0.00 ? 219 SER B O    2  
ATOM 5748  C CB   . SER B 2 19  ? 14.655  -6.776  1.343   1.00 0.00 ? 219 SER B CB   2  
ATOM 5749  O OG   . SER B 2 19  ? 14.800  -5.921  2.462   1.00 0.00 ? 219 SER B OG   2  
ATOM 5750  H H    . SER B 2 19  ? 11.968  -5.048  1.072   1.00 0.00 ? 219 SER B H    2  
ATOM 5751  H HA   . SER B 2 19  ? 13.886  -5.378  -0.083  1.00 0.00 ? 219 SER B HA   2  
ATOM 5752  H HB2  . SER B 2 19  ? 14.408  -7.767  1.692   1.00 0.00 ? 219 SER B HB2  2  
ATOM 5753  H HB3  . SER B 2 19  ? 15.592  -6.808  0.804   1.00 0.00 ? 219 SER B HB3  2  
ATOM 5754  H HG   . SER B 2 19  ? 15.749  -5.789  2.641   1.00 0.00 ? 219 SER B HG   2  
ATOM 5755  N N    . ILE B 2 20  ? 14.248  -7.685  -1.433  1.00 0.00 ? 220 ILE B N    2  
ATOM 5756  C CA   . ILE B 2 20  ? 14.085  -8.677  -2.474  1.00 0.00 ? 220 ILE B CA   2  
ATOM 5757  C C    . ILE B 2 20  ? 15.187  -9.725  -2.361  1.00 0.00 ? 220 ILE B C    2  
ATOM 5758  O O    . ILE B 2 20  ? 15.053  -10.811 -2.955  1.00 0.00 ? 220 ILE B O    2  
ATOM 5759  C CB   . ILE B 2 20  ? 14.089  -8.018  -3.876  1.00 0.00 ? 220 ILE B CB   2  
ATOM 5760  C CG1  . ILE B 2 20  ? 13.344  -8.897  -4.878  1.00 0.00 ? 220 ILE B CG1  2  
ATOM 5761  C CG2  . ILE B 2 20  ? 15.508  -7.749  -4.356  1.00 0.00 ? 220 ILE B CG2  2  
ATOM 5762  C CD1  . ILE B 2 20  ? 11.892  -9.125  -4.517  1.00 0.00 ? 220 ILE B CD1  2  
ATOM 5763  O OXT  . ILE B 2 20  ? 16.171  -9.459  -1.636  1.00 0.00 ? 220 ILE B OXT  2  
ATOM 5764  H H    . ILE B 2 20  ? 15.126  -7.267  -1.310  1.00 0.00 ? 220 ILE B H    2  
ATOM 5765  H HA   . ILE B 2 20  ? 13.128  -9.159  -2.325  1.00 0.00 ? 220 ILE B HA   2  
ATOM 5766  H HB   . ILE B 2 20  ? 13.581  -7.068  -3.798  1.00 0.00 ? 220 ILE B HB   2  
ATOM 5767  H HG12 . ILE B 2 20  ? 13.374  -8.429  -5.851  1.00 0.00 ? 220 ILE B HG12 2  
ATOM 5768  H HG13 . ILE B 2 20  ? 13.828  -9.863  -4.931  1.00 0.00 ? 220 ILE B HG13 2  
ATOM 5769  H HG21 . ILE B 2 20  ? 16.005  -7.092  -3.656  1.00 0.00 ? 220 ILE B HG21 2  
ATOM 5770  H HG22 . ILE B 2 20  ? 15.476  -7.281  -5.328  1.00 0.00 ? 220 ILE B HG22 2  
ATOM 5771  H HG23 . ILE B 2 20  ? 16.049  -8.681  -4.422  1.00 0.00 ? 220 ILE B HG23 2  
ATOM 5772  H HD11 . ILE B 2 20  ? 11.832  -9.619  -3.559  1.00 0.00 ? 220 ILE B HD11 2  
ATOM 5773  H HD12 . ILE B 2 20  ? 11.428  -9.744  -5.270  1.00 0.00 ? 220 ILE B HD12 2  
ATOM 5774  H HD13 . ILE B 2 20  ? 11.379  -8.174  -4.466  1.00 0.00 ? 220 ILE B HD13 2  
ATOM 5775  N N    . ALA A 1 1   ? 14.173  19.704  19.262  1.00 0.00 ? 1   ALA A N    3  
ATOM 5776  C CA   . ALA A 1 1   ? 13.260  20.559  18.473  1.00 0.00 ? 1   ALA A CA   3  
ATOM 5777  C C    . ALA A 1 1   ? 12.192  19.713  17.795  1.00 0.00 ? 1   ALA A C    3  
ATOM 5778  O O    . ALA A 1 1   ? 12.480  18.967  16.857  1.00 0.00 ? 1   ALA A O    3  
ATOM 5779  C CB   . ALA A 1 1   ? 14.040  21.358  17.439  1.00 0.00 ? 1   ALA A CB   3  
ATOM 5780  H H1   . ALA A 1 1   ? 14.961  20.270  19.637  1.00 0.00 ? 1   ALA A H1   3  
ATOM 5781  H H2   . ALA A 1 1   ? 14.557  18.939  18.665  1.00 0.00 ? 1   ALA A H2   3  
ATOM 5782  H H3   . ALA A 1 1   ? 13.657  19.275  20.059  1.00 0.00 ? 1   ALA A H3   3  
ATOM 5783  H HA   . ALA A 1 1   ? 12.779  21.257  19.143  1.00 0.00 ? 1   ALA A HA   3  
ATOM 5784  H HB1  . ALA A 1 1   ? 14.793  21.951  17.934  1.00 0.00 ? 1   ALA A HB1  3  
ATOM 5785  H HB2  . ALA A 1 1   ? 13.364  22.011  16.904  1.00 0.00 ? 1   ALA A HB2  3  
ATOM 5786  H HB3  . ALA A 1 1   ? 14.513  20.682  16.744  1.00 0.00 ? 1   ALA A HB3  3  
ATOM 5787  N N    . THR A 1 2   ? 10.960  19.826  18.271  1.00 0.00 ? 2   THR A N    3  
ATOM 5788  C CA   . THR A 1 2   ? 9.855   19.068  17.712  1.00 0.00 ? 2   THR A CA   3  
ATOM 5789  C C    . THR A 1 2   ? 9.226   19.815  16.538  1.00 0.00 ? 2   THR A C    3  
ATOM 5790  O O    . THR A 1 2   ? 8.635   20.881  16.715  1.00 0.00 ? 2   THR A O    3  
ATOM 5791  C CB   . THR A 1 2   ? 8.782   18.806  18.781  1.00 0.00 ? 2   THR A CB   3  
ATOM 5792  O OG1  . THR A 1 2   ? 9.412   18.492  20.031  1.00 0.00 ? 2   THR A OG1  3  
ATOM 5793  C CG2  . THR A 1 2   ? 7.869   17.663  18.370  1.00 0.00 ? 2   THR A CG2  3  
ATOM 5794  H H    . THR A 1 2   ? 10.786  20.442  19.022  1.00 0.00 ? 2   THR A H    3  
ATOM 5795  H HA   . THR A 1 2   ? 10.237  18.120  17.369  1.00 0.00 ? 2   THR A HA   3  
ATOM 5796  H HB   . THR A 1 2   ? 8.188   19.701  18.900  1.00 0.00 ? 2   THR A HB   3  
ATOM 5797  H HG1  . THR A 1 2   ? 10.018  17.749  19.905  1.00 0.00 ? 2   THR A HG1  3  
ATOM 5798  H HG21 . THR A 1 2   ? 8.454   16.765  18.243  1.00 0.00 ? 2   THR A HG21 3  
ATOM 5799  H HG22 . THR A 1 2   ? 7.382   17.910  17.438  1.00 0.00 ? 2   THR A HG22 3  
ATOM 5800  H HG23 . THR A 1 2   ? 7.126   17.504  19.136  1.00 0.00 ? 2   THR A HG23 3  
ATOM 5801  N N    . PRO A 1 3   ? 9.356   19.271  15.321  1.00 0.00 ? 3   PRO A N    3  
ATOM 5802  C CA   . PRO A 1 3   ? 8.798   19.893  14.123  1.00 0.00 ? 3   PRO A CA   3  
ATOM 5803  C C    . PRO A 1 3   ? 7.277   19.779  14.075  1.00 0.00 ? 3   PRO A C    3  
ATOM 5804  O O    . PRO A 1 3   ? 6.707   18.707  14.310  1.00 0.00 ? 3   PRO A O    3  
ATOM 5805  C CB   . PRO A 1 3   ? 9.439   19.107  12.980  1.00 0.00 ? 3   PRO A CB   3  
ATOM 5806  C CG   . PRO A 1 3   ? 9.753   17.774  13.564  1.00 0.00 ? 3   PRO A CG   3  
ATOM 5807  C CD   . PRO A 1 3   ? 10.055  18.010  15.019  1.00 0.00 ? 3   PRO A CD   3  
ATOM 5808  H HA   . PRO A 1 3   ? 9.082   20.933  14.055  1.00 0.00 ? 3   PRO A HA   3  
ATOM 5809  H HB2  . PRO A 1 3   ? 8.739   19.025  12.160  1.00 0.00 ? 3   PRO A HB2  3  
ATOM 5810  H HB3  . PRO A 1 3   ? 10.335  19.614  12.646  1.00 0.00 ? 3   PRO A HB3  3  
ATOM 5811  H HG2  . PRO A 1 3   ? 8.901   17.120  13.461  1.00 0.00 ? 3   PRO A HG2  3  
ATOM 5812  H HG3  . PRO A 1 3   ? 10.613  17.348  13.068  1.00 0.00 ? 3   PRO A HG3  3  
ATOM 5813  H HD2  . PRO A 1 3   ? 9.666   17.202  15.619  1.00 0.00 ? 3   PRO A HD2  3  
ATOM 5814  H HD3  . PRO A 1 3   ? 11.119  18.115  15.172  1.00 0.00 ? 3   PRO A HD3  3  
ATOM 5815  N N    . ALA A 1 4   ? 6.625   20.890  13.783  1.00 0.00 ? 4   ALA A N    3  
ATOM 5816  C CA   . ALA A 1 4   ? 5.175   20.930  13.702  1.00 0.00 ? 4   ALA A CA   3  
ATOM 5817  C C    . ALA A 1 4   ? 4.689   20.478  12.330  1.00 0.00 ? 4   ALA A C    3  
ATOM 5818  O O    . ALA A 1 4   ? 5.288   20.816  11.308  1.00 0.00 ? 4   ALA A O    3  
ATOM 5819  C CB   . ALA A 1 4   ? 4.673   22.331  14.008  1.00 0.00 ? 4   ALA A CB   3  
ATOM 5820  H H    . ALA A 1 4   ? 7.138   21.715  13.615  1.00 0.00 ? 4   ALA A H    3  
ATOM 5821  H HA   . ALA A 1 4   ? 4.779   20.257  14.452  1.00 0.00 ? 4   ALA A HA   3  
ATOM 5822  H HB1  . ALA A 1 4   ? 4.951   22.601  15.017  1.00 0.00 ? 4   ALA A HB1  3  
ATOM 5823  H HB2  . ALA A 1 4   ? 3.597   22.357  13.912  1.00 0.00 ? 4   ALA A HB2  3  
ATOM 5824  H HB3  . ALA A 1 4   ? 5.115   23.030  13.315  1.00 0.00 ? 4   ALA A HB3  3  
ATOM 5825  N N    . SER A 1 5   ? 3.613   19.707  12.318  1.00 0.00 ? 5   SER A N    3  
ATOM 5826  C CA   . SER A 1 5   ? 3.041   19.213  11.076  1.00 0.00 ? 5   SER A CA   3  
ATOM 5827  C C    . SER A 1 5   ? 2.047   20.226  10.517  1.00 0.00 ? 5   SER A C    3  
ATOM 5828  O O    . SER A 1 5   ? 1.035   20.533  11.155  1.00 0.00 ? 5   SER A O    3  
ATOM 5829  C CB   . SER A 1 5   ? 2.346   17.870  11.318  1.00 0.00 ? 5   SER A CB   3  
ATOM 5830  O OG   . SER A 1 5   ? 2.985   17.144  12.356  1.00 0.00 ? 5   SER A OG   3  
ATOM 5831  H H    . SER A 1 5   ? 3.183   19.469  13.170  1.00 0.00 ? 5   SER A H    3  
ATOM 5832  H HA   . SER A 1 5   ? 3.843   19.077  10.367  1.00 0.00 ? 5   SER A HA   3  
ATOM 5833  H HB2  . SER A 1 5   ? 1.317   18.044  11.597  1.00 0.00 ? 5   SER A HB2  3  
ATOM 5834  H HB3  . SER A 1 5   ? 2.378   17.282  10.412  1.00 0.00 ? 5   SER A HB3  3  
ATOM 5835  H HG   . SER A 1 5   ? 3.939   17.321  12.328  1.00 0.00 ? 5   SER A HG   3  
ATOM 5836  N N    . ALA A 1 6   ? 2.342   20.760  9.340   1.00 0.00 ? 6   ALA A N    3  
ATOM 5837  C CA   . ALA A 1 6   ? 1.461   21.738  8.716   1.00 0.00 ? 6   ALA A CA   3  
ATOM 5838  C C    . ALA A 1 6   ? 0.359   21.058  7.895   1.00 0.00 ? 6   ALA A C    3  
ATOM 5839  O O    . ALA A 1 6   ? -0.825  21.235  8.198   1.00 0.00 ? 6   ALA A O    3  
ATOM 5840  C CB   . ALA A 1 6   ? 2.253   22.733  7.874   1.00 0.00 ? 6   ALA A CB   3  
ATOM 5841  H H    . ALA A 1 6   ? 3.174   20.494  8.883   1.00 0.00 ? 6   ALA A H    3  
ATOM 5842  H HA   . ALA A 1 6   ? 0.988   22.292  9.514   1.00 0.00 ? 6   ALA A HA   3  
ATOM 5843  H HB1  . ALA A 1 6   ? 1.586   23.492  7.494   1.00 0.00 ? 6   ALA A HB1  3  
ATOM 5844  H HB2  . ALA A 1 6   ? 2.718   22.216  7.047   1.00 0.00 ? 6   ALA A HB2  3  
ATOM 5845  H HB3  . ALA A 1 6   ? 3.015   23.196  8.483   1.00 0.00 ? 6   ALA A HB3  3  
ATOM 5846  N N    . PRO A 1 7   ? 0.705   20.253  6.862   1.00 0.00 ? 7   PRO A N    3  
ATOM 5847  C CA   . PRO A 1 7   ? -0.299  19.575  6.032   1.00 0.00 ? 7   PRO A CA   3  
ATOM 5848  C C    . PRO A 1 7   ? -1.089  18.541  6.819   1.00 0.00 ? 7   PRO A C    3  
ATOM 5849  O O    . PRO A 1 7   ? -0.527  17.801  7.628   1.00 0.00 ? 7   PRO A O    3  
ATOM 5850  C CB   . PRO A 1 7   ? 0.523   18.892  4.933   1.00 0.00 ? 7   PRO A CB   3  
ATOM 5851  C CG   . PRO A 1 7   ? 1.857   19.553  4.978   1.00 0.00 ? 7   PRO A CG   3  
ATOM 5852  C CD   . PRO A 1 7   ? 2.070   19.929  6.412   1.00 0.00 ? 7   PRO A CD   3  
ATOM 5853  H HA   . PRO A 1 7   ? -0.983  20.282  5.586   1.00 0.00 ? 7   PRO A HA   3  
ATOM 5854  H HB2  . PRO A 1 7   ? 0.598   17.835  5.145   1.00 0.00 ? 7   PRO A HB2  3  
ATOM 5855  H HB3  . PRO A 1 7   ? 0.041   19.040  3.979   1.00 0.00 ? 7   PRO A HB3  3  
ATOM 5856  H HG2  . PRO A 1 7   ? 2.623   18.864  4.652   1.00 0.00 ? 7   PRO A HG2  3  
ATOM 5857  H HG3  . PRO A 1 7   ? 1.853   20.435  4.356   1.00 0.00 ? 7   PRO A HG3  3  
ATOM 5858  H HD2  . PRO A 1 7   ? 2.478   19.096  6.966   1.00 0.00 ? 7   PRO A HD2  3  
ATOM 5859  H HD3  . PRO A 1 7   ? 2.716   20.791  6.486   1.00 0.00 ? 7   PRO A HD3  3  
ATOM 5860  N N    . ASP A 1 8   ? -2.391  18.496  6.580   1.00 0.00 ? 8   ASP A N    3  
ATOM 5861  C CA   . ASP A 1 8   ? -3.265  17.555  7.269   1.00 0.00 ? 8   ASP A CA   3  
ATOM 5862  C C    . ASP A 1 8   ? -3.162  16.161  6.649   1.00 0.00 ? 8   ASP A C    3  
ATOM 5863  O O    . ASP A 1 8   ? -2.775  16.017  5.489   1.00 0.00 ? 8   ASP A O    3  
ATOM 5864  C CB   . ASP A 1 8   ? -4.715  18.054  7.230   1.00 0.00 ? 8   ASP A CB   3  
ATOM 5865  C CG   . ASP A 1 8   ? -5.688  17.061  7.830   1.00 0.00 ? 8   ASP A CG   3  
ATOM 5866  O OD1  . ASP A 1 8   ? -5.649  16.848  9.060   1.00 0.00 ? 8   ASP A OD1  3  
ATOM 5867  O OD2  . ASP A 1 8   ? -6.483  16.475  7.070   1.00 0.00 ? 8   ASP A OD2  3  
ATOM 5868  H H    . ASP A 1 8   ? -2.777  19.113  5.917   1.00 0.00 ? 8   ASP A H    3  
ATOM 5869  H HA   . ASP A 1 8   ? -2.941  17.500  8.298   1.00 0.00 ? 8   ASP A HA   3  
ATOM 5870  H HB2  . ASP A 1 8   ? -4.785  18.977  7.787   1.00 0.00 ? 8   ASP A HB2  3  
ATOM 5871  H HB3  . ASP A 1 8   ? -4.999  18.235  6.203   1.00 0.00 ? 8   ASP A HB3  3  
ATOM 5872  N N    . THR A 1 9   ? -3.508  15.144  7.430   1.00 0.00 ? 9   THR A N    3  
ATOM 5873  C CA   . THR A 1 9   ? -3.462  13.758  6.978   1.00 0.00 ? 9   THR A CA   3  
ATOM 5874  C C    . THR A 1 9   ? -4.336  13.530  5.740   1.00 0.00 ? 9   THR A C    3  
ATOM 5875  O O    . THR A 1 9   ? -3.932  12.837  4.805   1.00 0.00 ? 9   THR A O    3  
ATOM 5876  C CB   . THR A 1 9   ? -3.908  12.812  8.111   1.00 0.00 ? 9   THR A CB   3  
ATOM 5877  O OG1  . THR A 1 9   ? -3.195  13.135  9.314   1.00 0.00 ? 9   THR A OG1  3  
ATOM 5878  C CG2  . THR A 1 9   ? -3.661  11.355  7.744   1.00 0.00 ? 9   THR A CG2  3  
ATOM 5879  H H    . THR A 1 9   ? -3.797  15.330  8.349   1.00 0.00 ? 9   THR A H    3  
ATOM 5880  H HA   . THR A 1 9   ? -2.437  13.524  6.728   1.00 0.00 ? 9   THR A HA   3  
ATOM 5881  H HB   . THR A 1 9   ? -4.967  12.952  8.278   1.00 0.00 ? 9   THR A HB   3  
ATOM 5882  H HG1  . THR A 1 9   ? -2.245  13.197  9.111   1.00 0.00 ? 9   THR A HG1  3  
ATOM 5883  H HG21 . THR A 1 9   ? -4.042  10.718  8.527   1.00 0.00 ? 9   THR A HG21 3  
ATOM 5884  H HG22 . THR A 1 9   ? -2.600  11.188  7.628   1.00 0.00 ? 9   THR A HG22 3  
ATOM 5885  H HG23 . THR A 1 9   ? -4.164  11.125  6.816   1.00 0.00 ? 9   THR A HG23 3  
ATOM 5886  N N    . ARG A 1 10  ? -5.523  14.132  5.720   1.00 0.00 ? 10  ARG A N    3  
ATOM 5887  C CA   . ARG A 1 10  ? -6.434  13.975  4.590   1.00 0.00 ? 10  ARG A CA   3  
ATOM 5888  C C    . ARG A 1 10  ? -5.891  14.695  3.360   1.00 0.00 ? 10  ARG A C    3  
ATOM 5889  O O    . ARG A 1 10  ? -6.166  14.301  2.225   1.00 0.00 ? 10  ARG A O    3  
ATOM 5890  C CB   . ARG A 1 10  ? -7.829  14.497  4.945   1.00 0.00 ? 10  ARG A CB   3  
ATOM 5891  C CG   . ARG A 1 10  ? -8.667  13.501  5.739   1.00 0.00 ? 10  ARG A CG   3  
ATOM 5892  C CD   . ARG A 1 10  ? -9.226  14.120  7.011   1.00 0.00 ? 10  ARG A CD   3  
ATOM 5893  N NE   . ARG A 1 10  ? -8.166  14.611  7.891   1.00 0.00 ? 10  ARG A NE   3  
ATOM 5894  C CZ   . ARG A 1 10  ? -7.837  14.054  9.056   1.00 0.00 ? 10  ARG A CZ   3  
ATOM 5895  N NH1  . ARG A 1 10  ? -8.521  13.017  9.525   1.00 0.00 ? 10  ARG A NH1  3  
ATOM 5896  N NH2  . ARG A 1 10  ? -6.841  14.564  9.766   1.00 0.00 ? 10  ARG A NH2  3  
ATOM 5897  H H    . ARG A 1 10  ? -5.788  14.705  6.474   1.00 0.00 ? 10  ARG A H    3  
ATOM 5898  H HA   . ARG A 1 10  ? -6.503  12.920  4.371   1.00 0.00 ? 10  ARG A HA   3  
ATOM 5899  H HB2  . ARG A 1 10  ? -7.724  15.397  5.535   1.00 0.00 ? 10  ARG A HB2  3  
ATOM 5900  H HB3  . ARG A 1 10  ? -8.357  14.733  4.033   1.00 0.00 ? 10  ARG A HB3  3  
ATOM 5901  H HG2  . ARG A 1 10  ? -9.490  13.171  5.123   1.00 0.00 ? 10  ARG A HG2  3  
ATOM 5902  H HG3  . ARG A 1 10  ? -8.051  12.654  6.002   1.00 0.00 ? 10  ARG A HG3  3  
ATOM 5903  H HD2  . ARG A 1 10  ? -9.870  14.945  6.744   1.00 0.00 ? 10  ARG A HD2  3  
ATOM 5904  H HD3  . ARG A 1 10  ? -9.799  13.373  7.537   1.00 0.00 ? 10  ARG A HD3  3  
ATOM 5905  H HE   . ARG A 1 10  ? -7.660  15.409  7.585   1.00 0.00 ? 10  ARG A HE   3  
ATOM 5906  H HH11 . ARG A 1 10  ? -9.303  12.647  9.007   1.00 0.00 ? 10  ARG A HH11 3  
ATOM 5907  H HH12 . ARG A 1 10  ? -8.266  12.593  10.408  1.00 0.00 ? 10  ARG A HH12 3  
ATOM 5908  H HH21 . ARG A 1 10  ? -6.339  15.375  9.426   1.00 0.00 ? 10  ARG A HH21 3  
ATOM 5909  H HH22 . ARG A 1 10  ? -6.576  14.147  10.647  1.00 0.00 ? 10  ARG A HH22 3  
ATOM 5910  N N    . ALA A 1 11  ? -5.100  15.739  3.594   1.00 0.00 ? 11  ALA A N    3  
ATOM 5911  C CA   . ALA A 1 11  ? -4.503  16.507  2.510   1.00 0.00 ? 11  ALA A CA   3  
ATOM 5912  C C    . ALA A 1 11  ? -3.526  15.645  1.722   1.00 0.00 ? 11  ALA A C    3  
ATOM 5913  O O    . ALA A 1 11  ? -3.376  15.805  0.508   1.00 0.00 ? 11  ALA A O    3  
ATOM 5914  C CB   . ALA A 1 11  ? -3.800  17.740  3.056   1.00 0.00 ? 11  ALA A CB   3  
ATOM 5915  H H    . ALA A 1 11  ? -4.911  15.994  4.521   1.00 0.00 ? 11  ALA A H    3  
ATOM 5916  H HA   . ALA A 1 11  ? -5.297  16.832  1.854   1.00 0.00 ? 11  ALA A HA   3  
ATOM 5917  H HB1  . ALA A 1 11  ? -3.002  17.437  3.718   1.00 0.00 ? 11  ALA A HB1  3  
ATOM 5918  H HB2  . ALA A 1 11  ? -4.508  18.347  3.601   1.00 0.00 ? 11  ALA A HB2  3  
ATOM 5919  H HB3  . ALA A 1 11  ? -3.390  18.314  2.238   1.00 0.00 ? 11  ALA A HB3  3  
ATOM 5920  N N    . LEU A 1 12  ? -2.865  14.727  2.421   1.00 0.00 ? 12  LEU A N    3  
ATOM 5921  C CA   . LEU A 1 12  ? -1.915  13.822  1.787   1.00 0.00 ? 12  LEU A CA   3  
ATOM 5922  C C    . LEU A 1 12  ? -2.660  12.839  0.896   1.00 0.00 ? 12  LEU A C    3  
ATOM 5923  O O    . LEU A 1 12  ? -2.222  12.528  -0.212  1.00 0.00 ? 12  LEU A O    3  
ATOM 5924  C CB   . LEU A 1 12  ? -1.102  13.068  2.845   1.00 0.00 ? 12  LEU A CB   3  
ATOM 5925  C CG   . LEU A 1 12  ? -0.099  13.918  3.626   1.00 0.00 ? 12  LEU A CG   3  
ATOM 5926  C CD1  . LEU A 1 12  ? 0.530   13.104  4.747   1.00 0.00 ? 12  LEU A CD1  3  
ATOM 5927  C CD2  . LEU A 1 12  ? 0.975   14.468  2.697   1.00 0.00 ? 12  LEU A CD2  3  
ATOM 5928  H H    . LEU A 1 12  ? -3.022  14.657  3.386   1.00 0.00 ? 12  LEU A H    3  
ATOM 5929  H HA   . LEU A 1 12  ? -1.248  14.412  1.176   1.00 0.00 ? 12  LEU A HA   3  
ATOM 5930  H HB2  . LEU A 1 12  ? -1.793  12.625  3.549   1.00 0.00 ? 12  LEU A HB2  3  
ATOM 5931  H HB3  . LEU A 1 12  ? -0.560  12.274  2.354   1.00 0.00 ? 12  LEU A HB3  3  
ATOM 5932  H HG   . LEU A 1 12  ? -0.617  14.756  4.073   1.00 0.00 ? 12  LEU A HG   3  
ATOM 5933  H HD11 . LEU A 1 12  ? 1.224   13.723  5.294   1.00 0.00 ? 12  LEU A HD11 3  
ATOM 5934  H HD12 . LEU A 1 12  ? 1.053   12.257  4.328   1.00 0.00 ? 12  LEU A HD12 3  
ATOM 5935  H HD13 . LEU A 1 12  ? -0.244  12.755  5.415   1.00 0.00 ? 12  LEU A HD13 3  
ATOM 5936  H HD21 . LEU A 1 12  ? 1.471   13.649  2.195   1.00 0.00 ? 12  LEU A HD21 3  
ATOM 5937  H HD22 . LEU A 1 12  ? 1.698   15.027  3.271   1.00 0.00 ? 12  LEU A HD22 3  
ATOM 5938  H HD23 . LEU A 1 12  ? 0.519   15.116  1.963   1.00 0.00 ? 12  LEU A HD23 3  
ATOM 5939  N N    . VAL A 1 13  ? -3.803  12.370  1.387   1.00 0.00 ? 13  VAL A N    3  
ATOM 5940  C CA   . VAL A 1 13  ? -4.630  11.431  0.645   1.00 0.00 ? 13  VAL A CA   3  
ATOM 5941  C C    . VAL A 1 13  ? -5.128  12.079  -0.639  1.00 0.00 ? 13  VAL A C    3  
ATOM 5942  O O    . VAL A 1 13  ? -5.033  11.494  -1.720  1.00 0.00 ? 13  VAL A O    3  
ATOM 5943  C CB   . VAL A 1 13  ? -5.839  10.956  1.480   1.00 0.00 ? 13  VAL A CB   3  
ATOM 5944  C CG1  . VAL A 1 13  ? -6.598  9.856   0.750   1.00 0.00 ? 13  VAL A CG1  3  
ATOM 5945  C CG2  . VAL A 1 13  ? -5.394  10.479  2.857   1.00 0.00 ? 13  VAL A CG2  3  
ATOM 5946  H H    . VAL A 1 13  ? -4.099  12.670  2.272   1.00 0.00 ? 13  VAL A H    3  
ATOM 5947  H HA   . VAL A 1 13  ? -4.026  10.571  0.395   1.00 0.00 ? 13  VAL A HA   3  
ATOM 5948  H HB   . VAL A 1 13  ? -6.508  11.794  1.613   1.00 0.00 ? 13  VAL A HB   3  
ATOM 5949  H HG11 . VAL A 1 13  ? -6.962  10.236  -0.193  1.00 0.00 ? 13  VAL A HG11 3  
ATOM 5950  H HG12 . VAL A 1 13  ? -7.433  9.533   1.353   1.00 0.00 ? 13  VAL A HG12 3  
ATOM 5951  H HG13 . VAL A 1 13  ? -5.939  9.021   0.570   1.00 0.00 ? 13  VAL A HG13 3  
ATOM 5952  H HG21 . VAL A 1 13  ? -6.249  10.100  3.401   1.00 0.00 ? 13  VAL A HG21 3  
ATOM 5953  H HG22 . VAL A 1 13  ? -4.961  11.305  3.401   1.00 0.00 ? 13  VAL A HG22 3  
ATOM 5954  H HG23 . VAL A 1 13  ? -4.660  9.695   2.747   1.00 0.00 ? 13  VAL A HG23 3  
ATOM 5955  N N    . ALA A 1 14  ? -5.630  13.302  -0.512  1.00 0.00 ? 14  ALA A N    3  
ATOM 5956  C CA   . ALA A 1 14  ? -6.140  14.049  -1.654  1.00 0.00 ? 14  ALA A CA   3  
ATOM 5957  C C    . ALA A 1 14  ? -5.050  14.263  -2.699  1.00 0.00 ? 14  ALA A C    3  
ATOM 5958  O O    . ALA A 1 14  ? -5.308  14.195  -3.903  1.00 0.00 ? 14  ALA A O    3  
ATOM 5959  C CB   . ALA A 1 14  ? -6.710  15.384  -1.200  1.00 0.00 ? 14  ALA A CB   3  
ATOM 5960  H H    . ALA A 1 14  ? -5.666  13.711  0.380   1.00 0.00 ? 14  ALA A H    3  
ATOM 5961  H HA   . ALA A 1 14  ? -6.940  13.475  -2.096  1.00 0.00 ? 14  ALA A HA   3  
ATOM 5962  H HB1  . ALA A 1 14  ? -7.465  15.217  -0.446  1.00 0.00 ? 14  ALA A HB1  3  
ATOM 5963  H HB2  . ALA A 1 14  ? -7.151  15.894  -2.045  1.00 0.00 ? 14  ALA A HB2  3  
ATOM 5964  H HB3  . ALA A 1 14  ? -5.918  15.992  -0.787  1.00 0.00 ? 14  ALA A HB3  3  
ATOM 5965  N N    . ASP A 1 15  ? -3.832  14.518  -2.233  1.00 0.00 ? 15  ASP A N    3  
ATOM 5966  C CA   . ASP A 1 15  ? -2.698  14.731  -3.127  1.00 0.00 ? 15  ASP A CA   3  
ATOM 5967  C C    . ASP A 1 15  ? -2.356  13.446  -3.873  1.00 0.00 ? 15  ASP A C    3  
ATOM 5968  O O    . ASP A 1 15  ? -2.111  13.467  -5.079  1.00 0.00 ? 15  ASP A O    3  
ATOM 5969  C CB   . ASP A 1 15  ? -1.477  15.220  -2.340  1.00 0.00 ? 15  ASP A CB   3  
ATOM 5970  C CG   . ASP A 1 15  ? -0.213  15.245  -3.178  1.00 0.00 ? 15  ASP A CG   3  
ATOM 5971  O OD1  . ASP A 1 15  ? -0.089  16.127  -4.055  1.00 0.00 ? 15  ASP A OD1  3  
ATOM 5972  O OD2  . ASP A 1 15  ? 0.669   14.391  -2.959  1.00 0.00 ? 15  ASP A OD2  3  
ATOM 5973  H H    . ASP A 1 15  ? -3.691  14.567  -1.262  1.00 0.00 ? 15  ASP A H    3  
ATOM 5974  H HA   . ASP A 1 15  ? -2.980  15.487  -3.844  1.00 0.00 ? 15  ASP A HA   3  
ATOM 5975  H HB2  . ASP A 1 15  ? -1.665  16.220  -1.978  1.00 0.00 ? 15  ASP A HB2  3  
ATOM 5976  H HB3  . ASP A 1 15  ? -1.317  14.562  -1.499  1.00 0.00 ? 15  ASP A HB3  3  
ATOM 5977  N N    . PHE A 1 16  ? -2.360  12.331  -3.151  1.00 0.00 ? 16  PHE A N    3  
ATOM 5978  C CA   . PHE A 1 16  ? -2.048  11.035  -3.743  1.00 0.00 ? 16  PHE A CA   3  
ATOM 5979  C C    . PHE A 1 16  ? -3.103  10.641  -4.776  1.00 0.00 ? 16  PHE A C    3  
ATOM 5980  O O    . PHE A 1 16  ? -2.769  10.248  -5.896  1.00 0.00 ? 16  PHE A O    3  
ATOM 5981  C CB   . PHE A 1 16  ? -1.948  9.964   -2.656  1.00 0.00 ? 16  PHE A CB   3  
ATOM 5982  C CG   . PHE A 1 16  ? -1.439  8.641   -3.156  1.00 0.00 ? 16  PHE A CG   3  
ATOM 5983  C CD1  . PHE A 1 16  ? -0.145  8.521   -3.638  1.00 0.00 ? 16  PHE A CD1  3  
ATOM 5984  C CD2  . PHE A 1 16  ? -2.254  7.520   -3.151  1.00 0.00 ? 16  PHE A CD2  3  
ATOM 5985  C CE1  . PHE A 1 16  ? 0.326   7.308   -4.104  1.00 0.00 ? 16  PHE A CE1  3  
ATOM 5986  C CE2  . PHE A 1 16  ? -1.789  6.305   -3.615  1.00 0.00 ? 16  PHE A CE2  3  
ATOM 5987  C CZ   . PHE A 1 16  ? -0.497  6.199   -4.092  1.00 0.00 ? 16  PHE A CZ   3  
ATOM 5988  H H    . PHE A 1 16  ? -2.577  12.381  -2.194  1.00 0.00 ? 16  PHE A H    3  
ATOM 5989  H HA   . PHE A 1 16  ? -1.092  11.119  -4.239  1.00 0.00 ? 16  PHE A HA   3  
ATOM 5990  H HB2  . PHE A 1 16  ? -1.276  10.308  -1.883  1.00 0.00 ? 16  PHE A HB2  3  
ATOM 5991  H HB3  . PHE A 1 16  ? -2.927  9.803   -2.230  1.00 0.00 ? 16  PHE A HB3  3  
ATOM 5992  H HD1  . PHE A 1 16  ? 0.498   9.388   -3.649  1.00 0.00 ? 16  PHE A HD1  3  
ATOM 5993  H HD2  . PHE A 1 16  ? -3.264  7.601   -2.777  1.00 0.00 ? 16  PHE A HD2  3  
ATOM 5994  H HE1  . PHE A 1 16  ? 1.338   7.229   -4.476  1.00 0.00 ? 16  PHE A HE1  3  
ATOM 5995  H HE2  . PHE A 1 16  ? -2.434  5.439   -3.606  1.00 0.00 ? 16  PHE A HE2  3  
ATOM 5996  H HZ   . PHE A 1 16  ? -0.133  5.249   -4.456  1.00 0.00 ? 16  PHE A HZ   3  
ATOM 5997  N N    . VAL A 1 17  ? -4.374  10.754  -4.398  1.00 0.00 ? 17  VAL A N    3  
ATOM 5998  C CA   . VAL A 1 17  ? -5.472  10.416  -5.302  1.00 0.00 ? 17  VAL A CA   3  
ATOM 5999  C C    . VAL A 1 17  ? -5.453  11.329  -6.524  1.00 0.00 ? 17  VAL A C    3  
ATOM 6000  O O    . VAL A 1 17  ? -5.579  10.864  -7.659  1.00 0.00 ? 17  VAL A O    3  
ATOM 6001  C CB   . VAL A 1 17  ? -6.845  10.510  -4.601  1.00 0.00 ? 17  VAL A CB   3  
ATOM 6002  C CG1  . VAL A 1 17  ? -7.977  10.209  -5.573  1.00 0.00 ? 17  VAL A CG1  3  
ATOM 6003  C CG2  . VAL A 1 17  ? -6.902  9.559   -3.417  1.00 0.00 ? 17  VAL A CG2  3  
ATOM 6004  H H    . VAL A 1 17  ? -4.578  11.067  -3.487  1.00 0.00 ? 17  VAL A H    3  
ATOM 6005  H HA   . VAL A 1 17  ? -5.327  9.395   -5.627  1.00 0.00 ? 17  VAL A HA   3  
ATOM 6006  H HB   . VAL A 1 17  ? -6.972  11.517  -4.235  1.00 0.00 ? 17  VAL A HB   3  
ATOM 6007  H HG11 . VAL A 1 17  ? -7.809  9.246   -6.033  1.00 0.00 ? 17  VAL A HG11 3  
ATOM 6008  H HG12 . VAL A 1 17  ? -8.008  10.973  -6.338  1.00 0.00 ? 17  VAL A HG12 3  
ATOM 6009  H HG13 . VAL A 1 17  ? -8.915  10.195  -5.038  1.00 0.00 ? 17  VAL A HG13 3  
ATOM 6010  H HG21 . VAL A 1 17  ? -6.743  8.548   -3.762  1.00 0.00 ? 17  VAL A HG21 3  
ATOM 6011  H HG22 . VAL A 1 17  ? -7.868  9.631   -2.942  1.00 0.00 ? 17  VAL A HG22 3  
ATOM 6012  H HG23 . VAL A 1 17  ? -6.131  9.824   -2.709  1.00 0.00 ? 17  VAL A HG23 3  
ATOM 6013  N N    . GLY A 1 18  ? -5.270  12.626  -6.283  1.00 0.00 ? 18  GLY A N    3  
ATOM 6014  C CA   . GLY A 1 18  ? -5.215  13.586  -7.369  1.00 0.00 ? 18  GLY A CA   3  
ATOM 6015  C C    . GLY A 1 18  ? -4.056  13.302  -8.304  1.00 0.00 ? 18  GLY A C    3  
ATOM 6016  O O    . GLY A 1 18  ? -4.194  13.382  -9.525  1.00 0.00 ? 18  GLY A O    3  
ATOM 6017  H H    . GLY A 1 18  ? -5.175  12.935  -5.355  1.00 0.00 ? 18  GLY A H    3  
ATOM 6018  H HA2  . GLY A 1 18  ? -6.141  13.544  -7.927  1.00 0.00 ? 18  GLY A HA2  3  
ATOM 6019  H HA3  . GLY A 1 18  ? -5.095  14.577  -6.957  1.00 0.00 ? 18  GLY A HA3  3  
ATOM 6020  N N    . TYR A 1 19  ? -2.914  12.948  -7.721  1.00 0.00 ? 19  TYR A N    3  
ATOM 6021  C CA   . TYR A 1 19  ? -1.722  12.627  -8.492  1.00 0.00 ? 19  TYR A CA   3  
ATOM 6022  C C    . TYR A 1 19  ? -1.991  11.421  -9.381  1.00 0.00 ? 19  TYR A C    3  
ATOM 6023  O O    . TYR A 1 19  ? -1.622  11.411  -10.549 1.00 0.00 ? 19  TYR A O    3  
ATOM 6024  C CB   . TYR A 1 19  ? -0.546  12.336  -7.552  1.00 0.00 ? 19  TYR A CB   3  
ATOM 6025  C CG   . TYR A 1 19  ? 0.804   12.291  -8.234  1.00 0.00 ? 19  TYR A CG   3  
ATOM 6026  C CD1  . TYR A 1 19  ? 1.347   13.431  -8.813  1.00 0.00 ? 19  TYR A CD1  3  
ATOM 6027  C CD2  . TYR A 1 19  ? 1.539   11.113  -8.288  1.00 0.00 ? 19  TYR A CD2  3  
ATOM 6028  C CE1  . TYR A 1 19  ? 2.582   13.398  -9.428  1.00 0.00 ? 19  TYR A CE1  3  
ATOM 6029  C CE2  . TYR A 1 19  ? 2.775   11.072  -8.903  1.00 0.00 ? 19  TYR A CE2  3  
ATOM 6030  C CZ   . TYR A 1 19  ? 3.293   12.219  -9.470  1.00 0.00 ? 19  TYR A CZ   3  
ATOM 6031  O OH   . TYR A 1 19  ? 4.526   12.187  -10.081 1.00 0.00 ? 19  TYR A OH   3  
ATOM 6032  H H    . TYR A 1 19  ? -2.872  12.909  -6.739  1.00 0.00 ? 19  TYR A H    3  
ATOM 6033  H HA   . TYR A 1 19  ? -1.483  13.477  -9.112  1.00 0.00 ? 19  TYR A HA   3  
ATOM 6034  H HB2  . TYR A 1 19  ? -0.506  13.103  -6.793  1.00 0.00 ? 19  TYR A HB2  3  
ATOM 6035  H HB3  . TYR A 1 19  ? -0.709  11.379  -7.076  1.00 0.00 ? 19  TYR A HB3  3  
ATOM 6036  H HD1  . TYR A 1 19  ? 0.788   14.354  -8.778  1.00 0.00 ? 19  TYR A HD1  3  
ATOM 6037  H HD2  . TYR A 1 19  ? 1.129   10.217  -7.842  1.00 0.00 ? 19  TYR A HD2  3  
ATOM 6038  H HE1  . TYR A 1 19  ? 2.986   14.295  -9.874  1.00 0.00 ? 19  TYR A HE1  3  
ATOM 6039  H HE2  . TYR A 1 19  ? 3.331   10.146  -8.937  1.00 0.00 ? 19  TYR A HE2  3  
ATOM 6040  H HH   . TYR A 1 19  ? 4.537   11.489  -10.746 1.00 0.00 ? 19  TYR A HH   3  
ATOM 6041  N N    . LYS A 1 20  ? -2.658  10.416  -8.817  1.00 0.00 ? 20  LYS A N    3  
ATOM 6042  C CA   . LYS A 1 20  ? -2.991  9.197   -9.550  1.00 0.00 ? 20  LYS A CA   3  
ATOM 6043  C C    . LYS A 1 20  ? -3.861  9.508   -10.764 1.00 0.00 ? 20  LYS A C    3  
ATOM 6044  O O    . LYS A 1 20  ? -3.620  9.000   -11.859 1.00 0.00 ? 20  LYS A O    3  
ATOM 6045  C CB   . LYS A 1 20  ? -3.720  8.209   -8.637  1.00 0.00 ? 20  LYS A CB   3  
ATOM 6046  C CG   . LYS A 1 20  ? -2.791  7.324   -7.821  1.00 0.00 ? 20  LYS A CG   3  
ATOM 6047  C CD   . LYS A 1 20  ? -2.028  6.351   -8.706  1.00 0.00 ? 20  LYS A CD   3  
ATOM 6048  C CE   . LYS A 1 20  ? -2.970  5.452   -9.494  1.00 0.00 ? 20  LYS A CE   3  
ATOM 6049  N NZ   . LYS A 1 20  ? -2.242  4.609   -10.474 1.00 0.00 ? 20  LYS A NZ   3  
ATOM 6050  H H    . LYS A 1 20  ? -2.936  10.498  -7.877  1.00 0.00 ? 20  LYS A H    3  
ATOM 6051  H HA   . LYS A 1 20  ? -2.068  8.750   -9.886  1.00 0.00 ? 20  LYS A HA   3  
ATOM 6052  H HB2  . LYS A 1 20  ? -4.346  8.763   -7.951  1.00 0.00 ? 20  LYS A HB2  3  
ATOM 6053  H HB3  . LYS A 1 20  ? -4.346  7.572   -9.243  1.00 0.00 ? 20  LYS A HB3  3  
ATOM 6054  H HG2  . LYS A 1 20  ? -2.083  7.950   -7.296  1.00 0.00 ? 20  LYS A HG2  3  
ATOM 6055  H HG3  . LYS A 1 20  ? -3.378  6.765   -7.108  1.00 0.00 ? 20  LYS A HG3  3  
ATOM 6056  H HD2  . LYS A 1 20  ? -1.419  6.912   -9.400  1.00 0.00 ? 20  LYS A HD2  3  
ATOM 6057  H HD3  . LYS A 1 20  ? -1.394  5.735   -8.084  1.00 0.00 ? 20  LYS A HD3  3  
ATOM 6058  H HE2  . LYS A 1 20  ? -3.496  4.810   -8.802  1.00 0.00 ? 20  LYS A HE2  3  
ATOM 6059  H HE3  . LYS A 1 20  ? -3.682  6.071   -10.021 1.00 0.00 ? 20  LYS A HE3  3  
ATOM 6060  H HZ1  . LYS A 1 20  ? -1.526  5.177   -10.977 1.00 0.00 ? 20  LYS A HZ1  3  
ATOM 6061  H HZ2  . LYS A 1 20  ? -2.910  4.214   -11.174 1.00 0.00 ? 20  LYS A HZ2  3  
ATOM 6062  H HZ3  . LYS A 1 20  ? -1.760  3.820   -9.986  1.00 0.00 ? 20  LYS A HZ3  3  
ATOM 6063  N N    . LEU A 1 21  ? -4.866  10.347  -10.558 1.00 0.00 ? 21  LEU A N    3  
ATOM 6064  C CA   . LEU A 1 21  ? -5.778  10.732  -11.628 1.00 0.00 ? 21  LEU A CA   3  
ATOM 6065  C C    . LEU A 1 21  ? -5.047  11.539  -12.695 1.00 0.00 ? 21  LEU A C    3  
ATOM 6066  O O    . LEU A 1 21  ? -5.265  11.349  -13.894 1.00 0.00 ? 21  LEU A O    3  
ATOM 6067  C CB   . LEU A 1 21  ? -6.941  11.549  -11.058 1.00 0.00 ? 21  LEU A CB   3  
ATOM 6068  C CG   . LEU A 1 21  ? -7.986  12.009  -12.076 1.00 0.00 ? 21  LEU A CG   3  
ATOM 6069  C CD1  . LEU A 1 21  ? -8.727  10.818  -12.667 1.00 0.00 ? 21  LEU A CD1  3  
ATOM 6070  C CD2  . LEU A 1 21  ? -8.965  12.976  -11.429 1.00 0.00 ? 21  LEU A CD2  3  
ATOM 6071  H H    . LEU A 1 21  ? -5.000  10.719  -9.659  1.00 0.00 ? 21  LEU A H    3  
ATOM 6072  H HA   . LEU A 1 21  ? -6.165  9.829   -12.076 1.00 0.00 ? 21  LEU A HA   3  
ATOM 6073  H HB2  . LEU A 1 21  ? -7.439  10.949  -10.312 1.00 0.00 ? 21  LEU A HB2  3  
ATOM 6074  H HB3  . LEU A 1 21  ? -6.533  12.425  -10.575 1.00 0.00 ? 21  LEU A HB3  3  
ATOM 6075  H HG   . LEU A 1 21  ? -7.489  12.527  -12.885 1.00 0.00 ? 21  LEU A HG   3  
ATOM 6076  H HD11 . LEU A 1 21  ? -9.225  10.275  -11.877 1.00 0.00 ? 21  LEU A HD11 3  
ATOM 6077  H HD12 . LEU A 1 21  ? -8.024  10.166  -13.165 1.00 0.00 ? 21  LEU A HD12 3  
ATOM 6078  H HD13 . LEU A 1 21  ? -9.458  11.168  -13.379 1.00 0.00 ? 21  LEU A HD13 3  
ATOM 6079  H HD21 . LEU A 1 21  ? -8.427  13.837  -11.059 1.00 0.00 ? 21  LEU A HD21 3  
ATOM 6080  H HD22 . LEU A 1 21  ? -9.466  12.486  -10.610 1.00 0.00 ? 21  LEU A HD22 3  
ATOM 6081  H HD23 . LEU A 1 21  ? -9.695  13.296  -12.159 1.00 0.00 ? 21  LEU A HD23 3  
ATOM 6082  N N    . ARG A 1 22  ? -4.166  12.425  -12.255 1.00 0.00 ? 22  ARG A N    3  
ATOM 6083  C CA   . ARG A 1 22  ? -3.414  13.269  -13.170 1.00 0.00 ? 22  ARG A CA   3  
ATOM 6084  C C    . ARG A 1 22  ? -2.329  12.483  -13.907 1.00 0.00 ? 22  ARG A C    3  
ATOM 6085  O O    . ARG A 1 22  ? -1.998  12.800  -15.042 1.00 0.00 ? 22  ARG A O    3  
ATOM 6086  C CB   . ARG A 1 22  ? -2.795  14.453  -12.419 1.00 0.00 ? 22  ARG A CB   3  
ATOM 6087  C CG   . ARG A 1 22  ? -3.826  15.455  -11.923 1.00 0.00 ? 22  ARG A CG   3  
ATOM 6088  C CD   . ARG A 1 22  ? -3.179  16.750  -11.456 1.00 0.00 ? 22  ARG A CD   3  
ATOM 6089  N NE   . ARG A 1 22  ? -2.366  16.573  -10.254 1.00 0.00 ? 22  ARG A NE   3  
ATOM 6090  C CZ   . ARG A 1 22  ? -2.762  16.904  -9.025  1.00 0.00 ? 22  ARG A CZ   3  
ATOM 6091  N NH1  . ARG A 1 22  ? -3.969  17.421  -8.822  1.00 0.00 ? 22  ARG A NH1  3  
ATOM 6092  N NH2  . ARG A 1 22  ? -1.935  16.734  -8.000  1.00 0.00 ? 22  ARG A NH2  3  
ATOM 6093  H H    . ARG A 1 22  ? -4.021  12.518  -11.287 1.00 0.00 ? 22  ARG A H    3  
ATOM 6094  H HA   . ARG A 1 22  ? -4.110  13.651  -13.900 1.00 0.00 ? 22  ARG A HA   3  
ATOM 6095  H HB2  . ARG A 1 22  ? -2.247  14.077  -11.567 1.00 0.00 ? 22  ARG A HB2  3  
ATOM 6096  H HB3  . ARG A 1 22  ? -2.111  14.967  -13.079 1.00 0.00 ? 22  ARG A HB3  3  
ATOM 6097  H HG2  . ARG A 1 22  ? -4.511  15.678  -12.728 1.00 0.00 ? 22  ARG A HG2  3  
ATOM 6098  H HG3  . ARG A 1 22  ? -4.369  15.018  -11.097 1.00 0.00 ? 22  ARG A HG3  3  
ATOM 6099  H HD2  . ARG A 1 22  ? -2.548  17.128  -12.249 1.00 0.00 ? 22  ARG A HD2  3  
ATOM 6100  H HD3  . ARG A 1 22  ? -3.958  17.469  -11.249 1.00 0.00 ? 22  ARG A HD3  3  
ATOM 6101  H HE   . ARG A 1 22  ? -1.462  16.194  -10.373 1.00 0.00 ? 22  ARG A HE   3  
ATOM 6102  H HH11 . ARG A 1 22  ? -4.598  17.567  -9.597  1.00 0.00 ? 22  ARG A HH11 3  
ATOM 6103  H HH12 . ARG A 1 22  ? -4.266  17.664  -7.886  1.00 0.00 ? 22  ARG A HH12 3  
ATOM 6104  H HH21 . ARG A 1 22  ? -1.017  16.356  -8.154  1.00 0.00 ? 22  ARG A HH21 3  
ATOM 6105  H HH22 . ARG A 1 22  ? -2.220  16.986  -7.065  1.00 0.00 ? 22  ARG A HH22 3  
ATOM 6106  N N    . GLN A 1 23  ? -1.793  11.449  -13.271 1.00 0.00 ? 23  GLN A N    3  
ATOM 6107  C CA   . GLN A 1 23  ? -0.742  10.636  -13.879 1.00 0.00 ? 23  GLN A CA   3  
ATOM 6108  C C    . GLN A 1 23  ? -1.235  9.898   -15.120 1.00 0.00 ? 23  GLN A C    3  
ATOM 6109  O O    . GLN A 1 23  ? -0.459  9.642   -16.045 1.00 0.00 ? 23  GLN A O    3  
ATOM 6110  C CB   . GLN A 1 23  ? -0.177  9.634   -12.869 1.00 0.00 ? 23  GLN A CB   3  
ATOM 6111  C CG   . GLN A 1 23  ? 0.870   10.231  -11.940 1.00 0.00 ? 23  GLN A CG   3  
ATOM 6112  C CD   . GLN A 1 23  ? 1.955   10.981  -12.690 1.00 0.00 ? 23  GLN A CD   3  
ATOM 6113  O OE1  . GLN A 1 23  ? 1.864   12.192  -12.894 1.00 0.00 ? 23  GLN A OE1  3  
ATOM 6114  N NE2  . GLN A 1 23  ? 2.985   10.267  -13.114 1.00 0.00 ? 23  GLN A NE2  3  
ATOM 6115  H H    . GLN A 1 23  ? -2.101  11.233  -12.361 1.00 0.00 ? 23  GLN A H    3  
ATOM 6116  H HA   . GLN A 1 23  ? 0.051   11.306  -14.177 1.00 0.00 ? 23  GLN A HA   3  
ATOM 6117  H HB2  . GLN A 1 23  ? -0.988  9.255   -12.263 1.00 0.00 ? 23  GLN A HB2  3  
ATOM 6118  H HB3  . GLN A 1 23  ? 0.273   8.813   -13.406 1.00 0.00 ? 23  GLN A HB3  3  
ATOM 6119  H HG2  . GLN A 1 23  ? 0.382   10.916  -11.264 1.00 0.00 ? 23  GLN A HG2  3  
ATOM 6120  H HG3  . GLN A 1 23  ? 1.328   9.434   -11.374 1.00 0.00 ? 23  GLN A HG3  3  
ATOM 6121  H HE21 . GLN A 1 23  ? 2.992   9.300   -12.925 1.00 0.00 ? 23  GLN A HE21 3  
ATOM 6122  H HE22 . GLN A 1 23  ? 3.700   10.729  -13.599 1.00 0.00 ? 23  GLN A HE22 3  
ATOM 6123  N N    . LYS A 1 24  ? -2.516  9.558   -15.152 1.00 0.00 ? 24  LYS A N    3  
ATOM 6124  C CA   . LYS A 1 24  ? -3.075  8.845   -16.295 1.00 0.00 ? 24  LYS A CA   3  
ATOM 6125  C C    . LYS A 1 24  ? -3.663  9.821   -17.313 1.00 0.00 ? 24  LYS A C    3  
ATOM 6126  O O    . LYS A 1 24  ? -4.168  9.415   -18.360 1.00 0.00 ? 24  LYS A O    3  
ATOM 6127  C CB   . LYS A 1 24  ? -4.141  7.839   -15.841 1.00 0.00 ? 24  LYS A CB   3  
ATOM 6128  C CG   . LYS A 1 24  ? -5.461  8.471   -15.420 1.00 0.00 ? 24  LYS A CG   3  
ATOM 6129  C CD   . LYS A 1 24  ? -6.483  7.412   -15.029 1.00 0.00 ? 24  LYS A CD   3  
ATOM 6130  C CE   . LYS A 1 24  ? -7.882  7.995   -14.925 1.00 0.00 ? 24  LYS A CE   3  
ATOM 6131  N NZ   . LYS A 1 24  ? -8.661  7.807   -16.177 1.00 0.00 ? 24  LYS A NZ   3  
ATOM 6132  H H    . LYS A 1 24  ? -3.097  9.788   -14.395 1.00 0.00 ? 24  LYS A H    3  
ATOM 6133  H HA   . LYS A 1 24  ? -2.267  8.305   -16.768 1.00 0.00 ? 24  LYS A HA   3  
ATOM 6134  H HB2  . LYS A 1 24  ? -4.339  7.156   -16.653 1.00 0.00 ? 24  LYS A HB2  3  
ATOM 6135  H HB3  . LYS A 1 24  ? -3.753  7.279   -15.003 1.00 0.00 ? 24  LYS A HB3  3  
ATOM 6136  H HG2  . LYS A 1 24  ? -5.286  9.117   -14.573 1.00 0.00 ? 24  LYS A HG2  3  
ATOM 6137  H HG3  . LYS A 1 24  ? -5.852  9.050   -16.243 1.00 0.00 ? 24  LYS A HG3  3  
ATOM 6138  H HD2  . LYS A 1 24  ? -6.486  6.635   -15.779 1.00 0.00 ? 24  LYS A HD2  3  
ATOM 6139  H HD3  . LYS A 1 24  ? -6.204  6.991   -14.074 1.00 0.00 ? 24  LYS A HD3  3  
ATOM 6140  H HE2  . LYS A 1 24  ? -8.402  7.507   -14.114 1.00 0.00 ? 24  LYS A HE2  3  
ATOM 6141  H HE3  . LYS A 1 24  ? -7.805  9.051   -14.717 1.00 0.00 ? 24  LYS A HE3  3  
ATOM 6142  H HZ1  . LYS A 1 24  ? -8.733  6.793   -16.407 1.00 0.00 ? 24  LYS A HZ1  3  
ATOM 6143  H HZ2  . LYS A 1 24  ? -8.199  8.298   -16.972 1.00 0.00 ? 24  LYS A HZ2  3  
ATOM 6144  H HZ3  . LYS A 1 24  ? -9.623  8.192   -16.059 1.00 0.00 ? 24  LYS A HZ3  3  
ATOM 6145  N N    . GLY A 1 25  ? -3.580  11.107  -17.009 1.00 0.00 ? 25  GLY A N    3  
ATOM 6146  C CA   . GLY A 1 25  ? -4.108  12.112  -17.909 1.00 0.00 ? 25  GLY A CA   3  
ATOM 6147  C C    . GLY A 1 25  ? -3.024  13.022  -18.446 1.00 0.00 ? 25  GLY A C    3  
ATOM 6148  O O    . GLY A 1 25  ? -2.784  13.083  -19.655 1.00 0.00 ? 25  GLY A O    3  
ATOM 6149  H H    . GLY A 1 25  ? -3.145  11.378  -16.172 1.00 0.00 ? 25  GLY A H    3  
ATOM 6150  H HA2  . GLY A 1 25  ? -4.594  11.619  -18.737 1.00 0.00 ? 25  GLY A HA2  3  
ATOM 6151  H HA3  . GLY A 1 25  ? -4.833  12.709  -17.378 1.00 0.00 ? 25  GLY A HA3  3  
ATOM 6152  N N    . TYR A 1 26  ? -2.355  13.709  -17.539 1.00 0.00 ? 26  TYR A N    3  
ATOM 6153  C CA   . TYR A 1 26  ? -1.286  14.626  -17.890 1.00 0.00 ? 26  TYR A CA   3  
ATOM 6154  C C    . TYR A 1 26  ? -0.326  14.758  -16.716 1.00 0.00 ? 26  TYR A C    3  
ATOM 6155  O O    . TYR A 1 26  ? -0.654  15.395  -15.711 1.00 0.00 ? 26  TYR A O    3  
ATOM 6156  C CB   . TYR A 1 26  ? -1.859  15.997  -18.259 1.00 0.00 ? 26  TYR A CB   3  
ATOM 6157  C CG   . TYR A 1 26  ? -0.853  16.938  -18.879 1.00 0.00 ? 26  TYR A CG   3  
ATOM 6158  C CD1  . TYR A 1 26  ? -0.392  16.732  -20.170 1.00 0.00 ? 26  TYR A CD1  3  
ATOM 6159  C CD2  . TYR A 1 26  ? -0.372  18.036  -18.177 1.00 0.00 ? 26  TYR A CD2  3  
ATOM 6160  C CE1  . TYR A 1 26  ? 0.521   17.590  -20.745 1.00 0.00 ? 26  TYR A CE1  3  
ATOM 6161  C CE2  . TYR A 1 26  ? 0.540   18.902  -18.747 1.00 0.00 ? 26  TYR A CE2  3  
ATOM 6162  C CZ   . TYR A 1 26  ? 0.982   18.674  -20.031 1.00 0.00 ? 26  TYR A CZ   3  
ATOM 6163  O OH   . TYR A 1 26  ? 1.888   19.534  -20.610 1.00 0.00 ? 26  TYR A OH   3  
ATOM 6164  H H    . TYR A 1 26  ? -2.581  13.590  -16.589 1.00 0.00 ? 26  TYR A H    3  
ATOM 6165  H HA   . TYR A 1 26  ? -0.755  14.219  -18.737 1.00 0.00 ? 26  TYR A HA   3  
ATOM 6166  H HB2  . TYR A 1 26  ? -2.664  15.864  -18.966 1.00 0.00 ? 26  TYR A HB2  3  
ATOM 6167  H HB3  . TYR A 1 26  ? -2.247  16.468  -17.367 1.00 0.00 ? 26  TYR A HB3  3  
ATOM 6168  H HD1  . TYR A 1 26  ? -0.756  15.883  -20.729 1.00 0.00 ? 26  TYR A HD1  3  
ATOM 6169  H HD2  . TYR A 1 26  ? -0.721  18.209  -17.170 1.00 0.00 ? 26  TYR A HD2  3  
ATOM 6170  H HE1  . TYR A 1 26  ? 0.868   17.413  -21.753 1.00 0.00 ? 26  TYR A HE1  3  
ATOM 6171  H HE2  . TYR A 1 26  ? 0.904   19.750  -18.186 1.00 0.00 ? 26  TYR A HE2  3  
ATOM 6172  H HH   . TYR A 1 26  ? 1.721   19.572  -21.568 1.00 0.00 ? 26  TYR A HH   3  
ATOM 6173  N N    . VAL A 1 27  ? 0.839   14.132  -16.835 1.00 0.00 ? 27  VAL A N    3  
ATOM 6174  C CA   . VAL A 1 27  ? 1.845   14.169  -15.782 1.00 0.00 ? 27  VAL A CA   3  
ATOM 6175  C C    . VAL A 1 27  ? 2.207   15.607  -15.433 1.00 0.00 ? 27  VAL A C    3  
ATOM 6176  O O    . VAL A 1 27  ? 2.777   16.337  -16.247 1.00 0.00 ? 27  VAL A O    3  
ATOM 6177  C CB   . VAL A 1 27  ? 3.119   13.397  -16.190 1.00 0.00 ? 27  VAL A CB   3  
ATOM 6178  C CG1  . VAL A 1 27  ? 4.200   13.526  -15.126 1.00 0.00 ? 27  VAL A CG1  3  
ATOM 6179  C CG2  . VAL A 1 27  ? 2.791   11.934  -16.442 1.00 0.00 ? 27  VAL A CG2  3  
ATOM 6180  H H    . VAL A 1 27  ? 1.027   13.631  -17.661 1.00 0.00 ? 27  VAL A H    3  
ATOM 6181  H HA   . VAL A 1 27  ? 1.428   13.694  -14.906 1.00 0.00 ? 27  VAL A HA   3  
ATOM 6182  H HB   . VAL A 1 27  ? 3.494   13.820  -17.109 1.00 0.00 ? 27  VAL A HB   3  
ATOM 6183  H HG11 . VAL A 1 27  ? 3.829   13.146  -14.186 1.00 0.00 ? 27  VAL A HG11 3  
ATOM 6184  H HG12 . VAL A 1 27  ? 4.468   14.567  -15.012 1.00 0.00 ? 27  VAL A HG12 3  
ATOM 6185  H HG13 . VAL A 1 27  ? 5.071   12.963  -15.426 1.00 0.00 ? 27  VAL A HG13 3  
ATOM 6186  H HG21 . VAL A 1 27  ? 2.011   11.864  -17.187 1.00 0.00 ? 27  VAL A HG21 3  
ATOM 6187  H HG22 . VAL A 1 27  ? 2.453   11.479  -15.522 1.00 0.00 ? 27  VAL A HG22 3  
ATOM 6188  H HG23 . VAL A 1 27  ? 3.673   11.422  -16.795 1.00 0.00 ? 27  VAL A HG23 3  
ATOM 6189  N N    . CYS A 1 28  ? 1.861   16.003  -14.220 1.00 0.00 ? 28  CYS A N    3  
ATOM 6190  C CA   . CYS A 1 28  ? 2.126   17.347  -13.746 1.00 0.00 ? 28  CYS A CA   3  
ATOM 6191  C C    . CYS A 1 28  ? 2.854   17.295  -12.410 1.00 0.00 ? 28  CYS A C    3  
ATOM 6192  O O    . CYS A 1 28  ? 2.410   16.624  -11.476 1.00 0.00 ? 28  CYS A O    3  
ATOM 6193  C CB   . CYS A 1 28  ? 0.810   18.123  -13.610 1.00 0.00 ? 28  CYS A CB   3  
ATOM 6194  S SG   . CYS A 1 28  ? 1.008   19.918  -13.540 1.00 0.00 ? 28  CYS A SG   3  
ATOM 6195  H H    . CYS A 1 28  ? 1.422   15.366  -13.619 1.00 0.00 ? 28  CYS A H    3  
ATOM 6196  H HA   . CYS A 1 28  ? 2.755   17.840  -14.471 1.00 0.00 ? 28  CYS A HA   3  
ATOM 6197  H HB2  . CYS A 1 28  ? 0.181   17.899  -14.460 1.00 0.00 ? 28  CYS A HB2  3  
ATOM 6198  H HB3  . CYS A 1 28  ? 0.309   17.813  -12.706 1.00 0.00 ? 28  CYS A HB3  3  
ATOM 6199  H HG   . CYS A 1 28  ? 1.560   20.221  -12.369 1.00 0.00 ? 28  CYS A HG   3  
ATOM 6200  N N    . GLY A 1 29  ? 3.977   17.992  -12.332 1.00 0.00 ? 29  GLY A N    3  
ATOM 6201  C CA   . GLY A 1 29  ? 4.761   18.019  -11.118 1.00 0.00 ? 29  GLY A CA   3  
ATOM 6202  C C    . GLY A 1 29  ? 6.230   18.230  -11.402 1.00 0.00 ? 29  GLY A C    3  
ATOM 6203  O O    . GLY A 1 29  ? 6.594   19.068  -12.230 1.00 0.00 ? 29  GLY A O    3  
ATOM 6204  H H    . GLY A 1 29  ? 4.281   18.503  -13.118 1.00 0.00 ? 29  GLY A H    3  
ATOM 6205  H HA2  . GLY A 1 29  ? 4.408   18.824  -10.490 1.00 0.00 ? 29  GLY A HA2  3  
ATOM 6206  H HA3  . GLY A 1 29  ? 4.635   17.084  -10.595 1.00 0.00 ? 29  GLY A HA3  3  
ATOM 6207  N N    . ALA A 1 30  ? 7.072   17.462  -10.732 1.00 0.00 ? 30  ALA A N    3  
ATOM 6208  C CA   . ALA A 1 30  ? 8.511   17.563  -10.909 1.00 0.00 ? 30  ALA A CA   3  
ATOM 6209  C C    . ALA A 1 30  ? 9.159   16.195  -10.755 1.00 0.00 ? 30  ALA A C    3  
ATOM 6210  O O    . ALA A 1 30  ? 8.574   15.293  -10.149 1.00 0.00 ? 30  ALA A O    3  
ATOM 6211  C CB   . ALA A 1 30  ? 9.103   18.550  -9.912  1.00 0.00 ? 30  ALA A CB   3  
ATOM 6212  H H    . ALA A 1 30  ? 6.715   16.797  -10.104 1.00 0.00 ? 30  ALA A H    3  
ATOM 6213  H HA   . ALA A 1 30  ? 8.700   17.933  -11.906 1.00 0.00 ? 30  ALA A HA   3  
ATOM 6214  H HB1  . ALA A 1 30  ? 10.163  18.651  -10.093 1.00 0.00 ? 30  ALA A HB1  3  
ATOM 6215  H HB2  . ALA A 1 30  ? 8.943   18.189  -8.906  1.00 0.00 ? 30  ALA A HB2  3  
ATOM 6216  H HB3  . ALA A 1 30  ? 8.625   19.511  -10.029 1.00 0.00 ? 30  ALA A HB3  3  
ATOM 6217  N N    . GLY A 1 31  ? 10.356  16.041  -11.305 1.00 0.00 ? 31  GLY A N    3  
ATOM 6218  C CA   . GLY A 1 31  ? 11.059  14.776  -11.216 1.00 0.00 ? 31  GLY A CA   3  
ATOM 6219  C C    . GLY A 1 31  ? 11.960  14.715  -9.999  1.00 0.00 ? 31  GLY A C    3  
ATOM 6220  O O    . GLY A 1 31  ? 12.957  15.437  -9.931  1.00 0.00 ? 31  GLY A O    3  
ATOM 6221  H H    . GLY A 1 31  ? 10.776  16.802  -11.769 1.00 0.00 ? 31  GLY A H    3  
ATOM 6222  H HA2  . GLY A 1 31  ? 10.336  13.976  -11.159 1.00 0.00 ? 31  GLY A HA2  3  
ATOM 6223  H HA3  . GLY A 1 31  ? 11.660  14.644  -12.103 1.00 0.00 ? 31  GLY A HA3  3  
ATOM 6224  N N    . PRO A 1 32  ? 11.632  13.865  -9.014  1.00 0.00 ? 32  PRO A N    3  
ATOM 6225  C CA   . PRO A 1 32  ? 12.415  13.725  -7.790  1.00 0.00 ? 32  PRO A CA   3  
ATOM 6226  C C    . PRO A 1 32  ? 13.650  12.851  -7.998  1.00 0.00 ? 32  PRO A C    3  
ATOM 6227  O O    . PRO A 1 32  ? 13.673  11.685  -7.600  1.00 0.00 ? 32  PRO A O    3  
ATOM 6228  C CB   . PRO A 1 32  ? 11.442  13.056  -6.801  1.00 0.00 ? 32  PRO A CB   3  
ATOM 6229  C CG   . PRO A 1 32  ? 10.149  12.885  -7.541  1.00 0.00 ? 32  PRO A CG   3  
ATOM 6230  C CD   . PRO A 1 32  ? 10.478  12.966  -9.004  1.00 0.00 ? 32  PRO A CD   3  
ATOM 6231  H HA   . PRO A 1 32  ? 12.720  14.686  -7.403  1.00 0.00 ? 32  PRO A HA   3  
ATOM 6232  H HB2  . PRO A 1 32  ? 11.842  12.103  -6.493  1.00 0.00 ? 32  PRO A HB2  3  
ATOM 6233  H HB3  . PRO A 1 32  ? 11.316  13.692  -5.937  1.00 0.00 ? 32  PRO A HB3  3  
ATOM 6234  H HG2  . PRO A 1 32  ? 9.718   11.920  -7.310  1.00 0.00 ? 32  PRO A HG2  3  
ATOM 6235  H HG3  . PRO A 1 32  ? 9.465   13.674  -7.270  1.00 0.00 ? 32  PRO A HG3  3  
ATOM 6236  H HD2  . PRO A 1 32  ? 10.739  11.992  -9.391  1.00 0.00 ? 32  PRO A HD2  3  
ATOM 6237  H HD3  . PRO A 1 32  ? 9.653   13.389  -9.557  1.00 0.00 ? 32  PRO A HD3  3  
ATOM 6238  N N    . GLY A 1 33  ? 14.662  13.417  -8.636  1.00 0.00 ? 33  GLY A N    3  
ATOM 6239  C CA   . GLY A 1 33  ? 15.888  12.687  -8.880  1.00 0.00 ? 33  GLY A CA   3  
ATOM 6240  C C    . GLY A 1 33  ? 16.798  12.708  -7.671  1.00 0.00 ? 33  GLY A C    3  
ATOM 6241  O O    . GLY A 1 33  ? 16.785  11.784  -6.853  1.00 0.00 ? 33  GLY A O    3  
ATOM 6242  H H    . GLY A 1 33  ? 14.577  14.345  -8.941  1.00 0.00 ? 33  GLY A H    3  
ATOM 6243  H HA2  . GLY A 1 33  ? 15.646  11.663  -9.123  1.00 0.00 ? 33  GLY A HA2  3  
ATOM 6244  H HA3  . GLY A 1 33  ? 16.404  13.138  -9.715  1.00 0.00 ? 33  GLY A HA3  3  
ATOM 6245  N N    . GLU A 1 34  ? 17.586  13.762  -7.550  1.00 0.00 ? 34  GLU A N    3  
ATOM 6246  C CA   . GLU A 1 34  ? 18.490  13.908  -6.426  1.00 0.00 ? 34  GLU A CA   3  
ATOM 6247  C C    . GLU A 1 34  ? 18.146  15.161  -5.638  1.00 0.00 ? 34  GLU A C    3  
ATOM 6248  O O    . GLU A 1 34  ? 18.027  16.255  -6.201  1.00 0.00 ? 34  GLU A O    3  
ATOM 6249  C CB   . GLU A 1 34  ? 19.942  13.956  -6.896  1.00 0.00 ? 34  GLU A CB   3  
ATOM 6250  C CG   . GLU A 1 34  ? 20.938  13.890  -5.751  1.00 0.00 ? 34  GLU A CG   3  
ATOM 6251  C CD   . GLU A 1 34  ? 22.308  13.421  -6.187  1.00 0.00 ? 34  GLU A CD   3  
ATOM 6252  O OE1  . GLU A 1 34  ? 22.525  12.193  -6.253  1.00 0.00 ? 34  GLU A OE1  3  
ATOM 6253  O OE2  . GLU A 1 34  ? 23.178  14.270  -6.461  1.00 0.00 ? 34  GLU A OE2  3  
ATOM 6254  H H    . GLU A 1 34  ? 17.556  14.465  -8.233  1.00 0.00 ? 34  GLU A H    3  
ATOM 6255  H HA   . GLU A 1 34  ? 18.359  13.052  -5.784  1.00 0.00 ? 34  GLU A HA   3  
ATOM 6256  H HB2  . GLU A 1 34  ? 20.123  13.118  -7.553  1.00 0.00 ? 34  GLU A HB2  3  
ATOM 6257  H HB3  . GLU A 1 34  ? 20.105  14.875  -7.438  1.00 0.00 ? 34  GLU A HB3  3  
ATOM 6258  H HG2  . GLU A 1 34  ? 21.035  14.874  -5.317  1.00 0.00 ? 34  GLU A HG2  3  
ATOM 6259  H HG3  . GLU A 1 34  ? 20.561  13.206  -5.007  1.00 0.00 ? 34  GLU A HG3  3  
ATOM 6260  N N    . GLY A 1 35  ? 17.977  14.987  -4.339  1.00 0.00 ? 35  GLY A N    3  
ATOM 6261  C CA   . GLY A 1 35  ? 17.634  16.089  -3.470  1.00 0.00 ? 35  GLY A CA   3  
ATOM 6262  C C    . GLY A 1 35  ? 16.861  15.618  -2.259  1.00 0.00 ? 35  GLY A C    3  
ATOM 6263  O O    . GLY A 1 35  ? 15.635  15.507  -2.316  1.00 0.00 ? 35  GLY A O    3  
ATOM 6264  H H    . GLY A 1 35  ? 18.090  14.084  -3.957  1.00 0.00 ? 35  GLY A H    3  
ATOM 6265  H HA2  . GLY A 1 35  ? 18.541  16.575  -3.143  1.00 0.00 ? 35  GLY A HA2  3  
ATOM 6266  H HA3  . GLY A 1 35  ? 17.030  16.796  -4.018  1.00 0.00 ? 35  GLY A HA3  3  
ATOM 6267  N N    . PRO A 1 36  ? 17.556  15.306  -1.153  1.00 0.00 ? 36  PRO A N    3  
ATOM 6268  C CA   . PRO A 1 36  ? 16.918  14.833  0.080   1.00 0.00 ? 36  PRO A CA   3  
ATOM 6269  C C    . PRO A 1 36  ? 15.929  15.849  0.639   1.00 0.00 ? 36  PRO A C    3  
ATOM 6270  O O    . PRO A 1 36  ? 16.318  16.916  1.115   1.00 0.00 ? 36  PRO A O    3  
ATOM 6271  C CB   . PRO A 1 36  ? 18.091  14.641  1.049   1.00 0.00 ? 36  PRO A CB   3  
ATOM 6272  C CG   . PRO A 1 36  ? 19.297  14.531  0.183   1.00 0.00 ? 36  PRO A CG   3  
ATOM 6273  C CD   . PRO A 1 36  ? 19.019  15.390  -1.015  1.00 0.00 ? 36  PRO A CD   3  
ATOM 6274  H HA   . PRO A 1 36  ? 16.416  13.889  -0.072  1.00 0.00 ? 36  PRO A HA   3  
ATOM 6275  H HB2  . PRO A 1 36  ? 18.156  15.491  1.712   1.00 0.00 ? 36  PRO A HB2  3  
ATOM 6276  H HB3  . PRO A 1 36  ? 17.940  13.742  1.626   1.00 0.00 ? 36  PRO A HB3  3  
ATOM 6277  H HG2  . PRO A 1 36  ? 20.165  14.897  0.715   1.00 0.00 ? 36  PRO A HG2  3  
ATOM 6278  H HG3  . PRO A 1 36  ? 19.444  13.503  -0.116  1.00 0.00 ? 36  PRO A HG3  3  
ATOM 6279  H HD2  . PRO A 1 36  ? 19.332  16.407  -0.831  1.00 0.00 ? 36  PRO A HD2  3  
ATOM 6280  H HD3  . PRO A 1 36  ? 19.513  14.992  -1.889  1.00 0.00 ? 36  PRO A HD3  3  
ATOM 6281  N N    . ALA A 1 37  ? 14.650  15.513  0.567   1.00 0.00 ? 37  ALA A N    3  
ATOM 6282  C CA   . ALA A 1 37  ? 13.603  16.392  1.057   1.00 0.00 ? 37  ALA A CA   3  
ATOM 6283  C C    . ALA A 1 37  ? 13.297  16.107  2.520   1.00 0.00 ? 37  ALA A C    3  
ATOM 6284  O O    . ALA A 1 37  ? 13.442  14.976  2.985   1.00 0.00 ? 37  ALA A O    3  
ATOM 6285  C CB   . ALA A 1 37  ? 12.346  16.233  0.215   1.00 0.00 ? 37  ALA A CB   3  
ATOM 6286  H H    . ALA A 1 37  ? 14.404  14.647  0.178   1.00 0.00 ? 37  ALA A H    3  
ATOM 6287  H HA   . ALA A 1 37  ? 13.947  17.411  0.962   1.00 0.00 ? 37  ALA A HA   3  
ATOM 6288  H HB1  . ALA A 1 37  ? 12.013  15.207  0.255   1.00 0.00 ? 37  ALA A HB1  3  
ATOM 6289  H HB2  . ALA A 1 37  ? 12.560  16.504  -0.808  1.00 0.00 ? 37  ALA A HB2  3  
ATOM 6290  H HB3  . ALA A 1 37  ? 11.571  16.879  0.603   1.00 0.00 ? 37  ALA A HB3  3  
ATOM 6291  N N    . ALA A 1 38  ? 12.865  17.135  3.238   1.00 0.00 ? 38  ALA A N    3  
ATOM 6292  C CA   . ALA A 1 38  ? 12.533  17.001  4.651   1.00 0.00 ? 38  ALA A CA   3  
ATOM 6293  C C    . ALA A 1 38  ? 11.258  16.183  4.834   1.00 0.00 ? 38  ALA A C    3  
ATOM 6294  O O    . ALA A 1 38  ? 11.056  15.549  5.874   1.00 0.00 ? 38  ALA A O    3  
ATOM 6295  C CB   . ALA A 1 38  ? 12.381  18.371  5.291   1.00 0.00 ? 38  ALA A CB   3  
ATOM 6296  H H    . ALA A 1 38  ? 12.768  18.013  2.805   1.00 0.00 ? 38  ALA A H    3  
ATOM 6297  H HA   . ALA A 1 38  ? 13.351  16.488  5.138   1.00 0.00 ? 38  ALA A HA   3  
ATOM 6298  H HB1  . ALA A 1 38  ? 13.290  18.937  5.151   1.00 0.00 ? 38  ALA A HB1  3  
ATOM 6299  H HB2  . ALA A 1 38  ? 12.187  18.256  6.347   1.00 0.00 ? 38  ALA A HB2  3  
ATOM 6300  H HB3  . ALA A 1 38  ? 11.557  18.895  4.831   1.00 0.00 ? 38  ALA A HB3  3  
ATOM 6301  N N    . ASP A 1 39  ? 10.404  16.199  3.819   1.00 0.00 ? 39  ASP A N    3  
ATOM 6302  C CA   . ASP A 1 39  ? 9.152   15.455  3.859   1.00 0.00 ? 39  ASP A CA   3  
ATOM 6303  C C    . ASP A 1 39  ? 9.273   14.169  3.056   1.00 0.00 ? 39  ASP A C    3  
ATOM 6304  O O    . ASP A 1 39  ? 9.287   14.192  1.823   1.00 0.00 ? 39  ASP A O    3  
ATOM 6305  C CB   . ASP A 1 39  ? 7.991   16.286  3.308   1.00 0.00 ? 39  ASP A CB   3  
ATOM 6306  C CG   . ASP A 1 39  ? 6.658   15.564  3.416   1.00 0.00 ? 39  ASP A CG   3  
ATOM 6307  O OD1  . ASP A 1 39  ? 6.400   14.643  2.607   1.00 0.00 ? 39  ASP A OD1  3  
ATOM 6308  O OD2  . ASP A 1 39  ? 5.866   15.913  4.316   1.00 0.00 ? 39  ASP A OD2  3  
ATOM 6309  H H    . ASP A 1 39  ? 10.626  16.717  3.018   1.00 0.00 ? 39  ASP A H    3  
ATOM 6310  H HA   . ASP A 1 39  ? 8.948   15.205  4.890   1.00 0.00 ? 39  ASP A HA   3  
ATOM 6311  H HB2  . ASP A 1 39  ? 7.925   17.212  3.862   1.00 0.00 ? 39  ASP A HB2  3  
ATOM 6312  H HB3  . ASP A 1 39  ? 8.178   16.507  2.268   1.00 0.00 ? 39  ASP A HB3  3  
ATOM 6313  N N    . PRO A 1 40  ? 9.393   13.032  3.745   1.00 0.00 ? 40  PRO A N    3  
ATOM 6314  C CA   . PRO A 1 40  ? 9.495   11.734  3.107   1.00 0.00 ? 40  PRO A CA   3  
ATOM 6315  C C    . PRO A 1 40  ? 8.128   11.080  2.946   1.00 0.00 ? 40  PRO A C    3  
ATOM 6316  O O    . PRO A 1 40  ? 8.007   10.013  2.352   1.00 0.00 ? 40  PRO A O    3  
ATOM 6317  C CB   . PRO A 1 40  ? 10.355  10.945  4.089   1.00 0.00 ? 40  PRO A CB   3  
ATOM 6318  C CG   . PRO A 1 40  ? 10.079  11.549  5.433   1.00 0.00 ? 40  PRO A CG   3  
ATOM 6319  C CD   . PRO A 1 40  ? 9.468   12.915  5.209   1.00 0.00 ? 40  PRO A CD   3  
ATOM 6320  H HA   . PRO A 1 40  ? 9.989   11.796  2.150   1.00 0.00 ? 40  PRO A HA   3  
ATOM 6321  H HB2  . PRO A 1 40  ? 10.068  9.905   4.060   1.00 0.00 ? 40  PRO A HB2  3  
ATOM 6322  H HB3  . PRO A 1 40  ? 11.396  11.044  3.819   1.00 0.00 ? 40  PRO A HB3  3  
ATOM 6323  H HG2  . PRO A 1 40  ? 9.390   10.921  5.978   1.00 0.00 ? 40  PRO A HG2  3  
ATOM 6324  H HG3  . PRO A 1 40  ? 11.004  11.645  5.983   1.00 0.00 ? 40  PRO A HG3  3  
ATOM 6325  H HD2  . PRO A 1 40  ? 8.483   12.963  5.646   1.00 0.00 ? 40  PRO A HD2  3  
ATOM 6326  H HD3  . PRO A 1 40  ? 10.104  13.684  5.625   1.00 0.00 ? 40  PRO A HD3  3  
ATOM 6327  N N    . LEU A 1 41  ? 7.100   11.744  3.462   1.00 0.00 ? 41  LEU A N    3  
ATOM 6328  C CA   . LEU A 1 41  ? 5.739   11.231  3.401   1.00 0.00 ? 41  LEU A CA   3  
ATOM 6329  C C    . LEU A 1 41  ? 5.260   11.148  1.963   1.00 0.00 ? 41  LEU A C    3  
ATOM 6330  O O    . LEU A 1 41  ? 4.623   10.174  1.569   1.00 0.00 ? 41  LEU A O    3  
ATOM 6331  C CB   . LEU A 1 41  ? 4.795   12.116  4.220   1.00 0.00 ? 41  LEU A CB   3  
ATOM 6332  C CG   . LEU A 1 41  ? 5.175   12.281  5.694   1.00 0.00 ? 41  LEU A CG   3  
ATOM 6333  C CD1  . LEU A 1 41  ? 4.179   13.186  6.403   1.00 0.00 ? 41  LEU A CD1  3  
ATOM 6334  C CD2  . LEU A 1 41  ? 5.247   10.927  6.382   1.00 0.00 ? 41  LEU A CD2  3  
ATOM 6335  H H    . LEU A 1 41  ? 7.261   12.618  3.879   1.00 0.00 ? 41  LEU A H    3  
ATOM 6336  H HA   . LEU A 1 41  ? 5.742   10.239  3.824   1.00 0.00 ? 41  LEU A HA   3  
ATOM 6337  H HB2  . LEU A 1 41  ? 4.769   13.095  3.765   1.00 0.00 ? 41  LEU A HB2  3  
ATOM 6338  H HB3  . LEU A 1 41  ? 3.806   11.688  4.171   1.00 0.00 ? 41  LEU A HB3  3  
ATOM 6339  H HG   . LEU A 1 41  ? 6.150   12.743  5.756   1.00 0.00 ? 41  LEU A HG   3  
ATOM 6340  H HD11 . LEU A 1 41  ? 4.454   13.278  7.444   1.00 0.00 ? 41  LEU A HD11 3  
ATOM 6341  H HD12 . LEU A 1 41  ? 3.189   12.759  6.329   1.00 0.00 ? 41  LEU A HD12 3  
ATOM 6342  H HD13 . LEU A 1 41  ? 4.186   14.161  5.941   1.00 0.00 ? 41  LEU A HD13 3  
ATOM 6343  H HD21 . LEU A 1 41  ? 5.596   11.054  7.397   1.00 0.00 ? 41  LEU A HD21 3  
ATOM 6344  H HD22 . LEU A 1 41  ? 5.929   10.287  5.843   1.00 0.00 ? 41  LEU A HD22 3  
ATOM 6345  H HD23 . LEU A 1 41  ? 4.265   10.477  6.393   1.00 0.00 ? 41  LEU A HD23 3  
ATOM 6346  N N    . HIS A 1 42  ? 5.585   12.169  1.181   1.00 0.00 ? 42  HIS A N    3  
ATOM 6347  C CA   . HIS A 1 42  ? 5.196   12.208  -0.224  1.00 0.00 ? 42  HIS A CA   3  
ATOM 6348  C C    . HIS A 1 42  ? 5.774   11.014  -0.982  1.00 0.00 ? 42  HIS A C    3  
ATOM 6349  O O    . HIS A 1 42  ? 5.109   10.430  -1.836  1.00 0.00 ? 42  HIS A O    3  
ATOM 6350  C CB   . HIS A 1 42  ? 5.656   13.511  -0.880  1.00 0.00 ? 42  HIS A CB   3  
ATOM 6351  C CG   . HIS A 1 42  ? 4.788   14.686  -0.558  1.00 0.00 ? 42  HIS A CG   3  
ATOM 6352  N ND1  . HIS A 1 42  ? 3.414   14.644  -0.612  1.00 0.00 ? 42  HIS A ND1  3  
ATOM 6353  C CD2  . HIS A 1 42  ? 5.108   15.941  -0.173  1.00 0.00 ? 42  HIS A CD2  3  
ATOM 6354  C CE1  . HIS A 1 42  ? 2.927   15.822  -0.282  1.00 0.00 ? 42  HIS A CE1  3  
ATOM 6355  N NE2  . HIS A 1 42  ? 3.932   16.630  -0.008  1.00 0.00 ? 42  HIS A NE2  3  
ATOM 6356  H H    . HIS A 1 42  ? 6.083   12.930  1.568   1.00 0.00 ? 42  HIS A H    3  
ATOM 6357  H HA   . HIS A 1 42  ? 4.120   12.156  -0.268  1.00 0.00 ? 42  HIS A HA   3  
ATOM 6358  H HB2  . HIS A 1 42  ? 6.659   13.738  -0.549  1.00 0.00 ? 42  HIS A HB2  3  
ATOM 6359  H HB3  . HIS A 1 42  ? 5.657   13.384  -1.953  1.00 0.00 ? 42  HIS A HB3  3  
ATOM 6360  H HD1  . HIS A 1 42  ? 2.865   13.855  -0.855  1.00 0.00 ? 42  HIS A HD1  3  
ATOM 6361  H HD2  . HIS A 1 42  ? 6.105   16.330  -0.022  1.00 0.00 ? 42  HIS A HD2  3  
ATOM 6362  H HE1  . HIS A 1 42  ? 1.879   16.081  -0.238  1.00 0.00 ? 42  HIS A HE1  3  
ATOM 6363  H HE2  . HIS A 1 42  ? 3.846   17.499  0.448   1.00 0.00 ? 42  HIS A HE2  3  
ATOM 6364  N N    . GLN A 1 43  ? 7.006   10.645  -0.656  1.00 0.00 ? 43  GLN A N    3  
ATOM 6365  C CA   . GLN A 1 43  ? 7.653   9.519   -1.314  1.00 0.00 ? 43  GLN A CA   3  
ATOM 6366  C C    . GLN A 1 43  ? 7.190   8.199   -0.714  1.00 0.00 ? 43  GLN A C    3  
ATOM 6367  O O    . GLN A 1 43  ? 7.016   7.215   -1.430  1.00 0.00 ? 43  GLN A O    3  
ATOM 6368  C CB   . GLN A 1 43  ? 9.174   9.637   -1.231  1.00 0.00 ? 43  GLN A CB   3  
ATOM 6369  C CG   . GLN A 1 43  ? 9.783   10.425  -2.382  1.00 0.00 ? 43  GLN A CG   3  
ATOM 6370  C CD   . GLN A 1 43  ? 9.331   9.923   -3.744  1.00 0.00 ? 43  GLN A CD   3  
ATOM 6371  O OE1  . GLN A 1 43  ? 9.039   8.740   -3.924  1.00 0.00 ? 43  GLN A OE1  3  
ATOM 6372  N NE2  . GLN A 1 43  ? 9.272   10.822  -4.714  1.00 0.00 ? 43  GLN A NE2  3  
ATOM 6373  H H    . GLN A 1 43  ? 7.485   11.136  0.043   1.00 0.00 ? 43  GLN A H    3  
ATOM 6374  H HA   . GLN A 1 43  ? 7.362   9.541   -2.353  1.00 0.00 ? 43  GLN A HA   3  
ATOM 6375  H HB2  . GLN A 1 43  ? 9.436   10.129  -0.305  1.00 0.00 ? 43  GLN A HB2  3  
ATOM 6376  H HB3  . GLN A 1 43  ? 9.601   8.645   -1.236  1.00 0.00 ? 43  GLN A HB3  3  
ATOM 6377  H HG2  . GLN A 1 43  ? 9.492   11.461  -2.284  1.00 0.00 ? 43  GLN A HG2  3  
ATOM 6378  H HG3  . GLN A 1 43  ? 10.857  10.348  -2.324  1.00 0.00 ? 43  GLN A HG3  3  
ATOM 6379  H HE21 . GLN A 1 43  ? 9.514   11.748  -4.501  1.00 0.00 ? 43  GLN A HE21 3  
ATOM 6380  H HE22 . GLN A 1 43  ? 8.991   10.526  -5.604  1.00 0.00 ? 43  GLN A HE22 3  
ATOM 6381  N N    . ALA A 1 44  ? 6.987   8.185   0.600   1.00 0.00 ? 44  ALA A N    3  
ATOM 6382  C CA   . ALA A 1 44  ? 6.529   6.987   1.293   1.00 0.00 ? 44  ALA A CA   3  
ATOM 6383  C C    . ALA A 1 44  ? 5.154   6.571   0.782   1.00 0.00 ? 44  ALA A C    3  
ATOM 6384  O O    . ALA A 1 44  ? 4.904   5.393   0.528   1.00 0.00 ? 44  ALA A O    3  
ATOM 6385  C CB   . ALA A 1 44  ? 6.489   7.224   2.796   1.00 0.00 ? 44  ALA A CB   3  
ATOM 6386  H H    . ALA A 1 44  ? 7.160   9.000   1.121   1.00 0.00 ? 44  ALA A H    3  
ATOM 6387  H HA   . ALA A 1 44  ? 7.234   6.193   1.093   1.00 0.00 ? 44  ALA A HA   3  
ATOM 6388  H HB1  . ALA A 1 44  ? 6.238   6.302   3.300   1.00 0.00 ? 44  ALA A HB1  3  
ATOM 6389  H HB2  . ALA A 1 44  ? 5.743   7.971   3.022   1.00 0.00 ? 44  ALA A HB2  3  
ATOM 6390  H HB3  . ALA A 1 44  ? 7.457   7.568   3.134   1.00 0.00 ? 44  ALA A HB3  3  
ATOM 6391  N N    . MET A 1 45  ? 4.274   7.554   0.619   1.00 0.00 ? 45  MET A N    3  
ATOM 6392  C CA   . MET A 1 45  ? 2.927   7.308   0.124   1.00 0.00 ? 45  MET A CA   3  
ATOM 6393  C C    . MET A 1 45  ? 2.990   6.749   -1.290  1.00 0.00 ? 45  MET A C    3  
ATOM 6394  O O    . MET A 1 45  ? 2.239   5.844   -1.651  1.00 0.00 ? 45  MET A O    3  
ATOM 6395  C CB   . MET A 1 45  ? 2.111   8.603   0.151   1.00 0.00 ? 45  MET A CB   3  
ATOM 6396  C CG   . MET A 1 45  ? 0.631   8.380   0.391   1.00 0.00 ? 45  MET A CG   3  
ATOM 6397  S SD   . MET A 1 45  ? -0.249  9.915   0.736   1.00 0.00 ? 45  MET A SD   3  
ATOM 6398  C CE   . MET A 1 45  ? -1.795  9.276   1.374   1.00 0.00 ? 45  MET A CE   3  
ATOM 6399  H H    . MET A 1 45  ? 4.538   8.474   0.845   1.00 0.00 ? 45  MET A H    3  
ATOM 6400  H HA   . MET A 1 45  ? 2.459   6.580   0.771   1.00 0.00 ? 45  MET A HA   3  
ATOM 6401  H HB2  . MET A 1 45  ? 2.489   9.236   0.940   1.00 0.00 ? 45  MET A HB2  3  
ATOM 6402  H HB3  . MET A 1 45  ? 2.228   9.111   -0.795  1.00 0.00 ? 45  MET A HB3  3  
ATOM 6403  H HG2  . MET A 1 45  ? 0.201   7.926   -0.488  1.00 0.00 ? 45  MET A HG2  3  
ATOM 6404  H HG3  . MET A 1 45  ? 0.513   7.716   1.234   1.00 0.00 ? 45  MET A HG3  3  
ATOM 6405  H HE1  . MET A 1 45  ? -1.608  8.720   2.280   1.00 0.00 ? 45  MET A HE1  3  
ATOM 6406  H HE2  . MET A 1 45  ? -2.245  8.625   0.637   1.00 0.00 ? 45  MET A HE2  3  
ATOM 6407  H HE3  . MET A 1 45  ? -2.464  10.098  1.585   1.00 0.00 ? 45  MET A HE3  3  
ATOM 6408  N N    . ARG A 1 46  ? 3.910   7.292   -2.083  1.00 0.00 ? 46  ARG A N    3  
ATOM 6409  C CA   . ARG A 1 46  ? 4.106   6.846   -3.453  1.00 0.00 ? 46  ARG A CA   3  
ATOM 6410  C C    . ARG A 1 46  ? 4.624   5.414   -3.456  1.00 0.00 ? 46  ARG A C    3  
ATOM 6411  O O    . ARG A 1 46  ? 4.095   4.555   -4.155  1.00 0.00 ? 46  ARG A O    3  
ATOM 6412  C CB   . ARG A 1 46  ? 5.098   7.775   -4.168  1.00 0.00 ? 46  ARG A CB   3  
ATOM 6413  C CG   . ARG A 1 46  ? 5.211   7.549   -5.674  1.00 0.00 ? 46  ARG A CG   3  
ATOM 6414  C CD   . ARG A 1 46  ? 6.257   6.494   -6.026  1.00 0.00 ? 46  ARG A CD   3  
ATOM 6415  N NE   . ARG A 1 46  ? 7.531   6.715   -5.336  1.00 0.00 ? 46  ARG A NE   3  
ATOM 6416  C CZ   . ARG A 1 46  ? 8.566   5.870   -5.390  1.00 0.00 ? 46  ARG A CZ   3  
ATOM 6417  N NH1  . ARG A 1 46  ? 8.509   4.785   -6.155  1.00 0.00 ? 46  ARG A NH1  3  
ATOM 6418  N NH2  . ARG A 1 46  ? 9.668   6.131   -4.694  1.00 0.00 ? 46  ARG A NH2  3  
ATOM 6419  H H    . ARG A 1 46  ? 4.470   8.015   -1.732  1.00 0.00 ? 46  ARG A H    3  
ATOM 6420  H HA   . ARG A 1 46  ? 3.152   6.882   -3.959  1.00 0.00 ? 46  ARG A HA   3  
ATOM 6421  H HB2  . ARG A 1 46  ? 4.791   8.796   -4.007  1.00 0.00 ? 46  ARG A HB2  3  
ATOM 6422  H HB3  . ARG A 1 46  ? 6.076   7.634   -3.734  1.00 0.00 ? 46  ARG A HB3  3  
ATOM 6423  H HG2  . ARG A 1 46  ? 4.252   7.224   -6.052  1.00 0.00 ? 46  ARG A HG2  3  
ATOM 6424  H HG3  . ARG A 1 46  ? 5.484   8.483   -6.145  1.00 0.00 ? 46  ARG A HG3  3  
ATOM 6425  H HD2  . ARG A 1 46  ? 5.875   5.523   -5.750  1.00 0.00 ? 46  ARG A HD2  3  
ATOM 6426  H HD3  . ARG A 1 46  ? 6.427   6.520   -7.092  1.00 0.00 ? 46  ARG A HD3  3  
ATOM 6427  H HE   . ARG A 1 46  ? 7.618   7.532   -4.791  1.00 0.00 ? 46  ARG A HE   3  
ATOM 6428  H HH11 . ARG A 1 46  ? 7.685   4.589   -6.707  1.00 0.00 ? 46  ARG A HH11 3  
ATOM 6429  H HH12 . ARG A 1 46  ? 9.291   4.149   -6.196  1.00 0.00 ? 46  ARG A HH12 3  
ATOM 6430  H HH21 . ARG A 1 46  ? 9.725   6.962   -4.129  1.00 0.00 ? 46  ARG A HH21 3  
ATOM 6431  H HH22 . ARG A 1 46  ? 10.455  5.499   -4.730  1.00 0.00 ? 46  ARG A HH22 3  
ATOM 6432  N N    . ALA A 1 47  ? 5.652   5.167   -2.648  1.00 0.00 ? 47  ALA A N    3  
ATOM 6433  C CA   . ALA A 1 47  ? 6.266   3.849   -2.548  1.00 0.00 ? 47  ALA A CA   3  
ATOM 6434  C C    . ALA A 1 47  ? 5.272   2.802   -2.059  1.00 0.00 ? 47  ALA A C    3  
ATOM 6435  O O    . ALA A 1 47  ? 5.301   1.660   -2.511  1.00 0.00 ? 47  ALA A O    3  
ATOM 6436  C CB   . ALA A 1 47  ? 7.480   3.899   -1.628  1.00 0.00 ? 47  ALA A CB   3  
ATOM 6437  H H    . ALA A 1 47  ? 6.012   5.901   -2.099  1.00 0.00 ? 47  ALA A H    3  
ATOM 6438  H HA   . ALA A 1 47  ? 6.609   3.567   -3.534  1.00 0.00 ? 47  ALA A HA   3  
ATOM 6439  H HB1  . ALA A 1 47  ? 7.966   2.936   -1.621  1.00 0.00 ? 47  ALA A HB1  3  
ATOM 6440  H HB2  . ALA A 1 47  ? 7.163   4.147   -0.626  1.00 0.00 ? 47  ALA A HB2  3  
ATOM 6441  H HB3  . ALA A 1 47  ? 8.171   4.648   -1.982  1.00 0.00 ? 47  ALA A HB3  3  
ATOM 6442  N N    . ALA A 1 48  ? 4.385   3.202   -1.154  1.00 0.00 ? 48  ALA A N    3  
ATOM 6443  C CA   . ALA A 1 48  ? 3.378   2.298   -0.600  1.00 0.00 ? 48  ALA A CA   3  
ATOM 6444  C C    . ALA A 1 48  ? 2.534   1.650   -1.694  1.00 0.00 ? 48  ALA A C    3  
ATOM 6445  O O    . ALA A 1 48  ? 2.089   0.512   -1.557  1.00 0.00 ? 48  ALA A O    3  
ATOM 6446  C CB   . ALA A 1 48  ? 2.488   3.045   0.380   1.00 0.00 ? 48  ALA A CB   3  
ATOM 6447  H H    . ALA A 1 48  ? 4.412   4.134   -0.837  1.00 0.00 ? 48  ALA A H    3  
ATOM 6448  H HA   . ALA A 1 48  ? 3.896   1.522   -0.054  1.00 0.00 ? 48  ALA A HA   3  
ATOM 6449  H HB1  . ALA A 1 48  ? 1.931   3.805   -0.146  1.00 0.00 ? 48  ALA A HB1  3  
ATOM 6450  H HB2  . ALA A 1 48  ? 3.100   3.507   1.140   1.00 0.00 ? 48  ALA A HB2  3  
ATOM 6451  H HB3  . ALA A 1 48  ? 1.802   2.352   0.843   1.00 0.00 ? 48  ALA A HB3  3  
ATOM 6452  N N    . GLY A 1 49  ? 2.318   2.376   -2.780  1.00 0.00 ? 49  GLY A N    3  
ATOM 6453  C CA   . GLY A 1 49  ? 1.538   1.845   -3.877  1.00 0.00 ? 49  GLY A CA   3  
ATOM 6454  C C    . GLY A 1 49  ? 2.356   1.693   -5.141  1.00 0.00 ? 49  GLY A C    3  
ATOM 6455  O O    . GLY A 1 49  ? 1.805   1.592   -6.232  1.00 0.00 ? 49  GLY A O    3  
ATOM 6456  H H    . GLY A 1 49  ? 2.687   3.284   -2.836  1.00 0.00 ? 49  GLY A H    3  
ATOM 6457  H HA2  . GLY A 1 49  ? 1.148   0.879   -3.592  1.00 0.00 ? 49  GLY A HA2  3  
ATOM 6458  H HA3  . GLY A 1 49  ? 0.711   2.512   -4.072  1.00 0.00 ? 49  GLY A HA3  3  
ATOM 6459  N N    . ASP A 1 50  ? 3.676   1.663   -4.995  1.00 0.00 ? 50  ASP A N    3  
ATOM 6460  C CA   . ASP A 1 50  ? 4.566   1.537   -6.148  1.00 0.00 ? 50  ASP A CA   3  
ATOM 6461  C C    . ASP A 1 50  ? 5.631   0.471   -5.915  1.00 0.00 ? 50  ASP A C    3  
ATOM 6462  O O    . ASP A 1 50  ? 5.851   -0.389  -6.763  1.00 0.00 ? 50  ASP A O    3  
ATOM 6463  C CB   . ASP A 1 50  ? 5.232   2.881   -6.453  1.00 0.00 ? 50  ASP A CB   3  
ATOM 6464  C CG   . ASP A 1 50  ? 5.929   2.901   -7.797  1.00 0.00 ? 50  ASP A CG   3  
ATOM 6465  O OD1  . ASP A 1 50  ? 5.498   2.165   -8.710  1.00 0.00 ? 50  ASP A OD1  3  
ATOM 6466  O OD2  . ASP A 1 50  ? 6.907   3.657   -7.949  1.00 0.00 ? 50  ASP A OD2  3  
ATOM 6467  H H    . ASP A 1 50  ? 4.058   1.728   -4.094  1.00 0.00 ? 50  ASP A H    3  
ATOM 6468  H HA   . ASP A 1 50  ? 3.964   1.245   -6.997  1.00 0.00 ? 50  ASP A HA   3  
ATOM 6469  H HB2  . ASP A 1 50  ? 4.479   3.655   -6.451  1.00 0.00 ? 50  ASP A HB2  3  
ATOM 6470  H HB3  . ASP A 1 50  ? 5.963   3.096   -5.686  1.00 0.00 ? 50  ASP A HB3  3  
ATOM 6471  N N    . GLU A 1 51  ? 6.274   0.519   -4.753  1.00 0.00 ? 51  GLU A N    3  
ATOM 6472  C CA   . GLU A 1 51  ? 7.320   -0.444  -4.413  1.00 0.00 ? 51  GLU A CA   3  
