data_2A11
# 
_entry.id   2A11 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2A11         
RCSB  RCSB033357   
WWPDB D_1000033357 
# 
_pdbx_database_related.db_name        TargetDB 
_pdbx_database_related.db_id          Rv2925c 
_pdbx_database_related.details        . 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        2A11 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-17 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Akey, D.L.'                                                      1 
'Berger, J.M.'                                                    2 
'Mycobacterium Tuberculosis Structural Proteomics Project (XMTB)' 3 
# 
_citation.id                        primary 
_citation.title                     'Structure of the nuclease domain of ribonuclease III from M. tuberculosis at 2.1 A' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            14 
_citation.page_first                2744 
_citation.page_last                 2750 
_citation.year                      2005 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16155207 
_citation.pdbx_database_id_DOI      10.1110/ps.051665905 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Akey, D.L.'   1 
primary 'Berger, J.M.' 2 
# 
_cell.entry_id           2A11 
_cell.length_a           72.589 
_cell.length_b           72.589 
_cell.length_c           96.013 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2A11 
_symmetry.space_group_name_H-M             'P 43 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                96 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ribonuclease III' 25556.984 1   3.1.26.3 ? 'Nuclease domain' ? 
2 non-polymer syn 'CALCIUM ION'      40.078    2   ?        ? ?                 ? 
3 water       nat water              18.015    161 ?        ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNase III' 
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.3.1.26.3 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GAMIRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASV
VNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPTLGA
GLDWKTSLQELTAARGLGAPSYLVTSTGPDHDKEFTAVVVVMDSEYGSGVGRSKKEAEQKAAAAAWKALEVLDNAMPGKT
SA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GAMIRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASV
VNTQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPTLGA
GLDWKTSLQELTAARGLGAPSYLVTSTGPDHDKEFTAVVVVMDSEYGSGVGRSKKEAEQKAAAAAWKALEVLDNAMPGKT
SA
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         Rv2925c 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ALA n 
1 3   MET n 
1 4   ILE n 
1 5   ARG n 
1 6   SER n 
1 7   ARG n 
1 8   GLN n 
1 9   PRO n 
1 10  LEU n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  LEU n 
1 15  GLY n 
1 16  VAL n 
1 17  ASP n 
1 18  LEU n 
1 19  PRO n 
1 20  ASP n 
1 21  GLU n 
1 22  LEU n 
1 23  LEU n 
1 24  SER n 
1 25  LEU n 
1 26  ALA n 
1 27  LEU n 
1 28  THR n 
1 29  HIS n 
1 30  ARG n 
1 31  SER n 
1 32  TYR n 
1 33  ALA n 
1 34  TYR n 
1 35  GLU n 
1 36  ASN n 
1 37  GLY n 
1 38  GLY n 
1 39  LEU n 
1 40  PRO n 
1 41  THR n 
1 42  ASN n 
1 43  GLU n 
1 44  ARG n 
1 45  LEU n 
1 46  GLU n 
1 47  PHE n 
1 48  LEU n 
1 49  GLY n 
1 50  ASP n 
1 51  ALA n 
1 52  VAL n 
1 53  LEU n 
1 54  GLY n 
1 55  LEU n 
1 56  THR n 
1 57  ILE n 
1 58  THR n 
1 59  ASP n 
1 60  ALA n 
1 61  LEU n 
1 62  PHE n 
1 63  HIS n 
1 64  ARG n 
1 65  HIS n 
1 66  PRO n 
1 67  ASP n 
1 68  ARG n 
1 69  SER n 
1 70  GLU n 
1 71  GLY n 
1 72  ASP n 
1 73  LEU n 
1 74  ALA n 
1 75  LYS n 
1 76  LEU n 
1 77  ARG n 
1 78  ALA n 
1 79  SER n 
1 80  VAL n 
1 81  VAL n 
1 82  ASN n 
1 83  THR n 
1 84  GLN n 
1 85  ALA n 
1 86  LEU n 
1 87  ALA n 
1 88  ASP n 
1 89  VAL n 
1 90  ALA n 
1 91  ARG n 
1 92  ARG n 
1 93  LEU n 
1 94  CYS n 
1 95  ALA n 
1 96  GLU n 
1 97  GLY n 
1 98  LEU n 
1 99  GLY n 
1 100 VAL n 
1 101 HIS n 
1 102 VAL n 
1 103 LEU n 
1 104 LEU n 
1 105 GLY n 
1 106 ARG n 
1 107 GLY n 
1 108 GLU n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 GLY n 
1 113 GLY n 
1 114 ALA n 
1 115 ASP n 
1 116 LYS n 
1 117 SER n 
1 118 SER n 
1 119 ILE n 
1 120 LEU n 
1 121 ALA n 
1 122 ASP n 
1 123 GLY n 
1 124 MET n 
1 125 GLU n 
1 126 SER n 
1 127 LEU n 
1 128 LEU n 
1 129 GLY n 
1 130 ALA n 
1 131 ILE n 
1 132 TYR n 
1 133 LEU n 
1 134 GLN n 
1 135 HIS n 
1 136 GLY n 
1 137 MET n 
1 138 GLU n 
1 139 LYS n 
1 140 ALA n 
1 141 ARG n 
1 142 GLU n 
1 143 VAL n 
1 144 ILE n 
1 145 LEU n 
1 146 ARG n 
1 147 LEU n 
1 148 PHE n 
1 149 GLY n 
1 150 PRO n 
1 151 LEU n 
1 152 LEU n 
1 153 ASP n 
1 154 ALA n 
1 155 ALA n 
1 156 PRO n 
1 157 THR n 
1 158 LEU n 
1 159 GLY n 
1 160 ALA n 
1 161 GLY n 
1 162 LEU n 
1 163 ASP n 
1 164 TRP n 
1 165 LYS n 
1 166 THR n 
1 167 SER n 
1 168 LEU n 
1 169 GLN n 
1 170 GLU n 
1 171 LEU n 
1 172 THR n 
1 173 ALA n 
1 174 ALA n 
1 175 ARG n 
1 176 GLY n 
1 177 LEU n 
1 178 GLY n 
1 179 ALA n 
1 180 PRO n 
1 181 SER n 
1 182 TYR n 
1 183 LEU n 
1 184 VAL n 
1 185 THR n 
1 186 SER n 
1 187 THR n 
1 188 GLY n 
1 189 PRO n 
1 190 ASP n 
1 191 HIS n 
1 192 ASP n 
1 193 LYS n 
1 194 GLU n 
1 195 PHE n 
1 196 THR n 
1 197 ALA n 
1 198 VAL n 
1 199 VAL n 
1 200 VAL n 
1 201 VAL n 
1 202 MET n 
1 203 ASP n 
1 204 SER n 
1 205 GLU n 
1 206 TYR n 
1 207 GLY n 
1 208 SER n 
1 209 GLY n 
1 210 VAL n 
1 211 GLY n 
1 212 ARG n 
1 213 SER n 
1 214 LYS n 
1 215 LYS n 
1 216 GLU n 
1 217 ALA n 
1 218 GLU n 
1 219 GLN n 
1 220 LYS n 
1 221 ALA n 
1 222 ALA n 
1 223 ALA n 
1 224 ALA n 
1 225 ALA n 
1 226 TRP n 
1 227 LYS n 
1 228 ALA n 
1 229 LEU n 
1 230 GLU n 
1 231 VAL n 
1 232 LEU n 
1 233 ASP n 
1 234 ASN n 
1 235 ALA n 
1 236 MET n 
1 237 PRO n 
1 238 GLY n 
1 239 LYS n 
1 240 THR n 
1 241 SER n 
1 242 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Mycobacterium 
_entity_src_gen.pdbx_gene_src_gene                 rnc 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mycobacterium tuberculosis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1773 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLyS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    RNC_MYCTU 
_struct_ref.pdbx_db_accession          P66666 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MIRSRQPLLDALGVDLPDELLSLALTHRSYAYENGGLPTNERLEFLGDAVLGLTITDALFHRHPDRSEGDLAKLRASVVN
TQALADVARRLCAEGLGVHVLLGRGEANTGGADKSSILADGMESLLGAIYLQHGMEKAREVILRLFGPLLDAAPTLGAGL
DWKTSLQELTAARGLGAPSYLVTSTGPDHDKEFTAVVVVMDSEYGSGVGRSKKEAEQKAAAAAWKALEVLDNAMPGKTSA

;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2A11 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 242 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P66666 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  240 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       240 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2A11 GLY A 1 ? UNP P66666 ? ? 'CLONING ARTIFACT' -1 1 
1 2A11 ALA A 2 ? UNP P66666 ? ? 'CLONING ARTIFACT' 0  2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CA  non-polymer         . 'CALCIUM ION'   ? 'Ca 2'           40.078  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2A11 
_exptl.crystals_number   2 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.5 
_exptl_crystal.density_percent_sol   50.3 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.pdbx_details    
'15% PEG 3000, 100 mM Ca-acetate, 100 mM Tris-HCl, pH 7.5, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
