data_1ZZZ
# 
_entry.id   1ZZZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   1ZZZ         
WWPDB D_1000177548 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1yyy 
_pdbx_database_related.content_type   unspecified 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        1ZZZ 
_pdbx_database_status.recvd_initial_deposition_date   1998-06-02 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    ? 
_pdbx_database_status.SG_entry                        . 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Krishnan, R.'      1 
'Zhang, E.'         2 
'Hakansson, K.'     3 
'Arni, R.K.'        4 
'Tulinsky, A.'      5 
'Lim-Wilby, M.S.L.' 6 
'Levy, O.E.'        7 
'Semple, J.E.'      8 
'Brunck, T.K.'      9 
# 
_citation.id                        primary 
_citation.title                     
'Highly selective mechanism-based thrombin inhibitors: structures of thrombin and trypsin inhibited with rigid peptidyl aldehydes.' 
_citation.journal_abbrev            Biochemistry 
_citation.journal_volume            37 
_citation.page_first                12094 
_citation.page_last                 12103 
_citation.year                      1998 
_citation.journal_id_ASTM           BICHAW 
_citation.country                   US 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_id_CSD            0033 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   9724521 
_citation.pdbx_database_id_DOI      10.1021/bi980840e 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Krishnan, R.'    1 
primary 'Zhang, E.'       2 
primary 'Hakansson, K.'   3 
primary 'Arni, R.K.'      4 
primary 'Tulinsky, A.'    5 
primary 'Lim-Wilby, M.S.' 6 
primary 'Levy, O.E.'      7 
primary 'Semple, J.E.'    8 
primary 'Brunck, T.K.'    9 
# 
_cell.entry_id           1ZZZ 
_cell.length_a           63.670 
_cell.length_b           63.200 
_cell.length_c           69.220 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         1ZZZ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat TRYPSIN 24739.814 1   ? ? ? ? 
2 non-polymer syn 
'2-{(3S)-3-[(benzylsulfonyl)amino]-2-oxopiperidin-1-yl}-N-{(2S)-1-[(3R)-1-carbamimidoylpiperidin-3-yl]-3-oxopropan-2-yl}acetamide' 
506.618   1   ? ? ? ? 
3 non-polymer syn 'CALCIUM ION' 40.078    1   ? ? ? ? 
4 water       nat water 18.015    157 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        TRP-CVS1694 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;LGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFIS
ASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDS
SCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_seq_one_letter_code_can   
;LGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEGNEQFIS
ASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDS
SCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTIASN
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   LEU n 
1 2   GLY n 
1 3   ALA n 
1 4   ALA n 
1 5   VAL n 
1 6   ALA n 
1 7   PHE n 
1 8   PRO n 
1 9   VAL n 
1 10  ASP n 
1 11  ASP n 
1 12  ASP n 
1 13  ASP n 
1 14  LYS n 
1 15  ILE n 
1 16  VAL n 
1 17  GLY n 
1 18  GLY n 
1 19  TYR n 
1 20  THR n 
1 21  CYS n 
1 22  GLY n 
1 23  ALA n 
1 24  ASN n 
1 25  THR n 
1 26  VAL n 
1 27  PRO n 
1 28  TYR n 
1 29  GLN n 
1 30  VAL n 
1 31  SER n 
1 32  LEU n 
1 33  ASN n 
1 34  SER n 
1 35  GLY n 
1 36  TYR n 
1 37  HIS n 
1 38  PHE n 
1 39  CYS n 
1 40  GLY n 
1 41  GLY n 
1 42  SER n 
1 43  LEU n 
1 44  ILE n 
1 45  ASN n 
1 46  SER n 
1 47  GLN n 
1 48  TRP n 
1 49  VAL n 
1 50  VAL n 
1 51  SER n 
1 52  ALA n 
1 53  ALA n 
1 54  HIS n 
1 55  CYS n 
1 56  TYR n 
1 57  LYS n 
1 58  SER n 
1 59  GLY n 
1 60  ILE n 
1 61  GLN n 
1 62  VAL n 
1 63  ARG n 
1 64  LEU n 
1 65  GLY n 
1 66  GLU n 
1 67  ASP n 
1 68  ASN n 
1 69  ILE n 
1 70  ASN n 
1 71  VAL n 
1 72  VAL n 
1 73  GLU n 
1 74  GLY n 
1 75  ASN n 
1 76  GLU n 
1 77  GLN n 
1 78  PHE n 
1 79  ILE n 
1 80  SER n 
1 81  ALA n 
1 82  SER n 
1 83  LYS n 
1 84  SER n 
1 85  ILE n 
1 86  VAL n 
1 87  HIS n 
1 88  PRO n 
1 89  SER n 
1 90  TYR n 
1 91  ASN n 
1 92  SER n 
1 93  ASN n 
1 94  THR n 
1 95  LEU n 
1 96  ASN n 
1 97  ASN n 
1 98  ASP n 
1 99  ILE n 
1 100 MET n 
1 101 LEU n 
1 102 ILE n 
1 103 LYS n 
1 104 LEU n 
1 105 LYS n 
1 106 SER n 
1 107 ALA n 
1 108 ALA n 
1 109 SER n 
1 110 LEU n 
1 111 ASN n 
1 112 SER n 
1 113 ARG n 
1 114 VAL n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 SER n 
1 119 LEU n 
1 120 PRO n 
1 121 THR n 
1 122 SER n 
1 123 CYS n 
1 124 ALA n 
1 125 SER n 
1 126 ALA n 
1 127 GLY n 
1 128 THR n 
1 129 GLN n 
1 130 CYS n 
1 131 LEU n 
1 132 ILE n 
1 133 SER n 
1 134 GLY n 
1 135 TRP n 
1 136 GLY n 
1 137 ASN n 
1 138 THR n 
1 139 LYS n 
1 140 SER n 
1 141 SER n 
1 142 GLY n 
1 143 THR n 
1 144 SER n 
1 145 TYR n 
1 146 PRO n 
1 147 ASP n 
1 148 VAL n 
1 149 LEU n 
1 150 LYS n 
1 151 CYS n 
1 152 LEU n 
1 153 LYS n 
1 154 ALA n 
1 155 PRO n 
1 156 ILE n 
1 157 LEU n 
1 158 SER n 
1 159 ASP n 
1 160 SER n 
1 161 SER n 
1 162 CYS n 
1 163 LYS n 
1 164 SER n 
1 165 ALA n 
1 166 TYR n 
1 167 PRO n 
1 168 GLY n 
1 169 GLN n 
1 170 ILE n 
1 171 THR n 
1 172 SER n 
1 173 ASN n 
1 174 MET n 
1 175 PHE n 
1 176 CYS n 
1 177 ALA n 
1 178 GLY n 
1 179 TYR n 
1 180 LEU n 
1 181 GLU n 
1 182 GLY n 
1 183 GLY n 
1 184 LYS n 
1 185 ASP n 
1 186 SER n 
1 187 CYS n 
1 188 GLN n 
1 189 GLY n 
1 190 ASP n 
1 191 SER n 
1 192 GLY n 
1 193 GLY n 
1 194 PRO n 
1 195 VAL n 
1 196 VAL n 
1 197 CYS n 
1 198 SER n 
1 199 GLY n 
1 200 LYS n 
1 201 LEU n 
1 202 GLN n 
1 203 GLY n 
1 204 ILE n 
1 205 VAL n 
1 206 SER n 
1 207 TRP n 
1 208 GLY n 
1 209 SER n 
1 210 GLY n 
1 211 CYS n 
1 212 ALA n 
1 213 GLN n 
1 214 LYS n 
1 215 ASN n 
1 216 LYS n 
1 217 PRO n 
1 218 GLY n 
1 219 VAL n 
1 220 TYR n 
1 221 THR n 
1 222 LYS n 
1 223 VAL n 
1 224 CYS n 
1 225 ASN n 
1 226 TYR n 
1 227 VAL n 
1 228 SER n 
1 229 TRP n 
1 230 ILE n 
1 231 LYS n 
1 232 GLN n 
1 233 THR n 
1 234 ILE n 
1 235 ALA n 
1 236 SER n 
1 237 ASN n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                cattle 
_entity_src_nat.pdbx_organism_scientific   'Bos taurus' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      9913 
_entity_src_nat.genus                      Bos 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TRY1_BOVIN 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P00760 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;FIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVSAAHCYKSGIQVRLGEDNINVVEG
NEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLNSRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKA
PILSDSSCKSAYPGQITSNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIKQTI
ASN
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              1ZZZ 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 237 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P00760 
_struct_ref_seq.db_align_beg                  7 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  243 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       245 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0IV peptide-like        . 
'2-{(3S)-3-[(benzylsulfonyl)amino]-2-oxopiperidin-1-yl}-N-{(2S)-1-[(3R)-1-carbamimidoylpiperidin-3-yl]-3-oxopropan-2-yl}acetamide' 
CVS1694 'C23 H34 N6 O5 S' 506.618 
ALA 'L-peptide linking' y ALANINE ?       'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE ?       'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE ?       'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?       'C4 H7 N O4'      133.103 
CA  non-polymer         . 'CALCIUM ION' ?       'Ca 2'            40.078  
CYS 'L-peptide linking' y CYSTEINE ?       'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE ?       'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?       'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE ?       'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE ?       'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER ?       'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?       'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE ?       'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE ?       'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE ?       'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE ?       'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE ?       'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE ?       'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE ?       'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?       'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE ?       'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE ?       'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          1ZZZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.81 
_exptl_crystal.density_percent_sol   56.28 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'pH 7.5' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           300 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   RIGAKU 
_diffrn_detector.pdbx_collection_date   1995-09 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'NI FILTER' 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      ? 
_diffrn_source.type                        ? 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             1.5418 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     1ZZZ 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             ? 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   16355 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         72 
_reflns.pdbx_Rmerge_I_obs            0.043 
_reflns.pdbx_Rsym_value              0.12 
_reflns.pdbx_netI_over_sigmaI        15.4 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              2.00 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.9 
_reflns_shell.d_res_low              2.0 
_reflns_shell.percent_possible_all   43 
_reflns_shell.Rmerge_I_obs           0.1 
_reflns_shell.pdbx_Rsym_value        0.25 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        2.0 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 1ZZZ 
_refine.ls_number_reflns_obs                     15565 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          4.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             7.0 
_refine.ls_d_res_high                            1.9 
_refine.ls_percent_reflns_obs                    72 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.157 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               20.70 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1PPC' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        1ZZZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.2 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           7.0 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1629 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             157 
_refine_hist.number_atoms_total               1815 
_refine_hist.d_res_high                       1.9 
_refine_hist.d_res_low                        7.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
p_bond_d            0.015 0.020 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_d           0.035 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_angle_deg         ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_planar_d          0.055 0.050 ? ? 'X-RAY DIFFRACTION' ? 
p_hb_or_metal_coord ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_mcbond_it         1.1   1.0   ? ? 'X-RAY DIFFRACTION' ? 
p_mcangle_it        1.8   1.5   ? ? 'X-RAY DIFFRACTION' ? 
p_scbond_it         2.6   2.0   ? ? 'X-RAY DIFFRACTION' ? 
p_scangle_it        3.8   2.5   ? ? 'X-RAY DIFFRACTION' ? 
p_plane_restr       0.027 0.030 ? ? 'X-RAY DIFFRACTION' ? 
p_chiral_restr      0.15  0.20  ? ? 'X-RAY DIFFRACTION' ? 
p_singtor_nbd       0.22  0.60  ? ? 'X-RAY DIFFRACTION' ? 
p_multtor_nbd       0.31  0.60  ? ? 'X-RAY DIFFRACTION' ? 
p_xhyhbond_nbd      ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_xyhbond_nbd       0.28  0.60  ? ? 'X-RAY DIFFRACTION' ? 
p_planar_tor        4.0   3     ? ? 'X-RAY DIFFRACTION' ? 
p_staggered_tor     20.0  15    ? ? 'X-RAY DIFFRACTION' ? 
p_orthonormal_tor   ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
p_transverse_tor    30.0  20    ? ? 'X-RAY DIFFRACTION' ? 
p_special_tor       ?     ?     ? ? 'X-RAY DIFFRACTION' ? 
# 
_struct.entry_id                  1ZZZ 
_struct.title                     'Trypsin inhibitors with rigid tripeptidyl aldehydes' 
_struct.pdbx_descriptor           'Trypsin/Trypsin inhibitor complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        1ZZZ 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            'SERINE PROTEASE, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ALA A 53  ? CYS A 55  ? ALA A 56  CYS A 58  5 ? 3 
HELX_P HELX_P2 2 VAL A 223 ? ASN A 225 ? VAL A 231 ASN A 233 5 ? 3 
HELX_P HELX_P3 3 VAL A 227 ? ALA A 235 ? VAL A 235 ALA A 243 1 ? 9 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 21  SG ? ? ? 1_555 A CYS 151 SG  ? ? A CYS 22  A CYS 157 1_555 ? ? ? ? ? ? ? 2.092 ? 
disulf2 disulf ? ? A CYS 39  SG ? ? ? 1_555 A CYS 55  SG  ? ? A CYS 42  A CYS 58  1_555 ? ? ? ? ? ? ? 2.076 ? 
disulf3 disulf ? ? A CYS 123 SG ? ? ? 1_555 A CYS 224 SG  ? ? A CYS 128 A CYS 232 1_555 ? ? ? ? ? ? ? 2.013 ? 
disulf4 disulf ? ? A CYS 130 SG ? ? ? 1_555 A CYS 197 SG  ? ? A CYS 136 A CYS 201 1_555 ? ? ? ? ? ? ? 2.002 ? 
disulf5 disulf ? ? A CYS 162 SG ? ? ? 1_555 A CYS 176 SG  ? ? A CYS 168 A CYS 182 1_555 ? ? ? ? ? ? ? 2.041 ? 
disulf6 disulf ? ? A CYS 187 SG ? ? ? 1_555 A CYS 211 SG  ? ? A CYS 191 A CYS 220 1_555 ? ? ? ? ? ? ? 2.065 ? 
metalc1 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 66  OE1 ? ? A CA  701 A GLU 70  1_555 ? ? ? ? ? ? ? 2.192 ? 
metalc2 metalc ? ? C CA  .   CA ? ? ? 1_555 A VAL 71  O   ? ? A CA  701 A VAL 75  1_555 ? ? ? ? ? ? ? 2.290 ? 
metalc3 metalc ? ? C CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  701 A HOH 574 1_555 ? ? ? ? ? ? ? 2.583 ? 
metalc4 metalc ? ? C CA  .   CA ? ? ? 1_555 A ASN 68  O   ? ? A CA  701 A ASN 72  1_555 ? ? ? ? ? ? ? 2.439 ? 
metalc5 metalc ? ? C CA  .   CA ? ? ? 1_555 D HOH .   O   ? ? A CA  701 A HOH 409 1_555 ? ? ? ? ? ? ? 2.453 ? 
metalc6 metalc ? ? C CA  .   CA ? ? ? 1_555 A GLU 76  OE2 ? ? A CA  701 A GLU 80  1_555 ? ? ? ? ? ? ? 2.633 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 77  ? SER A 80  ? GLN A 81  SER A 84  
A 2 GLN A 61  ? LEU A 64  ? GLN A 64  LEU A 67  
A 3 GLN A 29  ? ASN A 33  ? GLN A 30  ASN A 34  
A 4 HIS A 37  ? ASN A 45  ? HIS A 40  ASN A 48  
A 5 TRP A 48  ? SER A 51  ? TRP A 51  SER A 54  
A 6 MET A 100 ? LEU A 104 ? MET A 104 LEU A 108 
A 7 ALA A 81  ? VAL A 86  ? ALA A 85  VAL A 90  
B 1 LYS A 150 ? PRO A 155 ? LYS A 156 PRO A 161 
B 2 GLN A 129 ? GLY A 134 ? GLN A 135 GLY A 140 
B 3 PRO A 194 ? CYS A 197 ? PRO A 198 CYS A 201 
B 4 LYS A 200 ? TRP A 207 ? LYS A 204 TRP A 215 
B 5 GLY A 218 ? LYS A 222 ? GLY A 226 LYS A 230 
B 6 MET A 174 ? ALA A 177 ? MET A 180 ALA A 183 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLN A 77  ? O GLN A 81  N LEU A 64  ? N LEU A 67  
A 2 3 O GLN A 61  ? O GLN A 64  N ASN A 33  ? N ASN A 34  
A 3 4 O VAL A 30  ? O VAL A 31  N GLY A 41  ? N GLY A 44  
A 4 5 O SER A 42  ? O SER A 45  N VAL A 50  ? N VAL A 53  
A 5 6 O VAL A 49  ? O VAL A 52  N ILE A 102 ? N ILE A 106 
A 6 7 O LEU A 101 ? O LEU A 105 N ILE A 85  ? N ILE A 89  
B 1 2 O LYS A 150 ? O LYS A 156 N GLY A 134 ? N GLY A 140 
B 2 3 O LEU A 131 ? O LEU A 137 N VAL A 196 ? N VAL A 200 
B 3 4 O VAL A 195 ? O VAL A 199 N GLY A 203 ? N GLY A 211 
B 4 5 O ILE A 204 ? O ILE A 212 N THR A 221 ? N THR A 229 
B 5 6 O GLY A 218 ? O GLY A 226 N ALA A 177 ? N ALA A 183 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE 0IV A 246' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE CA A 701'  
CAT Author   ? ? ? ? 3  'ACTIVE SITE OF TRYPSIN'             
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 17 HIS A 54  ? HIS A 57  . ? 1_555 ? 
2  AC1 17 LEU A 95  ? LEU A 99  . ? 1_555 ? 
3  AC1 17 ASP A 185 ? ASP A 189 . ? 1_555 ? 
4  AC1 17 SER A 186 ? SER A 190 . ? 1_555 ? 
5  AC1 17 CYS A 187 ? CYS A 191 . ? 1_555 ? 
6  AC1 17 GLY A 189 ? GLY A 193 . ? 1_555 ? 
7  AC1 17 SER A 191 ? SER A 195 . ? 1_555 ? 
8  AC1 17 SER A 206 ? SER A 214 . ? 1_555 ? 
9  AC1 17 TRP A 207 ? TRP A 215 . ? 1_555 ? 
10 AC1 17 GLY A 208 ? GLY A 216 . ? 1_555 ? 
11 AC1 17 SER A 209 ? SER A 217 . ? 1_555 ? 
12 AC1 17 GLY A 210 ? GLY A 219 . ? 1_555 ? 
13 AC1 17 GLY A 218 ? GLY A 226 . ? 1_555 ? 
14 AC1 17 HOH D .   ? HOH A 412 . ? 1_555 ? 
15 AC1 17 HOH D .   ? HOH A 434 . ? 1_555 ? 
16 AC1 17 HOH D .   ? HOH A 464 . ? 1_555 ? 
17 AC1 17 HOH D .   ? HOH A 554 . ? 1_555 ? 
18 AC2 6  GLU A 66  ? GLU A 70  . ? 1_555 ? 
19 AC2 6  ASN A 68  ? ASN A 72  . ? 1_555 ? 
20 AC2 6  VAL A 71  ? VAL A 75  . ? 1_555 ? 
21 AC2 6  GLU A 76  ? GLU A 80  . ? 1_555 ? 
22 AC2 6  HOH D .   ? HOH A 409 . ? 1_555 ? 
23 AC2 6  HOH D .   ? HOH A 574 . ? 1_555 ? 
24 CAT 3  HIS A 54  ? HIS A 57  . ? 1_555 ? 
25 CAT 3  ASP A 98  ? ASP A 102 . ? 1_555 ? 
26 CAT 3  SER A 191 ? SER A 195 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          1ZZZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    1ZZZ 
_atom_sites.fract_transf_matrix[1][1]   0.015706 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015823 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014447 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 15  ? 10.922 3.292   26.669 1.00 9.81  ? 16  ILE A N   1 
ATOM   2    C  CA  . ILE A 1 15  ? 10.955 3.564   25.223 1.00 11.67 ? 16  ILE A CA  1 
ATOM   3    C  C   . ILE A 1 15  ? 10.580 5.076   25.085 1.00 15.00 ? 16  ILE A C   1 
ATOM   4    O  O   . ILE A 1 15  ? 9.654  5.506   25.813 1.00 13.28 ? 16  ILE A O   1 
ATOM   5    C  CB  . ILE A 1 15  ? 9.954  2.696   24.371 1.00 10.13 ? 16  ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 15  ? 10.217 1.185   24.541 1.00 15.22 ? 16  ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 15  ? 9.906  3.071   22.867 1.00 12.63 ? 16  ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 15  ? 11.672 0.827   24.111 1.00 14.28 ? 16  ILE A CD1 1 
ATOM   9    N  N   . VAL A 1 16  ? 11.381 5.865   24.370 1.00 13.65 ? 17  VAL A N   1 
ATOM   10   C  CA  . VAL A 1 16  ? 11.100 7.302   24.196 1.00 10.84 ? 17  VAL A CA  1 
ATOM   11   C  C   . VAL A 1 16  ? 10.618 7.424   22.757 1.00 11.86 ? 17  VAL A C   1 
ATOM   12   O  O   . VAL A 1 16  ? 11.207 6.782   21.875 1.00 12.14 ? 17  VAL A O   1 
ATOM   13   C  CB  . VAL A 1 16  ? 12.405 8.123   24.389 1.00 10.13 ? 17  VAL A CB  1 
ATOM   14   C  CG1 . VAL A 1 16  ? 12.125 9.535   23.870 1.00 11.41 ? 17  VAL A CG1 1 
ATOM   15   C  CG2 . VAL A 1 16  ? 13.044 8.122   25.751 1.00 8.26  ? 17  VAL A CG2 1 
ATOM   16   N  N   . GLY A 1 17  ? 9.454  8.066   22.528 1.00 12.71 ? 18  GLY A N   1 
ATOM   17   C  CA  . GLY A 1 17  ? 8.986  8.259   21.122 1.00 10.74 ? 18  GLY A CA  1 
ATOM   18   C  C   . GLY A 1 17  ? 8.242  7.060   20.563 1.00 13.02 ? 18  GLY A C   1 
ATOM   19   O  O   . GLY A 1 17  ? 8.020  7.026   19.311 1.00 12.66 ? 18  GLY A O   1 
ATOM   20   N  N   . GLY A 1 18  ? 7.779  6.162   21.427 1.00 13.62 ? 19  GLY A N   1 
ATOM   21   C  CA  . GLY A 1 18  ? 7.108  4.970   20.861 1.00 14.08 ? 19  GLY A CA  1 
ATOM   22   C  C   . GLY A 1 18  ? 5.608  5.066   21.060 1.00 17.27 ? 19  GLY A C   1 
ATOM   23   O  O   . GLY A 1 18  ? 5.028  6.170   21.148 1.00 17.28 ? 19  GLY A O   1 
ATOM   24   N  N   . TYR A 1 19  ? 4.898  3.924   20.928 1.00 18.05 ? 20  TYR A N   1 
ATOM   25   C  CA  . TYR A 1 19  ? 3.418  4.019   21.143 1.00 18.08 ? 20  TYR A CA  1 
ATOM   26   C  C   . TYR A 1 19  ? 3.025  2.901   22.102 1.00 17.70 ? 20  TYR A C   1 
ATOM   27   O  O   . TYR A 1 19  ? 3.844  1.987   22.188 1.00 18.23 ? 20  TYR A O   1 
ATOM   28   C  CB  . TYR A 1 19  ? 2.732  3.832   19.776 1.00 14.95 ? 20  TYR A CB  1 
ATOM   29   C  CG  . TYR A 1 19  ? 3.256  2.605   19.040 1.00 17.86 ? 20  TYR A CG  1 
ATOM   30   C  CD1 . TYR A 1 19  ? 4.457  2.678   18.333 1.00 18.15 ? 20  TYR A CD1 1 
ATOM   31   C  CD2 . TYR A 1 19  ? 2.507  1.417   19.015 1.00 19.95 ? 20  TYR A CD2 1 
ATOM   32   C  CE1 . TYR A 1 19  ? 4.899  1.507   17.691 1.00 19.76 ? 20  TYR A CE1 1 
ATOM   33   C  CE2 . TYR A 1 19  ? 3.010  0.266   18.436 1.00 20.56 ? 20  TYR A CE2 1 
ATOM   34   C  CZ  . TYR A 1 19  ? 4.246  0.299   17.814 1.00 17.65 ? 20  TYR A CZ  1 
ATOM   35   O  OH  . TYR A 1 19  ? 4.650  -0.762  17.058 1.00 20.90 ? 20  TYR A OH  1 
ATOM   36   N  N   . THR A 1 20  ? 1.808  2.885   22.603 1.00 17.14 ? 21  THR A N   1 
ATOM   37   C  CA  . THR A 1 20  ? 1.310  1.737   23.372 1.00 15.36 ? 21  THR A CA  1 
ATOM   38   C  C   . THR A 1 20  ? 1.174  0.503   22.512 1.00 16.71 ? 21  THR A C   1 
ATOM   39   O  O   . THR A 1 20  ? 0.512  0.475   21.449 1.00 15.56 ? 21  THR A O   1 
ATOM   40   C  CB  . THR A 1 20  ? -0.056 2.095   24.052 1.00 17.78 ? 21  THR A CB  1 
ATOM   41   O  OG1 . THR A 1 20  ? 0.216  3.222   24.944 1.00 18.36 ? 21  THR A OG1 1 
ATOM   42   C  CG2 . THR A 1 20  ? -0.475 0.892   24.934 1.00 20.24 ? 21  THR A CG2 1 
ATOM   43   N  N   . CYS A 1 21  ? 1.758  -0.646  22.953 1.00 16.20 ? 22  CYS A N   1 
ATOM   44   C  CA  . CYS A 1 21  ? 1.757  -1.790  22.021 1.00 14.80 ? 22  CYS A CA  1 
ATOM   45   C  C   . CYS A 1 21  ? 0.338  -2.341  21.839 1.00 15.52 ? 22  CYS A C   1 
ATOM   46   O  O   . CYS A 1 21  ? -0.045 -2.734  20.725 1.00 16.50 ? 22  CYS A O   1 
ATOM   47   C  CB  . CYS A 1 21  ? 2.641  -2.925  22.554 1.00 11.44 ? 22  CYS A CB  1 
ATOM   48   S  SG  . CYS A 1 21  ? 4.364  -2.529  22.864 1.00 12.39 ? 22  CYS A SG  1 
ATOM   49   N  N   . GLY A 1 22  ? -0.394 -2.319  22.935 1.00 14.98 ? 23  GLY A N   1 
ATOM   50   C  CA  . GLY A 1 22  ? -1.681 -3.081  22.935 1.00 16.34 ? 23  GLY A CA  1 
ATOM   51   C  C   . GLY A 1 22  ? -1.375 -4.329  23.781 1.00 16.27 ? 23  GLY A C   1 
ATOM   52   O  O   . GLY A 1 22  ? -0.361 -5.059  23.592 1.00 17.41 ? 23  GLY A O   1 
ATOM   53   N  N   . ALA A 1 23  ? -2.335 -4.705  24.613 1.00 16.49 ? 24  ALA A N   1 
ATOM   54   C  CA  . ALA A 1 23  ? -2.188 -5.827  25.537 1.00 17.06 ? 24  ALA A CA  1 
ATOM   55   C  C   . ALA A 1 23  ? -1.811 -7.122  24.825 1.00 17.89 ? 24  ALA A C   1 
ATOM   56   O  O   . ALA A 1 23  ? -2.555 -7.544  23.900 1.00 20.24 ? 24  ALA A O   1 
ATOM   57   C  CB  . ALA A 1 23  ? -3.473 -5.962  26.340 1.00 15.66 ? 24  ALA A CB  1 
ATOM   58   N  N   . ASN A 1 24  ? -0.817 -7.812  25.355 1.00 17.30 ? 25  ASN A N   1 
ATOM   59   C  CA  . ASN A 1 24  ? -0.431 -9.123  24.797 1.00 19.64 ? 25  ASN A CA  1 
ATOM   60   C  C   . ASN A 1 24  ? -0.153 -9.164  23.296 1.00 19.51 ? 25  ASN A C   1 
ATOM   61   O  O   . ASN A 1 24  ? -0.217 -10.257 22.698 1.00 19.27 ? 25  ASN A O   1 
ATOM   62   C  CB  . ASN A 1 24  ? -1.508 -10.176 25.199 1.00 20.55 ? 25  ASN A CB  1 
ATOM   63   C  CG  . ASN A 1 24  ? -1.753 -10.139 26.706 1.00 22.62 ? 25  ASN A CG  1 
ATOM   64   O  OD1 . ASN A 1 24  ? -0.887 -10.448 27.559 1.00 30.16 ? 25  ASN A OD1 1 
ATOM   65   N  ND2 . ASN A 1 24  ? -2.952 -9.786  27.128 1.00 19.82 ? 25  ASN A ND2 1 
ATOM   66   N  N   . THR A 1 25  ? 0.209  -8.055  22.660 1.00 17.85 ? 26  THR A N   1 
ATOM   67   C  CA  . THR A 1 25  ? 0.602  -8.102  21.230 1.00 17.13 ? 26  THR A CA  1 
ATOM   68   C  C   . THR A 1 25  ? 2.086  -8.414  21.044 1.00 15.68 ? 26  THR A C   1 
ATOM   69   O  O   . THR A 1 25  ? 2.519  -8.613  19.889 1.00 13.70 ? 26  THR A O   1 
ATOM   70   C  CB  . THR A 1 25  ? 0.192  -6.735  20.517 1.00 16.12 ? 26  THR A CB  1 
ATOM   71   O  OG1 . THR A 1 25  ? 0.868  -5.722  21.302 1.00 17.13 ? 26  THR A OG1 1 
ATOM   72   C  CG2 . THR A 1 25  ? -1.348 -6.513  20.725 1.00 16.51 ? 26  THR A CG2 1 
ATOM   73   N  N   . VAL A 1 26  ? 2.827  -8.538  22.143 1.00 14.61 ? 27  VAL A N   1 
ATOM   74   C  CA  . VAL A 1 26  ? 4.304  -8.887  22.068 1.00 14.46 ? 27  VAL A CA  1 
ATOM   75   C  C   . VAL A 1 26  ? 4.417  -9.993  23.135 1.00 14.07 ? 27  VAL A C   1 
ATOM   76   O  O   . VAL A 1 26  ? 4.837  -9.796  24.285 1.00 12.19 ? 27  VAL A O   1 
ATOM   77   C  CB  . VAL A 1 26  ? 5.202  -7.646  22.377 1.00 12.06 ? 27  VAL A CB  1 
ATOM   78   C  CG1 . VAL A 1 26  ? 6.673  -7.910  22.122 1.00 6.89  ? 27  VAL A CG1 1 
ATOM   79   C  CG2 . VAL A 1 26  ? 4.770  -6.409  21.571 1.00 9.65  ? 27  VAL A CG2 1 
ATOM   80   N  N   . PRO A 1 27  ? 3.921  -11.168 22.734 1.00 14.91 ? 28  PRO A N   1 
ATOM   81   C  CA  . PRO A 1 27  ? 3.695  -12.287 23.647 1.00 13.62 ? 28  PRO A CA  1 
ATOM   82   C  C   . PRO A 1 27  ? 4.971  -12.910 24.192 1.00 12.34 ? 28  PRO A C   1 