ATOM 6473  C C    . GLU A 1 51  ? 6.753   -1.854  -4.359  1.00 0.00 ? 51  GLU A C    3  
ATOM 6474  O O    . GLU A 1 51  ? 7.446   -2.827  -4.665  1.00 0.00 ? 51  GLU A O    3  
ATOM 6475  C CB   . GLU A 1 51  ? 7.968   -0.081  -3.078  1.00 0.00 ? 51  GLU A CB   3  
ATOM 6476  C CG   . GLU A 1 51  ? 9.108   0.913   -3.212  1.00 0.00 ? 51  GLU A CG   3  
ATOM 6477  C CD   . GLU A 1 51  ? 10.227  0.403   -4.099  1.00 0.00 ? 51  GLU A CD   3  
ATOM 6478  O OE1  . GLU A 1 51  ? 10.123  0.545   -5.336  1.00 0.00 ? 51  GLU A OE1  3  
ATOM 6479  O OE2  . GLU A 1 51  ? 11.214  -0.139  -3.561  1.00 0.00 ? 51  GLU A OE2  3  
ATOM 6480  H H    . GLU A 1 51  ? 6.034   1.212   -4.099  1.00 0.00 ? 51  GLU A H    3  
ATOM 6481  H HA   . GLU A 1 51  ? 8.069   -0.401  -5.190  1.00 0.00 ? 51  GLU A HA   3  
ATOM 6482  H HB2  . GLU A 1 51  ? 7.219   0.352   -2.432  1.00 0.00 ? 51  GLU A HB2  3  
ATOM 6483  H HB3  . GLU A 1 51  ? 8.354   -0.980  -2.617  1.00 0.00 ? 51  GLU A HB3  3  
ATOM 6484  H HG2  . GLU A 1 51  ? 8.724   1.829   -3.636  1.00 0.00 ? 51  GLU A HG2  3  
ATOM 6485  H HG3  . GLU A 1 51  ? 9.510   1.112   -2.229  1.00 0.00 ? 51  GLU A HG3  3  
ATOM 6486  N N    . PHE A 1 52  ? 5.481   -1.946  -3.990  1.00 0.00 ? 52  PHE A N    3  
ATOM 6487  C CA   . PHE A 1 52  ? 4.785   -3.220  -3.915  1.00 0.00 ? 52  PHE A CA   3  
ATOM 6488  C C    . PHE A 1 52  ? 4.787   -3.899  -5.284  1.00 0.00 ? 52  PHE A C    3  
ATOM 6489  O O    . PHE A 1 52  ? 4.846   -5.121  -5.386  1.00 0.00 ? 52  PHE A O    3  
ATOM 6490  C CB   . PHE A 1 52  ? 3.348   -2.986  -3.435  1.00 0.00 ? 52  PHE A CB   3  
ATOM 6491  C CG   . PHE A 1 52  ? 2.571   -4.241  -3.158  1.00 0.00 ? 52  PHE A CG   3  
ATOM 6492  C CD1  . PHE A 1 52  ? 2.724   -4.916  -1.958  1.00 0.00 ? 52  PHE A CD1  3  
ATOM 6493  C CD2  . PHE A 1 52  ? 1.682   -4.740  -4.095  1.00 0.00 ? 52  PHE A CD2  3  
ATOM 6494  C CE1  . PHE A 1 52  ? 2.000   -6.063  -1.699  1.00 0.00 ? 52  PHE A CE1  3  
ATOM 6495  C CE2  . PHE A 1 52  ? 0.956   -5.885  -3.841  1.00 0.00 ? 52  PHE A CE2  3  
ATOM 6496  C CZ   . PHE A 1 52  ? 1.117   -6.549  -2.642  1.00 0.00 ? 52  PHE A CZ   3  
ATOM 6497  H H    . PHE A 1 52  ? 5.001   -1.129  -3.748  1.00 0.00 ? 52  PHE A H    3  
ATOM 6498  H HA   . PHE A 1 52  ? 5.304   -3.847  -3.206  1.00 0.00 ? 52  PHE A HA   3  
ATOM 6499  H HB2  . PHE A 1 52  ? 3.373   -2.410  -2.523  1.00 0.00 ? 52  PHE A HB2  3  
ATOM 6500  H HB3  . PHE A 1 52  ? 2.814   -2.425  -4.190  1.00 0.00 ? 52  PHE A HB3  3  
ATOM 6501  H HD1  . PHE A 1 52  ? 3.415   -4.538  -1.219  1.00 0.00 ? 52  PHE A HD1  3  
ATOM 6502  H HD2  . PHE A 1 52  ? 1.558   -4.222  -5.036  1.00 0.00 ? 52  PHE A HD2  3  
ATOM 6503  H HE1  . PHE A 1 52  ? 2.125   -6.581  -0.759  1.00 0.00 ? 52  PHE A HE1  3  
ATOM 6504  H HE2  . PHE A 1 52  ? 0.265   -6.263  -4.580  1.00 0.00 ? 52  PHE A HE2  3  
ATOM 6505  H HZ   . PHE A 1 52  ? 0.548   -7.445  -2.440  1.00 0.00 ? 52  PHE A HZ   3  
ATOM 6506  N N    . GLU A 1 53  ? 4.753   -3.084  -6.332  1.00 0.00 ? 53  GLU A N    3  
ATOM 6507  C CA   . GLU A 1 53  ? 4.749   -3.580  -7.701  1.00 0.00 ? 53  GLU A CA   3  
ATOM 6508  C C    . GLU A 1 53  ? 6.176   -3.795  -8.205  1.00 0.00 ? 53  GLU A C    3  
ATOM 6509  O O    . GLU A 1 53  ? 6.422   -4.636  -9.073  1.00 0.00 ? 53  GLU A O    3  
ATOM 6510  C CB   . GLU A 1 53  ? 4.016   -2.586  -8.608  1.00 0.00 ? 53  GLU A CB   3  
ATOM 6511  C CG   . GLU A 1 53  ? 3.856   -3.063  -10.040 1.00 0.00 ? 53  GLU A CG   3  
ATOM 6512  C CD   . GLU A 1 53  ? 2.810   -4.145  -10.180 1.00 0.00 ? 53  GLU A CD   3  
ATOM 6513  O OE1  . GLU A 1 53  ? 2.975   -5.225  -9.578  1.00 0.00 ? 53  GLU A OE1  3  
ATOM 6514  O OE2  . GLU A 1 53  ? 1.807   -3.919  -10.890 1.00 0.00 ? 53  GLU A OE2  3  
ATOM 6515  H H    . GLU A 1 53  ? 4.735   -2.116  -6.179  1.00 0.00 ? 53  GLU A H    3  
ATOM 6516  H HA   . GLU A 1 53  ? 4.227   -4.524  -7.713  1.00 0.00 ? 53  GLU A HA   3  
ATOM 6517  H HB2  . GLU A 1 53  ? 3.032   -2.406  -8.201  1.00 0.00 ? 53  GLU A HB2  3  
ATOM 6518  H HB3  . GLU A 1 53  ? 4.566   -1.655  -8.620  1.00 0.00 ? 53  GLU A HB3  3  
ATOM 6519  H HG2  . GLU A 1 53  ? 3.566   -2.223  -10.654 1.00 0.00 ? 53  GLU A HG2  3  
ATOM 6520  H HG3  . GLU A 1 53  ? 4.803   -3.450  -10.388 1.00 0.00 ? 53  GLU A HG3  3  
ATOM 6521  N N    . THR A 1 54  ? 7.109   -3.041  -7.641  1.00 0.00 ? 54  THR A N    3  
ATOM 6522  C CA   . THR A 1 54  ? 8.514   -3.117  -8.022  1.00 0.00 ? 54  THR A CA   3  
ATOM 6523  C C    . THR A 1 54  ? 9.058   -4.541  -7.930  1.00 0.00 ? 54  THR A C    3  
ATOM 6524  O O    . THR A 1 54  ? 9.692   -5.036  -8.863  1.00 0.00 ? 54  THR A O    3  
ATOM 6525  C CB   . THR A 1 54  ? 9.372   -2.195  -7.133  1.00 0.00 ? 54  THR A CB   3  
ATOM 6526  O OG1  . THR A 1 54  ? 8.894   -0.844  -7.223  1.00 0.00 ? 54  THR A OG1  3  
ATOM 6527  C CG2  . THR A 1 54  ? 10.836  -2.249  -7.540  1.00 0.00 ? 54  THR A CG2  3  
ATOM 6528  H H    . THR A 1 54  ? 6.844   -2.410  -6.937  1.00 0.00 ? 54  THR A H    3  
ATOM 6529  H HA   . THR A 1 54  ? 8.601   -2.775  -9.044  1.00 0.00 ? 54  THR A HA   3  
ATOM 6530  H HB   . THR A 1 54  ? 9.287   -2.528  -6.109  1.00 0.00 ? 54  THR A HB   3  
ATOM 6531  H HG1  . THR A 1 54  ? 9.283   -0.320  -6.497  1.00 0.00 ? 54  THR A HG1  3  
ATOM 6532  H HG21 . THR A 1 54  ? 10.929  -1.983  -8.583  1.00 0.00 ? 54  THR A HG21 3  
ATOM 6533  H HG22 . THR A 1 54  ? 11.215  -3.250  -7.387  1.00 0.00 ? 54  THR A HG22 3  
ATOM 6534  H HG23 . THR A 1 54  ? 11.400  -1.553  -6.938  1.00 0.00 ? 54  THR A HG23 3  
ATOM 6535  N N    . ARG A 1 55  ? 8.794   -5.206  -6.817  1.00 0.00 ? 55  ARG A N    3  
ATOM 6536  C CA   . ARG A 1 55  ? 9.288   -6.560  -6.617  1.00 0.00 ? 55  ARG A CA   3  
ATOM 6537  C C    . ARG A 1 55  ? 8.195   -7.595  -6.851  1.00 0.00 ? 55  ARG A C    3  
ATOM 6538  O O    . ARG A 1 55  ? 8.360   -8.771  -6.528  1.00 0.00 ? 55  ARG A O    3  
ATOM 6539  C CB   . ARG A 1 55  ? 9.879   -6.696  -5.214  1.00 0.00 ? 55  ARG A CB   3  
ATOM 6540  C CG   . ARG A 1 55  ? 11.245  -6.038  -5.080  1.00 0.00 ? 55  ARG A CG   3  
ATOM 6541  C CD   . ARG A 1 55  ? 11.552  -5.651  -3.645  1.00 0.00 ? 55  ARG A CD   3  
ATOM 6542  N NE   . ARG A 1 55  ? 10.580  -4.699  -3.113  1.00 0.00 ? 55  ARG A NE   3  
ATOM 6543  C CZ   . ARG A 1 55  ? 10.753  -3.378  -3.092  1.00 0.00 ? 55  ARG A CZ   3  
ATOM 6544  N NH1  . ARG A 1 55  ? 11.864  -2.831  -3.569  1.00 0.00 ? 55  ARG A NH1  3  
ATOM 6545  N NH2  . ARG A 1 55  ? 9.818   -2.599  -2.572  1.00 0.00 ? 55  ARG A NH2  3  
ATOM 6546  H H    . ARG A 1 55  ? 8.253   -4.779  -6.114  1.00 0.00 ? 55  ARG A H    3  
ATOM 6547  H HA   . ARG A 1 55  ? 10.073  -6.726  -7.338  1.00 0.00 ? 55  ARG A HA   3  
ATOM 6548  H HB2  . ARG A 1 55  ? 9.205   -6.238  -4.505  1.00 0.00 ? 55  ARG A HB2  3  
ATOM 6549  H HB3  . ARG A 1 55  ? 9.981   -7.745  -4.978  1.00 0.00 ? 55  ARG A HB3  3  
ATOM 6550  H HG2  . ARG A 1 55  ? 12.000  -6.730  -5.421  1.00 0.00 ? 55  ARG A HG2  3  
ATOM 6551  H HG3  . ARG A 1 55  ? 11.269  -5.149  -5.694  1.00 0.00 ? 55  ARG A HG3  3  
ATOM 6552  H HD2  . ARG A 1 55  ? 11.539  -6.544  -3.035  1.00 0.00 ? 55  ARG A HD2  3  
ATOM 6553  H HD3  . ARG A 1 55  ? 12.536  -5.207  -3.607  1.00 0.00 ? 55  ARG A HD3  3  
ATOM 6554  H HE   . ARG A 1 55  ? 9.749   -5.070  -2.735  1.00 0.00 ? 55  ARG A HE   3  
ATOM 6555  H HH11 . ARG A 1 55  ? 12.593  -3.408  -3.953  1.00 0.00 ? 55  ARG A HH11 3  
ATOM 6556  H HH12 . ARG A 1 55  ? 11.978  -1.828  -3.551  1.00 0.00 ? 55  ARG A HH12 3  
ATOM 6557  H HH21 . ARG A 1 55  ? 8.965   -3.002  -2.188  1.00 0.00 ? 55  ARG A HH21 3  
ATOM 6558  H HH22 . ARG A 1 55  ? 9.945   -1.606  -2.557  1.00 0.00 ? 55  ARG A HH22 3  
ATOM 6559  N N    . PHE A 1 56  ? 7.087   -7.158  -7.429  1.00 0.00 ? 56  PHE A N    3  
ATOM 6560  C CA   . PHE A 1 56  ? 5.981   -8.054  -7.717  1.00 0.00 ? 56  PHE A CA   3  
ATOM 6561  C C    . PHE A 1 56  ? 6.052   -8.497  -9.174  1.00 0.00 ? 56  PHE A C    3  
ATOM 6562  O O    . PHE A 1 56  ? 6.801   -9.415  -9.513  1.00 0.00 ? 56  PHE A O    3  
ATOM 6563  C CB   . PHE A 1 56  ? 4.634   -7.377  -7.430  1.00 0.00 ? 56  PHE A CB   3  
ATOM 6564  C CG   . PHE A 1 56  ? 3.510   -8.340  -7.157  1.00 0.00 ? 56  PHE A CG   3  
ATOM 6565  C CD1  . PHE A 1 56  ? 3.015   -9.160  -8.159  1.00 0.00 ? 56  PHE A CD1  3  
ATOM 6566  C CD2  . PHE A 1 56  ? 2.944   -8.420  -5.895  1.00 0.00 ? 56  PHE A CD2  3  
ATOM 6567  C CE1  . PHE A 1 56  ? 1.978   -10.038 -7.911  1.00 0.00 ? 56  PHE A CE1  3  
ATOM 6568  C CE2  . PHE A 1 56  ? 1.908   -9.298  -5.639  1.00 0.00 ? 56  PHE A CE2  3  
ATOM 6569  C CZ   . PHE A 1 56  ? 1.426   -10.109 -6.649  1.00 0.00 ? 56  PHE A CZ   3  
ATOM 6570  H H    . PHE A 1 56  ? 7.016   -6.213  -7.678  1.00 0.00 ? 56  PHE A H    3  
ATOM 6571  H HA   . PHE A 1 56  ? 6.083   -8.923  -7.083  1.00 0.00 ? 56  PHE A HA   3  
ATOM 6572  H HB2  . PHE A 1 56  ? 4.739   -6.738  -6.566  1.00 0.00 ? 56  PHE A HB2  3  
ATOM 6573  H HB3  . PHE A 1 56  ? 4.356   -6.774  -8.283  1.00 0.00 ? 56  PHE A HB3  3  
ATOM 6574  H HD1  . PHE A 1 56  ? 3.450   -9.107  -9.147  1.00 0.00 ? 56  PHE A HD1  3  
ATOM 6575  H HD2  . PHE A 1 56  ? 3.319   -7.788  -5.105  1.00 0.00 ? 56  PHE A HD2  3  
ATOM 6576  H HE1  . PHE A 1 56  ? 1.602   -10.669 -8.703  1.00 0.00 ? 56  PHE A HE1  3  
ATOM 6577  H HE2  . PHE A 1 56  ? 1.477   -9.351  -4.652  1.00 0.00 ? 56  PHE A HE2  3  
ATOM 6578  H HZ   . PHE A 1 56  ? 0.615   -10.794 -6.450  1.00 0.00 ? 56  PHE A HZ   3  
ATOM 6579  N N    . ARG A 1 57  ? 5.291   -7.812  -10.026 1.00 0.00 ? 57  ARG A N    3  
ATOM 6580  C CA   . ARG A 1 57  ? 5.225   -8.104  -11.453 1.00 0.00 ? 57  ARG A CA   3  
ATOM 6581  C C    . ARG A 1 57  ? 4.095   -7.292  -12.062 1.00 0.00 ? 57  ARG A C    3  
ATOM 6582  O O    . ARG A 1 57  ? 4.319   -6.362  -12.834 1.00 0.00 ? 57  ARG A O    3  
ATOM 6583  C CB   . ARG A 1 57  ? 4.965   -9.593  -11.699 1.00 0.00 ? 57  ARG A CB   3  
ATOM 6584  C CG   . ARG A 1 57  ? 5.124   -10.014 -13.153 1.00 0.00 ? 57  ARG A CG   3  
ATOM 6585  C CD   . ARG A 1 57  ? 4.754   -11.474 -13.356 1.00 0.00 ? 57  ARG A CD   3  
ATOM 6586  N NE   . ARG A 1 57  ? 5.506   -12.363 -12.469 1.00 0.00 ? 57  ARG A NE   3  
ATOM 6587  C CZ   . ARG A 1 57  ? 4.945   -13.225 -11.622 1.00 0.00 ? 57  ARG A CZ   3  
ATOM 6588  N NH1  . ARG A 1 57  ? 3.623   -13.314 -11.537 1.00 0.00 ? 57  ARG A NH1  3  
ATOM 6589  N NH2  . ARG A 1 57  ? 5.705   -14.000 -10.858 1.00 0.00 ? 57  ARG A NH2  3  
ATOM 6590  H H    . ARG A 1 57  ? 4.750   -7.067  -9.676  1.00 0.00 ? 57  ARG A H    3  
ATOM 6591  H HA   . ARG A 1 57  ? 6.162   -7.816  -11.907 1.00 0.00 ? 57  ARG A HA   3  
ATOM 6592  H HB2  . ARG A 1 57  ? 5.654   -10.170 -11.100 1.00 0.00 ? 57  ARG A HB2  3  
ATOM 6593  H HB3  . ARG A 1 57  ? 3.955   -9.822  -11.389 1.00 0.00 ? 57  ARG A HB3  3  
ATOM 6594  H HG2  . ARG A 1 57  ? 4.481   -9.403  -13.767 1.00 0.00 ? 57  ARG A HG2  3  
ATOM 6595  H HG3  . ARG A 1 57  ? 6.154   -9.867  -13.450 1.00 0.00 ? 57  ARG A HG3  3  
ATOM 6596  H HD2  . ARG A 1 57  ? 3.698   -11.596 -13.160 1.00 0.00 ? 57  ARG A HD2  3  
ATOM 6597  H HD3  . ARG A 1 57  ? 4.961   -11.745 -14.381 1.00 0.00 ? 57  ARG A HD3  3  
ATOM 6598  H HE   . ARG A 1 57  ? 6.489   -12.311 -12.513 1.00 0.00 ? 57  ARG A HE   3  
ATOM 6599  H HH11 . ARG A 1 57  ? 3.038   -12.733 -12.114 1.00 0.00 ? 57  ARG A HH11 3  
ATOM 6600  H HH12 . ARG A 1 57  ? 3.200   -13.962 -10.892 1.00 0.00 ? 57  ARG A HH12 3  
ATOM 6601  H HH21 . ARG A 1 57  ? 6.711   -13.938 -10.913 1.00 0.00 ? 57  ARG A HH21 3  
ATOM 6602  H HH22 . ARG A 1 57  ? 5.282   -14.652 -10.227 1.00 0.00 ? 57  ARG A HH22 3  
ATOM 6603  N N    . ARG A 1 58  ? 2.877   -7.659  -11.684 1.00 0.00 ? 58  ARG A N    3  
ATOM 6604  C CA   . ARG A 1 58  ? 1.676   -6.991  -12.150 1.00 0.00 ? 58  ARG A CA   3  
ATOM 6605  C C    . ARG A 1 58  ? 0.570   -7.176  -11.119 1.00 0.00 ? 58  ARG A C    3  
ATOM 6606  O O    . ARG A 1 58  ? -0.292  -8.034  -11.267 1.00 0.00 ? 58  ARG A O    3  
ATOM 6607  C CB   . ARG A 1 58  ? 1.232   -7.537  -13.514 1.00 0.00 ? 58  ARG A CB   3  
ATOM 6608  C CG   . ARG A 1 58  ? 1.964   -6.918  -14.699 1.00 0.00 ? 58  ARG A CG   3  
ATOM 6609  C CD   . ARG A 1 58  ? 1.458   -5.516  -15.017 1.00 0.00 ? 58  ARG A CD   3  
ATOM 6610  N NE   . ARG A 1 58  ? 1.744   -4.558  -13.947 1.00 0.00 ? 58  ARG A NE   3  
ATOM 6611  C CZ   . ARG A 1 58  ? 2.267   -3.349  -14.142 1.00 0.00 ? 58  ARG A CZ   3  
ATOM 6612  N NH1  . ARG A 1 58  ? 2.627   -2.955  -15.355 1.00 0.00 ? 58  ARG A NH1  3  
ATOM 6613  N NH2  . ARG A 1 58  ? 2.444   -2.544  -13.112 1.00 0.00 ? 58  ARG A NH2  3  
ATOM 6614  H H    . ARG A 1 58  ? 2.785   -8.406  -11.058 1.00 0.00 ? 58  ARG A H    3  
ATOM 6615  H HA   . ARG A 1 58  ? 1.894   -5.938  -12.243 1.00 0.00 ? 58  ARG A HA   3  
ATOM 6616  H HB2  . ARG A 1 58  ? 1.401   -8.602  -13.533 1.00 0.00 ? 58  ARG A HB2  3  
ATOM 6617  H HB3  . ARG A 1 58  ? 0.175   -7.348  -13.636 1.00 0.00 ? 58  ARG A HB3  3  
ATOM 6618  H HG2  . ARG A 1 58  ? 3.017   -6.863  -14.467 1.00 0.00 ? 58  ARG A HG2  3  
ATOM 6619  H HG3  . ARG A 1 58  ? 1.818   -7.547  -15.564 1.00 0.00 ? 58  ARG A HG3  3  
ATOM 6620  H HD2  . ARG A 1 58  ? 1.933   -5.175  -15.924 1.00 0.00 ? 58  ARG A HD2  3  
ATOM 6621  H HD3  . ARG A 1 58  ? 0.388   -5.562  -15.168 1.00 0.00 ? 58  ARG A HD3  3  
ATOM 6622  H HE   . ARG A 1 58  ? 1.519   -4.827  -13.027 1.00 0.00 ? 58  ARG A HE   3  
ATOM 6623  H HH11 . ARG A 1 58  ? 2.512   -3.567  -16.148 1.00 0.00 ? 58  ARG A HH11 3  
ATOM 6624  H HH12 . ARG A 1 58  ? 3.021   -2.036  -15.493 1.00 0.00 ? 58  ARG A HH12 3  
ATOM 6625  H HH21 . ARG A 1 58  ? 2.183   -2.849  -12.183 1.00 0.00 ? 58  ARG A HH21 3  
ATOM 6626  H HH22 . ARG A 1 58  ? 2.838   -1.627  -13.242 1.00 0.00 ? 58  ARG A HH22 3  
ATOM 6627  N N    . THR A 1 59  ? 0.624   -6.383  -10.066 1.00 0.00 ? 59  THR A N    3  
ATOM 6628  C CA   . THR A 1 59  ? -0.349  -6.440  -8.987  1.00 0.00 ? 59  THR A CA   3  
ATOM 6629  C C    . THR A 1 59  ? -1.774  -6.231  -9.498  1.00 0.00 ? 59  THR A C    3  
ATOM 6630  O O    . THR A 1 59  ? -2.690  -6.972  -9.141  1.00 0.00 ? 59  THR A O    3  
ATOM 6631  C CB   . THR A 1 59  ? -0.025  -5.373  -7.921  1.00 0.00 ? 59  THR A CB   3  
ATOM 6632  O OG1  . THR A 1 59  ? 1.315   -5.554  -7.445  1.00 0.00 ? 59  THR A OG1  3  
ATOM 6633  C CG2  . THR A 1 59  ? -0.999  -5.443  -6.755  1.00 0.00 ? 59  THR A CG2  3  
ATOM 6634  H H    . THR A 1 59  ? 1.364   -5.728  -10.007 1.00 0.00 ? 59  THR A H    3  
ATOM 6635  H HA   . THR A 1 59  ? -0.280  -7.413  -8.523  1.00 0.00 ? 59  THR A HA   3  
ATOM 6636  H HB   . THR A 1 59  ? -0.107  -4.397  -8.380  1.00 0.00 ? 59  THR A HB   3  
ATOM 6637  H HG1  . THR A 1 59  ? 1.942   -5.451  -8.180  1.00 0.00 ? 59  THR A HG1  3  
ATOM 6638  H HG21 . THR A 1 59  ? -0.740  -4.692  -6.025  1.00 0.00 ? 59  THR A HG21 3  
ATOM 6639  H HG22 . THR A 1 59  ? -0.948  -6.420  -6.301  1.00 0.00 ? 59  THR A HG22 3  
ATOM 6640  H HG23 . THR A 1 59  ? -2.002  -5.265  -7.115  1.00 0.00 ? 59  THR A HG23 3  
ATOM 6641  N N    . PHE A 1 60  ? -1.943  -5.245  -10.368 1.00 0.00 ? 60  PHE A N    3  
ATOM 6642  C CA   . PHE A 1 60  ? -3.252  -4.919  -10.923 1.00 0.00 ? 60  PHE A CA   3  
ATOM 6643  C C    . PHE A 1 60  ? -3.701  -5.946  -11.964 1.00 0.00 ? 60  PHE A C    3  
ATOM 6644  O O    . PHE A 1 60  ? -4.783  -5.821  -12.540 1.00 0.00 ? 60  PHE A O    3  
ATOM 6645  C CB   . PHE A 1 60  ? -3.218  -3.524  -11.555 1.00 0.00 ? 60  PHE A CB   3  
ATOM 6646  C CG   . PHE A 1 60  ? -3.173  -2.394  -10.560 1.00 0.00 ? 60  PHE A CG   3  
ATOM 6647  C CD1  . PHE A 1 60  ? -2.091  -2.241  -9.705  1.00 0.00 ? 60  PHE A CD1  3  
ATOM 6648  C CD2  . PHE A 1 60  ? -4.213  -1.482  -10.486 1.00 0.00 ? 60  PHE A CD2  3  
ATOM 6649  C CE1  . PHE A 1 60  ? -2.050  -1.201  -8.794  1.00 0.00 ? 60  PHE A CE1  3  
ATOM 6650  C CE2  . PHE A 1 60  ? -4.177  -0.441  -9.578  1.00 0.00 ? 60  PHE A CE2  3  
ATOM 6651  C CZ   . PHE A 1 60  ? -3.096  -0.301  -8.731  1.00 0.00 ? 60  PHE A CZ   3  
ATOM 6652  H H    . PHE A 1 60  ? -1.165  -4.716  -10.644 1.00 0.00 ? 60  PHE A H    3  
ATOM 6653  H HA   . PHE A 1 60  ? -3.964  -4.916  -10.111 1.00 0.00 ? 60  PHE A HA   3  
ATOM 6654  H HB2  . PHE A 1 60  ? -2.342  -3.446  -12.180 1.00 0.00 ? 60  PHE A HB2  3  
ATOM 6655  H HB3  . PHE A 1 60  ? -4.099  -3.393  -12.167 1.00 0.00 ? 60  PHE A HB3  3  
ATOM 6656  H HD1  . PHE A 1 60  ? -1.273  -2.945  -9.755  1.00 0.00 ? 60  PHE A HD1  3  
ATOM 6657  H HD2  . PHE A 1 60  ? -5.062  -1.589  -11.146 1.00 0.00 ? 60  PHE A HD2  3  
ATOM 6658  H HE1  . PHE A 1 60  ? -1.205  -1.095  -8.132  1.00 0.00 ? 60  PHE A HE1  3  
ATOM 6659  H HE2  . PHE A 1 60  ? -4.994  0.264   -9.533  1.00 0.00 ? 60  PHE A HE2  3  
ATOM 6660  H HZ   . PHE A 1 60  ? -3.067  0.512   -8.020  1.00 0.00 ? 60  PHE A HZ   3  
ATOM 6661  N N    . SER A 1 61  ? -2.886  -6.966  -12.196 1.00 0.00 ? 61  SER A N    3  
ATOM 6662  C CA   . SER A 1 61  ? -3.216  -7.983  -13.181 1.00 0.00 ? 61  SER A CA   3  
ATOM 6663  C C    . SER A 1 61  ? -3.215  -9.387  -12.578 1.00 0.00 ? 61  SER A C    3  
ATOM 6664  O O    . SER A 1 61  ? -4.205  -10.104 -12.667 1.00 0.00 ? 61  SER A O    3  
ATOM 6665  C CB   . SER A 1 61  ? -2.224  -7.918  -14.342 1.00 0.00 ? 61  SER A CB   3  
ATOM 6666  O OG   . SER A 1 61  ? -2.003  -6.578  -14.754 1.00 0.00 ? 61  SER A OG   3  
ATOM 6667  H H    . SER A 1 61  ? -2.049  -7.036  -11.694 1.00 0.00 ? 61  SER A H    3  
ATOM 6668  H HA   . SER A 1 61  ? -4.204  -7.766  -13.558 1.00 0.00 ? 61  SER A HA   3  
ATOM 6669  H HB2  . SER A 1 61  ? -1.283  -8.346  -14.031 1.00 0.00 ? 61  SER A HB2  3  
ATOM 6670  H HB3  . SER A 1 61  ? -2.615  -8.481  -15.176 1.00 0.00 ? 61  SER A HB3  3  
ATOM 6671  H HG   . SER A 1 61  ? -2.858  -6.156  -14.940 1.00 0.00 ? 61  SER A HG   3  
ATOM 6672  N N    . ASP A 1 62  ? -2.108  -9.768  -11.955 1.00 0.00 ? 62  ASP A N    3  
ATOM 6673  C CA   . ASP A 1 62  ? -1.975  -11.098 -11.365 1.00 0.00 ? 62  ASP A CA   3  
ATOM 6674  C C    . ASP A 1 62  ? -2.676  -11.191 -10.018 1.00 0.00 ? 62  ASP A C    3  
ATOM 6675  O O    . ASP A 1 62  ? -3.558  -12.023 -9.837  1.00 0.00 ? 62  ASP A O    3  
ATOM 6676  C CB   . ASP A 1 62  ? -0.498  -11.471 -11.199 1.00 0.00 ? 62  ASP A CB   3  
ATOM 6677  C CG   . ASP A 1 62  ? -0.296  -12.960 -10.969 1.00 0.00 ? 62  ASP A CG   3  
ATOM 6678  O OD1  . ASP A 1 62  ? -0.392  -13.410 -9.809  1.00 0.00 ? 62  ASP A OD1  3  
ATOM 6679  O OD2  . ASP A 1 62  ? -0.027  -13.687 -11.955 1.00 0.00 ? 62  ASP A OD2  3  
ATOM 6680  H H    . ASP A 1 62  ? -1.357  -9.137  -11.887 1.00 0.00 ? 62  ASP A H    3  
ATOM 6681  H HA   . ASP A 1 62  ? -2.436  -11.802 -12.042 1.00 0.00 ? 62  ASP A HA   3  
ATOM 6682  H HB2  . ASP A 1 62  ? 0.040   -11.188 -12.093 1.00 0.00 ? 62  ASP A HB2  3  
ATOM 6683  H HB3  . ASP A 1 62  ? -0.089  -10.936 -10.355 1.00 0.00 ? 62  ASP A HB3  3  
ATOM 6684  N N    . LEU A 1 63  ? -2.294  -10.327 -9.082  1.00 0.00 ? 63  LEU A N    3  
ATOM 6685  C CA   . LEU A 1 63  ? -2.884  -10.335 -7.746  1.00 0.00 ? 63  LEU A CA   3  
ATOM 6686  C C    . LEU A 1 63  ? -4.393  -10.121 -7.816  1.00 0.00 ? 63  LEU A C    3  
ATOM 6687  O O    . LEU A 1 63  ? -5.162  -10.806 -7.144  1.00 0.00 ? 63  LEU A O    3  
ATOM 6688  C CB   . LEU A 1 63  ? -2.241  -9.261  -6.865  1.00 0.00 ? 63  LEU A CB   3  
ATOM 6689  C CG   . LEU A 1 63  ? -2.525  -9.404  -5.368  1.00 0.00 ? 63  LEU A CG   3  
ATOM 6690  C CD1  . LEU A 1 63  ? -1.710  -10.541 -4.775  1.00 0.00 ? 63  LEU A CD1  3  
ATOM 6691  C CD2  . LEU A 1 63  ? -2.238  -8.102  -4.635  1.00 0.00 ? 63  LEU A CD2  3  
ATOM 6692  H H    . LEU A 1 63  ? -1.602  -9.668  -9.295  1.00 0.00 ? 63  LEU A H    3  
ATOM 6693  H HA   . LEU A 1 63  ? -2.693  -11.304 -7.308  1.00 0.00 ? 63  LEU A HA   3  
ATOM 6694  H HB2  . LEU A 1 63  ? -1.172  -9.294  -7.016  1.00 0.00 ? 63  LEU A HB2  3  
ATOM 6695  H HB3  . LEU A 1 63  ? -2.605  -8.297  -7.186  1.00 0.00 ? 63  LEU A HB3  3  
ATOM 6696  H HG   . LEU A 1 63  ? -3.570  -9.641  -5.229  1.00 0.00 ? 63  LEU A HG   3  
ATOM 6697  H HD11 . LEU A 1 63  ? -0.659  -10.363 -4.953  1.00 0.00 ? 63  LEU A HD11 3  
ATOM 6698  H HD12 . LEU A 1 63  ? -2.001  -11.473 -5.238  1.00 0.00 ? 63  LEU A HD12 3  
ATOM 6699  H HD13 . LEU A 1 63  ? -1.890  -10.597 -3.711  1.00 0.00 ? 63  LEU A HD13 3  
ATOM 6700  H HD21 . LEU A 1 63  ? -2.454  -8.228  -3.585  1.00 0.00 ? 63  LEU A HD21 3  
ATOM 6701  H HD22 . LEU A 1 63  ? -2.857  -7.316  -5.039  1.00 0.00 ? 63  LEU A HD22 3  
ATOM 6702  H HD23 . LEU A 1 63  ? -1.197  -7.840  -4.759  1.00 0.00 ? 63  LEU A HD23 3  
ATOM 6703  N N    . ALA A 1 64  ? -4.806  -9.186  -8.660  1.00 0.00 ? 64  ALA A N    3  
ATOM 6704  C CA   . ALA A 1 64  ? -6.220  -8.875  -8.833  1.00 0.00 ? 64  ALA A CA   3  
ATOM 6705  C C    . ALA A 1 64  ? -6.976  -10.031 -9.487  1.00 0.00 ? 64  ALA A C    3  
ATOM 6706  O O    . ALA A 1 64  ? -8.205  -10.090 -9.430  1.00 0.00 ? 64  ALA A O    3  
ATOM 6707  C CB   . ALA A 1 64  ? -6.385  -7.605  -9.653  1.00 0.00 ? 64  ALA A CB   3  
ATOM 6708  H H    . ALA A 1 64  ? -4.140  -8.676  -9.168  1.00 0.00 ? 64  ALA A H    3  
ATOM 6709  H HA   . ALA A 1 64  ? -6.641  -8.697  -7.853  1.00 0.00 ? 64  ALA A HA   3  
ATOM 6710  H HB1  . ALA A 1 64  ? -7.435  -7.379  -9.758  1.00 0.00 ? 64  ALA A HB1  3  
ATOM 6711  H HB2  . ALA A 1 64  ? -5.948  -7.750  -10.631 1.00 0.00 ? 64  ALA A HB2  3  
ATOM 6712  H HB3  . ALA A 1 64  ? -5.887  -6.785  -9.154  1.00 0.00 ? 64  ALA A HB3  3  
ATOM 6713  N N    . ALA A 1 65  ? -6.246  -10.945 -10.112 1.00 0.00 ? 65  ALA A N    3  
ATOM 6714  C CA   . ALA A 1 65  ? -6.864  -12.088 -10.769 1.00 0.00 ? 65  ALA A CA   3  
ATOM 6715  C C    . ALA A 1 65  ? -6.841  -13.319 -9.871  1.00 0.00 ? 65  ALA A C    3  
ATOM 6716  O O    . ALA A 1 65  ? -7.857  -13.997 -9.713  1.00 0.00 ? 65  ALA A O    3  
ATOM 6717  C CB   . ALA A 1 65  ? -6.169  -12.393 -12.086 1.00 0.00 ? 65  ALA A CB   3  
ATOM 6718  H H    . ALA A 1 65  ? -5.271  -10.849 -10.133 1.00 0.00 ? 65  ALA A H    3  
ATOM 6719  H HA   . ALA A 1 65  ? -7.892  -11.831 -10.984 1.00 0.00 ? 65  ALA A HA   3  
ATOM 6720  H HB1  . ALA A 1 65  ? -6.661  -13.224 -12.569 1.00 0.00 ? 65  ALA A HB1  3  
ATOM 6721  H HB2  . ALA A 1 65  ? -5.136  -12.647 -11.898 1.00 0.00 ? 65  ALA A HB2  3  
ATOM 6722  H HB3  . ALA A 1 65  ? -6.214  -11.526 -12.727 1.00 0.00 ? 65  ALA A HB3  3  
ATOM 6723  N N    . GLN A 1 66  ? -5.684  -13.590 -9.271  1.00 0.00 ? 66  GLN A N    3  
ATOM 6724  C CA   . GLN A 1 66  ? -5.520  -14.749 -8.396  1.00 0.00 ? 66  GLN A CA   3  
ATOM 6725  C C    . GLN A 1 66  ? -6.407  -14.641 -7.155  1.00 0.00 ? 66  GLN A C    3  
ATOM 6726  O O    . GLN A 1 66  ? -6.899  -15.650 -6.650  1.00 0.00 ? 66  GLN A O    3  
ATOM 6727  C CB   . GLN A 1 66  ? -4.050  -14.931 -7.990  1.00 0.00 ? 66  GLN A CB   3  
ATOM 6728  C CG   . GLN A 1 66  ? -3.466  -13.775 -7.193  1.00 0.00 ? 66  GLN A CG   3  
ATOM 6729  C CD   . GLN A 1 66  ? -2.172  -14.142 -6.494  1.00 0.00 ? 66  GLN A CD   3  
ATOM 6730  O OE1  . GLN A 1 66  ? -2.181  -14.621 -5.360  1.00 0.00 ? 66  GLN A OE1  3  
ATOM 6731  N NE2  . GLN A 1 66  ? -1.050  -13.927 -7.164  1.00 0.00 ? 66  GLN A NE2  3  
ATOM 6732  H H    . GLN A 1 66  ? -4.912  -12.998 -9.429  1.00 0.00 ? 66  GLN A H    3  
ATOM 6733  H HA   . GLN A 1 66  ? -5.831  -15.620 -8.956  1.00 0.00 ? 66  GLN A HA   3  
ATOM 6734  H HB2  . GLN A 1 66  ? -3.967  -15.826 -7.393  1.00 0.00 ? 66  GLN A HB2  3  
ATOM 6735  H HB3  . GLN A 1 66  ? -3.458  -15.055 -8.884  1.00 0.00 ? 66  GLN A HB3  3  
ATOM 6736  H HG2  . GLN A 1 66  ? -3.273  -12.952 -7.867  1.00 0.00 ? 66  GLN A HG2  3  
ATOM 6737  H HG3  . GLN A 1 66  ? -4.185  -13.467 -6.450  1.00 0.00 ? 66  GLN A HG3  3  
ATOM 6738  H HE21 . GLN A 1 66  ? -1.111  -13.548 -8.074  1.00 0.00 ? 66  GLN A HE21 3  
ATOM 6739  H HE22 . GLN A 1 66  ? -0.199  -14.151 -6.726  1.00 0.00 ? 66  GLN A HE22 3  
ATOM 6740  N N    . LEU A 1 67  ? -6.616  -13.420 -6.671  1.00 0.00 ? 67  LEU A N    3  
ATOM 6741  C CA   . LEU A 1 67  ? -7.460  -13.207 -5.500  1.00 0.00 ? 67  LEU A CA   3  
ATOM 6742  C C    . LEU A 1 67  ? -8.929  -13.174 -5.905  1.00 0.00 ? 67  LEU A C    3  
ATOM 6743  O O    . LEU A 1 67  ? -9.822  -13.213 -5.059  1.00 0.00 ? 67  LEU A O    3  
ATOM 6744  C CB   . LEU A 1 67  ? -7.085  -11.908 -4.780  1.00 0.00 ? 67  LEU A CB   3  
ATOM 6745  C CG   . LEU A 1 67  ? -6.155  -12.068 -3.572  1.00 0.00 ? 67  LEU A CG   3  
ATOM 6746  C CD1  . LEU A 1 67  ? -6.710  -13.094 -2.597  1.00 0.00 ? 67  LEU A CD1  3  
ATOM 6747  C CD2  . LEU A 1 67  ? -4.756  -12.457 -4.015  1.00 0.00 ? 67  LEU A CD2  3  
ATOM 6748  H H    . LEU A 1 67  ? -6.185  -12.648 -7.101  1.00 0.00 ? 67  LEU A H    3  
ATOM 6749  H HA   . LEU A 1 67  ? -7.307  -14.039 -4.829  1.00 0.00 ? 67  LEU A HA   3  
ATOM 6750  H HB2  . LEU A 1 67  ? -6.603  -11.253 -5.491  1.00 0.00 ? 67  LEU A HB2  3  
ATOM 6751  H HB3  . LEU A 1 67  ? -7.994  -11.435 -4.442  1.00 0.00 ? 67  LEU A HB3  3  
ATOM 6752  H HG   . LEU A 1 67  ? -6.089  -11.124 -3.052  1.00 0.00 ? 67  LEU A HG   3  
ATOM 6753  H HD11 . LEU A 1 67  ? -7.683  -12.777 -2.254  1.00 0.00 ? 67  LEU A HD11 3  
ATOM 6754  H HD12 . LEU A 1 67  ? -6.043  -13.185 -1.751  1.00 0.00 ? 67  LEU A HD12 3  
ATOM 6755  H HD13 . LEU A 1 67  ? -6.796  -14.051 -3.091  1.00 0.00 ? 67  LEU A HD13 3  
ATOM 6756  H HD21 . LEU A 1 67  ? -4.342  -11.672 -4.631  1.00 0.00 ? 67  LEU A HD21 3  
ATOM 6757  H HD22 . LEU A 1 67  ? -4.799  -13.375 -4.584  1.00 0.00 ? 67  LEU A HD22 3  
ATOM 6758  H HD23 . LEU A 1 67  ? -4.130  -12.601 -3.147  1.00 0.00 ? 67  LEU A HD23 3  
ATOM 6759  N N    . HIS A 1 68  ? -9.173  -13.105 -7.206  1.00 0.00 ? 68  HIS A N    3  
ATOM 6760  C CA   . HIS A 1 68  ? -10.533 -13.075 -7.718  1.00 0.00 ? 68  HIS A CA   3  
ATOM 6761  C C    . HIS A 1 68  ? -11.006 -14.493 -8.009  1.00 0.00 ? 68  HIS A C    3  
ATOM 6762  O O    . HIS A 1 68  ? -12.186 -14.728 -8.257  1.00 0.00 ? 68  HIS A O    3  
ATOM 6763  C CB   . HIS A 1 68  ? -10.622 -12.211 -8.979  1.00 0.00 ? 68  HIS A CB   3  
ATOM 6764  C CG   . HIS A 1 68  ? -11.961 -11.560 -9.167  1.00 0.00 ? 68  HIS A CG   3  
ATOM 6765  N ND1  . HIS A 1 68  ? -12.664 -11.600 -10.351 1.00 0.00 ? 68  HIS A ND1  3  
ATOM 6766  C CD2  . HIS A 1 68  ? -12.721 -10.838 -8.307  1.00 0.00 ? 68  HIS A CD2  3  
ATOM 6767  C CE1  . HIS A 1 68  ? -13.794 -10.934 -10.213 1.00 0.00 ? 68  HIS A CE1  3  
ATOM 6768  N NE2  . HIS A 1 68  ? -13.854 -10.463 -8.984  1.00 0.00 ? 68  HIS A NE2  3  
ATOM 6769  H H    . HIS A 1 68  ? -8.421  -13.080 -7.835  1.00 0.00 ? 68  HIS A H    3  
ATOM 6770  H HA   . HIS A 1 68  ? -11.164 -12.647 -6.953  1.00 0.00 ? 68  HIS A HA   3  
ATOM 6771  H HB2  . HIS A 1 68  ? -9.879  -11.430 -8.923  1.00 0.00 ? 68  HIS A HB2  3  
ATOM 6772  H HB3  . HIS A 1 68  ? -10.426 -12.829 -9.842  1.00 0.00 ? 68  HIS A HB3  3  
ATOM 6773  H HD1  . HIS A 1 68  ? -12.379 -12.063 -11.178 1.00 0.00 ? 68  HIS A HD1  3  
ATOM 6774  H HD2  . HIS A 1 68  ? -12.480 -10.602 -7.280  1.00 0.00 ? 68  HIS A HD2  3  
ATOM 6775  H HE1  . HIS A 1 68  ? -14.539 -10.790 -10.981 1.00 0.00 ? 68  HIS A HE1  3  
ATOM 6776  H HE2  . HIS A 1 68  ? -14.639 -10.018 -8.587  1.00 0.00 ? 68  HIS A HE2  3  
ATOM 6777  N N    . VAL A 1 69  ? -10.065 -15.436 -7.991  1.00 0.00 ? 69  VAL A N    3  
ATOM 6778  C CA   . VAL A 1 69  ? -10.386 -16.838 -8.226  1.00 0.00 ? 69  VAL A CA   3  
ATOM 6779  C C    . VAL A 1 69  ? -11.252 -17.350 -7.084  1.00 0.00 ? 69  VAL A C    3  
ATOM 6780  O O    . VAL A 1 69  ? -12.234 -18.065 -7.295  1.00 0.00 ? 69  VAL A O    3  
ATOM 6781  C CB   . VAL A 1 69  ? -9.113  -17.712 -8.341  1.00 0.00 ? 69  VAL A CB   3  
ATOM 6782  C CG1  . VAL A 1 69  ? -9.470  -19.161 -8.643  1.00 0.00 ? 69  VAL A CG1  3  
ATOM 6783  C CG2  . VAL A 1 69  ? -8.178  -17.167 -9.410  1.00 0.00 ? 69  VAL A CG2  3  
ATOM 6784  H H    . VAL A 1 69  ? -9.136  -15.180 -7.813  1.00 0.00 ? 69  VAL A H    3  
ATOM 6785  H HA   . VAL A 1 69  ? -10.941 -16.908 -9.150  1.00 0.00 ? 69  VAL A HA   3  
ATOM 6786  H HB   . VAL A 1 69  ? -8.594  -17.684 -7.393  1.00 0.00 ? 69  VAL A HB   3  
ATOM 6787  H HG11 . VAL A 1 69  ? -10.124 -19.539 -7.871  1.00 0.00 ? 69  VAL A HG11 3  
ATOM 6788  H HG12 . VAL A 1 69  ? -8.568  -19.755 -8.673  1.00 0.00 ? 69  VAL A HG12 3  
ATOM 6789  H HG13 . VAL A 1 69  ? -9.970  -19.216 -9.599  1.00 0.00 ? 69  VAL A HG13 3  
ATOM 6790  H HG21 . VAL A 1 69  ? -7.325  -17.822 -9.510  1.00 0.00 ? 69  VAL A HG21 3  
ATOM 6791  H HG22 . VAL A 1 69  ? -7.842  -16.180 -9.125  1.00 0.00 ? 69  VAL A HG22 3  
ATOM 6792  H HG23 . VAL A 1 69  ? -8.702  -17.111 -10.351 1.00 0.00 ? 69  VAL A HG23 3  
ATOM 6793  N N    . THR A 1 70  ? -10.883 -16.951 -5.879  1.00 0.00 ? 70  THR A N    3  
ATOM 6794  C CA   . THR A 1 70  ? -11.609 -17.331 -4.688  1.00 0.00 ? 70  THR A CA   3  
ATOM 6795  C C    . THR A 1 70  ? -12.912 -16.544 -4.608  1.00 0.00 ? 70  THR A C    3  
ATOM 6796  O O    . THR A 1 70  ? -12.906 -15.317 -4.733  1.00 0.00 ? 70  THR A O    3  
ATOM 6797  C CB   . THR A 1 70  ? -10.760 -17.057 -3.433  1.00 0.00 ? 70  THR A CB   3  
ATOM 6798  O OG1  . THR A 1 70  ? -9.376  -17.291 -3.734  1.00 0.00 ? 70  THR A OG1  3  
ATOM 6799  C CG2  . THR A 1 70  ? -11.189 -17.947 -2.276  1.00 0.00 ? 70  THR A CG2  3  
ATOM 6800  H H    . THR A 1 70  ? -10.094 -16.377 -5.788  1.00 0.00 ? 70  THR A H    3  
ATOM 6801  H HA   . THR A 1 70  ? -11.828 -18.387 -4.739  1.00 0.00 ? 70  THR A HA   3  
ATOM 6802  H HB   . THR A 1 70  ? -10.890 -16.024 -3.145  1.00 0.00 ? 70  THR A HB   3  
ATOM 6803  H HG1  . THR A 1 70  ? -9.289  -18.139 -4.201  1.00 0.00 ? 70  THR A HG1  3  
ATOM 6804  H HG21 . THR A 1 70  ? -11.108 -18.984 -2.570  1.00 0.00 ? 70  THR A HG21 3  
ATOM 6805  H HG22 . THR A 1 70  ? -12.214 -17.727 -2.014  1.00 0.00 ? 70  THR A HG22 3  
ATOM 6806  H HG23 . THR A 1 70  ? -10.552 -17.764 -1.425  1.00 0.00 ? 70  THR A HG23 3  
ATOM 6807  N N    . PRO A 1 71  ? -14.048 -17.242 -4.444  1.00 0.00 ? 71  PRO A N    3  
ATOM 6808  C CA   . PRO A 1 71  ? -15.365 -16.604 -4.348  1.00 0.00 ? 71  PRO A CA   3  
ATOM 6809  C C    . PRO A 1 71  ? -15.411 -15.546 -3.252  1.00 0.00 ? 71  PRO A C    3  
ATOM 6810  O O    . PRO A 1 71  ? -15.435 -15.867 -2.061  1.00 0.00 ? 71  PRO A O    3  
ATOM 6811  C CB   . PRO A 1 71  ? -16.307 -17.764 -4.015  1.00 0.00 ? 71  PRO A CB   3  
ATOM 6812  C CG   . PRO A 1 71  ? -15.608 -18.978 -4.523  1.00 0.00 ? 71  PRO A CG   3  
ATOM 6813  C CD   . PRO A 1 71  ? -14.139 -18.712 -4.354  1.00 0.00 ? 71  PRO A CD   3  
ATOM 6814  H HA   . PRO A 1 71  ? -15.657 -16.158 -5.288  1.00 0.00 ? 71  PRO A HA   3  
ATOM 6815  H HB2  . PRO A 1 71  ? -16.459 -17.813 -2.946  1.00 0.00 ? 71  PRO A HB2  3  
ATOM 6816  H HB3  . PRO A 1 71  ? -17.254 -17.617 -4.512  1.00 0.00 ? 71  PRO A HB3  3  
ATOM 6817  H HG2  . PRO A 1 71  ? -15.903 -19.842 -3.947  1.00 0.00 ? 71  PRO A HG2  3  
ATOM 6818  H HG3  . PRO A 1 71  ? -15.841 -19.125 -5.566  1.00 0.00 ? 71  PRO A HG3  3  
ATOM 6819  H HD2  . PRO A 1 71  ? -13.800 -19.061 -3.391  1.00 0.00 ? 71  PRO A HD2  3  
ATOM 6820  H HD3  . PRO A 1 71  ? -13.577 -19.180 -5.148  1.00 0.00 ? 71  PRO A HD3  3  
ATOM 6821  N N    . GLY A 1 72  ? -15.406 -14.288 -3.663  1.00 0.00 ? 72  GLY A N    3  
ATOM 6822  C CA   . GLY A 1 72  ? -15.444 -13.197 -2.717  1.00 0.00 ? 72  GLY A CA   3  
ATOM 6823  C C    . GLY A 1 72  ? -16.607 -12.263 -2.970  1.00 0.00 ? 72  GLY A C    3  
ATOM 6824  O O    . GLY A 1 72  ? -17.752 -12.701 -3.072  1.00 0.00 ? 72  GLY A O    3  
ATOM 6825  H H    . GLY A 1 72  ? -15.377 -14.098 -4.628  1.00 0.00 ? 72  GLY A H    3  
ATOM 6826  H HA2  . GLY A 1 72  ? -15.531 -13.601 -1.719  1.00 0.00 ? 72  GLY A HA2  3  
ATOM 6827  H HA3  . GLY A 1 72  ? -14.523 -12.638 -2.790  1.00 0.00 ? 72  GLY A HA3  3  
ATOM 6828  N N    . SER A 1 73  ? -16.317 -10.977 -3.070  1.00 0.00 ? 73  SER A N    3  
ATOM 6829  C CA   . SER A 1 73  ? -17.342 -9.967  -3.308  1.00 0.00 ? 73  SER A CA   3  
ATOM 6830  C C    . SER A 1 73  ? -16.706 -8.725  -3.935  1.00 0.00 ? 73  SER A C    3  
ATOM 6831  O O    . SER A 1 73  ? -15.727 -8.831  -4.676  1.00 0.00 ? 73  SER A O    3  
ATOM 6832  C CB   . SER A 1 73  ? -18.038 -9.599  -1.992  1.00 0.00 ? 73  SER A CB   3  
ATOM 6833  O OG   . SER A 1 73  ? -18.297 -10.749 -1.201  1.00 0.00 ? 73  SER A OG   3  
ATOM 6834  H H    . SER A 1 73  ? -15.374 -10.691 -2.994  1.00 0.00 ? 73  SER A H    3  
ATOM 6835  H HA   . SER A 1 73  ? -18.068 -10.380 -3.994  1.00 0.00 ? 73  SER A HA   3  
ATOM 6836  H HB2  . SER A 1 73  ? -17.405 -8.931  -1.429  1.00 0.00 ? 73  SER A HB2  3  
ATOM 6837  H HB3  . SER A 1 73  ? -18.975 -9.109  -2.211  1.00 0.00 ? 73  SER A HB3  3  
ATOM 6838  H HG   . SER A 1 73  ? -18.471 -11.501 -1.781  1.00 0.00 ? 73  SER A HG   3  
ATOM 6839  N N    . ALA A 1 74  ? -17.260 -7.556  -3.639  1.00 0.00 ? 74  ALA A N    3  
ATOM 6840  C CA   . ALA A 1 74  ? -16.735 -6.309  -4.173  1.00 0.00 ? 74  ALA A CA   3  
ATOM 6841  C C    . ALA A 1 74  ? -15.751 -5.679  -3.188  1.00 0.00 ? 74  ALA A C    3  
ATOM 6842  O O    . ALA A 1 74  ? -15.172 -6.379  -2.351  1.00 0.00 ? 74  ALA A O    3  
ATOM 6843  C CB   . ALA A 1 74  ? -17.877 -5.352  -4.490  1.00 0.00 ? 74  ALA A CB   3  
ATOM 6844  H H    . ALA A 1 74  ? -18.038 -7.530  -3.041  1.00 0.00 ? 74  ALA A H    3  
ATOM 6845  H HA   . ALA A 1 74  ? -16.216 -6.534  -5.095  1.00 0.00 ? 74  ALA A HA   3  
ATOM 6846  H HB1  . ALA A 1 74  ? -17.471 -4.409  -4.828  1.00 0.00 ? 74  ALA A HB1  3  
ATOM 6847  H HB2  . ALA A 1 74  ? -18.471 -5.192  -3.602  1.00 0.00 ? 74  ALA A HB2  3  
ATOM 6848  H HB3  . ALA A 1 74  ? -18.495 -5.776  -5.266  1.00 0.00 ? 74  ALA A HB3  3  
ATOM 6849  N N    . GLN A 1 75  ? -15.567 -4.362  -3.296  1.00 0.00 ? 75  GLN A N    3  
ATOM 6850  C CA   . GLN A 1 75  ? -14.654 -3.617  -2.427  1.00 0.00 ? 75  GLN A CA   3  
ATOM 6851  C C    . GLN A 1 75  ? -14.915 -3.902  -0.946  1.00 0.00 ? 75  GLN A C    3  
ATOM 6852  O O    . GLN A 1 75  ? -13.986 -3.937  -0.139  1.00 0.00 ? 75  GLN A O    3  
ATOM 6853  C CB   . GLN A 1 75  ? -14.790 -2.115  -2.689  1.00 0.00 ? 75  GLN A CB   3  
ATOM 6854  C CG   . GLN A 1 75  ? -13.460 -1.391  -2.834  1.00 0.00 ? 75  GLN A CG   3  
ATOM 6855  C CD   . GLN A 1 75  ? -12.517 -1.665  -1.681  1.00 0.00 ? 75  GLN A CD   3  
ATOM 6856  O OE1  . GLN A 1 75  ? -11.728 -2.605  -1.717  1.00 0.00 ? 75  GLN A OE1  3  
ATOM 6857  N NE2  . GLN A 1 75  ? -12.595 -0.849  -0.648  1.00 0.00 ? 75  GLN A NE2  3  
ATOM 6858  H H    . GLN A 1 75  ? -16.047 -3.874  -4.003  1.00 0.00 ? 75  GLN A H    3  
ATOM 6859  H HA   . GLN A 1 75  ? -13.647 -3.921  -2.670  1.00 0.00 ? 75  GLN A HA   3  
ATOM 6860  H HB2  . GLN A 1 75  ? -15.353 -1.969  -3.597  1.00 0.00 ? 75  GLN A HB2  3  
ATOM 6861  H HB3  . GLN A 1 75  ? -15.331 -1.668  -1.866  1.00 0.00 ? 75  GLN A HB3  3  
ATOM 6862  H HG2  . GLN A 1 75  ? -12.988 -1.712  -3.749  1.00 0.00 ? 75  GLN A HG2  3  
ATOM 6863  H HG3  . GLN A 1 75  ? -13.647 -0.330  -2.880  1.00 0.00 ? 75  GLN A HG3  3  
ATOM 6864  H HE21 . GLN A 1 75  ? -13.249 -0.122  -0.679  1.00 0.00 ? 75  GLN A HE21 3  
ATOM 6865  H HE22 . GLN A 1 75  ? -11.996 -1.006  0.114   1.00 0.00 ? 75  GLN A HE22 3  
ATOM 6866  N N    . GLN A 1 76  ? -16.179 -4.100  -0.596  1.00 0.00 ? 76  GLN A N    3  
ATOM 6867  C CA   . GLN A 1 76  ? -16.566 -4.386  0.781   1.00 0.00 ? 76  GLN A CA   3  
ATOM 6868  C C    . GLN A 1 76  ? -15.806 -5.604  1.305   1.00 0.00 ? 76  GLN A C    3  
ATOM 6869  O O    . GLN A 1 76  ? -15.300 -5.604  2.430   1.00 0.00 ? 76  GLN A O    3  
ATOM 6870  C CB   . GLN A 1 76  ? -18.076 -4.636  0.874   1.00 0.00 ? 76  GLN A CB   3  
ATOM 6871  C CG   . GLN A 1 76  ? -18.937 -3.391  0.687   1.00 0.00 ? 76  GLN A CG   3  
ATOM 6872  C CD   . GLN A 1 76  ? -18.921 -2.856  -0.734  1.00 0.00 ? 76  GLN A CD   3  
ATOM 6873  O OE1  . GLN A 1 76  ? -18.640 -3.585  -1.687  1.00 0.00 ? 76  GLN A OE1  3  
ATOM 6874  N NE2  . GLN A 1 76  ? -19.244 -1.583  -0.888  1.00 0.00 ? 76  GLN A NE2  3  
ATOM 6875  H H    . GLN A 1 76  ? -16.878 -4.054  -1.287  1.00 0.00 ? 76  GLN A H    3  
ATOM 6876  H HA   . GLN A 1 76  ? -16.311 -3.527  1.384   1.00 0.00 ? 76  GLN A HA   3  
ATOM 6877  H HB2  . GLN A 1 76  ? -18.356 -5.353  0.117   1.00 0.00 ? 76  GLN A HB2  3  
ATOM 6878  H HB3  . GLN A 1 76  ? -18.296 -5.053  1.846   1.00 0.00 ? 76  GLN A HB3  3  
ATOM 6879  H HG2  . GLN A 1 76  ? -19.956 -3.634  0.949   1.00 0.00 ? 76  GLN A HG2  3  
ATOM 6880  H HG3  . GLN A 1 76  ? -18.573 -2.618  1.348   1.00 0.00 ? 76  GLN A HG3  3  
ATOM 6881  H HE21 . GLN A 1 76  ? -19.476 -1.063  -0.087  1.00 0.00 ? 76  GLN A HE21 3  
ATOM 6882  H HE22 . GLN A 1 76  ? -19.245 -1.212  -1.796  1.00 0.00 ? 76  GLN A HE22 3  
ATOM 6883  N N    . ARG A 1 77  ? -15.705 -6.628  0.464   1.00 0.00 ? 77  ARG A N    3  
ATOM 6884  C CA   . ARG A 1 77  ? -15.006 -7.851  0.827   1.00 0.00 ? 77  ARG A CA   3  
ATOM 6885  C C    . ARG A 1 77  ? -13.512 -7.588  0.963   1.00 0.00 ? 77  ARG A C    3  
ATOM 6886  O O    . ARG A 1 77  ? -12.883 -8.055  1.908   1.00 0.00 ? 77  ARG A O    3  
ATOM 6887  C CB   . ARG A 1 77  ? -15.248 -8.936  -0.222  1.00 0.00 ? 77  ARG A CB   3  
ATOM 6888  C CG   . ARG A 1 77  ? -14.536 -10.249 0.069   1.00 0.00 ? 77  ARG A CG   3  
ATOM 6889  C CD   . ARG A 1 77  ? -15.167 -10.981 1.243   1.00 0.00 ? 77  ARG A CD   3  
ATOM 6890  N NE   . ARG A 1 77  ? -16.525 -11.437 0.944   1.00 0.00 ? 77  ARG A NE   3  
ATOM 6891  C CZ   . ARG A 1 77  ? -17.105 -12.483 1.531   1.00 0.00 ? 77  ARG A CZ   3  
ATOM 6892  N NH1  . ARG A 1 77  ? -16.448 -13.185 2.448   1.00 0.00 ? 77  ARG A NH1  3  
ATOM 6893  N NH2  . ARG A 1 77  ? -18.345 -12.820 1.202   1.00 0.00 ? 77  ARG A NH2  3  
ATOM 6894  H H    . ARG A 1 77  ? -16.103 -6.552  -0.431  1.00 0.00 ? 77  ARG A H    3  
ATOM 6895  H HA   . ARG A 1 77  ? -15.392 -8.186  1.777   1.00 0.00 ? 77  ARG A HA   3  
ATOM 6896  H HB2  . ARG A 1 77  ? -16.310 -9.132  -0.282  1.00 0.00 ? 77  ARG A HB2  3  
ATOM 6897  H HB3  . ARG A 1 77  ? -14.906 -8.573  -1.179  1.00 0.00 ? 77  ARG A HB3  3  
ATOM 6898  H HG2  . ARG A 1 77  ? -14.594 -10.878 -0.806  1.00 0.00 ? 77  ARG A HG2  3  
ATOM 6899  H HG3  . ARG A 1 77  ? -13.501 -10.043 0.298   1.00 0.00 ? 77  ARG A HG3  3  
ATOM 6900  H HD2  . ARG A 1 77  ? -14.556 -11.836 1.484   1.00 0.00 ? 77  ARG A HD2  3  
ATOM 6901  H HD3  . ARG A 1 77  ? -15.201 -10.311 2.090   1.00 0.00 ? 77  ARG A HD3  3  
ATOM 6902  H HE   . ARG A 1 77  ? -17.037 -10.929 0.265   1.00 0.00 ? 77  ARG A HE   3  
ATOM 6903  H HH11 . ARG A 1 77  ? -15.513 -12.934 2.700   1.00 0.00 ? 77  ARG A HH11 3  
ATOM 6904  H HH12 . ARG A 1 77  ? -16.892 -13.974 2.902   1.00 0.00 ? 77  ARG A HH12 3  
ATOM 6905  H HH21 . ARG A 1 77  ? -18.851 -12.286 0.513   1.00 0.00 ? 77  ARG A HH21 3  
ATOM 6906  H HH22 . ARG A 1 77  ? -18.787 -13.618 1.636   1.00 0.00 ? 77  ARG A HH22 3  
ATOM 6907  N N    . PHE A 1 78  ? -12.961 -6.824  0.026   1.00 0.00 ? 78  PHE A N    3  
ATOM 6908  C CA   . PHE A 1 78  ? -11.535 -6.503  0.033   1.00 0.00 ? 78  PHE A CA   3  
ATOM 6909  C C    . PHE A 1 78  ? -11.160 -5.709  1.280   1.00 0.00 ? 78  PHE A C    3  
ATOM 6910  O O    . PHE A 1 78  ? -10.089 -5.902  1.855   1.00 0.00 ? 78  PHE A O    3  
ATOM 6911  C CB   . PHE A 1 78  ? -11.154 -5.717  -1.222  1.00 0.00 ? 78  PHE A CB   3  
ATOM 6912  C CG   . PHE A 1 78  ? -11.316 -6.495  -2.501  1.00 0.00 ? 78  PHE A CG   3  
ATOM 6913  C CD1  . PHE A 1 78  ? -10.626 -7.682  -2.703  1.00 0.00 ? 78  PHE A CD1  3  
ATOM 6914  C CD2  . PHE A 1 78  ? -12.155 -6.034  -3.502  1.00 0.00 ? 78  PHE A CD2  3  
ATOM 6915  C CE1  . PHE A 1 78  ? -10.771 -8.393  -3.879  1.00 0.00 ? 78  PHE A CE1  3  
ATOM 6916  C CE2  . PHE A 1 78  ? -12.304 -6.740  -4.681  1.00 0.00 ? 78  PHE A CE2  3  
ATOM 6917  C CZ   . PHE A 1 78  ? -11.610 -7.921  -4.868  1.00 0.00 ? 78  PHE A CZ   3  
ATOM 6918  H H    . PHE A 1 78  ? -13.529 -6.459  -0.687  1.00 0.00 ? 78  PHE A H    3  
ATOM 6919  H HA   . PHE A 1 78  ? -10.989 -7.435  0.041   1.00 0.00 ? 78  PHE A HA   3  
ATOM 6920  H HB2  . PHE A 1 78  ? -11.775 -4.837  -1.289  1.00 0.00 ? 78  PHE A HB2  3  
ATOM 6921  H HB3  . PHE A 1 78  ? -10.120 -5.412  -1.147  1.00 0.00 ? 78  PHE A HB3  3  
ATOM 6922  H HD1  . PHE A 1 78  ? -9.969  -8.052  -1.929  1.00 0.00 ? 78  PHE A HD1  3  
ATOM 6923  H HD2  . PHE A 1 78  ? -12.696 -5.112  -3.356  1.00 0.00 ? 78  PHE A HD2  3  
ATOM 6924  H HE1  . PHE A 1 78  ? -10.228 -9.315  -4.026  1.00 0.00 ? 78  PHE A HE1  3  
ATOM 6925  H HE2  . PHE A 1 78  ? -12.962 -6.371  -5.455  1.00 0.00 ? 78  PHE A HE2  3  
ATOM 6926  H HZ   . PHE A 1 78  ? -11.724 -8.474  -5.790  1.00 0.00 ? 78  PHE A HZ   3  
ATOM 6927  N N    . THR A 1 79  ? -12.052 -4.827  1.704   1.00 0.00 ? 79  THR A N    3  
ATOM 6928  C CA   . THR A 1 79  ? -11.811 -4.022  2.890   1.00 0.00 ? 79  THR A CA   3  
ATOM 6929  C C    . THR A 1 79  ? -11.762 -4.903  4.137   1.00 0.00 ? 79  THR A C    3  
ATOM 6930  O O    . THR A 1 79  ? -10.812 -4.837  4.919   1.00 0.00 ? 79  THR A O    3  
ATOM 6931  C CB   . THR A 1 79  ? -12.897 -2.943  3.067   1.00 0.00 ? 79  THR A CB   3  
ATOM 6932  O OG1  . THR A 1 79  ? -13.113 -2.259  1.828   1.00 0.00 ? 79  THR A OG1  3  
ATOM 6933  C CG2  . THR A 1 79  ? -12.497 -1.935  4.136   1.00 0.00 ? 79  THR A CG2  3  
ATOM 6934  H H    . THR A 1 79  ? -12.888 -4.710  1.201   1.00 0.00 ? 79  THR A H    3  
ATOM 6935  H HA   . THR A 1 79  ? -10.856 -3.531  2.772   1.00 0.00 ? 79  THR A HA   3  
ATOM 6936  H HB   . THR A 1 79  ? -13.816 -3.421  3.370   1.00 0.00 ? 79  THR A HB   3  
ATOM 6937  H HG1  . THR A 1 79  ? -13.191 -2.903  1.112   1.00 0.00 ? 79  THR A HG1  3  
ATOM 6938  H HG21 . THR A 1 79  ? -12.367 -2.443  5.080   1.00 0.00 ? 79  THR A HG21 3  
ATOM 6939  H HG22 . THR A 1 79  ? -13.271 -1.188  4.233   1.00 0.00 ? 79  THR A HG22 3  
ATOM 6940  H HG23 . THR A 1 79  ? -11.570 -1.458  3.854   1.00 0.00 ? 79  THR A HG23 3  
ATOM 6941  N N    . GLN A 1 80  ? -12.768 -5.757  4.296   1.00 0.00 ? 80  GLN A N    3  
ATOM 6942  C CA   . GLN A 1 80  ? -12.838 -6.643  5.451   1.00 0.00 ? 80  GLN A CA   3  
ATOM 6943  C C    . GLN A 1 80  ? -11.763 -7.732  5.382   1.00 0.00 ? 80  GLN A C    3  
ATOM 6944  O O    . GLN A 1 80  ? -11.230 -8.149  6.408   1.00 0.00 ? 80  GLN A O    3  
ATOM 6945  C CB   . GLN A 1 80  ? -14.231 -7.274  5.561   1.00 0.00 ? 80  GLN A CB   3  
ATOM 6946  C CG   . GLN A 1 80  ? -14.460 -8.052  6.853   1.00 0.00 ? 80  GLN A CG   3  
ATOM 6947  C CD   . GLN A 1 80  ? -14.086 -7.256  8.090   1.00 0.00 ? 80  GLN A CD   3  
ATOM 6948  O OE1  . GLN A 1 80  ? -14.908 -6.538  8.653   1.00 0.00 ? 80  GLN A OE1  3  
ATOM 6949  N NE2  . GLN A 1 80  ? -12.842 -7.385  8.520   1.00 0.00 ? 80  GLN A NE2  3  
ATOM 6950  H H    . GLN A 1 80  ? -13.485 -5.787  3.622   1.00 0.00 ? 80  GLN A H    3  
ATOM 6951  H HA   . GLN A 1 80  ? -12.659 -6.043  6.331   1.00 0.00 ? 80  GLN A HA   3  
ATOM 6952  H HB2  . GLN A 1 80  ? -14.972 -6.490  5.504   1.00 0.00 ? 80  GLN A HB2  3  
ATOM 6953  H HB3  . GLN A 1 80  ? -14.373 -7.950  4.732   1.00 0.00 ? 80  GLN A HB3  3  
ATOM 6954  H HG2  . GLN A 1 80  ? -15.504 -8.316  6.917   1.00 0.00 ? 80  GLN A HG2  3  
ATOM 6955  H HG3  . GLN A 1 80  ? -13.864 -8.954  6.826   1.00 0.00 ? 80  GLN A HG3  3  
ATOM 6956  H HE21 . GLN A 1 80  ? -12.239 -7.981  8.025   1.00 0.00 ? 80  GLN A HE21 3  
ATOM 6957  H HE22 . GLN A 1 80  ? -12.562 -6.862  9.310   1.00 0.00 ? 80  GLN A HE22 3  
ATOM 6958  N N    . VAL A 1 81  ? -11.436 -8.184  4.175   1.00 0.00 ? 81  VAL A N    3  
ATOM 6959  C CA   . VAL A 1 81  ? -10.426 -9.223  4.009   1.00 0.00 ? 81  VAL A CA   3  
ATOM 6960  C C    . VAL A 1 81  ? -9.045  -8.697  4.409   1.00 0.00 ? 81  VAL A C    3  
ATOM 6961  O O    . VAL A 1 81  ? -8.212  -9.439  4.923   1.00 0.00 ? 81  VAL A O    3  
ATOM 6962  C CB   . VAL A 1 81  ? -10.411 -9.793  2.561   1.00 0.00 ? 81  VAL A CB   3  
ATOM 6963  C CG1  . VAL A 1 81  ? -9.560  -8.955  1.618   1.00 0.00 ? 81  VAL A CG1  3  
ATOM 6964  C CG2  . VAL A 1 81  ? -9.947  -11.239 2.563   1.00 0.00 ? 81  VAL A CG2  3  
ATOM 6965  H H    . VAL A 1 81  ? -11.887 -7.819  3.382   1.00 0.00 ? 81  VAL A H    3  
ATOM 6966  H HA   . VAL A 1 81  ? -10.685 -10.031 4.680   1.00 0.00 ? 81  VAL A HA   3  
ATOM 6967  H HB   . VAL A 1 81  ? -11.426 -9.775  2.189   1.00 0.00 ? 81  VAL A HB   3  
ATOM 6968  H HG11 . VAL A 1 81  ? -9.936  -7.943  1.598   1.00 0.00 ? 81  VAL A HG11 3  
ATOM 6969  H HG12 . VAL A 1 81  ? -9.605  -9.375  0.625   1.00 0.00 ? 81  VAL A HG12 3  
ATOM 6970  H HG13 . VAL A 1 81  ? -8.537  -8.954  1.961   1.00 0.00 ? 81  VAL A HG13 3  
ATOM 6971  H HG21 . VAL A 1 81  ? -8.950  -11.298 2.970   1.00 0.00 ? 81  VAL A HG21 3  
ATOM 6972  H HG22 . VAL A 1 81  ? -9.945  -11.616 1.551   1.00 0.00 ? 81  VAL A HG22 3  
ATOM 6973  H HG23 . VAL A 1 81  ? -10.620 -11.833 3.167   1.00 0.00 ? 81  VAL A HG23 3  
ATOM 6974  N N    . SER A 1 82  ? -8.820  -7.406  4.201   1.00 0.00 ? 82  SER A N    3  
ATOM 6975  C CA   . SER A 1 82  ? -7.553  -6.797  4.567   1.00 0.00 ? 82  SER A CA   3  
ATOM 6976  C C    . SER A 1 82  ? -7.505  -6.564  6.075   1.00 0.00 ? 82  SER A C    3  
ATOM 6977  O O    . SER A 1 82  ? -6.505  -6.862  6.725   1.00 0.00 ? 82  SER A O    3  
ATOM 6978  C CB   . SER A 1 82  ? -7.354  -5.484  3.809   1.00 0.00 ? 82  SER A CB   3  
ATOM 6979  O OG   . SER A 1 82  ? -7.424  -5.694  2.409   1.00 0.00 ? 82  SER A OG   3  
ATOM 6980  H H    . SER A 1 82  ? -9.515  -6.856  3.781   1.00 0.00 ? 82  SER A H    3  
ATOM 6981  H HA   . SER A 1 82  ? -6.766  -7.484  4.297   1.00 0.00 ? 82  SER A HA   3  
ATOM 6982  H HB2  . SER A 1 82  ? -8.124  -4.782  4.094   1.00 0.00 ? 82  SER A HB2  3  
ATOM 6983  H HB3  . SER A 1 82  ? -6.385  -5.074  4.052   1.00 0.00 ? 82  SER A HB3  3  
ATOM 6984  H HG   . SER A 1 82  ? -8.348  -5.729  2.136   1.00 0.00 ? 82  SER A HG   3  
ATOM 6985  N N    . ASP A 1 83  ? -8.609  -6.055  6.622   1.00 0.00 ? 83  ASP A N    3  
ATOM 6986  C CA   . ASP A 1 83  ? -8.719  -5.790  8.059   1.00 0.00 ? 83  ASP A CA   3  
ATOM 6987  C C    . ASP A 1 83  ? -8.574  -7.084  8.857   1.00 0.00 ? 83  ASP A C    3  
ATOM 6988  O O    . ASP A 1 83  ? -7.979  -7.106  9.936   1.00 0.00 ? 83  ASP A O    3  
ATOM 6989  C CB   . ASP A 1 83  ? -10.069 -5.128  8.363   1.00 0.00 ? 83  ASP A CB   3  
ATOM 6990  C CG   . ASP A 1 83  ? -10.440 -5.151  9.839   1.00 0.00 ? 83  ASP A CG   3  
ATOM 6991  O OD1  . ASP A 1 83  ? -9.695  -4.575  10.657  1.00 0.00 ? 83  ASP A OD1  3  
ATOM 6992  O OD2  . ASP A 1 83  ? -11.496 -5.728  10.181  1.00 0.00 ? 83  ASP A OD2  3  
ATOM 6993  H H    . ASP A 1 83  ? -9.372  -5.842  6.042   1.00 0.00 ? 83  ASP A H    3  
ATOM 6994  H HA   . ASP A 1 83  ? -7.921  -5.116  8.336   1.00 0.00 ? 83  ASP A HA   3  
ATOM 6995  H HB2  . ASP A 1 83  ? -10.035 -4.097  8.041   1.00 0.00 ? 83  ASP A HB2  3  
ATOM 6996  H HB3  . ASP A 1 83  ? -10.842 -5.643  7.811   1.00 0.00 ? 83  ASP A HB3  3  
ATOM 6997  N N    . GLU A 1 84  ? -9.105  -8.164  8.292   1.00 0.00 ? 84  GLU A N    3  
ATOM 6998  C CA   . GLU A 1 84  ? -9.063  -9.482  8.914   1.00 0.00 ? 84  GLU A CA   3  
ATOM 6999  C C    . GLU A 1 84  ? -7.637  -9.888  9.289   1.00 0.00 ? 84  GLU A C    3  
ATOM 7000  O O    . GLU A 1 84  ? -7.332  -10.105 10.462  1.00 0.00 ? 84  GLU A O    3  
ATOM 7001  C CB   . GLU A 1 84  ? -9.662  -10.518 7.959   1.00 0.00 ? 84  GLU A CB   3  
ATOM 7002  C CG   . GLU A 1 84  ? -9.423  -11.955 8.383   1.00 0.00 ? 84  GLU A CG   3  
ATOM 7003  C CD   . GLU A 1 84  ? -10.363 -12.403 9.474   1.00 0.00 ? 84  GLU A CD   3  
ATOM 7004  O OE1  . GLU A 1 84  ? -11.446 -12.921 9.147   1.00 0.00 ? 84  GLU A OE1  3  
ATOM 7005  O OE2  . GLU A 1 84  ? -10.018 -12.248 10.664  1.00 0.00 ? 84  GLU A OE2  3  
ATOM 7006  H H    . GLU A 1 84  ? -9.551  -8.069  7.422   1.00 0.00 ? 84  GLU A H    3  
ATOM 7007  H HA   . GLU A 1 84  ? -9.660  -9.447  9.810   1.00 0.00 ? 84  GLU A HA   3  
ATOM 7008  H HB2  . GLU A 1 84  ? -10.728 -10.358 7.896   1.00 0.00 ? 84  GLU A HB2  3  
ATOM 7009  H HB3  . GLU A 1 84  ? -9.228  -10.378 6.979   1.00 0.00 ? 84  GLU A HB3  3  
ATOM 7010  H HG2  . GLU A 1 84  ? -9.557  -12.598 7.527   1.00 0.00 ? 84  GLU A HG2  3  
ATOM 7011  H HG3  . GLU A 1 84  ? -8.410  -12.046 8.745   1.00 0.00 ? 84  GLU A HG3  3  
ATOM 7012  N N    . LEU A 1 85  ? -6.766  -9.969  8.293   1.00 0.00 ? 85  LEU A N    3  
ATOM 7013  C CA   . LEU A 1 85  ? -5.387  -10.377 8.523   1.00 0.00 ? 85  LEU A CA   3  
ATOM 7014  C C    . LEU A 1 85  ? -4.542  -9.242  9.089   1.00 0.00 ? 85  LEU A C    3  
ATOM 7015  O O    . LEU A 1 85  ? -3.458  -9.480  9.621   1.00 0.00 ? 85  LEU A O    3  
ATOM 7016  C CB   . LEU A 1 85  ? -4.766  -10.919 7.234   1.00 0.00 ? 85  LEU A CB   3  
ATOM 7017  C CG   . LEU A 1 85  ? -4.224  -12.352 7.329   1.00 0.00 ? 85  LEU A CG   3  
ATOM 7018  C CD1  . LEU A 1 85  ? -2.934  -12.387 8.129   1.00 0.00 ? 85  LEU A CD1  3  
ATOM 7019  C CD2  . LEU A 1 85  ? -5.256  -13.277 7.958   1.00 0.00 ? 85  LEU A CD2  3  
ATOM 7020  H H    . LEU A 1 85  ? -7.057  -9.747  7.382   1.00 0.00 ? 85  LEU A H    3  
ATOM 7021  H HA   . LEU A 1 85  ? -5.408  -11.174 9.250   1.00 0.00 ? 85  LEU A HA   3  
ATOM 7022  H HB2  . LEU A 1 85  ? -5.518  -10.891 6.458   1.00 0.00 ? 85  LEU A HB2  3  
ATOM 7023  H HB3  . LEU A 1 85  ? -3.953  -10.269 6.949   1.00 0.00 ? 85  LEU A HB3  3  
ATOM 7024  H HG   . LEU A 1 85  ? -4.010  -12.716 6.335   1.00 0.00 ? 85  LEU A HG   3  
ATOM 7025  H HD11 . LEU A 1 85  ? -2.168  -11.837 7.604   1.00 0.00 ? 85  LEU A HD11 3  
ATOM 7026  H HD12 . LEU A 1 85  ? -2.617  -13.411 8.256   1.00 0.00 ? 85  LEU A HD12 3  
ATOM 7027  H HD13 . LEU A 1 85  ? -3.099  -11.940 9.097   1.00 0.00 ? 85  LEU A HD13 3  
ATOM 7028  H HD21 . LEU A 1 85  ? -5.529  -12.900 8.932   1.00 0.00 ? 85  LEU A HD21 3  
ATOM 7029  H HD22 . LEU A 1 85  ? -4.836  -14.267 8.060   1.00 0.00 ? 85  LEU A HD22 3  
ATOM 7030  H HD23 . LEU A 1 85  ? -6.132  -13.320 7.330   1.00 0.00 ? 85  LEU A HD23 3  
ATOM 7031  N N    . PHE A 1 86  ? -5.032  -8.012  8.984   1.00 0.00 ? 86  PHE A N    3  
ATOM 7032  C CA   . PHE A 1 86  ? -4.304  -6.868  9.514   1.00 0.00 ? 86  PHE A CA   3  
ATOM 7033  C C    . PHE A 1 86  ? -4.228  -6.977  11.032  1.00 0.00 ? 86  PHE A C    3  
ATOM 7034  O O    . PHE A 1 86  ? -3.229  -6.604  11.647  1.00 0.00 ? 86  PHE A O    3  
ATOM 7035  C CB   . PHE A 1 86  ? -4.972  -5.552  9.110   1.00 0.00 ? 86  PHE A CB   3  
ATOM 7036  C CG   . PHE A 1 86  ? -4.067  -4.359  9.247   1.00 0.00 ? 86  PHE A CG   3  
ATOM 7037  C CD1  . PHE A 1 86  ? -3.042  -4.143  8.337   1.00 0.00 ? 86  PHE A CD1  3  
ATOM 7038  C CD2  . PHE A 1 86  ? -4.234  -3.457  10.287  1.00 0.00 ? 86  PHE A CD2  3  
ATOM 7039  C CE1  . PHE A 1 86  ? -2.202  -3.053  8.463   1.00 0.00 ? 86  PHE A CE1  3  
ATOM 7040  C CE2  . PHE A 1 86  ? -3.396  -2.365  10.417  1.00 0.00 ? 86  PHE A CE2  3  
ATOM 7041  C CZ   . PHE A 1 86  ? -2.379  -2.163  9.504   1.00 0.00 ? 86  PHE A CZ   3  
ATOM 7042  H H    . PHE A 1 86  ? -5.896  -7.870  8.539   1.00 0.00 ? 86  PHE A H    3  
ATOM 7043  H HA   . PHE A 1 86  ? -3.302  -6.896  9.111   1.00 0.00 ? 86  PHE A HA   3  
ATOM 7044  H HB2  . PHE A 1 86  ? -5.285  -5.616  8.078   1.00 0.00 ? 86  PHE A HB2  3  
ATOM 7045  H HB3  . PHE A 1 86  ? -5.840  -5.390  9.734   1.00 0.00 ? 86  PHE A HB3  3  
ATOM 7046  H HD1  . PHE A 1 86  ? -2.901  -4.837  7.522   1.00 0.00 ? 86  PHE A HD1  3  
ATOM 7047  H HD2  . PHE A 1 86  ? -5.030  -3.613  11.002  1.00 0.00 ? 86  PHE A HD2  3  
ATOM 7048  H HE1  . PHE A 1 86  ? -1.409  -2.898  7.749   1.00 0.00 ? 86  PHE A HE1  3  
ATOM 7049  H HE2  . PHE A 1 86  ? -3.535  -1.670  11.233  1.00 0.00 ? 86  PHE A HE2  3  
ATOM 7050  H HZ   . PHE A 1 86  ? -1.721  -1.310  9.604   1.00 0.00 ? 86  PHE A HZ   3  
ATOM 7051  N N    . GLN A 1 87  ? -5.287  -7.515  11.626  1.00 0.00 ? 87  GLN A N    3  
ATOM 7052  C CA   . GLN A 1 87  ? -5.347  -7.700  13.069  1.00 0.00 ? 87  GLN A CA   3  
ATOM 7053  C C    . GLN A 1 87  ? -4.804  -9.075  13.447  1.00 0.00 ? 87  GLN A C    3  
ATOM 7054  O O    . GLN A 1 87  ? -4.952  -9.531  14.580  1.00 0.00 ? 87  GLN A O    3  
ATOM 7055  C CB   . GLN A 1 87  ? -6.784  -7.545  13.571  1.00 0.00 ? 87  GLN A CB   3  
ATOM 7056  C CG   . GLN A 1 87  ? -7.429  -6.228  13.173  1.00 0.00 ? 87  GLN A CG   3  
ATOM 7057  C CD   . GLN A 1 87  ? -8.732  -5.975  13.903  1.00 0.00 ? 87  GLN A CD   3  
ATOM 7058  O OE1  . GLN A 1 87  ? -8.897  -6.361  15.061  1.00 0.00 ? 87  GLN A OE1  3  
ATOM 7059  N NE2  . GLN A 1 87  ? -9.669  -5.333  13.231  1.00 0.00 ? 87  GLN A NE2  3  
ATOM 7060  H H    . GLN A 1 87  ? -6.054  -7.787  11.077  1.00 0.00 ? 87  GLN A H    3  
ATOM 7061  H HA   . GLN A 1 87  ? -4.727  -6.943  13.529  1.00 0.00 ? 87  GLN A HA   3  
ATOM 7062  H HB2  . GLN A 1 87  ? -7.381  -8.351  13.171  1.00 0.00 ? 87  GLN A HB2  3  
ATOM 7063  H HB3  . GLN A 1 87  ? -6.785  -7.610  14.649  1.00 0.00 ? 87  GLN A HB3  3  
ATOM 7064  H HG2  . GLN A 1 87  ? -6.747  -5.423  13.401  1.00 0.00 ? 87  GLN A HG2  3  
ATOM 7065  H HG3  . GLN A 1 87  ? -7.625  -6.245  12.112  1.00 0.00 ? 87  GLN A HG3  3  
ATOM 7066  H HE21 . GLN A 1 87  ? -9.472  -5.056  12.297  1.00 0.00 ? 87  GLN A HE21 3  
ATOM 7067  H HE22 . GLN A 1 87  ? -10.519 -5.152  13.680  1.00 0.00 ? 87  GLN A HE22 3  
ATOM 7068  N N    . GLY A 1 88  ? -4.182  -9.733  12.480  1.00 0.00 ? 88  GLY A N    3  
ATOM 7069  C CA   . GLY A 1 88  ? -3.607  -11.042 12.709  1.00 0.00 ? 88  GLY A CA   3  
ATOM 7070  C C    . GLY A 1 88  ? -2.160  -11.087 12.275  1.00 0.00 ? 88  GLY A C    3  
ATOM 7071  O O    . GLY A 1 88  ? -1.629  -12.145 11.933  1.00 0.00 ? 88  GLY A O    3  
ATOM 7072  H H    . GLY A 1 88  ? -4.109  -9.322  11.590  1.00 0.00 ? 88  GLY A H    3  
ATOM 7073  H HA2  . GLY A 1 88  ? -3.671  -11.275 13.761  1.00 0.00 ? 88  GLY A HA2  3  
ATOM 7074  H HA3  . GLY A 1 88  ? -4.167  -11.776 12.148  1.00 0.00 ? 88  GLY A HA3  3  
ATOM 7075  N N    . GLY A 1 89  ? -1.528  -9.922  12.283  1.00 0.00 ? 89  GLY A N    3  
ATOM 7076  C CA   . GLY A 1 89  ? -0.142  -9.815  11.884  1.00 0.00 ? 89  GLY A CA   3  
ATOM 7077  C C    . GLY A 1 89  ? 0.130   -8.521  11.143  1.00 0.00 ? 89  GLY A C    3  
ATOM 7078  O O    . GLY A 1 89  ? 0.127   -8.496  9.914   1.00 0.00 ? 89  GLY A O    3  
ATOM 7079  H H    . GLY A 1 89  ? -2.015  -9.119  12.562  1.00 0.00 ? 89  GLY A H    3  
ATOM 7080  H HA2  . GLY A 1 89  ? 0.481   -9.855  12.764  1.00 0.00 ? 89  GLY A HA2  3  
ATOM 7081  H HA3  . GLY A 1 89  ? 0.105   -10.646 11.238  1.00 0.00 ? 89  GLY A HA3  3  
ATOM 7082  N N    . PRO A 1 90  ? 0.368   -7.418  11.869  1.00 0.00 ? 90  PRO A N    3  
ATOM 7083  C CA   . PRO A 1 90  ? 0.629   -6.115  11.264  1.00 0.00 ? 90  PRO A CA   3  
ATOM 7084  C C    . PRO A 1 90  ? 2.094   -5.945  10.868  1.00 0.00 ? 90  PRO A C    3  
ATOM 7085  O O    . PRO A 1 90  ? 2.779   -5.036  11.339  1.00 0.00 ? 90  PRO A O    3  
ATOM 7086  C CB   . PRO A 1 90  ? 0.250   -5.150  12.384  1.00 0.00 ? 90  PRO A CB   3  
ATOM 7087  C CG   . PRO A 1 90  ? 0.565   -5.885  13.645  1.00 0.00 ? 90  PRO A CG   3  
ATOM 7088  C CD   . PRO A 1 90  ? 0.417   -7.358  13.342  1.00 0.00 ? 90  PRO A CD   3  
ATOM 7089  H HA   . PRO A 1 90  ? -0.003  -5.940  10.403  1.00 0.00 ? 90  PRO A HA   3  
ATOM 7090  H HB2  . PRO A 1 90  ? 0.835   -4.246  12.296  1.00 0.00 ? 90  PRO A HB2  3  
ATOM 7091  H HB3  . PRO A 1 90  ? -0.801  -4.913  12.318  1.00 0.00 ? 90  PRO A HB3  3  
ATOM 7092  H HG2  . PRO A 1 90  ? 1.578   -5.669  13.951  1.00 0.00 ? 90  PRO A HG2  3  
ATOM 7093  H HG3  . PRO A 1 90  ? -0.129  -5.592  14.418  1.00 0.00 ? 90  PRO A HG3  3  
ATOM 7094  H HD2  . PRO A 1 90  ? 1.269   -7.905  13.718  1.00 0.00 ? 90  PRO A HD2  3  
ATOM 7095  H HD3  . PRO A 1 90  ? -0.497  -7.740  13.774  1.00 0.00 ? 90  PRO A HD3  3  
ATOM 7096  N N    . ASN A 1 91  ? 2.566   -6.830  10.000  1.00 0.00 ? 91  ASN A N    3  
ATOM 7097  C CA   . ASN A 1 91  ? 3.948   -6.787  9.542   1.00 0.00 ? 91  ASN A CA   3  
ATOM 7098  C C    . ASN A 1 91  ? 4.146   -5.671  8.517   1.00 0.00 ? 91  ASN A C    3  
ATOM 7099  O O    . ASN A 1 91  ? 3.182   -5.052  8.060   1.00 0.00 ? 91  ASN A O    3  
ATOM 7100  C CB   . ASN A 1 91  ? 4.356   -8.137  8.944   1.00 0.00 ? 91  ASN A CB   3  
ATOM 7101  C CG   . ASN A 1 91  ? 5.864   -8.313  8.873   1.00 0.00 ? 91  ASN A CG   3  
ATOM 7102  O OD1  . ASN A 1 91  ? 6.603   -7.820  9.726   1.00 0.00 ? 91  ASN A OD1  3  
ATOM 7103  N ND2  . ASN A 1 91  ? 6.332   -8.996  7.842   1.00 0.00 ? 91  ASN A ND2  3  
ATOM 7104  H H    . ASN A 1 91  ? 1.966   -7.530  9.660   1.00 0.00 ? 91  ASN A H    3  
ATOM 7105  H HA   . ASN A 1 91  ? 4.571   -6.584  10.401  1.00 0.00 ? 91  ASN A HA   3  
ATOM 7106  H HB2  . ASN A 1 91  ? 3.949   -8.931  9.552   1.00 0.00 ? 91  ASN A HB2  3  
ATOM 7107  H HB3  . ASN A 1 91  ? 3.958   -8.217  7.943   1.00 0.00 ? 91  ASN A HB3  3  
ATOM 7108  H HD21 . ASN A 1 91  ? 5.686   -9.345  7.180   1.00 0.00 ? 91  ASN A HD21 3  
ATOM 7109  H HD22 . ASN A 1 91  ? 7.303   -9.139  7.778   1.00 0.00 ? 91  ASN A HD22 3  
ATOM 7110  N N    . TRP A 1 92  ? 5.404   -5.433  8.160   1.00 0.00 ? 92  TRP A N    3  
ATOM 7111  C CA   . TRP A 1 92  ? 5.774   -4.392  7.203   1.00 0.00 ? 92  TRP A CA   3  
ATOM 7112  C C    . TRP A 1 92  ? 4.988   -4.516  5.899   1.00 0.00 ? 92  TRP A C    3  
ATOM 7113  O O    . TRP A 1 92  ? 4.418   -3.540  5.416   1.00 0.00 ? 92  TRP A O    3  
ATOM 7114  C CB   . TRP A 1 92  ? 7.272   -4.474  6.910   1.00 0.00 ? 92  TRP A CB   3  
ATOM 7115  C CG   . TRP A 1 92  ? 8.106   -4.704  8.132   1.00 0.00 ? 92  TRP A CG   3  
ATOM 7116  C CD1  . TRP A 1 92  ? 7.995   -4.062  9.328   1.00 0.00 ? 92  TRP A CD1  3  
ATOM 7117  C CD2  . TRP A 1 92  ? 9.179   -5.640  8.279   1.00 0.00 ? 92  TRP A CD2  3  
ATOM 7118  N NE1  . TRP A 1 92  ? 8.930   -4.538  10.208  1.00 0.00 ? 92  TRP A NE1  3  
ATOM 7119  C CE2  . TRP A 1 92  ? 9.670   -5.507  9.590   1.00 0.00 ? 92  TRP A CE2  3  
ATOM 7120  C CE3  . TRP A 1 92  ? 9.774   -6.578  7.429   1.00 0.00 ? 92  TRP A CE3  3  
ATOM 7121  C CZ2  . TRP A 1 92  ? 10.725  -6.276  10.070  1.00 0.00 ? 92  TRP A CZ2  3  
ATOM 7122  C CZ3  . TRP A 1 92  ? 10.823  -7.339  7.907   1.00 0.00 ? 92  TRP A CZ3  3  
ATOM 7123  C CH2  . TRP A 1 92  ? 11.288  -7.185  9.218   1.00 0.00 ? 92  TRP A CH2  3  
ATOM 7124  H H    . TRP A 1 92  ? 6.116   -5.974  8.565   1.00 0.00 ? 92  TRP A H    3  
ATOM 7125  H HA   . TRP A 1 92  ? 5.558   -3.436  7.652   1.00 0.00 ? 92  TRP A HA   3  
ATOM 7126  H HB2  . TRP A 1 92  ? 7.452   -5.291  6.227   1.00 0.00 ? 92  TRP A HB2  3  
ATOM 7127  H HB3  . TRP A 1 92  ? 7.596   -3.550  6.452   1.00 0.00 ? 92  TRP A HB3  3  
ATOM 7128  H HD1  . TRP A 1 92  ? 7.271   -3.287  9.536   1.00 0.00 ? 92  TRP A HD1  3  
ATOM 7129  H HE1  . TRP A 1 92  ? 9.048   -4.230  11.135  1.00 0.00 ? 92  TRP A HE1  3  
ATOM 7130  H HE3  . TRP A 1 92  ? 9.430   -6.712  6.414   1.00 0.00 ? 92  TRP A HE3  3  
ATOM 7131  H HZ2  . TRP A 1 92  ? 11.097  -6.170  11.079  1.00 0.00 ? 92  TRP A HZ2  3  
ATOM 7132  H HZ3  . TRP A 1 92  ? 11.295  -8.070  7.264   1.00 0.00 ? 92  TRP A HZ3  3  
ATOM 7133  H HH2  . TRP A 1 92  ? 12.110  -7.801  9.550   1.00 0.00 ? 92  TRP A HH2  3  
ATOM 7134  N N    . GLY A 1 93  ? 4.958   -5.720  5.339   1.00 0.00 ? 93  GLY A N    3  
ATOM 7135  C CA   . GLY A 1 93  ? 4.242   -5.946  4.095   1.00 0.00 ? 93  GLY A CA   3  
ATOM 7136  C C    . GLY A 1 93  ? 2.747   -5.756  4.245   1.00 0.00 ? 93  GLY A C    3  
ATOM 7137  O O    . GLY A 1 93  ? 2.079   -5.307  3.317   1.00 0.00 ? 93  GLY A O    3  
ATOM 7138  H H    . GLY A 1 93  ? 5.420   -6.467  5.780   1.00 0.00 ? 93  GLY A H    3  
ATOM 7139  H HA2  . GLY A 1 93  ? 4.610   -5.256  3.350   1.00 0.00 ? 93  GLY A HA2  3  
ATOM 7140  H HA3  . GLY A 1 93  ? 4.434   -6.955  3.760   1.00 0.00 ? 93  GLY A HA3  3  
ATOM 7141  N N    . ARG A 1 94  ? 2.228   -6.092  5.417   1.00 0.00 ? 94  ARG A N    3  
ATOM 7142  C CA   . ARG A 1 94  ? 0.806   -5.960  5.695   1.00 0.00 ? 94  ARG A CA   3  
ATOM 7143  C C    . ARG A 1 94  ? 0.375   -4.505  5.599   1.00 0.00 ? 94  ARG A C    3  
ATOM 7144  O O    . ARG A 1 94  ? -0.668  -4.197  5.028   1.00 0.00 ? 94  ARG A O    3  
ATOM 7145  C CB   . ARG A 1 94  ? 0.483   -6.505  7.085   1.00 0.00 ? 94  ARG A CB   3  
ATOM 7146  C CG   . ARG A 1 94  ? -0.682  -7.479  7.102   1.00 0.00 ? 94  ARG A CG   3  
ATOM 7147  C CD   . ARG A 1 94  ? -0.371  -8.736  6.305   1.00 0.00 ? 94  ARG A CD   3  
ATOM 7148  N NE   . ARG A 1 94  ? 0.932   -9.306  6.655   1.00 0.00 ? 94  ARG A NE   3  
ATOM 7149  C CZ   . ARG A 1 94  ? 1.104   -10.350 7.469   1.00 0.00 ? 94  ARG A CZ   3  
ATOM 7150  N NH1  . ARG A 1 94  ? 0.060   -10.917 8.064   1.00 0.00 ? 94  ARG A NH1  3  
ATOM 7151  N NH2  . ARG A 1 94  ? 2.327   -10.813 7.698   1.00 0.00 ? 94  ARG A NH2  3  
ATOM 7152  H H    . ARG A 1 94  ? 2.822   -6.446  6.114   1.00 0.00 ? 94  ARG A H    3  
ATOM 7153  H HA   . ARG A 1 94  ? 0.266   -6.535  4.958   1.00 0.00 ? 94  ARG A HA   3  
ATOM 7154  H HB2  . ARG A 1 94  ? 1.356   -7.012  7.471   1.00 0.00 ? 94  ARG A HB2  3  
ATOM 7155  H HB3  . ARG A 1 94  ? 0.242   -5.679  7.735   1.00 0.00 ? 94  ARG A HB3  3  
ATOM 7156  H HG2  . ARG A 1 94  ? -0.891  -7.757  8.126   1.00 0.00 ? 94  ARG A HG2  3  
ATOM 7157  H HG3  . ARG A 1 94  ? -1.546  -6.994  6.674   1.00 0.00 ? 94  ARG A HG3  3  
ATOM 7158  H HD2  . ARG A 1 94  ? -1.138  -9.469  6.501   1.00 0.00 ? 94  ARG A HD2  3  
ATOM 7159  H HD3  . ARG A 1 94  ? -0.374  -8.488  5.252   1.00 0.00 ? 94  ARG A HD3  3  
ATOM 7160  H HE   . ARG A 1 94  ? 1.735   -8.884  6.253   1.00 0.00 ? 94  ARG A HE   3  
ATOM 7161  H HH11 . ARG A 1 94  ? -0.861  -10.565 7.906   1.00 0.00 ? 94  ARG A HH11 3  
ATOM 7162  H HH12 . ARG A 1 94  ? 0.195   -11.700 8.687   1.00 0.00 ? 94  ARG A HH12 3  
ATOM 7163  H HH21 . ARG A 1 94  ? 3.120   -10.379 7.263   1.00 0.00 ? 94  ARG A HH21 3  
ATOM 7164  H HH22 . ARG A 1 94  ? 2.466   -11.599 8.314   1.00 0.00 ? 94  ARG A HH22 3  
ATOM 7165  N N    . LEU A 1 95  ? 1.195   -3.615  6.148   1.00 0.00 ? 95  LEU A N    3  
ATOM 7166  C CA   . LEU A 1 95  ? 0.904   -2.188  6.120   1.00 0.00 ? 95  LEU A CA   3  
ATOM 7167  C C    . LEU A 1 95  ? 0.905   -1.675  4.683   1.00 0.00 ? 95  LEU A C    3  
ATOM 7168  O O    . LEU A 1 95  ? 0.032   -0.902  4.285   1.00 0.00 ? 95  LEU A O    3  
ATOM 7169  C CB   . LEU A 1 95  ? 1.928   -1.419  6.962   1.00 0.00 ? 95  LEU A CB   3  
ATOM 7170  C CG   . LEU A 1 95  ? 1.628   0.069   7.160   1.00 0.00 ? 95  LEU A CG   3  
ATOM 7171  C CD1  . LEU A 1 95  ? 0.245   0.260   7.768   1.00 0.00 ? 95  LEU A CD1  3  
ATOM 7172  C CD2  . LEU A 1 95  ? 2.695   0.707   8.042   1.00 0.00 ? 95  LEU A CD2  3  
ATOM 7173  H H    . LEU A 1 95  ? 2.019   -3.930  6.584   1.00 0.00 ? 95  LEU A H    3  
ATOM 7174  H HA   . LEU A 1 95  ? -0.078  -2.042  6.542   1.00 0.00 ? 95  LEU A HA   3  
ATOM 7175  H HB2  . LEU A 1 95  ? 1.985   -1.886  7.933   1.00 0.00 ? 95  LEU A HB2  3  
ATOM 7176  H HB3  . LEU A 1 95  ? 2.892   -1.508  6.483   1.00 0.00 ? 95  LEU A HB3  3  
ATOM 7177  H HG   . LEU A 1 95  ? 1.645   0.565   6.200   1.00 0.00 ? 95  LEU A HG   3  
ATOM 7178  H HD11 . LEU A 1 95  ? 0.205   -0.226  8.732   1.00 0.00 ? 95  LEU A HD11 3  
ATOM 7179  H HD12 . LEU A 1 95  ? -0.497  -0.176  7.114   1.00 0.00 ? 95  LEU A HD12 3  
ATOM 7180  H HD13 . LEU A 1 95  ? 0.045   1.313   7.885   1.00 0.00 ? 95  LEU A HD13 3  
ATOM 7181  H HD21 . LEU A 1 95  ? 2.504   1.767   8.128   1.00 0.00 ? 95  LEU A HD21 3  
ATOM 7182  H HD22 . LEU A 1 95  ? 3.668   0.549   7.599   1.00 0.00 ? 95  LEU A HD22 3  
ATOM 7183  H HD23 . LEU A 1 95  ? 2.668   0.255   9.023   1.00 0.00 ? 95  LEU A HD23 3  
ATOM 7184  N N    . VAL A 1 96  ? 1.881   -2.128  3.905   1.00 0.00 ? 96  VAL A N    3  
ATOM 7185  C CA   . VAL A 1 96  ? 1.993   -1.732  2.505   1.00 0.00 ? 96  VAL A CA   3  
ATOM 7186  C C    . VAL A 1 96  ? 0.807   -2.267  1.705   1.00 0.00 ? 96  VAL A C    3  
ATOM 7187  O O    . VAL A 1 96  ? 0.170   -1.531  0.947   1.00 0.00 ? 96  VAL A O    3  
ATOM 7188  C CB   . VAL A 1 96  ? 3.311   -2.242  1.879   1.00 0.00 ? 96  VAL A CB   3  
ATOM 7189  C CG1  . VAL A 1 96  ? 3.414   -1.844  0.415   1.00 0.00 ? 96  VAL A CG1  3  
ATOM 7190  C CG2  . VAL A 1 96  ? 4.509   -1.717  2.656   1.00 0.00 ? 96  VAL A CG2  3  
ATOM 7191  H H    . VAL A 1 96  ? 2.546   -2.743  4.283   1.00 0.00 ? 96  VAL A H    3  
ATOM 7192  H HA   . VAL A 1 96  ? 1.989   -0.652  2.460   1.00 0.00 ? 96  VAL A HA   3  
ATOM 7193  H HB   . VAL A 1 96  ? 3.320   -3.322  1.937   1.00 0.00 ? 96  VAL A HB   3  
ATOM 7194  H HG11 . VAL A 1 96  ? 2.582   -2.263  -0.130  1.00 0.00 ? 96  VAL A HG11 3  
ATOM 7195  H HG12 . VAL A 1 96  ? 4.341   -2.221  0.005   1.00 0.00 ? 96  VAL A HG12 3  
ATOM 7196  H HG13 . VAL A 1 96  ? 3.397   -0.768  0.332   1.00 0.00 ? 96  VAL A HG13 3  
ATOM 7197  H HG21 . VAL A 1 96  ? 5.418   -2.101  2.219   1.00 0.00 ? 96  VAL A HG21 3  
