data_1ZYX
# 
_entry.id   1ZYX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZYX         
RCSB  RCSB033283   
WWPDB D_1000033283 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1SV3 'Structure Of The Complex Formed Between Phospholipase A2 and 4-Methoxybenzoic Acid At 1.3A Resolution.' unspecified 
PDB 1Q7A 
;Crystal Structure Of The Complex Formed Between Russell'S Viper Phospholipase A2 and An Antiinflammatory Agent Oxyphenbutazone At 1.6A Resolution
;
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZYX 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Singh, N.'   1 
'Jabeen, T.'  2 
'Sharma, S.'  3 
'Bhushan, A.' 4 
'Singh, T.P.' 5 
# 
_citation.id                        primary 
_citation.title                     
;Crystal structure of the complex of a group IIA phospholipase A2 with a synthetic anti-inflammatory agent licofelone at 1.9A resolution
;
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Singh, N.'   1 
primary 'Jabeen, T.'  2 
primary 'Sharma, S.'  3 
primary 'Bhushan, A.' 4 
primary 'Singh, T.P.' 5 
# 
_cell.entry_id           1ZYX 
_cell.length_a           53.440 
_cell.length_b           53.440 
_cell.length_c           48.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZYX 
_symmetry.space_group_name_H-M             'P 43' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                78 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'Phospholipase A2 VRV-PL-VIIIa'                                                        13629.767 1   3.1.1.4 ? ? 
? 
2 non-polymer syn 'SULFATE ION'                                                                          96.063    2   ?       ? ? 
? 
3 non-polymer syn '[6-(4-CHLOROPHENYL)-2,2-DIMETHYL-7-PHENYL-2,3-DIHYDRO-1H-PYRROLIZIN-5-YL]ACETIC ACID' 379.879   1   ?       ? ? 
? 
4 water       nat water                                                                                  18.015    161 ?       ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Phosphatidylcholine 2- acylhydrolase, DPLA2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTS
CENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTS
CENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   LEU n 
1 3   LEU n 
1 4   GLU n 
1 5   PHE n 
1 6   GLY n 
1 7   LYS n 
1 8   MET n 
1 9   ILE n 
1 10  LEU n 
1 11  GLU n 
1 12  GLU n 
1 13  THR n 
1 14  GLY n 
1 15  LYS n 
1 16  LEU n 
1 17  ALA n 
1 18  ILE n 
1 19  PRO n 
1 20  SER n 
1 21  TYR n 
1 22  SER n 
1 23  SER n 
1 24  TYR n 
1 25  GLY n 
1 26  CYS n 
1 27  TYR n 
1 28  CYS n 
1 29  GLY n 
1 30  TRP n 
1 31  GLY n 
1 32  GLY n 
1 33  LYS n 
1 34  GLY n 
1 35  THR n 
1 36  PRO n 
1 37  LYS n 
1 38  ASP n 
1 39  ALA n 
1 40  THR n 
1 41  ASP n 
1 42  ARG n 
1 43  CYS n 
1 44  CYS n 
1 45  PHE n 
1 46  VAL n 
1 47  HIS n 
1 48  ASP n 
1 49  CYS n 
1 50  CYS n 
1 51  TYR n 
1 52  GLY n 
1 53  ASN n 
1 54  LEU n 
1 55  PRO n 
1 56  ASP n 
1 57  CYS n 
1 58  ASN n 
1 59  PRO n 
1 60  LYS n 
1 61  SER n 
1 62  ASP n 
1 63  ARG n 
1 64  TYR n 
1 65  LYS n 
1 66  TYR n 
1 67  LYS n 
1 68  ARG n 
1 69  VAL n 
1 70  ASN n 
1 71  GLY n 
1 72  ALA n 
1 73  ILE n 
1 74  VAL n 
1 75  CYS n 
1 76  GLU n 
1 77  LYS n 
1 78  GLY n 
1 79  THR n 
1 80  SER n 
1 81  CYS n 
1 82  GLU n 
1 83  ASN n 
1 84  ARG n 
1 85  ILE n 
1 86  CYS n 
1 87  GLU n 
1 88  CYS n 
1 89  ASP n 
1 90  LYS n 
1 91  ALA n 
1 92  ALA n 
1 93  ALA n 
1 94  ILE n 
1 95  CYS n 
1 96  PHE n 
1 97  ARG n 
1 98  GLN n 
1 99  ASN n 
1 100 LEU n 
1 101 ASN n 
1 102 THR n 
1 103 TYR n 
1 104 SER n 
1 105 LYS n 
1 106 LYS n 
1 107 TYR n 
1 108 MET n 
1 109 LEU n 
1 110 TYR n 
1 111 PRO n 
1 112 ASP n 
1 113 PHE n 
1 114 LEU n 
1 115 CYS n 
1 116 LYS n 
1 117 GLY n 
1 118 GLU n 
1 119 LEU n 
1 120 LYS n 
1 121 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Daboia russellii pulchella' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      97228 
_entity_src_nat.genus                      Daboia 
_entity_src_nat.species                    'Daboia russellii' 
_entity_src_nat.strain                     pulchella 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PA28_DABRP 
_struct_ref.pdbx_db_accession          P59071 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SLLEFGKMILEETGKLAIPSYSSYGCYCGWGGKGTPKDATDRCCFVHDCCYGNLPDCNPKSDRYKYKRVNGAIVCEKGTS
CENRICECDKAAAICFRQNLNTYSKKYMLYPDFLCKGELKC
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZYX 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 121 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P59071 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  121 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       133 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                ?          
'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                               ?          
'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                             ?          
'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                        ?          
'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                               ?          
'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                              ?          
'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                        ?          
'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                                ?          
'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                              ?          
'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                                  ?          'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                             ?          
'C6 H13 N O2'     131.173 
LCF non-polymer         . '[6-(4-CHLOROPHENYL)-2,2-DIMETHYL-7-PHENYL-2,3-DIHYDRO-1H-PYRROLIZIN-5-YL]ACETIC ACID' LICOFELONE 
'C23 H22 Cl N O2' 379.879 
LEU 'L-peptide linking' y LEUCINE                                                                                ?          
'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                                 ?          
'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                             ?          
'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                          ?          
'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                                ?          
'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                                 ?          
'C3 H7 N O3'      105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                          ?          
'O4 S -2'         96.063  
THR 'L-peptide linking' y THREONINE                                                                              ?          
'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                             ?          
'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                               ?          
'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                                 ?          
'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1ZYX 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   50 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.0 
_exptl_crystal_grow.pdbx_details    'Ammonium Sulphate, PEG4000, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           293 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2005-03-21 
_diffrn_detector.details                Mirror 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    graphite 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.541812 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU RU300' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.541812 
# 
_reflns.entry_id                     1ZYX 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             17.97 
_reflns.d_resolution_high            1.95 
_reflns.number_obs                   9639 
_reflns.number_all                   10086 
_reflns.percent_possible_obs         95.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        21.5 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.95 
_reflns_shell.d_res_low              1.97 
_reflns_shell.percent_possible_all   95 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 1ZYX 
_refine.ls_number_reflns_obs                     9639 
_refine.ls_number_reflns_all                     10086 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               1011564.86 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             17.97 
_refine.ls_d_res_high                            1.95 
_refine.ls_percent_reflns_obs                    98 
_refine.ls_R_factor_obs                          0.193 
_refine.ls_R_factor_all                          0.202 
_refine.ls_R_factor_R_work                       0.193 
_refine.ls_R_factor_R_free                       0.219 
_refine.ls_R_factor_R_free_error                 0.010 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.3 
_refine.ls_number_reflns_R_free                  509 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               31.8 
_refine.aniso_B[1][1]                            1.46 
_refine.aniso_B[2][2]                            1.46 
_refine.aniso_B[3][3]                            -2.92 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.292602 
_refine.solvent_model_param_bsol                 46.0814 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZYX 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.22 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.25 
_refine_analyze.Luzzati_sigma_a_free            0.24 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        944 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         37 
_refine_hist.number_atoms_solvent             161 
_refine_hist.number_atoms_total               1142 
_refine_hist.d_res_high                       1.95 
_refine_hist.d_res_low                        17.97 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.008 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 21.6  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.73  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        0.82  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       1.45  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        1.10  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       1.79  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.90 
_refine_ls_shell.d_res_low                        2.02 
_refine_ls_shell.number_reflns_R_work             861 
_refine_ls_shell.R_factor_R_work                  0.286 
_refine_ls_shell.percent_reflns_obs               50.4 
_refine_ls_shell.R_factor_R_free                  0.326 
_refine_ls_shell.R_factor_R_free_error            0.050 
_refine_ls_shell.percent_reflns_R_free            4.8 
_refine_ls_shell.number_reflns_R_free             43 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 ion.param         water.top   'X-RAY DIFFRACTION' 
3 water_rep.param   lcf.top     'X-RAY DIFFRACTION' 
4 lcf.param         ion.top     'X-RAY DIFFRACTION' 
5 so4.param         so4.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  1ZYX 
_struct.title                     
;Crystal structure of the complex of a group IIA phospholipase A2 with a synthetic anti-inflammatory agent licofelone at 1.9A resolution
;
_struct.pdbx_descriptor           'Phospholipase A2 VRV-PL-VIIIa (E.C.3.1.1.4)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZYX 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'inhibitor, complex, drug, HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 1   ? GLY A 14  ? SER A 1   GLY A 14  1 ? 14 
HELX_P HELX_P2 2 LEU A 16  ? TYR A 21  ? LEU A 17  TYR A 22  1 ? 6  
HELX_P HELX_P3 3 ASP A 38  ? ASN A 53  ? ASP A 39  ASN A 54  1 ? 16 
HELX_P HELX_P4 4 THR A 79  ? ASN A 99  ? THR A 89  ASN A 109 1 ? 21 
HELX_P HELX_P5 5 LEU A 100 ? TYR A 103 ? LEU A 110 TYR A 113 5 ? 4  
HELX_P HELX_P6 6 SER A 104 ? MET A 108 ? SER A 114 MET A 118 5 ? 5  
HELX_P HELX_P7 7 PRO A 111 ? CYS A 115 ? PRO A 121 CYS A 126 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 26 SG ? ? ? 1_555 A CYS 115 SG ? ? A CYS 27 A CYS 126 1_555 ? ? ? ? ? ? ? 1.785 ? 
disulf2 disulf ? ? A CYS 28 SG ? ? ? 1_555 A CYS 44  SG ? ? A CYS 29 A CYS 45  1_555 ? ? ? ? ? ? ? 1.868 ? 
disulf3 disulf ? ? A CYS 43 SG ? ? ? 1_555 A CYS 95  SG ? ? A CYS 44 A CYS 105 1_555 ? ? ? ? ? ? ? 2.028 ? 
disulf4 disulf ? ? A CYS 49 SG ? ? ? 1_555 A CYS 121 SG ? ? A CYS 50 A CYS 133 1_555 ? ? ? ? ? ? ? 2.009 ? 
disulf5 disulf ? ? A CYS 50 SG ? ? ? 1_555 A CYS 88  SG ? ? A CYS 51 A CYS 98  1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf6 disulf ? ? A CYS 57 SG ? ? ? 1_555 A CYS 81  SG ? ? A CYS 61 A CYS 91  1_555 ? ? ? ? ? ? ? 1.660 ? 
disulf7 disulf ? ? A CYS 75 SG ? ? ? 1_555 A CYS 86  SG ? ? A CYS 84 A CYS 96  1_555 ? ? ? ? ? ? ? 2.032 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          ILE 
_struct_mon_prot_cis.label_seq_id           18 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           ILE 
_struct_mon_prot_cis.auth_seq_id            19 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    19 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     20 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.20 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   2 
_struct_sheet.details          ? 
# 
_struct_sheet_order.sheet_id     A 
_struct_sheet_order.range_id_1   1 
_struct_sheet_order.range_id_2   2 
_struct_sheet_order.offset       ? 
_struct_sheet_order.sense        anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 TYR A 66 ? VAL A 69 ? TYR A 75 VAL A 78 
A 2 ALA A 72 ? CYS A 75 ? ALA A 81 CYS A 84 
# 
_pdbx_struct_sheet_hbond.sheet_id                A 
_pdbx_struct_sheet_hbond.range_id_1              1 
_pdbx_struct_sheet_hbond.range_id_2              2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id   N 
_pdbx_struct_sheet_hbond.range_1_label_comp_id   LYS 
_pdbx_struct_sheet_hbond.range_1_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_1_label_seq_id    67 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id    N 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id    LYS 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id     76 
_pdbx_struct_sheet_hbond.range_2_label_atom_id   O 
_pdbx_struct_sheet_hbond.range_2_label_comp_id   VAL 
_pdbx_struct_sheet_hbond.range_2_label_asym_id   A 
_pdbx_struct_sheet_hbond.range_2_label_seq_id    74 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code    ? 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id    O 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id    VAL 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id    A 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id     83 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 A 261'  
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 262'  
AC3 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE LCF A 2001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 LYS A 15  ? LYS A 16   . ? 4_555 ? 
2  AC1 4 SER A 20  ? SER A 21   . ? 4_555 ? 
3  AC1 4 LYS A 67  ? LYS A 76   . ? 1_555 ? 
4  AC1 4 HOH E .   ? HOH A 2020 . ? 4_555 ? 
5  AC2 5 ARG A 42  ? ARG A 43   . ? 1_555 ? 
6  AC2 5 ARG A 63  ? ARG A 72   . ? 4_565 ? 
7  AC2 5 HOH E .   ? HOH A 2090 . ? 1_555 ? 
8  AC2 5 HOH E .   ? HOH A 2120 . ? 1_555 ? 
9  AC2 5 HOH E .   ? HOH A 2121 . ? 1_555 ? 
10 AC3 9 LEU A 2   ? LEU A 2    . ? 1_555 ? 
11 AC3 9 PHE A 5   ? PHE A 5    . ? 1_555 ? 
12 AC3 9 ILE A 18  ? ILE A 19   . ? 1_555 ? 
13 AC3 9 GLY A 29  ? GLY A 30   . ? 1_555 ? 
14 AC3 9 TRP A 30  ? TRP A 31   . ? 1_555 ? 
15 AC3 9 ASN A 101 ? ASN A 111  . ? 2_564 ? 
16 AC3 9 HOH E .   ? HOH A 2154 . ? 1_555 ? 
17 AC3 9 HOH E .   ? HOH A 2155 . ? 1_555 ? 
18 AC3 9 HOH E .   ? HOH A 2160 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZYX 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZYX 
_atom_sites.fract_transf_matrix[1][1]   0.018713 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018713 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020589 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 1   ? 14.114  15.559 -3.496  1.00 23.26  ? 1    SER A N   1 
ATOM   2    C  CA  . SER A 1 1   ? 13.251  15.735 -4.704  1.00 24.14  ? 1    SER A CA  1 