ATOM   83   O  O   . PRO A 1 27  ? 4.901  -13.648 25.197 1.00 15.34 ? 28  PRO A O   1 
ATOM   84   C  CB  . PRO A 1 27  ? 2.847  -13.264 22.808 1.00 13.85 ? 28  PRO A CB  1 
ATOM   85   C  CG  . PRO A 1 27  ? 3.033  -12.917 21.377 1.00 11.70 ? 28  PRO A CG  1 
ATOM   86   C  CD  . PRO A 1 27  ? 3.549  -11.505 21.327 1.00 13.60 ? 28  PRO A CD  1 
ATOM   87   N  N   . TYR A 1 28  ? 6.098  -12.631 23.606 1.00 11.94 ? 29  TYR A N   1 
ATOM   88   C  CA  . TYR A 1 28  ? 7.449  -13.039 23.990 1.00 10.90 ? 29  TYR A CA  1 
ATOM   89   C  C   . TYR A 1 28  ? 8.140  -12.030 24.933 1.00 11.41 ? 29  TYR A C   1 
ATOM   90   O  O   . TYR A 1 28  ? 9.158  -12.461 25.536 1.00 12.04 ? 29  TYR A O   1 
ATOM   91   C  CB  . TYR A 1 28  ? 8.393  -13.289 22.800 1.00 2.67  ? 29  TYR A CB  1 
ATOM   92   C  CG  . TYR A 1 28  ? 8.460  -12.100 21.876 1.00 12.39 ? 29  TYR A CG  1 
ATOM   93   C  CD1 . TYR A 1 28  ? 9.310  -11.013 22.166 1.00 11.46 ? 29  TYR A CD1 1 
ATOM   94   C  CD2 . TYR A 1 28  ? 7.587  -12.019 20.799 1.00 6.34  ? 29  TYR A CD2 1 
ATOM   95   C  CE1 . TYR A 1 28  ? 9.391  -9.901  21.323 1.00 10.11 ? 29  TYR A CE1 1 
ATOM   96   C  CE2 . TYR A 1 28  ? 7.532  -10.855 20.043 1.00 14.99 ? 29  TYR A CE2 1 
ATOM   97   C  CZ  . TYR A 1 28  ? 8.393  -9.774  20.369 1.00 11.40 ? 29  TYR A CZ  1 
ATOM   98   O  OH  . TYR A 1 28  ? 8.461  -8.814  19.410 1.00 11.98 ? 29  TYR A OH  1 
ATOM   99   N  N   . GLN A 1 29  ? 7.503  -10.911 25.253 1.00 10.54 ? 30  GLN A N   1 
ATOM   100  C  CA  . GLN A 1 29  ? 8.158  -9.910  26.149 1.00 8.83  ? 30  GLN A CA  1 
ATOM   101  C  C   . GLN A 1 29  ? 8.081  -10.397 27.592 1.00 11.76 ? 30  GLN A C   1 
ATOM   102  O  O   . GLN A 1 29  ? 6.921  -10.617 28.046 1.00 10.73 ? 30  GLN A O   1 
ATOM   103  C  CB  . GLN A 1 29  ? 7.613  -8.492  25.948 1.00 12.45 ? 30  GLN A CB  1 
ATOM   104  C  CG  . GLN A 1 29  ? 7.982  -7.453  27.004 1.00 9.92  ? 30  GLN A CG  1 
ATOM   105  C  CD  . GLN A 1 29  ? 9.359  -6.836  26.741 1.00 12.79 ? 30  GLN A CD  1 
ATOM   106  O  OE1 . GLN A 1 29  ? 10.212 -6.759  27.624 1.00 13.14 ? 30  GLN A OE1 1 
ATOM   107  N  NE2 . GLN A 1 29  ? 9.466  -6.385  25.504 1.00 7.37  ? 30  GLN A NE2 1 
ATOM   108  N  N   . VAL A 1 30  ? 9.198  -10.321 28.347 1.00 9.36  ? 31  VAL A N   1 
ATOM   109  C  CA  . VAL A 1 30  ? 9.075  -10.648 29.771 1.00 10.92 ? 31  VAL A CA  1 
ATOM   110  C  C   . VAL A 1 30  ? 9.475  -9.357  30.537 1.00 10.56 ? 31  VAL A C   1 
ATOM   111  O  O   . VAL A 1 30  ? 10.252 -8.540  30.016 1.00 11.94 ? 31  VAL A O   1 
ATOM   112  C  CB  . VAL A 1 30  ? 9.776  -11.922 30.293 1.00 10.65 ? 31  VAL A CB  1 
ATOM   113  C  CG1 . VAL A 1 30  ? 9.539  -13.182 29.443 1.00 16.58 ? 31  VAL A CG1 1 
ATOM   114  C  CG2 . VAL A 1 30  ? 11.275 -11.792 30.401 1.00 5.99  ? 31  VAL A CG2 1 
ATOM   115  N  N   . SER A 1 31  ? 9.050  -9.346  31.787 1.00 6.98  ? 32  SER A N   1 
ATOM   116  C  CA  . SER A 1 31  ? 9.422  -8.355  32.778 1.00 10.12 ? 32  SER A CA  1 
ATOM   117  C  C   . SER A 1 31  ? 10.255 -9.106  33.834 1.00 12.92 ? 32  SER A C   1 
ATOM   118  O  O   . SER A 1 31  ? 9.728  -10.099 34.367 1.00 12.87 ? 32  SER A O   1 
ATOM   119  C  CB  . SER A 1 31  ? 8.244  -7.626  33.391 1.00 7.35  ? 32  SER A CB  1 
ATOM   120  O  OG  . SER A 1 31  ? 8.546  -6.874  34.596 1.00 11.32 ? 32  SER A OG  1 
ATOM   121  N  N   . LEU A 1 32  ? 11.435 -8.599  34.266 1.00 12.80 ? 33  LEU A N   1 
ATOM   122  C  CA  . LEU A 1 32  ? 12.223 -9.218  35.348 1.00 13.63 ? 33  LEU A CA  1 
ATOM   123  C  C   . LEU A 1 32  ? 11.804 -8.406  36.581 1.00 13.20 ? 33  LEU A C   1 
ATOM   124  O  O   . LEU A 1 32  ? 11.970 -7.195  36.476 1.00 11.36 ? 33  LEU A O   1 
ATOM   125  C  CB  . LEU A 1 32  ? 13.734 -9.235  35.077 1.00 13.94 ? 33  LEU A CB  1 
ATOM   126  C  CG  . LEU A 1 32  ? 14.204 -9.881  33.774 1.00 17.20 ? 33  LEU A CG  1 
ATOM   127  C  CD1 . LEU A 1 32  ? 15.697 -10.062 33.772 1.00 13.24 ? 33  LEU A CD1 1 
ATOM   128  C  CD2 . LEU A 1 32  ? 13.571 -11.245 33.605 1.00 17.43 ? 33  LEU A CD2 1 
ATOM   129  N  N   . ASN A 1 33  ? 11.426 -9.038  37.666 1.00 11.42 ? 34  ASN A N   1 
ATOM   130  C  CA  . ASN A 1 33  ? 10.867 -8.274  38.767 1.00 9.28  ? 34  ASN A CA  1 
ATOM   131  C  C   . ASN A 1 33  ? 11.668 -8.639  40.008 1.00 12.39 ? 34  ASN A C   1 
ATOM   132  O  O   . ASN A 1 33  ? 11.764 -9.845  40.236 1.00 11.84 ? 34  ASN A O   1 
ATOM   133  C  CB  . ASN A 1 33  ? 9.374  -8.578  38.788 1.00 2.46  ? 34  ASN A CB  1 
ATOM   134  C  CG  . ASN A 1 33  ? 8.701  -7.825  39.910 1.00 13.62 ? 34  ASN A CG  1 
ATOM   135  O  OD1 . ASN A 1 33  ? 8.887  -8.151  41.099 1.00 10.30 ? 34  ASN A OD1 1 
ATOM   136  N  ND2 . ASN A 1 33  ? 8.092  -6.727  39.442 1.00 13.50 ? 34  ASN A ND2 1 
ATOM   137  N  N   . SER A 1 34  ? 11.954 -7.701  40.891 1.00 12.72 ? 37  SER A N   1 
ATOM   138  C  CA  . SER A 1 34  ? 12.530 -7.973  42.231 1.00 15.08 ? 37  SER A CA  1 
ATOM   139  C  C   . SER A 1 34  ? 11.717 -7.154  43.241 1.00 14.95 ? 37  SER A C   1 
ATOM   140  O  O   . SER A 1 34  ? 12.335 -6.441  44.049 1.00 17.14 ? 37  SER A O   1 
ATOM   141  C  CB  . SER A 1 34  ? 14.038 -7.663  42.343 1.00 17.84 ? 37  SER A CB  1 
ATOM   142  O  OG  . SER A 1 34  ? 14.356 -6.360  41.857 1.00 19.27 ? 37  SER A OG  1 
ATOM   143  N  N   . GLY A 1 35  ? 10.405 -7.041  43.098 1.00 15.11 ? 38  GLY A N   1 
ATOM   144  C  CA  . GLY A 1 35  ? 9.642  -6.083  43.914 1.00 15.49 ? 38  GLY A CA  1 
ATOM   145  C  C   . GLY A 1 35  ? 9.373  -4.781  43.151 1.00 16.05 ? 38  GLY A C   1 
ATOM   146  O  O   . GLY A 1 35  ? 8.694  -3.919  43.710 1.00 15.95 ? 38  GLY A O   1 
ATOM   147  N  N   . TYR A 1 36  ? 9.840  -4.668  41.925 1.00 14.13 ? 39  TYR A N   1 
ATOM   148  C  CA  . TYR A 1 36  ? 9.655  -3.611  40.953 1.00 12.87 ? 39  TYR A CA  1 
ATOM   149  C  C   . TYR A 1 36  ? 10.268 -4.201  39.663 1.00 13.28 ? 39  TYR A C   1 
ATOM   150  O  O   . TYR A 1 36  ? 11.066 -5.157  39.808 1.00 12.84 ? 39  TYR A O   1 
ATOM   151  C  CB  . TYR A 1 36  ? 10.371 -2.260  41.232 1.00 13.08 ? 39  TYR A CB  1 
ATOM   152  C  CG  . TYR A 1 36  ? 11.849 -2.487  41.511 1.00 12.36 ? 39  TYR A CG  1 
ATOM   153  C  CD1 . TYR A 1 36  ? 12.255 -2.990  42.746 1.00 9.02  ? 39  TYR A CD1 1 
ATOM   154  C  CD2 . TYR A 1 36  ? 12.801 -2.214  40.540 1.00 11.80 ? 39  TYR A CD2 1 
ATOM   155  C  CE1 . TYR A 1 36  ? 13.591 -3.332  42.982 1.00 13.73 ? 39  TYR A CE1 1 
ATOM   156  C  CE2 . TYR A 1 36  ? 14.170 -2.366  40.816 1.00 12.73 ? 39  TYR A CE2 1 
ATOM   157  C  CZ  . TYR A 1 36  ? 14.524 -2.992  41.996 1.00 17.44 ? 39  TYR A CZ  1 
ATOM   158  O  OH  . TYR A 1 36  ? 15.853 -3.053  42.291 1.00 19.10 ? 39  TYR A OH  1 
ATOM   159  N  N   . HIS A 1 37  ? 9.894  -3.600  38.555 1.00 13.08 ? 40  HIS A N   1 
ATOM   160  C  CA  . HIS A 1 37  ? 10.363 -3.970  37.224 1.00 14.89 ? 40  HIS A CA  1 
ATOM   161  C  C   . HIS A 1 37  ? 11.752 -3.314  37.014 1.00 16.02 ? 40  HIS A C   1 
ATOM   162  O  O   . HIS A 1 37  ? 11.872 -2.133  37.345 1.00 13.16 ? 40  HIS A O   1 
ATOM   163  C  CB  . HIS A 1 37  ? 9.433  -3.638  36.050 1.00 10.86 ? 40  HIS A CB  1 
ATOM   164  C  CG  . HIS A 1 37  ? 10.110 -3.544  34.722 1.00 10.80 ? 40  HIS A CG  1 
ATOM   165  N  ND1 . HIS A 1 37  ? 9.972  -4.505  33.748 1.00 5.46  ? 40  HIS A ND1 1 
ATOM   166  C  CD2 . HIS A 1 37  ? 10.768 -2.516  34.131 1.00 12.69 ? 40  HIS A CD2 1 
ATOM   167  C  CE1 . HIS A 1 37  ? 10.734 -4.189  32.720 1.00 12.56 ? 40  HIS A CE1 1 
ATOM   168  N  NE2 . HIS A 1 37  ? 11.211 -2.979  32.899 1.00 11.62 ? 40  HIS A NE2 1 
ATOM   169  N  N   . PHE A 1 38  ? 12.775 -4.112  36.668 1.00 13.15 ? 41  PHE A N   1 
ATOM   170  C  CA  . PHE A 1 38  ? 14.131 -3.576  36.471 1.00 14.11 ? 41  PHE A CA  1 
ATOM   171  C  C   . PHE A 1 38  ? 14.675 -3.940  35.090 1.00 14.28 ? 41  PHE A C   1 
ATOM   172  O  O   . PHE A 1 38  ? 15.642 -3.243  34.713 1.00 13.22 ? 41  PHE A O   1 
ATOM   173  C  CB  . PHE A 1 38  ? 15.071 -4.093  37.543 1.00 12.72 ? 41  PHE A CB  1 
ATOM   174  C  CG  . PHE A 1 38  ? 15.398 -5.558  37.589 1.00 17.49 ? 41  PHE A CG  1 
ATOM   175  C  CD1 . PHE A 1 38  ? 16.466 -6.033  36.839 1.00 15.14 ? 41  PHE A CD1 1 
ATOM   176  C  CD2 . PHE A 1 38  ? 14.672 -6.439  38.397 1.00 16.70 ? 41  PHE A CD2 1 
ATOM   177  C  CE1 . PHE A 1 38  ? 16.744 -7.373  36.750 1.00 13.29 ? 41  PHE A CE1 1 
ATOM   178  C  CE2 . PHE A 1 38  ? 15.022 -7.797  38.441 1.00 17.18 ? 41  PHE A CE2 1 
ATOM   179  C  CZ  . PHE A 1 38  ? 16.076 -8.248  37.627 1.00 18.39 ? 41  PHE A CZ  1 
ATOM   180  N  N   . CYS A 1 39  ? 14.149 -4.968  34.407 1.00 11.06 ? 42  CYS A N   1 
ATOM   181  C  CA  . CYS A 1 39  ? 14.733 -5.194  33.058 1.00 11.82 ? 42  CYS A CA  1 
ATOM   182  C  C   . CYS A 1 39  ? 13.637 -5.922  32.257 1.00 10.38 ? 42  CYS A C   1 
ATOM   183  O  O   . CYS A 1 39  ? 12.815 -6.556  32.950 1.00 9.11  ? 42  CYS A O   1 
ATOM   184  C  CB  . CYS A 1 39  ? 16.017 -6.055  33.236 1.00 14.79 ? 42  CYS A CB  1 
ATOM   185  S  SG  . CYS A 1 39  ? 17.592 -5.111  33.366 1.00 11.74 ? 42  CYS A SG  1 
ATOM   186  N  N   . GLY A 1 40  ? 13.854 -6.031  30.976 1.00 9.40  ? 43  GLY A N   1 
ATOM   187  C  CA  . GLY A 1 40  ? 12.997 -6.883  30.149 1.00 10.48 ? 43  GLY A CA  1 
ATOM   188  C  C   . GLY A 1 40  ? 13.707 -8.189  29.748 1.00 10.83 ? 43  GLY A C   1 
ATOM   189  O  O   . GLY A 1 40  ? 14.781 -8.501  30.286 1.00 10.34 ? 43  GLY A O   1 
ATOM   190  N  N   . GLY A 1 41  ? 13.119 -8.950  28.843 1.00 6.94  ? 44  GLY A N   1 
ATOM   191  C  CA  . GLY A 1 41  ? 13.781 -10.228 28.447 1.00 11.27 ? 44  GLY A CA  1 
ATOM   192  C  C   . GLY A 1 41  ? 12.721 -10.836 27.463 1.00 10.75 ? 44  GLY A C   1 
ATOM   193  O  O   . GLY A 1 41  ? 11.718 -10.163 27.171 1.00 8.12  ? 44  GLY A O   1 
ATOM   194  N  N   . SER A 1 42  ? 13.307 -11.799 26.758 1.00 10.46 ? 45  SER A N   1 
ATOM   195  C  CA  . SER A 1 42  ? 12.464 -12.506 25.785 1.00 10.65 ? 45  SER A CA  1 
ATOM   196  C  C   . SER A 1 42  ? 12.382 -14.043 26.059 1.00 11.51 ? 45  SER A C   1 
ATOM   197  O  O   . SER A 1 42  ? 13.405 -14.701 26.146 1.00 10.50 ? 45  SER A O   1 
ATOM   198  C  CB  . SER A 1 42  ? 12.968 -12.449 24.385 1.00 12.49 ? 45  SER A CB  1 
ATOM   199  O  OG  . SER A 1 42  ? 13.508 -11.256 23.981 1.00 13.80 ? 45  SER A OG  1 
ATOM   200  N  N   . LEU A 1 43  ? 11.136 -14.513 25.921 1.00 11.48 ? 46  LEU A N   1 
ATOM   201  C  CA  . LEU A 1 43  ? 10.916 -15.969 26.085 1.00 11.14 ? 46  LEU A CA  1 
ATOM   202  C  C   . LEU A 1 43  ? 11.371 -16.633 24.805 1.00 10.12 ? 46  LEU A C   1 
ATOM   203  O  O   . LEU A 1 43  ? 10.736 -16.363 23.734 1.00 11.76 ? 46  LEU A O   1 
ATOM   204  C  CB  . LEU A 1 43  ? 9.420  -16.111 26.421 1.00 14.85 ? 46  LEU A CB  1 
ATOM   205  C  CG  . LEU A 1 43  ? 8.991  -17.556 26.730 1.00 13.66 ? 46  LEU A CG  1 
ATOM   206  C  CD1 . LEU A 1 43  ? 9.721  -17.942 28.035 1.00 14.46 ? 46  LEU A CD1 1 
ATOM   207  C  CD2 . LEU A 1 43  ? 7.499  -17.644 26.989 1.00 12.55 ? 46  LEU A CD2 1 
ATOM   208  N  N   . ILE A 1 44  ? 12.315 -17.576 24.875 1.00 10.31 ? 47  ILE A N   1 
ATOM   209  C  CA  . ILE A 1 44  ? 12.677 -18.267 23.594 1.00 10.19 ? 47  ILE A CA  1 
ATOM   210  C  C   . ILE A 1 44  ? 12.195 -19.717 23.588 1.00 14.60 ? 47  ILE A C   1 
ATOM   211  O  O   . ILE A 1 44  ? 12.325 -20.341 22.502 1.00 13.64 ? 47  ILE A O   1 
ATOM   212  C  CB  . ILE A 1 44  ? 14.223 -18.159 23.331 1.00 12.62 ? 47  ILE A CB  1 
ATOM   213  C  CG1 . ILE A 1 44  ? 14.948 -18.765 24.565 1.00 13.55 ? 47  ILE A CG1 1 
ATOM   214  C  CG2 . ILE A 1 44  ? 14.844 -16.773 23.032 1.00 16.64 ? 47  ILE A CG2 1 
ATOM   215  C  CD1 . ILE A 1 44  ? 16.496 -18.754 24.315 1.00 17.57 ? 47  ILE A CD1 1 
ATOM   216  N  N   . ASN A 1 45  ? 11.822 -20.279 24.737 1.00 11.81 ? 48  ASN A N   1 
ATOM   217  C  CA  . ASN A 1 45  ? 11.168 -21.599 24.717 1.00 13.99 ? 48  ASN A CA  1 
ATOM   218  C  C   . ASN A 1 45  ? 10.336 -21.658 26.010 1.00 13.72 ? 48  ASN A C   1 
ATOM   219  O  O   . ASN A 1 45  ? 10.544 -20.674 26.761 1.00 16.44 ? 48  ASN A O   1 
ATOM   220  C  CB  . ASN A 1 45  ? 11.994 -22.860 24.549 1.00 16.00 ? 48  ASN A CB  1 
ATOM   221  C  CG  . ASN A 1 45  ? 13.022 -23.156 25.611 1.00 16.93 ? 48  ASN A CG  1 
ATOM   222  O  OD1 . ASN A 1 45  ? 14.128 -23.456 25.141 1.00 21.28 ? 48  ASN A OD1 1 
ATOM   223  N  ND2 . ASN A 1 45  ? 12.842 -22.972 26.905 1.00 18.41 ? 48  ASN A ND2 1 
ATOM   224  N  N   . SER A 1 46  ? 9.763  -22.764 26.428 1.00 10.22 ? 49  SER A N   1 
ATOM   225  C  CA  . SER A 1 46  ? 8.894  -22.755 27.609 1.00 10.95 ? 49  SER A CA  1 
ATOM   226  C  C   . SER A 1 46  ? 9.592  -22.631 28.928 1.00 10.34 ? 49  SER A C   1 
ATOM   227  O  O   . SER A 1 46  ? 9.050  -22.356 29.997 1.00 12.04 ? 49  SER A O   1 
ATOM   228  C  CB  . SER A 1 46  ? 7.978  -24.010 27.539 1.00 17.11 ? 49  SER A CB  1 
ATOM   229  O  OG  . SER A 1 46  ? 8.832  -25.108 27.848 1.00 17.75 ? 49  SER A OG  1 
ATOM   230  N  N   . GLN A 1 47  ? 10.900 -22.804 28.848 1.00 12.65 ? 50  GLN A N   1 
ATOM   231  C  CA  . GLN A 1 47  ? 11.715 -22.772 30.070 1.00 13.43 ? 50  GLN A CA  1 
ATOM   232  C  C   . GLN A 1 47  ? 12.882 -21.791 30.116 1.00 13.72 ? 50  GLN A C   1 
ATOM   233  O  O   . GLN A 1 47  ? 13.590 -21.679 31.151 1.00 13.87 ? 50  GLN A O   1 
ATOM   234  C  CB  . GLN A 1 47  ? 12.137 -24.253 30.288 1.00 15.37 ? 50  GLN A CB  1 
ATOM   235  C  CG  . GLN A 1 47  ? 11.890 -24.403 31.781 1.00 25.19 ? 50  GLN A CG  1 
ATOM   236  C  CD  . GLN A 1 47  ? 11.998 -25.724 32.477 1.00 31.65 ? 50  GLN A CD  1 
ATOM   237  O  OE1 . GLN A 1 47  ? 12.037 -25.675 33.733 1.00 33.26 ? 50  GLN A OE1 1 
ATOM   238  N  NE2 . GLN A 1 47  ? 12.062 -26.740 31.619 1.00 24.20 ? 50  GLN A NE2 1 
ATOM   239  N  N   . TRP A 1 48  ? 13.093 -21.060 29.031 1.00 11.22 ? 51  TRP A N   1 
ATOM   240  C  CA  . TRP A 1 48  ? 14.279 -20.166 28.990 1.00 11.62 ? 51  TRP A CA  1 
ATOM   241  C  C   . TRP A 1 48  ? 13.966 -18.748 28.484 1.00 11.80 ? 51  TRP A C   1 
ATOM   242  O  O   . TRP A 1 48  ? 13.238 -18.636 27.479 1.00 10.09 ? 51  TRP A O   1 
ATOM   243  C  CB  . TRP A 1 48  ? 15.304 -20.854 28.062 1.00 12.78 ? 51  TRP A CB  1 
ATOM   244  C  CG  . TRP A 1 48  ? 16.003 -22.025 28.728 1.00 11.00 ? 51  TRP A CG  1 
ATOM   245  C  CD1 . TRP A 1 48  ? 15.586 -23.347 28.624 1.00 13.00 ? 51  TRP A CD1 1 
ATOM   246  C  CD2 . TRP A 1 48  ? 17.178 -22.046 29.535 1.00 8.06  ? 51  TRP A CD2 1 
ATOM   247  N  NE1 . TRP A 1 48  ? 16.396 -24.167 29.384 1.00 10.57 ? 51  TRP A NE1 1 
ATOM   248  C  CE2 . TRP A 1 48  ? 17.369 -23.379 29.978 1.00 13.31 ? 51  TRP A CE2 1 
ATOM   249  C  CE3 . TRP A 1 48  ? 18.077 -21.063 29.952 1.00 12.34 ? 51  TRP A CE3 1 
ATOM   250  C  CZ2 . TRP A 1 48  ? 18.565 -23.812 30.579 1.00 14.11 ? 51  TRP A CZ2 1 
ATOM   251  C  CZ3 . TRP A 1 48  ? 19.128 -21.426 30.772 1.00 13.14 ? 51  TRP A CZ3 1 
ATOM   252  C  CH2 . TRP A 1 48  ? 19.417 -22.796 31.017 1.00 16.21 ? 51  TRP A CH2 1 
ATOM   253  N  N   . VAL A 1 49  ? 14.501 -17.772 29.175 1.00 10.57 ? 52  VAL A N   1 
ATOM   254  C  CA  . VAL A 1 49  ? 14.428 -16.349 28.740 1.00 11.76 ? 52  VAL A CA  1 
ATOM   255  C  C   . VAL A 1 49  ? 15.872 -15.873 28.402 1.00 12.45 ? 52  VAL A C   1 
ATOM   256  O  O   . VAL A 1 49  ? 16.862 -16.166 29.129 1.00 11.66 ? 52  VAL A O   1 
ATOM   257  C  CB  . VAL A 1 49  ? 13.843 -15.604 29.989 1.00 10.15 ? 52  VAL A CB  1 
ATOM   258  C  CG1 . VAL A 1 49  ? 14.173 -14.101 30.026 1.00 9.97  ? 52  VAL A CG1 1 
ATOM   259  C  CG2 . VAL A 1 49  ? 12.404 -15.967 30.209 1.00 4.29  ? 52  VAL A CG2 1 
ATOM   260  N  N   . VAL A 1 50  ? 15.991 -15.065 27.361 1.00 10.95 ? 53  VAL A N   1 
ATOM   261  C  CA  . VAL A 1 50  ? 17.240 -14.342 27.041 1.00 14.13 ? 53  VAL A CA  1 
ATOM   262  C  C   . VAL A 1 50  ? 17.153 -12.922 27.633 1.00 14.09 ? 53  VAL A C   1 
ATOM   263  O  O   . VAL A 1 50  ? 16.133 -12.201 27.502 1.00 12.20 ? 53  VAL A O   1 
ATOM   264  C  CB  . VAL A 1 50  ? 17.350 -14.283 25.493 1.00 13.64 ? 53  VAL A CB  1 
ATOM   265  C  CG1 . VAL A 1 50  ? 18.611 -13.573 25.078 1.00 16.92 ? 53  VAL A CG1 1 
ATOM   266  C  CG2 . VAL A 1 50  ? 17.666 -15.724 25.062 1.00 17.46 ? 53  VAL A CG2 1 
ATOM   267  N  N   . SER A 1 51  ? 18.283 -12.382 28.118 1.00 14.70 ? 54  SER A N   1 
ATOM   268  C  CA  . SER A 1 51  ? 18.187 -10.996 28.674 1.00 11.55 ? 54  SER A CA  1 
ATOM   269  C  C   . SER A 1 51  ? 19.605 -10.412 28.606 1.00 11.88 ? 54  SER A C   1 
ATOM   270  O  O   . SER A 1 51  ? 20.327 -10.992 27.750 1.00 11.61 ? 54  SER A O   1 
ATOM   271  C  CB  . SER A 1 51  ? 17.594 -10.981 30.079 1.00 11.03 ? 54  SER A CB  1 
ATOM   272  O  OG  . SER A 1 51  ? 17.456 -9.634  30.534 1.00 6.65  ? 54  SER A OG  1 
ATOM   273  N  N   . ALA A 1 52  ? 19.841 -9.325  29.335 1.00 6.22  ? 55  ALA A N   1 
ATOM   274  C  CA  . ALA A 1 52  ? 21.220 -8.793  29.193 1.00 5.84  ? 55  ALA A CA  1 
ATOM   275  C  C   . ALA A 1 52  ? 21.958 -9.166  30.482 1.00 6.21  ? 55  ALA A C   1 
ATOM   276  O  O   . ALA A 1 52  ? 21.411 -9.135  31.602 1.00 4.75  ? 55  ALA A O   1 
ATOM   277  C  CB  . ALA A 1 52  ? 21.063 -7.270  29.056 1.00 2.84  ? 55  ALA A CB  1 
ATOM   278  N  N   . ALA A 1 53  ? 23.256 -9.374  30.290 1.00 9.46  ? 56  ALA A N   1 
ATOM   279  C  CA  . ALA A 1 53  ? 24.170 -9.775  31.380 1.00 9.98  ? 56  ALA A CA  1 
ATOM   280  C  C   . ALA A 1 53  ? 24.126 -8.659  32.431 1.00 10.83 ? 56  ALA A C   1 
ATOM   281  O  O   . ALA A 1 53  ? 24.111 -8.932  33.644 1.00 12.43 ? 56  ALA A O   1 
ATOM   282  C  CB  . ALA A 1 53  ? 25.586 -10.113 31.019 1.00 4.69  ? 56  ALA A CB  1 
ATOM   283  N  N   . HIS A 1 54  ? 24.086 -7.437  31.975 1.00 10.65 ? 57  HIS A N   1 
ATOM   284  C  CA  . HIS A 1 54  ? 24.026 -6.322  32.960 1.00 14.54 ? 57  HIS A CA  1 
ATOM   285  C  C   . HIS A 1 54  ? 22.758 -6.309  33.806 1.00 14.08 ? 57  HIS A C   1 
ATOM   286  O  O   . HIS A 1 54  ? 22.763 -5.611  34.818 1.00 15.07 ? 57  HIS A O   1 
ATOM   287  C  CB  . HIS A 1 54  ? 24.304 -4.946  32.354 1.00 14.64 ? 57  HIS A CB  1 
ATOM   288  C  CG  . HIS A 1 54  ? 23.254 -4.253  31.581 1.00 15.10 ? 57  HIS A CG  1 
ATOM   289  N  ND1 . HIS A 1 54  ? 23.095 -4.320  30.203 1.00 13.32 ? 57  HIS A ND1 1 
ATOM   290  C  CD2 . HIS A 1 54  ? 22.415 -3.260  32.045 1.00 14.41 ? 57  HIS A CD2 1 
ATOM   291  C  CE1 . HIS A 1 54  ? 22.121 -3.510  29.810 1.00 10.40 ? 57  HIS A CE1 1 
ATOM   292  N  NE2 . HIS A 1 54  ? 21.770 -2.815  30.908 1.00 13.76 ? 57  HIS A NE2 1 
ATOM   293  N  N   . CYS A 1 55  ? 21.646 -6.952  33.478 1.00 12.01 ? 58  CYS A N   1 
ATOM   294  C  CA  . CYS A 1 55  ? 20.450 -7.050  34.298 1.00 11.78 ? 58  CYS A CA  1 
ATOM   295  C  C   . CYS A 1 55  ? 20.635 -8.052  35.431 1.00 13.41 ? 58  CYS A C   1 
ATOM   296  O  O   . CYS A 1 55  ? 19.766 -8.102  36.317 1.00 16.00 ? 58  CYS A O   1 
ATOM   297  C  CB  . CYS A 1 55  ? 19.321 -7.512  33.382 1.00 11.01 ? 58  CYS A CB  1 
ATOM   298  S  SG  . CYS A 1 55  ? 18.935 -6.160  32.181 1.00 12.07 ? 58  CYS A SG  1 
ATOM   299  N  N   . TYR A 1 56  ? 21.765 -8.735  35.426 1.00 13.16 ? 59  TYR A N   1 
ATOM   300  C  CA  . TYR A 1 56  ? 22.031 -9.785  36.388 1.00 13.75 ? 59  TYR A CA  1 
ATOM   301  C  C   . TYR A 1 56  ? 21.873 -9.433  37.854 1.00 15.07 ? 59  TYR A C   1 
ATOM   302  O  O   . TYR A 1 56  ? 22.537 -8.512  38.356 1.00 14.13 ? 59  TYR A O   1 
ATOM   303  C  CB  . TYR A 1 56  ? 23.250 -10.674 36.086 1.00 12.93 ? 59  TYR A CB  1 
ATOM   304  C  CG  . TYR A 1 56  ? 23.392 -11.655 37.238 1.00 16.32 ? 59  TYR A CG  1 
ATOM   305  C  CD1 . TYR A 1 56  ? 24.010 -11.191 38.383 1.00 16.85 ? 59  TYR A CD1 1 
ATOM   306  C  CD2 . TYR A 1 56  ? 22.710 -12.871 37.310 1.00 10.79 ? 59  TYR A CD2 1 
ATOM   307  C  CE1 . TYR A 1 56  ? 24.099 -11.957 39.525 1.00 20.88 ? 59  TYR A CE1 1 
ATOM   308  C  CE2 . TYR A 1 56  ? 23.026 -13.731 38.363 1.00 16.18 ? 59  TYR A CE2 1 
ATOM   309  C  CZ  . TYR A 1 56  ? 23.607 -13.271 39.497 1.00 17.23 ? 59  TYR A CZ  1 
ATOM   310  O  OH  . TYR A 1 56  ? 23.614 -13.981 40.661 1.00 23.75 ? 59  TYR A OH  1 
ATOM   311  N  N   . LYS A 1 57  ? 20.906 -10.080 38.496 1.00 15.29 ? 60  LYS A N   1 
ATOM   312  C  CA  . LYS A 1 57  ? 20.866 -10.041 39.978 1.00 18.19 ? 60  LYS A CA  1 
ATOM   313  C  C   . LYS A 1 57  ? 20.211 -11.312 40.543 1.00 19.93 ? 60  LYS A C   1 
ATOM   314  O  O   . LYS A 1 57  ? 19.598 -12.129 39.818 1.00 18.00 ? 60  LYS A O   1 
ATOM   315  C  CB  . LYS A 1 57  ? 20.159 -8.830  40.555 1.00 19.30 ? 60  LYS A CB  1 
ATOM   316  C  CG  . LYS A 1 57  ? 18.708 -8.663  40.119 1.00 24.53 ? 60  LYS A CG  1 
ATOM   317  C  CD  . LYS A 1 57  ? 17.894 -8.259  41.358 1.00 28.22 ? 60  LYS A CD  1 
ATOM   318  C  CE  . LYS A 1 57  ? 17.918 -6.807  41.734 1.00 28.24 ? 60  LYS A CE  1 
ATOM   319  N  NZ  . LYS A 1 57  ? 17.415 -6.010  40.596 1.00 30.50 ? 60  LYS A NZ  1 
ATOM   320  N  N   . SER A 1 58  ? 20.360 -11.434 41.850 1.00 20.24 ? 61  SER A N   1 
ATOM   321  C  CA  . SER A 1 58  ? 19.733 -12.530 42.593 1.00 22.78 ? 61  SER A CA  1 
ATOM   322  C  C   . SER A 1 58  ? 18.326 -12.096 42.985 1.00 22.60 ? 61  SER A C   1 
ATOM   323  O  O   . SER A 1 58  ? 17.961 -10.932 42.884 1.00 24.24 ? 61  SER A O   1 
ATOM   324  C  CB  . SER A 1 58  ? 20.564 -13.108 43.735 1.00 24.80 ? 61  SER A CB  1 
ATOM   325  O  OG  . SER A 1 58  ? 20.807 -12.210 44.806 1.00 31.89 ? 61  SER A OG  1 
ATOM   326  N  N   . GLY A 1 59  ? 17.436 -13.054 43.187 1.00 23.05 ? 62  GLY A N   1 
ATOM   327  C  CA  . GLY A 1 59  ? 16.045 -12.722 43.589 1.00 21.48 ? 62  GLY A CA  1 
ATOM   328  C  C   . GLY A 1 59  ? 15.179 -12.427 42.377 1.00 21.49 ? 62  GLY A C   1 
ATOM   329  O  O   . GLY A 1 59  ? 14.285 -11.587 42.628 1.00 22.98 ? 62  GLY A O   1 
ATOM   330  N  N   . ILE A 1 60  ? 15.359 -12.929 41.170 1.00 19.15 ? 63  ILE A N   1 
ATOM   331  C  CA  . ILE A 1 60  ? 14.557 -12.600 39.985 1.00 16.65 ? 63  ILE A CA  1 
ATOM   332  C  C   . ILE A 1 60  ? 13.299 -13.505 39.848 1.00 18.52 ? 63  ILE A C   1 
ATOM   333  O  O   . ILE A 1 60  ? 13.423 -14.748 40.065 1.00 16.62 ? 63  ILE A O   1 
ATOM   334  C  CB  . ILE A 1 60  ? 15.436 -12.793 38.696 1.00 15.88 ? 63  ILE A CB  1 
ATOM   335  C  CG1 . ILE A 1 60  ? 16.611 -11.785 38.786 1.00 12.06 ? 63  ILE A CG1 1 
ATOM   336  C  CG2 . ILE A 1 60  ? 14.630 -12.634 37.376 1.00 13.09 ? 63  ILE A CG2 1 
ATOM   337  C  CD1 . ILE A 1 60  ? 17.572 -11.667 37.554 1.00 16.85 ? 63  ILE A CD1 1 
ATOM   338  N  N   . GLN A 1 61  ? 12.177 -12.777 39.668 1.00 16.65 ? 64  GLN A N   1 
ATOM   339  C  CA  . GLN A 1 61  ? 10.843 -13.352 39.338 1.00 15.37 ? 64  GLN A CA  1 
ATOM   340  C  C   . GLN A 1 61  ? 10.514 -12.875 37.897 1.00 13.62 ? 64  GLN A C   1 
ATOM   341  O  O   . GLN A 1 61  ? 10.785 -11.702 37.538 1.00 11.87 ? 64  GLN A O   1 
ATOM   342  C  CB  . GLN A 1 61  ? 9.743  -13.073 40.337 1.00 9.80  ? 64  GLN A CB  1 
ATOM   343  C  CG  . GLN A 1 61  ? 8.400  -13.755 39.993 1.00 14.36 ? 64  GLN A CG  1 
ATOM   344  C  CD  . GLN A 1 61  ? 7.306  -13.245 40.875 1.00 14.43 ? 64  GLN A CD  1 
ATOM   345  O  OE1 . GLN A 1 61  ? 6.778  -13.905 41.797 1.00 17.34 ? 64  GLN A OE1 1 
ATOM   346  N  NE2 . GLN A 1 61  ? 7.092  -11.932 40.785 1.00 13.70 ? 64  GLN A NE2 1 
ATOM   347  N  N   . VAL A 1 62  ? 10.310 -13.858 37.023 1.00 10.63 ? 65  VAL A N   1 
ATOM   348  C  CA  . VAL A 1 62  ? 10.078 -13.638 35.610 1.00 11.00 ? 65  VAL A CA  1 
ATOM   349  C  C   . VAL A 1 62  ? 8.568  -13.424 35.468 1.00 12.59 ? 65  VAL A C   1 
ATOM   350  O  O   . VAL A 1 62  ? 7.863  -14.294 36.044 1.00 12.34 ? 65  VAL A O   1 
ATOM   351  C  CB  . VAL A 1 62  ? 10.598 -14.814 34.756 1.00 12.29 ? 65  VAL A CB  1 
ATOM   352  C  CG1 . VAL A 1 62  ? 10.200 -14.548 33.293 1.00 12.08 ? 65  VAL A CG1 1 
ATOM   353  C  CG2 . VAL A 1 62  ? 12.094 -15.033 34.996 1.00 11.73 ? 65  VAL A CG2 1 
ATOM   354  N  N   . ARG A 1 63  ? 8.138  -12.333 34.906 1.00 10.46 ? 66  ARG A N   1 
ATOM   355  C  CA  . ARG A 1 63  ? 6.680  -12.068 34.768 1.00 10.93 ? 66  ARG A CA  1 
ATOM   356  C  C   . ARG A 1 63  ? 6.285  -12.201 33.301 1.00 10.35 ? 66  ARG A C   1 
ATOM   357  O  O   . ARG A 1 63  ? 6.794  -11.341 32.570 1.00 9.32  ? 66  ARG A O   1 
ATOM   358  C  CB  . ARG A 1 63  ? 6.310  -10.765 35.479 1.00 4.77  ? 66  ARG A CB  1 
ATOM   359  C  CG  . ARG A 1 63  ? 6.631  -10.851 36.983 1.00 11.47 ? 66  ARG A CG  1 
ATOM   360  C  CD  . ARG A 1 63  ? 6.079  -9.669  37.721 1.00 12.56 ? 66  ARG A CD  1 
ATOM   361  N  NE  . ARG A 1 63  ? 6.004  -9.941  39.165 1.00 10.04 ? 66  ARG A NE  1 
ATOM   362  C  CZ  . ARG A 1 63  ? 5.267  -9.207  40.013 1.00 14.90 ? 66  ARG A CZ  1 
ATOM   363  N  NH1 . ARG A 1 63  ? 4.500  -8.143  39.748 1.00 5.63  ? 66  ARG A NH1 1 
ATOM   364  N  NH2 . ARG A 1 63  ? 5.367  -9.563  41.324 1.00 10.83 ? 66  ARG A NH2 1 
ATOM   365  N  N   . LEU A 1 64  ? 5.466  -13.151 32.890 1.00 10.55 ? 67  LEU A N   1 
ATOM   366  C  CA  . LEU A 1 64  ? 5.039  -13.392 31.512 1.00 11.68 ? 67  LEU A CA  1 