loop_
_diffrn.id 
_diffrn.ambient_temp 
_diffrn.ambient_temp_details 
_diffrn.crystal_id 
1   100 ? 1 
2   ?   ? 1 
1,2 ?   ? 1 
# 
loop_
_diffrn_detector.diffrn_id 
_diffrn_detector.detector 
_diffrn_detector.type 
_diffrn_detector.pdbx_collection_date 
_diffrn_detector.details 
1 CCD 'ADSC QUANTUM 4' 2002-09-20 ? 
2 CCD 'ADSC QUANTUM 4' 2003-08-04 ? 
# 
loop_
_diffrn_radiation.diffrn_id 
_diffrn_radiation.wavelength_id 
_diffrn_radiation.pdbx_diffrn_protocol 
_diffrn_radiation.monochromator 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l 
_diffrn_radiation.pdbx_scattering_type 
1 1 MAD                 'ALS 8.3.1' M x-ray 
2 1 'SINGLE WAVELENGTH' 'ALS 8.3.1' M x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9793 1.0 
2 1.000  1.0 
3 1.100  1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.pdbx_wavelength_list        '0.9793, 1.000, 1.100' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
_diffrn_source.pdbx_wavelength             ? 
# 
_reflns.entry_id                     2A11 
_reflns.d_resolution_low             50.00 
_reflns.d_resolution_high            2.10 
_reflns.number_obs                   15508 
_reflns.percent_possible_obs         99.100 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_chi_squared             0.973 
_reflns.pdbx_redundancy              4.600 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        28.0 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   15593 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1,2 
# 
_reflns_shell.d_res_low              2.18 
_reflns_shell.d_res_high             2.10 
_reflns_shell.number_measured_obs    1517 
_reflns_shell.percent_possible_obs   99.600 
_reflns_shell.Rmerge_I_obs           0.252 
_reflns_shell.pdbx_chi_squared       0.900 
_reflns_shell.pdbx_redundancy        4.700 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.meanI_over_sigI_obs    5.0 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1,2 
# 
_refine.ls_d_res_high                            2.100 
_refine.ls_d_res_low                             50. 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.100 
_refine.ls_number_reflns_obs                     15447 
_refine.ls_R_factor_R_work                       0.2585 
_refine.ls_R_factor_R_free                       0.2857 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  774 
_refine.B_iso_mean                               56.844 
_refine.solvent_model_param_bsol                 84.097 
_refine.aniso_B[1][1]                            -3.355 
_refine.aniso_B[2][2]                            -3.355 
_refine.aniso_B[3][3]                            6.710 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.entry_id                                 2A11 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     15593 
_refine.ls_R_factor_all                          0.286 
_refine.ls_R_factor_obs                          0.286 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1158 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             161 
_refine_hist.number_atoms_total               1321 
_refine_hist.d_res_high                       2.100 
_refine_hist.d_res_low                        50. 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_angle_deg  1.40  ?   ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d     0.008 ?   ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it  3.720 3.0 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it 5.215 4.5 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it  5.729 4.5 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it 7.726 6.5 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 CNS_TOPPAR:protein_rep.param CNS_TOPPAR:protein.top 'X-RAY DIFFRACTION' 
2 CNS_TOPPAR:dna-rna_rep.param CNS_TOPPAR:dna-rna.top 'X-RAY DIFFRACTION' 
3 CNS_TOPPAR:water_rep.param   CNS_TOPPAR:water.top   'X-RAY DIFFRACTION' 
4 CNS_TOPPAR:ion.param         CNS_TOPPAR:ion.top     'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2A11 
_struct.title                     'Crystal Structure of Nuclease Domain of Ribonuclase III from Mycobacterium Tuberculosis' 
_struct.pdbx_descriptor           'Ribonuclease III (E.C.3.1.26.3)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2A11 
_struct_keywords.pdbx_keywords   TRANSCRIPTION,TRANSLATION,HYDROLASE 
_struct_keywords.text            
;ribonuclease; RNase III; nuclease domain; Structural Genomics, PSI, Protein Structure Initiative; Mycobacterium Tuberculosis Structural Proteomics Project (XMTB), TRANSCRIPTION, TRANSLATION, HYDROLASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
'The second part of the biological assembly is generated by the two fold symmetry operator:  -x, -y, -z+1/2' 
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 7   ? GLY A 15  ? ARG A 5   GLY A 13  1 ? 9  
HELX_P HELX_P2  2  PRO A 19  ? LEU A 27  ? PRO A 17  LEU A 25  1 ? 9  
HELX_P HELX_P3  3  HIS A 29  ? ASN A 36  ? HIS A 27  ASN A 34  1 ? 8  
HELX_P HELX_P4  4  ASN A 42  ? HIS A 65  ? ASN A 40  HIS A 63  1 ? 24 
HELX_P HELX_P5  5  SER A 69  ? ASN A 82  ? SER A 67  ASN A 80  1 ? 14 
HELX_P HELX_P6  6  ASN A 82  ? LEU A 93  ? ASN A 80  LEU A 91  1 ? 12 
HELX_P HELX_P7  7  LEU A 98  ? VAL A 102 ? LEU A 96  VAL A 100 5 ? 5  
HELX_P HELX_P8  8  GLY A 105 ? THR A 111 ? GLY A 103 THR A 109 1 ? 7  
HELX_P HELX_P9  9  GLY A 112 ? ASP A 115 ? GLY A 110 ASP A 113 5 ? 4  
HELX_P HELX_P10 10 LYS A 116 ? GLY A 136 ? LYS A 114 GLY A 134 1 ? 21 
HELX_P HELX_P11 11 GLY A 136 ? PHE A 148 ? GLY A 134 PHE A 146 1 ? 13 
HELX_P HELX_P12 12 PHE A 148 ? ALA A 155 ? PHE A 146 ALA A 153 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? B CA . CA ? ? ? 1_555 A GLU 46  OE2 ? ? A CA 1001 A GLU 44   1_555 ? ? ? ? ? ? ? 2.285 ? 
metalc2  metalc ? ? B CA . CA ? ? ? 1_555 A GLU 125 OE1 ? ? A CA 1001 A GLU 123  1_555 ? ? ? ? ? ? ? 2.785 ? 
metalc3  metalc ? ? B CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1001 A HOH 1008 1_555 ? ? ? ? ? ? ? 2.842 ? 
metalc4  metalc ? ? B CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1001 A HOH 1009 1_555 ? ? ? ? ? ? ? 2.604 ? 
metalc5  metalc ? ? B CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1001 A HOH 1010 1_555 ? ? ? ? ? ? ? 2.884 ? 
metalc6  metalc ? ? C CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1002 A HOH 1004 1_555 ? ? ? ? ? ? ? 2.281 ? 
metalc7  metalc ? ? C CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1002 A HOH 1005 1_555 ? ? ? ? ? ? ? 2.516 ? 
metalc8  metalc ? ? C CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1002 A HOH 1006 1_555 ? ? ? ? ? ? ? 2.825 ? 
metalc9  metalc ? ? C CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1002 A HOH 1007 1_555 ? ? ? ? ? ? ? 2.481 ? 
metalc10 metalc ? ? C CA . CA ? ? ? 1_555 D HOH .   O   ? ? A CA 1002 A HOH 1010 1_555 ? ? ? ? ? ? ? 3.299 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE CA A 1001' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE CA A 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLU A 46  ? GLU A 44   . ? 1_555 ? 