ATOM 7198  H HG22 . VAL A 1 96  ? 4.440   -2.037  3.684   1.00 0.00 ? 96  VAL A HG22 3  
ATOM 7199  H HG23 . VAL A 1 96  ? 4.519   -0.638  2.616   1.00 0.00 ? 96  VAL A HG23 3  
ATOM 7200  N N    . ALA A 1 97  ? 0.503   -3.546  1.900   1.00 0.00 ? 97  ALA A N    3  
ATOM 7201  C CA   . ALA A 1 97  ? -0.604  -4.191  1.204   1.00 0.00 ? 97  ALA A CA   3  
ATOM 7202  C C    . ALA A 1 97  ? -1.937  -3.542  1.559   1.00 0.00 ? 97  ALA A C    3  
ATOM 7203  O O    . ALA A 1 97  ? -2.785  -3.349  0.693   1.00 0.00 ? 97  ALA A O    3  
ATOM 7204  C CB   . ALA A 1 97  ? -0.636  -5.676  1.528   1.00 0.00 ? 97  ALA A CB   3  
ATOM 7205  H H    . ALA A 1 97  ? 1.046   -4.074  2.527   1.00 0.00 ? 97  ALA A H    3  
ATOM 7206  H HA   . ALA A 1 97  ? -0.436  -4.083  0.143   1.00 0.00 ? 97  ALA A HA   3  
ATOM 7207  H HB1  . ALA A 1 97  ? 0.322   -6.117  1.294   1.00 0.00 ? 97  ALA A HB1  3  
ATOM 7208  H HB2  . ALA A 1 97  ? -1.405  -6.155  0.940   1.00 0.00 ? 97  ALA A HB2  3  
ATOM 7209  H HB3  . ALA A 1 97  ? -0.848  -5.812  2.579   1.00 0.00 ? 97  ALA A HB3  3  
ATOM 7210  N N    . PHE A 1 98  ? -2.108  -3.202  2.830   1.00 0.00 ? 98  PHE A N    3  
ATOM 7211  C CA   . PHE A 1 98  ? -3.337  -2.573  3.303   1.00 0.00 ? 98  PHE A CA   3  
ATOM 7212  C C    . PHE A 1 98  ? -3.584  -1.252  2.575   1.00 0.00 ? 98  PHE A C    3  
ATOM 7213  O O    . PHE A 1 98  ? -4.721  -0.926  2.223   1.00 0.00 ? 98  PHE A O    3  
ATOM 7214  C CB   . PHE A 1 98  ? -3.250  -2.335  4.813   1.00 0.00 ? 98  PHE A CB   3  
ATOM 7215  C CG   . PHE A 1 98  ? -4.561  -1.977  5.459   1.00 0.00 ? 98  PHE A CG   3  
ATOM 7216  C CD1  . PHE A 1 98  ? -5.504  -2.956  5.733   1.00 0.00 ? 98  PHE A CD1  3  
ATOM 7217  C CD2  . PHE A 1 98  ? -4.847  -0.664  5.798   1.00 0.00 ? 98  PHE A CD2  3  
ATOM 7218  C CE1  . PHE A 1 98  ? -6.706  -2.634  6.332   1.00 0.00 ? 98  PHE A CE1  3  
ATOM 7219  C CE2  . PHE A 1 98  ? -6.049  -0.335  6.400   1.00 0.00 ? 98  PHE A CE2  3  
ATOM 7220  C CZ   . PHE A 1 98  ? -6.979  -1.321  6.667   1.00 0.00 ? 98  PHE A CZ   3  
ATOM 7221  H H    . PHE A 1 98  ? -1.390  -3.385  3.476   1.00 0.00 ? 98  PHE A H    3  
ATOM 7222  H HA   . PHE A 1 98  ? -4.157  -3.246  3.098   1.00 0.00 ? 98  PHE A HA   3  
ATOM 7223  H HB2  . PHE A 1 98  ? -2.884  -3.233  5.288   1.00 0.00 ? 98  PHE A HB2  3  
ATOM 7224  H HB3  . PHE A 1 98  ? -2.555  -1.529  5.001   1.00 0.00 ? 98  PHE A HB3  3  
ATOM 7225  H HD1  . PHE A 1 98  ? -5.294  -3.984  5.471   1.00 0.00 ? 98  PHE A HD1  3  
ATOM 7226  H HD2  . PHE A 1 98  ? -4.121  0.107   5.591   1.00 0.00 ? 98  PHE A HD2  3  
ATOM 7227  H HE1  . PHE A 1 98  ? -7.431  -3.407  6.540   1.00 0.00 ? 98  PHE A HE1  3  
ATOM 7228  H HE2  . PHE A 1 98  ? -6.261  0.689   6.659   1.00 0.00 ? 98  PHE A HE2  3  
ATOM 7229  H HZ   . PHE A 1 98  ? -7.919  -1.066  7.137   1.00 0.00 ? 98  PHE A HZ   3  
ATOM 7230  N N    . PHE A 1 99  ? -2.512  -0.506  2.340   1.00 0.00 ? 99  PHE A N    3  
ATOM 7231  C CA   . PHE A 1 99  ? -2.611  0.778   1.662   1.00 0.00 ? 99  PHE A CA   3  
ATOM 7232  C C    . PHE A 1 99  ? -2.801  0.595   0.159   1.00 0.00 ? 99  PHE A C    3  
ATOM 7233  O O    . PHE A 1 99  ? -3.697  1.197   -0.435  1.00 0.00 ? 99  PHE A O    3  
ATOM 7234  C CB   . PHE A 1 99  ? -1.364  1.622   1.936   1.00 0.00 ? 99  PHE A CB   3  
ATOM 7235  C CG   . PHE A 1 99  ? -1.496  3.050   1.482   1.00 0.00 ? 99  PHE A CG   3  
ATOM 7236  C CD1  . PHE A 1 99  ? -2.116  3.991   2.289   1.00 0.00 ? 99  PHE A CD1  3  
ATOM 7237  C CD2  . PHE A 1 99  ? -1.002  3.450   0.251   1.00 0.00 ? 99  PHE A CD2  3  
ATOM 7238  C CE1  . PHE A 1 99  ? -2.242  5.303   1.879   1.00 0.00 ? 99  PHE A CE1  3  
ATOM 7239  C CE2  . PHE A 1 99  ? -1.125  4.761   -0.166  1.00 0.00 ? 99  PHE A CE2  3  
ATOM 7240  C CZ   . PHE A 1 99  ? -1.745  5.689   0.649   1.00 0.00 ? 99  PHE A CZ   3  
ATOM 7241  H H    . PHE A 1 99  ? -1.630  -0.830  2.629   1.00 0.00 ? 99  PHE A H    3  
ATOM 7242  H HA   . PHE A 1 99  ? -3.474  1.293   2.061   1.00 0.00 ? 99  PHE A HA   3  
ATOM 7243  H HB2  . PHE A 1 99  ? -1.167  1.628   2.997   1.00 0.00 ? 99  PHE A HB2  3  
ATOM 7244  H HB3  . PHE A 1 99  ? -0.521  1.183   1.421   1.00 0.00 ? 99  PHE A HB3  3  
ATOM 7245  H HD1  . PHE A 1 99  ? -2.505  3.689   3.251   1.00 0.00 ? 99  PHE A HD1  3  
ATOM 7246  H HD2  . PHE A 1 99  ? -0.516  2.726   -0.387  1.00 0.00 ? 99  PHE A HD2  3  
ATOM 7247  H HE1  . PHE A 1 99  ? -2.727  6.027   2.519   1.00 0.00 ? 99  PHE A HE1  3  
ATOM 7248  H HE2  . PHE A 1 99  ? -0.735  5.063   -1.128  1.00 0.00 ? 99  PHE A HE2  3  
ATOM 7249  H HZ   . PHE A 1 99  ? -1.843  6.714   0.326   1.00 0.00 ? 99  PHE A HZ   3  
ATOM 7250  N N    . VAL A 1 100 ? -1.967  -0.246  -0.450  1.00 0.00 ? 100 VAL A N    3  
ATOM 7251  C CA   . VAL A 1 100 ? -2.041  -0.483  -1.889  1.00 0.00 ? 100 VAL A CA   3  
ATOM 7252  C C    . VAL A 1 100 ? -3.377  -1.116  -2.286  1.00 0.00 ? 100 VAL A C    3  
ATOM 7253  O O    . VAL A 1 100 ? -3.886  -0.853  -3.373  1.00 0.00 ? 100 VAL A O    3  
ATOM 7254  C CB   . VAL A 1 100 ? -0.861  -1.348  -2.399  1.00 0.00 ? 100 VAL A CB   3  
ATOM 7255  C CG1  . VAL A 1 100 ? -1.017  -2.809  -2.003  1.00 0.00 ? 100 VAL A CG1  3  
ATOM 7256  C CG2  . VAL A 1 100 ? -0.713  -1.214  -3.907  1.00 0.00 ? 100 VAL A CG2  3  
ATOM 7257  H H    . VAL A 1 100 ? -1.279  -0.709  0.079   1.00 0.00 ? 100 VAL A H    3  
ATOM 7258  H HA   . VAL A 1 100 ? -1.970  0.481   -2.372  1.00 0.00 ? 100 VAL A HA   3  
ATOM 7259  H HB   . VAL A 1 100 ? 0.044   -0.977  -1.943  1.00 0.00 ? 100 VAL A HB   3  
ATOM 7260  H HG11 . VAL A 1 100 ? -0.130  -3.355  -2.289  1.00 0.00 ? 100 VAL A HG11 3  
ATOM 7261  H HG12 . VAL A 1 100 ? -1.874  -3.229  -2.509  1.00 0.00 ? 100 VAL A HG12 3  
ATOM 7262  H HG13 . VAL A 1 100 ? -1.157  -2.881  -0.934  1.00 0.00 ? 100 VAL A HG13 3  
ATOM 7263  H HG21 . VAL A 1 100 ? -0.461  -0.193  -4.154  1.00 0.00 ? 100 VAL A HG21 3  
ATOM 7264  H HG22 . VAL A 1 100 ? -1.644  -1.479  -4.383  1.00 0.00 ? 100 VAL A HG22 3  
ATOM 7265  H HG23 . VAL A 1 100 ? 0.071   -1.871  -4.254  1.00 0.00 ? 100 VAL A HG23 3  
ATOM 7266  N N    . PHE A 1 101 ? -3.952  -1.929  -1.400  1.00 0.00 ? 101 PHE A N    3  
ATOM 7267  C CA   . PHE A 1 101 ? -5.233  -2.578  -1.673  1.00 0.00 ? 101 PHE A CA   3  
ATOM 7268  C C    . PHE A 1 101 ? -6.321  -1.536  -1.895  1.00 0.00 ? 101 PHE A C    3  
ATOM 7269  O O    . PHE A 1 101 ? -6.991  -1.528  -2.931  1.00 0.00 ? 101 PHE A O    3  
ATOM 7270  C CB   . PHE A 1 101 ? -5.627  -3.502  -0.518  1.00 0.00 ? 101 PHE A CB   3  
ATOM 7271  C CG   . PHE A 1 101 ? -5.787  -4.939  -0.923  1.00 0.00 ? 101 PHE A CG   3  
ATOM 7272  C CD1  . PHE A 1 101 ? -4.676  -5.730  -1.163  1.00 0.00 ? 101 PHE A CD1  3  
ATOM 7273  C CD2  . PHE A 1 101 ? -7.048  -5.496  -1.067  1.00 0.00 ? 101 PHE A CD2  3  
ATOM 7274  C CE1  . PHE A 1 101 ? -4.817  -7.053  -1.537  1.00 0.00 ? 101 PHE A CE1  3  
ATOM 7275  C CE2  . PHE A 1 101 ? -7.195  -6.818  -1.441  1.00 0.00 ? 101 PHE A CE2  3  
ATOM 7276  C CZ   . PHE A 1 101 ? -6.079  -7.598  -1.677  1.00 0.00 ? 101 PHE A CZ   3  
ATOM 7277  H H    . PHE A 1 101 ? -3.496  -2.106  -0.547  1.00 0.00 ? 101 PHE A H    3  
ATOM 7278  H HA   . PHE A 1 101 ? -5.123  -3.164  -2.572  1.00 0.00 ? 101 PHE A HA   3  
ATOM 7279  H HB2  . PHE A 1 101 ? -4.866  -3.456  0.246   1.00 0.00 ? 101 PHE A HB2  3  
ATOM 7280  H HB3  . PHE A 1 101 ? -6.566  -3.166  -0.101  1.00 0.00 ? 101 PHE A HB3  3  
ATOM 7281  H HD1  . PHE A 1 101 ? -3.689  -5.305  -1.053  1.00 0.00 ? 101 PHE A HD1  3  
ATOM 7282  H HD2  . PHE A 1 101 ? -7.922  -4.888  -0.882  1.00 0.00 ? 101 PHE A HD2  3  
ATOM 7283  H HE1  . PHE A 1 101 ? -3.942  -7.659  -1.721  1.00 0.00 ? 101 PHE A HE1  3  
ATOM 7284  H HE2  . PHE A 1 101 ? -8.183  -7.243  -1.549  1.00 0.00 ? 101 PHE A HE2  3  
ATOM 7285  H HZ   . PHE A 1 101 ? -6.193  -8.630  -1.968  1.00 0.00 ? 101 PHE A HZ   3  
ATOM 7286  N N    . GLY A 1 102 ? -6.470  -0.642  -0.926  1.00 0.00 ? 102 GLY A N    3  
ATOM 7287  C CA   . GLY A 1 102 ? -7.470  0.400   -1.026  1.00 0.00 ? 102 GLY A CA   3  
ATOM 7288  C C    . GLY A 1 102 ? -7.206  1.328   -2.194  1.00 0.00 ? 102 GLY A C    3  
ATOM 7289  O O    . GLY A 1 102 ? -8.120  1.673   -2.940  1.00 0.00 ? 102 GLY A O    3  
ATOM 7290  H H    . GLY A 1 102 ? -5.895  -0.692  -0.133  1.00 0.00 ? 102 GLY A H    3  
ATOM 7291  H HA2  . GLY A 1 102 ? -8.441  -0.057  -1.152  1.00 0.00 ? 102 GLY A HA2  3  
ATOM 7292  H HA3  . GLY A 1 102 ? -7.467  0.978   -0.113  1.00 0.00 ? 102 GLY A HA3  3  
ATOM 7293  N N    . ALA A 1 103 ? -5.942  1.706   -2.364  1.00 0.00 ? 103 ALA A N    3  
ATOM 7294  C CA   . ALA A 1 103 ? -5.542  2.595   -3.447  1.00 0.00 ? 103 ALA A CA   3  
ATOM 7295  C C    . ALA A 1 103 ? -5.838  1.973   -4.809  1.00 0.00 ? 103 ALA A C    3  
ATOM 7296  O O    . ALA A 1 103 ? -6.343  2.645   -5.709  1.00 0.00 ? 103 ALA A O    3  
ATOM 7297  C CB   . ALA A 1 103 ? -4.062  2.942   -3.327  1.00 0.00 ? 103 ALA A CB   3  
ATOM 7298  H H    . ALA A 1 103 ? -5.258  1.375   -1.741  1.00 0.00 ? 103 ALA A H    3  
ATOM 7299  H HA   . ALA A 1 103 ? -6.109  3.509   -3.352  1.00 0.00 ? 103 ALA A HA   3  
ATOM 7300  H HB1  . ALA A 1 103 ? -3.895  3.488   -2.411  1.00 0.00 ? 103 ALA A HB1  3  
ATOM 7301  H HB2  . ALA A 1 103 ? -3.765  3.550   -4.169  1.00 0.00 ? 103 ALA A HB2  3  
ATOM 7302  H HB3  . ALA A 1 103 ? -3.477  2.034   -3.316  1.00 0.00 ? 103 ALA A HB3  3  
ATOM 7303  N N    . ALA A 1 104 ? -5.538  0.687   -4.948  1.00 0.00 ? 104 ALA A N    3  
ATOM 7304  C CA   . ALA A 1 104 ? -5.768  -0.028  -6.198  1.00 0.00 ? 104 ALA A CA   3  
ATOM 7305  C C    . ALA A 1 104 ? -7.251  -0.078  -6.541  1.00 0.00 ? 104 ALA A C    3  
ATOM 7306  O O    . ALA A 1 104 ? -7.642  0.137   -7.690  1.00 0.00 ? 104 ALA A O    3  
ATOM 7307  C CB   . ALA A 1 104 ? -5.205  -1.437  -6.114  1.00 0.00 ? 104 ALA A CB   3  
ATOM 7308  H H    . ALA A 1 104 ? -5.143  0.202   -4.188  1.00 0.00 ? 104 ALA A H    3  
ATOM 7309  H HA   . ALA A 1 104 ? -5.243  0.497   -6.984  1.00 0.00 ? 104 ALA A HA   3  
ATOM 7310  H HB1  . ALA A 1 104 ? -5.320  -1.928  -7.068  1.00 0.00 ? 104 ALA A HB1  3  
ATOM 7311  H HB2  . ALA A 1 104 ? -5.738  -1.994  -5.357  1.00 0.00 ? 104 ALA A HB2  3  
ATOM 7312  H HB3  . ALA A 1 104 ? -4.158  -1.392  -5.858  1.00 0.00 ? 104 ALA A HB3  3  
ATOM 7313  N N    . LEU A 1 105 ? -8.076  -0.362  -5.541  1.00 0.00 ? 105 LEU A N    3  
ATOM 7314  C CA   . LEU A 1 105 ? -9.518  -0.444  -5.744  1.00 0.00 ? 105 LEU A CA   3  
ATOM 7315  C C    . LEU A 1 105 ? -10.102 0.933   -6.044  1.00 0.00 ? 105 LEU A C    3  
ATOM 7316  O O    . LEU A 1 105 ? -10.982 1.074   -6.897  1.00 0.00 ? 105 LEU A O    3  
ATOM 7317  C CB   . LEU A 1 105 ? -10.199 -1.058  -4.519  1.00 0.00 ? 105 LEU A CB   3  
ATOM 7318  C CG   . LEU A 1 105 ? -10.522 -2.554  -4.636  1.00 0.00 ? 105 LEU A CG   3  
ATOM 7319  C CD1  . LEU A 1 105 ? -11.334 -2.833  -5.893  1.00 0.00 ? 105 LEU A CD1  3  
ATOM 7320  C CD2  . LEU A 1 105 ? -9.246  -3.384  -4.623  1.00 0.00 ? 105 LEU A CD2  3  
ATOM 7321  H H    . LEU A 1 105 ? -7.706  -0.524  -4.644  1.00 0.00 ? 105 LEU A H    3  
ATOM 7322  H HA   . LEU A 1 105 ? -9.691  -1.083  -6.596  1.00 0.00 ? 105 LEU A HA   3  
ATOM 7323  H HB2  . LEU A 1 105 ? -9.554  -0.916  -3.664  1.00 0.00 ? 105 LEU A HB2  3  
ATOM 7324  H HB3  . LEU A 1 105 ? -11.122 -0.528  -4.345  1.00 0.00 ? 105 LEU A HB3  3  
ATOM 7325  H HG   . LEU A 1 105 ? -11.119 -2.849  -3.785  1.00 0.00 ? 105 LEU A HG   3  
ATOM 7326  H HD11 . LEU A 1 105 ? -12.211 -2.203  -5.901  1.00 0.00 ? 105 LEU A HD11 3  
ATOM 7327  H HD12 . LEU A 1 105 ? -11.637 -3.871  -5.903  1.00 0.00 ? 105 LEU A HD12 3  
ATOM 7328  H HD13 . LEU A 1 105 ? -10.732 -2.624  -6.766  1.00 0.00 ? 105 LEU A HD13 3  
ATOM 7329  H HD21 . LEU A 1 105 ? -8.729  -3.239  -3.685  1.00 0.00 ? 105 LEU A HD21 3  
ATOM 7330  H HD22 . LEU A 1 105 ? -8.606  -3.077  -5.438  1.00 0.00 ? 105 LEU A HD22 3  
ATOM 7331  H HD23 . LEU A 1 105 ? -9.497  -4.429  -4.737  1.00 0.00 ? 105 LEU A HD23 3  
ATOM 7332  N N    . CYS A 1 106 ? -9.603  1.947   -5.351  1.00 0.00 ? 106 CYS A N    3  
ATOM 7333  C CA   . CYS A 1 106 ? -10.067 3.307   -5.563  1.00 0.00 ? 106 CYS A CA   3  
ATOM 7334  C C    . CYS A 1 106 ? -9.684  3.785   -6.958  1.00 0.00 ? 106 CYS A C    3  
ATOM 7335  O O    . CYS A 1 106 ? -10.512 4.333   -7.677  1.00 0.00 ? 106 CYS A O    3  
ATOM 7336  C CB   . CYS A 1 106 ? -9.497  4.248   -4.502  1.00 0.00 ? 106 CYS A CB   3  
ATOM 7337  S SG   . CYS A 1 106 ? -10.309 4.114   -2.893  1.00 0.00 ? 106 CYS A SG   3  
ATOM 7338  H H    . CYS A 1 106 ? -8.911  1.775   -4.672  1.00 0.00 ? 106 CYS A H    3  
ATOM 7339  H HA   . CYS A 1 106 ? -11.145 3.303   -5.486  1.00 0.00 ? 106 CYS A HA   3  
ATOM 7340  H HB2  . CYS A 1 106 ? -8.449  4.028   -4.360  1.00 0.00 ? 106 CYS A HB2  3  
ATOM 7341  H HB3  . CYS A 1 106 ? -9.604  5.267   -4.840  1.00 0.00 ? 106 CYS A HB3  3  
ATOM 7342  H HG   . CYS A 1 106 ? -10.650 5.341   -2.510  1.00 0.00 ? 106 CYS A HG   3  
ATOM 7343  N N    . ALA A 1 107 ? -8.433  3.544   -7.345  1.00 0.00 ? 107 ALA A N    3  
ATOM 7344  C CA   . ALA A 1 107 ? -7.948  3.942   -8.661  1.00 0.00 ? 107 ALA A CA   3  
ATOM 7345  C C    . ALA A 1 107 ? -8.789  3.299   -9.757  1.00 0.00 ? 107 ALA A C    3  
ATOM 7346  O O    . ALA A 1 107 ? -9.155  3.949   -10.739 1.00 0.00 ? 107 ALA A O    3  
ATOM 7347  C CB   . ALA A 1 107 ? -6.483  3.566   -8.821  1.00 0.00 ? 107 ALA A CB   3  
ATOM 7348  H H    . ALA A 1 107 ? -7.817  3.087   -6.726  1.00 0.00 ? 107 ALA A H    3  
ATOM 7349  H HA   . ALA A 1 107 ? -8.032  5.017   -8.737  1.00 0.00 ? 107 ALA A HA   3  
ATOM 7350  H HB1  . ALA A 1 107 ? -6.146  3.841   -9.810  1.00 0.00 ? 107 ALA A HB1  3  
ATOM 7351  H HB2  . ALA A 1 107 ? -6.368  2.502   -8.683  1.00 0.00 ? 107 ALA A HB2  3  
ATOM 7352  H HB3  . ALA A 1 107 ? -5.895  4.089   -8.081  1.00 0.00 ? 107 ALA A HB3  3  
ATOM 7353  N N    . GLU A 1 108 ? -9.106  2.024   -9.571  1.00 0.00 ? 108 GLU A N    3  
ATOM 7354  C CA   . GLU A 1 108 ? -9.919  1.290   -10.527 1.00 0.00 ? 108 GLU A CA   3  
ATOM 7355  C C    . GLU A 1 108 ? -11.315 1.902   -10.614 1.00 0.00 ? 108 GLU A C    3  
ATOM 7356  O O    . GLU A 1 108 ? -11.845 2.118   -11.705 1.00 0.00 ? 108 GLU A O    3  
ATOM 7357  C CB   . GLU A 1 108 ? -10.009 -0.184  -10.121 1.00 0.00 ? 108 GLU A CB   3  
ATOM 7358  C CG   . GLU A 1 108 ? -10.791 -1.041  -11.101 1.00 0.00 ? 108 GLU A CG   3  
ATOM 7359  C CD   . GLU A 1 108 ? -11.929 -1.789  -10.440 1.00 0.00 ? 108 GLU A CD   3  
ATOM 7360  O OE1  . GLU A 1 108 ? -12.826 -1.137  -9.868  1.00 0.00 ? 108 GLU A OE1  3  
ATOM 7361  O OE2  . GLU A 1 108 ? -11.940 -3.036  -10.503 1.00 0.00 ? 108 GLU A OE2  3  
ATOM 7362  H H    . GLU A 1 108 ? -8.775  1.561   -8.770  1.00 0.00 ? 108 GLU A H    3  
ATOM 7363  H HA   . GLU A 1 108 ? -9.444  1.361   -11.495 1.00 0.00 ? 108 GLU A HA   3  
ATOM 7364  H HB2  . GLU A 1 108 ? -9.008  -0.585  -10.047 1.00 0.00 ? 108 GLU A HB2  3  
ATOM 7365  H HB3  . GLU A 1 108 ? -10.487 -0.251  -9.154  1.00 0.00 ? 108 GLU A HB3  3  
ATOM 7366  H HG2  . GLU A 1 108 ? -11.201 -0.401  -11.869 1.00 0.00 ? 108 GLU A HG2  3  
ATOM 7367  H HG3  . GLU A 1 108 ? -10.119 -1.758  -11.551 1.00 0.00 ? 108 GLU A HG3  3  
ATOM 7368  N N    . SER A 1 109 ? -11.893 2.196   -9.456  1.00 0.00 ? 109 SER A N    3  
ATOM 7369  C CA   . SER A 1 109 ? -13.224 2.783   -9.388  1.00 0.00 ? 109 SER A CA   3  
ATOM 7370  C C    . SER A 1 109 ? -13.233 4.190   -9.988  1.00 0.00 ? 109 SER A C    3  
ATOM 7371  O O    . SER A 1 109 ? -14.190 4.576   -10.661 1.00 0.00 ? 109 SER A O    3  
ATOM 7372  C CB   . SER A 1 109 ? -13.713 2.810   -7.940  1.00 0.00 ? 109 SER A CB   3  
ATOM 7373  O OG   . SER A 1 109 ? -13.654 1.513   -7.362  1.00 0.00 ? 109 SER A OG   3  
ATOM 7374  H H    . SER A 1 109 ? -11.410 2.010   -8.623  1.00 0.00 ? 109 SER A H    3  
ATOM 7375  H HA   . SER A 1 109 ? -13.887 2.157   -9.967  1.00 0.00 ? 109 SER A HA   3  
ATOM 7376  H HB2  . SER A 1 109 ? -13.090 3.478   -7.362  1.00 0.00 ? 109 SER A HB2  3  
ATOM 7377  H HB3  . SER A 1 109 ? -14.735 3.157   -7.915  1.00 0.00 ? 109 SER A HB3  3  
ATOM 7378  H HG   . SER A 1 109 ? -12.735 1.310   -7.130  1.00 0.00 ? 109 SER A HG   3  
ATOM 7379  N N    . VAL A 1 110 ? -12.168 4.953   -9.747  1.00 0.00 ? 110 VAL A N    3  
ATOM 7380  C CA   . VAL A 1 110 ? -12.056 6.303   -10.290 1.00 0.00 ? 110 VAL A CA   3  
ATOM 7381  C C    . VAL A 1 110 ? -12.022 6.246   -11.814 1.00 0.00 ? 110 VAL A C    3  
ATOM 7382  O O    . VAL A 1 110 ? -12.672 7.041   -12.494 1.00 0.00 ? 110 VAL A O    3  
ATOM 7383  C CB   . VAL A 1 110 ? -10.792 7.030   -9.766  1.00 0.00 ? 110 VAL A CB   3  
ATOM 7384  C CG1  . VAL A 1 110 ? -10.533 8.315   -10.543 1.00 0.00 ? 110 VAL A CG1  3  
ATOM 7385  C CG2  . VAL A 1 110 ? -10.930 7.341   -8.284  1.00 0.00 ? 110 VAL A CG2  3  
ATOM 7386  H H    . VAL A 1 110 ? -11.443 4.602   -9.179  1.00 0.00 ? 110 VAL A H    3  
ATOM 7387  H HA   . VAL A 1 110 ? -12.929 6.861   -9.978  1.00 0.00 ? 110 VAL A HA   3  
ATOM 7388  H HB   . VAL A 1 110 ? -9.940  6.376   -9.896  1.00 0.00 ? 110 VAL A HB   3  
ATOM 7389  H HG11 . VAL A 1 110 ? -11.369 8.986   -10.417 1.00 0.00 ? 110 VAL A HG11 3  
ATOM 7390  H HG12 . VAL A 1 110 ? -10.413 8.083   -11.590 1.00 0.00 ? 110 VAL A HG12 3  
ATOM 7391  H HG13 . VAL A 1 110 ? -9.636  8.785   -10.172 1.00 0.00 ? 110 VAL A HG13 3  
ATOM 7392  H HG21 . VAL A 1 110 ? -11.086 6.424   -7.737  1.00 0.00 ? 110 VAL A HG21 3  
ATOM 7393  H HG22 . VAL A 1 110 ? -11.771 8.000   -8.131  1.00 0.00 ? 110 VAL A HG22 3  
ATOM 7394  H HG23 . VAL A 1 110 ? -10.028 7.819   -7.932  1.00 0.00 ? 110 VAL A HG23 3  
ATOM 7395  N N    . ASN A 1 111 ? -11.289 5.273   -12.342 1.00 0.00 ? 111 ASN A N    3  
ATOM 7396  C CA   . ASN A 1 111 ? -11.173 5.086   -13.787 1.00 0.00 ? 111 ASN A CA   3  
ATOM 7397  C C    . ASN A 1 111 ? -12.493 4.578   -14.370 1.00 0.00 ? 111 ASN A C    3  
ATOM 7398  O O    . ASN A 1 111 ? -12.675 4.517   -15.585 1.00 0.00 ? 111 ASN A O    3  
ATOM 7399  C CB   . ASN A 1 111 ? -10.033 4.112   -14.100 1.00 0.00 ? 111 ASN A CB   3  
ATOM 7400  C CG   . ASN A 1 111 ? -9.652  4.098   -15.571 1.00 0.00 ? 111 ASN A CG   3  
ATOM 7401  O OD1  . ASN A 1 111 ? -9.003  5.020   -16.069 1.00 0.00 ? 111 ASN A OD1  3  
ATOM 7402  N ND2  . ASN A 1 111 ? -10.030 3.040   -16.267 1.00 0.00 ? 111 ASN A ND2  3  
ATOM 7403  H H    . ASN A 1 111 ? -10.803 4.662   -11.742 1.00 0.00 ? 111 ASN A H    3  
ATOM 7404  H HA   . ASN A 1 111 ? -10.947 6.047   -14.225 1.00 0.00 ? 111 ASN A HA   3  
ATOM 7405  H HB2  . ASN A 1 111 ? -9.163  4.391   -13.527 1.00 0.00 ? 111 ASN A HB2  3  
ATOM 7406  H HB3  . ASN A 1 111 ? -10.337 3.115   -13.821 1.00 0.00 ? 111 ASN A HB3  3  
ATOM 7407  H HD21 . ASN A 1 111 ? -10.534 2.334   -15.801 1.00 0.00 ? 111 ASN A HD21 3  
ATOM 7408  H HD22 . ASN A 1 111 ? -9.787  2.998   -17.222 1.00 0.00 ? 111 ASN A HD22 3  
ATOM 7409  N N    . LYS A 1 112 ? -13.414 4.213   -13.484 1.00 0.00 ? 112 LYS A N    3  
ATOM 7410  C CA   . LYS A 1 112 ? -14.728 3.733   -13.885 1.00 0.00 ? 112 LYS A CA   3  
ATOM 7411  C C    . LYS A 1 112 ? -15.775 4.811   -13.636 1.00 0.00 ? 112 LYS A C    3  
ATOM 7412  O O    . LYS A 1 112 ? -16.975 4.571   -13.781 1.00 0.00 ? 112 LYS A O    3  
ATOM 7413  C CB   . LYS A 1 112 ? -15.096 2.471   -13.105 1.00 0.00 ? 112 LYS A CB   3  
ATOM 7414  C CG   . LYS A 1 112 ? -14.415 1.214   -13.612 1.00 0.00 ? 112 LYS A CG   3  
ATOM 7415  C CD   . LYS A 1 112 ? -14.259 0.179   -12.509 1.00 0.00 ? 112 LYS A CD   3  
ATOM 7416  C CE   . LYS A 1 112 ? -15.583 -0.140  -11.833 1.00 0.00 ? 112 LYS A CE   3  
ATOM 7417  N NZ   . LYS A 1 112 ? -15.387 -0.884  -10.562 1.00 0.00 ? 112 LYS A NZ   3  
ATOM 7418  H H    . LYS A 1 112 ? -13.202 4.270   -12.529 1.00 0.00 ? 112 LYS A H    3  
ATOM 7419  H HA   . LYS A 1 112 ? -14.697 3.504   -14.940 1.00 0.00 ? 112 LYS A HA   3  
ATOM 7420  H HB2  . LYS A 1 112 ? -14.821 2.611   -12.070 1.00 0.00 ? 112 LYS A HB2  3  
ATOM 7421  H HB3  . LYS A 1 112 ? -16.165 2.323   -13.165 1.00 0.00 ? 112 LYS A HB3  3  
ATOM 7422  H HG2  . LYS A 1 112 ? -15.008 0.791   -14.409 1.00 0.00 ? 112 LYS A HG2  3  
ATOM 7423  H HG3  . LYS A 1 112 ? -13.436 1.473   -13.991 1.00 0.00 ? 112 LYS A HG3  3  
ATOM 7424  H HD2  . LYS A 1 112 ? -13.861 -0.728  -12.938 1.00 0.00 ? 112 LYS A HD2  3  
ATOM 7425  H HD3  . LYS A 1 112 ? -13.570 0.559   -11.770 1.00 0.00 ? 112 LYS A HD3  3  
ATOM 7426  H HE2  . LYS A 1 112 ? -16.095 0.786   -11.621 1.00 0.00 ? 112 LYS A HE2  3  
ATOM 7427  H HE3  . LYS A 1 112 ? -16.182 -0.738  -12.502 1.00 0.00 ? 112 LYS A HE3  3  
ATOM 7428  H HZ1  . LYS A 1 112 ? -14.368 -1.025  -10.380 1.00 0.00 ? 112 LYS A HZ1  3  
ATOM 7429  H HZ2  . LYS A 1 112 ? -15.852 -1.817  -10.611 1.00 0.00 ? 112 LYS A HZ2  3  
ATOM 7430  H HZ3  . LYS A 1 112 ? -15.795 -0.346  -9.764  1.00 0.00 ? 112 LYS A HZ3  3  
ATOM 7431  N N    . GLU A 1 113 ? -15.303 5.997   -13.243 1.00 0.00 ? 113 GLU A N    3  
ATOM 7432  C CA   . GLU A 1 113 ? -16.176 7.134   -12.957 1.00 0.00 ? 113 GLU A CA   3  
ATOM 7433  C C    . GLU A 1 113 ? -17.102 6.807   -11.784 1.00 0.00 ? 113 GLU A C    3  
ATOM 7434  O O    . GLU A 1 113 ? -18.239 7.275   -11.714 1.00 0.00 ? 113 GLU A O    3  
ATOM 7435  C CB   . GLU A 1 113 ? -16.986 7.505   -14.205 1.00 0.00 ? 113 GLU A CB   3  
ATOM 7436  C CG   . GLU A 1 113 ? -17.420 8.959   -14.253 1.00 0.00 ? 113 GLU A CG   3  
ATOM 7437  C CD   . GLU A 1 113 ? -18.131 9.302   -15.543 1.00 0.00 ? 113 GLU A CD   3  
ATOM 7438  O OE1  . GLU A 1 113 ? -19.329 8.984   -15.667 1.00 0.00 ? 113 GLU A OE1  3  
ATOM 7439  O OE2  . GLU A 1 113 ? -17.491 9.883   -16.445 1.00 0.00 ? 113 GLU A OE2  3  
ATOM 7440  H H    . GLU A 1 113 ? -14.332 6.112   -13.146 1.00 0.00 ? 113 GLU A H    3  
ATOM 7441  H HA   . GLU A 1 113 ? -15.550 7.970   -12.682 1.00 0.00 ? 113 GLU A HA   3  
ATOM 7442  H HB2  . GLU A 1 113 ? -16.387 7.303   -15.080 1.00 0.00 ? 113 GLU A HB2  3  
ATOM 7443  H HB3  . GLU A 1 113 ? -17.874 6.887   -14.239 1.00 0.00 ? 113 GLU A HB3  3  
ATOM 7444  H HG2  . GLU A 1 113 ? -18.091 9.150   -13.430 1.00 0.00 ? 113 GLU A HG2  3  
ATOM 7445  H HG3  . GLU A 1 113 ? -16.546 9.588   -14.161 1.00 0.00 ? 113 GLU A HG3  3  
ATOM 7446  N N    . MET A 1 114 ? -16.601 6.002   -10.858 1.00 0.00 ? 114 MET A N    3  
ATOM 7447  C CA   . MET A 1 114 ? -17.373 5.596   -9.694  1.00 0.00 ? 114 MET A CA   3  
ATOM 7448  C C    . MET A 1 114 ? -16.874 6.310   -8.442  1.00 0.00 ? 114 MET A C    3  
ATOM 7449  O O    . MET A 1 114 ? -16.375 5.680   -7.507  1.00 0.00 ? 114 MET A O    3  
ATOM 7450  C CB   . MET A 1 114 ? -17.283 4.079   -9.512  1.00 0.00 ? 114 MET A CB   3  
ATOM 7451  C CG   . MET A 1 114 ? -18.605 3.422   -9.156  1.00 0.00 ? 114 MET A CG   3  
ATOM 7452  S SD   . MET A 1 114 ? -19.262 3.980   -7.574  1.00 0.00 ? 114 MET A SD   3  
ATOM 7453  C CE   . MET A 1 114 ? -20.641 2.855   -7.375  1.00 0.00 ? 114 MET A CE   3  
ATOM 7454  H H    . MET A 1 114 ? -15.679 5.672   -10.959 1.00 0.00 ? 114 MET A H    3  
ATOM 7455  H HA   . MET A 1 114 ? -18.404 5.871   -9.867  1.00 0.00 ? 114 MET A HA   3  
ATOM 7456  H HB2  . MET A 1 114 ? -16.925 3.640   -10.431 1.00 0.00 ? 114 MET A HB2  3  
ATOM 7457  H HB3  . MET A 1 114 ? -16.576 3.866   -8.723  1.00 0.00 ? 114 MET A HB3  3  
ATOM 7458  H HG2  . MET A 1 114 ? -19.325 3.653   -9.927  1.00 0.00 ? 114 MET A HG2  3  
ATOM 7459  H HG3  . MET A 1 114 ? -18.458 2.352   -9.114  1.00 0.00 ? 114 MET A HG3  3  
ATOM 7460  H HE1  . MET A 1 114 ? -20.283 1.837   -7.415  1.00 0.00 ? 114 MET A HE1  3  
ATOM 7461  H HE2  . MET A 1 114 ? -21.354 3.016   -8.168  1.00 0.00 ? 114 MET A HE2  3  
ATOM 7462  H HE3  . MET A 1 114 ? -21.115 3.030   -6.421  1.00 0.00 ? 114 MET A HE3  3  
ATOM 7463  N N    . GLU A 1 115 ? -17.016 7.630   -8.430  1.00 0.00 ? 115 GLU A N    3  
ATOM 7464  C CA   . GLU A 1 115 ? -16.584 8.446   -7.299  1.00 0.00 ? 115 GLU A CA   3  
ATOM 7465  C C    . GLU A 1 115 ? -17.413 8.132   -6.055  1.00 0.00 ? 115 GLU A C    3  
ATOM 7466  O O    . GLU A 1 115 ? -16.982 8.381   -4.929  1.00 0.00 ? 115 GLU A O    3  
ATOM 7467  C CB   . GLU A 1 115 ? -16.708 9.930   -7.647  1.00 0.00 ? 115 GLU A CB   3  
ATOM 7468  C CG   . GLU A 1 115 ? -15.878 10.843  -6.759  1.00 0.00 ? 115 GLU A CG   3  
ATOM 7469  C CD   . GLU A 1 115 ? -14.397 10.765  -7.062  1.00 0.00 ? 115 GLU A CD   3  
ATOM 7470  O OE1  . GLU A 1 115 ? -14.037 10.643  -8.252  1.00 0.00 ? 115 GLU A OE1  3  
ATOM 7471  O OE2  . GLU A 1 115 ? -13.585 10.840  -6.113  1.00 0.00 ? 115 GLU A OE2  3  
ATOM 7472  H H    . GLU A 1 115 ? -17.418 8.072   -9.208  1.00 0.00 ? 115 GLU A H    3  
ATOM 7473  H HA   . GLU A 1 115 ? -15.549 8.216   -7.098  1.00 0.00 ? 115 GLU A HA   3  
ATOM 7474  H HB2  . GLU A 1 115 ? -16.390 10.075  -8.669  1.00 0.00 ? 115 GLU A HB2  3  
ATOM 7475  H HB3  . GLU A 1 115 ? -17.743 10.222  -7.557  1.00 0.00 ? 115 GLU A HB3  3  
ATOM 7476  H HG2  . GLU A 1 115 ? -16.206 11.861  -6.905  1.00 0.00 ? 115 GLU A HG2  3  
ATOM 7477  H HG3  . GLU A 1 115 ? -16.035 10.560  -5.728  1.00 0.00 ? 115 GLU A HG3  3  
ATOM 7478  N N    . VAL A 1 116 ? -18.602 7.580   -6.273  1.00 0.00 ? 116 VAL A N    3  
ATOM 7479  C CA   . VAL A 1 116 ? -19.499 7.223   -5.183  1.00 0.00 ? 116 VAL A CA   3  
ATOM 7480  C C    . VAL A 1 116 ? -18.831 6.228   -4.236  1.00 0.00 ? 116 VAL A C    3  
ATOM 7481  O O    . VAL A 1 116 ? -18.708 6.481   -3.036  1.00 0.00 ? 116 VAL A O    3  
ATOM 7482  C CB   . VAL A 1 116 ? -20.813 6.614   -5.719  1.00 0.00 ? 116 VAL A CB   3  
ATOM 7483  C CG1  . VAL A 1 116 ? -21.728 6.206   -4.574  1.00 0.00 ? 116 VAL A CG1  3  
ATOM 7484  C CG2  . VAL A 1 116 ? -21.519 7.588   -6.649  1.00 0.00 ? 116 VAL A CG2  3  
ATOM 7485  H H    . VAL A 1 116 ? -18.885 7.409   -7.197  1.00 0.00 ? 116 VAL A H    3  
ATOM 7486  H HA   . VAL A 1 116 ? -19.739 8.125   -4.636  1.00 0.00 ? 116 VAL A HA   3  
ATOM 7487  H HB   . VAL A 1 116 ? -20.568 5.726   -6.285  1.00 0.00 ? 116 VAL A HB   3  
ATOM 7488  H HG11 . VAL A 1 116 ? -21.963 7.073   -3.974  1.00 0.00 ? 116 VAL A HG11 3  
ATOM 7489  H HG12 . VAL A 1 116 ? -21.230 5.469   -3.960  1.00 0.00 ? 116 VAL A HG12 3  
ATOM 7490  H HG13 . VAL A 1 116 ? -22.639 5.786   -4.974  1.00 0.00 ? 116 VAL A HG13 3  
ATOM 7491  H HG21 . VAL A 1 116 ? -22.435 7.142   -7.009  1.00 0.00 ? 116 VAL A HG21 3  
ATOM 7492  H HG22 . VAL A 1 116 ? -20.877 7.815   -7.489  1.00 0.00 ? 116 VAL A HG22 3  
ATOM 7493  H HG23 . VAL A 1 116 ? -21.747 8.498   -6.113  1.00 0.00 ? 116 VAL A HG23 3  
ATOM 7494  N N    . LEU A 1 117 ? -18.386 5.104   -4.782  1.00 0.00 ? 117 LEU A N    3  
ATOM 7495  C CA   . LEU A 1 117 ? -17.736 4.078   -3.983  1.00 0.00 ? 117 LEU A CA   3  
ATOM 7496  C C    . LEU A 1 117 ? -16.400 4.578   -3.449  1.00 0.00 ? 117 LEU A C    3  
ATOM 7497  O O    . LEU A 1 117 ? -16.030 4.286   -2.314  1.00 0.00 ? 117 LEU A O    3  
ATOM 7498  C CB   . LEU A 1 117 ? -17.533 2.802   -4.804  1.00 0.00 ? 117 LEU A CB   3  
ATOM 7499  C CG   . LEU A 1 117 ? -17.070 1.581   -4.008  1.00 0.00 ? 117 LEU A CG   3  
ATOM 7500  C CD1  . LEU A 1 117 ? -18.152 1.133   -3.040  1.00 0.00 ? 117 LEU A CD1  3  
ATOM 7501  C CD2  . LEU A 1 117 ? -16.693 0.449   -4.948  1.00 0.00 ? 117 LEU A CD2  3  
ATOM 7502  H H    . LEU A 1 117 ? -18.505 4.960   -5.747  1.00 0.00 ? 117 LEU A H    3  
ATOM 7503  H HA   . LEU A 1 117 ? -18.381 3.855   -3.147  1.00 0.00 ? 117 LEU A HA   3  
ATOM 7504  H HB2  . LEU A 1 117 ? -18.470 2.557   -5.285  1.00 0.00 ? 117 LEU A HB2  3  
ATOM 7505  H HB3  . LEU A 1 117 ? -16.797 3.005   -5.569  1.00 0.00 ? 117 LEU A HB3  3  
ATOM 7506  H HG   . LEU A 1 117 ? -16.195 1.846   -3.432  1.00 0.00 ? 117 LEU A HG   3  
ATOM 7507  H HD11 . LEU A 1 117 ? -18.375 1.934   -2.352  1.00 0.00 ? 117 LEU A HD11 3  
ATOM 7508  H HD12 . LEU A 1 117 ? -17.806 0.272   -2.487  1.00 0.00 ? 117 LEU A HD12 3  
ATOM 7509  H HD13 . LEU A 1 117 ? -19.042 0.871   -3.590  1.00 0.00 ? 117 LEU A HD13 3  
ATOM 7510  H HD21 . LEU A 1 117 ? -17.560 0.153   -5.519  1.00 0.00 ? 117 LEU A HD21 3  
ATOM 7511  H HD22 . LEU A 1 117 ? -16.334 -0.392  -4.371  1.00 0.00 ? 117 LEU A HD22 3  
ATOM 7512  H HD23 . LEU A 1 117 ? -15.915 0.782   -5.618  1.00 0.00 ? 117 LEU A HD23 3  
ATOM 7513  N N    . VAL A 1 118 ? -15.691 5.350   -4.267  1.00 0.00 ? 118 VAL A N    3  
ATOM 7514  C CA   . VAL A 1 118 ? -14.393 5.895   -3.880  1.00 0.00 ? 118 VAL A CA   3  
ATOM 7515  C C    . VAL A 1 118 ? -14.518 6.762   -2.631  1.00 0.00 ? 118 VAL A C    3  
ATOM 7516  O O    . VAL A 1 118 ? -13.757 6.602   -1.677  1.00 0.00 ? 118 VAL A O    3  
ATOM 7517  C CB   . VAL A 1 118 ? -13.762 6.720   -5.025  1.00 0.00 ? 118 VAL A CB   3  
ATOM 7518  C CG1  . VAL A 1 118 ? -12.474 7.394   -4.574  1.00 0.00 ? 118 VAL A CG1  3  
ATOM 7519  C CG2  . VAL A 1 118 ? -13.498 5.834   -6.228  1.00 0.00 ? 118 VAL A CG2  3  
ATOM 7520  H H    . VAL A 1 118 ? -16.051 5.561   -5.155  1.00 0.00 ? 118 VAL A H    3  
ATOM 7521  H HA   . VAL A 1 118 ? -13.736 5.065   -3.662  1.00 0.00 ? 118 VAL A HA   3  
ATOM 7522  H HB   . VAL A 1 118 ? -14.462 7.489   -5.317  1.00 0.00 ? 118 VAL A HB   3  
ATOM 7523  H HG11 . VAL A 1 118 ? -12.046 7.941   -5.399  1.00 0.00 ? 118 VAL A HG11 3  
ATOM 7524  H HG12 . VAL A 1 118 ? -11.774 6.643   -4.239  1.00 0.00 ? 118 VAL A HG12 3  
ATOM 7525  H HG13 . VAL A 1 118 ? -12.687 8.074   -3.763  1.00 0.00 ? 118 VAL A HG13 3  
ATOM 7526  H HG21 . VAL A 1 118 ? -13.079 6.428   -7.027  1.00 0.00 ? 118 VAL A HG21 3  
ATOM 7527  H HG22 . VAL A 1 118 ? -14.424 5.388   -6.556  1.00 0.00 ? 118 VAL A HG22 3  
ATOM 7528  H HG23 . VAL A 1 118 ? -12.802 5.056   -5.953  1.00 0.00 ? 118 VAL A HG23 3  
ATOM 7529  N N    . GLY A 1 119 ? -15.491 7.668   -2.639  1.00 0.00 ? 119 GLY A N    3  
ATOM 7530  C CA   . GLY A 1 119 ? -15.704 8.540   -1.500  1.00 0.00 ? 119 GLY A CA   3  
ATOM 7531  C C    . GLY A 1 119 ? -16.001 7.762   -0.232  1.00 0.00 ? 119 GLY A C    3  
ATOM 7532  O O    . GLY A 1 119 ? -15.542 8.126   0.853   1.00 0.00 ? 119 GLY A O    3  
ATOM 7533  H H    . GLY A 1 119 ? -16.067 7.751   -3.432  1.00 0.00 ? 119 GLY A H    3  
ATOM 7534  H HA2  . GLY A 1 119 ? -14.818 9.137   -1.344  1.00 0.00 ? 119 GLY A HA2  3  
ATOM 7535  H HA3  . GLY A 1 119 ? -16.536 9.196   -1.711  1.00 0.00 ? 119 GLY A HA3  3  
ATOM 7536  N N    . GLN A 1 120 ? -16.769 6.689   -0.373  1.00 0.00 ? 120 GLN A N    3  
ATOM 7537  C CA   . GLN A 1 120 ? -17.122 5.848   0.762   1.00 0.00 ? 120 GLN A CA   3  
ATOM 7538  C C    . GLN A 1 120 ? -15.895 5.108   1.280   1.00 0.00 ? 120 GLN A C    3  
ATOM 7539  O O    . GLN A 1 120 ? -15.596 5.144   2.472   1.00 0.00 ? 120 GLN A O    3  
ATOM 7540  C CB   . GLN A 1 120 ? -18.209 4.847   0.371   1.00 0.00 ? 120 GLN A CB   3  
ATOM 7541  C CG   . GLN A 1 120 ? -19.552 5.491   0.073   1.00 0.00 ? 120 GLN A CG   3  
ATOM 7542  C CD   . GLN A 1 120 ? -20.576 4.492   -0.427  1.00 0.00 ? 120 GLN A CD   3  
ATOM 7543  O OE1  . GLN A 1 120 ? -20.531 3.310   -0.079  1.00 0.00 ? 120 GLN A OE1  3  
ATOM 7544  N NE2  . GLN A 1 120 ? -21.506 4.957   -1.242  1.00 0.00 ? 120 GLN A NE2  3  
ATOM 7545  H H    . GLN A 1 120 ? -17.110 6.458   -1.264  1.00 0.00 ? 120 GLN A H    3  
ATOM 7546  H HA   . GLN A 1 120 ? -17.500 6.488   1.545   1.00 0.00 ? 120 GLN A HA   3  
ATOM 7547  H HB2  . GLN A 1 120 ? -17.889 4.308   -0.509  1.00 0.00 ? 120 GLN A HB2  3  
ATOM 7548  H HB3  . GLN A 1 120 ? -18.344 4.145   1.182   1.00 0.00 ? 120 GLN A HB3  3  
ATOM 7549  H HG2  . GLN A 1 120 ? -19.928 5.949   0.976   1.00 0.00 ? 120 GLN A HG2  3  
ATOM 7550  H HG3  . GLN A 1 120 ? -19.412 6.250   -0.683  1.00 0.00 ? 120 GLN A HG3  3  
ATOM 7551  H HE21 . GLN A 1 120 ? -21.483 5.913   -1.479  1.00 0.00 ? 120 GLN A HE21 3  
ATOM 7552  H HE22 . GLN A 1 120 ? -22.179 4.329   -1.581  1.00 0.00 ? 120 GLN A HE22 3  
ATOM 7553  N N    . VAL A 1 121 ? -15.177 4.456   0.367   1.00 0.00 ? 121 VAL A N    3  
ATOM 7554  C CA   . VAL A 1 121 ? -13.976 3.701   0.716   1.00 0.00 ? 121 VAL A CA   3  
ATOM 7555  C C    . VAL A 1 121 ? -12.941 4.596   1.389   1.00 0.00 ? 121 VAL A C    3  
ATOM 7556  O O    . VAL A 1 121 ? -12.340 4.213   2.397   1.00 0.00 ? 121 VAL A O    3  
ATOM 7557  C CB   . VAL A 1 121 ? -13.346 3.031   -0.525  1.00 0.00 ? 121 VAL A CB   3  
ATOM 7558  C CG1  . VAL A 1 121 ? -12.017 2.377   -0.177  1.00 0.00 ? 121 VAL A CG1  3  
ATOM 7559  C CG2  . VAL A 1 121 ? -14.302 2.006   -1.117  1.00 0.00 ? 121 VAL A CG2  3  
ATOM 7560  H H    . VAL A 1 121 ? -15.463 4.485   -0.573  1.00 0.00 ? 121 VAL A H    3  
ATOM 7561  H HA   . VAL A 1 121 ? -14.264 2.924   1.409   1.00 0.00 ? 121 VAL A HA   3  
ATOM 7562  H HB   . VAL A 1 121 ? -13.164 3.791   -1.269  1.00 0.00 ? 121 VAL A HB   3  
ATOM 7563  H HG11 . VAL A 1 121 ? -11.333 3.128   0.188   1.00 0.00 ? 121 VAL A HG11 3  
ATOM 7564  H HG12 . VAL A 1 121 ? -11.602 1.908   -1.057  1.00 0.00 ? 121 VAL A HG12 3  
ATOM 7565  H HG13 . VAL A 1 121 ? -12.174 1.631   0.585   1.00 0.00 ? 121 VAL A HG13 3  
ATOM 7566  H HG21 . VAL A 1 121 ? -13.856 1.570   -2.000  1.00 0.00 ? 121 VAL A HG21 3  
ATOM 7567  H HG22 . VAL A 1 121 ? -15.230 2.489   -1.384  1.00 0.00 ? 121 VAL A HG22 3  
ATOM 7568  H HG23 . VAL A 1 121 ? -14.494 1.231   -0.391  1.00 0.00 ? 121 VAL A HG23 3  
ATOM 7569  N N    . GLN A 1 122 ? -12.746 5.788   0.835   1.00 0.00 ? 122 GLN A N    3  
ATOM 7570  C CA   . GLN A 1 122 ? -11.794 6.740   1.388   1.00 0.00 ? 122 GLN A CA   3  
ATOM 7571  C C    . GLN A 1 122 ? -12.149 7.061   2.832   1.00 0.00 ? 122 GLN A C    3  
ATOM 7572  O O    . GLN A 1 122 ? -11.286 7.052   3.711   1.00 0.00 ? 122 GLN A O    3  
ATOM 7573  C CB   . GLN A 1 122 ? -11.764 8.020   0.548   1.00 0.00 ? 122 GLN A CB   3  
ATOM 7574  C CG   . GLN A 1 122 ? -10.435 8.262   -0.151  1.00 0.00 ? 122 GLN A CG   3  
ATOM 7575  C CD   . GLN A 1 122 ? -10.014 7.098   -1.028  1.00 0.00 ? 122 GLN A CD   3  
ATOM 7576  O OE1  . GLN A 1 122 ? -10.367 7.032   -2.203  1.00 0.00 ? 122 GLN A OE1  3  
ATOM 7577  N NE2  . GLN A 1 122 ? -9.258  6.168   -0.464  1.00 0.00 ? 122 GLN A NE2  3  
ATOM 7578  H H    . GLN A 1 122 ? -13.256 6.032   0.028   1.00 0.00 ? 122 GLN A H    3  
ATOM 7579  H HA   . GLN A 1 122 ? -10.818 6.281   1.365   1.00 0.00 ? 122 GLN A HA   3  
ATOM 7580  H HB2  . GLN A 1 122 ? -12.537 7.962   -0.205  1.00 0.00 ? 122 GLN A HB2  3  
ATOM 7581  H HB3  . GLN A 1 122 ? -11.965 8.864   1.192   1.00 0.00 ? 122 GLN A HB3  3  
ATOM 7582  H HG2  . GLN A 1 122 ? -10.523 9.144   -0.769  1.00 0.00 ? 122 GLN A HG2  3  
ATOM 7583  H HG3  . GLN A 1 122 ? -9.673  8.424   0.598   1.00 0.00 ? 122 GLN A HG3  3  
ATOM 7584  H HE21 . GLN A 1 122 ? -9.011  6.278   0.477   1.00 0.00 ? 122 GLN A HE21 3  
ATOM 7585  H HE22 . GLN A 1 122 ? -8.977  5.405   -1.013  1.00 0.00 ? 122 GLN A HE22 3  
ATOM 7586  N N    . GLU A 1 123 ? -13.428 7.311   3.075   1.00 0.00 ? 123 GLU A N    3  
ATOM 7587  C CA   . GLU A 1 123 ? -13.902 7.627   4.412   1.00 0.00 ? 123 GLU A CA   3  
ATOM 7588  C C    . GLU A 1 123 ? -13.715 6.437   5.346   1.00 0.00 ? 123 GLU A C    3  
ATOM 7589  O O    . GLU A 1 123 ? -13.237 6.593   6.469   1.00 0.00 ? 123 GLU A O    3  
ATOM 7590  C CB   . GLU A 1 123 ? -15.372 8.036   4.370   1.00 0.00 ? 123 GLU A CB   3  
ATOM 7591  C CG   . GLU A 1 123 ? -15.954 8.333   5.741   1.00 0.00 ? 123 GLU A CG   3  
ATOM 7592  C CD   . GLU A 1 123 ? -17.273 9.067   5.668   1.00 0.00 ? 123 GLU A CD   3  
ATOM 7593  O OE1  . GLU A 1 123 ? -17.256 10.313  5.619   1.00 0.00 ? 123 GLU A OE1  3  
ATOM 7594  O OE2  . GLU A 1 123 ? -18.333 8.406   5.672   1.00 0.00 ? 123 GLU A OE2  3  
ATOM 7595  H H    . GLU A 1 123 ? -14.072 7.281   2.335   1.00 0.00 ? 123 GLU A H    3  
ATOM 7596  H HA   . GLU A 1 123 ? -13.317 8.457   4.785   1.00 0.00 ? 123 GLU A HA   3  
ATOM 7597  H HB2  . GLU A 1 123 ? -15.471 8.922   3.760   1.00 0.00 ? 123 GLU A HB2  3  
ATOM 7598  H HB3  . GLU A 1 123 ? -15.942 7.234   3.925   1.00 0.00 ? 123 GLU A HB3  3  
ATOM 7599  H HG2  . GLU A 1 123 ? -16.109 7.400   6.260   1.00 0.00 ? 123 GLU A HG2  3  
ATOM 7600  H HG3  . GLU A 1 123 ? -15.251 8.939   6.294   1.00 0.00 ? 123 GLU A HG3  3  
ATOM 7601  N N    . TRP A 1 124 ? -14.080 5.251   4.869   1.00 0.00 ? 124 TRP A N    3  
ATOM 7602  C CA   . TRP A 1 124 ? -13.955 4.032   5.662   1.00 0.00 ? 124 TRP A CA   3  
ATOM 7603  C C    . TRP A 1 124 ? -12.521 3.836   6.140   1.00 0.00 ? 124 TRP A C    3  
ATOM 7604  O O    . TRP A 1 124 ? -12.286 3.515   7.307   1.00 0.00 ? 124 TRP A O    3  
ATOM 7605  C CB   . TRP A 1 124 ? -14.390 2.806   4.853   1.00 0.00 ? 124 TRP A CB   3  
ATOM 7606  C CG   . TRP A 1 124 ? -15.860 2.751   4.568   1.00 0.00 ? 124 TRP A CG   3  
ATOM 7607  C CD1  . TRP A 1 124 ? -16.864 3.318   5.301   1.00 0.00 ? 124 TRP A CD1  3  
ATOM 7608  C CD2  . TRP A 1 124 ? -16.495 2.079   3.472   1.00 0.00 ? 124 TRP A CD2  3  
ATOM 7609  N NE1  . TRP A 1 124 ? -18.080 3.045   4.723   1.00 0.00 ? 124 TRP A NE1  3  
ATOM 7610  C CE2  . TRP A 1 124 ? -17.880 2.288   3.601   1.00 0.00 ? 124 TRP A CE2  3  
ATOM 7611  C CE3  . TRP A 1 124 ? -16.024 1.326   2.393   1.00 0.00 ? 124 TRP A CE3  3  
ATOM 7612  C CZ2  . TRP A 1 124 ? -18.799 1.769   2.694   1.00 0.00 ? 124 TRP A CZ2  3  
ATOM 7613  C CZ3  . TRP A 1 124 ? -16.939 0.811   1.492   1.00 0.00 ? 124 TRP A CZ3  3  
ATOM 7614  C CH2  . TRP A 1 124 ? -18.312 1.036   1.646   1.00 0.00 ? 124 TRP A CH2  3  
ATOM 7615  H H    . TRP A 1 124 ? -14.452 5.197   3.959   1.00 0.00 ? 124 TRP A H    3  
ATOM 7616  H HA   . TRP A 1 124 ? -14.598 4.131   6.523   1.00 0.00 ? 124 TRP A HA   3  
ATOM 7617  H HB2  . TRP A 1 124 ? -13.870 2.807   3.908   1.00 0.00 ? 124 TRP A HB2  3  
ATOM 7618  H HB3  . TRP A 1 124 ? -14.124 1.915   5.403   1.00 0.00 ? 124 TRP A HB3  3  
ATOM 7619  H HD1  . TRP A 1 124 ? -16.712 3.897   6.200   1.00 0.00 ? 124 TRP A HD1  3  
ATOM 7620  H HE1  . TRP A 1 124 ? -18.958 3.344   5.061   1.00 0.00 ? 124 TRP A HE1  3  
ATOM 7621  H HE3  . TRP A 1 124 ? -14.970 1.142   2.257   1.00 0.00 ? 124 TRP A HE3  3  
ATOM 7622  H HZ2  . TRP A 1 124 ? -19.861 1.936   2.800   1.00 0.00 ? 124 TRP A HZ2  3  
ATOM 7623  H HZ3  . TRP A 1 124 ? -16.595 0.226   0.652   1.00 0.00 ? 124 TRP A HZ3  3  
ATOM 7624  H HH2  . TRP A 1 124 ? -18.990 0.614   0.919   1.00 0.00 ? 124 TRP A HH2  3  
ATOM 7625  N N    . MET A 1 125 ? -11.571 4.045   5.234   1.00 0.00 ? 125 MET A N    3  
ATOM 7626  C CA   . MET A 1 125 ? -10.156 3.888   5.552   1.00 0.00 ? 125 MET A CA   3  
ATOM 7627  C C    . MET A 1 125 ? -9.685  4.955   6.533   1.00 0.00 ? 125 MET A C    3  
ATOM 7628  O O    . MET A 1 125 ? -9.063  4.639   7.548   1.00 0.00 ? 125 MET A O    3  
ATOM 7629  C CB   . MET A 1 125 ? -9.311  3.950   4.281   1.00 0.00 ? 125 MET A CB   3  
ATOM 7630  C CG   . MET A 1 125 ? -9.504  2.759   3.358   1.00 0.00 ? 125 MET A CG   3  
ATOM 7631  S SD   . MET A 1 125 ? -8.356  2.763   1.967   1.00 0.00 ? 125 MET A SD   3  
ATOM 7632  C CE   . MET A 1 125 ? -6.816  2.378   2.798   1.00 0.00 ? 125 MET A CE   3  
ATOM 7633  H H    . MET A 1 125 ? -11.831 4.306   4.321   1.00 0.00 ? 125 MET A H    3  
ATOM 7634  H HA   . MET A 1 125 ? -10.029 2.917   6.009   1.00 0.00 ? 125 MET A HA   3  
ATOM 7635  H HB2  . MET A 1 125 ? -9.572  4.846   3.736   1.00 0.00 ? 125 MET A HB2  3  
ATOM 7636  H HB3  . MET A 1 125 ? -8.268  3.999   4.557   1.00 0.00 ? 125 MET A HB3  3  
ATOM 7637  H HG2  . MET A 1 125 ? -9.355  1.852   3.926   1.00 0.00 ? 125 MET A HG2  3  
ATOM 7638  H HG3  . MET A 1 125 ? -10.514 2.779   2.974   1.00 0.00 ? 125 MET A HG3  3  
ATOM 7639  H HE1  . MET A 1 125 ? -6.016  2.350   2.074   1.00 0.00 ? 125 MET A HE1  3  
ATOM 7640  H HE2  . MET A 1 125 ? -6.898  1.415   3.281   1.00 0.00 ? 125 MET A HE2  3  
ATOM 7641  H HE3  . MET A 1 125 ? -6.606  3.135   3.538   1.00 0.00 ? 125 MET A HE3  3  
ATOM 7642  N N    . VAL A 1 126 ? -9.987  6.216   6.231   1.00 0.00 ? 126 VAL A N    3  
ATOM 7643  C CA   . VAL A 1 126 ? -9.579  7.327   7.089   1.00 0.00 ? 126 VAL A CA   3  
ATOM 7644  C C    . VAL A 1 126 ? -10.169 7.190   8.490   1.00 0.00 ? 126 VAL A C    3  
ATOM 7645  O O    . VAL A 1 126 ? -9.459  7.325   9.486   1.00 0.00 ? 126 VAL A O    3  
ATOM 7646  C CB   . VAL A 1 126 ? -9.989  8.691   6.491   1.00 0.00 ? 126 VAL A CB   3  
ATOM 7647  C CG1  . VAL A 1 126 ? -9.682  9.826   7.456   1.00 0.00 ? 126 VAL A CG1  3  
ATOM 7648  C CG2  . VAL A 1 126 ? -9.282  8.925   5.168   1.00 0.00 ? 126 VAL A CG2  3  
ATOM 7649  H H    . VAL A 1 126 ? -10.500 6.403   5.412   1.00 0.00 ? 126 VAL A H    3  
ATOM 7650  H HA   . VAL A 1 126 ? -8.501  7.303   7.163   1.00 0.00 ? 126 VAL A HA   3  
ATOM 7651  H HB   . VAL A 1 126 ? -11.053 8.677   6.310   1.00 0.00 ? 126 VAL A HB   3  
ATOM 7652  H HG11 . VAL A 1 126 ? -10.224 9.673   8.376   1.00 0.00 ? 126 VAL A HG11 3  
ATOM 7653  H HG12 . VAL A 1 126 ? -9.981  10.765  7.013   1.00 0.00 ? 126 VAL A HG12 3  
ATOM 7654  H HG13 . VAL A 1 126 ? -8.621  9.847   7.661   1.00 0.00 ? 126 VAL A HG13 3  
ATOM 7655  H HG21 . VAL A 1 126 ? -9.581  8.167   4.463   1.00 0.00 ? 126 VAL A HG21 3  
ATOM 7656  H HG22 . VAL A 1 126 ? -8.215  8.878   5.320   1.00 0.00 ? 126 VAL A HG22 3  
ATOM 7657  H HG23 . VAL A 1 126 ? -9.548  9.899   4.785   1.00 0.00 ? 126 VAL A HG23 3  
ATOM 7658  N N    . ALA A 1 127 ? -11.463 6.899   8.560   1.00 0.00 ? 127 ALA A N    3  
ATOM 7659  C CA   . ALA A 1 127 ? -12.142 6.745   9.839   1.00 0.00 ? 127 ALA A CA   3  
ATOM 7660  C C    . ALA A 1 127 ? -11.527 5.614   10.652  1.00 0.00 ? 127 ALA A C    3  
ATOM 7661  O O    . ALA A 1 127 ? -11.327 5.746   11.856  1.00 0.00 ? 127 ALA A O    3  
ATOM 7662  C CB   . ALA A 1 127 ? -13.629 6.504   9.627   1.00 0.00 ? 127 ALA A CB   3  
ATOM 7663  H H    . ALA A 1 127 ? -11.978 6.792   7.727   1.00 0.00 ? 127 ALA A H    3  
ATOM 7664  H HA   . ALA A 1 127 ? -12.027 7.669   10.386  1.00 0.00 ? 127 ALA A HA   3  
ATOM 7665  H HB1  . ALA A 1 127 ? -14.132 6.492   10.582  1.00 0.00 ? 127 ALA A HB1  3  
ATOM 7666  H HB2  . ALA A 1 127 ? -13.773 5.556   9.132   1.00 0.00 ? 127 ALA A HB2  3  
ATOM 7667  H HB3  . ALA A 1 127 ? -14.037 7.295   9.016   1.00 0.00 ? 127 ALA A HB3  3  
ATOM 7668  N N    . TYR A 1 128 ? -11.196 4.513   9.988   1.00 0.00 ? 128 TYR A N    3  
ATOM 7669  C CA   . TYR A 1 128 ? -10.603 3.366   10.666  1.00 0.00 ? 128 TYR A CA   3  
ATOM 7670  C C    . TYR A 1 128 ? -9.262  3.744   11.288  1.00 0.00 ? 128 TYR A C    3  
ATOM 7671  O O    . TYR A 1 128 ? -8.938  3.320   12.402  1.00 0.00 ? 128 TYR A O    3  
ATOM 7672  C CB   . TYR A 1 128 ? -10.421 2.197   9.694   1.00 0.00 ? 128 TYR A CB   3  
ATOM 7673  C CG   . TYR A 1 128 ? -10.582 0.840   10.346  1.00 0.00 ? 128 TYR A CG   3  
ATOM 7674  C CD1  . TYR A 1 128 ? -9.665  0.387   11.286  1.00 0.00 ? 128 TYR A CD1  3  
ATOM 7675  C CD2  . TYR A 1 128 ? -11.657 0.018   10.028  1.00 0.00 ? 128 TYR A CD2  3  
ATOM 7676  C CE1  . TYR A 1 128 ? -9.810  -0.847  11.887  1.00 0.00 ? 128 TYR A CE1  3  
ATOM 7677  C CE2  . TYR A 1 128 ? -11.807 -1.218  10.626  1.00 0.00 ? 128 TYR A CE2  3  
ATOM 7678  C CZ   . TYR A 1 128 ? -10.884 -1.643  11.557  1.00 0.00 ? 128 TYR A CZ   3  
ATOM 7679  O OH   . TYR A 1 128 ? -11.026 -2.871  12.154  1.00 0.00 ? 128 TYR A OH   3  
ATOM 7680  H H    . TYR A 1 128 ? -11.354 4.471   9.020   1.00 0.00 ? 128 TYR A H    3  
ATOM 7681  H HA   . TYR A 1 128 ? -11.278 3.064   11.454  1.00 0.00 ? 128 TYR A HA   3  
ATOM 7682  H HB2  . TYR A 1 128 ? -11.153 2.274   8.904   1.00 0.00 ? 128 TYR A HB2  3  
ATOM 7683  H HB3  . TYR A 1 128 ? -9.430  2.245   9.266   1.00 0.00 ? 128 TYR A HB3  3  
ATOM 7684  H HD1  . TYR A 1 128 ? -8.826  1.015   11.545  1.00 0.00 ? 128 TYR A HD1  3  
ATOM 7685  H HD2  . TYR A 1 128 ? -12.376 0.352   9.297   1.00 0.00 ? 128 TYR A HD2  3  
ATOM 7686  H HE1  . TYR A 1 128 ? -9.085  -1.180  12.614  1.00 0.00 ? 128 TYR A HE1  3  
ATOM 7687  H HE2  . TYR A 1 128 ? -12.647 -1.846  10.368  1.00 0.00 ? 128 TYR A HE2  3  
ATOM 7688  H HH   . TYR A 1 128 ? -10.646 -3.554  11.572  1.00 0.00 ? 128 TYR A HH   3  
ATOM 7689  N N    . LEU A 1 129 ? -8.505  4.567   10.574  1.00 0.00 ? 129 LEU A N    3  
ATOM 7690  C CA   . LEU A 1 129 ? -7.197  5.021   11.037  1.00 0.00 ? 129 LEU A CA   3  
ATOM 7691  C C    . LEU A 1 129 ? -7.325  5.920   12.265  1.00 0.00 ? 129 LEU A C    3  
ATOM 7692  O O    . LEU A 1 129 ? -6.369  6.094   13.020  1.00 0.00 ? 129 LEU A O    3  
ATOM 7693  C CB   . LEU A 1 129 ? -6.476  5.781   9.922   1.00 0.00 ? 129 LEU A CB   3  
ATOM 7694  C CG   . LEU A 1 129 ? -6.070  4.939   8.709   1.00 0.00 ? 129 LEU A CG   3  
ATOM 7695  C CD1  . LEU A 1 129 ? -5.822  5.831   7.502   1.00 0.00 ? 129 LEU A CD1  3  
ATOM 7696  C CD2  . LEU A 1 129 ? -4.830  4.121   9.025   1.00 0.00 ? 129 LEU A CD2  3  
ATOM 7697  H H    . LEU A 1 129 ? -8.834  4.881   9.703   1.00 0.00 ? 129 LEU A H    3  
ATOM 7698  H HA   . LEU A 1 129 ? -6.617  4.151   11.301  1.00 0.00 ? 129 LEU A HA   3  
ATOM 7699  H HB2  . LEU A 1 129 ? -7.124  6.574   9.580   1.00 0.00 ? 129 LEU A HB2  3  
ATOM 7700  H HB3  . LEU A 1 129 ? -5.582  6.224   10.337  1.00 0.00 ? 129 LEU A HB3  3  
ATOM 7701  H HG   . LEU A 1 129 ? -6.872  4.257   8.464   1.00 0.00 ? 129 LEU A HG   3  
ATOM 7702  H HD11 . LEU A 1 129 ? -5.047  6.545   7.735   1.00 0.00 ? 129 LEU A HD11 3  
ATOM 7703  H HD12 . LEU A 1 129 ? -6.732  6.356   7.250   1.00 0.00 ? 129 LEU A HD12 3  
ATOM 7704  H HD13 . LEU A 1 129 ? -5.513  5.225   6.664   1.00 0.00 ? 129 LEU A HD13 3  
ATOM 7705  H HD21 . LEU A 1 129 ? -4.012  4.785   9.266   1.00 0.00 ? 129 LEU A HD21 3  
ATOM 7706  H HD22 . LEU A 1 129 ? -4.567  3.524   8.166   1.00 0.00 ? 129 LEU A HD22 3  
ATOM 7707  H HD23 . LEU A 1 129 ? -5.030  3.476   9.868   1.00 0.00 ? 129 LEU A HD23 3  
ATOM 7708  N N    . GLU A 1 130 ? -8.502  6.492   12.460  1.00 0.00 ? 130 GLU A N    3  
ATOM 7709  C CA   . GLU A 1 130 ? -8.735  7.374   13.594  1.00 0.00 ? 130 GLU A CA   3  
ATOM 7710  C C    . GLU A 1 130 ? -9.581  6.694   14.670  1.00 0.00 ? 130 GLU A C    3  
ATOM 7711  O O    . GLU A 1 130 ? -9.669  7.181   15.796  1.00 0.00 ? 130 GLU A O    3  
ATOM 7712  C CB   . GLU A 1 130 ? -9.418  8.661   13.132  1.00 0.00 ? 130 GLU A CB   3  
ATOM 7713  C CG   . GLU A 1 130 ? -8.719  9.336   11.964  1.00 0.00 ? 130 GLU A CG   3  
ATOM 7714  C CD   . GLU A 1 130 ? -9.075  10.801  11.842  1.00 0.00 ? 130 GLU A CD   3  
ATOM 7715  O OE1  . GLU A 1 130 ? -10.279 11.124  11.754  1.00 0.00 ? 130 GLU A OE1  3  
ATOM 7716  O OE2  . GLU A 1 130 ? -8.150  11.642  11.848  1.00 0.00 ? 130 GLU A OE2  3  
ATOM 7717  H H    . GLU A 1 130 ? -9.228  6.330   11.820  1.00 0.00 ? 130 GLU A H    3  
ATOM 7718  H HA   . GLU A 1 130 ? -7.776  7.623   14.019  1.00 0.00 ? 130 GLU A HA   3  
ATOM 7719  H HB2  . GLU A 1 130 ? -10.429 8.431   12.836  1.00 0.00 ? 130 GLU A HB2  3  
ATOM 7720  H HB3  . GLU A 1 130 ? -9.444  9.356   13.958  1.00 0.00 ? 130 GLU A HB3  3  
ATOM 7721  H HG2  . GLU A 1 130 ? -7.652  9.253   12.103  1.00 0.00 ? 130 GLU A HG2  3  
ATOM 7722  H HG3  . GLU A 1 130 ? -9.003  8.834   11.051  1.00 0.00 ? 130 GLU A HG3  3  
ATOM 7723  N N    . THR A 1 131 ? -10.201 5.572   14.329  1.00 0.00 ? 131 THR A N    3  
ATOM 7724  C CA   . THR A 1 131 ? -11.037 4.855   15.282  1.00 0.00 ? 131 THR A CA   3  
ATOM 7725  C C    . THR A 1 131 ? -10.267 3.741   15.992  1.00 0.00 ? 131 THR A C    3  
ATOM 7726  O O    . THR A 1 131 ? -10.070 3.792   17.204  1.00 0.00 ? 131 THR A O    3  
ATOM 7727  C CB   . THR A 1 131 ? -12.284 4.254   14.602  1.00 0.00 ? 131 THR A CB   3  
ATOM 7728  O OG1  . THR A 1 131 ? -13.016 5.274   13.909  1.00 0.00 ? 131 THR A OG1  3  
ATOM 7729  C CG2  . THR A 1 131 ? -13.196 3.587   15.624  1.00 0.00 ? 131 THR A CG2  3  
ATOM 7730  H H    . THR A 1 131 ? -10.107 5.227   13.416  1.00 0.00 ? 131 THR A H    3  
ATOM 7731  H HA   . THR A 1 131 ? -11.372 5.566   16.022  1.00 0.00 ? 131 THR A HA   3  
ATOM 7732  H HB   . THR A 1 131 ? -11.962 3.507   13.890  1.00 0.00 ? 131 THR A HB   3  
ATOM 7733  H HG1  . THR A 1 131 ? -12.398 5.932   13.551  1.00 0.00 ? 131 THR A HG1  3  
ATOM 7734  H HG21 . THR A 1 131 ? -14.058 3.173   15.122  1.00 0.00 ? 131 THR A HG21 3  
ATOM 7735  H HG22 . THR A 1 131 ? -13.519 4.318   16.351  1.00 0.00 ? 131 THR A HG22 3  
ATOM 7736  H HG23 . THR A 1 131 ? -12.659 2.796   16.124  1.00 0.00 ? 131 THR A HG23 3  
ATOM 7737  N N    . ARG A 1 132 ? -9.822  2.741   15.241  1.00 0.00 ? 132 ARG A N    3  
ATOM 7738  C CA   . ARG A 1 132 ? -9.112  1.616   15.839  1.00 0.00 ? 132 ARG A CA   3  
ATOM 7739  C C    . ARG A 1 132 ? -7.606  1.718   15.639  1.00 0.00 ? 132 ARG A C    3  
ATOM 7740  O O    . ARG A 1 132 ? -6.831  1.289   16.492  1.00 0.00 ? 132 ARG A O    3  
ATOM 7741  C CB   . ARG A 1 132 ? -9.621  0.301   15.255  1.00 0.00 ? 132 ARG A CB   3  
ATOM 7742  C CG   . ARG A 1 132 ? -9.155  -0.920  16.028  1.00 0.00 ? 132 ARG A CG   3  
ATOM 7743  C CD   . ARG A 1 132 ? -9.828  -2.189  15.535  1.00 0.00 ? 132 ARG A CD   3  
ATOM 7744  N NE   . ARG A 1 132 ? -9.794  -3.245  16.544  1.00 0.00 ? 132 ARG A NE   3  
ATOM 7745  C CZ   . ARG A 1 132 ? -10.829 -3.575  17.310  1.00 0.00 ? 132 ARG A CZ   3  
ATOM 7746  N NH1  . ARG A 1 132 ? -11.996 -2.954  17.170  1.00 0.00 ? 132 ARG A NH1  3  
ATOM 7747  N NH2  . ARG A 1 132 ? -10.698 -4.537  18.215  1.00 0.00 ? 132 ARG A NH2  3  
ATOM 7748  H H    . ARG A 1 132 ? -9.971  2.759   14.272  1.00 0.00 ? 132 ARG A H    3  
ATOM 7749  H HA   . ARG A 1 132 ? -9.319  1.626   16.898  1.00 0.00 ? 132 ARG A HA   3  
ATOM 7750  H HB2  . ARG A 1 132 ? -10.701 0.313   15.256  1.00 0.00 ? 132 ARG A HB2  3  
ATOM 7751  H HB3  . ARG A 1 132 ? -9.271  0.213   14.238  1.00 0.00 ? 132 ARG A HB3  3  
ATOM 7752  H HG2  . ARG A 1 132 ? -8.087  -1.024  15.908  1.00 0.00 ? 132 ARG A HG2  3  
ATOM 7753  H HG3  . ARG A 1 132 ? -9.390  -0.781  17.072  1.00 0.00 ? 132 ARG A HG3  3  
ATOM 7754  H HD2  . ARG A 1 132 ? -10.857 -1.967  15.294  1.00 0.00 ? 132 ARG A HD2  3  
ATOM 7755  H HD3  . ARG A 1 132 ? -9.316  -2.534  14.648  1.00 0.00 ? 132 ARG A HD3  3  
ATOM 7756  H HE   . ARG A 1 132 ? -8.941  -3.730  16.661  1.00 0.00 ? 132 ARG A HE   3  
ATOM 7757  H HH11 . ARG A 1 132 ? -12.107 -2.226  16.478  1.00 0.00 ? 132 ARG A HH11 3  
ATOM 7758  H HH12 . ARG A 1 132 ? -12.779 -3.206  17.754  1.00 0.00 ? 132 ARG A HH12 3  
ATOM 7759  H HH21 . ARG A 1 132 ? -9.821  -5.019  18.320  1.00 0.00 ? 132 ARG A HH21 3  
ATOM 7760  H HH22 . ARG A 1 132 ? -11.473 -4.785  18.806  1.00 0.00 ? 132 ARG A HH22 3  
ATOM 7761  N N    . LEU A 1 133 ? -7.188  2.299   14.527  1.00 0.00 ? 133 LEU A N    3  
ATOM 7762  C CA   . LEU A 1 133 ? -5.766  2.427   14.237  1.00 0.00 ? 133 LEU A CA   3  
ATOM 7763  C C    . LEU A 1 133 ? -5.206  3.740   14.778  1.00 0.00 ? 133 LEU A C    3  
ATOM 7764  O O    . LEU A 1 133 ? -4.089  4.127   14.443  1.00 0.00 ? 133 LEU A O    3  
ATOM 7765  C CB   . LEU A 1 133 ? -5.516  2.311   12.730  1.00 0.00 ? 133 LEU A CB   3  
ATOM 7766  C CG   . LEU A 1 133 ? -6.050  1.029   12.083  1.00 0.00 ? 133 LEU A CG   3  
ATOM 7767  C CD1  . LEU A 1 133 ? -5.755  1.021   10.593  1.00 0.00 ? 133 LEU A CD1  3  
ATOM 7768  C CD2  . LEU A 1 133 ? -5.455  -0.200  12.754  1.00 0.00 ? 133 LEU A CD2  3  
ATOM 7769  H H    . LEU A 1 133 ? -7.845  2.651   13.885  1.00 0.00 ? 133 LEU A H    3  
ATOM 7770  H HA   . LEU A 1 133 ? -5.259  1.612   14.733  1.00 0.00 ? 133 LEU A HA   3  
ATOM 7771  H HB2  . LEU A 1 133 ? -5.981  3.156   12.242  1.00 0.00 ? 133 LEU A HB2  3  
ATOM 7772  H HB3  . LEU A 1 133 ? -4.451  2.358   12.554  1.00 0.00 ? 133 LEU A HB3  3  
ATOM 7773  H HG   . LEU A 1 133 ? -7.122  0.992   12.209  1.00 0.00 ? 133 LEU A HG   3  
ATOM 7774  H HD11 . LEU A 1 133 ? -6.220  1.877   10.128  1.00 0.00 ? 133 LEU A HD11 3  
ATOM 7775  H HD12 . LEU A 1 133 ? -6.146  0.116   10.155  1.00 0.00 ? 133 LEU A HD12 3  
ATOM 7776  H HD13 . LEU A 1 133 ? -4.688  1.064   10.438  1.00 0.00 ? 133 LEU A HD13 3  
ATOM 7777  H HD21 . LEU A 1 133 ? -5.863  -1.092  12.303  1.00 0.00 ? 133 LEU A HD21 3  
ATOM 7778  H HD22 . LEU A 1 133 ? -5.698  -0.186  13.807  1.00 0.00 ? 133 LEU A HD22 3  
ATOM 7779  H HD23 . LEU A 1 133 ? -4.383  -0.192  12.633  1.00 0.00 ? 133 LEU A HD23 3  
ATOM 7780  N N    . ALA A 1 134 ? -5.980  4.405   15.631  1.00 0.00 ? 134 ALA A N    3  
ATOM 7781  C CA   . ALA A 1 134 ? -5.558  5.672   16.219  1.00 0.00 ? 134 ALA A CA   3  
ATOM 7782  C C    . ALA A 1 134 ? -4.303  5.480   17.063  1.00 0.00 ? 134 ALA A C    3  
ATOM 7783  O O    . ALA A 1 134 ? -3.293  6.159   16.864  1.00 0.00 ? 134 ALA A O    3  
ATOM 7784  C CB   . ALA A 1 134 ? -6.680  6.256   17.062  1.00 0.00 ? 134 ALA A CB   3  
ATOM 7785  H H    . ALA A 1 134 ? -6.850  4.031   15.879  1.00 0.00 ? 134 ALA A H    3  
ATOM 7786  H HA   . ALA A 1 134 ? -5.342  6.361   15.415  1.00 0.00 ? 134 ALA A HA   3  
ATOM 7787  H HB1  . ALA A 1 134 ? -7.549  6.419   16.443  1.00 0.00 ? 134 ALA A HB1  3  
ATOM 7788  H HB2  . ALA A 1 134 ? -6.360  7.195   17.486  1.00 0.00 ? 134 ALA A HB2  3  
ATOM 7789  H HB3  . ALA A 1 134 ? -6.929  5.568   17.857  1.00 0.00 ? 134 ALA A HB3  3  
ATOM 7790  N N    . ASP A 1 135 ? -4.375  4.539   17.995  1.00 0.00 ? 135 ASP A N    3  
ATOM 7791  C CA   . ASP A 1 135 ? -3.250  4.229   18.870  1.00 0.00 ? 135 ASP A CA   3  
ATOM 7792  C C    . ASP A 1 135 ? -2.077  3.688   18.063  1.00 0.00 ? 135 ASP A C    3  
ATOM 7793  O O    . ASP A 1 135 ? -0.916  3.987   18.348  1.00 0.00 ? 135 ASP A O    3  
ATOM 7794  C CB   . ASP A 1 135 ? -3.668  3.203   19.926  1.00 0.00 ? 135 ASP A CB   3  
ATOM 7795  C CG   . ASP A 1 135 ? -2.488  2.624   20.680  1.00 0.00 ? 135 ASP A CG   3  
ATOM 7796  O OD1  . ASP A 1 135 ? -1.975  3.295   21.600  1.00 0.00 ? 135 ASP A OD1  3  
ATOM 7797  O OD2  . ASP A 1 135 ? -2.069  1.492   20.356  1.00 0.00 ? 135 ASP A OD2  3  
ATOM 7798  H H    . ASP A 1 135 ? -5.220  4.043   18.108  1.00 0.00 ? 135 ASP A H    3  
ATOM 7799  H HA   . ASP A 1 135 ? -2.947  5.141   19.363  1.00 0.00 ? 135 ASP A HA   3  
ATOM 7800  H HB2  . ASP A 1 135 ? -4.327  3.678   20.637  1.00 0.00 ? 135 ASP A HB2  3  
ATOM 7801  H HB3  . ASP A 1 135 ? -4.195  2.393   19.441  1.00 0.00 ? 135 ASP A HB3  3  
ATOM 7802  N N    . TRP A 1 136 ? -2.394  2.900   17.044  1.00 0.00 ? 136 TRP A N    3  
ATOM 7803  C CA   . TRP A 1 136 ? -1.381  2.306   16.186  1.00 0.00 ? 136 TRP A CA   3  
ATOM 7804  C C    . TRP A 1 136 ? -0.552  3.388   15.503  1.00 0.00 ? 136 TRP A C    3  
ATOM 7805  O O    . TRP A 1 136 ? 0.671   3.431   15.648  1.00 0.00 ? 136 TRP A O    3  
ATOM 7806  C CB   . TRP A 1 136 ? -2.033  1.406   15.135  1.00 0.00 ? 136 TRP A CB   3  
ATOM 7807  C CG   . TRP A 1 136 ? -2.682  0.188   15.713  1.00 0.00 ? 136 TRP A CG   3  
ATOM 7808  C CD1  . TRP A 1 136 ? -3.960  0.085   16.184  1.00 0.00 ? 136 TRP A CD1  3  
ATOM 7809  C CD2  . TRP A 1 136 ? -2.087  -1.102  15.880  1.00 0.00 ? 136 TRP A CD2  3  
ATOM 7810  N NE1  . TRP A 1 136 ? -4.194  -1.192  16.631  1.00 0.00 ? 136 TRP A NE1  3  
ATOM 7811  C CE2  . TRP A 1 136 ? -3.058  -1.939  16.456  1.00 0.00 ? 136 TRP A CE2  3  
ATOM 7812  C CE3  . TRP A 1 136 ? -0.824  -1.629  15.599  1.00 0.00 ? 136 TRP A CE3  3  
ATOM 7813  C CZ2  . TRP A 1 136 ? -2.807  -3.275  16.754  1.00 0.00 ? 136 TRP A CZ2  3  
ATOM 7814  C CZ3  . TRP A 1 136 ? -0.576  -2.955  15.894  1.00 0.00 ? 136 TRP A CZ3  3  
ATOM 7815  C CH2  . TRP A 1 136 ? -1.562  -3.765  16.468  1.00 0.00 ? 136 TRP A CH2  3  
ATOM 7816  H H    . TRP A 1 136 ? -3.338  2.720   16.862  1.00 0.00 ? 136 TRP A H    3  
ATOM 7817  H HA   . TRP A 1 136 ? -0.728  1.710   16.805  1.00 0.00 ? 136 TRP A HA   3  
ATOM 7818  H HB2  . TRP A 1 136 ? -2.791  1.969   14.612  1.00 0.00 ? 136 TRP A HB2  3  
ATOM 7819  H HB3  . TRP A 1 136 ? -1.279  1.081   14.432  1.00 0.00 ? 136 TRP A HB3  3  
ATOM 7820  H HD1  . TRP A 1 136 ? -4.674  0.897   16.196  1.00 0.00 ? 136 TRP A HD1  3  
ATOM 7821  H HE1  . TRP A 1 136 ? -5.047  -1.523  17.014  1.00 0.00 ? 136 TRP A HE1  3  
ATOM 7822  H HE3  . TRP A 1 136 ? -0.051  -1.020  15.155  1.00 0.00 ? 136 TRP A HE3  3  
ATOM 7823  H HZ2  . TRP A 1 136 ? -3.558  -3.914  17.196  1.00 0.00 ? 136 TRP A HZ2  3  
ATOM 7824  H HZ3  . TRP A 1 136 ? 0.395   -3.380  15.684  1.00 0.00 ? 136 TRP A HZ3  3  
ATOM 7825  H HH2  . TRP A 1 136 ? -1.324  -4.794  16.683  1.00 0.00 ? 136 TRP A HH2  3  
ATOM 7826  N N    . ILE A 1 137 ? -1.228  4.275   14.784  1.00 0.00 ? 137 ILE A N    3  
ATOM 7827  C CA   . ILE A 1 137 ? -0.562  5.360   14.076  1.00 0.00 ? 137 ILE A CA   3  
ATOM 7828  C C    . ILE A 1 137 ? 0.205   6.259   15.047  1.00 0.00 ? 137 ILE A C    3  
ATOM 7829  O O    . ILE A 1 137 ? 1.294   6.732   14.736  1.00 0.00 ? 137 ILE A O    3  
ATOM 7830  C CB   . ILE A 1 137 ? -1.575  6.200   13.262  1.00 0.00 ? 137 ILE A CB   3  
ATOM 7831  C CG1  . ILE A 1 137 ? -2.250  5.331   12.195  1.00 0.00 ? 137 ILE A CG1  3  
ATOM 7832  C CG2  . ILE A 1 137 ? -0.902  7.404   12.616  1.00 0.00 ? 137 ILE A CG2  3  
ATOM 7833  C CD1  . ILE A 1 137 ? -1.283  4.700   11.214  1.00 0.00 ? 137 ILE A CD1  3  
ATOM 7834  H H    . ILE A 1 137 ? -2.209  4.199   14.725  1.00 0.00 ? 137 ILE A H    3  
ATOM 7835  H HA   . ILE A 1 137 ? 0.141   4.919   13.384  1.00 0.00 ? 137 ILE A HA   3  
ATOM 7836  H HB   . ILE A 1 137 ? -2.328  6.566   13.944  1.00 0.00 ? 137 ILE A HB   3  
ATOM 7837  H HG12 . ILE A 1 137 ? -2.791  4.533   12.683  1.00 0.00 ? 137 ILE A HG12 3  
ATOM 7838  H HG13 . ILE A 1 137 ? -2.946  5.938   11.635  1.00 0.00 ? 137 ILE A HG13 3  
ATOM 7839  H HG21 . ILE A 1 137 ? -0.084  7.068   11.996  1.00 0.00 ? 137 ILE A HG21 3  
ATOM 7840  H HG22 . ILE A 1 137 ? -0.524  8.062   13.387  1.00 0.00 ? 137 ILE A HG22 3  
ATOM 7841  H HG23 . ILE A 1 137 ? -1.619  7.935   12.009  1.00 0.00 ? 137 ILE A HG23 3  
ATOM 7842  H HD11 . ILE A 1 137 ? -0.734  5.475   10.701  1.00 0.00 ? 137 ILE A HD11 3  
ATOM 7843  H HD12 . ILE A 1 137 ? -1.832  4.111   10.494  1.00 0.00 ? 137 ILE A HD12 3  
ATOM 7844  H HD13 . ILE A 1 137 ? -0.592  4.064   11.748  1.00 0.00 ? 137 ILE A HD13 3  
ATOM 7845  N N    . HIS A 1 138 ? -0.354  6.458   16.235  1.00 0.00 ? 138 HIS A N    3  
ATOM 7846  C CA   . HIS A 1 138 ? 0.276   7.302   17.244  1.00 0.00 ? 138 HIS A CA   3  
ATOM 7847  C C    . HIS A 1 138 ? 1.617   6.730   17.700  1.00 0.00 ? 138 HIS A C    3  
ATOM 7848  O O    . HIS A 1 138 ? 2.619   7.445   17.746  1.00 0.00 ? 138 HIS A O    3  
ATOM 7849  C CB   . HIS A 1 138 ? -0.650  7.477   18.448  1.00 0.00 ? 138 HIS A CB   3  
ATOM 7850  C CG   . HIS A 1 138 ? -0.554  8.831   19.076  1.00 0.00 ? 138 HIS A CG   3  
ATOM 7851  N ND1  . HIS A 1 138 ? 0.154   9.086   20.233  1.00 0.00 ? 138 HIS A ND1  3  
ATOM 7852  C CD2  . HIS A 1 138 ? -1.082  10.017  18.694  1.00 0.00 ? 138 HIS A CD2  3  
ATOM 7853  C CE1  . HIS A 1 138 ? 0.055   10.367  20.532  1.00 0.00 ? 138 HIS A CE1  3  
ATOM 7854  N NE2  . HIS A 1 138 ? -0.689  10.951  19.615  1.00 0.00 ? 138 HIS A NE2  3  
ATOM 7855  H H    . HIS A 1 138 ? -1.218  6.033   16.435  1.00 0.00 ? 138 HIS A H    3  
ATOM 7856  H HA   . HIS A 1 138 ? 0.450   8.271   16.799  1.00 0.00 ? 138 HIS A HA   3  
ATOM 7857  H HB2  . HIS A 1 138 ? -1.672  7.329   18.133  1.00 0.00 ? 138 HIS A HB2  3  
ATOM 7858  H HB3  . HIS A 1 138 ? -0.398  6.742   19.199  1.00 0.00 ? 138 HIS A HB3  3  
ATOM 7859  H HD1  . HIS A 1 138 ? 0.658   8.422   20.763  1.00 0.00 ? 138 HIS A HD1  3  
ATOM 7860  H HD2  . HIS A 1 138 ? -1.698  10.192  17.824  1.00 0.00 ? 138 HIS A HD2  3  
ATOM 7861  H HE1  . HIS A 1 138 ? 0.515   10.857  21.380  1.00 0.00 ? 138 HIS A HE1  3  
ATOM 7862  H HE2  . HIS A 1 138 ? -0.914  11.911  19.589  1.00 0.00 ? 138 HIS A HE2  3  
ATOM 7863  N N    . SER A 1 139 ? 1.643   5.443   18.022  1.00 0.00 ? 139 SER A N    3  
ATOM 7864  C CA   . SER A 1 139 ? 2.869   4.798   18.479  1.00 0.00 ? 139 SER A CA   3  
ATOM 7865  C C    . SER A 1 139 ? 3.882   4.644   17.343  1.00 0.00 ? 139 SER A C    3  
ATOM 7866  O O    . SER A 1 139 ? 5.090   4.704   17.569  1.00 0.00 ? 139 SER A O    3  
ATOM 7867  C CB   . SER A 1 139 ? 2.546   3.433   19.083  1.00 0.00 ? 139 SER A CB   3  
ATOM 7868  O OG   . SER A 1 139 ? 1.496   3.532   20.035  1.00 0.00 ? 139 SER A OG   3  
ATOM 7869  H H    . SER A 1 139 ? 0.815   4.914   17.959  1.00 0.00 ? 139 SER A H    3  
ATOM 7870  H HA   . SER A 1 139 ? 3.301   5.423   19.245  1.00 0.00 ? 139 SER A HA   3  
ATOM 7871  H HB2  . SER A 1 139 ? 2.240   2.759   18.298  1.00 0.00 ? 139 SER A HB2  3  
ATOM 7872  H HB3  . SER A 1 139 ? 3.425   3.042   19.573  1.00 0.00 ? 139 SER A HB3  3  
ATOM 7873  H HG   . SER A 1 139 ? 0.929   2.747   19.963  1.00 0.00 ? 139 SER A HG   3  
ATOM 7874  N N    . SER A 1 140 ? 3.390   4.456   16.125  1.00 0.00 ? 140 SER A N    3  
ATOM 7875  C CA   . SER A 1 140 ? 4.262   4.301   14.966  1.00 0.00 ? 140 SER A CA   3  
ATOM 7876  C C    . SER A 1 140 ? 4.712   5.662   14.430  1.00 0.00 ? 140 SER A C    3  
ATOM 7877  O O    . SER A 1 140 ? 5.550   5.740   13.525  1.00 0.00 ? 140 SER A O    3  
ATOM 7878  C CB   . SER A 1 140 ? 3.535   3.513   13.876  1.00 0.00 ? 140 SER A CB   3  
ATOM 7879  O OG   . SER A 1 140 ? 3.042   2.284   14.387  1.00 0.00 ? 140 SER A OG   3  
ATOM 7880  H H    . SER A 1 140 ? 2.418   4.407   16.000  1.00 0.00 ? 140 SER A H    3  
ATOM 7881  H HA   . SER A 1 140 ? 5.131   3.745   15.279  1.00 0.00 ? 140 SER A HA   3  
ATOM 7882  H HB2  . SER A 1 140 ? 2.704   4.096   13.506  1.00 0.00 ? 140 SER A HB2  3  
ATOM 7883  H HB3  . SER A 1 140 ? 4.218   3.304   13.066  1.00 0.00 ? 140 SER A HB3  3  
ATOM 7884  H HG   . SER A 1 140 ? 3.711   1.888   14.970  1.00 0.00 ? 140 SER A HG   3  
ATOM 7885  N N    . GLY A 1 141 ? 4.150   6.728   14.997  1.00 0.00 ? 141 GLY A N    3  
ATOM 7886  C CA   . GLY A 1 141 ? 4.489   8.074   14.576  1.00 0.00 ? 141 GLY A CA   3  
ATOM 7887  C C    . GLY A 1 141 ? 4.042   8.353   13.161  1.00 0.00 ? 141 GLY A C    3  
ATOM 7888  O O    . GLY A 1 141 ? 4.764   8.979   12.383  1.00 0.00 ? 141 GLY A O    3  
ATOM 7889  H H    . GLY A 1 141 ? 3.492   6.596   15.712  1.00 0.00 ? 141 GLY A H    3  
ATOM 7890  H HA2  . GLY A 1 141 ? 4.013   8.781   15.239  1.00 0.00 ? 141 GLY A HA2  3  
ATOM 7891  H HA3  . GLY A 1 141 ? 5.561   8.203   14.638  1.00 0.00 ? 141 GLY A HA3  3  
ATOM 7892  N N    . GLY A 1 142 ? 2.851   7.890   12.826  1.00 0.00 ? 142 GLY A N    3  
ATOM 7893  C CA   . GLY A 1 142 ? 2.332   8.078   11.492  1.00 0.00 ? 142 GLY A CA   3  
ATOM 7894  C C    . GLY A 1 142 ? 3.032   7.178   10.502  1.00 0.00 ? 142 GLY A C    3  
ATOM 7895  O O    . GLY A 1 142 ? 2.773   5.978   10.453  1.00 0.00 ? 142 GLY A O    3  
ATOM 7896  H H    . GLY A 1 142 ? 2.317   7.406   13.497  1.00 0.00 ? 142 GLY A H    3  
ATOM 7897  H HA2  . GLY A 1 142 ? 1.275   7.856   11.489  1.00 0.00 ? 142 GLY A HA2  3  
ATOM 7898  H HA3  . GLY A 1 142 ? 2.480   9.106   11.199  1.00 0.00 ? 142 GLY A HA3  3  
ATOM 7899  N N    . TRP A 1 143 ? 3.938   7.752   9.728   1.00 0.00 ? 143 TRP A N    3  
ATOM 7900  C CA   . TRP A 1 143 ? 4.696   6.992   8.748   1.00 0.00 ? 143 TRP A CA   3  
ATOM 7901  C C    . TRP A 1 143 ? 6.182   7.058   9.083   1.00 0.00 ? 143 TRP A C    3  
ATOM 7902  O O    . TRP A 1 143 ? 7.031   6.726   8.260   1.00 0.00 ? 143 TRP A O    3  
ATOM 7903  C CB   . TRP A 1 143 ? 4.448   7.533   7.333   1.00 0.00 ? 143 TRP A CB   3  
ATOM 7904  C CG   . TRP A 1 143 ? 2.996   7.632   6.969   1.00 0.00 ? 143 TRP A CG   3  
ATOM 7905  C CD1  . TRP A 1 143 ? 2.199   8.738   7.071   1.00 0.00 ? 143 TRP A CD1  3  
ATOM 7906  C CD2  . TRP A 1 143 ? 2.168   6.588   6.440   1.00 0.00 ? 143 TRP A CD2  3  
ATOM 7907  N NE1  . TRP A 1 143 ? 0.928   8.445   6.637   1.00 0.00 ? 143 TRP A NE1  3  
ATOM 7908  C CE2  . TRP A 1 143 ? 0.883   7.132   6.249   1.00 0.00 ? 143 TRP A CE2  3  
ATOM 7909  C CE3  . TRP A 1 143 ? 2.384   5.243   6.114   1.00 0.00 ? 143 TRP A CE3  3  
ATOM 7910  C CZ2  . TRP A 1 143 ? -0.175  6.383   5.739   1.00 0.00 ? 143 TRP A CZ2  3  
ATOM 7911  C CZ3  . TRP A 1 143 ? 1.332   4.501   5.609   1.00 0.00 ? 143 TRP A CZ3  3  
ATOM 7912  C CH2  . TRP A 1 143 ? 0.065   5.072   5.429   1.00 0.00 ? 143 TRP A CH2  3  
ATOM 7913  H H    . TRP A 1 143 ? 4.100   8.719   9.813   1.00 0.00 ? 143 TRP A H    3  
ATOM 7914  H HA   . TRP A 1 143 ? 4.370   5.963   8.798   1.00 0.00 ? 143 TRP A HA   3  
ATOM 7915  H HB2  . TRP A 1 143 ? 4.879   8.520   7.253   1.00 0.00 ? 143 TRP A HB2  3  
ATOM 7916  H HB3  . TRP A 1 143 ? 4.925   6.879   6.620   1.00 0.00 ? 143 TRP A HB3  3  
ATOM 7917  H HD1  . TRP A 1 143 ? 2.533   9.697   7.439   1.00 0.00 ? 143 TRP A HD1  3  
ATOM 7918  H HE1  . TRP A 1 143 ? 0.176   9.075   6.613   1.00 0.00 ? 143 TRP A HE1  3  
ATOM 7919  H HE3  . TRP A 1 143 ? 3.354   4.786   6.247   1.00 0.00 ? 143 TRP A HE3  3  
ATOM 7920  H HZ2  . TRP A 1 143 ? -1.158  6.807   5.595   1.00 0.00 ? 143 TRP A HZ2  3  
ATOM 7921  H HZ3  . TRP A 1 143 ? 1.481   3.462   5.353   1.00 0.00 ? 143 TRP A HZ3  3  
ATOM 7922  H HH2  . TRP A 1 143 ? -0.729  4.456   5.034   1.00 0.00 ? 143 TRP A HH2  3  
ATOM 7923  N N    . ALA A 1 144 ? 6.480   7.469   10.315  1.00 0.00 ? 144 ALA A N    3  