ATOM   367  C  C   . LEU A 1 64  ? 3.577  -12.970 31.315 1.00 11.64 ? 67  LEU A C   1 
ATOM   368  O  O   . LEU A 1 64  ? 2.963  -12.868 32.386 1.00 10.73 ? 67  LEU A O   1 
ATOM   369  C  CB  . LEU A 1 64  ? 5.133  -14.908 31.130 1.00 10.43 ? 67  LEU A CB  1 
ATOM   370  C  CG  . LEU A 1 64  ? 6.471  -15.594 31.479 1.00 9.92  ? 67  LEU A CG  1 
ATOM   371  C  CD1 . LEU A 1 64  ? 6.452  -17.103 31.418 1.00 11.97 ? 67  LEU A CD1 1 
ATOM   372  C  CD2 . LEU A 1 64  ? 7.367  -15.375 30.255 1.00 19.32 ? 67  LEU A CD2 1 
ATOM   373  N  N   . GLY A 1 65  ? 3.284  -12.549 30.089 1.00 11.85 ? 69  GLY A N   1 
ATOM   374  C  CA  . GLY A 1 65  ? 1.891  -12.172 29.783 1.00 12.52 ? 69  GLY A CA  1 
ATOM   375  C  C   . GLY A 1 65  ? 1.427  -10.876 30.420 1.00 13.21 ? 69  GLY A C   1 
ATOM   376  O  O   . GLY A 1 65  ? 0.191  -10.691 30.486 1.00 14.06 ? 69  GLY A O   1 
ATOM   377  N  N   . GLU A 1 66  ? 2.334  -9.954  30.663 1.00 11.95 ? 70  GLU A N   1 
ATOM   378  C  CA  . GLU A 1 66  ? 2.110  -8.655  31.295 1.00 12.66 ? 70  GLU A CA  1 
ATOM   379  C  C   . GLU A 1 66  ? 1.813  -7.573  30.250 1.00 11.95 ? 70  GLU A C   1 
ATOM   380  O  O   . GLU A 1 66  ? 2.286  -7.634  29.128 1.00 11.11 ? 70  GLU A O   1 
ATOM   381  C  CB  . GLU A 1 66  ? 3.353  -8.153  32.033 1.00 13.73 ? 70  GLU A CB  1 
ATOM   382  C  CG  . GLU A 1 66  ? 3.632  -8.880  33.364 1.00 12.36 ? 70  GLU A CG  1 
ATOM   383  C  CD  . GLU A 1 66  ? 2.665  -8.361  34.416 1.00 16.69 ? 70  GLU A CD  1 
ATOM   384  O  OE1 . GLU A 1 66  ? 1.608  -7.785  34.240 1.00 18.89 ? 70  GLU A OE1 1 
ATOM   385  O  OE2 . GLU A 1 66  ? 3.143  -8.532  35.544 1.00 15.40 ? 70  GLU A OE2 1 
ATOM   386  N  N   . ASP A 1 67  ? 0.835  -6.751  30.633 1.00 12.68 ? 71  ASP A N   1 
ATOM   387  C  CA  . ASP A 1 67  ? 0.572  -5.511  29.863 1.00 12.72 ? 71  ASP A CA  1 
ATOM   388  C  C   . ASP A 1 67  ? 0.855  -4.372  30.855 1.00 12.83 ? 71  ASP A C   1 
ATOM   389  O  O   . ASP A 1 67  ? 1.941  -3.812  30.976 1.00 11.71 ? 71  ASP A O   1 
ATOM   390  C  CB  . ASP A 1 67  ? -0.736 -5.458  29.137 1.00 13.15 ? 71  ASP A CB  1 
ATOM   391  C  CG  . ASP A 1 67  ? -0.734 -4.143  28.318 1.00 18.80 ? 71  ASP A CG  1 
ATOM   392  O  OD1 . ASP A 1 67  ? 0.331  -3.940  27.715 1.00 16.32 ? 71  ASP A OD1 1 
ATOM   393  O  OD2 . ASP A 1 67  ? -1.816 -3.552  28.125 1.00 15.88 ? 71  ASP A OD2 1 
ATOM   394  N  N   . ASN A 1 68  ? -0.064 -4.136  31.772 1.00 12.64 ? 72  ASN A N   1 
ATOM   395  C  CA  . ASN A 1 68  ? 0.009  -3.157  32.844 1.00 12.35 ? 72  ASN A CA  1 
ATOM   396  C  C   . ASN A 1 68  ? 0.885  -3.815  33.913 1.00 13.81 ? 72  ASN A C   1 
ATOM   397  O  O   . ASN A 1 68  ? 0.463  -4.857  34.400 1.00 13.42 ? 72  ASN A O   1 
ATOM   398  C  CB  . ASN A 1 68  ? -1.409 -2.703  33.256 1.00 9.86  ? 72  ASN A CB  1 
ATOM   399  C  CG  . ASN A 1 68  ? -1.241 -1.680  34.394 1.00 14.89 ? 72  ASN A CG  1 
ATOM   400  O  OD1 . ASN A 1 68  ? -0.303 -1.754  35.214 1.00 11.51 ? 72  ASN A OD1 1 
ATOM   401  N  ND2 . ASN A 1 68  ? -2.234 -0.802  34.472 1.00 15.52 ? 72  ASN A ND2 1 
ATOM   402  N  N   . ILE A 1 69  ? 2.055  -3.344  34.306 1.00 13.40 ? 73  ILE A N   1 
ATOM   403  C  CA  . ILE A 1 69  ? 2.838  -4.142  35.281 1.00 12.55 ? 73  ILE A CA  1 
ATOM   404  C  C   . ILE A 1 69  ? 2.477  -3.848  36.737 1.00 12.21 ? 73  ILE A C   1 
ATOM   405  O  O   . ILE A 1 69  ? 3.098  -4.400  37.698 1.00 11.92 ? 73  ILE A O   1 
ATOM   406  C  CB  . ILE A 1 69  ? 4.360  -3.977  35.033 1.00 11.63 ? 73  ILE A CB  1 
ATOM   407  C  CG1 . ILE A 1 69  ? 4.619  -2.421  35.020 1.00 10.75 ? 73  ILE A CG1 1 
ATOM   408  C  CG2 . ILE A 1 69  ? 4.846  -4.675  33.753 1.00 13.00 ? 73  ILE A CG2 1 
ATOM   409  C  CD1 . ILE A 1 69  ? 6.152  -2.166  35.158 1.00 16.00 ? 73  ILE A CD1 1 
ATOM   410  N  N   . ASN A 1 70  ? 1.481  -2.980  36.814 1.00 12.34 ? 74  ASN A N   1 
ATOM   411  C  CA  . ASN A 1 70  ? 1.103  -2.582  38.185 1.00 12.42 ? 74  ASN A CA  1 
ATOM   412  C  C   . ASN A 1 70  ? -0.212 -3.241  38.577 1.00 12.78 ? 74  ASN A C   1 
ATOM   413  O  O   . ASN A 1 70  ? -0.601 -3.198  39.771 1.00 14.94 ? 74  ASN A O   1 
ATOM   414  C  CB  . ASN A 1 70  ? 1.041  -1.041  38.280 1.00 14.26 ? 74  ASN A CB  1 
ATOM   415  C  CG  . ASN A 1 70  ? 2.451  -0.447  38.268 1.00 20.09 ? 74  ASN A CG  1 
ATOM   416  O  OD1 . ASN A 1 70  ? 3.307  -0.846  39.085 1.00 20.68 ? 74  ASN A OD1 1 
ATOM   417  N  ND2 . ASN A 1 70  ? 2.667  0.435   37.310 1.00 19.14 ? 74  ASN A ND2 1 
ATOM   418  N  N   . VAL A 1 71  ? -0.954 -3.727  37.604 1.00 13.06 ? 75  VAL A N   1 
ATOM   419  C  CA  . VAL A 1 71  ? -2.274 -4.277  37.942 1.00 13.27 ? 75  VAL A CA  1 
ATOM   420  C  C   . VAL A 1 71  ? -2.265 -5.772  37.551 1.00 12.14 ? 75  VAL A C   1 
ATOM   421  O  O   . VAL A 1 71  ? -1.807 -6.022  36.436 1.00 14.34 ? 75  VAL A O   1 
ATOM   422  C  CB  . VAL A 1 71  ? -3.347 -3.494  37.133 1.00 16.07 ? 75  VAL A CB  1 
ATOM   423  C  CG1 . VAL A 1 71  ? -4.725 -4.153  37.277 1.00 13.83 ? 75  VAL A CG1 1 
ATOM   424  C  CG2 . VAL A 1 71  ? -3.403 -2.008  37.589 1.00 20.89 ? 75  VAL A CG2 1 
ATOM   425  N  N   . VAL A 1 72  ? -2.790 -6.637  38.380 1.00 12.88 ? 76  VAL A N   1 
ATOM   426  C  CA  . VAL A 1 72  ? -3.104 -8.009  37.897 1.00 15.93 ? 76  VAL A CA  1 
ATOM   427  C  C   . VAL A 1 72  ? -4.378 -7.886  37.020 1.00 16.43 ? 76  VAL A C   1 
ATOM   428  O  O   . VAL A 1 72  ? -5.500 -7.579  37.479 1.00 17.58 ? 76  VAL A O   1 
ATOM   429  C  CB  . VAL A 1 72  ? -3.394 -8.991  39.087 1.00 14.59 ? 76  VAL A CB  1 
ATOM   430  C  CG1 . VAL A 1 72  ? -3.734 -10.404 38.564 1.00 8.87  ? 76  VAL A CG1 1 
ATOM   431  C  CG2 . VAL A 1 72  ? -2.124 -9.095  39.945 1.00 10.64 ? 76  VAL A CG2 1 
ATOM   432  N  N   . GLU A 1 73  ? -4.279 -8.274  35.769 1.00 14.79 ? 77  GLU A N   1 
ATOM   433  C  CA  . GLU A 1 73  ? -5.385 -8.131  34.832 1.00 16.45 ? 77  GLU A CA  1 
ATOM   434  C  C   . GLU A 1 73  ? -5.975 -9.450  34.335 1.00 16.56 ? 77  GLU A C   1 
ATOM   435  O  O   . GLU A 1 73  ? -6.888 -9.440  33.470 1.00 16.71 ? 77  GLU A O   1 
ATOM   436  C  CB  . GLU A 1 73  ? -4.788 -7.460  33.559 1.00 15.15 ? 77  GLU A CB  1 
ATOM   437  C  CG  . GLU A 1 73  ? -4.289 -6.054  33.783 1.00 19.25 ? 77  GLU A CG  1 
ATOM   438  C  CD  . GLU A 1 73  ? -3.805 -5.296  32.585 1.00 21.14 ? 77  GLU A CD  1 
ATOM   439  O  OE1 . GLU A 1 73  ? -2.744 -5.582  32.065 1.00 19.87 ? 77  GLU A OE1 1 
ATOM   440  O  OE2 . GLU A 1 73  ? -4.497 -4.302  32.295 1.00 23.21 ? 77  GLU A OE2 1 
ATOM   441  N  N   . GLY A 1 74  ? -5.115 -10.442 34.394 1.00 15.99 ? 78  GLY A N   1 
ATOM   442  C  CA  . GLY A 1 74  ? -5.373 -11.811 33.923 1.00 16.20 ? 78  GLY A CA  1 
ATOM   443  C  C   . GLY A 1 74  ? -4.294 -12.093 32.858 1.00 16.87 ? 78  GLY A C   1 
ATOM   444  O  O   . GLY A 1 74  ? -3.757 -11.087 32.328 1.00 17.66 ? 78  GLY A O   1 
ATOM   445  N  N   . ASN A 1 75  ? -3.908 -13.340 32.792 1.00 14.11 ? 79  ASN A N   1 
ATOM   446  C  CA  . ASN A 1 75  ? -2.942 -13.672 31.712 1.00 15.61 ? 79  ASN A CA  1 
ATOM   447  C  C   . ASN A 1 75  ? -1.511 -13.592 32.231 1.00 13.24 ? 79  ASN A C   1 
ATOM   448  O  O   . ASN A 1 75  ? -0.688 -14.155 31.473 1.00 14.15 ? 79  ASN A O   1 
ATOM   449  C  CB  . ASN A 1 75  ? -3.021 -12.889 30.404 1.00 17.54 ? 79  ASN A CB  1 
ATOM   450  C  CG  . ASN A 1 75  ? -4.351 -13.133 29.719 1.00 25.69 ? 79  ASN A CG  1 
ATOM   451  O  OD1 . ASN A 1 75  ? -4.680 -14.232 29.265 1.00 27.81 ? 79  ASN A OD1 1 
ATOM   452  N  ND2 . ASN A 1 75  ? -5.093 -12.047 29.469 1.00 27.69 ? 79  ASN A ND2 1 
ATOM   453  N  N   . GLU A 1 76  ? -1.337 -13.123 33.448 1.00 10.77 ? 80  GLU A N   1 
ATOM   454  C  CA  . GLU A 1 76  ? 0.075  -13.146 33.891 1.00 12.84 ? 80  GLU A CA  1 
ATOM   455  C  C   . GLU A 1 76  ? 0.498  -14.549 34.325 1.00 12.46 ? 80  GLU A C   1 
ATOM   456  O  O   . GLU A 1 76  ? -0.364 -15.260 34.827 1.00 13.48 ? 80  GLU A O   1 
ATOM   457  C  CB  . GLU A 1 76  ? 0.144  -12.307 35.176 1.00 10.72 ? 80  GLU A CB  1 
ATOM   458  C  CG  . GLU A 1 76  ? -0.112 -10.788 35.015 1.00 13.77 ? 80  GLU A CG  1 
ATOM   459  C  CD  . GLU A 1 76  ? -1.561 -10.438 35.130 1.00 14.86 ? 80  GLU A CD  1 
ATOM   460  O  OE1 . GLU A 1 76  ? -2.511 -11.216 35.149 1.00 13.39 ? 80  GLU A OE1 1 
ATOM   461  O  OE2 . GLU A 1 76  ? -1.780 -9.241  35.036 1.00 10.67 ? 80  GLU A OE2 1 
ATOM   462  N  N   . GLN A 1 77  ? 1.735  -14.974 34.316 1.00 12.97 ? 81  GLN A N   1 
ATOM   463  C  CA  . GLN A 1 77  ? 2.368  -16.147 34.921 1.00 11.49 ? 81  GLN A CA  1 
ATOM   464  C  C   . GLN A 1 77  ? 3.623  -15.563 35.591 1.00 12.91 ? 81  GLN A C   1 
ATOM   465  O  O   . GLN A 1 77  ? 4.385  -14.768 34.956 1.00 13.62 ? 81  GLN A O   1 
ATOM   466  C  CB  . GLN A 1 77  ? 2.770  -17.206 33.882 1.00 14.15 ? 81  GLN A CB  1 
ATOM   467  C  CG  . GLN A 1 77  ? 1.540  -17.857 33.219 1.00 8.99  ? 81  GLN A CG  1 
ATOM   468  C  CD  . GLN A 1 77  ? 1.954  -18.752 32.071 1.00 16.82 ? 81  GLN A CD  1 
ATOM   469  O  OE1 . GLN A 1 77  ? 1.510  -18.551 30.939 1.00 21.51 ? 81  GLN A OE1 1 
ATOM   470  N  NE2 . GLN A 1 77  ? 2.902  -19.634 32.370 1.00 12.62 ? 81  GLN A NE2 1 
ATOM   471  N  N   . PHE A 1 78  ? 3.683  -15.736 36.895 1.00 13.05 ? 82  PHE A N   1 
ATOM   472  C  CA  . PHE A 1 78  ? 4.833  -15.310 37.731 1.00 12.25 ? 82  PHE A CA  1 
ATOM   473  C  C   . PHE A 1 78  ? 5.676  -16.559 38.070 1.00 11.22 ? 82  PHE A C   1 
ATOM   474  O  O   . PHE A 1 78  ? 5.150  -17.554 38.617 1.00 12.18 ? 82  PHE A O   1 
ATOM   475  C  CB  . PHE A 1 78  ? 4.429  -14.582 38.992 1.00 6.07  ? 82  PHE A CB  1 
ATOM   476  C  CG  . PHE A 1 78  ? 3.800  -13.237 38.847 1.00 14.42 ? 82  PHE A CG  1 
ATOM   477  C  CD1 . PHE A 1 78  ? 3.639  -12.672 37.590 1.00 11.29 ? 82  PHE A CD1 1 
ATOM   478  C  CD2 . PHE A 1 78  ? 3.186  -12.698 39.998 1.00 10.41 ? 82  PHE A CD2 1 
ATOM   479  C  CE1 . PHE A 1 78  ? 2.908  -11.437 37.507 1.00 17.78 ? 82  PHE A CE1 1 
ATOM   480  C  CE2 . PHE A 1 78  ? 2.506  -11.506 39.898 1.00 10.98 ? 82  PHE A CE2 1 
ATOM   481  C  CZ  . PHE A 1 78  ? 2.353  -10.875 38.661 1.00 13.84 ? 82  PHE A CZ  1 
ATOM   482  N  N   . ILE A 1 79  ? 6.901  -16.639 37.583 1.00 9.94  ? 83  ILE A N   1 
ATOM   483  C  CA  . ILE A 1 79  ? 7.735  -17.842 37.727 1.00 10.35 ? 83  ILE A CA  1 
ATOM   484  C  C   . ILE A 1 79  ? 9.102  -17.497 38.211 1.00 9.24  ? 83  ILE A C   1 
ATOM   485  O  O   . ILE A 1 79  ? 9.650  -16.597 37.605 1.00 10.94 ? 83  ILE A O   1 
ATOM   486  C  CB  . ILE A 1 79  ? 7.854  -18.638 36.381 1.00 10.03 ? 83  ILE A CB  1 
ATOM   487  C  CG1 . ILE A 1 79  ? 6.403  -18.897 35.882 1.00 14.05 ? 83  ILE A CG1 1 
ATOM   488  C  CG2 . ILE A 1 79  ? 8.540  -20.011 36.749 1.00 10.59 ? 83  ILE A CG2 1 
ATOM   489  C  CD1 . ILE A 1 79  ? 6.378  -19.493 34.453 1.00 16.39 ? 83  ILE A CD1 1 
ATOM   490  N  N   . SER A 1 80  ? 9.621  -17.986 39.274 1.00 11.13 ? 84  SER A N   1 
ATOM   491  C  CA  . SER A 1 80  ? 10.975 -17.745 39.762 1.00 13.25 ? 84  SER A CA  1 
ATOM   492  C  C   . SER A 1 80  ? 12.020 -18.210 38.748 1.00 12.15 ? 84  SER A C   1 
ATOM   493  O  O   . SER A 1 80  ? 11.881 -19.216 38.063 1.00 11.61 ? 84  SER A O   1 
ATOM   494  C  CB  . SER A 1 80  ? 11.284 -18.553 41.025 1.00 11.87 ? 84  SER A CB  1 
ATOM   495  O  OG  . SER A 1 80  ? 10.441 -18.029 42.029 1.00 22.42 ? 84  SER A OG  1 
ATOM   496  N  N   . ALA A 1 81  ? 13.092 -17.415 38.770 1.00 11.95 ? 85  ALA A N   1 
ATOM   497  C  CA  . ALA A 1 81  ? 14.168 -17.934 37.883 1.00 11.24 ? 85  ALA A CA  1 
ATOM   498  C  C   . ALA A 1 81  ? 14.759 -19.077 38.720 1.00 13.57 ? 85  ALA A C   1 
ATOM   499  O  O   . ALA A 1 81  ? 14.921 -19.036 39.959 1.00 12.99 ? 85  ALA A O   1 
ATOM   500  C  CB  . ALA A 1 81  ? 15.079 -16.747 37.532 1.00 11.98 ? 85  ALA A CB  1 
ATOM   501  N  N   . SER A 1 82  ? 15.170 -20.107 38.020 1.00 13.50 ? 86  SER A N   1 
ATOM   502  C  CA  . SER A 1 82  ? 15.816 -21.245 38.696 1.00 17.87 ? 86  SER A CA  1 
ATOM   503  C  C   . SER A 1 82  ? 17.326 -20.986 38.654 1.00 19.08 ? 86  SER A C   1 
ATOM   504  O  O   . SER A 1 82  ? 18.025 -21.223 39.632 1.00 20.98 ? 86  SER A O   1 
ATOM   505  C  CB  . SER A 1 82  ? 15.628 -22.488 37.838 1.00 15.35 ? 86  SER A CB  1 
ATOM   506  O  OG  . SER A 1 82  ? 16.119 -23.492 38.681 1.00 31.16 ? 86  SER A OG  1 
ATOM   507  N  N   . LYS A 1 83  ? 17.822 -20.604 37.487 1.00 19.66 ? 87  LYS A N   1 
ATOM   508  C  CA  . LYS A 1 83  ? 19.224 -20.089 37.435 1.00 18.71 ? 87  LYS A CA  1 
ATOM   509  C  C   . LYS A 1 83  ? 19.398 -18.984 36.383 1.00 15.31 ? 87  LYS A C   1 
ATOM   510  O  O   . LYS A 1 83  ? 18.672 -18.990 35.346 1.00 13.06 ? 87  LYS A O   1 
ATOM   511  C  CB  . LYS A 1 83  ? 20.149 -21.279 37.172 1.00 21.29 ? 87  LYS A CB  1 
ATOM   512  C  CG  . LYS A 1 83  ? 20.166 -21.890 35.774 1.00 25.02 ? 87  LYS A CG  1 
ATOM   513  C  CD  . LYS A 1 83  ? 20.415 -23.439 35.920 1.00 32.49 ? 87  LYS A CD  1 
ATOM   514  C  CE  . LYS A 1 83  ? 21.815 -23.692 36.492 1.00 31.78 ? 87  LYS A CE  1 
ATOM   515  N  NZ  . LYS A 1 83  ? 22.744 -24.329 35.516 1.00 32.93 ? 87  LYS A NZ  1 
ATOM   516  N  N   . SER A 1 84  ? 20.410 -18.151 36.643 1.00 15.22 ? 88  SER A N   1 
ATOM   517  C  CA  . SER A 1 84  ? 20.799 -17.123 35.663 1.00 15.09 ? 88  SER A CA  1 
ATOM   518  C  C   . SER A 1 84  ? 22.219 -17.386 35.170 1.00 15.14 ? 88  SER A C   1 
ATOM   519  O  O   . SER A 1 84  ? 23.128 -17.455 35.978 1.00 15.70 ? 88  SER A O   1 
ATOM   520  C  CB  . SER A 1 84  ? 20.693 -15.712 36.204 1.00 15.85 ? 88  SER A CB  1 
ATOM   521  O  OG  . SER A 1 84  ? 19.397 -15.483 36.722 1.00 21.97 ? 88  SER A OG  1 
ATOM   522  N  N   . ILE A 1 85  ? 22.423 -17.423 33.880 1.00 12.77 ? 89  ILE A N   1 
ATOM   523  C  CA  . ILE A 1 85  ? 23.723 -17.669 33.284 1.00 11.04 ? 89  ILE A CA  1 
ATOM   524  C  C   . ILE A 1 85  ? 24.195 -16.450 32.494 1.00 10.04 ? 89  ILE A C   1 
ATOM   525  O  O   . ILE A 1 85  ? 23.979 -16.420 31.284 1.00 7.66  ? 89  ILE A O   1 
ATOM   526  C  CB  . ILE A 1 85  ? 23.654 -18.978 32.386 1.00 14.69 ? 89  ILE A CB  1 
ATOM   527  C  CG1 . ILE A 1 85  ? 23.090 -20.188 33.250 1.00 14.68 ? 89  ILE A CG1 1 
ATOM   528  C  CG2 . ILE A 1 85  ? 24.964 -19.337 31.628 1.00 10.59 ? 89  ILE A CG2 1 
ATOM   529  C  CD1 . ILE A 1 85  ? 22.803 -21.504 32.442 1.00 12.75 ? 89  ILE A CD1 1 
ATOM   530  N  N   . VAL A 1 86  ? 25.096 -15.674 33.086 1.00 9.56  ? 90  VAL A N   1 
ATOM   531  C  CA  . VAL A 1 86  ? 25.791 -14.587 32.399 1.00 10.74 ? 90  VAL A CA  1 
ATOM   532  C  C   . VAL A 1 86  ? 26.836 -15.141 31.435 1.00 12.14 ? 90  VAL A C   1 
ATOM   533  O  O   . VAL A 1 86  ? 27.577 -16.092 31.861 1.00 12.65 ? 90  VAL A O   1 
ATOM   534  C  CB  . VAL A 1 86  ? 26.400 -13.715 33.510 1.00 12.80 ? 90  VAL A CB  1 
ATOM   535  C  CG1 . VAL A 1 86  ? 27.361 -12.647 33.006 1.00 12.81 ? 90  VAL A CG1 1 
ATOM   536  C  CG2 . VAL A 1 86  ? 25.354 -13.092 34.408 1.00 12.19 ? 90  VAL A CG2 1 
ATOM   537  N  N   . HIS A 1 87  ? 26.946 -14.552 30.246 1.00 10.35 ? 91  HIS A N   1 
ATOM   538  C  CA  . HIS A 1 87  ? 28.006 -15.023 29.341 1.00 9.61  ? 91  HIS A CA  1 
ATOM   539  C  C   . HIS A 1 87  ? 29.365 -14.935 30.035 1.00 11.03 ? 91  HIS A C   1 
ATOM   540  O  O   . HIS A 1 87  ? 29.617 -13.971 30.782 1.00 11.83 ? 91  HIS A O   1 
ATOM   541  C  CB  . HIS A 1 87  ? 28.045 -14.032 28.142 1.00 10.03 ? 91  HIS A CB  1 
ATOM   542  C  CG  . HIS A 1 87  ? 28.842 -14.699 27.035 1.00 10.39 ? 91  HIS A CG  1 
ATOM   543  N  ND1 . HIS A 1 87  ? 30.216 -14.866 27.046 1.00 10.46 ? 91  HIS A ND1 1 
ATOM   544  C  CD2 . HIS A 1 87  ? 28.358 -15.335 25.956 1.00 10.27 ? 91  HIS A CD2 1 
ATOM   545  C  CE1 . HIS A 1 87  ? 30.525 -15.434 25.881 1.00 11.45 ? 91  HIS A CE1 1 
ATOM   546  N  NE2 . HIS A 1 87  ? 29.434 -15.807 25.244 1.00 10.81 ? 91  HIS A NE2 1 
ATOM   547  N  N   . PRO A 1 88  ? 30.190 -16.015 30.063 1.00 13.57 ? 92  PRO A N   1 
ATOM   548  C  CA  . PRO A 1 88  ? 31.464 -16.064 30.754 1.00 12.94 ? 92  PRO A CA  1 
ATOM   549  C  C   . PRO A 1 88  ? 32.458 -14.938 30.368 1.00 13.88 ? 92  PRO A C   1 
ATOM   550  O  O   . PRO A 1 88  ? 33.388 -14.608 31.131 1.00 11.66 ? 92  PRO A O   1 
ATOM   551  C  CB  . PRO A 1 88  ? 32.000 -17.470 30.464 1.00 14.17 ? 92  PRO A CB  1 
ATOM   552  C  CG  . PRO A 1 88  ? 30.866 -18.287 29.917 1.00 14.39 ? 92  PRO A CG  1 
ATOM   553  C  CD  . PRO A 1 88  ? 29.799 -17.327 29.462 1.00 12.48 ? 92  PRO A CD  1 
ATOM   554  N  N   . SER A 1 89  ? 32.298 -14.434 29.152 1.00 13.89 ? 93  SER A N   1 
ATOM   555  C  CA  . SER A 1 89  ? 33.124 -13.383 28.592 1.00 15.41 ? 93  SER A CA  1 
ATOM   556  C  C   . SER A 1 89  ? 32.543 -11.970 28.696 1.00 16.23 ? 93  SER A C   1 
ATOM   557  O  O   . SER A 1 89  ? 33.058 -11.060 28.010 1.00 15.79 ? 93  SER A O   1 
ATOM   558  C  CB  . SER A 1 89  ? 33.447 -13.671 27.152 1.00 12.76 ? 93  SER A CB  1 
ATOM   559  O  OG  . SER A 1 89  ? 34.183 -14.866 27.279 1.00 17.46 ? 93  SER A OG  1 
ATOM   560  N  N   . TYR A 1 90  ? 31.434 -11.884 29.378 1.00 15.60 ? 94  TYR A N   1 
ATOM   561  C  CA  . TYR A 1 90  ? 30.832 -10.546 29.629 1.00 16.00 ? 94  TYR A CA  1 
ATOM   562  C  C   . TYR A 1 90  ? 31.877 -9.622  30.270 1.00 15.65 ? 94  TYR A C   1 
ATOM   563  O  O   . TYR A 1 90  ? 32.472 -9.893  31.337 1.00 15.43 ? 94  TYR A O   1 
ATOM   564  C  CB  . TYR A 1 90  ? 29.586 -10.706 30.512 1.00 9.47  ? 94  TYR A CB  1 
ATOM   565  C  CG  . TYR A 1 90  ? 29.075 -9.350  30.984 1.00 13.24 ? 94  TYR A CG  1 
ATOM   566  C  CD1 . TYR A 1 90  ? 28.615 -8.348  30.115 1.00 9.63  ? 94  TYR A CD1 1 
ATOM   567  C  CD2 . TYR A 1 90  ? 29.044 -9.192  32.392 1.00 10.28 ? 94  TYR A CD2 1 
ATOM   568  C  CE1 . TYR A 1 90  ? 28.056 -7.156  30.623 1.00 10.15 ? 94  TYR A CE1 1 
ATOM   569  C  CE2 . TYR A 1 90  ? 28.432 -8.045  32.900 1.00 10.75 ? 94  TYR A CE2 1 
ATOM   570  C  CZ  . TYR A 1 90  ? 28.045 -7.016  32.018 1.00 14.33 ? 94  TYR A CZ  1 
ATOM   571  O  OH  . TYR A 1 90  ? 27.570 -5.844  32.606 1.00 16.24 ? 94  TYR A OH  1 
ATOM   572  N  N   . ASN A 1 91  ? 31.940 -8.406  29.772 1.00 15.67 ? 95  ASN A N   1 
ATOM   573  C  CA  . ASN A 1 91  ? 32.852 -7.350  30.328 1.00 17.28 ? 95  ASN A CA  1 
ATOM   574  C  C   . ASN A 1 91  ? 31.989 -6.145  30.736 1.00 16.80 ? 95  ASN A C   1 
ATOM   575  O  O   . ASN A 1 91  ? 31.334 -5.464  29.904 1.00 18.13 ? 95  ASN A O   1 
ATOM   576  C  CB  . ASN A 1 91  ? 33.959 -6.939  29.337 1.00 24.60 ? 95  ASN A CB  1 
ATOM   577  C  CG  . ASN A 1 91  ? 34.858 -5.826  29.861 1.00 24.68 ? 95  ASN A CG  1 
ATOM   578  O  OD1 . ASN A 1 91  ? 34.474 -5.056  30.742 1.00 22.43 ? 95  ASN A OD1 1 
ATOM   579  N  ND2 . ASN A 1 91  ? 36.116 -5.903  29.489 1.00 27.82 ? 95  ASN A ND2 1 
ATOM   580  N  N   . SER A 1 92  ? 31.896 -6.022  32.042 1.00 15.30 ? 96  SER A N   1 
ATOM   581  C  CA  . SER A 1 92  ? 31.096 -4.919  32.569 1.00 16.78 ? 96  SER A CA  1 
ATOM   582  C  C   . SER A 1 92  ? 31.774 -3.558  32.295 1.00 17.72 ? 96  SER A C   1 
ATOM   583  O  O   . SER A 1 92  ? 30.984 -2.624  32.475 1.00 17.34 ? 96  SER A O   1 
ATOM   584  C  CB  . SER A 1 92  ? 30.773 -4.887  34.053 1.00 15.92 ? 96  SER A CB  1 
ATOM   585  O  OG  . SER A 1 92  ? 31.963 -5.142  34.766 1.00 24.44 ? 96  SER A OG  1 
ATOM   586  N  N   . ASN A 1 93  ? 32.928 -3.423  31.696 1.00 18.04 ? 97  ASN A N   1 
ATOM   587  C  CA  . ASN A 1 93  ? 33.344 -2.013  31.433 1.00 21.01 ? 97  ASN A CA  1 
ATOM   588  C  C   . ASN A 1 93  ? 32.812 -1.640  30.046 1.00 23.00 ? 97  ASN A C   1 
ATOM   589  O  O   . ASN A 1 93  ? 32.281 -0.548  29.809 1.00 24.72 ? 97  ASN A O   1 
ATOM   590  C  CB  . ASN A 1 93  ? 34.845 -1.829  31.657 1.00 22.12 ? 97  ASN A CB  1 
ATOM   591  C  CG  . ASN A 1 93  ? 35.006 -1.737  33.183 1.00 33.67 ? 97  ASN A CG  1 
ATOM   592  O  OD1 . ASN A 1 93  ? 35.803 -2.418  33.862 1.00 38.95 ? 97  ASN A OD1 1 
ATOM   593  N  ND2 . ASN A 1 93  ? 33.991 -1.144  33.843 1.00 34.38 ? 97  ASN A ND2 1 
ATOM   594  N  N   . THR A 1 94  ? 33.056 -2.545  29.126 1.00 20.41 ? 98  THR A N   1 
ATOM   595  C  CA  . THR A 1 94  ? 32.667 -2.421  27.742 1.00 19.56 ? 98  THR A CA  1 
ATOM   596  C  C   . THR A 1 94  ? 31.250 -2.885  27.404 1.00 20.01 ? 98  THR A C   1 
ATOM   597  O  O   . THR A 1 94  ? 30.925 -2.491  26.239 1.00 20.62 ? 98  THR A O   1 
ATOM   598  C  CB  . THR A 1 94  ? 33.702 -3.234  26.847 1.00 18.57 ? 98  THR A CB  1 
ATOM   599  O  OG1 . THR A 1 94  ? 33.599 -4.650  27.166 1.00 20.97 ? 98  THR A OG1 1 
ATOM   600  C  CG2 . THR A 1 94  ? 35.117 -2.686  27.059 1.00 17.68 ? 98  THR A CG2 1 
ATOM   601  N  N   . LEU A 1 95  ? 30.642 -3.712  28.258 1.00 16.94 ? 99  LEU A N   1 
ATOM   602  C  CA  . LEU A 1 95  ? 29.359 -4.294  27.872 1.00 14.78 ? 99  LEU A CA  1 
ATOM   603  C  C   . LEU A 1 95  ? 29.538 -5.194  26.653 1.00 14.83 ? 99  LEU A C   1 
ATOM   604  O  O   . LEU A 1 95  ? 28.550 -5.548  25.972 1.00 14.75 ? 99  LEU A O   1 
ATOM   605  C  CB  . LEU A 1 95  ? 28.283 -3.198  27.819 1.00 17.45 ? 99  LEU A CB  1 
ATOM   606  C  CG  . LEU A 1 95  ? 27.963 -2.540  29.166 1.00 21.50 ? 99  LEU A CG  1 
ATOM   607  C  CD1 . LEU A 1 95  ? 26.635 -1.779  29.113 1.00 28.10 ? 99  LEU A CD1 1 
ATOM   608  C  CD2 . LEU A 1 95  ? 27.667 -3.546  30.277 1.00 21.82 ? 99  LEU A CD2 1 
ATOM   609  N  N   . ASN A 1 96  ? 30.735 -5.663  26.299 1.00 13.75 ? 100 ASN A N   1 
ATOM   610  C  CA  . ASN A 1 96  ? 30.898 -6.719  25.258 1.00 14.92 ? 100 ASN A CA  1 
ATOM   611  C  C   . ASN A 1 96  ? 30.358 -8.080  25.808 1.00 13.43 ? 100 ASN A C   1 
ATOM   612  O  O   . ASN A 1 96  ? 30.559 -8.335  27.006 1.00 11.59 ? 100 ASN A O   1 
ATOM   613  C  CB  . ASN A 1 96  ? 32.378 -6.799  24.902 1.00 12.97 ? 100 ASN A CB  1 
ATOM   614  C  CG  . ASN A 1 96  ? 32.567 -7.592  23.651 1.00 14.45 ? 100 ASN A CG  1 
ATOM   615  O  OD1 . ASN A 1 96  ? 33.514 -8.410  23.500 1.00 22.75 ? 100 ASN A OD1 1 
ATOM   616  N  ND2 . ASN A 1 96  ? 31.688 -7.430  22.702 1.00 10.89 ? 100 ASN A ND2 1 
ATOM   617  N  N   . ASN A 1 97  ? 29.658 -8.865  25.016 1.00 12.89 ? 101 ASN A N   1 
ATOM   618  C  CA  . ASN A 1 97  ? 28.987 -10.122 25.452 1.00 12.83 ? 101 ASN A CA  1 
ATOM   619  C  C   . ASN A 1 97  ? 27.936 -9.802  26.530 1.00 13.02 ? 101 ASN A C   1 
ATOM   620  O  O   . ASN A 1 97  ? 27.884 -10.585 27.514 1.00 12.03 ? 101 ASN A O   1 
ATOM   621  C  CB  . ASN A 1 97  ? 29.982 -11.182 25.978 1.00 10.86 ? 101 ASN A CB  1 
ATOM   622  C  CG  . ASN A 1 97  ? 31.121 -11.358 24.954 1.00 12.72 ? 101 ASN A CG  1 
ATOM   623  O  OD1 . ASN A 1 97  ? 32.319 -11.219 25.306 1.00 12.25 ? 101 ASN A OD1 1 
ATOM   624  N  ND2 . ASN A 1 97  ? 30.759 -11.706 23.742 1.00 3.29  ? 101 ASN A ND2 1 
ATOM   625  N  N   . ASP A 1 98  ? 27.100 -8.804  26.205 1.00 9.30  ? 102 ASP A N   1 
ATOM   626  C  CA  . ASP A 1 98  ? 26.042 -8.417  27.153 1.00 12.98 ? 102 ASP A CA  1 
ATOM   627  C  C   . ASP A 1 98  ? 24.806 -9.286  26.836 1.00 12.65 ? 102 ASP A C   1 
ATOM   628  O  O   . ASP A 1 98  ? 23.762 -8.843  26.289 1.00 14.59 ? 102 ASP A O   1 
ATOM   629  C  CB  . ASP A 1 98  ? 25.705 -6.946  27.178 1.00 11.28 ? 102 ASP A CB  1 
ATOM   630  C  CG  . ASP A 1 98  ? 24.811 -6.500  28.317 1.00 16.33 ? 102 ASP A CG  1 
ATOM   631  O  OD1 . ASP A 1 98  ? 24.699 -7.137  29.370 1.00 13.93 ? 102 ASP A OD1 1 
ATOM   632  O  OD2 . ASP A 1 98  ? 24.158 -5.438  28.130 1.00 16.23 ? 102 ASP A OD2 1 
ATOM   633  N  N   . ILE A 1 99  ? 24.820 -10.485 27.367 1.00 13.16 ? 103 ILE A N   1 
ATOM   634  C  CA  . ILE A 1 99  ? 23.772 -11.531 27.200 1.00 10.29 ? 103 ILE A CA  1 
ATOM   635  C  C   . ILE A 1 99  ? 23.811 -12.441 28.437 1.00 10.22 ? 103 ILE A C   1 
ATOM   636  O  O   . ILE A 1 99  ? 24.846 -12.781 29.042 1.00 11.81 ? 103 ILE A O   1 
ATOM   637  C  CB  . ILE A 1 99  ? 23.944 -12.289 25.846 1.00 5.63  ? 103 ILE A CB  1 
ATOM   638  C  CG1 . ILE A 1 99  ? 22.835 -13.380 25.648 1.00 12.35 ? 103 ILE A CG1 1 
ATOM   639  C  CG2 . ILE A 1 99  ? 25.327 -13.016 25.781 1.00 8.88  ? 103 ILE A CG2 1 
ATOM   640  C  CD1 . ILE A 1 99  ? 22.727 -13.750 24.099 1.00 11.49 ? 103 ILE A CD1 1 
ATOM   641  N  N   . MET A 1 100 ? 22.629 -12.953 28.718 1.00 10.58 ? 104 MET A N   1 
ATOM   642  C  CA  . MET A 1 100 ? 22.379 -13.791 29.905 1.00 11.76 ? 104 MET A CA  1 
ATOM   643  C  C   . MET A 1 100 ? 21.172 -14.671 29.525 1.00 11.28 ? 104 MET A C   1 
ATOM   644  O  O   . MET A 1 100 ? 20.175 -14.174 28.961 1.00 12.02 ? 104 MET A O   1 
ATOM   645  C  CB  . MET A 1 100 ? 22.031 -12.913 31.104 1.00 9.43  ? 104 MET A CB  1 
ATOM   646  C  CG  . MET A 1 100 ? 21.526 -13.680 32.268 1.00 13.97 ? 104 MET A CG  1 
ATOM   647  S  SD  . MET A 1 100 ? 21.388 -12.530 33.647 1.00 15.62 ? 104 MET A SD  1 
ATOM   648  C  CE  . MET A 1 100 ? 19.867 -11.584 33.529 1.00 15.94 ? 104 MET A CE  1 
ATOM   649  N  N   . LEU A 1 101 ? 21.207 -15.863 30.084 1.00 10.06 ? 105 LEU A N   1 