2  AC1 6 ASP A 122 ? ASP A 120  . ? 1_555 ? 
3  AC1 6 GLU A 125 ? GLU A 123  . ? 1_555 ? 
4  AC1 6 HOH D .   ? HOH A 1008 . ? 1_555 ? 
5  AC1 6 HOH D .   ? HOH A 1009 . ? 1_555 ? 
6  AC1 6 HOH D .   ? HOH A 1010 . ? 1_555 ? 
7  AC2 4 HOH D .   ? HOH A 1004 . ? 1_555 ? 
8  AC2 4 HOH D .   ? HOH A 1005 . ? 1_555 ? 
9  AC2 4 HOH D .   ? HOH A 1006 . ? 1_555 ? 
10 AC2 4 HOH D .   ? HOH A 1007 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2A11 
_atom_sites.fract_transf_matrix[1][1]   0.013776 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013776 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010415 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CA 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ILE A 1 4   ? 61.118 19.206  39.707 1.00 97.20  ? 2    ILE A N   1 
ATOM   2    C  CA  . ILE A 1 4   ? 62.060 19.648  40.723 1.00 98.00  ? 2    ILE A CA  1 
ATOM   3    C  C   . ILE A 1 4   ? 61.824 21.144  41.040 1.00 97.56  ? 2    ILE A C   1 
ATOM   4    O  O   . ILE A 1 4   ? 60.688 21.570  41.223 1.00 98.88  ? 2    ILE A O   1 
ATOM   5    C  CB  . ILE A 1 4   ? 63.504 19.328  40.298 1.00 101.57 ? 2    ILE A CB  1 
ATOM   6    C  CG1 . ILE A 1 4   ? 63.873 17.901  40.729 1.00 104.18 ? 2    ILE A CG1 1 
ATOM   7    C  CG2 . ILE A 1 4   ? 64.472 20.334  40.883 1.00 102.33 ? 2    ILE A CG2 1 
ATOM   8    C  CD1 . ILE A 1 4   ? 65.377 17.610  41.023 1.00 105.81 ? 2    ILE A CD1 1 
ATOM   9    N  N   . ARG A 1 5   ? 62.895 21.937  41.092 1.00 94.72  ? 3    ARG A N   1 
ATOM   10   C  CA  . ARG A 1 5   ? 62.922 23.370  41.396 1.00 92.24  ? 3    ARG A CA  1 
ATOM   11   C  C   . ARG A 1 5   ? 61.768 23.937  42.225 1.00 89.01  ? 3    ARG A C   1 
ATOM   12   O  O   . ARG A 1 5   ? 61.982 24.307  43.391 1.00 90.23  ? 3    ARG A O   1 
ATOM   13   C  CB  . ARG A 1 5   ? 63.074 24.179  40.108 1.00 95.99  ? 3    ARG A CB  1 
ATOM   14   C  CG  . ARG A 1 5   ? 64.058 25.373  40.193 1.00 101.73 ? 3    ARG A CG  1 
ATOM   15   C  CD  . ARG A 1 5   ? 65.499 24.900  40.305 1.00 106.75 ? 3    ARG A CD  1 
ATOM   16   N  NE  . ARG A 1 5   ? 66.433 25.933  39.854 1.00 109.65 ? 3    ARG A NE  1 
ATOM   17   C  CZ  . ARG A 1 5   ? 66.942 26.005  38.624 1.00 110.23 ? 3    ARG A CZ  1 
ATOM   18   N  NH1 . ARG A 1 5   ? 66.616 25.095  37.718 1.00 109.26 ? 3    ARG A NH1 1 
ATOM   19   N  NH2 . ARG A 1 5   ? 67.759 26.996  38.290 1.00 106.22 ? 3    ARG A NH2 1 
ATOM   20   N  N   . SER A 1 6   ? 60.565 24.023  41.652 1.00 82.04  ? 4    SER A N   1 
ATOM   21   C  CA  . SER A 1 6   ? 59.445 24.575  42.407 1.00 74.29  ? 4    SER A CA  1 
ATOM   22   C  C   . SER A 1 6   ? 59.093 23.738  43.629 1.00 67.31  ? 4    SER A C   1 
ATOM   23   O  O   . SER A 1 6   ? 58.845 22.534  43.544 1.00 60.90  ? 4    SER A O   1 
ATOM   24   C  CB  . SER A 1 6   ? 58.204 24.739  41.538 1.00 74.67  ? 4    SER A CB  1 
ATOM   25   O  OG  . SER A 1 6   ? 57.165 25.328  42.302 1.00 66.02  ? 4    SER A OG  1 
ATOM   26   N  N   . ARG A 1 7   ? 59.039 24.405  44.771 1.00 64.96  ? 5    ARG A N   1 
ATOM   27   C  CA  . ARG A 1 7   ? 58.743 23.728  46.019 1.00 65.58  ? 5    ARG A CA  1 
ATOM   28   C  C   . ARG A 1 7   ? 57.277 23.806  46.418 1.00 66.78  ? 5    ARG A C   1 
ATOM   29   O  O   . ARG A 1 7   ? 56.921 23.398  47.519 1.00 66.68  ? 5    ARG A O   1 
ATOM   30   C  CB  . ARG A 1 7   ? 59.628 24.301  47.130 1.00 56.65  ? 5    ARG A CB  1 
ATOM   31   C  CG  . ARG A 1 7   ? 61.114 24.074  46.868 1.00 50.31  ? 5    ARG A CG  1 
ATOM   32   C  CD  . ARG A 1 7   ? 62.015 24.858  47.809 1.00 47.89  ? 5    ARG A CD  1 
ATOM   33   N  NE  . ARG A 1 7   ? 63.385 24.436  47.587 1.00 42.22  ? 5    ARG A NE  1 
ATOM   34   C  CZ  . ARG A 1 7   ? 64.444 24.995  48.144 1.00 43.82  ? 5    ARG A CZ  1 
ATOM   35   N  NH1 . ARG A 1 7   ? 64.300 26.026  48.976 1.00 42.76  ? 5    ARG A NH1 1 
ATOM   36   N  NH2 . ARG A 1 7   ? 65.651 24.513  47.867 1.00 44.43  ? 5    ARG A NH2 1 
ATOM   37   N  N   . GLN A 1 8   ? 56.420 24.301  45.526 1.00 67.57  ? 6    GLN A N   1 
ATOM   38   C  CA  . GLN A 1 8   ? 55.001 24.406  45.862 1.00 67.93  ? 6    GLN A CA  1 
ATOM   39   C  C   . GLN A 1 8   ? 54.350 23.041  46.014 1.00 64.89  ? 6    GLN A C   1 
ATOM   40   O  O   . GLN A 1 8   ? 53.609 22.806  46.960 1.00 64.75  ? 6    GLN A O   1 
ATOM   41   C  CB  . GLN A 1 8   ? 54.235 25.223  44.819 1.00 69.72  ? 6    GLN A CB  1 
ATOM   42   C  CG  . GLN A 1 8   ? 52.894 25.724  45.345 1.00 67.95  ? 6    GLN A CG  1 
ATOM   43   C  CD  . GLN A 1 8   ? 53.046 26.674  46.533 1.00 73.35  ? 6    GLN A CD  1 
ATOM   44   O  OE1 . GLN A 1 8   ? 52.187 26.729  47.409 1.00 77.52  ? 6    GLN A OE1 1 
ATOM   45   N  NE2 . GLN A 1 8   ? 54.137 27.434  46.555 1.00 75.47  ? 6    GLN A NE2 1 
ATOM   46   N  N   . PRO A 1 9   ? 54.620 22.118  45.085 1.00 63.38  ? 7    PRO A N   1 
ATOM   47   C  CA  . PRO A 1 9   ? 54.005 20.794  45.217 1.00 65.63  ? 7    PRO A CA  1 