ATOM 7924  C CA   . ALA A 1 144 ? 7.858   7.603   10.786  1.00 0.00 ? 144 ALA A CA   3  
ATOM 7925  C C    . ALA A 1 144 ? 8.642   6.304   10.631  1.00 0.00 ? 144 ALA A C    3  
ATOM 7926  O O    . ALA A 1 144 ? 9.735   6.297   10.059  1.00 0.00 ? 144 ALA A O    3  
ATOM 7927  C CB   . ALA A 1 144 ? 7.875   8.054   12.236  1.00 0.00 ? 144 ALA A CB   3  
ATOM 7928  H H    . ALA A 1 144 ? 5.746   7.694   10.927  1.00 0.00 ? 144 ALA A H    3  
ATOM 7929  H HA   . ALA A 1 144 ? 8.336   8.370   10.193  1.00 0.00 ? 144 ALA A HA   3  
ATOM 7930  H HB1  . ALA A 1 144 ? 8.898   8.141   12.573  1.00 0.00 ? 144 ALA A HB1  3  
ATOM 7931  H HB2  . ALA A 1 144 ? 7.356   7.329   12.845  1.00 0.00 ? 144 ALA A HB2  3  
ATOM 7932  H HB3  . ALA A 1 144 ? 7.386   9.014   12.322  1.00 0.00 ? 144 ALA A HB3  3  
ATOM 7933  N N    . GLU A 1 145 ? 8.093   5.207   11.141  1.00 0.00 ? 145 GLU A N    3  
ATOM 7934  C CA   . GLU A 1 145 ? 8.770   3.921   11.043  1.00 0.00 ? 145 GLU A CA   3  
ATOM 7935  C C    . GLU A 1 145 ? 8.498   3.266   9.693   1.00 0.00 ? 145 GLU A C    3  
ATOM 7936  O O    . GLU A 1 145 ? 9.215   2.353   9.288   1.00 0.00 ? 145 GLU A O    3  
ATOM 7937  C CB   . GLU A 1 145 ? 8.352   2.989   12.185  1.00 0.00 ? 145 GLU A CB   3  
ATOM 7938  C CG   . GLU A 1 145 ? 6.938   2.442   12.071  1.00 0.00 ? 145 GLU A CG   3  
ATOM 7939  C CD   . GLU A 1 145 ? 6.663   1.350   13.086  1.00 0.00 ? 145 GLU A CD   3  
ATOM 7940  O OE1  . GLU A 1 145 ? 6.295   1.676   14.232  1.00 0.00 ? 145 GLU A OE1  3  
ATOM 7941  O OE2  . GLU A 1 145 ? 6.838   0.159   12.752  1.00 0.00 ? 145 GLU A OE2  3  
ATOM 7942  H H    . GLU A 1 145 ? 7.228   5.267   11.602  1.00 0.00 ? 145 GLU A H    3  
ATOM 7943  H HA   . GLU A 1 145 ? 9.831   4.109   11.122  1.00 0.00 ? 145 GLU A HA   3  
ATOM 7944  H HB2  . GLU A 1 145 ? 9.032   2.150   12.209  1.00 0.00 ? 145 GLU A HB2  3  
ATOM 7945  H HB3  . GLU A 1 145 ? 8.431   3.527   13.118  1.00 0.00 ? 145 GLU A HB3  3  
ATOM 7946  H HG2  . GLU A 1 145 ? 6.238   3.250   12.228  1.00 0.00 ? 145 GLU A HG2  3  
ATOM 7947  H HG3  . GLU A 1 145 ? 6.803   2.036   11.079  1.00 0.00 ? 145 GLU A HG3  3  
ATOM 7948  N N    . PHE A 1 146 ? 7.482   3.755   8.987   1.00 0.00 ? 146 PHE A N    3  
ATOM 7949  C CA   . PHE A 1 146 ? 7.121   3.208   7.681   1.00 0.00 ? 146 PHE A CA   3  
ATOM 7950  C C    . PHE A 1 146 ? 8.271   3.374   6.697   1.00 0.00 ? 146 PHE A C    3  
ATOM 7951  O O    . PHE A 1 146 ? 8.608   2.447   5.959   1.00 0.00 ? 146 PHE A O    3  
ATOM 7952  C CB   . PHE A 1 146 ? 5.859   3.885   7.136   1.00 0.00 ? 146 PHE A CB   3  
ATOM 7953  C CG   . PHE A 1 146 ? 5.446   3.392   5.775   1.00 0.00 ? 146 PHE A CG   3  
ATOM 7954  C CD1  . PHE A 1 146 ? 4.856   2.148   5.624   1.00 0.00 ? 146 PHE A CD1  3  
ATOM 7955  C CD2  . PHE A 1 146 ? 5.647   4.174   4.649   1.00 0.00 ? 146 PHE A CD2  3  
ATOM 7956  C CE1  . PHE A 1 146 ? 4.478   1.692   4.374   1.00 0.00 ? 146 PHE A CE1  3  
ATOM 7957  C CE2  . PHE A 1 146 ? 5.273   3.723   3.398   1.00 0.00 ? 146 PHE A CE2  3  
ATOM 7958  C CZ   . PHE A 1 146 ? 4.684   2.482   3.261   1.00 0.00 ? 146 PHE A CZ   3  
ATOM 7959  H H    . PHE A 1 146 ? 6.972   4.508   9.346   1.00 0.00 ? 146 PHE A H    3  
ATOM 7960  H HA   . PHE A 1 146 ? 6.926   2.153   7.812   1.00 0.00 ? 146 PHE A HA   3  
ATOM 7961  H HB2  . PHE A 1 146 ? 5.041   3.707   7.817   1.00 0.00 ? 146 PHE A HB2  3  
ATOM 7962  H HB3  . PHE A 1 146 ? 6.036   4.949   7.064   1.00 0.00 ? 146 PHE A HB3  3  
ATOM 7963  H HD1  . PHE A 1 146 ? 4.692   1.530   6.494   1.00 0.00 ? 146 PHE A HD1  3  
ATOM 7964  H HD2  . PHE A 1 146 ? 6.107   5.145   4.754   1.00 0.00 ? 146 PHE A HD2  3  
ATOM 7965  H HE1  . PHE A 1 146 ? 4.018   0.720   4.269   1.00 0.00 ? 146 PHE A HE1  3  
ATOM 7966  H HE2  . PHE A 1 146 ? 5.435   4.343   2.529   1.00 0.00 ? 146 PHE A HE2  3  
ATOM 7967  H HZ   . PHE A 1 146 ? 4.390   2.128   2.284   1.00 0.00 ? 146 PHE A HZ   3  
ATOM 7968  N N    . THR A 1 147 ? 8.880   4.551   6.703   1.00 0.00 ? 147 THR A N    3  
ATOM 7969  C CA   . THR A 1 147 ? 10.005  4.840   5.825   1.00 0.00 ? 147 THR A CA   3  
ATOM 7970  C C    . THR A 1 147 ? 11.175  3.899   6.115   1.00 0.00 ? 147 THR A C    3  
ATOM 7971  O O    . THR A 1 147 ? 12.008  3.633   5.248   1.00 0.00 ? 147 THR A O    3  
ATOM 7972  C CB   . THR A 1 147 ? 10.472  6.295   6.001   1.00 0.00 ? 147 THR A CB   3  
ATOM 7973  O OG1  . THR A 1 147 ? 9.392   7.088   6.507   1.00 0.00 ? 147 THR A OG1  3  
ATOM 7974  C CG2  . THR A 1 147 ? 10.959  6.880   4.686   1.00 0.00 ? 147 THR A CG2  3  
ATOM 7975  H H    . THR A 1 147 ? 8.553   5.260   7.304   1.00 0.00 ? 147 THR A H    3  
ATOM 7976  H HA   . THR A 1 147 ? 9.681   4.703   4.804   1.00 0.00 ? 147 THR A HA   3  
ATOM 7977  H HB   . THR A 1 147 ? 11.286  6.313   6.710   1.00 0.00 ? 147 THR A HB   3  
ATOM 7978  H HG1  . THR A 1 147 ? 9.736   7.721   7.152   1.00 0.00 ? 147 THR A HG1  3  
ATOM 7979  H HG21 . THR A 1 147 ? 11.795  6.301   4.320   1.00 0.00 ? 147 THR A HG21 3  
ATOM 7980  H HG22 . THR A 1 147 ? 11.270  7.902   4.842   1.00 0.00 ? 147 THR A HG22 3  
ATOM 7981  H HG23 . THR A 1 147 ? 10.158  6.854   3.962   1.00 0.00 ? 147 THR A HG23 3  
ATOM 7982  N N    . ALA A 1 148 ? 11.216  3.382   7.336   1.00 0.00 ? 148 ALA A N    3  
ATOM 7983  C CA   . ALA A 1 148 ? 12.278  2.477   7.747   1.00 0.00 ? 148 ALA A CA   3  
ATOM 7984  C C    . ALA A 1 148 ? 11.931  1.026   7.419   1.00 0.00 ? 148 ALA A C    3  
ATOM 7985  O O    . ALA A 1 148 ? 12.818  0.178   7.317   1.00 0.00 ? 148 ALA A O    3  
ATOM 7986  C CB   . ALA A 1 148 ? 12.552  2.632   9.235   1.00 0.00 ? 148 ALA A CB   3  
ATOM 7987  H H    . ALA A 1 148 ? 10.510  3.612   7.976   1.00 0.00 ? 148 ALA A H    3  
ATOM 7988  H HA   . ALA A 1 148 ? 13.176  2.753   7.212   1.00 0.00 ? 148 ALA A HA   3  
ATOM 7989  H HB1  . ALA A 1 148 ? 12.815  3.659   9.451   1.00 0.00 ? 148 ALA A HB1  3  
ATOM 7990  H HB2  . ALA A 1 148 ? 13.370  1.986   9.520   1.00 0.00 ? 148 ALA A HB2  3  
ATOM 7991  H HB3  . ALA A 1 148 ? 11.668  2.362   9.794   1.00 0.00 ? 148 ALA A HB3  3  
ATOM 7992  N N    . LEU A 1 149 ? 10.643  0.747   7.240   1.00 0.00 ? 149 LEU A N    3  
ATOM 7993  C CA   . LEU A 1 149 ? 10.185  -0.608  6.931   1.00 0.00 ? 149 LEU A CA   3  
ATOM 7994  C C    . LEU A 1 149 ? 10.776  -1.093  5.617   1.00 0.00 ? 149 LEU A C    3  
ATOM 7995  O O    . LEU A 1 149 ? 11.350  -2.178  5.547   1.00 0.00 ? 149 LEU A O    3  
ATOM 7996  C CB   . LEU A 1 149 ? 8.656   -0.675  6.863   1.00 0.00 ? 149 LEU A CB   3  
ATOM 7997  C CG   . LEU A 1 149 ? 7.913   -0.183  8.109   1.00 0.00 ? 149 LEU A CG   3  
ATOM 7998  C CD1  . LEU A 1 149 ? 6.434   -0.510  8.006   1.00 0.00 ? 149 LEU A CD1  3  
ATOM 7999  C CD2  . LEU A 1 149 ? 8.506   -0.790  9.371   1.00 0.00 ? 149 LEU A CD2  3  
ATOM 8000  H H    . LEU A 1 149 ? 9.983   1.469   7.319   1.00 0.00 ? 149 LEU A H    3  
ATOM 8001  H HA   . LEU A 1 149 ? 10.527  -1.258  7.723   1.00 0.00 ? 149 LEU A HA   3  
ATOM 8002  H HB2  . LEU A 1 149 ? 8.331   -0.080  6.021   1.00 0.00 ? 149 LEU A HB2  3  
ATOM 8003  H HB3  . LEU A 1 149 ? 8.371   -1.701  6.686   1.00 0.00 ? 149 LEU A HB3  3  
ATOM 8004  H HG   . LEU A 1 149 ? 8.012   0.892   8.175   1.00 0.00 ? 149 LEU A HG   3  
ATOM 8005  H HD11 . LEU A 1 149 ? 6.310   -1.572  7.853   1.00 0.00 ? 149 LEU A HD11 3  
ATOM 8006  H HD12 . LEU A 1 149 ? 6.003   0.027   7.173   1.00 0.00 ? 149 LEU A HD12 3  
ATOM 8007  H HD13 . LEU A 1 149 ? 5.936   -0.217  8.917   1.00 0.00 ? 149 LEU A HD13 3  
ATOM 8008  H HD21 . LEU A 1 149 ? 7.922   -0.483  10.226  1.00 0.00 ? 149 LEU A HD21 3  
ATOM 8009  H HD22 . LEU A 1 149 ? 9.525   -0.452  9.491   1.00 0.00 ? 149 LEU A HD22 3  
ATOM 8010  H HD23 . LEU A 1 149 ? 8.492   -1.866  9.294   1.00 0.00 ? 149 LEU A HD23 3  
ATOM 8011  N N    . TYR A 1 150 ? 10.651  -0.280  4.578   1.00 0.00 ? 150 TYR A N    3  
ATOM 8012  C CA   . TYR A 1 150 ? 11.182  -0.645  3.274   1.00 0.00 ? 150 TYR A CA   3  
ATOM 8013  C C    . TYR A 1 150 ? 12.615  -0.148  3.119   1.00 0.00 ? 150 TYR A C    3  
ATOM 8014  O O    . TYR A 1 150 ? 13.193  -0.207  2.033   1.00 0.00 ? 150 TYR A O    3  
ATOM 8015  C CB   . TYR A 1 150 ? 10.290  -0.108  2.146   1.00 0.00 ? 150 TYR A CB   3  
ATOM 8016  C CG   . TYR A 1 150 ? 10.164  1.406   2.088   1.00 0.00 ? 150 TYR A CG   3  
ATOM 8017  C CD1  . TYR A 1 150 ? 11.055  2.170   1.340   1.00 0.00 ? 150 TYR A CD1  3  
ATOM 8018  C CD2  . TYR A 1 150 ? 9.142   2.068   2.763   1.00 0.00 ? 150 TYR A CD2  3  
ATOM 8019  C CE1  . TYR A 1 150 ? 10.936  3.547   1.271   1.00 0.00 ? 150 TYR A CE1  3  
ATOM 8020  C CE2  . TYR A 1 150 ? 9.016   3.444   2.695   1.00 0.00 ? 150 TYR A CE2  3  
ATOM 8021  C CZ   . TYR A 1 150 ? 9.914   4.179   1.949   1.00 0.00 ? 150 TYR A CZ   3  
ATOM 8022  O OH   . TYR A 1 150 ? 9.788   5.548   1.884   1.00 0.00 ? 150 TYR A OH   3  
ATOM 8023  H H    . TYR A 1 150 ? 10.190  0.579   4.691   1.00 0.00 ? 150 TYR A H    3  
ATOM 8024  H HA   . TYR A 1 150 ? 11.192  -1.724  3.223   1.00 0.00 ? 150 TYR A HA   3  
ATOM 8025  H HB2  . TYR A 1 150 ? 10.692  -0.440  1.201   1.00 0.00 ? 150 TYR A HB2  3  
ATOM 8026  H HB3  . TYR A 1 150 ? 9.296   -0.518  2.266   1.00 0.00 ? 150 TYR A HB3  3  
ATOM 8027  H HD1  . TYR A 1 150 ? 11.854  1.673   0.809   1.00 0.00 ? 150 TYR A HD1  3  
ATOM 8028  H HD2  . TYR A 1 150 ? 8.442   1.493   3.350   1.00 0.00 ? 150 TYR A HD2  3  
ATOM 8029  H HE1  . TYR A 1 150 ? 11.640  4.120   0.686   1.00 0.00 ? 150 TYR A HE1  3  
ATOM 8030  H HE2  . TYR A 1 150 ? 8.216   3.940   3.227   1.00 0.00 ? 150 TYR A HE2  3  
ATOM 8031  H HH   . TYR A 1 150 ? 10.109  5.863   1.035   1.00 0.00 ? 150 TYR A HH   3  
ATOM 8032  N N    . GLY A 1 151 ? 13.182  0.337   4.219   1.00 0.00 ? 151 GLY A N    3  
ATOM 8033  C CA   . GLY A 1 151 ? 14.547  0.830   4.209   1.00 0.00 ? 151 GLY A CA   3  
ATOM 8034  C C    . GLY A 1 151 ? 15.548  -0.303  4.319   1.00 0.00 ? 151 GLY A C    3  
ATOM 8035  O O    . GLY A 1 151 ? 16.756  -0.110  4.151   1.00 0.00 ? 151 GLY A O    3  
ATOM 8036  H H    . GLY A 1 151 ? 12.666  0.355   5.053   1.00 0.00 ? 151 GLY A H    3  
ATOM 8037  H HA2  . GLY A 1 151 ? 14.722  1.369   3.289   1.00 0.00 ? 151 GLY A HA2  3  
ATOM 8038  H HA3  . GLY A 1 151 ? 14.686  1.501   5.043   1.00 0.00 ? 151 GLY A HA3  3  
ATOM 8039  N N    . ASP A 1 152 ? 15.041  -1.489  4.622   1.00 0.00 ? 152 ASP A N    3  
ATOM 8040  C CA   . ASP A 1 152 ? 15.867  -2.680  4.746   1.00 0.00 ? 152 ASP A CA   3  
ATOM 8041  C C    . ASP A 1 152 ? 15.177  -3.841  4.048   1.00 0.00 ? 152 ASP A C    3  
ATOM 8042  O O    . ASP A 1 152 ? 13.968  -3.802  3.833   1.00 0.00 ? 152 ASP A O    3  
ATOM 8043  C CB   . ASP A 1 152 ? 16.125  -3.026  6.217   1.00 0.00 ? 152 ASP A CB   3  
ATOM 8044  C CG   . ASP A 1 152 ? 17.144  -4.137  6.371   1.00 0.00 ? 152 ASP A CG   3  
ATOM 8045  O OD1  . ASP A 1 152 ? 18.337  -3.900  6.084   1.00 0.00 ? 152 ASP A OD1  3  
ATOM 8046  O OD2  . ASP A 1 152 ? 16.756  -5.260  6.755   1.00 0.00 ? 152 ASP A OD2  3  
ATOM 8047  H H    . ASP A 1 152 ? 14.072  -1.569  4.757   1.00 0.00 ? 152 ASP A H    3  
ATOM 8048  H HA   . ASP A 1 152 ? 16.811  -2.485  4.254   1.00 0.00 ? 152 ASP A HA   3  
ATOM 8049  H HB2  . ASP A 1 152 ? 16.495  -2.149  6.727   1.00 0.00 ? 152 ASP A HB2  3  
ATOM 8050  H HB3  . ASP A 1 152 ? 15.200  -3.342  6.674   1.00 0.00 ? 152 ASP A HB3  3  
ATOM 8051  N N    . GLY A 1 153 ? 15.940  -4.861  3.691   1.00 0.00 ? 153 GLY A N    3  
ATOM 8052  C CA   . GLY A 1 153 ? 15.370  -6.003  3.015   1.00 0.00 ? 153 GLY A CA   3  
ATOM 8053  C C    . GLY A 1 153 ? 15.414  -5.834  1.516   1.00 0.00 ? 153 GLY A C    3  
ATOM 8054  O O    . GLY A 1 153 ? 14.516  -5.238  0.921   1.00 0.00 ? 153 GLY A O    3  
ATOM 8055  H H    . GLY A 1 153 ? 16.900  -4.838  3.886   1.00 0.00 ? 153 GLY A H    3  
ATOM 8056  H HA2  . GLY A 1 153 ? 15.925  -6.888  3.288   1.00 0.00 ? 153 GLY A HA2  3  
ATOM 8057  H HA3  . GLY A 1 153 ? 14.342  -6.121  3.325   1.00 0.00 ? 153 GLY A HA3  3  
ATOM 8058  N N    . ALA A 1 154 ? 16.461  -6.354  0.901   1.00 0.00 ? 154 ALA A N    3  
ATOM 8059  C CA   . ALA A 1 154 ? 16.624  -6.248  -0.537  1.00 0.00 ? 154 ALA A CA   3  
ATOM 8060  C C    . ALA A 1 154 ? 17.167  -7.540  -1.126  1.00 0.00 ? 154 ALA A C    3  
ATOM 8061  O O    . ALA A 1 154 ? 17.712  -7.544  -2.226  1.00 0.00 ? 154 ALA A O    3  
ATOM 8062  C CB   . ALA A 1 154 ? 17.545  -5.082  -0.877  1.00 0.00 ? 154 ALA A CB   3  
ATOM 8063  H H    . ALA A 1 154 ? 17.141  -6.831  1.431   1.00 0.00 ? 154 ALA A H    3  
ATOM 8064  H HA   . ALA A 1 154 ? 15.654  -6.046  -0.968  1.00 0.00 ? 154 ALA A HA   3  
ATOM 8065  H HB1  . ALA A 1 154 ? 17.661  -5.019  -1.948  1.00 0.00 ? 154 ALA A HB1  3  
ATOM 8066  H HB2  . ALA A 1 154 ? 18.509  -5.239  -0.417  1.00 0.00 ? 154 ALA A HB2  3  
ATOM 8067  H HB3  . ALA A 1 154 ? 17.115  -4.163  -0.504  1.00 0.00 ? 154 ALA A HB3  3  
ATOM 8068  N N    . LEU A 1 155 ? 17.009  -8.640  -0.397  1.00 0.00 ? 155 LEU A N    3  
ATOM 8069  C CA   . LEU A 1 155 ? 17.500  -9.931  -0.861  1.00 0.00 ? 155 LEU A CA   3  
ATOM 8070  C C    . LEU A 1 155 ? 16.787  -11.077 -0.154  1.00 0.00 ? 155 LEU A C    3  
ATOM 8071  O O    . LEU A 1 155 ? 16.797  -11.163 1.074   1.00 0.00 ? 155 LEU A O    3  
ATOM 8072  C CB   . LEU A 1 155 ? 19.012  -10.036 -0.618  1.00 0.00 ? 155 LEU A CB   3  
ATOM 8073  C CG   . LEU A 1 155 ? 19.762  -11.023 -1.520  1.00 0.00 ? 155 LEU A CG   3  
ATOM 8074  C CD1  . LEU A 1 155 ? 21.230  -10.646 -1.603  1.00 0.00 ? 155 LEU A CD1  3  
ATOM 8075  C CD2  . LEU A 1 155 ? 19.621  -12.446 -1.004  1.00 0.00 ? 155 LEU A CD2  3  
ATOM 8076  H H    . LEU A 1 155 ? 16.553  -8.583  0.472   1.00 0.00 ? 155 LEU A H    3  
ATOM 8077  H HA   . LEU A 1 155 ? 17.310  -10.000 -1.922  1.00 0.00 ? 155 LEU A HA   3  
ATOM 8078  H HB2  . LEU A 1 155 ? 19.444  -9.056  -0.756  1.00 0.00 ? 155 LEU A HB2  3  
ATOM 8079  H HB3  . LEU A 1 155 ? 19.167  -10.334 0.410   1.00 0.00 ? 155 LEU A HB3  3  
ATOM 8080  H HG   . LEU A 1 155 ? 19.347  -10.981 -2.516  1.00 0.00 ? 155 LEU A HG   3  
ATOM 8081  H HD11 . LEU A 1 155 ? 21.737  -11.324 -2.274  1.00 0.00 ? 155 LEU A HD11 3  
ATOM 8082  H HD12 . LEU A 1 155 ? 21.675  -10.710 -0.620  1.00 0.00 ? 155 LEU A HD12 3  
ATOM 8083  H HD13 . LEU A 1 155 ? 21.322  -9.635  -1.975  1.00 0.00 ? 155 LEU A HD13 3  
ATOM 8084  H HD21 . LEU A 1 155 ? 20.089  -13.130 -1.697  1.00 0.00 ? 155 LEU A HD21 3  
ATOM 8085  H HD22 . LEU A 1 155 ? 18.574  -12.691 -0.909  1.00 0.00 ? 155 LEU A HD22 3  
ATOM 8086  H HD23 . LEU A 1 155 ? 20.099  -12.528 -0.038  1.00 0.00 ? 155 LEU A HD23 3  
ATOM 8087  N N    . GLU A 1 156 ? 16.150  -11.938 -0.933  1.00 0.00 ? 156 GLU A N    3  
ATOM 8088  C CA   . GLU A 1 156 ? 15.463  -13.098 -0.392  1.00 0.00 ? 156 GLU A CA   3  
ATOM 8089  C C    . GLU A 1 156 ? 15.988  -14.364 -1.060  1.00 0.00 ? 156 GLU A C    3  
ATOM 8090  O O    . GLU A 1 156 ? 15.858  -14.537 -2.270  1.00 0.00 ? 156 GLU A O    3  
ATOM 8091  C CB   . GLU A 1 156 ? 13.951  -12.993 -0.585  1.00 0.00 ? 156 GLU A CB   3  
ATOM 8092  C CG   . GLU A 1 156 ? 13.185  -14.075 0.158   1.00 0.00 ? 156 GLU A CG   3  
ATOM 8093  C CD   . GLU A 1 156 ? 11.702  -14.051 -0.127  1.00 0.00 ? 156 GLU A CD   3  
ATOM 8094  O OE1  . GLU A 1 156 ? 11.277  -14.632 -1.142  1.00 0.00 ? 156 GLU A OE1  3  
ATOM 8095  O OE2  . GLU A 1 156 ? 10.947  -13.451 0.664   1.00 0.00 ? 156 GLU A OE2  3  
ATOM 8096  H H    . GLU A 1 156 ? 16.134  -11.782 -1.911  1.00 0.00 ? 156 GLU A H    3  
ATOM 8097  H HA   . GLU A 1 156 ? 15.682  -13.146 0.664   1.00 0.00 ? 156 GLU A HA   3  
ATOM 8098  H HB2  . GLU A 1 156 ? 13.616  -12.030 -0.227  1.00 0.00 ? 156 GLU A HB2  3  
ATOM 8099  H HB3  . GLU A 1 156 ? 13.725  -13.077 -1.638  1.00 0.00 ? 156 GLU A HB3  3  
ATOM 8100  H HG2  . GLU A 1 156 ? 13.574  -15.038 -0.137  1.00 0.00 ? 156 GLU A HG2  3  
ATOM 8101  H HG3  . GLU A 1 156 ? 13.337  -13.938 1.220   1.00 0.00 ? 156 GLU A HG3  3  
ATOM 8102  N N    . GLU A 1 157 ? 16.576  -15.244 -0.264  1.00 0.00 ? 157 GLU A N    3  
ATOM 8103  C CA   . GLU A 1 157 ? 17.140  -16.493 -0.767  1.00 0.00 ? 157 GLU A CA   3  
ATOM 8104  C C    . GLU A 1 157 ? 16.079  -17.360 -1.445  1.00 0.00 ? 157 GLU A C    3  
ATOM 8105  O O    . GLU A 1 157 ? 16.347  -18.001 -2.462  1.00 0.00 ? 157 GLU A O    3  
ATOM 8106  C CB   . GLU A 1 157 ? 17.788  -17.260 0.382   1.00 0.00 ? 157 GLU A CB   3  
ATOM 8107  C CG   . GLU A 1 157 ? 19.257  -16.931 0.578   1.00 0.00 ? 157 GLU A CG   3  
ATOM 8108  C CD   . GLU A 1 157 ? 20.136  -17.613 -0.446  1.00 0.00 ? 157 GLU A CD   3  
ATOM 8109  O OE1  . GLU A 1 157 ? 20.385  -18.830 -0.297  1.00 0.00 ? 157 GLU A OE1  3  
ATOM 8110  O OE2  . GLU A 1 157 ? 20.582  -16.942 -1.401  1.00 0.00 ? 157 GLU A OE2  3  
ATOM 8111  H H    . GLU A 1 157 ? 16.629  -15.055 0.698   1.00 0.00 ? 157 GLU A H    3  
ATOM 8112  H HA   . GLU A 1 157 ? 17.900  -16.245 -1.494  1.00 0.00 ? 157 GLU A HA   3  
ATOM 8113  H HB2  . GLU A 1 157 ? 17.264  -17.025 1.297   1.00 0.00 ? 157 GLU A HB2  3  
ATOM 8114  H HB3  . GLU A 1 157 ? 17.701  -18.319 0.190   1.00 0.00 ? 157 GLU A HB3  3  
ATOM 8115  H HG2  . GLU A 1 157 ? 19.391  -15.863 0.492   1.00 0.00 ? 157 GLU A HG2  3  
ATOM 8116  H HG3  . GLU A 1 157 ? 19.557  -17.257 1.562   1.00 0.00 ? 157 GLU A HG3  3  
ATOM 8117  N N    . ALA A 1 158 ? 14.870  -17.348 -0.897  1.00 0.00 ? 158 ALA A N    3  
ATOM 8118  C CA   . ALA A 1 158 ? 13.763  -18.136 -1.436  1.00 0.00 ? 158 ALA A CA   3  
ATOM 8119  C C    . ALA A 1 158 ? 13.158  -17.496 -2.687  1.00 0.00 ? 158 ALA A C    3  
ATOM 8120  O O    . ALA A 1 158 ? 12.021  -17.800 -3.059  1.00 0.00 ? 158 ALA A O    3  
ATOM 8121  C CB   . ALA A 1 158 ? 12.694  -18.326 -0.370  1.00 0.00 ? 158 ALA A CB   3  
ATOM 8122  H H    . ALA A 1 158 ? 14.719  -16.801 -0.090  1.00 0.00 ? 158 ALA A H    3  
ATOM 8123  H HA   . ALA A 1 158 ? 14.151  -19.110 -1.696  1.00 0.00 ? 158 ALA A HA   3  
ATOM 8124  H HB1  . ALA A 1 158 ? 13.118  -18.834 0.483   1.00 0.00 ? 158 ALA A HB1  3  
ATOM 8125  H HB2  . ALA A 1 158 ? 11.884  -18.915 -0.774  1.00 0.00 ? 158 ALA A HB2  3  
ATOM 8126  H HB3  . ALA A 1 158 ? 12.318  -17.362 -0.063  1.00 0.00 ? 158 ALA A HB3  3  
ATOM 8127  N N    . ARG A 1 159 ? 13.913  -16.616 -3.335  1.00 0.00 ? 159 ARG A N    3  
ATOM 8128  C CA   . ARG A 1 159 ? 13.440  -15.949 -4.542  1.00 0.00 ? 159 ARG A CA   3  
ATOM 8129  C C    . ARG A 1 159 ? 14.593  -15.626 -5.488  1.00 0.00 ? 159 ARG A C    3  
ATOM 8130  O O    . ARG A 1 159 ? 14.427  -15.654 -6.705  1.00 0.00 ? 159 ARG A O    3  
ATOM 8131  C CB   . ARG A 1 159 ? 12.687  -14.669 -4.191  1.00 0.00 ? 159 ARG A CB   3  
ATOM 8132  C CG   . ARG A 1 159 ? 11.262  -14.655 -4.709  1.00 0.00 ? 159 ARG A CG   3  
ATOM 8133  C CD   . ARG A 1 159 ? 10.610  -13.305 -4.493  1.00 0.00 ? 159 ARG A CD   3  
ATOM 8134  N NE   . ARG A 1 159 ? 10.619  -12.910 -3.088  1.00 0.00 ? 159 ARG A NE   3  
ATOM 8135  C CZ   . ARG A 1 159 ? 10.386  -11.673 -2.659  1.00 0.00 ? 159 ARG A CZ   3  
ATOM 8136  N NH1  . ARG A 1 159 ? 10.138  -10.697 -3.523  1.00 0.00 ? 159 ARG A NH1  3  
ATOM 8137  N NH2  . ARG A 1 159 ? 10.402  -11.415 -1.359  1.00 0.00 ? 159 ARG A NH2  3  
ATOM 8138  H H    . ARG A 1 159 ? 14.806  -16.409 -2.992  1.00 0.00 ? 159 ARG A H    3  
ATOM 8139  H HA   . ARG A 1 159 ? 12.763  -16.621 -5.043  1.00 0.00 ? 159 ARG A HA   3  
ATOM 8140  H HB2  . ARG A 1 159 ? 12.658  -14.562 -3.116  1.00 0.00 ? 159 ARG A HB2  3  
ATOM 8141  H HB3  . ARG A 1 159 ? 13.211  -13.825 -4.616  1.00 0.00 ? 159 ARG A HB3  3  
ATOM 8142  H HG2  . ARG A 1 159 ? 11.271  -14.874 -5.767  1.00 0.00 ? 159 ARG A HG2  3  
ATOM 8143  H HG3  . ARG A 1 159 ? 10.692  -15.411 -4.187  1.00 0.00 ? 159 ARG A HG3  3  
ATOM 8144  H HD2  . ARG A 1 159 ? 11.147  -12.564 -5.068  1.00 0.00 ? 159 ARG A HD2  3  
ATOM 8145  H HD3  . ARG A 1 159 ? 9.588   -13.354 -4.837  1.00 0.00 ? 159 ARG A HD3  3  
ATOM 8146  H HE   . ARG A 1 159 ? 10.814  -13.616 -2.420  1.00 0.00 ? 159 ARG A HE   3  
ATOM 8147  H HH11 . ARG A 1 159 ? 10.125  -10.887 -4.515  1.00 0.00 ? 159 ARG A HH11 3  
ATOM 8148  H HH12 . ARG A 1 159 ? 9.968   -9.761  -3.195  1.00 0.00 ? 159 ARG A HH12 3  
ATOM 8149  H HH21 . ARG A 1 159 ? 10.588  -12.152 -0.701  1.00 0.00 ? 159 ARG A HH21 3  
ATOM 8150  H HH22 . ARG A 1 159 ? 10.222  -10.483 -1.022  1.00 0.00 ? 159 ARG A HH22 3  
ATOM 8151  N N    . ARG A 1 160 ? 15.755  -15.311 -4.922  1.00 0.00 ? 160 ARG A N    3  
ATOM 8152  C CA   . ARG A 1 160 ? 16.933  -14.979 -5.718  1.00 0.00 ? 160 ARG A CA   3  
ATOM 8153  C C    . ARG A 1 160 ? 17.317  -16.115 -6.662  1.00 0.00 ? 160 ARG A C    3  
ATOM 8154  O O    . ARG A 1 160 ? 17.252  -15.966 -7.884  1.00 0.00 ? 160 ARG A O    3  
ATOM 8155  C CB   . ARG A 1 160 ? 18.115  -14.641 -4.809  1.00 0.00 ? 160 ARG A CB   3  
ATOM 8156  C CG   . ARG A 1 160 ? 18.048  -13.247 -4.208  1.00 0.00 ? 160 ARG A CG   3  
ATOM 8157  C CD   . ARG A 1 160 ? 17.967  -12.178 -5.285  1.00 0.00 ? 160 ARG A CD   3  
ATOM 8158  N NE   . ARG A 1 160 ? 19.180  -12.115 -6.099  1.00 0.00 ? 160 ARG A NE   3  
ATOM 8159  C CZ   . ARG A 1 160 ? 19.172  -12.014 -7.426  1.00 0.00 ? 160 ARG A CZ   3  
ATOM 8160  N NH1  . ARG A 1 160 ? 18.019  -11.949 -8.081  1.00 0.00 ? 160 ARG A NH1  3  
ATOM 8161  N NH2  . ARG A 1 160 ? 20.313  -11.964 -8.099  1.00 0.00 ? 160 ARG A NH2  3  
ATOM 8162  H H    . ARG A 1 160 ? 15.815  -15.273 -3.942  1.00 0.00 ? 160 ARG A H    3  
ATOM 8163  H HA   . ARG A 1 160 ? 16.691  -14.109 -6.308  1.00 0.00 ? 160 ARG A HA   3  
ATOM 8164  H HB2  . ARG A 1 160 ? 18.149  -15.358 -4.000  1.00 0.00 ? 160 ARG A HB2  3  
ATOM 8165  H HB3  . ARG A 1 160 ? 19.026  -14.720 -5.383  1.00 0.00 ? 160 ARG A HB3  3  
ATOM 8166  H HG2  . ARG A 1 160 ? 17.173  -13.179 -3.581  1.00 0.00 ? 160 ARG A HG2  3  
ATOM 8167  H HG3  . ARG A 1 160 ? 18.934  -13.080 -3.613  1.00 0.00 ? 160 ARG A HG3  3  
ATOM 8168  H HD2  . ARG A 1 160 ? 17.127  -12.396 -5.928  1.00 0.00 ? 160 ARG A HD2  3  
ATOM 8169  H HD3  . ARG A 1 160 ? 17.815  -11.219 -4.811  1.00 0.00 ? 160 ARG A HD3  3  
ATOM 8170  H HE   . ARG A 1 160 ? 20.044  -12.147 -5.628  1.00 0.00 ? 160 ARG A HE   3  
ATOM 8171  H HH11 . ARG A 1 160 ? 17.152  -11.968 -7.580  1.00 0.00 ? 160 ARG A HH11 3  
ATOM 8172  H HH12 . ARG A 1 160 ? 18.011  -11.894 -9.087  1.00 0.00 ? 160 ARG A HH12 3  
ATOM 8173  H HH21 . ARG A 1 160 ? 21.196  -12.005 -7.612  1.00 0.00 ? 160 ARG A HH21 3  
ATOM 8174  H HH22 . ARG A 1 160 ? 20.303  -11.874 -9.099  1.00 0.00 ? 160 ARG A HH22 3  
ATOM 8175  N N    . LEU A 1 161 ? 17.725  -17.243 -6.101  1.00 0.00 ? 161 LEU A N    3  
ATOM 8176  C CA   . LEU A 1 161 ? 18.123  -18.385 -6.914  1.00 0.00 ? 161 LEU A CA   3  
ATOM 8177  C C    . LEU A 1 161 ? 16.989  -19.395 -7.034  1.00 0.00 ? 161 LEU A C    3  
ATOM 8178  O O    . LEU A 1 161 ? 17.050  -20.321 -7.841  1.00 0.00 ? 161 LEU A O    3  
ATOM 8179  C CB   . LEU A 1 161 ? 19.367  -19.055 -6.327  1.00 0.00 ? 161 LEU A CB   3  
ATOM 8180  C CG   . LEU A 1 161 ? 20.658  -18.244 -6.437  1.00 0.00 ? 161 LEU A CG   3  
ATOM 8181  C CD1  . LEU A 1 161 ? 21.801  -18.965 -5.742  1.00 0.00 ? 161 LEU A CD1  3  
ATOM 8182  C CD2  . LEU A 1 161 ? 21.003  -17.985 -7.895  1.00 0.00 ? 161 LEU A CD2  3  
ATOM 8183  H H    . LEU A 1 161 ? 17.768  -17.309 -5.123  1.00 0.00 ? 161 LEU A H    3  
ATOM 8184  H HA   . LEU A 1 161 ? 18.359  -18.016 -7.900  1.00 0.00 ? 161 LEU A HA   3  
ATOM 8185  H HB2  . LEU A 1 161 ? 19.182  -19.259 -5.282  1.00 0.00 ? 161 LEU A HB2  3  
ATOM 8186  H HB3  . LEU A 1 161 ? 19.515  -19.995 -6.837  1.00 0.00 ? 161 LEU A HB3  3  
ATOM 8187  H HG   . LEU A 1 161 ? 20.520  -17.288 -5.951  1.00 0.00 ? 161 LEU A HG   3  
ATOM 8188  H HD11 . LEU A 1 161 ? 21.563  -19.091 -4.696  1.00 0.00 ? 161 LEU A HD11 3  
ATOM 8189  H HD12 . LEU A 1 161 ? 22.705  -18.381 -5.838  1.00 0.00 ? 161 LEU A HD12 3  
ATOM 8190  H HD13 . LEU A 1 161 ? 21.948  -19.933 -6.197  1.00 0.00 ? 161 LEU A HD13 3  
ATOM 8191  H HD21 . LEU A 1 161 ? 20.198  -17.436 -8.362  1.00 0.00 ? 161 LEU A HD21 3  
ATOM 8192  H HD22 . LEU A 1 161 ? 21.138  -18.928 -8.405  1.00 0.00 ? 161 LEU A HD22 3  
ATOM 8193  H HD23 . LEU A 1 161 ? 21.915  -17.408 -7.952  1.00 0.00 ? 161 LEU A HD23 3  
ATOM 8194  N N    . ARG A 1 162 ? 15.956  -19.216 -6.228  1.00 0.00 ? 162 ARG A N    3  
ATOM 8195  C CA   . ARG A 1 162 ? 14.810  -20.110 -6.256  1.00 0.00 ? 162 ARG A CA   3  
ATOM 8196  C C    . ARG A 1 162 ? 13.580  -19.367 -6.760  1.00 0.00 ? 162 ARG A C    3  
ATOM 8197  O O    . ARG A 1 162 ? 12.897  -18.692 -5.994  1.00 0.00 ? 162 ARG A O    3  
ATOM 8198  C CB   . ARG A 1 162 ? 14.538  -20.700 -4.867  1.00 0.00 ? 162 ARG A CB   3  
ATOM 8199  C CG   . ARG A 1 162 ? 15.251  -22.019 -4.609  1.00 0.00 ? 162 ARG A CG   3  
ATOM 8200  C CD   . ARG A 1 162 ? 16.723  -21.812 -4.296  1.00 0.00 ? 162 ARG A CD   3  
ATOM 8201  N NE   . ARG A 1 162 ? 16.929  -21.215 -2.977  1.00 0.00 ? 162 ARG A NE   3  
ATOM 8202  C CZ   . ARG A 1 162 ? 18.112  -20.800 -2.524  1.00 0.00 ? 162 ARG A CZ   3  
ATOM 8203  N NH1  . ARG A 1 162 ? 19.198  -20.933 -3.277  1.00 0.00 ? 162 ARG A NH1  3  
ATOM 8204  N NH2  . ARG A 1 162 ? 18.209  -20.272 -1.309  1.00 0.00 ? 162 ARG A NH2  3  
ATOM 8205  H H    . ARG A 1 162 ? 15.957  -18.459 -5.609  1.00 0.00 ? 162 ARG A H    3  
ATOM 8206  H HA   . ARG A 1 162 ? 15.035  -20.912 -6.942  1.00 0.00 ? 162 ARG A HA   3  
ATOM 8207  H HB2  . ARG A 1 162 ? 14.861  -19.991 -4.119  1.00 0.00 ? 162 ARG A HB2  3  
ATOM 8208  H HB3  . ARG A 1 162 ? 13.477  -20.864 -4.761  1.00 0.00 ? 162 ARG A HB3  3  
ATOM 8209  H HG2  . ARG A 1 162 ? 14.783  -22.512 -3.770  1.00 0.00 ? 162 ARG A HG2  3  
ATOM 8210  H HG3  . ARG A 1 162 ? 15.165  -22.642 -5.488  1.00 0.00 ? 162 ARG A HG3  3  
ATOM 8211  H HD2  . ARG A 1 162 ? 17.224  -22.768 -4.328  1.00 0.00 ? 162 ARG A HD2  3  
ATOM 8212  H HD3  . ARG A 1 162 ? 17.147  -21.160 -5.045  1.00 0.00 ? 162 ARG A HD3  3  
ATOM 8213  H HE   . ARG A 1 162 ? 16.133  -21.123 -2.391  1.00 0.00 ? 162 ARG A HE   3  
ATOM 8214  H HH11 . ARG A 1 162 ? 19.137  -21.348 -4.194  1.00 0.00 ? 162 ARG A HH11 3  
ATOM 8215  H HH12 . ARG A 1 162 ? 20.094  -20.629 -2.931  1.00 0.00 ? 162 ARG A HH12 3  
ATOM 8216  H HH21 . ARG A 1 162 ? 17.392  -20.190 -0.727  1.00 0.00 ? 162 ARG A HH21 3  
ATOM 8217  H HH22 . ARG A 1 162 ? 19.098  -19.943 -0.967  1.00 0.00 ? 162 ARG A HH22 3  
ATOM 8218  N N    . GLU A 1 163 ? 13.315  -19.479 -8.050  1.00 0.00 ? 163 GLU A N    3  
ATOM 8219  C CA   . GLU A 1 163 ? 12.164  -18.817 -8.642  1.00 0.00 ? 163 GLU A CA   3  
ATOM 8220  C C    . GLU A 1 163 ? 11.036  -19.814 -8.850  1.00 0.00 ? 163 GLU A C    3  
ATOM 8221  O O    . GLU A 1 163 ? 10.036  -19.801 -8.128  1.00 0.00 ? 163 GLU A O    3  
ATOM 8222  C CB   . GLU A 1 163 ? 12.537  -18.164 -9.975  1.00 0.00 ? 163 GLU A CB   3  
ATOM 8223  C CG   . GLU A 1 163 ? 11.365  -17.480 -10.662 1.00 0.00 ? 163 GLU A CG   3  
ATOM 8224  C CD   . GLU A 1 163 ? 11.179  -17.935 -12.095 1.00 0.00 ? 163 GLU A CD   3  
ATOM 8225  O OE1  . GLU A 1 163 ? 10.998  -19.149 -12.324 1.00 0.00 ? 163 GLU A OE1  3  
ATOM 8226  O OE2  . GLU A 1 163 ? 11.211  -17.074 -13.000 1.00 0.00 ? 163 GLU A OE2  3  
ATOM 8227  H H    . GLU A 1 163 ? 13.897  -20.031 -8.615  1.00 0.00 ? 163 GLU A H    3  
ATOM 8228  H HA   . GLU A 1 163 ? 11.833  -18.054 -7.956  1.00 0.00 ? 163 GLU A HA   3  
ATOM 8229  H HB2  . GLU A 1 163 ? 13.306  -17.427 -9.800  1.00 0.00 ? 163 GLU A HB2  3  
ATOM 8230  H HB3  . GLU A 1 163 ? 12.923  -18.925 -10.639 1.00 0.00 ? 163 GLU A HB3  3  
ATOM 8231  H HG2  . GLU A 1 163 ? 10.462  -17.701 -10.111 1.00 0.00 ? 163 GLU A HG2  3  
ATOM 8232  H HG3  . GLU A 1 163 ? 11.535  -16.413 -10.657 1.00 0.00 ? 163 GLU A HG3  3  
ATOM 8233  N N    . GLY A 1 164 ? 11.207  -20.682 -9.832  1.00 0.00 ? 164 GLY A N    3  
ATOM 8234  C CA   . GLY A 1 164 ? 10.203  -21.674 -10.122 1.00 0.00 ? 164 GLY A CA   3  
ATOM 8235  C C    . GLY A 1 164 ? 10.567  -22.526 -11.317 1.00 0.00 ? 164 GLY A C    3  
ATOM 8236  O O    . GLY A 1 164 ? 10.631  -23.750 -11.205 1.00 0.00 ? 164 GLY A O    3  
ATOM 8237  H H    . GLY A 1 164 ? 12.025  -20.645 -10.371 1.00 0.00 ? 164 GLY A H    3  
ATOM 8238  H HA2  . GLY A 1 164 ? 10.085  -22.314 -9.260  1.00 0.00 ? 164 GLY A HA2  3  
ATOM 8239  H HA3  . GLY A 1 164 ? 9.265   -21.176 -10.321 1.00 0.00 ? 164 GLY A HA3  3  
ATOM 8240  N N    . ASN A 1 165 ? 10.841  -21.886 -12.452 1.00 0.00 ? 165 ASN A N    3  
ATOM 8241  C CA   . ASN A 1 165 ? 11.181  -22.623 -13.669 1.00 0.00 ? 165 ASN A CA   3  
ATOM 8242  C C    . ASN A 1 165 ? 11.614  -21.695 -14.802 1.00 0.00 ? 165 ASN A C    3  
ATOM 8243  O O    . ASN A 1 165 ? 12.423  -22.078 -15.646 1.00 0.00 ? 165 ASN A O    3  
ATOM 8244  C CB   . ASN A 1 165 ? 9.976   -23.462 -14.128 1.00 0.00 ? 165 ASN A CB   3  
ATOM 8245  C CG   . ASN A 1 165 ? 10.181  -24.105 -15.490 1.00 0.00 ? 165 ASN A CG   3  
ATOM 8246  O OD1  . ASN A 1 165 ? 9.795   -23.550 -16.519 1.00 0.00 ? 165 ASN A OD1  3  
ATOM 8247  N ND2  . ASN A 1 165 ? 10.775  -25.285 -15.506 1.00 0.00 ? 165 ASN A ND2  3  
ATOM 8248  H H    . ASN A 1 165 ? 10.827  -20.897 -12.469 1.00 0.00 ? 165 ASN A H    3  
ATOM 8249  H HA   . ASN A 1 165 ? 11.997  -23.289 -13.436 1.00 0.00 ? 165 ASN A HA   3  
ATOM 8250  H HB2  . ASN A 1 165 ? 9.798   -24.246 -13.407 1.00 0.00 ? 165 ASN A HB2  3  
ATOM 8251  H HB3  . ASN A 1 165 ? 9.106   -22.825 -14.181 1.00 0.00 ? 165 ASN A HB3  3  
ATOM 8252  H HD21 . ASN A 1 165 ? 11.045  -25.683 -14.646 1.00 0.00 ? 165 ASN A HD21 3  
ATOM 8253  H HD22 . ASN A 1 165 ? 10.928  -25.716 -16.378 1.00 0.00 ? 165 ASN A HD22 3  
ATOM 8254  N N    . TRP A 1 166 ? 11.098  -20.475 -14.810 1.00 0.00 ? 166 TRP A N    3  
ATOM 8255  C CA   . TRP A 1 166 ? 11.408  -19.526 -15.875 1.00 0.00 ? 166 TRP A CA   3  
ATOM 8256  C C    . TRP A 1 166 ? 12.808  -18.941 -15.732 1.00 0.00 ? 166 TRP A C    3  
ATOM 8257  O O    . TRP A 1 166 ? 13.717  -19.282 -16.490 1.00 0.00 ? 166 TRP A O    3  
ATOM 8258  C CB   . TRP A 1 166 ? 10.372  -18.401 -15.900 1.00 0.00 ? 166 TRP A CB   3  
ATOM 8259  C CG   . TRP A 1 166 ? 8.961   -18.895 -15.847 1.00 0.00 ? 166 TRP A CG   3  
ATOM 8260  C CD1  . TRP A 1 166 ? 8.008   -18.557 -14.931 1.00 0.00 ? 166 TRP A CD1  3  
ATOM 8261  C CD2  . TRP A 1 166 ? 8.345   -19.833 -16.741 1.00 0.00 ? 166 TRP A CD2  3  
ATOM 8262  N NE1  . TRP A 1 166 ? 6.836   -19.217 -15.206 1.00 0.00 ? 166 TRP A NE1  3  
ATOM 8263  C CE2  . TRP A 1 166 ? 7.018   -20.010 -16.308 1.00 0.00 ? 166 TRP A CE2  3  
ATOM 8264  C CE3  . TRP A 1 166 ? 8.786   -20.540 -17.865 1.00 0.00 ? 166 TRP A CE3  3  
ATOM 8265  C CZ2  . TRP A 1 166 ? 6.128   -20.862 -16.959 1.00 0.00 ? 166 TRP A CZ2  3  
ATOM 8266  C CZ3  . TRP A 1 166 ? 7.902   -21.386 -18.510 1.00 0.00 ? 166 TRP A CZ3  3  
ATOM 8267  C CH2  . TRP A 1 166 ? 6.588   -21.542 -18.055 1.00 0.00 ? 166 TRP A CH2  3  
ATOM 8268  H H    . TRP A 1 166 ? 10.514  -20.192 -14.073 1.00 0.00 ? 166 TRP A H    3  
ATOM 8269  H HA   . TRP A 1 166 ? 11.356  -20.061 -16.810 1.00 0.00 ? 166 TRP A HA   3  
ATOM 8270  H HB2  . TRP A 1 166 ? 10.533  -17.752 -15.052 1.00 0.00 ? 166 TRP A HB2  3  
ATOM 8271  H HB3  . TRP A 1 166 ? 10.494  -17.832 -16.811 1.00 0.00 ? 166 TRP A HB3  3  
ATOM 8272  H HD1  . TRP A 1 166 ? 8.163   -17.863 -14.119 1.00 0.00 ? 166 TRP A HD1  3  
ATOM 8273  H HE1  . TRP A 1 166 ? 5.999   -19.137 -14.689 1.00 0.00 ? 166 TRP A HE1  3  
ATOM 8274  H HE3  . TRP A 1 166 ? 9.796   -20.433 -18.232 1.00 0.00 ? 166 TRP A HE3  3  
ATOM 8275  H HZ2  . TRP A 1 166 ? 5.111   -20.991 -16.621 1.00 0.00 ? 166 TRP A HZ2  3  
ATOM 8276  H HZ3  . TRP A 1 166 ? 8.227   -21.941 -19.378 1.00 0.00 ? 166 TRP A HZ3  3  
ATOM 8277  H HH2  . TRP A 1 166 ? 5.934   -22.214 -18.589 1.00 0.00 ? 166 TRP A HH2  3  
ATOM 8278  N N    . ALA A 1 167 ? 12.980  -18.061 -14.762 1.00 0.00 ? 167 ALA A N    3  
ATOM 8279  C CA   . ALA A 1 167 ? 14.262  -17.422 -14.535 1.00 0.00 ? 167 ALA A CA   3  
ATOM 8280  C C    . ALA A 1 167 ? 14.771  -17.716 -13.133 1.00 0.00 ? 167 ALA A C    3  
ATOM 8281  O O    . ALA A 1 167 ? 14.487  -16.979 -12.188 1.00 0.00 ? 167 ALA A O    3  
ATOM 8282  C CB   . ALA A 1 167 ? 14.150  -15.922 -14.762 1.00 0.00 ? 167 ALA A CB   3  
ATOM 8283  H H    . ALA A 1 167 ? 12.219  -17.842 -14.168 1.00 0.00 ? 167 ALA A H    3  
ATOM 8284  H HA   . ALA A 1 167 ? 14.964  -17.820 -15.255 1.00 0.00 ? 167 ALA A HA   3  
ATOM 8285  H HB1  . ALA A 1 167 ? 13.443  -15.504 -14.060 1.00 0.00 ? 167 ALA A HB1  3  
ATOM 8286  H HB2  . ALA A 1 167 ? 13.809  -15.733 -15.768 1.00 0.00 ? 167 ALA A HB2  3  
ATOM 8287  H HB3  . ALA A 1 167 ? 15.115  -15.463 -14.614 1.00 0.00 ? 167 ALA A HB3  3  
ATOM 8288  N N    . SER A 1 168 ? 15.523  -18.795 -13.005 1.00 0.00 ? 168 SER A N    3  
ATOM 8289  C CA   . SER A 1 168 ? 16.078  -19.191 -11.721 1.00 0.00 ? 168 SER A CA   3  
ATOM 8290  C C    . SER A 1 168 ? 17.355  -18.412 -11.432 1.00 0.00 ? 168 SER A C    3  
ATOM 8291  O O    . SER A 1 168 ? 17.866  -18.419 -10.314 1.00 0.00 ? 168 SER A O    3  
ATOM 8292  C CB   . SER A 1 168 ? 16.355  -20.690 -11.722 1.00 0.00 ? 168 SER A CB   3  
ATOM 8293  O OG   . SER A 1 168 ? 15.208  -21.409 -12.147 1.00 0.00 ? 168 SER A OG   3  
ATOM 8294  H H    . SER A 1 168 ? 15.714  -19.344 -13.801 1.00 0.00 ? 168 SER A H    3  
ATOM 8295  H HA   . SER A 1 168 ? 15.349  -18.966 -10.956 1.00 0.00 ? 168 SER A HA   3  
ATOM 8296  H HB2  . SER A 1 168 ? 17.172  -20.905 -12.396 1.00 0.00 ? 168 SER A HB2  3  
ATOM 8297  H HB3  . SER A 1 168 ? 16.615  -21.006 -10.723 1.00 0.00 ? 168 SER A HB3  3  
ATOM 8298  H HG   . SER A 1 168 ? 14.675  -21.639 -11.371 1.00 0.00 ? 168 SER A HG   3  
ATOM 8299  N N    . VAL A 1 169 ? 17.859  -17.741 -12.456 1.00 0.00 ? 169 VAL A N    3  
ATOM 8300  C CA   . VAL A 1 169 ? 19.066  -16.941 -12.334 1.00 0.00 ? 169 VAL A CA   3  
ATOM 8301  C C    . VAL A 1 169 ? 18.750  -15.470 -12.582 1.00 0.00 ? 169 VAL A C    3  
ATOM 8302  O O    . VAL A 1 169 ? 19.504  -14.758 -13.244 1.00 0.00 ? 169 VAL A O    3  
ATOM 8303  C CB   . VAL A 1 169 ? 20.168  -17.411 -13.312 1.00 0.00 ? 169 VAL A CB   3  
ATOM 8304  C CG1  . VAL A 1 169 ? 20.784  -18.717 -12.837 1.00 0.00 ? 169 VAL A CG1  3  
ATOM 8305  C CG2  . VAL A 1 169 ? 19.616  -17.567 -14.722 1.00 0.00 ? 169 VAL A CG2  3  
ATOM 8306  H H    . VAL A 1 169 ? 17.401  -17.782 -13.321 1.00 0.00 ? 169 VAL A H    3  
ATOM 8307  H HA   . VAL A 1 169 ? 19.438  -17.051 -11.326 1.00 0.00 ? 169 VAL A HA   3  
ATOM 8308  H HB   . VAL A 1 169 ? 20.945  -16.660 -13.333 1.00 0.00 ? 169 VAL A HB   3  
ATOM 8309  H HG11 . VAL A 1 169 ? 20.026  -19.486 -12.813 1.00 0.00 ? 169 VAL A HG11 3  
ATOM 8310  H HG12 . VAL A 1 169 ? 21.191  -18.584 -11.847 1.00 0.00 ? 169 VAL A HG12 3  
ATOM 8311  H HG13 . VAL A 1 169 ? 21.573  -19.010 -13.512 1.00 0.00 ? 169 VAL A HG13 3  
ATOM 8312  H HG21 . VAL A 1 169 ? 19.209  -16.622 -15.053 1.00 0.00 ? 169 VAL A HG21 3  
ATOM 8313  H HG22 . VAL A 1 169 ? 18.838  -18.316 -14.722 1.00 0.00 ? 169 VAL A HG22 3  
ATOM 8314  H HG23 . VAL A 1 169 ? 20.410  -17.870 -15.388 1.00 0.00 ? 169 VAL A HG23 3  
ATOM 8315  N N    . ARG A 1 170 ? 17.621  -15.025 -12.044 1.00 0.00 ? 170 ARG A N    3  
ATOM 8316  C CA   . ARG A 1 170 ? 17.188  -13.641 -12.198 1.00 0.00 ? 170 ARG A CA   3  
ATOM 8317  C C    . ARG A 1 170 ? 17.864  -12.748 -11.164 1.00 0.00 ? 170 ARG A C    3  
ATOM 8318  O O    . ARG A 1 170 ? 18.807  -13.220 -10.499 1.00 0.00 ? 170 ARG A O    3  
ATOM 8319  C CB   . ARG A 1 170 ? 15.667  -13.537 -12.066 1.00 0.00 ? 170 ARG A CB   3  
ATOM 8320  C CG   . ARG A 1 170 ? 15.122  -14.073 -10.750 1.00 0.00 ? 170 ARG A CG   3  
ATOM 8321  C CD   . ARG A 1 170 ? 13.639  -13.773 -10.598 1.00 0.00 ? 170 ARG A CD   3  
ATOM 8322  N NE   . ARG A 1 170 ? 12.834  -14.418 -11.636 1.00 0.00 ? 170 ARG A NE   3  
ATOM 8323  C CZ   . ARG A 1 170 ? 12.036  -13.763 -12.483 1.00 0.00 ? 170 ARG A CZ   3  
ATOM 8324  N NH1  . ARG A 1 170 ? 11.933  -12.440 -12.429 1.00 0.00 ? 170 ARG A NH1  3  
ATOM 8325  N NH2  . ARG A 1 170 ? 11.336  -14.435 -13.381 1.00 0.00 ? 170 ARG A NH2  3  
ATOM 8326  H H    . ARG A 1 170 ? 17.069  -15.642 -11.523 1.00 0.00 ? 170 ARG A H    3  
ATOM 8327  H HA   . ARG A 1 170 ? 17.479  -13.311 -13.184 1.00 0.00 ? 170 ARG A HA   3  
ATOM 8328  H HB2  . ARG A 1 170 ? 15.382  -12.498 -12.148 1.00 0.00 ? 170 ARG A HB2  3  
ATOM 8329  H HB3  . ARG A 1 170 ? 15.207  -14.091 -12.872 1.00 0.00 ? 170 ARG A HB3  3  
ATOM 8330  H HG2  . ARG A 1 170 ? 15.269  -15.144 -10.719 1.00 0.00 ? 170 ARG A HG2  3  
ATOM 8331  H HG3  . ARG A 1 170 ? 15.659  -13.609 -9.936  1.00 0.00 ? 170 ARG A HG3  3  
ATOM 8332  H HD2  . ARG A 1 170 ? 13.309  -14.127 -9.633  1.00 0.00 ? 170 ARG A HD2  3  
ATOM 8333  H HD3  . ARG A 1 170 ? 13.495  -12.705 -10.658 1.00 0.00 ? 170 ARG A HD3  3  
ATOM 8334  H HE   . ARG A 1 170 ? 12.889  -15.400 -11.703 1.00 0.00 ? 170 ARG A HE   3  
ATOM 8335  H HH11 . ARG A 1 170 ? 12.456  -11.912 -11.746 1.00 0.00 ? 170 ARG A HH11 3  
ATOM 8336  H HH12 . ARG A 1 170 ? 11.332  -11.956 -13.078 1.00 0.00 ? 170 ARG A HH12 3  
ATOM 8337  H HH21 . ARG A 1 170 ? 11.405  -15.445 -13.425 1.00 0.00 ? 170 ARG A HH21 3  
ATOM 8338  H HH22 . ARG A 1 170 ? 10.727  -13.950 -14.018 1.00 0.00 ? 170 ARG A HH22 3  
ATOM 8339  N N    . ILE B 2 1   ? -13.389 -14.287 10.223  1.00 0.00 ? 201 ILE B N    3  
ATOM 8340  C CA   . ILE B 2 1   ? -14.422 -14.030 9.194   1.00 0.00 ? 201 ILE B CA   3  
ATOM 8341  C C    . ILE B 2 1   ? -14.031 -14.703 7.879   1.00 0.00 ? 201 ILE B C    3  
ATOM 8342  O O    . ILE B 2 1   ? -14.770 -15.532 7.347   1.00 0.00 ? 201 ILE B O    3  
ATOM 8343  C CB   . ILE B 2 1   ? -14.616 -12.513 8.958   1.00 0.00 ? 201 ILE B CB   3  
ATOM 8344  C CG1  . ILE B 2 1   ? -14.836 -11.790 10.289  1.00 0.00 ? 201 ILE B CG1  3  
ATOM 8345  C CG2  . ILE B 2 1   ? -15.788 -12.266 8.017   1.00 0.00 ? 201 ILE B CG2  3  
ATOM 8346  C CD1  . ILE B 2 1   ? -14.762 -10.283 10.181  1.00 0.00 ? 201 ILE B CD1  3  
ATOM 8347  H H1   . ILE B 2 1   ? -13.687 -13.899 11.144  1.00 0.00 ? 201 ILE B H1   3  
ATOM 8348  H H2   . ILE B 2 1   ? -12.489 -13.834 9.946   1.00 0.00 ? 201 ILE B H2   3  
ATOM 8349  H H3   . ILE B 2 1   ? -13.231 -15.311 10.324  1.00 0.00 ? 201 ILE B H3   3  
ATOM 8350  H HA   . ILE B 2 1   ? -15.357 -14.448 9.536   1.00 0.00 ? 201 ILE B HA   3  
ATOM 8351  H HB   . ILE B 2 1   ? -13.723 -12.128 8.489   1.00 0.00 ? 201 ILE B HB   3  
ATOM 8352  H HG12 . ILE B 2 1   ? -15.812 -12.047 10.673  1.00 0.00 ? 201 ILE B HG12 3  
ATOM 8353  H HG13 . ILE B 2 1   ? -14.083 -12.111 10.995  1.00 0.00 ? 201 ILE B HG13 3  
ATOM 8354  H HG21 . ILE B 2 1   ? -16.698 -12.627 8.472   1.00 0.00 ? 201 ILE B HG21 3  
ATOM 8355  H HG22 . ILE B 2 1   ? -15.620 -12.787 7.087   1.00 0.00 ? 201 ILE B HG22 3  
ATOM 8356  H HG23 . ILE B 2 1   ? -15.879 -11.206 7.824   1.00 0.00 ? 201 ILE B HG23 3  
ATOM 8357  H HD11 . ILE B 2 1   ? -15.557 -9.928  9.541   1.00 0.00 ? 201 ILE B HD11 3  
ATOM 8358  H HD12 . ILE B 2 1   ? -13.809 -10.001 9.762   1.00 0.00 ? 201 ILE B HD12 3  
ATOM 8359  H HD13 . ILE B 2 1   ? -14.867 -9.846  11.163  1.00 0.00 ? 201 ILE B HD13 3  
ATOM 8360  N N    . ILE B 2 2   ? -12.857 -14.348 7.371   1.00 0.00 ? 202 ILE B N    3  
ATOM 8361  C CA   . ILE B 2 2   ? -12.341 -14.910 6.126   1.00 0.00 ? 202 ILE B CA   3  
ATOM 8362  C C    . ILE B 2 2   ? -10.820 -14.928 6.157   1.00 0.00 ? 202 ILE B C    3  
ATOM 8363  O O    . ILE B 2 2   ? -10.159 -14.479 5.217   1.00 0.00 ? 202 ILE B O    3  
ATOM 8364  C CB   . ILE B 2 2   ? -12.812 -14.128 4.873   1.00 0.00 ? 202 ILE B CB   3  
ATOM 8365  C CG1  . ILE B 2 2   ? -13.312 -12.723 5.232   1.00 0.00 ? 202 ILE B CG1  3  
ATOM 8366  C CG2  . ILE B 2 2   ? -13.893 -14.906 4.143   1.00 0.00 ? 202 ILE B CG2  3  
ATOM 8367  C CD1  . ILE B 2 2   ? -12.210 -11.743 5.571   1.00 0.00 ? 202 ILE B CD1  3  
ATOM 8368  H H    . ILE B 2 2   ? -12.307 -13.687 7.858   1.00 0.00 ? 202 ILE B H    3  
ATOM 8369  H HA   . ILE B 2 2   ? -12.701 -15.928 6.047   1.00 0.00 ? 202 ILE B HA   3  
ATOM 8370  H HB   . ILE B 2 2   ? -11.968 -14.037 4.207   1.00 0.00 ? 202 ILE B HB   3  
ATOM 8371  H HG12 . ILE B 2 2   ? -13.860 -12.322 4.393   1.00 0.00 ? 202 ILE B HG12 3  
ATOM 8372  H HG13 . ILE B 2 2   ? -13.970 -12.792 6.085   1.00 0.00 ? 202 ILE B HG13 3  
ATOM 8373  H HG21 . ILE B 2 2   ? -13.496 -15.860 3.827   1.00 0.00 ? 202 ILE B HG21 3  
ATOM 8374  H HG22 . ILE B 2 2   ? -14.215 -14.345 3.278   1.00 0.00 ? 202 ILE B HG22 3  
ATOM 8375  H HG23 . ILE B 2 2   ? -14.733 -15.064 4.802   1.00 0.00 ? 202 ILE B HG23 3  
ATOM 8376  H HD11 . ILE B 2 2   ? -12.640 -10.773 5.772   1.00 0.00 ? 202 ILE B HD11 3  
ATOM 8377  H HD12 . ILE B 2 2   ? -11.524 -11.669 4.739   1.00 0.00 ? 202 ILE B HD12 3  
ATOM 8378  H HD13 . ILE B 2 2   ? -11.677 -12.089 6.445   1.00 0.00 ? 202 ILE B HD13 3  
ATOM 8379  N N    . LYS B 2 3   ? -10.278 -15.459 7.247   1.00 0.00 ? 203 LYS B N    3  
ATOM 8380  C CA   . LYS B 2 3   ? -8.834  -15.533 7.446   1.00 0.00 ? 203 LYS B CA   3  
ATOM 8381  C C    . LYS B 2 3   ? -8.125  -16.285 6.325   1.00 0.00 ? 203 LYS B C    3  
ATOM 8382  O O    . LYS B 2 3   ? -6.998  -15.953 5.979   1.00 0.00 ? 203 LYS B O    3  
ATOM 8383  C CB   . LYS B 2 3   ? -8.514  -16.181 8.793   1.00 0.00 ? 203 LYS B CB   3  
ATOM 8384  C CG   . LYS B 2 3   ? -8.472  -15.188 9.940   1.00 0.00 ? 203 LYS B CG   3  
ATOM 8385  C CD   . LYS B 2 3   ? -8.218  -15.874 11.269  1.00 0.00 ? 203 LYS B CD   3  
ATOM 8386  C CE   . LYS B 2 3   ? -8.126  -14.866 12.405  1.00 0.00 ? 203 LYS B CE   3  
ATOM 8387  N NZ   . LYS B 2 3   ? -9.355  -14.036 12.519  1.00 0.00 ? 203 LYS B NZ   3  
ATOM 8388  H H    . LYS B 2 3   ? -10.873 -15.817 7.946   1.00 0.00 ? 203 LYS B H    3  
ATOM 8389  H HA   . LYS B 2 3   ? -8.461  -14.521 7.461   1.00 0.00 ? 203 LYS B HA   3  
ATOM 8390  H HB2  . LYS B 2 3   ? -9.269  -16.923 9.013   1.00 0.00 ? 203 LYS B HB2  3  
ATOM 8391  H HB3  . LYS B 2 3   ? -7.552  -16.665 8.728   1.00 0.00 ? 203 LYS B HB3  3  
ATOM 8392  H HG2  . LYS B 2 3   ? -7.678  -14.478 9.760   1.00 0.00 ? 203 LYS B HG2  3  
ATOM 8393  H HG3  . LYS B 2 3   ? -9.417  -14.667 9.990   1.00 0.00 ? 203 LYS B HG3  3  
ATOM 8394  H HD2  . LYS B 2 3   ? -9.031  -16.556 11.470  1.00 0.00 ? 203 LYS B HD2  3  
ATOM 8395  H HD3  . LYS B 2 3   ? -7.289  -16.422 11.209  1.00 0.00 ? 203 LYS B HD3  3  
ATOM 8396  H HE2  . LYS B 2 3   ? -7.977  -15.402 13.331  1.00 0.00 ? 203 LYS B HE2  3  
ATOM 8397  H HE3  . LYS B 2 3   ? -7.279  -14.220 12.225  1.00 0.00 ? 203 LYS B HE3  3  
ATOM 8398  H HZ1  . LYS B 2 3   ? -10.202 -14.647 12.538  1.00 0.00 ? 203 LYS B HZ1  3  
ATOM 8399  H HZ2  . LYS B 2 3   ? -9.430  -13.383 11.705  1.00 0.00 ? 203 LYS B HZ2  3  
ATOM 8400  H HZ3  . LYS B 2 3   ? -9.325  -13.472 13.396  1.00 0.00 ? 203 LYS B HZ3  3  
ATOM 8401  N N    . ASN B 2 4   ? -8.779  -17.294 5.762   1.00 0.00 ? 204 ASN B N    3  
ATOM 8402  C CA   . ASN B 2 4   ? -8.182  -18.081 4.685   1.00 0.00 ? 204 ASN B CA   3  
ATOM 8403  C C    . ASN B 2 4   ? -7.837  -17.209 3.472   1.00 0.00 ? 204 ASN B C    3  
ATOM 8404  O O    . ASN B 2 4   ? -6.707  -17.242 2.977   1.00 0.00 ? 204 ASN B O    3  
ATOM 8405  C CB   . ASN B 2 4   ? -9.100  -19.243 4.274   1.00 0.00 ? 204 ASN B CB   3  
ATOM 8406  C CG   . ASN B 2 4   ? -10.456 -18.804 3.742   1.00 0.00 ? 204 ASN B CG   3  
ATOM 8407  O OD1  . ASN B 2 4   ? -11.024 -17.800 4.178   1.00 0.00 ? 204 ASN B OD1  3  
ATOM 8408  N ND2  . ASN B 2 4   ? -10.990 -19.567 2.803   1.00 0.00 ? 204 ASN B ND2  3  
ATOM 8409  H H    . ASN B 2 4   ? -9.680  -17.516 6.077   1.00 0.00 ? 204 ASN B H    3  
ATOM 8410  H HA   . ASN B 2 4   ? -7.261  -18.495 5.071   1.00 0.00 ? 204 ASN B HA   3  
ATOM 8411  H HB2  . ASN B 2 4   ? -8.609  -19.820 3.505   1.00 0.00 ? 204 ASN B HB2  3  
ATOM 8412  H HB3  . ASN B 2 4   ? -9.264  -19.876 5.135   1.00 0.00 ? 204 ASN B HB3  3  
ATOM 8413  H HD21 . ASN B 2 4   ? -10.488 -20.363 2.511   1.00 0.00 ? 204 ASN B HD21 3  
ATOM 8414  H HD22 . ASN B 2 4   ? -11.864 -19.307 2.428   1.00 0.00 ? 204 ASN B HD22 3  
ATOM 8415  N N    . ILE B 2 5   ? -8.797  -16.419 3.007   1.00 0.00 ? 205 ILE B N    3  
ATOM 8416  C CA   . ILE B 2 5   ? -8.570  -15.547 1.862   1.00 0.00 ? 205 ILE B CA   3  
ATOM 8417  C C    . ILE B 2 5   ? -7.630  -14.414 2.248   1.00 0.00 ? 205 ILE B C    3  
ATOM 8418  O O    . ILE B 2 5   ? -6.741  -14.039 1.481   1.00 0.00 ? 205 ILE B O    3  
ATOM 8419  C CB   . ILE B 2 5   ? -9.887  -14.948 1.319   1.00 0.00 ? 205 ILE B CB   3  
ATOM 8420  C CG1  . ILE B 2 5   ? -10.958 -16.036 1.177   1.00 0.00 ? 205 ILE B CG1  3  
ATOM 8421  C CG2  . ILE B 2 5   ? -9.643  -14.263 -0.023  1.00 0.00 ? 205 ILE B CG2  3  
ATOM 8422  C CD1  . ILE B 2 5   ? -12.322 -15.501 0.798   1.00 0.00 ? 205 ILE B CD1  3  
ATOM 8423  H H    . ILE B 2 5   ? -9.676  -16.424 3.444   1.00 0.00 ? 205 ILE B H    3  
ATOM 8424  H HA   . ILE B 2 5   ? -8.112  -16.136 1.079   1.00 0.00 ? 205 ILE B HA   3  
ATOM 8425  H HB   . ILE B 2 5   ? -10.232 -14.202 2.018   1.00 0.00 ? 205 ILE B HB   3  
ATOM 8426  H HG12 . ILE B 2 5   ? -10.654 -16.733 0.412   1.00 0.00 ? 205 ILE B HG12 3  
ATOM 8427  H HG13 . ILE B 2 5   ? -11.055 -16.560 2.117   1.00 0.00 ? 205 ILE B HG13 3  
ATOM 8428  H HG21 . ILE B 2 5   ? -10.561 -13.816 -0.373  1.00 0.00 ? 205 ILE B HG21 3  
ATOM 8429  H HG22 . ILE B 2 5   ? -9.299  -14.992 -0.743  1.00 0.00 ? 205 ILE B HG22 3  
ATOM 8430  H HG23 . ILE B 2 5   ? -8.891  -13.496 0.098   1.00 0.00 ? 205 ILE B HG23 3  
ATOM 8431  H HD11 . ILE B 2 5   ? -13.021 -16.319 0.716   1.00 0.00 ? 205 ILE B HD11 3  
ATOM 8432  H HD12 . ILE B 2 5   ? -12.258 -14.987 -0.149  1.00 0.00 ? 205 ILE B HD12 3  
ATOM 8433  H HD13 . ILE B 2 5   ? -12.661 -14.813 1.558   1.00 0.00 ? 205 ILE B HD13 3  
ATOM 8434  N N    . ALA B 2 6   ? -7.826  -13.894 3.455   1.00 0.00 ? 206 ALA B N    3  
ATOM 8435  C CA   . ALA B 2 6   ? -7.011  -12.805 3.971   1.00 0.00 ? 206 ALA B CA   3  
ATOM 8436  C C    . ALA B 2 6   ? -5.543  -13.203 4.046   1.00 0.00 ? 206 ALA B C    3  
ATOM 8437  O O    . ALA B 2 6   ? -4.664  -12.455 3.625   1.00 0.00 ? 206 ALA B O    3  
ATOM 8438  C CB   . ALA B 2 6   ? -7.514  -12.391 5.339   1.00 0.00 ? 206 ALA B CB   3  
ATOM 8439  H H    . ALA B 2 6   ? -8.545  -14.255 4.017   1.00 0.00 ? 206 ALA B H    3  
ATOM 8440  H HA   . ALA B 2 6   ? -7.113  -11.962 3.303   1.00 0.00 ? 206 ALA B HA   3  
ATOM 8441  H HB1  . ALA B 2 6   ? -8.553  -12.104 5.269   1.00 0.00 ? 206 ALA B HB1  3  
ATOM 8442  H HB2  . ALA B 2 6   ? -6.934  -11.556 5.699   1.00 0.00 ? 206 ALA B HB2  3  
ATOM 8443  H HB3  . ALA B 2 6   ? -7.415  -13.219 6.025   1.00 0.00 ? 206 ALA B HB3  3  
ATOM 8444  N N    . ARG B 2 7   ? -5.291  -14.393 4.576   1.00 0.00 ? 207 ARG B N    3  
ATOM 8445  C CA   . ARG B 2 7   ? -3.937  -14.909 4.717   1.00 0.00 ? 207 ARG B CA   3  
ATOM 8446  C C    . ARG B 2 7   ? -3.283  -15.069 3.352   1.00 0.00 ? 207 ARG B C    3  
ATOM 8447  O O    . ARG B 2 7   ? -2.089  -14.818 3.194   1.00 0.00 ? 207 ARG B O    3  
ATOM 8448  C CB   . ARG B 2 7   ? -3.954  -16.254 5.450   1.00 0.00 ? 207 ARG B CB   3  
ATOM 8449  C CG   . ARG B 2 7   ? -3.003  -16.328 6.636   1.00 0.00 ? 207 ARG B CG   3  
ATOM 8450  C CD   . ARG B 2 7   ? -1.546  -16.328 6.198   1.00 0.00 ? 207 ARG B CD   3  
ATOM 8451  N NE   . ARG B 2 7   ? -1.265  -17.380 5.222   1.00 0.00 ? 207 ARG B NE   3  
ATOM 8452  C CZ   . ARG B 2 7   ? -0.101  -18.017 5.116   1.00 0.00 ? 207 ARG B CZ   3  
ATOM 8453  N NH1  . ARG B 2 7   ? 0.885   -17.767 5.971   1.00 0.00 ? 207 ARG B NH1  3  
ATOM 8454  N NH2  . ARG B 2 7   ? 0.064   -18.921 4.161   1.00 0.00 ? 207 ARG B NH2  3  
ATOM 8455  H H    . ARG B 2 7   ? -6.044  -14.946 4.884   1.00 0.00 ? 207 ARG B H    3  
ATOM 8456  H HA   . ARG B 2 7   ? -3.367  -14.198 5.297   1.00 0.00 ? 207 ARG B HA   3  
ATOM 8457  H HB2  . ARG B 2 7   ? -4.955  -16.441 5.809   1.00 0.00 ? 207 ARG B HB2  3  
ATOM 8458  H HB3  . ARG B 2 7   ? -3.682  -17.033 4.751   1.00 0.00 ? 207 ARG B HB3  3  
ATOM 8459  H HG2  . ARG B 2 7   ? -3.174  -15.476 7.275   1.00 0.00 ? 207 ARG B HG2  3  
ATOM 8460  H HG3  . ARG B 2 7   ? -3.204  -17.236 7.188   1.00 0.00 ? 207 ARG B HG3  3  
ATOM 8461  H HD2  . ARG B 2 7   ? -1.319  -15.371 5.754   1.00 0.00 ? 207 ARG B HD2  3  
ATOM 8462  H HD3  . ARG B 2 7   ? -0.921  -16.480 7.066   1.00 0.00 ? 207 ARG B HD3  3  
ATOM 8463  H HE   . ARG B 2 7   ? -1.991  -17.614 4.590   1.00 0.00 ? 207 ARG B HE   3  
ATOM 8464  H HH11 . ARG B 2 7   ? 0.758   -17.097 6.711   1.00 0.00 ? 207 ARG B HH11 3  
ATOM 8465  H HH12 . ARG B 2 7   ? 1.768   -18.244 5.878   1.00 0.00 ? 207 ARG B HH12 3  
ATOM 8466  H HH21 . ARG B 2 7   ? -0.685  -19.119 3.525   1.00 0.00 ? 207 ARG B HH21 3  
ATOM 8467  H HH22 . ARG B 2 7   ? 0.939   -19.413 4.070   1.00 0.00 ? 207 ARG B HH22 3  
ATOM 8468  N N    . HIS B 2 8   ? -4.081  -15.475 2.370   1.00 0.00 ? 208 HIS B N    3  
ATOM 8469  C CA   . HIS B 2 8   ? -3.593  -15.676 1.012   1.00 0.00 ? 208 HIS B CA   3  
ATOM 8470  C C    . HIS B 2 8   ? -2.992  -14.391 0.443   1.00 0.00 ? 208 HIS B C    3  
ATOM 8471  O O    . HIS B 2 8   ? -1.834  -14.373 0.029   1.00 0.00 ? 208 HIS B O    3  
ATOM 8472  C CB   . HIS B 2 8   ? -4.730  -16.169 0.112   1.00 0.00 ? 208 HIS B CB   3  
ATOM 8473  C CG   . HIS B 2 8   ? -4.265  -16.814 -1.158  1.00 0.00 ? 208 HIS B CG   3  
ATOM 8474  N ND1  . HIS B 2 8   ? -4.281  -18.179 -1.355  1.00 0.00 ? 208 HIS B ND1  3  
ATOM 8475  C CD2  . HIS B 2 8   ? -3.790  -16.277 -2.309  1.00 0.00 ? 208 HIS B CD2  3  
ATOM 8476  C CE1  . HIS B 2 8   ? -3.836  -18.452 -2.566  1.00 0.00 ? 208 HIS B CE1  3  
ATOM 8477  N NE2  . HIS B 2 8   ? -3.531  -17.318 -3.163  1.00 0.00 ? 208 HIS B NE2  3  
ATOM 8478  H H    . HIS B 2 8   ? -5.029  -15.653 2.567   1.00 0.00 ? 208 HIS B H    3  
ATOM 8479  H HA   . HIS B 2 8   ? -2.823  -16.432 1.046   1.00 0.00 ? 208 HIS B HA   3  
ATOM 8480  H HB2  . HIS B 2 8   ? -5.318  -16.895 0.653   1.00 0.00 ? 208 HIS B HB2  3  
ATOM 8481  H HB3  . HIS B 2 8   ? -5.358  -15.330 -0.152  1.00 0.00 ? 208 HIS B HB3  3  
ATOM 8482  H HD1  . HIS B 2 8   ? -4.584  -18.853 -0.697  1.00 0.00 ? 208 HIS B HD1  3  
ATOM 8483  H HD2  . HIS B 2 8   ? -3.641  -15.227 -2.514  1.00 0.00 ? 208 HIS B HD2  3  
ATOM 8484  H HE1  . HIS B 2 8   ? -3.741  -19.437 -2.996  1.00 0.00 ? 208 HIS B HE1  3  
ATOM 8485  H HE2  . HIS B 2 8   ? -3.194  -17.236 -4.086  1.00 0.00 ? 208 HIS B HE2  3  
ATOM 8486  N N    . LEU B 2 9   ? -3.772  -13.314 0.438   1.00 0.00 ? 209 LEU B N    3  
ATOM 8487  C CA   . LEU B 2 9   ? -3.299  -12.040 -0.094  1.00 0.00 ? 209 LEU B CA   3  
ATOM 8488  C C    . LEU B 2 9   ? -2.214  -11.443 0.795   1.00 0.00 ? 209 LEU B C    3  
ATOM 8489  O O    . LEU B 2 9   ? -1.260  -10.840 0.303   1.00 0.00 ? 209 LEU B O    3  
ATOM 8490  C CB   . LEU B 2 9   ? -4.459  -11.050 -0.254  1.00 0.00 ? 209 LEU B CB   3  
ATOM 8491  C CG   . LEU B 2 9   ? -5.280  -10.777 1.011   1.00 0.00 ? 209 LEU B CG   3  
ATOM 8492  C CD1  . LEU B 2 9   ? -4.941  -9.409  1.594   1.00 0.00 ? 209 LEU B CD1  3  
ATOM 8493  C CD2  . LEU B 2 9   ? -6.765  -10.871 0.705   1.00 0.00 ? 209 LEU B CD2  3  
ATOM 8494  H H    . LEU B 2 9   ? -4.683  -13.377 0.802   1.00 0.00 ? 209 LEU B H    3  
ATOM 8495  H HA   . LEU B 2 9   ? -2.872  -12.233 -1.068  1.00 0.00 ? 209 LEU B HA   3  
ATOM 8496  H HB2  . LEU B 2 9   ? -4.055  -10.110 -0.602  1.00 0.00 ? 209 LEU B HB2  3  
ATOM 8497  H HB3  . LEU B 2 9   ? -5.126  -11.434 -1.011  1.00 0.00 ? 209 LEU B HB3  3  
ATOM 8498  H HG   . LEU B 2 9   ? -5.042  -11.524 1.754   1.00 0.00 ? 209 LEU B HG   3  
ATOM 8499  H HD11 . LEU B 2 9   ? -3.884  -9.364  1.818   1.00 0.00 ? 209 LEU B HD11 3  
ATOM 8500  H HD12 . LEU B 2 9   ? -5.508  -9.251  2.500   1.00 0.00 ? 209 LEU B HD12 3  
ATOM 8501  H HD13 . LEU B 2 9   ? -5.190  -8.640  0.878   1.00 0.00 ? 209 LEU B HD13 3  
ATOM 8502  H HD21 . LEU B 2 9   ? -7.330  -10.734 1.616   1.00 0.00 ? 209 LEU B HD21 3  
ATOM 8503  H HD22 . LEU B 2 9   ? -6.987  -11.841 0.285   1.00 0.00 ? 209 LEU B HD22 3  
ATOM 8504  H HD23 . LEU B 2 9   ? -7.037  -10.102 -0.003  1.00 0.00 ? 209 LEU B HD23 3  
ATOM 8505  N N    . ALA B 2 10  ? -2.362  -11.626 2.101   1.00 0.00 ? 210 ALA B N    3  
ATOM 8506  C CA   . ALA B 2 10  ? -1.406  -11.098 3.060   1.00 0.00 ? 210 ALA B CA   3  
ATOM 8507  C C    . ALA B 2 10  ? -0.029  -11.721 2.885   1.00 0.00 ? 210 ALA B C    3  
ATOM 8508  O O    . ALA B 2 10  ? 0.959   -11.008 2.750   1.00 0.00 ? 210 ALA B O    3  
ATOM 8509  C CB   . ALA B 2 10  ? -1.904  -11.319 4.479   1.00 0.00 ? 210 ALA B CB   3  
ATOM 8510  H H    . ALA B 2 10  ? -3.142  -12.127 2.428   1.00 0.00 ? 210 ALA B H    3  
ATOM 8511  H HA   . ALA B 2 10  ? -1.329  -10.034 2.898   1.00 0.00 ? 210 ALA B HA   3  
ATOM 8512  H HB1  . ALA B 2 10  ? -2.903  -10.917 4.577   1.00 0.00 ? 210 ALA B HB1  3  
ATOM 8513  H HB2  . ALA B 2 10  ? -1.245  -10.816 5.171   1.00 0.00 ? 210 ALA B HB2  3  
ATOM 8514  H HB3  . ALA B 2 10  ? -1.917  -12.376 4.695   1.00 0.00 ? 210 ALA B HB3  3  
ATOM 8515  N N    . GLN B 2 11  ? 0.027   -13.048 2.865   1.00 0.00 ? 211 GLN B N    3  
ATOM 8516  C CA   . GLN B 2 11  ? 1.292   -13.761 2.732   1.00 0.00 ? 211 GLN B CA   3  
ATOM 8517  C C    . GLN B 2 11  ? 2.007   -13.399 1.433   1.00 0.00 ? 211 GLN B C    3  
ATOM 8518  O O    . GLN B 2 11  ? 3.214   -13.139 1.437   1.00 0.00 ? 211 GLN B O    3  
ATOM 8519  C CB   . GLN B 2 11  ? 1.061   -15.272 2.808   1.00 0.00 ? 211 GLN B CB   3  
ATOM 8520  C CG   . GLN B 2 11  ? 2.344   -16.080 2.900   1.00 0.00 ? 211 GLN B CG   3  
ATOM 8521  C CD   . GLN B 2 11  ? 3.209   -15.677 4.080   1.00 0.00 ? 211 GLN B CD   3  
ATOM 8522  O OE1  . GLN B 2 11  ? 2.711   -15.278 5.133   1.00 0.00 ? 211 GLN B OE1  3  
ATOM 8523  N NE2  . GLN B 2 11  ? 4.515   -15.775 3.907   1.00 0.00 ? 211 GLN B NE2  3  
ATOM 8524  H H    . GLN B 2 11  ? -0.809  -13.564 2.939   1.00 0.00 ? 211 GLN B H    3  
ATOM 8525  H HA   . GLN B 2 11  ? 1.919   -13.467 3.561   1.00 0.00 ? 211 GLN B HA   3  
ATOM 8526  H HB2  . GLN B 2 11  ? 0.462   -15.490 3.679   1.00 0.00 ? 211 GLN B HB2  3  
ATOM 8527  H HB3  . GLN B 2 11  ? 0.526   -15.588 1.925   1.00 0.00 ? 211 GLN B HB3  3  
ATOM 8528  H HG2  . GLN B 2 11  ? 2.091   -17.125 3.001   1.00 0.00 ? 211 GLN B HG2  3  
ATOM 8529  H HG3  . GLN B 2 11  ? 2.910   -15.935 1.993   1.00 0.00 ? 211 GLN B HG3  3  
ATOM 8530  H HE21 . GLN B 2 11  ? 4.847   -16.099 3.036   1.00 0.00 ? 211 GLN B HE21 3  
ATOM 8531  H HE22 . GLN B 2 11  ? 5.103   -15.515 4.646   1.00 0.00 ? 211 GLN B HE22 3  
ATOM 8532  N N    . VAL B 2 12  ? 1.267   -13.375 0.331   1.00 0.00 ? 212 VAL B N    3  
ATOM 8533  C CA   . VAL B 2 12  ? 1.846   -13.049 -0.966  1.00 0.00 ? 212 VAL B CA   3  
ATOM 8534  C C    . VAL B 2 12  ? 2.399   -11.623 -0.983  1.00 0.00 ? 212 VAL B C    3  
ATOM 8535  O O    . VAL B 2 12  ? 3.577   -11.412 -1.263  1.00 0.00 ? 212 VAL B O    3  
ATOM 8536  C CB   . VAL B 2 12  ? 0.815   -13.214 -2.112  1.00 0.00 ? 212 VAL B CB   3  
ATOM 8537  C CG1  . VAL B 2 12  ? 1.393   -12.753 -3.443  1.00 0.00 ? 212 VAL B CG1  3  
ATOM 8538  C CG2  . VAL B 2 12  ? 0.350   -14.658 -2.213  1.00 0.00 ? 212 VAL B CG2  3  
ATOM 8539  H H    . VAL B 2 12  ? 0.309   -13.583 0.391   1.00 0.00 ? 212 VAL B H    3  
ATOM 8540  H HA   . VAL B 2 12  ? 2.660   -13.738 -1.145  1.00 0.00 ? 212 VAL B HA   3  
ATOM 8541  H HB   . VAL B 2 12  ? -0.043  -12.598 -1.885  1.00 0.00 ? 212 VAL B HB   3  
ATOM 8542  H HG11 . VAL B 2 12  ? 2.263   -13.347 -3.682  1.00 0.00 ? 212 VAL B HG11 3  
ATOM 8543  H HG12 . VAL B 2 12  ? 1.674   -11.714 -3.374  1.00 0.00 ? 212 VAL B HG12 3  
ATOM 8544  H HG13 . VAL B 2 12  ? 0.650   -12.876 -4.220  1.00 0.00 ? 212 VAL B HG13 3  
ATOM 8545  H HG21 . VAL B 2 12  ? -0.350  -14.754 -3.030  1.00 0.00 ? 212 VAL B HG21 3  
ATOM 8546  H HG22 . VAL B 2 12  ? -0.133  -14.948 -1.290  1.00 0.00 ? 212 VAL B HG22 3  
ATOM 8547  H HG23 . VAL B 2 12  ? 1.200   -15.298 -2.391  1.00 0.00 ? 212 VAL B HG23 3  
ATOM 8548  N N    . GLY B 2 13  ? 1.551   -10.658 -0.647  1.00 0.00 ? 213 GLY B N    3  
ATOM 8549  C CA   . GLY B 2 13  ? 1.954   -9.263  -0.665  1.00 0.00 ? 213 GLY B CA   3  
ATOM 8550  C C    . GLY B 2 13  ? 3.020   -8.905  0.356   1.00 0.00 ? 213 GLY B C    3  
ATOM 8551  O O    . GLY B 2 13  ? 3.991   -8.219  0.028   1.00 0.00 ? 213 GLY B O    3  
ATOM 8552  H H    . GLY B 2 13  ? 0.635   -10.896 -0.379  1.00 0.00 ? 213 GLY B H    3  
ATOM 8553  H HA2  . GLY B 2 13  ? 2.334   -9.027  -1.648  1.00 0.00 ? 213 GLY B HA2  3  
ATOM 8554  H HA3  . GLY B 2 13  ? 1.081   -8.655  -0.481  1.00 0.00 ? 213 GLY B HA3  3  
ATOM 8555  N N    . ASP B 2 14  ? 2.846   -9.369  1.588   1.00 0.00 ? 214 ASP B N    3  
ATOM 8556  C CA   . ASP B 2 14  ? 3.788   -9.074  2.670   1.00 0.00 ? 214 ASP B CA   3  
ATOM 8557  C C    . ASP B 2 14  ? 5.206   -9.497  2.309   1.00 0.00 ? 214 ASP B C    3  
ATOM 8558  O O    . ASP B 2 14  ? 6.160   -8.733  2.483   1.00 0.00 ? 214 ASP B O    3  
ATOM 8559  C CB   . ASP B 2 14  ? 3.360   -9.787  3.957   1.00 0.00 ? 214 ASP B CB   3  
ATOM 8560  C CG   . ASP B 2 14  ? 4.074   -9.268  5.191   1.00 0.00 ? 214 ASP B CG   3  
ATOM 8561  O OD1  . ASP B 2 14  ? 5.259   -9.597  5.387   1.00 0.00 ? 214 ASP B OD1  3  
ATOM 8562  O OD2  . ASP B 2 14  ? 3.444   -8.539  5.982   1.00 0.00 ? 214 ASP B OD2  3  
ATOM 8563  H H    . ASP B 2 14  ? 2.064   -9.937  1.778   1.00 0.00 ? 214 ASP B H    3  
ATOM 8564  H HA   . ASP B 2 14  ? 3.775   -8.007  2.840   1.00 0.00 ? 214 ASP B HA   3  
ATOM 8565  H HB2  . ASP B 2 14  ? 2.298   -9.652  4.099   1.00 0.00 ? 214 ASP B HB2  3  
ATOM 8566  H HB3  . ASP B 2 14  ? 3.572   -10.842 3.858   1.00 0.00 ? 214 ASP B HB3  3  
ATOM 8567  N N    . SER B 2 15  ? 5.331   -10.711 1.800   1.00 0.00 ? 215 SER B N    3  
ATOM 8568  C CA   . SER B 2 15  ? 6.626   -11.255 1.431   1.00 0.00 ? 215 SER B CA   3  
ATOM 8569  C C    . SER B 2 15  ? 7.156   -10.656 0.125   1.00 0.00 ? 215 SER B C    3  
ATOM 8570  O O    . SER B 2 15  ? 8.334   -10.333 0.030   1.00 0.00 ? 215 SER B O    3  
ATOM 8571  C CB   . SER B 2 15  ? 6.529   -12.775 1.306   1.00 0.00 ? 215 SER B CB   3  
ATOM 8572  O OG   . SER B 2 15  ? 5.776   -13.329 2.377   1.00 0.00 ? 215 SER B OG   3  
ATOM 8573  H H    . SER B 2 15  ? 4.528   -11.262 1.675   1.00 0.00 ? 215 SER B H    3  
ATOM 8574  H HA   . SER B 2 15  ? 7.319   -11.018 2.222   1.00 0.00 ? 215 SER B HA   3  
ATOM 8575  H HB2  . SER B 2 15  ? 6.044   -13.027 0.374   1.00 0.00 ? 215 SER B HB2  3  
ATOM 8576  H HB3  . SER B 2 15  ? 7.521   -13.200 1.322   1.00 0.00 ? 215 SER B HB3  3  
ATOM 8577  H HG   . SER B 2 15  ? 4.848   -13.399 2.112   1.00 0.00 ? 215 SER B HG   3  
ATOM 8578  N N    . MET B 2 16  ? 6.275   -10.484 -0.858  1.00 0.00 ? 216 MET B N    3  
ATOM 8579  C CA   . MET B 2 16  ? 6.664   -9.963  -2.173  1.00 0.00 ? 216 MET B CA   3  
ATOM 8580  C C    . MET B 2 16  ? 7.400   -8.626  -2.090  1.00 0.00 ? 216 MET B C    3  
ATOM 8581  O O    . MET B 2 16  ? 8.471   -8.468  -2.679  1.00 0.00 ? 216 MET B O    3  
ATOM 8582  C CB   . MET B 2 16  ? 5.439   -9.808  -3.073  1.00 0.00 ? 216 MET B CB   3  
ATOM 8583  C CG   . MET B 2 16  ? 5.747   -10.009 -4.548  1.00 0.00 ? 216 MET B CG   3  
ATOM 8584  S SD   . MET B 2 16  ? 5.900   -11.752 -4.994  1.00 0.00 ? 216 MET B SD   3  
ATOM 8585  C CE   . MET B 2 16  ? 6.460   -11.627 -6.692  1.00 0.00 ? 216 MET B CE   3  
ATOM 8586  H H    . MET B 2 16  ? 5.332   -10.713 -0.699  1.00 0.00 ? 216 MET B H    3  
ATOM 8587  H HA   . MET B 2 16  ? 7.326   -10.687 -2.623  1.00 0.00 ? 216 MET B HA   3  
ATOM 8588  H HB2  . MET B 2 16  ? 4.695   -10.532 -2.776  1.00 0.00 ? 216 MET B HB2  3  
ATOM 8589  H HB3  . MET B 2 16  ? 5.034   -8.815  -2.943  1.00 0.00 ? 216 MET B HB3  3  
ATOM 8590  H HG2  . MET B 2 16  ? 4.951   -9.570  -5.132  1.00 0.00 ? 216 MET B HG2  3  
ATOM 8591  H HG3  . MET B 2 16  ? 6.677   -9.511  -4.778  1.00 0.00 ? 216 MET B HG3  3  
ATOM 8592  H HE1  . MET B 2 16  ? 6.621   -12.617 -7.092  1.00 0.00 ? 216 MET B HE1  3  
ATOM 8593  H HE2  . MET B 2 16  ? 7.385   -11.069 -6.726  1.00 0.00 ? 216 MET B HE2  3  
ATOM 8594  H HE3  . MET B 2 16  ? 5.710   -11.121 -7.280  1.00 0.00 ? 216 MET B HE3  3  
ATOM 8595  N N    . ASP B 2 17  ? 6.836   -7.674  -1.361  1.00 0.00 ? 217 ASP B N    3  
ATOM 8596  C CA   . ASP B 2 17  ? 7.454   -6.354  -1.240  1.00 0.00 ? 217 ASP B CA   3  
ATOM 8597  C C    . ASP B 2 17  ? 8.741   -6.414  -0.418  1.00 0.00 ? 217 ASP B C    3  
ATOM 8598  O O    . ASP B 2 17  ? 9.692   -5.679  -0.680  1.00 0.00 ? 217 ASP B O    3  
ATOM 8599  C CB   . ASP B 2 17  ? 6.479   -5.346  -0.621  1.00 0.00 ? 217 ASP B CB   3  
ATOM 8600  C CG   . ASP B 2 17  ? 7.063   -3.945  -0.551  1.00 0.00 ? 217 ASP B CG   3  
ATOM 8601  O OD1  . ASP B 2 17  ? 7.575   -3.458  -1.581  1.00 0.00 ? 217 ASP B OD1  3  
ATOM 8602  O OD2  . ASP B 2 17  ? 7.017   -3.331  0.537   1.00 0.00 ? 217 ASP B OD2  3  
ATOM 8603  H H    . ASP B 2 17  ? 5.991   -7.857  -0.895  1.00 0.00 ? 217 ASP B H    3  
ATOM 8604  H HA   . ASP B 2 17  ? 7.705   -6.024  -2.236  1.00 0.00 ? 217 ASP B HA   3  
ATOM 8605  H HB2  . ASP B 2 17  ? 5.580   -5.314  -1.216  1.00 0.00 ? 217 ASP B HB2  3  
ATOM 8606  H HB3  . ASP B 2 17  ? 6.233   -5.663  0.381   1.00 0.00 ? 217 ASP B HB3  3  
ATOM 8607  N N    . ARG B 2 18  ? 8.769   -7.286  0.581   1.00 0.00 ? 218 ARG B N    3  
ATOM 8608  C CA   . ARG B 2 18  ? 9.944   -7.428  1.430   1.00 0.00 ? 218 ARG B CA   3  
ATOM 8609  C C    . ARG B 2 18  ? 11.043  -8.218  0.729   1.00 0.00 ? 218 ARG B C    3  
ATOM 8610  O O    . ARG B 2 18  ? 10.947  -9.441  0.602   1.00 0.00 ? 218 ARG B O    3  
ATOM 8611  C CB   . ARG B 2 18  ? 9.571   -8.109  2.747   1.00 0.00 ? 218 ARG B CB   3  
ATOM 8612  C CG   . ARG B 2 18  ? 10.289  -7.531  3.957   1.00 0.00 ? 218 ARG B CG   3  
ATOM 8613  C CD   . ARG B 2 18  ? 10.062  -6.030  4.080   1.00 0.00 ? 218 ARG B CD   3  
ATOM 8614  N NE   . ARG B 2 18  ? 8.652   -5.673  3.921   1.00 0.00 ? 218 ARG B NE   3  
ATOM 8615  C CZ   . ARG B 2 18  ? 8.202   -4.790  3.024   1.00 0.00 ? 218 ARG B CZ   3  
ATOM 8616  N NH1  . ARG B 2 18  ? 9.050   -4.112  2.264   1.00 0.00 ? 218 ARG B NH1  3  
ATOM 8617  N NH2  . ARG B 2 18  ? 6.903   -4.567  2.897   1.00 0.00 ? 218 ARG B NH2  3  
ATOM 8618  H H    . ARG B 2 18  ? 7.991   -7.859  0.737   1.00 0.00 ? 218 ARG B H    3  
ATOM 8619  H HA   . ARG B 2 18  ? 10.314  -6.436  1.643   1.00 0.00 ? 218 ARG B HA   3  
ATOM 8620  H HB2  . ARG B 2 18  ? 8.507   -8.008  2.903   1.00 0.00 ? 218 ARG B HB2  3  
ATOM 8621  H HB3  . ARG B 2 18  ? 9.816   -9.159  2.679   1.00 0.00 ? 218 ARG B HB3  3  
ATOM 8622  H HG2  . ARG B 2 18  ? 9.915   -8.014  4.847   1.00 0.00 ? 218 ARG B HG2  3  
ATOM 8623  H HG3  . ARG B 2 18  ? 11.348  -7.720  3.860   1.00 0.00 ? 218 ARG B HG3  3  
ATOM 8624  H HD2  . ARG B 2 18  ? 10.399  -5.704  5.052   1.00 0.00 ? 218 ARG B HD2  3  
ATOM 8625  H HD3  . ARG B 2 18  ? 10.639  -5.531  3.315   1.00 0.00 ? 218 ARG B HD3  3  
ATOM 8626  H HE   . ARG B 2 18  ? 8.003   -6.141  4.495   1.00 0.00 ? 218 ARG B HE   3  
ATOM 8627  H HH11 . ARG B 2 18  ? 10.047  -4.252  2.356   1.00 0.00 ? 218 ARG B HH11 3  
ATOM 8628  H HH12 . ARG B 2 18  ? 8.699   -3.459  1.577   1.00 0.00 ? 218 ARG B HH12 3  
ATOM 8629  H HH21 . ARG B 2 18  ? 6.247   -5.052  3.472   1.00 0.00 ? 218 ARG B HH21 3  
ATOM 8630  H HH22 . ARG B 2 18  ? 6.574   -3.913  2.193   1.00 0.00 ? 218 ARG B HH22 3  
ATOM 8631  N N    . SER B 2 19  ? 12.079  -7.514  0.279   1.00 0.00 ? 219 SER B N    3  
ATOM 8632  C CA   . SER B 2 19  ? 13.219  -8.135  -0.399  1.00 0.00 ? 219 SER B CA   3  
ATOM 8633  C C    . SER B 2 19  ? 12.836  -8.726  -1.759  1.00 0.00 ? 219 SER B C    3  
ATOM 8634  O O    . SER B 2 19  ? 11.694  -8.607  -2.210  1.00 0.00 ? 219 SER B O    3  
ATOM 8635  C CB   . SER B 2 19  ? 13.836  -9.220  0.491   1.00 0.00 ? 219 SER B CB   3  
ATOM 8636  O OG   . SER B 2 19  ? 14.261  -8.681  1.731   1.00 0.00 ? 219 SER B OG   3  
ATOM 8637  H H    . SER B 2 19  ? 12.076  -6.541  0.399   1.00 0.00 ? 219 SER B H    3  
ATOM 8638  H HA   . SER B 2 19  ? 13.955  -7.366  -0.560  1.00 0.00 ? 219 SER B HA   3  
ATOM 8639  H HB2  . SER B 2 19  ? 13.102  -9.989  0.678   1.00 0.00 ? 219 SER B HB2  3  
ATOM 8640  H HB3  . SER B 2 19  ? 14.688  -9.652  -0.012  1.00 0.00 ? 219 SER B HB3  3  
ATOM 8641  H HG   . SER B 2 19  ? 13.788  -9.118  2.452   1.00 0.00 ? 219 SER B HG   3  
ATOM 8642  N N    . ILE B 2 20  ? 13.813  -9.350  -2.408  1.00 0.00 ? 220 ILE B N    3  
ATOM 8643  C CA   . ILE B 2 20  ? 13.618  -9.971  -3.708  1.00 0.00 ? 220 ILE B CA   3  
ATOM 8644  C C    . ILE B 2 20  ? 14.766  -10.941 -3.982  1.00 0.00 ? 220 ILE B C    3  
ATOM 8645  O O    . ILE B 2 20  ? 14.581  -11.898 -4.761  1.00 0.00 ? 220 ILE B O    3  
ATOM 8646  C CB   . ILE B 2 20  ? 13.530  -8.914  -4.840  1.00 0.00 ? 220 ILE B CB   3  
ATOM 8647  C CG1  . ILE B 2 20  ? 13.185  -9.575  -6.179  1.00 0.00 ? 220 ILE B CG1  3  
ATOM 8648  C CG2  . ILE B 2 20  ? 14.830  -8.128  -4.946  1.00 0.00 ? 220 ILE B CG2  3  