ATOM   650  C  CA  . LEU A 1 101 ? 20.090 -16.812 29.912 1.00 11.71 ? 105 LEU A CA  1 
ATOM   651  C  C   . LEU A 1 101 ? 19.532 -17.049 31.297 1.00 11.47 ? 105 LEU A C   1 
ATOM   652  O  O   . LEU A 1 101 ? 20.323 -17.319 32.213 1.00 16.26 ? 105 LEU A O   1 
ATOM   653  C  CB  . LEU A 1 101 ? 20.644 -18.101 29.332 1.00 10.30 ? 105 LEU A CB  1 
ATOM   654  C  CG  . LEU A 1 101 ? 20.632 -18.558 27.912 1.00 16.53 ? 105 LEU A CG  1 
ATOM   655  C  CD1 . LEU A 1 101 ? 20.167 -17.610 26.866 1.00 16.65 ? 105 LEU A CD1 1 
ATOM   656  C  CD2 . LEU A 1 101 ? 21.958 -19.268 27.643 1.00 17.35 ? 105 LEU A CD2 1 
ATOM   657  N  N   . ILE A 1 102 ? 18.233 -17.179 31.357 1.00 10.37 ? 106 ILE A N   1 
ATOM   658  C  CA  . ILE A 1 102 ? 17.600 -17.441 32.650 1.00 11.90 ? 106 ILE A CA  1 
ATOM   659  C  C   . ILE A 1 102 ? 16.655 -18.660 32.452 1.00 12.68 ? 106 ILE A C   1 
ATOM   660  O  O   . ILE A 1 102 ? 15.909 -18.675 31.458 1.00 10.46 ? 106 ILE A O   1 
ATOM   661  C  CB  . ILE A 1 102 ? 16.696 -16.241 33.103 1.00 8.12  ? 106 ILE A CB  1 
ATOM   662  C  CG1 . ILE A 1 102 ? 17.537 -14.940 33.202 1.00 13.47 ? 106 ILE A CG1 1 
ATOM   663  C  CG2 . ILE A 1 102 ? 15.888 -16.478 34.416 1.00 6.85  ? 106 ILE A CG2 1 
ATOM   664  C  CD1 . ILE A 1 102 ? 16.606 -13.756 33.639 1.00 17.53 ? 106 ILE A CD1 1 
ATOM   665  N  N   . LYS A 1 103 ? 16.904 -19.620 33.367 1.00 12.74 ? 107 LYS A N   1 
ATOM   666  C  CA  . LYS A 1 103 ? 16.037 -20.837 33.346 1.00 8.45  ? 107 LYS A CA  1 
ATOM   667  C  C   . LYS A 1 103 ? 14.916 -20.594 34.361 1.00 10.65 ? 107 LYS A C   1 
ATOM   668  O  O   . LYS A 1 103 ? 15.130 -20.249 35.561 1.00 10.91 ? 107 LYS A O   1 
ATOM   669  C  CB  . LYS A 1 103 ? 16.854 -22.049 33.750 1.00 12.72 ? 107 LYS A CB  1 
ATOM   670  C  CG  . LYS A 1 103 ? 16.150 -23.362 33.391 1.00 16.75 ? 107 LYS A CG  1 
ATOM   671  C  CD  . LYS A 1 103 ? 16.951 -24.555 33.895 1.00 17.91 ? 107 LYS A CD  1 
ATOM   672  C  CE  . LYS A 1 103 ? 16.134 -25.739 33.383 1.00 26.00 ? 107 LYS A CE  1 
ATOM   673  N  NZ  . LYS A 1 103 ? 16.671 -27.010 33.977 1.00 29.54 ? 107 LYS A NZ  1 
ATOM   674  N  N   . LEU A 1 104 ? 13.720 -20.947 33.863 1.00 10.12 ? 108 LEU A N   1 
ATOM   675  C  CA  . LEU A 1 104 ? 12.536 -20.813 34.735 1.00 12.31 ? 108 LEU A CA  1 
ATOM   676  C  C   . LEU A 1 104 ? 12.438 -21.973 35.730 1.00 13.34 ? 108 LEU A C   1 
ATOM   677  O  O   . LEU A 1 104 ? 12.820 -23.080 35.353 1.00 15.79 ? 108 LEU A O   1 
ATOM   678  C  CB  . LEU A 1 104 ? 11.281 -20.784 33.844 1.00 12.37 ? 108 LEU A CB  1 
ATOM   679  C  CG  . LEU A 1 104 ? 11.222 -19.657 32.798 1.00 17.60 ? 108 LEU A CG  1 
ATOM   680  C  CD1 . LEU A 1 104 ? 9.804  -19.492 32.242 1.00 16.75 ? 108 LEU A CD1 1 
ATOM   681  C  CD2 . LEU A 1 104 ? 11.688 -18.394 33.511 1.00 15.21 ? 108 LEU A CD2 1 
ATOM   682  N  N   . LYS A 1 105 ? 11.968 -21.755 36.938 1.00 14.62 ? 109 LYS A N   1 
ATOM   683  C  CA  . LYS A 1 105 ? 11.798 -22.854 37.924 1.00 16.31 ? 109 LYS A CA  1 
ATOM   684  C  C   . LYS A 1 105 ? 10.877 -23.929 37.299 1.00 16.75 ? 109 LYS A C   1 
ATOM   685  O  O   . LYS A 1 105 ? 11.006 -25.107 37.685 1.00 16.16 ? 109 LYS A O   1 
ATOM   686  C  CB  . LYS A 1 105 ? 11.025 -22.279 39.112 1.00 22.79 ? 109 LYS A CB  1 
ATOM   687  C  CG  . LYS A 1 105 ? 11.550 -22.794 40.438 1.00 29.11 ? 109 LYS A CG  1 
ATOM   688  C  CD  . LYS A 1 105 ? 12.902 -22.016 40.441 1.00 31.72 ? 109 LYS A CD  1 
ATOM   689  C  CE  . LYS A 1 105 ? 13.089 -21.514 41.886 1.00 35.34 ? 109 LYS A CE  1 
ATOM   690  N  NZ  . LYS A 1 105 ? 14.032 -20.357 41.975 1.00 31.79 ? 109 LYS A NZ  1 
ATOM   691  N  N   . SER A 1 106 ? 9.862  -23.525 36.543 1.00 16.19 ? 110 SER A N   1 
ATOM   692  C  CA  . SER A 1 106 ? 8.908  -24.413 35.853 1.00 16.53 ? 110 SER A CA  1 
ATOM   693  C  C   . SER A 1 106 ? 8.553  -23.810 34.501 1.00 17.43 ? 110 SER A C   1 
ATOM   694  O  O   . SER A 1 106 ? 8.852  -22.621 34.273 1.00 15.64 ? 110 SER A O   1 
ATOM   695  C  CB  . SER A 1 106 ? 7.687  -24.750 36.653 1.00 17.09 ? 110 SER A CB  1 
ATOM   696  O  OG  . SER A 1 106 ? 6.988  -23.666 37.212 1.00 21.51 ? 110 SER A OG  1 
ATOM   697  N  N   . ALA A 1 107 ? 8.097  -24.630 33.609 1.00 17.20 ? 111 ALA A N   1 
ATOM   698  C  CA  . ALA A 1 107 ? 7.739  -24.309 32.238 1.00 17.97 ? 111 ALA A CA  1 
ATOM   699  C  C   . ALA A 1 107 ? 6.479  -23.447 32.194 1.00 18.81 ? 111 ALA A C   1 
ATOM   700  O  O   . ALA A 1 107 ? 5.580  -23.552 33.046 1.00 20.03 ? 111 ALA A O   1 
ATOM   701  C  CB  . ALA A 1 107 ? 7.567  -25.578 31.424 1.00 14.63 ? 111 ALA A CB  1 
ATOM   702  N  N   . ALA A 1 108 ? 6.615  -22.354 31.458 1.00 18.39 ? 112 ALA A N   1 
ATOM   703  C  CA  . ALA A 1 108 ? 5.489  -21.420 31.271 1.00 18.69 ? 112 ALA A CA  1 
ATOM   704  C  C   . ALA A 1 108 ? 4.410  -22.224 30.496 1.00 19.16 ? 112 ALA A C   1 
ATOM   705  O  O   . ALA A 1 108 ? 4.778  -23.135 29.738 1.00 14.64 ? 112 ALA A O   1 
ATOM   706  C  CB  . ALA A 1 108 ? 5.951  -20.338 30.288 1.00 14.09 ? 112 ALA A CB  1 
ATOM   707  N  N   . SER A 1 109 ? 3.200  -21.677 30.572 1.00 19.45 ? 113 SER A N   1 
ATOM   708  C  CA  . SER A 1 109 ? 2.113  -22.171 29.724 1.00 22.10 ? 113 SER A CA  1 
ATOM   709  C  C   . SER A 1 109 ? 2.103  -21.349 28.444 1.00 22.63 ? 113 SER A C   1 
ATOM   710  O  O   . SER A 1 109 ? 1.799  -20.174 28.544 1.00 24.12 ? 113 SER A O   1 
ATOM   711  C  CB  . SER A 1 109 ? 0.697  -22.141 30.282 1.00 23.98 ? 113 SER A CB  1 
ATOM   712  O  OG  . SER A 1 109 ? 0.696  -23.080 31.342 1.00 30.30 ? 113 SER A OG  1 
ATOM   713  N  N   . LEU A 1 110 ? 2.411  -21.915 27.314 1.00 23.37 ? 114 LEU A N   1 
ATOM   714  C  CA  . LEU A 1 110 ? 2.428  -21.193 26.050 1.00 23.94 ? 114 LEU A CA  1 
ATOM   715  C  C   . LEU A 1 110 ? 1.025  -21.294 25.445 1.00 27.51 ? 114 LEU A C   1 
ATOM   716  O  O   . LEU A 1 110 ? 0.303  -22.286 25.615 1.00 27.21 ? 114 LEU A O   1 
ATOM   717  C  CB  . LEU A 1 110 ? 3.563  -21.766 25.219 1.00 23.30 ? 114 LEU A CB  1 
ATOM   718  C  CG  . LEU A 1 110 ? 4.911  -21.080 25.268 1.00 23.80 ? 114 LEU A CG  1 
ATOM   719  C  CD1 . LEU A 1 110 ? 5.337  -20.551 26.635 1.00 21.84 ? 114 LEU A CD1 1 
ATOM   720  C  CD2 . LEU A 1 110 ? 5.867  -22.189 24.885 1.00 24.20 ? 114 LEU A CD2 1 
ATOM   721  N  N   . ASN A 1 111 ? 0.552  -20.130 25.061 1.00 28.84 ? 115 ASN A N   1 
ATOM   722  C  CA  . ASN A 1 111 ? -0.693 -19.691 24.454 1.00 30.22 ? 115 ASN A CA  1 
ATOM   723  C  C   . ASN A 1 111 ? -0.445 -18.506 23.501 1.00 30.42 ? 115 ASN A C   1 
ATOM   724  O  O   . ASN A 1 111 ? 0.632  -18.213 22.934 1.00 30.45 ? 115 ASN A O   1 
ATOM   725  C  CB  . ASN A 1 111 ? -1.669 -19.352 25.574 1.00 31.26 ? 115 ASN A CB  1 
ATOM   726  C  CG  . ASN A 1 111 ? -1.088 -18.463 26.650 1.00 34.83 ? 115 ASN A CG  1 
ATOM   727  O  OD1 . ASN A 1 111 ? -0.894 -17.276 26.403 1.00 33.05 ? 115 ASN A OD1 1 
ATOM   728  N  ND2 . ASN A 1 111 ? -0.942 -18.921 27.893 1.00 35.90 ? 115 ASN A ND2 1 
ATOM   729  N  N   . SER A 1 112 ? -1.554 -17.845 23.191 1.00 30.35 ? 116 SER A N   1 
ATOM   730  C  CA  . SER A 1 112 ? -1.519 -16.676 22.279 1.00 29.30 ? 116 SER A CA  1 
ATOM   731  C  C   . SER A 1 112 ? -0.895 -15.459 22.970 1.00 27.16 ? 116 SER A C   1 
ATOM   732  O  O   . SER A 1 112 ? -0.435 -14.524 22.292 1.00 27.62 ? 116 SER A O   1 
ATOM   733  C  CB  . SER A 1 112 ? -2.930 -16.435 21.761 1.00 29.92 ? 116 SER A CB  1 
ATOM   734  O  OG  . SER A 1 112 ? -3.859 -16.622 22.820 1.00 38.99 ? 116 SER A OG  1 
ATOM   735  N  N   . ARG A 1 113 ? -1.062 -15.403 24.287 1.00 25.39 ? 117 ARG A N   1 
ATOM   736  C  CA  . ARG A 1 113 ? -0.562 -14.331 25.128 1.00 22.47 ? 117 ARG A CA  1 
ATOM   737  C  C   . ARG A 1 113 ? 0.894  -14.500 25.514 1.00 21.14 ? 117 ARG A C   1 
ATOM   738  O  O   . ARG A 1 113 ? 1.299  -13.618 26.286 1.00 23.40 ? 117 ARG A O   1 
ATOM   739  C  CB  . ARG A 1 113 ? -1.059 -14.310 26.596 1.00 25.36 ? 117 ARG A CB  1 
ATOM   740  C  CG  . ARG A 1 113 ? -2.481 -13.750 26.544 1.00 35.89 ? 117 ARG A CG  1 
ATOM   741  C  CD  . ARG A 1 113 ? -3.101 -14.506 25.397 1.00 37.80 ? 117 ARG A CD  1 
ATOM   742  N  NE  . ARG A 1 113 ? -4.085 -13.564 24.856 1.00 46.04 ? 117 ARG A NE  1 
ATOM   743  C  CZ  . ARG A 1 113 ? -5.238 -13.380 25.531 1.00 48.29 ? 117 ARG A CZ  1 
ATOM   744  N  NH1 . ARG A 1 113 ? -5.572 -14.071 26.626 1.00 47.83 ? 117 ARG A NH1 1 
ATOM   745  N  NH2 . ARG A 1 113 ? -5.832 -12.206 25.244 1.00 49.48 ? 117 ARG A NH2 1 
ATOM   746  N  N   . VAL A 1 114 ? 1.274  -15.755 25.598 1.00 19.99 ? 118 VAL A N   1 
ATOM   747  C  CA  . VAL A 1 114 ? 2.605  -16.103 26.074 1.00 17.28 ? 118 VAL A CA  1 
ATOM   748  C  C   . VAL A 1 114 ? 3.191  -17.107 25.096 1.00 18.78 ? 118 VAL A C   1 
ATOM   749  O  O   . VAL A 1 114 ? 2.624  -18.206 24.997 1.00 19.37 ? 118 VAL A O   1 
ATOM   750  C  CB  . VAL A 1 114 ? 2.470  -16.631 27.502 1.00 12.09 ? 118 VAL A CB  1 
ATOM   751  C  CG1 . VAL A 1 114 ? 3.905  -17.074 27.817 1.00 13.17 ? 118 VAL A CG1 1 
ATOM   752  C  CG2 . VAL A 1 114 ? 2.026  -15.584 28.510 1.00 12.88 ? 118 VAL A CG2 1 
ATOM   753  N  N   . ALA A 1 115 ? 4.139  -16.664 24.302 1.00 16.43 ? 119 ALA A N   1 
ATOM   754  C  CA  . ALA A 1 115 ? 4.744  -17.384 23.188 1.00 13.75 ? 119 ALA A CA  1 
ATOM   755  C  C   . ALA A 1 115 ? 6.239  -17.046 23.105 1.00 16.18 ? 119 ALA A C   1 
ATOM   756  O  O   . ALA A 1 115 ? 6.708  -16.017 23.616 1.00 13.91 ? 119 ALA A O   1 
ATOM   757  C  CB  . ALA A 1 115 ? 4.023  -17.018 21.906 1.00 9.46  ? 119 ALA A CB  1 
ATOM   758  N  N   . SER A 1 116 ? 6.990  -17.896 22.405 1.00 14.85 ? 120 SER A N   1 
ATOM   759  C  CA  . SER A 1 116 ? 8.457  -17.802 22.397 1.00 13.25 ? 120 SER A CA  1 
ATOM   760  C  C   . SER A 1 116 ? 8.816  -17.226 21.043 1.00 14.26 ? 120 SER A C   1 
ATOM   761  O  O   . SER A 1 116 ? 7.897  -17.124 20.198 1.00 14.15 ? 120 SER A O   1 
ATOM   762  C  CB  . SER A 1 116 ? 9.068  -19.175 22.693 1.00 16.83 ? 120 SER A CB  1 
ATOM   763  O  OG  . SER A 1 116 ? 8.776  -19.912 21.531 1.00 19.92 ? 120 SER A OG  1 
ATOM   764  N  N   . ILE A 1 117 ? 9.946  -16.529 21.046 1.00 13.32 ? 121 ILE A N   1 
ATOM   765  C  CA  . ILE A 1 117 ? 10.424 -15.840 19.806 1.00 13.85 ? 121 ILE A CA  1 
ATOM   766  C  C   . ILE A 1 117 ? 11.556 -16.735 19.266 1.00 14.53 ? 121 ILE A C   1 
ATOM   767  O  O   . ILE A 1 117 ? 12.314 -17.282 20.075 1.00 14.56 ? 121 ILE A O   1 
ATOM   768  C  CB  . ILE A 1 117 ? 10.844 -14.361 20.191 1.00 11.51 ? 121 ILE A CB  1 
ATOM   769  C  CG1 . ILE A 1 117 ? 11.251 -13.561 18.938 1.00 14.65 ? 121 ILE A CG1 1 
ATOM   770  C  CG2 . ILE A 1 117 ? 11.901 -14.304 21.356 1.00 12.00 ? 121 ILE A CG2 1 
ATOM   771  C  CD1 . ILE A 1 117 ? 10.012 -13.425 17.979 1.00 14.44 ? 121 ILE A CD1 1 
ATOM   772  N  N   . SER A 1 118 ? 11.604 -16.937 17.961 1.00 14.82 ? 122 SER A N   1 
ATOM   773  C  CA  . SER A 1 118 ? 12.687 -17.704 17.332 1.00 16.84 ? 122 SER A CA  1 
ATOM   774  C  C   . SER A 1 118 ? 13.997 -16.914 17.346 1.00 16.06 ? 122 SER A C   1 
ATOM   775  O  O   . SER A 1 118 ? 13.936 -15.671 17.158 1.00 16.58 ? 122 SER A O   1 
ATOM   776  C  CB  . SER A 1 118 ? 12.386 -17.804 15.829 1.00 21.51 ? 122 SER A CB  1 
ATOM   777  O  OG  . SER A 1 118 ? 11.090 -18.388 15.771 1.00 26.13 ? 122 SER A OG  1 
ATOM   778  N  N   . LEU A 1 119 ? 15.058 -17.716 17.279 1.00 14.62 ? 123 LEU A N   1 
ATOM   779  C  CA  . LEU A 1 119 ? 16.463 -17.261 17.194 1.00 14.84 ? 123 LEU A CA  1 
ATOM   780  C  C   . LEU A 1 119 ? 16.736 -17.091 15.704 1.00 16.29 ? 123 LEU A C   1 
ATOM   781  O  O   . LEU A 1 119 ? 16.136 -17.729 14.814 1.00 16.67 ? 123 LEU A O   1 
ATOM   782  C  CB  . LEU A 1 119 ? 17.426 -18.241 17.890 1.00 17.63 ? 123 LEU A CB  1 
ATOM   783  C  CG  . LEU A 1 119 ? 17.193 -18.400 19.403 1.00 14.43 ? 123 LEU A CG  1 
ATOM   784  C  CD1 . LEU A 1 119 ? 18.162 -19.486 19.846 1.00 16.97 ? 123 LEU A CD1 1 
ATOM   785  C  CD2 . LEU A 1 119 ? 17.534 -17.022 20.013 1.00 16.88 ? 123 LEU A CD2 1 
ATOM   786  N  N   . PRO A 1 120 ? 17.572 -16.135 15.371 1.00 16.37 ? 124 PRO A N   1 
ATOM   787  C  CA  . PRO A 1 120 ? 17.857 -15.953 13.929 1.00 18.09 ? 124 PRO A CA  1 
ATOM   788  C  C   . PRO A 1 120 ? 18.749 -17.133 13.489 1.00 20.80 ? 124 PRO A C   1 
ATOM   789  O  O   . PRO A 1 120 ? 19.588 -17.764 14.150 1.00 18.63 ? 124 PRO A O   1 
ATOM   790  C  CB  . PRO A 1 120 ? 18.667 -14.654 13.868 1.00 15.47 ? 124 PRO A CB  1 
ATOM   791  C  CG  . PRO A 1 120 ? 19.158 -14.391 15.255 1.00 15.18 ? 124 PRO A CG  1 
ATOM   792  C  CD  . PRO A 1 120 ? 18.346 -15.241 16.228 1.00 16.60 ? 124 PRO A CD  1 
ATOM   793  N  N   . THR A 1 121 ? 18.720 -17.292 12.172 1.00 23.04 ? 125 THR A N   1 
ATOM   794  C  CA  . THR A 1 121 ? 19.638 -18.289 11.555 1.00 25.66 ? 125 THR A CA  1 
ATOM   795  C  C   . THR A 1 121 ? 20.726 -17.490 10.834 1.00 24.00 ? 125 THR A C   1 
ATOM   796  O  O   . THR A 1 121 ? 21.820 -17.945 10.478 1.00 28.30 ? 125 THR A O   1 
ATOM   797  C  CB  . THR A 1 121 ? 18.890 -19.307 10.606 1.00 24.97 ? 125 THR A CB  1 
ATOM   798  O  OG1 . THR A 1 121 ? 18.187 -18.498 9.588  1.00 29.41 ? 125 THR A OG1 1 
ATOM   799  C  CG2 . THR A 1 121 ? 17.839 -20.126 11.372 1.00 29.57 ? 125 THR A CG2 1 
ATOM   800  N  N   . SER A 1 122 ? 20.528 -16.225 10.631 1.00 23.47 ? 127 SER A N   1 
ATOM   801  C  CA  . SER A 1 122 ? 21.548 -15.334 10.025 1.00 21.29 ? 127 SER A CA  1 
ATOM   802  C  C   . SER A 1 122 ? 21.316 -13.925 10.574 1.00 20.37 ? 127 SER A C   1 
ATOM   803  O  O   . SER A 1 122 ? 20.263 -13.625 11.163 1.00 17.28 ? 127 SER A O   1 
ATOM   804  C  CB  . SER A 1 122 ? 21.280 -15.476 8.534  1.00 22.67 ? 127 SER A CB  1 
ATOM   805  O  OG  . SER A 1 122 ? 20.060 -14.746 8.421  1.00 28.77 ? 127 SER A OG  1 
ATOM   806  N  N   . CYS A 1 123 ? 22.391 -13.157 10.576 1.00 19.53 ? 128 CYS A N   1 
ATOM   807  C  CA  . CYS A 1 123 ? 22.314 -11.763 11.057 1.00 19.38 ? 128 CYS A CA  1 
ATOM   808  C  C   . CYS A 1 123 ? 21.467 -10.919 10.093 1.00 21.00 ? 128 CYS A C   1 
ATOM   809  O  O   . CYS A 1 123 ? 21.460 -11.276 8.893  1.00 21.34 ? 128 CYS A O   1 
ATOM   810  C  CB  . CYS A 1 123 ? 23.775 -11.321 10.983 1.00 16.11 ? 128 CYS A CB  1 
ATOM   811  S  SG  . CYS A 1 123 ? 24.794 -12.309 12.104 1.00 18.54 ? 128 CYS A SG  1 
ATOM   812  N  N   . ALA A 1 124 ? 20.810 -9.856  10.557 1.00 20.10 ? 129 ALA A N   1 
ATOM   813  C  CA  . ALA A 1 124 ? 19.990 -8.911  9.784  1.00 18.42 ? 129 ALA A CA  1 
ATOM   814  C  C   . ALA A 1 124 ? 20.929 -7.895  9.089  1.00 18.73 ? 129 ALA A C   1 
ATOM   815  O  O   . ALA A 1 124 ? 21.899 -7.377  9.659  1.00 20.40 ? 129 ALA A O   1 
ATOM   816  C  CB  . ALA A 1 124 ? 19.130 -8.114  10.748 1.00 8.19  ? 129 ALA A CB  1 
ATOM   817  N  N   . SER A 1 125 ? 20.472 -7.268  8.013  1.00 17.18 ? 130 SER A N   1 
ATOM   818  C  CA  . SER A 1 125 ? 21.369 -6.298  7.373  1.00 19.49 ? 130 SER A CA  1 
ATOM   819  C  C   . SER A 1 125 ? 21.022 -4.913  7.891  1.00 19.53 ? 130 SER A C   1 
ATOM   820  O  O   . SER A 1 125 ? 19.911 -4.707  8.424  1.00 18.02 ? 130 SER A O   1 
ATOM   821  C  CB  . SER A 1 125 ? 21.408 -6.656  5.910  1.00 23.73 ? 130 SER A CB  1 
ATOM   822  O  OG  . SER A 1 125 ? 20.161 -6.929  5.335  1.00 28.94 ? 130 SER A OG  1 
ATOM   823  N  N   . ALA A 1 126 ? 21.846 -3.932  7.514  1.00 18.35 ? 132 ALA A N   1 
ATOM   824  C  CA  . ALA A 1 126 ? 21.583 -2.518  7.836  1.00 16.71 ? 132 ALA A CA  1 
ATOM   825  C  C   . ALA A 1 126 ? 20.260 -2.160  7.150  1.00 14.56 ? 132 ALA A C   1 
ATOM   826  O  O   . ALA A 1 126 ? 20.036 -2.499  5.968  1.00 13.78 ? 132 ALA A O   1 
ATOM   827  C  CB  . ALA A 1 126 ? 22.761 -1.637  7.307  1.00 15.63 ? 132 ALA A CB  1 
ATOM   828  N  N   . GLY A 1 127 ? 19.436 -1.362  7.810  1.00 12.74 ? 133 GLY A N   1 
ATOM   829  C  CA  . GLY A 1 127 ? 18.190 -0.948  7.173  1.00 13.51 ? 133 GLY A CA  1 
ATOM   830  C  C   . GLY A 1 127 ? 16.995 -1.814  7.533  1.00 15.50 ? 133 GLY A C   1 
ATOM   831  O  O   . GLY A 1 127 ? 15.842 -1.518  7.190  1.00 15.90 ? 133 GLY A O   1 
ATOM   832  N  N   . THR A 1 128 ? 17.215 -3.000  8.077  1.00 15.92 ? 134 THR A N   1 
ATOM   833  C  CA  . THR A 1 128 ? 16.079 -3.886  8.465  1.00 16.11 ? 134 THR A CA  1 
ATOM   834  C  C   . THR A 1 128 ? 15.377 -3.128  9.598  1.00 15.61 ? 134 THR A C   1 
ATOM   835  O  O   . THR A 1 128 ? 16.013 -2.638  10.533 1.00 14.60 ? 134 THR A O   1 
ATOM   836  C  CB  . THR A 1 128 ? 16.720 -5.211  9.049  1.00 17.52 ? 134 THR A CB  1 
ATOM   837  O  OG1 . THR A 1 128 ? 17.475 -5.753  7.904  1.00 19.56 ? 134 THR A OG1 1 
ATOM   838  C  CG2 . THR A 1 128 ? 15.718 -6.296  9.454  1.00 20.70 ? 134 THR A CG2 1 
ATOM   839  N  N   . GLN A 1 129 ? 14.076 -3.129  9.520  1.00 15.78 ? 135 GLN A N   1 
ATOM   840  C  CA  . GLN A 1 129 ? 13.173 -2.509  10.521 1.00 16.70 ? 135 GLN A CA  1 
ATOM   841  C  C   . GLN A 1 129 ? 12.861 -3.589  11.570 1.00 15.59 ? 135 GLN A C   1 
ATOM   842  O  O   . GLN A 1 129 ? 12.313 -4.610  11.127 1.00 16.46 ? 135 GLN A O   1 
ATOM   843  C  CB  . GLN A 1 129 ? 11.829 -2.278  9.786  1.00 23.52 ? 135 GLN A CB  1 
ATOM   844  C  CG  . GLN A 1 129 ? 11.291 -0.884  10.024 1.00 34.09 ? 135 GLN A CG  1 
ATOM   845  C  CD  . GLN A 1 129 ? 12.142 0.355   10.085 1.00 32.13 ? 135 GLN A CD  1 
ATOM   846  O  OE1 . GLN A 1 129 ? 12.106 0.958   11.175 1.00 33.30 ? 135 GLN A OE1 1 
ATOM   847  N  NE2 . GLN A 1 129 ? 12.719 0.982   9.043  1.00 27.35 ? 135 GLN A NE2 1 
ATOM   848  N  N   . CYS A 1 130 ? 12.825 -3.243  12.825 1.00 14.40 ? 136 CYS A N   1 
ATOM   849  C  CA  . CYS A 1 130 ? 12.689 -4.113  13.965 1.00 14.23 ? 136 CYS A CA  1 
ATOM   850  C  C   . CYS A 1 130 ? 11.715 -3.464  14.946 1.00 14.91 ? 136 CYS A C   1 
ATOM   851  O  O   . CYS A 1 130 ? 11.484 -2.258  14.845 1.00 15.19 ? 136 CYS A O   1 
ATOM   852  C  CB  . CYS A 1 130 ? 14.061 -4.262  14.645 1.00 14.11 ? 136 CYS A CB  1 
ATOM   853  S  SG  . CYS A 1 130 ? 15.339 -4.873  13.528 1.00 15.15 ? 136 CYS A SG  1 
ATOM   854  N  N   . LEU A 1 131 ? 11.230 -4.235  15.887 1.00 13.00 ? 137 LEU A N   1 
ATOM   855  C  CA  . LEU A 1 131 ? 10.314 -3.779  16.899 1.00 12.52 ? 137 LEU A CA  1 
ATOM   856  C  C   . LEU A 1 131 ? 11.083 -3.931  18.216 1.00 12.72 ? 137 LEU A C   1 
ATOM   857  O  O   . LEU A 1 131 ? 11.536 -5.062  18.442 1.00 12.93 ? 137 LEU A O   1 
ATOM   858  C  CB  . LEU A 1 131 ? 9.015  -4.628  16.842 1.00 16.38 ? 137 LEU A CB  1 
ATOM   859  C  CG  . LEU A 1 131 ? 8.026  -4.320  17.982 1.00 13.13 ? 137 LEU A CG  1 
ATOM   860  C  CD1 . LEU A 1 131 ? 7.383  -2.997  17.643 1.00 11.28 ? 137 LEU A CD1 1 
ATOM   861  C  CD2 . LEU A 1 131 ? 6.998  -5.424  18.169 1.00 16.24 ? 137 LEU A CD2 1 
ATOM   862  N  N   . ILE A 1 132 ? 11.215 -2.865  18.948 1.00 10.02 ? 138 ILE A N   1 
ATOM   863  C  CA  . ILE A 1 132 ? 11.793 -2.849  20.289 1.00 10.83 ? 138 ILE A CA  1 
ATOM   864  C  C   . ILE A 1 132 ? 10.649 -2.561  21.284 1.00 11.29 ? 138 ILE A C   1 
ATOM   865  O  O   . ILE A 1 132 ? 9.799  -1.705  20.926 1.00 11.25 ? 138 ILE A O   1 
ATOM   866  C  CB  . ILE A 1 132 ? 12.836 -1.638  20.352 1.00 10.01 ? 138 ILE A CB  1 
ATOM   867  C  CG1 . ILE A 1 132 ? 13.657 -1.758  19.055 1.00 2.26  ? 138 ILE A CG1 1 
ATOM   868  C  CG2 . ILE A 1 132 ? 13.586 -1.700  21.704 1.00 5.39  ? 138 ILE A CG2 1 
ATOM   869  C  CD1 . ILE A 1 132 ? 14.892 -0.877  18.924 1.00 19.07 ? 138 ILE A CD1 1 
ATOM   870  N  N   . SER A 1 133 ? 10.716 -3.086  22.492 1.00 9.37  ? 139 SER A N   1 
ATOM   871  C  CA  . SER A 1 133 ? 9.604  -2.874  23.447 1.00 9.22  ? 139 SER A CA  1 
ATOM   872  C  C   . SER A 1 133 ? 10.124 -3.022  24.863 1.00 8.12  ? 139 SER A C   1 
ATOM   873  O  O   . SER A 1 133 ? 11.239 -3.559  25.125 1.00 11.08 ? 139 SER A O   1 
ATOM   874  C  CB  . SER A 1 133 ? 8.495  -3.931  23.179 1.00 13.12 ? 139 SER A CB  1 
ATOM   875  O  OG  . SER A 1 133 ? 8.979  -5.257  22.922 1.00 15.74 ? 139 SER A OG  1 
ATOM   876  N  N   . GLY A 1 134 ? 9.475  -2.347  25.789 1.00 8.22  ? 140 GLY A N   1 
ATOM   877  C  CA  . GLY A 1 134 ? 9.833  -2.343  27.209 1.00 7.41  ? 140 GLY A CA  1 
ATOM   878  C  C   . GLY A 1 134 ? 8.927  -1.427  28.045 1.00 12.67 ? 140 GLY A C   1 
ATOM   879  O  O   . GLY A 1 134 ? 8.159  -0.664  27.405 1.00 14.14 ? 140 GLY A O   1 
ATOM   880  N  N   . TRP A 1 135 ? 9.180  -1.416  29.349 1.00 10.21 ? 141 TRP A N   1 
ATOM   881  C  CA  . TRP A 1 135 ? 8.420  -0.575  30.267 1.00 11.05 ? 141 TRP A CA  1 
ATOM   882  C  C   . TRP A 1 135 ? 9.394  0.477   30.846 1.00 11.10 ? 141 TRP A C   1 
ATOM   883  O  O   . TRP A 1 135 ? 9.112  0.917   31.965 1.00 10.44 ? 141 TRP A O   1 
ATOM   884  C  CB  . TRP A 1 135 ? 7.967  -1.503  31.431 1.00 13.90 ? 141 TRP A CB  1 
ATOM   885  C  CG  . TRP A 1 135 ? 6.785  -2.380  31.136 1.00 12.05 ? 141 TRP A CG  1 
ATOM   886  C  CD1 . TRP A 1 135 ? 5.467  -2.022  31.157 1.00 12.24 ? 141 TRP A CD1 1 
ATOM   887  C  CD2 . TRP A 1 135 ? 6.830  -3.753  30.646 1.00 13.57 ? 141 TRP A CD2 1 
ATOM   888  N  NE1 . TRP A 1 135 ? 4.677  -3.092  30.821 1.00 9.97  ? 141 TRP A NE1 1 
ATOM   889  C  CE2 . TRP A 1 135 ? 5.474  -4.190  30.543 1.00 15.60 ? 141 TRP A CE2 1 
ATOM   890  C  CE3 . TRP A 1 135 ? 7.870  -4.671  30.445 1.00 11.86 ? 141 TRP A CE3 1 
ATOM   891  C  CZ2 . TRP A 1 135 ? 5.166  -5.449  29.994 1.00 13.74 ? 141 TRP A CZ2 1 
ATOM   892  C  CZ3 . TRP A 1 135 ? 7.578  -5.945  29.996 1.00 10.12 ? 141 TRP A CZ3 1 
ATOM   893  C  CH2 . TRP A 1 135 ? 6.233  -6.359  29.846 1.00 16.33 ? 141 TRP A CH2 1 
ATOM   894  N  N   . GLY A 1 136 ? 10.440 0.850   30.074 1.00 12.63 ? 142 GLY A N   1 
ATOM   895  C  CA  . GLY A 1 136 ? 11.482 1.771   30.584 1.00 12.91 ? 142 GLY A CA  1 
ATOM   896  C  C   . GLY A 1 136 ? 10.951 3.208   30.487 1.00 14.23 ? 142 GLY A C   1 
ATOM   897  O  O   . GLY A 1 136 ? 9.895  3.454   29.911 1.00 12.40 ? 142 GLY A O   1 
ATOM   898  N  N   . ASN A 1 137 ? 11.790 4.152   30.915 1.00 15.30 ? 143 ASN A N   1 
ATOM   899  C  CA  . ASN A 1 137 ? 11.474 5.578   30.881 1.00 12.60 ? 143 ASN A CA  1 
ATOM   900  C  C   . ASN A 1 137 ? 11.082 5.983   29.444 1.00 14.60 ? 143 ASN A C   1 
ATOM   901  O  O   . ASN A 1 137 ? 11.710 5.515   28.452 1.00 12.58 ? 143 ASN A O   1 
ATOM   902  C  CB  . ASN A 1 137 ? 12.724 6.267   31.426 1.00 18.15 ? 143 ASN A CB  1 
ATOM   903  C  CG  . ASN A 1 137 ? 12.543 7.756   31.602 1.00 15.86 ? 143 ASN A CG  1 
ATOM   904  O  OD1 . ASN A 1 137 ? 11.457 8.328   31.466 1.00 20.43 ? 143 ASN A OD1 1 
ATOM   905  N  ND2 . ASN A 1 137 ? 13.698 8.403   31.563 1.00 25.47 ? 143 ASN A ND2 1 
ATOM   906  N  N   . THR A 1 138 ? 10.027 6.818   29.412 1.00 13.58 ? 144 THR A N   1 
ATOM   907  C  CA  . THR A 1 138 ? 9.460  7.386   28.188 1.00 15.23 ? 144 THR A CA  1 
ATOM   908  C  C   . THR A 1 138 ? 9.968  8.844   28.014 1.00 17.79 ? 144 THR A C   1 
ATOM   909  O  O   . THR A 1 138 ? 9.583  9.529   27.017 1.00 17.15 ? 144 THR A O   1 
ATOM   910  C  CB  . THR A 1 138 ? 7.879  7.336   28.122 1.00 14.81 ? 144 THR A CB  1 
ATOM   911  O  OG1 . THR A 1 138 ? 7.459  8.079   29.331 1.00 19.41 ? 144 THR A OG1 1 
ATOM   912  C  CG2 . THR A 1 138 ? 7.176  5.965   28.237 1.00 18.47 ? 144 THR A CG2 1 
ATOM   913  N  N   . LYS A 1 139 ? 10.863 9.290   28.884 1.00 20.33 ? 145 LYS A N   1 
ATOM   914  C  CA  . LYS A 1 139 ? 11.461 10.640  28.701 1.00 24.07 ? 145 LYS A CA  1 
ATOM   915  C  C   . LYS A 1 139 ? 12.960 10.686  28.372 1.00 26.05 ? 145 LYS A C   1 
ATOM   916  O  O   . LYS A 1 139 ? 13.759 10.192  29.178 1.00 25.55 ? 145 LYS A O   1 
ATOM   917  C  CB  . LYS A 1 139 ? 11.506 11.434  30.001 1.00 28.26 ? 145 LYS A CB  1 
ATOM   918  C  CG  . LYS A 1 139 ? 10.101 11.563  30.581 1.00 35.26 ? 145 LYS A CG  1 
ATOM   919  C  CD  . LYS A 1 139 ? 9.308  12.307  29.516 1.00 31.39 ? 145 LYS A CD  1 
ATOM   920  C  CE  . LYS A 1 139 ? 8.271  13.170  30.245 1.00 42.29 ? 145 LYS A CE  1 
ATOM   921  N  NZ  . LYS A 1 139 ? 6.952  13.031  29.522 1.00 47.47 ? 145 LYS A NZ  1 
ATOM   922  N  N   . SER A 1 140 ? 13.208 11.605  27.445 1.00 28.16 ? 146 SER A N   1 
ATOM   923  C  CA  . SER A 1 140 ? 14.567 11.946  26.990 1.00 31.68 ? 146 SER A CA  1 
ATOM   924  C  C   . SER A 1 140 ? 15.215 12.774  28.111 1.00 35.65 ? 146 SER A C   1 
ATOM   925  O  O   . SER A 1 140 ? 16.439 12.850  28.267 1.00 38.31 ? 146 SER A O   1 
ATOM   926  C  CB  . SER A 1 140 ? 14.554 12.998  25.894 1.00 30.42 ? 146 SER A CB  1 
ATOM   927  O  OG  . SER A 1 140 ? 14.664 12.344  24.652 1.00 37.37 ? 146 SER A OG  1 
ATOM   928  N  N   . SER A 1 141 ? 14.341 13.532  28.744 1.00 36.53 ? 147 SER A N   1 
ATOM   929  C  CA  . SER A 1 141 ? 14.815 14.364  29.870 1.00 38.22 ? 147 SER A CA  1 
ATOM   930  C  C   . SER A 1 141 ? 13.859 14.218  31.051 1.00 37.38 ? 147 SER A C   1 
ATOM   931  O  O   . SER A 1 141 ? 12.727 14.757  31.068 1.00 39.67 ? 147 SER A O   1 
ATOM   932  C  CB  . SER A 1 141 ? 14.949 15.804  29.333 1.00 38.79 ? 147 SER A CB  1 
ATOM   933  O  OG  . SER A 1 141 ? 14.964 16.613  30.506 1.00 43.93 ? 147 SER A OG  1 