ATOM   3    C  C   . SER A 1 1   ? 11.819  16.064 -4.297  1.00 24.72  ? 1    SER A C   1 
ATOM   4    O  O   . SER A 1 1   ? 11.468  15.990 -3.119  1.00 24.19  ? 1    SER A O   1 
ATOM   5    C  CB  . SER A 1 1   ? 13.255  14.460 -5.559  1.00 23.91  ? 1    SER A CB  1 
ATOM   6    O  OG  . SER A 1 1   ? 12.563  13.400 -4.917  1.00 24.12  ? 1    SER A OG  1 
ATOM   7    N  N   . LEU A 1 2   ? 10.998  16.425 -5.281  1.00 25.47  ? 2    LEU A N   1 
ATOM   8    C  CA  . LEU A 1 2   ? 9.603   16.768 -5.035  1.00 26.64  ? 2    LEU A CA  1 
ATOM   9    C  C   . LEU A 1 2   ? 8.849   15.664 -4.294  1.00 26.35  ? 2    LEU A C   1 
ATOM   10   O  O   . LEU A 1 2   ? 7.849   15.926 -3.625  1.00 25.99  ? 2    LEU A O   1 
ATOM   11   C  CB  . LEU A 1 2   ? 8.905   17.085 -6.361  1.00 28.19  ? 2    LEU A CB  1 
ATOM   12   C  CG  . LEU A 1 2   ? 9.035   18.515 -6.898  1.00 29.32  ? 2    LEU A CG  1 
ATOM   13   C  CD1 . LEU A 1 2   ? 10.447  19.031 -6.729  1.00 30.89  ? 2    LEU A CD1 1 
ATOM   14   C  CD2 . LEU A 1 2   ? 8.644   18.528 -8.364  1.00 30.98  ? 2    LEU A CD2 1 
ATOM   15   N  N   . LEU A 1 3   ? 9.330   14.433 -4.409  1.00 26.41  ? 3    LEU A N   1 
ATOM   16   C  CA  . LEU A 1 3   ? 8.695   13.304 -3.736  1.00 26.48  ? 3    LEU A CA  1 
ATOM   17   C  C   . LEU A 1 3   ? 8.884   13.374 -2.220  1.00 25.76  ? 3    LEU A C   1 
ATOM   18   O  O   . LEU A 1 3   ? 7.948   13.122 -1.464  1.00 25.35  ? 3    LEU A O   1 
ATOM   19   C  CB  . LEU A 1 3   ? 9.250   11.987 -4.284  1.00 27.89  ? 3    LEU A CB  1 
ATOM   20   C  CG  . LEU A 1 3   ? 8.505   11.391 -5.487  1.00 29.98  ? 3    LEU A CG  1 
ATOM   21   C  CD1 . LEU A 1 3   ? 7.284   10.629 -4.996  1.00 31.17  ? 3    LEU A CD1 1 
ATOM   22   C  CD2 . LEU A 1 3   ? 8.094   12.490 -6.464  1.00 31.34  ? 3    LEU A CD2 1 
ATOM   23   N  N   . GLU A 1 4   ? 10.092  13.718 -1.776  1.00 25.01  ? 4    GLU A N   1 
ATOM   24   C  CA  . GLU A 1 4   ? 10.361  13.833 -0.346  1.00 24.46  ? 4    GLU A CA  1 
ATOM   25   C  C   . GLU A 1 4   ? 9.740   15.113 0.207   1.00 24.00  ? 4    GLU A C   1 
ATOM   26   O  O   . GLU A 1 4   ? 9.217   15.132 1.321   1.00 24.29  ? 4    GLU A O   1 
ATOM   27   C  CB  . GLU A 1 4   ? 11.867  13.849 -0.070  1.00 24.32  ? 4    GLU A CB  1 
ATOM   28   C  CG  . GLU A 1 4   ? 12.564  12.521 -0.310  1.00 25.36  ? 4    GLU A CG  1 
ATOM   29   C  CD  . GLU A 1 4   ? 12.810  12.243 -1.776  1.00 25.86  ? 4    GLU A CD  1 
ATOM   30   O  OE1 . GLU A 1 4   ? 12.678  11.075 -2.191  1.00 27.27  ? 4    GLU A OE1 1 
ATOM   31   O  OE2 . GLU A 1 4   ? 13.151  13.189 -2.511  1.00 26.14  ? 4    GLU A OE2 1 
ATOM   32   N  N   . PHE A 1 5   ? 9.800   16.181 -0.579  1.00 23.19  ? 5    PHE A N   1 
ATOM   33   C  CA  . PHE A 1 5   ? 9.259   17.464 -0.162  1.00 22.65  ? 5    PHE A CA  1 
ATOM   34   C  C   . PHE A 1 5   ? 7.746   17.380 0.058   1.00 23.05  ? 5    PHE A C   1 
ATOM   35   O  O   . PHE A 1 5   ? 7.234   17.870 1.065   1.00 23.08  ? 5    PHE A O   1 
ATOM   36   C  CB  . PHE A 1 5   ? 9.601   18.529 -1.209  1.00 21.50  ? 5    PHE A CB  1 
ATOM   37   C  CG  . PHE A 1 5   ? 9.307   19.940 -0.769  1.00 20.85  ? 5    PHE A CG  1 
ATOM   38   C  CD1 . PHE A 1 5   ? 9.498   20.330 0.555   1.00 20.40  ? 5    PHE A CD1 1 
ATOM   39   C  CD2 . PHE A 1 5   ? 8.868   20.886 -1.684  1.00 20.48  ? 5    PHE A CD2 1 
ATOM   40   C  CE1 . PHE A 1 5   ? 9.255   21.641 0.956   1.00 20.60  ? 5    PHE A CE1 1 
ATOM   41   C  CE2 . PHE A 1 5   ? 8.623   22.202 -1.291  1.00 20.74  ? 5    PHE A CE2 1 
ATOM   42   C  CZ  . PHE A 1 5   ? 8.817   22.578 0.033   1.00 20.43  ? 5    PHE A CZ  1 
ATOM   43   N  N   . GLY A 1 6   ? 7.037   16.747 -0.875  1.00 22.96  ? 6    GLY A N   1 
ATOM   44   C  CA  . GLY A 1 6   ? 5.594   16.613 -0.752  1.00 23.00  ? 6    GLY A CA  1 
ATOM   45   C  C   . GLY A 1 6   ? 5.177   15.799 0.460   1.00 23.25  ? 6    GLY A C   1 
ATOM   46   O  O   . GLY A 1 6   ? 4.186   16.108 1.117   1.00 23.64  ? 6    GLY A O   1 
ATOM   47   N  N   . LYS A 1 7   ? 5.937   14.752 0.751   1.00 23.54  ? 7    LYS A N   1 
ATOM   48   C  CA  . LYS A 1 7   ? 5.665   13.885 1.886   1.00 24.25  ? 7    LYS A CA  1 
ATOM   49   C  C   . LYS A 1 7   ? 5.900   14.651 3.184   1.00 23.95  ? 7    LYS A C   1 
ATOM   50   O  O   . LYS A 1 7   ? 5.167   14.493 4.157   1.00 23.72  ? 7    LYS A O   1 
ATOM   51   C  CB  . LYS A 1 7   ? 6.587   12.666 1.823   1.00 26.12  ? 7    LYS A CB  1 
ATOM   52   C  CG  . LYS A 1 7   ? 6.439   11.674 2.970   1.00 28.35  ? 7    LYS A CG  1 
ATOM   53   C  CD  . LYS A 1 7   ? 7.394   10.505 2.780   1.00 30.84  ? 7    LYS A CD  1 
ATOM   54   C  CE  . LYS A 1 7   ? 7.332   9.516  3.937   1.00 32.23  ? 7    LYS A CE  1 
ATOM   55   N  NZ  . LYS A 1 7   ? 8.312   8.406  3.736   1.00 34.35  ? 7    LYS A NZ  1 
ATOM   56   N  N   . MET A 1 8   ? 6.928   15.490 3.179   1.00 22.85  ? 8    MET A N   1 
ATOM   57   C  CA  . MET A 1 8   ? 7.295   16.296 4.335   1.00 22.88  ? 8    MET A CA  1 
ATOM   58   C  C   . MET A 1 8   ? 6.184   17.307 4.657   1.00 22.77  ? 8    MET A C   1 
ATOM   59   O  O   . MET A 1 8   ? 5.766   17.441 5.809   1.00 22.73  ? 8    MET A O   1 
ATOM   60   C  CB  . MET A 1 8   ? 8.608   17.020 4.022   1.00 22.66  ? 8    MET A CB  1 
ATOM   61   C  CG  . MET A 1 8   ? 9.390   17.499 5.214   1.00 23.93  ? 8    MET A CG  1 
ATOM   62   S  SD  . MET A 1 8   ? 10.916  18.301 4.667   1.00 23.53  ? 8    MET A SD  1 
ATOM   63   C  CE  . MET A 1 8   ? 12.040  16.910 4.637   1.00 22.46  ? 8    MET A CE  1 
ATOM   64   N  N   . ILE A 1 9   ? 5.721   18.013 3.627   1.00 21.90  ? 9    ILE A N   1 
ATOM   65   C  CA  . ILE A 1 9   ? 4.657   19.005 3.755   1.00 21.93  ? 9    ILE A CA  1 
ATOM   66   C  C   . ILE A 1 9   ? 3.365   18.367 4.287   1.00 22.20  ? 9    ILE A C   1 
ATOM   67   O  O   . ILE A 1 9   ? 2.739   18.879 5.218   1.00 21.47  ? 9    ILE A O   1 
ATOM   68   C  CB  . ILE A 1 9   ? 4.375   19.667 2.383   1.00 22.20  ? 9    ILE A CB  1 
ATOM   69   C  CG1 . ILE A 1 9   ? 5.618   20.443 1.928   1.00 22.08  ? 9    ILE A CG1 1 
ATOM   70   C  CG2 . ILE A 1 9   ? 3.158   20.591 2.472   1.00 21.35  ? 9    ILE A CG2 1 
ATOM   71   C  CD1 . ILE A 1 9   ? 5.523   21.003 0.519   1.00 22.97  ? 9    ILE A CD1 1 
ATOM   72   N  N   . LEU A 1 10  ? 2.973   17.247 3.690   1.00 22.20  ? 10   LEU A N   1 
ATOM   73   C  CA  . LEU A 1 10  ? 1.766   16.545 4.115   1.00 22.91  ? 10   LEU A CA  1 
ATOM   74   C  C   . LEU A 1 10  ? 1.847   16.145 5.590   1.00 23.01  ? 10   LEU A C   1 
ATOM   75   O  O   . LEU A 1 10  ? 0.892   16.345 6.338   1.00 22.66  ? 10   LEU A O   1 
ATOM   76   C  CB  . LEU A 1 10  ? 1.543   15.304 3.244   1.00 23.74  ? 10   LEU A CB  1 
ATOM   77   C  CG  . LEU A 1 10  ? 0.374   14.385 3.616   1.00 24.89  ? 10   LEU A CG  1 
ATOM   78   C  CD1 . LEU A 1 10  ? -0.941  15.161 3.592   1.00 24.87  ? 10   LEU A CD1 1 
ATOM   79   C  CD2 . LEU A 1 10  ? 0.328   13.222 2.639   1.00 25.25  ? 10   LEU A CD2 1 
ATOM   80   N  N   . GLU A 1 11  ? 2.983   15.587 6.008   1.00 23.10  ? 11   GLU A N   1 
ATOM   81   C  CA  . GLU A 1 11  ? 3.164   15.169 7.399   1.00 23.91  ? 11   GLU A CA  1 
ATOM   82   C  C   . GLU A 1 11  ? 3.116   16.365 8.348   1.00 24.20  ? 11   GLU A C   1 
ATOM   83   O  O   . GLU A 1 11  ? 2.491   16.324 9.413   1.00 23.83  ? 11   GLU A O   1 
ATOM   84   C  CB  . GLU A 1 11  ? 4.515   14.474 7.589   1.00 24.15  ? 11   GLU A CB  1 
ATOM   85   C  CG  . GLU A 1 11  ? 4.775   13.294 6.673   1.00 25.02  ? 11   GLU A CG  1 
ATOM   86   C  CD  . GLU A 1 11  ? 6.145   12.676 6.908   1.00 25.96  ? 11   GLU A CD  1 
ATOM   87   O  OE1 . GLU A 1 11  ? 7.098   13.424 7.208   1.00 24.61  ? 11   GLU A OE1 1 
ATOM   88   O  OE2 . GLU A 1 11  ? 6.275   11.443 6.777   1.00 26.72  ? 11   GLU A OE2 1 
ATOM   89   N  N   . GLU A 1 12  ? 3.788   17.433 7.948   1.00 24.33  ? 12   GLU A N   1 
ATOM   90   C  CA  . GLU A 1 12  ? 3.857   18.631 8.760   1.00 24.57  ? 12   GLU A CA  1 
ATOM   91   C  C   . GLU A 1 12  ? 2.555   19.423 8.850   1.00 24.40  ? 12   GLU A C   1 
ATOM   92   O  O   . GLU A 1 12  ? 2.125   19.790 9.943   1.00 24.40  ? 12   GLU A O   1 
ATOM   93   C  CB  . GLU A 1 12  ? 4.964   19.546 8.230   1.00 25.07  ? 12   GLU A CB  1 
ATOM   94   C  CG  . GLU A 1 12  ? 5.659   20.363 9.310   1.00 25.86  ? 12   GLU A CG  1 
ATOM   95   C  CD  . GLU A 1 12  ? 6.491   19.508 10.241  1.00 25.83  ? 12   GLU A CD  1 
ATOM   96   O  OE1 . GLU A 1 12  ? 6.998   20.043 11.242  1.00 27.68  ? 12   GLU A OE1 1 
ATOM   97   O  OE2 . GLU A 1 12  ? 6.649   18.301 9.975   1.00 26.19  ? 12   GLU A OE2 1 
ATOM   98   N  N   . THR A 1 13  ? 1.925   19.675 7.707   1.00 24.50  ? 13   THR A N   1 
ATOM   99   C  CA  . THR A 1 13  ? 0.711   20.485 7.666   1.00 24.82  ? 13   THR A CA  1 
ATOM   100  C  C   . THR A 1 13  ? -0.617  19.759 7.506   1.00 25.84  ? 13   THR A C   1 
ATOM   101  O  O   . THR A 1 13  ? -1.673  20.328 7.791   1.00 25.27  ? 13   THR A O   1 
ATOM   102  C  CB  . THR A 1 13  ? 0.784   21.494 6.523   1.00 24.28  ? 13   THR A CB  1 
ATOM   103  O  OG1 . THR A 1 13  ? 0.697   20.789 5.275   1.00 24.02  ? 13   THR A OG1 1 
ATOM   104  C  CG2 . THR A 1 13  ? 2.095   22.272 6.580   1.00 24.39  ? 13   THR A CG2 1 
ATOM   105  N  N   . GLY A 1 14  ? -0.575  18.522 7.027   1.00 26.55  ? 14   GLY A N   1 
ATOM   106  C  CA  . GLY A 1 14  ? -1.806  17.789 6.818   1.00 28.00  ? 14   GLY A CA  1 
ATOM   107  C  C   . GLY A 1 14  ? -2.378  18.134 5.455   1.00 29.33  ? 14   GLY A C   1 
ATOM   108  O  O   . GLY A 1 14  ? -3.368  17.544 5.024   1.00 29.92  ? 14   GLY A O   1 
ATOM   109  N  N   . LYS A 1 15  ? -1.755  19.093 4.772   1.00 29.87  ? 16   LYS A N   1 
ATOM   110  C  CA  . LYS A 1 15  ? -2.206  19.509 3.442   1.00 30.82  ? 16   LYS A CA  1 
ATOM   111  C  C   . LYS A 1 15  ? -1.364  18.855 2.350   1.00 31.28  ? 16   LYS A C   1 
ATOM   112  O  O   . LYS A 1 15  ? -0.168  18.628 2.529   1.00 30.78  ? 16   LYS A O   1 
ATOM   113  C  CB  . LYS A 1 15  ? -2.103  21.028 3.274   1.00 30.86  ? 16   LYS A CB  1 
ATOM   114  C  CG  . LYS A 1 15  ? -3.055  21.862 4.113   1.00 31.47  ? 16   LYS A CG  1 
ATOM   115  C  CD  . LYS A 1 15  ? -2.832  23.341 3.809   1.00 32.71  ? 16   LYS A CD  1 
ATOM   116  C  CE  . LYS A 1 15  ? -3.743  24.245 4.614   1.00 33.45  ? 16   LYS A CE  1 
ATOM   117  N  NZ  . LYS A 1 15  ? -5.169  24.046 4.249   1.00 34.86  ? 16   LYS A NZ  1 
ATOM   118  N  N   . LEU A 1 16  ? -1.994  18.557 1.218   1.00 31.61  ? 17   LEU A N   1 
ATOM   119  C  CA  . LEU A 1 16  ? -1.290  17.957 0.093   1.00 32.32  ? 17   LEU A CA  1 
ATOM   120  C  C   . LEU A 1 16  ? -0.578  19.069 -0.676  1.00 32.45  ? 17   LEU A C   1 
ATOM   121  O  O   . LEU A 1 16  ? -1.179  20.104 -0.979  1.00 32.11  ? 17   LEU A O   1 
ATOM   122  C  CB  . LEU A 1 16  ? -2.283  17.227 -0.821  1.00 33.08  ? 17   LEU A CB  1 
ATOM   123  C  CG  . LEU A 1 16  ? -2.912  15.960 -0.231  1.00 33.98  ? 17   LEU A CG  1 
ATOM   124  C  CD1 . LEU A 1 16  ? -4.139  15.546 -1.028  1.00 34.53  ? 17   LEU A CD1 1 
ATOM   125  C  CD2 . LEU A 1 16  ? -1.875  14.852 -0.224  1.00 34.26  ? 17   LEU A CD2 1 
ATOM   126  N  N   . ALA A 1 17  ? 0.704   18.856 -0.975  1.00 32.51  ? 18   ALA A N   1 
ATOM   127  C  CA  . ALA A 1 17  ? 1.505   19.836 -1.708  1.00 32.77  ? 18   ALA A CA  1 
ATOM   128  C  C   . ALA A 1 17  ? 0.719   20.350 -2.906  1.00 33.23  ? 18   ALA A C   1 
ATOM   129  O  O   . ALA A 1 17  ? 0.629   21.558 -3.133  1.00 33.36  ? 18   ALA A O   1 
ATOM   130  C  CB  . ALA A 1 17  ? 2.807   19.208 -2.161  1.00 32.81  ? 18   ALA A CB  1 
ATOM   131  N  N   . ILE A 1 18  ? 0.168   19.420 -3.678  1.00 33.48  ? 19   ILE A N   1 
ATOM   132  C  CA  . ILE A 1 18  ? -0.656  19.757 -4.834  1.00 34.08  ? 19   ILE A CA  1 
ATOM   133  C  C   . ILE A 1 18  ? -2.075  19.465 -4.348  1.00 33.69  ? 19   ILE A C   1 
ATOM   134  O  O   . ILE A 1 18  ? -2.352  18.362 -3.884  1.00 34.06  ? 19   ILE A O   1 
ATOM   135  C  CB  . ILE A 1 18  ? -0.366  18.828 -6.043  1.00 34.91  ? 19   ILE A CB  1 
ATOM   136  C  CG1 . ILE A 1 18  ? 1.128   18.807 -6.360  1.00 35.46  ? 19   ILE A CG1 1 
ATOM   137  C  CG2 . ILE A 1 18  ? -1.148  19.303 -7.262  1.00 35.07  ? 19   ILE A CG2 1 
ATOM   138  C  CD1 . ILE A 1 18  ? 1.657   20.099 -6.928  1.00 36.78  ? 19   ILE A CD1 1 
ATOM   139  N  N   . PRO A 1 19  ? -2.996  20.433 -4.462  1.00 33.47  ? 20   PRO A N   1 
ATOM   140  C  CA  . PRO A 1 19  ? -2.862  21.786 -5.004  1.00 33.02  ? 20   PRO A CA  1 
ATOM   141  C  C   . PRO A 1 19  ? -2.871  22.869 -3.924  1.00 32.41  ? 20   PRO A C   1 
ATOM   142  O  O   . PRO A 1 19  ? -3.265  24.003 -4.193  1.00 32.90  ? 20   PRO A O   1 
ATOM   143  C  CB  . PRO A 1 19  ? -4.094  21.896 -5.867  1.00 33.47  ? 20   PRO A CB  1 
ATOM   144  C  CG  . PRO A 1 19  ? -5.127  21.333 -4.917  1.00 33.38  ? 20   PRO A CG  1 
ATOM   145  C  CD  . PRO A 1 19  ? -4.426  20.100 -4.312  1.00 33.26  ? 20   PRO A CD  1 
ATOM   146  N  N   . SER A 1 20  ? -2.464  22.528 -2.708  1.00 31.16  ? 21   SER A N   1 
ATOM   147  C  CA  . SER A 1 20  ? -2.462  23.506 -1.627  1.00 30.50  ? 21   SER A CA  1 
ATOM   148  C  C   . SER A 1 20  ? -1.298  24.489 -1.679  1.00 29.83  ? 21   SER A C   1 
ATOM   149  O  O   . SER A 1 20  ? -1.467  25.670 -1.382  1.00 29.60  ? 21   SER A O   1 
ATOM   150  C  CB  . SER A 1 20  ? -2.456  22.797 -0.274  1.00 30.75  ? 21   SER A CB  1 
ATOM   151  O  OG  . SER A 1 20  ? -3.683  22.134 -0.047  1.00 31.55  ? 21   SER A OG  1 
ATOM   152  N  N   . TYR A 1 21  ? -0.123  24.003 -2.065  1.00 29.09  ? 22   TYR A N   1 
ATOM   153  C  CA  . TYR A 1 21  ? 1.067   24.842 -2.085  1.00 28.79  ? 22   TYR A CA  1 
ATOM   154  C  C   . TYR A 1 21  ? 1.707   25.015 -3.465  1.00 28.93  ? 22   TYR A C   1 
ATOM   155  O  O   . TYR A 1 21  ? 2.692   25.755 -3.586  1.00 30.23  ? 22   TYR A O   1 
ATOM   156  C  CB  . TYR A 1 21  ? 2.080   24.324 -1.082  1.00 27.98  ? 22   TYR A CB  1 
ATOM   157  C  CG  . TYR A 1 21  ? 1.636   24.522 0.345   1.00 27.94  ? 22   TYR A CG  1 
ATOM   158  C  CD1 . TYR A 1 21  ? 1.635   25.778 0.951   1.00 27.23  ? 22   TYR A CD1 1 
ATOM   159  C  CD2 . TYR A 1 21  ? 1.221   23.424 1.096   1.00 27.47  ? 22   TYR A CD2 1 
ATOM   160  C  CE1 . TYR A 1 21  ? 1.235   25.934 2.273   1.00 27.26  ? 22   TYR A CE1 1 
ATOM   161  C  CE2 . TYR A 1 21  ? 0.816   23.568 2.416   1.00 27.61  ? 22   TYR A CE2 1 
ATOM   162  C  CZ  . TYR A 1 21  ? 0.828   24.826 2.999   1.00 27.21  ? 22   TYR A CZ  1 
ATOM   163  O  OH  . TYR A 1 21  ? 0.442   24.969 4.307   1.00 26.43  ? 22   TYR A OH  1 
ATOM   164  N  N   . SER A 1 22  ? 1.161   24.391 -4.506  1.00 28.72  ? 23   SER A N   1 
ATOM   165  C  CA  . SER A 1 22  ? 1.788   24.447 -5.836  1.00 28.55  ? 23   SER A CA  1 
ATOM   166  C  C   . SER A 1 22  ? 1.395   25.637 -6.703  1.00 28.42  ? 23   SER A C   1 
ATOM   167  O  O   . SER A 1 22  ? 2.049   25.922 -7.704  1.00 28.73  ? 23   SER A O   1 
ATOM   168  C  CB  . SER A 1 22  ? 1.498   23.148 -6.589  1.00 28.61  ? 23   SER A CB  1 
ATOM   169  O  OG  . SER A 1 22  ? 0.105   22.918 -6.699  1.00 28.33  ? 23   SER A OG  1 
ATOM   170  N  N   . SER A 1 23  ? 0.327   26.327 -6.322  1.00 28.28  ? 24   SER A N   1 
ATOM   171  C  CA  . SER A 1 23  ? -0.138  27.485 -7.074  1.00 28.15  ? 24   SER A CA  1 
ATOM   172  C  C   . SER A 1 23  ? -0.629  28.553 -6.107  1.00 27.57  ? 24   SER A C   1 
ATOM   173  O  O   . SER A 1 23  ? -1.606  29.252 -6.380  1.00 27.91  ? 24   SER A O   1 
ATOM   174  C  CB  . SER A 1 23  ? -1.274  27.080 -8.013  1.00 29.02  ? 24   SER A CB  1 
ATOM   175  O  OG  . SER A 1 23  ? -2.345  26.499 -7.288  1.00 30.81  ? 24   SER A OG  1 
ATOM   176  N  N   . TYR A 1 24  ? 0.073   28.686 -4.988  1.00 25.82  ? 25   TYR A N   1 
ATOM   177  C  CA  . TYR A 1 24  ? -0.291  29.646 -3.957  1.00 24.90  ? 25   TYR A CA  1 
ATOM   178  C  C   . TYR A 1 24  ? 0.520   30.939 -4.018  1.00 24.69  ? 25   TYR A C   1 
ATOM   179  O  O   . TYR A 1 24  ? 1.749   30.917 -4.089  1.00 25.52  ? 25   TYR A O   1 
ATOM   180  C  CB  . TYR A 1 24  ? -0.127  28.979 -2.587  1.00 24.03  ? 25   TYR A CB  1 
ATOM   181  C  CG  . TYR A 1 24  ? -0.661  29.765 -1.409  1.00 23.37  ? 25   TYR A CG  1 
ATOM   182  C  CD1 . TYR A 1 24  ? 0.018   30.883 -0.919  1.00 23.00  ? 25   TYR A CD1 1 
ATOM   183  C  CD2 . TYR A 1 24  ? -1.832  29.368 -0.761  1.00 23.07  ? 25   TYR A CD2 1 