ATOM 8649  C CD1  . ILE B 2 20  ? 12.937  -8.589  -7.300  1.00 0.00 ? 220 ILE B CD1  3  
ATOM 8650  O OXT  . ILE B 2 20  ? 15.850  -10.744 -3.386  1.00 0.00 ? 220 ILE B OXT  3  
ATOM 8651  H H    . ILE B 2 20  ? 14.703  -9.394  -2.000  1.00 0.00 ? 220 ILE B H    3  
ATOM 8652  H HA   . ILE B 2 20  ? 12.691  -10.523 -3.679  1.00 0.00 ? 220 ILE B HA   3  
ATOM 8653  H HB   . ILE B 2 20  ? 12.746  -8.217  -4.582  1.00 0.00 ? 220 ILE B HB   3  
ATOM 8654  H HG12 . ILE B 2 20  ? 13.999  -10.217 -6.479  1.00 0.00 ? 220 ILE B HG12 3  
ATOM 8655  H HG13 . ILE B 2 20  ? 12.292  -10.170 -6.057  1.00 0.00 ? 220 ILE B HG13 3  
ATOM 8656  H HG21 . ILE B 2 20  ? 15.036  -7.646  -4.004  1.00 0.00 ? 220 ILE B HG21 3  
ATOM 8657  H HG22 . ILE B 2 20  ? 14.736  -7.380  -5.719  1.00 0.00 ? 220 ILE B HG22 3  
ATOM 8658  H HG23 . ILE B 2 20  ? 15.638  -8.800  -5.192  1.00 0.00 ? 220 ILE B HG23 3  
ATOM 8659  H HD11 . ILE B 2 20  ? 12.154  -7.905  -7.009  1.00 0.00 ? 220 ILE B HD11 3  
ATOM 8660  H HD12 . ILE B 2 20  ? 12.637  -9.122  -8.190  1.00 0.00 ? 220 ILE B HD12 3  
ATOM 8661  H HD13 . ILE B 2 20  ? 13.842  -8.035  -7.500  1.00 0.00 ? 220 ILE B HD13 3  
ATOM 8662  N N    . ALA A 1 1   ? 12.984  18.672  19.710  1.00 0.00 ? 1   ALA A N    4  
ATOM 8663  C CA   . ALA A 1 1   ? 12.417  19.189  18.447  1.00 0.00 ? 1   ALA A CA   4  
ATOM 8664  C C    . ALA A 1 1   ? 11.129  18.452  18.106  1.00 0.00 ? 1   ALA A C    4  
ATOM 8665  O O    . ALA A 1 1   ? 11.052  17.231  18.228  1.00 0.00 ? 1   ALA A O    4  
ATOM 8666  C CB   . ALA A 1 1   ? 13.422  19.044  17.317  1.00 0.00 ? 1   ALA A CB   4  
ATOM 8667  H H1   . ALA A 1 1   ? 13.834  19.217  19.972  1.00 0.00 ? 1   ALA A H1   4  
ATOM 8668  H H2   . ALA A 1 1   ? 13.245  17.669  19.602  1.00 0.00 ? 1   ALA A H2   4  
ATOM 8669  H H3   . ALA A 1 1   ? 12.282  18.757  20.475  1.00 0.00 ? 1   ALA A H3   4  
ATOM 8670  H HA   . ALA A 1 1   ? 12.198  20.240  18.574  1.00 0.00 ? 1   ALA A HA   4  
ATOM 8671  H HB1  . ALA A 1 1   ? 14.318  19.599  17.557  1.00 0.00 ? 1   ALA A HB1  4  
ATOM 8672  H HB2  . ALA A 1 1   ? 12.996  19.430  16.404  1.00 0.00 ? 1   ALA A HB2  4  
ATOM 8673  H HB3  . ALA A 1 1   ? 13.669  18.002  17.186  1.00 0.00 ? 1   ALA A HB3  4  
ATOM 8674  N N    . THR A 1 2   ? 10.114  19.198  17.702  1.00 0.00 ? 2   THR A N    4  
ATOM 8675  C CA   . THR A 1 2   ? 8.835   18.611  17.341  1.00 0.00 ? 2   THR A CA   4  
ATOM 8676  C C    . THR A 1 2   ? 8.326   19.217  16.036  1.00 0.00 ? 2   THR A C    4  
ATOM 8677  O O    . THR A 1 2   ? 7.825   20.342  16.020  1.00 0.00 ? 2   THR A O    4  
ATOM 8678  C CB   . THR A 1 2   ? 7.783   18.820  18.451  1.00 0.00 ? 2   THR A CB   4  
ATOM 8679  O OG1  . THR A 1 2   ? 8.345   18.498  19.734  1.00 0.00 ? 2   THR A OG1  4  
ATOM 8680  C CG2  . THR A 1 2   ? 6.556   17.953  18.203  1.00 0.00 ? 2   THR A CG2  4  
ATOM 8681  H H    . THR A 1 2   ? 10.230  20.176  17.635  1.00 0.00 ? 2   THR A H    4  
ATOM 8682  H HA   . THR A 1 2   ? 8.979   17.550  17.202  1.00 0.00 ? 2   THR A HA   4  
ATOM 8683  H HB   . THR A 1 2   ? 7.480   19.857  18.448  1.00 0.00 ? 2   THR A HB   4  
ATOM 8684  H HG1  . THR A 1 2   ? 9.297   18.663  19.717  1.00 0.00 ? 2   THR A HG1  4  
ATOM 8685  H HG21 . THR A 1 2   ? 6.845   16.910  18.201  1.00 0.00 ? 2   THR A HG21 4  
ATOM 8686  H HG22 . THR A 1 2   ? 6.123   18.207  17.245  1.00 0.00 ? 2   THR A HG22 4  
ATOM 8687  H HG23 . THR A 1 2   ? 5.830   18.124  18.983  1.00 0.00 ? 2   THR A HG23 4  
ATOM 8688  N N    . PRO A 1 3   ? 8.469   18.481  14.922  1.00 0.00 ? 3   PRO A N    4  
ATOM 8689  C CA   . PRO A 1 3   ? 8.027   18.948  13.607  1.00 0.00 ? 3   PRO A CA   4  
ATOM 8690  C C    . PRO A 1 3   ? 6.508   19.036  13.509  1.00 0.00 ? 3   PRO A C    4  
ATOM 8691  O O    . PRO A 1 3   ? 5.806   18.022  13.576  1.00 0.00 ? 3   PRO A O    4  
ATOM 8692  C CB   . PRO A 1 3   ? 8.575   17.887  12.646  1.00 0.00 ? 3   PRO A CB   4  
ATOM 8693  C CG   . PRO A 1 3   ? 8.740   16.662  13.475  1.00 0.00 ? 3   PRO A CG   4  
ATOM 8694  C CD   . PRO A 1 3   ? 9.069   17.136  14.863  1.00 0.00 ? 3   PRO A CD   4  
ATOM 8695  H HA   . PRO A 1 3   ? 8.457   19.910  13.365  1.00 0.00 ? 3   PRO A HA   4  
ATOM 8696  H HB2  . PRO A 1 3   ? 7.870   17.729  11.843  1.00 0.00 ? 3   PRO A HB2  4  
ATOM 8697  H HB3  . PRO A 1 3   ? 9.520   18.218  12.243  1.00 0.00 ? 3   PRO A HB3  4  
ATOM 8698  H HG2  . PRO A 1 3   ? 7.818   16.097  13.480  1.00 0.00 ? 3   PRO A HG2  4  
ATOM 8699  H HG3  . PRO A 1 3   ? 9.546   16.061  13.082  1.00 0.00 ? 3   PRO A HG3  4  
ATOM 8700  H HD2  . PRO A 1 3   ? 8.622   16.483  15.599  1.00 0.00 ? 3   PRO A HD2  4  
ATOM 8701  H HD3  . PRO A 1 3   ? 10.139  17.185  15.002  1.00 0.00 ? 3   PRO A HD3  4  
ATOM 8702  N N    . ALA A 1 4   ? 6.002   20.251  13.363  1.00 0.00 ? 4   ALA A N    4  
ATOM 8703  C CA   . ALA A 1 4   ? 4.571   20.471  13.263  1.00 0.00 ? 4   ALA A CA   4  
ATOM 8704  C C    . ALA A 1 4   ? 4.057   20.025  11.902  1.00 0.00 ? 4   ALA A C    4  
ATOM 8705  O O    . ALA A 1 4   ? 4.478   20.545  10.867  1.00 0.00 ? 4   ALA A O    4  
ATOM 8706  C CB   . ALA A 1 4   ? 4.241   21.934  13.505  1.00 0.00 ? 4   ALA A CB   4  
ATOM 8707  H H    . ALA A 1 4   ? 6.612   21.021  13.316  1.00 0.00 ? 4   ALA A H    4  
ATOM 8708  H HA   . ALA A 1 4   ? 4.089   19.883  14.031  1.00 0.00 ? 4   ALA A HA   4  
ATOM 8709  H HB1  . ALA A 1 4   ? 4.564   22.217  14.497  1.00 0.00 ? 4   ALA A HB1  4  
ATOM 8710  H HB2  . ALA A 1 4   ? 3.176   22.084  13.416  1.00 0.00 ? 4   ALA A HB2  4  
ATOM 8711  H HB3  . ALA A 1 4   ? 4.754   22.546  12.774  1.00 0.00 ? 4   ALA A HB3  4  
ATOM 8712  N N    . SER A 1 5   ? 3.163   19.052  11.909  1.00 0.00 ? 5   SER A N    4  
ATOM 8713  C CA   . SER A 1 5   ? 2.595   18.534  10.681  1.00 0.00 ? 5   SER A CA   4  
ATOM 8714  C C    . SER A 1 5   ? 1.436   19.412  10.221  1.00 0.00 ? 5   SER A C    4  
ATOM 8715  O O    . SER A 1 5   ? 0.371   19.436  10.846  1.00 0.00 ? 5   SER A O    4  
ATOM 8716  C CB   . SER A 1 5   ? 2.130   17.096  10.893  1.00 0.00 ? 5   SER A CB   4  
ATOM 8717  O OG   . SER A 1 5   ? 3.029   16.394  11.738  1.00 0.00 ? 5   SER A OG   4  
ATOM 8718  H H    . SER A 1 5   ? 2.875   18.671  12.770  1.00 0.00 ? 5   SER A H    4  
ATOM 8719  H HA   . SER A 1 5   ? 3.365   18.549  9.925   1.00 0.00 ? 5   SER A HA   4  
ATOM 8720  H HB2  . SER A 1 5   ? 1.152   17.099  11.349  1.00 0.00 ? 5   SER A HB2  4  
ATOM 8721  H HB3  . SER A 1 5   ? 2.080   16.591  9.939   1.00 0.00 ? 5   SER A HB3  4  
ATOM 8722  H HG   . SER A 1 5   ? 3.104   16.863  12.580  1.00 0.00 ? 5   SER A HG   4  
ATOM 8723  N N    . ALA A 1 6   ? 1.657   20.148  9.143   1.00 0.00 ? 6   ALA A N    4  
ATOM 8724  C CA   . ALA A 1 6   ? 0.638   21.035  8.599   1.00 0.00 ? 6   ALA A CA   4  
ATOM 8725  C C    . ALA A 1 6   ? -0.339  20.292  7.676   1.00 0.00 ? 6   ALA A C    4  
ATOM 8726  O O    . ALA A 1 6   ? -1.550  20.392  7.864   1.00 0.00 ? 6   ALA A O    4  
ATOM 8727  C CB   . ALA A 1 6   ? 1.282   22.214  7.880   1.00 0.00 ? 6   ALA A CB   4  
ATOM 8728  H H    . ALA A 1 6   ? 2.534   20.094  8.696   1.00 0.00 ? 6   ALA A H    4  
ATOM 8729  H HA   . ALA A 1 6   ? 0.078   21.429  9.436   1.00 0.00 ? 6   ALA A HA   4  
ATOM 8730  H HB1  . ALA A 1 6   ? 0.513   22.897  7.547   1.00 0.00 ? 6   ALA A HB1  4  
ATOM 8731  H HB2  . ALA A 1 6   ? 1.840   21.856  7.026   1.00 0.00 ? 6   ALA A HB2  4  
ATOM 8732  H HB3  . ALA A 1 6   ? 1.949   22.727  8.558   1.00 0.00 ? 6   ALA A HB3  4  
ATOM 8733  N N    . PRO A 1 7   ? 0.153   19.538  6.664   1.00 0.00 ? 7   PRO A N    4  
ATOM 8734  C CA   . PRO A 1 7   ? -0.725  18.799  5.748   1.00 0.00 ? 7   PRO A CA   4  
ATOM 8735  C C    . PRO A 1 7   ? -1.505  17.696  6.456   1.00 0.00 ? 7   PRO A C    4  
ATOM 8736  O O    . PRO A 1 7   ? -0.936  16.884  7.190   1.00 0.00 ? 7   PRO A O    4  
ATOM 8737  C CB   . PRO A 1 7   ? 0.236   18.191  4.718   1.00 0.00 ? 7   PRO A CB   4  
ATOM 8738  C CG   . PRO A 1 7   ? 1.507   18.953  4.870   1.00 0.00 ? 7   PRO A CG   4  
ATOM 8739  C CD   . PRO A 1 7   ? 1.571   19.354  6.311   1.00 0.00 ? 7   PRO A CD   4  
ATOM 8740  H HA   . PRO A 1 7   ? -1.419  19.462  5.249   1.00 0.00 ? 7   PRO A HA   4  
ATOM 8741  H HB2  . PRO A 1 7   ? 0.379   17.142  4.932   1.00 0.00 ? 7   PRO A HB2  4  
ATOM 8742  H HB3  . PRO A 1 7   ? -0.176  18.306  3.727   1.00 0.00 ? 7   PRO A HB3  4  
ATOM 8743  H HG2  . PRO A 1 7   ? 2.346   18.321  4.619   1.00 0.00 ? 7   PRO A HG2  4  
ATOM 8744  H HG3  . PRO A 1 7   ? 1.491   19.827  4.236   1.00 0.00 ? 7   PRO A HG3  4  
ATOM 8745  H HD2  . PRO A 1 7   ? 2.020   18.572  6.903   1.00 0.00 ? 7   PRO A HD2  4  
ATOM 8746  H HD3  . PRO A 1 7   ? 2.118   20.279  6.423   1.00 0.00 ? 7   PRO A HD3  4  
ATOM 8747  N N    . ASP A 1 8   ? -2.814  17.685  6.250   1.00 0.00 ? 8   ASP A N    4  
ATOM 8748  C CA   . ASP A 1 8   ? -3.673  16.677  6.853   1.00 0.00 ? 8   ASP A CA   4  
ATOM 8749  C C    . ASP A 1 8   ? -3.579  15.370  6.074   1.00 0.00 ? 8   ASP A C    4  
ATOM 8750  O O    . ASP A 1 8   ? -3.256  15.367  4.885   1.00 0.00 ? 8   ASP A O    4  
ATOM 8751  C CB   . ASP A 1 8   ? -5.124  17.165  6.907   1.00 0.00 ? 8   ASP A CB   4  
ATOM 8752  C CG   . ASP A 1 8   ? -6.080  16.091  7.389   1.00 0.00 ? 8   ASP A CG   4  
ATOM 8753  O OD1  . ASP A 1 8   ? -6.124  15.824  8.605   1.00 0.00 ? 8   ASP A OD1  4  
ATOM 8754  O OD2  . ASP A 1 8   ? -6.778  15.497  6.549   1.00 0.00 ? 8   ASP A OD2  4  
ATOM 8755  H H    . ASP A 1 8   ? -3.217  18.381  5.678   1.00 0.00 ? 8   ASP A H    4  
ATOM 8756  H HA   . ASP A 1 8   ? -3.325  16.507  7.860   1.00 0.00 ? 8   ASP A HA   4  
ATOM 8757  H HB2  . ASP A 1 8   ? -5.189  18.006  7.580   1.00 0.00 ? 8   ASP A HB2  4  
ATOM 8758  H HB3  . ASP A 1 8   ? -5.429  17.476  5.918   1.00 0.00 ? 8   ASP A HB3  4  
ATOM 8759  N N    . THR A 1 9   ? -3.854  14.267  6.757   1.00 0.00 ? 9   THR A N    4  
ATOM 8760  C CA   . THR A 1 9   ? -3.802  12.943  6.161   1.00 0.00 ? 9   THR A CA   4  
ATOM 8761  C C    . THR A 1 9   ? -4.696  12.830  4.922   1.00 0.00 ? 9   THR A C    4  
ATOM 8762  O O    . THR A 1 9   ? -4.312  12.216  3.928   1.00 0.00 ? 9   THR A O    4  
ATOM 8763  C CB   . THR A 1 9   ? -4.224  11.889  7.194   1.00 0.00 ? 9   THR A CB   4  
ATOM 8764  O OG1  . THR A 1 9   ? -3.833  12.328  8.506   1.00 0.00 ? 9   THR A OG1  4  
ATOM 8765  C CG2  . THR A 1 9   ? -3.587  10.543  6.885   1.00 0.00 ? 9   THR A CG2  4  
ATOM 8766  H H    . THR A 1 9   ? -4.100  14.344  7.704   1.00 0.00 ? 9   THR A H    4  
ATOM 8767  H HA   . THR A 1 9   ? -2.780  12.745  5.875   1.00 0.00 ? 9   THR A HA   4  
ATOM 8768  H HB   . THR A 1 9   ? -5.299  11.782  7.164   1.00 0.00 ? 9   THR A HB   4  
ATOM 8769  H HG1  . THR A 1 9   ? -3.231  11.673  8.899   1.00 0.00 ? 9   THR A HG1  4  
ATOM 8770  H HG21 . THR A 1 9   ? -3.819  9.845   7.676   1.00 0.00 ? 9   THR A HG21 4  
ATOM 8771  H HG22 . THR A 1 9   ? -2.516  10.658  6.811   1.00 0.00 ? 9   THR A HG22 4  
ATOM 8772  H HG23 . THR A 1 9   ? -3.975  10.168  5.951   1.00 0.00 ? 9   THR A HG23 4  
ATOM 8773  N N    . ARG A 1 10  ? -5.869  13.450  4.972   1.00 0.00 ? 10  ARG A N    4  
ATOM 8774  C CA   . ARG A 1 10  ? -6.803  13.398  3.853   1.00 0.00 ? 10  ARG A CA   4  
ATOM 8775  C C    . ARG A 1 10  ? -6.272  14.202  2.672   1.00 0.00 ? 10  ARG A C    4  
ATOM 8776  O O    . ARG A 1 10  ? -6.477  13.834  1.516   1.00 0.00 ? 10  ARG A O    4  
ATOM 8777  C CB   . ARG A 1 10  ? -8.176  13.917  4.276   1.00 0.00 ? 10  ARG A CB   4  
ATOM 8778  C CG   . ARG A 1 10  ? -8.970  12.922  5.106   1.00 0.00 ? 10  ARG A CG   4  
ATOM 8779  C CD   . ARG A 1 10  ? -9.762  13.613  6.204   1.00 0.00 ? 10  ARG A CD   4  
ATOM 8780  N NE   . ARG A 1 10  ? -8.896  14.115  7.269   1.00 0.00 ? 10  ARG A NE   4  
ATOM 8781  C CZ   . ARG A 1 10  ? -9.049  13.818  8.555   1.00 0.00 ? 10  ARG A CZ   4  
ATOM 8782  N NH1  . ARG A 1 10  ? -10.039 13.019  8.941   1.00 0.00 ? 10  ARG A NH1  4  
ATOM 8783  N NH2  . ARG A 1 10  ? -8.212  14.318  9.455   1.00 0.00 ? 10  ARG A NH2  4  
ATOM 8784  H H    . ARG A 1 10  ? -6.106  13.976  5.773   1.00 0.00 ? 10  ARG A H    4  
ATOM 8785  H HA   . ARG A 1 10  ? -6.898  12.364  3.554   1.00 0.00 ? 10  ARG A HA   4  
ATOM 8786  H HB2  . ARG A 1 10  ? -8.045  14.817  4.857   1.00 0.00 ? 10  ARG A HB2  4  
ATOM 8787  H HB3  . ARG A 1 10  ? -8.747  14.150  3.390   1.00 0.00 ? 10  ARG A HB3  4  
ATOM 8788  H HG2  . ARG A 1 10  ? -9.655  12.396  4.461   1.00 0.00 ? 10  ARG A HG2  4  
ATOM 8789  H HG3  . ARG A 1 10  ? -8.285  12.216  5.557   1.00 0.00 ? 10  ARG A HG3  4  
ATOM 8790  H HD2  . ARG A 1 10  ? -10.304 14.441  5.773   1.00 0.00 ? 10  ARG A HD2  4  
ATOM 8791  H HD3  . ARG A 1 10  ? -10.461 12.906  6.625   1.00 0.00 ? 10  ARG A HD3  4  
ATOM 8792  H HE   . ARG A 1 10  ? -8.147  14.713  7.003   1.00 0.00 ? 10  ARG A HE   4  
ATOM 8793  H HH11 . ARG A 1 10  ? -10.676 12.635  8.258   1.00 0.00 ? 10  ARG A HH11 4  
ATOM 8794  H HH12 . ARG A 1 10  ? -10.162 12.794  9.914   1.00 0.00 ? 10  ARG A HH12 4  
ATOM 8795  H HH21 . ARG A 1 10  ? -7.456  14.928  9.162   1.00 0.00 ? 10  ARG A HH21 4  
ATOM 8796  H HH22 . ARG A 1 10  ? -8.321  14.091  10.432  1.00 0.00 ? 10  ARG A HH22 4  
ATOM 8797  N N    . ALA A 1 11  ? -5.571  15.290  2.973   1.00 0.00 ? 11  ALA A N    4  
ATOM 8798  C CA   . ALA A 1 11  ? -4.994  16.139  1.938   1.00 0.00 ? 11  ALA A CA   4  
ATOM 8799  C C    . ALA A 1 11  ? -3.924  15.369  1.173   1.00 0.00 ? 11  ALA A C    4  
ATOM 8800  O O    . ALA A 1 11  ? -3.731  15.568  -0.028  1.00 0.00 ? 11  ALA A O    4  
ATOM 8801  C CB   . ALA A 1 11  ? -4.407  17.402  2.550   1.00 0.00 ? 11  ALA A CB   4  
ATOM 8802  H H    . ALA A 1 11  ? -5.437  15.526  3.914   1.00 0.00 ? 11  ALA A H    4  
ATOM 8803  H HA   . ALA A 1 11  ? -5.784  16.422  1.256   1.00 0.00 ? 11  ALA A HA   4  
ATOM 8804  H HB1  . ALA A 1 11  ? -3.631  17.135  3.251   1.00 0.00 ? 11  ALA A HB1  4  
ATOM 8805  H HB2  . ALA A 1 11  ? -5.185  17.947  3.065   1.00 0.00 ? 11  ALA A HB2  4  
ATOM 8806  H HB3  . ALA A 1 11  ? -3.989  18.021  1.769   1.00 0.00 ? 11  ALA A HB3  4  
ATOM 8807  N N    . LEU A 1 12  ? -3.232  14.489  1.888   1.00 0.00 ? 12  LEU A N    4  
ATOM 8808  C CA   . LEU A 1 12  ? -2.194  13.663  1.294   1.00 0.00 ? 12  LEU A CA   4  
ATOM 8809  C C    . LEU A 1 12  ? -2.825  12.615  0.384   1.00 0.00 ? 12  LEU A C    4  
ATOM 8810  O O    . LEU A 1 12  ? -2.330  12.339  -0.711  1.00 0.00 ? 12  LEU A O    4  
ATOM 8811  C CB   . LEU A 1 12  ? -1.367  12.991  2.393   1.00 0.00 ? 12  LEU A CB   4  
ATOM 8812  C CG   . LEU A 1 12  ? -0.094  12.290  1.920   1.00 0.00 ? 12  LEU A CG   4  
ATOM 8813  C CD1  . LEU A 1 12  ? 0.893   13.296  1.352   1.00 0.00 ? 12  LEU A CD1  4  
ATOM 8814  C CD2  . LEU A 1 12  ? 0.536   11.503  3.059   1.00 0.00 ? 12  LEU A CD2  4  
ATOM 8815  H H    . LEU A 1 12  ? -3.422  14.401  2.847   1.00 0.00 ? 12  LEU A H    4  
ATOM 8816  H HA   . LEU A 1 12  ? -1.554  14.303  0.705   1.00 0.00 ? 12  LEU A HA   4  
ATOM 8817  H HB2  . LEU A 1 12  ? -1.090  13.746  3.114   1.00 0.00 ? 12  LEU A HB2  4  
ATOM 8818  H HB3  . LEU A 1 12  ? -1.991  12.260  2.886   1.00 0.00 ? 12  LEU A HB3  4  
ATOM 8819  H HG   . LEU A 1 12  ? -0.348  11.593  1.134   1.00 0.00 ? 12  LEU A HG   4  
ATOM 8820  H HD11 . LEU A 1 12  ? 1.766   12.776  0.981   1.00 0.00 ? 12  LEU A HD11 4  
ATOM 8821  H HD12 . LEU A 1 12  ? 1.190   13.988  2.126   1.00 0.00 ? 12  LEU A HD12 4  
ATOM 8822  H HD13 . LEU A 1 12  ? 0.427   13.839  0.543   1.00 0.00 ? 12  LEU A HD13 4  
ATOM 8823  H HD21 . LEU A 1 12  ? 0.766   12.171  3.875   1.00 0.00 ? 12  LEU A HD21 4  
ATOM 8824  H HD22 . LEU A 1 12  ? 1.445   11.034  2.712   1.00 0.00 ? 12  LEU A HD22 4  
ATOM 8825  H HD23 . LEU A 1 12  ? -0.154  10.746  3.398   1.00 0.00 ? 12  LEU A HD23 4  
ATOM 8826  N N    . VAL A 1 13  ? -3.938  12.052  0.842   1.00 0.00 ? 13  VAL A N    4  
ATOM 8827  C CA   . VAL A 1 13  ? -4.661  11.044  0.079   1.00 0.00 ? 13  VAL A CA   4  
ATOM 8828  C C    . VAL A 1 13  ? -5.168  11.636  -1.232  1.00 0.00 ? 13  VAL A C    4  
ATOM 8829  O O    . VAL A 1 13  ? -5.008  11.037  -2.296  1.00 0.00 ? 13  VAL A O    4  
ATOM 8830  C CB   . VAL A 1 13  ? -5.852  10.468  0.883   1.00 0.00 ? 13  VAL A CB   4  
ATOM 8831  C CG1  . VAL A 1 13  ? -6.638  9.466   0.049   1.00 0.00 ? 13  VAL A CG1  4  
ATOM 8832  C CG2  . VAL A 1 13  ? -5.368  9.821   2.172   1.00 0.00 ? 13  VAL A CG2  4  
ATOM 8833  H H    . VAL A 1 13  ? -4.278  12.322  1.721   1.00 0.00 ? 13  VAL A H    4  
ATOM 8834  H HA   . VAL A 1 13  ? -3.977  10.238  -0.142  1.00 0.00 ? 13  VAL A HA   4  
ATOM 8835  H HB   . VAL A 1 13  ? -6.511  11.285  1.141   1.00 0.00 ? 13  VAL A HB   4  
ATOM 8836  H HG11 . VAL A 1 13  ? -5.998  8.636   -0.217  1.00 0.00 ? 13  VAL A HG11 4  
ATOM 8837  H HG12 . VAL A 1 13  ? -6.995  9.946   -0.850  1.00 0.00 ? 13  VAL A HG12 4  
ATOM 8838  H HG13 . VAL A 1 13  ? -7.480  9.103   0.621   1.00 0.00 ? 13  VAL A HG13 4  
ATOM 8839  H HG21 . VAL A 1 13  ? -6.211  9.400   2.701   1.00 0.00 ? 13  VAL A HG21 4  
ATOM 8840  H HG22 . VAL A 1 13  ? -4.890  10.565  2.792   1.00 0.00 ? 13  VAL A HG22 4  
ATOM 8841  H HG23 . VAL A 1 13  ? -4.660  9.038   1.938   1.00 0.00 ? 13  VAL A HG23 4  
ATOM 8842  N N    . ALA A 1 14  ? -5.756  12.825  -1.148  1.00 0.00 ? 14  ALA A N    4  
ATOM 8843  C CA   . ALA A 1 14  ? -6.284  13.510  -2.322  1.00 0.00 ? 14  ALA A CA   4  
ATOM 8844  C C    . ALA A 1 14  ? -5.187  13.756  -3.354  1.00 0.00 ? 14  ALA A C    4  
ATOM 8845  O O    . ALA A 1 14  ? -5.425  13.664  -4.559  1.00 0.00 ? 14  ALA A O    4  
ATOM 8846  C CB   . ALA A 1 14  ? -6.933  14.824  -1.916  1.00 0.00 ? 14  ALA A CB   4  
ATOM 8847  H H    . ALA A 1 14  ? -5.841  13.254  -0.267  1.00 0.00 ? 14  ALA A H    4  
ATOM 8848  H HA   . ALA A 1 14  ? -7.045  12.882  -2.764  1.00 0.00 ? 14  ALA A HA   4  
ATOM 8849  H HB1  . ALA A 1 14  ? -7.642  14.643  -1.122  1.00 0.00 ? 14  ALA A HB1  4  
ATOM 8850  H HB2  . ALA A 1 14  ? -7.445  15.250  -2.766  1.00 0.00 ? 14  ALA A HB2  4  
ATOM 8851  H HB3  . ALA A 1 14  ? -6.172  15.508  -1.572  1.00 0.00 ? 14  ALA A HB3  4  
ATOM 8852  N N    . ASP A 1 15  ? -3.982  14.051  -2.872  1.00 0.00 ? 15  ASP A N    4  
ATOM 8853  C CA   . ASP A 1 15  ? -2.840  14.302  -3.749  1.00 0.00 ? 15  ASP A CA   4  
ATOM 8854  C C    . ASP A 1 15  ? -2.513  13.060  -4.565  1.00 0.00 ? 15  ASP A C    4  
ATOM 8855  O O    . ASP A 1 15  ? -2.426  13.119  -5.790  1.00 0.00 ? 15  ASP A O    4  
ATOM 8856  C CB   . ASP A 1 15  ? -1.611  14.718  -2.935  1.00 0.00 ? 15  ASP A CB   4  
ATOM 8857  C CG   . ASP A 1 15  ? -0.340  14.756  -3.767  1.00 0.00 ? 15  ASP A CG   4  
ATOM 8858  O OD1  . ASP A 1 15  ? -0.169  15.703  -4.566  1.00 0.00 ? 15  ASP A OD1  4  
ATOM 8859  O OD2  . ASP A 1 15  ? 0.504   13.846  -3.618  1.00 0.00 ? 15  ASP A OD2  4  
ATOM 8860  H H    . ASP A 1 15  ? -3.857  14.099  -1.900  1.00 0.00 ? 15  ASP A H    4  
ATOM 8861  H HA   . ASP A 1 15  ? -3.106  15.103  -4.423  1.00 0.00 ? 15  ASP A HA   4  
ATOM 8862  H HB2  . ASP A 1 15  ? -1.778  15.703  -2.525  1.00 0.00 ? 15  ASP A HB2  4  
ATOM 8863  H HB3  . ASP A 1 15  ? -1.470  14.017  -2.126  1.00 0.00 ? 15  ASP A HB3  4  
ATOM 8864  N N    . PHE A 1 16  ? -2.366  11.934  -3.877  1.00 0.00 ? 16  PHE A N    4  
ATOM 8865  C CA   . PHE A 1 16  ? -2.047  10.670  -4.531  1.00 0.00 ? 16  PHE A CA   4  
ATOM 8866  C C    . PHE A 1 16  ? -3.162  10.248  -5.485  1.00 0.00 ? 16  PHE A C    4  
ATOM 8867  O O    . PHE A 1 16  ? -2.895  9.825   -6.608  1.00 0.00 ? 16  PHE A O    4  
ATOM 8868  C CB   . PHE A 1 16  ? -1.804  9.577   -3.490  1.00 0.00 ? 16  PHE A CB   4  
ATOM 8869  C CG   . PHE A 1 16  ? -1.188  8.323   -4.054  1.00 0.00 ? 16  PHE A CG   4  
ATOM 8870  C CD1  . PHE A 1 16  ? 0.032   8.367   -4.713  1.00 0.00 ? 16  PHE A CD1  4  
ATOM 8871  C CD2  . PHE A 1 16  ? -1.826  7.100   -3.920  1.00 0.00 ? 16  PHE A CD2  4  
ATOM 8872  C CE1  . PHE A 1 16  ? 0.601   7.218   -5.227  1.00 0.00 ? 16  PHE A CE1  4  
ATOM 8873  C CE2  . PHE A 1 16  ? -1.260  5.946   -4.433  1.00 0.00 ? 16  PHE A CE2  4  
ATOM 8874  C CZ   . PHE A 1 16  ? -0.046  6.006   -5.087  1.00 0.00 ? 16  PHE A CZ   4  
ATOM 8875  H H    . PHE A 1 16  ? -2.472  11.954  -2.901  1.00 0.00 ? 16  PHE A H    4  
ATOM 8876  H HA   . PHE A 1 16  ? -1.141  10.813  -5.103  1.00 0.00 ? 16  PHE A HA   4  
ATOM 8877  H HB2  . PHE A 1 16  ? -1.138  9.959   -2.730  1.00 0.00 ? 16  PHE A HB2  4  
ATOM 8878  H HB3  . PHE A 1 16  ? -2.747  9.312   -3.032  1.00 0.00 ? 16  PHE A HB3  4  
ATOM 8879  H HD1  . PHE A 1 16  ? 0.538   9.314   -4.824  1.00 0.00 ? 16  PHE A HD1  4  
ATOM 8880  H HD2  . PHE A 1 16  ? -2.778  7.053   -3.409  1.00 0.00 ? 16  PHE A HD2  4  
ATOM 8881  H HE1  . PHE A 1 16  ? 1.550   7.268   -5.739  1.00 0.00 ? 16  PHE A HE1  4  
ATOM 8882  H HE2  . PHE A 1 16  ? -1.767  4.999   -4.320  1.00 0.00 ? 16  PHE A HE2  4  
ATOM 8883  H HZ   . PHE A 1 16  ? 0.398   5.105   -5.486  1.00 0.00 ? 16  PHE A HZ   4  
ATOM 8884  N N    . VAL A 1 17  ? -4.410  10.371  -5.040  1.00 0.00 ? 17  VAL A N    4  
ATOM 8885  C CA   . VAL A 1 17  ? -5.552  10.005  -5.871  1.00 0.00 ? 17  VAL A CA   4  
ATOM 8886  C C    . VAL A 1 17  ? -5.588  10.868  -7.131  1.00 0.00 ? 17  VAL A C    4  
ATOM 8887  O O    . VAL A 1 17  ? -5.733  10.356  -8.245  1.00 0.00 ? 17  VAL A O    4  
ATOM 8888  C CB   . VAL A 1 17  ? -6.888  10.141  -5.102  1.00 0.00 ? 17  VAL A CB   4  
ATOM 8889  C CG1  . VAL A 1 17  ? -8.074  9.919   -6.030  1.00 0.00 ? 17  VAL A CG1  4  
ATOM 8890  C CG2  . VAL A 1 17  ? -6.933  9.162   -3.940  1.00 0.00 ? 17  VAL A CG2  4  
ATOM 8891  H H    . VAL A 1 17  ? -4.566  10.715  -4.132  1.00 0.00 ? 17  VAL A H    4  
ATOM 8892  H HA   . VAL A 1 17  ? -5.430  8.970   -6.161  1.00 0.00 ? 17  VAL A HA   4  
ATOM 8893  H HB   . VAL A 1 17  ? -6.952  11.141  -4.703  1.00 0.00 ? 17  VAL A HB   4  
ATOM 8894  H HG11 . VAL A 1 17  ? -8.008  8.936   -6.470  1.00 0.00 ? 17  VAL A HG11 4  
ATOM 8895  H HG12 . VAL A 1 17  ? -8.065  10.666  -6.812  1.00 0.00 ? 17  VAL A HG12 4  
ATOM 8896  H HG13 . VAL A 1 17  ? -8.991  9.999   -5.466  1.00 0.00 ? 17  VAL A HG13 4  
ATOM 8897  H HG21 . VAL A 1 17  ? -6.957  8.152   -4.321  1.00 0.00 ? 17  VAL A HG21 4  
ATOM 8898  H HG22 . VAL A 1 17  ? -7.819  9.344   -3.349  1.00 0.00 ? 17  VAL A HG22 4  
ATOM 8899  H HG23 . VAL A 1 17  ? -6.056  9.292   -3.323  1.00 0.00 ? 17  VAL A HG23 4  
ATOM 8900  N N    . GLY A 1 18  ? -5.434  12.175  -6.950  1.00 0.00 ? 18  GLY A N    4  
ATOM 8901  C CA   . GLY A 1 18  ? -5.435  13.084  -8.077  1.00 0.00 ? 18  GLY A CA   4  
ATOM 8902  C C    . GLY A 1 18  ? -4.245  12.844  -8.986  1.00 0.00 ? 18  GLY A C    4  
ATOM 8903  O O    . GLY A 1 18  ? -4.344  12.963  -10.206 1.00 0.00 ? 18  GLY A O    4  
ATOM 8904  H H    . GLY A 1 18  ? -5.320  12.529  -6.037  1.00 0.00 ? 18  GLY A H    4  
ATOM 8905  H HA2  . GLY A 1 18  ? -6.345  12.942  -8.642  1.00 0.00 ? 18  GLY A HA2  4  
ATOM 8906  H HA3  . GLY A 1 18  ? -5.400  14.098  -7.712  1.00 0.00 ? 18  GLY A HA3  4  
ATOM 8907  N N    . TYR A 1 19  ? -3.110  12.509  -8.381  1.00 0.00 ? 19  TYR A N    4  
ATOM 8908  C CA   . TYR A 1 19  ? -1.891  12.230  -9.126  1.00 0.00 ? 19  TYR A CA   4  
ATOM 8909  C C    . TYR A 1 19  ? -2.084  10.990  -9.989  1.00 0.00 ? 19  TYR A C    4  
ATOM 8910  O O    . TYR A 1 19  ? -1.821  11.012  -11.187 1.00 0.00 ? 19  TYR A O    4  
ATOM 8911  C CB   . TYR A 1 19  ? -0.720  12.028  -8.157  1.00 0.00 ? 19  TYR A CB   4  
ATOM 8912  C CG   . TYR A 1 19  ? 0.646   12.017  -8.812  1.00 0.00 ? 19  TYR A CG   4  
ATOM 8913  C CD1  . TYR A 1 19  ? 1.116   13.125  -9.506  1.00 0.00 ? 19  TYR A CD1  4  
ATOM 8914  C CD2  . TYR A 1 19  ? 1.471   10.903  -8.717  1.00 0.00 ? 19  TYR A CD2  4  
ATOM 8915  C CE1  . TYR A 1 19  ? 2.370   13.122  -10.088 1.00 0.00 ? 19  TYR A CE1  4  
ATOM 8916  C CE2  . TYR A 1 19  ? 2.724   10.891  -9.299  1.00 0.00 ? 19  TYR A CE2  4  
ATOM 8917  C CZ   . TYR A 1 19  ? 3.170   12.004  -9.982  1.00 0.00 ? 19  TYR A CZ   4  
ATOM 8918  O OH   . TYR A 1 19  ? 4.424   12.003  -10.552 1.00 0.00 ? 19  TYR A OH   4  
ATOM 8919  H H    . TYR A 1 19  ? -3.091  12.450  -7.398  1.00 0.00 ? 19  TYR A H    4  
ATOM 8920  H HA   . TYR A 1 19  ? -1.683  13.075  -9.765  1.00 0.00 ? 19  TYR A HA   4  
ATOM 8921  H HB2  . TYR A 1 19  ? -0.727  12.826  -7.432  1.00 0.00 ? 19  TYR A HB2  4  
ATOM 8922  H HB3  . TYR A 1 19  ? -0.850  11.085  -7.644  1.00 0.00 ? 19  TYR A HB3  4  
ATOM 8923  H HD1  . TYR A 1 19  ? 0.487   13.998  -9.587  1.00 0.00 ? 19  TYR A HD1  4  
ATOM 8924  H HD2  . TYR A 1 19  ? 1.119   10.033  -8.182  1.00 0.00 ? 19  TYR A HD2  4  
ATOM 8925  H HE1  . TYR A 1 19  ? 2.719   13.992  -10.622 1.00 0.00 ? 19  TYR A HE1  4  
ATOM 8926  H HE2  . TYR A 1 19  ? 3.350   10.016  -9.215  1.00 0.00 ? 19  TYR A HE2  4  
ATOM 8927  H HH   . TYR A 1 19  ? 4.533   11.209  -11.099 1.00 0.00 ? 19  TYR A HH   4  
ATOM 8928  N N    . LYS A 1 20  ? -2.585  9.924   -9.368  1.00 0.00 ? 20  LYS A N    4  
ATOM 8929  C CA   . LYS A 1 20  ? -2.831  8.660   -10.060 1.00 0.00 ? 20  LYS A CA   4  
ATOM 8930  C C    . LYS A 1 20  ? -3.783  8.850   -11.235 1.00 0.00 ? 20  LYS A C    4  
ATOM 8931  O O    . LYS A 1 20  ? -3.597  8.262   -12.302 1.00 0.00 ? 20  LYS A O    4  
ATOM 8932  C CB   . LYS A 1 20  ? -3.411  7.630   -9.087  1.00 0.00 ? 20  LYS A CB   4  
ATOM 8933  C CG   . LYS A 1 20  ? -2.371  6.988   -8.181  1.00 0.00 ? 20  LYS A CG   4  
ATOM 8934  C CD   . LYS A 1 20  ? -1.469  6.042   -8.953  1.00 0.00 ? 20  LYS A CD   4  
ATOM 8935  C CE   . LYS A 1 20  ? -2.238  4.835   -9.467  1.00 0.00 ? 20  LYS A CE   4  
ATOM 8936  N NZ   . LYS A 1 20  ? -1.421  4.011   -10.392 1.00 0.00 ? 20  LYS A NZ   4  
ATOM 8937  H H    . LYS A 1 20  ? -2.792  9.986   -8.407  1.00 0.00 ? 20  LYS A H    4  
ATOM 8938  H HA   . LYS A 1 20  ? -1.885  8.297   -10.434 1.00 0.00 ? 20  LYS A HA   4  
ATOM 8939  H HB2  . LYS A 1 20  ? -4.148  8.116   -8.464  1.00 0.00 ? 20  LYS A HB2  4  
ATOM 8940  H HB3  . LYS A 1 20  ? -3.893  6.849   -9.656  1.00 0.00 ? 20  LYS A HB3  4  
ATOM 8941  H HG2  . LYS A 1 20  ? -1.765  7.764   -7.737  1.00 0.00 ? 20  LYS A HG2  4  
ATOM 8942  H HG3  . LYS A 1 20  ? -2.878  6.435   -7.404  1.00 0.00 ? 20  LYS A HG3  4  
ATOM 8943  H HD2  . LYS A 1 20  ? -1.046  6.569   -9.794  1.00 0.00 ? 20  LYS A HD2  4  
ATOM 8944  H HD3  . LYS A 1 20  ? -0.678  5.704   -8.301  1.00 0.00 ? 20  LYS A HD3  4  
ATOM 8945  H HE2  . LYS A 1 20  ? -2.534  4.226   -8.626  1.00 0.00 ? 20  LYS A HE2  4  
ATOM 8946  H HE3  . LYS A 1 20  ? -3.118  5.181   -9.988  1.00 0.00 ? 20  LYS A HE3  4  
ATOM 8947  H HZ1  . LYS A 1 20  ? -1.270  4.524   -11.290 1.00 0.00 ? 20  LYS A HZ1  4  
ATOM 8948  H HZ2  . LYS A 1 20  ? -1.907  3.114   -10.596 1.00 0.00 ? 20  LYS A HZ2  4  
ATOM 8949  H HZ3  . LYS A 1 20  ? -0.492  3.804   -9.965  1.00 0.00 ? 20  LYS A HZ3  4  
ATOM 8950  N N    . LEU A 1 21  ? -4.803  9.672   -11.033 1.00 0.00 ? 21  LEU A N    4  
ATOM 8951  C CA   . LEU A 1 21  ? -5.780  9.943   -12.077 1.00 0.00 ? 21  LEU A CA   4  
ATOM 8952  C C    . LEU A 1 21  ? -5.134  10.687  -13.244 1.00 0.00 ? 21  LEU A C    4  
ATOM 8953  O O    . LEU A 1 21  ? -5.500  10.492  -14.400 1.00 0.00 ? 21  LEU A O    4  
ATOM 8954  C CB   . LEU A 1 21  ? -6.946  10.759  -11.515 1.00 0.00 ? 21  LEU A CB   4  
ATOM 8955  C CG   . LEU A 1 21  ? -8.103  10.997  -12.490 1.00 0.00 ? 21  LEU A CG   4  
ATOM 8956  C CD1  . LEU A 1 21  ? -8.835  9.699   -12.785 1.00 0.00 ? 21  LEU A CD1  4  
ATOM 8957  C CD2  . LEU A 1 21  ? -9.065  12.035  -11.937 1.00 0.00 ? 21  LEU A CD2  4  
ATOM 8958  H H    . LEU A 1 21  ? -4.908  10.097  -10.152 1.00 0.00 ? 21  LEU A H    4  
ATOM 8959  H HA   . LEU A 1 21  ? -6.154  8.996   -12.435 1.00 0.00 ? 21  LEU A HA   4  
ATOM 8960  H HB2  . LEU A 1 21  ? -7.332  10.241  -10.648 1.00 0.00 ? 21  LEU A HB2  4  
ATOM 8961  H HB3  . LEU A 1 21  ? -6.566  11.719  -11.199 1.00 0.00 ? 21  LEU A HB3  4  
ATOM 8962  H HG   . LEU A 1 21  ? -7.705  11.372  -13.422 1.00 0.00 ? 21  LEU A HG   4  
ATOM 8963  H HD11 . LEU A 1 21  ? -9.254  9.306   -11.871 1.00 0.00 ? 21  LEU A HD11 4  
ATOM 8964  H HD12 . LEU A 1 21  ? -8.143  8.983   -13.201 1.00 0.00 ? 21  LEU A HD12 4  
ATOM 8965  H HD13 . LEU A 1 21  ? -9.628  9.889   -13.493 1.00 0.00 ? 21  LEU A HD13 4  
ATOM 8966  H HD21 . LEU A 1 21  ? -8.569  12.992  -11.887 1.00 0.00 ? 21  LEU A HD21 4  
ATOM 8967  H HD22 . LEU A 1 21  ? -9.381  11.740  -10.949 1.00 0.00 ? 21  LEU A HD22 4  
ATOM 8968  H HD23 . LEU A 1 21  ? -9.927  12.108  -12.584 1.00 0.00 ? 21  LEU A HD23 4  
ATOM 8969  N N    . ARG A 1 22  ? -4.156  11.525  -12.936 1.00 0.00 ? 22  ARG A N    4  
ATOM 8970  C CA   . ARG A 1 22  ? -3.465  12.298  -13.958 1.00 0.00 ? 22  ARG A CA   4  
ATOM 8971  C C    . ARG A 1 22  ? -2.381  11.475  -14.643 1.00 0.00 ? 22  ARG A C    4  
ATOM 8972  O O    . ARG A 1 22  ? -1.992  11.775  -15.768 1.00 0.00 ? 22  ARG A O    4  
ATOM 8973  C CB   . ARG A 1 22  ? -2.854  13.555  -13.344 1.00 0.00 ? 22  ARG A CB   4  
ATOM 8974  C CG   . ARG A 1 22  ? -3.867  14.659  -13.095 1.00 0.00 ? 22  ARG A CG   4  
ATOM 8975  C CD   . ARG A 1 22  ? -3.266  15.798  -12.292 1.00 0.00 ? 22  ARG A CD   4  
ATOM 8976  N NE   . ARG A 1 22  ? -3.150  15.464  -10.874 1.00 0.00 ? 22  ARG A NE   4  
ATOM 8977  C CZ   . ARG A 1 22  ? -2.570  16.250  -9.965  1.00 0.00 ? 22  ARG A CZ   4  
ATOM 8978  N NH1  . ARG A 1 22  ? -2.059  17.424  -10.327 1.00 0.00 ? 22  ARG A NH1  4  
ATOM 8979  N NH2  . ARG A 1 22  ? -2.504  15.862  -8.695  1.00 0.00 ? 22  ARG A NH2  4  
ATOM 8980  H H    . ARG A 1 22  ? -3.893  11.628  -11.996 1.00 0.00 ? 22  ARG A H    4  
ATOM 8981  H HA   . ARG A 1 22  ? -4.195  12.591  -14.697 1.00 0.00 ? 22  ARG A HA   4  
ATOM 8982  H HB2  . ARG A 1 22  ? -2.396  13.295  -12.402 1.00 0.00 ? 22  ARG A HB2  4  
ATOM 8983  H HB3  . ARG A 1 22  ? -2.097  13.936  -14.011 1.00 0.00 ? 22  ARG A HB3  4  
ATOM 8984  H HG2  . ARG A 1 22  ? -4.207  15.043  -14.045 1.00 0.00 ? 22  ARG A HG2  4  
ATOM 8985  H HG3  . ARG A 1 22  ? -4.705  14.250  -12.549 1.00 0.00 ? 22  ARG A HG3  4  
ATOM 8986  H HD2  . ARG A 1 22  ? -2.283  16.017  -12.683 1.00 0.00 ? 22  ARG A HD2  4  
ATOM 8987  H HD3  . ARG A 1 22  ? -3.897  16.668  -12.398 1.00 0.00 ? 22  ARG A HD3  4  
ATOM 8988  H HE   . ARG A 1 22  ? -3.534  14.603  -10.586 1.00 0.00 ? 22  ARG A HE   4  
ATOM 8989  H HH11 . ARG A 1 22  ? -2.109  17.726  -11.287 1.00 0.00 ? 22  ARG A HH11 4  
ATOM 8990  H HH12 . ARG A 1 22  ? -1.630  18.023  -9.639  1.00 0.00 ? 22  ARG A HH12 4  
ATOM 8991  H HH21 . ARG A 1 22  ? -2.890  14.982  -8.416  1.00 0.00 ? 22  ARG A HH21 4  
ATOM 8992  H HH22 . ARG A 1 22  ? -2.065  16.454  -8.002  1.00 0.00 ? 22  ARG A HH22 4  
ATOM 8993  N N    . GLN A 1 23  ? -1.912  10.432  -13.971 1.00 0.00 ? 23  GLN A N    4  
ATOM 8994  C CA   . GLN A 1 23  ? -0.864  9.572   -14.517 1.00 0.00 ? 23  GLN A CA   4  
ATOM 8995  C C    . GLN A 1 23  ? -1.310  8.889   -15.808 1.00 0.00 ? 23  GLN A C    4  
ATOM 8996  O O    . GLN A 1 23  ? -0.482  8.544   -16.652 1.00 0.00 ? 23  GLN A O    4  
ATOM 8997  C CB   . GLN A 1 23  ? -0.452  8.509   -13.497 1.00 0.00 ? 23  GLN A CB   4  
ATOM 8998  C CG   . GLN A 1 23  ? 0.290   9.067   -12.294 1.00 0.00 ? 23  GLN A CG   4  
ATOM 8999  C CD   . GLN A 1 23  ? 1.479   9.922   -12.684 1.00 0.00 ? 23  GLN A CD   4  
ATOM 9000  O OE1  . GLN A 1 23  ? 1.374   11.143  -12.795 1.00 0.00 ? 23  GLN A OE1  4  
ATOM 9001  N NE2  . GLN A 1 23  ? 2.615   9.282   -12.910 1.00 0.00 ? 23  GLN A NE2  4  
ATOM 9002  H H    . GLN A 1 23  ? -2.267  10.243  -13.076 1.00 0.00 ? 23  GLN A H    4  
ATOM 9003  H HA   . GLN A 1 23  ? -0.008  10.193  -14.734 1.00 0.00 ? 23  GLN A HA   4  
ATOM 9004  H HB2  . GLN A 1 23  ? -1.339  8.004   -13.142 1.00 0.00 ? 23  GLN A HB2  4  
ATOM 9005  H HB3  . GLN A 1 23  ? 0.188   7.789   -13.984 1.00 0.00 ? 23  GLN A HB3  4  
ATOM 9006  H HG2  . GLN A 1 23  ? -0.393  9.669   -11.713 1.00 0.00 ? 23  GLN A HG2  4  
ATOM 9007  H HG3  . GLN A 1 23  ? 0.641   8.242   -11.690 1.00 0.00 ? 23  GLN A HG3  4  
ATOM 9008  H HE21 . GLN A 1 23  ? 2.624   8.300   -12.819 1.00 0.00 ? 23  GLN A HE21 4  
ATOM 9009  H HE22 . GLN A 1 23  ? 3.403   9.811   -13.154 1.00 0.00 ? 23  GLN A HE22 4  
ATOM 9010  N N    . LYS A 1 24  ? -2.615  8.701   -15.961 1.00 0.00 ? 24  LYS A N    4  
ATOM 9011  C CA   . LYS A 1 24  ? -3.154  8.051   -17.150 1.00 0.00 ? 24  LYS A CA   4  
ATOM 9012  C C    . LYS A 1 24  ? -3.580  9.075   -18.200 1.00 0.00 ? 24  LYS A C    4  
ATOM 9013  O O    . LYS A 1 24  ? -4.105  8.713   -19.254 1.00 0.00 ? 24  LYS A O    4  
ATOM 9014  C CB   . LYS A 1 24  ? -4.338  7.141   -16.779 1.00 0.00 ? 24  LYS A CB   4  
ATOM 9015  C CG   . LYS A 1 24  ? -5.464  7.840   -16.027 1.00 0.00 ? 24  LYS A CG   4  
ATOM 9016  C CD   . LYS A 1 24  ? -6.597  8.256   -16.958 1.00 0.00 ? 24  LYS A CD   4  
ATOM 9017  C CE   . LYS A 1 24  ? -7.724  8.941   -16.200 1.00 0.00 ? 24  LYS A CE   4  
ATOM 9018  N NZ   . LYS A 1 24  ? -8.816  9.395   -17.103 1.00 0.00 ? 24  LYS A NZ   4  
ATOM 9019  H H    . LYS A 1 24  ? -3.228  9.003   -15.259 1.00 0.00 ? 24  LYS A H    4  
ATOM 9020  H HA   . LYS A 1 24  ? -2.369  7.440   -17.570 1.00 0.00 ? 24  LYS A HA   4  
ATOM 9021  H HB2  . LYS A 1 24  ? -4.749  6.725   -17.685 1.00 0.00 ? 24  LYS A HB2  4  
ATOM 9022  H HB3  . LYS A 1 24  ? -3.971  6.333   -16.161 1.00 0.00 ? 24  LYS A HB3  4  
ATOM 9023  H HG2  . LYS A 1 24  ? -5.856  7.164   -15.280 1.00 0.00 ? 24  LYS A HG2  4  
ATOM 9024  H HG3  . LYS A 1 24  ? -5.067  8.719   -15.543 1.00 0.00 ? 24  LYS A HG3  4  
ATOM 9025  H HD2  . LYS A 1 24  ? -6.208  8.940   -17.698 1.00 0.00 ? 24  LYS A HD2  4  
ATOM 9026  H HD3  . LYS A 1 24  ? -6.987  7.377   -17.448 1.00 0.00 ? 24  LYS A HD3  4  
ATOM 9027  H HE2  . LYS A 1 24  ? -8.133  8.244   -15.482 1.00 0.00 ? 24  LYS A HE2  4  
ATOM 9028  H HE3  . LYS A 1 24  ? -7.321  9.796   -15.677 1.00 0.00 ? 24  LYS A HE3  4  
ATOM 9029  H HZ1  . LYS A 1 24  ? -9.127  8.611   -17.714 1.00 0.00 ? 24  LYS A HZ1  4  
ATOM 9030  H HZ2  . LYS A 1 24  ? -8.487  10.181  -17.706 1.00 0.00 ? 24  LYS A HZ2  4  
ATOM 9031  H HZ3  . LYS A 1 24  ? -9.633  9.725   -16.543 1.00 0.00 ? 24  LYS A HZ3  4  
ATOM 9032  N N    . GLY A 1 25  ? -3.344  10.349  -17.920 1.00 0.00 ? 25  GLY A N    4  
ATOM 9033  C CA   . GLY A 1 25  ? -3.728  11.391  -18.853 1.00 0.00 ? 25  GLY A CA   4  
ATOM 9034  C C    . GLY A 1 25  ? -2.578  12.314  -19.199 1.00 0.00 ? 25  GLY A C    4  
ATOM 9035  O O    . GLY A 1 25  ? -2.188  12.423  -20.360 1.00 0.00 ? 25  GLY A O    4  
ATOM 9036  H H    . GLY A 1 25  ? -2.894  10.585  -17.079 1.00 0.00 ? 25  GLY A H    4  
ATOM 9037  H HA2  . GLY A 1 25  ? -4.088  10.931  -19.760 1.00 0.00 ? 25  GLY A HA2  4  
ATOM 9038  H HA3  . GLY A 1 25  ? -4.525  11.976  -18.418 1.00 0.00 ? 25  GLY A HA3  4  
ATOM 9039  N N    . TYR A 1 26  ? -2.035  12.974  -18.188 1.00 0.00 ? 26  TYR A N    4  
ATOM 9040  C CA   . TYR A 1 26  ? -0.926  13.897  -18.375 1.00 0.00 ? 26  TYR A CA   4  
ATOM 9041  C C    . TYR A 1 26  ? -0.162  14.058  -17.069 1.00 0.00 ? 26  TYR A C    4  
ATOM 9042  O O    . TYR A 1 26  ? -0.630  14.721  -16.141 1.00 0.00 ? 26  TYR A O    4  
ATOM 9043  C CB   . TYR A 1 26  ? -1.436  15.258  -18.860 1.00 0.00 ? 26  TYR A CB   4  
ATOM 9044  C CG   . TYR A 1 26  ? -0.396  16.073  -19.602 1.00 0.00 ? 26  TYR A CG   4  
ATOM 9045  C CD1  . TYR A 1 26  ? 0.533   16.848  -18.917 1.00 0.00 ? 26  TYR A CD1  4  
ATOM 9046  C CD2  . TYR A 1 26  ? -0.345  16.066  -20.990 1.00 0.00 ? 26  TYR A CD2  4  
ATOM 9047  C CE1  . TYR A 1 26  ? 1.479   17.592  -19.595 1.00 0.00 ? 26  TYR A CE1  4  
ATOM 9048  C CE2  . TYR A 1 26  ? 0.599   16.807  -21.674 1.00 0.00 ? 26  TYR A CE2  4  
ATOM 9049  C CZ   . TYR A 1 26  ? 1.508   17.566  -20.972 1.00 0.00 ? 26  TYR A CZ   4  
ATOM 9050  O OH   . TYR A 1 26  ? 2.449   18.304  -21.652 1.00 0.00 ? 26  TYR A OH   4  
ATOM 9051  H H    . TYR A 1 26  ? -2.380  12.826  -17.279 1.00 0.00 ? 26  TYR A H    4  
ATOM 9052  H HA   . TYR A 1 26  ? -0.265  13.480  -19.121 1.00 0.00 ? 26  TYR A HA   4  
ATOM 9053  H HB2  . TYR A 1 26  ? -2.269  15.102  -19.528 1.00 0.00 ? 26  TYR A HB2  4  
ATOM 9054  H HB3  . TYR A 1 26  ? -1.766  15.836  -18.008 1.00 0.00 ? 26  TYR A HB3  4  
ATOM 9055  H HD1  . TYR A 1 26  ? 0.510   16.865  -17.836 1.00 0.00 ? 26  TYR A HD1  4  
ATOM 9056  H HD2  . TYR A 1 26  ? -1.059  15.469  -21.539 1.00 0.00 ? 26  TYR A HD2  4  
ATOM 9057  H HE1  . TYR A 1 26  ? 2.193   18.185  -19.045 1.00 0.00 ? 26  TYR A HE1  4  
ATOM 9058  H HE2  . TYR A 1 26  ? 0.622   16.787  -22.755 1.00 0.00 ? 26  TYR A HE2  4  
ATOM 9059  H HH   . TYR A 1 26  ? 3.207   17.737  -21.858 1.00 0.00 ? 26  TYR A HH   4  
ATOM 9060  N N    . VAL A 1 27  ? 0.998   13.427  -16.994 1.00 0.00 ? 27  VAL A N    4  
ATOM 9061  C CA   . VAL A 1 27  ? 1.834   13.502  -15.805 1.00 0.00 ? 27  VAL A CA   4  
ATOM 9062  C C    . VAL A 1 27  ? 2.346   14.925  -15.600 1.00 0.00 ? 27  VAL A C    4  
ATOM 9063  O O    . VAL A 1 27  ? 3.020   15.485  -16.466 1.00 0.00 ? 27  VAL A O    4  
ATOM 9064  C CB   . VAL A 1 27  ? 3.034   12.529  -15.896 1.00 0.00 ? 27  VAL A CB   4  
ATOM 9065  C CG1  . VAL A 1 27  ? 3.909   12.618  -14.649 1.00 0.00 ? 27  VAL A CG1  4  
ATOM 9066  C CG2  . VAL A 1 27  ? 2.550   11.103  -16.113 1.00 0.00 ? 27  VAL A CG2  4  
ATOM 9067  H H    . VAL A 1 27  ? 1.300   12.890  -17.762 1.00 0.00 ? 27  VAL A H    4  
ATOM 9068  H HA   . VAL A 1 27  ? 1.229   13.220  -14.956 1.00 0.00 ? 27  VAL A HA   4  
ATOM 9069  H HB   . VAL A 1 27  ? 3.636   12.811  -16.749 1.00 0.00 ? 27  VAL A HB   4  
ATOM 9070  H HG11 . VAL A 1 27  ? 3.310   12.421  -13.771 1.00 0.00 ? 27  VAL A HG11 4  
ATOM 9071  H HG12 . VAL A 1 27  ? 4.335   13.609  -14.579 1.00 0.00 ? 27  VAL A HG12 4  
ATOM 9072  H HG13 . VAL A 1 27  ? 4.703   11.890  -14.713 1.00 0.00 ? 27  VAL A HG13 4  
ATOM 9073  H HG21 . VAL A 1 27  ? 1.864   11.080  -16.948 1.00 0.00 ? 27  VAL A HG21 4  
ATOM 9074  H HG22 . VAL A 1 27  ? 2.048   10.752  -15.225 1.00 0.00 ? 27  VAL A HG22 4  
ATOM 9075  H HG23 . VAL A 1 27  ? 3.395   10.465  -16.326 1.00 0.00 ? 27  VAL A HG23 4  
ATOM 9076  N N    . CYS A 1 28  ? 2.008   15.512  -14.462 1.00 0.00 ? 28  CYS A N    4  
ATOM 9077  C CA   . CYS A 1 28  ? 2.434   16.864  -14.145 1.00 0.00 ? 28  CYS A CA   4  
ATOM 9078  C C    . CYS A 1 28  ? 3.077   16.903  -12.768 1.00 0.00 ? 28  CYS A C    4  
ATOM 9079  O O    . CYS A 1 28  ? 2.384   16.926  -11.751 1.00 0.00 ? 28  CYS A O    4  
ATOM 9080  C CB   . CYS A 1 28  ? 1.248   17.825  -14.194 1.00 0.00 ? 28  CYS A CB   4  
ATOM 9081  S SG   . CYS A 1 28  ? 1.692   19.572  -14.015 1.00 0.00 ? 28  CYS A SG   4  
ATOM 9082  H H    . CYS A 1 28  ? 1.458   15.023  -13.816 1.00 0.00 ? 28  CYS A H    4  
ATOM 9083  H HA   . CYS A 1 28  ? 3.164   17.164  -14.882 1.00 0.00 ? 28  CYS A HA   4  
ATOM 9084  H HB2  . CYS A 1 28  ? 0.743   17.713  -15.141 1.00 0.00 ? 28  CYS A HB2  4  
ATOM 9085  H HB3  . CYS A 1 28  ? 0.564   17.578  -13.394 1.00 0.00 ? 28  CYS A HB3  4  
ATOM 9086  H HG   . CYS A 1 28  ? 2.985   19.640  -13.699 1.00 0.00 ? 28  CYS A HG   4  
ATOM 9087  N N    . GLY A 1 29  ? 4.398   16.890  -12.741 1.00 0.00 ? 29  GLY A N    4  
ATOM 9088  C CA   . GLY A 1 29  ? 5.112   16.925  -11.486 1.00 0.00 ? 29  GLY A CA   4  
ATOM 9089  C C    . GLY A 1 29  ? 6.592   17.122  -11.687 1.00 0.00 ? 29  GLY A C    4  
ATOM 9090  O O    . GLY A 1 29  ? 7.014   17.964  -12.483 1.00 0.00 ? 29  GLY A O    4  
ATOM 9091  H H    . GLY A 1 29  ? 4.900   16.858  -13.588 1.00 0.00 ? 29  GLY A H    4  
ATOM 9092  H HA2  . GLY A 1 29  ? 4.726   17.734  -10.882 1.00 0.00 ? 29  GLY A HA2  4  
ATOM 9093  H HA3  . GLY A 1 29  ? 4.954   15.993  -10.967 1.00 0.00 ? 29  GLY A HA3  4  
ATOM 9094  N N    . ALA A 1 30  ? 7.382   16.337  -10.986 1.00 0.00 ? 30  ALA A N    4  
ATOM 9095  C CA   . ALA A 1 30  ? 8.827   16.427  -11.088 1.00 0.00 ? 30  ALA A CA   4  
ATOM 9096  C C    . ALA A 1 30  ? 9.445   15.039  -11.051 1.00 0.00 ? 30  ALA A C    4  
ATOM 9097  O O    . ALA A 1 30  ? 8.745   14.047  -10.838 1.00 0.00 ? 30  ALA A O    4  
ATOM 9098  C CB   . ALA A 1 30  ? 9.380   17.289  -9.964  1.00 0.00 ? 30  ALA A CB   4  
ATOM 9099  H H    . ALA A 1 30  ? 6.984   15.662  -10.388 1.00 0.00 ? 30  ALA A H    4  
ATOM 9100  H HA   . ALA A 1 30  ? 9.068   16.899  -12.030 1.00 0.00 ? 30  ALA A HA   4  
ATOM 9101  H HB1  . ALA A 1 30  ? 10.454  17.356  -10.061 1.00 0.00 ? 30  ALA A HB1  4  
ATOM 9102  H HB2  . ALA A 1 30  ? 9.131   16.842  -9.012  1.00 0.00 ? 30  ALA A HB2  4  
ATOM 9103  H HB3  . ALA A 1 30  ? 8.949   18.277  -10.023 1.00 0.00 ? 30  ALA A HB3  4  
ATOM 9104  N N    . GLY A 1 31  ? 10.749  14.972  -11.258 1.00 0.00 ? 31  GLY A N    4  
ATOM 9105  C CA   . GLY A 1 31  ? 11.443  13.703  -11.236 1.00 0.00 ? 31  GLY A CA   4  
ATOM 9106  C C    . GLY A 1 31  ? 12.483  13.658  -10.136 1.00 0.00 ? 31  GLY A C    4  
ATOM 9107  O O    . GLY A 1 31  ? 13.659  13.940  -10.381 1.00 0.00 ? 31  GLY A O    4  
ATOM 9108  H H    . GLY A 1 31  ? 11.258  15.803  -11.420 1.00 0.00 ? 31  GLY A H    4  
ATOM 9109  H HA2  . GLY A 1 31  ? 10.726  12.912  -11.074 1.00 0.00 ? 31  GLY A HA2  4  
ATOM 9110  H HA3  . GLY A 1 31  ? 11.932  13.547  -12.187 1.00 0.00 ? 31  GLY A HA3  4  
ATOM 9111  N N    . PRO A 1 32  ? 12.072  13.334  -8.896  1.00 0.00 ? 32  PRO A N    4  
ATOM 9112  C CA   . PRO A 1 32  ? 12.982  13.260  -7.753  1.00 0.00 ? 32  PRO A CA   4  
ATOM 9113  C C    . PRO A 1 32  ? 13.972  12.108  -7.886  1.00 0.00 ? 32  PRO A C    4  
ATOM 9114  O O    . PRO A 1 32  ? 13.643  10.950  -7.612  1.00 0.00 ? 32  PRO A O    4  
ATOM 9115  C CB   . PRO A 1 32  ? 12.054  13.035  -6.549  1.00 0.00 ? 32  PRO A CB   4  
ATOM 9116  C CG   . PRO A 1 32  ? 10.684  13.349  -7.043  1.00 0.00 ? 32  PRO A CG   4  
ATOM 9117  C CD   . PRO A 1 32  ? 10.692  13.016  -8.505  1.00 0.00 ? 32  PRO A CD   4  
ATOM 9118  H HA   . PRO A 1 32  ? 13.526  14.183  -7.622  1.00 0.00 ? 32  PRO A HA   4  
ATOM 9119  H HB2  . PRO A 1 32  ? 12.129  12.007  -6.223  1.00 0.00 ? 32  PRO A HB2  4  
ATOM 9120  H HB3  . PRO A 1 32  ? 12.344  13.692  -5.743  1.00 0.00 ? 32  PRO A HB3  4  
ATOM 9121  H HG2  . PRO A 1 32  ? 9.959   12.741  -6.522  1.00 0.00 ? 32  PRO A HG2  4  
ATOM 9122  H HG3  . PRO A 1 32  ? 10.472  14.397  -6.898  1.00 0.00 ? 32  PRO A HG3  4  
ATOM 9123  H HD2  . PRO A 1 32  ? 10.477  11.968  -8.656  1.00 0.00 ? 32  PRO A HD2  4  
ATOM 9124  H HD3  . PRO A 1 32  ? 9.986   13.634  -9.039  1.00 0.00 ? 32  PRO A HD3  4  
ATOM 9125  N N    . GLY A 1 33  ? 15.177  12.429  -8.325  1.00 0.00 ? 33  GLY A N    4  
ATOM 9126  C CA   . GLY A 1 33  ? 16.199  11.421  -8.487  1.00 0.00 ? 33  GLY A CA   4  
ATOM 9127  C C    . GLY A 1 33  ? 17.240  11.508  -7.399  1.00 0.00 ? 33  GLY A C    4  
ATOM 9128  O O    . GLY A 1 33  ? 17.538  10.519  -6.728  1.00 0.00 ? 33  GLY A O    4  
ATOM 9129  H H    . GLY A 1 33  ? 15.378  13.369  -8.540  1.00 0.00 ? 33  GLY A H    4  
ATOM 9130  H HA2  . GLY A 1 33  ? 15.737  10.446  -8.458  1.00 0.00 ? 33  GLY A HA2  4  
ATOM 9131  H HA3  . GLY A 1 33  ? 16.680  11.555  -9.444  1.00 0.00 ? 33  GLY A HA3  4  
ATOM 9132  N N    . GLU A 1 34  ? 17.783  12.701  -7.216  1.00 0.00 ? 34  GLU A N    4  
ATOM 9133  C CA   . GLU A 1 34  ? 18.797  12.937  -6.203  1.00 0.00 ? 34  GLU A CA   4  
ATOM 9134  C C    . GLU A 1 34  ? 18.528  14.248  -5.482  1.00 0.00 ? 34  GLU A C    4  
ATOM 9135  O O    . GLU A 1 34  ? 18.977  15.312  -5.910  1.00 0.00 ? 34  GLU A O    4  
ATOM 9136  C CB   . GLU A 1 34  ? 20.189  12.967  -6.832  1.00 0.00 ? 34  GLU A CB   4  
ATOM 9137  C CG   . GLU A 1 34  ? 20.819  11.595  -6.985  1.00 0.00 ? 34  GLU A CG   4  
ATOM 9138  C CD   . GLU A 1 34  ? 22.248  11.674  -7.469  1.00 0.00 ? 34  GLU A CD   4  
ATOM 9139  O OE1  . GLU A 1 34  ? 23.069  12.344  -6.805  1.00 0.00 ? 34  GLU A OE1  4  
ATOM 9140  O OE2  . GLU A 1 34  ? 22.558  11.079  -8.517  1.00 0.00 ? 34  GLU A OE2  4  
ATOM 9141  H H    . GLU A 1 34  ? 17.484  13.455  -7.776  1.00 0.00 ? 34  GLU A H    4  
ATOM 9142  H HA   . GLU A 1 34  ? 18.750  12.128  -5.489  1.00 0.00 ? 34  GLU A HA   4  
ATOM 9143  H HB2  . GLU A 1 34  ? 20.121  13.417  -7.812  1.00 0.00 ? 34  GLU A HB2  4  
ATOM 9144  H HB3  . GLU A 1 34  ? 20.837  13.572  -6.213  1.00 0.00 ? 34  GLU A HB3  4  
ATOM 9145  H HG2  . GLU A 1 34  ? 20.805  11.098  -6.025  1.00 0.00 ? 34  GLU A HG2  4  
ATOM 9146  H HG3  . GLU A 1 34  ? 20.242  11.020  -7.696  1.00 0.00 ? 34  GLU A HG3  4  
ATOM 9147  N N    . GLY A 1 35  ? 17.781  14.169  -4.398  1.00 0.00 ? 35  GLY A N    4  
ATOM 9148  C CA   . GLY A 1 35  ? 17.460  15.348  -3.633  1.00 0.00 ? 35  GLY A CA   4  
ATOM 9149  C C    . GLY A 1 35  ? 16.902  14.997  -2.273  1.00 0.00 ? 35  GLY A C    4  
ATOM 9150  O O    . GLY A 1 35  ? 15.756  14.554  -2.172  1.00 0.00 ? 35  GLY A O    4  
ATOM 9151  H H    . GLY A 1 35  ? 17.448  13.289  -4.104  1.00 0.00 ? 35  GLY A H    4  
ATOM 9152  H HA2  . GLY A 1 35  ? 18.355  15.940  -3.507  1.00 0.00 ? 35  GLY A HA2  4  
ATOM 9153  H HA3  . GLY A 1 35  ? 16.727  15.928  -4.173  1.00 0.00 ? 35  GLY A HA3  4  
ATOM 9154  N N    . PRO A 1 36  ? 17.702  15.163  -1.209  1.00 0.00 ? 36  PRO A N    4  
ATOM 9155  C CA   . PRO A 1 36  ? 17.276  14.859  0.158   1.00 0.00 ? 36  PRO A CA   4  
ATOM 9156  C C    . PRO A 1 36  ? 16.040  15.657  0.557   1.00 0.00 ? 36  PRO A C    4  
ATOM 9157  O O    . PRO A 1 36  ? 16.089  16.882  0.685   1.00 0.00 ? 36  PRO A O    4  
ATOM 9158  C CB   . PRO A 1 36  ? 18.479  15.263  1.017   1.00 0.00 ? 36  PRO A CB   4  
ATOM 9159  C CG   . PRO A 1 36  ? 19.638  15.252  0.082   1.00 0.00 ? 36  PRO A CG   4  
ATOM 9160  C CD   . PRO A 1 36  ? 19.089  15.657  -1.255  1.00 0.00 ? 36  PRO A CD   4  
ATOM 9161  H HA   . PRO A 1 36  ? 17.076  13.805  0.283   1.00 0.00 ? 36  PRO A HA   4  
ATOM 9162  H HB2  . PRO A 1 36  ? 18.315  16.246  1.434   1.00 0.00 ? 36  PRO A HB2  4  
ATOM 9163  H HB3  . PRO A 1 36  ? 18.612  14.547  1.815   1.00 0.00 ? 36  PRO A HB3  4  
ATOM 9164  H HG2  . PRO A 1 36  ? 20.384  15.960  0.412   1.00 0.00 ? 36  PRO A HG2  4  
ATOM 9165  H HG3  . PRO A 1 36  ? 20.058  14.259  0.030   1.00 0.00 ? 36  PRO A HG3  4  
ATOM 9166  H HD2  . PRO A 1 36  ? 19.114  16.730  -1.366  1.00 0.00 ? 36  PRO A HD2  4  
ATOM 9167  H HD3  . PRO A 1 36  ? 19.642  15.180  -2.051  1.00 0.00 ? 36  PRO A HD3  4  
ATOM 9168  N N    . ALA A 1 37  ? 14.931  14.960  0.728   1.00 0.00 ? 37  ALA A N    4  
ATOM 9169  C CA   . ALA A 1 37  ? 13.684  15.596  1.107   1.00 0.00 ? 37  ALA A CA   4  
ATOM 9170  C C    . ALA A 1 37  ? 13.369  15.318  2.569   1.00 0.00 ? 37  ALA A C    4  
ATOM 9171  O O    . ALA A 1 37  ? 13.598  14.210  3.064   1.00 0.00 ? 37  ALA A O    4  
ATOM 9172  C CB   . ALA A 1 37  ? 12.550  15.113  0.215   1.00 0.00 ? 37  ALA A CB   4  
ATOM 9173  H H    . ALA A 1 37  ? 14.953  13.991  0.597   1.00 0.00 ? 37  ALA A H    4  
ATOM 9174  H HA   . ALA A 1 37  ? 13.794  16.662  0.967   1.00 0.00 ? 37  ALA A HA   4  
ATOM 9175  H HB1  . ALA A 1 37  ? 12.418  14.048  0.344   1.00 0.00 ? 37  ALA A HB1  4  
ATOM 9176  H HB2  . ALA A 1 37  ? 12.792  15.323  -0.816  1.00 0.00 ? 37  ALA A HB2  4  
ATOM 9177  H HB3  . ALA A 1 37  ? 11.638  15.625  0.483   1.00 0.00 ? 37  ALA A HB3  4  
ATOM 9178  N N    . ALA A 1 38  ? 12.867  16.329  3.258   1.00 0.00 ? 38  ALA A N    4  
ATOM 9179  C CA   . ALA A 1 38  ? 12.517  16.204  4.661   1.00 0.00 ? 38  ALA A CA   4  
ATOM 9180  C C    . ALA A 1 38  ? 11.257  15.367  4.824   1.00 0.00 ? 38  ALA A C    4  
ATOM 9181  O O    . ALA A 1 38  ? 11.121  14.609  5.782   1.00 0.00 ? 38  ALA A O    4  
ATOM 9182  C CB   . ALA A 1 38  ? 12.328  17.580  5.277   1.00 0.00 ? 38  ALA A CB   4  
ATOM 9183  H H    . ALA A 1 38  ? 12.728  17.195  2.805   1.00 0.00 ? 38  ALA A H    4  
ATOM 9184  H HA   . ALA A 1 38  ? 13.333  15.714  5.170   1.00 0.00 ? 38  ALA A HA   4  
ATOM 9185  H HB1  . ALA A 1 38  ? 13.238  18.151  5.169   1.00 0.00 ? 38  ALA A HB1  4  
ATOM 9186  H HB2  . ALA A 1 38  ? 12.089  17.476  6.325   1.00 0.00 ? 38  ALA A HB2  4  
ATOM 9187  H HB3  . ALA A 1 38  ? 11.521  18.091  4.772   1.00 0.00 ? 38  ALA A HB3  4  
ATOM 9188  N N    . ASP A 1 39  ? 10.340  15.505  3.876   1.00 0.00 ? 39  ASP A N    4  
ATOM 9189  C CA   . ASP A 1 39  ? 9.091   14.758  3.910   1.00 0.00 ? 39  ASP A CA   4  
ATOM 9190  C C    . ASP A 1 39  ? 9.191   13.501  3.055   1.00 0.00 ? 39  ASP A C    4  
ATOM 9191  O O    . ASP A 1 39  ? 9.319   13.578  1.832   1.00 0.00 ? 39  ASP A O    4  
ATOM 9192  C CB   . ASP A 1 39  ? 7.927   15.623  3.422   1.00 0.00 ? 39  ASP A CB   4  
ATOM 9193  C CG   . ASP A 1 39  ? 6.716   14.791  3.043   1.00 0.00 ? 39  ASP A CG   4  
ATOM 9194  O OD1  . ASP A 1 39  ? 6.099   14.190  3.945   1.00 0.00 ? 39  ASP A OD1  4  
ATOM 9195  O OD2  . ASP A 1 39  ? 6.384   14.733  1.839   1.00 0.00 ? 39  ASP A OD2  4  
ATOM 9196  H H    . ASP A 1 39  ? 10.511  16.123  3.128   1.00 0.00 ? 39  ASP A H    4  
ATOM 9197  H HA   . ASP A 1 39  ? 8.908   14.469  4.934   1.00 0.00 ? 39  ASP A HA   4  
ATOM 9198  H HB2  . ASP A 1 39  ? 7.640   16.305  4.209   1.00 0.00 ? 39  ASP A HB2  4  
ATOM 9199  H HB3  . ASP A 1 39  ? 8.240   16.187  2.556   1.00 0.00 ? 39  ASP A HB3  4  
ATOM 9200  N N    . PRO A 1 40  ? 9.160   12.322  3.685   1.00 0.00 ? 40  PRO A N    4  
ATOM 9201  C CA   . PRO A 1 40  ? 9.228   11.054  2.980   1.00 0.00 ? 40  PRO A CA   4  
ATOM 9202  C C    . PRO A 1 40  ? 7.846   10.468  2.687   1.00 0.00 ? 40  PRO A C    4  
ATOM 9203  O O    . PRO A 1 40  ? 7.732   9.424   2.053   1.00 0.00 ? 40  PRO A O    4  
ATOM 9204  C CB   . PRO A 1 40  ? 9.981   10.175  3.974   1.00 0.00 ? 40  PRO A CB   4  
ATOM 9205  C CG   . PRO A 1 40  ? 9.611   10.703  5.329   1.00 0.00 ? 40  PRO A CG   4  
ATOM 9206  C CD   . PRO A 1 40  ? 9.106   12.120  5.143   1.00 0.00 ? 40  PRO A CD   4  
ATOM 9207  H HA   . PRO A 1 40  ? 9.793   11.137  2.063   1.00 0.00 ? 40  PRO A HA   4  
ATOM 9208  H HB2  . PRO A 1 40  ? 9.673   9.148   3.851   1.00 0.00 ? 40  PRO A HB2  4  
ATOM 9209  H HB3  . PRO A 1 40  ? 11.043  10.259  3.800   1.00 0.00 ? 40  PRO A HB3  4  
ATOM 9210  H HG2  . PRO A 1 40  ? 8.834   10.087  5.760   1.00 0.00 ? 40  PRO A HG2  4  
ATOM 9211  H HG3  . PRO A 1 40  ? 10.484  10.699  5.969   1.00 0.00 ? 40  PRO A HG3  4  
ATOM 9212  H HD2  . PRO A 1 40  ? 8.093   12.212  5.509   1.00 0.00 ? 40  PRO A HD2  4  
ATOM 9213  H HD3  . PRO A 1 40  ? 9.754   12.819  5.653   1.00 0.00 ? 40  PRO A HD3  4  
ATOM 9214  N N    . LEU A 1 41  ? 6.797   11.160  3.131   1.00 0.00 ? 41  LEU A N    4  
ATOM 9215  C CA   . LEU A 1 41  ? 5.429   10.684  2.945   1.00 0.00 ? 41  LEU A CA   4  
ATOM 9216  C C    . LEU A 1 41  ? 5.041   10.617  1.474   1.00 0.00 ? 41  LEU A C    4  
ATOM 9217  O O    . LEU A 1 41  ? 4.455   9.632   1.033   1.00 0.00 ? 41  LEU A O    4  
ATOM 9218  C CB   . LEU A 1 41  ? 4.442   11.572  3.705   1.00 0.00 ? 41  LEU A CB   4  
ATOM 9219  C CG   . LEU A 1 41  ? 4.353   11.304  5.207   1.00 0.00 ? 41  LEU A CG   4  
ATOM 9220  C CD1  . LEU A 1 41  ? 3.341   12.233  5.856   1.00 0.00 ? 41  LEU A CD1  4  
ATOM 9221  C CD2  . LEU A 1 41  ? 3.983   9.852   5.463   1.00 0.00 ? 41  LEU A CD2  4  
ATOM 9222  H H    . LEU A 1 41  ? 6.947   12.015  3.592   1.00 0.00 ? 41  LEU A H    4  
ATOM 9223  H HA   . LEU A 1 41  ? 5.379   9.688   3.355   1.00 0.00 ? 41  LEU A HA   4  
ATOM 9224  H HB2  . LEU A 1 41  ? 4.731   12.602  3.561   1.00 0.00 ? 41  LEU A HB2  4  
ATOM 9225  H HB3  . LEU A 1 41  ? 3.461   11.428  3.278   1.00 0.00 ? 41  LEU A HB3  4  
ATOM 9226  H HG   . LEU A 1 41  ? 5.316   11.491  5.657   1.00 0.00 ? 41  LEU A HG   4  
ATOM 9227  H HD11 . LEU A 1 41  ? 3.231   11.971  6.898   1.00 0.00 ? 41  LEU A HD11 4  
ATOM 9228  H HD12 . LEU A 1 41  ? 2.388   12.135  5.357   1.00 0.00 ? 41  LEU A HD12 4  
ATOM 9229  H HD13 . LEU A 1 41  ? 3.685   13.254  5.776   1.00 0.00 ? 41  LEU A HD13 4  
ATOM 9230  H HD21 . LEU A 1 41  ? 3.930   9.675   6.527   1.00 0.00 ? 41  LEU A HD21 4  
ATOM 9231  H HD22 . LEU A 1 41  ? 4.731   9.207   5.028   1.00 0.00 ? 41  LEU A HD22 4  
ATOM 9232  H HD23 . LEU A 1 41  ? 3.023   9.641   5.015   1.00 0.00 ? 41  LEU A HD23 4  
ATOM 9233  N N    . HIS A 1 42  ? 5.374   11.654  0.716   1.00 0.00 ? 42  HIS A N    4  
ATOM 9234  C CA   . HIS A 1 42  ? 5.040   11.684  -0.707  1.00 0.00 ? 42  HIS A CA   4  
ATOM 9235  C C    . HIS A 1 42  ? 5.732   10.547  -1.450  1.00 0.00 ? 42  HIS A C    4  
ATOM 9236  O O    . HIS A 1 42  ? 5.197   10.006  -2.418  1.00 0.00 ? 42  HIS A O    4  
ATOM 9237  C CB   . HIS A 1 42  ? 5.406   13.032  -1.327  1.00 0.00 ? 42  HIS A CB   4  
ATOM 9238  C CG   . HIS A 1 42  ? 4.358   14.078  -1.114  1.00 0.00 ? 42  HIS A CG   4  
ATOM 9239  N ND1  . HIS A 1 42  ? 3.538   14.547  -2.117  1.00 0.00 ? 42  HIS A ND1  4  
ATOM 9240  C CD2  . HIS A 1 42  ? 3.987   14.736  0.008   1.00 0.00 ? 42  HIS A CD2  4  
ATOM 9241  C CE1  . HIS A 1 42  ? 2.712   15.447  -1.622  1.00 0.00 ? 42  HIS A CE1  4  
ATOM 9242  N NE2  . HIS A 1 42  ? 2.963   15.578  -0.337  1.00 0.00 ? 42  HIS A NE2  4  
ATOM 9243  H H    . HIS A 1 42  ? 5.848   12.415  1.121   1.00 0.00 ? 42  HIS A H    4  
ATOM 9244  H HA   . HIS A 1 42  ? 3.972   11.543  -0.791  1.00 0.00 ? 42  HIS A HA   4  
ATOM 9245  H HB2  . HIS A 1 42  ? 6.326   13.389  -0.888  1.00 0.00 ? 42  HIS A HB2  4  
ATOM 9246  H HB3  . HIS A 1 42  ? 5.543   12.908  -2.391  1.00 0.00 ? 42  HIS A HB3  4  
ATOM 9247  H HD1  . HIS A 1 42  ? 3.557   14.260  -3.061  1.00 0.00 ? 42  HIS A HD1  4  
ATOM 9248  H HD2  . HIS A 1 42  ? 4.423   14.623  0.992   1.00 0.00 ? 42  HIS A HD2  4  
ATOM 9249  H HE1  . HIS A 1 42  ? 1.957   15.987  -2.176  1.00 0.00 ? 42  HIS A HE1  4  
ATOM 9250  H HE2  . HIS A 1 42  ? 2.456   16.155  0.288   1.00 0.00 ? 42  HIS A HE2  4  
ATOM 9251  N N    . GLN A 1 43  ? 6.916   10.178  -0.983  1.00 0.00 ? 43  GLN A N    4  
ATOM 9252  C CA   . GLN A 1 43  ? 7.664   9.091   -1.595  1.00 0.00 ? 43  GLN A CA   4  
ATOM 9253  C C    . GLN A 1 43  ? 7.121   7.749   -1.121  1.00 0.00 ? 43  GLN A C    4  
ATOM 9254  O O    . GLN A 1 43  ? 6.920   6.836   -1.920  1.00 0.00 ? 43  GLN A O    4  
ATOM 9255  C CB   . GLN A 1 43  ? 9.151   9.201   -1.253  1.00 0.00 ? 43  GLN A CB   4  
ATOM 9256  C CG   . GLN A 1 43  ? 9.923   10.129  -2.175  1.00 0.00 ? 43  GLN A CG   4  
ATOM 9257  C CD   . GLN A 1 43  ? 9.876   9.685   -3.626  1.00 0.00 ? 43  GLN A CD   4  
ATOM 9258  O OE1  . GLN A 1 43  ? 9.690   8.502   -3.928  1.00 0.00 ? 43  GLN A OE1  4  
ATOM 9259  N NE2  . GLN A 1 43  ? 10.051  10.631  -4.533  1.00 0.00 ? 43  GLN A NE2  4  
ATOM 9260  H H    . GLN A 1 43  ? 7.293   10.644  -0.209  1.00 0.00 ? 43  GLN A H    4  
ATOM 9261  H HA   . GLN A 1 43  ? 7.542   9.162   -2.666  1.00 0.00 ? 43  GLN A HA   4  
ATOM 9262  H HB2  . GLN A 1 43  ? 9.248   9.571   -0.243  1.00 0.00 ? 43  GLN A HB2  4  
ATOM 9263  H HB3  . GLN A 1 43  ? 9.597   8.220   -1.312  1.00 0.00 ? 43  GLN A HB3  4  
ATOM 9264  H HG2  . GLN A 1 43  ? 9.498   11.119  -2.106  1.00 0.00 ? 43  GLN A HG2  4  
ATOM 9265  H HG3  . GLN A 1 43  ? 10.955  10.159  -1.853  1.00 0.00 ? 43  GLN A HG3  4  
ATOM 9266  H HE21 . GLN A 1 43  ? 10.196  11.556  -4.221  1.00 0.00 ? 43  GLN A HE21 4  
ATOM 9267  H HE22 . GLN A 1 43  ? 10.042  10.373  -5.481  1.00 0.00 ? 43  GLN A HE22 4  
ATOM 9268  N N    . ALA A 1 44  ? 6.867   7.650   0.179   1.00 0.00 ? 44  ALA A N    4  
ATOM 9269  C CA   . ALA A 1 44  ? 6.348   6.428   0.784   1.00 0.00 ? 44  ALA A CA   4  
ATOM 9270  C C    . ALA A 1 44  ? 4.981   6.057   0.223   1.00 0.00 ? 44  ALA A C    4  
ATOM 9271  O O    . ALA A 1 44  ? 4.721   4.891   -0.069  1.00 0.00 ? 44  ALA A O    4  
ATOM 9272  C CB   . ALA A 1 44  ? 6.271   6.582   2.296   1.00 0.00 ? 44  ALA A CB   4  
ATOM 9273  H H    . ALA A 1 44  ? 7.046   8.424   0.758   1.00 0.00 ? 44  ALA A H    4  
ATOM 9274  H HA   . ALA A 1 44  ? 7.041   5.629   0.566   1.00 0.00 ? 44  ALA A HA   4  
ATOM 9275  H HB1  . ALA A 1 44  ? 5.966   5.645   2.740   1.00 0.00 ? 44  ALA A HB1  4  
ATOM 9276  H HB2  . ALA A 1 44  ? 5.550   7.349   2.543   1.00 0.00 ? 44  ALA A HB2  4  
ATOM 9277  H HB3  . ALA A 1 44  ? 7.240   6.863   2.679   1.00 0.00 ? 44  ALA A HB3  4  
ATOM 9278  N N    . MET A 1 45  ? 4.112   7.052   0.068   1.00 0.00 ? 45  MET A N    4  
ATOM 9279  C CA   . MET A 1 45  ? 2.774   6.822   -0.465  1.00 0.00 ? 45  MET A CA   4  
ATOM 9280  C C    . MET A 1 45  ? 2.860   6.270   -1.882  1.00 0.00 ? 45  MET A C    4  
ATOM 9281  O O    . MET A 1 45  ? 2.069   5.418   -2.284  1.00 0.00 ? 45  MET A O    4  
ATOM 9282  C CB   . MET A 1 45  ? 1.963   8.117   -0.448  1.00 0.00 ? 45  MET A CB   4  
ATOM 9283  C CG   . MET A 1 45  ? 0.469   7.898   -0.610  1.00 0.00 ? 45  MET A CG   4  
ATOM 9284  S SD   . MET A 1 45  ? -0.503  9.304   -0.040  1.00 0.00 ? 45  MET A SD   4  
ATOM 9285  C CE   . MET A 1 45  ? -2.148  8.596   -0.069  1.00 0.00 ? 45  MET A CE   4  
ATOM 9286  H H    . MET A 1 45  ? 4.375   7.966   0.328   1.00 0.00 ? 45  MET A H    4  
ATOM 9287  H HA   . MET A 1 45  ? 2.287   6.092   0.165   1.00 0.00 ? 45  MET A HA   4  
ATOM 9288  H HB2  . MET A 1 45  ? 2.133   8.621   0.492   1.00 0.00 ? 45  MET A HB2  4  
ATOM 9289  H HB3  . MET A 1 45  ? 2.303   8.752   -1.254  1.00 0.00 ? 45  MET A HB3  4  
ATOM 9290  H HG2  . MET A 1 45  ? 0.254   7.730   -1.655  1.00 0.00 ? 45  MET A HG2  4  
ATOM 9291  H HG3  . MET A 1 45  ? 0.184   7.026   -0.041  1.00 0.00 ? 45  MET A HG3  4  
ATOM 9292  H HE1  . MET A 1 45  ? -2.142  7.645   0.440   1.00 0.00 ? 45  MET A HE1  4  
ATOM 9293  H HE2  . MET A 1 45  ? -2.461  8.457   -1.093  1.00 0.00 ? 45  MET A HE2  4  
ATOM 9294  H HE3  . MET A 1 45  ? -2.836  9.265   0.429   1.00 0.00 ? 45  MET A HE3  4  
ATOM 9295  N N    . ARG A 1 46  ? 3.840   6.762   -2.627  1.00 0.00 ? 46  ARG A N    4  
ATOM 9296  C CA   . ARG A 1 46  ? 4.068   6.312   -3.992  1.00 0.00 ? 46  ARG A CA   4  
ATOM 9297  C C    . ARG A 1 46  ? 4.683   4.917   -3.967  1.00 0.00 ? 46  ARG A C    4  
ATOM 9298  O O    . ARG A 1 46  ? 4.296   4.043   -4.736  1.00 0.00 ? 46  ARG A O    4  
ATOM 9299  C CB   . ARG A 1 46  ? 4.990   7.299   -4.723  1.00 0.00 ? 46  ARG A CB   4  
ATOM 9300  C CG   . ARG A 1 46  ? 5.140   7.038   -6.219  1.00 0.00 ? 46  ARG A CG   4  
ATOM 9301  C CD   . ARG A 1 46  ? 6.292   6.088   -6.522  1.00 0.00 ? 46  ARG A CD   4  
ATOM 9302  N NE   . ARG A 1 46  ? 7.486   6.379   -5.726  1.00 0.00 ? 46  ARG A NE   4  
ATOM 9303  C CZ   . ARG A 1 46  ? 8.436   5.480   -5.455  1.00 0.00 ? 46  ARG A CZ   4  
ATOM 9304  N NH1  . ARG A 1 46  ? 8.364   4.258   -5.975  1.00 0.00 ? 46  ARG A NH1  4  
ATOM 9305  N NH2  . ARG A 1 46  ? 9.469   5.814   -4.688  1.00 0.00 ? 46  ARG A NH2  4  
ATOM 9306  H H    . ARG A 1 46  ? 4.428   7.447   -2.246  1.00 0.00 ? 46  ARG A H    4  
ATOM 9307  H HA   . ARG A 1 46  ? 3.114   6.270   -4.498  1.00 0.00 ? 46  ARG A HA   4  
ATOM 9308  H HB2  . ARG A 1 46  ? 4.595   8.296   -4.597  1.00 0.00 ? 46  ARG A HB2  4  
ATOM 9309  H HB3  . ARG A 1 46  ? 5.972   7.254   -4.273  1.00 0.00 ? 46  ARG A HB3  4  
ATOM 9310  H HG2  . ARG A 1 46  ? 4.226   6.603   -6.591  1.00 0.00 ? 46  ARG A HG2  4  
ATOM 9311  H HG3  . ARG A 1 46  ? 5.321   7.978   -6.720  1.00 0.00 ? 46  ARG A HG3  4  
ATOM 9312  H HD2  . ARG A 1 46  ? 5.970   5.078   -6.312  1.00 0.00 ? 46  ARG A HD2  4  
ATOM 9313  H HD3  . ARG A 1 46  ? 6.542   6.173   -7.569  1.00 0.00 ? 46  ARG A HD3  4  
ATOM 9314  H HE   . ARG A 1 46  ? 7.574   7.288   -5.363  1.00 0.00 ? 46  ARG A HE   4  
ATOM 9315  H HH11 . ARG A 1 46  ? 7.602   4.007   -6.581  1.00 0.00 ? 46  ARG A HH11 4  
ATOM 9316  H HH12 . ARG A 1 46  ? 9.072   3.569   -5.753  1.00 0.00 ? 46  ARG A HH12 4  
ATOM 9317  H HH21 . ARG A 1 46  ? 9.539   6.747   -4.308  1.00 0.00 ? 46  ARG A HH21 4  
ATOM 9318  H HH22 . ARG A 1 46  ? 10.195  5.140   -4.483  1.00 0.00 ? 46  ARG A HH22 4  
ATOM 9319  N N    . ALA A 1 47  ? 5.631   4.724   -3.058  1.00 0.00 ? 47  ALA A N    4  
ATOM 9320  C CA   . ALA A 1 47  ? 6.323   3.452   -2.902  1.00 0.00 ? 47  ALA A CA   4  
ATOM 9321  C C    . ALA A 1 47  ? 5.355   2.323   -2.572  1.00 0.00 ? 47  ALA A C    4  
ATOM 9322  O O    . ALA A 1 47  ? 5.420   1.250   -3.174  1.00 0.00 ? 47  ALA A O    4  
ATOM 9323  C CB   . ALA A 1 47  ? 7.382   3.566   -1.818  1.00 0.00 ? 47  ALA A CB   4  
ATOM 9324  H H    . ALA A 1 47  ? 5.883   5.472   -2.471  1.00 0.00 ? 47  ALA A H    4  
ATOM 9325  H HA   . ALA A 1 47  ? 6.821   3.226   -3.835  1.00 0.00 ? 47  ALA A HA   4  
ATOM 9326  H HB1  . ALA A 1 47  ? 7.936   2.642   -1.757  1.00 0.00 ? 47  ALA A HB1  4  
ATOM 9327  H HB2  . ALA A 1 47  ? 6.904   3.764   -0.869  1.00 0.00 ? 47  ALA A HB2  4  
ATOM 9328  H HB3  . ALA A 1 47  ? 8.055   4.375   -2.058  1.00 0.00 ? 47  ALA A HB3  4  
ATOM 9329  N N    . ALA A 1 48  ? 4.448   2.583   -1.631  1.00 0.00 ? 48  ALA A N    4  
ATOM 9330  C CA   . ALA A 1 48  ? 3.459   1.593   -1.204  1.00 0.00 ? 48  ALA A CA   4  
ATOM 9331  C C    . ALA A 1 48  ? 2.646   1.058   -2.380  1.00 0.00 ? 48  ALA A C    4  
ATOM 9332  O O    . ALA A 1 48  ? 2.139   -0.059  -2.335  1.00 0.00 ? 48  ALA A O    4  
ATOM 9333  C CB   . ALA A 1 48  ? 2.531   2.194   -0.154  1.00 0.00 ? 48  ALA A CB   4  
ATOM 9334  H H    . ALA A 1 48  ? 4.451   3.466   -1.200  1.00 0.00 ? 48  ALA A H    4  
ATOM 9335  H HA   . ALA A 1 48  ? 3.993   0.771   -0.747  1.00 0.00 ? 48  ALA A HA   4  
ATOM 9336  H HB1  . ALA A 1 48  ? 1.951   2.989   -0.598  1.00 0.00 ? 48  ALA A HB1  4  
ATOM 9337  H HB2  . ALA A 1 48  ? 3.118   2.590   0.662   1.00 0.00 ? 48  ALA A HB2  4  
ATOM 9338  H HB3  . ALA A 1 48  ? 1.867   1.427   0.218   1.00 0.00 ? 48  ALA A HB3  4  
ATOM 9339  N N    . GLY A 1 49  ? 2.531   1.851   -3.435  1.00 0.00 ? 49  GLY A N    4  
ATOM 9340  C CA   . GLY A 1 49  ? 1.787   1.421   -4.595  1.00 0.00 ? 49  GLY A CA   4  
ATOM 9341  C C    . GLY A 1 49  ? 2.619   1.467   -5.858  1.00 0.00 ? 49  GLY A C    4  
ATOM 9342  O O    . GLY A 1 49  ? 2.125   1.852   -6.920  1.00 0.00 ? 49  GLY A O    4  
ATOM 9343  H H    . GLY A 1 49  ? 2.961   2.732   -3.427  1.00 0.00 ? 49  GLY A H    4  
ATOM 9344  H HA2  . GLY A 1 49  ? 1.448   0.409   -4.436  1.00 0.00 ? 49  GLY A HA2  4  
ATOM 9345  H HA3  . GLY A 1 49  ? 0.927   2.064   -4.719  1.00 0.00 ? 49  GLY A HA3  4  
ATOM 9346  N N    . ASP A 1 50  ? 3.887   1.072   -5.753  1.00 0.00 ? 50  ASP A N    4  
ATOM 9347  C CA   . ASP A 1 50  ? 4.773   1.090   -6.913  1.00 0.00 ? 50  ASP A CA   4  
ATOM 9348  C C    . ASP A 1 50  ? 6.020   0.231   -6.707  1.00 0.00 ? 50  ASP A C    4  
ATOM 9349  O O    . ASP A 1 50  ? 6.421   -0.507  -7.605  1.00 0.00 ? 50  ASP A O    4  
ATOM 9350  C CB   . ASP A 1 50  ? 5.192   2.527   -7.231  1.00 0.00 ? 50  ASP A CB   4  
ATOM 9351  C CG   . ASP A 1 50  ? 6.040   2.623   -8.478  1.00 0.00 ? 50  ASP A CG   4  
ATOM 9352  O OD1  . ASP A 1 50  ? 5.537   2.292   -9.571  1.00 0.00 ? 50  ASP A OD1  4  
ATOM 9353  O OD2  . ASP A 1 50  ? 7.210   3.041   -8.374  1.00 0.00 ? 50  ASP A OD2  4  
ATOM 9354  H H    . ASP A 1 50  ? 4.231   0.773   -4.882  1.00 0.00 ? 50  ASP A H    4  
ATOM 9355  H HA   . ASP A 1 50  ? 4.219   0.700   -7.753  1.00 0.00 ? 50  ASP A HA   4  
ATOM 9356  H HB2  . ASP A 1 50  ? 4.307   3.130   -7.373  1.00 0.00 ? 50  ASP A HB2  4  
ATOM 9357  H HB3  . ASP A 1 50  ? 5.761   2.922   -6.400  1.00 0.00 ? 50  ASP A HB3  4  
ATOM 9358  N N    . GLU A 1 51  ? 6.613   0.317   -5.521  1.00 0.00 ? 51  GLU A N    4  
ATOM 9359  C CA   . GLU A 1 51  ? 7.838   -0.424  -5.209  1.00 0.00 ? 51  GLU A CA   4  
ATOM 9360  C C    . GLU A 1 51  ? 7.700   -1.923  -5.462  1.00 0.00 ? 51  GLU A C    4  
ATOM 9361  O O    . GLU A 1 51  ? 8.430   -2.490  -6.279  1.00 0.00 ? 51  GLU A O    4  
ATOM 9362  C CB   . GLU A 1 51  ? 8.252   -0.181  -3.759  1.00 0.00 ? 51  GLU A CB   4  
ATOM 9363  C CG   . GLU A 1 51  ? 9.021   1.113   -3.560  1.00 0.00 ? 51  GLU A CG   4  
ATOM 9364  C CD   . GLU A 1 51  ? 10.084  1.317   -4.617  1.00 0.00 ? 51  GLU A CD   4  
ATOM 9365  O OE1  . GLU A 1 51  ? 11.102  0.601   -4.594  1.00 0.00 ? 51  GLU A OE1  4  
ATOM 9366  O OE2  . GLU A 1 51  ? 9.897   2.189   -5.493  1.00 0.00 ? 51  GLU A OE2  4  
ATOM 9367  H H    . GLU A 1 51  ? 6.216   0.891   -4.827  1.00 0.00 ? 51  GLU A H    4  
ATOM 9368  H HA   . GLU A 1 51  ? 8.615   -0.043  -5.851  1.00 0.00 ? 51  GLU A HA   4  
ATOM 9369  H HB2  . GLU A 1 51  ? 7.363   -0.148  -3.142  1.00 0.00 ? 51  GLU A HB2  4  
ATOM 9370  H HB3  . GLU A 1 51  ? 8.875   -1.001  -3.432  1.00 0.00 ? 51  GLU A HB3  4  
ATOM 9371  H HG2  . GLU A 1 51  ? 8.329   1.942   -3.601  1.00 0.00 ? 51  GLU A HG2  4  
ATOM 9372  H HG3  . GLU A 1 51  ? 9.498   1.088   -2.591  1.00 0.00 ? 51  GLU A HG3  4  
ATOM 9373  N N    . PHE A 1 52  ? 6.765   -2.557  -4.768  1.00 0.00 ? 52  PHE A N    4  