ATOM   48   C  C   . PRO A 1 9   ? 54.380 20.145  46.559 1.00 68.50  ? 7    PRO A C   1 
ATOM   49   O  O   . PRO A 1 9   ? 53.664 19.281  47.070 1.00 71.81  ? 7    PRO A O   1 
ATOM   50   C  CB  . PRO A 1 9   ? 54.550 20.039  44.005 1.00 63.38  ? 7    PRO A CB  1 
ATOM   51   C  CG  . PRO A 1 9   ? 55.882 20.676  43.784 1.00 63.17  ? 7    PRO A CG  1 
ATOM   52   C  CD  . PRO A 1 9   ? 55.612 22.142  44.000 1.00 61.09  ? 7    PRO A CD  1 
ATOM   53   N  N   . LEU A 1 10  ? 55.500 20.582  47.132 1.00 67.50  ? 8    LEU A N   1 
ATOM   54   C  CA  . LEU A 1 10  ? 55.956 20.068  48.421 1.00 61.94  ? 8    LEU A CA  1 
ATOM   55   C  C   . LEU A 1 10  ? 55.191 20.790  49.531 1.00 61.62  ? 8    LEU A C   1 
ATOM   56   O  O   . LEU A 1 10  ? 54.612 20.154  50.406 1.00 57.16  ? 8    LEU A O   1 
ATOM   57   C  CB  . LEU A 1 10  ? 57.460 20.314  48.596 1.00 60.78  ? 8    LEU A CB  1 
ATOM   58   C  CG  . LEU A 1 10  ? 58.313 19.217  49.247 1.00 55.15  ? 8    LEU A CG  1 
ATOM   59   C  CD1 . LEU A 1 10  ? 59.617 19.840  49.666 1.00 58.02  ? 8    LEU A CD1 1 
ATOM   60   C  CD2 . LEU A 1 10  ? 57.622 18.608  50.452 1.00 50.45  ? 8    LEU A CD2 1 
ATOM   61   N  N   . LEU A 1 11  ? 55.195 22.121  49.496 1.00 59.17  ? 9    LEU A N   1 
ATOM   62   C  CA  . LEU A 1 11  ? 54.486 22.898  50.506 1.00 63.57  ? 9    LEU A CA  1 
ATOM   63   C  C   . LEU A 1 11  ? 53.014 22.515  50.497 1.00 69.13  ? 9    LEU A C   1 
ATOM   64   O  O   . LEU A 1 11  ? 52.294 22.719  51.484 1.00 67.44  ? 9    LEU A O   1 
ATOM   65   C  CB  . LEU A 1 11  ? 54.631 24.398  50.246 1.00 60.46  ? 9    LEU A CB  1 
ATOM   66   C  CG  . LEU A 1 11  ? 55.974 25.053  50.598 1.00 60.83  ? 9    LEU A CG  1 
ATOM   67   C  CD1 . LEU A 1 11  ? 55.970 26.477  50.084 1.00 54.95  ? 9    LEU A CD1 1 
ATOM   68   C  CD2 . LEU A 1 11  ? 56.214 25.025  52.114 1.00 54.74  ? 9    LEU A CD2 1 
ATOM   69   N  N   . ASP A 1 12  ? 52.577 21.951  49.374 1.00 69.47  ? 10   ASP A N   1 
ATOM   70   C  CA  . ASP A 1 12  ? 51.202 21.509  49.223 1.00 71.93  ? 10   ASP A CA  1 
ATOM   71   C  C   . ASP A 1 12  ? 51.025 20.170  49.918 1.00 72.55  ? 10   ASP A C   1 
ATOM   72   O  O   . ASP A 1 12  ? 50.133 20.017  50.746 1.00 76.50  ? 10   ASP A O   1 
ATOM   73   C  CB  . ASP A 1 12  ? 50.820 21.400  47.740 1.00 77.94  ? 10   ASP A CB  1 
ATOM   74   C  CG  . ASP A 1 12  ? 50.557 22.761  47.103 1.00 84.25  ? 10   ASP A CG  1 
ATOM   75   O  OD1 . ASP A 1 12  ? 49.842 23.578  47.719 1.00 85.31  ? 10   ASP A OD1 1 
ATOM   76   O  OD2 . ASP A 1 12  ? 51.053 23.014  45.985 1.00 91.66  ? 10   ASP A OD2 1 
ATOM   77   N  N   . ALA A 1 13  ? 51.866 19.196  49.591 1.00 73.75  ? 11   ALA A N   1 
ATOM   78   C  CA  . ALA A 1 13  ? 51.768 17.896  50.246 1.00 73.51  ? 11   ALA A CA  1 
ATOM   79   C  C   . ALA A 1 13  ? 51.729 18.112  51.763 1.00 72.94  ? 11   ALA A C   1 
ATOM   80   O  O   . ALA A 1 13  ? 50.857 17.597  52.456 1.00 71.58  ? 11   ALA A O   1 
ATOM   81   C  CB  . ALA A 1 13  ? 52.959 17.032  49.870 1.00 73.58  ? 11   ALA A CB  1 
ATOM   82   N  N   . LEU A 1 14  ? 52.678 18.897  52.263 1.00 70.90  ? 12   LEU A N   1 
ATOM   83   C  CA  . LEU A 1 14  ? 52.768 19.197  53.683 1.00 70.71  ? 12   LEU A CA  1 
ATOM   84   C  C   . LEU A 1 14  ? 51.478 19.791  54.220 1.00 72.83  ? 12   LEU A C   1 
ATOM   85   O  O   . LEU A 1 14  ? 51.051 19.461  55.327 1.00 76.78  ? 12   LEU A O   1 
ATOM   86   C  CB  . LEU A 1 14  ? 53.924 20.160  53.943 1.00 66.92  ? 12   LEU A CB  1 
ATOM   87   C  CG  . LEU A 1 14  ? 55.251 19.511  54.340 1.00 60.44  ? 12   LEU A CG  1 
ATOM   88   C  CD1 . LEU A 1 14  ? 55.476 18.215  53.575 1.00 62.04  ? 12   LEU A CD1 1 
ATOM   89   C  CD2 . LEU A 1 14  ? 56.369 20.497  54.091 1.00 49.55  ? 12   LEU A CD2 1 
ATOM   90   N  N   . GLY A 1 15  ? 50.868 20.677  53.442 1.00 67.86  ? 13   GLY A N   1 
ATOM   91   C  CA  . GLY A 1 15  ? 49.618 21.280  53.860 1.00 62.43  ? 13   GLY A CA  1 
ATOM   92   C  C   . GLY A 1 15  ? 49.768 22.573  54.631 1.00 61.05  ? 13   GLY A C   1 
ATOM   93   O  O   . GLY A 1 15  ? 48.787 23.137  55.110 1.00 61.63  ? 13   GLY A O   1 
ATOM   94   N  N   . VAL A 1 16  ? 50.992 23.051  54.775 1.00 58.06  ? 14   VAL A N   1 
ATOM   95   C  CA  . VAL A 1 16  ? 51.194 24.303  55.480 1.00 56.17  ? 14   VAL A CA  1 
ATOM   96   C  C   . VAL A 1 16  ? 52.098 25.162  54.640 1.00 58.95  ? 14   VAL A C   1 
ATOM   97   O  O   . VAL A 1 16  ? 52.429 24.811  53.512 1.00 63.03  ? 14   VAL A O   1 
ATOM   98   C  CB  . VAL A 1 16  ? 51.856 24.100  56.846 1.00 61.45  ? 14   VAL A CB  1 
ATOM   99   C  CG1 . VAL A 1 16  ? 50.976 23.207  57.720 1.00 63.26  ? 14   VAL A CG1 1 
ATOM   100  C  CG2 . VAL A 1 16  ? 53.256 23.508  56.666 1.00 50.39  ? 14   VAL A CG2 1 
ATOM   101  N  N   . ASP A 1 17  ? 52.500 26.296  55.187 1.00 58.48  ? 15   ASP A N   1 
ATOM   102  C  CA  . ASP A 1 17  ? 53.376 27.173  54.454 1.00 58.27  ? 15   ASP A CA  1 