ATOM   934  N  N   . GLY A 1 142 ? 14.390 13.773  32.170 1.00 36.92 ? 148 GLY A N   1 
ATOM   935  C  CA  . GLY A 1 142 ? 13.429 13.581  33.300 1.00 36.64 ? 148 GLY A CA  1 
ATOM   936  C  C   . GLY A 1 142 ? 13.070 12.081  33.208 1.00 37.05 ? 148 GLY A C   1 
ATOM   937  O  O   . GLY A 1 142 ? 13.682 11.324  32.421 1.00 35.30 ? 148 GLY A O   1 
ATOM   938  N  N   . THR A 1 143 ? 12.160 11.722  34.100 1.00 36.78 ? 149 THR A N   1 
ATOM   939  C  CA  . THR A 1 143 ? 11.844 10.267  34.117 1.00 37.43 ? 149 THR A CA  1 
ATOM   940  C  C   . THR A 1 143 ? 10.340 10.049  34.267 1.00 36.21 ? 149 THR A C   1 
ATOM   941  O  O   . THR A 1 143 ? 9.716  10.658  35.163 1.00 36.29 ? 149 THR A O   1 
ATOM   942  C  CB  . THR A 1 143 ? 12.667 9.622   35.307 1.00 40.45 ? 149 THR A CB  1 
ATOM   943  O  OG1 . THR A 1 143 ? 11.728 8.615   35.849 1.00 46.96 ? 149 THR A OG1 1 
ATOM   944  C  CG2 . THR A 1 143 ? 12.953 10.640  36.408 1.00 37.44 ? 149 THR A CG2 1 
ATOM   945  N  N   . SER A 1 144 ? 9.788  9.297   33.328 1.00 32.72 ? 150 SER A N   1 
ATOM   946  C  CA  . SER A 1 144 ? 8.354  8.969   33.382 1.00 29.48 ? 150 SER A CA  1 
ATOM   947  C  C   . SER A 1 144 ? 8.227  7.498   32.890 1.00 27.99 ? 150 SER A C   1 
ATOM   948  O  O   . SER A 1 144 ? 8.466  7.301   31.680 1.00 25.04 ? 150 SER A O   1 
ATOM   949  C  CB  . SER A 1 144 ? 7.610  9.852   32.379 1.00 29.61 ? 150 SER A CB  1 
ATOM   950  O  OG  . SER A 1 144 ? 6.215  9.593   32.558 1.00 24.52 ? 150 SER A OG  1 
ATOM   951  N  N   . TYR A 1 145 ? 7.913  6.635   33.848 1.00 26.45 ? 151 TYR A N   1 
ATOM   952  C  CA  . TYR A 1 145 ? 7.752  5.180   33.608 1.00 23.97 ? 151 TYR A CA  1 
ATOM   953  C  C   . TYR A 1 145 ? 6.297  4.827   33.296 1.00 21.34 ? 151 TYR A C   1 
ATOM   954  O  O   . TYR A 1 145 ? 5.549  5.189   34.218 1.00 22.07 ? 151 TYR A O   1 
ATOM   955  C  CB  . TYR A 1 145 ? 8.084  4.456   34.934 1.00 21.21 ? 151 TYR A CB  1 
ATOM   956  C  CG  . TYR A 1 145 ? 9.573  4.581   35.150 1.00 26.86 ? 151 TYR A CG  1 
ATOM   957  C  CD1 . TYR A 1 145 ? 10.396 3.859   34.270 1.00 32.82 ? 151 TYR A CD1 1 
ATOM   958  C  CD2 . TYR A 1 145 ? 10.136 5.502   36.023 1.00 29.33 ? 151 TYR A CD2 1 
ATOM   959  C  CE1 . TYR A 1 145 ? 11.781 3.982   34.335 1.00 36.05 ? 151 TYR A CE1 1 
ATOM   960  C  CE2 . TYR A 1 145 ? 11.514 5.683   36.083 1.00 32.78 ? 151 TYR A CE2 1 
ATOM   961  C  CZ  . TYR A 1 145 ? 12.324 4.858   35.292 1.00 36.34 ? 151 TYR A CZ  1 
ATOM   962  O  OH  . TYR A 1 145 ? 13.685 4.997   35.319 1.00 35.28 ? 151 TYR A OH  1 
ATOM   963  N  N   . PRO A 1 146 ? 5.998  4.045   32.279 1.00 17.83 ? 152 PRO A N   1 
ATOM   964  C  CA  . PRO A 1 146 ? 4.618  3.731   31.930 1.00 17.40 ? 152 PRO A CA  1 
ATOM   965  C  C   . PRO A 1 146 ? 4.127  2.507   32.714 1.00 16.59 ? 152 PRO A C   1 
ATOM   966  O  O   . PRO A 1 146 ? 4.917  1.783   33.385 1.00 17.68 ? 152 PRO A O   1 
ATOM   967  C  CB  . PRO A 1 146 ? 4.691  3.429   30.441 1.00 16.97 ? 152 PRO A CB  1 
ATOM   968  C  CG  . PRO A 1 146 ? 6.086  2.960   30.193 1.00 15.87 ? 152 PRO A CG  1 
ATOM   969  C  CD  . PRO A 1 146 ? 6.928  3.526   31.295 1.00 17.88 ? 152 PRO A CD  1 
ATOM   970  N  N   . ASP A 1 147 ? 2.797  2.402   32.737 1.00 15.81 ? 153 ASP A N   1 
ATOM   971  C  CA  . ASP A 1 147 ? 2.212  1.189   33.362 1.00 13.56 ? 153 ASP A CA  1 
ATOM   972  C  C   . ASP A 1 147 ? 2.192  0.054   32.308 1.00 12.07 ? 153 ASP A C   1 
ATOM   973  O  O   . ASP A 1 147 ? 2.386  -1.111  32.677 1.00 12.63 ? 153 ASP A O   1 
ATOM   974  C  CB  . ASP A 1 147 ? 0.757  1.535   33.738 1.00 18.60 ? 153 ASP A CB  1 
ATOM   975  C  CG  . ASP A 1 147 ? 0.741  2.275   35.078 1.00 27.58 ? 153 ASP A CG  1 
ATOM   976  O  OD1 . ASP A 1 147 ? 1.529  2.047   36.007 1.00 23.59 ? 153 ASP A OD1 1 
ATOM   977  O  OD2 . ASP A 1 147 ? -0.326 2.916   35.193 1.00 29.77 ? 153 ASP A OD2 1 
ATOM   978  N  N   . VAL A 1 148 ? 1.883  0.430   31.085 1.00 11.15 ? 154 VAL A N   1 
ATOM   979  C  CA  . VAL A 1 148 ? 1.703  -0.449  29.950 1.00 12.90 ? 154 VAL A CA  1 
ATOM   980  C  C   . VAL A 1 148 ? 2.956  -0.485  29.068 1.00 15.25 ? 154 VAL A C   1 
ATOM   981  O  O   . VAL A 1 148 ? 3.779  0.431   28.997 1.00 15.53 ? 154 VAL A O   1 
ATOM   982  C  CB  . VAL A 1 148 ? 0.418  -0.251  29.156 1.00 13.44 ? 154 VAL A CB  1 
ATOM   983  C  CG1 . VAL A 1 148 ? -0.784 -0.389  30.084 1.00 18.84 ? 154 VAL A CG1 1 
ATOM   984  C  CG2 . VAL A 1 148 ? 0.329  0.957   28.221 1.00 14.30 ? 154 VAL A CG2 1 
ATOM   985  N  N   . LEU A 1 149 ? 2.997  -1.570  28.275 1.00 14.74 ? 155 LEU A N   1 
ATOM   986  C  CA  . LEU A 1 149 ? 4.170  -1.856  27.478 1.00 12.68 ? 155 LEU A CA  1 
ATOM   987  C  C   . LEU A 1 149 ? 4.166  -0.847  26.327 1.00 13.78 ? 155 LEU A C   1 
ATOM   988  O  O   . LEU A 1 149 ? 3.184  -0.858  25.567 1.00 12.78 ? 155 LEU A O   1 
ATOM   989  C  CB  . LEU A 1 149 ? 4.011  -3.315  26.979 1.00 11.33 ? 155 LEU A CB  1 
ATOM   990  C  CG  . LEU A 1 149 ? 5.160  -3.813  26.129 1.00 12.20 ? 155 LEU A CG  1 
ATOM   991  C  CD1 . LEU A 1 149 ? 6.408  -3.840  26.991 1.00 4.16  ? 155 LEU A CD1 1 
ATOM   992  C  CD2 . LEU A 1 149 ? 4.852  -5.189  25.497 1.00 10.14 ? 155 LEU A CD2 1 
ATOM   993  N  N   . LYS A 1 150 ? 5.384  -0.385  25.979 1.00 14.05 ? 156 LYS A N   1 
ATOM   994  C  CA  . LYS A 1 150 ? 5.494  0.570   24.834 1.00 13.26 ? 156 LYS A CA  1 
ATOM   995  C  C   . LYS A 1 150 ? 6.337  -0.136  23.760 1.00 14.17 ? 156 LYS A C   1 
ATOM   996  O  O   . LYS A 1 150 ? 7.166  -1.007  24.127 1.00 13.22 ? 156 LYS A O   1 
ATOM   997  C  CB  . LYS A 1 150 ? 6.261  1.791   25.339 1.00 12.33 ? 156 LYS A CB  1 
ATOM   998  C  CG  . LYS A 1 150 ? 5.523  2.537   26.469 1.00 14.71 ? 156 LYS A CG  1 
ATOM   999  C  CD  . LYS A 1 150 ? 4.150  3.029   25.940 1.00 18.36 ? 156 LYS A CD  1 
ATOM   1000 C  CE  . LYS A 1 150 ? 3.543  3.928   27.005 1.00 24.18 ? 156 LYS A CE  1 
ATOM   1001 N  NZ  . LYS A 1 150 ? 2.400  4.718   26.491 1.00 28.75 ? 156 LYS A NZ  1 
ATOM   1002 N  N   . CYS A 1 151 ? 6.090  0.326   22.535 1.00 13.20 ? 157 CYS A N   1 
ATOM   1003 C  CA  . CYS A 1 151 ? 6.711  -0.271  21.335 1.00 13.80 ? 157 CYS A CA  1 
ATOM   1004 C  C   . CYS A 1 151 ? 7.404  0.760   20.464 1.00 13.28 ? 157 CYS A C   1 
ATOM   1005 O  O   . CYS A 1 151 ? 6.996  1.928   20.547 1.00 12.73 ? 157 CYS A O   1 
ATOM   1006 C  CB  . CYS A 1 151 ? 5.675  -0.999  20.473 1.00 13.29 ? 157 CYS A CB  1 
ATOM   1007 S  SG  . CYS A 1 151 ? 5.214  -2.652  20.956 1.00 13.51 ? 157 CYS A SG  1 
ATOM   1008 N  N   . LEU A 1 152 ? 8.412  0.338   19.709 1.00 12.60 ? 158 LEU A N   1 
ATOM   1009 C  CA  . LEU A 1 152 ? 9.058  1.308   18.842 1.00 12.74 ? 158 LEU A CA  1 
ATOM   1010 C  C   . LEU A 1 152 ? 9.512  0.591   17.590 1.00 12.40 ? 158 LEU A C   1 
ATOM   1011 O  O   . LEU A 1 152 ? 10.184 -0.418  17.791 1.00 12.61 ? 158 LEU A O   1 
ATOM   1012 C  CB  . LEU A 1 152 ? 10.197 2.055   19.570 1.00 14.33 ? 158 LEU A CB  1 
ATOM   1013 C  CG  . LEU A 1 152 ? 11.084 2.965   18.704 1.00 16.23 ? 158 LEU A CG  1 
ATOM   1014 C  CD1 . LEU A 1 152 ? 10.467 4.292   18.255 1.00 12.96 ? 158 LEU A CD1 1 
ATOM   1015 C  CD2 . LEU A 1 152 ? 12.424 3.258   19.397 1.00 8.94  ? 158 LEU A CD2 1 
ATOM   1016 N  N   . LYS A 1 153 ? 9.272  1.129   16.412 1.00 13.55 ? 159 LYS A N   1 
ATOM   1017 C  CA  . LYS A 1 153 ? 9.856  0.618   15.169 1.00 16.54 ? 159 LYS A CA  1 
ATOM   1018 C  C   . LYS A 1 153 ? 11.186 1.304   14.885 1.00 16.67 ? 159 LYS A C   1 
ATOM   1019 O  O   . LYS A 1 153 ? 11.092 2.529   14.970 1.00 17.33 ? 159 LYS A O   1 
ATOM   1020 C  CB  . LYS A 1 153 ? 8.890  0.614   14.010 1.00 17.11 ? 159 LYS A CB  1 
ATOM   1021 C  CG  . LYS A 1 153 ? 7.894  -0.515  14.273 1.00 31.63 ? 159 LYS A CG  1 
ATOM   1022 C  CD  . LYS A 1 153 ? 6.463  0.005   14.212 1.00 36.54 ? 159 LYS A CD  1 
ATOM   1023 C  CE  . LYS A 1 153 ? 5.597  -1.066  13.530 1.00 41.02 ? 159 LYS A CE  1 
ATOM   1024 N  NZ  . LYS A 1 153 ? 4.396  -0.349  12.955 1.00 36.31 ? 159 LYS A NZ  1 
ATOM   1025 N  N   . ALA A 1 154 ? 12.324 0.660   14.684 1.00 17.04 ? 160 ALA A N   1 
ATOM   1026 C  CA  . ALA A 1 154 ? 13.650 1.308   14.528 1.00 15.96 ? 160 ALA A CA  1 
ATOM   1027 C  C   . ALA A 1 154 ? 14.510 0.494   13.568 1.00 14.96 ? 160 ALA A C   1 
ATOM   1028 O  O   . ALA A 1 154 ? 14.344 -0.724  13.582 1.00 17.73 ? 160 ALA A O   1 
ATOM   1029 C  CB  . ALA A 1 154 ? 14.299 1.364   15.918 1.00 14.86 ? 160 ALA A CB  1 
ATOM   1030 N  N   . PRO A 1 155 ? 15.172 1.076   12.594 1.00 15.35 ? 161 PRO A N   1 
ATOM   1031 C  CA  . PRO A 1 155 ? 15.959 0.312   11.625 1.00 14.64 ? 161 PRO A CA  1 
ATOM   1032 C  C   . PRO A 1 155 ? 17.328 0.060   12.330 1.00 15.87 ? 161 PRO A C   1 
ATOM   1033 O  O   . PRO A 1 155 ? 17.664 0.776   13.283 1.00 15.73 ? 161 PRO A O   1 
ATOM   1034 C  CB  . PRO A 1 155 ? 16.226 1.306   10.476 1.00 14.70 ? 161 PRO A CB  1 
ATOM   1035 C  CG  . PRO A 1 155 ? 15.917 2.659   11.038 1.00 14.64 ? 161 PRO A CG  1 
ATOM   1036 C  CD  . PRO A 1 155 ? 15.120 2.526   12.333 1.00 13.02 ? 161 PRO A CD  1 
ATOM   1037 N  N   . ILE A 1 156 ? 18.043 -0.910  11.828 1.00 15.06 ? 162 ILE A N   1 
ATOM   1038 C  CA  . ILE A 1 156 ? 19.423 -1.246  12.185 1.00 15.51 ? 162 ILE A CA  1 
ATOM   1039 C  C   . ILE A 1 156 ? 20.277 -0.298  11.299 1.00 15.60 ? 162 ILE A C   1 
ATOM   1040 O  O   . ILE A 1 156 ? 19.950 -0.236  10.103 1.00 12.55 ? 162 ILE A O   1 
ATOM   1041 C  CB  . ILE A 1 156 ? 19.751 -2.747  11.753 1.00 15.08 ? 162 ILE A CB  1 
ATOM   1042 C  CG1 . ILE A 1 156 ? 18.872 -3.685  12.616 1.00 13.28 ? 162 ILE A CG1 1 
ATOM   1043 C  CG2 . ILE A 1 156 ? 21.281 -2.965  11.870 1.00 10.41 ? 162 ILE A CG2 1 
ATOM   1044 C  CD1 . ILE A 1 156 ? 19.032 -5.200  12.457 1.00 10.83 ? 162 ILE A CD1 1 
ATOM   1045 N  N   . LEU A 1 157 ? 21.194 0.396   11.966 1.00 14.53 ? 163 LEU A N   1 
ATOM   1046 C  CA  . LEU A 1 157 ? 22.022 1.349   11.226 1.00 14.70 ? 163 LEU A CA  1 
ATOM   1047 C  C   . LEU A 1 157 ? 23.206 0.621   10.608 1.00 15.58 ? 163 LEU A C   1 
ATOM   1048 O  O   . LEU A 1 157 ? 23.655 -0.440  11.068 1.00 16.86 ? 163 LEU A O   1 
ATOM   1049 C  CB  . LEU A 1 157 ? 22.374 2.473   12.222 1.00 13.09 ? 163 LEU A CB  1 
ATOM   1050 C  CG  . LEU A 1 157 ? 21.147 3.150   12.845 1.00 18.32 ? 163 LEU A CG  1 
ATOM   1051 C  CD1 . LEU A 1 157 ? 21.624 4.334   13.650 1.00 19.08 ? 163 LEU A CD1 1 
ATOM   1052 C  CD2 . LEU A 1 157 ? 20.086 3.559   11.833 1.00 15.62 ? 163 LEU A CD2 1 
ATOM   1053 N  N   . SER A 1 158 ? 23.941 1.340   9.790  1.00 14.66 ? 164 SER A N   1 
ATOM   1054 C  CA  . SER A 1 158 ? 25.128 0.755   9.151  1.00 13.79 ? 164 SER A CA  1 
ATOM   1055 C  C   . SER A 1 158 ? 26.220 0.744   10.213 1.00 14.46 ? 164 SER A C   1 
ATOM   1056 O  O   . SER A 1 158 ? 26.209 1.484   11.210 1.00 13.25 ? 164 SER A O   1 
ATOM   1057 C  CB  . SER A 1 158 ? 25.529 1.598   7.917  1.00 12.86 ? 164 SER A CB  1 
ATOM   1058 O  OG  . SER A 1 158 ? 26.050 2.809   8.473  1.00 13.84 ? 164 SER A OG  1 
ATOM   1059 N  N   . ASP A 1 159 ? 27.144 -0.199  10.010 1.00 14.50 ? 165 ASP A N   1 
ATOM   1060 C  CA  . ASP A 1 159 ? 28.256 -0.308  10.969 1.00 16.57 ? 165 ASP A CA  1 
ATOM   1061 C  C   . ASP A 1 159 ? 29.132 0.944   10.896 1.00 17.50 ? 165 ASP A C   1 
ATOM   1062 O  O   . ASP A 1 159 ? 29.715 1.357   11.931 1.00 14.33 ? 165 ASP A O   1 
ATOM   1063 C  CB  . ASP A 1 159 ? 28.844 -1.697  11.200 1.00 24.82 ? 165 ASP A CB  1 
ATOM   1064 C  CG  . ASP A 1 159 ? 27.987 -2.526  12.177 1.00 32.94 ? 165 ASP A CG  1 
ATOM   1065 O  OD1 . ASP A 1 159 ? 27.711 -2.332  13.411 1.00 32.30 ? 165 ASP A OD1 1 
ATOM   1066 O  OD2 . ASP A 1 159 ? 27.360 -3.507  11.651 1.00 38.63 ? 165 ASP A OD2 1 
ATOM   1067 N  N   . SER A 1 160 ? 29.192 1.542   9.692  1.00 17.12 ? 166 SER A N   1 
ATOM   1068 C  CA  . SER A 1 160 ? 29.970 2.791   9.597  1.00 16.74 ? 166 SER A CA  1 
ATOM   1069 C  C   . SER A 1 160 ? 29.365 3.879   10.434 1.00 16.51 ? 166 SER A C   1 
ATOM   1070 O  O   . SER A 1 160 ? 30.069 4.572   11.235 1.00 18.06 ? 166 SER A O   1 
ATOM   1071 C  CB  . SER A 1 160 ? 30.339 3.214   8.188  1.00 21.78 ? 166 SER A CB  1 
ATOM   1072 O  OG  . SER A 1 160 ? 29.172 3.519   7.474  1.00 24.39 ? 166 SER A OG  1 
ATOM   1073 N  N   . SER A 1 161 ? 28.038 4.025   10.264 1.00 15.82 ? 167 SER A N   1 
ATOM   1074 C  CA  . SER A 1 161 ? 27.415 5.068   11.132 1.00 14.59 ? 167 SER A CA  1 
ATOM   1075 C  C   . SER A 1 161 ? 27.591 4.703   12.577 1.00 13.66 ? 167 SER A C   1 
ATOM   1076 O  O   . SER A 1 161 ? 27.622 5.563   13.445 1.00 14.99 ? 167 SER A O   1 
ATOM   1077 C  CB  . SER A 1 161 ? 25.963 5.307   10.752 1.00 19.78 ? 167 SER A CB  1 
ATOM   1078 O  OG  . SER A 1 161 ? 25.987 5.703   9.372  1.00 19.88 ? 167 SER A OG  1 
ATOM   1079 N  N   . CYS A 1 162 ? 27.380 3.441   12.933 1.00 15.48 ? 168 CYS A N   1 
ATOM   1080 C  CA  . CYS A 1 162 ? 27.439 3.039   14.352 1.00 16.52 ? 168 CYS A CA  1 
ATOM   1081 C  C   . CYS A 1 162 ? 28.809 3.404   14.920 1.00 18.10 ? 168 CYS A C   1 
ATOM   1082 O  O   . CYS A 1 162 ? 28.852 4.024   15.998 1.00 16.08 ? 168 CYS A O   1 
ATOM   1083 C  CB  . CYS A 1 162 ? 27.114 1.548   14.430 1.00 13.70 ? 168 CYS A CB  1 
ATOM   1084 S  SG  . CYS A 1 162 ? 26.954 1.002   16.132 1.00 13.99 ? 168 CYS A SG  1 
ATOM   1085 N  N   . LYS A 1 163 ? 29.888 3.050   14.222 1.00 17.93 ? 169 LYS A N   1 
ATOM   1086 C  CA  . LYS A 1 163 ? 31.236 3.341   14.701 1.00 19.46 ? 169 LYS A CA  1 
ATOM   1087 C  C   . LYS A 1 163 ? 31.610 4.819   14.731 1.00 19.37 ? 169 LYS A C   1 
ATOM   1088 O  O   . LYS A 1 163 ? 32.442 5.201   15.571 1.00 18.78 ? 169 LYS A O   1 
ATOM   1089 C  CB  . LYS A 1 163 ? 32.380 2.670   13.966 1.00 20.53 ? 169 LYS A CB  1 
ATOM   1090 C  CG  . LYS A 1 163 ? 32.051 1.186   14.085 1.00 25.66 ? 169 LYS A CG  1 
ATOM   1091 C  CD  . LYS A 1 163 ? 33.123 0.353   13.365 1.00 32.81 ? 169 LYS A CD  1 
ATOM   1092 C  CE  . LYS A 1 163 ? 33.106 -1.030  14.043 1.00 34.39 ? 169 LYS A CE  1 
ATOM   1093 N  NZ  . LYS A 1 163 ? 33.905 -1.936  13.191 1.00 41.97 ? 169 LYS A NZ  1 
ATOM   1094 N  N   . SER A 1 164 ? 31.146 5.545   13.719 1.00 20.43 ? 170 SER A N   1 
ATOM   1095 C  CA  . SER A 1 164 ? 31.429 6.993   13.809 1.00 17.80 ? 170 SER A CA  1 
ATOM   1096 C  C   . SER A 1 164 ? 30.627 7.606   14.902 1.00 17.80 ? 170 SER A C   1 
ATOM   1097 O  O   . SER A 1 164 ? 31.280 8.464   15.521 1.00 19.13 ? 170 SER A O   1 
ATOM   1098 C  CB  . SER A 1 164 ? 31.544 7.665   12.466 1.00 20.89 ? 170 SER A CB  1 
ATOM   1099 O  OG  . SER A 1 164 ? 30.212 7.657   12.016 1.00 29.03 ? 170 SER A OG  1 
ATOM   1100 N  N   . ALA A 1 165 ? 29.496 7.191   15.415 1.00 17.27 ? 171 ALA A N   1 
ATOM   1101 C  CA  . ALA A 1 165 ? 28.811 7.625   16.628 1.00 15.64 ? 171 ALA A CA  1 
ATOM   1102 C  C   . ALA A 1 165 ? 29.510 7.294   17.933 1.00 15.38 ? 171 ALA A C   1 
ATOM   1103 O  O   . ALA A 1 165 ? 29.402 8.061   18.913 1.00 16.34 ? 171 ALA A O   1 
ATOM   1104 C  CB  . ALA A 1 165 ? 27.393 6.999   16.674 1.00 19.84 ? 171 ALA A CB  1 
ATOM   1105 N  N   . TYR A 1 166 ? 30.158 6.132   18.043 1.00 14.81 ? 172 TYR A N   1 
ATOM   1106 C  CA  . TYR A 1 166 ? 30.823 5.625   19.252 1.00 13.85 ? 172 TYR A CA  1 
ATOM   1107 C  C   . TYR A 1 166 ? 32.162 5.046   18.856 1.00 16.33 ? 172 TYR A C   1 
ATOM   1108 O  O   . TYR A 1 166 ? 32.389 3.831   18.885 1.00 14.41 ? 172 TYR A O   1 
ATOM   1109 C  CB  . TYR A 1 166 ? 30.035 4.464   19.914 1.00 11.83 ? 172 TYR A CB  1 
ATOM   1110 C  CG  . TYR A 1 166 ? 28.632 4.827   20.343 1.00 10.41 ? 172 TYR A CG  1 
ATOM   1111 C  CD1 . TYR A 1 166 ? 28.484 5.625   21.465 1.00 12.47 ? 172 TYR A CD1 1 
ATOM   1112 C  CD2 . TYR A 1 166 ? 27.527 4.594   19.502 1.00 9.94  ? 172 TYR A CD2 1 
ATOM   1113 C  CE1 . TYR A 1 166 ? 27.223 6.061   21.892 1.00 14.89 ? 172 TYR A CE1 1 
ATOM   1114 C  CE2 . TYR A 1 166 ? 26.250 4.968   19.934 1.00 14.41 ? 172 TYR A CE2 1 
ATOM   1115 C  CZ  . TYR A 1 166 ? 26.124 5.695   21.130 1.00 14.35 ? 172 TYR A CZ  1 
ATOM   1116 O  OH  . TYR A 1 166 ? 24.889 6.015   21.628 1.00 15.28 ? 172 TYR A OH  1 
ATOM   1117 N  N   . PRO A 1 167 ? 33.098 5.919   18.412 1.00 17.67 ? 173 PRO A N   1 
ATOM   1118 C  CA  . PRO A 1 167 ? 34.408 5.382   17.957 1.00 15.55 ? 173 PRO A CA  1 
ATOM   1119 C  C   . PRO A 1 167 ? 35.110 4.659   19.114 1.00 15.90 ? 173 PRO A C   1 
ATOM   1120 O  O   . PRO A 1 167 ? 35.055 5.114   20.274 1.00 13.80 ? 173 PRO A O   1 
ATOM   1121 C  CB  . PRO A 1 167 ? 35.163 6.681   17.622 1.00 18.00 ? 173 PRO A CB  1 
ATOM   1122 C  CG  . PRO A 1 167 ? 34.382 7.835   18.147 1.00 15.96 ? 173 PRO A CG  1 
ATOM   1123 C  CD  . PRO A 1 167 ? 32.960 7.378   18.372 1.00 14.84 ? 173 PRO A CD  1 
ATOM   1124 N  N   . GLY A 1 168 ? 35.732 3.550   18.813 1.00 17.34 ? 174 GLY A N   1 
ATOM   1125 C  CA  . GLY A 1 168 ? 36.547 2.686   19.716 1.00 18.71 ? 174 GLY A CA  1 
ATOM   1126 C  C   . GLY A 1 168 ? 35.663 1.873   20.701 1.00 19.85 ? 174 GLY A C   1 
ATOM   1127 O  O   . GLY A 1 168 ? 36.185 1.008   21.422 1.00 21.22 ? 174 GLY A O   1 
ATOM   1128 N  N   . GLN A 1 169 ? 34.350 1.998   20.699 1.00 19.54 ? 175 GLN A N   1 
ATOM   1129 C  CA  . GLN A 1 169 ? 33.414 1.342   21.634 1.00 17.27 ? 175 GLN A CA  1 
ATOM   1130 C  C   . GLN A 1 169 ? 32.586 0.221   21.035 1.00 17.77 ? 175 GLN A C   1 
ATOM   1131 O  O   . GLN A 1 169 ? 31.932 -0.501  21.804 1.00 17.02 ? 175 GLN A O   1 
ATOM   1132 C  CB  . GLN A 1 169 ? 32.562 2.401   22.310 1.00 14.04 ? 175 GLN A CB  1 
ATOM   1133 C  CG  . GLN A 1 169 ? 33.279 3.530   23.036 1.00 21.92 ? 175 GLN A CG  1 
ATOM   1134 C  CD  . GLN A 1 169 ? 32.428 4.783   23.187 1.00 28.75 ? 175 GLN A CD  1 
ATOM   1135 O  OE1 . GLN A 1 169 ? 32.401 5.791   22.433 1.00 36.42 ? 175 GLN A OE1 1 
ATOM   1136 N  NE2 . GLN A 1 169 ? 31.633 4.704   24.238 1.00 29.04 ? 175 GLN A NE2 1 
ATOM   1137 N  N   . ILE A 1 170 ? 32.499 0.075   19.724 1.00 17.03 ? 176 ILE A N   1 
ATOM   1138 C  CA  . ILE A 1 170 ? 31.664 -0.937  19.071 1.00 16.63 ? 176 ILE A CA  1 
ATOM   1139 C  C   . ILE A 1 170 ? 32.461 -2.202  18.764 1.00 17.32 ? 176 ILE A C   1 
ATOM   1140 O  O   . ILE A 1 170 ? 33.303 -2.209  17.825 1.00 17.42 ? 176 ILE A O   1 
ATOM   1141 C  CB  . ILE A 1 170 ? 31.018 -0.258  17.795 1.00 12.37 ? 176 ILE A CB  1 
ATOM   1142 C  CG1 . ILE A 1 170 ? 30.172 0.975   18.182 1.00 13.07 ? 176 ILE A CG1 1 
ATOM   1143 C  CG2 . ILE A 1 170 ? 30.053 -1.211  17.018 1.00 17.33 ? 176 ILE A CG2 1 
ATOM   1144 C  CD1 . ILE A 1 170 ? 28.923 0.846   19.088 1.00 11.21 ? 176 ILE A CD1 1 
ATOM   1145 N  N   . THR A 1 171 ? 32.044 -3.369  19.269 1.00 15.97 ? 177 THR A N   1 
ATOM   1146 C  CA  . THR A 1 171 ? 32.707 -4.660  18.946 1.00 13.13 ? 177 THR A CA  1 
ATOM   1147 C  C   . THR A 1 171 ? 31.840 -5.314  17.919 1.00 13.99 ? 177 THR A C   1 
ATOM   1148 O  O   . THR A 1 171 ? 30.719 -4.907  17.527 1.00 10.61 ? 177 THR A O   1 
ATOM   1149 C  CB  . THR A 1 171 ? 32.935 -5.531  20.229 1.00 17.59 ? 177 THR A CB  1 
ATOM   1150 O  OG1 . THR A 1 171 ? 31.569 -6.036  20.490 1.00 14.33 ? 177 THR A OG1 1 
ATOM   1151 C  CG2 . THR A 1 171 ? 33.521 -4.705  21.376 1.00 12.67 ? 177 THR A CG2 1 
ATOM   1152 N  N   . SER A 1 172 ? 32.300 -6.481  17.448 1.00 14.36 ? 178 SER A N   1 
ATOM   1153 C  CA  . SER A 1 172 ? 31.513 -7.150  16.392 1.00 14.34 ? 178 SER A CA  1 
ATOM   1154 C  C   . SER A 1 172 ? 30.226 -7.810  16.936 1.00 13.38 ? 178 SER A C   1 
ATOM   1155 O  O   . SER A 1 172 ? 29.489 -8.278  16.043 1.00 13.53 ? 178 SER A O   1 
ATOM   1156 C  CB  . SER A 1 172 ? 32.401 -8.185  15.684 1.00 20.38 ? 178 SER A CB  1 
ATOM   1157 O  OG  . SER A 1 172 ? 32.985 -8.908  16.765 1.00 23.81 ? 178 SER A OG  1 
ATOM   1158 N  N   . ASN A 1 173 ? 29.950 -7.746  18.216 1.00 11.75 ? 179 ASN A N   1 
ATOM   1159 C  CA  . ASN A 1 173 ? 28.829 -8.346  18.935 1.00 12.46 ? 179 ASN A CA  1 
ATOM   1160 C  C   . ASN A 1 173 ? 27.747 -7.325  19.309 1.00 11.50 ? 179 ASN A C   1 
ATOM   1161 O  O   . ASN A 1 173 ? 27.065 -7.444  20.342 1.00 9.53  ? 179 ASN A O   1 
ATOM   1162 C  CB  . ASN A 1 173 ? 29.337 -8.927  20.304 1.00 13.23 ? 179 ASN A CB  1 
ATOM   1163 C  CG  . ASN A 1 173 ? 30.201 -10.165 20.002 1.00 15.11 ? 179 ASN A CG  1 
ATOM   1164 O  OD1 . ASN A 1 173 ? 29.989 -10.886 19.033 1.00 12.69 ? 179 ASN A OD1 1 
ATOM   1165 N  ND2 . ASN A 1 173 ? 31.363 -10.066 20.602 1.00 17.27 ? 179 ASN A ND2 1 
ATOM   1166 N  N   . MET A 1 174 ? 27.857 -6.165  18.690 1.00 12.39 ? 180 MET A N   1 
ATOM   1167 C  CA  . MET A 1 174 ? 26.983 -5.014  18.937 1.00 8.83  ? 180 MET A CA  1 
ATOM   1168 C  C   . MET A 1 174 ? 26.538 -4.452  17.602 1.00 11.05 ? 180 MET A C   1 
ATOM   1169 O  O   . MET A 1 174 ? 27.185 -4.665  16.569 1.00 11.77 ? 180 MET A O   1 
ATOM   1170 C  CB  . MET A 1 174 ? 27.793 -3.898  19.623 1.00 12.64 ? 180 MET A CB  1 
ATOM   1171 C  CG  . MET A 1 174 ? 28.251 -4.274  21.010 1.00 7.78  ? 180 MET A CG  1 
ATOM   1172 S  SD  . MET A 1 174 ? 29.385 -3.002  21.655 1.00 12.98 ? 180 MET A SD  1 
ATOM   1173 C  CE  . MET A 1 174 ? 30.009 -3.738  23.175 1.00 12.24 ? 180 MET A CE  1 
ATOM   1174 N  N   . PHE A 1 175 ? 25.310 -3.874  17.646 1.00 12.27 ? 181 PHE A N   1 
ATOM   1175 C  CA  . PHE A 1 175 ? 24.872 -3.143  16.454 1.00 12.75 ? 181 PHE A CA  1 
ATOM   1176 C  C   . PHE A 1 175 ? 24.156 -1.884  17.050 1.00 12.27 ? 181 PHE A C   1 
ATOM   1177 O  O   . PHE A 1 175 ? 23.624 -1.917  18.202 1.00 8.96  ? 181 PHE A O   1 
ATOM   1178 C  CB  . PHE A 1 175 ? 24.065 -3.895  15.387 1.00 13.07 ? 181 PHE A CB  1 
ATOM   1179 C  CG  . PHE A 1 175 ? 22.744 -4.462  15.828 1.00 11.69 ? 181 PHE A CG  1 
ATOM   1180 C  CD1 . PHE A 1 175 ? 21.624 -3.624  15.912 1.00 9.27  ? 181 PHE A CD1 1 
ATOM   1181 C  CD2 . PHE A 1 175 ? 22.665 -5.716  16.440 1.00 12.72 ? 181 PHE A CD2 1 
ATOM   1182 C  CE1 . PHE A 1 175 ? 20.406 -4.035  16.415 1.00 11.27 ? 181 PHE A CE1 1 
ATOM   1183 C  CE2 . PHE A 1 175 ? 21.462 -6.154  16.995 1.00 15.65 ? 181 PHE A CE2 1 
ATOM   1184 C  CZ  . PHE A 1 175 ? 20.288 -5.314  16.956 1.00 13.74 ? 181 PHE A CZ  1 
ATOM   1185 N  N   . CYS A 1 176 ? 23.987 -0.968  16.092 1.00 8.08  ? 182 CYS A N   1 
ATOM   1186 C  CA  . CYS A 1 176 ? 23.289 0.287   16.495 1.00 10.57 ? 182 CYS A CA  1 
ATOM   1187 C  C   . CYS A 1 176 ? 21.911 0.176   15.798 1.00 10.45 ? 182 CYS A C   1 
ATOM   1188 O  O   . CYS A 1 176 ? 21.875 -0.245  14.633 1.00 10.54 ? 182 CYS A O   1 
ATOM   1189 C  CB  . CYS A 1 176 ? 23.964 1.589   15.984 1.00 13.34 ? 182 CYS A CB  1 
ATOM   1190 S  SG  . CYS A 1 176 ? 25.416 2.093   16.912 1.00 12.97 ? 182 CYS A SG  1 
ATOM   1191 N  N   . ALA A 1 177 ? 20.897 0.713   16.451 1.00 11.20 ? 183 ALA A N   1 
ATOM   1192 C  CA  . ALA A 1 177 ? 19.561 0.836   15.876 1.00 10.65 ? 183 ALA A CA  1 
ATOM   1193 C  C   . ALA A 1 177 ? 18.899 2.087   16.449 1.00 12.27 ? 183 ALA A C   1 
ATOM   1194 O  O   . ALA A 1 177 ? 19.020 2.454   17.628 1.00 12.30 ? 183 ALA A O   1 
ATOM   1195 C  CB  . ALA A 1 177 ? 18.627 -0.357  16.123 1.00 9.12  ? 183 ALA A CB  1 
ATOM   1196 N  N   . GLY A 1 178 A 18.113 2.663   15.533 1.00 12.38 ? 184 GLY A N   1 
ATOM   1197 C  CA  . GLY A 1 178 A 17.338 3.846   15.975 1.00 15.01 ? 184 GLY A CA  1 
ATOM   1198 C  C   . GLY A 1 178 A 17.420 5.009   14.974 1.00 15.76 ? 184 GLY A C   1 
ATOM   1199 O  O   . GLY A 1 178 A 17.330 4.775   13.763 1.00 14.53 ? 184 GLY A O   1 
ATOM   1200 N  N   . TYR A 1 179 ? 17.515 6.208   15.543 1.00 16.78 ? 184 TYR A N   1 
ATOM   1201 C  CA  . TYR A 1 179 ? 17.380 7.488   14.787 1.00 18.15 ? 184 TYR A CA  1 
ATOM   1202 C  C   . TYR A 1 179 ? 18.474 8.485   15.182 1.00 17.50 ? 184 TYR A C   1 
ATOM   1203 O  O   . TYR A 1 179 ? 18.491 8.925   16.357 1.00 20.29 ? 184 TYR A O   1 
ATOM   1204 C  CB  . TYR A 1 179 ? 15.964 8.087   15.094 1.00 12.06 ? 184 TYR A CB  1 
ATOM   1205 C  CG  . TYR A 1 179 ? 14.866 7.169   14.639 1.00 13.76 ? 184 TYR A CG  1 
ATOM   1206 C  CD1 . TYR A 1 179 ? 14.411 6.142   15.477 1.00 14.55 ? 184 TYR A CD1 1 
ATOM   1207 C  CD2 . TYR A 1 179 ? 14.379 7.207   13.356 1.00 12.14 ? 184 TYR A CD2 1 
ATOM   1208 C  CE1 . TYR A 1 179 ? 13.357 5.280   15.148 1.00 8.26  ? 184 TYR A CE1 1 
ATOM   1209 C  CE2 . TYR A 1 179 ? 13.359 6.349   12.951 1.00 13.13 ? 184 TYR A CE2 1 
ATOM   1210 C  CZ  . TYR A 1 179 ? 12.960 5.326   13.819 1.00 13.67 ? 184 TYR A CZ  1 
ATOM   1211 O  OH  . TYR A 1 179 ? 11.999 4.464   13.361 1.00 15.78 ? 184 TYR A OH  1 
ATOM   1212 N  N   . LEU A 1 180 ? 19.228 8.938   14.191 1.00 17.96 ? 185 LEU A N   1 
ATOM   1213 C  CA  . LEU A 1 180 ? 20.306 9.925   14.440 1.00 17.00 ? 185 LEU A CA  1 
ATOM   1214 C  C   . LEU A 1 180 ? 19.774 11.294  14.816 1.00 19.71 ? 185 LEU A C   1 
ATOM   1215 O  O   . LEU A 1 180 ? 20.430 11.925  15.646 1.00 19.29 ? 185 LEU A O   1 
ATOM   1216 C  CB  . LEU A 1 180 ? 21.260 9.917   13.252 1.00 16.30 ? 185 LEU A CB  1 