ATOM   184  C  CE1 . TYR A 1 24  ? -0.455  31.584 0.195   1.00 23.09  ? 25   TYR A CE1 1 
ATOM   185  C  CE2 . TYR A 1 24  ? -2.315  30.062 0.348   1.00 23.33  ? 25   TYR A CE2 1 
ATOM   186  C  CZ  . TYR A 1 24  ? -1.621  31.168 0.821   1.00 23.10  ? 25   TYR A CZ  1 
ATOM   187  O  OH  . TYR A 1 24  ? -2.101  31.850 1.913   1.00 22.46  ? 25   TYR A OH  1 
ATOM   188  N  N   . GLY A 1 25  ? -0.181  32.067 -3.995  1.00 24.28  ? 26   GLY A N   1 
ATOM   189  C  CA  . GLY A 1 25  ? 0.478   33.359 -4.018  1.00 23.85  ? 26   GLY A CA  1 
ATOM   190  C  C   . GLY A 1 25  ? 1.348   33.631 -5.228  1.00 23.71  ? 26   GLY A C   1 
ATOM   191  O  O   . GLY A 1 25  ? 1.034   33.210 -6.336  1.00 23.89  ? 26   GLY A O   1 
ATOM   192  N  N   . CYS A 1 26  ? 2.454   34.335 -5.003  1.00 23.19  ? 27   CYS A N   1 
ATOM   193  C  CA  . CYS A 1 26  ? 3.383   34.695 -6.064  1.00 22.83  ? 27   CYS A CA  1 
ATOM   194  C  C   . CYS A 1 26  ? 4.627   33.828 -6.150  1.00 23.20  ? 27   CYS A C   1 
ATOM   195  O  O   . CYS A 1 26  ? 5.318   33.845 -7.172  1.00 23.10  ? 27   CYS A O   1 
ATOM   196  C  CB  . CYS A 1 26  ? 3.817   36.146 -5.892  1.00 23.42  ? 27   CYS A CB  1 
ATOM   197  S  SG  . CYS A 1 26  ? 2.434   37.312 -6.042  1.00 24.88  ? 27   CYS A SG  1 
ATOM   198  N  N   . TYR A 1 27  ? 4.983   33.019 -5.114  1.00 22.83  ? 28   TYR A N   1 
ATOM   199  C  CA  . TYR A 1 27  ? 6.271   32.228 -5.157  1.00 23.28  ? 28   TYR A CA  1 
ATOM   200  C  C   . TYR A 1 27  ? 6.106   30.696 -5.029  1.00 24.18  ? 28   TYR A C   1 
ATOM   201  O  O   . TYR A 1 27  ? 6.941   29.918 -5.489  1.00 23.85  ? 28   TYR A O   1 
ATOM   202  C  CB  . TYR A 1 27  ? 7.222   32.731 -4.076  1.00 21.74  ? 28   TYR A CB  1 
ATOM   203  C  CG  . TYR A 1 27  ? 7.865   33.994 -4.562  1.00 21.80  ? 28   TYR A CG  1 
ATOM   204  C  CD1 . TYR A 1 27  ? 7.185   35.201 -4.413  1.00 21.02  ? 28   TYR A CD1 1 
ATOM   205  C  CD2 . TYR A 1 27  ? 9.096   34.004 -5.184  1.00 20.89  ? 28   TYR A CD2 1 
ATOM   206  C  CE1 . TYR A 1 27  ? 7.717   36.391 -4.876  1.00 21.91  ? 28   TYR A CE1 1 
ATOM   207  C  CE2 . TYR A 1 27  ? 9.633   35.181 -5.682  1.00 21.96  ? 28   TYR A CE2 1 
ATOM   208  C  CZ  . TYR A 1 27  ? 8.938   36.371 -5.528  1.00 22.18  ? 28   TYR A CZ  1 
ATOM   209  O  OH  . TYR A 1 27  ? 9.462   37.534 -6.043  1.00 23.33  ? 28   TYR A OH  1 
ATOM   210  N  N   . CYS A 1 28  ? 5.002   30.289 -4.408  1.00 24.85  ? 29   CYS A N   1 
ATOM   211  C  CA  . CYS A 1 28  ? 4.632   28.859 -4.261  1.00 27.14  ? 29   CYS A CA  1 
ATOM   212  C  C   . CYS A 1 28  ? 4.069   28.382 -5.573  1.00 30.01  ? 29   CYS A C   1 
ATOM   213  O  O   . CYS A 1 28  ? 2.868   28.464 -5.836  1.00 30.80  ? 29   CYS A O   1 
ATOM   214  C  CB  . CYS A 1 28  ? 3.602   28.650 -3.138  1.00 25.01  ? 29   CYS A CB  1 
ATOM   215  S  SG  . CYS A 1 28  ? 4.042   29.435 -1.551  1.00 22.32  ? 29   CYS A SG  1 
ATOM   216  N  N   . GLY A 1 29  ? 4.968   27.904 -6.388  1.00 32.37  ? 30   GLY A N   1 
ATOM   217  C  CA  . GLY A 1 29  ? 4.671   27.468 -7.722  1.00 35.71  ? 30   GLY A CA  1 
ATOM   218  C  C   . GLY A 1 29  ? 5.861   27.796 -8.626  1.00 37.81  ? 30   GLY A C   1 
ATOM   219  O  O   . GLY A 1 29  ? 6.970   28.025 -8.148  1.00 38.25  ? 30   GLY A O   1 
ATOM   220  N  N   . TRP A 1 30  ? 5.637   27.796 -9.930  1.00 40.22  ? 31   TRP A N   1 
ATOM   221  C  CA  . TRP A 1 30  ? 6.727   28.031 -10.887 1.00 41.75  ? 31   TRP A CA  1 
ATOM   222  C  C   . TRP A 1 30  ? 7.316   29.419 -10.809 1.00 41.53  ? 31   TRP A C   1 
ATOM   223  O  O   . TRP A 1 30  ? 6.590   30.412 -10.873 1.00 42.01  ? 31   TRP A O   1 
ATOM   224  C  CB  . TRP A 1 30  ? 6.237   27.796 -12.304 1.00 44.29  ? 31   TRP A CB  1 
ATOM   225  C  CG  . TRP A 1 30  ? 7.343   27.408 -13.243 1.00 46.47  ? 31   TRP A CG  1 
ATOM   226  C  CD1 . TRP A 1 30  ? 8.352   28.206 -13.710 1.00 47.46  ? 31   TRP A CD1 1 
ATOM   227  C  CD2 . TRP A 1 30  ? 7.557   26.114 -13.815 1.00 47.69  ? 31   TRP A CD2 1 
ATOM   228  N  NE1 . TRP A 1 30  ? 9.181   27.485 -14.540 1.00 48.20  ? 31   TRP A NE1 1 
ATOM   229  C  CE2 . TRP A 1 30  ? 8.715   26.198 -14.621 1.00 48.12  ? 31   TRP A CE2 1 
ATOM   230  C  CE3 . TRP A 1 30  ? 6.881   24.888 -13.724 1.00 48.23  ? 31   TRP A CE3 1 
ATOM   231  C  CZ2 . TRP A 1 30  ? 9.214   25.101 -15.334 1.00 48.69  ? 31   TRP A CZ2 1 
ATOM   232  C  CZ3 . TRP A 1 30  ? 7.376   23.796 -14.431 1.00 48.64  ? 31   TRP A CZ3 1 
ATOM   233  C  CH2 . TRP A 1 30  ? 8.533   23.911 -15.227 1.00 48.94  ? 31   TRP A CH2 1 
ATOM   234  N  N   . GLY A 1 31  ? 8.631   29.506 -10.674 1.00 41.27  ? 32   GLY A N   1 
ATOM   235  C  CA  . GLY A 1 31  ? 9.311   30.776 -10.591 1.00 40.66  ? 32   GLY A CA  1 
ATOM   236  C  C   . GLY A 1 31  ? 8.713   31.648 -9.493  1.00 40.10  ? 32   GLY A C   1 
ATOM   237  O  O   . GLY A 1 31  ? 8.300   31.137 -8.453  1.00 39.77  ? 32   GLY A O   1 
ATOM   238  N  N   . GLY A 1 32  ? 8.684   32.949 -9.740  1.00 39.75  ? 33   GLY A N   1 
ATOM   239  C  CA  . GLY A 1 32  ? 8.138   33.874 -8.803  1.00 39.08  ? 33   GLY A CA  1 
ATOM   240  C  C   . GLY A 1 32  ? 8.541   35.295 -9.186  1.00 38.73  ? 33   GLY A C   1 
ATOM   241  O  O   . GLY A 1 32  ? 9.620   35.506 -9.741  1.00 39.01  ? 33   GLY A O   1 
ATOM   242  N  N   . LYS A 1 33  ? 7.677   36.248 -8.909  1.00 38.15  ? 34   LYS A N   1 
ATOM   243  C  CA  . LYS A 1 33  ? 7.899   37.662 -9.180  1.00 37.96  ? 34   LYS A CA  1 
ATOM   244  C  C   . LYS A 1 33  ? 7.135   38.441 -8.154  1.00 36.59  ? 34   LYS A C   1 
ATOM   245  O  O   . LYS A 1 33  ? 6.277   37.894 -7.473  1.00 36.02  ? 34   LYS A O   1 
ATOM   246  C  CB  . LYS A 1 33  ? 7.404   38.059 -10.573 1.00 39.64  ? 34   LYS A CB  1 
ATOM   247  C  CG  . LYS A 1 33  ? 8.275   37.592 -11.730 1.00 41.98  ? 34   LYS A CG  1 
ATOM   248  C  CD  . LYS A 1 33  ? 7.810   38.207 -13.038 1.00 43.45  ? 34   LYS A CD  1 
ATOM   249  C  CE  . LYS A 1 33  ? 8.740   37.869 -14.197 1.00 43.99  ? 34   LYS A CE  1 
ATOM   250  N  NZ  . LYS A 1 33  ? 8.350   38.570 -15.453 1.00 45.06  ? 34   LYS A NZ  1 
ATOM   251  N  N   . GLY A 1 34  ? 7.457   39.719 -8.019  1.00 35.30  ? 35   GLY A N   1 
ATOM   252  C  CA  . GLY A 1 34  ? 6.738   40.567 -7.093  1.00 34.38  ? 35   GLY A CA  1 
ATOM   253  C  C   . GLY A 1 34  ? 6.972   40.322 -5.618  1.00 33.36  ? 35   GLY A C   1 
ATOM   254  O  O   . GLY A 1 34  ? 7.914   39.638 -5.218  1.00 33.35  ? 35   GLY A O   1 
ATOM   255  N  N   . THR A 1 35  ? 6.087   40.895 -4.812  1.00 32.60  ? 36   THR A N   1 
ATOM   256  C  CA  . THR A 1 35  ? 6.146   40.799 -3.363  1.00 31.91  ? 36   THR A CA  1 
ATOM   257  C  C   . THR A 1 35  ? 5.278   39.661 -2.835  1.00 30.90  ? 36   THR A C   1 
ATOM   258  O  O   . THR A 1 35  ? 4.122   39.512 -3.241  1.00 30.57  ? 36   THR A O   1 
ATOM   259  C  CB  . THR A 1 35  ? 5.654   42.108 -2.727  1.00 32.50  ? 36   THR A CB  1 
ATOM   260  O  OG1 . THR A 1 35  ? 6.274   43.216 -3.390  1.00 33.83  ? 36   THR A OG1 1 
ATOM   261  C  CG2 . THR A 1 35  ? 6.002   42.149 -1.244  1.00 33.47  ? 36   THR A CG2 1 
ATOM   262  N  N   . PRO A 1 36  ? 5.827   38.836 -1.927  1.00 29.74  ? 37   PRO A N   1 
ATOM   263  C  CA  . PRO A 1 36  ? 5.052   37.725 -1.367  1.00 28.77  ? 37   PRO A CA  1 
ATOM   264  C  C   . PRO A 1 36  ? 3.766   38.270 -0.746  1.00 28.30  ? 37   PRO A C   1 
ATOM   265  O  O   . PRO A 1 36  ? 3.790   39.272 -0.030  1.00 27.32  ? 37   PRO A O   1 
ATOM   266  C  CB  . PRO A 1 36  ? 6.002   37.133 -0.330  1.00 28.73  ? 37   PRO A CB  1 
ATOM   267  C  CG  . PRO A 1 36  ? 7.350   37.349 -0.972  1.00 29.10  ? 37   PRO A CG  1 
ATOM   268  C  CD  . PRO A 1 36  ? 7.232   38.778 -1.482  1.00 29.60  ? 37   PRO A CD  1 
ATOM   269  N  N   . LYS A 1 37  ? 2.653   37.600 -1.022  1.00 27.32  ? 38   LYS A N   1 
ATOM   270  C  CA  . LYS A 1 37  ? 1.343   38.016 -0.537  1.00 26.57  ? 38   LYS A CA  1 
ATOM   271  C  C   . LYS A 1 37  ? 1.124   37.889 0.970   1.00 25.53  ? 38   LYS A C   1 
ATOM   272  O  O   . LYS A 1 37  ? 0.389   38.682 1.560   1.00 25.05  ? 38   LYS A O   1 
ATOM   273  C  CB  . LYS A 1 37  ? 0.260   37.230 -1.277  1.00 27.44  ? 38   LYS A CB  1 
ATOM   274  C  CG  . LYS A 1 37  ? 0.307   37.372 -2.798  1.00 28.56  ? 38   LYS A CG  1 
ATOM   275  C  CD  . LYS A 1 37  ? -0.415  38.625 -3.285  1.00 30.46  ? 38   LYS A CD  1 
ATOM   276  C  CE  . LYS A 1 37  ? 0.271   39.910 -2.872  1.00 31.36  ? 38   LYS A CE  1 
ATOM   277  N  NZ  . LYS A 1 37  ? -0.541  41.113 -3.225  1.00 32.46  ? 38   LYS A NZ  1 
ATOM   278  N  N   . ASP A 1 38  ? 1.745   36.890 1.588   1.00 23.77  ? 39   ASP A N   1 
ATOM   279  C  CA  . ASP A 1 38  ? 1.592   36.686 3.023   1.00 22.36  ? 39   ASP A CA  1 
ATOM   280  C  C   . ASP A 1 38  ? 2.715   35.808 3.574   1.00 21.77  ? 39   ASP A C   1 
ATOM   281  O  O   . ASP A 1 38  ? 3.668   35.485 2.857   1.00 21.07  ? 39   ASP A O   1 
ATOM   282  C  CB  . ASP A 1 38  ? 0.227   36.052 3.320   1.00 22.15  ? 39   ASP A CB  1 
ATOM   283  C  CG  . ASP A 1 38  ? 0.089   34.663 2.735   1.00 22.42  ? 39   ASP A CG  1 
ATOM   284  O  OD1 . ASP A 1 38  ? 1.026   34.222 2.037   1.00 22.33  ? 39   ASP A OD1 1 
ATOM   285  O  OD2 . ASP A 1 38  ? -0.953  34.013 2.973   1.00 21.98  ? 39   ASP A OD2 1 
ATOM   286  N  N   . ALA A 1 39  ? 2.597   35.428 4.844   1.00 19.92  ? 40   ALA A N   1 
ATOM   287  C  CA  . ALA A 1 39  ? 3.608   34.603 5.500   1.00 19.31  ? 40   ALA A CA  1 
ATOM   288  C  C   . ALA A 1 39  ? 3.897   33.304 4.745   1.00 18.43  ? 40   ALA A C   1 
ATOM   289  O  O   . ALA A 1 39  ? 5.053   32.949 4.542   1.00 18.21  ? 40   ALA A O   1 
ATOM   290  C  CB  . ALA A 1 39  ? 3.181   34.293 6.932   1.00 18.65  ? 40   ALA A CB  1 
ATOM   291  N  N   . THR A 1 40  ? 2.847   32.594 4.344   1.00 18.16  ? 41   THR A N   1 
ATOM   292  C  CA  . THR A 1 40  ? 3.012   31.343 3.604   1.00 17.74  ? 41   THR A CA  1 
ATOM   293  C  C   . THR A 1 40  ? 3.746   31.559 2.283   1.00 17.47  ? 41   THR A C   1 
ATOM   294  O  O   . THR A 1 40  ? 4.602   30.760 1.907   1.00 16.96  ? 41   THR A O   1 
ATOM   295  C  CB  . THR A 1 40  ? 1.654   30.679 3.321   1.00 17.59  ? 41   THR A CB  1 
ATOM   296  O  OG1 . THR A 1 40  ? 1.108   30.192 4.548   1.00 18.07  ? 41   THR A OG1 1 
ATOM   297  C  CG2 . THR A 1 40  ? 1.809   29.518 2.342   1.00 17.94  ? 41   THR A CG2 1 
ATOM   298  N  N   . ASP A 1 41  ? 3.412   32.642 1.590   1.00 17.44  ? 42   ASP A N   1 
ATOM   299  C  CA  . ASP A 1 41  ? 4.050   32.964 0.321   1.00 18.28  ? 42   ASP A CA  1 
ATOM   300  C  C   . ASP A 1 41  ? 5.506   33.357 0.584   1.00 18.85  ? 42   ASP A C   1 
ATOM   301  O  O   . ASP A 1 41  ? 6.377   33.154 -0.267  1.00 17.68  ? 42   ASP A O   1 
ATOM   302  C  CB  . ASP A 1 41  ? 3.293   34.110 -0.372  1.00 18.54  ? 42   ASP A CB  1 
ATOM   303  C  CG  . ASP A 1 41  ? 3.546   34.168 -1.874  1.00 18.90  ? 42   ASP A CG  1 
ATOM   304  O  OD1 . ASP A 1 41  ? 4.063   33.183 -2.448  1.00 19.42  ? 42   ASP A OD1 1 
ATOM   305  O  OD2 . ASP A 1 41  ? 3.215   35.201 -2.489  1.00 19.31  ? 42   ASP A OD2 1 
ATOM   306  N  N   . ARG A 1 42  ? 5.769   33.923 1.764   1.00 19.36  ? 43   ARG A N   1 
ATOM   307  C  CA  . ARG A 1 42  ? 7.133   34.305 2.110   1.00 19.99  ? 43   ARG A CA  1 
ATOM   308  C  C   . ARG A 1 42  ? 7.953   33.036 2.326   1.00 19.11  ? 43   ARG A C   1 
ATOM   309  O  O   . ARG A 1 42  ? 9.140   33.001 2.022   1.00 19.51  ? 43   ARG A O   1 
ATOM   310  C  CB  . ARG A 1 42  ? 7.170   35.194 3.368   1.00 21.24  ? 43   ARG A CB  1 
ATOM   311  C  CG  . ARG A 1 42  ? 6.753   36.644 3.109   1.00 24.40  ? 43   ARG A CG  1 
ATOM   312  C  CD  . ARG A 1 42  ? 7.168   37.580 4.252   1.00 26.41  ? 43   ARG A CD  1 
ATOM   313  N  NE  . ARG A 1 42  ? 6.300   37.489 5.426   1.00 28.08  ? 43   ARG A NE  1 
ATOM   314  C  CZ  . ARG A 1 42  ? 5.065   37.985 5.487   1.00 29.73  ? 43   ARG A CZ  1 
ATOM   315  N  NH1 . ARG A 1 42  ? 4.544   38.609 4.437   1.00 30.36  ? 43   ARG A NH1 1 
ATOM   316  N  NH2 . ARG A 1 42  ? 4.352   37.871 6.600   1.00 29.51  ? 43   ARG A NH2 1 
ATOM   317  N  N   . CYS A 1 43  ? 7.315   31.990 2.844   1.00 18.85  ? 44   CYS A N   1 
ATOM   318  C  CA  . CYS A 1 43  ? 8.004   30.722 3.054   1.00 18.43  ? 44   CYS A CA  1 
ATOM   319  C  C   . CYS A 1 43  ? 8.520   30.198 1.719   1.00 18.34  ? 44   CYS A C   1 
ATOM   320  O  O   . CYS A 1 43  ? 9.637   29.692 1.635   1.00 18.15  ? 44   CYS A O   1 
ATOM   321  C  CB  . CYS A 1 43  ? 7.064   29.666 3.636   1.00 19.03  ? 44   CYS A CB  1 
ATOM   322  S  SG  . CYS A 1 43  ? 6.406   29.934 5.309   1.00 20.06  ? 44   CYS A SG  1 
ATOM   323  N  N   . CYS A 1 44  ? 7.691   30.299 0.680   1.00 18.66  ? 45   CYS A N   1 
ATOM   324  C  CA  . CYS A 1 44  ? 8.074   29.828 -0.647  1.00 18.50  ? 45   CYS A CA  1 
ATOM   325  C  C   . CYS A 1 44  ? 9.158   30.720 -1.243  1.00 18.64  ? 45   CYS A C   1 
ATOM   326  O  O   . CYS A 1 44  ? 10.041  30.248 -1.961  1.00 18.22  ? 45   CYS A O   1 
ATOM   327  C  CB  . CYS A 1 44  ? 6.849   29.775 -1.567  1.00 19.33  ? 45   CYS A CB  1 
ATOM   328  S  SG  . CYS A 1 44  ? 5.605   28.578 -0.993  1.00 20.68  ? 45   CYS A SG  1 
ATOM   329  N  N   . PHE A 1 45  ? 9.097   32.010 -0.938  1.00 18.36  ? 46   PHE A N   1 
ATOM   330  C  CA  . PHE A 1 45  ? 10.102  32.945 -1.432  1.00 19.06  ? 46   PHE A CA  1 
ATOM   331  C  C   . PHE A 1 45  ? 11.468  32.531 -0.881  1.00 18.07  ? 46   PHE A C   1 
ATOM   332  O  O   . PHE A 1 45  ? 12.437  32.400 -1.628  1.00 18.50  ? 46   PHE A O   1 
ATOM   333  C  CB  . PHE A 1 45  ? 9.790   34.370 -0.970  1.00 19.56  ? 46   PHE A CB  1 
ATOM   334  C  CG  . PHE A 1 45  ? 10.861  35.356 -1.326  1.00 21.18  ? 46   PHE A CG  1 
ATOM   335  C  CD1 . PHE A 1 45  ? 11.045  35.750 -2.645  1.00 20.93  ? 46   PHE A CD1 1 
ATOM   336  C  CD2 . PHE A 1 45  ? 11.730  35.840 -0.352  1.00 21.35  ? 46   PHE A CD2 1 
ATOM   337  C  CE1 . PHE A 1 45  ? 12.085  36.608 -2.994  1.00 21.80  ? 46   PHE A CE1 1 
ATOM   338  C  CE2 . PHE A 1 45  ? 12.773  36.700 -0.693  1.00 21.97  ? 46   PHE A CE2 1 
ATOM   339  C  CZ  . PHE A 1 45  ? 12.950  37.082 -2.016  1.00 21.58  ? 46   PHE A CZ  1 
ATOM   340  N  N   . VAL A 1 46  ? 11.538  32.335 0.432   1.00 17.45  ? 47   VAL A N   1 
ATOM   341  C  CA  . VAL A 1 46  ? 12.778  31.922 1.077   1.00 16.98  ? 47   VAL A CA  1 
ATOM   342  C  C   . VAL A 1 46  ? 13.233  30.555 0.553   1.00 16.71  ? 47   VAL A C   1 
ATOM   343  O  O   . VAL A 1 46  ? 14.420  30.334 0.341   1.00 16.27  ? 47   VAL A O   1 
ATOM   344  C  CB  . VAL A 1 46  ? 12.608  31.863 2.607   1.00 17.61  ? 47   VAL A CB  1 
ATOM   345  C  CG1 . VAL A 1 46  ? 13.857  31.279 3.254   1.00 16.89  ? 47   VAL A CG1 1 
ATOM   346  C  CG2 . VAL A 1 46  ? 12.334  33.265 3.147   1.00 16.88  ? 47   VAL A CG2 1 
ATOM   347  N  N   . HIS A 1 47  ? 12.282  29.647 0.340   1.00 16.06  ? 48   HIS A N   1 
ATOM   348  C  CA  . HIS A 1 47  ? 12.581  28.314 -0.180  1.00 15.63  ? 48   HIS A CA  1 
ATOM   349  C  C   . HIS A 1 47  ? 13.183  28.440 -1.584  1.00 15.83  ? 48   HIS A C   1 
ATOM   350  O  O   . HIS A 1 47  ? 14.160  27.759 -1.898  1.00 15.43  ? 48   HIS A O   1 
ATOM   351  C  CB  . HIS A 1 47  ? 11.294  27.497 -0.212  1.00 15.41  ? 48   HIS A CB  1 
ATOM   352  C  CG  . HIS A 1 47  ? 11.516  26.044 -0.629  1.00 15.70  ? 48   HIS A CG  1 
ATOM   353  N  ND1 . HIS A 1 47  ? 11.140  25.563 -1.866  1.00 14.97  ? 48   HIS A ND1 1 
ATOM   354  C  CD2 . HIS A 1 47  ? 12.093  25.003 0.022   1.00 14.96  ? 48   HIS A CD2 1 
ATOM   355  C  CE1 . HIS A 1 47  ? 11.474  24.286 -1.958  1.00 15.80  ? 48   HIS A CE1 1 
ATOM   356  N  NE2 . HIS A 1 47  ? 12.053  23.922 -0.827  1.00 15.25  ? 48   HIS A NE2 1 
ATOM   357  N  N   . ASP A 1 48  ? 12.550  29.292 -2.411  1.00 16.10  ? 49   ASP A N   1 
ATOM   358  C  CA  . ASP A 1 48  ? 13.044  29.559 -3.762  1.00 17.08  ? 49   ASP A CA  1 
ATOM   359  C  C   . ASP A 1 48  ? 14.528  30.038 -3.696  1.00 17.26  ? 49   ASP A C   1 
ATOM   360  O  O   . ASP A 1 48  ? 15.374  29.624 -4.491  1.00 17.03  ? 49   ASP A O   1 
ATOM   361  C  CB  . ASP A 1 48  ? 12.188  30.628 -4.456  1.00 18.68  ? 49   ASP A CB  1 
ATOM   362  C  CG  . ASP A 1 48  ? 10.976  30.133 -5.214  1.00 20.80  ? 49   ASP A CG  1 
ATOM   363  O  OD1 . ASP A 1 48  ? 10.549  28.993 -4.959  1.00 21.99  ? 49   ASP A OD1 1 
ATOM   364  O  OD2 . ASP A 1 48  ? 10.446  30.879 -6.062  1.00 21.61  ? 49   ASP A OD2 1 