ATOM   103  C  C   . ASP A 1 17  ? 54.647 27.408  55.240 1.00 56.82  ? 15   ASP A C   1 
ATOM   104  O  O   . ASP A 1 17  ? 54.625 27.549  56.464 1.00 53.67  ? 15   ASP A O   1 
ATOM   105  C  CB  . ASP A 1 17  ? 52.702 28.512  54.177 1.00 66.73  ? 15   ASP A CB  1 
ATOM   106  C  CG  . ASP A 1 17  ? 53.546 29.397  53.288 1.00 77.13  ? 15   ASP A CG  1 
ATOM   107  O  OD1 . ASP A 1 17  ? 53.632 29.102  52.074 1.00 81.97  ? 15   ASP A OD1 1 
ATOM   108  O  OD2 . ASP A 1 17  ? 54.141 30.369  53.806 1.00 80.48  ? 15   ASP A OD2 1 
ATOM   109  N  N   . LEU A 1 18  ? 55.765 27.448  54.532 1.00 51.63  ? 16   LEU A N   1 
ATOM   110  C  CA  . LEU A 1 18  ? 57.029 27.672  55.194 1.00 50.72  ? 16   LEU A CA  1 
ATOM   111  C  C   . LEU A 1 18  ? 57.843 28.722  54.483 1.00 49.07  ? 16   LEU A C   1 
ATOM   112  O  O   . LEU A 1 18  ? 58.010 28.673  53.262 1.00 55.04  ? 16   LEU A O   1 
ATOM   113  C  CB  . LEU A 1 18  ? 57.842 26.370  55.256 1.00 47.55  ? 16   LEU A CB  1 
ATOM   114  C  CG  . LEU A 1 18  ? 57.313 25.201  56.094 1.00 44.35  ? 16   LEU A CG  1 
ATOM   115  C  CD1 . LEU A 1 18  ? 58.213 23.980  55.869 1.00 36.38  ? 16   LEU A CD1 1 
ATOM   116  C  CD2 . LEU A 1 18  ? 57.284 25.591  57.574 1.00 43.43  ? 16   LEU A CD2 1 
ATOM   117  N  N   . PRO A 1 19  ? 58.366 29.687  55.239 1.00 38.01  ? 17   PRO A N   1 
ATOM   118  C  CA  . PRO A 1 19  ? 59.191 30.763  54.695 1.00 39.67  ? 17   PRO A CA  1 
ATOM   119  C  C   . PRO A 1 19  ? 60.323 30.101  53.892 1.00 49.41  ? 17   PRO A C   1 
ATOM   120  O  O   . PRO A 1 19  ? 60.830 29.035  54.282 1.00 37.66  ? 17   PRO A O   1 
ATOM   121  C  CB  . PRO A 1 19  ? 59.742 31.448  55.940 1.00 40.57  ? 17   PRO A CB  1 
ATOM   122  C  CG  . PRO A 1 19  ? 58.724 31.149  56.993 1.00 51.30  ? 17   PRO A CG  1 
ATOM   123  C  CD  . PRO A 1 19  ? 58.333 29.726  56.708 1.00 47.36  ? 17   PRO A CD  1 
ATOM   124  N  N   . ASP A 1 20  ? 60.725 30.742  52.794 1.00 48.52  ? 18   ASP A N   1 
ATOM   125  C  CA  . ASP A 1 20  ? 61.778 30.232  51.912 1.00 45.34  ? 18   ASP A CA  1 
ATOM   126  C  C   . ASP A 1 20  ? 63.068 29.808  52.618 1.00 39.64  ? 18   ASP A C   1 
ATOM   127  O  O   . ASP A 1 20  ? 63.585 28.728  52.364 1.00 42.36  ? 18   ASP A O   1 
ATOM   128  C  CB  . ASP A 1 20  ? 62.129 31.289  50.866 1.00 56.12  ? 18   ASP A CB  1 
ATOM   129  C  CG  . ASP A 1 20  ? 60.905 31.876  50.198 1.00 65.46  ? 18   ASP A CG  1 
ATOM   130  O  OD1 . ASP A 1 20  ? 60.142 31.115  49.567 1.00 68.96  ? 18   ASP A OD1 1 
ATOM   131  O  OD2 . ASP A 1 20  ? 60.708 33.103  50.306 1.00 74.88  ? 18   ASP A OD2 1 
ATOM   132  N  N   . GLU A 1 21  ? 63.593 30.667  53.485 1.00 37.57  ? 19   GLU A N   1 
ATOM   133  C  CA  . GLU A 1 21  ? 64.821 30.368  54.194 1.00 45.87  ? 19   GLU A CA  1 
ATOM   134  C  C   . GLU A 1 21  ? 64.744 29.125  55.089 1.00 50.61  ? 19   GLU A C   1 
ATOM   135  O  O   . GLU A 1 21  ? 65.678 28.316  55.122 1.00 49.96  ? 19   GLU A O   1 
ATOM   136  C  CB  . GLU A 1 21  ? 65.252 31.576  55.024 1.00 51.14  ? 19   GLU A CB  1 
ATOM   137  C  CG  . GLU A 1 21  ? 64.104 32.368  55.621 1.00 75.93  ? 19   GLU A CG  1 
ATOM   138  C  CD  . GLU A 1 21  ? 63.241 33.037  54.559 1.00 85.95  ? 19   GLU A CD  1 
ATOM   139  O  OE1 . GLU A 1 21  ? 63.800 33.730  53.680 1.00 92.84  ? 19   GLU A OE1 1 
ATOM   140  O  OE2 . GLU A 1 21  ? 62.004 32.873  54.604 1.00 91.24  ? 19   GLU A OE2 1 
ATOM   141  N  N   . LEU A 1 22  ? 63.639 28.968  55.811 1.00 47.17  ? 20   LEU A N   1 
ATOM   142  C  CA  . LEU A 1 22  ? 63.486 27.820  56.697 1.00 48.04  ? 20   LEU A CA  1 
ATOM   143  C  C   . LEU A 1 22  ? 63.315 26.545  55.908 1.00 41.52  ? 20   LEU A C   1 
ATOM   144  O  O   . LEU A 1 22  ? 63.849 25.499  56.275 1.00 44.93  ? 20   LEU A O   1 
ATOM   145  C  CB  . LEU A 1 22  ? 62.280 27.996  57.622 1.00 48.71  ? 20   LEU A CB  1 
ATOM   146  C  CG  . LEU A 1 22  ? 61.966 26.823  58.551 1.00 43.63  ? 20   LEU A CG  1 
ATOM   147  C  CD1 . LEU A 1 22  ? 63.123 26.629  59.534 1.00 39.59  ? 20   LEU A CD1 1 
ATOM   148  C  CD2 . LEU A 1 22  ? 60.658 27.099  59.296 1.00 41.65  ? 20   LEU A CD2 1 
ATOM   149  N  N   . LEU A 1 23  ? 62.559 26.622  54.829 1.00 34.81  ? 21   LEU A N   1 
ATOM   150  C  CA  . LEU A 1 23  ? 62.341 25.443  54.014 1.00 34.68  ? 21   LEU A CA  1 
ATOM   151  C  C   . LEU A 1 23  ? 63.649 25.031  53.340 1.00 40.54  ? 21   LEU A C   1 
ATOM   152  O  O   . LEU A 1 23  ? 63.923 23.833  53.178 1.00 38.62  ? 21   LEU A O   1 
ATOM   153  C  CB  . LEU A 1 23  ? 61.259 25.720  52.971 1.00 34.15  ? 21   LEU A CB  1 
ATOM   154  C  CG  . LEU A 1 23  ? 61.040 24.656  51.903 1.00 34.84  ? 21   LEU A CG  1 
ATOM   155  C  CD1 . LEU A 1 23  ? 60.771 23.285  52.526 1.00 39.46  ? 21   LEU A CD1 1 
ATOM   156  C  CD2 . LEU A 1 23  ? 59.890 25.107  51.014 1.00 32.14  ? 21   LEU A CD2 1 
ATOM   157  N  N   . SER A 1 24  ? 64.460 26.023  52.962 1.00 37.60  ? 22   SER A N   1 
ATOM   158  C  CA  . SER A 1 24  ? 65.738 25.740  52.315 1.00 40.70  ? 22   SER A CA  1 