ATOM 9374  C CA   . PHE A 1 52  ? 6.535   -3.993  -4.911  1.00 0.00 ? 52  PHE A CA   4  
ATOM 9375  C C    . PHE A 1 52  ? 6.214   -4.370  -6.358  1.00 0.00 ? 52  PHE A C    4  
ATOM 9376  O O    . PHE A 1 52  ? 6.502   -5.483  -6.792  1.00 0.00 ? 52  PHE A O    4  
ATOM 9377  C CB   . PHE A 1 52  ? 5.406   -4.451  -3.978  1.00 0.00 ? 52  PHE A CB   4  
ATOM 9378  C CG   . PHE A 1 52  ? 4.039   -3.973  -4.376  1.00 0.00 ? 52  PHE A CG   4  
ATOM 9379  C CD1  . PHE A 1 52  ? 3.692   -2.637  -4.260  1.00 0.00 ? 52  PHE A CD1  4  
ATOM 9380  C CD2  . PHE A 1 52  ? 3.100   -4.863  -4.866  1.00 0.00 ? 52  PHE A CD2  4  
ATOM 9381  C CE1  . PHE A 1 52  ? 2.435   -2.201  -4.627  1.00 0.00 ? 52  PHE A CE1  4  
ATOM 9382  C CE2  . PHE A 1 52  ? 1.841   -4.432  -5.235  1.00 0.00 ? 52  PHE A CE2  4  
ATOM 9383  C CZ   . PHE A 1 52  ? 1.508   -3.100  -5.116  1.00 0.00 ? 52  PHE A CZ   4  
ATOM 9384  H H    . PHE A 1 52  ? 6.231   -2.052  -4.119  1.00 0.00 ? 52  PHE A H    4  
ATOM 9385  H HA   . PHE A 1 52  ? 7.445   -4.497  -4.623  1.00 0.00 ? 52  PHE A HA   4  
ATOM 9386  H HB2  . PHE A 1 52  ? 5.382   -5.529  -3.959  1.00 0.00 ? 52  PHE A HB2  4  
ATOM 9387  H HB3  . PHE A 1 52  ? 5.606   -4.087  -2.980  1.00 0.00 ? 52  PHE A HB3  4  
ATOM 9388  H HD1  . PHE A 1 52  ? 4.417   -1.934  -3.879  1.00 0.00 ? 52  PHE A HD1  4  
ATOM 9389  H HD2  . PHE A 1 52  ? 3.359   -5.907  -4.959  1.00 0.00 ? 52  PHE A HD2  4  
ATOM 9390  H HE1  . PHE A 1 52  ? 2.176   -1.156  -4.531  1.00 0.00 ? 52  PHE A HE1  4  
ATOM 9391  H HE2  . PHE A 1 52  ? 1.120   -5.139  -5.616  1.00 0.00 ? 52  PHE A HE2  4  
ATOM 9392  H HZ   . PHE A 1 52  ? 0.523   -2.762  -5.404  1.00 0.00 ? 52  PHE A HZ   4  
ATOM 9393  N N    . GLU A 1 53  ? 5.640   -3.435  -7.107  1.00 0.00 ? 53  GLU A N    4  
ATOM 9394  C CA   . GLU A 1 53  ? 5.284   -3.694  -8.493  1.00 0.00 ? 53  GLU A CA   4  
ATOM 9395  C C    . GLU A 1 53  ? 6.526   -3.745  -9.374  1.00 0.00 ? 53  GLU A C    4  
ATOM 9396  O O    . GLU A 1 53  ? 6.683   -4.654  -10.188 1.00 0.00 ? 53  GLU A O    4  
ATOM 9397  C CB   . GLU A 1 53  ? 4.308   -2.637  -9.012  1.00 0.00 ? 53  GLU A CB   4  
ATOM 9398  C CG   . GLU A 1 53  ? 3.736   -2.972  -10.382 1.00 0.00 ? 53  GLU A CG   4  
ATOM 9399  C CD   . GLU A 1 53  ? 3.016   -4.305  -10.404 1.00 0.00 ? 53  GLU A CD   4  
ATOM 9400  O OE1  . GLU A 1 53  ? 3.644   -5.338  -10.095 1.00 0.00 ? 53  GLU A OE1  4  
ATOM 9401  O OE2  . GLU A 1 53  ? 1.809   -4.331  -10.728 1.00 0.00 ? 53  GLU A OE2  4  
ATOM 9402  H H    . GLU A 1 53  ? 5.461   -2.554  -6.721  1.00 0.00 ? 53  GLU A H    4  
ATOM 9403  H HA   . GLU A 1 53  ? 4.802   -4.660  -8.529  1.00 0.00 ? 53  GLU A HA   4  
ATOM 9404  H HB2  . GLU A 1 53  ? 3.487   -2.546  -8.316  1.00 0.00 ? 53  GLU A HB2  4  
ATOM 9405  H HB3  . GLU A 1 53  ? 4.820   -1.689  -9.081  1.00 0.00 ? 53  GLU A HB3  4  
ATOM 9406  H HG2  . GLU A 1 53  ? 3.037   -2.200  -10.665 1.00 0.00 ? 53  GLU A HG2  4  
ATOM 9407  H HG3  . GLU A 1 53  ? 4.545   -3.004  -11.096 1.00 0.00 ? 53  GLU A HG3  4  
ATOM 9408  N N    . THR A 1 54  ? 7.413   -2.775  -9.205  1.00 0.00 ? 54  THR A N    4  
ATOM 9409  C CA   . THR A 1 54  ? 8.641   -2.724  -9.986  1.00 0.00 ? 54  THR A CA   4  
ATOM 9410  C C    . THR A 1 54  ? 9.537   -3.919  -9.664  1.00 0.00 ? 54  THR A C    4  
ATOM 9411  O O    . THR A 1 54  ? 10.364  -4.331  -10.477 1.00 0.00 ? 54  THR A O    4  
ATOM 9412  C CB   . THR A 1 54  ? 9.414   -1.420  -9.716  1.00 0.00 ? 54  THR A CB   4  
ATOM 9413  O OG1  . THR A 1 54  ? 8.499   -0.325  -9.595  1.00 0.00 ? 54  THR A OG1  4  
ATOM 9414  C CG2  . THR A 1 54  ? 10.401  -1.131  -10.837 1.00 0.00 ? 54  THR A CG2  4  
ATOM 9415  H H    . THR A 1 54  ? 7.236   -2.067  -8.546  1.00 0.00 ? 54  THR A H    4  
ATOM 9416  H HA   . THR A 1 54  ? 8.373   -2.753  -11.032 1.00 0.00 ? 54  THR A HA   4  
ATOM 9417  H HB   . THR A 1 54  ? 9.962   -1.529  -8.793  1.00 0.00 ? 54  THR A HB   4  
ATOM 9418  H HG1  . THR A 1 54  ? 8.810   0.276   -8.898  1.00 0.00 ? 54  THR A HG1  4  
ATOM 9419  H HG21 . THR A 1 54  ? 9.872   -1.086  -11.777 1.00 0.00 ? 54  THR A HG21 4  
ATOM 9420  H HG22 . THR A 1 54  ? 11.143  -1.915  -10.877 1.00 0.00 ? 54  THR A HG22 4  
ATOM 9421  H HG23 . THR A 1 54  ? 10.888  -0.183  -10.651 1.00 0.00 ? 54  THR A HG23 4  
ATOM 9422  N N    . ARG A 1 55  ? 9.356   -4.477  -8.476  1.00 0.00 ? 55  ARG A N    4  
ATOM 9423  C CA   . ARG A 1 55  ? 10.144  -5.617  -8.041  1.00 0.00 ? 55  ARG A CA   4  
ATOM 9424  C C    . ARG A 1 55  ? 9.511   -6.933  -8.496  1.00 0.00 ? 55  ARG A C    4  
ATOM 9425  O O    . ARG A 1 55  ? 10.207  -7.938  -8.666  1.00 0.00 ? 55  ARG A O    4  
ATOM 9426  C CB   . ARG A 1 55  ? 10.315  -5.589  -6.521  1.00 0.00 ? 55  ARG A CB   4  
ATOM 9427  C CG   . ARG A 1 55  ? 11.107  -4.382  -6.033  1.00 0.00 ? 55  ARG A CG   4  
ATOM 9428  C CD   . ARG A 1 55  ? 11.475  -4.494  -4.564  1.00 0.00 ? 55  ARG A CD   4  
ATOM 9429  N NE   . ARG A 1 55  ? 10.599  -3.702  -3.705  1.00 0.00 ? 55  ARG A NE   4  
ATOM 9430  C CZ   . ARG A 1 55  ? 11.023  -2.701  -2.933  1.00 0.00 ? 55  ARG A CZ   4  
ATOM 9431  N NH1  . ARG A 1 55  ? 12.290  -2.307  -2.980  1.00 0.00 ? 55  ARG A NH1  4  
ATOM 9432  N NH2  . ARG A 1 55  ? 10.179  -2.086  -2.119  1.00 0.00 ? 55  ARG A NH2  4  
ATOM 9433  H H    . ARG A 1 55  ? 8.676   -4.106  -7.874  1.00 0.00 ? 55  ARG A H    4  
ATOM 9434  H HA   . ARG A 1 55  ? 11.119  -5.530  -8.499  1.00 0.00 ? 55  ARG A HA   4  
ATOM 9435  H HB2  . ARG A 1 55  ? 9.338   -5.564  -6.059  1.00 0.00 ? 55  ARG A HB2  4  
ATOM 9436  H HB3  . ARG A 1 55  ? 10.833  -6.484  -6.208  1.00 0.00 ? 55  ARG A HB3  4  
ATOM 9437  H HG2  . ARG A 1 55  ? 12.016  -4.304  -6.613  1.00 0.00 ? 55  ARG A HG2  4  
ATOM 9438  H HG3  . ARG A 1 55  ? 10.511  -3.492  -6.179  1.00 0.00 ? 55  ARG A HG3  4  
ATOM 9439  H HD2  . ARG A 1 55  ? 11.406  -5.530  -4.268  1.00 0.00 ? 55  ARG A HD2  4  
ATOM 9440  H HD3  . ARG A 1 55  ? 12.492  -4.151  -4.436  1.00 0.00 ? 55  ARG A HD3  4  
ATOM 9441  H HE   . ARG A 1 55  ? 9.650   -3.951  -3.674  1.00 0.00 ? 55  ARG A HE   4  
ATOM 9442  H HH11 . ARG A 1 55  ? 12.942  -2.761  -3.603  1.00 0.00 ? 55  ARG A HH11 4  
ATOM 9443  H HH12 . ARG A 1 55  ? 12.602  -1.550  -2.403  1.00 0.00 ? 55  ARG A HH12 4  
ATOM 9444  H HH21 . ARG A 1 55  ? 9.204   -2.368  -2.083  1.00 0.00 ? 55  ARG A HH21 4  
ATOM 9445  H HH22 . ARG A 1 55  ? 10.504  -1.347  -1.518  1.00 0.00 ? 55  ARG A HH22 4  
ATOM 9446  N N    . PHE A 1 56  ? 8.201   -6.926  -8.715  1.00 0.00 ? 56  PHE A N    4  
ATOM 9447  C CA   . PHE A 1 56  ? 7.501   -8.129  -9.154  1.00 0.00 ? 56  PHE A CA   4  
ATOM 9448  C C    . PHE A 1 56  ? 7.305   -8.126  -10.668 1.00 0.00 ? 56  PHE A C    4  
ATOM 9449  O O    . PHE A 1 56  ? 8.194   -8.553  -11.408 1.00 0.00 ? 56  PHE A O    4  
ATOM 9450  C CB   . PHE A 1 56  ? 6.152   -8.274  -8.440  1.00 0.00 ? 56  PHE A CB   4  
ATOM 9451  C CG   . PHE A 1 56  ? 5.425   -9.557  -8.760  1.00 0.00 ? 56  PHE A CG   4  
ATOM 9452  C CD1  . PHE A 1 56  ? 5.961   -10.782 -8.403  1.00 0.00 ? 56  PHE A CD1  4  
ATOM 9453  C CD2  . PHE A 1 56  ? 4.206   -9.530  -9.418  1.00 0.00 ? 56  PHE A CD2  4  
ATOM 9454  C CE1  . PHE A 1 56  ? 5.292   -11.957 -8.695  1.00 0.00 ? 56  PHE A CE1  4  
ATOM 9455  C CE2  . PHE A 1 56  ? 3.533   -10.700 -9.713  1.00 0.00 ? 56  PHE A CE2  4  
ATOM 9456  C CZ   . PHE A 1 56  ? 4.078   -11.915 -9.351  1.00 0.00 ? 56  PHE A CZ   4  
ATOM 9457  H H    . PHE A 1 56  ? 7.694   -6.096  -8.584  1.00 0.00 ? 56  PHE A H    4  
ATOM 9458  H HA   . PHE A 1 56  ? 8.121   -8.974  -8.895  1.00 0.00 ? 56  PHE A HA   4  
ATOM 9459  H HB2  . PHE A 1 56  ? 6.312   -8.246  -7.373  1.00 0.00 ? 56  PHE A HB2  4  
ATOM 9460  H HB3  . PHE A 1 56  ? 5.512   -7.452  -8.724  1.00 0.00 ? 56  PHE A HB3  4  
ATOM 9461  H HD1  . PHE A 1 56  ? 6.911   -10.816 -7.890  1.00 0.00 ? 56  PHE A HD1  4  
ATOM 9462  H HD2  . PHE A 1 56  ? 3.780   -8.582  -9.703  1.00 0.00 ? 56  PHE A HD2  4  
ATOM 9463  H HE1  . PHE A 1 56  ? 5.721   -12.907 -8.412  1.00 0.00 ? 56  PHE A HE1  4  
ATOM 9464  H HE2  . PHE A 1 56  ? 2.583   -10.663 -10.226 1.00 0.00 ? 56  PHE A HE2  4  
ATOM 9465  H HZ   . PHE A 1 56  ? 3.552   -12.831 -9.578  1.00 0.00 ? 56  PHE A HZ   4  
ATOM 9466  N N    . ARG A 1 57  ? 6.162   -7.609  -11.126 1.00 0.00 ? 57  ARG A N    4  
ATOM 9467  C CA   . ARG A 1 57  ? 5.837   -7.576  -12.551 1.00 0.00 ? 57  ARG A CA   4  
ATOM 9468  C C    . ARG A 1 57  ? 4.470   -6.931  -12.771 1.00 0.00 ? 57  ARG A C    4  
ATOM 9469  O O    . ARG A 1 57  ? 4.361   -5.876  -13.400 1.00 0.00 ? 57  ARG A O    4  
ATOM 9470  C CB   . ARG A 1 57  ? 5.842   -8.998  -13.130 1.00 0.00 ? 57  ARG A CB   4  
ATOM 9471  C CG   . ARG A 1 57  ? 5.267   -9.100  -14.533 1.00 0.00 ? 57  ARG A CG   4  
ATOM 9472  C CD   . ARG A 1 57  ? 5.118   -10.551 -14.970 1.00 0.00 ? 57  ARG A CD   4  
ATOM 9473  N NE   . ARG A 1 57  ? 4.515   -11.388 -13.927 1.00 0.00 ? 57  ARG A NE   4  
ATOM 9474  C CZ   . ARG A 1 57  ? 3.204   -11.568 -13.773 1.00 0.00 ? 57  ARG A CZ   4  
ATOM 9475  N NH1  . ARG A 1 57  ? 2.347   -10.958 -14.582 1.00 0.00 ? 57  ARG A NH1  4  
ATOM 9476  N NH2  . ARG A 1 57  ? 2.754   -12.364 -12.809 1.00 0.00 ? 57  ARG A NH2  4  
ATOM 9477  H H    . ARG A 1 57  ? 5.528   -7.216  -10.486 1.00 0.00 ? 57  ARG A H    4  
ATOM 9478  H HA   . ARG A 1 57  ? 6.589   -6.987  -13.053 1.00 0.00 ? 57  ARG A HA   4  
ATOM 9479  H HB2  . ARG A 1 57  ? 6.860   -9.359  -13.158 1.00 0.00 ? 57  ARG A HB2  4  
ATOM 9480  H HB3  . ARG A 1 57  ? 5.262   -9.639  -12.480 1.00 0.00 ? 57  ARG A HB3  4  
ATOM 9481  H HG2  . ARG A 1 57  ? 4.297   -8.628  -14.549 1.00 0.00 ? 57  ARG A HG2  4  
ATOM 9482  H HG3  . ARG A 1 57  ? 5.931   -8.591  -15.218 1.00 0.00 ? 57  ARG A HG3  4  
ATOM 9483  H HD2  . ARG A 1 57  ? 4.490   -10.584 -15.848 1.00 0.00 ? 57  ARG A HD2  4  
ATOM 9484  H HD3  . ARG A 1 57  ? 6.093   -10.942 -15.211 1.00 0.00 ? 57  ARG A HD3  4  
ATOM 9485  H HE   . ARG A 1 57  ? 5.132   -11.853 -13.312 1.00 0.00 ? 57  ARG A HE   4  
ATOM 9486  H HH11 . ARG A 1 57  ? 2.682   -10.353 -15.316 1.00 0.00 ? 57  ARG A HH11 4  
ATOM 9487  H HH12 . ARG A 1 57  ? 1.350   -11.103 -14.477 1.00 0.00 ? 57  ARG A HH12 4  
ATOM 9488  H HH21 . ARG A 1 57  ? 3.399   -12.834 -12.199 1.00 0.00 ? 57  ARG A HH21 4  
ATOM 9489  H HH22 . ARG A 1 57  ? 1.757   -12.493 -12.678 1.00 0.00 ? 57  ARG A HH22 4  
ATOM 9490  N N    . ARG A 1 58  ? 3.432   -7.581  -12.258 1.00 0.00 ? 58  ARG A N    4  
ATOM 9491  C CA   . ARG A 1 58  ? 2.070   -7.083  -12.388 1.00 0.00 ? 58  ARG A CA   4  
ATOM 9492  C C    . ARG A 1 58  ? 1.247   -7.481  -11.173 1.00 0.00 ? 58  ARG A C    4  
ATOM 9493  O O    . ARG A 1 58  ? 0.184   -8.087  -11.295 1.00 0.00 ? 58  ARG A O    4  
ATOM 9494  C CB   . ARG A 1 58  ? 1.420   -7.608  -13.669 1.00 0.00 ? 58  ARG A CB   4  
ATOM 9495  C CG   . ARG A 1 58  ? 1.444   -6.608  -14.818 1.00 0.00 ? 58  ARG A CG   4  
ATOM 9496  C CD   . ARG A 1 58  ? 0.443   -5.475  -14.608 1.00 0.00 ? 58  ARG A CD   4  
ATOM 9497  N NE   . ARG A 1 58  ? 0.839   -4.563  -13.530 1.00 0.00 ? 58  ARG A NE   4  
ATOM 9498  C CZ   . ARG A 1 58  ? 0.618   -3.248  -13.538 1.00 0.00 ? 58  ARG A CZ   4  
ATOM 9499  N NH1  . ARG A 1 58  ? 0.003   -2.675  -14.567 1.00 0.00 ? 58  ARG A NH1  4  
ATOM 9500  N NH2  . ARG A 1 58  ? 1.008   -2.513  -12.505 1.00 0.00 ? 58  ARG A NH2  4  
ATOM 9501  H H    . ARG A 1 58  ? 3.587   -8.415  -11.769 1.00 0.00 ? 58  ARG A H    4  
ATOM 9502  H HA   . ARG A 1 58  ? 2.118   -6.005  -12.435 1.00 0.00 ? 58  ARG A HA   4  
ATOM 9503  H HB2  . ARG A 1 58  ? 1.942   -8.499  -13.983 1.00 0.00 ? 58  ARG A HB2  4  
ATOM 9504  H HB3  . ARG A 1 58  ? 0.391   -7.858  -13.460 1.00 0.00 ? 58  ARG A HB3  4  
ATOM 9505  H HG2  . ARG A 1 58  ? 2.435   -6.185  -14.892 1.00 0.00 ? 58  ARG A HG2  4  
ATOM 9506  H HG3  . ARG A 1 58  ? 1.203   -7.124  -15.737 1.00 0.00 ? 58  ARG A HG3  4  
ATOM 9507  H HD2  . ARG A 1 58  ? 0.361   -4.913  -15.525 1.00 0.00 ? 58  ARG A HD2  4  
ATOM 9508  H HD3  . ARG A 1 58  ? -0.518  -5.908  -14.366 1.00 0.00 ? 58  ARG A HD3  4  
ATOM 9509  H HE   . ARG A 1 58  ? 1.296   -4.954  -12.753 1.00 0.00 ? 58  ARG A HE   4  
ATOM 9510  H HH11 . ARG A 1 58  ? -0.306  -3.229  -15.350 1.00 0.00 ? 58  ARG A HH11 4  
ATOM 9511  H HH12 . ARG A 1 58  ? -0.154  -1.677  -14.571 1.00 0.00 ? 58  ARG A HH12 4  
ATOM 9512  H HH21 . ARG A 1 58  ? 1.466   -2.954  -11.717 1.00 0.00 ? 58  ARG A HH21 4  
ATOM 9513  H HH22 . ARG A 1 58  ? 0.856   -1.519  -12.498 1.00 0.00 ? 58  ARG A HH22 4  
ATOM 9514  N N    . THR A 1 59  ? 1.750   -7.121  -10.006 1.00 0.00 ? 59  THR A N    4  
ATOM 9515  C CA   . THR A 1 59  ? 1.094   -7.421  -8.746  1.00 0.00 ? 59  THR A CA   4  
ATOM 9516  C C    . THR A 1 59  ? -0.259  -6.721  -8.656  1.00 0.00 ? 59  THR A C    4  
ATOM 9517  O O    . THR A 1 59  ? -1.179  -7.223  -8.017  1.00 0.00 ? 59  THR A O    4  
ATOM 9518  C CB   . THR A 1 59  ? 1.966   -6.990  -7.557  1.00 0.00 ? 59  THR A CB   4  
ATOM 9519  O OG1  . THR A 1 59  ? 3.334   -6.876  -7.972  1.00 0.00 ? 59  THR A OG1  4  
ATOM 9520  C CG2  . THR A 1 59  ? 1.862   -7.995  -6.419  1.00 0.00 ? 59  THR A CG2  4  
ATOM 9521  H H    . THR A 1 59  ? 2.598   -6.614  -9.993  1.00 0.00 ? 59  THR A H    4  
ATOM 9522  H HA   . THR A 1 59  ? 0.943   -8.490  -8.690  1.00 0.00 ? 59  THR A HA   4  
ATOM 9523  H HB   . THR A 1 59  ? 1.621   -6.029  -7.204  1.00 0.00 ? 59  THR A HB   4  
ATOM 9524  H HG1  . THR A 1 59  ? 3.425   -6.144  -8.605  1.00 0.00 ? 59  THR A HG1  4  
ATOM 9525  H HG21 . THR A 1 59  ? 2.479   -7.669  -5.596  1.00 0.00 ? 59  THR A HG21 4  
ATOM 9526  H HG22 . THR A 1 59  ? 2.199   -8.963  -6.759  1.00 0.00 ? 59  THR A HG22 4  
ATOM 9527  H HG23 . THR A 1 59  ? 0.835   -8.065  -6.093  1.00 0.00 ? 59  THR A HG23 4  
ATOM 9528  N N    . PHE A 1 60  ? -0.371  -5.561  -9.301  1.00 0.00 ? 60  PHE A N    4  
ATOM 9529  C CA   . PHE A 1 60  ? -1.620  -4.803  -9.305  1.00 0.00 ? 60  PHE A CA   4  
ATOM 9530  C C    . PHE A 1 60  ? -2.742  -5.636  -9.915  1.00 0.00 ? 60  PHE A C    4  
ATOM 9531  O O    . PHE A 1 60  ? -3.879  -5.610  -9.442  1.00 0.00 ? 60  PHE A O    4  
ATOM 9532  C CB   . PHE A 1 60  ? -1.458  -3.494  -10.083 1.00 0.00 ? 60  PHE A CB   4  
ATOM 9533  C CG   . PHE A 1 60  ? -0.982  -2.347  -9.236  1.00 0.00 ? 60  PHE A CG   4  
ATOM 9534  C CD1  . PHE A 1 60  ? -1.881  -1.612  -8.479  1.00 0.00 ? 60  PHE A CD1  4  
ATOM 9535  C CD2  . PHE A 1 60  ? 0.360   -2.003  -9.197  1.00 0.00 ? 60  PHE A CD2  4  
ATOM 9536  C CE1  . PHE A 1 60  ? -1.449  -0.556  -7.699  1.00 0.00 ? 60  PHE A CE1  4  
ATOM 9537  C CE2  . PHE A 1 60  ? 0.796   -0.948  -8.418  1.00 0.00 ? 60  PHE A CE2  4  
ATOM 9538  C CZ   . PHE A 1 60  ? -0.110  -0.225  -7.669  1.00 0.00 ? 60  PHE A CZ   4  
ATOM 9539  H H    . PHE A 1 60  ? 0.413   -5.200  -9.782  1.00 0.00 ? 60  PHE A H    4  
ATOM 9540  H HA   . PHE A 1 60  ? -1.874  -4.575  -8.281  1.00 0.00 ? 60  PHE A HA   4  
ATOM 9541  H HB2  . PHE A 1 60  ? -0.743  -3.640  -10.878 1.00 0.00 ? 60  PHE A HB2  4  
ATOM 9542  H HB3  . PHE A 1 60  ? -2.412  -3.219  -10.511 1.00 0.00 ? 60  PHE A HB3  4  
ATOM 9543  H HD1  . PHE A 1 60  ? -2.930  -1.870  -8.501  1.00 0.00 ? 60  PHE A HD1  4  
ATOM 9544  H HD2  . PHE A 1 60  ? 1.070   -2.569  -9.784  1.00 0.00 ? 60  PHE A HD2  4  
ATOM 9545  H HE1  . PHE A 1 60  ? -2.161  0.008   -7.113  1.00 0.00 ? 60  PHE A HE1  4  
ATOM 9546  H HE2  . PHE A 1 60  ? 1.844   -0.692  -8.394  1.00 0.00 ? 60  PHE A HE2  4  
ATOM 9547  H HZ   . PHE A 1 60  ? 0.230   0.601   -7.060  1.00 0.00 ? 60  PHE A HZ   4  
ATOM 9548  N N    . SER A 1 61  ? -2.409  -6.379  -10.960 1.00 0.00 ? 61  SER A N    4  
ATOM 9549  C CA   . SER A 1 61  ? -3.374  -7.229  -11.629 1.00 0.00 ? 61  SER A CA   4  
ATOM 9550  C C    . SER A 1 61  ? -3.446  -8.589  -10.947 1.00 0.00 ? 61  SER A C    4  
ATOM 9551  O O    . SER A 1 61  ? -4.524  -9.161  -10.791 1.00 0.00 ? 61  SER A O    4  
ATOM 9552  C CB   . SER A 1 61  ? -2.988  -7.386  -13.098 1.00 0.00 ? 61  SER A CB   4  
ATOM 9553  O OG   . SER A 1 61  ? -2.499  -6.160  -13.615 1.00 0.00 ? 61  SER A OG   4  
ATOM 9554  H H    . SER A 1 61  ? -1.488  -6.350  -11.295 1.00 0.00 ? 61  SER A H    4  
ATOM 9555  H HA   . SER A 1 61  ? -4.340  -6.752  -11.567 1.00 0.00 ? 61  SER A HA   4  
ATOM 9556  H HB2  . SER A 1 61  ? -2.218  -8.138  -13.189 1.00 0.00 ? 61  SER A HB2  4  
ATOM 9557  H HB3  . SER A 1 61  ? -3.855  -7.686  -13.669 1.00 0.00 ? 61  SER A HB3  4  
ATOM 9558  H HG   . SER A 1 61  ? -3.221  -5.514  -13.640 1.00 0.00 ? 61  SER A HG   4  
ATOM 9559  N N    . ASP A 1 62  ? -2.289  -9.086  -10.519 1.00 0.00 ? 62  ASP A N    4  
ATOM 9560  C CA   . ASP A 1 62  ? -2.196  -10.380 -9.846  1.00 0.00 ? 62  ASP A CA   4  
ATOM 9561  C C    . ASP A 1 62  ? -3.014  -10.391 -8.563  1.00 0.00 ? 62  ASP A C    4  
ATOM 9562  O O    . ASP A 1 62  ? -3.696  -11.370 -8.264  1.00 0.00 ? 62  ASP A O    4  
ATOM 9563  C CB   . ASP A 1 62  ? -0.737  -10.711 -9.530  1.00 0.00 ? 62  ASP A CB   4  
ATOM 9564  C CG   . ASP A 1 62  ? -0.578  -12.076 -8.893  1.00 0.00 ? 62  ASP A CG   4  
ATOM 9565  O OD1  . ASP A 1 62  ? -0.514  -13.077 -9.635  1.00 0.00 ? 62  ASP A OD1  4  
ATOM 9566  O OD2  . ASP A 1 62  ? -0.505  -12.155 -7.649  1.00 0.00 ? 62  ASP A OD2  4  
ATOM 9567  H H    . ASP A 1 62  ? -1.464  -8.571  -10.672 1.00 0.00 ? 62  ASP A H    4  
ATOM 9568  H HA   . ASP A 1 62  ? -2.588  -11.129 -10.516 1.00 0.00 ? 62  ASP A HA   4  
ATOM 9569  H HB2  . ASP A 1 62  ? -0.164  -10.692 -10.444 1.00 0.00 ? 62  ASP A HB2  4  
ATOM 9570  H HB3  . ASP A 1 62  ? -0.346  -9.968  -8.850  1.00 0.00 ? 62  ASP A HB3  4  
ATOM 9571  N N    . LEU A 1 63  ? -2.945  -9.293  -7.814  1.00 0.00 ? 63  LEU A N    4  
ATOM 9572  C CA   . LEU A 1 63  ? -3.685  -9.161  -6.563  1.00 0.00 ? 63  LEU A CA   4  
ATOM 9573  C C    . LEU A 1 63  ? -5.181  -9.297  -6.814  1.00 0.00 ? 63  LEU A C    4  
ATOM 9574  O O    . LEU A 1 63  ? -5.900  -9.919  -6.038  1.00 0.00 ? 63  LEU A O    4  
ATOM 9575  C CB   . LEU A 1 63  ? -3.384  -7.810  -5.908  1.00 0.00 ? 63  LEU A CB   4  
ATOM 9576  C CG   . LEU A 1 63  ? -3.918  -7.637  -4.485  1.00 0.00 ? 63  LEU A CG   4  
ATOM 9577  C CD1  . LEU A 1 63  ? -3.230  -8.603  -3.532  1.00 0.00 ? 63  LEU A CD1  4  
ATOM 9578  C CD2  . LEU A 1 63  ? -3.737  -6.197  -4.025  1.00 0.00 ? 63  LEU A CD2  4  
ATOM 9579  H H    . LEU A 1 63  ? -2.370  -8.551  -8.109  1.00 0.00 ? 63  LEU A H    4  
ATOM 9580  H HA   . LEU A 1 63  ? -3.368  -9.954  -5.903  1.00 0.00 ? 63  LEU A HA   4  
ATOM 9581  H HB2  . LEU A 1 63  ? -2.312  -7.678  -5.884  1.00 0.00 ? 63  LEU A HB2  4  
ATOM 9582  H HB3  . LEU A 1 63  ? -3.811  -7.033  -6.524  1.00 0.00 ? 63  LEU A HB3  4  
ATOM 9583  H HG   . LEU A 1 63  ? -4.974  -7.860  -4.479  1.00 0.00 ? 63  LEU A HG   4  
ATOM 9584  H HD11 . LEU A 1 63  ? -2.168  -8.402  -3.517  1.00 0.00 ? 63  LEU A HD11 4  
ATOM 9585  H HD12 . LEU A 1 63  ? -3.398  -9.616  -3.866  1.00 0.00 ? 63  LEU A HD12 4  
ATOM 9586  H HD13 . LEU A 1 63  ? -3.635  -8.479  -2.539  1.00 0.00 ? 63  LEU A HD13 4  
ATOM 9587  H HD21 . LEU A 1 63  ? -4.131  -6.083  -3.025  1.00 0.00 ? 63  LEU A HD21 4  
ATOM 9588  H HD22 . LEU A 1 63  ? -4.267  -5.536  -4.696  1.00 0.00 ? 63  LEU A HD22 4  
ATOM 9589  H HD23 . LEU A 1 63  ? -2.686  -5.945  -4.027  1.00 0.00 ? 63  LEU A HD23 4  
ATOM 9590  N N    . ALA A 1 64  ? -5.640  -8.714  -7.910  1.00 0.00 ? 64  ALA A N    4  
ATOM 9591  C CA   . ALA A 1 64  ? -7.042  -8.786  -8.274  1.00 0.00 ? 64  ALA A CA   4  
ATOM 9592  C C    . ALA A 1 64  ? -7.379  -10.184 -8.779  1.00 0.00 ? 64  ALA A C    4  
ATOM 9593  O O    . ALA A 1 64  ? -8.399  -10.760 -8.408  1.00 0.00 ? 64  ALA A O    4  
ATOM 9594  C CB   . ALA A 1 64  ? -7.376  -7.740  -9.328  1.00 0.00 ? 64  ALA A CB   4  
ATOM 9595  H H    . ALA A 1 64  ? -5.020  -8.220  -8.485  1.00 0.00 ? 64  ALA A H    4  
ATOM 9596  H HA   . ALA A 1 64  ? -7.631  -8.581  -7.390  1.00 0.00 ? 64  ALA A HA   4  
ATOM 9597  H HB1  . ALA A 1 64  ? -8.428  -7.793  -9.567  1.00 0.00 ? 64  ALA A HB1  4  
ATOM 9598  H HB2  . ALA A 1 64  ? -6.794  -7.927  -10.218 1.00 0.00 ? 64  ALA A HB2  4  
ATOM 9599  H HB3  . ALA A 1 64  ? -7.144  -6.757  -8.947  1.00 0.00 ? 64  ALA A HB3  4  
ATOM 9600  N N    . ALA A 1 65  ? -6.497  -10.728 -9.608  1.00 0.00 ? 65  ALA A N    4  
ATOM 9601  C CA   . ALA A 1 65  ? -6.682  -12.057 -10.176 1.00 0.00 ? 65  ALA A CA   4  
ATOM 9602  C C    . ALA A 1 65  ? -6.788  -13.124 -9.093  1.00 0.00 ? 65  ALA A C    4  
ATOM 9603  O O    . ALA A 1 65  ? -7.696  -13.957 -9.123  1.00 0.00 ? 65  ALA A O    4  
ATOM 9604  C CB   . ALA A 1 65  ? -5.547  -12.382 -11.137 1.00 0.00 ? 65  ALA A CB   4  
ATOM 9605  H H    . ALA A 1 65  ? -5.697  -10.212 -9.858  1.00 0.00 ? 65  ALA A H    4  
ATOM 9606  H HA   . ALA A 1 65  ? -7.604  -12.048 -10.741 1.00 0.00 ? 65  ALA A HA   4  
ATOM 9607  H HB1  . ALA A 1 65  ? -5.722  -13.347 -11.588 1.00 0.00 ? 65  ALA A HB1  4  
ATOM 9608  H HB2  . ALA A 1 65  ? -4.612  -12.400 -10.598 1.00 0.00 ? 65  ALA A HB2  4  
ATOM 9609  H HB3  . ALA A 1 65  ? -5.503  -11.628 -11.909 1.00 0.00 ? 65  ALA A HB3  4  
ATOM 9610  N N    . GLN A 1 66  ? -5.875  -13.092 -8.127  1.00 0.00 ? 66  GLN A N    4  
ATOM 9611  C CA   . GLN A 1 66  ? -5.885  -14.068 -7.042  1.00 0.00 ? 66  GLN A CA   4  
ATOM 9612  C C    . GLN A 1 66  ? -7.124  -13.889 -6.167  1.00 0.00 ? 66  GLN A C    4  
ATOM 9613  O O    . GLN A 1 66  ? -7.686  -14.860 -5.665  1.00 0.00 ? 66  GLN A O    4  
ATOM 9614  C CB   . GLN A 1 66  ? -4.608  -13.969 -6.197  1.00 0.00 ? 66  GLN A CB   4  
ATOM 9615  C CG   . GLN A 1 66  ? -4.405  -12.617 -5.527  1.00 0.00 ? 66  GLN A CG   4  
ATOM 9616  C CD   . GLN A 1 66  ? -3.163  -12.568 -4.660  1.00 0.00 ? 66  GLN A CD   4  
ATOM 9617  O OE1  . GLN A 1 66  ? -3.215  -12.838 -3.462  1.00 0.00 ? 66  GLN A OE1  4  
ATOM 9618  N NE2  . GLN A 1 66  ? -2.034  -12.232 -5.260  1.00 0.00 ? 66  GLN A NE2  4  
ATOM 9619  H H    . GLN A 1 66  ? -5.171  -12.404 -8.151  1.00 0.00 ? 66  GLN A H    4  
ATOM 9620  H HA   . GLN A 1 66  ? -5.927  -15.049 -7.491  1.00 0.00 ? 66  GLN A HA   4  
ATOM 9621  H HB2  . GLN A 1 66  ? -4.643  -14.724 -5.427  1.00 0.00 ? 66  GLN A HB2  4  
ATOM 9622  H HB3  . GLN A 1 66  ? -3.757  -14.159 -6.835  1.00 0.00 ? 66  GLN A HB3  4  
ATOM 9623  H HG2  . GLN A 1 66  ? -4.318  -11.861 -6.292  1.00 0.00 ? 66  GLN A HG2  4  
ATOM 9624  H HG3  . GLN A 1 66  ? -5.266  -12.403 -4.910  1.00 0.00 ? 66  GLN A HG3  4  
ATOM 9625  H HE21 . GLN A 1 66  ? -2.057  -12.036 -6.227  1.00 0.00 ? 66  GLN A HE21 4  
ATOM 9626  H HE22 . GLN A 1 66  ? -1.219  -12.186 -4.721  1.00 0.00 ? 66  GLN A HE22 4  
ATOM 9627  N N    . LEU A 1 67  ? -7.561  -12.643 -6.012  1.00 0.00 ? 67  LEU A N    4  
ATOM 9628  C CA   . LEU A 1 67  ? -8.743  -12.345 -5.208  1.00 0.00 ? 67  LEU A CA   4  
ATOM 9629  C C    . LEU A 1 67  ? -10.001 -12.842 -5.910  1.00 0.00 ? 67  LEU A C    4  
ATOM 9630  O O    . LEU A 1 67  ? -11.014 -13.128 -5.272  1.00 0.00 ? 67  LEU A O    4  
ATOM 9631  C CB   . LEU A 1 67  ? -8.845  -10.839 -4.938  1.00 0.00 ? 67  LEU A CB   4  
ATOM 9632  C CG   . LEU A 1 67  ? -8.488  -10.399 -3.514  1.00 0.00 ? 67  LEU A CG   4  
ATOM 9633  C CD1  . LEU A 1 67  ? -9.562  -10.841 -2.535  1.00 0.00 ? 67  LEU A CD1  4  
ATOM 9634  C CD2  . LEU A 1 67  ? -7.131  -10.953 -3.103  1.00 0.00 ? 67  LEU A CD2  4  
ATOM 9635  H H    . LEU A 1 67  ? -7.075  -11.906 -6.440  1.00 0.00 ? 67  LEU A H    4  
ATOM 9636  H HA   . LEU A 1 67  ? -8.641  -12.865 -4.268  1.00 0.00 ? 67  LEU A HA   4  
ATOM 9637  H HB2  . LEU A 1 67  ? -8.188  -10.324 -5.624  1.00 0.00 ? 67  LEU A HB2  4  
ATOM 9638  H HB3  . LEU A 1 67  ? -9.860  -10.528 -5.139  1.00 0.00 ? 67  LEU A HB3  4  
ATOM 9639  H HG   . LEU A 1 67  ? -8.432  -9.321  -3.483  1.00 0.00 ? 67  LEU A HG   4  
ATOM 9640  H HD11 . LEU A 1 67  ? -10.497 -10.369 -2.791  1.00 0.00 ? 67  LEU A HD11 4  
ATOM 9641  H HD12 . LEU A 1 67  ? -9.275  -10.555 -1.533  1.00 0.00 ? 67  LEU A HD12 4  
ATOM 9642  H HD13 . LEU A 1 67  ? -9.674  -11.915 -2.583  1.00 0.00 ? 67  LEU A HD13 4  
ATOM 9643  H HD21 . LEU A 1 67  ? -6.376  -10.603 -3.792  1.00 0.00 ? 67  LEU A HD21 4  
ATOM 9644  H HD22 . LEU A 1 67  ? -7.162  -12.032 -3.121  1.00 0.00 ? 67  LEU A HD22 4  
ATOM 9645  H HD23 . LEU A 1 67  ? -6.892  -10.615 -2.106  1.00 0.00 ? 67  LEU A HD23 4  
ATOM 9646  N N    . HIS A 1 68  ? -9.924  -12.956 -7.234  1.00 0.00 ? 68  HIS A N    4  
ATOM 9647  C CA   . HIS A 1 68  ? -11.050 -13.427 -8.030  1.00 0.00 ? 68  HIS A CA   4  
ATOM 9648  C C    . HIS A 1 68  ? -11.150 -14.948 -7.969  1.00 0.00 ? 68  HIS A C    4  
ATOM 9649  O O    . HIS A 1 68  ? -12.158 -15.530 -8.365  1.00 0.00 ? 68  HIS A O    4  
ATOM 9650  C CB   . HIS A 1 68  ? -10.937 -12.949 -9.484  1.00 0.00 ? 68  HIS A CB   4  
ATOM 9651  C CG   . HIS A 1 68  ? -11.526 -11.589 -9.712  1.00 0.00 ? 68  HIS A CG   4  
ATOM 9652  N ND1  . HIS A 1 68  ? -12.877 -11.372 -9.863  1.00 0.00 ? 68  HIS A ND1  4  
ATOM 9653  C CD2  . HIS A 1 68  ? -10.943 -10.369 -9.796  1.00 0.00 ? 68  HIS A CD2  4  
ATOM 9654  C CE1  . HIS A 1 68  ? -13.098 -10.081 -10.028 1.00 0.00 ? 68  HIS A CE1  4  
ATOM 9655  N NE2  . HIS A 1 68  ? -11.942 -9.449  -9.990  1.00 0.00 ? 68  HIS A NE2  4  
ATOM 9656  H H    . HIS A 1 68  ? -9.084  -12.713 -7.685  1.00 0.00 ? 68  HIS A H    4  
ATOM 9657  H HA   . HIS A 1 68  ? -11.949 -13.011 -7.598  1.00 0.00 ? 68  HIS A HA   4  
ATOM 9658  H HB2  . HIS A 1 68  ? -9.895  -12.912 -9.763  1.00 0.00 ? 68  HIS A HB2  4  
ATOM 9659  H HB3  . HIS A 1 68  ? -11.453 -13.649 -10.128 1.00 0.00 ? 68  HIS A HB3  4  
ATOM 9660  H HD1  . HIS A 1 68  ? -13.578 -12.069 -9.859  1.00 0.00 ? 68  HIS A HD1  4  
ATOM 9661  H HD2  . HIS A 1 68  ? -9.884  -10.159 -9.721  1.00 0.00 ? 68  HIS A HD2  4  
ATOM 9662  H HE1  . HIS A 1 68  ? -14.066 -9.621  -10.171 1.00 0.00 ? 68  HIS A HE1  4  
ATOM 9663  H HE2  . HIS A 1 68  ? -11.837 -8.472  -9.890  1.00 0.00 ? 68  HIS A HE2  4  
ATOM 9664  N N    . VAL A 1 69  ? -10.097 -15.589 -7.469  1.00 0.00 ? 69  VAL A N    4  
ATOM 9665  C CA   . VAL A 1 69  ? -10.082 -17.041 -7.327  1.00 0.00 ? 69  VAL A CA   4  
ATOM 9666  C C    . VAL A 1 69  ? -10.932 -17.422 -6.122  1.00 0.00 ? 69  VAL A C    4  
ATOM 9667  O O    . VAL A 1 69  ? -11.542 -18.494 -6.071  1.00 0.00 ? 69  VAL A O    4  
ATOM 9668  C CB   . VAL A 1 69  ? -8.647  -17.588 -7.146  1.00 0.00 ? 69  VAL A CB   4  
ATOM 9669  C CG1  . VAL A 1 69  ? -8.651  -19.103 -7.018  1.00 0.00 ? 69  VAL A CG1  4  
ATOM 9670  C CG2  . VAL A 1 69  ? -7.759  -17.162 -8.301  1.00 0.00 ? 69  VAL A CG2  4  
ATOM 9671  H H    . VAL A 1 69  ? -9.313  -15.072 -7.186  1.00 0.00 ? 69  VAL A H    4  
ATOM 9672  H HA   . VAL A 1 69  ? -10.512 -17.476 -8.220  1.00 0.00 ? 69  VAL A HA   4  
ATOM 9673  H HB   . VAL A 1 69  ? -8.238  -17.174 -6.234  1.00 0.00 ? 69  VAL A HB   4  
ATOM 9674  H HG11 . VAL A 1 69  ? -9.362  -19.399 -6.262  1.00 0.00 ? 69  VAL A HG11 4  
ATOM 9675  H HG12 . VAL A 1 69  ? -7.665  -19.442 -6.736  1.00 0.00 ? 69  VAL A HG12 4  
ATOM 9676  H HG13 . VAL A 1 69  ? -8.926  -19.543 -7.964  1.00 0.00 ? 69  VAL A HG13 4  
ATOM 9677  H HG21 . VAL A 1 69  ? -6.769  -17.569 -8.162  1.00 0.00 ? 69  VAL A HG21 4  
ATOM 9678  H HG22 . VAL A 1 69  ? -7.705  -16.083 -8.335  1.00 0.00 ? 69  VAL A HG22 4  
ATOM 9679  H HG23 . VAL A 1 69  ? -8.174  -17.531 -9.227  1.00 0.00 ? 69  VAL A HG23 4  
ATOM 9680  N N    . THR A 1 70  ? -10.971 -16.516 -5.160  1.00 0.00 ? 70  THR A N    4  
ATOM 9681  C CA   . THR A 1 70  ? -11.743 -16.705 -3.951  1.00 0.00 ? 70  THR A CA   4  
ATOM 9682  C C    . THR A 1 70  ? -13.127 -16.069 -4.098  1.00 0.00 ? 70  THR A C    4  
ATOM 9683  O O    . THR A 1 70  ? -13.339 -15.240 -4.987  1.00 0.00 ? 70  THR A O    4  
ATOM 9684  C CB   . THR A 1 70  ? -11.011 -16.086 -2.743  1.00 0.00 ? 70  THR A CB   4  
ATOM 9685  O OG1  . THR A 1 70  ? -10.417 -14.836 -3.121  1.00 0.00 ? 70  THR A OG1  4  
ATOM 9686  C CG2  . THR A 1 70  ? -9.933  -17.026 -2.219  1.00 0.00 ? 70  THR A CG2  4  
ATOM 9687  H H    . THR A 1 70  ? -10.460 -15.687 -5.269  1.00 0.00 ? 70  THR A H    4  
ATOM 9688  H HA   . THR A 1 70  ? -11.854 -17.768 -3.781  1.00 0.00 ? 70  THR A HA   4  
ATOM 9689  H HB   . THR A 1 70  ? -11.733 -15.911 -1.957  1.00 0.00 ? 70  THR A HB   4  
ATOM 9690  H HG1  . THR A 1 70  ? -10.994 -14.376 -3.742  1.00 0.00 ? 70  THR A HG1  4  
ATOM 9691  H HG21 . THR A 1 70  ? -9.188  -17.183 -2.984  1.00 0.00 ? 70  THR A HG21 4  
ATOM 9692  H HG22 . THR A 1 70  ? -10.380 -17.973 -1.952  1.00 0.00 ? 70  THR A HG22 4  
ATOM 9693  H HG23 . THR A 1 70  ? -9.467  -16.589 -1.349  1.00 0.00 ? 70  THR A HG23 4  
ATOM 9694  N N    . PRO A 1 71  ? -14.094 -16.470 -3.256  1.00 0.00 ? 71  PRO A N    4  
ATOM 9695  C CA   . PRO A 1 71  ? -15.456 -15.923 -3.284  1.00 0.00 ? 71  PRO A CA   4  
ATOM 9696  C C    . PRO A 1 71  ? -15.510 -14.488 -2.751  1.00 0.00 ? 71  PRO A C    4  
ATOM 9697  O O    . PRO A 1 71  ? -16.039 -14.229 -1.665  1.00 0.00 ? 71  PRO A O    4  
ATOM 9698  C CB   . PRO A 1 71  ? -16.250 -16.872 -2.371  1.00 0.00 ? 71  PRO A CB   4  
ATOM 9699  C CG   . PRO A 1 71  ? -15.349 -18.039 -2.126  1.00 0.00 ? 71  PRO A CG   4  
ATOM 9700  C CD   . PRO A 1 71  ? -13.955 -17.506 -2.227  1.00 0.00 ? 71  PRO A CD   4  
ATOM 9701  H HA   . PRO A 1 71  ? -15.870 -15.948 -4.282  1.00 0.00 ? 71  PRO A HA   4  
ATOM 9702  H HB2  . PRO A 1 71  ? -16.497 -16.366 -1.450  1.00 0.00 ? 71  PRO A HB2  4  
ATOM 9703  H HB3  . PRO A 1 71  ? -17.157 -17.178 -2.871  1.00 0.00 ? 71  PRO A HB3  4  
ATOM 9704  H HG2  . PRO A 1 71  ? -15.528 -18.441 -1.139  1.00 0.00 ? 71  PRO A HG2  4  
ATOM 9705  H HG3  . PRO A 1 71  ? -15.516 -18.798 -2.876  1.00 0.00 ? 71  PRO A HG3  4  
ATOM 9706  H HD2  . PRO A 1 71  ? -13.640 -17.081 -1.284  1.00 0.00 ? 71  PRO A HD2  4  
ATOM 9707  H HD3  . PRO A 1 71  ? -13.273 -18.281 -2.546  1.00 0.00 ? 71  PRO A HD3  4  
ATOM 9708  N N    . GLY A 1 72  ? -14.950 -13.562 -3.519  1.00 0.00 ? 72  GLY A N    4  
ATOM 9709  C CA   . GLY A 1 72  ? -14.932 -12.168 -3.124  1.00 0.00 ? 72  GLY A CA   4  
ATOM 9710  C C    . GLY A 1 72  ? -16.241 -11.462 -3.420  1.00 0.00 ? 72  GLY A C    4  
ATOM 9711  O O    . GLY A 1 72  ? -17.266 -12.106 -3.653  1.00 0.00 ? 72  GLY A O    4  
ATOM 9712  H H    . GLY A 1 72  ? -14.539 -13.833 -4.370  1.00 0.00 ? 72  GLY A H    4  
ATOM 9713  H HA2  . GLY A 1 72  ? -14.738 -12.108 -2.063  1.00 0.00 ? 72  GLY A HA2  4  
ATOM 9714  H HA3  . GLY A 1 72  ? -14.137 -11.665 -3.652  1.00 0.00 ? 72  GLY A HA3  4  
ATOM 9715  N N    . SER A 1 73  ? -16.212 -10.136 -3.406  1.00 0.00 ? 73  SER A N    4  
ATOM 9716  C CA   . SER A 1 73  ? -17.399 -9.333  -3.669  1.00 0.00 ? 73  SER A CA   4  
ATOM 9717  C C    . SER A 1 73  ? -16.992 -7.977  -4.249  1.00 0.00 ? 73  SER A C    4  
ATOM 9718  O O    . SER A 1 73  ? -16.161 -7.913  -5.159  1.00 0.00 ? 73  SER A O    4  
ATOM 9719  C CB   . SER A 1 73  ? -18.218 -9.161  -2.384  1.00 0.00 ? 73  SER A CB   4  
ATOM 9720  O OG   . SER A 1 73  ? -18.442 -10.412 -1.754  1.00 0.00 ? 73  SER A OG   4  
ATOM 9721  H H    . SER A 1 73  ? -15.365 -9.680  -3.230  1.00 0.00 ? 73  SER A H    4  
ATOM 9722  H HA   . SER A 1 73  ? -17.996 -9.857  -4.402  1.00 0.00 ? 73  SER A HA   4  
ATOM 9723  H HB2  . SER A 1 73  ? -17.682 -8.520  -1.700  1.00 0.00 ? 73  SER A HB2  4  
ATOM 9724  H HB3  . SER A 1 73  ? -19.171 -8.714  -2.624  1.00 0.00 ? 73  SER A HB3  4  
ATOM 9725  H HG   . SER A 1 73  ? -18.219 -11.121 -2.373  1.00 0.00 ? 73  SER A HG   4  
ATOM 9726  N N    . ALA A 1 74  ? -17.546 -6.897  -3.713  1.00 0.00 ? 74  ALA A N    4  
ATOM 9727  C CA   . ALA A 1 74  ? -17.233 -5.564  -4.201  1.00 0.00 ? 74  ALA A CA   4  
ATOM 9728  C C    . ALA A 1 74  ? -16.205 -4.883  -3.302  1.00 0.00 ? 74  ALA A C    4  
ATOM 9729  O O    . ALA A 1 74  ? -15.485 -5.550  -2.553  1.00 0.00 ? 74  ALA A O    4  
ATOM 9730  C CB   . ALA A 1 74  ? -18.499 -4.726  -4.295  1.00 0.00 ? 74  ALA A CB   4  
ATOM 9731  H H    . ALA A 1 74  ? -18.166 -6.994  -2.955  1.00 0.00 ? 74  ALA A H    4  
ATOM 9732  H HA   . ALA A 1 74  ? -16.821 -5.661  -5.195  1.00 0.00 ? 74  ALA A HA   4  
ATOM 9733  H HB1  . ALA A 1 74  ? -18.944 -4.637  -3.314  1.00 0.00 ? 74  ALA A HB1  4  
ATOM 9734  H HB2  . ALA A 1 74  ? -19.198 -5.200  -4.967  1.00 0.00 ? 74  ALA A HB2  4  
ATOM 9735  H HB3  . ALA A 1 74  ? -18.251 -3.742  -4.667  1.00 0.00 ? 74  ALA A HB3  4  
ATOM 9736  N N    . GLN A 1 75  ? -16.160 -3.555  -3.375  1.00 0.00 ? 75  GLN A N    4  
ATOM 9737  C CA   . GLN A 1 75  ? -15.227 -2.745  -2.595  1.00 0.00 ? 75  GLN A CA   4  
ATOM 9738  C C    . GLN A 1 75  ? -15.267 -3.087  -1.108  1.00 0.00 ? 75  GLN A C    4  
ATOM 9739  O O    . GLN A 1 75  ? -14.224 -3.223  -0.475  1.00 0.00 ? 75  GLN A O    4  
ATOM 9740  C CB   . GLN A 1 75  ? -15.550 -1.263  -2.786  1.00 0.00 ? 75  GLN A CB   4  
ATOM 9741  C CG   . GLN A 1 75  ? -14.807 -0.616  -3.944  1.00 0.00 ? 75  GLN A CG   4  
ATOM 9742  C CD   . GLN A 1 75  ? -13.438 -0.107  -3.542  1.00 0.00 ? 75  GLN A CD   4  
ATOM 9743  O OE1  . GLN A 1 75  ? -12.773 -0.680  -2.682  1.00 0.00 ? 75  GLN A OE1  4  
ATOM 9744  N NE2  . GLN A 1 75  ? -13.009 0.981   -4.159  1.00 0.00 ? 75  GLN A NE2  4  
ATOM 9745  H H    . GLN A 1 75  ? -16.785 -3.099  -3.977  1.00 0.00 ? 75  GLN A H    4  
ATOM 9746  H HA   . GLN A 1 75  ? -14.234 -2.934  -2.969  1.00 0.00 ? 75  GLN A HA   4  
ATOM 9747  H HB2  . GLN A 1 75  ? -16.611 -1.160  -2.964  1.00 0.00 ? 75  GLN A HB2  4  
ATOM 9748  H HB3  . GLN A 1 75  ? -15.293 -0.732  -1.880  1.00 0.00 ? 75  GLN A HB3  4  
ATOM 9749  H HG2  . GLN A 1 75  ? -14.685 -1.347  -4.729  1.00 0.00 ? 75  GLN A HG2  4  
ATOM 9750  H HG3  . GLN A 1 75  ? -15.392 0.213   -4.313  1.00 0.00 ? 75  GLN A HG3  4  
ATOM 9751  H HE21 . GLN A 1 75  ? -13.590 1.391   -4.835  1.00 0.00 ? 75  GLN A HE21 4  
ATOM 9752  H HE22 . GLN A 1 75  ? -12.133 1.337   -3.906  1.00 0.00 ? 75  GLN A HE22 4  
ATOM 9753  N N    . GLN A 1 76  ? -16.470 -3.256  -0.568  1.00 0.00 ? 76  GLN A N    4  
ATOM 9754  C CA   . GLN A 1 76  ? -16.650 -3.565  0.849   1.00 0.00 ? 76  GLN A CA   4  
ATOM 9755  C C    . GLN A 1 76  ? -15.847 -4.800  1.251   1.00 0.00 ? 76  GLN A C    4  
ATOM 9756  O O    . GLN A 1 76  ? -15.175 -4.807  2.279   1.00 0.00 ? 76  GLN A O    4  
ATOM 9757  C CB   . GLN A 1 76  ? -18.135 -3.781  1.170   1.00 0.00 ? 76  GLN A CB   4  
ATOM 9758  C CG   . GLN A 1 76  ? -19.025 -2.578  0.877   1.00 0.00 ? 76  GLN A CG   4  
ATOM 9759  C CD   . GLN A 1 76  ? -19.347 -2.426  -0.599  1.00 0.00 ? 76  GLN A CD   4  
ATOM 9760  O OE1  . GLN A 1 76  ? -19.312 -3.398  -1.355  1.00 0.00 ? 76  GLN A OE1  4  
ATOM 9761  N NE2  . GLN A 1 76  ? -19.663 -1.211  -1.017  1.00 0.00 ? 76  GLN A NE2  4  
ATOM 9762  H H    . GLN A 1 76  ? -17.263 -3.180  -1.142  1.00 0.00 ? 76  GLN A H    4  
ATOM 9763  H HA   . GLN A 1 76  ? -16.291 -2.720  1.416   1.00 0.00 ? 76  GLN A HA   4  
ATOM 9764  H HB2  . GLN A 1 76  ? -18.497 -4.615  0.583   1.00 0.00 ? 76  GLN A HB2  4  
ATOM 9765  H HB3  . GLN A 1 76  ? -18.230 -4.025  2.216   1.00 0.00 ? 76  GLN A HB3  4  
ATOM 9766  H HG2  . GLN A 1 76  ? -19.951 -2.691  1.419   1.00 0.00 ? 76  GLN A HG2  4  
ATOM 9767  H HG3  . GLN A 1 76  ? -18.519 -1.684  1.212   1.00 0.00 ? 76  GLN A HG3  4  
ATOM 9768  H HE21 . GLN A 1 76  ? -19.674 -0.482  -0.360  1.00 0.00 ? 76  GLN A HE21 4  
ATOM 9769  H HE22 . GLN A 1 76  ? -19.882 -1.089  -1.969  1.00 0.00 ? 76  GLN A HE22 4  
ATOM 9770  N N    . ARG A 1 77  ? -15.905 -5.833  0.422   1.00 0.00 ? 77  ARG A N    4  
ATOM 9771  C CA   . ARG A 1 77  ? -15.184 -7.068  0.691   1.00 0.00 ? 77  ARG A CA   4  
ATOM 9772  C C    . ARG A 1 77  ? -13.681 -6.875  0.497   1.00 0.00 ? 77  ARG A C    4  
ATOM 9773  O O    . ARG A 1 77  ? -12.875 -7.418  1.252   1.00 0.00 ? 77  ARG A O    4  
ATOM 9774  C CB   . ARG A 1 77  ? -15.695 -8.184  -0.225  1.00 0.00 ? 77  ARG A CB   4  
ATOM 9775  C CG   . ARG A 1 77  ? -14.933 -9.495  -0.102  1.00 0.00 ? 77  ARG A CG   4  
ATOM 9776  C CD   . ARG A 1 77  ? -15.240 -10.209 1.205   1.00 0.00 ? 77  ARG A CD   4  
ATOM 9777  N NE   . ARG A 1 77  ? -16.670 -10.468 1.370   1.00 0.00 ? 77  ARG A NE   4  
ATOM 9778  C CZ   . ARG A 1 77  ? -17.216 -11.686 1.399   1.00 0.00 ? 77  ARG A CZ   4  
ATOM 9779  N NH1  . ARG A 1 77  ? -16.460 -12.766 1.234   1.00 0.00 ? 77  ARG A NH1  4  
ATOM 9780  N NH2  . ARG A 1 77  ? -18.522 -11.821 1.575   1.00 0.00 ? 77  ARG A NH2  4  
ATOM 9781  H H    . ARG A 1 77  ? -16.445 -5.759  -0.394  1.00 0.00 ? 77  ARG A H    4  
ATOM 9782  H HA   . ARG A 1 77  ? -15.371 -7.345  1.718   1.00 0.00 ? 77  ARG A HA   4  
ATOM 9783  H HB2  . ARG A 1 77  ? -16.733 -8.377  0.010   1.00 0.00 ? 77  ARG A HB2  4  
ATOM 9784  H HB3  . ARG A 1 77  ? -15.628 -7.849  -1.251  1.00 0.00 ? 77  ARG A HB3  4  
ATOM 9785  H HG2  . ARG A 1 77  ? -15.206 -10.139 -0.925  1.00 0.00 ? 77  ARG A HG2  4  
ATOM 9786  H HG3  . ARG A 1 77  ? -13.874 -9.287  -0.146  1.00 0.00 ? 77  ARG A HG3  4  
ATOM 9787  H HD2  . ARG A 1 77  ? -14.710 -11.149 1.219   1.00 0.00 ? 77  ARG A HD2  4  
ATOM 9788  H HD3  . ARG A 1 77  ? -14.899 -9.592  2.024   1.00 0.00 ? 77  ARG A HD3  4  
ATOM 9789  H HE   . ARG A 1 77  ? -17.257 -9.684  1.479   1.00 0.00 ? 77  ARG A HE   4  
ATOM 9790  H HH11 . ARG A 1 77  ? -15.477 -12.674 1.089   1.00 0.00 ? 77  ARG A HH11 4  
ATOM 9791  H HH12 . ARG A 1 77  ? -16.879 -13.686 1.254   1.00 0.00 ? 77  ARG A HH12 4  
ATOM 9792  H HH21 . ARG A 1 77  ? -19.109 -11.006 1.682   1.00 0.00 ? 77  ARG A HH21 4  
ATOM 9793  H HH22 . ARG A 1 77  ? -18.936 -12.737 1.626   1.00 0.00 ? 77  ARG A HH22 4  
ATOM 9794  N N    . PHE A 1 78  ? -13.314 -6.090  -0.511  1.00 0.00 ? 78  PHE A N    4  
ATOM 9795  C CA   . PHE A 1 78  ? -11.909 -5.833  -0.814  1.00 0.00 ? 78  PHE A CA   4  
ATOM 9796  C C    . PHE A 1 78  ? -11.226 -5.057  0.307   1.00 0.00 ? 78  PHE A C    4  
ATOM 9797  O O    . PHE A 1 78  ? -10.127 -5.407  0.728   1.00 0.00 ? 78  PHE A O    4  
ATOM 9798  C CB   . PHE A 1 78  ? -11.773 -5.079  -2.139  1.00 0.00 ? 78  PHE A CB   4  
ATOM 9799  C CG   . PHE A 1 78  ? -12.031 -5.939  -3.345  1.00 0.00 ? 78  PHE A CG   4  
ATOM 9800  C CD1  . PHE A 1 78  ? -11.468 -7.204  -3.444  1.00 0.00 ? 78  PHE A CD1  4  
ATOM 9801  C CD2  . PHE A 1 78  ? -12.832 -5.484  -4.377  1.00 0.00 ? 78  PHE A CD2  4  
ATOM 9802  C CE1  . PHE A 1 78  ? -11.703 -7.995  -4.553  1.00 0.00 ? 78  PHE A CE1  4  
ATOM 9803  C CE2  . PHE A 1 78  ? -13.070 -6.270  -5.488  1.00 0.00 ? 78  PHE A CE2  4  
ATOM 9804  C CZ   . PHE A 1 78  ? -12.505 -7.527  -5.576  1.00 0.00 ? 78  PHE A CZ   4  
ATOM 9805  H H    . PHE A 1 78  ? -14.008 -5.662  -1.061  1.00 0.00 ? 78  PHE A H    4  
ATOM 9806  H HA   . PHE A 1 78  ? -11.418 -6.790  -0.912  1.00 0.00 ? 78  PHE A HA   4  
ATOM 9807  H HB2  . PHE A 1 78  ? -12.481 -4.263  -2.155  1.00 0.00 ? 78  PHE A HB2  4  
ATOM 9808  H HB3  . PHE A 1 78  ? -10.772 -4.683  -2.220  1.00 0.00 ? 78  PHE A HB3  4  
ATOM 9809  H HD1  . PHE A 1 78  ? -10.841 -7.571  -2.644  1.00 0.00 ? 78  PHE A HD1  4  
ATOM 9810  H HD2  . PHE A 1 78  ? -13.274 -4.502  -4.311  1.00 0.00 ? 78  PHE A HD2  4  
ATOM 9811  H HE1  . PHE A 1 78  ? -11.262 -8.977  -4.621  1.00 0.00 ? 78  PHE A HE1  4  
ATOM 9812  H HE2  . PHE A 1 78  ? -13.699 -5.903  -6.286  1.00 0.00 ? 78  PHE A HE2  4  
ATOM 9813  H HZ   . PHE A 1 78  ? -12.689 -8.144  -6.444  1.00 0.00 ? 78  PHE A HZ   4  
ATOM 9814  N N    . THR A 1 79  ? -11.873 -4.010  0.798   1.00 0.00 ? 79  THR A N    4  
ATOM 9815  C CA   . THR A 1 79  ? -11.299 -3.213  1.871   1.00 0.00 ? 79  THR A CA   4  
ATOM 9816  C C    . THR A 1 79  ? -11.271 -4.001  3.178   1.00 0.00 ? 79  THR A C    4  
ATOM 9817  O O    . THR A 1 79  ? -10.303 -3.932  3.938   1.00 0.00 ? 79  THR A O    4  
ATOM 9818  C CB   . THR A 1 79  ? -12.083 -1.905  2.087   1.00 0.00 ? 79  THR A CB   4  
ATOM 9819  O OG1  . THR A 1 79  ? -12.545 -1.398  0.829   1.00 0.00 ? 79  THR A OG1  4  
ATOM 9820  C CG2  . THR A 1 79  ? -11.213 -0.857  2.769   1.00 0.00 ? 79  THR A CG2  4  
ATOM 9821  H H    . THR A 1 79  ? -12.752 -3.763  0.428   1.00 0.00 ? 79  THR A H    4  
ATOM 9822  H HA   . THR A 1 79  ? -10.286 -2.960  1.593   1.00 0.00 ? 79  THR A HA   4  
ATOM 9823  H HB   . THR A 1 79  ? -12.934 -2.111  2.719   1.00 0.00 ? 79  THR A HB   4  
ATOM 9824  H HG1  . THR A 1 79  ? -11.915 -1.624  0.137   1.00 0.00 ? 79  THR A HG1  4  
ATOM 9825  H HG21 . THR A 1 79  ? -10.896 -1.225  3.735   1.00 0.00 ? 79  THR A HG21 4  
ATOM 9826  H HG22 . THR A 1 79  ? -11.780 0.053   2.898   1.00 0.00 ? 79  THR A HG22 4  
ATOM 9827  H HG23 . THR A 1 79  ? -10.347 -0.658  2.158   1.00 0.00 ? 79  THR A HG23 4  
ATOM 9828  N N    . GLN A 1 80  ? -12.326 -4.777  3.413   1.00 0.00 ? 80  GLN A N    4  
ATOM 9829  C CA   . GLN A 1 80  ? -12.440 -5.576  4.629   1.00 0.00 ? 80  GLN A CA   4  
ATOM 9830  C C    . GLN A 1 80  ? -11.377 -6.672  4.686   1.00 0.00 ? 80  GLN A C    4  
ATOM 9831  O O    . GLN A 1 80  ? -10.910 -7.039  5.764   1.00 0.00 ? 80  GLN A O    4  
ATOM 9832  C CB   . GLN A 1 80  ? -13.831 -6.203  4.734   1.00 0.00 ? 80  GLN A CB   4  
ATOM 9833  C CG   . GLN A 1 80  ? -14.198 -6.615  6.148   1.00 0.00 ? 80  GLN A CG   4  
ATOM 9834  C CD   . GLN A 1 80  ? -14.641 -5.439  6.996   1.00 0.00 ? 80  GLN A CD   4  
ATOM 9835  O OE1  . GLN A 1 80  ? -15.836 -5.172  7.131   1.00 0.00 ? 80  GLN A OE1  4  
ATOM 9836  N NE2  . GLN A 1 80  ? -13.686 -4.715  7.556   1.00 0.00 ? 80  GLN A NE2  4  
ATOM 9837  H H    . GLN A 1 80  ? -13.049 -4.810  2.752   1.00 0.00 ? 80  GLN A H    4  
ATOM 9838  H HA   . GLN A 1 80  ? -12.295 -4.913  5.470   1.00 0.00 ? 80  GLN A HA   4  
ATOM 9839  H HB2  . GLN A 1 80  ? -14.562 -5.488  4.386   1.00 0.00 ? 80  GLN A HB2  4  
ATOM 9840  H HB3  . GLN A 1 80  ? -13.869 -7.079  4.105   1.00 0.00 ? 80  GLN A HB3  4  
ATOM 9841  H HG2  . GLN A 1 80  ? -15.004 -7.332  6.104   1.00 0.00 ? 80  GLN A HG2  4  
ATOM 9842  H HG3  . GLN A 1 80  ? -13.335 -7.070  6.612   1.00 0.00 ? 80  GLN A HG3  4  
ATOM 9843  H HE21 . GLN A 1 80  ? -12.746 -4.973  7.397   1.00 0.00 ? 80  GLN A HE21 4  
ATOM 9844  H HE22 . GLN A 1 80  ? -13.948 -3.942  8.096   1.00 0.00 ? 80  GLN A HE22 4  
ATOM 9845  N N    . VAL A 1 81  ? -10.992 -7.192  3.528   1.00 0.00 ? 81  VAL A N    4  
ATOM 9846  C CA   . VAL A 1 81  ? -9.987  -8.247  3.471   1.00 0.00 ? 81  VAL A CA   4  
ATOM 9847  C C    . VAL A 1 81  ? -8.585  -7.682  3.712   1.00 0.00 ? 81  VAL A C    4  
ATOM 9848  O O    . VAL A 1 81  ? -7.633  -8.424  3.943   1.00 0.00 ? 81  VAL A O    4  
ATOM 9849  C CB   . VAL A 1 81  ? -10.043 -9.012  2.125   1.00 0.00 ? 81  VAL A CB   4  
ATOM 9850  C CG1  . VAL A 1 81  ? -9.267  -8.291  1.032   1.00 0.00 ? 81  VAL A CG1  4  
ATOM 9851  C CG2  . VAL A 1 81  ? -9.542  -10.439 2.296   1.00 0.00 ? 81  VAL A CG2  4  
ATOM 9852  H H    . VAL A 1 81  ? -11.398 -6.865  2.695   1.00 0.00 ? 81  VAL A H    4  
ATOM 9853  H HA   . VAL A 1 81  ? -10.209 -8.950  4.263   1.00 0.00 ? 81  VAL A HA   4  
ATOM 9854  H HB   . VAL A 1 81  ? -11.076 -9.061  1.815   1.00 0.00 ? 81  VAL A HB   4  
ATOM 9855  H HG11 . VAL A 1 81  ? -9.692  -7.310  0.874   1.00 0.00 ? 81  VAL A HG11 4  
ATOM 9856  H HG12 . VAL A 1 81  ? -9.323  -8.859  0.115   1.00 0.00 ? 81  VAL A HG12 4  
ATOM 9857  H HG13 . VAL A 1 81  ? -8.232  -8.191  1.329   1.00 0.00 ? 81  VAL A HG13 4  
ATOM 9858  H HG21 . VAL A 1 81  ? -8.553  -10.427 2.727   1.00 0.00 ? 81  VAL A HG21 4  
ATOM 9859  H HG22 . VAL A 1 81  ? -9.510  -10.925 1.333   1.00 0.00 ? 81  VAL A HG22 4  
ATOM 9860  H HG23 . VAL A 1 81  ? -10.213 -10.980 2.948   1.00 0.00 ? 81  VAL A HG23 4  
ATOM 9861  N N    . SER A 1 82  ? -8.474  -6.361  3.687   1.00 0.00 ? 82  SER A N    4  
ATOM 9862  C CA   . SER A 1 82  ? -7.198  -5.704  3.909   1.00 0.00 ? 82  SER A CA   4  
ATOM 9863  C C    . SER A 1 82  ? -6.971  -5.484  5.404   1.00 0.00 ? 82  SER A C    4  
ATOM 9864  O O    . SER A 1 82  ? -5.897  -5.781  5.933   1.00 0.00 ? 82  SER A O    4  
ATOM 9865  C CB   . SER A 1 82  ? -7.156  -4.369  3.164   1.00 0.00 ? 82  SER A CB   4  
ATOM 9866  O OG   . SER A 1 82  ? -7.609  -4.512  1.826   1.00 0.00 ? 82  SER A OG   4  
ATOM 9867  H H    . SER A 1 82  ? -9.272  -5.816  3.519   1.00 0.00 ? 82  SER A H    4  
ATOM 9868  H HA   . SER A 1 82  ? -6.420  -6.348  3.526   1.00 0.00 ? 82  SER A HA   4  
ATOM 9869  H HB2  . SER A 1 82  ? -7.789  -3.656  3.671   1.00 0.00 ? 82  SER A HB2  4  
ATOM 9870  H HB3  . SER A 1 82  ? -6.140  -4.001  3.149   1.00 0.00 ? 82  SER A HB3  4  
ATOM 9871  H HG   . SER A 1 82  ? -8.234  -5.246  1.771   1.00 0.00 ? 82  SER A HG   4  
ATOM 9872  N N    . ASP A 1 83  ? -7.999  -4.991  6.090   1.00 0.00 ? 83  ASP A N    4  
ATOM 9873  C CA   . ASP A 1 83  ? -7.901  -4.725  7.524   1.00 0.00 ? 83  ASP A CA   4  
ATOM 9874  C C    . ASP A 1 83  ? -8.090  -6.003  8.338   1.00 0.00 ? 83  ASP A C    4  
ATOM 9875  O O    . ASP A 1 83  ? -7.798  -6.033  9.531   1.00 0.00 ? 83  ASP A O    4  
ATOM 9876  C CB   . ASP A 1 83  ? -8.924  -3.664  7.954   1.00 0.00 ? 83  ASP A CB   4  
ATOM 9877  C CG   . ASP A 1 83  ? -10.356 -4.169  7.940   1.00 0.00 ? 83  ASP A CG   4  
ATOM 9878  O OD1  . ASP A 1 83  ? -10.951 -4.238  6.852   1.00 0.00 ? 83  ASP A OD1  4  
ATOM 9879  O OD2  . ASP A 1 83  ? -10.900 -4.485  9.021   1.00 0.00 ? 83  ASP A OD2  4  
ATOM 9880  H H    . ASP A 1 83  ? -8.843  -4.801  5.623   1.00 0.00 ? 83  ASP A H    4  
ATOM 9881  H HA   . ASP A 1 83  ? -6.908  -4.345  7.714   1.00 0.00 ? 83  ASP A HA   4  
ATOM 9882  H HB2  . ASP A 1 83  ? -8.691  -3.340  8.957   1.00 0.00 ? 83  ASP A HB2  4  
ATOM 9883  H HB3  . ASP A 1 83  ? -8.855  -2.820  7.286   1.00 0.00 ? 83  ASP A HB3  4  
ATOM 9884  N N    . GLU A 1 84  ? -8.558  -7.058  7.680   1.00 0.00 ? 84  GLU A N    4  
ATOM 9885  C CA   . GLU A 1 84  ? -8.782  -8.345  8.334   1.00 0.00 ? 84  GLU A CA   4  
ATOM 9886  C C    . GLU A 1 84  ? -7.476  -8.906  8.901   1.00 0.00 ? 84  GLU A C    4  
ATOM 9887  O O    . GLU A 1 84  ? -7.444  -9.433  10.013  1.00 0.00 ? 84  GLU A O    4  
ATOM 9888  C CB   . GLU A 1 84  ? -9.393  -9.336  7.338   1.00 0.00 ? 84  GLU A CB   4  
ATOM 9889  C CG   . GLU A 1 84  ? -9.657  -10.721 7.913   1.00 0.00 ? 84  GLU A CG   4  
ATOM 9890  C CD   . GLU A 1 84  ? -10.701 -10.716 9.008   1.00 0.00 ? 84  GLU A CD   4  
ATOM 9891  O OE1  . GLU A 1 84  ? -11.904 -10.617 8.692   1.00 0.00 ? 84  GLU A OE1  4  
ATOM 9892  O OE2  . GLU A 1 84  ? -10.325 -10.826 10.196  1.00 0.00 ? 84  GLU A OE2  4  
ATOM 9893  H H    . GLU A 1 84  ? -8.770  -6.966  6.727   1.00 0.00 ? 84  GLU A H    4  
ATOM 9894  H HA   . GLU A 1 84  ? -9.477  -8.188  9.145   1.00 0.00 ? 84  GLU A HA   4  
ATOM 9895  H HB2  . GLU A 1 84  ? -10.332 -8.937  6.982   1.00 0.00 ? 84  GLU A HB2  4  
ATOM 9896  H HB3  . GLU A 1 84  ? -8.718  -9.441  6.499   1.00 0.00 ? 84  GLU A HB3  4  
ATOM 9897  H HG2  . GLU A 1 84  ? -9.998  -11.366 7.118   1.00 0.00 ? 84  GLU A HG2  4  
ATOM 9898  H HG3  . GLU A 1 84  ? -8.733  -11.108 8.317   1.00 0.00 ? 84  GLU A HG3  4  
ATOM 9899  N N    . LEU A 1 85  ? -6.399  -8.778  8.136   1.00 0.00 ? 85  LEU A N    4  
ATOM 9900  C CA   . LEU A 1 85  ? -5.101  -9.285  8.565   1.00 0.00 ? 85  LEU A CA   4  
ATOM 9901  C C    . LEU A 1 85  ? -4.249  -8.173  9.171   1.00 0.00 ? 85  LEU A C    4  
ATOM 9902  O O    . LEU A 1 85  ? -3.221  -8.434  9.796   1.00 0.00 ? 85  LEU A O    4  
ATOM 9903  C CB   . LEU A 1 85  ? -4.364  -9.925  7.384   1.00 0.00 ? 85  LEU A CB   4  
ATOM 9904  C CG   . LEU A 1 85  ? -3.812  -11.334 7.639   1.00 0.00 ? 85  LEU A CG   4  
ATOM 9905  C CD1  . LEU A 1 85  ? -2.559  -11.277 8.500   1.00 0.00 ? 85  LEU A CD1  4  
ATOM 9906  C CD2  . LEU A 1 85  ? -4.869  -12.216 8.289   1.00 0.00 ? 85  LEU A CD2  4  
ATOM 9907  H H    . LEU A 1 85  ? -6.478  -8.332  7.267   1.00 0.00 ? 85  LEU A H    4  
ATOM 9908  H HA   . LEU A 1 85  ? -5.274  -10.037 9.318   1.00 0.00 ? 85  LEU A HA   4  
ATOM 9909  H HB2  . LEU A 1 85  ? -5.045  -9.976  6.547   1.00 0.00 ? 85  LEU A HB2  4  
ATOM 9910  H HB3  . LEU A 1 85  ? -3.538  -9.285  7.117   1.00 0.00 ? 85  LEU A HB3  4  
ATOM 9911  H HG   . LEU A 1 85  ? -3.542  -11.780 6.692   1.00 0.00 ? 85  LEU A HG   4  
ATOM 9912  H HD11 . LEU A 1 85  ? -1.822  -10.651 8.019   1.00 0.00 ? 85  LEU A HD11 4  
ATOM 9913  H HD12 . LEU A 1 85  ? -2.162  -12.273 8.622   1.00 0.00 ? 85  LEU A HD12 4  
ATOM 9914  H HD13 . LEU A 1 85  ? -2.807  -10.866 9.468   1.00 0.00 ? 85  LEU A HD13 4  
ATOM 9915  H HD21 . LEU A 1 85  ? -4.472  -13.210 8.426   1.00 0.00 ? 85  LEU A HD21 4  
ATOM 9916  H HD22 . LEU A 1 85  ? -5.742  -12.261 7.654   1.00 0.00 ? 85  LEU A HD22 4  
ATOM 9917  H HD23 . LEU A 1 85  ? -5.144  -11.804 9.248   1.00 0.00 ? 85  LEU A HD23 4  
ATOM 9918  N N    . PHE A 1 86  ? -4.685  -6.934  8.997   1.00 0.00 ? 86  PHE A N    4  
ATOM 9919  C CA   . PHE A 1 86  ? -3.952  -5.792  9.529   1.00 0.00 ? 86  PHE A CA   4  
ATOM 9920  C C    . PHE A 1 86  ? -4.008  -5.777  11.056  1.00 0.00 ? 86  PHE A C    4  
ATOM 9921  O O    . PHE A 1 86  ? -3.112  -5.249  11.717  1.00 0.00 ? 86  PHE A O    4  
ATOM 9922  C CB   . PHE A 1 86  ? -4.510  -4.484  8.967   1.00 0.00 ? 86  PHE A CB   4  
ATOM 9923  C CG   . PHE A 1 86  ? -3.553  -3.333  9.068   1.00 0.00 ? 86  PHE A CG   4  
ATOM 9924  C CD1  . PHE A 1 86  ? -2.441  -3.269  8.246   1.00 0.00 ? 86  PHE A CD1  4  
ATOM 9925  C CD2  . PHE A 1 86  ? -3.762  -2.319  9.987   1.00 0.00 ? 86  PHE A CD2  4  
ATOM 9926  C CE1  . PHE A 1 86  ? -1.556  -2.215  8.340   1.00 0.00 ? 86  PHE A CE1  4  
ATOM 9927  C CE2  . PHE A 1 86  ? -2.880  -1.262  10.084  1.00 0.00 ? 86  PHE A CE2  4  
ATOM 9928  C CZ   . PHE A 1 86  ? -1.775  -1.210  9.260   1.00 0.00 ? 86  PHE A CZ   4  
ATOM 9929  H H    . PHE A 1 86  ? -5.516  -6.783  8.501   1.00 0.00 ? 86  PHE A H    4  
ATOM 9930  H HA   . PHE A 1 86  ? -2.922  -5.894  9.222   1.00 0.00 ? 86  PHE A HA   4  
ATOM 9931  H HB2  . PHE A 1 86  ? -4.755  -4.622  7.925   1.00 0.00 ? 86  PHE A HB2  4  
ATOM 9932  H HB3  . PHE A 1 86  ? -5.406  -4.220  9.511   1.00 0.00 ? 86  PHE A HB3  4  
ATOM 9933  H HD1  . PHE A 1 86  ? -2.270  -4.054  7.525   1.00 0.00 ? 86  PHE A HD1  4  
ATOM 9934  H HD2  . PHE A 1 86  ? -4.626  -2.360  10.631  1.00 0.00 ? 86  PHE A HD2  4  
ATOM 9935  H HE1  . PHE A 1 86  ? -0.691  -2.174  7.694   1.00 0.00 ? 86  PHE A HE1  4  
ATOM 9936  H HE2  . PHE A 1 86  ? -3.057  -0.476  10.806  1.00 0.00 ? 86  PHE A HE2  4  
ATOM 9937  H HZ   . PHE A 1 86  ? -1.082  -0.384  9.334   1.00 0.00 ? 86  PHE A HZ   4  
ATOM 9938  N N    . GLN A 1 87  ? -5.054  -6.384  11.607  1.00 0.00 ? 87  GLN A N    4  
ATOM 9939  C CA   . GLN A 1 87  ? -5.234  -6.453  13.058  1.00 0.00 ? 87  GLN A CA   4  
ATOM 9940  C C    . GLN A 1 87  ? -4.186  -7.368  13.688  1.00 0.00 ? 87  GLN A C    4  
ATOM 9941  O O    . GLN A 1 87  ? -4.050  -7.428  14.911  1.00 0.00 ? 87  GLN A O    4  
ATOM 9942  C CB   . GLN A 1 87  ? -6.637  -6.966  13.396  1.00 0.00 ? 87  GLN A CB   4  
ATOM 9943  C CG   . GLN A 1 87  ? -7.754  -6.211  12.696  1.00 0.00 ? 87  GLN A CG   4  
ATOM 9944  C CD   . GLN A 1 87  ? -9.049  -7.000  12.650  1.00 0.00 ? 87  GLN A CD   4  
ATOM 9945  O OE1  . GLN A 1 87  ? -9.395  -7.719  13.590  1.00 0.00 ? 87  GLN A OE1  4  
ATOM 9946  N NE2  . GLN A 1 87  ? -9.767  -6.886  11.546  1.00 0.00 ? 87  GLN A NE2  4  
ATOM 9947  H H    . GLN A 1 87  ? -5.730  -6.788  11.025  1.00 0.00 ? 87  GLN A H    4  
ATOM 9948  H HA   . GLN A 1 87  ? -5.115  -5.457  13.459  1.00 0.00 ? 87  GLN A HA   4  
ATOM 9949  H HB2  . GLN A 1 87  ? -6.703  -8.006  13.113  1.00 0.00 ? 87  GLN A HB2  4  
ATOM 9950  H HB3  . GLN A 1 87  ? -6.789  -6.883  14.463  1.00 0.00 ? 87  GLN A HB3  4  
ATOM 9951  H HG2  . GLN A 1 87  ? -7.932  -5.288  13.227  1.00 0.00 ? 87  GLN A HG2  4  
ATOM 9952  H HG3  . GLN A 1 87  ? -7.445  -5.991  11.684  1.00 0.00 ? 87  GLN A HG3  4  
ATOM 9953  H HE21 . GLN A 1 87  ? -9.428  -6.304  10.828  1.00 0.00 ? 87  GLN A HE21 4  
ATOM 9954  H HE22 . GLN A 1 87  ? -10.603 -7.397  11.482  1.00 0.00 ? 87  GLN A HE22 4  
ATOM 9955  N N    . GLY A 1 88  ? -3.451  -8.081  12.842  1.00 0.00 ? 88  GLY A N    4  
ATOM 9956  C CA   . GLY A 1 88  ? -2.426  -8.980  13.321  1.00 0.00 ? 88  GLY A CA   4  
ATOM 9957  C C    . GLY A 1 88  ? -1.092  -8.285  13.498  1.00 0.00 ? 88  GLY A C    4  
ATOM 9958  O O    . GLY A 1 88  ? -0.154  -8.863  14.045  1.00 0.00 ? 88  GLY A O    4  
ATOM 9959  H H    . GLY A 1 88  ? -3.607  -7.991  11.878  1.00 0.00 ? 88  GLY A H    4  
ATOM 9960  H HA2  . GLY A 1 88  ? -2.736  -9.392  14.272  1.00 0.00 ? 88  GLY A HA2  4  
ATOM 9961  H HA3  . GLY A 1 88  ? -2.308  -9.786  12.613  1.00 0.00 ? 88  GLY A HA3  4  
ATOM 9962  N N    . GLY A 1 89  ? -1.000  -7.046  13.031  1.00 0.00 ? 89  GLY A N    4  
ATOM 9963  C CA   . GLY A 1 89  ? 0.235   -6.301  13.159  1.00 0.00 ? 89  GLY A CA   4  
ATOM 9964  C C    . GLY A 1 89  ? 0.610   -5.561  11.887  1.00 0.00 ? 89  GLY A C    4  
ATOM 9965  O O    . GLY A 1 89  ? 0.548   -6.127  10.794  1.00 0.00 ? 89  GLY A O    4  
ATOM 9966  H H    . GLY A 1 89  ? -1.781  -6.634  12.596  1.00 0.00 ? 89  GLY A H    4  
ATOM 9967  H HA2  . GLY A 1 89  ? 0.128   -5.584  13.960  1.00 0.00 ? 89  GLY A HA2  4  
ATOM 9968  H HA3  . GLY A 1 89  ? 1.029   -6.987  13.410  1.00 0.00 ? 89  GLY A HA3  4  
ATOM 9969  N N    . PRO A 1 90  ? 1.005   -4.284  12.003  1.00 0.00 ? 90  PRO A N    4  
ATOM 9970  C CA   . PRO A 1 90  ? 1.400   -3.469  10.855  1.00 0.00 ? 90  PRO A CA   4  
ATOM 9971  C C    . PRO A 1 90  ? 2.823   -3.780  10.397  1.00 0.00 ? 90  PRO A C    4  
ATOM 9972  O O    . PRO A 1 90  ? 3.738   -2.974  10.569  1.00 0.00 ? 90  PRO A O    4  
ATOM 9973  C CB   . PRO A 1 90  ? 1.298   -2.042  11.393  1.00 0.00 ? 90  PRO A CB   4  
ATOM 9974  C CG   . PRO A 1 90  ? 1.570   -2.162  12.854  1.00 0.00 ? 90  PRO A CG   4  
ATOM 9975  C CD   . PRO A 1 90  ? 1.090   -3.530  13.269  1.00 0.00 ? 90  PRO A CD   4  
ATOM 9976  H HA   . PRO A 1 90  ? 0.720   -3.597  10.027  1.00 0.00 ? 90  PRO A HA   4  
ATOM 9977  H HB2  . PRO A 1 90  ? 2.032   -1.416  10.904  1.00 0.00 ? 90  PRO A HB2  4  
ATOM 9978  H HB3  . PRO A 1 90  ? 0.307   -1.655  11.207  1.00 0.00 ? 90  PRO A HB3  4  
ATOM 9979  H HG2  . PRO A 1 90  ? 2.630   -2.067  13.040  1.00 0.00 ? 90  PRO A HG2  4  
ATOM 9980  H HG3  . PRO A 1 90  ? 1.027   -1.397  13.392  1.00 0.00 ? 90  PRO A HG3  4  
ATOM 9981  H HD2  . PRO A 1 90  ? 1.799   -3.990  13.940  1.00 0.00 ? 90  PRO A HD2  4  
ATOM 9982  H HD3  . PRO A 1 90  ? 0.120   -3.461  13.739  1.00 0.00 ? 90  PRO A HD3  4  
ATOM 9983  N N    . ASN A 1 91  ? 3.004   -4.966  9.834   1.00 0.00 ? 91  ASN A N    4  
ATOM 9984  C CA   . ASN A 1 91  ? 4.313   -5.396  9.352   1.00 0.00 ? 91  ASN A CA   4  
ATOM 9985  C C    . ASN A 1 91  ? 4.738   -4.580  8.127   1.00 0.00 ? 91  ASN A C    4  
ATOM 9986  O O    . ASN A 1 91  ? 3.942   -3.813  7.579   1.00 0.00 ? 91  ASN A O    4  
ATOM 9987  C CB   . ASN A 1 91  ? 4.286   -6.890  9.019   1.00 0.00 ? 91  ASN A CB   4  
ATOM 9988  C CG   . ASN A 1 91  ? 5.662   -7.532  9.076   1.00 0.00 ? 91  ASN A CG   4  
ATOM 9989  O OD1  . ASN A 1 91  ? 6.350   -7.475  10.093  1.00 0.00 ? 91  ASN A OD1  4  
ATOM 9990  N ND2  . ASN A 1 91  ? 6.075   -8.136  7.979   1.00 0.00 ? 91  ASN A ND2  4  
ATOM 9991  H H    . ASN A 1 91  ? 2.238   -5.572  9.749   1.00 0.00 ? 91  ASN A H    4  
ATOM 9992  H HA   . ASN A 1 91  ? 5.025   -5.226  10.145  1.00 0.00 ? 91  ASN A HA   4  
ATOM 9993  H HB2  . ASN A 1 91  ? 3.648   -7.396  9.729   1.00 0.00 ? 91  ASN A HB2  4  
ATOM 9994  H HB3  . ASN A 1 91  ? 3.887   -7.025  8.025   1.00 0.00 ? 91  ASN A HB3  4  
ATOM 9995  H HD21 . ASN A 1 91  ? 5.474   -8.136  7.191   1.00 0.00 ? 91  ASN A HD21 4  
ATOM 9996  H HD22 . ASN A 1 91  ? 6.956   -8.562  7.985   1.00 0.00 ? 91  ASN A HD22 4  
ATOM 9997  N N    . TRP A 1 92  ? 5.987   -4.769  7.703   1.00 0.00 ? 92  TRP A N    4  
ATOM 9998  C CA   . TRP A 1 92  ? 6.568   -4.051  6.566   1.00 0.00 ? 92  TRP A CA   4  
ATOM 9999  C C    . TRP A 1 92  ? 5.645   -4.015  5.348   1.00 0.00 ? 92  TRP A C    4  
ATOM 10000 O O    . TRP A 1 92  ? 5.096   -2.968  5.009   1.00 0.00 ? 92  TRP A O    4  
ATOM 10001 C CB   . TRP A 1 92  ? 7.903   -4.686  6.167   1.00 0.00 ? 92  TRP A CB   4  
ATOM 10002 C CG   . TRP A 1 92  ? 8.764   -5.061  7.334   1.00 0.00 ? 92  TRP A CG   4  
ATOM 10003 C CD1  . TRP A 1 92  ? 9.243   -4.227  8.301   1.00 0.00 ? 92  TRP A CD1  4  
ATOM 10004 C CD2  . TRP A 1 92  ? 9.252   -6.367  7.652   1.00 0.00 ? 92  TRP A CD2  4  
ATOM 10005 N NE1  . TRP A 1 92  ? 9.988   -4.935  9.208   1.00 0.00 ? 92  TRP A NE1  4  
ATOM 10006 C CE2  . TRP A 1 92  ? 10.012  -6.250  8.829   1.00 0.00 ? 92  TRP A CE2  4  
ATOM 10007 C CE3  . TRP A 1 92  ? 9.118   -7.622  7.057   1.00 0.00 ? 92  TRP A CE3  4  
ATOM 10008 C CZ2  . TRP A 1 92  ? 10.634  -7.343  9.424   1.00 0.00 ? 92  TRP A CZ2  4  
ATOM 10009 C CZ3  . TRP A 1 92  ? 9.736   -8.704  7.649   1.00 0.00 ? 92  TRP A CZ3  4  
ATOM 10010 C CH2  . TRP A 1 92  ? 10.485  -8.560  8.820   1.00 0.00 ? 92  TRP A CH2  4  
ATOM 10011 H H    . TRP A 1 92  ? 6.545   -5.422  8.175   1.00 0.00 ? 92  TRP A H    4  
ATOM 10012 H HA   . TRP A 1 92  ? 6.757   -3.035  6.883   1.00 0.00 ? 92  TRP A HA   4  
ATOM 10013 H HB2  . TRP A 1 92  ? 7.713   -5.583  5.595   1.00 0.00 ? 92  TRP A HB2  4  
ATOM 10014 H HB3  . TRP A 1 92  ? 8.457   -3.988  5.557   1.00 0.00 ? 92  TRP A HB3  4  
ATOM 10015 H HD1  . TRP A 1 92  ? 9.050   -3.165  8.338   1.00 0.00 ? 92  TRP A HD1  4  
ATOM 10016 H HE1  . TRP A 1 92  ? 10.436  -4.556  10.000  1.00 0.00 ? 92  TRP A HE1  4  
ATOM 10017 H HE3  . TRP A 1 92  ? 8.544   -7.754  6.152   1.00 0.00 ? 92  TRP A HE3  4  
ATOM 10018 H HZ2  . TRP A 1 92  ? 11.215  -7.249  10.331  1.00 0.00 ? 92  TRP A HZ2  4  
ATOM 10019 H HZ3  . TRP A 1 92  ? 9.644   -9.684  7.204   1.00 0.00 ? 92  TRP A HZ3  4  
ATOM 10020 H HH2  . TRP A 1 92  ? 10.951  -9.436  9.247   1.00 0.00 ? 92  TRP A HH2  4  
ATOM 10021 N N    . GLY A 1 93  ? 5.483   -5.155  4.690   1.00 0.00 ? 93  GLY A N    4  
ATOM 10022 C CA   . GLY A 1 93  ? 4.640   -5.215  3.511   1.00 0.00 ? 93  GLY A CA   4  
ATOM 10023 C C    . GLY A 1 93  ? 3.169   -5.291  3.853   1.00 0.00 ? 93  GLY A C    4  
ATOM 10024 O O    . GLY A 1 93  ? 2.319   -5.062  2.996   1.00 0.00 ? 93  GLY A O    4  
ATOM 10025 H H    . GLY A 1 93  ? 5.931   -5.978  5.012   1.00 0.00 ? 93  GLY A H    4  
ATOM 10026 H HA2  . GLY A 1 93  ? 4.812   -4.332  2.911   1.00 0.00 ? 93  GLY A HA2  4  
ATOM 10027 H HA3  . GLY A 1 93  ? 4.908   -6.086  2.933   1.00 0.00 ? 93  GLY A HA3  4  
ATOM 10028 N N    . ARG A 1 94  ? 2.867   -5.620  5.103   1.00 0.00 ? 94  ARG A N    4  
ATOM 10029 C CA   . ARG A 1 94  ? 1.483   -5.717  5.552   1.00 0.00 ? 94  ARG A CA   4  
ATOM 10030 C C    . ARG A 1 94  ? 0.799   -4.363  5.422   1.00 0.00 ? 94  ARG A C    4  
ATOM 10031 O O    . ARG A 1 94  ? -0.322  -4.269  4.923   1.00 0.00 ? 94  ARG A O    4  
ATOM 10032 C CB   . ARG A 1 94  ? 1.423   -6.200  7.000   1.00 0.00 ? 94  ARG A CB   4  
ATOM 10033 C CG   . ARG A 1 94  ? 0.301   -7.188  7.262   1.00 0.00 ? 94  ARG A CG   4  
ATOM 10034 C CD   . ARG A 1 94  ? 0.798   -8.398  8.038   1.00 0.00 ? 94  ARG A CD   4  
ATOM 10035 N NE   . ARG A 1 94  ? 1.967   -9.007  7.403   1.00 0.00 ? 94  ARG A NE   4  
ATOM 10036 C CZ   . ARG A 1 94  ? 2.275   -10.300 7.475   1.00 0.00 ? 94  ARG A CZ   4  
ATOM 10037 N NH1  . ARG A 1 94  ? 1.514   -11.138 8.169   1.00 0.00 ? 94  ARG A NH1  4  
ATOM 10038 N NH2  . ARG A 1 94  ? 3.359   -10.747 6.857   1.00 0.00 ? 94  ARG A NH2  4  
ATOM 10039 H H    . ARG A 1 94  ? 3.593   -5.814  5.733   1.00 0.00 ? 94  ARG A H    4  
ATOM 10040 H HA   . ARG A 1 94  ? 0.975   -6.430  4.919   1.00 0.00 ? 94  ARG A HA   4  
ATOM 10041 H HB2  . ARG A 1 94  ? 2.361   -6.677  7.249   1.00 0.00 ? 94  ARG A HB2  4  
ATOM 10042 H HB3  . ARG A 1 94  ? 1.282   -5.346  7.647   1.00 0.00 ? 94  ARG A HB3  4  
ATOM 10043 H HG2  . ARG A 1 94  ? -0.474  -6.699  7.834   1.00 0.00 ? 94  ARG A HG2  4  
ATOM 10044 H HG3  . ARG A 1 94  ? -0.101  -7.520  6.316   1.00 0.00 ? 94  ARG A HG3  4  
ATOM 10045 H HD2  . ARG A 1 94  ? 1.065   -8.085  9.037   1.00 0.00 ? 94  ARG A HD2  4  
ATOM 10046 H HD3  . ARG A 1 94  ? 0.004   -9.127  8.089   1.00 0.00 ? 94  ARG A HD3  4  
ATOM 10047 H HE   . ARG A 1 94  ? 2.563   -8.412  6.884   1.00 0.00 ? 94  ARG A HE   4  
ATOM 10048 H HH11 . ARG A 1 94  ? 0.704   -10.806 8.651   1.00 0.00 ? 94  ARG A HH11 4  
ATOM 10049 H HH12 . ARG A 1 94  ? 1.746   -12.118 8.204   1.00 0.00 ? 94  ARG A HH12 4  
ATOM 10050 H HH21 . ARG A 1 94  ? 3.939   -10.108 6.340   1.00 0.00 ? 94  ARG A HH21 4  
ATOM 10051 H HH22 . ARG A 1 94  ? 3.607   -11.724 6.903   1.00 0.00 ? 94  ARG A HH22 4  
ATOM 10052 N N    . LEU A 1 95  ? 1.491   -3.317  5.860   1.00 0.00 ? 95  LEU A N    4  
ATOM 10053 C CA   . LEU A 1 95  ? 0.962   -1.962  5.769   1.00 0.00 ? 95  LEU A CA   4  
ATOM 10054 C C    . LEU A 1 95  ? 0.899   -1.536  4.307   1.00 0.00 ? 95  LEU A C    4  
ATOM 10055 O O    . LEU A 1 95  ? -0.045  -0.873  3.880   1.00 0.00 ? 95  LEU A O    4  
ATOM 10056 C CB   . LEU A 1 95  ? 1.832   -0.988  6.577   1.00 0.00 ? 95  LEU A CB   4  
ATOM 10057 C CG   . LEU A 1 95  ? 1.436   0.491   6.484   1.00 0.00 ? 95  LEU A CG   4  
ATOM 10058 C CD1  . LEU A 1 95  ? -0.025  0.687   6.856   1.00 0.00 ? 95  LEU A CD1  4  
ATOM 10059 C CD2  . LEU A 1 95  ? 2.322   1.331   7.385   1.00 0.00 ? 95  LEU A CD2  4  
ATOM 10060 H H    . LEU A 1 95  ? 2.381   -3.460  6.256   1.00 0.00 ? 95  LEU A H    4  
ATOM 10061 H HA   . LEU A 1 95  ? -0.038  -1.967  6.176   1.00 0.00 ? 95  LEU A HA   4  
ATOM 10062 H HB2  . LEU A 1 95  ? 1.792   -1.283  7.616   1.00 0.00 ? 95  LEU A HB2  4  
ATOM 10063 H HB3  . LEU A 1 95  ? 2.852   -1.084  6.234   1.00 0.00 ? 95  LEU A HB3  4  
ATOM 10064 H HG   . LEU A 1 95  ? 1.572   0.832   5.468   1.00 0.00 ? 95  LEU A HG   4  
ATOM 10065 H HD11 . LEU A 1 95  ? -0.649  0.127   6.175   1.00 0.00 ? 95  LEU A HD11 4  
ATOM 10066 H HD12 . LEU A 1 95  ? -0.277  1.737   6.796   1.00 0.00 ? 95  LEU A HD12 4  
ATOM 10067 H HD13 . LEU A 1 95  ? -0.189  0.337   7.866   1.00 0.00 ? 95  LEU A HD13 4  
ATOM 10068 H HD21 . LEU A 1 95  ? 2.049   2.370   7.289   1.00 0.00 ? 95  LEU A HD21 4  
ATOM 10069 H HD22 . LEU A 1 95  ? 3.355   1.200   7.100   1.00 0.00 ? 95  LEU A HD22 4  
ATOM 10070 H HD23 . LEU A 1 95  ? 2.190   1.019   8.411   1.00 0.00 ? 95  LEU A HD23 4  
ATOM 10071 N N    . VAL A 1 96  ? 1.905   -1.953  3.543   1.00 0.00 ? 96  VAL A N    4  
ATOM 10072 C CA   . VAL A 1 96  ? 1.986   -1.637  2.122   1.00 0.00 ? 96  VAL A CA   4  
ATOM 10073 C C    . VAL A 1 96  ? 0.798   -2.232  1.368   1.00 0.00 ? 96  VAL A C    4  
ATOM 10074 O O    . VAL A 1 96  ? 0.079   -1.521  0.665   1.00 0.00 ? 96  VAL A O    4  
ATOM 10075 C CB   . VAL A 1 96  ? 3.305   -2.162  1.507   1.00 0.00 ? 96  VAL A CB   4  
ATOM 10076 C CG1  . VAL A 1 96  ? 3.328   -1.964  -0.002  1.00 0.00 ? 96  VAL A CG1  4  
ATOM 10077 C CG2  . VAL A 1 96  ? 4.503   -1.479  2.150   1.00 0.00 ? 96  VAL A CG2  4  
ATOM 10078 H H    . VAL A 1 96  ? 2.616   -2.489  3.951   1.00 0.00 ? 96  VAL A H    4  
ATOM 10079 H HA   . VAL A 1 96  ? 1.965   -0.561  2.018   1.00 0.00 ? 96  VAL A HA   4  
ATOM 10080 H HB   . VAL A 1 96  ? 3.373   -3.222  1.709   1.00 0.00 ? 96  VAL A HB   4  
ATOM 10081 H HG11 . VAL A 1 96  ? 2.502   -2.499  -0.448  1.00 0.00 ? 96  VAL A HG11 4  
ATOM 10082 H HG12 . VAL A 1 96  ? 4.258   -2.339  -0.401  1.00 0.00 ? 96  VAL A HG12 4  
ATOM 10083 H HG13 . VAL A 1 96  ? 3.238   -0.911  -0.227  1.00 0.00 ? 96  VAL A HG13 4  
ATOM 10084 H HG21 . VAL A 1 96  ? 5.410   -1.812  1.670   1.00 0.00 ? 96  VAL A HG21 4  
ATOM 10085 H HG22 . VAL A 1 96  ? 4.539   -1.727  3.201   1.00 0.00 ? 96  VAL A HG22 4  
ATOM 10086 H HG23 . VAL A 1 96  ? 4.409   -0.408  2.037   1.00 0.00 ? 96  VAL A HG23 4  
ATOM 10087 N N    . ALA A 1 97  ? 0.587   -3.533  1.545   1.00 0.00 ? 97  ALA A N    4  
ATOM 10088 C CA   . ALA A 1 97  ? -0.505  -4.241  0.881   1.00 0.00 ? 97  ALA A CA   4  
ATOM 10089 C C    . ALA A 1 97  ? -1.861  -3.665  1.268   1.00 0.00 ? 97  ALA A C    4  
ATOM 10090 O O    . ALA A 1 97  ? -2.722  -3.463  0.415   1.00 0.00 ? 97  ALA A O    4  
ATOM 10091 C CB   . ALA A 1 97  ? -0.448  -5.727  1.209   1.00 0.00 ? 97  ALA A CB   4  
ATOM 10092 H H    . ALA A 1 97  ? 1.189   -4.036  2.139   1.00 0.00 ? 97  ALA A H    4  
ATOM 10093 H HA   . ALA A 1 97  ? -0.370  -4.130  -0.185  1.00 0.00 ? 97  ALA A HA   4  
ATOM 10094 H HB1  . ALA A 1 97  ? 0.483   -6.140  0.849   1.00 0.00 ? 97  ALA A HB1  4  
ATOM 10095 H HB2  . ALA A 1 97  ? -1.274  -6.232  0.730   1.00 0.00 ? 97  ALA A HB2  4  
ATOM 10096 H HB3  . ALA A 1 97  ? -0.514  -5.865  2.278   1.00 0.00 ? 97  ALA A HB3  4  
ATOM 10097 N N    . PHE A 1 98  ? -2.039  -3.394  2.555   1.00 0.00 ? 98  PHE A N    4  
ATOM 10098 C CA   . PHE A 1 98  ? -3.288  -2.834  3.064   1.00 0.00 ? 98  PHE A CA   4  
ATOM 10099 C C    . PHE A 1 98  ? -3.557  -1.457  2.452   1.00 0.00 ? 98  PHE A C    4  