ATOM   365  N  N   . CYS A 1 49  ? 14.833  30.963 -2.728  1.00 17.22  ? 50   CYS A N   1 
ATOM   366  C  CA  . CYS A 1 49  ? 16.167  31.545 -2.515  1.00 18.22  ? 50   CYS A CA  1 
ATOM   367  C  C   . CYS A 1 49  ? 17.124  30.470 -2.021  1.00 17.81  ? 50   CYS A C   1 
ATOM   368  O  O   . CYS A 1 49  ? 18.301  30.455 -2.384  1.00 17.78  ? 50   CYS A O   1 
ATOM   369  C  CB  . CYS A 1 49  ? 16.118  32.665 -1.481  1.00 19.54  ? 50   CYS A CB  1 
ATOM   370  S  SG  . CYS A 1 49  ? 15.257  34.173 -2.034  1.00 22.41  ? 50   CYS A SG  1 
ATOM   371  N  N   . CYS A 1 50  ? 16.616  29.574 -1.183  1.00 17.08  ? 51   CYS A N   1 
ATOM   372  C  CA  . CYS A 1 50  ? 17.437  28.505 -0.647  1.00 17.25  ? 51   CYS A CA  1 
ATOM   373  C  C   . CYS A 1 50  ? 17.924  27.606 -1.791  1.00 17.94  ? 51   CYS A C   1 
ATOM   374  O  O   . CYS A 1 50  ? 19.098  27.243 -1.846  1.00 18.71  ? 51   CYS A O   1 
ATOM   375  C  CB  . CYS A 1 50  ? 16.637  27.704 0.377   1.00 16.21  ? 51   CYS A CB  1 
ATOM   376  S  SG  . CYS A 1 50  ? 17.620  26.658 1.499   1.00 15.82  ? 51   CYS A SG  1 
ATOM   377  N  N   . TYR A 1 51  ? 17.017  27.246 -2.696  1.00 18.51  ? 52   TYR A N   1 
ATOM   378  C  CA  . TYR A 1 51  ? 17.368  26.422 -3.851  1.00 19.06  ? 52   TYR A CA  1 
ATOM   379  C  C   . TYR A 1 51  ? 18.333  27.215 -4.731  1.00 19.86  ? 52   TYR A C   1 
ATOM   380  O  O   . TYR A 1 51  ? 19.255  26.654 -5.325  1.00 19.79  ? 52   TYR A O   1 
ATOM   381  C  CB  . TYR A 1 51  ? 16.122  26.081 -4.680  1.00 18.59  ? 52   TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 51  ? 15.342  24.868 -4.220  1.00 17.27  ? 52   TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 51  ? 15.646  24.216 -3.024  1.00 17.43  ? 52   TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 51  ? 14.297  24.367 -4.993  1.00 18.33  ? 52   TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 51  ? 14.926  23.091 -2.611  1.00 17.23  ? 52   TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 51  ? 13.571  23.245 -4.593  1.00 17.30  ? 52   TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 51  ? 13.889  22.616 -3.405  1.00 17.37  ? 52   TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 51  ? 13.151  21.523 -3.011  1.00 18.87  ? 52   TYR A OH  1 
ATOM   389  N  N   . GLY A 1 52  ? 18.092  28.521 -4.815  1.00 20.33  ? 53   GLY A N   1 
ATOM   390  C  CA  . GLY A 1 52  ? 18.931  29.397 -5.618  1.00 21.88  ? 53   GLY A CA  1 
ATOM   391  C  C   . GLY A 1 52  ? 20.393  29.434 -5.204  1.00 22.63  ? 53   GLY A C   1 
ATOM   392  O  O   . GLY A 1 52  ? 21.253  29.797 -6.008  1.00 23.01  ? 53   GLY A O   1 
ATOM   393  N  N   . ASN A 1 53  ? 20.685  29.076 -3.957  1.00 23.67  ? 54   ASN A N   1 
ATOM   394  C  CA  . ASN A 1 53  ? 22.067  29.061 -3.481  1.00 25.03  ? 54   ASN A CA  1 
ATOM   395  C  C   . ASN A 1 53  ? 22.740  27.741 -3.869  1.00 24.65  ? 54   ASN A C   1 
ATOM   396  O  O   . ASN A 1 53  ? 23.908  27.527 -3.558  1.00 24.96  ? 54   ASN A O   1 
ATOM   397  C  CB  . ASN A 1 53  ? 22.140  29.202 -1.952  1.00 27.30  ? 54   ASN A CB  1 
ATOM   398  C  CG  . ASN A 1 53  ? 21.631  30.541 -1.451  1.00 30.03  ? 54   ASN A CG  1 
ATOM   399  O  OD1 . ASN A 1 53  ? 21.853  31.580 -2.075  1.00 31.87  ? 54   ASN A OD1 1 
ATOM   400  N  ND2 . ASN A 1 53  ? 20.958  30.525 -0.300  1.00 30.47  ? 54   ASN A ND2 1 
ATOM   401  N  N   . LEU A 1 54  ? 21.998  26.860 -4.539  1.00 24.42  ? 55   LEU A N   1 
ATOM   402  C  CA  . LEU A 1 54  ? 22.519  25.548 -4.952  1.00 24.54  ? 55   LEU A CA  1 
ATOM   403  C  C   . LEU A 1 54  ? 22.483  25.401 -6.477  1.00 24.18  ? 55   LEU A C   1 
ATOM   404  O  O   . LEU A 1 54  ? 21.788  24.537 -7.009  1.00 23.99  ? 55   LEU A O   1 
ATOM   405  C  CB  . LEU A 1 54  ? 21.675  24.436 -4.313  1.00 23.77  ? 55   LEU A CB  1 
ATOM   406  C  CG  . LEU A 1 54  ? 21.373  24.588 -2.818  1.00 24.16  ? 55   LEU A CG  1 
ATOM   407  C  CD1 . LEU A 1 54  ? 20.363  23.533 -2.379  1.00 23.80  ? 55   LEU A CD1 1 
ATOM   408  C  CD2 . LEU A 1 54  ? 22.660  24.467 -2.019  1.00 24.11  ? 55   LEU A CD2 1 
ATOM   409  N  N   . PRO A 1 55  ? 23.378  26.171 -7.131  1.00 24.84  ? 56   PRO A N   1 
ATOM   410  C  CA  . PRO A 1 55  ? 23.496  26.218 -8.629  1.00 25.25  ? 56   PRO A CA  1 
ATOM   411  C  C   . PRO A 1 55  ? 23.638  24.912 -9.351  1.00 25.10  ? 56   PRO A C   1 
ATOM   412  O  O   . PRO A 1 55  ? 22.976  24.615 -10.346 1.00 25.38  ? 56   PRO A O   1 
ATOM   413  C  CB  . PRO A 1 55  ? 24.632  27.180 -8.840  1.00 25.69  ? 56   PRO A CB  1 
ATOM   414  C  CG  . PRO A 1 55  ? 24.372  28.167 -7.738  1.00 26.32  ? 56   PRO A CG  1 
ATOM   415  C  CD  . PRO A 1 55  ? 23.652  27.500 -6.611  1.00 25.55  ? 56   PRO A CD  1 
ATOM   416  N  N   . ASP A 1 56  ? 24.604  24.120 -8.830  1.00 24.74  ? 59   ASP A N   1 
ATOM   417  C  CA  . ASP A 1 56  ? 24.989  22.851 -9.430  1.00 24.58  ? 59   ASP A CA  1 
ATOM   418  C  C   . ASP A 1 56  ? 24.157  21.646 -8.961  1.00 23.73  ? 59   ASP A C   1 
ATOM   419  O  O   . ASP A 1 56  ? 24.317  20.527 -9.478  1.00 23.98  ? 59   ASP A O   1 
ATOM   420  C  CB  . ASP A 1 56  ? 26.509  22.712 -9.339  1.00 26.23  ? 59   ASP A CB  1 
ATOM   421  C  CG  . ASP A 1 56  ? 27.219  23.715 -10.241 1.00 27.40  ? 59   ASP A CG  1 
ATOM   422  O  OD1 . ASP A 1 56  ? 28.382  24.031 -9.978  1.00 28.79  ? 59   ASP A OD1 1 
ATOM   423  O  OD2 . ASP A 1 56  ? 26.587  24.176 -11.221 1.00 27.23  ? 59   ASP A OD2 1 
ATOM   424  N  N   . CYS A 1 57  ? 23.223  21.849 -8.027  1.00 21.90  ? 61   CYS A N   1 
ATOM   425  C  CA  . CYS A 1 57  ? 22.382  20.747 -7.579  1.00 20.58  ? 61   CYS A CA  1 
ATOM   426  C  C   . CYS A 1 57  ? 21.087  20.679 -8.370  1.00 20.82  ? 61   CYS A C   1 
ATOM   427  O  O   . CYS A 1 57  ? 20.782  21.589 -9.139  1.00 21.16  ? 61   CYS A O   1 
ATOM   428  C  CB  . CYS A 1 57  ? 22.058  20.891 -6.100  1.00 19.27  ? 61   CYS A CB  1 
ATOM   429  S  SG  . CYS A 1 57  ? 23.478  20.604 -4.994  1.00 16.60  ? 61   CYS A SG  1 
ATOM   430  N  N   . ASN A 1 58  ? 20.329  19.606 -8.182  1.00 20.80  ? 67   ASN A N   1 
ATOM   431  C  CA  . ASN A 1 58  ? 19.063  19.414 -8.882  1.00 21.45  ? 67   ASN A CA  1 
ATOM   432  C  C   . ASN A 1 58  ? 18.013  19.015 -7.842  1.00 21.68  ? 67   ASN A C   1 
ATOM   433  O  O   . ASN A 1 58  ? 17.682  17.844 -7.709  1.00 21.10  ? 67   ASN A O   1 
ATOM   434  C  CB  . ASN A 1 58  ? 19.229  18.312 -9.932  1.00 22.02  ? 67   ASN A CB  1 
ATOM   435  C  CG  . ASN A 1 58  ? 20.196  18.707 -11.037 1.00 22.79  ? 67   ASN A CG  1 
ATOM   436  O  OD1 . ASN A 1 58  ? 19.789  19.238 -12.068 1.00 23.13  ? 67   ASN A OD1 1 
ATOM   437  N  ND2 . ASN A 1 58  ? 21.486  18.467 -10.815 1.00 22.12  ? 67   ASN A ND2 1 
ATOM   438  N  N   . PRO A 1 59  ? 17.479  20.003 -7.098  1.00 22.76  ? 68   PRO A N   1 
ATOM   439  C  CA  . PRO A 1 59  ? 16.472  19.849 -6.040  1.00 23.10  ? 68   PRO A CA  1 
ATOM   440  C  C   . PRO A 1 59  ? 15.191  19.124 -6.413  1.00 23.54  ? 68   PRO A C   1 
ATOM   441  O  O   . PRO A 1 59  ? 14.603  18.427 -5.590  1.00 23.64  ? 68   PRO A O   1 
ATOM   442  C  CB  . PRO A 1 59  ? 16.200  21.289 -5.612  1.00 23.16  ? 68   PRO A CB  1 
ATOM   443  C  CG  . PRO A 1 59  ? 17.495  21.976 -5.893  1.00 23.60  ? 68   PRO A CG  1 
ATOM   444  C  CD  . PRO A 1 59  ? 17.837  21.425 -7.252  1.00 22.99  ? 68   PRO A CD  1 
ATOM   445  N  N   . LYS A 1 60  ? 14.756  19.299 -7.652  1.00 24.40  ? 69   LYS A N   1 
ATOM   446  C  CA  . LYS A 1 60  ? 13.527  18.677 -8.119  1.00 25.51  ? 69   LYS A CA  1 
ATOM   447  C  C   . LYS A 1 60  ? 13.627  17.170 -8.313  1.00 25.06  ? 69   LYS A C   1 
ATOM   448  O  O   . LYS A 1 60  ? 12.654  16.451 -8.090  1.00 25.38  ? 69   LYS A O   1 
ATOM   449  C  CB  . LYS A 1 60  ? 13.096  19.316 -9.439  1.00 27.04  ? 69   LYS A CB  1 
ATOM   450  C  CG  . LYS A 1 60  ? 11.763  18.824 -9.962  1.00 30.19  ? 69   LYS A CG  1 
ATOM   451  C  CD  . LYS A 1 60  ? 11.544  19.243 -11.413 1.00 31.85  ? 69   LYS A CD  1 
ATOM   452  C  CE  . LYS A 1 60  ? 12.318  18.348 -12.374 1.00 32.79  ? 69   LYS A CE  1 
ATOM   453  N  NZ  . LYS A 1 60  ? 11.759  16.959 -12.414 1.00 33.48  ? 69   LYS A NZ  1 
ATOM   454  N  N   . SER A 1 61  ? 14.805  16.691 -8.699  1.00 23.99  ? 70   SER A N   1 
ATOM   455  C  CA  . SER A 1 61  ? 14.983  15.271 -8.979  1.00 23.63  ? 70   SER A CA  1 
ATOM   456  C  C   . SER A 1 61  ? 15.946  14.468 -8.108  1.00 23.13  ? 70   SER A C   1 
ATOM   457  O  O   . SER A 1 61  ? 15.915  13.235 -8.111  1.00 23.25  ? 70   SER A O   1 
ATOM   458  C  CB  . SER A 1 61  ? 15.395  15.108 -10.444 1.00 23.94  ? 70   SER A CB  1 
ATOM   459  O  OG  . SER A 1 61  ? 16.500  15.932 -10.758 1.00 24.15  ? 70   SER A OG  1 
ATOM   460  N  N   . ASP A 1 62  ? 16.836  15.145 -7.380  1.00 21.93  ? 71   ASP A N   1 
ATOM   461  C  CA  . ASP A 1 62  ? 17.769  14.457 -6.494  1.00 20.74  ? 71   ASP A CA  1 
ATOM   462  C  C   . ASP A 1 62  ? 17.007  14.012 -5.264  1.00 20.97  ? 71   ASP A C   1 
ATOM   463  O  O   . ASP A 1 62  ? 16.361  14.824 -4.593  1.00 19.88  ? 71   ASP A O   1 
ATOM   464  C  CB  . ASP A 1 62  ? 18.951  15.382 -6.155  1.00 19.30  ? 71   ASP A CB  1 
ATOM   465  C  CG  . ASP A 1 62  ? 20.140  14.641 -5.590  1.00 18.30  ? 71   ASP A CG  1 
ATOM   466  O  OD1 . ASP A 1 62  ? 20.012  13.437 -5.322  1.00 17.00  ? 71   ASP A OD1 1 
ATOM   467  O  OD2 . ASP A 1 62  ? 21.209  15.268 -5.418  1.00 17.33  ? 71   ASP A OD2 1 
ATOM   468  N  N   . ARG A 1 63  ? 17.056  12.723 -4.931  1.00 20.76  ? 72   ARG A N   1 
ATOM   469  C  CA  . ARG A 1 63  ? 16.354  12.236 -3.749  1.00 21.60  ? 72   ARG A CA  1 
ATOM   470  C  C   . ARG A 1 63  ? 17.251  12.154 -2.527  1.00 21.03  ? 72   ARG A C   1 
ATOM   471  O  O   . ARG A 1 63  ? 18.396  11.715 -2.610  1.00 20.68  ? 72   ARG A O   1 
ATOM   472  C  CB  . ARG A 1 63  ? 15.734  10.884 -4.040  1.00 23.69  ? 72   ARG A CB  1 
ATOM   473  C  CG  . ARG A 1 63  ? 15.327  10.685 -5.507  1.00 26.70  ? 72   ARG A CG  1 
ATOM   474  C  CD  . ARG A 1 63  ? 13.879  10.204 -5.602  1.00 29.65  ? 72   ARG A CD  1 
ATOM   475  N  NE  . ARG A 1 63  ? 13.707  8.871  -5.038  1.00 31.82  ? 72   ARG A NE  1 
ATOM   476  C  CZ  . ARG A 1 63  ? 12.818  7.989  -5.486  1.00 33.27  ? 72   ARG A CZ  1 
ATOM   477  N  NH1 . ARG A 1 63  ? 12.028  8.298  -6.507  1.00 34.79  ? 72   ARG A NH1 1 
ATOM   478  N  NH2 . ARG A 1 63  ? 12.713  6.800  -4.911  1.00 33.67  ? 72   ARG A NH2 1 
ATOM   479  N  N   . TYR A 1 64  ? 16.721  12.589 -1.389  1.00 20.52  ? 73   TYR A N   1 
ATOM   480  C  CA  . TYR A 1 64  ? 17.455  12.530 -0.135  1.00 20.62  ? 73   TYR A CA  1 
ATOM   481  C  C   . TYR A 1 64  ? 16.663  11.679 0.843   1.00 21.08  ? 73   TYR A C   1 
ATOM   482  O  O   . TYR A 1 64  ? 15.534  11.272 0.560   1.00 20.50  ? 73   TYR A O   1 
ATOM   483  C  CB  . TYR A 1 64  ? 17.687  13.939 0.434   1.00 20.66  ? 73   TYR A CB  1 
ATOM   484  C  CG  . TYR A 1 64  ? 16.440  14.780 0.641   1.00 19.14  ? 73   TYR A CG  1 
ATOM   485  C  CD1 . TYR A 1 64  ? 15.629  14.604 1.765   1.00 18.81  ? 73   TYR A CD1 1 
ATOM   486  C  CD2 . TYR A 1 64  ? 16.077  15.759 -0.283  1.00 18.97  ? 73   TYR A CD2 1 
ATOM   487  C  CE1 . TYR A 1 64  ? 14.489  15.385 1.963   1.00 17.99  ? 73   TYR A CE1 1 
ATOM   488  C  CE2 . TYR A 1 64  ? 14.932  16.545 -0.093  1.00 18.56  ? 73   TYR A CE2 1 
ATOM   489  C  CZ  . TYR A 1 64  ? 14.147  16.347 1.033   1.00 18.42  ? 73   TYR A CZ  1 
ATOM   490  O  OH  . TYR A 1 64  ? 13.007  17.100 1.214   1.00 18.92  ? 73   TYR A OH  1 
ATOM   491  N  N   . LYS A 1 65  ? 17.271  11.393 1.985   1.00 22.33  ? 74   LYS A N   1 
ATOM   492  C  CA  . LYS A 1 65  ? 16.628  10.596 3.017   1.00 23.08  ? 74   LYS A CA  1 
ATOM   493  C  C   . LYS A 1 65  ? 16.468  11.471 4.248   1.00 22.65  ? 74   LYS A C   1 
ATOM   494  O  O   . LYS A 1 65  ? 17.316  12.312 4.536   1.00 22.14  ? 74   LYS A O   1 
ATOM   495  C  CB  . LYS A 1 65  ? 17.495  9.389  3.393   1.00 25.17  ? 74   LYS A CB  1 
ATOM   496  C  CG  . LYS A 1 65  ? 17.860  8.457  2.251   1.00 27.74  ? 74   LYS A CG  1 
ATOM   497  C  CD  . LYS A 1 65  ? 16.680  7.611  1.817   1.00 30.13  ? 74   LYS A CD  1 
ATOM   498  C  CE  . LYS A 1 65  ? 17.125  6.543  0.825   1.00 31.21  ? 74   LYS A CE  1 
ATOM   499  N  NZ  . LYS A 1 65  ? 15.978  5.719  0.362   1.00 32.59  ? 74   LYS A NZ  1 
ATOM   500  N  N   . TYR A 1 66  ? 15.375  11.275 4.968   1.00 23.03  ? 75   TYR A N   1 
ATOM   501  C  CA  . TYR A 1 66  ? 15.136  12.022 6.190   1.00 23.66  ? 75   TYR A CA  1 
ATOM   502  C  C   . TYR A 1 66  ? 14.276  11.139 7.070   1.00 24.54  ? 75   TYR A C   1 
ATOM   503  O  O   . TYR A 1 66  ? 13.573  10.257 6.577   1.00 23.73  ? 75   TYR A O   1 
ATOM   504  C  CB  . TYR A 1 66  ? 14.435  13.359 5.891   1.00 23.02  ? 75   TYR A CB  1 
ATOM   505  C  CG  . TYR A 1 66  ? 12.942  13.284 5.661   1.00 22.53  ? 75   TYR A CG  1 
ATOM   506  C  CD1 . TYR A 1 66  ? 12.050  13.274 6.738   1.00 22.54  ? 75   TYR A CD1 1 
ATOM   507  C  CD2 . TYR A 1 66  ? 12.415  13.253 4.369   1.00 21.84  ? 75   TYR A CD2 1 
ATOM   508  C  CE1 . TYR A 1 66  ? 10.674  13.241 6.534   1.00 21.80  ? 75   TYR A CE1 1 
ATOM   509  C  CE2 . TYR A 1 66  ? 11.036  13.218 4.155   1.00 22.20  ? 75   TYR A CE2 1 
ATOM   510  C  CZ  . TYR A 1 66  ? 10.175  13.214 5.247   1.00 21.76  ? 75   TYR A CZ  1 
ATOM   511  O  OH  . TYR A 1 66  ? 8.814   13.192 5.053   1.00 22.20  ? 75   TYR A OH  1 
ATOM   512  N  N   . LYS A 1 67  ? 14.355  11.360 8.375   1.00 25.65  ? 76   LYS A N   1 
ATOM   513  C  CA  . LYS A 1 67  ? 13.576  10.584 9.318   1.00 27.63  ? 76   LYS A CA  1 
ATOM   514  C  C   . LYS A 1 67  ? 12.992  11.536 10.343  1.00 28.68  ? 76   LYS A C   1 
ATOM   515  O  O   . LYS A 1 67  ? 13.419  12.687 10.444  1.00 28.64  ? 76   LYS A O   1 
ATOM   516  C  CB  . LYS A 1 67  ? 14.465  9.560  10.024  1.00 27.73  ? 76   LYS A CB  1 
ATOM   517  C  CG  . LYS A 1 67  ? 15.608  10.188 10.799  1.00 28.97  ? 76   LYS A CG  1 
ATOM   518  C  CD  . LYS A 1 67  ? 16.418  9.142  11.542  1.00 30.87  ? 76   LYS A CD  1 
ATOM   519  C  CE  . LYS A 1 67  ? 17.580  9.784  12.283  1.00 31.19  ? 76   LYS A CE  1 
ATOM   520  N  NZ  . LYS A 1 67  ? 18.342  8.790  13.083  1.00 32.51  ? 76   LYS A NZ  1 
ATOM   521  N  N   . ARG A 1 68  ? 12.003  11.055 11.087  1.00 30.31  ? 77   ARG A N   1 
ATOM   522  C  CA  . ARG A 1 68  ? 11.380  11.860 12.125  1.00 31.76  ? 77   ARG A CA  1 
ATOM   523  C  C   . ARG A 1 68  ? 11.905  11.308 13.445  1.00 32.74  ? 77   ARG A C   1 
ATOM   524  O  O   . ARG A 1 68  ? 11.923  10.091 13.654  1.00 32.68  ? 77   ARG A O   1 
ATOM   525  C  CB  . ARG A 1 68  ? 9.851   11.715 12.117  1.00 32.14  ? 77   ARG A CB  1 
ATOM   526  C  CG  . ARG A 1 68  ? 9.145   11.715 10.753  1.00 32.69  ? 77   ARG A CG  1 
ATOM   527  C  CD  . ARG A 1 68  ? 9.114   13.066 10.033  1.00 32.53  ? 77   ARG A CD  1 
ATOM   528  N  NE  . ARG A 1 68  ? 8.661   14.172 10.870  1.00 32.25  ? 77   ARG A NE  1 
ATOM   529  C  CZ  . ARG A 1 68  ? 8.091   15.284 10.405  1.00 31.42  ? 77   ARG A CZ  1 
ATOM   530  N  NH1 . ARG A 1 68  ? 7.882   15.448 9.109   1.00 31.17  ? 77   ARG A NH1 1 
ATOM   531  N  NH2 . ARG A 1 68  ? 7.763   16.258 11.237  1.00 31.38  ? 77   ARG A NH2 1 
ATOM   532  N  N   . VAL A 1 69  ? 12.358  12.198 14.319  1.00 33.72  ? 78   VAL A N   1 
ATOM   533  C  CA  . VAL A 1 69  ? 12.839  11.802 15.636  1.00 34.76  ? 78   VAL A CA  1 
ATOM   534  C  C   . VAL A 1 69  ? 11.894  12.494 16.612  1.00 35.37  ? 78   VAL A C   1 
ATOM   535  O  O   . VAL A 1 69  ? 12.153  13.609 17.064  1.00 35.52  ? 78   VAL A O   1 
ATOM   536  C  CB  . VAL A 1 69  ? 14.285  12.267 15.880  1.00 34.83  ? 78   VAL A CB  1 
ATOM   537  C  CG1 . VAL A 1 69  ? 14.717  11.910 17.296  1.00 35.22  ? 78   VAL A CG1 1 
ATOM   538  C  CG2 . VAL A 1 69  ? 15.210  11.607 14.876  1.00 34.90  ? 78   VAL A CG2 1 
ATOM   539  N  N   . ASN A 1 70  ? 10.782  11.826 16.908  1.00 36.30  ? 79   ASN A N   1 
ATOM   540  C  CA  . ASN A 1 70  ? 9.760   12.370 17.796  1.00 36.64  ? 79   ASN A CA  1 
ATOM   541  C  C   . ASN A 1 70  ? 9.215   13.687 17.252  1.00 36.29  ? 79   ASN A C   1 
ATOM   542  O  O   . ASN A 1 70  ? 9.172   14.694 17.959  1.00 37.34  ? 79   ASN A O   1 
ATOM   543  C  CB  . ASN A 1 70  ? 10.331  12.589 19.194  1.00 38.03  ? 79   ASN A CB  1 
ATOM   544  C  CG  . ASN A 1 70  ? 9.832   11.568 20.184  1.00 38.91  ? 79   ASN A CG  1 