ATOM   159  C  C   . SER A 1 24  ? 66.654 25.036  53.310 1.00 39.20  ? 22   SER A C   1 
ATOM   160  O  O   . SER A 1 24  ? 67.232 24.009  52.992 1.00 36.52  ? 22   SER A O   1 
ATOM   161  C  CB  . SER A 1 24  ? 66.401 27.024  51.802 1.00 41.41  ? 22   SER A CB  1 
ATOM   162  O  OG  . SER A 1 24  ? 65.716 27.525  50.666 1.00 47.36  ? 22   SER A OG  1 
ATOM   163  N  N   . LEU A 1 25  ? 66.764 25.589  54.514 1.00 35.75  ? 23   LEU A N   1 
ATOM   164  C  CA  . LEU A 1 25  ? 67.583 24.992  55.550 1.00 39.12  ? 23   LEU A CA  1 
ATOM   165  C  C   . LEU A 1 25  ? 67.120 23.554  55.771 1.00 40.82  ? 23   LEU A C   1 
ATOM   166  O  O   . LEU A 1 25  ? 67.933 22.628  55.793 1.00 36.73  ? 23   LEU A O   1 
ATOM   167  C  CB  . LEU A 1 25  ? 67.459 25.783  56.858 1.00 35.31  ? 23   LEU A CB  1 
ATOM   168  C  CG  . LEU A 1 25  ? 68.218 25.235  58.078 1.00 39.92  ? 23   LEU A CG  1 
ATOM   169  C  CD1 . LEU A 1 25  ? 69.715 25.262  57.790 1.00 40.95  ? 23   LEU A CD1 1 
ATOM   170  C  CD2 . LEU A 1 25  ? 67.910 26.068  59.327 1.00 35.53  ? 23   LEU A CD2 1 
ATOM   171  N  N   . ALA A 1 26  ? 65.810 23.367  55.920 1.00 35.08  ? 24   ALA A N   1 
ATOM   172  C  CA  . ALA A 1 26  ? 65.265 22.031  56.141 1.00 31.99  ? 24   ALA A CA  1 
ATOM   173  C  C   . ALA A 1 26  ? 65.708 21.063  55.070 1.00 30.63  ? 24   ALA A C   1 
ATOM   174  O  O   . ALA A 1 26  ? 65.945 19.895  55.356 1.00 30.72  ? 24   ALA A O   1 
ATOM   175  C  CB  . ALA A 1 26  ? 63.729 22.071  56.197 1.00 33.11  ? 24   ALA A CB  1 
ATOM   176  N  N   . LEU A 1 27  ? 65.828 21.540  53.833 1.00 33.66  ? 25   LEU A N   1 
ATOM   177  C  CA  . LEU A 1 27  ? 66.222 20.656  52.726 1.00 32.94  ? 25   LEU A CA  1 
ATOM   178  C  C   . LEU A 1 27  ? 67.753 20.552  52.533 1.00 34.50  ? 25   LEU A C   1 
ATOM   179  O  O   . LEU A 1 27  ? 68.225 19.849  51.642 1.00 32.38  ? 25   LEU A O   1 
ATOM   180  C  CB  . LEU A 1 27  ? 65.567 21.140  51.415 1.00 36.65  ? 25   LEU A CB  1 
ATOM   181  C  CG  . LEU A 1 27  ? 64.028 21.123  51.279 1.00 35.07  ? 25   LEU A CG  1 
ATOM   182  C  CD1 . LEU A 1 27  ? 63.610 21.787  49.984 1.00 35.58  ? 25   LEU A CD1 1 
ATOM   183  C  CD2 . LEU A 1 27  ? 63.508 19.698  51.314 1.00 38.15  ? 25   LEU A CD2 1 
ATOM   184  N  N   . THR A 1 28  ? 68.525 21.233  53.375 1.00 28.19  ? 26   THR A N   1 
ATOM   185  C  CA  . THR A 1 28  ? 69.965 21.223  53.221 1.00 39.03  ? 26   THR A CA  1 
ATOM   186  C  C   . THR A 1 28  ? 70.722 20.057  53.849 1.00 35.64  ? 26   THR A C   1 
ATOM   187  O  O   . THR A 1 28  ? 71.021 20.075  55.022 1.00 35.30  ? 26   THR A O   1 
ATOM   188  C  CB  . THR A 1 28  ? 70.545 22.512  53.748 1.00 31.40  ? 26   THR A CB  1 
ATOM   189  O  OG1 . THR A 1 28  ? 69.909 23.601  53.085 1.00 40.09  ? 26   THR A OG1 1 
ATOM   190  C  CG2 . THR A 1 28  ? 72.049 22.582  53.472 1.00 39.65  ? 26   THR A CG2 1 
ATOM   191  N  N   . HIS A 1 29  ? 71.028 19.042  53.057 1.00 35.82  ? 27   HIS A N   1 
ATOM   192  C  CA  . HIS A 1 29  ? 71.784 17.910  53.583 1.00 33.67  ? 27   HIS A CA  1 
ATOM   193  C  C   . HIS A 1 29  ? 73.204 18.380  53.834 1.00 32.96  ? 27   HIS A C   1 
ATOM   194  O  O   . HIS A 1 29  ? 73.698 19.274  53.150 1.00 37.40  ? 27   HIS A O   1 
ATOM   195  C  CB  . HIS A 1 29  ? 71.768 16.755  52.593 1.00 37.82  ? 27   HIS A CB  1 
ATOM   196  C  CG  . HIS A 1 29  ? 72.436 15.516  53.104 1.00 46.98  ? 27   HIS A CG  1 
ATOM   197  N  ND1 . HIS A 1 29  ? 73.779 15.261  52.913 1.00 43.21  ? 27   HIS A ND1 1 
ATOM   198  C  CD2 . HIS A 1 29  ? 71.953 14.476  53.828 1.00 44.05  ? 27   HIS A CD2 1 
ATOM   199  C  CE1 . HIS A 1 29  ? 74.092 14.117  53.500 1.00 45.69  ? 27   HIS A CE1 1 
ATOM   200  N  NE2 . HIS A 1 29  ? 73.003 13.621  54.064 1.00 37.13  ? 27   HIS A NE2 1 
ATOM   201  N  N   . ARG A 1 30  ? 73.868 17.791  54.817 1.00 29.04  ? 28   ARG A N   1 
ATOM   202  C  CA  . ARG A 1 30  ? 75.225 18.190  55.158 1.00 39.01  ? 28   ARG A CA  1 
ATOM   203  C  C   . ARG A 1 30  ? 76.223 18.195  53.988 1.00 35.95  ? 28   ARG A C   1 
ATOM   204  O  O   . ARG A 1 30  ? 77.107 19.050  53.934 1.00 47.47  ? 28   ARG A O   1 
ATOM   205  C  CB  . ARG A 1 30  ? 75.749 17.306  56.294 1.00 44.11  ? 28   ARG A CB  1 
ATOM   206  C  CG  . ARG A 1 30  ? 75.913 15.843  55.919 1.00 48.99  ? 28   ARG A CG  1 
ATOM   207  C  CD  . ARG A 1 30  ? 75.508 14.949  57.075 1.00 56.20  ? 28   ARG A CD  1 
ATOM   208  N  NE  . ARG A 1 30  ? 76.534 14.910  58.107 1.00 63.68  ? 28   ARG A NE  1 
ATOM   209  C  CZ  . ARG A 1 30  ? 77.840 14.936  57.863 1.00 78.29  ? 28   ARG A CZ  1 
ATOM   210  N  NH1 . ARG A 1 30  ? 78.569 15.973  58.262 1.00 81.04  ? 28   ARG A NH1 1 
ATOM   211  N  NH2 . ARG A 1 30  ? 78.418 13.931  57.210 1.00 80.52  ? 28   ARG A NH2 1 
ATOM   212  N  N   . SER A 1 31  ? 76.085 17.250  53.068 1.00 37.89  ? 29   SER A N   1 
ATOM   213  C  CA  . SER A 1 31  ? 76.984 17.176  51.911 1.00 45.92  ? 29   SER A CA  1 