ATOM   1217 C  CG  . LEU A 1 180 ? 21.860 8.521   13.016 1.00 12.37 ? 185 LEU A CG  1 
ATOM   1218 C  CD1 . LEU A 1 180 ? 22.889 8.597   11.885 1.00 17.87 ? 185 LEU A CD1 1 
ATOM   1219 C  CD2 . LEU A 1 180 ? 22.758 8.321   14.269 1.00 13.97 ? 185 LEU A CD2 1 
ATOM   1220 N  N   . GLU A 1 181 ? 18.526 11.502  14.417 1.00 21.40 ? 186 GLU A N   1 
ATOM   1221 C  CA  . GLU A 1 181 ? 17.792 12.742  14.678 1.00 23.90 ? 186 GLU A CA  1 
ATOM   1222 C  C   . GLU A 1 181 ? 17.340 12.827  16.127 1.00 24.20 ? 186 GLU A C   1 
ATOM   1223 O  O   . GLU A 1 181 ? 17.077 13.984  16.528 1.00 26.49 ? 186 GLU A O   1 
ATOM   1224 C  CB  . GLU A 1 181 ? 16.664 13.065  13.699 1.00 22.07 ? 186 GLU A CB  1 
ATOM   1225 C  CG  . GLU A 1 181 ? 15.429 12.187  13.498 1.00 28.92 ? 186 GLU A CG  1 
ATOM   1226 C  CD  . GLU A 1 181 ? 15.548 10.971  12.625 1.00 30.91 ? 186 GLU A CD  1 
ATOM   1227 O  OE1 . GLU A 1 181 ? 16.555 10.262  12.562 1.00 33.02 ? 186 GLU A OE1 1 
ATOM   1228 O  OE2 . GLU A 1 181 ? 14.503 10.632  12.030 1.00 30.93 ? 186 GLU A OE2 1 
ATOM   1229 N  N   . GLY A 1 182 ? 17.590 11.843  16.985 1.00 22.72 ? 187 GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 182 ? 17.126 11.915  18.389 1.00 21.21 ? 187 GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 182 ? 15.583 11.801  18.409 1.00 19.85 ? 187 GLY A C   1 
ATOM   1232 O  O   . GLY A 1 182 ? 14.970 11.658  17.340 1.00 20.05 ? 187 GLY A O   1 
ATOM   1233 N  N   . GLY A 1 183 A 15.005 11.663  19.601 1.00 16.83 ? 188 GLY A N   1 
ATOM   1234 C  CA  . GLY A 1 183 A 13.547 11.600  19.705 1.00 15.49 ? 188 GLY A CA  1 
ATOM   1235 C  C   . GLY A 1 183 A 12.857 10.276  19.872 1.00 16.87 ? 188 GLY A C   1 
ATOM   1236 O  O   . GLY A 1 183 A 11.768 10.182  20.456 1.00 17.47 ? 188 GLY A O   1 
ATOM   1237 N  N   . LYS A 1 184 ? 13.587 9.214   19.585 1.00 15.63 ? 188 LYS A N   1 
ATOM   1238 C  CA  . LYS A 1 184 ? 13.053 7.847   19.583 1.00 15.48 ? 188 LYS A CA  1 
ATOM   1239 C  C   . LYS A 1 184 ? 14.190 6.891   19.982 1.00 13.35 ? 188 LYS A C   1 
ATOM   1240 O  O   . LYS A 1 184 ? 15.181 6.751   19.241 1.00 13.08 ? 188 LYS A O   1 
ATOM   1241 C  CB  . LYS A 1 184 ? 12.582 7.543   18.166 1.00 11.43 ? 188 LYS A CB  1 
ATOM   1242 C  CG  . LYS A 1 184 ? 11.226 8.247   17.935 1.00 14.93 ? 188 LYS A CG  1 
ATOM   1243 C  CD  . LYS A 1 184 ? 11.097 8.104   16.451 1.00 17.82 ? 188 LYS A CD  1 
ATOM   1244 C  CE  . LYS A 1 184 ? 9.876  7.568   15.799 1.00 28.84 ? 188 LYS A CE  1 
ATOM   1245 N  NZ  . LYS A 1 184 ? 10.029 7.823   14.318 1.00 31.69 ? 188 LYS A NZ  1 
ATOM   1246 N  N   . ASP A 1 185 ? 13.922 6.200   21.053 1.00 12.40 ? 189 ASP A N   1 
ATOM   1247 C  CA  . ASP A 1 185 ? 14.973 5.256   21.530 1.00 13.20 ? 189 ASP A CA  1 
ATOM   1248 C  C   . ASP A 1 185 ? 14.437 4.348   22.670 1.00 12.85 ? 189 ASP A C   1 
ATOM   1249 O  O   . ASP A 1 185 ? 13.368 4.663   23.207 1.00 10.27 ? 189 ASP A O   1 
ATOM   1250 C  CB  . ASP A 1 185 ? 16.088 6.185   22.011 1.00 10.71 ? 189 ASP A CB  1 
ATOM   1251 C  CG  . ASP A 1 185 ? 17.466 5.619   22.229 1.00 16.13 ? 189 ASP A CG  1 
ATOM   1252 O  OD1 . ASP A 1 185 ? 17.725 4.459   21.841 1.00 12.38 ? 189 ASP A OD1 1 
ATOM   1253 O  OD2 . ASP A 1 185 ? 18.363 6.227   22.870 1.00 17.35 ? 189 ASP A OD2 1 
ATOM   1254 N  N   . SER A 1 186 ? 15.346 3.431   23.073 1.00 10.80 ? 190 SER A N   1 
ATOM   1255 C  CA  . SER A 1 186 ? 15.136 2.671   24.299 1.00 12.00 ? 190 SER A CA  1 
ATOM   1256 C  C   . SER A 1 186 ? 15.791 3.510   25.390 1.00 11.90 ? 190 SER A C   1 
ATOM   1257 O  O   . SER A 1 186 ? 16.571 4.453   25.111 1.00 11.89 ? 190 SER A O   1 
ATOM   1258 C  CB  . SER A 1 186 ? 15.511 1.188   24.120 1.00 12.39 ? 190 SER A CB  1 
ATOM   1259 O  OG  . SER A 1 186 ? 16.876 1.135   23.706 1.00 17.53 ? 190 SER A OG  1 
ATOM   1260 N  N   . CYS A 1 187 ? 15.435 3.247   26.641 1.00 12.94 ? 191 CYS A N   1 
ATOM   1261 C  CA  . CYS A 1 187 ? 15.909 4.112   27.759 1.00 11.13 ? 191 CYS A CA  1 
ATOM   1262 C  C   . CYS A 1 187 ? 15.946 3.208   29.007 1.00 13.09 ? 191 CYS A C   1 
ATOM   1263 O  O   . CYS A 1 187 ? 15.688 1.984   28.959 1.00 10.24 ? 191 CYS A O   1 
ATOM   1264 C  CB  . CYS A 1 187 ? 14.903 5.300   27.843 1.00 14.88 ? 191 CYS A CB  1 
ATOM   1265 S  SG  . CYS A 1 187 ? 15.513 6.699   28.875 1.00 19.01 ? 191 CYS A SG  1 
ATOM   1266 N  N   . GLN A 1 188 ? 16.416 3.773   30.114 1.00 13.07 ? 192 GLN A N   1 
ATOM   1267 C  CA  . GLN A 1 188 ? 16.537 3.129   31.406 1.00 13.92 ? 192 GLN A CA  1 
ATOM   1268 C  C   . GLN A 1 188 ? 15.290 2.240   31.624 1.00 13.57 ? 192 GLN A C   1 
ATOM   1269 O  O   . GLN A 1 188 ? 14.149 2.711   31.508 1.00 13.66 ? 192 GLN A O   1 
ATOM   1270 C  CB  . GLN A 1 188 ? 16.681 4.041   32.617 1.00 17.36 ? 192 GLN A CB  1 
ATOM   1271 C  CG  . GLN A 1 188 ? 17.389 5.384   32.442 1.00 35.38 ? 192 GLN A CG  1 
ATOM   1272 C  CD  . GLN A 1 188 ? 16.529 6.637   32.690 1.00 39.94 ? 192 GLN A CD  1 
ATOM   1273 O  OE1 . GLN A 1 188 ? 16.238 7.458   31.788 1.00 37.29 ? 192 GLN A OE1 1 
ATOM   1274 N  NE2 . GLN A 1 188 ? 15.955 6.747   33.908 1.00 39.18 ? 192 GLN A NE2 1 
ATOM   1275 N  N   . GLY A 1 189 ? 15.502 0.949   31.890 1.00 14.80 ? 193 GLY A N   1 
ATOM   1276 C  CA  . GLY A 1 189 ? 14.304 0.112   32.216 1.00 12.73 ? 193 GLY A CA  1 
ATOM   1277 C  C   . GLY A 1 189 ? 14.044 -0.951  31.130 1.00 13.16 ? 193 GLY A C   1 
ATOM   1278 O  O   . GLY A 1 189 ? 13.179 -1.832  31.334 1.00 10.82 ? 193 GLY A O   1 
ATOM   1279 N  N   . ASP A 1 190 ? 14.477 -0.553  29.945 1.00 10.59 ? 194 ASP A N   1 
ATOM   1280 C  CA  . ASP A 1 190 ? 14.260 -1.290  28.715 1.00 10.81 ? 194 ASP A CA  1 
ATOM   1281 C  C   . ASP A 1 190 ? 15.327 -2.387  28.584 1.00 10.98 ? 194 ASP A C   1 
ATOM   1282 O  O   . ASP A 1 190 ? 15.139 -3.282  27.716 1.00 11.29 ? 194 ASP A O   1 
ATOM   1283 C  CB  . ASP A 1 190 ? 14.305 -0.323  27.496 1.00 4.62  ? 194 ASP A CB  1 
ATOM   1284 C  CG  . ASP A 1 190 ? 13.044 0.562   27.448 1.00 14.79 ? 194 ASP A CG  1 
ATOM   1285 O  OD1 . ASP A 1 190 ? 11.967 0.049   27.867 1.00 9.06  ? 194 ASP A OD1 1 
ATOM   1286 O  OD2 . ASP A 1 190 ? 13.041 1.643   26.800 1.00 14.83 ? 194 ASP A OD2 1 
ATOM   1287 N  N   . SER A 1 191 ? 16.448 -2.245  29.268 1.00 9.63  ? 195 SER A N   1 
ATOM   1288 C  CA  . SER A 1 191 ? 17.551 -3.208  29.101 1.00 12.14 ? 195 SER A CA  1 
ATOM   1289 C  C   . SER A 1 191 ? 17.053 -4.681  29.169 1.00 9.80  ? 195 SER A C   1 
ATOM   1290 O  O   . SER A 1 191 ? 16.319 -4.955  30.106 1.00 8.55  ? 195 SER A O   1 
ATOM   1291 C  CB  . SER A 1 191 ? 18.575 -3.010  30.211 1.00 17.26 ? 195 SER A CB  1 
ATOM   1292 O  OG  . SER A 1 191 ? 19.287 -1.818  29.834 1.00 13.90 ? 195 SER A OG  1 
ATOM   1293 N  N   . GLY A 1 192 ? 17.767 -5.521  28.462 1.00 10.86 ? 196 GLY A N   1 
ATOM   1294 C  CA  . GLY A 1 192 ? 17.471 -6.931  28.446 1.00 9.17  ? 196 GLY A CA  1 
ATOM   1295 C  C   . GLY A 1 192 ? 16.359 -7.247  27.437 1.00 12.35 ? 196 GLY A C   1 
ATOM   1296 O  O   . GLY A 1 192 ? 16.406 -8.428  26.971 1.00 11.79 ? 196 GLY A O   1 
ATOM   1297 N  N   . GLY A 1 193 ? 15.551 -6.280  27.013 1.00 9.89  ? 197 GLY A N   1 
ATOM   1298 C  CA  . GLY A 1 193 ? 14.335 -6.469  26.184 1.00 10.80 ? 197 GLY A CA  1 
ATOM   1299 C  C   . GLY A 1 193 ? 14.635 -6.806  24.736 1.00 11.08 ? 197 GLY A C   1 
ATOM   1300 O  O   . GLY A 1 193 ? 15.792 -6.591  24.365 1.00 11.81 ? 197 GLY A O   1 
ATOM   1301 N  N   . PRO A 1 194 ? 13.692 -7.332  23.970 1.00 10.61 ? 198 PRO A N   1 
ATOM   1302 C  CA  . PRO A 1 194 ? 13.899 -7.763  22.592 1.00 8.87  ? 198 PRO A CA  1 
ATOM   1303 C  C   . PRO A 1 194 ? 13.998 -6.673  21.535 1.00 10.64 ? 198 PRO A C   1 
ATOM   1304 O  O   . PRO A 1 194 ? 13.438 -5.564  21.589 1.00 10.23 ? 198 PRO A O   1 
ATOM   1305 C  CB  . PRO A 1 194 ? 12.576 -8.465  22.211 1.00 8.24  ? 198 PRO A CB  1 
ATOM   1306 C  CG  . PRO A 1 194 ? 11.536 -8.019  23.206 1.00 9.80  ? 198 PRO A CG  1 
ATOM   1307 C  CD  . PRO A 1 194 ? 12.287 -7.485  24.436 1.00 10.50 ? 198 PRO A CD  1 
ATOM   1308 N  N   . VAL A 1 195 ? 14.670 -7.041  20.469 1.00 10.29 ? 199 VAL A N   1 
ATOM   1309 C  CA  . VAL A 1 195 ? 14.767 -6.274  19.231 1.00 9.59  ? 199 VAL A CA  1 
ATOM   1310 C  C   . VAL A 1 195 ? 14.307 -7.357  18.239 1.00 11.24 ? 199 VAL A C   1 
ATOM   1311 O  O   . VAL A 1 195 ? 15.125 -8.290  18.040 1.00 12.19 ? 199 VAL A O   1 
ATOM   1312 C  CB  . VAL A 1 195 ? 16.154 -5.646  19.003 1.00 10.57 ? 199 VAL A CB  1 
ATOM   1313 C  CG1 . VAL A 1 195 ? 16.175 -4.953  17.648 1.00 7.76  ? 199 VAL A CG1 1 
ATOM   1314 C  CG2 . VAL A 1 195 ? 16.623 -4.732  20.136 1.00 10.07 ? 199 VAL A CG2 1 
ATOM   1315 N  N   . VAL A 1 196 ? 13.167 -7.302  17.609 1.00 10.58 ? 200 VAL A N   1 
ATOM   1316 C  CA  . VAL A 1 196 ? 12.733 -8.441  16.767 1.00 10.87 ? 200 VAL A CA  1 
ATOM   1317 C  C   . VAL A 1 196 ? 12.653 -7.964  15.339 1.00 14.78 ? 200 VAL A C   1 
ATOM   1318 O  O   . VAL A 1 196 ? 12.089 -6.841  15.205 1.00 15.73 ? 200 VAL A O   1 
ATOM   1319 C  CB  . VAL A 1 196 ? 11.422 -8.983  17.364 1.00 13.00 ? 200 VAL A CB  1 
ATOM   1320 C  CG1 . VAL A 1 196 ? 10.637 -9.874  16.425 1.00 10.60 ? 200 VAL A CG1 1 
ATOM   1321 C  CG2 . VAL A 1 196 ? 11.710 -9.749  18.639 1.00 11.59 ? 200 VAL A CG2 1 
ATOM   1322 N  N   . CYS A 1 197 ? 13.175 -8.679  14.364 1.00 14.68 ? 201 CYS A N   1 
ATOM   1323 C  CA  . CYS A 1 197 ? 13.251 -8.149  12.982 1.00 17.56 ? 201 CYS A CA  1 
ATOM   1324 C  C   . CYS A 1 197 ? 12.809 -9.325  12.116 1.00 21.11 ? 201 CYS A C   1 
ATOM   1325 O  O   . CYS A 1 197 ? 13.286 -10.475 12.343 1.00 22.18 ? 201 CYS A O   1 
ATOM   1326 C  CB  . CYS A 1 197 ? 14.685 -7.754  12.544 1.00 14.22 ? 201 CYS A CB  1 
ATOM   1327 S  SG  . CYS A 1 197 ? 15.496 -6.839  13.872 1.00 14.69 ? 201 CYS A SG  1 
ATOM   1328 N  N   . SER A 1 198 ? 11.708 -9.163  11.413 1.00 23.33 ? 202 SER A N   1 
ATOM   1329 C  CA  . SER A 1 198 ? 11.110 -10.276 10.606 1.00 23.70 ? 202 SER A CA  1 
ATOM   1330 C  C   . SER A 1 198 ? 10.848 -11.494 11.499 1.00 21.78 ? 202 SER A C   1 
ATOM   1331 O  O   . SER A 1 198 ? 11.238 -12.545 11.003 1.00 22.27 ? 202 SER A O   1 
ATOM   1332 C  CB  . SER A 1 198 ? 11.974 -10.697 9.412  1.00 28.26 ? 202 SER A CB  1 
ATOM   1333 O  OG  . SER A 1 198 ? 12.537 -9.529  8.800  1.00 38.42 ? 202 SER A OG  1 
ATOM   1334 N  N   . GLY A 1 199 ? 10.234 -11.401 12.665 1.00 20.32 ? 203 GLY A N   1 
ATOM   1335 C  CA  . GLY A 1 199 ? 10.018 -12.603 13.420 1.00 19.31 ? 203 GLY A CA  1 
ATOM   1336 C  C   . GLY A 1 199 ? 11.200 -13.247 14.106 1.00 19.43 ? 203 GLY A C   1 
ATOM   1337 O  O   . GLY A 1 199 ? 10.873 -14.356 14.578 1.00 16.70 ? 203 GLY A O   1 
ATOM   1338 N  N   . LYS A 1 200 ? 12.440 -12.722 14.076 1.00 17.15 ? 204 LYS A N   1 
ATOM   1339 C  CA  . LYS A 1 200 ? 13.456 -13.441 14.881 1.00 16.21 ? 204 LYS A CA  1 
ATOM   1340 C  C   . LYS A 1 200 ? 13.902 -12.428 15.995 1.00 17.25 ? 204 LYS A C   1 
ATOM   1341 O  O   . LYS A 1 200 ? 14.129 -11.295 15.489 1.00 16.49 ? 204 LYS A O   1 
ATOM   1342 C  CB  . LYS A 1 200 ? 14.778 -13.678 14.155 1.00 17.59 ? 204 LYS A CB  1 
ATOM   1343 C  CG  . LYS A 1 200 ? 14.790 -14.135 12.703 1.00 21.19 ? 204 LYS A CG  1 
ATOM   1344 C  CD  . LYS A 1 200 ? 13.550 -15.003 12.561 1.00 18.88 ? 204 LYS A CD  1 
ATOM   1345 C  CE  . LYS A 1 200 ? 13.925 -16.463 12.677 1.00 25.83 ? 204 LYS A CE  1 
ATOM   1346 N  NZ  . LYS A 1 200 ? 13.417 -16.995 11.348 1.00 27.23 ? 204 LYS A NZ  1 
ATOM   1347 N  N   . LEU A 1 201 ? 14.633 -12.931 16.997 1.00 14.87 ? 209 LEU A N   1 
ATOM   1348 C  CA  . LEU A 1 201 ? 15.222 -12.025 17.980 1.00 13.44 ? 209 LEU A CA  1 
ATOM   1349 C  C   . LEU A 1 201 ? 16.628 -11.686 17.429 1.00 13.72 ? 209 LEU A C   1 
ATOM   1350 O  O   . LEU A 1 201 ? 17.547 -12.540 17.582 1.00 15.27 ? 209 LEU A O   1 
ATOM   1351 C  CB  . LEU A 1 201 ? 15.362 -12.834 19.283 1.00 12.43 ? 209 LEU A CB  1 
ATOM   1352 C  CG  . LEU A 1 201 ? 16.002 -12.062 20.441 1.00 14.37 ? 209 LEU A CG  1 
ATOM   1353 C  CD1 . LEU A 1 201 ? 14.996 -10.967 20.824 1.00 11.03 ? 209 LEU A CD1 1 
ATOM   1354 C  CD2 . LEU A 1 201 ? 16.086 -13.006 21.646 1.00 13.87 ? 209 LEU A CD2 1 
ATOM   1355 N  N   . GLN A 1 202 ? 16.864 -10.497 16.909 1.00 13.27 ? 210 GLN A N   1 
ATOM   1356 C  CA  . GLN A 1 202 ? 18.190 -10.052 16.458 1.00 13.62 ? 210 GLN A CA  1 
ATOM   1357 C  C   . GLN A 1 202 ? 18.987 -9.314  17.529 1.00 12.14 ? 210 GLN A C   1 
ATOM   1358 O  O   . GLN A 1 202 ? 20.247 -9.213  17.505 1.00 11.66 ? 210 GLN A O   1 
ATOM   1359 C  CB  . GLN A 1 202 ? 18.065 -9.223  15.140 1.00 12.81 ? 210 GLN A CB  1 
ATOM   1360 C  CG  . GLN A 1 202 ? 17.611 -10.089 13.977 1.00 14.53 ? 210 GLN A CG  1 
ATOM   1361 C  CD  . GLN A 1 202 ? 18.506 -11.138 13.388 1.00 18.22 ? 210 GLN A CD  1 
ATOM   1362 O  OE1 . GLN A 1 202 ? 18.357 -11.769 12.327 1.00 17.28 ? 210 GLN A OE1 1 
ATOM   1363 N  NE2 . GLN A 1 202 ? 19.743 -11.288 13.845 1.00 11.64 ? 210 GLN A NE2 1 
ATOM   1364 N  N   . GLY A 1 203 ? 18.267 -8.655  18.467 1.00 10.18 ? 211 GLY A N   1 
ATOM   1365 C  CA  . GLY A 1 203 ? 19.042 -7.905  19.419 1.00 7.93  ? 211 GLY A CA  1 
ATOM   1366 C  C   . GLY A 1 203 ? 18.484 -7.946  20.815 1.00 10.19 ? 211 GLY A C   1 
ATOM   1367 O  O   . GLY A 1 203 ? 17.353 -8.387  21.044 1.00 11.78 ? 211 GLY A O   1 
ATOM   1368 N  N   . ILE A 1 204 ? 19.300 -7.497  21.735 1.00 9.72  ? 212 ILE A N   1 
ATOM   1369 C  CA  . ILE A 1 204 ? 18.957 -7.337  23.149 1.00 8.79  ? 212 ILE A CA  1 
ATOM   1370 C  C   . ILE A 1 204 ? 19.237 -5.842  23.468 1.00 8.69  ? 212 ILE A C   1 
ATOM   1371 O  O   . ILE A 1 204 ? 20.319 -5.362  23.132 1.00 10.44 ? 212 ILE A O   1 
ATOM   1372 C  CB  . ILE A 1 204 ? 19.779 -8.269  24.100 1.00 4.68  ? 212 ILE A CB  1 
ATOM   1373 C  CG1 . ILE A 1 204 ? 19.475 -9.743  23.617 1.00 10.92 ? 212 ILE A CG1 1 
ATOM   1374 C  CG2 . ILE A 1 204 ? 19.440 -8.111  25.597 1.00 9.49  ? 212 ILE A CG2 1 
ATOM   1375 C  CD1 . ILE A 1 204 ? 20.535 -10.725 24.258 1.00 8.10  ? 212 ILE A CD1 1 
ATOM   1376 N  N   . VAL A 1 205 ? 18.359 -5.209  24.220 1.00 7.37  ? 213 VAL A N   1 
ATOM   1377 C  CA  . VAL A 1 205 ? 18.678 -3.832  24.643 1.00 11.00 ? 213 VAL A CA  1 
ATOM   1378 C  C   . VAL A 1 205 ? 19.931 -3.904  25.544 1.00 12.15 ? 213 VAL A C   1 
ATOM   1379 O  O   . VAL A 1 205 ? 19.811 -4.353  26.728 1.00 12.17 ? 213 VAL A O   1 
ATOM   1380 C  CB  . VAL A 1 205 ? 17.429 -3.244  25.333 1.00 14.75 ? 213 VAL A CB  1 
ATOM   1381 C  CG1 . VAL A 1 205 ? 17.674 -1.851  25.912 1.00 4.14  ? 213 VAL A CG1 1 
ATOM   1382 C  CG2 . VAL A 1 205 ? 16.199 -3.249  24.414 1.00 12.16 ? 213 VAL A CG2 1 
ATOM   1383 N  N   . SER A 1 206 ? 20.859 -2.982  25.199 1.00 10.14 ? 214 SER A N   1 
ATOM   1384 C  CA  . SER A 1 206 ? 22.108 -3.031  25.953 1.00 7.93  ? 214 SER A CA  1 
ATOM   1385 C  C   . SER A 1 206 ? 22.524 -1.691  26.543 1.00 11.07 ? 214 SER A C   1 
ATOM   1386 O  O   . SER A 1 206 ? 22.291 -1.476  27.788 1.00 10.04 ? 214 SER A O   1 
ATOM   1387 C  CB  . SER A 1 206 ? 23.109 -3.836  25.121 1.00 7.58  ? 214 SER A CB  1 
ATOM   1388 O  OG  . SER A 1 206 ? 24.329 -3.971  25.850 1.00 7.96  ? 214 SER A OG  1 
ATOM   1389 N  N   . TRP A 1 207 ? 23.035 -0.805  25.673 1.00 11.41 ? 215 TRP A N   1 
ATOM   1390 C  CA  . TRP A 1 207 ? 23.516 0.501   26.231 1.00 10.61 ? 215 TRP A CA  1 
ATOM   1391 C  C   . TRP A 1 207 ? 23.359 1.601   25.181 1.00 11.78 ? 215 TRP A C   1 
ATOM   1392 O  O   . TRP A 1 207 ? 22.875 1.439   24.047 1.00 9.89  ? 215 TRP A O   1 
ATOM   1393 C  CB  . TRP A 1 207 ? 24.987 0.308   26.564 1.00 11.25 ? 215 TRP A CB  1 
ATOM   1394 C  CG  . TRP A 1 207 ? 25.983 -0.022  25.523 1.00 17.19 ? 215 TRP A CG  1 
ATOM   1395 C  CD1 . TRP A 1 207 ? 26.320 -1.267  25.059 1.00 15.23 ? 215 TRP A CD1 1 
ATOM   1396 C  CD2 . TRP A 1 207 ? 26.930 0.845   24.838 1.00 16.29 ? 215 TRP A CD2 1 
ATOM   1397 N  NE1 . TRP A 1 207 ? 27.207 -1.223  23.999 1.00 15.30 ? 215 TRP A NE1 1 
ATOM   1398 C  CE2 . TRP A 1 207 ? 27.673 0.078   23.929 1.00 14.54 ? 215 TRP A CE2 1 
ATOM   1399 C  CE3 . TRP A 1 207 ? 27.101 2.226   24.851 1.00 16.80 ? 215 TRP A CE3 1 
ATOM   1400 C  CZ2 . TRP A 1 207 ? 28.527 0.613   22.976 1.00 15.18 ? 215 TRP A CZ2 1 
ATOM   1401 C  CZ3 . TRP A 1 207 ? 28.003 2.759   23.933 1.00 17.68 ? 215 TRP A CZ3 1 
ATOM   1402 C  CH2 . TRP A 1 207 ? 28.730 1.979   23.054 1.00 14.70 ? 215 TRP A CH2 1 
ATOM   1403 N  N   . GLY A 1 208 ? 23.786 2.797   25.575 1.00 12.33 ? 216 GLY A N   1 
ATOM   1404 C  CA  . GLY A 1 208 ? 23.858 3.993   24.725 1.00 14.16 ? 216 GLY A CA  1 
ATOM   1405 C  C   . GLY A 1 208 ? 24.485 5.125   25.600 1.00 15.90 ? 216 GLY A C   1 
ATOM   1406 O  O   . GLY A 1 208 ? 24.921 4.878   26.753 1.00 14.30 ? 216 GLY A O   1 
ATOM   1407 N  N   . SER A 1 209 ? 24.039 6.309   25.173 1.00 18.08 ? 217 SER A N   1 
ATOM   1408 C  CA  . SER A 1 209 ? 24.461 7.594   25.804 1.00 17.47 ? 217 SER A CA  1 
ATOM   1409 C  C   . SER A 1 209 ? 23.268 8.502   26.044 1.00 15.93 ? 217 SER A C   1 
ATOM   1410 O  O   . SER A 1 209 ? 22.735 9.036   25.030 1.00 18.75 ? 217 SER A O   1 
ATOM   1411 C  CB  . SER A 1 209 ? 25.403 8.316   24.831 1.00 21.30 ? 217 SER A CB  1 
ATOM   1412 O  OG  . SER A 1 209 ? 26.180 9.202   25.647 1.00 26.34 ? 217 SER A OG  1 
ATOM   1413 N  N   . GLY A 1 210 ? 22.734 8.541   27.250 1.00 15.01 ? 219 GLY A N   1 
ATOM   1414 C  CA  . GLY A 1 210 ? 21.441 9.228   27.493 1.00 18.40 ? 219 GLY A CA  1 
ATOM   1415 C  C   . GLY A 1 210 ? 20.278 8.509   26.788 1.00 19.33 ? 219 GLY A C   1 
ATOM   1416 O  O   . GLY A 1 210 ? 20.499 7.329   26.352 1.00 21.94 ? 219 GLY A O   1 
ATOM   1417 N  N   . CYS A 1 211 ? 19.122 9.113   26.547 1.00 16.44 ? 220 CYS A N   1 
ATOM   1418 C  CA  . CYS A 1 211 ? 18.068 8.470   25.750 1.00 17.03 ? 220 CYS A CA  1 
ATOM   1419 C  C   . CYS A 1 211 ? 17.626 9.405   24.633 1.00 17.87 ? 220 CYS A C   1 
ATOM   1420 O  O   . CYS A 1 211 ? 17.317 10.568  24.947 1.00 16.67 ? 220 CYS A O   1 
ATOM   1421 C  CB  . CYS A 1 211 ? 16.789 8.134   26.525 1.00 18.72 ? 220 CYS A CB  1 
ATOM   1422 S  SG  . CYS A 1 211 ? 17.304 7.180   27.966 1.00 19.37 ? 220 CYS A SG  1 
ATOM   1423 N  N   . ALA A 1 212 A 17.490 8.894   23.444 1.00 16.47 ? 221 ALA A N   1 
ATOM   1424 C  CA  . ALA A 1 212 A 17.001 9.661   22.312 1.00 16.13 ? 221 ALA A CA  1 
ATOM   1425 C  C   . ALA A 1 212 A 17.724 10.999  22.103 1.00 17.99 ? 221 ALA A C   1 
ATOM   1426 O  O   . ALA A 1 212 A 17.066 11.885  21.505 1.00 17.63 ? 221 ALA A O   1 
ATOM   1427 C  CB  . ALA A 1 212 A 15.523 9.871   22.557 1.00 18.07 ? 221 ALA A CB  1 
ATOM   1428 N  N   . GLN A 1 213 ? 19.024 11.038  22.294 1.00 18.15 ? 221 GLN A N   1 
ATOM   1429 C  CA  . GLN A 1 213 ? 19.930 12.166  21.986 1.00 17.67 ? 221 GLN A CA  1 
ATOM   1430 C  C   . GLN A 1 213 ? 20.343 12.022  20.517 1.00 17.82 ? 221 GLN A C   1 
ATOM   1431 O  O   . GLN A 1 213 ? 20.489 10.946  19.972 1.00 17.89 ? 221 GLN A O   1 
ATOM   1432 C  CB  . GLN A 1 213 ? 21.209 12.257  22.795 1.00 21.87 ? 221 GLN A CB  1 
ATOM   1433 C  CG  . GLN A 1 213 ? 21.108 12.464  24.285 1.00 26.98 ? 221 GLN A CG  1 
ATOM   1434 C  CD  . GLN A 1 213 ? 20.175 13.579  24.678 1.00 36.44 ? 221 GLN A CD  1 
ATOM   1435 O  OE1 . GLN A 1 213 ? 19.040 13.429  25.160 1.00 36.71 ? 221 GLN A OE1 1 
ATOM   1436 N  NE2 . GLN A 1 213 ? 20.622 14.811  24.341 1.00 34.89 ? 221 GLN A NE2 1 
ATOM   1437 N  N   . LYS A 1 214 ? 20.448 13.118  19.791 1.00 19.49 ? 222 LYS A N   1 
ATOM   1438 C  CA  . LYS A 1 214 ? 20.860 13.266  18.384 1.00 17.59 ? 222 LYS A CA  1 
ATOM   1439 C  C   . LYS A 1 214 ? 22.270 12.711  18.267 1.00 17.37 ? 222 LYS A C   1 
ATOM   1440 O  O   . LYS A 1 214 ? 22.989 12.818  19.304 1.00 16.16 ? 222 LYS A O   1 
ATOM   1441 C  CB  . LYS A 1 214 ? 20.930 14.797  18.143 1.00 23.42 ? 222 LYS A CB  1 
ATOM   1442 C  CG  . LYS A 1 214 ? 20.892 15.130  16.651 1.00 31.98 ? 222 LYS A CG  1 
ATOM   1443 C  CD  . LYS A 1 214 ? 21.968 16.176  16.358 1.00 45.00 ? 222 LYS A CD  1 
ATOM   1444 C  CE  . LYS A 1 214 ? 22.124 16.754  14.954 1.00 43.38 ? 222 LYS A CE  1 
ATOM   1445 N  NZ  . LYS A 1 214 ? 22.989 17.989  15.051 1.00 44.69 ? 222 LYS A NZ  1 
ATOM   1446 N  N   . ASN A 1 215 ? 22.508 12.008  17.202 1.00 16.37 ? 223 ASN A N   1 
ATOM   1447 C  CA  . ASN A 1 215 ? 23.669 11.217  16.827 1.00 17.05 ? 223 ASN A CA  1 
ATOM   1448 C  C   . ASN A 1 215 ? 24.216 10.219  17.837 1.00 17.48 ? 223 ASN A C   1 
ATOM   1449 O  O   . ASN A 1 215 ? 25.433 9.859   17.849 1.00 16.94 ? 223 ASN A O   1 
ATOM   1450 C  CB  . ASN A 1 215 ? 24.776 12.165  16.361 1.00 23.94 ? 223 ASN A CB  1 
ATOM   1451 C  CG  . ASN A 1 215 ? 24.330 13.335  15.532 1.00 25.78 ? 223 ASN A CG  1 
ATOM   1452 O  OD1 . ASN A 1 215 ? 24.601 14.423  16.092 1.00 34.99 ? 223 ASN A OD1 1 
ATOM   1453 N  ND2 . ASN A 1 215 ? 23.619 13.112  14.443 1.00 28.08 ? 223 ASN A ND2 1 
ATOM   1454 N  N   . LYS A 1 216 ? 23.348 9.805   18.777 1.00 17.29 ? 224 LYS A N   1 
ATOM   1455 C  CA  . LYS A 1 216 ? 23.705 8.832   19.828 1.00 14.94 ? 224 LYS A CA  1 
ATOM   1456 C  C   . LYS A 1 216 ? 22.607 7.736   19.904 1.00 15.53 ? 224 LYS A C   1 
ATOM   1457 O  O   . LYS A 1 216 ? 21.789 7.735   20.826 1.00 15.42 ? 224 LYS A O   1 
ATOM   1458 C  CB  . LYS A 1 216 ? 23.741 9.465   21.195 1.00 17.15 ? 224 LYS A CB  1 
ATOM   1459 C  CG  . LYS A 1 216 ? 24.539 10.744  21.383 1.00 19.15 ? 224 LYS A CG  1 
ATOM   1460 C  CD  . LYS A 1 216 ? 25.961 10.400  21.785 1.00 33.14 ? 224 LYS A CD  1 
ATOM   1461 C  CE  . LYS A 1 216 ? 26.757 10.067  20.515 1.00 36.01 ? 224 LYS A CE  1 
ATOM   1462 N  NZ  . LYS A 1 216 ? 28.217 10.392  20.795 1.00 38.39 ? 224 LYS A NZ  1 
ATOM   1463 N  N   . PRO A 1 217 ? 22.501 6.951   18.837 1.00 15.17 ? 225 PRO A N   1 
ATOM   1464 C  CA  . PRO A 1 217 ? 21.577 5.820   18.722 1.00 13.80 ? 225 PRO A CA  1 
ATOM   1465 C  C   . PRO A 1 217 ? 21.833 4.782   19.834 1.00 12.49 ? 225 PRO A C   1 
ATOM   1466 O  O   . PRO A 1 217 ? 22.928 4.734   20.428 1.00 12.35 ? 225 PRO A O   1 
ATOM   1467 C  CB  . PRO A 1 217 ? 21.915 5.187   17.377 1.00 12.46 ? 225 PRO A CB  1 
ATOM   1468 C  CG  . PRO A 1 217 ? 23.276 5.649   17.012 1.00 13.59 ? 225 PRO A CG  1 
ATOM   1469 C  CD  . PRO A 1 217 ? 23.562 6.914   17.777 1.00 15.65 ? 225 PRO A CD  1 
ATOM   1470 N  N   . GLY A 1 218 ? 20.833 3.938   20.065 1.00 11.98 ? 226 GLY A N   1 
ATOM   1471 C  CA  . GLY A 1 218 ? 21.001 2.843   21.068 1.00 10.09 ? 226 GLY A CA  1 
ATOM   1472 C  C   . GLY A 1 218 ? 21.871 1.763   20.440 1.00 9.33  ? 226 GLY A C   1 
ATOM   1473 O  O   . GLY A 1 218 ? 21.947 1.531   19.221 1.00 9.68  ? 226 GLY A O   1 
ATOM   1474 N  N   . VAL A 1 219 ? 22.560 1.022   21.287 1.00 9.16  ? 227 VAL A N   1 
ATOM   1475 C  CA  . VAL A 1 219 ? 23.445 -0.102  21.065 1.00 7.64  ? 227 VAL A CA  1 
ATOM   1476 C  C   . VAL A 1 219 ? 22.771 -1.378  21.644 1.00 9.14  ? 227 VAL A C   1 
ATOM   1477 O  O   . VAL A 1 219 ? 22.257 -1.473  22.784 1.00 7.40  ? 227 VAL A O   1 
ATOM   1478 C  CB  . VAL A 1 219 ? 24.884 0.162   21.478 1.00 13.35 ? 227 VAL A CB  1 
ATOM   1479 C  CG1 . VAL A 1 219 ? 25.830 -0.889  20.821 1.00 10.52 ? 227 VAL A CG1 1 
ATOM   1480 C  CG2 . VAL A 1 219 ? 25.400 1.569   21.141 1.00 12.59 ? 227 VAL A CG2 1 
ATOM   1481 N  N   . TYR A 1 220 ? 22.907 -2.384  20.817 1.00 8.03  ? 228 TYR A N   1 
ATOM   1482 C  CA  . TYR A 1 220 ? 22.264 -3.687  21.049 1.00 10.03 ? 228 TYR A CA  1 
ATOM   1483 C  C   . TYR A 1 220 ? 23.234 -4.843  20.942 1.00 10.91 ? 228 TYR A C   1 
ATOM   1484 O  O   . TYR A 1 220 ? 24.089 -4.821  20.038 1.00 9.70  ? 228 TYR A O   1 
ATOM   1485 C  CB  . TYR A 1 220 ? 21.038 -3.859  20.106 1.00 9.22  ? 228 TYR A CB  1 
ATOM   1486 C  CG  . TYR A 1 220 ? 20.063 -2.697  20.241 1.00 13.53 ? 228 TYR A CG  1 
ATOM   1487 C  CD1 . TYR A 1 220 ? 20.169 -1.533  19.472 1.00 15.44 ? 228 TYR A CD1 1 
ATOM   1488 C  CD2 . TYR A 1 220 ? 19.027 -2.763  21.176 1.00 11.95 ? 228 TYR A CD2 1 
ATOM   1489 C  CE1 . TYR A 1 220 ? 19.250 -0.496  19.681 1.00 13.46 ? 228 TYR A CE1 1 
ATOM   1490 C  CE2 . TYR A 1 220 ? 18.128 -1.741  21.427 1.00 11.82 ? 228 TYR A CE2 1 
ATOM   1491 C  CZ  . TYR A 1 220 ? 18.390 -0.521  20.767 1.00 15.28 ? 228 TYR A CZ  1 
ATOM   1492 O  OH  . TYR A 1 220 ? 17.525 0.536   20.962 1.00 11.61 ? 228 TYR A OH  1 
ATOM   1493 N  N   . THR A 1 221 ? 22.905 -5.864  21.756 1.00 9.50  ? 229 THR A N   1 
ATOM   1494 C  CA  . THR A 1 221 ? 23.682 -7.094  21.621 1.00 10.46 ? 229 THR A CA  1 
ATOM   1495 C  C   . THR A 1 221 ? 23.311 -7.831  20.324 1.00 11.47 ? 229 THR A C   1 
ATOM   1496 O  O   . THR A 1 221 ? 22.119 -8.055  20.102 1.00 10.53 ? 229 THR A O   1 
ATOM   1497 C  CB  . THR A 1 221 ? 23.444 -8.082  22.854 1.00 10.98 ? 229 THR A CB  1 
ATOM   1498 O  OG1 . THR A 1 221 ? 23.655 -7.275  24.051 1.00 5.89  ? 229 THR A OG1 1 
ATOM   1499 C  CG2 . THR A 1 221 ? 24.485 -9.240  22.776 1.00 10.26 ? 229 THR A CG2 1 