ATOM   545  O  OD1 . ASN A 1 70  ? 10.117  10.372 20.060  1.00 39.83  ? 79   ASN A OD1 1 
ATOM   546  N  ND2 . ASN A 1 70  ? 9.069   12.028 21.170  1.00 39.56  ? 79   ASN A ND2 1 
ATOM   547  N  N   . GLY A 1 71  ? 8.799   13.676 15.991  1.00 34.96  ? 80   GLY A N   1 
ATOM   548  C  CA  . GLY A 1 71  ? 8.272   14.887 15.389  1.00 32.99  ? 80   GLY A CA  1 
ATOM   549  C  C   . GLY A 1 71  ? 9.321   15.707 14.652  1.00 31.31  ? 80   GLY A C   1 
ATOM   550  O  O   . GLY A 1 71  ? 9.028   16.296 13.615  1.00 31.62  ? 80   GLY A O   1 
ATOM   551  N  N   . ALA A 1 72  ? 10.543  15.746 15.174  1.00 29.41  ? 81   ALA A N   1 
ATOM   552  C  CA  . ALA A 1 72  ? 11.603  16.522 14.538  1.00 27.84  ? 81   ALA A CA  1 
ATOM   553  C  C   . ALA A 1 72  ? 12.085  15.894 13.234  1.00 26.85  ? 81   ALA A C   1 
ATOM   554  O  O   . ALA A 1 72  ? 12.201  14.673 13.122  1.00 26.19  ? 81   ALA A O   1 
ATOM   555  C  CB  . ALA A 1 72  ? 12.778  16.699 15.498  1.00 27.72  ? 81   ALA A CB  1 
ATOM   556  N  N   . ILE A 1 73  ? 12.358  16.743 12.247  1.00 25.55  ? 82   ILE A N   1 
ATOM   557  C  CA  . ILE A 1 73  ? 12.845  16.285 10.953  1.00 24.82  ? 82   ILE A CA  1 
ATOM   558  C  C   . ILE A 1 73  ? 14.367  16.218 11.019  1.00 24.94  ? 82   ILE A C   1 
ATOM   559  O  O   . ILE A 1 73  ? 15.019  17.180 11.418  1.00 25.28  ? 82   ILE A O   1 
ATOM   560  C  CB  . ILE A 1 73  ? 12.429  17.259 9.815   1.00 24.23  ? 82   ILE A CB  1 
ATOM   561  C  CG1 . ILE A 1 73  ? 10.901  17.336 9.727   1.00 23.83  ? 82   ILE A CG1 1 
ATOM   562  C  CG2 . ILE A 1 73  ? 13.007  16.785 8.481   1.00 23.92  ? 82   ILE A CG2 1 
ATOM   563  C  CD1 . ILE A 1 73  ? 10.377  18.424 8.799   1.00 22.42  ? 82   ILE A CD1 1 
ATOM   564  N  N   . VAL A 1 74  ? 14.929  15.075 10.647  1.00 25.11  ? 83   VAL A N   1 
ATOM   565  C  CA  . VAL A 1 74  ? 16.377  14.898 10.659  1.00 25.25  ? 83   VAL A CA  1 
ATOM   566  C  C   . VAL A 1 74  ? 16.835  14.435 9.278   1.00 24.88  ? 83   VAL A C   1 
ATOM   567  O  O   . VAL A 1 74  ? 16.460  13.353 8.821   1.00 24.95  ? 83   VAL A O   1 
ATOM   568  C  CB  . VAL A 1 74  ? 16.813  13.846 11.707  1.00 26.00  ? 83   VAL A CB  1 
ATOM   569  C  CG1 . VAL A 1 74  ? 18.333  13.725 11.728  1.00 26.66  ? 83   VAL A CG1 1 
ATOM   570  C  CG2 . VAL A 1 74  ? 16.297  14.239 13.088  1.00 27.19  ? 83   VAL A CG2 1 
ATOM   571  N  N   . CYS A 1 75  ? 17.626  15.269 8.611   1.00 24.25  ? 84   CYS A N   1 
ATOM   572  C  CA  . CYS A 1 75  ? 18.138  14.941 7.286   1.00 24.24  ? 84   CYS A CA  1 
ATOM   573  C  C   . CYS A 1 75  ? 19.253  13.905 7.404   1.00 25.11  ? 84   CYS A C   1 
ATOM   574  O  O   . CYS A 1 75  ? 20.213  14.108 8.148   1.00 25.27  ? 84   CYS A O   1 
ATOM   575  C  CB  . CYS A 1 75  ? 18.673  16.204 6.598   1.00 22.18  ? 84   CYS A CB  1 
ATOM   576  S  SG  . CYS A 1 75  ? 17.407  17.439 6.152   1.00 21.16  ? 84   CYS A SG  1 
ATOM   577  N  N   . GLU A 1 76  ? 19.120  12.794 6.683   1.00 26.48  ? 85   GLU A N   1 
ATOM   578  C  CA  . GLU A 1 76  ? 20.133  11.734 6.713   1.00 27.62  ? 85   GLU A CA  1 
ATOM   579  C  C   . GLU A 1 76  ? 21.339  12.142 5.867   1.00 27.53  ? 85   GLU A C   1 
ATOM   580  O  O   . GLU A 1 76  ? 21.220  12.935 4.936   1.00 27.00  ? 85   GLU A O   1 
ATOM   581  C  CB  . GLU A 1 76  ? 19.566  10.420 6.158   1.00 29.11  ? 85   GLU A CB  1 
ATOM   582  C  CG  . GLU A 1 76  ? 18.387  9.815  6.925   1.00 31.74  ? 85   GLU A CG  1 
ATOM   583  C  CD  . GLU A 1 76  ? 18.804  9.018  8.153   1.00 33.26  ? 85   GLU A CD  1 
ATOM   584  O  OE1 . GLU A 1 76  ? 18.033  8.123  8.562   1.00 34.29  ? 85   GLU A OE1 1 
ATOM   585  O  OE2 . GLU A 1 76  ? 19.891  9.285  8.714   1.00 34.38  ? 85   GLU A OE2 1 
ATOM   586  N  N   . LYS A 1 77  ? 22.499  11.586 6.190   1.00 27.15  ? 86   LYS A N   1 
ATOM   587  C  CA  . LYS A 1 77  ? 23.721  11.894 5.460   1.00 27.54  ? 86   LYS A CA  1 
ATOM   588  C  C   . LYS A 1 77  ? 23.701  11.295 4.049   1.00 26.06  ? 86   LYS A C   1 
ATOM   589  O  O   . LYS A 1 77  ? 23.466  10.099 3.872   1.00 25.46  ? 86   LYS A O   1 
ATOM   590  C  CB  . LYS A 1 77  ? 24.932  11.359 6.232   1.00 29.91  ? 86   LYS A CB  1 
ATOM   591  C  CG  . LYS A 1 77  ? 26.271  11.631 5.575   1.00 32.05  ? 86   LYS A CG  1 
ATOM   592  C  CD  . LYS A 1 77  ? 27.390  10.881 6.290   1.00 34.18  ? 86   LYS A CD  1 
ATOM   593  C  CE  . LYS A 1 77  ? 28.758  11.263 5.728   1.00 35.19  ? 86   LYS A CE  1 
ATOM   594  N  NZ  . LYS A 1 77  ? 29.029  12.727 5.889   1.00 36.96  ? 86   LYS A NZ  1 
ATOM   595  N  N   . GLY A 1 78  ? 23.943  12.145 3.055   1.00 24.65  ? 88   GLY A N   1 
ATOM   596  C  CA  . GLY A 1 78  ? 23.974  11.709 1.668   1.00 22.85  ? 88   GLY A CA  1 
ATOM   597  C  C   . GLY A 1 78  ? 25.025  12.534 0.948   1.00 21.90  ? 88   GLY A C   1 
ATOM   598  O  O   . GLY A 1 78  ? 26.076  12.822 1.520   1.00 22.08  ? 88   GLY A O   1 
ATOM   599  N  N   . THR A 1 79  ? 24.773  12.920 -0.299  1.00 20.68  ? 89   THR A N   1 
ATOM   600  C  CA  . THR A 1 79  ? 25.758  13.739 -0.999  1.00 19.56  ? 89   THR A CA  1 
ATOM   601  C  C   . THR A 1 79  ? 25.617  15.169 -0.492  1.00 19.71  ? 89   THR A C   1 
ATOM   602  O  O   . THR A 1 79  ? 24.632  15.508 0.164   1.00 18.13  ? 89   THR A O   1 
ATOM   603  C  CB  . THR A 1 79  ? 25.557  13.723 -2.536  1.00 19.66  ? 89   THR A CB  1 
ATOM   604  O  OG1 . THR A 1 79  ? 24.308  14.340 -2.876  1.00 18.38  ? 89   THR A OG1 1 
ATOM   605  C  CG2 . THR A 1 79  ? 25.575  12.293 -3.053  1.00 19.24  ? 89   THR A CG2 1 
ATOM   606  N  N   . SER A 1 80  ? 26.610  16.001 -0.777  1.00 19.31  ? 90   SER A N   1 
ATOM   607  C  CA  . SER A 1 80  ? 26.566  17.380 -0.337  1.00 20.00  ? 90   SER A CA  1 
ATOM   608  C  C   . SER A 1 80  ? 25.284  18.068 -0.806  1.00 19.07  ? 90   SER A C   1 
ATOM   609  O  O   . SER A 1 80  ? 24.639  18.777 -0.035  1.00 19.32  ? 90   SER A O   1 
ATOM   610  C  CB  . SER A 1 80  ? 27.788  18.135 -0.854  1.00 20.60  ? 90   SER A CB  1 
ATOM   611  O  OG  . SER A 1 80  ? 27.732  19.485 -0.445  1.00 24.80  ? 90   SER A OG  1 
ATOM   612  N  N   . CYS A 1 81  ? 24.917  17.857 -2.067  1.00 18.44  ? 91   CYS A N   1 
ATOM   613  C  CA  . CYS A 1 81  ? 23.702  18.459 -2.620  1.00 18.22  ? 91   CYS A CA  1 
ATOM   614  C  C   . CYS A 1 81  ? 22.453  17.966 -1.900  1.00 17.74  ? 91   CYS A C   1 
ATOM   615  O  O   . CYS A 1 81  ? 21.566  18.751 -1.562  1.00 17.55  ? 91   CYS A O   1 
ATOM   616  C  CB  . CYS A 1 81  ? 23.559  18.134 -4.108  1.00 17.78  ? 91   CYS A CB  1 
ATOM   617  S  SG  . CYS A 1 81  ? 24.424  19.263 -5.245  1.00 17.45  ? 91   CYS A SG  1 
ATOM   618  N  N   . GLU A 1 82  ? 22.381  16.658 -1.692  1.00 16.94  ? 92   GLU A N   1 
ATOM   619  C  CA  . GLU A 1 82  ? 21.239  16.065 -1.009  1.00 17.34  ? 92   GLU A CA  1 
ATOM   620  C  C   . GLU A 1 82  ? 21.073  16.624 0.406   1.00 17.33  ? 92   GLU A C   1 
ATOM   621  O  O   . GLU A 1 82  ? 19.954  16.896 0.831   1.00 17.42  ? 92   GLU A O   1 
ATOM   622  C  CB  . GLU A 1 82  ? 21.391  14.541 -0.991  1.00 16.84  ? 92   GLU A CB  1 
ATOM   623  C  CG  . GLU A 1 82  ? 21.152  13.936 -2.364  1.00 17.00  ? 92   GLU A CG  1 
ATOM   624  C  CD  . GLU A 1 82  ? 21.673  12.526 -2.519  1.00 16.83  ? 92   GLU A CD  1 
ATOM   625  O  OE1 . GLU A 1 82  ? 22.221  11.971 -1.548  1.00 17.05  ? 92   GLU A OE1 1 
ATOM   626  O  OE2 . GLU A 1 82  ? 21.529  11.975 -3.632  1.00 17.81  ? 92   GLU A OE2 1 
ATOM   627  N  N   . ASN A 1 83  ? 22.177  16.809 1.128   1.00 17.11  ? 93   ASN A N   1 
ATOM   628  C  CA  . ASN A 1 83  ? 22.101  17.348 2.484   1.00 17.83  ? 93   ASN A CA  1 
ATOM   629  C  C   . ASN A 1 83  ? 21.534  18.768 2.473   1.00 17.54  ? 93   ASN A C   1 
ATOM   630  O  O   . ASN A 1 83  ? 20.653  19.100 3.259   1.00 16.17  ? 93   ASN A O   1 
ATOM   631  C  CB  . ASN A 1 83  ? 23.480  17.387 3.155   1.00 19.33  ? 93   ASN A CB  1 
ATOM   632  C  CG  . ASN A 1 83  ? 24.127  16.016 3.266   1.00 21.33  ? 93   ASN A CG  1 
ATOM   633  O  OD1 . ASN A 1 83  ? 23.444  14.993 3.341   1.00 21.80  ? 93   ASN A OD1 1 
ATOM   634  N  ND2 . ASN A 1 83  ? 25.461  15.993 3.299   1.00 22.08  ? 93   ASN A ND2 1 
ATOM   635  N  N   . ARG A 1 84  ? 22.044  19.597 1.568   1.00 17.16  ? 94   ARG A N   1 
ATOM   636  C  CA  . ARG A 1 84  ? 21.610  20.982 1.459   1.00 17.72  ? 94   ARG A CA  1 
ATOM   637  C  C   . ARG A 1 84  ? 20.189  21.141 0.926   1.00 17.15  ? 94   ARG A C   1 
ATOM   638  O  O   . ARG A 1 84  ? 19.482  22.073 1.305   1.00 16.82  ? 94   ARG A O   1 
ATOM   639  C  CB  . ARG A 1 84  ? 22.604  21.756 0.590   1.00 19.08  ? 94   ARG A CB  1 
ATOM   640  C  CG  . ARG A 1 84  ? 24.007  21.757 1.186   1.00 21.65  ? 94   ARG A CG  1 
ATOM   641  C  CD  . ARG A 1 84  ? 25.049  22.164 0.156   1.00 23.83  ? 94   ARG A CD  1 
ATOM   642  N  NE  . ARG A 1 84  ? 25.076  23.605 -0.045  1.00 26.36  ? 94   ARG A NE  1 
ATOM   643  C  CZ  . ARG A 1 84  ? 25.715  24.203 -1.044  1.00 27.57  ? 94   ARG A CZ  1 
ATOM   644  N  NH1 . ARG A 1 84  ? 26.378  23.481 -1.939  1.00 27.35  ? 94   ARG A NH1 1 
ATOM   645  N  NH2 . ARG A 1 84  ? 25.691  25.525 -1.144  1.00 28.38  ? 94   ARG A NH2 1 
ATOM   646  N  N   . ILE A 1 85  ? 19.772  20.246 0.040   1.00 16.01  ? 95   ILE A N   1 
ATOM   647  C  CA  . ILE A 1 85  ? 18.418  20.306 -0.503  1.00 15.20  ? 95   ILE A CA  1 
ATOM   648  C  C   . ILE A 1 85  ? 17.455  19.989 0.636   1.00 14.99  ? 95   ILE A C   1 
ATOM   649  O  O   . ILE A 1 85  ? 16.452  20.673 0.844   1.00 14.87  ? 95   ILE A O   1 
ATOM   650  C  CB  . ILE A 1 85  ? 18.214  19.262 -1.639  1.00 15.01  ? 95   ILE A CB  1 
ATOM   651  C  CG1 . ILE A 1 85  ? 19.002  19.681 -2.880  1.00 15.32  ? 95   ILE A CG1 1 
ATOM   652  C  CG2 . ILE A 1 85  ? 16.731  19.123 -1.969  1.00 14.74  ? 95   ILE A CG2 1 
ATOM   653  C  CD1 . ILE A 1 85  ? 19.075  18.595 -3.956  1.00 16.31  ? 95   ILE A CD1 1 
ATOM   654  N  N   . CYS A 1 86  ? 17.773  18.940 1.380   1.00 14.97  ? 96   CYS A N   1 
ATOM   655  C  CA  . CYS A 1 86  ? 16.941  18.531 2.495   1.00 15.51  ? 96   CYS A CA  1 
ATOM   656  C  C   . CYS A 1 86  ? 16.775  19.648 3.539   1.00 15.94  ? 96   CYS A C   1 
ATOM   657  O  O   . CYS A 1 86  ? 15.685  19.830 4.090   1.00 14.79  ? 96   CYS A O   1 
ATOM   658  C  CB  . CYS A 1 86  ? 17.534  17.282 3.146   1.00 16.21  ? 96   CYS A CB  1 
ATOM   659  S  SG  . CYS A 1 86  ? 16.523  16.630 4.511   1.00 17.86  ? 96   CYS A SG  1 
ATOM   660  N  N   . GLU A 1 87  ? 17.852  20.385 3.824   1.00 15.51  ? 97   GLU A N   1 
ATOM   661  C  CA  . GLU A 1 87  ? 17.769  21.474 4.793   1.00 16.42  ? 97   GLU A CA  1 
ATOM   662  C  C   . GLU A 1 87  ? 16.842  22.584 4.280   1.00 16.56  ? 97   GLU A C   1 
ATOM   663  O  O   . GLU A 1 87  ? 16.114  23.195 5.062   1.00 16.41  ? 97   GLU A O   1 
ATOM   664  C  CB  . GLU A 1 87  ? 19.162  22.050 5.101   1.00 17.24  ? 97   GLU A CB  1 
ATOM   665  C  CG  . GLU A 1 87  ? 20.060  21.160 5.984   1.00 19.15  ? 97   GLU A CG  1 
ATOM   666  C  CD  . GLU A 1 87  ? 19.454  20.847 7.351   1.00 20.44  ? 97   GLU A CD  1 
ATOM   667  O  OE1 . GLU A 1 87  ? 18.747  21.709 7.913   1.00 21.01  ? 97   GLU A OE1 1 
ATOM   668  O  OE2 . GLU A 1 87  ? 19.700  19.737 7.881   1.00 21.69  ? 97   GLU A OE2 1 
ATOM   669  N  N   . CYS A 1 88  ? 16.870  22.848 2.975   1.00 15.77  ? 98   CYS A N   1 
ATOM   670  C  CA  . CYS A 1 88  ? 15.991  23.862 2.388   1.00 15.95  ? 98   CYS A CA  1 
ATOM   671  C  C   . CYS A 1 88  ? 14.526  23.471 2.543   1.00 16.11  ? 98   CYS A C   1 
ATOM   672  O  O   . CYS A 1 88  ? 13.679  24.293 2.921   1.00 16.25  ? 98   CYS A O   1 
ATOM   673  C  CB  . CYS A 1 88  ? 16.264  24.033 0.894   1.00 15.84  ? 98   CYS A CB  1 
ATOM   674  S  SG  . CYS A 1 88  ? 17.789  24.922 0.473   1.00 16.67  ? 98   CYS A SG  1 
ATOM   675  N  N   . ASP A 1 89  ? 14.229  22.216 2.222   1.00 15.71  ? 99   ASP A N   1 
ATOM   676  C  CA  . ASP A 1 89  ? 12.866  21.699 2.309   1.00 16.04  ? 99   ASP A CA  1 
ATOM   677  C  C   . ASP A 1 89  ? 12.366  21.651 3.748   1.00 16.67  ? 99   ASP A C   1 
ATOM   678  O  O   . ASP A 1 89  ? 11.238  22.046 4.027   1.00 18.07  ? 99   ASP A O   1 
ATOM   679  C  CB  . ASP A 1 89  ? 12.788  20.295 1.709   1.00 15.50  ? 99   ASP A CB  1 
ATOM   680  C  CG  . ASP A 1 89  ? 13.006  20.281 0.209   1.00 15.25  ? 99   ASP A CG  1 
ATOM   681  O  OD1 . ASP A 1 89  ? 13.076  21.361 -0.412  1.00 16.37  ? 99   ASP A OD1 1 
ATOM   682  O  OD2 . ASP A 1 89  ? 13.102  19.174 -0.354  1.00 15.97  ? 99   ASP A OD2 1 
ATOM   683  N  N   . LYS A 1 90  ? 13.202  21.145 4.650   1.00 17.00  ? 100  LYS A N   1 
ATOM   684  C  CA  . LYS A 1 90  ? 12.854  21.045 6.062   1.00 16.76  ? 100  LYS A CA  1 
ATOM   685  C  C   . LYS A 1 90  ? 12.417  22.410 6.600   1.00 16.40  ? 100  LYS A C   1 
ATOM   686  O  O   . LYS A 1 90  ? 11.422  22.515 7.321   1.00 16.04  ? 100  LYS A O   1 
ATOM   687  C  CB  . LYS A 1 90  ? 14.058  20.533 6.858   1.00 17.39  ? 100  LYS A CB  1 
ATOM   688  C  CG  . LYS A 1 90  ? 13.882  20.601 8.366   1.00 17.74  ? 100  LYS A CG  1 
ATOM   689  C  CD  . LYS A 1 90  ? 15.168  20.206 9.074   1.00 19.38  ? 100  LYS A CD  1 
ATOM   690  C  CE  . LYS A 1 90  ? 15.041  20.361 10.576  1.00 20.30  ? 100  LYS A CE  1 
ATOM   691  N  NZ  . LYS A 1 90  ? 16.317  20.017 11.260  1.00 22.86  ? 100  LYS A NZ  1 
ATOM   692  N  N   . ALA A 1 91  ? 13.168  23.448 6.241   1.00 15.49  ? 101  ALA A N   1 
ATOM   693  C  CA  . ALA A 1 91  ? 12.865  24.809 6.674   1.00 15.67  ? 101  ALA A CA  1 
ATOM   694  C  C   . ALA A 1 91  ? 11.507  25.251 6.136   1.00 15.20  ? 101  ALA A C   1 
ATOM   695  O  O   . ALA A 1 91  ? 10.716  25.862 6.853   1.00 15.35  ? 101  ALA A O   1 
ATOM   696  C  CB  . ALA A 1 91  ? 13.961  25.770 6.193   1.00 15.01  ? 101  ALA A CB  1 
ATOM   697  N  N   . ALA A 1 92  ? 11.238  24.943 4.872   1.00 14.90  ? 102  ALA A N   1 
ATOM   698  C  CA  . ALA A 1 92  ? 9.969   25.311 4.259   1.00 15.15  ? 102  ALA A CA  1 
ATOM   699  C  C   . ALA A 1 92  ? 8.787   24.607 4.946   1.00 16.06  ? 102  ALA A C   1 
ATOM   700  O  O   . ALA A 1 92  ? 7.753   25.232 5.212   1.00 15.22  ? 102  ALA A O   1 
ATOM   701  C  CB  . ALA A 1 92  ? 9.994   24.980 2.766   1.00 15.07  ? 102  ALA A CB  1 
ATOM   702  N  N   . ALA A 1 93  ? 8.938   23.316 5.238   1.00 16.28  ? 103  ALA A N   1 
ATOM   703  C  CA  . ALA A 1 93  ? 7.872   22.555 5.894   1.00 17.48  ? 103  ALA A CA  1 
ATOM   704  C  C   . ALA A 1 93  ? 7.547   23.166 7.256   1.00 18.23  ? 103  ALA A C   1 
ATOM   705  O  O   . ALA A 1 93  ? 6.379   23.315 7.615   1.00 18.27  ? 103  ALA A O   1 
ATOM   706  C  CB  . ALA A 1 93  ? 8.282   21.095 6.064   1.00 17.27  ? 103  ALA A CB  1 
ATOM   707  N  N   . ILE A 1 94  ? 8.587   23.508 8.011   1.00 18.58  ? 104  ILE A N   1 
ATOM   708  C  CA  . ILE A 1 94  ? 8.414   24.117 9.326   1.00 19.11  ? 104  ILE A CA  1 
ATOM   709  C  C   . ILE A 1 94  ? 7.742   25.485 9.173   1.00 18.99  ? 104  ILE A C   1 
ATOM   710  O  O   . ILE A 1 94  ? 6.817   25.822 9.912   1.00 18.85  ? 104  ILE A O   1 
ATOM   711  C  CB  . ILE A 1 94  ? 9.779   24.274 10.037  1.00 19.49  ? 104  ILE A CB  1 
ATOM   712  C  CG1 . ILE A 1 94  ? 10.277  22.898 10.504  1.00 20.81  ? 104  ILE A CG1 1 
ATOM   713  C  CG2 . ILE A 1 94  ? 9.661   25.229 11.220  1.00 19.86  ? 104  ILE A CG2 1 
ATOM   714  C  CD1 . ILE A 1 94  ? 11.720  22.903 11.018  1.00 20.08  ? 104  ILE A CD1 1 
ATOM   715  N  N   . CYS A 1 95  ? 8.205   26.264 8.201   1.00 18.27  ? 105  CYS A N   1 
ATOM   716  C  CA  . CYS A 1 95  ? 7.641   27.584 7.946   1.00 18.59  ? 105  CYS A CA  1 
ATOM   717  C  C   . CYS A 1 95  ? 6.151   27.470 7.596   1.00 19.10  ? 105  CYS A C   1 
ATOM   718  O  O   . CYS A 1 95  ? 5.328   28.248 8.096   1.00 18.32  ? 105  CYS A O   1 
ATOM   719  C  CB  . CYS A 1 95  ? 8.422   28.261 6.820   1.00 18.43  ? 105  CYS A CB  1 
ATOM   720  S  SG  . CYS A 1 95  ? 8.048   30.013 6.496   1.00 19.10  ? 105  CYS A SG  1 
ATOM   721  N  N   . PHE A 1 96  ? 5.798   26.507 6.743   1.00 19.00  ? 106  PHE A N   1 
ATOM   722  C  CA  . PHE A 1 96  ? 4.394   26.310 6.378   1.00 19.94  ? 106  PHE A CA  1 
ATOM   723  C  C   . PHE A 1 96  ? 3.563   25.986 7.624   1.00 21.07  ? 106  PHE A C   1 
ATOM   724  O  O   . PHE A 1 96  ? 2.453   26.496 7.798   1.00 20.90  ? 106  PHE A O   1 
ATOM   725  C  CB  . PHE A 1 96  ? 4.230   25.157 5.375   1.00 19.55  ? 106  PHE A CB  1 