ATOM   214  C  C   . SER A 1 31  ? 76.969 18.501  51.140 1.00 46.55  ? 29   SER A C   1 
ATOM   215  O  O   . SER A 1 31  ? 78.017 19.119  50.898 1.00 47.04  ? 29   SER A O   1 
ATOM   216  C  CB  . SER A 1 31  ? 76.552 16.041  50.986 1.00 34.78  ? 29   SER A CB  1 
ATOM   217  O  OG  . SER A 1 31  ? 75.276 16.294  50.447 1.00 51.67  ? 29   SER A OG  1 
ATOM   218  N  N   . TYR A 1 32  ? 75.768 18.925  50.758 1.00 46.45  ? 30   TYR A N   1 
ATOM   219  C  CA  . TYR A 1 32  ? 75.583 20.175  50.046 1.00 39.16  ? 30   TYR A CA  1 
ATOM   220  C  C   . TYR A 1 32  ? 76.195 21.264  50.882 1.00 41.34  ? 30   TYR A C   1 
ATOM   221  O  O   . TYR A 1 32  ? 76.952 22.097  50.399 1.00 50.25  ? 30   TYR A O   1 
ATOM   222  C  CB  . TYR A 1 32  ? 74.093 20.470  49.869 1.00 41.21  ? 30   TYR A CB  1 
ATOM   223  C  CG  . TYR A 1 32  ? 73.820 21.733  49.094 1.00 41.41  ? 30   TYR A CG  1 
ATOM   224  C  CD1 . TYR A 1 32  ? 73.635 21.697  47.711 1.00 39.01  ? 30   TYR A CD1 1 
ATOM   225  C  CD2 . TYR A 1 32  ? 73.772 22.975  49.737 1.00 41.00  ? 30   TYR A CD2 1 
ATOM   226  C  CE1 . TYR A 1 32  ? 73.405 22.866  46.985 1.00 42.66  ? 30   TYR A CE1 1 
ATOM   227  C  CE2 . TYR A 1 32  ? 73.546 24.152  49.021 1.00 35.63  ? 30   TYR A CE2 1 
ATOM   228  C  CZ  . TYR A 1 32  ? 73.362 24.082  47.645 1.00 44.34  ? 30   TYR A CZ  1 
ATOM   229  O  OH  . TYR A 1 32  ? 73.132 25.230  46.929 1.00 52.26  ? 30   TYR A OH  1 
ATOM   230  N  N   . ALA A 1 33  ? 75.864 21.251  52.164 1.00 38.95  ? 31   ALA A N   1 
ATOM   231  C  CA  . ALA A 1 33  ? 76.351 22.266  53.077 1.00 31.44  ? 31   ALA A CA  1 
ATOM   232  C  C   . ALA A 1 33  ? 77.876 22.425  53.061 1.00 39.12  ? 31   ALA A C   1 
ATOM   233  O  O   . ALA A 1 33  ? 78.382 23.544  52.985 1.00 44.42  ? 31   ALA A O   1 
ATOM   234  C  CB  . ALA A 1 33  ? 75.868 21.959  54.502 1.00 31.58  ? 31   ALA A CB  1 
ATOM   235  N  N   . TYR A 1 34  ? 78.604 21.315  53.159 1.00 47.31  ? 32   TYR A N   1 
ATOM   236  C  CA  . TYR A 1 34  ? 80.075 21.365  53.166 1.00 49.84  ? 32   TYR A CA  1 
ATOM   237  C  C   . TYR A 1 34  ? 80.631 21.828  51.813 1.00 45.09  ? 32   TYR A C   1 
ATOM   238  O  O   . TYR A 1 34  ? 81.451 22.739  51.737 1.00 49.96  ? 32   TYR A O   1 
ATOM   239  C  CB  . TYR A 1 34  ? 80.644 19.986  53.520 1.00 49.79  ? 32   TYR A CB  1 
ATOM   240  C  CG  . TYR A 1 34  ? 80.187 19.441  54.866 1.00 53.96  ? 32   TYR A CG  1 
ATOM   241  C  CD1 . TYR A 1 34  ? 80.033 20.284  55.978 1.00 51.13  ? 32   TYR A CD1 1 
ATOM   242  C  CD2 . TYR A 1 34  ? 79.948 18.080  55.040 1.00 54.91  ? 32   TYR A CD2 1 
ATOM   243  C  CE1 . TYR A 1 34  ? 79.655 19.782  57.224 1.00 45.55  ? 32   TYR A CE1 1 
ATOM   244  C  CE2 . TYR A 1 34  ? 79.567 17.568  56.287 1.00 52.99  ? 32   TYR A CE2 1 
ATOM   245  C  CZ  . TYR A 1 34  ? 79.426 18.428  57.369 1.00 46.55  ? 32   TYR A CZ  1 
ATOM   246  O  OH  . TYR A 1 34  ? 79.064 17.925  58.596 1.00 55.37  ? 32   TYR A OH  1 
ATOM   247  N  N   . GLU A 1 35  ? 80.166 21.185  50.752 1.00 47.36  ? 33   GLU A N   1 
ATOM   248  C  CA  . GLU A 1 35  ? 80.573 21.510  49.398 1.00 49.87  ? 33   GLU A CA  1 
ATOM   249  C  C   . GLU A 1 35  ? 80.379 22.982  49.052 1.00 56.58  ? 33   GLU A C   1 
ATOM   250  O  O   . GLU A 1 35  ? 81.075 23.511  48.189 1.00 57.24  ? 33   GLU A O   1 
ATOM   251  C  CB  . GLU A 1 35  ? 79.781 20.642  48.433 1.00 58.28  ? 33   GLU A CB  1 
ATOM   252  C  CG  . GLU A 1 35  ? 79.828 21.060  46.986 1.00 69.24  ? 33   GLU A CG  1 
ATOM   253  C  CD  . GLU A 1 35  ? 78.979 20.145  46.128 1.00 75.82  ? 33   GLU A CD  1 
ATOM   254  O  OE1 . GLU A 1 35  ? 79.283 18.930  46.083 1.00 75.98  ? 33   GLU A OE1 1 
ATOM   255  O  OE2 . GLU A 1 35  ? 78.006 20.637  45.515 1.00 75.89  ? 33   GLU A OE2 1 
ATOM   256  N  N   . ASN A 1 36  ? 79.448 23.659  49.716 1.00 50.96  ? 34   ASN A N   1 
ATOM   257  C  CA  . ASN A 1 36  ? 79.230 25.057  49.389 1.00 50.25  ? 34   ASN A CA  1 
ATOM   258  C  C   . ASN A 1 36  ? 79.736 26.070  50.398 1.00 51.53  ? 34   ASN A C   1 
ATOM   259  O  O   . ASN A 1 36  ? 79.193 27.167  50.530 1.00 53.23  ? 34   ASN A O   1 
ATOM   260  C  CB  . ASN A 1 36  ? 77.755 25.308  49.061 1.00 51.78  ? 34   ASN A CB  1 
ATOM   261  C  CG  . ASN A 1 36  ? 77.312 24.562  47.813 1.00 54.60  ? 34   ASN A CG  1 
ATOM   262  O  OD1 . ASN A 1 36  ? 76.890 23.411  47.877 1.00 61.71  ? 34   ASN A OD1 1 
ATOM   263  N  ND2 . ASN A 1 36  ? 77.442 25.206  46.666 1.00 57.51  ? 34   ASN A ND2 1 
ATOM   264  N  N   . GLY A 1 37  ? 80.784 25.703  51.122 1.00 51.98  ? 35   GLY A N   1 
ATOM   265  C  CA  . GLY A 1 37  ? 81.373 26.643  52.056 1.00 53.26  ? 35   GLY A CA  1 
ATOM   266  C  C   . GLY A 1 37  ? 80.980 26.613  53.512 1.00 50.72  ? 35   GLY A C   1 
ATOM   267  O  O   . GLY A 1 37  ? 81.223 27.585  54.220 1.00 54.20  ? 35   GLY A O   1 
ATOM   268  N  N   . GLY A 1 38  ? 80.387 25.516  53.969 1.00 50.93  ? 36   GLY A N   1 