ATOM   1500 N  N   . LYS A 1 222 ? 24.304 -8.287  19.573 1.00 10.78 ? 230 LYS A N   1 
ATOM   1501 C  CA  . LYS A 1 222 ? 24.076 -8.907  18.276 1.00 11.99 ? 230 LYS A CA  1 
ATOM   1502 C  C   . LYS A 1 222 ? 23.857 -10.435 18.443 1.00 14.69 ? 230 LYS A C   1 
ATOM   1503 O  O   . LYS A 1 222 ? 24.841 -11.210 18.506 1.00 13.74 ? 230 LYS A O   1 
ATOM   1504 C  CB  . LYS A 1 222 ? 25.269 -8.645  17.422 1.00 11.72 ? 230 LYS A CB  1 
ATOM   1505 C  CG  . LYS A 1 222 ? 25.027 -8.976  15.938 1.00 13.94 ? 230 LYS A CG  1 
ATOM   1506 C  CD  . LYS A 1 222 ? 26.248 -8.392  15.198 1.00 17.09 ? 230 LYS A CD  1 
ATOM   1507 C  CE  . LYS A 1 222 ? 26.174 -8.776  13.739 1.00 21.66 ? 230 LYS A CE  1 
ATOM   1508 N  NZ  . LYS A 1 222 ? 27.175 -7.924  13.016 1.00 32.34 ? 230 LYS A NZ  1 
ATOM   1509 N  N   . VAL A 1 223 ? 22.581 -10.751 18.681 1.00 14.16 ? 231 VAL A N   1 
ATOM   1510 C  CA  . VAL A 1 223 ? 22.152 -12.120 19.026 1.00 14.07 ? 231 VAL A CA  1 
ATOM   1511 C  C   . VAL A 1 223 ? 22.618 -13.136 17.974 1.00 15.10 ? 231 VAL A C   1 
ATOM   1512 O  O   . VAL A 1 223 ? 22.943 -14.272 18.334 1.00 12.52 ? 231 VAL A O   1 
ATOM   1513 C  CB  . VAL A 1 223 ? 20.662 -12.232 19.326 1.00 12.76 ? 231 VAL A CB  1 
ATOM   1514 C  CG1 . VAL A 1 223 ? 20.197 -13.694 19.530 1.00 10.60 ? 231 VAL A CG1 1 
ATOM   1515 C  CG2 . VAL A 1 223 ? 20.142 -11.390 20.493 1.00 10.05 ? 231 VAL A CG2 1 
ATOM   1516 N  N   . CYS A 1 224 ? 22.620 -12.843 16.688 1.00 15.77 ? 232 CYS A N   1 
ATOM   1517 C  CA  . CYS A 1 224 ? 23.044 -13.880 15.733 1.00 15.34 ? 232 CYS A CA  1 
ATOM   1518 C  C   . CYS A 1 224 ? 24.417 -14.413 16.126 1.00 16.69 ? 232 CYS A C   1 
ATOM   1519 O  O   . CYS A 1 224 ? 24.745 -15.518 15.602 1.00 18.37 ? 232 CYS A O   1 
ATOM   1520 C  CB  . CYS A 1 224 ? 22.977 -13.395 14.294 1.00 15.55 ? 232 CYS A CB  1 
ATOM   1521 S  SG  . CYS A 1 224 ? 24.004 -11.950 13.920 1.00 17.04 ? 232 CYS A SG  1 
ATOM   1522 N  N   . ASN A 1 225 ? 25.304 -13.734 16.832 1.00 14.02 ? 233 ASN A N   1 
ATOM   1523 C  CA  . ASN A 1 225 ? 26.672 -14.181 17.112 1.00 13.65 ? 233 ASN A CA  1 
ATOM   1524 C  C   . ASN A 1 225 ? 26.635 -15.217 18.256 1.00 14.96 ? 233 ASN A C   1 
ATOM   1525 O  O   . ASN A 1 225 ? 27.706 -15.747 18.545 1.00 14.40 ? 233 ASN A O   1 
ATOM   1526 C  CB  . ASN A 1 225 ? 27.620 -13.065 17.539 1.00 15.29 ? 233 ASN A CB  1 
ATOM   1527 C  CG  . ASN A 1 225 ? 28.034 -12.142 16.399 1.00 18.20 ? 233 ASN A CG  1 
ATOM   1528 O  OD1 . ASN A 1 225 ? 27.695 -12.365 15.219 1.00 13.27 ? 233 ASN A OD1 1 
ATOM   1529 N  ND2 . ASN A 1 225 ? 28.932 -11.224 16.787 1.00 19.14 ? 233 ASN A ND2 1 
ATOM   1530 N  N   . TYR A 1 226 ? 25.496 -15.329 18.915 1.00 11.50 ? 234 TYR A N   1 
ATOM   1531 C  CA  . TYR A 1 226 ? 25.373 -16.136 20.130 1.00 10.94 ? 234 TYR A CA  1 
ATOM   1532 C  C   . TYR A 1 226 ? 24.491 -17.375 20.034 1.00 8.53  ? 234 TYR A C   1 
ATOM   1533 O  O   . TYR A 1 226 ? 24.183 -18.052 21.023 1.00 12.14 ? 234 TYR A O   1 
ATOM   1534 C  CB  . TYR A 1 226 ? 24.915 -15.216 21.307 1.00 12.43 ? 234 TYR A CB  1 
ATOM   1535 C  CG  . TYR A 1 226 ? 25.920 -14.109 21.611 1.00 16.76 ? 234 TYR A CG  1 
ATOM   1536 C  CD1 . TYR A 1 226 ? 27.032 -14.397 22.439 1.00 10.45 ? 234 TYR A CD1 1 
ATOM   1537 C  CD2 . TYR A 1 226 ? 25.728 -12.800 21.168 1.00 13.11 ? 234 TYR A CD2 1 
ATOM   1538 C  CE1 . TYR A 1 226 ? 27.852 -13.386 22.858 1.00 13.72 ? 234 TYR A CE1 1 
ATOM   1539 C  CE2 . TYR A 1 226 ? 26.735 -11.851 21.362 1.00 12.74 ? 234 TYR A CE2 1 
ATOM   1540 C  CZ  . TYR A 1 226 ? 27.742 -12.113 22.274 1.00 15.21 ? 234 TYR A CZ  1 
ATOM   1541 O  OH  . TYR A 1 226 ? 28.715 -11.163 22.526 1.00 20.40 ? 234 TYR A OH  1 
ATOM   1542 N  N   . VAL A 1 227 ? 23.963 -17.652 18.857 1.00 11.62 ? 235 VAL A N   1 
ATOM   1543 C  CA  . VAL A 1 227 ? 22.985 -18.741 18.675 1.00 11.98 ? 235 VAL A CA  1 
ATOM   1544 C  C   . VAL A 1 227 ? 23.545 -20.081 19.112 1.00 12.98 ? 235 VAL A C   1 
ATOM   1545 O  O   . VAL A 1 227 ? 22.830 -20.826 19.844 1.00 13.42 ? 235 VAL A O   1 
ATOM   1546 C  CB  . VAL A 1 227 ? 22.446 -18.663 17.228 1.00 10.78 ? 235 VAL A CB  1 
ATOM   1547 C  CG1 . VAL A 1 227 ? 21.817 -20.059 17.041 1.00 17.92 ? 235 VAL A CG1 1 
ATOM   1548 C  CG2 . VAL A 1 227 ? 21.479 -17.515 17.000 1.00 13.49 ? 235 VAL A CG2 1 
ATOM   1549 N  N   . SER A 1 228 ? 24.751 -20.441 18.622 1.00 12.75 ? 236 SER A N   1 
ATOM   1550 C  CA  . SER A 1 228 ? 25.410 -21.684 19.105 1.00 11.72 ? 236 SER A CA  1 
ATOM   1551 C  C   . SER A 1 228 ? 25.614 -21.780 20.608 1.00 12.32 ? 236 SER A C   1 
ATOM   1552 O  O   . SER A 1 228 ? 25.431 -22.869 21.216 1.00 13.13 ? 236 SER A O   1 
ATOM   1553 C  CB  . SER A 1 228 ? 26.834 -21.663 18.494 1.00 16.74 ? 236 SER A CB  1 
ATOM   1554 O  OG  . SER A 1 228 ? 26.523 -22.047 17.152 1.00 24.74 ? 236 SER A OG  1 
ATOM   1555 N  N   . TRP A 1 229 ? 26.083 -20.706 21.182 1.00 11.38 ? 237 TRP A N   1 
ATOM   1556 C  CA  . TRP A 1 229 ? 26.343 -20.576 22.624 1.00 12.85 ? 237 TRP A CA  1 
ATOM   1557 C  C   . TRP A 1 229 ? 25.000 -20.836 23.314 1.00 12.80 ? 237 TRP A C   1 
ATOM   1558 O  O   . TRP A 1 229 ? 24.927 -21.664 24.226 1.00 15.49 ? 237 TRP A O   1 
ATOM   1559 C  CB  . TRP A 1 229 ? 26.878 -19.180 22.999 1.00 14.63 ? 237 TRP A CB  1 
ATOM   1560 C  CG  . TRP A 1 229 ? 27.063 -18.974 24.483 1.00 13.85 ? 237 TRP A CG  1 
ATOM   1561 C  CD1 . TRP A 1 229 ? 28.039 -19.666 25.169 1.00 14.60 ? 237 TRP A CD1 1 
ATOM   1562 C  CD2 . TRP A 1 229 ? 26.229 -18.365 25.490 1.00 12.76 ? 237 TRP A CD2 1 
ATOM   1563 N  NE1 . TRP A 1 229 ? 27.894 -19.440 26.527 1.00 15.94 ? 237 TRP A NE1 1 
ATOM   1564 C  CE2 . TRP A 1 229 ? 26.799 -18.630 26.753 1.00 13.98 ? 237 TRP A CE2 1 
ATOM   1565 C  CE3 . TRP A 1 229 ? 25.061 -17.583 25.465 1.00 12.22 ? 237 TRP A CE3 1 
ATOM   1566 C  CZ2 . TRP A 1 229 ? 26.240 -18.176 27.944 1.00 10.91 ? 237 TRP A CZ2 1 
ATOM   1567 C  CZ3 . TRP A 1 229 ? 24.531 -16.990 26.598 1.00 12.64 ? 237 TRP A CZ3 1 
ATOM   1568 C  CH2 . TRP A 1 229 ? 25.223 -17.194 27.802 1.00 13.45 ? 237 TRP A CH2 1 
ATOM   1569 N  N   . ILE A 1 230 ? 23.968 -20.171 22.874 1.00 13.65 ? 238 ILE A N   1 
ATOM   1570 C  CA  . ILE A 1 230 ? 22.643 -20.331 23.500 1.00 12.77 ? 238 ILE A CA  1 
ATOM   1571 C  C   . ILE A 1 230 ? 22.231 -21.810 23.473 1.00 13.13 ? 238 ILE A C   1 
ATOM   1572 O  O   . ILE A 1 230 ? 21.892 -22.385 24.557 1.00 11.99 ? 238 ILE A O   1 
ATOM   1573 C  CB  . ILE A 1 230 ? 21.547 -19.398 22.821 1.00 11.33 ? 238 ILE A CB  1 
ATOM   1574 C  CG1 . ILE A 1 230 ? 21.821 -17.893 23.188 1.00 11.18 ? 238 ILE A CG1 1 
ATOM   1575 C  CG2 . ILE A 1 230 ? 20.184 -19.750 23.539 1.00 11.29 ? 238 ILE A CG2 1 
ATOM   1576 C  CD1 . ILE A 1 230 ? 20.951 -16.910 22.311 1.00 4.06  ? 238 ILE A CD1 1 
ATOM   1577 N  N   . LYS A 1 231 ? 22.357 -22.352 22.244 1.00 11.47 ? 239 LYS A N   1 
ATOM   1578 C  CA  . LYS A 1 231 ? 21.885 -23.725 22.023 1.00 14.53 ? 239 LYS A CA  1 
ATOM   1579 C  C   . LYS A 1 231 ? 22.669 -24.740 22.844 1.00 13.47 ? 239 LYS A C   1 
ATOM   1580 O  O   . LYS A 1 231 ? 22.118 -25.551 23.623 1.00 13.70 ? 239 LYS A O   1 
ATOM   1581 C  CB  . LYS A 1 231 ? 21.907 -24.108 20.545 1.00 20.86 ? 239 LYS A CB  1 
ATOM   1582 C  CG  . LYS A 1 231 ? 20.681 -23.577 19.784 1.00 28.55 ? 239 LYS A CG  1 
ATOM   1583 C  CD  . LYS A 1 231 ? 20.854 -23.799 18.277 1.00 35.24 ? 239 LYS A CD  1 
ATOM   1584 C  CE  . LYS A 1 231 ? 19.486 -23.895 17.612 1.00 44.73 ? 239 LYS A CE  1 
ATOM   1585 N  NZ  . LYS A 1 231 ? 19.511 -24.643 16.320 1.00 47.66 ? 239 LYS A NZ  1 
ATOM   1586 N  N   . GLN A 1 232 ? 23.970 -24.482 22.872 1.00 13.51 ? 240 GLN A N   1 
ATOM   1587 C  CA  . GLN A 1 232 ? 24.900 -25.345 23.594 1.00 11.11 ? 240 GLN A CA  1 
ATOM   1588 C  C   . GLN A 1 232 ? 24.705 -25.313 25.082 1.00 13.14 ? 240 GLN A C   1 
ATOM   1589 O  O   . GLN A 1 232 ? 24.718 -26.347 25.791 1.00 12.07 ? 240 GLN A O   1 
ATOM   1590 C  CB  . GLN A 1 232 ? 26.350 -25.224 23.224 1.00 13.62 ? 240 GLN A CB  1 
ATOM   1591 C  CG  . GLN A 1 232 ? 26.645 -25.744 21.820 1.00 16.28 ? 240 GLN A CG  1 
ATOM   1592 C  CD  . GLN A 1 232 ? 28.093 -25.477 21.452 1.00 20.14 ? 240 GLN A CD  1 
ATOM   1593 O  OE1 . GLN A 1 232 ? 28.707 -24.498 21.886 1.00 24.45 ? 240 GLN A OE1 1 
ATOM   1594 N  NE2 . GLN A 1 232 ? 28.502 -26.164 20.362 1.00 18.60 ? 240 GLN A NE2 1 
ATOM   1595 N  N   . THR A 1 233 ? 24.450 -24.094 25.534 1.00 11.88 ? 241 THR A N   1 
ATOM   1596 C  CA  . THR A 1 233 ? 24.279 -23.931 26.991 1.00 12.46 ? 241 THR A CA  1 
ATOM   1597 C  C   . THR A 1 233 ? 22.949 -24.477 27.479 1.00 13.40 ? 241 THR A C   1 
ATOM   1598 O  O   . THR A 1 233 ? 22.868 -25.053 28.579 1.00 14.90 ? 241 THR A O   1 
ATOM   1599 C  CB  . THR A 1 233 ? 24.401 -22.353 27.269 1.00 14.57 ? 241 THR A CB  1 
ATOM   1600 O  OG1 . THR A 1 233 ? 25.661 -21.933 26.609 1.00 14.22 ? 241 THR A OG1 1 
ATOM   1601 C  CG2 . THR A 1 233 ? 24.301 -22.174 28.778 1.00 12.35 ? 241 THR A CG2 1 
ATOM   1602 N  N   . ILE A 1 234 ? 21.919 -24.308 26.646 1.00 12.96 ? 242 ILE A N   1 
ATOM   1603 C  CA  . ILE A 1 234 ? 20.591 -24.848 27.019 1.00 16.23 ? 242 ILE A CA  1 
ATOM   1604 C  C   . ILE A 1 234 ? 20.604 -26.388 27.011 1.00 17.46 ? 242 ILE A C   1 
ATOM   1605 O  O   . ILE A 1 234 ? 19.827 -27.018 27.751 1.00 18.50 ? 242 ILE A O   1 
ATOM   1606 C  CB  . ILE A 1 234 ? 19.563 -24.314 25.953 1.00 14.16 ? 242 ILE A CB  1 
ATOM   1607 C  CG1 . ILE A 1 234 ? 19.373 -22.807 26.331 1.00 18.06 ? 242 ILE A CG1 1 
ATOM   1608 C  CG2 . ILE A 1 234 ? 18.189 -25.013 26.066 1.00 21.97 ? 242 ILE A CG2 1 
ATOM   1609 C  CD1 . ILE A 1 234 ? 18.106 -22.234 25.649 1.00 19.46 ? 242 ILE A CD1 1 
ATOM   1610 N  N   . ALA A 1 235 ? 21.295 -26.985 26.038 1.00 18.05 ? 243 ALA A N   1 
ATOM   1611 C  CA  . ALA A 1 235 ? 21.397 -28.448 25.931 1.00 18.20 ? 243 ALA A CA  1 
ATOM   1612 C  C   . ALA A 1 235 ? 22.021 -29.100 27.167 1.00 18.39 ? 243 ALA A C   1 
ATOM   1613 O  O   . ALA A 1 235 ? 21.604 -30.202 27.616 1.00 19.44 ? 243 ALA A O   1 
ATOM   1614 C  CB  . ALA A 1 235 ? 22.089 -28.873 24.658 1.00 15.11 ? 243 ALA A CB  1 
ATOM   1615 N  N   . SER A 1 236 ? 22.951 -28.399 27.776 1.00 16.45 ? 244 SER A N   1 
ATOM   1616 C  CA  . SER A 1 236 ? 23.730 -28.836 28.920 1.00 14.77 ? 244 SER A CA  1 
ATOM   1617 C  C   . SER A 1 236 ? 23.192 -28.420 30.257 1.00 14.26 ? 244 SER A C   1 
ATOM   1618 O  O   . SER A 1 236 ? 23.760 -28.815 31.307 1.00 13.42 ? 244 SER A O   1 
ATOM   1619 C  CB  . SER A 1 236 ? 25.205 -28.507 28.772 1.00 19.27 ? 244 SER A CB  1 
ATOM   1620 O  OG  . SER A 1 236 ? 25.494 -27.126 28.731 1.00 25.50 ? 244 SER A OG  1 
ATOM   1621 N  N   . ASN A 1 237 ? 22.034 -27.758 30.290 1.00 15.48 ? 245 ASN A N   1 
ATOM   1622 C  CA  . ASN A 1 237 ? 21.515 -27.267 31.590 1.00 14.75 ? 245 ASN A CA  1 
ATOM   1623 C  C   . ASN A 1 237 ? 20.044 -27.706 31.755 1.00 19.23 ? 245 ASN A C   1 
ATOM   1624 O  O   . ASN A 1 237 ? 19.400 -27.304 32.778 1.00 19.17 ? 245 ASN A O   1 
ATOM   1625 C  CB  . ASN A 1 237 ? 21.655 -25.758 31.813 1.00 15.30 ? 245 ASN A CB  1 
ATOM   1626 C  CG  . ASN A 1 237 ? 23.105 -25.371 32.137 1.00 19.22 ? 245 ASN A CG  1 
ATOM   1627 O  OD1 . ASN A 1 237 ? 23.429 -25.366 33.345 1.00 15.05 ? 245 ASN A OD1 1 
ATOM   1628 N  ND2 . ASN A 1 237 ? 24.001 -25.143 31.152 1.00 11.66 ? 245 ASN A ND2 1 
ATOM   1629 O  OXT . ASN A 1 237 ? 19.580 -28.522 30.939 1.00 21.10 ? 245 ASN A OXT 1 
HETATM 1630 S  S   . 0IV B 2 .   ? 24.073 5.725   29.947 1.00 54.01 ? 246 0IV A S   1 
HETATM 1631 O  O1S . 0IV B 2 .   ? 23.151 6.220   28.926 1.00 53.63 ? 246 0IV A O1S 1 
HETATM 1632 O  O2S . 0IV B 2 .   ? 23.361 4.977   30.981 1.00 52.86 ? 246 0IV A O2S 1 
HETATM 1633 N  N   . 0IV B 2 .   ? 25.157 4.682   29.214 1.00 50.82 ? 246 0IV A N   1 
HETATM 1634 C  CA  . 0IV B 2 .   ? 25.597 3.391   29.625 1.00 43.95 ? 246 0IV A CA  1 
HETATM 1635 C  CB  . 0IV B 2 .   ? 26.184 3.482   31.005 1.00 40.79 ? 246 0IV A CB  1 
HETATM 1636 C  CG  . 0IV B 2 .   ? 26.432 2.154   31.672 1.00 41.34 ? 246 0IV A CG  1 
HETATM 1637 C  CD  . 0IV B 2 .   ? 25.271 1.181   31.640 1.00 34.25 ? 246 0IV A CD  1 
HETATM 1638 C  C7  . 0IV B 2 .   ? 24.537 2.241   29.495 1.00 36.89 ? 246 0IV A C7  1 
HETATM 1639 O  O   . 0IV B 2 .   ? 23.776 2.382   28.531 1.00 33.41 ? 246 0IV A O   1 
HETATM 1640 N  N1  . 0IV B 2 .   ? 24.604 1.174   30.310 1.00 35.84 ? 246 0IV A N1  1 
HETATM 1641 C  CA1 . 0IV B 2 .   ? 23.702 0.053   29.947 1.00 34.87 ? 246 0IV A CA1 1 
HETATM 1642 C  C8  . 0IV B 2 .   ? 22.418 0.867   30.286 1.00 34.94 ? 246 0IV A C8  1 
HETATM 1643 O  O1  . 0IV B 2 .   ? 22.147 1.332   31.433 1.00 35.25 ? 246 0IV A O1  1 
HETATM 1644 C  C21 . 0IV B 2 .   ? 20.191 4.532   28.619 1.00 33.18 ? 246 0IV A C21 1 
HETATM 1645 C  C31 . 0IV B 2 .   ? 20.979 4.378   27.320 1.00 32.31 ? 246 0IV A C31 1 
HETATM 1646 N  N2  . 0IV B 2 .   ? 21.288 0.355   29.555 1.00 33.67 ? 246 0IV A N2  1 
HETATM 1647 C  CA2 . 0IV B 2 .   ? 19.955 0.525   29.958 1.00 34.11 ? 246 0IV A CA2 1 
HETATM 1648 C  C9  . 0IV B 2 .   ? 19.452 -0.507  31.073 1.00 34.45 ? 246 0IV A C9  1 
HETATM 1649 O  O2  . 0IV B 2 .   ? 18.056 -0.629  31.172 1.00 34.78 ? 246 0IV A O2  1 
HETATM 1650 C  CB1 . 0IV B 2 .   ? 19.195 0.804   28.765 1.00 33.80 ? 246 0IV A CB1 1 
HETATM 1651 C  CZ  . 0IV B 2 .   ? 19.990 3.754   25.054 1.00 31.78 ? 246 0IV A CZ  1 
HETATM 1652 N  NE  . 0IV B 2 .   ? 20.277 3.413   26.375 1.00 32.36 ? 246 0IV A NE  1 
HETATM 1653 C  C11 . 0IV B 2 .   ? 20.050 3.178   29.156 1.00 32.53 ? 246 0IV A C11 1 
HETATM 1654 C  CG1 . 0IV B 2 .   ? 19.338 2.158   28.191 1.00 32.73 ? 246 0IV A CG1 1 
HETATM 1655 C  CD1 . 0IV B 2 .   ? 20.124 2.085   26.865 1.00 32.43 ? 246 0IV A CD1 1 
HETATM 1656 N  NH1 . 0IV B 2 .   ? 19.541 2.875   24.212 1.00 30.36 ? 246 0IV A NH1 1 
HETATM 1657 N  NH2 . 0IV B 2 .   ? 20.130 4.970   24.720 1.00 31.03 ? 246 0IV A NH2 1 
HETATM 1658 CA CA  . CA  C 3 .   ? -0.285 -7.074  35.087 0.75 11.65 ? 701 CA  A CA  1 
HETATM 1659 O  O   . HOH D 4 .   ? -1.906 -9.321  31.622 0.94 9.36  ? 401 HOH A O   1 
HETATM 1660 O  O   . HOH D 4 .   ? 5.425  -10.135 30.304 0.89 9.16  ? 402 HOH A O   1 
HETATM 1661 O  O   . HOH D 4 .   ? 4.989  -12.810 27.881 0.84 10.79 ? 403 HOH A O   1 
HETATM 1662 O  O   . HOH D 4 .   ? 15.776 -10.180 25.007 0.81 7.73  ? 404 HOH A O   1 
HETATM 1663 O  O   . HOH D 4 .   ? 8.727  2.136   27.843 0.80 9.97  ? 405 HOH A O   1 
HETATM 1664 O  O   . HOH D 4 .   ? 9.840  -6.575  20.373 0.92 7.58  ? 406 HOH A O   1 
HETATM 1665 O  O   . HOH D 4 .   ? 7.493  -6.400  36.967 0.84 8.26  ? 407 HOH A O   1 
HETATM 1666 O  O   . HOH D 4 .   ? 25.265 -1.134  13.450 0.91 8.01  ? 408 HOH A O   1 
HETATM 1667 O  O   . HOH D 4 .   ? 0.951  -7.675  37.119 0.86 9.59  ? 409 HOH A O   1 
HETATM 1668 O  O   . HOH D 4 .   ? 11.436 -3.361  29.734 0.88 10.85 ? 410 HOH A O   1 
HETATM 1669 O  O   . HOH D 4 .   ? 7.131  5.764   23.971 0.77 16.80 ? 411 HOH A O   1 
HETATM 1670 O  O   . HOH D 4 .   ? 20.026 0.103   23.752 0.82 15.73 ? 412 HOH A O   1 
HETATM 1671 O  O   . HOH D 4 .   ? 27.617 -7.343  23.129 0.86 9.38  ? 413 HOH A O   1 
HETATM 1672 O  O   . HOH D 4 .   ? 17.345 2.671   19.648 0.84 10.81 ? 414 HOH A O   1 
HETATM 1673 O  O   . HOH D 4 .   ? 30.601 -13.414 33.323 0.86 19.07 ? 415 HOH A O   1 
HETATM 1674 O  O   . HOH D 4 .   ? 26.350 -4.995  24.055 0.83 10.19 ? 416 HOH A O   1 
HETATM 1675 O  O   . HOH D 4 .   ? 26.222 -8.565  35.701 0.78 22.50 ? 417 HOH A O   1 
HETATM 1676 O  O   . HOH D 4 .   ? 25.674 5.147   6.647  0.82 11.36 ? 418 HOH A O   1 
HETATM 1677 O  O   . HOH D 4 .   ? 17.763 5.930   18.483 0.84 11.76 ? 419 HOH A O   1 
HETATM 1678 O  O   . HOH D 4 .   ? 3.751  -9.278  27.297 0.79 11.25 ? 420 HOH A O   1 
HETATM 1679 O  O   . HOH D 4 .   ? 7.782  1.017   34.014 0.84 13.22 ? 421 HOH A O   1 
HETATM 1680 O  O   . HOH D 4 .   ? 26.484 -2.425  8.040  0.81 18.24 ? 422 HOH A O   1 
HETATM 1681 O  O   . HOH D 4 .   ? 21.631 -10.525 15.548 0.85 7.44  ? 423 HOH A O   1 
HETATM 1682 O  O   . HOH D 4 .   ? 0.689  -1.920  25.588 0.82 8.41  ? 424 HOH A O   1 
HETATM 1683 O  O   . HOH D 4 .   ? 30.227 -4.430  14.484 0.76 17.28 ? 425 HOH A O   1 
HETATM 1684 O  O   . HOH D 4 .   ? 16.093 -11.045 11.130 0.82 18.15 ? 426 HOH A O   1 
HETATM 1685 O  O   . HOH D 4 .   ? 17.129 -15.523 10.439 0.81 24.16 ? 427 HOH A O   1 
HETATM 1686 O  O   . HOH D 4 .   ? 18.895 7.854   20.185 0.85 14.05 ? 428 HOH A O   1 
HETATM 1687 O  O   . HOH D 4 .   ? 29.043 7.965   9.228  0.83 19.25 ? 429 HOH A O   1 
HETATM 1688 O  O   . HOH D 4 .   ? 1.465  -6.420  26.610 0.78 11.28 ? 430 HOH A O   1 
HETATM 1689 O  O   . HOH D 4 .   ? 28.901 0.126   7.050  0.71 21.45 ? 431 HOH A O   1 
HETATM 1690 O  O   . HOH D 4 .   ? -1.005 -16.898 30.601 0.76 13.03 ? 432 HOH A O   1 
HETATM 1691 O  O   . HOH D 4 .   ? 2.530  -7.891  24.974 0.88 10.87 ? 433 HOH A O   1 
HETATM 1692 O  O   . HOH D 4 .   ? 22.005 6.122   22.942 0.78 19.84 ? 434 HOH A O   1 
HETATM 1693 O  O   . HOH D 4 .   ? -3.199 -8.776  29.503 0.79 27.29 ? 435 HOH A O   1 
HETATM 1694 O  O   . HOH D 4 .   ? 27.697 -23.883 26.685 0.84 14.32 ? 436 HOH A O   1 
HETATM 1695 O  O   . HOH D 4 .   ? 20.904 8.857   23.209 0.80 13.73 ? 437 HOH A O   1 
HETATM 1696 O  O   . HOH D 4 .   ? 27.737 -18.759 19.551 0.74 19.38 ? 438 HOH A O   1 
HETATM 1697 O  O   . HOH D 4 .   ? 7.413  3.608   15.991 0.80 12.28 ? 439 HOH A O   1 
HETATM 1698 O  O   . HOH D 4 .   ? 13.033 -19.837 20.059 0.74 30.36 ? 440 HOH A O   1 
HETATM 1699 O  O   . HOH D 4 .   ? 7.736  -1.690  38.923 0.79 10.43 ? 441 HOH A O   1 
HETATM 1700 O  O   . HOH D 4 .   ? 4.389  -6.769  37.139 0.84 9.81  ? 442 HOH A O   1 
HETATM 1701 O  O   . HOH D 4 .   ? 16.804 -27.164 29.482 0.71 27.79 ? 443 HOH A O   1 
HETATM 1702 O  O   . HOH D 4 .   ? 37.154 -13.857 28.114 0.81 16.52 ? 444 HOH A O   1 
HETATM 1703 O  O   . HOH D 4 .   ? 34.950 -9.139  26.682 0.71 27.76 ? 445 HOH A O   1 
HETATM 1704 O  O   . HOH D 4 .   ? 5.294  1.553   36.233 0.72 22.94 ? 446 HOH A O   1 
HETATM 1705 O  O   . HOH D 4 .   ? 15.281 6.197   9.601  0.88 17.45 ? 447 HOH A O   1 
HETATM 1706 O  O   . HOH D 4 .   ? 32.933 -12.483 33.062 0.78 23.50 ? 448 HOH A O   1 
HETATM 1707 O  O   . HOH D 4 .   ? 8.062  -20.024 40.722 0.79 16.26 ? 449 HOH A O   1 
HETATM 1708 O  O   . HOH D 4 .   ? 29.710 -22.046 20.188 0.69 26.15 ? 451 HOH A O   1 
HETATM 1709 O  O   . HOH D 4 .   ? -5.347 -19.218 22.745 0.79 31.34 ? 452 HOH A O   1 
HETATM 1710 O  O   . HOH D 4 .   ? 32.803 5.418   10.413 0.77 18.42 ? 453 HOH A O   1 
HETATM 1711 O  O   . HOH D 4 .   ? 27.283 -5.645  35.289 0.72 15.56 ? 454 HOH A O   1 
HETATM 1712 O  O   . HOH D 4 .   ? 10.325 -6.438  11.479 0.76 24.60 ? 455 HOH A O   1 
HETATM 1713 O  O   . HOH D 4 .   ? 8.139  9.382   24.666 0.79 20.75 ? 456 HOH A O   1 
HETATM 1714 O  O   . HOH D 4 .   ? 18.472 8.572   11.619 0.77 22.49 ? 457 HOH A O   1 
HETATM 1715 O  O   . HOH D 4 .   ? -2.236 -1.404  26.505 0.82 11.05 ? 458 HOH A O   1 
HETATM 1716 O  O   . HOH D 4 .   ? 26.827 -8.938  11.035 0.65 21.07 ? 460 HOH A O   1 
HETATM 1717 O  O   . HOH D 4 .   ? 29.729 -23.316 24.093 0.71 25.71 ? 461 HOH A O   1 
HETATM 1718 O  O   . HOH D 4 .   ? 33.408 1.694   17.078 0.74 24.63 ? 462 HOH A O   1 
HETATM 1719 O  O   . HOH D 4 .   ? 8.868  -23.114 22.328 0.67 22.46 ? 463 HOH A O   1 
HETATM 1720 O  O   . HOH D 4 .   ? 17.174 -1.560  33.484 0.70 17.85 ? 464 HOH A O   1 
HETATM 1721 O  O   . HOH D 4 .   ? 35.634 -5.948  25.761 0.70 22.99 ? 466 HOH A O   1 
HETATM 1722 O  O   . HOH D 4 .   ? 19.300 -14.796 39.542 0.77 15.89 ? 467 HOH A O   1 
HETATM 1723 O  O   . HOH D 4 .   ? 9.144  -25.348 24.562 0.74 25.11 ? 468 HOH A O   1 
HETATM 1724 O  O   . HOH D 4 .   ? 33.412 -11.821 20.634 0.78 25.76 ? 469 HOH A O   1 
HETATM 1725 O  O   . HOH D 4 .   ? 17.896 -9.068  44.908 0.75 24.61 ? 470 HOH A O   1 
HETATM 1726 O  O   . HOH D 4 .   ? 6.653  -16.078 33.396 0.74 19.95 ? 471 HOH A O   1 
HETATM 1727 O  O   . HOH D 4 .   ? 13.132 10.790  15.774 0.76 33.05 ? 473 HOH A O   1 
HETATM 1728 O  O   . HOH D 4 .   ? 16.335 10.219  30.769 0.73 29.63 ? 474 HOH A O   1 
HETATM 1729 O  O   . HOH D 4 .   ? -6.122 -15.106 33.390 0.78 10.74 ? 475 HOH A O   1 
HETATM 1730 O  O   . HOH D 4 .   ? -3.219 -15.363 34.647 0.68 20.73 ? 476 HOH A O   1 
HETATM 1731 O  O   . HOH D 4 .   ? 33.765 -7.218  33.656 0.73 26.70 ? 478 HOH A O   1 
HETATM 1732 O  O   . HOH D 4 .   ? 21.949 13.122  26.772 0.77 36.75 ? 481 HOH A O   1 
HETATM 1733 O  O   . HOH D 4 .   ? 5.808  -18.929 19.225 0.64 27.59 ? 483 HOH A O   1 
HETATM 1734 O  O   . HOH D 4 .   ? 22.937 -2.770  3.330  0.67 34.30 ? 486 HOH A O   1 
HETATM 1735 O  O   . HOH D 4 .   ? 4.987  -20.378 21.293 0.73 23.76 ? 487 HOH A O   1 
HETATM 1736 O  O   . HOH D 4 .   ? 7.113  -11.589 15.474 0.72 26.28 ? 490 HOH A O   1 
HETATM 1737 O  O   . HOH D 4 .   ? 1.625  -11.182 26.720 0.79 11.34 ? 491 HOH A O   1 
HETATM 1738 O  O   . HOH D 4 .   ? 28.257 -17.801 33.715 0.78 23.15 ? 493 HOH A O   1 
HETATM 1739 O  O   . HOH D 4 .   ? 19.566 -26.591 22.767 0.72 16.32 ? 494 HOH A O   1 
HETATM 1740 O  O   . HOH D 4 .   ? 23.662 -28.847 34.052 0.77 27.26 ? 496 HOH A O   1 
HETATM 1741 O  O   . HOH D 4 .   ? 12.529 -4.272  27.601 0.86 11.21 ? 497 HOH A O   1 
HETATM 1742 O  O   . HOH D 4 .   ? 1.012  -6.844  39.452 0.78 16.32 ? 498 HOH A O   1 
HETATM 1743 O  O   . HOH D 4 .   ? 27.943 -25.793 28.404 0.79 11.50 ? 499 HOH A O   1 
HETATM 1744 O  O   . HOH D 4 .   ? -5.092 -17.201 31.553 0.74 18.52 ? 500 HOH A O   1 
HETATM 1745 O  O   . HOH D 4 .   ? 26.121 3.493   4.653  0.77 24.44 ? 501 HOH A O   1 
HETATM 1746 O  O   . HOH D 4 .   ? 24.768 -3.196  10.089 0.76 16.78 ? 502 HOH A O   1 
HETATM 1747 O  O   . HOH D 4 .   ? 7.018  -9.008  17.257 0.75 20.25 ? 503 HOH A O   1 
HETATM 1748 O  O   . HOH D 4 .   ? 17.326 5.856   11.038 0.83 18.40 ? 504 HOH A O   1 
HETATM 1749 O  O   . HOH D 4 .   ? 26.035 -28.689 24.424 0.68 18.31 ? 505 HOH A O   1 
HETATM 1750 O  O   . HOH D 4 .   ? -0.095 5.035   21.714 0.79 24.21 ? 506 HOH A O   1 
HETATM 1751 O  O   . HOH D 4 .   ? 32.085 -0.607  24.386 0.72 15.97 ? 507 HOH A O   1 
HETATM 1752 O  O   . HOH D 4 .   ? 14.639 -20.720 17.624 0.70 14.03 ? 508 HOH A O   1 
HETATM 1753 O  O   . HOH D 4 .   ? 22.048 -8.855  13.075 0.77 21.67 ? 509 HOH A O   1 
HETATM 1754 O  O   . HOH D 4 .   ? -2.669 -17.307 32.955 0.79 16.50 ? 510 HOH A O   1 
HETATM 1755 O  O   . HOH D 4 .   ? 34.595 -12.108 31.987 0.74 18.86 ? 511 HOH A O   1 
HETATM 1756 O  O   . HOH D 4 .   ? 26.903 8.729   13.432 0.75 21.54 ? 512 HOH A O   1 
HETATM 1757 O  O   . HOH D 4 .   ? 38.079 -3.859  30.693 0.81 25.41 ? 514 HOH A O   1 
HETATM 1758 O  O   . HOH D 4 .   ? 22.357 -9.502  43.448 0.65 17.35 ? 515 HOH A O   1 
HETATM 1759 O  O   . HOH D 4 .   ? 14.212 -25.369 36.720 0.74 23.87 ? 516 HOH A O   1 
HETATM 1760 O  O   . HOH D 4 .   ? 30.188 -14.601 20.410 0.77 24.82 ? 517 HOH A O   1 
HETATM 1761 O  O   . HOH D 4 .   ? 4.679  -13.052 43.531 0.74 20.26 ? 521 HOH A O   1 
HETATM 1762 O  O   . HOH D 4 .   ? 25.672 8.258   9.345  0.70 27.90 ? 522 HOH A O   1 
HETATM 1763 O  O   . HOH D 4 .   ? 25.190 -31.159 31.583 0.61 27.48 ? 525 HOH A O   1 
HETATM 1764 O  O   . HOH D 4 .   ? 24.333 -4.977  5.692  0.72 31.15 ? 526 HOH A O   1 
HETATM 1765 O  O   . HOH D 4 .   ? 32.197 -13.596 22.529 0.77 20.83 ? 527 HOH A O   1 
HETATM 1766 O  O   . HOH D 4 .   ? 28.921 5.516   5.943  0.73 20.69 ? 528 HOH A O   1 
HETATM 1767 O  O   . HOH D 4 .   ? 2.963  -20.893 34.451 0.77 20.06 ? 530 HOH A O   1 
HETATM 1768 O  O   . HOH D 4 .   ? 7.097  -22.946 39.570 0.78 15.99 ? 532 HOH A O   1 
HETATM 1769 O  O   . HOH D 4 .   ? 8.370  -10.061 43.120 0.71 28.93 ? 534 HOH A O   1 
HETATM 1770 O  O   . HOH D 4 .   ? 4.560  -22.995 35.641 0.76 18.05 ? 535 HOH A O   1 
HETATM 1771 O  O   . HOH D 4 .   ? 18.051 -28.194 24.151 0.71 22.45 ? 536 HOH A O   1 
HETATM 1772 O  O   . HOH D 4 .   ? 5.875  -15.020 18.975 0.72 22.31 ? 539 HOH A O   1 
HETATM 1773 O  O   . HOH D 4 .   ? 11.056 -26.146 26.638 0.75 26.75 ? 540 HOH A O   1 
HETATM 1774 O  O   . HOH D 4 .   ? 10.056 -19.991 19.274 0.74 24.81 ? 541 HOH A O   1 
HETATM 1775 O  O   . HOH D 4 .   ? 10.031 12.119  21.499 0.70 21.50 ? 542 HOH A O   1 
HETATM 1776 O  O   . HOH D 4 .   ? 7.319  7.619   36.858 0.68 22.22 ? 547 HOH A O   1 
HETATM 1777 O  O   . HOH D 4 .   ? 8.181  0.921   36.395 0.79 26.17 ? 550 HOH A O   1 
HETATM 1778 O  O   . HOH D 4 .   ? 8.977  -15.995 15.567 0.70 27.39 ? 553 HOH A O   1 
HETATM 1779 O  O   . HOH D 4 .   ? 18.860 1.247   33.484 0.70 25.20 ? 554 HOH A O   1 
HETATM 1780 O  O   . HOH D 4 .   ? 6.906  5.861   17.700 0.65 22.03 ? 555 HOH A O   1 
HETATM 1781 O  O   . HOH D 4 .   ? 34.780 2.853   10.948 0.69 22.10 ? 556 HOH A O   1 
HETATM 1782 O  O   . HOH D 4 .   ? 16.143 -10.253 8.675  0.65 28.49 ? 558 HOH A O   1 
HETATM 1783 O  O   . HOH D 4 .   ? 17.685 -8.429  7.024  0.69 26.03 ? 559 HOH A O   1 