ATOM   726  C  CG  . PHE A 1 96  ? 4.698   25.476 3.985   1.00 19.53  ? 106  PHE A CG  1 
ATOM   727  C  CD1 . PHE A 1 96  ? 4.610   26.769 3.479   1.00 19.42  ? 106  PHE A CD1 1 
ATOM   728  C  CD2 . PHE A 1 96  ? 5.192   24.469 3.163   1.00 19.53  ? 106  PHE A CD2 1 
ATOM   729  C  CE1 . PHE A 1 96  ? 5.007   27.052 2.175   1.00 20.09  ? 106  PHE A CE1 1 
ATOM   730  C  CE2 . PHE A 1 96  ? 5.592   24.741 1.858   1.00 19.36  ? 106  PHE A CE2 1 
ATOM   731  C  CZ  . PHE A 1 96  ? 5.500   26.032 1.362   1.00 20.36  ? 106  PHE A CZ  1 
ATOM   732  N  N   . ARG A 1 97  ? 4.100   25.121 8.477   1.00 22.37  ? 107  ARG A N   1 
ATOM   733  C  CA  . ARG A 1 97  ? 3.421   24.722 9.707   1.00 24.21  ? 107  ARG A CA  1 
ATOM   734  C  C   . ARG A 1 97  ? 3.207   25.901 10.650  1.00 24.77  ? 107  ARG A C   1 
ATOM   735  O  O   . ARG A 1 97  ? 2.145   26.035 11.261  1.00 24.38  ? 107  ARG A O   1 
ATOM   736  C  CB  . ARG A 1 97  ? 4.245   23.657 10.435  1.00 25.80  ? 107  ARG A CB  1 
ATOM   737  C  CG  . ARG A 1 97  ? 3.520   22.352 10.654  1.00 29.65  ? 107  ARG A CG  1 
ATOM   738  C  CD  . ARG A 1 97  ? 2.876   22.265 12.022  1.00 31.54  ? 107  ARG A CD  1 
ATOM   739  N  NE  . ARG A 1 97  ? 1.818   23.243 12.205  1.00 34.00  ? 107  ARG A NE  1 
ATOM   740  C  CZ  . ARG A 1 97  ? 1.107   23.371 13.321  1.00 34.36  ? 107  ARG A CZ  1 
ATOM   741  N  NH1 . ARG A 1 97  ? 1.337   22.576 14.355  1.00 34.96  ? 107  ARG A NH1 1 
ATOM   742  N  NH2 . ARG A 1 97  ? 0.182   24.313 13.409  1.00 33.97  ? 107  ARG A NH2 1 
ATOM   743  N  N   . GLN A 1 98  ? 4.221   26.754 10.764  1.00 24.78  ? 108  GLN A N   1 
ATOM   744  C  CA  . GLN A 1 98  ? 4.150   27.901 11.656  1.00 25.27  ? 108  GLN A CA  1 
ATOM   745  C  C   . GLN A 1 98  ? 3.164   28.959 11.177  1.00 24.98  ? 108  GLN A C   1 
ATOM   746  O  O   . GLN A 1 98  ? 2.705   29.788 11.964  1.00 24.79  ? 108  GLN A O   1 
ATOM   747  C  CB  . GLN A 1 98  ? 5.543   28.523 11.815  1.00 26.82  ? 108  GLN A CB  1 
ATOM   748  C  CG  . GLN A 1 98  ? 5.692   29.417 13.047  1.00 30.28  ? 108  GLN A CG  1 
ATOM   749  C  CD  . GLN A 1 98  ? 7.137   29.839 13.302  1.00 31.84  ? 108  GLN A CD  1 
ATOM   750  O  OE1 . GLN A 1 98  ? 7.477   30.301 14.392  1.00 33.04  ? 108  GLN A OE1 1 
ATOM   751  N  NE2 . GLN A 1 98  ? 7.990   29.685 12.294  1.00 31.75  ? 108  GLN A NE2 1 
ATOM   752  N  N   . ASN A 1 99  ? 2.835   28.922 9.891   1.00 23.85  ? 109  ASN A N   1 
ATOM   753  C  CA  . ASN A 1 99  ? 1.923   29.898 9.317   1.00 24.26  ? 109  ASN A CA  1 
ATOM   754  C  C   . ASN A 1 99  ? 0.604   29.325 8.811   1.00 24.74  ? 109  ASN A C   1 
ATOM   755  O  O   . ASN A 1 99  ? -0.112  29.986 8.061   1.00 23.82  ? 109  ASN A O   1 
ATOM   756  C  CB  . ASN A 1 99  ? 2.634   30.655 8.194   1.00 23.40  ? 109  ASN A CB  1 
ATOM   757  C  CG  . ASN A 1 99  ? 3.782   31.501 8.708   1.00 23.76  ? 109  ASN A CG  1 
ATOM   758  O  OD1 . ASN A 1 99  ? 3.570   32.481 9.421   1.00 23.46  ? 109  ASN A OD1 1 
ATOM   759  N  ND2 . ASN A 1 99  ? 5.002   31.120 8.362   1.00 23.19  ? 109  ASN A ND2 1 
ATOM   760  N  N   . LEU A 1 100 ? 0.281   28.102 9.227   1.00 26.24  ? 110  LEU A N   1 
ATOM   761  C  CA  . LEU A 1 100 ? -0.968  27.463 8.815   1.00 28.22  ? 110  LEU A CA  1 
ATOM   762  C  C   . LEU A 1 100 ? -2.175  28.314 9.199   1.00 29.64  ? 110  LEU A C   1 
ATOM   763  O  O   . LEU A 1 100 ? -3.176  28.352 8.479   1.00 29.69  ? 110  LEU A O   1 
ATOM   764  C  CB  . LEU A 1 100 ? -1.113  26.088 9.470   1.00 28.57  ? 110  LEU A CB  1 
ATOM   765  C  CG  . LEU A 1 100 ? -0.807  24.838 8.640   1.00 29.56  ? 110  LEU A CG  1 
ATOM   766  C  CD1 . LEU A 1 100 ? -1.004  23.596 9.505   1.00 29.27  ? 110  LEU A CD1 1 
ATOM   767  C  CD2 . LEU A 1 100 ? -1.720  24.787 7.423   1.00 29.59  ? 110  LEU A CD2 1 
ATOM   768  N  N   . ASN A 1 101 ? -2.067  28.994 10.338  1.00 30.55  ? 111  ASN A N   1 
ATOM   769  C  CA  . ASN A 1 101 ? -3.144  29.832 10.854  1.00 31.91  ? 111  ASN A CA  1 
ATOM   770  C  C   . ASN A 1 101 ? -3.551  30.989 9.946   1.00 31.55  ? 111  ASN A C   1 
ATOM   771  O  O   . ASN A 1 101 ? -4.670  31.490 10.046  1.00 32.08  ? 111  ASN A O   1 
ATOM   772  C  CB  . ASN A 1 101 ? -2.772  30.386 12.237  1.00 33.58  ? 111  ASN A CB  1 
ATOM   773  C  CG  . ASN A 1 101 ? -1.463  31.178 12.229  1.00 35.48  ? 111  ASN A CG  1 
ATOM   774  O  OD1 . ASN A 1 101 ? -1.196  31.961 13.146  1.00 37.09  ? 111  ASN A OD1 1 
ATOM   775  N  ND2 . ASN A 1 101 ? -0.637  30.966 11.204  1.00 35.70  ? 111  ASN A ND2 1 
ATOM   776  N  N   . THR A 1 102 ? -2.651  31.422 9.069   1.00 30.94  ? 112  THR A N   1 
ATOM   777  C  CA  . THR A 1 102 ? -2.967  32.524 8.169   1.00 30.23  ? 112  THR A CA  1 
ATOM   778  C  C   . THR A 1 102 ? -3.107  32.082 6.712   1.00 29.92  ? 112  THR A C   1 
ATOM   779  O  O   . THR A 1 102 ? -3.282  32.907 5.823   1.00 29.51  ? 112  THR A O   1 
ATOM   780  C  CB  . THR A 1 102 ? -1.908  33.640 8.250   1.00 30.17  ? 112  THR A CB  1 
ATOM   781  O  OG1 . THR A 1 102 ? -0.619  33.101 7.930   1.00 30.04  ? 112  THR A OG1 1 
ATOM   782  C  CG2 . THR A 1 102 ? -1.878  34.249 9.654   1.00 29.74  ? 112  THR A CG2 1 
ATOM   783  N  N   . TYR A 1 103 ? -3.023  30.780 6.469   1.00 30.01  ? 113  TYR A N   1 
ATOM   784  C  CA  . TYR A 1 103 ? -3.165  30.258 5.114   1.00 30.41  ? 113  TYR A CA  1 
ATOM   785  C  C   . TYR A 1 103 ? -4.530  30.705 4.594   1.00 30.95  ? 113  TYR A C   1 
ATOM   786  O  O   . TYR A 1 103 ? -5.548  30.482 5.245   1.00 31.11  ? 113  TYR A O   1 
ATOM   787  C  CB  . TYR A 1 103 ? -3.062  28.730 5.137   1.00 29.50  ? 113  TYR A CB  1 
ATOM   788  C  CG  . TYR A 1 103 ? -3.209  28.062 3.790   1.00 28.94  ? 113  TYR A CG  1 
ATOM   789  C  CD1 . TYR A 1 103 ? -4.462  27.913 3.195   1.00 29.37  ? 113  TYR A CD1 1 
ATOM   790  C  CD2 . TYR A 1 103 ? -2.099  27.563 3.118   1.00 29.21  ? 113  TYR A CD2 1 
ATOM   791  C  CE1 . TYR A 1 103 ? -4.606  27.278 1.965   1.00 29.49  ? 113  TYR A CE1 1 
ATOM   792  C  CE2 . TYR A 1 103 ? -2.229  26.923 1.886   1.00 29.41  ? 113  TYR A CE2 1 
ATOM   793  C  CZ  . TYR A 1 103 ? -3.486  26.783 1.317   1.00 29.48  ? 113  TYR A CZ  1 
ATOM   794  O  OH  . TYR A 1 103 ? -3.625  26.140 0.110   1.00 29.45  ? 113  TYR A OH  1 
ATOM   795  N  N   . SER A 1 104 ? -4.547  31.340 3.426   1.00 32.27  ? 114  SER A N   1 
ATOM   796  C  CA  . SER A 1 104 ? -5.794  31.841 2.850   1.00 33.36  ? 114  SER A CA  1 
ATOM   797  C  C   . SER A 1 104 ? -6.117  31.287 1.462   1.00 33.99  ? 114  SER A C   1 
ATOM   798  O  O   . SER A 1 104 ? -5.308  31.370 0.541   1.00 33.62  ? 114  SER A O   1 
ATOM   799  C  CB  . SER A 1 104 ? -5.745  33.369 2.792   1.00 33.65  ? 114  SER A CB  1 
ATOM   800  O  OG  . SER A 1 104 ? -6.916  33.894 2.196   1.00 35.19  ? 114  SER A OG  1 
ATOM   801  N  N   . LYS A 1 105 ? -7.316  30.737 1.313   1.00 35.36  ? 115  LYS A N   1 
ATOM   802  C  CA  . LYS A 1 105 ? -7.744  30.170 0.040   1.00 36.54  ? 115  LYS A CA  1 
ATOM   803  C  C   . LYS A 1 105 ? -7.828  31.188 -1.095  1.00 36.79  ? 115  LYS A C   1 
ATOM   804  O  O   . LYS A 1 105 ? -7.800  30.814 -2.266  1.00 36.84  ? 115  LYS A O   1 
ATOM   805  C  CB  . LYS A 1 105 ? -9.096  29.467 0.200   1.00 37.93  ? 115  LYS A CB  1 
ATOM   806  C  CG  . LYS A 1 105 ? -9.042  28.215 1.073   1.00 39.45  ? 115  LYS A CG  1 
ATOM   807  C  CD  . LYS A 1 105 ? -10.394 27.509 1.144   1.00 40.41  ? 115  LYS A CD  1 
ATOM   808  C  CE  . LYS A 1 105 ? -11.464 28.388 1.784   1.00 41.43  ? 115  LYS A CE  1 
ATOM   809  N  NZ  . LYS A 1 105 ? -12.791 27.697 1.842   1.00 42.30  ? 115  LYS A NZ  1 
ATOM   810  N  N   . LYS A 1 106 ? -7.927  32.472 -0.763  1.00 37.10  ? 116  LYS A N   1 
ATOM   811  C  CA  . LYS A 1 106 ? -8.009  33.490 -1.803  1.00 37.20  ? 116  LYS A CA  1 
ATOM   812  C  C   . LYS A 1 106 ? -6.689  33.616 -2.560  1.00 36.75  ? 116  LYS A C   1 
ATOM   813  O  O   . LYS A 1 106 ? -6.631  34.249 -3.618  1.00 36.49  ? 116  LYS A O   1 
ATOM   814  C  CB  . LYS A 1 106 ? -8.407  34.848 -1.211  1.00 38.33  ? 116  LYS A CB  1 
ATOM   815  C  CG  . LYS A 1 106 ? -7.369  35.506 -0.318  1.00 39.94  ? 116  LYS A CG  1 
ATOM   816  C  CD  . LYS A 1 106 ? -7.862  36.871 0.153   1.00 41.10  ? 116  LYS A CD  1 
ATOM   817  C  CE  . LYS A 1 106 ? -6.895  37.511 1.143   1.00 42.19  ? 116  LYS A CE  1 
ATOM   818  N  NZ  . LYS A 1 106 ? -7.412  38.807 1.676   1.00 43.00  ? 116  LYS A NZ  1 
ATOM   819  N  N   . TYR A 1 107 ? -5.633  33.010 -2.021  1.00 35.74  ? 117  TYR A N   1 
ATOM   820  C  CA  . TYR A 1 107 ? -4.327  33.058 -2.666  1.00 34.99  ? 117  TYR A CA  1 
ATOM   821  C  C   . TYR A 1 107 ? -4.049  31.821 -3.510  1.00 34.22  ? 117  TYR A C   1 
ATOM   822  O  O   . TYR A 1 107 ? -2.992  31.708 -4.127  1.00 33.79  ? 117  TYR A O   1 
ATOM   823  C  CB  . TYR A 1 107 ? -3.221  33.257 -1.626  1.00 35.40  ? 117  TYR A CB  1 
ATOM   824  C  CG  . TYR A 1 107 ? -3.267  34.624 -0.989  1.00 35.85  ? 117  TYR A CG  1 
ATOM   825  C  CD1 . TYR A 1 107 ? -3.312  35.775 -1.777  1.00 36.29  ? 117  TYR A CD1 1 
ATOM   826  C  CD2 . TYR A 1 107 ? -3.301  34.772 0.398   1.00 36.19  ? 117  TYR A CD2 1 
ATOM   827  C  CE1 . TYR A 1 107 ? -3.397  37.038 -1.202  1.00 36.73  ? 117  TYR A CE1 1 
ATOM   828  C  CE2 . TYR A 1 107 ? -3.384  36.034 0.984   1.00 36.45  ? 117  TYR A CE2 1 
ATOM   829  C  CZ  . TYR A 1 107 ? -3.434  37.159 0.177   1.00 36.70  ? 117  TYR A CZ  1 
ATOM   830  O  OH  . TYR A 1 107 ? -3.535  38.407 0.743   1.00 37.84  ? 117  TYR A OH  1 
ATOM   831  N  N   . MET A 1 108 ? -4.998  30.891 -3.530  1.00 33.68  ? 118  MET A N   1 
ATOM   832  C  CA  . MET A 1 108 ? -4.855  29.689 -4.342  1.00 33.49  ? 118  MET A CA  1 
ATOM   833  C  C   . MET A 1 108 ? -5.126  30.115 -5.782  1.00 32.84  ? 118  MET A C   1 
ATOM   834  O  O   . MET A 1 108 ? -6.029  30.914 -6.031  1.00 33.26  ? 118  MET A O   1 
ATOM   835  C  CB  . MET A 1 108 ? -5.875  28.623 -3.926  1.00 34.43  ? 118  MET A CB  1 
ATOM   836  C  CG  . MET A 1 108 ? -5.595  27.953 -2.588  1.00 35.94  ? 118  MET A CG  1 
ATOM   837  S  SD  . MET A 1 108 ? -6.789  26.630 -2.193  1.00 37.83  ? 118  MET A SD  1 
ATOM   838  C  CE  . MET A 1 108 ? -6.096  25.276 -3.097  1.00 36.12  ? 118  MET A CE  1 
ATOM   839  N  N   . LEU A 1 109 ? -4.344  29.597 -6.722  1.00 31.91  ? 119  LEU A N   1 
ATOM   840  C  CA  . LEU A 1 109 ? -4.521  29.934 -8.135  1.00 31.28  ? 119  LEU A CA  1 
ATOM   841  C  C   . LEU A 1 109 ? -4.498  31.441 -8.350  1.00 30.24  ? 119  LEU A C   1 
ATOM   842  O  O   . LEU A 1 109 ? -5.260  31.978 -9.158  1.00 30.24  ? 119  LEU A O   1 
ATOM   843  C  CB  . LEU A 1 109 ? -5.849  29.367 -8.655  1.00 32.54  ? 119  LEU A CB  1 
ATOM   844  C  CG  . LEU A 1 109 ? -6.057  27.853 -8.547  1.00 33.30  ? 119  LEU A CG  1 
ATOM   845  C  CD1 . LEU A 1 109 ? -7.420  27.481 -9.118  1.00 33.54  ? 119  LEU A CD1 1 
ATOM   846  C  CD2 . LEU A 1 109 ? -4.949  27.124 -9.294  1.00 34.01  ? 119  LEU A CD2 1 
ATOM   847  N  N   . TYR A 1 110 ? -3.613  32.116 -7.626  1.00 28.49  ? 120  TYR A N   1 
ATOM   848  C  CA  . TYR A 1 110 ? -3.483  33.564 -7.713  1.00 27.02  ? 120  TYR A CA  1 
ATOM   849  C  C   . TYR A 1 110 ? -3.046  34.009 -9.114  1.00 26.17  ? 120  TYR A C   1 
ATOM   850  O  O   . TYR A 1 110 ? -2.088  33.477 -9.672  1.00 24.81  ? 120  TYR A O   1 
ATOM   851  C  CB  . TYR A 1 110 ? -2.472  34.038 -6.665  1.00 26.68  ? 120  TYR A CB  1 
ATOM   852  C  CG  . TYR A 1 110 ? -2.579  35.498 -6.306  1.00 26.54  ? 120  TYR A CG  1 
ATOM   853  C  CD1 . TYR A 1 110 ? -3.735  36.006 -5.712  1.00 26.55  ? 120  TYR A CD1 1 
ATOM   854  C  CD2 . TYR A 1 110 ? -1.511  36.368 -6.529  1.00 26.40  ? 120  TYR A CD2 1 
ATOM   855  C  CE1 . TYR A 1 110 ? -3.824  37.349 -5.343  1.00 26.82  ? 120  TYR A CE1 1 
ATOM   856  C  CE2 . TYR A 1 110 ? -1.588  37.708 -6.165  1.00 26.57  ? 120  TYR A CE2 1 
ATOM   857  C  CZ  . TYR A 1 110 ? -2.744  38.191 -5.572  1.00 27.13  ? 120  TYR A CZ  1 
ATOM   858  O  OH  . TYR A 1 110 ? -2.808  39.509 -5.195  1.00 27.69  ? 120  TYR A OH  1 
ATOM   859  N  N   . PRO A 1 111 ? -3.753  34.992 -9.701  1.00 26.19  ? 121  PRO A N   1 
ATOM   860  C  CA  . PRO A 1 111 ? -3.449  35.518 -11.040 1.00 26.08  ? 121  PRO A CA  1 
ATOM   861  C  C   . PRO A 1 111 ? -2.062  36.151 -11.106 1.00 25.74  ? 121  PRO A C   1 
ATOM   862  O  O   . PRO A 1 111 ? -1.683  36.929 -10.235 1.00 25.46  ? 121  PRO A O   1 
ATOM   863  C  CB  . PRO A 1 111 ? -4.552  36.556 -11.268 1.00 26.08  ? 121  PRO A CB  1 
ATOM   864  C  CG  . PRO A 1 111 ? -5.672  36.075 -10.401 1.00 26.37  ? 121  PRO A CG  1 
ATOM   865  C  CD  . PRO A 1 111 ? -4.955  35.641 -9.152  1.00 26.13  ? 121  PRO A CD  1 
ATOM   866  N  N   . ASP A 1 112 ? -1.324  35.832 -12.161 1.00 25.91  ? 122  ASP A N   1 
ATOM   867  C  CA  . ASP A 1 112 ? 0.024   36.347 -12.351 1.00 26.36  ? 122  ASP A CA  1 
ATOM   868  C  C   . ASP A 1 112 ? 0.164   37.869 -12.352 1.00 27.06  ? 122  ASP A C   1 
ATOM   869  O  O   . ASP A 1 112 ? 1.114   38.403 -11.774 1.00 26.27  ? 122  ASP A O   1 
ATOM   870  C  CB  . ASP A 1 112 ? 0.610   35.786 -13.651 1.00 26.28  ? 122  ASP A CB  1 
ATOM   871  C  CG  . ASP A 1 112 ? 1.998   36.334 -13.955 1.00 27.15  ? 122  ASP A CG  1 
ATOM   872  O  OD1 . ASP A 1 112 ? 2.098   37.458 -14.485 1.00 26.43  ? 122  ASP A OD1 1 
ATOM   873  O  OD2 . ASP A 1 112 ? 2.994   35.638 -13.652 1.00 27.94  ? 122  ASP A OD2 1 
ATOM   874  N  N   . PHE A 1 113 ? -0.769  38.569 -12.992 1.00 27.43  ? 124  PHE A N   1 
ATOM   875  C  CA  . PHE A 1 113 ? -0.675  40.026 -13.072 1.00 28.20  ? 124  PHE A CA  1 
ATOM   876  C  C   . PHE A 1 113 ? -0.722  40.748 -11.728 1.00 28.28  ? 124  PHE A C   1 
ATOM   877  O  O   . PHE A 1 113 ? -0.337  41.914 -11.637 1.00 28.29  ? 124  PHE A O   1 
ATOM   878  C  CB  . PHE A 1 113 ? -1.770  40.596 -13.988 1.00 28.06  ? 124  PHE A CB  1 
ATOM   879  C  CG  . PHE A 1 113 ? -3.108  40.734 -13.328 1.00 27.99  ? 124  PHE A CG  1 
ATOM   880  C  CD1 . PHE A 1 113 ? -3.908  39.623 -13.104 1.00 27.77  ? 124  PHE A CD1 1 
ATOM   881  C  CD2 . PHE A 1 113 ? -3.572  41.988 -12.935 1.00 29.20  ? 124  PHE A CD2 1 
ATOM   882  C  CE1 . PHE A 1 113 ? -5.153  39.751 -12.500 1.00 28.32  ? 124  PHE A CE1 1 
ATOM   883  C  CE2 . PHE A 1 113 ? -4.821  42.130 -12.327 1.00 28.74  ? 124  PHE A CE2 1 
ATOM   884  C  CZ  . PHE A 1 113 ? -5.612  41.009 -12.110 1.00 28.61  ? 124  PHE A CZ  1 
ATOM   885  N  N   . LEU A 1 114 ? -1.201  40.072 -10.688 1.00 28.72  ? 125  LEU A N   1 
ATOM   886  C  CA  . LEU A 1 114 ? -1.271  40.692 -9.369  1.00 29.11  ? 125  LEU A CA  1 
ATOM   887  C  C   . LEU A 1 114 ? 0.057   40.579 -8.620  1.00 29.67  ? 125  LEU A C   1 
ATOM   888  O  O   . LEU A 1 114 ? 0.206   41.098 -7.512  1.00 29.61  ? 125  LEU A O   1 
ATOM   889  C  CB  . LEU A 1 114 ? -2.401  40.073 -8.540  1.00 29.50  ? 125  LEU A CB  1 
ATOM   890  C  CG  . LEU A 1 114 ? -3.824  40.418 -8.995  1.00 29.84  ? 125  LEU A CG  1 
ATOM   891  C  CD1 . LEU A 1 114 ? -4.864  39.772 -8.084  1.00 30.40  ? 125  LEU A CD1 1 
ATOM   892  C  CD2 . LEU A 1 114 ? -4.019  41.926 -9.040  1.00 29.84  ? 125  LEU A CD2 1 
ATOM   893  N  N   . CYS A 1 115 ? 0.993   39.898 -9.224  1.00 30.04  ? 126  CYS A N   1 
ATOM   894  C  CA  . CYS A 1 115 ? 2.305   39.826 -8.670  1.00 31.26  ? 126  CYS A CA  1 
ATOM   895  C  C   . CYS A 1 115 ? 3.127   40.914 -9.320  1.00 33.42  ? 126  CYS A C   1 
ATOM   896  O  O   . CYS A 1 115 ? 3.562   40.821 -10.465 1.00 34.29  ? 126  CYS A O   1 
ATOM   897  C  CB  . CYS A 1 115 ? 2.899   38.425 -8.874  1.00 28.58  ? 126  CYS A CB  1 
ATOM   898  S  SG  . CYS A 1 115 ? 2.188   37.136 -7.801  1.00 24.88  ? 126  CYS A SG  1 
ATOM   899  N  N   . LYS A 1 116 ? 3.306   41.971 -8.568  1.00 36.15  ? 127  LYS A N   1 
ATOM   900  C  CA  . LYS A 1 116 ? 4.043   43.121 -8.998  1.00 38.78  ? 127  LYS A CA  1 
ATOM   901  C  C   . LYS A 1 116 ? 5.027   43.523 -7.905  1.00 39.90  ? 127  LYS A C   1 
ATOM   902  O  O   . LYS A 1 116 ? 4.772   43.314 -6.716  1.00 39.80  ? 127  LYS A O   1 
ATOM   903  C  CB  . LYS A 1 116 ? 3.109   44.292 -9.333  1.00 39.78  ? 127  LYS A CB  1 
ATOM   904  C  CG  . LYS A 1 116 ? 3.750   45.362 -10.201 1.00 42.13  ? 127  LYS A CG  1 
ATOM   905  C  CD  . LYS A 1 116 ? 4.714   46.258 -9.437  1.00 43.43  ? 127  LYS A CD  1 
ATOM   906  C  CE  . LYS A 1 116 ? 5.262   47.373 -10.317 1.00 44.46  ? 127  LYS A CE  1 