ATOM 10100 O O    . PHE A 1 98  ? -4.687  -1.143  2.066   1.00 0.00 ? 98  PHE A O    4  
ATOM 10101 C CB   . PHE A 1 98  ? -3.223  -2.745  4.595   1.00 0.00 ? 98  PHE A CB   4  
ATOM 10102 C CG   . PHE A 1 98  ? -4.191  -1.771  5.213   1.00 0.00 ? 98  PHE A CG   4  
ATOM 10103 C CD1  . PHE A 1 98  ? -5.536  -2.083  5.323   1.00 0.00 ? 98  PHE A CD1  4  
ATOM 10104 C CD2  . PHE A 1 98  ? -3.749  -0.546  5.688   1.00 0.00 ? 98  PHE A CD2  4  
ATOM 10105 C CE1  . PHE A 1 98  ? -6.424  -1.191  5.894   1.00 0.00 ? 98  PHE A CE1  4  
ATOM 10106 C CE2  . PHE A 1 98  ? -4.633  0.349   6.261   1.00 0.00 ? 98  PHE A CE2  4  
ATOM 10107 C CZ   . PHE A 1 98  ? -5.972  0.026   6.364   1.00 0.00 ? 98  PHE A CZ   4  
ATOM 10108 H H    . PHE A 1 98  ? -1.309  -3.580  3.185   1.00 0.00 ? 98  PHE A H    4  
ATOM 10109 H HA   . PHE A 1 98  ? -4.088  -3.503  2.784   1.00 0.00 ? 98  PHE A HA   4  
ATOM 10110 H HB2  . PHE A 1 98  ? -3.432  -3.718  5.011   1.00 0.00 ? 98  PHE A HB2  4  
ATOM 10111 H HB3  . PHE A 1 98  ? -2.225  -2.447  4.884   1.00 0.00 ? 98  PHE A HB3  4  
ATOM 10112 H HD1  . PHE A 1 98  ? -5.890  -3.035  4.957   1.00 0.00 ? 98  PHE A HD1  4  
ATOM 10113 H HD2  . PHE A 1 98  ? -2.703  -0.291  5.607   1.00 0.00 ? 98  PHE A HD2  4  
ATOM 10114 H HE1  . PHE A 1 98  ? -7.469  -1.446  5.973   1.00 0.00 ? 98  PHE A HE1  4  
ATOM 10115 H HE2  . PHE A 1 98  ? -4.276  1.300   6.628   1.00 0.00 ? 98  PHE A HE2  4  
ATOM 10116 H HZ   . PHE A 1 98  ? -6.665  0.723   6.811   1.00 0.00 ? 98  PHE A HZ   4  
ATOM 10117 N N    . PHE A 1 99  ? -2.508  -0.654  2.354   1.00 0.00 ? 99  PHE A N    4  
ATOM 10118 C CA   . PHE A 1 99  ? -2.617  0.691   1.809   1.00 0.00 ? 99  PHE A CA   4  
ATOM 10119 C C    . PHE A 1 99  ? -2.861  0.670   0.299   1.00 0.00 ? 99  PHE A C    4  
ATOM 10120 O O    . PHE A 1 99  ? -3.760  1.350   -0.203  1.00 0.00 ? 99  PHE A O    4  
ATOM 10121 C CB   . PHE A 1 99  ? -1.344  1.483   2.121   1.00 0.00 ? 99  PHE A CB   4  
ATOM 10122 C CG   . PHE A 1 99  ? -1.534  2.970   2.110   1.00 0.00 ? 99  PHE A CG   4  
ATOM 10123 C CD1  . PHE A 1 99  ? -2.282  3.590   3.096   1.00 0.00 ? 99  PHE A CD1  4  
ATOM 10124 C CD2  . PHE A 1 99  ? -0.959  3.746   1.119   1.00 0.00 ? 99  PHE A CD2  4  
ATOM 10125 C CE1  . PHE A 1 99  ? -2.454  4.961   3.092   1.00 0.00 ? 99  PHE A CE1  4  
ATOM 10126 C CE2  . PHE A 1 99  ? -1.127  5.115   1.111   1.00 0.00 ? 99  PHE A CE2  4  
ATOM 10127 C CZ   . PHE A 1 99  ? -1.876  5.724   2.099   1.00 0.00 ? 99  PHE A CZ   4  
ATOM 10128 H H    . PHE A 1 99  ? -1.633  -0.974  2.662   1.00 0.00 ? 99  PHE A H    4  
ATOM 10129 H HA   . PHE A 1 99  ? -3.454  1.176   2.287   1.00 0.00 ? 99  PHE A HA   4  
ATOM 10130 H HB2  . PHE A 1 99  ? -0.988  1.206   3.101   1.00 0.00 ? 99  PHE A HB2  4  
ATOM 10131 H HB3  . PHE A 1 99  ? -0.589  1.240   1.388   1.00 0.00 ? 99  PHE A HB3  4  
ATOM 10132 H HD1  . PHE A 1 99  ? -2.735  2.991   3.873   1.00 0.00 ? 99  PHE A HD1  4  
ATOM 10133 H HD2  . PHE A 1 99  ? -0.373  3.270   0.347   1.00 0.00 ? 99  PHE A HD2  4  
ATOM 10134 H HE1  . PHE A 1 99  ? -3.040  5.434   3.865   1.00 0.00 ? 99  PHE A HE1  4  
ATOM 10135 H HE2  . PHE A 1 99  ? -0.671  5.709   0.333   1.00 0.00 ? 99  PHE A HE2  4  
ATOM 10136 H HZ   . PHE A 1 99  ? -2.008  6.796   2.093   1.00 0.00 ? 99  PHE A HZ   4  
ATOM 10137 N N    . VAL A 1 100 ? -2.076  -0.124  -0.421  1.00 0.00 ? 100 VAL A N    4  
ATOM 10138 C CA   . VAL A 1 100 ? -2.203  -0.198  -1.872  1.00 0.00 ? 100 VAL A CA   4  
ATOM 10139 C C    . VAL A 1 100 ? -3.516  -0.850  -2.304  1.00 0.00 ? 100 VAL A C    4  
ATOM 10140 O O    . VAL A 1 100 ? -4.063  -0.497  -3.348  1.00 0.00 ? 100 VAL A O    4  
ATOM 10141 C CB   . VAL A 1 100 ? -1.007  -0.935  -2.524  1.00 0.00 ? 100 VAL A CB   4  
ATOM 10142 C CG1  . VAL A 1 100 ? -1.039  -2.429  -2.238  1.00 0.00 ? 100 VAL A CG1  4  
ATOM 10143 C CG2  . VAL A 1 100 ? -0.980  -0.676  -4.022  1.00 0.00 ? 100 VAL A CG2  4  
ATOM 10144 H H    . VAL A 1 100 ? -1.395  -0.671  0.031   1.00 0.00 ? 100 VAL A H    4  
ATOM 10145 H HA   . VAL A 1 100 ? -2.198  0.817   -2.242  1.00 0.00 ? 100 VAL A HA   4  
ATOM 10146 H HB   . VAL A 1 100 ? -0.099  -0.533  -2.102  1.00 0.00 ? 100 VAL A HB   4  
ATOM 10147 H HG11 . VAL A 1 100 ? -0.163  -2.895  -2.660  1.00 0.00 ? 100 VAL A HG11 4  
ATOM 10148 H HG12 . VAL A 1 100 ? -1.925  -2.860  -2.681  1.00 0.00 ? 100 VAL A HG12 4  
ATOM 10149 H HG13 . VAL A 1 100 ? -1.054  -2.591  -1.170  1.00 0.00 ? 100 VAL A HG13 4  
ATOM 10150 H HG21 . VAL A 1 100 ? -0.964  0.388   -4.203  1.00 0.00 ? 100 VAL A HG21 4  
ATOM 10151 H HG22 . VAL A 1 100 ? -1.860  -1.104  -4.476  1.00 0.00 ? 100 VAL A HG22 4  
ATOM 10152 H HG23 . VAL A 1 100 ? -0.095  -1.127  -4.450  1.00 0.00 ? 100 VAL A HG23 4  
ATOM 10153 N N    . PHE A 1 101 ? -4.029  -1.782  -1.503  1.00 0.00 ? 101 PHE A N    4  
ATOM 10154 C CA   . PHE A 1 101 ? -5.281  -2.461  -1.831  1.00 0.00 ? 101 PHE A CA   4  
ATOM 10155 C C    . PHE A 1 101 ? -6.402  -1.443  -2.002  1.00 0.00 ? 101 PHE A C    4  
ATOM 10156 O O    . PHE A 1 101 ? -7.064  -1.398  -3.043  1.00 0.00 ? 101 PHE A O    4  
ATOM 10157 C CB   . PHE A 1 101 ? -5.648  -3.473  -0.743  1.00 0.00 ? 101 PHE A CB   4  
ATOM 10158 C CG   . PHE A 1 101 ? -6.373  -4.684  -1.267  1.00 0.00 ? 101 PHE A CG   4  
ATOM 10159 C CD1  . PHE A 1 101 ? -7.568  -4.552  -1.957  1.00 0.00 ? 101 PHE A CD1  4  
ATOM 10160 C CD2  . PHE A 1 101 ? -5.860  -5.955  -1.064  1.00 0.00 ? 101 PHE A CD2  4  
ATOM 10161 C CE1  . PHE A 1 101 ? -8.236  -5.663  -2.436  1.00 0.00 ? 101 PHE A CE1  4  
ATOM 10162 C CE2  . PHE A 1 101 ? -6.525  -7.070  -1.541  1.00 0.00 ? 101 PHE A CE2  4  
ATOM 10163 C CZ   . PHE A 1 101 ? -7.714  -6.922  -2.228  1.00 0.00 ? 101 PHE A CZ   4  
ATOM 10164 H H    . PHE A 1 101 ? -3.551  -2.026  -0.679  1.00 0.00 ? 101 PHE A H    4  
ATOM 10165 H HA   . PHE A 1 101 ? -5.139  -2.982  -2.767  1.00 0.00 ? 101 PHE A HA   4  
ATOM 10166 H HB2  . PHE A 1 101 ? -4.745  -3.812  -0.258  1.00 0.00 ? 101 PHE A HB2  4  
ATOM 10167 H HB3  . PHE A 1 101 ? -6.283  -2.993  -0.014  1.00 0.00 ? 101 PHE A HB3  4  
ATOM 10168 H HD1  . PHE A 1 101 ? -7.978  -3.566  -2.123  1.00 0.00 ? 101 PHE A HD1  4  
ATOM 10169 H HD2  . PHE A 1 101 ? -4.931  -6.073  -0.528  1.00 0.00 ? 101 PHE A HD2  4  
ATOM 10170 H HE1  . PHE A 1 101 ? -9.167  -5.544  -2.973  1.00 0.00 ? 101 PHE A HE1  4  
ATOM 10171 H HE2  . PHE A 1 101 ? -6.116  -8.056  -1.375  1.00 0.00 ? 101 PHE A HE2  4  
ATOM 10172 H HZ   . PHE A 1 101 ? -8.235  -7.792  -2.600  1.00 0.00 ? 101 PHE A HZ   4  
ATOM 10173 N N    . GLY A 1 102 ? -6.591  -0.613  -0.984  1.00 0.00 ? 102 GLY A N    4  
ATOM 10174 C CA   . GLY A 1 102 ? -7.621  0.401   -1.034  1.00 0.00 ? 102 GLY A CA   4  
ATOM 10175 C C    . GLY A 1 102 ? -7.354  1.432   -2.112  1.00 0.00 ? 102 GLY A C    4  
ATOM 10176 O O    . GLY A 1 102 ? -8.256  1.807   -2.857  1.00 0.00 ? 102 GLY A O    4  
ATOM 10177 H H    . GLY A 1 102 ? -6.025  -0.698  -0.186  1.00 0.00 ? 102 GLY A H    4  
ATOM 10178 H HA2  . GLY A 1 102 ? -8.572  -0.072  -1.228  1.00 0.00 ? 102 GLY A HA2  4  
ATOM 10179 H HA3  . GLY A 1 102 ? -7.667  0.902   -0.079  1.00 0.00 ? 102 GLY A HA3  4  
ATOM 10180 N N    . ALA A 1 103 ? -6.104  1.870   -2.209  1.00 0.00 ? 103 ALA A N    4  
ATOM 10181 C CA   . ALA A 1 103 ? -5.711  2.868   -3.198  1.00 0.00 ? 103 ALA A CA   4  
ATOM 10182 C C    . ALA A 1 103 ? -5.954  2.376   -4.625  1.00 0.00 ? 103 ALA A C    4  
ATOM 10183 O O    . ALA A 1 103 ? -6.416  3.134   -5.478  1.00 0.00 ? 103 ALA A O    4  
ATOM 10184 C CB   . ALA A 1 103 ? -4.250  3.246   -3.012  1.00 0.00 ? 103 ALA A CB   4  
ATOM 10185 H H    . ALA A 1 103 ? -5.424  1.514   -1.597  1.00 0.00 ? 103 ALA A H    4  
ATOM 10186 H HA   . ALA A 1 103 ? -6.308  3.753   -3.030  1.00 0.00 ? 103 ALA A HA   4  
ATOM 10187 H HB1  . ALA A 1 103 ? -4.099  3.619   -2.010  1.00 0.00 ? 103 ALA A HB1  4  
ATOM 10188 H HB2  . ALA A 1 103 ? -3.983  4.012   -3.726  1.00 0.00 ? 103 ALA A HB2  4  
ATOM 10189 H HB3  . ALA A 1 103 ? -3.630  2.376   -3.170  1.00 0.00 ? 103 ALA A HB3  4  
ATOM 10190 N N    . ALA A 1 104 ? -5.646  1.109   -4.879  1.00 0.00 ? 104 ALA A N    4  
ATOM 10191 C CA   . ALA A 1 104 ? -5.830  0.527   -6.204  1.00 0.00 ? 104 ALA A CA   4  
ATOM 10192 C C    . ALA A 1 104 ? -7.307  0.441   -6.563  1.00 0.00 ? 104 ALA A C    4  
ATOM 10193 O O    . ALA A 1 104 ? -7.711  0.828   -7.660  1.00 0.00 ? 104 ALA A O    4  
ATOM 10194 C CB   . ALA A 1 104 ? -5.188  -0.851  -6.273  1.00 0.00 ? 104 ALA A CB   4  
ATOM 10195 H H    . ALA A 1 104 ? -5.281  0.549   -4.157  1.00 0.00 ? 104 ALA A H    4  
ATOM 10196 H HA   . ALA A 1 104 ? -5.333  1.165   -6.920  1.00 0.00 ? 104 ALA A HA   4  
ATOM 10197 H HB1  . ALA A 1 104 ? -5.684  -1.515  -5.581  1.00 0.00 ? 104 ALA A HB1  4  
ATOM 10198 H HB2  . ALA A 1 104 ? -4.144  -0.774  -6.013  1.00 0.00 ? 104 ALA A HB2  4  
ATOM 10199 H HB3  . ALA A 1 104 ? -5.280  -1.242  -7.277  1.00 0.00 ? 104 ALA A HB3  4  
ATOM 10200 N N    . LEU A 1 105 ? -8.110  -0.042  -5.623  1.00 0.00 ? 105 LEU A N    4  
ATOM 10201 C CA   . LEU A 1 105 ? -9.545  -0.180  -5.843  1.00 0.00 ? 105 LEU A CA   4  
ATOM 10202 C C    . LEU A 1 105 ? -10.209 1.187   -5.978  1.00 0.00 ? 105 LEU A C    4  
ATOM 10203 O O    . LEU A 1 105 ? -11.081 1.380   -6.826  1.00 0.00 ? 105 LEU A O    4  
ATOM 10204 C CB   . LEU A 1 105 ? -10.189 -0.977  -4.707  1.00 0.00 ? 105 LEU A CB   4  
ATOM 10205 C CG   . LEU A 1 105 ? -10.453 -2.456  -5.017  1.00 0.00 ? 105 LEU A CG   4  
ATOM 10206 C CD1  . LEU A 1 105 ? -11.416 -2.592  -6.186  1.00 0.00 ? 105 LEU A CD1  4  
ATOM 10207 C CD2  . LEU A 1 105 ? -9.149  -3.183  -5.311  1.00 0.00 ? 105 LEU A CD2  4  
ATOM 10208 H H    . LEU A 1 105 ? -7.727  -0.318  -4.760  1.00 0.00 ? 105 LEU A H    4  
ATOM 10209 H HA   . LEU A 1 105 ? -9.682  -0.719  -6.769  1.00 0.00 ? 105 LEU A HA   4  
ATOM 10210 H HB2  . LEU A 1 105 ? -9.539  -0.922  -3.846  1.00 0.00 ? 105 LEU A HB2  4  
ATOM 10211 H HB3  . LEU A 1 105 ? -11.129 -0.512  -4.457  1.00 0.00 ? 105 LEU A HB3  4  
ATOM 10212 H HG   . LEU A 1 105 ? -10.908 -2.920  -4.154  1.00 0.00 ? 105 LEU A HG   4  
ATOM 10213 H HD11 . LEU A 1 105 ? -12.362 -2.140  -5.929  1.00 0.00 ? 105 LEU A HD11 4  
ATOM 10214 H HD12 . LEU A 1 105 ? -11.566 -3.639  -6.407  1.00 0.00 ? 105 LEU A HD12 4  
ATOM 10215 H HD13 . LEU A 1 105 ? -11.004 -2.097  -7.051  1.00 0.00 ? 105 LEU A HD13 4  
ATOM 10216 H HD21 . LEU A 1 105 ? -8.495  -3.109  -4.454  1.00 0.00 ? 105 LEU A HD21 4  
ATOM 10217 H HD22 . LEU A 1 105 ? -8.672  -2.730  -6.168  1.00 0.00 ? 105 LEU A HD22 4  
ATOM 10218 H HD23 . LEU A 1 105 ? -9.354  -4.223  -5.520  1.00 0.00 ? 105 LEU A HD23 4  
ATOM 10219 N N    . CYS A 1 106 ? -9.795  2.135   -5.144  1.00 0.00 ? 106 CYS A N    4  
ATOM 10220 C CA   . CYS A 1 106 ? -10.344 3.482   -5.197  1.00 0.00 ? 106 CYS A CA   4  
ATOM 10221 C C    . CYS A 1 106 ? -9.998  4.146   -6.523  1.00 0.00 ? 106 CYS A C    4  
ATOM 10222 O O    . CYS A 1 106 ? -10.867 4.723   -7.172  1.00 0.00 ? 106 CYS A O    4  
ATOM 10223 C CB   . CYS A 1 106 ? -9.833  4.325   -4.029  1.00 0.00 ? 106 CYS A CB   4  
ATOM 10224 S SG   . CYS A 1 106 ? -10.650 3.962   -2.460  1.00 0.00 ? 106 CYS A SG   4  
ATOM 10225 H H    . CYS A 1 106 ? -9.114  1.918   -4.465  1.00 0.00 ? 106 CYS A H    4  
ATOM 10226 H HA   . CYS A 1 106 ? -11.418 3.400   -5.124  1.00 0.00 ? 106 CYS A HA   4  
ATOM 10227 H HB2  . CYS A 1 106 ? -8.775  4.149   -3.900  1.00 0.00 ? 106 CYS A HB2  4  
ATOM 10228 H HB3  . CYS A 1 106 ? -9.996  5.370   -4.251  1.00 0.00 ? 106 CYS A HB3  4  
ATOM 10229 H HG   . CYS A 1 106 ? -11.019 5.118   -1.918  1.00 0.00 ? 106 CYS A HG   4  
ATOM 10230 N N    . ALA A 1 107 ? -8.734  4.037   -6.935  1.00 0.00 ? 107 ALA A N    4  
ATOM 10231 C CA   . ALA A 1 107 ? -8.289  4.620   -8.198  1.00 0.00 ? 107 ALA A CA   4  
ATOM 10232 C C    . ALA A 1 107 ? -9.080  4.029   -9.356  1.00 0.00 ? 107 ALA A C    4  
ATOM 10233 O O    . ALA A 1 107 ? -9.401  4.720   -10.323 1.00 0.00 ? 107 ALA A O    4  
ATOM 10234 C CB   . ALA A 1 107 ? -6.799  4.385   -8.400  1.00 0.00 ? 107 ALA A CB   4  
ATOM 10235 H H    . ALA A 1 107 ? -8.083  3.554   -6.376  1.00 0.00 ? 107 ALA A H    4  
ATOM 10236 H HA   . ALA A 1 107 ? -8.463  5.687   -8.158  1.00 0.00 ? 107 ALA A HA   4  
ATOM 10237 H HB1  . ALA A 1 107 ? -6.487  4.826   -9.335  1.00 0.00 ? 107 ALA A HB1  4  
ATOM 10238 H HB2  . ALA A 1 107 ? -6.602  3.323   -8.420  1.00 0.00 ? 107 ALA A HB2  4  
ATOM 10239 H HB3  . ALA A 1 107 ? -6.250  4.837   -7.588  1.00 0.00 ? 107 ALA A HB3  4  
ATOM 10240 N N    . GLU A 1 108 ? -9.398  2.747   -9.240  1.00 0.00 ? 108 GLU A N    4  
ATOM 10241 C CA   . GLU A 1 108 ? -10.168 2.054   -10.257 1.00 0.00 ? 108 GLU A CA   4  
ATOM 10242 C C    . GLU A 1 108 ? -11.578 2.627   -10.314 1.00 0.00 ? 108 GLU A C    4  
ATOM 10243 O O    . GLU A 1 108 ? -12.110 2.894   -11.390 1.00 0.00 ? 108 GLU A O    4  
ATOM 10244 C CB   . GLU A 1 108 ? -10.215 0.558   -9.953  1.00 0.00 ? 108 GLU A CB   4  
ATOM 10245 C CG   . GLU A 1 108 ? -10.721 -0.284  -11.111 1.00 0.00 ? 108 GLU A CG   4  
ATOM 10246 C CD   . GLU A 1 108 ? -11.957 -1.086  -10.765 1.00 0.00 ? 108 GLU A CD   4  
ATOM 10247 O OE1  . GLU A 1 108 ? -12.867 -0.546  -10.103 1.00 0.00 ? 108 GLU A OE1  4  
ATOM 10248 O OE2  . GLU A 1 108 ? -12.039 -2.261  -11.178 1.00 0.00 ? 108 GLU A OE2  4  
ATOM 10249 H H    . GLU A 1 108 ? -9.098  2.249   -8.446  1.00 0.00 ? 108 GLU A H    4  
ATOM 10250 H HA   . GLU A 1 108 ? -9.684  2.210   -11.211 1.00 0.00 ? 108 GLU A HA   4  
ATOM 10251 H HB2  . GLU A 1 108 ? -9.219  0.224   -9.701  1.00 0.00 ? 108 GLU A HB2  4  
ATOM 10252 H HB3  . GLU A 1 108 ? -10.864 0.394   -9.106  1.00 0.00 ? 108 GLU A HB3  4  
ATOM 10253 H HG2  . GLU A 1 108 ? -10.959 0.371   -11.937 1.00 0.00 ? 108 GLU A HG2  4  
ATOM 10254 H HG3  . GLU A 1 108 ? -9.940  -0.966  -11.409 1.00 0.00 ? 108 GLU A HG3  4  
ATOM 10255 N N    . SER A 1 109 ? -12.164 2.840   -9.142  1.00 0.00 ? 109 SER A N    4  
ATOM 10256 C CA   . SER A 1 109 ? -13.507 3.390   -9.046  1.00 0.00 ? 109 SER A CA   4  
ATOM 10257 C C    . SER A 1 109 ? -13.531 4.835   -9.548  1.00 0.00 ? 109 SER A C    4  
ATOM 10258 O O    . SER A 1 109 ? -14.493 5.268   -10.180 1.00 0.00 ? 109 SER A O    4  
ATOM 10259 C CB   . SER A 1 109 ? -13.999 3.311   -7.600  1.00 0.00 ? 109 SER A CB   4  
ATOM 10260 O OG   . SER A 1 109 ? -13.744 2.026   -7.044  1.00 0.00 ? 109 SER A OG   4  
ATOM 10261 H H    . SER A 1 109 ? -11.679 2.620   -8.319  1.00 0.00 ? 109 SER A H    4  
ATOM 10262 H HA   . SER A 1 109 ? -14.156 2.793   -9.673  1.00 0.00 ? 109 SER A HA   4  
ATOM 10263 H HB2  . SER A 1 109 ? -13.488 4.055   -7.007  1.00 0.00 ? 109 SER A HB2  4  
ATOM 10264 H HB3  . SER A 1 109 ? -15.063 3.497   -7.574  1.00 0.00 ? 109 SER A HB3  4  
ATOM 10265 H HG   . SER A 1 109 ? -12.792 1.846   -7.065  1.00 0.00 ? 109 SER A HG   4  
ATOM 10266 N N    . VAL A 1 110 ? -12.457 5.573   -9.269  1.00 0.00 ? 110 VAL A N    4  
ATOM 10267 C CA   . VAL A 1 110 ? -12.338 6.962   -9.704  1.00 0.00 ? 110 VAL A CA   4  
ATOM 10268 C C    . VAL A 1 110 ? -12.318 7.037   -11.228 1.00 0.00 ? 110 VAL A C    4  
ATOM 10269 O O    . VAL A 1 110 ? -12.996 7.869   -11.832 1.00 0.00 ? 110 VAL A O    4  
ATOM 10270 C CB   . VAL A 1 110 ? -11.055 7.626   -9.138  1.00 0.00 ? 110 VAL A CB   4  
ATOM 10271 C CG1  . VAL A 1 110 ? -10.769 8.956   -9.825  1.00 0.00 ? 110 VAL A CG1  4  
ATOM 10272 C CG2  . VAL A 1 110 ? -11.170 7.827   -7.635  1.00 0.00 ? 110 VAL A CG2  4  
ATOM 10273 H H    . VAL A 1 110 ? -11.726 5.173   -8.746  1.00 0.00 ? 110 VAL A H    4  
ATOM 10274 H HA   . VAL A 1 110 ? -13.197 7.504   -9.336  1.00 0.00 ? 110 VAL A HA   4  
ATOM 10275 H HB   . VAL A 1 110 ? -10.221 6.964   -9.326  1.00 0.00 ? 110 VAL A HB   4  
ATOM 10276 H HG11 . VAL A 1 110 ? -11.586 9.641   -9.640  1.00 0.00 ? 110 VAL A HG11 4  
ATOM 10277 H HG12 . VAL A 1 110 ? -10.667 8.796   -10.888 1.00 0.00 ? 110 VAL A HG12 4  
ATOM 10278 H HG13 . VAL A 1 110 ? -9.852  9.375   -9.434  1.00 0.00 ? 110 VAL A HG13 4  
ATOM 10279 H HG21 . VAL A 1 110 ? -10.243 8.229   -7.253  1.00 0.00 ? 110 VAL A HG21 4  
ATOM 10280 H HG22 . VAL A 1 110 ? -11.372 6.880   -7.160  1.00 0.00 ? 110 VAL A HG22 4  
ATOM 10281 H HG23 . VAL A 1 110 ? -11.975 8.517   -7.422  1.00 0.00 ? 110 VAL A HG23 4  
ATOM 10282 N N    . ASN A 1 111 ? -11.555 6.142   -11.843 1.00 0.00 ? 111 ASN A N    4  
ATOM 10283 C CA   . ASN A 1 111 ? -11.434 6.094   -13.297 1.00 0.00 ? 111 ASN A CA   4  
ATOM 10284 C C    . ASN A 1 111 ? -12.745 5.645   -13.935 1.00 0.00 ? 111 ASN A C    4  
ATOM 10285 O O    . ASN A 1 111 ? -13.020 5.942   -15.094 1.00 0.00 ? 111 ASN A O    4  
ATOM 10286 C CB   . ASN A 1 111 ? -10.304 5.143   -13.699 1.00 0.00 ? 111 ASN A CB   4  
ATOM 10287 C CG   . ASN A 1 111 ? -9.904  5.278   -15.160 1.00 0.00 ? 111 ASN A CG   4  
ATOM 10288 O OD1  . ASN A 1 111 ? -10.029 6.347   -15.757 1.00 0.00 ? 111 ASN A OD1  4  
ATOM 10289 N ND2  . ASN A 1 111 ? -9.416  4.191   -15.744 1.00 0.00 ? 111 ASN A ND2  4  
ATOM 10290 H H    . ASN A 1 111 ? -11.051 5.494   -11.301 1.00 0.00 ? 111 ASN A H    4  
ATOM 10291 H HA   . ASN A 1 111 ? -11.200 7.089   -13.645 1.00 0.00 ? 111 ASN A HA   4  
ATOM 10292 H HB2  . ASN A 1 111 ? -9.437  5.350   -13.089 1.00 0.00 ? 111 ASN A HB2  4  
ATOM 10293 H HB3  . ASN A 1 111 ? -10.623 4.126   -13.525 1.00 0.00 ? 111 ASN A HB3  4  
ATOM 10294 H HD21 . ASN A 1 111 ? -9.342  3.370   -15.213 1.00 0.00 ? 111 ASN A HD21 4  
ATOM 10295 H HD22 . ASN A 1 111 ? -9.137  4.256   -16.685 1.00 0.00 ? 111 ASN A HD22 4  
ATOM 10296 N N    . LYS A 1 112 ? -13.564 4.945   -13.165 1.00 0.00 ? 112 LYS A N    4  
ATOM 10297 C CA   . LYS A 1 112 ? -14.842 4.450   -13.657 1.00 0.00 ? 112 LYS A CA   4  
ATOM 10298 C C    . LYS A 1 112 ? -15.981 5.411   -13.319 1.00 0.00 ? 112 LYS A C    4  
ATOM 10299 O O    . LYS A 1 112 ? -17.155 5.059   -13.437 1.00 0.00 ? 112 LYS A O    4  
ATOM 10300 C CB   . LYS A 1 112 ? -15.120 3.062   -13.082 1.00 0.00 ? 112 LYS A CB   4  
ATOM 10301 C CG   . LYS A 1 112 ? -14.395 1.953   -13.828 1.00 0.00 ? 112 LYS A CG   4  
ATOM 10302 C CD   . LYS A 1 112 ? -14.077 0.771   -12.930 1.00 0.00 ? 112 LYS A CD   4  
ATOM 10303 C CE   . LYS A 1 112 ? -15.334 0.041   -12.485 1.00 0.00 ? 112 LYS A CE   4  
ATOM 10304 N NZ   . LYS A 1 112 ? -15.007 -1.192  -11.724 1.00 0.00 ? 112 LYS A NZ   4  
ATOM 10305 H H    . LYS A 1 112 ? -13.301 4.753   -12.239 1.00 0.00 ? 112 LYS A H    4  
ATOM 10306 H HA   . LYS A 1 112 ? -14.768 4.372   -14.729 1.00 0.00 ? 112 LYS A HA   4  
ATOM 10307 H HB2  . LYS A 1 112 ? -14.804 3.039   -12.049 1.00 0.00 ? 112 LYS A HB2  4  
ATOM 10308 H HB3  . LYS A 1 112 ? -16.181 2.867   -13.131 1.00 0.00 ? 112 LYS A HB3  4  
ATOM 10309 H HG2  . LYS A 1 112 ? -15.024 1.613   -14.640 1.00 0.00 ? 112 LYS A HG2  4  
ATOM 10310 H HG3  . LYS A 1 112 ? -13.473 2.346   -14.229 1.00 0.00 ? 112 LYS A HG3  4  
ATOM 10311 H HD2  . LYS A 1 112 ? -13.448 0.081   -13.472 1.00 0.00 ? 112 LYS A HD2  4  
ATOM 10312 H HD3  . LYS A 1 112 ? -13.550 1.127   -12.056 1.00 0.00 ? 112 LYS A HD3  4  
ATOM 10313 H HE2  . LYS A 1 112 ? -15.917 0.699   -11.860 1.00 0.00 ? 112 LYS A HE2  4  
ATOM 10314 H HE3  . LYS A 1 112 ? -15.907 -0.227  -13.360 1.00 0.00 ? 112 LYS A HE3  4  
ATOM 10315 H HZ1  . LYS A 1 112 ? -14.298 -0.981  -10.987 1.00 0.00 ? 112 LYS A HZ1  4  
ATOM 10316 H HZ2  . LYS A 1 112 ? -14.616 -1.914  -12.364 1.00 0.00 ? 112 LYS A HZ2  4  
ATOM 10317 H HZ3  . LYS A 1 112 ? -15.865 -1.573  -11.270 1.00 0.00 ? 112 LYS A HZ3  4  
ATOM 10318 N N    . GLU A 1 113 ? -15.617 6.625   -12.908 1.00 0.00 ? 113 GLU A N    4  
ATOM 10319 C CA   . GLU A 1 113 ? -16.584 7.667   -12.560 1.00 0.00 ? 113 GLU A CA   4  
ATOM 10320 C C    . GLU A 1 113 ? -17.495 7.231   -11.409 1.00 0.00 ? 113 GLU A C    4  
ATOM 10321 O O    . GLU A 1 113 ? -18.716 7.413   -11.457 1.00 0.00 ? 113 GLU A O    4  
ATOM 10322 C CB   . GLU A 1 113 ? -17.418 8.062   -13.784 1.00 0.00 ? 113 GLU A CB   4  
ATOM 10323 C CG   . GLU A 1 113 ? -17.998 9.465   -13.701 1.00 0.00 ? 113 GLU A CG   4  
ATOM 10324 C CD   . GLU A 1 113 ? -18.808 9.831   -14.926 1.00 0.00 ? 113 GLU A CD   4  
ATOM 10325 O OE1  . GLU A 1 113 ? -20.022 9.529   -14.958 1.00 0.00 ? 113 GLU A OE1  4  
ATOM 10326 O OE2  . GLU A 1 113 ? -18.236 10.418  -15.867 1.00 0.00 ? 113 GLU A OE2  4  
ATOM 10327 H H    . GLU A 1 113 ? -14.661 6.829   -12.839 1.00 0.00 ? 113 GLU A H    4  
ATOM 10328 H HA   . GLU A 1 113 ? -16.022 8.530   -12.235 1.00 0.00 ? 113 GLU A HA   4  
ATOM 10329 H HB2  . GLU A 1 113 ? -16.795 8.006   -14.664 1.00 0.00 ? 113 GLU A HB2  4  
ATOM 10330 H HB3  . GLU A 1 113 ? -18.234 7.363   -13.888 1.00 0.00 ? 113 GLU A HB3  4  
ATOM 10331 H HG2  . GLU A 1 113 ? -18.638 9.526   -12.834 1.00 0.00 ? 113 GLU A HG2  4  
ATOM 10332 H HG3  . GLU A 1 113 ? -17.187 10.171  -13.601 1.00 0.00 ? 113 GLU A HG3  4  
ATOM 10333 N N    . MET A 1 114 ? -16.897 6.650   -10.377 1.00 0.00 ? 114 MET A N    4  
ATOM 10334 C CA   . MET A 1 114 ? -17.645 6.212   -9.207  1.00 0.00 ? 114 MET A CA   4  
ATOM 10335 C C    . MET A 1 114 ? -17.054 6.842   -7.950  1.00 0.00 ? 114 MET A C    4  
ATOM 10336 O O    . MET A 1 114 ? -16.657 6.145   -7.012  1.00 0.00 ? 114 MET A O    4  
ATOM 10337 C CB   . MET A 1 114 ? -17.634 4.686   -9.087  1.00 0.00 ? 114 MET A CB   4  
ATOM 10338 C CG   . MET A 1 114 ? -18.959 4.104   -8.611  1.00 0.00 ? 114 MET A CG   4  
ATOM 10339 S SD   . MET A 1 114 ? -19.662 5.007   -7.217  1.00 0.00 ? 114 MET A SD   4  
ATOM 10340 C CE   . MET A 1 114 ? -21.165 4.079   -6.929  1.00 0.00 ? 114 MET A CE   4  
ATOM 10341 H H    . MET A 1 114 ? -15.927 6.500   -10.407 1.00 0.00 ? 114 MET A H    4  
ATOM 10342 H HA   . MET A 1 114 ? -18.665 6.550   -9.320  1.00 0.00 ? 114 MET A HA   4  
ATOM 10343 H HB2  . MET A 1 114 ? -17.406 4.261   -10.054 1.00 0.00 ? 114 MET A HB2  4  
ATOM 10344 H HB3  . MET A 1 114 ? -16.866 4.396   -8.385  1.00 0.00 ? 114 MET A HB3  4  
ATOM 10345 H HG2  . MET A 1 114 ? -19.663 4.134   -9.429  1.00 0.00 ? 114 MET A HG2  4  
ATOM 10346 H HG3  . MET A 1 114 ? -18.800 3.076   -8.315  1.00 0.00 ? 114 MET A HG3  4  
ATOM 10347 H HE1  . MET A 1 114 ? -20.916 3.094   -6.565  1.00 0.00 ? 114 MET A HE1  4  
ATOM 10348 H HE2  . MET A 1 114 ? -21.719 3.994   -7.853  1.00 0.00 ? 114 MET A HE2  4  
ATOM 10349 H HE3  . MET A 1 114 ? -21.770 4.591   -6.193  1.00 0.00 ? 114 MET A HE3  4  
ATOM 10350 N N    . GLU A 1 115 ? -16.999 8.171   -7.943  1.00 0.00 ? 115 GLU A N    4  
ATOM 10351 C CA   . GLU A 1 115 ? -16.466 8.935   -6.817  1.00 0.00 ? 115 GLU A CA   4  
ATOM 10352 C C    . GLU A 1 115 ? -17.264 8.657   -5.546  1.00 0.00 ? 115 GLU A C    4  
ATOM 10353 O O    . GLU A 1 115 ? -16.731 8.724   -4.435  1.00 0.00 ? 115 GLU A O    4  
ATOM 10354 C CB   . GLU A 1 115 ? -16.519 10.428  -7.135  1.00 0.00 ? 115 GLU A CB   4  
ATOM 10355 C CG   . GLU A 1 115 ? -15.648 11.282  -6.235  1.00 0.00 ? 115 GLU A CG   4  
ATOM 10356 C CD   . GLU A 1 115 ? -14.190 11.223  -6.624  1.00 0.00 ? 115 GLU A CD   4  
ATOM 10357 O OE1  . GLU A 1 115 ? -13.820 11.851  -7.642  1.00 0.00 ? 115 GLU A OE1  4  
ATOM 10358 O OE2  . GLU A 1 115 ? -13.413 10.550  -5.922  1.00 0.00 ? 115 GLU A OE2  4  
ATOM 10359 H H    . GLU A 1 115 ? -17.330 8.660   -8.731  1.00 0.00 ? 115 GLU A H    4  
ATOM 10360 H HA   . GLU A 1 115 ? -15.437 8.639   -6.664  1.00 0.00 ? 115 GLU A HA   4  
ATOM 10361 H HB2  . GLU A 1 115 ? -16.198 10.578  -8.156  1.00 0.00 ? 115 GLU A HB2  4  
ATOM 10362 H HB3  . GLU A 1 115 ? -17.539 10.768  -7.037  1.00 0.00 ? 115 GLU A HB3  4  
ATOM 10363 H HG2  . GLU A 1 115 ? -15.982 12.307  -6.294  1.00 0.00 ? 115 GLU A HG2  4  
ATOM 10364 H HG3  . GLU A 1 115 ? -15.749 10.929  -5.219  1.00 0.00 ? 115 GLU A HG3  4  
ATOM 10365 N N    . VAL A 1 116 ? -18.541 8.340   -5.728  1.00 0.00 ? 116 VAL A N    4  
ATOM 10366 C CA   . VAL A 1 116 ? -19.442 8.050   -4.620  1.00 0.00 ? 116 VAL A CA   4  
ATOM 10367 C C    . VAL A 1 116 ? -18.899 6.916   -3.751  1.00 0.00 ? 116 VAL A C    4  
ATOM 10368 O O    . VAL A 1 116 ? -18.776 7.054   -2.533  1.00 0.00 ? 116 VAL A O    4  
ATOM 10369 C CB   . VAL A 1 116 ? -20.848 7.667   -5.133  1.00 0.00 ? 116 VAL A CB   4  
ATOM 10370 C CG1  . VAL A 1 116 ? -21.852 7.648   -3.992  1.00 0.00 ? 116 VAL A CG1  4  
ATOM 10371 C CG2  . VAL A 1 116 ? -21.300 8.625   -6.226  1.00 0.00 ? 116 VAL A CG2  4  
ATOM 10372 H H    . VAL A 1 116 ? -18.889 8.300   -6.644  1.00 0.00 ? 116 VAL A H    4  
ATOM 10373 H HA   . VAL A 1 116 ? -19.530 8.943   -4.018  1.00 0.00 ? 116 VAL A HA   4  
ATOM 10374 H HB   . VAL A 1 116 ? -20.798 6.674   -5.554  1.00 0.00 ? 116 VAL A HB   4  
ATOM 10375 H HG11 . VAL A 1 116 ? -22.829 7.401   -4.379  1.00 0.00 ? 116 VAL A HG11 4  
ATOM 10376 H HG12 . VAL A 1 116 ? -21.884 8.622   -3.527  1.00 0.00 ? 116 VAL A HG12 4  
ATOM 10377 H HG13 . VAL A 1 116 ? -21.555 6.909   -3.264  1.00 0.00 ? 116 VAL A HG13 4  
ATOM 10378 H HG21 . VAL A 1 116 ? -22.299 8.367   -6.543  1.00 0.00 ? 116 VAL A HG21 4  
ATOM 10379 H HG22 . VAL A 1 116 ? -20.626 8.556   -7.065  1.00 0.00 ? 116 VAL A HG22 4  
ATOM 10380 H HG23 . VAL A 1 116 ? -21.294 9.635   -5.842  1.00 0.00 ? 116 VAL A HG23 4  
ATOM 10381 N N    . LEU A 1 117 ? -18.551 5.805   -4.389  1.00 0.00 ? 117 LEU A N    4  
ATOM 10382 C CA   . LEU A 1 117 ? -18.026 4.649   -3.676  1.00 0.00 ? 117 LEU A CA   4  
ATOM 10383 C C    . LEU A 1 117 ? -16.635 4.940   -3.122  1.00 0.00 ? 117 LEU A C    4  
ATOM 10384 O O    . LEU A 1 117 ? -16.288 4.488   -2.034  1.00 0.00 ? 117 LEU A O    4  
ATOM 10385 C CB   . LEU A 1 117 ? -17.985 3.425   -4.595  1.00 0.00 ? 117 LEU A CB   4  
ATOM 10386 C CG   . LEU A 1 117 ? -17.814 2.082   -3.881  1.00 0.00 ? 117 LEU A CG   4  
ATOM 10387 C CD1  . LEU A 1 117 ? -18.834 1.930   -2.765  1.00 0.00 ? 117 LEU A CD1  4  
ATOM 10388 C CD2  . LEU A 1 117 ? -17.942 0.938   -4.872  1.00 0.00 ? 117 LEU A CD2  4  
ATOM 10389 H H    . LEU A 1 117 ? -18.652 5.762   -5.366  1.00 0.00 ? 117 LEU A H    4  
ATOM 10390 H HA   . LEU A 1 117 ? -18.689 4.444   -2.850  1.00 0.00 ? 117 LEU A HA   4  
ATOM 10391 H HB2  . LEU A 1 117 ? -18.905 3.395   -5.160  1.00 0.00 ? 117 LEU A HB2  4  
ATOM 10392 H HB3  . LEU A 1 117 ? -17.163 3.545   -5.285  1.00 0.00 ? 117 LEU A HB3  4  
ATOM 10393 H HG   . LEU A 1 117 ? -16.830 2.037   -3.441  1.00 0.00 ? 117 LEU A HG   4  
ATOM 10394 H HD11 . LEU A 1 117 ? -19.830 2.006   -3.175  1.00 0.00 ? 117 LEU A HD11 4  
ATOM 10395 H HD12 . LEU A 1 117 ? -18.686 2.710   -2.035  1.00 0.00 ? 117 LEU A HD12 4  
ATOM 10396 H HD13 . LEU A 1 117 ? -18.710 0.967   -2.293  1.00 0.00 ? 117 LEU A HD13 4  
ATOM 10397 H HD21 . LEU A 1 117 ? -18.866 1.038   -5.421  1.00 0.00 ? 117 LEU A HD21 4  
ATOM 10398 H HD22 . LEU A 1 117 ? -17.941 -0.002  -4.338  1.00 0.00 ? 117 LEU A HD22 4  
ATOM 10399 H HD23 . LEU A 1 117 ? -17.110 0.962   -5.559  1.00 0.00 ? 117 LEU A HD23 4  
ATOM 10400 N N    . VAL A 1 118 ? -15.853 5.709   -3.870  1.00 0.00 ? 118 VAL A N    4  
ATOM 10401 C CA   . VAL A 1 118 ? -14.500 6.068   -3.450  1.00 0.00 ? 118 VAL A CA   4  
ATOM 10402 C C    . VAL A 1 118 ? -14.531 6.811   -2.116  1.00 0.00 ? 118 VAL A C    4  
ATOM 10403 O O    . VAL A 1 118 ? -13.753 6.515   -1.205  1.00 0.00 ? 118 VAL A O    4  
ATOM 10404 C CB   . VAL A 1 118 ? -13.799 6.947   -4.509  1.00 0.00 ? 118 VAL A CB   4  
ATOM 10405 C CG1  . VAL A 1 118 ? -12.374 7.276   -4.089  1.00 0.00 ? 118 VAL A CG1  4  
ATOM 10406 C CG2  . VAL A 1 118 ? -13.808 6.263   -5.866  1.00 0.00 ? 118 VAL A CG2  4  
ATOM 10407 H H    . VAL A 1 118 ? -16.194 6.044   -4.728  1.00 0.00 ? 118 VAL A H    4  
ATOM 10408 H HA   . VAL A 1 118 ? -13.934 5.157   -3.332  1.00 0.00 ? 118 VAL A HA   4  
ATOM 10409 H HB   . VAL A 1 118 ? -14.347 7.875   -4.596  1.00 0.00 ? 118 VAL A HB   4  
ATOM 10410 H HG11 . VAL A 1 118 ? -11.894 7.851   -4.867  1.00 0.00 ? 118 VAL A HG11 4  
ATOM 10411 H HG12 . VAL A 1 118 ? -11.826 6.361   -3.928  1.00 0.00 ? 118 VAL A HG12 4  
ATOM 10412 H HG13 . VAL A 1 118 ? -12.391 7.851   -3.176  1.00 0.00 ? 118 VAL A HG13 4  
ATOM 10413 H HG21 . VAL A 1 118 ? -13.318 6.896   -6.591  1.00 0.00 ? 118 VAL A HG21 4  
ATOM 10414 H HG22 . VAL A 1 118 ? -14.828 6.090   -6.178  1.00 0.00 ? 118 VAL A HG22 4  
ATOM 10415 H HG23 . VAL A 1 118 ? -13.287 5.321   -5.801  1.00 0.00 ? 118 VAL A HG23 4  
ATOM 10416 N N    . GLY A 1 119 ? -15.451 7.763   -2.003  1.00 0.00 ? 119 GLY A N    4  
ATOM 10417 C CA   . GLY A 1 119 ? -15.579 8.532   -0.782  1.00 0.00 ? 119 GLY A CA   4  
ATOM 10418 C C    . GLY A 1 119 ? -16.028 7.671   0.380   1.00 0.00 ? 119 GLY A C    4  
ATOM 10419 O O    . GLY A 1 119 ? -15.565 7.844   1.508   1.00 0.00 ? 119 GLY A O    4  
ATOM 10420 H H    . GLY A 1 119 ? -16.052 7.943   -2.760  1.00 0.00 ? 119 GLY A H    4  
ATOM 10421 H HA2  . GLY A 1 119 ? -14.625 8.975   -0.544  1.00 0.00 ? 119 GLY A HA2  4  
ATOM 10422 H HA3  . GLY A 1 119 ? -16.305 9.318   -0.936  1.00 0.00 ? 119 GLY A HA3  4  
ATOM 10423 N N    . GLN A 1 120 ? -16.925 6.733   0.097   1.00 0.00 ? 120 GLN A N    4  
ATOM 10424 C CA   . GLN A 1 120 ? -17.435 5.826   1.116   1.00 0.00 ? 120 GLN A CA   4  
ATOM 10425 C C    . GLN A 1 120 ? -16.309 4.961   1.668   1.00 0.00 ? 120 GLN A C    4  
ATOM 10426 O O    . GLN A 1 120 ? -16.135 4.853   2.884   1.00 0.00 ? 120 GLN A O    4  
ATOM 10427 C CB   . GLN A 1 120 ? -18.544 4.944   0.542   1.00 0.00 ? 120 GLN A CB   4  
ATOM 10428 C CG   . GLN A 1 120 ? -19.864 5.675   0.381   1.00 0.00 ? 120 GLN A CG   4  
ATOM 10429 C CD   . GLN A 1 120 ? -20.845 4.934   -0.504  1.00 0.00 ? 120 GLN A CD   4  
ATOM 10430 O OE1  . GLN A 1 120 ? -20.831 3.703   -0.582  1.00 0.00 ? 120 GLN A OE1  4  
ATOM 10431 N NE2  . GLN A 1 120 ? -21.705 5.677   -1.180  1.00 0.00 ? 120 GLN A NE2  4  
ATOM 10432 H H    . GLN A 1 120 ? -17.257 6.652   -0.826  1.00 0.00 ? 120 GLN A H    4  
ATOM 10433 H HA   . GLN A 1 120 ? -17.844 6.423   1.920   1.00 0.00 ? 120 GLN A HA   4  
ATOM 10434 H HB2  . GLN A 1 120 ? -18.235 4.583   -0.428  1.00 0.00 ? 120 GLN A HB2  4  
ATOM 10435 H HB3  . GLN A 1 120 ? -18.700 4.102   1.199   1.00 0.00 ? 120 GLN A HB3  4  
ATOM 10436 H HG2  . GLN A 1 120 ? -20.310 5.800   1.357   1.00 0.00 ? 120 GLN A HG2  4  
ATOM 10437 H HG3  . GLN A 1 120 ? -19.670 6.645   -0.051  1.00 0.00 ? 120 GLN A HG3  4  
ATOM 10438 H HE21 . GLN A 1 120 ? -21.655 6.658   -1.072  1.00 0.00 ? 120 GLN A HE21 4  
ATOM 10439 H HE22 . GLN A 1 120 ? -22.355 5.227   -1.762  1.00 0.00 ? 120 GLN A HE22 4  
ATOM 10440 N N    . VAL A 1 121 ? -15.533 4.368   0.763   1.00 0.00 ? 121 VAL A N    4  
ATOM 10441 C CA   . VAL A 1 121 ? -14.414 3.516   1.146   1.00 0.00 ? 121 VAL A CA   4  
ATOM 10442 C C    . VAL A 1 121 ? -13.392 4.309   1.954   1.00 0.00 ? 121 VAL A C    4  
ATOM 10443 O O    . VAL A 1 121 ? -12.901 3.839   2.983   1.00 0.00 ? 121 VAL A O    4  
ATOM 10444 C CB   . VAL A 1 121 ? -13.731 2.892   -0.092  1.00 0.00 ? 121 VAL A CB   4  
ATOM 10445 C CG1  . VAL A 1 121 ? -12.491 2.104   0.305   1.00 0.00 ? 121 VAL A CG1  4  
ATOM 10446 C CG2  . VAL A 1 121 ? -14.707 2.002   -0.839  1.00 0.00 ? 121 VAL A CG2  4  
ATOM 10447 H H    . VAL A 1 121 ? -15.721 4.511   -0.192  1.00 0.00 ? 121 VAL A H    4  
ATOM 10448 H HA   . VAL A 1 121 ? -14.801 2.714   1.760   1.00 0.00 ? 121 VAL A HA   4  
ATOM 10449 H HB   . VAL A 1 121 ? -13.429 3.690   -0.753  1.00 0.00 ? 121 VAL A HB   4  
ATOM 10450 H HG11 . VAL A 1 121 ? -11.805 2.755   0.826   1.00 0.00 ? 121 VAL A HG11 4  
ATOM 10451 H HG12 . VAL A 1 121 ? -12.014 1.713   -0.581  1.00 0.00 ? 121 VAL A HG12 4  
ATOM 10452 H HG13 . VAL A 1 121 ? -12.775 1.288   0.952   1.00 0.00 ? 121 VAL A HG13 4  
ATOM 10453 H HG21 . VAL A 1 121 ? -14.228 1.599   -1.717  1.00 0.00 ? 121 VAL A HG21 4  
ATOM 10454 H HG22 . VAL A 1 121 ? -15.568 2.582   -1.132  1.00 0.00 ? 121 VAL A HG22 4  
ATOM 10455 H HG23 . VAL A 1 121 ? -15.021 1.194   -0.195  1.00 0.00 ? 121 VAL A HG23 4  
ATOM 10456 N N    . GLN A 1 122 ? -13.094 5.521   1.497   1.00 0.00 ? 122 GLN A N    4  
ATOM 10457 C CA   . GLN A 1 122 ? -12.141 6.382   2.187   1.00 0.00 ? 122 GLN A CA   4  
ATOM 10458 C C    . GLN A 1 122 ? -12.630 6.707   3.592   1.00 0.00 ? 122 GLN A C    4  
ATOM 10459 O O    . GLN A 1 122 ? -11.864 6.647   4.552   1.00 0.00 ? 122 GLN A O    4  
ATOM 10460 C CB   . GLN A 1 122 ? -11.908 7.671   1.400   1.00 0.00 ? 122 GLN A CB   4  
ATOM 10461 C CG   . GLN A 1 122 ? -10.525 7.759   0.772   1.00 0.00 ? 122 GLN A CG   4  
ATOM 10462 C CD   . GLN A 1 122 ? -10.276 6.670   -0.253  1.00 0.00 ? 122 GLN A CD   4  
ATOM 10463 O OE1  . GLN A 1 122 ? -10.603 6.822   -1.428  1.00 0.00 ? 122 GLN A OE1  4  
ATOM 10464 N NE2  . GLN A 1 122 ? -9.694  5.563   0.184   1.00 0.00 ? 122 GLN A NE2  4  
ATOM 10465 H H    . GLN A 1 122 ? -13.523 5.842   0.672   1.00 0.00 ? 122 GLN A H    4  
ATOM 10466 H HA   . GLN A 1 122 ? -11.208 5.843   2.261   1.00 0.00 ? 122 GLN A HA   4  
ATOM 10467 H HB2  . GLN A 1 122 ? -12.645 7.737   0.612   1.00 0.00 ? 122 GLN A HB2  4  
ATOM 10468 H HB3  . GLN A 1 122 ? -12.033 8.512   2.067   1.00 0.00 ? 122 GLN A HB3  4  
ATOM 10469 H HG2  . GLN A 1 122 ? -10.423 8.717   0.285   1.00 0.00 ? 122 GLN A HG2  4  
ATOM 10470 H HG3  . GLN A 1 122 ? -9.786  7.673   1.554   1.00 0.00 ? 122 GLN A HG3  4  
ATOM 10471 H HE21 . GLN A 1 122 ? -9.458  5.508   1.133   1.00 0.00 ? 122 GLN A HE21 4  
ATOM 10472 H HE22 . GLN A 1 122 ? -9.520  4.842   -0.461  1.00 0.00 ? 122 GLN A HE22 4  
ATOM 10473 N N    . GLU A 1 123 ? -13.913 7.037   3.709   1.00 0.00 ? 123 GLU A N    4  
ATOM 10474 C CA   . GLU A 1 123 ? -14.504 7.361   4.999   1.00 0.00 ? 123 GLU A CA   4  
ATOM 10475 C C    . GLU A 1 123 ? -14.356 6.188   5.964   1.00 0.00 ? 123 GLU A C    4  
ATOM 10476 O O    . GLU A 1 123 ? -13.922 6.363   7.104   1.00 0.00 ? 123 GLU A O    4  
ATOM 10477 C CB   . GLU A 1 123 ? -15.979 7.731   4.838   1.00 0.00 ? 123 GLU A CB   4  
ATOM 10478 C CG   . GLU A 1 123 ? -16.698 7.955   6.159   1.00 0.00 ? 123 GLU A CG   4  
ATOM 10479 C CD   . GLU A 1 123 ? -17.783 9.001   6.061   1.00 0.00 ? 123 GLU A CD   4  
ATOM 10480 O OE1  . GLU A 1 123 ? -18.895 8.668   5.604   1.00 0.00 ? 123 GLU A OE1  4  
ATOM 10481 O OE2  . GLU A 1 123 ? -17.527 10.163  6.438   1.00 0.00 ? 123 GLU A OE2  4  
ATOM 10482 H H    . GLU A 1 123 ? -14.475 7.072   2.902   1.00 0.00 ? 123 GLU A H    4  
ATOM 10483 H HA   . GLU A 1 123 ? -13.971 8.208   5.402   1.00 0.00 ? 123 GLU A HA   4  
ATOM 10484 H HB2  . GLU A 1 123 ? -16.048 8.638   4.256   1.00 0.00 ? 123 GLU A HB2  4  
ATOM 10485 H HB3  . GLU A 1 123 ? -16.482 6.935   4.308   1.00 0.00 ? 123 GLU A HB3  4  
ATOM 10486 H HG2  . GLU A 1 123 ? -17.147 7.024   6.471   1.00 0.00 ? 123 GLU A HG2  4  
ATOM 10487 H HG3  . GLU A 1 123 ? -15.978 8.272   6.899   1.00 0.00 ? 123 GLU A HG3  4  
ATOM 10488 N N    . TRP A 1 124 ? -14.693 4.995   5.486   1.00 0.00 ? 124 TRP A N    4  
ATOM 10489 C CA   . TRP A 1 124 ? -14.595 3.786   6.295   1.00 0.00 ? 124 TRP A CA   4  
ATOM 10490 C C    . TRP A 1 124 ? -13.149 3.517   6.699   1.00 0.00 ? 124 TRP A C    4  
ATOM 10491 O O    . TRP A 1 124 ? -12.867 3.205   7.856   1.00 0.00 ? 124 TRP A O    4  
ATOM 10492 C CB   . TRP A 1 124 ? -15.141 2.579   5.530   1.00 0.00 ? 124 TRP A CB   4  
ATOM 10493 C CG   . TRP A 1 124 ? -16.630 2.582   5.385   1.00 0.00 ? 124 TRP A CG   4  
ATOM 10494 C CD1  . TRP A 1 124 ? -17.536 3.001   6.310   1.00 0.00 ? 124 TRP A CD1  4  
ATOM 10495 C CD2  . TRP A 1 124 ? -17.386 2.136   4.252   1.00 0.00 ? 124 TRP A CD2  4  
ATOM 10496 N NE1  . TRP A 1 124 ? -18.809 2.845   5.825   1.00 0.00 ? 124 TRP A NE1  4  
ATOM 10497 C CE2  . TRP A 1 124 ? -18.746 2.320   4.563   1.00 0.00 ? 124 TRP A CE2  4  
ATOM 10498 C CE3  . TRP A 1 124 ? -17.047 1.606   3.003   1.00 0.00 ? 124 TRP A CE3  4  
ATOM 10499 C CZ2  . TRP A 1 124 ? -19.766 1.991   3.675   1.00 0.00 ? 124 TRP A CZ2  4  
ATOM 10500 C CZ3  . TRP A 1 124 ? -18.061 1.278   2.122   1.00 0.00 ? 124 TRP A CZ3  4  
ATOM 10501 C CH2  . TRP A 1 124 ? -19.405 1.473   2.460   1.00 0.00 ? 124 TRP A CH2  4  
ATOM 10502 H H    . TRP A 1 124 ? -15.019 4.925   4.560   1.00 0.00 ? 124 TRP A H    4  
ATOM 10503 H HA   . TRP A 1 124 ? -15.185 3.935   7.187   1.00 0.00 ? 124 TRP A HA   4  
ATOM 10504 H HB2  . TRP A 1 124 ? -14.710 2.564   4.541   1.00 0.00 ? 124 TRP A HB2  4  
ATOM 10505 H HB3  . TRP A 1 124 ? -14.859 1.676   6.052   1.00 0.00 ? 124 TRP A HB3  4  
ATOM 10506 H HD1  . TRP A 1 124 ? -17.276 3.394   7.280   1.00 0.00 ? 124 TRP A HD1  4  
ATOM 10507 H HE1  . TRP A 1 124 ? -19.637 3.076   6.311   1.00 0.00 ? 124 TRP A HE1  4  
ATOM 10508 H HE3  . TRP A 1 124 ? -16.016 1.448   2.724   1.00 0.00 ? 124 TRP A HE3  4  
ATOM 10509 H HZ2  . TRP A 1 124 ? -20.808 2.137   3.921   1.00 0.00 ? 124 TRP A HZ2  4  
ATOM 10510 H HZ3  . TRP A 1 124 ? -17.819 0.866   1.152   1.00 0.00 ? 124 TRP A HZ3  4  
ATOM 10511 H HH2  . TRP A 1 124 ? -20.162 1.204   1.740   1.00 0.00 ? 124 TRP A HH2  4  
ATOM 10512 N N    . MET A 1 125 ? -12.242 3.650   5.738   1.00 0.00 ? 125 MET A N    4  
ATOM 10513 C CA   . MET A 1 125 ? -10.820 3.415   5.971   1.00 0.00 ? 125 MET A CA   4  
ATOM 10514 C C    . MET A 1 125 ? -10.263 4.357   7.036   1.00 0.00 ? 125 MET A C    4  
ATOM 10515 O O    . MET A 1 125 ? -9.653  3.911   8.009   1.00 0.00 ? 125 MET A O    4  
ATOM 10516 C CB   . MET A 1 125 ? -10.039 3.581   4.666   1.00 0.00 ? 125 MET A CB   4  
ATOM 10517 C CG   . MET A 1 125 ? -9.008  2.491   4.434   1.00 0.00 ? 125 MET A CG   4  
ATOM 10518 S SD   . MET A 1 125 ? -8.109  2.708   2.886   1.00 0.00 ? 125 MET A SD   4  
ATOM 10519 C CE   . MET A 1 125 ? -7.199  1.166   2.801   1.00 0.00 ? 125 MET A CE   4  
ATOM 10520 H H    . MET A 1 125 ? -12.539 3.908   4.838   1.00 0.00 ? 125 MET A H    4  
ATOM 10521 H HA   . MET A 1 125 ? -10.707 2.398   6.316   1.00 0.00 ? 125 MET A HA   4  
ATOM 10522 H HB2  . MET A 1 125 ? -10.736 3.569   3.840   1.00 0.00 ? 125 MET A HB2  4  
ATOM 10523 H HB3  . MET A 1 125 ? -9.530  4.533   4.681   1.00 0.00 ? 125 MET A HB3  4  
ATOM 10524 H HG2  . MET A 1 125 ? -8.300  2.504   5.250   1.00 0.00 ? 125 MET A HG2  4  
ATOM 10525 H HG3  . MET A 1 125 ? -9.513  1.536   4.413   1.00 0.00 ? 125 MET A HG3  4  
ATOM 10526 H HE1  . MET A 1 125 ? -6.584  1.160   1.913   1.00 0.00 ? 125 MET A HE1  4  
ATOM 10527 H HE2  . MET A 1 125 ? -7.894  0.341   2.761   1.00 0.00 ? 125 MET A HE2  4  
ATOM 10528 H HE3  . MET A 1 125 ? -6.572  1.069   3.675   1.00 0.00 ? 125 MET A HE3  4  
ATOM 10529 N N    . VAL A 1 126 ? -10.488 5.654   6.855   1.00 0.00 ? 126 VAL A N    4  
ATOM 10530 C CA   . VAL A 1 126 ? -10.001 6.655   7.800   1.00 0.00 ? 126 VAL A CA   4  
ATOM 10531 C C    . VAL A 1 126 ? -10.629 6.456   9.177   1.00 0.00 ? 126 VAL A C    4  
ATOM 10532 O O    . VAL A 1 126 ? -9.936  6.493   10.193  1.00 0.00 ? 126 VAL A O    4  
ATOM 10533 C CB   . VAL A 1 126 ? -10.284 8.090   7.306   1.00 0.00 ? 126 VAL A CB   4  
ATOM 10534 C CG1  . VAL A 1 126 ? -9.836  9.119   8.337   1.00 0.00 ? 126 VAL A CG1  4  
ATOM 10535 C CG2  . VAL A 1 126 ? -9.593  8.339   5.973   1.00 0.00 ? 126 VAL A CG2  4  
ATOM 10536 H H    . VAL A 1 126 ? -10.998 5.947   6.066   1.00 0.00 ? 126 VAL A H    4  
ATOM 10537 H HA   . VAL A 1 126 ? -8.931  6.533   7.888   1.00 0.00 ? 126 VAL A HA   4  
ATOM 10538 H HB   . VAL A 1 126 ? -11.348 8.197   7.161   1.00 0.00 ? 126 VAL A HB   4  
ATOM 10539 H HG11 . VAL A 1 126 ? -10.410 8.995   9.243   1.00 0.00 ? 126 VAL A HG11 4  
ATOM 10540 H HG12 . VAL A 1 126 ? -9.990  10.112  7.944   1.00 0.00 ? 126 VAL A HG12 4  
ATOM 10541 H HG13 . VAL A 1 126 ? -8.787  8.977   8.553   1.00 0.00 ? 126 VAL A HG13 4  
ATOM 10542 H HG21 . VAL A 1 126 ? -9.996  7.669   5.227   1.00 0.00 ? 126 VAL A HG21 4  
ATOM 10543 H HG22 . VAL A 1 126 ? -8.534  8.163   6.080   1.00 0.00 ? 126 VAL A HG22 4  
ATOM 10544 H HG23 . VAL A 1 126 ? -9.760  9.361   5.665   1.00 0.00 ? 126 VAL A HG23 4  
ATOM 10545 N N    . ALA A 1 127 ? -11.936 6.218   9.203   1.00 0.00 ? 127 ALA A N    4  
ATOM 10546 C CA   . ALA A 1 127 ? -12.648 6.013   10.457  1.00 0.00 ? 127 ALA A CA   4  
ATOM 10547 C C    . ALA A 1 127 ? -12.085 4.815   11.211  1.00 0.00 ? 127 ALA A C    4  
ATOM 10548 O O    . ALA A 1 127 ? -11.846 4.887   12.414  1.00 0.00 ? 127 ALA A O    4  
ATOM 10549 C CB   . ALA A 1 127 ? -14.135 5.828   10.206  1.00 0.00 ? 127 ALA A CB   4  
ATOM 10550 H H    . ALA A 1 127 ? -12.435 6.177   8.356   1.00 0.00 ? 127 ALA A H    4  
ATOM 10551 H HA   . ALA A 1 127 ? -12.516 6.899   11.061  1.00 0.00 ? 127 ALA A HA   4  
ATOM 10552 H HB1  . ALA A 1 127 ? -14.645 5.682   11.148  1.00 0.00 ? 127 ALA A HB1  4  
ATOM 10553 H HB2  . ALA A 1 127 ? -14.290 4.965   9.574   1.00 0.00 ? 127 ALA A HB2  4  
ATOM 10554 H HB3  . ALA A 1 127 ? -14.530 6.708   9.717   1.00 0.00 ? 127 ALA A HB3  4  
ATOM 10555 N N    . TYR A 1 128 ? -11.854 3.723   10.490  1.00 0.00 ? 128 TYR A N    4  
ATOM 10556 C CA   . TYR A 1 128 ? -11.315 2.506   11.086  1.00 0.00 ? 128 TYR A CA   4  
ATOM 10557 C C    . TYR A 1 128 ? -9.953  2.768   11.724  1.00 0.00 ? 128 TYR A C    4  
ATOM 10558 O O    . TYR A 1 128 ? -9.648  2.250   12.806  1.00 0.00 ? 128 TYR A O    4  
ATOM 10559 C CB   . TYR A 1 128 ? -11.199 1.407   10.028  1.00 0.00 ? 128 TYR A CB   4  
ATOM 10560 C CG   . TYR A 1 128 ? -10.880 0.046   10.603  1.00 0.00 ? 128 TYR A CG   4  
ATOM 10561 C CD1  . TYR A 1 128 ? -11.787 -0.615  11.420  1.00 0.00 ? 128 TYR A CD1  4  
ATOM 10562 C CD2  . TYR A 1 128 ? -9.671  -0.574  10.329  1.00 0.00 ? 128 TYR A CD2  4  
ATOM 10563 C CE1  . TYR A 1 128 ? -11.497 -1.857  11.946  1.00 0.00 ? 128 TYR A CE1  4  
ATOM 10564 C CE2  . TYR A 1 128 ? -9.373  -1.818  10.851  1.00 0.00 ? 128 TYR A CE2  4  
ATOM 10565 C CZ   . TYR A 1 128 ? -10.289 -2.454  11.659  1.00 0.00 ? 128 TYR A CZ   4  
ATOM 10566 O OH   . TYR A 1 128 ? -10.001 -3.693  12.177  1.00 0.00 ? 128 TYR A OH   4  
ATOM 10567 H H    . TYR A 1 128 ? -12.058 3.735   9.528   1.00 0.00 ? 128 TYR A H    4  
ATOM 10568 H HA   . TYR A 1 128 ? -12.001 2.182   11.854  1.00 0.00 ? 128 TYR A HA   4  
ATOM 10569 H HB2  . TYR A 1 128 ? -12.136 1.331   9.495   1.00 0.00 ? 128 TYR A HB2  4  
ATOM 10570 H HB3  . TYR A 1 128 ? -10.415 1.667   9.333   1.00 0.00 ? 128 TYR A HB3  4  
ATOM 10571 H HD1  . TYR A 1 128 ? -12.734 -0.145  11.644  1.00 0.00 ? 128 TYR A HD1  4  
ATOM 10572 H HD2  . TYR A 1 128 ? -8.956  -0.072  9.694   1.00 0.00 ? 128 TYR A HD2  4  
ATOM 10573 H HE1  . TYR A 1 128 ? -12.215 -2.358  12.579  1.00 0.00 ? 128 TYR A HE1  4  
ATOM 10574 H HE2  . TYR A 1 128 ? -8.425  -2.284  10.628  1.00 0.00 ? 128 TYR A HE2  4  
ATOM 10575 H HH   . TYR A 1 128 ? -10.699 -4.314  11.926  1.00 0.00 ? 128 TYR A HH   4  
ATOM 10576 N N    . LEU A 1 129 ? -9.150  3.592   11.059  1.00 0.00 ? 129 LEU A N    4  
ATOM 10577 C CA   . LEU A 1 129 ? -7.821  3.943   11.543  1.00 0.00 ? 129 LEU A CA   4  
ATOM 10578 C C    . LEU A 1 129 ? -7.906  4.698   12.866  1.00 0.00 ? 129 LEU A C    4  
ATOM 10579 O O    . LEU A 1 129 ? -7.034  4.574   13.718  1.00 0.00 ? 129 LEU A O    4  
ATOM 10580 C CB   . LEU A 1 129 ? -7.092  4.801   10.504  1.00 0.00 ? 129 LEU A CB   4  
ATOM 10581 C CG   . LEU A 1 129 ? -6.561  4.043   9.287   1.00 0.00 ? 129 LEU A CG   4  
ATOM 10582 C CD1  . LEU A 1 129 ? -6.366  4.991   8.113   1.00 0.00 ? 129 LEU A CD1  4  
ATOM 10583 C CD2  . LEU A 1 129 ? -5.255  3.341   9.628   1.00 0.00 ? 129 LEU A CD2  4  
ATOM 10584 H H    . LEU A 1 129 ? -9.462  3.977   10.211  1.00 0.00 ? 129 LEU A H    4  
ATOM 10585 H HA   . LEU A 1 129 ? -7.267  3.028   11.695  1.00 0.00 ? 129 LEU A HA   4  
ATOM 10586 H HB2  . LEU A 1 129 ? -7.776  5.562   10.156  1.00 0.00 ? 129 LEU A HB2  4  
ATOM 10587 H HB3  . LEU A 1 129 ? -6.259  5.285   10.990  1.00 0.00 ? 129 LEU A HB3  4  
ATOM 10588 H HG   . LEU A 1 129 ? -7.280  3.290   8.995   1.00 0.00 ? 129 LEU A HG   4  
ATOM 10589 H HD11 . LEU A 1 129 ? -5.749  5.822   8.420   1.00 0.00 ? 129 LEU A HD11 4  
ATOM 10590 H HD12 . LEU A 1 129 ? -7.328  5.358   7.784   1.00 0.00 ? 129 LEU A HD12 4  
ATOM 10591 H HD13 . LEU A 1 129 ? -5.886  4.465   7.301   1.00 0.00 ? 129 LEU A HD13 4  
ATOM 10592 H HD21 . LEU A 1 129 ? -4.909  2.782   8.770   1.00 0.00 ? 129 LEU A HD21 4  
ATOM 10593 H HD22 . LEU A 1 129 ? -5.415  2.667   10.456  1.00 0.00 ? 129 LEU A HD22 4  
ATOM 10594 H HD23 . LEU A 1 129 ? -4.512  4.076   9.901   1.00 0.00 ? 129 LEU A HD23 4  
ATOM 10595 N N    . GLU A 1 130 ? -8.967  5.472   13.036  1.00 0.00 ? 130 GLU A N    4  
ATOM 10596 C CA   . GLU A 1 130 ? -9.152  6.249   14.253  1.00 0.00 ? 130 GLU A CA   4  
ATOM 10597 C C    . GLU A 1 130 ? -10.046 5.515   15.254  1.00 0.00 ? 130 GLU A C    4  
ATOM 10598 O O    . GLU A 1 130 ? -10.294 6.010   16.356  1.00 0.00 ? 130 GLU A O    4  
ATOM 10599 C CB   . GLU A 1 130 ? -9.752  7.619   13.917  1.00 0.00 ? 130 GLU A CB   4  
ATOM 10600 C CG   . GLU A 1 130 ? -8.986  8.375   12.839  1.00 0.00 ? 130 GLU A CG   4  
ATOM 10601 C CD   . GLU A 1 130 ? -9.556  9.750   12.567  1.00 0.00 ? 130 GLU A CD   4  
ATOM 10602 O OE1  . GLU A 1 130 ? -10.715 9.841   12.103  1.00 0.00 ? 130 GLU A OE1  4  
ATOM 10603 O OE2  . GLU A 1 130 ? -8.850  10.752  12.817  1.00 0.00 ? 130 GLU A OE2  4  
ATOM 10604 H H    . GLU A 1 130 ? -9.637  5.533   12.321  1.00 0.00 ? 130 GLU A H    4  
ATOM 10605 H HA   . GLU A 1 130 ? -8.180  6.396   14.700  1.00 0.00 ? 130 GLU A HA   4  
ATOM 10606 H HB2  . GLU A 1 130 ? -10.769 7.483   13.577  1.00 0.00 ? 130 GLU A HB2  4  
ATOM 10607 H HB3  . GLU A 1 130 ? -9.760  8.223   14.812  1.00 0.00 ? 130 GLU A HB3  4  
ATOM 10608 H HG2  . GLU A 1 130 ? -7.960  8.484   13.156  1.00 0.00 ? 130 GLU A HG2  4  
ATOM 10609 H HG3  . GLU A 1 130 ? -9.018  7.801   11.922  1.00 0.00 ? 130 GLU A HG3  4  
ATOM 10610 N N    . THR A 1 131 ? -10.519 4.334   14.878  1.00 0.00 ? 131 THR A N    4  
ATOM 10611 C CA   . THR A 1 131 ? -11.393 3.554   15.745  1.00 0.00 ? 131 THR A CA   4  
ATOM 10612 C C    . THR A 1 131 ? -10.669 2.365   16.382  1.00 0.00 ? 131 THR A C    4  
ATOM 10613 O O    . THR A 1 131 ? -10.501 2.312   17.599  1.00 0.00 ? 131 THR A O    4  
ATOM 10614 C CB   . THR A 1 131 ? -12.629 3.039   14.972  1.00 0.00 ? 131 THR A CB   4  
ATOM 10615 O OG1  . THR A 1 131 ? -13.373 4.141   14.437  1.00 0.00 ? 131 THR A OG1  4  
ATOM 10616 C CG2  . THR A 1 131 ? -13.534 2.212   15.871  1.00 0.00 ? 131 THR A CG2  4  
ATOM 10617 H H    . THR A 1 131 ? -10.280 3.981   13.995  1.00 0.00 ? 131 THR A H    4  
ATOM 10618 H HA   . THR A 1 131 ? -11.742 4.207   16.534  1.00 0.00 ? 131 THR A HA   4  
ATOM 10619 H HB   . THR A 1 131 ? -12.289 2.414   14.158  1.00 0.00 ? 131 THR A HB   4  
ATOM 10620 H HG1  . THR A 1 131 ? -12.763 4.783   14.045  1.00 0.00 ? 131 THR A HG1  4  
ATOM 10621 H HG21 . THR A 1 131 ? -14.368 1.839   15.296  1.00 0.00 ? 131 THR A HG21 4  
ATOM 10622 H HG22 . THR A 1 131 ? -13.902 2.830   16.678  1.00 0.00 ? 131 THR A HG22 4  
ATOM 10623 H HG23 . THR A 1 131 ? -12.978 1.381   16.279  1.00 0.00 ? 131 THR A HG23 4  
ATOM 10624 N N    . ARG A 1 132 ? -10.225 1.421   15.562  1.00 0.00 ? 132 ARG A N    4  
ATOM 10625 C CA   . ARG A 1 132 ? -9.566  0.225   16.077  1.00 0.00 ? 132 ARG A CA   4  
ATOM 10626 C C    . ARG A 1 132 ? -8.049  0.280   15.914  1.00 0.00 ? 132 ARG A C    4  
ATOM 10627 O O    . ARG A 1 132 ? -7.318  -0.396  16.634  1.00 0.00 ? 132 ARG A O    4  
ATOM 10628 C CB   . ARG A 1 132 ? -10.118 -1.019  15.376  1.00 0.00 ? 132 ARG A CB   4  
ATOM 10629 C CG   . ARG A 1 132 ? -9.709  -2.326  16.039  1.00 0.00 ? 132 ARG A CG   4  
ATOM 10630 C CD   . ARG A 1 132 ? -10.287 -3.527  15.310  1.00 0.00 ? 132 ARG A CD   4  
ATOM 10631 N NE   . ARG A 1 132 ? -9.940  -4.782  15.974  1.00 0.00 ? 132 ARG A NE   4  
ATOM 10632 C CZ   . ARG A 1 132 ? -10.795 -5.787  16.170  1.00 0.00 ? 132 ARG A CZ   4  
ATOM 10633 N NH1  . ARG A 1 132 ? -12.043 -5.703  15.721  1.00 0.00 ? 132 ARG A NH1  4  
ATOM 10634 N NH2  . ARG A 1 132 ? -10.399 -6.879  16.812  1.00 0.00 ? 132 ARG A NH2  4  
ATOM 10635 H H    . ARG A 1 132 ? -10.337 1.533   14.592  1.00 0.00 ? 132 ARG A H    4  
ATOM 10636 H HA   . ARG A 1 132 ? -9.796  0.155   17.129  1.00 0.00 ? 132 ARG A HA   4  
ATOM 10637 H HB2  . ARG A 1 132 ? -11.197 -0.966  15.370  1.00 0.00 ? 132 ARG A HB2  4  
ATOM 10638 H HB3  . ARG A 1 132 ? -9.762  -1.031  14.357  1.00 0.00 ? 132 ARG A HB3  4  
ATOM 10639 H HG2  . ARG A 1 132 ? -8.631  -2.400  16.032  1.00 0.00 ? 132 ARG A HG2  4  
ATOM 10640 H HG3  . ARG A 1 132 ? -10.065 -2.328  17.059  1.00 0.00 ? 132 ARG A HG3  4  
ATOM 10641 H HD2  . ARG A 1 132 ? -11.362 -3.430  15.277  1.00 0.00 ? 132 ARG A HD2  4  
ATOM 10642 H HD3  . ARG A 1 132 ? -9.897  -3.543  14.303  1.00 0.00 ? 132 ARG A HD3  4  
ATOM 10643 H HE   . ARG A 1 132 ? -9.010  -4.875  16.301  1.00 0.00 ? 132 ARG A HE   4  
ATOM 10644 H HH11 . ARG A 1 132 ? -12.351 -4.882  15.224  1.00 0.00 ? 132 ARG A HH11 4  
ATOM 10645 H HH12 . ARG A 1 132 ? -12.685 -6.464  15.866  1.00 0.00 ? 132 ARG A HH12 4  
ATOM 10646 H HH21 . ARG A 1 132 ? -9.447  -6.955  17.144  1.00 0.00 ? 132 ARG A HH21 4  
ATOM 10647 H HH22 . ARG A 1 132 ? -11.045 -7.633  16.983  1.00 0.00 ? 132 ARG A HH22 4  
ATOM 10648 N N    . LEU A 1 133 ? -7.574  1.088   14.981  1.00 0.00 ? 133 LEU A N    4  
ATOM 10649 C CA   . LEU A 1 133 ? -6.140  1.187   14.739  1.00 0.00 ? 133 LEU A CA   4  
ATOM 10650 C C    . LEU A 1 133 ? -5.550  2.440   15.378  1.00 0.00 ? 133 LEU A C    4  
ATOM 10651 O O    . LEU A 1 133 ? -4.423  2.826   15.073  1.00 0.00 ? 133 LEU A O    4  
ATOM 10652 C CB   . LEU A 1 133 ? -5.858  1.181   13.235  1.00 0.00 ? 133 LEU A CB   4  
ATOM 10653 C CG   . LEU A 1 133 ? -6.416  -0.027  12.482  1.00 0.00 ? 133 LEU A CG   4  
ATOM 10654 C CD1  . LEU A 1 133 ? -6.197  0.128   10.987  1.00 0.00 ? 133 LEU A CD1  4  
ATOM 10655 C CD2  . LEU A 1 133 ? -5.778  -1.312  12.985  1.00 0.00 ? 133 LEU A CD2  4  
ATOM 10656 H H    . LEU A 1 133 ? -8.191  1.627   14.445  1.00 0.00 ? 133 LEU A H    4  
ATOM 10657 H HA   . LEU A 1 133 ? -5.672  0.320   15.182  1.00 0.00 ? 133 LEU A HA   4  
ATOM 10658 H HB2  . LEU A 1 133 ? -6.286  2.076   12.806  1.00 0.00 ? 133 LEU A HB2  4  
ATOM 10659 H HB3  . LEU A 1 133 ? -4.789  1.207   13.088  1.00 0.00 ? 133 LEU A HB3  4  
ATOM 10660 H HG   . LEU A 1 133 ? -7.480  -0.091  12.657  1.00 0.00 ? 133 LEU A HG   4  
ATOM 10661 H HD11 . LEU A 1 133 ? -6.747  0.986   10.630  1.00 0.00 ? 133 LEU A HD11 4  
ATOM 10662 H HD12 . LEU A 1 133 ? -6.544  -0.759  10.478  1.00 0.00 ? 133 LEU A HD12 4  
ATOM 10663 H HD13 . LEU A 1 133 ? -5.143  0.268   10.790  1.00 0.00 ? 133 LEU A HD13 4  
ATOM 10664 H HD21 . LEU A 1 133 ? -6.163  -2.149  12.421  1.00 0.00 ? 133 LEU A HD21 4  
ATOM 10665 H HD22 . LEU A 1 133 ? -6.013  -1.445  14.031  1.00 0.00 ? 133 LEU A HD22 4  
ATOM 10666 H HD23 . LEU A 1 133 ? -4.707  -1.257  12.861  1.00 0.00 ? 133 LEU A HD23 4  
ATOM 10667 N N    . ALA A 1 134 ? -6.304  3.056   16.281  1.00 0.00 ? 134 ALA A N    4  
ATOM 10668 C CA   . ALA A 1 134 ? -5.858  4.272   16.952  1.00 0.00 ? 134 ALA A CA   4  
ATOM 10669 C C    . ALA A 1 134 ? -4.583  4.027   17.753  1.00 0.00 ? 134 ALA A C    4  
ATOM 10670 O O    . ALA A 1 134 ? -3.600  4.761   17.614  1.00 0.00 ? 134 ALA A O    4  
ATOM 10671 C CB   . ALA A 1 134 ? -6.959  4.812   17.849  1.00 0.00 ? 134 ALA A CB   4  
ATOM 10672 H H    . ALA A 1 134 ? -7.179  2.680   16.510  1.00 0.00 ? 134 ALA A H    4  
ATOM 10673 H HA   . ALA A 1 134 ? -5.653  5.011   16.191  1.00 0.00 ? 134 ALA A HA   4  
ATOM 10674 H HB1  . ALA A 1 134 ? -7.851  4.978   17.263  1.00 0.00 ? 134 ALA A HB1  4  
ATOM 10675 H HB2  . ALA A 1 134 ? -6.640  5.743   18.293  1.00 0.00 ? 134 ALA A HB2  4  
ATOM 10676 H HB3  . ALA A 1 134 ? -7.171  4.095   18.630  1.00 0.00 ? 134 ALA A HB3  4  
ATOM 10677 N N    . ASP A 1 135 ? -4.598  2.987   18.579  1.00 0.00 ? 135 ASP A N    4  
ATOM 10678 C CA   . ASP A 1 135 ? -3.436  2.644   19.395  1.00 0.00 ? 135 ASP A CA   4  
ATOM 10679 C C    . ASP A 1 135 ? -2.283  2.177   18.517  1.00 0.00 ? 135 ASP A C    4  
ATOM 10680 O O    . ASP A 1 135 ? -1.129  2.535   18.752  1.00 0.00 ? 135 ASP A O    4  
ATOM 10681 C CB   . ASP A 1 135 ? -3.782  1.556   20.412  1.00 0.00 ? 135 ASP A CB   4  
ATOM 10682 C CG   . ASP A 1 135 ? -2.544  0.955   21.055  1.00 0.00 ? 135 ASP A CG   4  
ATOM 10683 O OD1  . ASP A 1 135 ? -1.827  1.683   21.776  1.00 0.00 ? 135 ASP A OD1  4  
ATOM 10684 O OD2  . ASP A 1 135 ? -2.283  -0.249  20.842  1.00 0.00 ? 135 ASP A OD2  4  
ATOM 10685 H H    . ASP A 1 135 ? -5.417  2.440   18.649  1.00 0.00 ? 135 ASP A H    4  
ATOM 10686 H HA   . ASP A 1 135 ? -3.132  3.535   19.923  1.00 0.00 ? 135 ASP A HA   4  
ATOM 10687 H HB2  . ASP A 1 135 ? -4.402  1.980   21.189  1.00 0.00 ? 135 ASP A HB2  4  
ATOM 10688 H HB3  . ASP A 1 135 ? -4.327  0.766   19.913  1.00 0.00 ? 135 ASP A HB3  4  
ATOM 10689 N N    . TRP A 1 136 ? -2.607  1.381   17.502  1.00 0.00 ? 136 TRP A N    4  
ATOM 10690 C CA   . TRP A 1 136 ? -1.603  0.861   16.580  1.00 0.00 ? 136 TRP A CA   4  
ATOM 10691 C C    . TRP A 1 136 ? -0.845  2.008   15.916  1.00 0.00 ? 136 TRP A C    4  
ATOM 10692 O O    . TRP A 1 136 ? 0.389   2.053   15.943  1.00 0.00 ? 136 TRP A O    4  
ATOM 10693 C CB   . TRP A 1 136 ? -2.258  -0.022  15.515  1.00 0.00 ? 136 TRP A CB   4  
ATOM 10694 C CG   . TRP A 1 136 ? -2.941  -1.236  16.079  1.00 0.00 ? 136 TRP A CG   4  
ATOM 10695 C CD1  . TRP A 1 136 ? -4.244  -1.334  16.482  1.00 0.00 ? 136 TRP A CD1  4  
ATOM 10696 C CD2  . TRP A 1 136 ? -2.358  -2.527  16.297  1.00 0.00 ? 136 TRP A CD2  4  
ATOM 10697 N NE1  . TRP A 1 136 ? -4.502  -2.602  16.941  1.00 0.00 ? 136 TRP A NE1  4  
ATOM 10698 C CE2  . TRP A 1 136 ? -3.363  -3.353  16.835  1.00 0.00 ? 136 TRP A CE2  4  
ATOM 10699 C CE3  . TRP A 1 136 ? -1.087  -3.065  16.088  1.00 0.00 ? 136 TRP A CE3  4  
ATOM 10700 C CZ2  . TRP A 1 136 ? -3.133  -4.686  17.171  1.00 0.00 ? 136 TRP A CZ2  4  
ATOM 10701 C CZ3  . TRP A 1 136 ? -0.860  -4.387  16.421  1.00 0.00 ? 136 TRP A CZ3  4  
ATOM 10702 C CH2  . TRP A 1 136 ? -1.880  -5.185  16.955  1.00 0.00 ? 136 TRP A CH2  4  
ATOM 10703 H H    . TRP A 1 136 ? -3.546  1.132   17.374  1.00 0.00 ? 136 TRP A H    4  
ATOM 10704 H HA   . TRP A 1 136 ? -0.907  0.266   17.151  1.00 0.00 ? 136 TRP A HA   4  
ATOM 10705 H HB2  . TRP A 1 136 ? -2.996  0.560   14.984  1.00 0.00 ? 136 TRP A HB2  4  
ATOM 10706 H HB3  . TRP A 1 136 ? -1.504  -0.355  14.819  1.00 0.00 ? 136 TRP A HB3  4  
ATOM 10707 H HD1  . TRP A 1 136 ? -4.955  -0.523  16.445  1.00 0.00 ? 136 TRP A HD1  4  
ATOM 10708 H HE1  . TRP A 1 136 ? -5.366  -2.919  17.288  1.00 0.00 ? 136 TRP A HE1  4  
ATOM 10709 H HE3  . TRP A 1 136 ? -0.288  -2.465  15.680  1.00 0.00 ? 136 TRP A HE3  4  
ATOM 10710 H HZ2  . TRP A 1 136 ? -3.910  -5.313  17.586  1.00 0.00 ? 136 TRP A HZ2  4  
ATOM 10711 H HZ3  . TRP A 1 136 ? 0.117   -4.819  16.268  1.00 0.00 ? 136 TRP A HZ3  4  
ATOM 10712 H HH2  . TRP A 1 136 ? -1.657  -6.213  17.202  1.00 0.00 ? 136 TRP A HH2  4  
ATOM 10713 N N    . ILE A 1 137 ? -1.595  2.948   15.351  1.00 0.00 ? 137 ILE A N    4  
ATOM 10714 C CA   . ILE A 1 137 ? -1.006  4.102   14.690  1.00 0.00 ? 137 ILE A CA   4  
ATOM 10715 C C    . ILE A 1 137 ? -0.215  4.941   15.691  1.00 0.00 ? 137 ILE A C    4  
ATOM 10716 O O    . ILE A 1 137 ? 0.863   5.448   15.379  1.00 0.00 ? 137 ILE A O    4  
ATOM 10717 C CB   . ILE A 1 137 ? -2.090  4.971   13.999  1.00 0.00 ? 137 ILE A CB   4  
ATOM 10718 C CG1  . ILE A 1 137 ? -2.689  4.218   12.804  1.00 0.00 ? 137 ILE A CG1  4  
ATOM 10719 C CG2  . ILE A 1 137 ? -1.523  6.315   13.555  1.00 0.00 ? 137 ILE A CG2  4  
ATOM 10720 C CD1  . ILE A 1 137 ? -1.663  3.791   11.771  1.00 0.00 ? 137 ILE A CD1  4  
ATOM 10721 H H    . ILE A 1 137 ? -2.575  2.863   15.381  1.00 0.00 ? 137 ILE A H    4  
ATOM 10722 H HA   . ILE A 1 137 ? -0.329  3.737   13.930  1.00 0.00 ? 137 ILE A HA   4  
ATOM 10723 H HB   . ILE A 1 137 ? -2.875  5.163   14.717  1.00 0.00 ? 137 ILE A HB   4  
ATOM 10724 H HG12 . ILE A 1 137 ? -3.185  3.328   13.160  1.00 0.00 ? 137 ILE A HG12 4  
ATOM 10725 H HG13 . ILE A 1 137 ? -3.411  4.855   12.313  1.00 0.00 ? 137 ILE A HG13 4  
ATOM 10726 H HG21 . ILE A 1 137 ? -0.709  6.150   12.863  1.00 0.00 ? 137 ILE A HG21 4  
ATOM 10727 H HG22 . ILE A 1 137 ? -1.158  6.854   14.416  1.00 0.00 ? 137 ILE A HG22 4  
ATOM 10728 H HG23 . ILE A 1 137 ? -2.296  6.891   13.070  1.00 0.00 ? 137 ILE A HG23 4  
ATOM 10729 H HD11 . ILE A 1 137 ? -0.956  3.111   12.226  1.00 0.00 ? 137 ILE A HD11 4  
ATOM 10730 H HD12 . ILE A 1 137 ? -1.140  4.662   11.398  1.00 0.00 ? 137 ILE A HD12 4  
ATOM 10731 H HD13 . ILE A 1 137 ? -2.165  3.295   10.953  1.00 0.00 ? 137 ILE A HD13 4  
ATOM 10732 N N    . HIS A 1 138 ? -0.738  5.053   16.909  1.00 0.00 ? 138 HIS A N    4  
ATOM 10733 C CA   . HIS A 1 138 ? -0.080  5.825   17.958  1.00 0.00 ? 138 HIS A CA   4  
ATOM 10734 C C    . HIS A 1 138 ? 1.252   5.187   18.351  1.00 0.00 ? 138 HIS A C    4  
ATOM 10735 O O    . HIS A 1 138 ? 2.219   5.888   18.646  1.00 0.00 ? 138 HIS A O    4  
ATOM 10736 C CB   . HIS A 1 138 ? -0.984  5.948   19.190  1.00 0.00 ? 138 HIS A CB   4  
ATOM 10737 C CG   . HIS A 1 138 ? -0.468  6.901   20.224  1.00 0.00 ? 138 HIS A CG   4  
ATOM 10738 N ND1  . HIS A 1 138 ? 0.011   6.495   21.448  1.00 0.00 ? 138 HIS A ND1  4  
ATOM 10739 C CD2  . HIS A 1 138 ? -0.353  8.250   20.207  1.00 0.00 ? 138 HIS A CD2  4  
ATOM 10740 C CE1  . HIS A 1 138 ? 0.402   7.548   22.139  1.00 0.00 ? 138 HIS A CE1  4  
ATOM 10741 N NE2  . HIS A 1 138 ? 0.191   8.627   21.409  1.00 0.00 ? 138 HIS A NE2  4  
ATOM 10742 H H    . HIS A 1 138 ? -1.592  4.604   17.107  1.00 0.00 ? 138 HIS A H    4  
ATOM 10743 H HA   . HIS A 1 138 ? 0.111   6.812   17.565  1.00 0.00 ? 138 HIS A HA   4  
ATOM 10744 H HB2  . HIS A 1 138 ? -1.960  6.290   18.882  1.00 0.00 ? 138 HIS A HB2  4  
ATOM 10745 H HB3  . HIS A 1 138 ? -1.079  4.976   19.653  1.00 0.00 ? 138 HIS A HB3  4  
ATOM 10746 H HD1  . HIS A 1 138 ? 0.053   5.559   21.767  1.00 0.00 ? 138 HIS A HD1  4  
ATOM 10747 H HD2  . HIS A 1 138 ? -0.640  8.907   19.398  1.00 0.00 ? 138 HIS A HD2  4  
ATOM 10748 H HE1  . HIS A 1 138 ? 0.823   7.531   23.132  1.00 0.00 ? 138 HIS A HE1  4  
ATOM 10749 H HE2  . HIS A 1 138 ? 0.550   9.525   21.614  1.00 0.00 ? 138 HIS A HE2  4  
ATOM 10750 N N    . SER A 1 139 ? 1.299   3.862   18.347  1.00 0.00 ? 139 SER A N    4  
ATOM 10751 C CA   . SER A 1 139 ? 2.514   3.138   18.704  1.00 0.00 ? 139 SER A CA   4  
ATOM 10752 C C    . SER A 1 139 ? 3.555   3.238   17.591  1.00 0.00 ? 139 SER A C    4  
ATOM 10753 O O    . SER A 1 139 ? 4.758   3.276   17.846  1.00 0.00 ? 139 SER A O    4  
ATOM 10754 C CB   . SER A 1 139 ? 2.193   1.668   18.979  1.00 0.00 ? 139 SER A CB   4  
ATOM 10755 O OG   . SER A 1 139 ? 1.128   1.534   19.910  1.00 0.00 ? 139 SER A OG   4  
ATOM 10756 H H    . SER A 1 139 ? 0.493   3.356   18.100  1.00 0.00 ? 139 SER A H    4  
ATOM 10757 H HA   . SER A 1 139 ? 2.916   3.583   19.602  1.00 0.00 ? 139 SER A HA   4  
ATOM 10758 H HB2  . SER A 1 139 ? 1.908   1.185   18.056  1.00 0.00 ? 139 SER A HB2  4  
ATOM 10759 H HB3  . SER A 1 139 ? 3.069   1.183   19.383  1.00 0.00 ? 139 SER A HB3  4  
ATOM 10760 H HG   . SER A 1 139 ? 0.369   2.056   19.615  1.00 0.00 ? 139 SER A HG   4  
ATOM 10761 N N    . SER A 1 140 ? 3.085   3.282   16.354  1.00 0.00 ? 140 SER A N    4  
ATOM 10762 C CA   . SER A 1 140 ? 3.969   3.379   15.203  1.00 0.00 ? 140 SER A CA   4  
ATOM 10763 C C    . SER A 1 140 ? 4.332   4.831   14.912  1.00 0.00 ? 140 SER A C    4  
ATOM 10764 O O    . SER A 1 140 ? 5.162   5.114   14.043  1.00 0.00 ? 140 SER A O    4  
ATOM 10765 C CB   . SER A 1 140 ? 3.297   2.754   13.983  1.00 0.00 ? 140 SER A CB   4  
ATOM 10766 O OG   . SER A 1 140 ? 3.052   1.375   14.199  1.00 0.00 ? 140 SER A OG   4  
ATOM 10767 H H    . SER A 1 140 ? 2.115   3.234   16.208  1.00 0.00 ? 140 SER A H    4  
ATOM 10768 H HA   . SER A 1 140 ? 4.871   2.829   15.427  1.00 0.00 ? 140 SER A HA   4  
ATOM 10769 H HB2  . SER A 1 140 ? 2.356   3.250   13.798  1.00 0.00 ? 140 SER A HB2  4  
ATOM 10770 H HB3  . SER A 1 140 ? 3.940   2.865   13.122  1.00 0.00 ? 140 SER A HB3  4  
ATOM 10771 H HG   . SER A 1 140 ? 3.892   0.890   14.121  1.00 0.00 ? 140 SER A HG   4  
ATOM 10772 N N    . GLY A 1 141 ? 3.718   5.746   15.658  1.00 0.00 ? 141 GLY A N    4  
ATOM 10773 C CA   . GLY A 1 141 ? 3.968   7.158   15.461  1.00 0.00 ? 141 GLY A CA   4  
ATOM 10774 C C    . GLY A 1 141 ? 3.490   7.607   14.102  1.00 0.00 ? 141 GLY A C    4  
ATOM 10775 O O    . GLY A 1 141 ? 4.170   8.366   13.408  1.00 0.00 ? 141 GLY A O    4  
ATOM 10776 H H    . GLY A 1 141 ? 3.083   5.455   16.347  1.00 0.00 ? 141 GLY A H    4  
ATOM 10777 H HA2  . GLY A 1 141 ? 3.448   7.720   16.224  1.00 0.00 ? 141 GLY A HA2  4  
ATOM 10778 H HA3  . GLY A 1 141 ? 5.027   7.347   15.540  1.00 0.00 ? 141 GLY A HA3  4  
ATOM 10779 N N    . GLY A 1 142 ? 2.319   7.123   13.718  1.00 0.00 ? 142 GLY A N    4  
ATOM 10780 C CA   . GLY A 1 142 ? 1.759   7.460   12.430  1.00 0.00 ? 142 GLY A CA   4  
ATOM 10781 C C    . GLY A 1 142 ? 2.454   6.699   11.325  1.00 0.00 ? 142 GLY A C    4  
ATOM 10782 O O    . GLY A 1 142 ? 2.184   5.519   11.109  1.00 0.00 ? 142 GLY A O    4  
ATOM 10783 H H    . GLY A 1 142 ? 1.827   6.520   14.322  1.00 0.00 ? 142 GLY A H    4  
ATOM 10784 H HA2  . GLY A 1 142 ? 0.707   7.213   12.425  1.00 0.00 ? 142 GLY A HA2  4  
ATOM 10785 H HA3  . GLY A 1 142 ? 1.877   8.519   12.257  1.00 0.00 ? 142 GLY A HA3  4  
ATOM 10786 N N    . TRP A 1 143 ? 3.371   7.364   10.644  1.00 0.00 ? 143 TRP A N    4  
ATOM 10787 C CA   . TRP A 1 143 ? 4.119   6.741   9.564   1.00 0.00 ? 143 TRP A CA   4  
ATOM 10788 C C    . TRP A 1 143 ? 5.607   6.773   9.883   1.00 0.00 ? 143 TRP A C    4  
ATOM 10789 O O    . TRP A 1 143 ? 6.447   6.515   9.024   1.00 0.00 ? 143 TRP A O    4  
ATOM 10790 C CB   . TRP A 1 143 ? 3.841   7.458   8.242   1.00 0.00 ? 143 TRP A CB   4  
ATOM 10791 C CG   . TRP A 1 143 ? 2.380   7.594   7.938   1.00 0.00 ? 143 TRP A CG   4  
ATOM 10792 C CD1  . TRP A 1 143 ? 1.599   8.699   8.138   1.00 0.00 ? 143 TRP A CD1  4  
ATOM 10793 C CD2  . TRP A 1 143 ? 1.521   6.590   7.383   1.00 0.00 ? 143 TRP A CD2  4  
ATOM 10794 N NE1  . TRP A 1 143 ? 0.310   8.443   7.743   1.00 0.00 ? 143 TRP A NE1  4  
ATOM 10795 C CE2  . TRP A 1 143 ? 0.236   7.155   7.277   1.00 0.00 ? 143 TRP A CE2  4  
ATOM 10796 C CE3  . TRP A 1 143 ? 1.712   5.266   6.968   1.00 0.00 ? 143 TRP A CE3  4  
ATOM 10797 C CZ2  . TRP A 1 143 ? -0.850  6.445   6.771   1.00 0.00 ? 143 TRP A CZ2  4  
ATOM 10798 C CZ3  . TRP A 1 143 ? 0.632   4.563   6.466   1.00 0.00 ? 143 TRP A CZ3  4  
ATOM 10799 C CH2  . TRP A 1 143 ? -0.634  5.153   6.374   1.00 0.00 ? 143 TRP A CH2  4  
ATOM 10800 H H    . TRP A 1 143 ? 3.547   8.303   10.866  1.00 0.00 ? 143 TRP A H    4  
ATOM 10801 H HA   . TRP A 1 143 ? 3.798   5.711   9.484   1.00 0.00 ? 143 TRP A HA   4  
ATOM 10802 H HB2  . TRP A 1 143 ? 4.266   8.450   8.279   1.00 0.00 ? 143 TRP A HB2  4  
ATOM 10803 H HB3  . TRP A 1 143 ? 4.299   6.903   7.437   1.00 0.00 ? 143 TRP A HB3  4  
ATOM 10804 H HD1  . TRP A 1 143 ? 1.957   9.632   8.550   1.00 0.00 ? 143 TRP A HD1  4  
ATOM 10805 H HE1  . TRP A 1 143 ? -0.437  9.077   7.788   1.00 0.00 ? 143 TRP A HE1  4  
ATOM 10806 H HE3  . TRP A 1 143 ? 2.682   4.793   7.030   1.00 0.00 ? 143 TRP A HE3  4  
ATOM 10807 H HZ2  . TRP A 1 143 ? -1.832  6.885   6.693   1.00 0.00 ? 143 TRP A HZ2  4  
ATOM 10808 H HZ3  . TRP A 1 143 ? 0.761   3.540   6.142   1.00 0.00 ? 143 TRP A HZ3  4  
ATOM 10809 H HH2  . TRP A 1 143 ? -1.450  4.566   5.978   1.00 0.00 ? 143 TRP A HH2  4  
ATOM 10810 N N    . ALA A 1 144 ? 5.917   7.062   11.143  1.00 0.00 ? 144 ALA A N    4  
ATOM 10811 C CA   . ALA A 1 144 ? 7.298   7.153   11.602  1.00 0.00 ? 144 ALA A CA   4  
ATOM 10812 C C    . ALA A 1 144 ? 8.034   5.821   11.487  1.00 0.00 ? 144 ALA A C    4  
ATOM 10813 O O    . ALA A 1 144 ? 9.172   5.775   11.022  1.00 0.00 ? 144 ALA A O    4  
ATOM 10814 C CB   . ALA A 1 144 ? 7.347   7.651   13.035  1.00 0.00 ? 144 ALA A CB   4  
ATOM 10815 H H    . ALA A 1 144 ? 5.192   7.221   11.785  1.00 0.00 ? 144 ALA A H    4  
ATOM 10816 H HA   . ALA A 1 144 ? 7.802   7.880   10.982  1.00 0.00 ? 144 ALA A HA   4  
ATOM 10817 H HB1  . ALA A 1 144 ? 8.375   7.783   13.335  1.00 0.00 ? 144 ALA A HB1  4  
ATOM 10818 H HB2  . ALA A 1 144 ? 6.874   6.927   13.682  1.00 0.00 ? 144 ALA A HB2  4  
ATOM 10819 H HB3  . ALA A 1 144 ? 6.827   8.594   13.108  1.00 0.00 ? 144 ALA A HB3  4  
ATOM 10820 N N    . GLU A 1 145 ? 7.387   4.738   11.906  1.00 0.00 ? 145 GLU A N    4  
ATOM 10821 C CA   . GLU A 1 145 ? 8.013   3.420   11.845  1.00 0.00 ? 145 GLU A CA   4  
ATOM 10822 C C    . GLU A 1 145 ? 7.983   2.863   10.421  1.00 0.00 ? 145 GLU A C    4  
ATOM 10823 O O    . GLU A 1 145 ? 8.756   1.965   10.081  1.00 0.00 ? 145 GLU A O    4  
ATOM 10824 C CB   . GLU A 1 145 ? 7.346   2.453   12.841  1.00 0.00 ? 145 GLU A CB   4  