HETATM 1784 O  O   . HOH D 4 .   ? 19.775 11.762  27.664 0.65 28.20 ? 561 HOH A O   1 
HETATM 1785 O  O   . HOH D 4 .   ? 12.690 -10.608 44.561 0.70 22.06 ? 562 HOH A O   1 
HETATM 1786 O  O   . HOH D 4 .   ? 29.093 2.562   28.448 0.69 31.96 ? 567 HOH A O   1 
HETATM 1787 O  O   . HOH D 4 .   ? -4.996 -2.469  24.572 0.77 29.26 ? 569 HOH A O   1 
HETATM 1788 O  O   . HOH D 4 .   ? 4.681  -26.591 37.163 0.76 31.73 ? 570 HOH A O   1 
HETATM 1789 O  O   . HOH D 4 .   ? 25.482 -25.874 18.641 0.78 30.76 ? 573 HOH A O   1 
HETATM 1790 O  O   . HOH D 4 .   ? -1.276 -7.214  32.706 0.72 13.16 ? 574 HOH A O   1 
HETATM 1791 O  O   . HOH D 4 .   ? 0.761  4.166   30.769 0.79 20.39 ? 576 HOH A O   1 
HETATM 1792 O  O   . HOH D 4 .   ? 21.378 -1.120  2.815  0.71 29.87 ? 577 HOH A O   1 
HETATM 1793 O  O   . HOH D 4 .   ? -4.553 -17.466 28.422 0.76 36.38 ? 583 HOH A O   1 
HETATM 1794 O  O   . HOH D 4 .   ? 3.326  -2.685  17.190 0.65 28.90 ? 584 HOH A O   1 
HETATM 1795 O  O   . HOH D 4 .   ? 31.689 -13.523 18.331 0.67 28.52 ? 585 HOH A O   1 
HETATM 1796 O  O   . HOH D 4 .   ? 22.826 -17.371 40.034 0.69 39.80 ? 587 HOH A O   1 
HETATM 1797 O  O   . HOH D 4 .   ? 29.857 -16.737 22.496 0.77 21.38 ? 588 HOH A O   1 
HETATM 1798 O  O   . HOH D 4 .   ? 4.477  -22.403 37.904 0.73 23.36 ? 589 HOH A O   1 
HETATM 1799 O  O   . HOH D 4 .   ? 33.112 1.250   26.304 0.68 25.05 ? 591 HOH A O   1 
HETATM 1800 O  O   . HOH D 4 .   ? -4.071 -3.421  29.753 0.64 24.75 ? 592 HOH A O   1 
HETATM 1801 O  O   . HOH D 4 .   ? 17.277 -15.210 41.183 0.73 19.37 ? 594 HOH A O   1 
HETATM 1802 O  O   . HOH D 4 .   ? 11.440 14.767  26.868 0.82 32.05 ? 595 HOH A O   1 
HETATM 1803 O  O   . HOH D 4 .   ? 20.855 -16.378 41.377 0.70 33.45 ? 596 HOH A O   1 
HETATM 1804 O  O   . HOH D 4 .   ? 13.703 13.107  12.010 0.69 30.47 ? 598 HOH A O   1 
HETATM 1805 O  O   . HOH D 4 .   ? 1.152  5.383   29.226 0.73 28.84 ? 602 HOH A O   1 
HETATM 1806 O  O   . HOH D 4 .   ? 30.912 -11.267 35.143 0.72 29.32 ? 603 HOH A O   1 
HETATM 1807 O  O   . HOH D 4 .   ? 31.182 -21.104 23.495 0.68 31.79 ? 610 HOH A O   1 
HETATM 1808 O  O   . HOH D 4 .   ? 12.852 11.071  13.388 0.73 33.25 ? 612 HOH A O   1 
HETATM 1809 O  O   . HOH D 4 .   ? 35.458 -6.746  17.361 0.69 26.40 ? 614 HOH A O   1 
HETATM 1810 O  O   . HOH D 4 .   ? 20.843 -26.364 35.236 0.70 30.83 ? 617 HOH A O   1 
HETATM 1811 O  O   . HOH D 4 .   ? 23.050 -16.791 13.636 0.78 36.12 ? 623 HOH A O   1 
HETATM 1812 O  O   . HOH D 4 .   ? 28.040 10.641  18.472 0.69 22.29 ? 626 HOH A O   1 
HETATM 1813 O  O   . HOH D 4 .   ? 3.483  -7.128  42.319 0.74 27.43 ? 627 HOH A O   1 
HETATM 1814 O  O   . HOH D 4 .   ? 26.197 -32.438 34.248 0.74 31.01 ? 634 HOH A O   1 
HETATM 1815 O  O   . HOH D 4 .   ? 16.834 -0.376  35.731 0.73 27.34 ? 644 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   LEU 1   2   ?   ?   ?   A . n 
A 1 2   GLY 2   3   ?   ?   ?   A . n 
A 1 3   ALA 3   4   ?   ?   ?   A . n 
A 1 4   ALA 4   5   ?   ?   ?   A . n 
A 1 5   VAL 5   6   ?   ?   ?   A . n 
A 1 6   ALA 6   7   ?   ?   ?   A . n 
A 1 7   PHE 7   8   ?   ?   ?   A . n 
A 1 8   PRO 8   9   ?   ?   ?   A . n 
A 1 9   VAL 9   10  ?   ?   ?   A . n 
A 1 10  ASP 10  11  ?   ?   ?   A . n 
A 1 11  ASP 11  12  ?   ?   ?   A . n 
A 1 12  ASP 12  13  ?   ?   ?   A . n 
A 1 13  ASP 13  14  ?   ?   ?   A . n 
A 1 14  LYS 14  15  ?   ?   ?   A . n 
A 1 15  ILE 15  16  16  ILE ILE A . n 
A 1 16  VAL 16  17  17  VAL VAL A . n 
A 1 17  GLY 17  18  18  GLY GLY A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  TYR 19  20  20  TYR TYR A . n 
A 1 20  THR 20  21  21  THR THR A . n 
A 1 21  CYS 21  22  22  CYS CYS A . n 
A 1 22  GLY 22  23  23  GLY GLY A . n 
A 1 23  ALA 23  24  24  ALA ALA A . n 
A 1 24  ASN 24  25  25  ASN ASN A . n 
A 1 25  THR 25  26  26  THR THR A . n 
A 1 26  VAL 26  27  27  VAL VAL A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  TYR 28  29  29  TYR TYR A . n 
A 1 29  GLN 29  30  30  GLN GLN A . n 
A 1 30  VAL 30  31  31  VAL VAL A . n 
A 1 31  SER 31  32  32  SER SER A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  ASN 33  34  34  ASN ASN A . n 
A 1 34  SER 34  37  37  SER SER A . n 
A 1 35  GLY 35  38  38  GLY GLY A . n 
A 1 36  TYR 36  39  39  TYR TYR A . n 
A 1 37  HIS 37  40  40  HIS HIS A . n 
A 1 38  PHE 38  41  41  PHE PHE A . n 
A 1 39  CYS 39  42  42  CYS CYS A . n 
A 1 40  GLY 40  43  43  GLY GLY A . n 
A 1 41  GLY 41  44  44  GLY GLY A . n 
A 1 42  SER 42  45  45  SER SER A . n 
A 1 43  LEU 43  46  46  LEU LEU A . n 
A 1 44  ILE 44  47  47  ILE ILE A . n 
A 1 45  ASN 45  48  48  ASN ASN A . n 
A 1 46  SER 46  49  49  SER SER A . n 
A 1 47  GLN 47  50  50  GLN GLN A . n 
A 1 48  TRP 48  51  51  TRP TRP A . n 
A 1 49  VAL 49  52  52  VAL VAL A . n 
A 1 50  VAL 50  53  53  VAL VAL A . n 
A 1 51  SER 51  54  54  SER SER A . n 
A 1 52  ALA 52  55  55  ALA ALA A . n 
A 1 53  ALA 53  56  56  ALA ALA A . n 
A 1 54  HIS 54  57  57  HIS HIS A . n 
A 1 55  CYS 55  58  58  CYS CYS A . n 
A 1 56  TYR 56  59  59  TYR TYR A . n 
A 1 57  LYS 57  60  60  LYS LYS A . n 
A 1 58  SER 58  61  61  SER SER A . n 
A 1 59  GLY 59  62  62  GLY GLY A . n 
A 1 60  ILE 60  63  63  ILE ILE A . n 
A 1 61  GLN 61  64  64  GLN GLN A . n 
A 1 62  VAL 62  65  65  VAL VAL A . n 
A 1 63  ARG 63  66  66  ARG ARG A . n 
A 1 64  LEU 64  67  67  LEU LEU A . n 
A 1 65  GLY 65  69  69  GLY GLY A . n 
A 1 66  GLU 66  70  70  GLU GLU A . n 
A 1 67  ASP 67  71  71  ASP ASP A . n 
A 1 68  ASN 68  72  72  ASN ASN A . n 
A 1 69  ILE 69  73  73  ILE ILE A . n 
A 1 70  ASN 70  74  74  ASN ASN A . n 
A 1 71  VAL 71  75  75  VAL VAL A . n 
A 1 72  VAL 72  76  76  VAL VAL A . n 
A 1 73  GLU 73  77  77  GLU GLU A . n 
A 1 74  GLY 74  78  78  GLY GLY A . n 
A 1 75  ASN 75  79  79  ASN ASN A . n 
A 1 76  GLU 76  80  80  GLU GLU A . n 
A 1 77  GLN 77  81  81  GLN GLN A . n 
A 1 78  PHE 78  82  82  PHE PHE A . n 
A 1 79  ILE 79  83  83  ILE ILE A . n 
A 1 80  SER 80  84  84  SER SER A . n 
A 1 81  ALA 81  85  85  ALA ALA A . n 
A 1 82  SER 82  86  86  SER SER A . n 
A 1 83  LYS 83  87  87  LYS LYS A . n 
A 1 84  SER 84  88  88  SER SER A . n 
A 1 85  ILE 85  89  89  ILE ILE A . n 
A 1 86  VAL 86  90  90  VAL VAL A . n 
A 1 87  HIS 87  91  91  HIS HIS A . n 
A 1 88  PRO 88  92  92  PRO PRO A . n 
A 1 89  SER 89  93  93  SER SER A . n 
A 1 90  TYR 90  94  94  TYR TYR A . n 
A 1 91  ASN 91  95  95  ASN ASN A . n 
A 1 92  SER 92  96  96  SER SER A . n 
A 1 93  ASN 93  97  97  ASN ASN A . n 
A 1 94  THR 94  98  98  THR THR A . n 
A 1 95  LEU 95  99  99  LEU LEU A . n 
A 1 96  ASN 96  100 100 ASN ASN A . n 
A 1 97  ASN 97  101 101 ASN ASN A . n 
A 1 98  ASP 98  102 102 ASP ASP A . n 
A 1 99  ILE 99  103 103 ILE ILE A . n 
A 1 100 MET 100 104 104 MET MET A . n 
A 1 101 LEU 101 105 105 LEU LEU A . n 
A 1 102 ILE 102 106 106 ILE ILE A . n 
A 1 103 LYS 103 107 107 LYS LYS A . n 
A 1 104 LEU 104 108 108 LEU LEU A . n 
A 1 105 LYS 105 109 109 LYS LYS A . n 
A 1 106 SER 106 110 110 SER SER A . n 
A 1 107 ALA 107 111 111 ALA ALA A . n 
A 1 108 ALA 108 112 112 ALA ALA A . n 
A 1 109 SER 109 113 113 SER SER A . n 
A 1 110 LEU 110 114 114 LEU LEU A . n 
A 1 111 ASN 111 115 115 ASN ASN A . n 
A 1 112 SER 112 116 116 SER SER A . n 
A 1 113 ARG 113 117 117 ARG ARG A . n 
A 1 114 VAL 114 118 118 VAL VAL A . n 
A 1 115 ALA 115 119 119 ALA ALA A . n 
A 1 116 SER 116 120 120 SER SER A . n 
A 1 117 ILE 117 121 121 ILE ILE A . n 
A 1 118 SER 118 122 122 SER SER A . n 
A 1 119 LEU 119 123 123 LEU LEU A . n 
A 1 120 PRO 120 124 124 PRO PRO A . n 
A 1 121 THR 121 125 125 THR THR A . n 
A 1 122 SER 122 127 127 SER SER A . n 
A 1 123 CYS 123 128 128 CYS CYS A . n 
A 1 124 ALA 124 129 129 ALA ALA A . n 
A 1 125 SER 125 130 130 SER SER A . n 
A 1 126 ALA 126 132 132 ALA ALA A . n 
A 1 127 GLY 127 133 133 GLY GLY A . n 
A 1 128 THR 128 134 134 THR THR A . n 
A 1 129 GLN 129 135 135 GLN GLN A . n 
A 1 130 CYS 130 136 136 CYS CYS A . n 
A 1 131 LEU 131 137 137 LEU LEU A . n 
A 1 132 ILE 132 138 138 ILE ILE A . n 
A 1 133 SER 133 139 139 SER SER A . n 
A 1 134 GLY 134 140 140 GLY GLY A . n 
A 1 135 TRP 135 141 141 TRP TRP A . n 
A 1 136 GLY 136 142 142 GLY GLY A . n 
A 1 137 ASN 137 143 143 ASN ASN A . n 
A 1 138 THR 138 144 144 THR THR A . n 
A 1 139 LYS 139 145 145 LYS LYS A . n 
A 1 140 SER 140 146 146 SER SER A . n 
A 1 141 SER 141 147 147 SER SER A . n 
A 1 142 GLY 142 148 148 GLY GLY A . n 
A 1 143 THR 143 149 149 THR THR A . n 
A 1 144 SER 144 150 150 SER SER A . n 
A 1 145 TYR 145 151 151 TYR TYR A . n 
A 1 146 PRO 146 152 152 PRO PRO A . n 
A 1 147 ASP 147 153 153 ASP ASP A . n 
A 1 148 VAL 148 154 154 VAL VAL A . n 
A 1 149 LEU 149 155 155 LEU LEU A . n 
A 1 150 LYS 150 156 156 LYS LYS A . n 
A 1 151 CYS 151 157 157 CYS CYS A . n 
A 1 152 LEU 152 158 158 LEU LEU A . n 
A 1 153 LYS 153 159 159 LYS LYS A . n 
A 1 154 ALA 154 160 160 ALA ALA A . n 
A 1 155 PRO 155 161 161 PRO PRO A . n 
A 1 156 ILE 156 162 162 ILE ILE A . n 
A 1 157 LEU 157 163 163 LEU LEU A . n 
A 1 158 SER 158 164 164 SER SER A . n 
A 1 159 ASP 159 165 165 ASP ASP A . n 
A 1 160 SER 160 166 166 SER SER A . n 
A 1 161 SER 161 167 167 SER SER A . n 
A 1 162 CYS 162 168 168 CYS CYS A . n 
A 1 163 LYS 163 169 169 LYS LYS A . n 
A 1 164 SER 164 170 170 SER SER A . n 
A 1 165 ALA 165 171 171 ALA ALA A . n 
A 1 166 TYR 166 172 172 TYR TYR A . n 
A 1 167 PRO 167 173 173 PRO PRO A . n 
A 1 168 GLY 168 174 174 GLY GLY A . n 
A 1 169 GLN 169 175 175 GLN GLN A . n 
A 1 170 ILE 170 176 176 ILE ILE A . n 
A 1 171 THR 171 177 177 THR THR A . n 
A 1 172 SER 172 178 178 SER SER A . n 
A 1 173 ASN 173 179 179 ASN ASN A . n 
A 1 174 MET 174 180 180 MET MET A . n 
A 1 175 PHE 175 181 181 PHE PHE A . n 
A 1 176 CYS 176 182 182 CYS CYS A . n 
A 1 177 ALA 177 183 183 ALA ALA A . n 
A 1 178 GLY 178 184 184 GLY GLY A A n 
A 1 179 TYR 179 184 184 TYR TYR A . n 
A 1 180 LEU 180 185 185 LEU LEU A . n 
A 1 181 GLU 181 186 186 GLU GLU A . n 
A 1 182 GLY 182 187 187 GLY GLY A . n 
A 1 183 GLY 183 188 188 GLY GLY A A n 
A 1 184 LYS 184 188 188 LYS LYS A . n 
A 1 185 ASP 185 189 189 ASP ASP A . n 
A 1 186 SER 186 190 190 SER SER A . n 
A 1 187 CYS 187 191 191 CYS CYS A . n 
A 1 188 GLN 188 192 192 GLN GLN A . n 
A 1 189 GLY 189 193 193 GLY GLY A . n 
A 1 190 ASP 190 194 194 ASP ASP A . n 
A 1 191 SER 191 195 195 SER SER A . n 
A 1 192 GLY 192 196 196 GLY GLY A . n 
A 1 193 GLY 193 197 197 GLY GLY A . n 
A 1 194 PRO 194 198 198 PRO PRO A . n 
A 1 195 VAL 195 199 199 VAL VAL A . n 
A 1 196 VAL 196 200 200 VAL VAL A . n 
A 1 197 CYS 197 201 201 CYS CYS A . n 
A 1 198 SER 198 202 202 SER SER A . n 
A 1 199 GLY 199 203 203 GLY GLY A . n 
A 1 200 LYS 200 204 204 LYS LYS A . n 
A 1 201 LEU 201 209 209 LEU LEU A . n 
A 1 202 GLN 202 210 210 GLN GLN A . n 
A 1 203 GLY 203 211 211 GLY GLY A . n 
A 1 204 ILE 204 212 212 ILE ILE A . n 
A 1 205 VAL 205 213 213 VAL VAL A . n 
A 1 206 SER 206 214 214 SER SER A . n 
A 1 207 TRP 207 215 215 TRP TRP A . n 
A 1 208 GLY 208 216 216 GLY GLY A . n 
A 1 209 SER 209 217 217 SER SER A . n 
A 1 210 GLY 210 219 219 GLY GLY A . n 
A 1 211 CYS 211 220 220 CYS CYS A . n 
A 1 212 ALA 212 221 221 ALA ALA A A n 
A 1 213 GLN 213 221 221 GLN GLN A . n 
A 1 214 LYS 214 222 222 LYS LYS A . n 
A 1 215 ASN 215 223 223 ASN ASN A . n 
A 1 216 LYS 216 224 224 LYS LYS A . n 
A 1 217 PRO 217 225 225 PRO PRO A . n 
A 1 218 GLY 218 226 226 GLY GLY A . n 
A 1 219 VAL 219 227 227 VAL VAL A . n 
A 1 220 TYR 220 228 228 TYR TYR A . n 
A 1 221 THR 221 229 229 THR THR A . n 
A 1 222 LYS 222 230 230 LYS LYS A . n 
A 1 223 VAL 223 231 231 VAL VAL A . n 
A 1 224 CYS 224 232 232 CYS CYS A . n 
A 1 225 ASN 225 233 233 ASN ASN A . n 
A 1 226 TYR 226 234 234 TYR TYR A . n 
A 1 227 VAL 227 235 235 VAL VAL A . n 
A 1 228 SER 228 236 236 SER SER A . n 
A 1 229 TRP 229 237 237 TRP TRP A . n 
A 1 230 ILE 230 238 238 ILE ILE A . n 
A 1 231 LYS 231 239 239 LYS LYS A . n 
A 1 232 GLN 232 240 240 GLN GLN A . n 
A 1 233 THR 233 241 241 THR THR A . n 
A 1 234 ILE 234 242 242 ILE ILE A . n 
A 1 235 ALA 235 243 243 ALA ALA A . n 
A 1 236 SER 236 244 244 SER SER A . n 
A 1 237 ASN 237 245 245 ASN ASN A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 0IV 1   246 1   0IV SO2 A . 
C 3 CA  1   701 701 CA  CA  A . 
D 4 HOH 1   401 401 HOH HOH A . 
D 4 HOH 2   402 402 HOH HOH A . 
D 4 HOH 3   403 403 HOH HOH A . 
D 4 HOH 4   404 404 HOH HOH A . 
D 4 HOH 5   405 405 HOH HOH A . 
D 4 HOH 6   406 406 HOH HOH A . 
D 4 HOH 7   407 407 HOH HOH A . 
D 4 HOH 8   408 408 HOH HOH A . 
D 4 HOH 9   409 409 HOH HOH A . 
D 4 HOH 10  410 410 HOH HOH A . 
D 4 HOH 11  411 411 HOH HOH A . 
D 4 HOH 12  412 412 HOH HOH A . 
D 4 HOH 13  413 413 HOH HOH A . 
D 4 HOH 14  414 414 HOH HOH A . 
D 4 HOH 15  415 415 HOH HOH A . 
D 4 HOH 16  416 416 HOH HOH A . 
D 4 HOH 17  417 417 HOH HOH A . 
D 4 HOH 18  418 418 HOH HOH A . 
D 4 HOH 19  419 419 HOH HOH A . 
D 4 HOH 20  420 420 HOH HOH A . 
D 4 HOH 21  421 421 HOH HOH A . 
D 4 HOH 22  422 422 HOH HOH A . 
D 4 HOH 23  423 423 HOH HOH A . 
D 4 HOH 24  424 424 HOH HOH A . 
D 4 HOH 25  425 425 HOH HOH A . 
D 4 HOH 26  426 426 HOH HOH A . 
D 4 HOH 27  427 427 HOH HOH A . 
D 4 HOH 28  428 428 HOH HOH A . 
D 4 HOH 29  429 429 HOH HOH A . 
D 4 HOH 30  430 430 HOH HOH A . 
D 4 HOH 31  431 431 HOH HOH A . 
D 4 HOH 32  432 432 HOH HOH A . 
D 4 HOH 33  433 433 HOH HOH A . 
D 4 HOH 34  434 434 HOH HOH A . 
D 4 HOH 35  435 435 HOH HOH A . 
D 4 HOH 36  436 436 HOH HOH A . 
D 4 HOH 37  437 437 HOH HOH A . 
D 4 HOH 38  438 438 HOH HOH A . 
D 4 HOH 39  439 439 HOH HOH A . 
D 4 HOH 40  440 440 HOH HOH A . 
D 4 HOH 41  441 441 HOH HOH A . 
D 4 HOH 42  442 442 HOH HOH A . 
D 4 HOH 43  443 443 HOH HOH A . 
D 4 HOH 44  444 444 HOH HOH A . 
D 4 HOH 45  445 445 HOH HOH A . 
D 4 HOH 46  446 446 HOH HOH A . 
D 4 HOH 47  447 447 HOH HOH A . 
D 4 HOH 48  448 448 HOH HOH A . 
D 4 HOH 49  449 449 HOH HOH A . 
D 4 HOH 50  451 451 HOH HOH A . 
D 4 HOH 51  452 452 HOH HOH A . 
D 4 HOH 52  453 453 HOH HOH A . 
D 4 HOH 53  454 454 HOH HOH A . 
D 4 HOH 54  455 455 HOH HOH A . 
D 4 HOH 55  456 456 HOH HOH A . 
D 4 HOH 56  457 457 HOH HOH A . 
D 4 HOH 57  458 458 HOH HOH A . 
D 4 HOH 58  460 460 HOH HOH A . 
D 4 HOH 59  461 461 HOH HOH A . 
D 4 HOH 60  462 462 HOH HOH A . 
D 4 HOH 61  463 463 HOH HOH A . 
D 4 HOH 62  464 464 HOH HOH A . 
D 4 HOH 63  466 466 HOH HOH A . 
D 4 HOH 64  467 467 HOH HOH A . 
D 4 HOH 65  468 468 HOH HOH A . 
D 4 HOH 66  469 469 HOH HOH A . 
D 4 HOH 67  470 470 HOH HOH A . 
D 4 HOH 68  471 471 HOH HOH A . 
D 4 HOH 69  473 473 HOH HOH A . 
D 4 HOH 70  474 474 HOH HOH A . 
D 4 HOH 71  475 475 HOH HOH A . 
D 4 HOH 72  476 476 HOH HOH A . 
D 4 HOH 73  478 478 HOH HOH A . 
D 4 HOH 74  481 481 HOH HOH A . 
D 4 HOH 75  483 483 HOH HOH A . 
D 4 HOH 76  486 486 HOH HOH A . 
D 4 HOH 77  487 487 HOH HOH A . 
D 4 HOH 78  490 490 HOH HOH A . 
D 4 HOH 79  491 491 HOH HOH A . 
D 4 HOH 80  493 493 HOH HOH A . 
D 4 HOH 81  494 494 HOH HOH A . 
D 4 HOH 82  496 496 HOH HOH A . 
D 4 HOH 83  497 497 HOH HOH A . 
D 4 HOH 84  498 498 HOH HOH A . 
D 4 HOH 85  499 499 HOH HOH A . 
D 4 HOH 86  500 500 HOH HOH A . 
D 4 HOH 87  501 501 HOH HOH A . 
D 4 HOH 88  502 502 HOH HOH A . 
D 4 HOH 89  503 503 HOH HOH A . 
D 4 HOH 90  504 504 HOH HOH A . 
D 4 HOH 91  505 505 HOH HOH A . 
D 4 HOH 92  506 506 HOH HOH A . 
D 4 HOH 93  507 507 HOH HOH A . 
D 4 HOH 94  508 508 HOH HOH A . 
D 4 HOH 95  509 509 HOH HOH A . 
D 4 HOH 96  510 510 HOH HOH A . 
D 4 HOH 97  511 511 HOH HOH A . 
D 4 HOH 98  512 512 HOH HOH A . 
D 4 HOH 99  514 514 HOH HOH A . 
D 4 HOH 100 515 515 HOH HOH A . 
D 4 HOH 101 516 516 HOH HOH A . 
D 4 HOH 102 517 517 HOH HOH A . 
D 4 HOH 103 521 521 HOH HOH A . 
D 4 HOH 104 522 522 HOH HOH A . 
D 4 HOH 105 525 525 HOH HOH A . 
D 4 HOH 106 526 526 HOH HOH A . 
D 4 HOH 107 527 527 HOH HOH A . 
D 4 HOH 108 528 528 HOH HOH A . 
D 4 HOH 109 530 530 HOH HOH A . 
D 4 HOH 110 532 532 HOH HOH A . 
D 4 HOH 111 534 534 HOH HOH A . 
D 4 HOH 112 535 535 HOH HOH A . 
D 4 HOH 113 536 536 HOH HOH A . 
D 4 HOH 114 539 539 HOH HOH A . 
D 4 HOH 115 540 540 HOH HOH A . 
D 4 HOH 116 541 541 HOH HOH A . 
D 4 HOH 117 542 542 HOH HOH A . 
D 4 HOH 118 547 547 HOH HOH A . 
D 4 HOH 119 550 550 HOH HOH A . 
D 4 HOH 120 553 553 HOH HOH A . 
D 4 HOH 121 554 554 HOH HOH A . 
D 4 HOH 122 555 555 HOH HOH A . 
D 4 HOH 123 556 556 HOH HOH A . 
D 4 HOH 124 558 558 HOH HOH A . 
D 4 HOH 125 559 559 HOH HOH A . 
D 4 HOH 126 561 561 HOH HOH A . 
D 4 HOH 127 562 562 HOH HOH A . 
D 4 HOH 128 567 567 HOH HOH A . 
D 4 HOH 129 569 569 HOH HOH A . 
D 4 HOH 130 570 570 HOH HOH A . 
D 4 HOH 131 573 573 HOH HOH A . 
D 4 HOH 132 574 574 HOH HOH A . 
D 4 HOH 133 576 576 HOH HOH A . 
D 4 HOH 134 577 577 HOH HOH A . 
D 4 HOH 135 583 583 HOH HOH A . 
D 4 HOH 136 584 584 HOH HOH A . 
D 4 HOH 137 585 585 HOH HOH A . 
D 4 HOH 138 587 587 HOH HOH A . 
D 4 HOH 139 588 588 HOH HOH A . 
D 4 HOH 140 589 589 HOH HOH A . 
D 4 HOH 141 591 591 HOH HOH A . 
D 4 HOH 142 592 592 HOH HOH A . 
D 4 HOH 143 594 594 HOH HOH A . 
D 4 HOH 144 595 595 HOH HOH A . 
D 4 HOH 145 596 596 HOH HOH A . 
D 4 HOH 146 598 598 HOH HOH A . 
D 4 HOH 147 602 602 HOH HOH A . 
D 4 HOH 148 603 603 HOH HOH A . 
D 4 HOH 149 610 610 HOH HOH A . 
D 4 HOH 150 612 612 HOH HOH A . 
D 4 HOH 151 614 614 HOH HOH A . 
D 4 HOH 152 617 617 HOH HOH A . 
D 4 HOH 153 623 623 HOH HOH A . 
D 4 HOH 154 626 626 HOH HOH A . 
D 4 HOH 155 627 627 HOH HOH A . 
D 4 HOH 156 634 634 HOH HOH A . 
D 4 HOH 157 644 644 HOH HOH A . 
# 
_pdbx_molecule_features.prd_id    PRD_000324 
_pdbx_molecule_features.name      
'N-(benzylsulfonyl)-L-norvalyl-N-{(1R)-2-[(3R)-1-carbamimidoylpiperidin-3-yl]-1-formylethyl}glycinamide' 
_pdbx_molecule_features.type      Peptide-like 
_pdbx_molecule_features.class     Inhibitor 
_pdbx_molecule_features.details   ? 
# 
_pdbx_molecule.instance_id   1 
_pdbx_molecule.prd_id        PRD_000324 
_pdbx_molecule.asym_id       B 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE1 ? A GLU 66 ? A GLU 70  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? A VAL 71 ? A VAL 75  ? 1_555 161.9 ? 
2  OE1 ? A GLU 66 ? A GLU 70  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? D HOH .  ? A HOH 574 ? 1_555 87.6  ? 
3  O   ? A VAL 71 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? D HOH .  ? A HOH 574 ? 1_555 108.2 ? 
4  OE1 ? A GLU 66 ? A GLU 70  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? A ASN 68 ? A ASN 72  ? 1_555 85.5  ? 
5  O   ? A VAL 71 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? A ASN 68 ? A ASN 72  ? 1_555 87.3  ? 
6  O   ? D HOH .  ? A HOH 574 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? A ASN 68 ? A ASN 72  ? 1_555 84.7  ? 
7  OE1 ? A GLU 66 ? A GLU 70  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? D HOH .  ? A HOH 409 ? 1_555 78.8  ? 
8  O   ? A VAL 71 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? D HOH .  ? A HOH 409 ? 1_555 87.7  ? 
9  O   ? D HOH .  ? A HOH 574 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? D HOH .  ? A HOH 409 ? 1_555 160.7 ? 
10 O   ? A ASN 68 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 O   ? D HOH .  ? A HOH 409 ? 1_555 107.6 ? 
11 OE1 ? A GLU 66 ? A GLU 70  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 76 ? A GLU 80  ? 1_555 102.5 ? 
12 O   ? A VAL 71 ? A VAL 75  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 76 ? A GLU 80  ? 1_555 90.7  ? 
13 O   ? D HOH .  ? A HOH 574 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 76 ? A GLU 80  ? 1_555 73.7  ? 
14 O   ? A ASN 68 ? A ASN 72  ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 76 ? A GLU 80  ? 1_555 156.5 ? 
15 O   ? D HOH .  ? A HOH 409 ? 1_555 CA ? C CA . ? A CA 701 ? 1_555 OE2 ? A GLU 76 ? A GLU 80  ? 1_555 95.8  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1999-06-15 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2012-12-12 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Atomic model'              
3 3 'Structure model' 'Database references'       
4 3 'Structure model' 'Derived calculations'      
5 3 'Structure model' 'Non-polymer description'   
6 3 'Structure model' 'Structure summary'         
7 3 'Structure model' 'Version format compliance' 
8 4 'Structure model' Other                       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
RIGAKU 'data collection' SOFTWARE ? 1 
RIGAKU 'data reduction'  SOFTWARE ? 2 
X-PLOR 'model building'  .        ? 3 
PROLSQ refinement        .        ? 4 
X-PLOR refinement        .        ? 5 
RIGAKU 'data scaling'    .        ? 6 
X-PLOR phasing           .        ? 7 
# 
_pdbx_entry_details.entry_id             1ZZZ 
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   
;THE ACTIVE SITE INHIBITOR IS IN ITS R CHIRAL FORM. 
THE ACTIVE SITE SER 195 IS CLOSE TO THE CARBONYL CARBON  
(C9) OF THE ALDEHYDE GROUP OF THE INHIBITOR FORMING A TRANSITION-STATE COMPLEX.
;
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG A SER 195 ? ? C9 A 0IV 246 ? ? 1.81 
2 1 OG A SER 195 ? ? O2 A 0IV 246 ? ? 2.17 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CG1 A VAL 53  ? ? CB A VAL 53  ? ? CG2 A VAL 53  ? ? 101.11 110.90 -9.79  1.60 N 
2  1 CB  A TYR 59  ? ? CG A TYR 59  ? ? CD1 A TYR 59  ? ? 116.95 121.00 -4.05  0.60 N 
3  1 NE  A ARG 66  ? ? CZ A ARG 66  ? ? NH1 A ARG 66  ? ? 128.65 120.30 8.35   0.50 N 
4  1 NE  A ARG 66  ? ? CZ A ARG 66  ? ? NH2 A ARG 66  ? ? 115.14 120.30 -5.16  0.50 N 
5  1 CB  A TYR 94  ? ? CG A TYR 94  ? ? CD2 A TYR 94  ? ? 114.47 121.00 -6.53  0.60 N 
6  1 CG  A MET 104 ? ? SD A MET 104 ? ? CE  A MET 104 ? ? 110.56 100.20 10.36  1.60 N 
7  1 CB  A ARG 117 ? ? CA A ARG 117 ? ? C   A ARG 117 ? ? 93.92  110.40 -16.48 2.00 N 
8  1 NE  A ARG 117 ? ? CZ A ARG 117 ? ? NH1 A ARG 117 ? ? 123.57 120.30 3.27   0.50 N 
9  1 NE  A ARG 117 ? ? CZ A ARG 117 ? ? NH2 A ARG 117 ? ? 112.92 120.30 -7.38  0.50 N 
10 1 CB  A SER 130 ? ? CA A SER 130 ? ? C   A SER 130 ? ? 123.62 110.10 13.52  1.90 N 
11 1 CB  A LYS 145 ? ? CA A LYS 145 ? ? C   A LYS 145 ? ? 97.95  110.40 -12.45 2.00 N 
12 1 CB  A TYR 151 ? ? CG A TYR 151 ? ? CD1 A TYR 151 ? ? 116.47 121.00 -4.53  0.60 N 
13 1 CB  A ASP 153 ? ? CG A ASP 153 ? ? OD1 A ASP 153 ? ? 124.10 118.30 5.80   0.90 N 
14 1 CB  A ASP 153 ? ? CG A ASP 153 ? ? OD2 A ASP 153 ? ? 109.71 118.30 -8.59  0.90 N 
15 1 CB  A ASP 165 ? ? CG A ASP 165 ? ? OD1 A ASP 165 ? ? 130.52 118.30 12.22  0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP A 71  ? ? -117.05 -76.47 
2 1 ASN A 79  ? ? 93.75   -7.00  
3 1 GLN A 192 ? ? -39.47  124.43 
4 1 SER A 195 ? ? -47.53  150.33 
5 1 SER A 214 ? ? -128.53 -75.48 
6 1 ASN A 223 ? ? 49.70   22.56  
# 
loop_
_pdbx_validate_main_chain_plane.id 
_pdbx_validate_main_chain_plane.PDB_model_num 
_pdbx_validate_main_chain_plane.auth_comp_id 
_pdbx_validate_main_chain_plane.auth_asym_id 
_pdbx_validate_main_chain_plane.auth_seq_id 
_pdbx_validate_main_chain_plane.PDB_ins_code 
_pdbx_validate_main_chain_plane.label_alt_id 
_pdbx_validate_main_chain_plane.improper_torsion_angle 
1  1 GLY A 44  ? ? 10.94  
2  1 ASN A 48  ? ? -10.03 
3  1 GLU A 77  ? ? 15.20  
4  1 ALA A 111 ? ? 10.05  
5  1 ARG A 117 ? ? 18.93  
6  1 SER A 120 ? ? 10.70  
7  1 ALA A 129 ? ? -10.57 
8  1 GLN A 135 ? ? -10.89 
9  1 LEU A 155 ? ? -11.98 
10 1 GLU A 186 ? ? -11.13 
11 1 GLY A 193 ? ? 10.56  
12 1 SER A 195 ? ? -10.27 
13 1 LYS A 204 ? ? -20.15 
14 1 VAL A 213 ? ? -14.30 
15 1 GLY A 216 ? ? -11.44 
# 
loop_
_pdbx_validate_planes.id 
_pdbx_validate_planes.PDB_model_num 
_pdbx_validate_planes.auth_comp_id 
_pdbx_validate_planes.auth_asym_id 
_pdbx_validate_planes.auth_seq_id 
_pdbx_validate_planes.PDB_ins_code 
_pdbx_validate_planes.label_alt_id 
_pdbx_validate_planes.rmsd 
_pdbx_validate_planes.type 
1 1 TYR A 29  ? ? 0.062 'SIDE CHAIN' 
2 1 ARG A 117 ? ? 0.109 'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 A 0IV 246 ? C  ? B 0IV 1 C  
2 1 N 1 A 0IV 246 ? C1 ? B 0IV 1 C1 
3 1 N 1 A 0IV 246 ? C2 ? B 0IV 1 C2 
4 1 N 1 A 0IV 246 ? C3 ? B 0IV 1 C3 
5 1 N 1 A 0IV 246 ? C4 ? B 0IV 1 C4 
6 1 N 1 A 0IV 246 ? C5 ? B 0IV 1 C5 
7 1 N 1 A 0IV 246 ? C6 ? B 0IV 1 C6 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A LEU 2  ? A LEU 1  
2  1 Y 1 A GLY 3  ? A GLY 2  
3  1 Y 1 A ALA 4  ? A ALA 3  
4  1 Y 1 A ALA 5  ? A ALA 4  
5  1 Y 1 A VAL 6  ? A VAL 5  
6  1 Y 1 A ALA 7  ? A ALA 6  
7  1 Y 1 A PHE 8  ? A PHE 7  
8  1 Y 1 A PRO 9  ? A PRO 8  
9  1 Y 1 A VAL 10 ? A VAL 9  
10 1 Y 1 A ASP 11 ? A ASP 10 
11 1 Y 1 A ASP 12 ? A ASP 11 
12 1 Y 1 A ASP 13 ? A ASP 12 
13 1 Y 1 A ASP 14 ? A ASP 13 
14 1 Y 1 A LYS 15 ? A LYS 14 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 
'2-{(3S)-3-[(benzylsulfonyl)amino]-2-oxopiperidin-1-yl}-N-{(2S)-1-[(3R)-1-carbamimidoylpiperidin-3-yl]-3-oxopropan-2-yl}acetamide' 
0IV 
3 'CALCIUM ION' CA  
4 water HOH 
#