ATOM   907  N  NZ  . LYS A 1 116 ? 5.935   46.840 -11.539 1.00 45.43  ? 127  LYS A NZ  1 
ATOM   908  N  N   . GLY A 1 117 ? 6.156   44.092 -8.317  1.00 41.13  ? 128  GLY A N   1 
ATOM   909  C  CA  . GLY A 1 117 ? 7.157   44.525 -7.360  1.00 42.47  ? 128  GLY A CA  1 
ATOM   910  C  C   . GLY A 1 117 ? 8.469   43.785 -7.512  1.00 43.33  ? 128  GLY A C   1 
ATOM   911  O  O   . GLY A 1 117 ? 8.678   43.052 -8.480  1.00 43.60  ? 128  GLY A O   1 
ATOM   912  N  N   . GLU A 1 118 ? 9.362   43.983 -6.551  1.00 44.10  ? 129  GLU A N   1 
ATOM   913  C  CA  . GLU A 1 118 ? 10.659  43.328 -6.577  1.00 44.63  ? 129  GLU A CA  1 
ATOM   914  C  C   . GLU A 1 118 ? 11.125  42.995 -5.164  1.00 44.05  ? 129  GLU A C   1 
ATOM   915  O  O   . GLU A 1 118 ? 10.875  43.745 -4.216  1.00 44.21  ? 129  GLU A O   1 
ATOM   916  C  CB  . GLU A 1 118 ? 11.697  44.231 -7.244  1.00 45.83  ? 129  GLU A CB  1 
ATOM   917  C  CG  . GLU A 1 118 ? 11.911  45.538 -6.504  1.00 47.71  ? 129  GLU A CG  1 
ATOM   918  C  CD  . GLU A 1 118 ? 13.298  46.109 -6.714  1.00 48.72  ? 129  GLU A CD  1 
ATOM   919  O  OE1 . GLU A 1 118 ? 13.606  47.160 -6.108  1.00 49.58  ? 129  GLU A OE1 1 
ATOM   920  O  OE2 . GLU A 1 118 ? 14.080  45.505 -7.479  1.00 49.28  ? 129  GLU A OE2 1 
ATOM   921  N  N   . LEU A 1 119 ? 11.802  41.863 -5.032  1.00 43.08  ? 130  LEU A N   1 
ATOM   922  C  CA  . LEU A 1 119 ? 12.328  41.428 -3.749  1.00 41.76  ? 130  LEU A CA  1 
ATOM   923  C  C   . LEU A 1 119 ? 13.538  40.557 -4.056  1.00 40.75  ? 130  LEU A C   1 
ATOM   924  O  O   . LEU A 1 119 ? 13.422  39.553 -4.763  1.00 40.65  ? 130  LEU A O   1 
ATOM   925  C  CB  . LEU A 1 119 ? 11.284  40.611 -2.982  1.00 42.13  ? 130  LEU A CB  1 
ATOM   926  C  CG  . LEU A 1 119 ? 11.322  40.688 -1.448  1.00 42.66  ? 130  LEU A CG  1 
ATOM   927  C  CD1 . LEU A 1 119 ? 10.491  39.552 -0.871  1.00 41.96  ? 130  LEU A CD1 1 
ATOM   928  C  CD2 . LEU A 1 119 ? 12.752  40.596 -0.935  1.00 43.11  ? 130  LEU A CD2 1 
ATOM   929  N  N   . LYS A 1 120 ? 14.698  40.950 -3.541  1.00 38.86  ? 131  LYS A N   1 
ATOM   930  C  CA  . LYS A 1 120 ? 15.918  40.190 -3.772  1.00 37.08  ? 131  LYS A CA  1 
ATOM   931  C  C   . LYS A 1 120 ? 16.189  39.254 -2.598  1.00 34.87  ? 131  LYS A C   1 
ATOM   932  O  O   . LYS A 1 120 ? 15.784  39.524 -1.467  1.00 34.21  ? 131  LYS A O   1 
ATOM   933  C  CB  . LYS A 1 120 ? 17.107  41.138 -3.974  1.00 38.19  ? 131  LYS A CB  1 
ATOM   934  C  CG  . LYS A 1 120 ? 18.404  40.427 -4.339  1.00 40.42  ? 131  LYS A CG  1 
ATOM   935  C  CD  . LYS A 1 120 ? 19.480  41.399 -4.828  1.00 41.88  ? 131  LYS A CD  1 
ATOM   936  C  CE  . LYS A 1 120 ? 19.898  42.386 -3.747  1.00 42.86  ? 131  LYS A CE  1 
ATOM   937  N  NZ  . LYS A 1 120 ? 21.002  43.274 -4.213  1.00 44.18  ? 131  LYS A NZ  1 
ATOM   938  N  N   . CYS A 1 121 ? 16.862  38.143 -2.879  1.00 32.53  ? 133  CYS A N   1 
ATOM   939  C  CA  . CYS A 1 121 ? 17.188  37.164 -1.853  1.00 30.58  ? 133  CYS A CA  1 
ATOM   940  C  C   . CYS A 1 121 ? 18.225  37.707 -0.879  1.00 30.60  ? 133  CYS A C   1 
ATOM   941  O  O   . CYS A 1 121 ? 18.072  37.458 0.334   1.00 30.50  ? 133  CYS A O   1 
ATOM   942  C  CB  . CYS A 1 121 ? 17.713  35.883 -2.490  1.00 28.44  ? 133  CYS A CB  1 
ATOM   943  S  SG  . CYS A 1 121 ? 16.479  34.937 -3.433  1.00 25.32  ? 133  CYS A SG  1 
ATOM   944  O  OXT . CYS A 1 121 ? 19.180  38.356 -1.348  1.00 30.62  ? 133  CYS A OXT 1 
HETATM 945  S  S   . SO4 B 2 .   ? 21.421  7.554  14.326  1.00 100.00 ? 261  SO4 A S   1 
HETATM 946  O  O1  . SO4 B 2 .   ? 21.428  9.019  14.116  1.00 100.00 ? 261  SO4 A O1  1 
HETATM 947  O  O2  . SO4 B 2 .   ? 20.054  7.185  14.702  1.00 100.00 ? 261  SO4 A O2  1 
HETATM 948  O  O3  . SO4 B 2 .   ? 21.752  6.805  13.100  1.00 100.00 ? 261  SO4 A O3  1 
HETATM 949  O  O4  . SO4 B 2 .   ? 22.391  7.254  15.390  1.00 100.00 ? 261  SO4 A O4  1 
HETATM 950  S  S   . SO4 C 2 .   ? 3.908   42.177 6.322   1.00 100.00 ? 262  SO4 A S   1 
HETATM 951  O  O1  . SO4 C 2 .   ? 5.105   42.613 5.568   1.00 100.00 ? 262  SO4 A O1  1 
HETATM 952  O  O2  . SO4 C 2 .   ? 2.750   42.445 5.466   1.00 100.00 ? 262  SO4 A O2  1 
HETATM 953  O  O3  . SO4 C 2 .   ? 3.909   40.730 6.605   1.00 100.00 ? 262  SO4 A O3  1 
HETATM 954  O  O4  . SO4 C 2 .   ? 3.870   42.945 7.575   1.00 100.00 ? 262  SO4 A O4  1 
HETATM 955  C  C1  . LCF D 3 .   ? 5.576   21.167 -7.541  1.00 87.90  ? 2001 LCF A C1  1 
HETATM 956  C  C2  . LCF D 3 .   ? 6.320   23.595 -8.450  1.00 87.92  ? 2001 LCF A C2  1 
HETATM 957  C  C3  . LCF D 3 .   ? 6.682   23.866 -9.899  1.00 87.87  ? 2001 LCF A C3  1 
HETATM 958  C  C4  . LCF D 3 .   ? 6.597   22.638 -10.738 1.00 87.96  ? 2001 LCF A C4  1 
HETATM 959  C  C5  . LCF D 3 .   ? 6.150   21.619 -9.753  1.00 88.02  ? 2001 LCF A C5  1 
HETATM 960  C  C6  . LCF D 3 .   ? 5.838   20.165 -9.827  1.00 88.05  ? 2001 LCF A C6  1 
HETATM 961  C  C7  . LCF D 3 .   ? 5.440   19.824 -8.318  1.00 87.91  ? 2001 LCF A C7  1 
HETATM 962  N  N   . LCF D 3 .   ? 6.006   22.152 -8.498  1.00 88.00  ? 2001 LCF A N   1 
HETATM 963  C  C8  . LCF D 3 .   ? 5.392   21.688 -6.122  1.00 87.70  ? 2001 LCF A C8  1 
HETATM 964  C  C9  . LCF D 3 .   ? 6.703   21.872 -5.411  1.00 87.64  ? 2001 LCF A C9  1 
HETATM 965  O  O1  . LCF D 3 .   ? 7.146   22.994 -5.287  1.00 87.52  ? 2001 LCF A O1  1 
HETATM 966  O  O2  . LCF D 3 .   ? 7.315   20.922 -4.970  1.00 87.68  ? 2001 LCF A O2  1 
HETATM 967  C  C10 . LCF D 3 .   ? 8.109   24.193 -10.147 1.00 87.72  ? 2001 LCF A C10 1 
HETATM 968  C  C11 . LCF D 3 .   ? 5.830   24.999 -10.401 1.00 87.78  ? 2001 LCF A C11 1 
HETATM 969  C  C12 . LCF D 3 .   ? 5.932   19.381 -11.124 1.00 88.34  ? 2001 LCF A C12 1 
HETATM 970  C  C13 . LCF D 3 .   ? 6.327   19.945 -12.391 1.00 88.44  ? 2001 LCF A C13 1 
HETATM 971  C  C14 . LCF D 3 .   ? 6.406   19.187 -13.608 1.00 88.60  ? 2001 LCF A C14 1 
HETATM 972  C  C15 . LCF D 3 .   ? 6.088   17.818 -13.605 1.00 88.74  ? 2001 LCF A C15 1 
HETATM 973  C  C16 . LCF D 3 .   ? 5.693   17.217 -12.371 1.00 88.71  ? 2001 LCF A C16 1 
HETATM 974  C  C17 . LCF D 3 .   ? 5.629   18.004 -11.191 1.00 88.49  ? 2001 LCF A C17 1 
HETATM 975  C  C18 . LCF D 3 .   ? 5.012   18.594 -7.618  1.00 87.81  ? 2001 LCF A C18 1 
HETATM 976  C  C19 . LCF D 3 .   ? 4.881   17.360 -8.282  1.00 87.72  ? 2001 LCF A C19 1 
HETATM 977  C  C20 . LCF D 3 .   ? 4.481   16.181 -7.644  1.00 87.70  ? 2001 LCF A C20 1 
HETATM 978  C  C21 . LCF D 3 .   ? 4.183   16.168 -6.278  1.00 87.71  ? 2001 LCF A C21 1 
HETATM 979  C  C22 . LCF D 3 .   ? 4.289   17.354 -5.548  1.00 87.71  ? 2001 LCF A C22 1 
HETATM 980  C  C23 . LCF D 3 .   ? 4.698   18.546 -6.208  1.00 87.70  ? 2001 LCF A C23 1 
HETATM 981  CL CL1 . LCF D 3 .   ? 3.678   14.602 -5.570  1.00 87.53  ? 2001 LCF A CL1 1 
HETATM 982  O  O   . HOH E 4 .   ? 20.862  9.769  0.149   1.00 46.28  ? 2002 HOH A O   1 
HETATM 983  O  O   . HOH E 4 .   ? 13.631  18.344 -2.930  1.00 12.39  ? 2003 HOH A O   1 
HETATM 984  O  O   . HOH E 4 .   ? -0.051  32.610 5.254   1.00 22.56  ? 2004 HOH A O   1 
HETATM 985  O  O   . HOH E 4 .   ? 16.545  23.502 7.807   1.00 23.53  ? 2005 HOH A O   1 
HETATM 986  O  O   . HOH E 4 .   ? 17.125  26.608 8.162   1.00 22.07  ? 2006 HOH A O   1 
HETATM 987  O  O   . HOH E 4 .   ? 2.108   7.346  -8.339  1.00 70.67  ? 2007 HOH A O   1 
HETATM 988  O  O   . HOH E 4 .   ? 25.080  15.663 -7.583  1.00 16.84  ? 2008 HOH A O   1 
HETATM 989  O  O   . HOH E 4 .   ? 27.251  17.102 -6.861  1.00 19.40  ? 2009 HOH A O   1 
HETATM 990  O  O   . HOH E 4 .   ? 3.440   9.770  2.310   1.00 50.30  ? 2010 HOH A O   1 
HETATM 991  O  O   . HOH E 4 .   ? -4.400  21.095 8.279   1.00 44.48  ? 2011 HOH A O   1 
HETATM 992  O  O   . HOH E 4 .   ? 23.648  17.753 -9.162  1.00 20.78  ? 2012 HOH A O   1 
HETATM 993  O  O   . HOH E 4 .   ? 1.885   16.181 -0.371  1.00 35.81  ? 2013 HOH A O   1 
HETATM 994  O  O   . HOH E 4 .   ? -5.522  11.939 7.673   1.00 50.41  ? 2014 HOH A O   1 
HETATM 995  O  O   . HOH E 4 .   ? 1.804   42.161 -1.843  1.00 60.85  ? 2015 HOH A O   1 
HETATM 996  O  O   . HOH E 4 .   ? 15.193  24.412 10.066  1.00 22.30  ? 2016 HOH A O   1 
HETATM 997  O  O   . HOH E 4 .   ? 1.938   28.131 -10.058 1.00 37.74  ? 2017 HOH A O   1 
HETATM 998  O  O   . HOH E 4 .   ? 27.179  21.938 -6.109  1.00 42.26  ? 2018 HOH A O   1 
HETATM 999  O  O   . HOH E 4 .   ? 4.129   9.947  5.616   1.00 49.12  ? 2019 HOH A O   1 
HETATM 1000 O  O   . HOH E 4 .   ? -5.719  24.377 0.649   1.00 38.59  ? 2020 HOH A O   1 
HETATM 1001 O  O   . HOH E 4 .   ? 11.195  28.426 3.521   1.00 13.42  ? 2021 HOH A O   1 
HETATM 1002 O  O   . HOH E 4 .   ? 27.401  19.658 -7.871  1.00 27.15  ? 2022 HOH A O   1 
HETATM 1003 O  O   . HOH E 4 .   ? 13.726  27.203 2.824   1.00 17.10  ? 2023 HOH A O   1 
HETATM 1004 O  O   . HOH E 4 .   ? -4.856  14.471 5.516   1.00 57.86  ? 2024 HOH A O   1 
HETATM 1005 O  O   . HOH E 4 .   ? -0.497  14.489 8.085   1.00 26.06  ? 2025 HOH A O   1 
HETATM 1006 O  O   . HOH E 4 .   ? 7.246   33.362 6.354   1.00 28.60  ? 2026 HOH A O   1 
HETATM 1007 O  O   . HOH E 4 .   ? 29.155  20.723 -9.624  1.00 20.28  ? 2027 HOH A O   1 
HETATM 1008 O  O   . HOH E 4 .   ? 14.858  29.066 -7.146  1.00 29.12  ? 2028 HOH A O   1 
HETATM 1009 O  O   . HOH E 4 .   ? 2.295   31.033 -7.500  1.00 30.64  ? 2029 HOH A O   1 
HETATM 1010 O  O   . HOH E 4 .   ? 0.216   36.260 6.833   1.00 27.96  ? 2030 HOH A O   1 
HETATM 1011 O  O   . HOH E 4 .   ? -3.319  35.120 4.559   1.00 30.53  ? 2031 HOH A O   1 
HETATM 1012 O  O   . HOH E 4 .   ? 7.750   32.255 9.167   1.00 31.51  ? 2032 HOH A O   1 
HETATM 1013 O  O   . HOH E 4 .   ? 0.961   27.487 5.533   1.00 20.07  ? 2033 HOH A O   1 
HETATM 1014 O  O   . HOH E 4 .   ? 25.492  24.118 -5.997  1.00 22.95  ? 2034 HOH A O   1 
HETATM 1015 O  O   . HOH E 4 .   ? 11.582  29.948 5.808   1.00 26.44  ? 2035 HOH A O   1 
HETATM 1016 O  O   . HOH E 4 .   ? 29.880  22.538 -7.810  1.00 37.61  ? 2036 HOH A O   1 
HETATM 1017 O  O   . HOH E 4 .   ? 23.745  14.468 -5.386  1.00 17.32  ? 2037 HOH A O   1 
HETATM 1018 O  O   . HOH E 4 .   ? 1.095   33.405 10.070  1.00 29.43  ? 2038 HOH A O   1 
HETATM 1019 O  O   . HOH E 4 .   ? 0.852   33.441 -9.538  1.00 49.30  ? 2039 HOH A O   1 
HETATM 1020 O  O   . HOH E 4 .   ? -0.042  28.213 12.488  1.00 36.79  ? 2040 HOH A O   1 
HETATM 1021 O  O   . HOH E 4 .   ? 11.630  32.800 -7.571  1.00 49.32  ? 2041 HOH A O   1 
HETATM 1022 O  O   . HOH E 4 .   ? -6.455  33.615 -6.440  1.00 45.00  ? 2042 HOH A O   1 
HETATM 1023 O  O   . HOH E 4 .   ? 24.471  26.009 -12.977 1.00 54.14  ? 2043 HOH A O   1 
HETATM 1024 O  O   . HOH E 4 .   ? 16.223  6.229  8.332   1.00 47.42  ? 2044 HOH A O   1 
HETATM 1025 O  O   . HOH E 4 .   ? 20.698  35.630 -4.018  1.00 60.57  ? 2045 HOH A O   1 
HETATM 1026 O  O   . HOH E 4 .   ? 23.634  33.392 -3.843  1.00 57.84  ? 2046 HOH A O   1 
HETATM 1027 O  O   . HOH E 4 .   ? 20.115  37.409 1.919   1.00 26.16  ? 2047 HOH A O   1 
HETATM 1028 O  O   . HOH E 4 .   ? 10.714  9.785  6.303   1.00 39.41  ? 2048 HOH A O   1 
HETATM 1029 O  O   . HOH E 4 .   ? 15.170  7.444  5.867   1.00 45.39  ? 2049 HOH A O   1 
HETATM 1030 O  O   . HOH E 4 .   ? 12.843  15.565 19.224  1.00 71.18  ? 2050 HOH A O   1 
HETATM 1031 O  O   . HOH E 4 .   ? 11.158  6.968  6.414   1.00 56.23  ? 2051 HOH A O   1 
HETATM 1032 O  O   . HOH E 4 .   ? 8.170   16.716 19.684  1.00 89.88  ? 2052 HOH A O   1 
HETATM 1033 O  O   . HOH E 4 .   ? -4.948  26.258 7.736   1.00 51.41  ? 2053 HOH A O   1 
HETATM 1034 O  O   . HOH E 4 .   ? 12.256  40.920 -7.387  1.00 52.11  ? 2054 HOH A O   1 
HETATM 1035 O  O   . HOH E 4 .   ? 13.578  5.929  8.241   1.00 55.90  ? 2055 HOH A O   1 
HETATM 1036 O  O   . HOH E 4 .   ? 14.874  43.400 -2.233  1.00 71.03  ? 2056 HOH A O   1 
HETATM 1037 O  O   . HOH E 4 .   ? -8.616  25.328 0.045   1.00 70.17  ? 2057 HOH A O   1 
HETATM 1038 O  O   . HOH E 4 .   ? 16.223  32.702 -6.204  1.00 59.40  ? 2058 HOH A O   1 
HETATM 1039 O  O   . HOH E 4 .   ? 13.812  36.183 -6.201  1.00 46.02  ? 2059 HOH A O   1 
HETATM 1040 O  O   . HOH E 4 .   ? 13.345  33.989 -4.948  1.00 30.94  ? 2060 HOH A O   1 
HETATM 1041 O  O   . HOH E 4 .   ? 19.699  32.754 -3.183  1.00 31.47  ? 2061 HOH A O   1 
HETATM 1042 O  O   . HOH E 4 .   ? 21.575  17.459 -6.930  1.00 14.72  ? 2062 HOH A O   1 
HETATM 1043 O  O   . HOH E 4 .   ? 18.192  10.506 -6.441  1.00 26.53  ? 2063 HOH A O   1 
HETATM 1044 O  O   . HOH E 4 .   ? 11.009  8.403  10.015  1.00 57.49  ? 2064 HOH A O   1 
HETATM 1045 O  O   . HOH E 4 .   ? 11.843  19.641 12.652  1.00 29.68  ? 2065 HOH A O   1 
HETATM 1046 O  O   . HOH E 4 .   ? 18.490  17.824 9.735   1.00 27.13  ? 2066 HOH A O   1 
HETATM 1047 O  O   . HOH E 4 .   ? 20.153  11.580 1.846   1.00 28.96  ? 2067 HOH A O   1 
HETATM 1048 O  O   . HOH E 4 .   ? 5.617   33.848 11.206  1.00 71.61  ? 2068 HOH A O   1 
HETATM 1049 O  O   . HOH E 4 .   ? 13.598  6.328  1.429   1.00 60.29  ? 2069 HOH A O   1 
HETATM 1050 O  O   . HOH E 4 .   ? 8.494   10.061 7.704   1.00 49.07  ? 2070 HOH A O   1 
HETATM 1051 O  O   . HOH E 4 .   ? -6.984  31.370 -11.450 1.00 33.43  ? 2071 HOH A O   1 
HETATM 1052 O  O   . HOH E 4 .   ? 18.095  21.253 -12.757 1.00 66.49  ? 2072 HOH A O   1 
HETATM 1053 O  O   . HOH E 4 .   ? 21.150  18.224 6.335   1.00 44.31  ? 2073 HOH A O   1 
HETATM 1054 O  O   . HOH E 4 .   ? 20.018  14.718 3.558   1.00 36.60  ? 2074 HOH A O   1 
HETATM 1055 O  O   . HOH E 4 .   ? 16.129  22.903 -10.427 1.00 58.51  ? 2075 HOH A O   1 
HETATM 1056 O  O   . HOH E 4 .   ? 2.867   41.118 -5.135  1.00 33.60  ? 2076 HOH A O   1 
HETATM 1057 O  O   . HOH E 4 .   ? -7.286  32.362 6.238   1.00 64.73  ? 2077 HOH A O   1 
HETATM 1058 O  O   . HOH E 4 .   ? 19.686  6.699  10.618  1.00 55.77  ? 2078 HOH A O   1 
HETATM 1059 O  O   . HOH E 4 .   ? 13.954  9.121  -0.295  1.00 49.20  ? 2079 HOH A O   1 
HETATM 1060 O  O   . HOH E 4 .   ? -4.674  19.384 0.679   1.00 46.22  ? 2080 HOH A O   1 
HETATM 1061 O  O   . HOH E 4 .   ? 0.996   16.521 -3.597  1.00 65.02  ? 2081 HOH A O   1 
HETATM 1062 O  O   . HOH E 4 .   ? 5.348   40.046 2.033   1.00 33.93  ? 2082 HOH A O   1 
HETATM 1063 O  O   . HOH E 4 .   ? 7.630   35.895 7.178   1.00 50.05  ? 2083 HOH A O   1 
HETATM 1064 O  O   . HOH E 4 .   ? 9.384   30.330 9.637   1.00 25.73  ? 2084 HOH A O   1 
HETATM 1065 O  O   . HOH E 4 .   ? 21.238  16.245 10.760  1.00 54.71  ? 2085 HOH A O   1 
HETATM 1066 O  O   . HOH E 4 .   ? -5.861  28.955 7.405   1.00 61.98  ? 2086 HOH A O   1 
HETATM 1067 O  O   . HOH E 4 .   ? 29.765  18.875 4.055   1.00 79.63  ? 2087 HOH A O   1 
HETATM 1068 O  O   . HOH E 4 .   ? 27.183  18.317 3.167   1.00 62.20  ? 2088 HOH A O   1 
HETATM 1069 O  O   . HOH E 4 .   ? -2.145  26.674 -4.339  1.00 56.27  ? 2089 HOH A O   1 
HETATM 1070 O  O   . HOH E 4 .   ? 4.697   43.050 2.830   1.00 49.06  ? 2090 HOH A O   1 
HETATM 1071 O  O   . HOH E 4 .   ? 22.974  8.287  5.610   1.00 51.85  ? 2091 HOH A O   1 
HETATM 1072 O  O   . HOH E 4 .   ? -9.271  30.626 -5.222  1.00 56.29  ? 2092 HOH A O   1 
HETATM 1073 O  O   . HOH E 4 .   ? 21.424  39.177 -0.448  1.00 57.26  ? 2093 HOH A O   1 
HETATM 1074 O  O   . HOH E 4 .   ? 20.562  7.268  4.798   1.00 51.84  ? 2094 HOH A O   1 
HETATM 1075 O  O   . HOH E 4 .   ? 22.392  15.566 6.290   1.00 33.96  ? 2095 HOH A O   1 
HETATM 1076 O  O   . HOH E 4 .   ? 22.935  9.598  8.253   1.00 57.95  ? 2096 HOH A O   1 
HETATM 1077 O  O   . HOH E 4 .   ? 3.300   27.660 -12.320 1.00 81.80  ? 2097 HOH A O   1 
HETATM 1078 O  O   . HOH E 4 .   ? -0.631  41.123 0.647   1.00 67.43  ? 2098 HOH A O   1 
HETATM 1079 O  O   . HOH E 4 .   ? 5.197   29.824 -14.412 1.00 60.48  ? 2099 HOH A O   1 
HETATM 1080 O  O   . HOH E 4 .   ? -4.838  37.651 4.293   1.00 45.40  ? 2100 HOH A O   1 
HETATM 1081 O  O   . HOH E 4 .   ? -2.897  42.397 -1.847  1.00 60.46  ? 2101 HOH A O   1 
HETATM 1082 O  O   . HOH E 4 .   ? -5.420  34.942 7.393   1.00 55.77  ? 2102 HOH A O   1 
HETATM 1083 O  O   . HOH E 4 .   ? 17.455  37.352 -5.572  1.00 60.95  ? 2103 HOH A O   1 
HETATM 1084 O  O   . HOH E 4 .   ? 10.344  15.200 21.461  1.00 73.06  ? 2104 HOH A O   1 
HETATM 1085 O  O   . HOH E 4 .   ? 3.852   30.902 -11.171 1.00 69.99  ? 2105 HOH A O   1 
HETATM 1086 O  O   . HOH E 4 .   ? 13.479  7.359  12.906  1.00 46.18  ? 2106 HOH A O   1 
HETATM 1087 O  O   . HOH E 4 .   ? -5.019  40.381 -4.096  1.00 55.04  ? 2107 HOH A O   1 