ATOM 10825 C CG   . GLU A 1 145 ? 6.408   1.426   12.217  1.00 0.00 ? 145 GLU A CG   4  
ATOM 10826 C CD   . GLU A 1 145 ? 6.159   0.244   13.135  1.00 0.00 ? 145 GLU A CD   4  
ATOM 10827 O OE1  . GLU A 1 145 ? 5.475   0.417   14.164  1.00 0.00 ? 145 GLU A OE1  4  
ATOM 10828 O OE2  . GLU A 1 145 ? 6.654   -0.863  12.838  1.00 0.00 ? 145 GLU A OE2  4  
ATOM 10829 H H    . GLU A 1 145 ? 6.480   4.827   12.271  1.00 0.00 ? 145 GLU A H    4  
ATOM 10830 H HA   . GLU A 1 145 ? 9.046   3.548   12.133  1.00 0.00 ? 145 GLU A HA   4  
ATOM 10831 H HB2  . GLU A 1 145 ? 8.119   1.917   13.371  1.00 0.00 ? 145 GLU A HB2  4  
ATOM 10832 H HB3  . GLU A 1 145 ? 6.780   3.033   13.554  1.00 0.00 ? 145 GLU A HB3  4  
ATOM 10833 H HG2  . GLU A 1 145 ? 5.464   1.902   11.999  1.00 0.00 ? 145 GLU A HG2  4  
ATOM 10834 H HG3  . GLU A 1 145 ? 6.848   1.064   11.300  1.00 0.00 ? 145 GLU A HG3  4  
ATOM 10835 N N    . PHE A 1 146 ? 7.118   3.427   9.582   1.00 0.00 ? 146 PHE A N    4  
ATOM 10836 C CA   . PHE A 1 146 ? 6.992   2.981   8.197   1.00 0.00 ? 146 PHE A CA   4  
ATOM 10837 C C    . PHE A 1 146 ? 8.290   3.216   7.429   1.00 0.00 ? 146 PHE A C    4  
ATOM 10838 O O    . PHE A 1 146 ? 8.640   2.437   6.541   1.00 0.00 ? 146 PHE A O    4  
ATOM 10839 C CB   . PHE A 1 146 ? 5.826   3.687   7.499   1.00 0.00 ? 146 PHE A CB   4  
ATOM 10840 C CG   . PHE A 1 146 ? 5.574   3.193   6.100   1.00 0.00 ? 146 PHE A CG   4  
ATOM 10841 C CD1  . PHE A 1 146 ? 5.406   1.838   5.845   1.00 0.00 ? 146 PHE A CD1  4  
ATOM 10842 C CD2  . PHE A 1 146 ? 5.507   4.081   5.039   1.00 0.00 ? 146 PHE A CD2  4  
ATOM 10843 C CE1  . PHE A 1 146 ? 5.177   1.381   4.563   1.00 0.00 ? 146 PHE A CE1  4  
ATOM 10844 C CE2  . PHE A 1 146 ? 5.276   3.627   3.753   1.00 0.00 ? 146 PHE A CE2  4  
ATOM 10845 C CZ   . PHE A 1 146 ? 5.112   2.278   3.516   1.00 0.00 ? 146 PHE A CZ   4  
ATOM 10846 H H    . PHE A 1 146 ? 6.552   4.160   9.902   1.00 0.00 ? 146 PHE A H    4  
ATOM 10847 H HA   . PHE A 1 146 ? 6.794   1.918   8.215   1.00 0.00 ? 146 PHE A HA   4  
ATOM 10848 H HB2  . PHE A 1 146 ? 4.925   3.530   8.073   1.00 0.00 ? 146 PHE A HB2  4  
ATOM 10849 H HB3  . PHE A 1 146 ? 6.034   4.746   7.447   1.00 0.00 ? 146 PHE A HB3  4  
ATOM 10850 H HD1  . PHE A 1 146 ? 5.457   1.136   6.665   1.00 0.00 ? 146 PHE A HD1  4  
ATOM 10851 H HD2  . PHE A 1 146 ? 5.637   5.139   5.222   1.00 0.00 ? 146 PHE A HD2  4  
ATOM 10852 H HE1  . PHE A 1 146 ? 5.048   0.323   4.381   1.00 0.00 ? 146 PHE A HE1  4  
ATOM 10853 H HE2  . PHE A 1 146 ? 5.226   4.329   2.934   1.00 0.00 ? 146 PHE A HE2  4  
ATOM 10854 H HZ   . PHE A 1 146 ? 4.933   1.927   2.510   1.00 0.00 ? 146 PHE A HZ   4  
ATOM 10855 N N    . THR A 1 147 ? 9.001   4.278   7.790   1.00 0.00 ? 147 THR A N    4  
ATOM 10856 C CA   . THR A 1 147 ? 10.267  4.618   7.155   1.00 0.00 ? 147 THR A CA   4  
ATOM 10857 C C    . THR A 1 147 ? 11.247  3.445   7.223   1.00 0.00 ? 147 THR A C    4  
ATOM 10858 O O    . THR A 1 147 ? 11.985  3.183   6.274   1.00 0.00 ? 147 THR A O    4  
ATOM 10859 C CB   . THR A 1 147 ? 10.895  5.852   7.827   1.00 0.00 ? 147 THR A CB   4  
ATOM 10860 O OG1  . THR A 1 147 ? 9.876   6.601   8.505   1.00 0.00 ? 147 THR A OG1  4  
ATOM 10861 C CG2  . THR A 1 147 ? 11.583  6.740   6.803   1.00 0.00 ? 147 THR A CG2  4  
ATOM 10862 H H    . THR A 1 147 ? 8.658   4.863   8.499   1.00 0.00 ? 147 THR A H    4  
ATOM 10863 H HA   . THR A 1 147 ? 10.071  4.854   6.119   1.00 0.00 ? 147 THR A HA   4  
ATOM 10864 H HB   . THR A 1 147 ? 11.629  5.520   8.547   1.00 0.00 ? 147 THR A HB   4  
ATOM 10865 H HG1  . THR A 1 147 ? 9.907   6.399   9.451   1.00 0.00 ? 147 THR A HG1  4  
ATOM 10866 H HG21 . THR A 1 147 ? 12.398  6.200   6.347   1.00 0.00 ? 147 THR A HG21 4  
ATOM 10867 H HG22 . THR A 1 147 ? 11.967  7.623   7.293   1.00 0.00 ? 147 THR A HG22 4  
ATOM 10868 H HG23 . THR A 1 147 ? 10.871  7.030   6.044   1.00 0.00 ? 147 THR A HG23 4  
ATOM 10869 N N    . ALA A 1 148 ? 11.235  2.736   8.347   1.00 0.00 ? 148 ALA A N    4  
ATOM 10870 C CA   . ALA A 1 148 ? 12.113  1.592   8.535   1.00 0.00 ? 148 ALA A CA   4  
ATOM 10871 C C    . ALA A 1 148 ? 11.479  0.324   7.971   1.00 0.00 ? 148 ALA A C    4  
ATOM 10872 O O    . ALA A 1 148 ? 12.178  -0.595  7.544   1.00 0.00 ? 148 ALA A O    4  
ATOM 10873 C CB   . ALA A 1 148 ? 12.436  1.417   10.012  1.00 0.00 ? 148 ALA A CB   4  
ATOM 10874 H H    . ALA A 1 148 ? 10.627  2.994   9.071   1.00 0.00 ? 148 ALA A H    4  
ATOM 10875 H HA   . ALA A 1 148 ? 13.035  1.789   8.007   1.00 0.00 ? 148 ALA A HA   4  
ATOM 10876 H HB1  . ALA A 1 148 ? 12.800  2.352   10.412  1.00 0.00 ? 148 ALA A HB1  4  
ATOM 10877 H HB2  . ALA A 1 148 ? 13.194  0.656   10.129  1.00 0.00 ? 148 ALA A HB2  4  
ATOM 10878 H HB3  . ALA A 1 148 ? 11.543  1.120   10.545  1.00 0.00 ? 148 ALA A HB3  4  
ATOM 10879 N N    . LEU A 1 149 ? 10.145  0.292   7.959   1.00 0.00 ? 149 LEU A N    4  
ATOM 10880 C CA   . LEU A 1 149 ? 9.403   -0.860  7.449   1.00 0.00 ? 149 LEU A CA   4  
ATOM 10881 C C    . LEU A 1 149 ? 9.809   -1.182  6.013   1.00 0.00 ? 149 LEU A C    4  
ATOM 10882 O O    . LEU A 1 149 ? 10.201  -2.309  5.709   1.00 0.00 ? 149 LEU A O    4  
ATOM 10883 C CB   . LEU A 1 149 ? 7.890   -0.611  7.508   1.00 0.00 ? 149 LEU A CB   4  
ATOM 10884 C CG   . LEU A 1 149 ? 7.280   -0.518  8.913   1.00 0.00 ? 149 LEU A CG   4  
ATOM 10885 C CD1  . LEU A 1 149 ? 5.773   -0.346  8.823   1.00 0.00 ? 149 LEU A CD1  4  
ATOM 10886 C CD2  . LEU A 1 149 ? 7.621   -1.746  9.741   1.00 0.00 ? 149 LEU A CD2  4  
ATOM 10887 H H    . LEU A 1 149 ? 9.649   1.063   8.304   1.00 0.00 ? 149 LEU A H    4  
ATOM 10888 H HA   . LEU A 1 149 ? 9.643   -1.707  8.073   1.00 0.00 ? 149 LEU A HA   4  
ATOM 10889 H HB2  . LEU A 1 149 ? 7.684   0.314   6.991   1.00 0.00 ? 149 LEU A HB2  4  
ATOM 10890 H HB3  . LEU A 1 149 ? 7.397   -1.413  6.980   1.00 0.00 ? 149 LEU A HB3  4  
ATOM 10891 H HG   . LEU A 1 149 ? 7.684   0.350   9.415   1.00 0.00 ? 149 LEU A HG   4  
ATOM 10892 H HD11 . LEU A 1 149 ? 5.353   -1.147  8.232   1.00 0.00 ? 149 LEU A HD11 4  
ATOM 10893 H HD12 . LEU A 1 149 ? 5.545   0.602   8.358   1.00 0.00 ? 149 LEU A HD12 4  
ATOM 10894 H HD13 . LEU A 1 149 ? 5.350   -0.371  9.816   1.00 0.00 ? 149 LEU A HD13 4  
ATOM 10895 H HD21 . LEU A 1 149 ? 7.120   -1.684  10.698  1.00 0.00 ? 149 LEU A HD21 4  
ATOM 10896 H HD22 . LEU A 1 149 ? 8.689   -1.791  9.897   1.00 0.00 ? 149 LEU A HD22 4  
ATOM 10897 H HD23 . LEU A 1 149 ? 7.295   -2.633  9.221   1.00 0.00 ? 149 LEU A HD23 4  
ATOM 10898 N N    . TYR A 1 150 ? 9.733   -0.187  5.138   1.00 0.00 ? 150 TYR A N    4  
ATOM 10899 C CA   . TYR A 1 150 ? 10.096  -0.387  3.740   1.00 0.00 ? 150 TYR A CA   4  
ATOM 10900 C C    . TYR A 1 150 ? 11.501  0.148   3.471   1.00 0.00 ? 150 TYR A C    4  
ATOM 10901 O O    . TYR A 1 150 ? 11.940  0.240   2.326   1.00 0.00 ? 150 TYR A O    4  
ATOM 10902 C CB   . TYR A 1 150 ? 9.059   0.266   2.808   1.00 0.00 ? 150 TYR A CB   4  
ATOM 10903 C CG   . TYR A 1 150 ? 9.262   1.748   2.552   1.00 0.00 ? 150 TYR A CG   4  
ATOM 10904 C CD1  . TYR A 1 150 ? 9.142   2.682   3.573   1.00 0.00 ? 150 TYR A CD1  4  
ATOM 10905 C CD2  . TYR A 1 150 ? 9.567   2.207   1.277   1.00 0.00 ? 150 TYR A CD2  4  
ATOM 10906 C CE1  . TYR A 1 150 ? 9.322   4.030   3.329   1.00 0.00 ? 150 TYR A CE1  4  
ATOM 10907 C CE2  . TYR A 1 150 ? 9.749   3.552   1.026   1.00 0.00 ? 150 TYR A CE2  4  
ATOM 10908 C CZ   . TYR A 1 150 ? 9.627   4.460   2.054   1.00 0.00 ? 150 TYR A CZ   4  
ATOM 10909 O OH   . TYR A 1 150 ? 9.805   5.802   1.805   1.00 0.00 ? 150 TYR A OH   4  
ATOM 10910 H H    . TYR A 1 150 ? 9.429   0.700   5.436   1.00 0.00 ? 150 TYR A H    4  
ATOM 10911 H HA   . TYR A 1 150 ? 10.099  -1.451  3.557   1.00 0.00 ? 150 TYR A HA   4  
ATOM 10912 H HB2  . TYR A 1 150 ? 9.086   -0.233  1.853   1.00 0.00 ? 150 TYR A HB2  4  
ATOM 10913 H HB3  . TYR A 1 150 ? 8.077   0.140   3.240   1.00 0.00 ? 150 TYR A HB3  4  
ATOM 10914 H HD1  . TYR A 1 150 ? 8.909   2.342   4.571   1.00 0.00 ? 150 TYR A HD1  4  
ATOM 10915 H HD2  . TYR A 1 150 ? 9.661   1.492   0.473   1.00 0.00 ? 150 TYR A HD2  4  
ATOM 10916 H HE1  . TYR A 1 150 ? 9.228   4.741   4.137   1.00 0.00 ? 150 TYR A HE1  4  
ATOM 10917 H HE2  . TYR A 1 150 ? 9.986   3.887   0.028   1.00 0.00 ? 150 TYR A HE2  4  
ATOM 10918 H HH   . TYR A 1 150 ? 10.516  6.141   2.366   1.00 0.00 ? 150 TYR A HH   4  
ATOM 10919 N N    . GLY A 1 151 ? 12.211  0.476   4.543   1.00 0.00 ? 151 GLY A N    4  
ATOM 10920 C CA   . GLY A 1 151 ? 13.561  0.996   4.423   1.00 0.00 ? 151 GLY A CA   4  
ATOM 10921 C C    . GLY A 1 151 ? 14.601  -0.103  4.483   1.00 0.00 ? 151 GLY A C    4  
ATOM 10922 O O    . GLY A 1 151 ? 15.764  0.137   4.818   1.00 0.00 ? 151 GLY A O    4  
ATOM 10923 H H    . GLY A 1 151 ? 11.817  0.355   5.432   1.00 0.00 ? 151 GLY A H    4  
ATOM 10924 H HA2  . GLY A 1 151 ? 13.655  1.516   3.482   1.00 0.00 ? 151 GLY A HA2  4  
ATOM 10925 H HA3  . GLY A 1 151 ? 13.743  1.693   5.229   1.00 0.00 ? 151 GLY A HA3  4  
ATOM 10926 N N    . ASP A 1 152 ? 14.178  -1.315  4.155   1.00 0.00 ? 152 ASP A N    4  
ATOM 10927 C CA   . ASP A 1 152 ? 15.058  -2.468  4.174   1.00 0.00 ? 152 ASP A CA   4  
ATOM 10928 C C    . ASP A 1 152 ? 14.573  -3.515  3.176   1.00 0.00 ? 152 ASP A C    4  
ATOM 10929 O O    . ASP A 1 152 ? 13.568  -3.313  2.492   1.00 0.00 ? 152 ASP A O    4  
ATOM 10930 C CB   . ASP A 1 152 ? 15.122  -3.070  5.581   1.00 0.00 ? 152 ASP A CB   4  
ATOM 10931 C CG   . ASP A 1 152 ? 16.485  -3.648  5.902   1.00 0.00 ? 152 ASP A CG   4  
ATOM 10932 O OD1  . ASP A 1 152 ? 17.041  -4.378  5.054   1.00 0.00 ? 152 ASP A OD1  4  
ATOM 10933 O OD2  . ASP A 1 152 ? 17.008  -3.362  7.001   1.00 0.00 ? 152 ASP A OD2  4  
ATOM 10934 H H    . ASP A 1 152 ? 13.246  -1.434  3.876   1.00 0.00 ? 152 ASP A H    4  
ATOM 10935 H HA   . ASP A 1 152 ? 16.046  -2.140  3.884   1.00 0.00 ? 152 ASP A HA   4  
ATOM 10936 H HB2  . ASP A 1 152 ? 14.902  -2.299  6.306   1.00 0.00 ? 152 ASP A HB2  4  
ATOM 10937 H HB3  . ASP A 1 152 ? 14.388  -3.858  5.667   1.00 0.00 ? 152 ASP A HB3  4  
ATOM 10938 N N    . GLY A 1 153 ? 15.280  -4.628  3.112   1.00 0.00 ? 153 GLY A N    4  
ATOM 10939 C CA   . GLY A 1 153 ? 14.933  -5.692  2.199   1.00 0.00 ? 153 GLY A CA   4  
ATOM 10940 C C    . GLY A 1 153 ? 16.083  -6.654  2.001   1.00 0.00 ? 153 GLY A C    4  
ATOM 10941 O O    . GLY A 1 153 ? 15.882  -7.861  1.888   1.00 0.00 ? 153 GLY A O    4  
ATOM 10942 H H    . GLY A 1 153 ? 16.053  -4.735  3.714   1.00 0.00 ? 153 GLY A H    4  
ATOM 10943 H HA2  . GLY A 1 153 ? 14.085  -6.232  2.593   1.00 0.00 ? 153 GLY A HA2  4  
ATOM 10944 H HA3  . GLY A 1 153 ? 14.666  -5.264  1.244   1.00 0.00 ? 153 GLY A HA3  4  
ATOM 10945 N N    . ALA A 1 154 ? 17.296  -6.119  1.975   1.00 0.00 ? 154 ALA A N    4  
ATOM 10946 C CA   . ALA A 1 154 ? 18.481  -6.944  1.793   1.00 0.00 ? 154 ALA A CA   4  
ATOM 10947 C C    . ALA A 1 154 ? 19.195  -7.182  3.118   1.00 0.00 ? 154 ALA A C    4  
ATOM 10948 O O    . ALA A 1 154 ? 19.771  -8.248  3.340   1.00 0.00 ? 154 ALA A O    4  
ATOM 10949 C CB   . ALA A 1 154 ? 19.426  -6.300  0.792   1.00 0.00 ? 154 ALA A CB   4  
ATOM 10950 H H    . ALA A 1 154 ? 17.396  -5.144  2.074   1.00 0.00 ? 154 ALA A H    4  
ATOM 10951 H HA   . ALA A 1 154 ? 18.164  -7.895  1.389   1.00 0.00 ? 154 ALA A HA   4  
ATOM 10952 H HB1  . ALA A 1 154 ? 19.779  -5.357  1.183   1.00 0.00 ? 154 ALA A HB1  4  
ATOM 10953 H HB2  . ALA A 1 154 ? 18.905  -6.132  -0.138  1.00 0.00 ? 154 ALA A HB2  4  
ATOM 10954 H HB3  . ALA A 1 154 ? 20.267  -6.956  0.621   1.00 0.00 ? 154 ALA A HB3  4  
ATOM 10955 N N    . LEU A 1 155 ? 19.164  -6.187  3.993   1.00 0.00 ? 155 LEU A N    4  
ATOM 10956 C CA   . LEU A 1 155 ? 19.806  -6.298  5.296   1.00 0.00 ? 155 LEU A CA   4  
ATOM 10957 C C    . LEU A 1 155 ? 18.908  -7.076  6.251   1.00 0.00 ? 155 LEU A C    4  
ATOM 10958 O O    . LEU A 1 155 ? 19.382  -7.719  7.186   1.00 0.00 ? 155 LEU A O    4  
ATOM 10959 C CB   . LEU A 1 155 ? 20.117  -4.911  5.864   1.00 0.00 ? 155 LEU A CB   4  
ATOM 10960 C CG   . LEU A 1 155 ? 21.111  -4.885  7.027   1.00 0.00 ? 155 LEU A CG   4  
ATOM 10961 C CD1  . LEU A 1 155 ? 22.454  -5.457  6.599   1.00 0.00 ? 155 LEU A CD1  4  
ATOM 10962 C CD2  . LEU A 1 155 ? 21.271  -3.464  7.546   1.00 0.00 ? 155 LEU A CD2  4  
ATOM 10963 H H    . LEU A 1 155 ? 18.692  -5.359  3.760   1.00 0.00 ? 155 LEU A H    4  
ATOM 10964 H HA   . LEU A 1 155 ? 20.731  -6.841  5.165   1.00 0.00 ? 155 LEU A HA   4  
ATOM 10965 H HB2  . LEU A 1 155 ? 20.514  -4.299  5.067   1.00 0.00 ? 155 LEU A HB2  4  
ATOM 10966 H HB3  . LEU A 1 155 ? 19.192  -4.471  6.203   1.00 0.00 ? 155 LEU A HB3  4  
ATOM 10967 H HG   . LEU A 1 155 ? 20.730  -5.497  7.832   1.00 0.00 ? 155 LEU A HG   4  
ATOM 10968 H HD11 . LEU A 1 155 ? 22.884  -4.828  5.835   1.00 0.00 ? 155 LEU A HD11 4  
ATOM 10969 H HD12 . LEU A 1 155 ? 22.313  -6.454  6.209   1.00 0.00 ? 155 LEU A HD12 4  
ATOM 10970 H HD13 . LEU A 1 155 ? 23.119  -5.494  7.451   1.00 0.00 ? 155 LEU A HD13 4  
ATOM 10971 H HD21 . LEU A 1 155 ? 21.994  -3.451  8.345   1.00 0.00 ? 155 LEU A HD21 4  
ATOM 10972 H HD22 . LEU A 1 155 ? 20.321  -3.106  7.913   1.00 0.00 ? 155 LEU A HD22 4  
ATOM 10973 H HD23 . LEU A 1 155 ? 21.609  -2.826  6.744   1.00 0.00 ? 155 LEU A HD23 4  
ATOM 10974 N N    . GLU A 1 156 ? 17.607  -6.995  6.008   1.00 0.00 ? 156 GLU A N    4  
ATOM 10975 C CA   . GLU A 1 156 ? 16.617  -7.701  6.813   1.00 0.00 ? 156 GLU A CA   4  
ATOM 10976 C C    . GLU A 1 156 ? 16.789  -9.208  6.642   1.00 0.00 ? 156 GLU A C    4  
ATOM 10977 O O    . GLU A 1 156 ? 17.157  -9.674  5.565   1.00 0.00 ? 156 GLU A O    4  
ATOM 10978 C CB   . GLU A 1 156 ? 15.203  -7.274  6.389   1.00 0.00 ? 156 GLU A CB   4  
ATOM 10979 C CG   . GLU A 1 156 ? 14.077  -7.967  7.150   1.00 0.00 ? 156 GLU A CG   4  
ATOM 10980 C CD   . GLU A 1 156 ? 13.372  -9.032  6.330   1.00 0.00 ? 156 GLU A CD   4  
ATOM 10981 O OE1  . GLU A 1 156 ? 12.691  -8.680  5.350   1.00 0.00 ? 156 GLU A OE1  4  
ATOM 10982 O OE2  . GLU A 1 156 ? 13.487  -10.228 6.673   1.00 0.00 ? 156 GLU A OE2  4  
ATOM 10983 H H    . GLU A 1 156 ? 17.300  -6.428  5.268   1.00 0.00 ? 156 GLU A H    4  
ATOM 10984 H HA   . GLU A 1 156 ? 16.774  -7.439  7.849   1.00 0.00 ? 156 GLU A HA   4  
ATOM 10985 H HB2  . GLU A 1 156 ? 15.104  -6.210  6.540   1.00 0.00 ? 156 GLU A HB2  4  
ATOM 10986 H HB3  . GLU A 1 156 ? 15.080  -7.488  5.336   1.00 0.00 ? 156 GLU A HB3  4  
ATOM 10987 H HG2  . GLU A 1 156 ? 14.492  -8.433  8.032   1.00 0.00 ? 156 GLU A HG2  4  
ATOM 10988 H HG3  . GLU A 1 156 ? 13.352  -7.222  7.445   1.00 0.00 ? 156 GLU A HG3  4  
ATOM 10989 N N    . GLU A 1 157 ? 16.558  -9.962  7.710   1.00 0.00 ? 157 GLU A N    4  
ATOM 10990 C CA   . GLU A 1 157 ? 16.677  -11.412 7.651   1.00 0.00 ? 157 GLU A CA   4  
ATOM 10991 C C    . GLU A 1 157 ? 15.710  -12.071 8.628   1.00 0.00 ? 157 GLU A C    4  
ATOM 10992 O O    . GLU A 1 157 ? 16.038  -13.051 9.299   1.00 0.00 ? 157 GLU A O    4  
ATOM 10993 C CB   . GLU A 1 157 ? 18.118  -11.857 7.929   1.00 0.00 ? 157 GLU A CB   4  
ATOM 10994 C CG   . GLU A 1 157 ? 18.435  -13.247 7.394   1.00 0.00 ? 157 GLU A CG   4  
ATOM 10995 C CD   . GLU A 1 157 ? 17.674  -13.576 6.121   1.00 0.00 ? 157 GLU A CD   4  
ATOM 10996 O OE1  . GLU A 1 157 ? 18.163  -13.234 5.024   1.00 0.00 ? 157 GLU A OE1  4  
ATOM 10997 O OE2  . GLU A 1 157 ? 16.584  -14.182 6.216   1.00 0.00 ? 157 GLU A OE2  4  
ATOM 10998 H H    . GLU A 1 157 ? 16.307  -9.533  8.560   1.00 0.00 ? 157 GLU A H    4  
ATOM 10999 H HA   . GLU A 1 157 ? 16.407  -11.716 6.650   1.00 0.00 ? 157 GLU A HA   4  
ATOM 11000 H HB2  . GLU A 1 157 ? 18.795  -11.152 7.469   1.00 0.00 ? 157 GLU A HB2  4  
ATOM 11001 H HB3  . GLU A 1 157 ? 18.284  -11.859 8.998   1.00 0.00 ? 157 GLU A HB3  4  
ATOM 11002 H HG2  . GLU A 1 157 ? 19.493  -13.305 7.184   1.00 0.00 ? 157 GLU A HG2  4  
ATOM 11003 H HG3  . GLU A 1 157 ? 18.178  -13.977 8.146   1.00 0.00 ? 157 GLU A HG3  4  
ATOM 11004 N N    . ALA A 1 158 ? 14.509  -11.529 8.701   1.00 0.00 ? 158 ALA A N    4  
ATOM 11005 C CA   . ALA A 1 158 ? 13.483  -12.067 9.575   1.00 0.00 ? 158 ALA A CA   4  
ATOM 11006 C C    . ALA A 1 158 ? 12.634  -13.050 8.790   1.00 0.00 ? 158 ALA A C    4  
ATOM 11007 O O    . ALA A 1 158 ? 12.124  -14.034 9.329   1.00 0.00 ? 158 ALA A O    4  
ATOM 11008 C CB   . ALA A 1 158 ? 12.627  -10.953 10.157  1.00 0.00 ? 158 ALA A CB   4  
ATOM 11009 H H    . ALA A 1 158 ? 14.293  -10.761 8.120   1.00 0.00 ? 158 ALA A H    4  
ATOM 11010 H HA   . ALA A 1 158 ? 13.970  -12.588 10.387  1.00 0.00 ? 158 ALA A HA   4  
ATOM 11011 H HB1  . ALA A 1 158 ? 12.062  -10.481 9.365   1.00 0.00 ? 158 ALA A HB1  4  
ATOM 11012 H HB2  . ALA A 1 158 ? 13.264  -10.221 10.630  1.00 0.00 ? 158 ALA A HB2  4  
ATOM 11013 H HB3  . ALA A 1 158 ? 11.946  -11.366 10.887  1.00 0.00 ? 158 ALA A HB3  4  
ATOM 11014 N N    . ARG A 1 159 ? 12.485  -12.758 7.504   1.00 0.00 ? 159 ARG A N    4  
ATOM 11015 C CA   . ARG A 1 159 ? 11.732  -13.608 6.593   1.00 0.00 ? 159 ARG A CA   4  
ATOM 11016 C C    . ARG A 1 159 ? 12.291  -13.470 5.181   1.00 0.00 ? 159 ARG A C    4  
ATOM 11017 O O    . ARG A 1 159 ? 11.698  -13.955 4.218   1.00 0.00 ? 159 ARG A O    4  
ATOM 11018 C CB   . ARG A 1 159 ? 10.238  -13.259 6.618   1.00 0.00 ? 159 ARG A CB   4  
ATOM 11019 C CG   . ARG A 1 159 ? 9.932   -11.775 6.458   1.00 0.00 ? 159 ARG A CG   4  
ATOM 11020 C CD   . ARG A 1 159 ? 9.754   -11.379 5.000   1.00 0.00 ? 159 ARG A CD   4  
ATOM 11021 N NE   . ARG A 1 159 ? 10.878  -10.584 4.510   1.00 0.00 ? 159 ARG A NE   4  
ATOM 11022 C CZ   . ARG A 1 159 ? 11.308  -10.584 3.253   1.00 0.00 ? 159 ARG A CZ   4  
ATOM 11023 N NH1  . ARG A 1 159 ? 10.736  -11.365 2.344   1.00 0.00 ? 159 ARG A NH1  4  
ATOM 11024 N NH2  . ARG A 1 159 ? 12.328  -9.811  2.913   1.00 0.00 ? 159 ARG A NH2  4  
ATOM 11025 H H    . ARG A 1 159 ? 12.891  -11.928 7.158   1.00 0.00 ? 159 ARG A H    4  
ATOM 11026 H HA   . ARG A 1 159 ? 11.859  -14.631 6.916   1.00 0.00 ? 159 ARG A HA   4  
ATOM 11027 H HB2  . ARG A 1 159 ? 9.747   -13.790 5.817   1.00 0.00 ? 159 ARG A HB2  4  
ATOM 11028 H HB3  . ARG A 1 159 ? 9.822   -13.588 7.559   1.00 0.00 ? 159 ARG A HB3  4  
ATOM 11029 H HG2  . ARG A 1 159 ? 9.022   -11.547 6.992   1.00 0.00 ? 159 ARG A HG2  4  
ATOM 11030 H HG3  . ARG A 1 159 ? 10.748  -11.204 6.879   1.00 0.00 ? 159 ARG A HG3  4  
ATOM 11031 H HD2  . ARG A 1 159 ? 9.673   -12.277 4.402   1.00 0.00 ? 159 ARG A HD2  4  
ATOM 11032 H HD3  . ARG A 1 159 ? 8.847   -10.800 4.903   1.00 0.00 ? 159 ARG A HD3  4  
ATOM 11033 H HE   . ARG A 1 159 ? 11.344  -10.002 5.165   1.00 0.00 ? 159 ARG A HE   4  
ATOM 11034 H HH11 . ARG A 1 159 ? 9.975   -11.960 2.600   1.00 0.00 ? 159 ARG A HH11 4  
ATOM 11035 H HH12 . ARG A 1 159 ? 11.068  -11.357 1.395   1.00 0.00 ? 159 ARG A HH12 4  
ATOM 11036 H HH21 . ARG A 1 159 ? 12.767  -9.228  3.612   1.00 0.00 ? 159 ARG A HH21 4  
ATOM 11037 H HH22 . ARG A 1 159 ? 12.665  -9.799  1.963   1.00 0.00 ? 159 ARG A HH22 4  
ATOM 11038 N N    . ARG A 1 160 ? 13.438  -12.801 5.085   1.00 0.00 ? 160 ARG A N    4  
ATOM 11039 C CA   . ARG A 1 160 ? 14.108  -12.564 3.812   1.00 0.00 ? 160 ARG A CA   4  
ATOM 11040 C C    . ARG A 1 160 ? 14.444  -13.880 3.130   1.00 0.00 ? 160 ARG A C    4  
ATOM 11041 O O    . ARG A 1 160 ? 13.834  -14.243 2.125   1.00 0.00 ? 160 ARG A O    4  
ATOM 11042 C CB   . ARG A 1 160 ? 15.381  -11.747 4.046   1.00 0.00 ? 160 ARG A CB   4  
ATOM 11043 C CG   . ARG A 1 160 ? 15.804  -10.891 2.863   1.00 0.00 ? 160 ARG A CG   4  
ATOM 11044 C CD   . ARG A 1 160 ? 16.548  -11.697 1.812   1.00 0.00 ? 160 ARG A CD   4  
ATOM 11045 N NE   . ARG A 1 160 ? 17.676  -12.446 2.370   1.00 0.00 ? 160 ARG A NE   4  
ATOM 11046 C CZ   . ARG A 1 160 ? 18.580  -13.088 1.628   1.00 0.00 ? 160 ARG A CZ   4  
ATOM 11047 N NH1  . ARG A 1 160 ? 18.510  -13.050 0.303   1.00 0.00 ? 160 ARG A NH1  4  
ATOM 11048 N NH2  . ARG A 1 160 ? 19.562  -13.760 2.211   1.00 0.00 ? 160 ARG A NH2  4  
ATOM 11049 H H    . ARG A 1 160 ? 13.850  -12.454 5.901   1.00 0.00 ? 160 ARG A H    4  
ATOM 11050 H HA   . ARG A 1 160 ? 13.438  -12.002 3.181   1.00 0.00 ? 160 ARG A HA   4  
ATOM 11051 H HB2  . ARG A 1 160 ? 15.223  -11.094 4.892   1.00 0.00 ? 160 ARG A HB2  4  
ATOM 11052 H HB3  . ARG A 1 160 ? 16.191  -12.425 4.278   1.00 0.00 ? 160 ARG A HB3  4  
ATOM 11053 H HG2  . ARG A 1 160 ? 14.923  -10.462 2.410   1.00 0.00 ? 160 ARG A HG2  4  
ATOM 11054 H HG3  . ARG A 1 160 ? 16.448  -10.100 3.220   1.00 0.00 ? 160 ARG A HG3  4  
ATOM 11055 H HD2  . ARG A 1 160 ? 15.858  -12.393 1.361   1.00 0.00 ? 160 ARG A HD2  4  
ATOM 11056 H HD3  . ARG A 1 160 ? 16.917  -11.020 1.057   1.00 0.00 ? 160 ARG A HD3  4  
ATOM 11057 H HE   . ARG A 1 160 ? 17.754  -12.482 3.360   1.00 0.00 ? 160 ARG A HE   4  
ATOM 11058 H HH11 . ARG A 1 160 ? 17.775  -12.525 -0.155  1.00 0.00 ? 160 ARG A HH11 4  
ATOM 11059 H HH12 . ARG A 1 160 ? 19.174  -13.561 -0.255  1.00 0.00 ? 160 ARG A HH12 4  
ATOM 11060 H HH21 . ARG A 1 160 ? 19.628  -13.792 3.215   1.00 0.00 ? 160 ARG A HH21 4  
ATOM 11061 H HH22 . ARG A 1 160 ? 20.251  -14.242 1.652   1.00 0.00 ? 160 ARG A HH22 4  
ATOM 11062 N N    . LEU A 1 161 ? 15.401  -14.604 3.690   1.00 0.00 ? 161 LEU A N    4  
ATOM 11063 C CA   . LEU A 1 161 ? 15.802  -15.882 3.131   1.00 0.00 ? 161 LEU A CA   4  
ATOM 11064 C C    . LEU A 1 161 ? 14.974  -16.998 3.752   1.00 0.00 ? 161 LEU A C    4  
ATOM 11065 O O    . LEU A 1 161 ? 15.508  -17.998 4.231   1.00 0.00 ? 161 LEU A O    4  
ATOM 11066 C CB   . LEU A 1 161 ? 17.296  -16.128 3.365   1.00 0.00 ? 161 LEU A CB   4  
ATOM 11067 C CG   . LEU A 1 161 ? 17.933  -17.181 2.451   1.00 0.00 ? 161 LEU A CG   4  
ATOM 11068 C CD1  . LEU A 1 161 ? 17.767  -16.794 0.992   1.00 0.00 ? 161 LEU A CD1  4  
ATOM 11069 C CD2  . LEU A 1 161 ? 19.406  -17.360 2.783   1.00 0.00 ? 161 LEU A CD2  4  
ATOM 11070 H H    . LEU A 1 161 ? 15.851  -14.270 4.505   1.00 0.00 ? 161 LEU A H    4  
ATOM 11071 H HA   . LEU A 1 161 ? 15.611  -15.857 2.068   1.00 0.00 ? 161 LEU A HA   4  
ATOM 11072 H HB2  . LEU A 1 161 ? 17.819  -15.193 3.223   1.00 0.00 ? 161 LEU A HB2  4  
ATOM 11073 H HB3  . LEU A 1 161 ? 17.432  -16.444 4.389   1.00 0.00 ? 161 LEU A HB3  4  
ATOM 11074 H HG   . LEU A 1 161 ? 17.437  -18.129 2.604   1.00 0.00 ? 161 LEU A HG   4  
ATOM 11075 H HD11 . LEU A 1 161 ? 18.203  -15.819 0.828   1.00 0.00 ? 161 LEU A HD11 4  
ATOM 11076 H HD12 . LEU A 1 161 ? 16.718  -16.768 0.744   1.00 0.00 ? 161 LEU A HD12 4  
ATOM 11077 H HD13 . LEU A 1 161 ? 18.268  -17.521 0.369   1.00 0.00 ? 161 LEU A HD13 4  
ATOM 11078 H HD21 . LEU A 1 161 ? 19.924  -16.424 2.636   1.00 0.00 ? 161 LEU A HD21 4  
ATOM 11079 H HD22 . LEU A 1 161 ? 19.833  -18.114 2.137   1.00 0.00 ? 161 LEU A HD22 4  
ATOM 11080 H HD23 . LEU A 1 161 ? 19.508  -17.668 3.813   1.00 0.00 ? 161 LEU A HD23 4  
ATOM 11081 N N    . ARG A 1 162 ? 13.664  -16.808 3.764   1.00 0.00 ? 162 ARG A N    4  
ATOM 11082 C CA   . ARG A 1 162 ? 12.760  -17.793 4.326   1.00 0.00 ? 162 ARG A CA   4  
ATOM 11083 C C    . ARG A 1 162 ? 11.854  -18.347 3.238   1.00 0.00 ? 162 ARG A C    4  
ATOM 11084 O O    . ARG A 1 162 ? 10.992  -17.645 2.704   1.00 0.00 ? 162 ARG A O    4  
ATOM 11085 C CB   . ARG A 1 162 ? 11.934  -17.186 5.460   1.00 0.00 ? 162 ARG A CB   4  
ATOM 11086 C CG   . ARG A 1 162 ? 11.867  -18.074 6.693   1.00 0.00 ? 162 ARG A CG   4  
ATOM 11087 C CD   . ARG A 1 162 ? 13.253  -18.365 7.257   1.00 0.00 ? 162 ARG A CD   4  
ATOM 11088 N NE   . ARG A 1 162 ? 13.656  -17.387 8.269   1.00 0.00 ? 162 ARG A NE   4  
ATOM 11089 C CZ   . ARG A 1 162 ? 14.573  -16.437 8.072   1.00 0.00 ? 162 ARG A CZ   4  
ATOM 11090 N NH1  . ARG A 1 162 ? 15.191  -16.342 6.902   1.00 0.00 ? 162 ARG A NH1  4  
ATOM 11091 N NH2  . ARG A 1 162 ? 14.875  -15.591 9.051   1.00 0.00 ? 162 ARG A NH2  4  
ATOM 11092 H H    . ARG A 1 162 ? 13.295  -15.985 3.372   1.00 0.00 ? 162 ARG A H    4  
ATOM 11093 H HA   . ARG A 1 162 ? 13.358  -18.601 4.721   1.00 0.00 ? 162 ARG A HA   4  
ATOM 11094 H HB2  . ARG A 1 162 ? 12.369  -16.239 5.745   1.00 0.00 ? 162 ARG A HB2  4  
ATOM 11095 H HB3  . ARG A 1 162 ? 10.926  -17.019 5.110   1.00 0.00 ? 162 ARG A HB3  4  
ATOM 11096 H HG2  . ARG A 1 162 ? 11.279  -17.578 7.450   1.00 0.00 ? 162 ARG A HG2  4  
ATOM 11097 H HG3  . ARG A 1 162 ? 11.396  -19.008 6.423   1.00 0.00 ? 162 ARG A HG3  4  
ATOM 11098 H HD2  . ARG A 1 162 ? 13.247  -19.348 7.706   1.00 0.00 ? 162 ARG A HD2  4  
ATOM 11099 H HD3  . ARG A 1 162 ? 13.967  -18.345 6.448   1.00 0.00 ? 162 ARG A HD3  4  
ATOM 11100 H HE   . ARG A 1 162 ? 13.214  -17.446 9.150   1.00 0.00 ? 162 ARG A HE   4  
ATOM 11101 H HH11 . ARG A 1 162 ? 14.975  -16.983 6.164   1.00 0.00 ? 162 ARG A HH11 4  
ATOM 11102 H HH12 . ARG A 1 162 ? 15.883  -15.616 6.747   1.00 0.00 ? 162 ARG A HH12 4  
ATOM 11103 H HH21 . ARG A 1 162 ? 14.414  -15.663 9.947   1.00 0.00 ? 162 ARG A HH21 4  
ATOM 11104 H HH22 . ARG A 1 162 ? 15.562  -14.868 8.903   1.00 0.00 ? 162 ARG A HH22 4  
ATOM 11105 N N    . GLU A 1 163 ? 12.068  -19.605 2.906   1.00 0.00 ? 163 GLU A N    4  
ATOM 11106 C CA   . GLU A 1 163 ? 11.296  -20.267 1.873   1.00 0.00 ? 163 GLU A CA   4  
ATOM 11107 C C    . GLU A 1 163 ? 10.342  -21.285 2.481   1.00 0.00 ? 163 GLU A C    4  
ATOM 11108 O O    . GLU A 1 163 ? 10.542  -21.753 3.606   1.00 0.00 ? 163 GLU A O    4  
ATOM 11109 C CB   . GLU A 1 163 ? 12.232  -20.943 0.869   1.00 0.00 ? 163 GLU A CB   4  
ATOM 11110 C CG   . GLU A 1 163 ? 12.033  -20.459 -0.556  1.00 0.00 ? 163 GLU A CG   4  
ATOM 11111 C CD   . GLU A 1 163 ? 10.776  -21.013 -1.191  1.00 0.00 ? 163 GLU A CD   4  
ATOM 11112 O OE1  . GLU A 1 163 ? 9.667   -20.649 -0.753  1.00 0.00 ? 163 GLU A OE1  4  
ATOM 11113 O OE2  . GLU A 1 163 ? 10.894  -21.827 -2.129  1.00 0.00 ? 163 GLU A OE2  4  
ATOM 11114 H H    . GLU A 1 163 ? 12.762  -20.114 3.385   1.00 0.00 ? 163 GLU A H    4  
ATOM 11115 H HA   . GLU A 1 163 ? 10.717  -19.515 1.358   1.00 0.00 ? 163 GLU A HA   4  
ATOM 11116 H HB2  . GLU A 1 163 ? 13.254  -20.742 1.154   1.00 0.00 ? 163 GLU A HB2  4  
ATOM 11117 H HB3  . GLU A 1 163 ? 12.061  -22.011 0.893   1.00 0.00 ? 163 GLU A HB3  4  
ATOM 11118 H HG2  . GLU A 1 163 ? 11.969  -19.381 -0.551  1.00 0.00 ? 163 GLU A HG2  4  
ATOM 11119 H HG3  . GLU A 1 163 ? 12.884  -20.764 -1.149  1.00 0.00 ? 163 GLU A HG3  4  
ATOM 11120 N N    . GLY A 1 164 ? 9.308   -21.621 1.732   1.00 0.00 ? 164 GLY A N    4  
ATOM 11121 C CA   . GLY A 1 164 ? 8.321   -22.569 2.193   1.00 0.00 ? 164 GLY A CA   4  
ATOM 11122 C C    . GLY A 1 164 ? 6.932   -22.175 1.751   1.00 0.00 ? 164 GLY A C    4  
ATOM 11123 O O    . GLY A 1 164 ? 6.179   -22.994 1.226   1.00 0.00 ? 164 GLY A O    4  
ATOM 11124 H H    . GLY A 1 164 ? 9.216   -21.218 0.833   1.00 0.00 ? 164 GLY A H    4  
ATOM 11125 H HA2  . GLY A 1 164 ? 8.557   -23.547 1.796   1.00 0.00 ? 164 GLY A HA2  4  
ATOM 11126 H HA3  . GLY A 1 164 ? 8.347   -22.609 3.272   1.00 0.00 ? 164 GLY A HA3  4  
ATOM 11127 N N    . ASN A 1 165 ? 6.600   -20.909 1.955   1.00 0.00 ? 165 ASN A N    4  
ATOM 11128 C CA   . ASN A 1 165 ? 5.299   -20.382 1.571   1.00 0.00 ? 165 ASN A CA   4  
ATOM 11129 C C    . ASN A 1 165 ? 5.407   -18.891 1.277   1.00 0.00 ? 165 ASN A C    4  
ATOM 11130 O O    . ASN A 1 165 ? 5.814   -18.109 2.138   1.00 0.00 ? 165 ASN A O    4  
ATOM 11131 C CB   . ASN A 1 165 ? 4.276   -20.631 2.678   1.00 0.00 ? 165 ASN A CB   4  
ATOM 11132 C CG   . ASN A 1 165 ? 2.861   -20.725 2.142   1.00 0.00 ? 165 ASN A CG   4  
ATOM 11133 O OD1  . ASN A 1 165 ? 2.134   -19.734 2.093   1.00 0.00 ? 165 ASN A OD1  4  
ATOM 11134 N ND2  . ASN A 1 165 ? 2.454   -21.920 1.744   1.00 0.00 ? 165 ASN A ND2  4  
ATOM 11135 H H    . ASN A 1 165 ? 7.252   -20.306 2.378   1.00 0.00 ? 165 ASN A H    4  
ATOM 11136 H HA   . ASN A 1 165 ? 4.982   -20.895 0.673   1.00 0.00 ? 165 ASN A HA   4  
ATOM 11137 H HB2  . ASN A 1 165 ? 4.515   -21.557 3.179   1.00 0.00 ? 165 ASN A HB2  4  
ATOM 11138 H HB3  . ASN A 1 165 ? 4.318   -19.820 3.388   1.00 0.00 ? 165 ASN A HB3  4  
ATOM 11139 H HD21 . ASN A 1 165 ? 3.081   -22.676 1.816   1.00 0.00 ? 165 ASN A HD21 4  
ATOM 11140 H HD22 . ASN A 1 165 ? 1.541   -22.006 1.387   1.00 0.00 ? 165 ASN A HD22 4  
ATOM 11141 N N    . TRP A 1 166 ? 5.052   -18.507 0.059   1.00 0.00 ? 166 TRP A N    4  
ATOM 11142 C CA   . TRP A 1 166 ? 5.127   -17.113 -0.360  1.00 0.00 ? 166 TRP A CA   4  
ATOM 11143 C C    . TRP A 1 166 ? 3.750   -16.535 -0.658  1.00 0.00 ? 166 TRP A C    4  
ATOM 11144 O O    . TRP A 1 166 ? 3.495   -15.359 -0.406  1.00 0.00 ? 166 TRP A O    4  
ATOM 11145 C CB   . TRP A 1 166 ? 6.014   -16.983 -1.601  1.00 0.00 ? 166 TRP A CB   4  
ATOM 11146 C CG   . TRP A 1 166 ? 7.466   -16.808 -1.284  1.00 0.00 ? 166 TRP A CG   4  
ATOM 11147 C CD1  . TRP A 1 166 ? 8.304   -17.735 -0.738  1.00 0.00 ? 166 TRP A CD1  4  
ATOM 11148 C CD2  . TRP A 1 166 ? 8.252   -15.630 -1.499  1.00 0.00 ? 166 TRP A CD2  4  
ATOM 11149 N NE1  . TRP A 1 166 ? 9.562   -17.207 -0.598  1.00 0.00 ? 166 TRP A NE1  4  
ATOM 11150 C CE2  . TRP A 1 166 ? 9.557   -15.916 -1.057  1.00 0.00 ? 166 TRP A CE2  4  
ATOM 11151 C CE3  . TRP A 1 166 ? 7.979   -14.361 -2.021  1.00 0.00 ? 166 TRP A CE3  4  
ATOM 11152 C CZ2  . TRP A 1 166 ? 10.587  -14.980 -1.125  1.00 0.00 ? 166 TRP A CZ2  4  
ATOM 11153 C CZ3  . TRP A 1 166 ? 9.002   -13.434 -2.085  1.00 0.00 ? 166 TRP A CZ3  4  
ATOM 11154 C CH2  . TRP A 1 166 ? 10.291  -13.747 -1.636  1.00 0.00 ? 166 TRP A CH2  4  
ATOM 11155 H H    . TRP A 1 166 ? 4.725   -19.186 -0.580  1.00 0.00 ? 166 TRP A H    4  
ATOM 11156 H HA   . TRP A 1 166 ? 5.572   -16.549 0.445   1.00 0.00 ? 166 TRP A HA   4  
ATOM 11157 H HB2  . TRP A 1 166 ? 5.912   -17.874 -2.202  1.00 0.00 ? 166 TRP A HB2  4  
ATOM 11158 H HB3  . TRP A 1 166 ? 5.691   -16.129 -2.178  1.00 0.00 ? 166 TRP A HB3  4  
ATOM 11159 H HD1  . TRP A 1 166 ? 8.007   -18.734 -0.458  1.00 0.00 ? 166 TRP A HD1  4  
ATOM 11160 H HE1  . TRP A 1 166 ? 10.341  -17.680 -0.231  1.00 0.00 ? 166 TRP A HE1  4  
ATOM 11161 H HE3  . TRP A 1 166 ? 6.991   -14.102 -2.371  1.00 0.00 ? 166 TRP A HE3  4  
ATOM 11162 H HZ2  . TRP A 1 166 ? 11.587  -15.206 -0.782  1.00 0.00 ? 166 TRP A HZ2  4  
ATOM 11163 H HZ3  . TRP A 1 166 ? 8.809   -12.448 -2.482  1.00 0.00 ? 166 TRP A HZ3  4  
ATOM 11164 H HH2  . TRP A 1 166 ? 11.059  -12.990 -1.704  1.00 0.00 ? 166 TRP A HH2  4  
ATOM 11165 N N    . ALA A 1 167 ? 2.857   -17.363 -1.173  1.00 0.00 ? 167 ALA A N    4  
ATOM 11166 C CA   . ALA A 1 167 ? 1.520   -16.909 -1.519  1.00 0.00 ? 167 ALA A CA   4  
ATOM 11167 C C    . ALA A 1 167 ? 0.453   -17.570 -0.649  1.00 0.00 ? 167 ALA A C    4  
ATOM 11168 O O    . ALA A 1 167 ? -0.264  -16.889 0.087   1.00 0.00 ? 167 ALA A O    4  
ATOM 11169 C CB   . ALA A 1 167 ? 1.243   -17.176 -2.993  1.00 0.00 ? 167 ALA A CB   4  
ATOM 11170 H H    . ALA A 1 167 ? 3.100   -18.312 -1.315  1.00 0.00 ? 167 ALA A H    4  
ATOM 11171 H HA   . ALA A 1 167 ? 1.483   -15.840 -1.363  1.00 0.00 ? 167 ALA A HA   4  
ATOM 11172 H HB1  . ALA A 1 167 ? 1.997   -16.690 -3.594  1.00 0.00 ? 167 ALA A HB1  4  
ATOM 11173 H HB2  . ALA A 1 167 ? 0.269   -16.788 -3.253  1.00 0.00 ? 167 ALA A HB2  4  
ATOM 11174 H HB3  . ALA A 1 167 ? 1.269   -18.240 -3.175  1.00 0.00 ? 167 ALA A HB3  4  
ATOM 11175 N N    . SER A 1 168 ? 0.358   -18.892 -0.744  1.00 0.00 ? 168 SER A N    4  
ATOM 11176 C CA   . SER A 1 168 ? -0.628  -19.663 0.012   1.00 0.00 ? 168 SER A CA   4  
ATOM 11177 C C    . SER A 1 168 ? -0.387  -21.152 -0.197  1.00 0.00 ? 168 SER A C    4  
ATOM 11178 O O    . SER A 1 168 ? -0.066  -21.884 0.737   1.00 0.00 ? 168 SER A O    4  
ATOM 11179 C CB   . SER A 1 168 ? -2.046  -19.293 -0.439  1.00 0.00 ? 168 SER A CB   4  
ATOM 11180 O OG   . SER A 1 168 ? -2.084  -19.067 -1.842  1.00 0.00 ? 168 SER A OG   4  
ATOM 11181 H H    . SER A 1 168 ? 0.982   -19.367 -1.330  1.00 0.00 ? 168 SER A H    4  
ATOM 11182 H HA   . SER A 1 168 ? -0.512  -19.427 1.060   1.00 0.00 ? 168 SER A HA   4  
ATOM 11183 H HB2  . SER A 1 168 ? -2.725  -20.096 -0.197  1.00 0.00 ? 168 SER A HB2  4  
ATOM 11184 H HB3  . SER A 1 168 ? -2.359  -18.392 0.067   1.00 0.00 ? 168 SER A HB3  4  
ATOM 11185 H HG   . SER A 1 168 ? -2.890  -19.469 -2.214  1.00 0.00 ? 168 SER A HG   4  
ATOM 11186 N N    . VAL A 1 169 ? -0.537  -21.587 -1.439  1.00 0.00 ? 169 VAL A N    4  
ATOM 11187 C CA   . VAL A 1 169 ? -0.319  -22.982 -1.800  1.00 0.00 ? 169 VAL A CA   4  
ATOM 11188 C C    . VAL A 1 169 ? 1.138   -23.199 -2.183  1.00 0.00 ? 169 VAL A C    4  
ATOM 11189 O O    . VAL A 1 169 ? 1.570   -24.320 -2.449  1.00 0.00 ? 169 VAL A O    4  
ATOM 11190 C CB   . VAL A 1 169 ? -1.229  -23.407 -2.969  1.00 0.00 ? 169 VAL A CB   4  
ATOM 11191 C CG1  . VAL A 1 169 ? -2.681  -23.458 -2.520  1.00 0.00 ? 169 VAL A CG1  4  
ATOM 11192 C CG2  . VAL A 1 169 ? -1.064  -22.463 -4.153  1.00 0.00 ? 169 VAL A CG2  4  
ATOM 11193 H H    . VAL A 1 169 ? -0.816  -20.952 -2.134  1.00 0.00 ? 169 VAL A H    4  
ATOM 11194 H HA   . VAL A 1 169 ? -0.554  -23.594 -0.941  1.00 0.00 ? 169 VAL A HA   4  
ATOM 11195 H HB   . VAL A 1 169 ? -0.939  -24.399 -3.283  1.00 0.00 ? 169 VAL A HB   4  
ATOM 11196 H HG11 . VAL A 1 169 ? -2.989  -22.477 -2.187  1.00 0.00 ? 169 VAL A HG11 4  
ATOM 11197 H HG12 . VAL A 1 169 ? -2.783  -24.161 -1.706  1.00 0.00 ? 169 VAL A HG12 4  
ATOM 11198 H HG13 . VAL A 1 169 ? -3.304  -23.770 -3.345  1.00 0.00 ? 169 VAL A HG13 4  
ATOM 11199 H HG21 . VAL A 1 169 ? -1.336  -21.461 -3.856  1.00 0.00 ? 169 VAL A HG21 4  
ATOM 11200 H HG22 . VAL A 1 169 ? -1.703  -22.787 -4.961  1.00 0.00 ? 169 VAL A HG22 4  
ATOM 11201 H HG23 . VAL A 1 169 ? -0.033  -22.474 -4.481  1.00 0.00 ? 169 VAL A HG23 4  
ATOM 11202 N N    . ARG A 1 170 ? 1.881   -22.106 -2.198  1.00 0.00 ? 170 ARG A N    4  
ATOM 11203 C CA   . ARG A 1 170 ? 3.289   -22.113 -2.537  1.00 0.00 ? 170 ARG A CA   4  
ATOM 11204 C C    . ARG A 1 170 ? 3.954   -20.955 -1.814  1.00 0.00 ? 170 ARG A C    4  
ATOM 11205 O O    . ARG A 1 170 ? 5.165   -21.033 -1.527  1.00 0.00 ? 170 ARG A O    4  
ATOM 11206 C CB   . ARG A 1 170 ? 3.480   -21.979 -4.053  1.00 0.00 ? 170 ARG A CB   4  
ATOM 11207 C CG   . ARG A 1 170 ? 4.926   -22.109 -4.511  1.00 0.00 ? 170 ARG A CG   4  
ATOM 11208 C CD   . ARG A 1 170 ? 5.635   -20.763 -4.539  1.00 0.00 ? 170 ARG A CD   4  
ATOM 11209 N NE   . ARG A 1 170 ? 7.068   -20.906 -4.786  1.00 0.00 ? 170 ARG A NE   4  
ATOM 11210 C CZ   . ARG A 1 170 ? 7.995   -20.933 -3.826  1.00 0.00 ? 170 ARG A CZ   4  
ATOM 11211 N NH1  . ARG A 1 170 ? 7.654   -20.830 -2.545  1.00 0.00 ? 170 ARG A NH1  4  
ATOM 11212 N NH2  . ARG A 1 170 ? 9.273   -21.069 -4.146  1.00 0.00 ? 170 ARG A NH2  4  
ATOM 11213 H H    . ARG A 1 170 ? 1.471   -21.254 -1.949  1.00 0.00 ? 170 ARG A H    4  
ATOM 11214 H HA   . ARG A 1 170 ? 3.717   -23.046 -2.197  1.00 0.00 ? 170 ARG A HA   4  
ATOM 11215 H HB2  . ARG A 1 170 ? 2.902   -22.748 -4.543  1.00 0.00 ? 170 ARG A HB2  4  
ATOM 11216 H HB3  . ARG A 1 170 ? 3.112   -21.013 -4.364  1.00 0.00 ? 170 ARG A HB3  4  
ATOM 11217 H HG2  . ARG A 1 170 ? 5.450   -22.765 -3.831  1.00 0.00 ? 170 ARG A HG2  4  
ATOM 11218 H HG3  . ARG A 1 170 ? 4.939   -22.534 -5.503  1.00 0.00 ? 170 ARG A HG3  4  
ATOM 11219 H HD2  . ARG A 1 170 ? 5.202   -20.159 -5.323  1.00 0.00 ? 170 ARG A HD2  4  
ATOM 11220 H HD3  . ARG A 1 170 ? 5.491   -20.273 -3.587  1.00 0.00 ? 170 ARG A HD3  4  
ATOM 11221 H HE   . ARG A 1 170 ? 7.355   -20.988 -5.728  1.00 0.00 ? 170 ARG A HE   4  
ATOM 11222 H HH11 . ARG A 1 170 ? 6.686   -20.730 -2.280  1.00 0.00 ? 170 ARG A HH11 4  
ATOM 11223 H HH12 . ARG A 1 170 ? 8.372   -20.841 -1.828  1.00 0.00 ? 170 ARG A HH12 4  
ATOM 11224 H HH21 . ARG A 1 170 ? 9.549   -21.134 -5.109  1.00 0.00 ? 170 ARG A HH21 4  
ATOM 11225 H HH22 . ARG A 1 170 ? 9.973   -21.127 -3.419  1.00 0.00 ? 170 ARG A HH22 4  
ATOM 11226 N N    . ILE B 2 1   ? -14.231 -11.728 8.162   1.00 0.00 ? 201 ILE B N    4  
ATOM 11227 C CA   . ILE B 2 1   ? -14.388 -12.631 7.000   1.00 0.00 ? 201 ILE B CA   4  
ATOM 11228 C C    . ILE B 2 1   ? -13.319 -13.712 7.008   1.00 0.00 ? 201 ILE B C    4  
ATOM 11229 O O    . ILE B 2 1   ? -12.695 -13.970 8.035   1.00 0.00 ? 201 ILE B O    4  
ATOM 11230 C CB   . ILE B 2 1   ? -14.330 -11.867 5.655   1.00 0.00 ? 201 ILE B CB   4  
ATOM 11231 C CG1  . ILE B 2 1   ? -13.261 -10.772 5.691   1.00 0.00 ? 201 ILE B CG1  4  
ATOM 11232 C CG2  . ILE B 2 1   ? -15.691 -11.278 5.319   1.00 0.00 ? 201 ILE B CG2  4  
ATOM 11233 C CD1  . ILE B 2 1   ? -12.998 -10.141 4.340   1.00 0.00 ? 201 ILE B CD1  4  
ATOM 11234 H H1   . ILE B 2 1   ? -13.247 -11.382 8.224   1.00 0.00 ? 201 ILE B H1   4  
ATOM 11235 H H2   . ILE B 2 1   ? -14.460 -12.241 9.042   1.00 0.00 ? 201 ILE B H2   4  
ATOM 11236 H H3   . ILE B 2 1   ? -14.873 -10.909 8.078   1.00 0.00 ? 201 ILE B H3   4  
ATOM 11237 H HA   . ILE B 2 1   ? -15.357 -13.105 7.076   1.00 0.00 ? 201 ILE B HA   4  
ATOM 11238 H HB   . ILE B 2 1   ? -14.077 -12.578 4.881   1.00 0.00 ? 201 ILE B HB   4  
ATOM 11239 H HG12 . ILE B 2 1   ? -13.581 -9.991  6.363   1.00 0.00 ? 201 ILE B HG12 4  
ATOM 11240 H HG13 . ILE B 2 1   ? -12.333 -11.191 6.048   1.00 0.00 ? 201 ILE B HG13 4  
ATOM 11241 H HG21 . ILE B 2 1   ? -15.626 -10.730 4.390   1.00 0.00 ? 201 ILE B HG21 4  
ATOM 11242 H HG22 . ILE B 2 1   ? -15.997 -10.608 6.109   1.00 0.00 ? 201 ILE B HG22 4  
ATOM 11243 H HG23 . ILE B 2 1   ? -16.414 -12.072 5.219   1.00 0.00 ? 201 ILE B HG23 4  
ATOM 11244 H HD11 . ILE B 2 1   ? -12.272 -9.349  4.446   1.00 0.00 ? 201 ILE B HD11 4  
ATOM 11245 H HD12 . ILE B 2 1   ? -13.920 -9.734  3.948   1.00 0.00 ? 201 ILE B HD12 4  
ATOM 11246 H HD13 . ILE B 2 1   ? -12.618 -10.889 3.661   1.00 0.00 ? 201 ILE B HD13 4  
ATOM 11247 N N    . ILE B 2 2   ? -13.119 -14.345 5.856   1.00 0.00 ? 202 ILE B N    4  
ATOM 11248 C CA   . ILE B 2 2   ? -12.127 -15.405 5.718   1.00 0.00 ? 202 ILE B CA   4  
ATOM 11249 C C    . ILE B 2 2   ? -10.715 -14.836 5.823   1.00 0.00 ? 202 ILE B C    4  
ATOM 11250 O O    . ILE B 2 2   ? -10.229 -14.173 4.905   1.00 0.00 ? 202 ILE B O    4  
ATOM 11251 C CB   . ILE B 2 2   ? -12.284 -16.151 4.375   1.00 0.00 ? 202 ILE B CB   4  
ATOM 11252 C CG1  . ILE B 2 2   ? -13.746 -16.550 4.156   1.00 0.00 ? 202 ILE B CG1  4  
ATOM 11253 C CG2  . ILE B 2 2   ? -11.387 -17.382 4.336   1.00 0.00 ? 202 ILE B CG2  4  
ATOM 11254 C CD1  . ILE B 2 2   ? -14.062 -16.937 2.728   1.00 0.00 ? 202 ILE B CD1  4  
ATOM 11255 H H    . ILE B 2 2   ? -13.650 -14.090 5.075   1.00 0.00 ? 202 ILE B H    4  
ATOM 11256 H HA   . ILE B 2 2   ? -12.282 -16.112 6.521   1.00 0.00 ? 202 ILE B HA   4  
ATOM 11257 H HB   . ILE B 2 2   ? -11.979 -15.487 3.580   1.00 0.00 ? 202 ILE B HB   4  
ATOM 11258 H HG12 . ILE B 2 2   ? -13.981 -17.395 4.786   1.00 0.00 ? 202 ILE B HG12 4  
ATOM 11259 H HG13 . ILE B 2 2   ? -14.382 -15.719 4.424   1.00 0.00 ? 202 ILE B HG13 4  
ATOM 11260 H HG21 . ILE B 2 2   ? -11.525 -17.898 3.398   1.00 0.00 ? 202 ILE B HG21 4  
ATOM 11261 H HG22 . ILE B 2 2   ? -11.645 -18.042 5.150   1.00 0.00 ? 202 ILE B HG22 4  
ATOM 11262 H HG23 . ILE B 2 2   ? -10.354 -17.078 4.432   1.00 0.00 ? 202 ILE B HG23 4  
ATOM 11263 H HD11 . ILE B 2 2   ? -13.857 -16.103 2.074   1.00 0.00 ? 202 ILE B HD11 4  
ATOM 11264 H HD12 . ILE B 2 2   ? -15.105 -17.208 2.650   1.00 0.00 ? 202 ILE B HD12 4  
ATOM 11265 H HD13 . ILE B 2 2   ? -13.450 -17.780 2.440   1.00 0.00 ? 202 ILE B HD13 4  
ATOM 11266 N N    . LYS B 2 3   ? -10.070 -15.104 6.952   1.00 0.00 ? 203 LYS B N    4  
ATOM 11267 C CA   . LYS B 2 3   ? -8.717  -14.622 7.208   1.00 0.00 ? 203 LYS B CA   4  
ATOM 11268 C C    . LYS B 2 3   ? -7.714  -15.184 6.211   1.00 0.00 ? 203 LYS B C    4  
ATOM 11269 O O    . LYS B 2 3   ? -6.737  -14.519 5.877   1.00 0.00 ? 203 LYS B O    4  
ATOM 11270 C CB   . LYS B 2 3   ? -8.279  -14.965 8.632   1.00 0.00 ? 203 LYS B CB   4  
ATOM 11271 C CG   . LYS B 2 3   ? -8.739  -13.953 9.666   1.00 0.00 ? 203 LYS B CG   4  
ATOM 11272 C CD   . LYS B 2 3   ? -7.939  -14.073 10.951  1.00 0.00 ? 203 LYS B CD   4  
ATOM 11273 C CE   . LYS B 2 3   ? -8.416  -13.086 12.003  1.00 0.00 ? 203 LYS B CE   4  
ATOM 11274 N NZ   . LYS B 2 3   ? -8.179  -11.674 11.598  1.00 0.00 ? 203 LYS B NZ   4  
ATOM 11275 H H    . LYS B 2 3   ? -10.524 -15.643 7.642   1.00 0.00 ? 203 LYS B H    4  
ATOM 11276 H HA   . LYS B 2 3   ? -8.732  -13.547 7.104   1.00 0.00 ? 203 LYS B HA   4  
ATOM 11277 H HB2  . LYS B 2 3   ? -8.682  -15.931 8.899   1.00 0.00 ? 203 LYS B HB2  4  
ATOM 11278 H HB3  . LYS B 2 3   ? -7.200  -15.014 8.663   1.00 0.00 ? 203 LYS B HB3  4  
ATOM 11279 H HG2  . LYS B 2 3   ? -8.611  -12.958 9.265   1.00 0.00 ? 203 LYS B HG2  4  
ATOM 11280 H HG3  . LYS B 2 3   ? -9.783  -14.125 9.884   1.00 0.00 ? 203 LYS B HG3  4  
ATOM 11281 H HD2  . LYS B 2 3   ? -8.046  -15.075 11.339  1.00 0.00 ? 203 LYS B HD2  4  
ATOM 11282 H HD3  . LYS B 2 3   ? -6.898  -13.878 10.734  1.00 0.00 ? 203 LYS B HD3  4  
ATOM 11283 H HE2  . LYS B 2 3   ? -9.475  -13.231 12.162  1.00 0.00 ? 203 LYS B HE2  4  
ATOM 11284 H HE3  . LYS B 2 3   ? -7.887  -13.279 12.924  1.00 0.00 ? 203 LYS B HE3  4  
ATOM 11285 H HZ1  . LYS B 2 3   ? -8.326  -11.040 12.414  1.00 0.00 ? 203 LYS B HZ1  4  
ATOM 11286 H HZ2  . LYS B 2 3   ? -8.843  -11.398 10.840  1.00 0.00 ? 203 LYS B HZ2  4  
ATOM 11287 H HZ3  . LYS B 2 3   ? -7.201  -11.558 11.254  1.00 0.00 ? 203 LYS B HZ3  4  
ATOM 11288 N N    . ASN B 2 4   ? -7.949  -16.412 5.755   1.00 0.00 ? 204 ASN B N    4  
ATOM 11289 C CA   . ASN B 2 4   ? -7.058  -17.065 4.796   1.00 0.00 ? 204 ASN B CA   4  
ATOM 11290 C C    . ASN B 2 4   ? -6.781  -16.170 3.589   1.00 0.00 ? 204 ASN B C    4  
ATOM 11291 O O    . ASN B 2 4   ? -5.642  -16.067 3.133   1.00 0.00 ? 204 ASN B O    4  
ATOM 11292 C CB   . ASN B 2 4   ? -7.657  -18.387 4.324   1.00 0.00 ? 204 ASN B CB   4  
ATOM 11293 C CG   . ASN B 2 4   ? -6.633  -19.257 3.626   1.00 0.00 ? 204 ASN B CG   4  
ATOM 11294 O OD1  . ASN B 2 4   ? -5.456  -19.258 3.985   1.00 0.00 ? 204 ASN B OD1  4  
ATOM 11295 N ND2  . ASN B 2 4   ? -7.069  -19.996 2.623   1.00 0.00 ? 204 ASN B ND2  4  
ATOM 11296 H H    . ASN B 2 4   ? -8.741  -16.895 6.078   1.00 0.00 ? 204 ASN B H    4  
ATOM 11297 H HA   . ASN B 2 4   ? -6.123  -17.265 5.298   1.00 0.00 ? 204 ASN B HA   4  
ATOM 11298 H HB2  . ASN B 2 4   ? -8.041  -18.926 5.177   1.00 0.00 ? 204 ASN B HB2  4  
ATOM 11299 H HB3  . ASN B 2 4   ? -8.464  -18.186 3.634   1.00 0.00 ? 204 ASN B HB3  4  
ATOM 11300 H HD21 . ASN B 2 4   ? -8.024  -19.944 2.382   1.00 0.00 ? 204 ASN B HD21 4  
ATOM 11301 H HD22 . ASN B 2 4   ? -6.422  -20.573 2.161   1.00 0.00 ? 204 ASN B HD22 4  
ATOM 11302 N N    . ILE B 2 5   ? -7.822  -15.514 3.082   1.00 0.00 ? 205 ILE B N    4  
ATOM 11303 C CA   . ILE B 2 5   ? -7.677  -14.630 1.931   1.00 0.00 ? 205 ILE B CA   4  
ATOM 11304 C C    . ILE B 2 5   ? -6.863  -13.397 2.309   1.00 0.00 ? 205 ILE B C    4  
ATOM 11305 O O    . ILE B 2 5   ? -5.981  -12.969 1.563   1.00 0.00 ? 205 ILE B O    4  
ATOM 11306 C CB   . ILE B 2 5   ? -9.047  -14.185 1.370   1.00 0.00 ? 205 ILE B CB   4  
ATOM 11307 C CG1  . ILE B 2 5   ? -9.988  -15.385 1.240   1.00 0.00 ? 205 ILE B CG1  4  
ATOM 11308 C CG2  . ILE B 2 5   ? -8.867  -13.504 0.020   1.00 0.00 ? 205 ILE B CG2  4  
ATOM 11309 C CD1  . ILE B 2 5   ? -11.411 -15.009 0.879   1.00 0.00 ? 205 ILE B CD1  4  
ATOM 11310 H H    . ILE B 2 5   ? -8.702  -15.623 3.496   1.00 0.00 ? 205 ILE B H    4  
ATOM 11311 H HA   . ILE B 2 5   ? -7.153  -15.173 1.158   1.00 0.00 ? 205 ILE B HA   4  
ATOM 11312 H HB   . ILE B 2 5   ? -9.478  -13.469 2.054   1.00 0.00 ? 205 ILE B HB   4  
ATOM 11313 H HG12 . ILE B 2 5   ? -9.616  -16.041 0.470   1.00 0.00 ? 205 ILE B HG12 4  
ATOM 11314 H HG13 . ILE B 2 5   ? -10.013 -15.918 2.181   1.00 0.00 ? 205 ILE B HG13 4  
ATOM 11315 H HG21 . ILE B 2 5   ? -9.827  -13.184 -0.354  1.00 0.00 ? 205 ILE B HG21 4  
ATOM 11316 H HG22 . ILE B 2 5   ? -8.424  -14.199 -0.677  1.00 0.00 ? 205 ILE B HG22 4  
ATOM 11317 H HG23 . ILE B 2 5   ? -8.218  -12.647 0.131   1.00 0.00 ? 205 ILE B HG23 4  
ATOM 11318 H HD11 . ILE B 2 5   ? -11.407 -14.409 -0.018  1.00 0.00 ? 205 ILE B HD11 4  
ATOM 11319 H HD12 . ILE B 2 5   ? -11.851 -14.445 1.688   1.00 0.00 ? 205 ILE B HD12 4  
ATOM 11320 H HD13 . ILE B 2 5   ? -11.988 -15.905 0.710   1.00 0.00 ? 205 ILE B HD13 4  
ATOM 11321 N N    . ALA B 2 6   ? -7.152  -12.848 3.483   1.00 0.00 ? 206 ALA B N    4  
ATOM 11322 C CA   . ALA B 2 6   ? -6.451  -11.670 3.980   1.00 0.00 ? 206 ALA B CA   4  
ATOM 11323 C C    . ALA B 2 6   ? -4.963  -11.964 4.148   1.00 0.00 ? 206 ALA B C    4  
ATOM 11324 O O    . ALA B 2 6   ? -4.108  -11.183 3.734   1.00 0.00 ? 206 ALA B O    4  
ATOM 11325 C CB   . ALA B 2 6   ? -7.057  -11.221 5.299   1.00 0.00 ? 206 ALA B CB   4  
ATOM 11326 H H    . ALA B 2 6   ? -7.857  -13.247 4.035   1.00 0.00 ? 206 ALA B H    4  
ATOM 11327 H HA   . ALA B 2 6   ? -6.576  -10.876 3.259   1.00 0.00 ? 206 ALA B HA   4  
ATOM 11328 H HB1  . ALA B 2 6   ? -6.876  -11.972 6.052   1.00 0.00 ? 206 ALA B HB1  4  
ATOM 11329 H HB2  . ALA B 2 6   ? -8.123  -11.083 5.177   1.00 0.00 ? 206 ALA B HB2  4  
ATOM 11330 H HB3  . ALA B 2 6   ? -6.606  -10.289 5.604   1.00 0.00 ? 206 ALA B HB3  4  
ATOM 11331 N N    . ARG B 2 7   ? -4.670  -13.109 4.749   1.00 0.00 ? 207 ARG B N    4  
ATOM 11332 C CA   . ARG B 2 7   ? -3.298  -13.541 4.969   1.00 0.00 ? 207 ARG B CA   4  
ATOM 11333 C C    . ARG B 2 7   ? -2.612  -13.783 3.631   1.00 0.00 ? 207 ARG B C    4  
ATOM 11334 O O    . ARG B 2 7   ? -1.428  -13.501 3.465   1.00 0.00 ? 207 ARG B O    4  
ATOM 11335 C CB   . ARG B 2 7   ? -3.284  -14.817 5.815   1.00 0.00 ? 207 ARG B CB   4  
ATOM 11336 C CG   . ARG B 2 7   ? -1.893  -15.352 6.104   1.00 0.00 ? 207 ARG B CG   4  
ATOM 11337 C CD   . ARG B 2 7   ? -1.953  -16.729 6.742   1.00 0.00 ? 207 ARG B CD   4  
ATOM 11338 N NE   . ARG B 2 7   ? -2.671  -17.690 5.903   1.00 0.00 ? 207 ARG B NE   4  
ATOM 11339 C CZ   . ARG B 2 7   ? -2.074  -18.626 5.166   1.00 0.00 ? 207 ARG B CZ   4  
ATOM 11340 N NH1  . ARG B 2 7   ? -0.749  -18.732 5.163   1.00 0.00 ? 207 ARG B NH1  4  
ATOM 11341 N NH2  . ARG B 2 7   ? -2.804  -19.455 4.427   1.00 0.00 ? 207 ARG B NH2  4  
ATOM 11342 H H    . ARG B 2 7   ? -5.406  -13.682 5.059   1.00 0.00 ? 207 ARG B H    4  
ATOM 11343 H HA   . ARG B 2 7   ? -2.777  -12.757 5.496   1.00 0.00 ? 207 ARG B HA   4  
ATOM 11344 H HB2  . ARG B 2 7   ? -3.767  -14.614 6.759   1.00 0.00 ? 207 ARG B HB2  4  
ATOM 11345 H HB3  . ARG B 2 7   ? -3.839  -15.586 5.296   1.00 0.00 ? 207 ARG B HB3  4  
ATOM 11346 H HG2  . ARG B 2 7   ? -1.345  -15.421 5.176   1.00 0.00 ? 207 ARG B HG2  4  
ATOM 11347 H HG3  . ARG B 2 7   ? -1.389  -14.672 6.776   1.00 0.00 ? 207 ARG B HG3  4  
ATOM 11348 H HD2  . ARG B 2 7   ? -0.944  -17.084 6.899   1.00 0.00 ? 207 ARG B HD2  4  
ATOM 11349 H HD3  . ARG B 2 7   ? -2.458  -16.647 7.694   1.00 0.00 ? 207 ARG B HD3  4  
ATOM 11350 H HE   . ARG B 2 7   ? -3.652  -17.630 5.890   1.00 0.00 ? 207 ARG B HE   4  
ATOM 11351 H HH11 . ARG B 2 7   ? -0.185  -18.102 5.715   1.00 0.00 ? 207 ARG B HH11 4  
ATOM 11352 H HH12 . ARG B 2 7   ? -0.300  -19.449 4.612   1.00 0.00 ? 207 ARG B HH12 4  
ATOM 11353 H HH21 . ARG B 2 7   ? -3.809  -19.380 4.419   1.00 0.00 ? 207 ARG B HH21 4  
ATOM 11354 H HH22 . ARG B 2 7   ? -2.358  -20.166 3.869   1.00 0.00 ? 207 ARG B HH22 4  
ATOM 11355 N N    . HIS B 2 8   ? -3.388  -14.282 2.677   1.00 0.00 ? 208 HIS B N    4  
ATOM 11356 C CA   . HIS B 2 8   ? -2.893  -14.568 1.336   1.00 0.00 ? 208 HIS B CA   4  
ATOM 11357 C C    . HIS B 2 8   ? -2.299  -13.312 0.693   1.00 0.00 ? 208 HIS B C    4  
ATOM 11358 O O    . HIS B 2 8   ? -1.169  -13.335 0.214   1.00 0.00 ? 208 HIS B O    4  
ATOM 11359 C CB   . HIS B 2 8   ? -4.033  -15.130 0.475   1.00 0.00 ? 208 HIS B CB   4  
ATOM 11360 C CG   . HIS B 2 8   ? -3.657  -15.452 -0.944  1.00 0.00 ? 208 HIS B CG   4  
ATOM 11361 N ND1  . HIS B 2 8   ? -2.386  -15.817 -1.330  1.00 0.00 ? 208 HIS B ND1  4  
ATOM 11362 C CD2  . HIS B 2 8   ? -4.407  -15.471 -2.072  1.00 0.00 ? 208 HIS B CD2  4  
ATOM 11363 C CE1  . HIS B 2 8   ? -2.373  -16.043 -2.631  1.00 0.00 ? 208 HIS B CE1  4  
ATOM 11364 N NE2  . HIS B 2 8   ? -3.585  -15.844 -3.105  1.00 0.00 ? 208 HIS B NE2  4  
ATOM 11365 H H    . HIS B 2 8   ? -4.331  -14.468 2.883   1.00 0.00 ? 208 HIS B H    4  
ATOM 11366 H HA   . HIS B 2 8   ? -2.117  -15.316 1.423   1.00 0.00 ? 208 HIS B HA   4  
ATOM 11367 H HB2  . HIS B 2 8   ? -4.397  -16.039 0.930   1.00 0.00 ? 208 HIS B HB2  4  
ATOM 11368 H HB3  . HIS B 2 8   ? -4.836  -14.408 0.449   1.00 0.00 ? 208 HIS B HB3  4  
ATOM 11369 H HD1  . HIS B 2 8   ? -1.605  -15.908 -0.735  1.00 0.00 ? 208 HIS B HD1  4  
ATOM 11370 H HD2  . HIS B 2 8   ? -5.459  -15.227 -2.147  1.00 0.00 ? 208 HIS B HD2  4  
ATOM 11371 H HE1  . HIS B 2 8   ? -1.513  -16.343 -3.210  1.00 0.00 ? 208 HIS B HE1  4  
ATOM 11372 H HE2  . HIS B 2 8   ? -3.900  -16.173 -3.985  1.00 0.00 ? 208 HIS B HE2  4  
ATOM 11373 N N    . LEU B 2 9   ? -3.052  -12.217 0.705   1.00 0.00 ? 209 LEU B N    4  
ATOM 11374 C CA   . LEU B 2 9   ? -2.582  -10.969 0.106   1.00 0.00 ? 209 LEU B CA   4  
ATOM 11375 C C    . LEU B 2 9   ? -1.524  -10.297 0.979   1.00 0.00 ? 209 LEU B C    4  
ATOM 11376 O O    . LEU B 2 9   ? -0.569  -9.712  0.464   1.00 0.00 ? 209 LEU B O    4  
ATOM 11377 C CB   . LEU B 2 9   ? -3.752  -10.009 -0.148  1.00 0.00 ? 209 LEU B CB   4  
ATOM 11378 C CG   . LEU B 2 9   ? -4.622  -9.682  1.067   1.00 0.00 ? 209 LEU B CG   4  
ATOM 11379 C CD1  . LEU B 2 9   ? -4.339  -8.275  1.574   1.00 0.00 ? 209 LEU B CD1  4  
ATOM 11380 C CD2  . LEU B 2 9   ? -6.092  -9.836  0.718   1.00 0.00 ? 209 LEU B CD2  4  
ATOM 11381 H H    . LEU B 2 9   ? -3.938  -12.245 1.131   1.00 0.00 ? 209 LEU B H    4  
ATOM 11382 H HA   . LEU B 2 9   ? -2.130  -11.218 -0.844  1.00 0.00 ? 209 LEU B HA   4  
ATOM 11383 H HB2  . LEU B 2 9   ? -3.350  -9.084  -0.532  1.00 0.00 ? 209 LEU B HB2  4  
ATOM 11384 H HB3  . LEU B 2 9   ? -4.386  -10.446 -0.907  1.00 0.00 ? 209 LEU B HB3  4  
ATOM 11385 H HG   . LEU B 2 9   ? -4.393  -10.377 1.863   1.00 0.00 ? 209 LEU B HG   4  
ATOM 11386 H HD11 . LEU B 2 9   ? -3.302  -8.200  1.869   1.00 0.00 ? 209 LEU B HD11 4  
ATOM 11387 H HD12 . LEU B 2 9   ? -4.971  -8.065  2.426   1.00 0.00 ? 209 LEU B HD12 4  
ATOM 11388 H HD13 . LEU B 2 9   ? -4.542  -7.561  0.791   1.00 0.00 ? 209 LEU B HD13 4  
ATOM 11389 H HD21 . LEU B 2 9   ? -6.323  -9.225  -0.145  1.00 0.00 ? 209 LEU B HD21 4  
ATOM 11390 H HD22 . LEU B 2 9   ? -6.696  -9.518  1.554   1.00 0.00 ? 209 LEU B HD22 4  
ATOM 11391 H HD23 . LEU B 2 9   ? -6.304  -10.872 0.494   1.00 0.00 ? 209 LEU B HD23 4  
ATOM 11392 N N    . ALA B 2 10  ? -1.686  -10.397 2.295   1.00 0.00 ? 210 ALA B N    4  
ATOM 11393 C CA   . ALA B 2 10  ? -0.743  -9.795  3.229   1.00 0.00 ? 210 ALA B CA   4  
ATOM 11394 C C    . ALA B 2 10  ? 0.645   -10.405 3.074   1.00 0.00 ? 210 ALA B C    4  
ATOM 11395 O O    . ALA B 2 10  ? 1.639   -9.687  2.993   1.00 0.00 ? 210 ALA B O    4  
ATOM 11396 C CB   . ALA B 2 10  ? -1.233  -9.954  4.659   1.00 0.00 ? 210 ALA B CB   4  
ATOM 11397 H H    . ALA B 2 10  ? -2.465  -10.883 2.646   1.00 0.00 ? 210 ALA B H    4  
ATOM 11398 H HA   . ALA B 2 10  ? -0.685  -8.738  3.009   1.00 0.00 ? 210 ALA B HA   4  
ATOM 11399 H HB1  . ALA B 2 10  ? -2.173  -9.436  4.780   1.00 0.00 ? 210 ALA B HB1  4  
ATOM 11400 H HB2  . ALA B 2 10  ? -0.502  -9.538  5.338   1.00 0.00 ? 210 ALA B HB2  4  
ATOM 11401 H HB3  . ALA B 2 10  ? -1.371  -11.002 4.877   1.00 0.00 ? 210 ALA B HB3  4  
ATOM 11402 N N    . GLN B 2 11  ? 0.703   -11.730 3.023   1.00 0.00 ? 211 GLN B N    4  
ATOM 11403 C CA   . GLN B 2 11  ? 1.968   -12.438 2.879   1.00 0.00 ? 211 GLN B CA   4  
ATOM 11404 C C    . GLN B 2 11  ? 2.606   -12.135 1.525   1.00 0.00 ? 211 GLN B C    4  
ATOM 11405 O O    . GLN B 2 11  ? 3.822   -11.961 1.427   1.00 0.00 ? 211 GLN B O    4  
ATOM 11406 C CB   . GLN B 2 11  ? 1.753   -13.944 3.043   1.00 0.00 ? 211 GLN B CB   4  
ATOM 11407 C CG   . GLN B 2 11  ? 3.034   -14.758 2.979   1.00 0.00 ? 211 GLN B CG   4  
ATOM 11408 C CD   . GLN B 2 11  ? 2.801   -16.230 3.246   1.00 0.00 ? 211 GLN B CD   4  
ATOM 11409 O OE1  . GLN B 2 11  ? 2.923   -16.699 4.377   1.00 0.00 ? 211 GLN B OE1  4  
ATOM 11410 N NE2  . GLN B 2 11  ? 2.452   -16.964 2.206   1.00 0.00 ? 211 GLN B NE2  4  
ATOM 11411 H H    . GLN B 2 11  ? -0.130  -12.249 3.089   1.00 0.00 ? 211 GLN B H    4  
ATOM 11412 H HA   . GLN B 2 11  ? 2.629   -12.091 3.659   1.00 0.00 ? 211 GLN B HA   4  
ATOM 11413 H HB2  . GLN B 2 11  ? 1.285   -14.125 3.999   1.00 0.00 ? 211 GLN B HB2  4  
ATOM 11414 H HB3  . GLN B 2 11  ? 1.093   -14.289 2.260   1.00 0.00 ? 211 GLN B HB3  4  
ATOM 11415 H HG2  . GLN B 2 11  ? 3.466   -14.653 1.994   1.00 0.00 ? 211 GLN B HG2  4  
ATOM 11416 H HG3  . GLN B 2 11  ? 3.726   -14.379 3.716   1.00 0.00 ? 211 GLN B HG3  4  
ATOM 11417 H HE21 . GLN B 2 11  ? 2.366   -16.519 1.337   1.00 0.00 ? 211 GLN B HE21 4  
ATOM 11418 H HE22 . GLN B 2 11  ? 2.298   -17.926 2.343   1.00 0.00 ? 211 GLN B HE22 4  
ATOM 11419 N N    . VAL B 2 12  ? 1.780   -12.070 0.484   1.00 0.00 ? 212 VAL B N    4  
ATOM 11420 C CA   . VAL B 2 12  ? 2.269   -11.779 -0.856  1.00 0.00 ? 212 VAL B CA   4  
ATOM 11421 C C    . VAL B 2 12  ? 2.875   -10.378 -0.912  1.00 0.00 ? 212 VAL B C    4  
ATOM 11422 O O    . VAL B 2 12  ? 4.016   -10.209 -1.336  1.00 0.00 ? 212 VAL B O    4  
ATOM 11423 C CB   . VAL B 2 12  ? 1.148   -11.906 -1.917  1.00 0.00 ? 212 VAL B CB   4  
ATOM 11424 C CG1  . VAL B 2 12  ? 1.564   -11.277 -3.241  1.00 0.00 ? 212 VAL B CG1  4  
ATOM 11425 C CG2  . VAL B 2 12  ? 0.777   -13.363 -2.129  1.00 0.00 ? 212 VAL B CG2  4  
ATOM 11426 H H    . VAL B 2 12  ? 0.820   -12.225 0.623   1.00 0.00 ? 212 VAL B H    4  
ATOM 11427 H HA   . VAL B 2 12  ? 3.038   -12.500 -1.090  1.00 0.00 ? 212 VAL B HA   4  
ATOM 11428 H HB   . VAL B 2 12  ? 0.275   -11.386 -1.556  1.00 0.00 ? 212 VAL B HB   4  
ATOM 11429 H HG11 . VAL B 2 12  ? 2.458   -11.762 -3.602  1.00 0.00 ? 212 VAL B HG11 4  
ATOM 11430 H HG12 . VAL B 2 12  ? 1.760   -10.226 -3.095  1.00 0.00 ? 212 VAL B HG12 4  
ATOM 11431 H HG13 . VAL B 2 12  ? 0.771   -11.399 -3.964  1.00 0.00 ? 212 VAL B HG13 4  
ATOM 11432 H HG21 . VAL B 2 12  ? 0.486   -13.802 -1.188  1.00 0.00 ? 212 VAL B HG21 4  
ATOM 11433 H HG22 . VAL B 2 12  ? 1.627   -13.895 -2.528  1.00 0.00 ? 212 VAL B HG22 4  
ATOM 11434 H HG23 . VAL B 2 12  ? -0.045  -13.426 -2.827  1.00 0.00 ? 212 VAL B HG23 4  
ATOM 11435 N N    . GLY B 2 13  ? 2.116   -9.386  -0.457  1.00 0.00 ? 213 GLY B N    4  
ATOM 11436 C CA   . GLY B 2 13  ? 2.589   -8.014  -0.473  1.00 0.00 ? 213 GLY B CA   4  
ATOM 11437 C C    . GLY B 2 13  ? 3.814   -7.803  0.399   1.00 0.00 ? 213 GLY B C    4  
ATOM 11438 O O    . GLY B 2 13  ? 4.743   -7.093  0.014   1.00 0.00 ? 213 GLY B O    4  
ATOM 11439 H H    . GLY B 2 13  ? 1.218   -9.589  -0.103  1.00 0.00 ? 213 GLY B H    4  
ATOM 11440 H HA2  . GLY B 2 13  ? 2.836   -7.742  -1.488  1.00 0.00 ? 213 GLY B HA2  4  
ATOM 11441 H HA3  . GLY B 2 13  ? 1.797   -7.369  -0.123  1.00 0.00 ? 213 GLY B HA3  4  
ATOM 11442 N N    . ASP B 2 14  ? 3.821   -8.437  1.564   1.00 0.00 ? 214 ASP B N    4  
ATOM 11443 C CA   . ASP B 2 14  ? 4.930   -8.313  2.507   1.00 0.00 ? 214 ASP B CA   4  
ATOM 11444 C C    . ASP B 2 14  ? 6.218   -8.888  1.932   1.00 0.00 ? 214 ASP B C    4  
ATOM 11445 O O    . ASP B 2 14  ? 7.233   -8.197  1.833   1.00 0.00 ? 214 ASP B O    4  
ATOM 11446 C CB   . ASP B 2 14  ? 4.593   -9.036  3.812   1.00 0.00 ? 214 ASP B CB   4  
ATOM 11447 C CG   . ASP B 2 14  ? 5.026   -8.261  5.039   1.00 0.00 ? 214 ASP B CG   4  
ATOM 11448 O OD1  . ASP B 2 14  ? 6.155   -7.736  5.061   1.00 0.00 ? 214 ASP B OD1  4  
ATOM 11449 O OD2  . ASP B 2 14  ? 4.228   -8.172  5.998   1.00 0.00 ? 214 ASP B OD2  4  
ATOM 11450 H H    . ASP B 2 14  ? 3.051   -9.001  1.805   1.00 0.00 ? 214 ASP B H    4  
ATOM 11451 H HA   . ASP B 2 14  ? 5.076   -7.264  2.715   1.00 0.00 ? 214 ASP B HA   4  
ATOM 11452 H HB2  . ASP B 2 14  ? 3.524   -9.188  3.867   1.00 0.00 ? 214 ASP B HB2  4  
ATOM 11453 H HB3  . ASP B 2 14  ? 5.088   -9.994  3.822   1.00 0.00 ? 214 ASP B HB3  4  
ATOM 11454 N N    . SER B 2 15  ? 6.159   -10.147 1.529   1.00 0.00 ? 215 SER B N    4  
ATOM 11455 C CA   . SER B 2 15  ? 7.319   -10.840 0.991   1.00 0.00 ? 215 SER B CA   4  
ATOM 11456 C C    . SER B 2 15  ? 7.782   -10.263 -0.345  1.00 0.00 ? 215 SER B C    4  
ATOM 11457 O O    . SER B 2 15  ? 8.976   -10.248 -0.635  1.00 0.00 ? 215 SER B O    4  
ATOM 11458 C CB   . SER B 2 15  ? 7.001   -12.324 0.837   1.00 0.00 ? 215 SER B CB   4  
ATOM 11459 O OG   . SER B 2 15  ? 6.304   -12.808 1.973   1.00 0.00 ? 215 SER B OG   4  
ATOM 11460 H H    . SER B 2 15  ? 5.305   -10.629 1.598   1.00 0.00 ? 215 SER B H    4  
ATOM 11461 H HA   . SER B 2 15  ? 8.120   -10.736 1.705   1.00 0.00 ? 215 SER B HA   4  
ATOM 11462 H HB2  . SER B 2 15  ? 6.385   -12.469 -0.039  1.00 0.00 ? 215 SER B HB2  4  
ATOM 11463 H HB3  . SER B 2 15  ? 7.920   -12.880 0.727   1.00 0.00 ? 215 SER B HB3  4  
ATOM 11464 H HG   . SER B 2 15  ? 5.350   -12.731 1.817   1.00 0.00 ? 215 SER B HG   4  
ATOM 11465 N N    . MET B 2 16  ? 6.846   -9.790  -1.158  1.00 0.00 ? 216 MET B N    4  
ATOM 11466 C CA   . MET B 2 16  ? 7.193   -9.247  -2.467  1.00 0.00 ? 216 MET B CA   4  
ATOM 11467 C C    . MET B 2 16  ? 7.863   -7.885  -2.363  1.00 0.00 ? 216 MET B C    4  
ATOM 11468 O O    . MET B 2 16  ? 8.912   -7.659  -2.975  1.00 0.00 ? 216 MET B O    4  
ATOM 11469 C CB   . MET B 2 16  ? 5.963   -9.144  -3.365  1.00 0.00 ? 216 MET B CB   4  
ATOM 11470 C CG   . MET B 2 16  ? 6.288   -9.267  -4.845  1.00 0.00 ? 216 MET B CG   4  
ATOM 11471 S SD   . MET B 2 16  ? 7.176   -10.790 -5.231  1.00 0.00 ? 216 MET B SD   4  
ATOM 11472 C CE   . MET B 2 16  ? 5.947   -12.018 -4.791  1.00 0.00 ? 216 MET B CE   4  
ATOM 11473 H H    . MET B 2 16  ? 5.905   -9.806  -0.875  1.00 0.00 ? 216 MET B H    4  
ATOM 11474 H HA   . MET B 2 16  ? 7.892   -9.935  -2.921  1.00 0.00 ? 216 MET B HA   4  
ATOM 11475 H HB2  . MET B 2 16  ? 5.272   -9.931  -3.103  1.00 0.00 ? 216 MET B HB2  4  
ATOM 11476 H HB3  . MET B 2 16  ? 5.490   -8.188  -3.200  1.00 0.00 ? 216 MET B HB3  4  
ATOM 11477 H HG2  . MET B 2 16  ? 5.363   -9.253  -5.406  1.00 0.00 ? 216 MET B HG2  4  
ATOM 11478 H HG3  . MET B 2 16  ? 6.897   -8.424  -5.140  1.00 0.00 ? 216 MET B HG3  4  
ATOM 11479 H HE1  . MET B 2 16  ? 6.348   -13.006 -4.959  1.00 0.00 ? 216 MET B HE1  4  
ATOM 11480 H HE2  . MET B 2 16  ? 5.065   -11.880 -5.397  1.00 0.00 ? 216 MET B HE2  4  
ATOM 11481 H HE3  . MET B 2 16  ? 5.687   -11.909 -3.747  1.00 0.00 ? 216 MET B HE3  4  
ATOM 11482 N N    . ASP B 2 17  ? 7.272   -6.977  -1.590  1.00 0.00 ? 217 ASP B N    4  
ATOM 11483 C CA   . ASP B 2 17  ? 7.836   -5.637  -1.447  1.00 0.00 ? 217 ASP B CA   4  
ATOM 11484 C C    . ASP B 2 17  ? 9.192   -5.691  -0.762  1.00 0.00 ? 217 ASP B C    4  
ATOM 11485 O O    . ASP B 2 17  ? 10.122  -5.000  -1.158  1.00 0.00 ? 217 ASP B O    4  
ATOM 11486 C CB   . ASP B 2 17  ? 6.897   -4.706  -0.680  1.00 0.00 ? 217 ASP B CB   4  
ATOM 11487 C CG   . ASP B 2 17  ? 7.348   -3.260  -0.769  1.00 0.00 ? 217 ASP B CG   4  
ATOM 11488 O OD1  . ASP B 2 17  ? 7.617   -2.788  -1.895  1.00 0.00 ? 217 ASP B OD1  4  
ATOM 11489 O OD2  . ASP B 2 17  ? 7.449   -2.598  0.285   1.00 0.00 ? 217 ASP B OD2  4  
ATOM 11490 H H    . ASP B 2 17  ? 6.448   -7.208  -1.110  1.00 0.00 ? 217 ASP B H    4  
ATOM 11491 H HA   . ASP B 2 17  ? 7.977   -5.241  -2.442  1.00 0.00 ? 217 ASP B HA   4  
ATOM 11492 H HB2  . ASP B 2 17  ? 5.902   -4.780  -1.094  1.00 0.00 ? 217 ASP B HB2  4  
ATOM 11493 H HB3  . ASP B 2 17  ? 6.874   -4.993  0.361   1.00 0.00 ? 217 ASP B HB3  4  
ATOM 11494 N N    . ARG B 2 18  ? 9.310   -6.521  0.264   1.00 0.00 ? 218 ARG B N    4  
ATOM 11495 C CA   . ARG B 2 18  ? 10.575  -6.653  0.970   1.00 0.00 ? 218 ARG B CA   4  
ATOM 11496 C C    . ARG B 2 18  ? 11.556  -7.471  0.134   1.00 0.00 ? 218 ARG B C    4  
ATOM 11497 O O    . ARG B 2 18  ? 12.767  -7.384  0.320   1.00 0.00 ? 218 ARG B O    4  
ATOM 11498 C CB   . ARG B 2 18  ? 10.367  -7.287  2.346   1.00 0.00 ? 218 ARG B CB   4  
ATOM 11499 C CG   . ARG B 2 18  ? 11.217  -6.652  3.439   1.00 0.00 ? 218 ARG B CG   4  
ATOM 11500 C CD   . ARG B 2 18  ? 11.107  -5.132  3.429   1.00 0.00 ? 218 ARG B CD   4  
ATOM 11501 N NE   . ARG B 2 18  ? 9.715   -4.685  3.491   1.00 0.00 ? 218 ARG B NE   4  
ATOM 11502 C CZ   . ARG B 2 18  ? 9.149   -3.870  2.596   1.00 0.00 ? 218 ARG B CZ   4  
ATOM 11503 N NH1  . ARG B 2 18  ? 9.868   -3.365  1.600   1.00 0.00 ? 218 ARG B NH1  4  
ATOM 11504 N NH2  . ARG B 2 18  ? 7.861   -3.559  2.698   1.00 0.00 ? 218 ARG B NH2  4  
ATOM 11505 H H    . ARG B 2 18  ? 8.533   -7.045  0.554   1.00 0.00 ? 218 ARG B H    4  
ATOM 11506 H HA   . ARG B 2 18  ? 10.981  -5.660  1.100   1.00 0.00 ? 218 ARG B HA   4  
ATOM 11507 H HB2  . ARG B 2 18  ? 9.326   -7.187  2.623   1.00 0.00 ? 218 ARG B HB2  4  
ATOM 11508 H HB3  . ARG B 2 18  ? 10.617  -8.336  2.289   1.00 0.00 ? 218 ARG B HB3  4  
ATOM 11509 H HG2  . ARG B 2 18  ? 10.887  -7.022  4.398   1.00 0.00 ? 218 ARG B HG2  4  
ATOM 11510 H HG3  . ARG B 2 18  ? 12.249  -6.929  3.283   1.00 0.00 ? 218 ARG B HG3  4  
ATOM 11511 H HD2  . ARG B 2 18  ? 11.642  -4.738  4.282   1.00 0.00 ? 218 ARG B HD2  4  
ATOM 11512 H HD3  . ARG B 2 18  ? 11.556  -4.758  2.520   1.00 0.00 ? 218 ARG B HD3  4  
ATOM 11513 H HE   . ARG B 2 18  ? 9.170   -5.027  4.232   1.00 0.00 ? 218 ARG B HE   4  
ATOM 11514 H HH11 . ARG B 2 18  ? 10.842  -3.584  1.515   1.00 0.00 ? 218 ARG B HH11 4  
ATOM 11515 H HH12 . ARG B 2 18  ? 9.431   -2.763  0.917   1.00 0.00 ? 218 ARG B HH12 4  
ATOM 11516 H HH21 . ARG B 2 18  ? 7.308   -3.918  3.449   1.00 0.00 ? 218 ARG B HH21 4  
ATOM 11517 H HH22 . ARG B 2 18  ? 7.430   -2.967  1.996   1.00 0.00 ? 218 ARG B HH22 4  
ATOM 11518 N N    . SER B 2 19  ? 11.000  -8.264  -0.784  1.00 0.00 ? 219 SER B N    4  
ATOM 11519 C CA   . SER B 2 19  ? 11.778  -9.098  -1.702  1.00 0.00 ? 219 SER B CA   4  
ATOM 11520 C C    . SER B 2 19  ? 12.704  -10.081 -0.978  1.00 0.00 ? 219 SER B C    4  
ATOM 11521 O O    . SER B 2 19  ? 12.538  -10.361 0.214   1.00 0.00 ? 219 SER B O    4  
ATOM 11522 C CB   . SER B 2 19  ? 12.580  -8.206  -2.655  1.00 0.00 ? 219 SER B CB   4  
ATOM 11523 O OG   . SER B 2 19  ? 11.723  -7.538  -3.568  1.00 0.00 ? 219 SER B OG   4  
ATOM 11524 H H    . SER B 2 19  ? 10.024  -8.290  -0.846  1.00 0.00 ? 219 SER B H    4  
ATOM 11525 H HA   . SER B 2 19  ? 11.074  -9.670  -2.287  1.00 0.00 ? 219 SER B HA   4  
ATOM 11526 H HB2  . SER B 2 19  ? 13.124  -7.468  -2.086  1.00 0.00 ? 219 SER B HB2  4  
ATOM 11527 H HB3  . SER B 2 19  ? 13.275  -8.814  -3.214  1.00 0.00 ? 219 SER B HB3  4  
ATOM 11528 H HG   . SER B 2 19  ? 10.822  -7.530  -3.216  1.00 0.00 ? 219 SER B HG   4  
ATOM 11529 N N    . ILE B 2 20  ? 13.651  -10.629 -1.727  1.00 0.00 ? 220 ILE B N    4  
ATOM 11530 C CA   . ILE B 2 20  ? 14.615  -11.578 -1.198  1.00 0.00 ? 220 ILE B CA   4  
ATOM 11531 C C    . ILE B 2 20  ? 15.952  -11.383 -1.908  1.00 0.00 ? 220 ILE B C    4  
ATOM 11532 O O    . ILE B 2 20  ? 17.008  -11.525 -1.262  1.00 0.00 ? 220 ILE B O    4  
ATOM 11533 C CB   . ILE B 2 20  ? 14.129  -13.039 -1.369  1.00 0.00 ? 220 ILE B CB   4  
ATOM 11534 C CG1  . ILE B 2 20  ? 15.195  -14.031 -0.895  1.00 0.00 ? 220 ILE B CG1  4  
ATOM 11535 C CG2  . ILE B 2 20  ? 13.754  -13.314 -2.818  1.00 0.00 ? 220 ILE B CG2  4  
ATOM 11536 C CD1  . ILE B 2 20  ? 14.716  -15.466 -0.866  1.00 0.00 ? 220 ILE B CD1  4  
ATOM 11537 O OXT  . ILE B 2 20  ? 15.936  -11.049 -3.113  1.00 0.00 ? 220 ILE B OXT  4  
ATOM 11538 H H    . ILE B 2 20  ? 13.707  -10.385 -2.679  1.00 0.00 ? 220 ILE B H    4  
ATOM 11539 H HA   . ILE B 2 20  ? 14.742  -11.376 -0.143  1.00 0.00 ? 220 ILE B HA   4  
ATOM 11540 H HB   . ILE B 2 20  ? 13.240  -13.167 -0.770  1.00 0.00 ? 220 ILE B HB   4  
ATOM 11541 H HG12 . ILE B 2 20  ? 16.044  -13.979 -1.559  1.00 0.00 ? 220 ILE B HG12 4  
ATOM 11542 H HG13 . ILE B 2 20  ? 15.508  -13.764 0.105   1.00 0.00 ? 220 ILE B HG13 4  
ATOM 11543 H HG21 . ILE B 2 20  ? 12.955  -12.650 -3.113  1.00 0.00 ? 220 ILE B HG21 4  
ATOM 11544 H HG22 . ILE B 2 20  ? 13.426  -14.338 -2.918  1.00 0.00 ? 220 ILE B HG22 4  
ATOM 11545 H HG23 . ILE B 2 20  ? 14.614  -13.147 -3.451  1.00 0.00 ? 220 ILE B HG23 4  
ATOM 11546 H HD11 . ILE B 2 20  ? 15.524  -16.109 -0.550  1.00 0.00 ? 220 ILE B HD11 4  
ATOM 11547 H HD12 . ILE B 2 20  ? 14.389  -15.758 -1.853  1.00 0.00 ? 220 ILE B HD12 4  
ATOM 11548 H HD13 . ILE B 2 20  ? 13.893  -15.554 -0.174  1.00 0.00 ? 220 ILE B HD13 4  
ATOM 11549 N N    . ALA A 1 1   ? 13.648  21.015  19.516  1.00 0.00 ? 1   ALA A N    5  
ATOM 11550 C CA   . ALA A 1 1   ? 13.259  21.3