HETATM 1088 O  O   . HOH E 4 .   ? 12.944  13.313 21.041  1.00 51.65  ? 2108 HOH A O   1 
HETATM 1089 O  O   . HOH E 4 .   ? 16.640  27.694 -8.708  1.00 37.41  ? 2109 HOH A O   1 
HETATM 1090 O  O   . HOH E 4 .   ? 10.525  9.050  16.492  1.00 58.71  ? 2110 HOH A O   1 
HETATM 1091 O  O   . HOH E 4 .   ? 27.719  23.532 2.138   1.00 56.15  ? 2111 HOH A O   1 
HETATM 1092 O  O   . HOH E 4 .   ? 14.066  4.707  -1.067  1.00 64.86  ? 2112 HOH A O   1 
HETATM 1093 O  O   . HOH E 4 .   ? 7.379   14.211 20.301  1.00 81.36  ? 2113 HOH A O   1 
HETATM 1094 O  O   . HOH E 4 .   ? -6.580  25.592 5.816   1.00 50.92  ? 2114 HOH A O   1 
HETATM 1095 O  O   . HOH E 4 .   ? 10.327  28.253 -8.206  1.00 77.78  ? 2115 HOH A O   1 
HETATM 1096 O  O   . HOH E 4 .   ? 20.306  23.187 -11.628 1.00 67.03  ? 2116 HOH A O   1 
HETATM 1097 O  O   . HOH E 4 .   ? 8.152   27.335 -5.654  1.00 52.02  ? 2117 HOH A O   1 
HETATM 1098 O  O   . HOH E 4 .   ? 10.414  41.214 -9.075  1.00 48.49  ? 2118 HOH A O   1 
HETATM 1099 O  O   . HOH E 4 .   ? 11.625  19.977 -4.318  1.00 56.10  ? 2119 HOH A O   1 
HETATM 1100 O  O   . HOH E 4 .   ? 2.887   45.148 6.080   1.00 45.84  ? 2120 HOH A O   1 
HETATM 1101 O  O   . HOH E 4 .   ? 1.895   45.027 8.649   1.00 54.54  ? 2121 HOH A O   1 
HETATM 1102 O  O   . HOH E 4 .   ? 23.954  31.030 -6.768  1.00 45.21  ? 2122 HOH A O   1 
HETATM 1103 O  O   . HOH E 4 .   ? 16.980  7.476  14.985  1.00 59.30  ? 2123 HOH A O   1 
HETATM 1104 O  O   . HOH E 4 .   ? -0.810  43.416 -6.743  1.00 53.09  ? 2124 HOH A O   1 
HETATM 1105 O  O   . HOH E 4 .   ? 19.324  24.864 -7.630  1.00 48.12  ? 2125 HOH A O   1 
HETATM 1106 O  O   . HOH E 4 .   ? 11.331  11.712 -6.908  1.00 61.99  ? 2126 HOH A O   1 
HETATM 1107 O  O   . HOH E 4 .   ? 7.934   9.717  15.057  1.00 56.17  ? 2127 HOH A O   1 
HETATM 1108 O  O   . HOH E 4 .   ? 13.413  9.544  3.402   1.00 42.50  ? 2128 HOH A O   1 
HETATM 1109 O  O   . HOH E 4 .   ? -5.585  40.798 -1.069  1.00 56.40  ? 2129 HOH A O   1 
HETATM 1110 O  O   . HOH E 4 .   ? 26.757  20.968 -2.808  1.00 34.51  ? 2130 HOH A O   1 
HETATM 1111 O  O   . HOH E 4 .   ? -1.776  39.104 3.267   1.00 42.98  ? 2131 HOH A O   1 
HETATM 1112 O  O   . HOH E 4 .   ? 13.470  11.938 -8.942  1.00 44.23  ? 2132 HOH A O   1 
HETATM 1113 O  O   . HOH E 4 .   ? 8.293   27.989 10.618  1.00 92.19  ? 2133 HOH A O   1 
HETATM 1114 O  O   . HOH E 4 .   ? 5.321   13.146 -3.139  1.00 49.48  ? 2134 HOH A O   1 
HETATM 1115 O  O   . HOH E 4 .   ? 2.839   12.848 -0.626  1.00 48.21  ? 2135 HOH A O   1 
HETATM 1116 O  O   . HOH E 4 .   ? -2.354  37.527 5.987   1.00 49.17  ? 2136 HOH A O   1 
HETATM 1117 O  O   . HOH E 4 .   ? -3.827  40.719 4.242   1.00 72.60  ? 2137 HOH A O   1 
HETATM 1118 O  O   . HOH E 4 .   ? 0.956   36.466 9.644   1.00 49.29  ? 2138 HOH A O   1 
HETATM 1119 O  O   . HOH E 4 .   ? 3.060   37.260 11.430  1.00 53.90  ? 2139 HOH A O   1 
HETATM 1120 O  O   . HOH E 4 .   ? 4.547   10.299 -7.555  1.00 55.22  ? 2140 HOH A O   1 
HETATM 1121 O  O   . HOH E 4 .   ? 3.472   7.614  -6.140  1.00 62.95  ? 2141 HOH A O   1 
HETATM 1122 O  O   . HOH E 4 .   ? 18.329  21.880 10.738  1.00 45.69  ? 2142 HOH A O   1 
HETATM 1123 O  O   . HOH E 4 .   ? -2.101  39.821 -1.085  1.00 85.20  ? 2143 HOH A O   1 
HETATM 1124 O  O   . HOH E 4 .   ? 6.831   31.968 -13.401 1.00 74.48  ? 2144 HOH A O   1 
HETATM 1125 O  O   . HOH E 4 .   ? 25.596  31.074 -9.066  1.00 55.20  ? 2145 HOH A O   1 
HETATM 1126 O  O   . HOH E 4 .   ? -11.147 35.534 1.552   1.00 56.71  ? 2146 HOH A O   1 
HETATM 1127 O  O   . HOH E 4 .   ? 23.389  20.311 5.254   1.00 47.60  ? 2147 HOH A O   1 
HETATM 1128 O  O   . HOH E 4 .   ? -9.438  30.393 3.902   1.00 64.91  ? 2148 HOH A O   1 
HETATM 1129 O  O   . HOH E 4 .   ? -9.866  34.465 4.590   1.00 58.58  ? 2149 HOH A O   1 
HETATM 1130 O  O   . HOH E 4 .   ? -10.204 32.565 2.535   1.00 73.81  ? 2150 HOH A O   1 
HETATM 1131 O  O   . HOH E 4 .   ? 9.074   18.932 12.986  1.00 37.57  ? 2151 HOH A O   1 
HETATM 1132 O  O   . HOH E 4 .   ? 19.260  18.080 12.690  1.00 65.63  ? 2152 HOH A O   1 
HETATM 1133 O  O   . HOH E 4 .   ? 10.931  14.819 -9.672  1.00 54.70  ? 2153 HOH A O   1 
HETATM 1134 O  O   . HOH E 4 .   ? 1.258   14.100 -5.901  1.00 70.23  ? 2154 HOH A O   1 
HETATM 1135 O  O   . HOH E 4 .   ? 3.371   11.859 -5.656  1.00 65.11  ? 2155 HOH A O   1 
HETATM 1136 O  O   . HOH E 4 .   ? 8.417   15.089 -11.829 1.00 65.43  ? 2156 HOH A O   1 
HETATM 1137 O  O   . HOH E 4 .   ? 11.460  26.513 -4.688  1.00 29.86  ? 2157 HOH A O   1 
HETATM 1138 O  O   . HOH E 4 .   ? 8.808   27.265 -2.878  1.00 35.31  ? 2158 HOH A O   1 
HETATM 1139 O  O   . HOH E 4 .   ? 6.392   25.047 -3.026  1.00 46.27  ? 2159 HOH A O   1 
HETATM 1140 O  O   . HOH E 4 .   ? 4.372   22.666 -3.796  1.00 75.03  ? 2160 HOH A O   1 
HETATM 1141 O  O   . HOH E 4 .   ? 18.743  9.153  -1.314  1.00 42.51  ? 2161 HOH A O   1 
HETATM 1142 O  O   . HOH E 4 .   ? 8.736   29.293 -6.877  1.00 41.19  ? 2162 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   1   1   SER SER A . n 
A 1 2   LEU 2   2   2   LEU LEU A . n 
A 1 3   LEU 3   3   3   LEU LEU A . n 
A 1 4   GLU 4   4   4   GLU GLU A . n 
A 1 5   PHE 5   5   5   PHE PHE A . n 
A 1 6   GLY 6   6   6   GLY GLY A . n 
A 1 7   LYS 7   7   7   LYS LYS A . n 
A 1 8   MET 8   8   8   MET MET A . n 
A 1 9   ILE 9   9   9   ILE ILE A . n 
A 1 10  LEU 10  10  10  LEU LEU A . n 
A 1 11  GLU 11  11  11  GLU GLU A . n 
A 1 12  GLU 12  12  12  GLU GLU A . n 
A 1 13  THR 13  13  13  THR THR A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  LYS 15  16  16  LYS LYS A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ALA 17  18  18  ALA ALA A . n 
A 1 18  ILE 18  19  19  ILE ILE A . n 
A 1 19  PRO 19  20  20  PRO PRO A . n 
A 1 20  SER 20  21  21  SER SER A . n 
A 1 21  TYR 21  22  22  TYR TYR A . n 
A 1 22  SER 22  23  23  SER SER A . n 
A 1 23  SER 23  24  24  SER SER A . n 
A 1 24  TYR 24  25  25  TYR TYR A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  CYS 26  27  27  CYS CYS A . n 
A 1 27  TYR 27  28  28  TYR TYR A . n 
A 1 28  CYS 28  29  29  CYS CYS A . n 
A 1 29  GLY 29  30  30  GLY GLY A . n 
A 1 30  TRP 30  31  31  TRP TRP A . n 
A 1 31  GLY 31  32  32  GLY GLY A . n 
A 1 32  GLY 32  33  33  GLY GLY A . n 
A 1 33  LYS 33  34  34  LYS LYS A . n 
A 1 34  GLY 34  35  35  GLY GLY A . n 
A 1 35  THR 35  36  36  THR THR A . n 
A 1 36  PRO 36  37  37  PRO PRO A . n 
A 1 37  LYS 37  38  38  LYS LYS A . n 
A 1 38  ASP 38  39  39  ASP ASP A . n 
A 1 39  ALA 39  40  40  ALA ALA A . n 
A 1 40  THR 40  41  41  THR THR A . n 
A 1 41  ASP 41  42  42  ASP ASP A . n 
A 1 42  ARG 42  43  43  ARG ARG A . n 
A 1 43  CYS 43  44  44  CYS CYS A . n 
A 1 44  CYS 44  45  45  CYS CYS A . n 
A 1 45  PHE 45  46  46  PHE PHE A . n 
A 1 46  VAL 46  47  47  VAL VAL A . n 
A 1 47  HIS 47  48  48  HIS HIS A . n 
A 1 48  ASP 48  49  49  ASP ASP A . n 
A 1 49  CYS 49  50  50  CYS CYS A . n 
A 1 50  CYS 50  51  51  CYS CYS A . n 
A 1 51  TYR 51  52  52  TYR TYR A . n 
A 1 52  GLY 52  53  53  GLY GLY A . n 
A 1 53  ASN 53  54  54  ASN ASN A . n 
A 1 54  LEU 54  55  55  LEU LEU A . n 
A 1 55  PRO 55  56  56  PRO PRO A . n 
A 1 56  ASP 56  59  59  ASP ASP A . n 
A 1 57  CYS 57  61  61  CYS CYS A . n 
A 1 58  ASN 58  67  67  ASN ASN A . n 
A 1 59  PRO 59  68  68  PRO PRO A . n 
A 1 60  LYS 60  69  69  LYS LYS A . n 
A 1 61  SER 61  70  70  SER SER A . n 
A 1 62  ASP 62  71  71  ASP ASP A . n 
A 1 63  ARG 63  72  72  ARG ARG A . n 
A 1 64  TYR 64  73  73  TYR TYR A . n 
A 1 65  LYS 65  74  74  LYS LYS A . n 
A 1 66  TYR 66  75  75  TYR TYR A . n 
A 1 67  LYS 67  76  76  LYS LYS A . n 
A 1 68  ARG 68  77  77  ARG ARG A . n 
A 1 69  VAL 69  78  78  VAL VAL A . n 
A 1 70  ASN 70  79  79  ASN ASN A . n 
A 1 71  GLY 71  80  80  GLY GLY A . n 
A 1 72  ALA 72  81  81  ALA ALA A . n 
A 1 73  ILE 73  82  82  ILE ILE A . n 
A 1 74  VAL 74  83  83  VAL VAL A . n 
A 1 75  CYS 75  84  84  CYS CYS A . n 
A 1 76  GLU 76  85  85  GLU GLU A . n 
A 1 77  LYS 77  86  86  LYS LYS A . n 
A 1 78  GLY 78  88  88  GLY GLY A . n 
A 1 79  THR 79  89  89  THR THR A . n 
A 1 80  SER 80  90  90  SER SER A . n 
A 1 81  CYS 81  91  91  CYS CYS A . n 
A 1 82  GLU 82  92  92  GLU GLU A . n 
A 1 83  ASN 83  93  93  ASN ASN A . n 
A 1 84  ARG 84  94  94  ARG ARG A . n 
A 1 85  ILE 85  95  95  ILE ILE A . n 
A 1 86  CYS 86  96  96  CYS CYS A . n 
A 1 87  GLU 87  97  97  GLU GLU A . n 
A 1 88  CYS 88  98  98  CYS CYS A . n 
A 1 89  ASP 89  99  99  ASP ASP A . n 
A 1 90  LYS 90  100 100 LYS LYS A . n 
A 1 91  ALA 91  101 101 ALA ALA A . n 
A 1 92  ALA 92  102 102 ALA ALA A . n 
A 1 93  ALA 93  103 103 ALA ALA A . n 
A 1 94  ILE 94  104 104 ILE ILE A . n 
A 1 95  CYS 95  105 105 CYS CYS A . n 
A 1 96  PHE 96  106 106 PHE PHE A . n 
A 1 97  ARG 97  107 107 ARG ARG A . n 
A 1 98  GLN 98  108 108 GLN GLN A . n 
A 1 99  ASN 99  109 109 ASN ASN A . n 
A 1 100 LEU 100 110 110 LEU LEU A . n 
A 1 101 ASN 101 111 111 ASN ASN A . n 
A 1 102 THR 102 112 112 THR THR A . n 
A 1 103 TYR 103 113 113 TYR TYR A . n 
A 1 104 SER 104 114 114 SER SER A . n 
A 1 105 LYS 105 115 115 LYS LYS A . n 
A 1 106 LYS 106 116 116 LYS LYS A . n 
A 1 107 TYR 107 117 117 TYR TYR A . n 
A 1 108 MET 108 118 118 MET MET A . n 
A 1 109 LEU 109 119 119 LEU LEU A . n 
A 1 110 TYR 110 120 120 TYR TYR A . n 
A 1 111 PRO 111 121 121 PRO PRO A . n 
A 1 112 ASP 112 122 122 ASP ASP A . n 
A 1 113 PHE 113 124 124 PHE PHE A . n 
A 1 114 LEU 114 125 125 LEU LEU A . n 
A 1 115 CYS 115 126 126 CYS CYS A . n 
A 1 116 LYS 116 127 127 LYS LYS A . n 
A 1 117 GLY 117 128 128 GLY GLY A . n 
A 1 118 GLU 118 129 129 GLU GLU A . n 
A 1 119 LEU 119 130 130 LEU LEU A . n 
A 1 120 LYS 120 131 131 LYS LYS A . n 
A 1 121 CYS 121 133 133 CYS CYS A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   261  261  SO4 SO4 A . 
C 2 SO4 1   262  262  SO4 SO4 A . 
D 3 LCF 1   2001 2001 LCF LCF A . 
E 4 HOH 1   2002 1    HOH HOH A . 
E 4 HOH 2   2003 2    HOH HOH A . 
E 4 HOH 3   2004 3    HOH HOH A . 
E 4 HOH 4   2005 4    HOH HOH A . 
E 4 HOH 5   2006 5    HOH HOH A . 
E 4 HOH 6   2007 6    HOH HOH A . 
E 4 HOH 7   2008 7    HOH HOH A . 
E 4 HOH 8   2009 8    HOH HOH A . 
E 4 HOH 9   2010 9    HOH HOH A . 
E 4 HOH 10  2011 10   HOH HOH A . 
E 4 HOH 11  2012 11   HOH HOH A . 
E 4 HOH 12  2013 12   HOH HOH A . 
E 4 HOH 13  2014 13   HOH HOH A . 
E 4 HOH 14  2015 14   HOH HOH A . 
E 4 HOH 15  2016 15   HOH HOH A . 
E 4 HOH 16  2017 16   HOH HOH A . 
E 4 HOH 17  2018 17   HOH HOH A . 
E 4 HOH 18  2019 18   HOH HOH A . 
E 4 HOH 19  2020 19   HOH HOH A . 
E 4 HOH 20  2021 20   HOH HOH A . 
E 4 HOH 21  2022 21   HOH HOH A . 
E 4 HOH 22  2023 22   HOH HOH A . 
E 4 HOH 23  2024 23   HOH HOH A . 
E 4 HOH 24  2025 24   HOH HOH A . 
E 4 HOH 25  2026 25   HOH HOH A . 
E 4 HOH 26  2027 26   HOH HOH A . 
E 4 HOH 27  2028 27   HOH HOH A . 
E 4 HOH 28  2029 28   HOH HOH A . 
E 4 HOH 29  2030 29   HOH HOH A . 
E 4 HOH 30  2031 30   HOH HOH A . 
E 4 HOH 31  2032 31   HOH HOH A . 
E 4 HOH 32  2033 32   HOH HOH A . 
E 4 HOH 33  2034 33   HOH HOH A . 
E 4 HOH 34  2035 34   HOH HOH A . 
E 4 HOH 35  2036 35   HOH HOH A . 
E 4 HOH 36  2037 36   HOH HOH A . 
E 4 HOH 37  2038 37   HOH HOH A . 
E 4 HOH 38  2039 38   HOH HOH A . 
E 4 HOH 39  2040 39   HOH HOH A . 
E 4 HOH 40  2041 40   HOH HOH A . 
E 4 HOH 41  2042 41   HOH HOH A . 
E 4 HOH 42  2043 42   HOH HOH A . 
E 4 HOH 43  2044 43   HOH HOH A . 
E 4 HOH 44  2045 44   HOH HOH A . 
E 4 HOH 45  2046 45   HOH HOH A . 
E 4 HOH 46  2047 46   HOH HOH A . 
E 4 HOH 47  2048 47   HOH HOH A . 
E 4 HOH 48  2049 48   HOH HOH A . 
E 4 HOH 49  2050 49   HOH HOH A . 
E 4 HOH 50  2051 50   HOH HOH A . 
E 4 HOH 51  2052 51   HOH HOH A . 
E 4 HOH 52  2053 52   HOH HOH A . 
E 4 HOH 53  2054 53   HOH HOH A . 
E 4 HOH 54  2055 54   HOH HOH A . 
E 4 HOH 55  2056 55   HOH HOH A . 
E 4 HOH 56  2057 56   HOH HOH A . 
E 4 HOH 57  2058 57   HOH HOH A . 
E 4 HOH 58  2059 58   HOH HOH A . 
E 4 HOH 59  2060 59   HOH HOH A . 
E 4 HOH 60  2061 60   HOH HOH A . 
E 4 HOH 61  2062 61   HOH HOH A . 
E 4 HOH 62  2063 62   HOH HOH A . 
E 4 HOH 63  2064 63   HOH HOH A . 
E 4 HOH 64  2065 64   HOH HOH A . 
E 4 HOH 65  2066 65   HOH HOH A . 
E 4 HOH 66  2067 66   HOH HOH A . 
E 4 HOH 67  2068 67   HOH HOH A . 
E 4 HOH 68  2069 68   HOH HOH A . 
E 4 HOH 69  2070 69   HOH HOH A . 
E 4 HOH 70  2071 70   HOH HOH A . 
E 4 HOH 71  2072 71   HOH HOH A . 
E 4 HOH 72  2073 72   HOH HOH A . 
E 4 HOH 73  2074 73   HOH HOH A . 
E 4 HOH 74  2075 74   HOH HOH A . 
E 4 HOH 75  2076 75   HOH HOH A . 
E 4 HOH 76  2077 76   HOH HOH A . 
E 4 HOH 77  2078 77   HOH HOH A . 
E 4 HOH 78  2079 78   HOH HOH A . 
E 4 HOH 79  2080 79   HOH HOH A . 
E 4 HOH 80  2081 80   HOH HOH A . 
E 4 HOH 81  2082 81   HOH HOH A . 
E 4 HOH 82  2083 82   HOH HOH A . 
E 4 HOH 83  2084 83   HOH HOH A . 
E 4 HOH 84  2085 84   HOH HOH A . 
E 4 HOH 85  2086 85   HOH HOH A . 
E 4 HOH 86  2087 86   HOH HOH A . 
E 4 HOH 87  2088 87   HOH HOH A . 
E 4 HOH 88  2089 88   HOH HOH A . 
E 4 HOH 89  2090 89   HOH HOH A . 
E 4 HOH 90  2091 90   HOH HOH A . 
E 4 HOH 91  2092 91   HOH HOH A . 
E 4 HOH 92  2093 92   HOH HOH A . 
E 4 HOH 93  2094 93   HOH HOH A . 
E 4 HOH 94  2095 94   HOH HOH A . 
E 4 HOH 95  2096 95   HOH HOH A . 
E 4 HOH 96  2097 96   HOH HOH A . 
E 4 HOH 97  2098 97   HOH HOH A . 
E 4 HOH 98  2099 98   HOH HOH A . 
E 4 HOH 99  2100 99   HOH HOH A . 
E 4 HOH 100 2101 100  HOH HOH A . 
E 4 HOH 101 2102 101  HOH HOH A . 
E 4 HOH 102 2103 102  HOH HOH A . 
E 4 HOH 103 2104 103  HOH HOH A . 
E 4 HOH 104 2105 104  HOH HOH A . 
E 4 HOH 105 2106 105  HOH HOH A . 
E 4 HOH 106 2107 106  HOH HOH A . 
E 4 HOH 107 2108 107  HOH HOH A . 
E 4 HOH 108 2109 108  HOH HOH A . 
E 4 HOH 109 2110 109  HOH HOH A . 
E 4 HOH 110 2111 110  HOH HOH A . 
E 4 HOH 111 2112 111  HOH HOH A . 
E 4 HOH 112 2113 112  HOH HOH A . 
E 4 HOH 113 2114 113  HOH HOH A . 
E 4 HOH 114 2115 114  HOH HOH A . 
E 4 HOH 115 2116 115  HOH HOH A . 
E 4 HOH 116 2117 116  HOH HOH A . 
E 4 HOH 117 2118 117  HOH HOH A . 
E 4 HOH 118 2119 118  HOH HOH A . 
E 4 HOH 119 2120 119  HOH HOH A . 
E 4 HOH 120 2121 120  HOH HOH A . 
E 4 HOH 121 2122 121  HOH HOH A . 
E 4 HOH 122 2123 122  HOH HOH A . 
E 4 HOH 123 2124 123  HOH HOH A . 
E 4 HOH 124 2125 124  HOH HOH A . 
E 4 HOH 125 2126 125  HOH HOH A . 
E 4 HOH 126 2127 126  HOH HOH A . 
E 4 HOH 127 2128 127  HOH HOH A . 
E 4 HOH 128 2129 128  HOH HOH A . 
E 4 HOH 129 2130 129  HOH HOH A . 
E 4 HOH 130 2131 130  HOH HOH A . 
E 4 HOH 131 2132 131  HOH HOH A . 
E 4 HOH 132 2133 132  HOH HOH A . 
E 4 HOH 133 2134 133  HOH HOH A . 
E 4 HOH 134 2135 134  HOH HOH A . 
E 4 HOH 135 2136 135  HOH HOH A . 
E 4 HOH 136 2137 136  HOH HOH A . 
E 4 HOH 137 2138 137  HOH HOH A . 
E 4 HOH 138 2139 138  HOH HOH A . 
E 4 HOH 139 2140 139  HOH HOH A . 
E 4 HOH 140 2141 140  HOH HOH A . 
E 4 HOH 141 2142 141  HOH HOH A . 
E 4 HOH 142 2143 142  HOH HOH A . 
E 4 HOH 143 2144 143  HOH HOH A . 
E 4 HOH 144 2145 144  HOH HOH A . 
E 4 HOH 145 2146 145  HOH HOH A . 
E 4 HOH 146 2147 146  HOH HOH A . 
E 4 HOH 147 2148 147  HOH HOH A . 
E 4 HOH 148 2149 148  HOH HOH A . 
E 4 HOH 149 2150 149  HOH HOH A . 
E 4 HOH 150 2151 150  HOH HOH A . 
E 4 HOH 151 2152 151  HOH HOH A . 
E 4 HOH 152 2153 152  HOH HOH A . 
E 4 HOH 153 2154 153  HOH HOH A . 
E 4 HOH 154 2155 154  HOH HOH A . 
E 4 HOH 155 2156 155  HOH HOH A . 
E 4 HOH 156 2157 156  HOH HOH A . 
E 4 HOH 157 2158 157  HOH HOH A . 
E 4 HOH 158 2159 158  HOH HOH A . 
E 4 HOH 159 2160 159  HOH HOH A . 
E 4 HOH 160 2161 160  HOH HOH A . 
E 4 HOH 161 2162 161  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-06-28 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 4 'Structure model' '_software.classification' 
2 4 'Structure model' '_software.name'           
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
CNS     refinement       0.9 ? 1 
DENZO   'data reduction' .   ? 2 
AUTOMAR 'data reduction' .   ? 3 
AMoRE   phasing          .   ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 SER A 24 ? ? -141.90 38.01 
2 1 LEU A 55 ? ? -119.29 70.45 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                                                                          SO4 
3 '[6-(4-CHLOROPHENYL)-2,2-DIMETHYL-7-PHENYL-2,3-DIHYDRO-1H-PYRROLIZIN-5-YL]ACETIC ACID' LCF 
4 water                                                                                  HOH 
#