ATOM   269  C  CA  . GLY A 1 38  ? 79.999 25.438  55.364 1.00 54.07  ? 36   GLY A CA  1 
ATOM   270  C  C   . GLY A 1 38  ? 78.709 26.176  55.674 1.00 49.05  ? 36   GLY A C   1 
ATOM   271  O  O   . GLY A 1 38  ? 78.681 27.085  56.505 1.00 55.10  ? 36   GLY A O   1 
ATOM   272  N  N   . LEU A 1 39  ? 77.646 25.784  54.980 1.00 46.42  ? 37   LEU A N   1 
ATOM   273  C  CA  . LEU A 1 39  ? 76.307 26.352  55.166 1.00 41.69  ? 37   LEU A CA  1 
ATOM   274  C  C   . LEU A 1 39  ? 75.650 25.620  56.342 1.00 45.38  ? 37   LEU A C   1 
ATOM   275  O  O   . LEU A 1 39  ? 76.061 24.509  56.685 1.00 41.86  ? 37   LEU A O   1 
ATOM   276  C  CB  . LEU A 1 39  ? 75.453 26.083  53.923 1.00 38.56  ? 37   LEU A CB  1 
ATOM   277  C  CG  . LEU A 1 39  ? 75.290 27.100  52.785 1.00 42.10  ? 37   LEU A CG  1 
ATOM   278  C  CD1 . LEU A 1 39  ? 76.546 27.896  52.603 1.00 37.92  ? 37   LEU A CD1 1 
ATOM   279  C  CD2 . LEU A 1 39  ? 74.901 26.369  51.497 1.00 36.85  ? 37   LEU A CD2 1 
ATOM   280  N  N   . PRO A 1 40  ? 74.629 26.228  56.978 1.00 44.54  ? 38   PRO A N   1 
ATOM   281  C  CA  . PRO A 1 40  ? 73.971 25.533  58.096 1.00 36.30  ? 38   PRO A CA  1 
ATOM   282  C  C   . PRO A 1 40  ? 73.271 24.302  57.510 1.00 32.44  ? 38   PRO A C   1 
ATOM   283  O  O   . PRO A 1 40  ? 72.836 24.330  56.367 1.00 32.41  ? 38   PRO A O   1 
ATOM   284  C  CB  . PRO A 1 40  ? 72.964 26.565  58.603 1.00 40.49  ? 38   PRO A CB  1 
ATOM   285  C  CG  . PRO A 1 40  ? 73.617 27.881  58.250 1.00 46.59  ? 38   PRO A CG  1 
ATOM   286  C  CD  . PRO A 1 40  ? 74.154 27.621  56.861 1.00 39.59  ? 38   PRO A CD  1 
ATOM   287  N  N   . THR A 1 41  ? 73.154 23.221  58.271 1.00 30.17  ? 39   THR A N   1 
ATOM   288  C  CA  . THR A 1 41  ? 72.502 22.024  57.735 1.00 32.20  ? 39   THR A CA  1 
ATOM   289  C  C   . THR A 1 41  ? 71.145 21.771  58.369 1.00 29.62  ? 39   THR A C   1 
ATOM   290  O  O   . THR A 1 41  ? 70.802 22.383  59.363 1.00 30.37  ? 39   THR A O   1 
ATOM   291  C  CB  . THR A 1 41  ? 73.340 20.763  57.991 1.00 32.76  ? 39   THR A CB  1 
ATOM   292  O  OG1 . THR A 1 41  ? 73.298 20.448  59.389 1.00 31.85  ? 39   THR A OG1 1 
ATOM   293  C  CG2 . THR A 1 41  ? 74.782 20.999  57.580 1.00 33.04  ? 39   THR A CG2 1 
ATOM   294  N  N   . ASN A 1 42  ? 70.393 20.840  57.801 1.00 30.53  ? 40   ASN A N   1 
ATOM   295  C  CA  . ASN A 1 42  ? 69.084 20.492  58.341 1.00 28.63  ? 40   ASN A CA  1 
ATOM   296  C  C   . ASN A 1 42  ? 69.168 19.562  59.560 1.00 33.60  ? 40   ASN A C   1 
ATOM   297  O  O   . ASN A 1 42  ? 68.146 19.087  60.036 1.00 32.15  ? 40   ASN A O   1 
ATOM   298  C  CB  . ASN A 1 42  ? 68.241 19.805  57.287 1.00 24.82  ? 40   ASN A CB  1 
ATOM   299  C  CG  . ASN A 1 42  ? 68.795 18.438  56.891 1.00 37.34  ? 40   ASN A CG  1 
ATOM   300  O  OD1 . ASN A 1 42  ? 69.782 17.958  57.459 1.00 29.65  ? 40   ASN A OD1 1 
ATOM   301  N  ND2 . ASN A 1 42  ? 68.152 17.805  55.914 1.00 30.81  ? 40   ASN A ND2 1 
ATOM   302  N  N   . GLU A 1 43  ? 70.372 19.324  60.075 1.00 34.05  ? 41   GLU A N   1 
ATOM   303  C  CA  . GLU A 1 43  ? 70.548 18.414  61.209 1.00 29.70  ? 41   GLU A CA  1 
ATOM   304  C  C   . GLU A 1 43  ? 69.881 18.806  62.525 1.00 28.95  ? 41   GLU A C   1 
ATOM   305  O  O   . GLU A 1 43  ? 69.360 17.935  63.216 1.00 34.19  ? 41   GLU A O   1 
ATOM   306  C  CB  . GLU A 1 43  ? 72.044 18.139  61.429 1.00 27.53  ? 41   GLU A CB  1 
ATOM   307  C  CG  . GLU A 1 43  ? 72.638 17.356  60.247 1.00 40.98  ? 41   GLU A CG  1 
ATOM   308  C  CD  . GLU A 1 43  ? 74.143 17.274  60.284 1.00 49.68  ? 41   GLU A CD  1 
ATOM   309  O  OE1 . GLU A 1 43  ? 74.801 18.326  60.112 1.00 47.63  ? 41   GLU A OE1 1 
ATOM   310  O  OE2 . GLU A 1 43  ? 74.661 16.154  60.489 1.00 50.60  ? 41   GLU A OE2 1 
ATOM   311  N  N   . ARG A 1 44  ? 69.885 20.094  62.868 1.00 29.73  ? 42   ARG A N   1 
ATOM   312  C  CA  . ARG A 1 44  ? 69.249 20.558  64.108 1.00 29.32  ? 42   ARG A CA  1 
ATOM   313  C  C   . ARG A 1 44  ? 67.742 20.364  63.972 1.00 34.81  ? 42   ARG A C   1 
ATOM   314  O  O   . ARG A 1 44  ? 67.064 19.869  64.893 1.00 31.16  ? 42   ARG A O   1 
ATOM   315  C  CB  . ARG A 1 44  ? 69.587 22.031  64.363 1.00 34.63  ? 42   ARG A CB  1 
ATOM   316  C  CG  . ARG A 1 44  ? 71.020 22.268  64.900 1.00 40.70  ? 42   ARG A CG  1 
ATOM   317  C  CD  . ARG A 1 44  ? 71.401 23.748  64.785 1.00 43.65  ? 42   ARG A CD  1 
ATOM   318  N  NE  . ARG A 1 44  ? 70.322 24.626  65.235 1.00 39.33  ? 42   ARG A NE  1 
ATOM   319  C  CZ  . ARG A 1 44  ? 70.060 24.899  66.508 1.00 40.28  ? 42   ARG A CZ  1 
ATOM   320  N  NH1 . ARG A 1 44  ? 70.806 24.372  67.470 1.00 32.35  ? 42   ARG A NH1 1 
ATOM   321  N  NH2 . ARG A 1 44  ? 69.046 25.691  66.815 1.00 35.61  ? 42   ARG A NH2 1 
ATOM   322  N  N   . LEU A 1 45  ? 67.239 20.723  62.796 1.00 26.86  ? 43   LEU A N   1 
ATOM   323  C  CA  . LEU A 1 45  ? 65.829 20.581  62.472 1.00 29.10  ? 43   LEU A CA  1 
ATOM   324  C  C   . LEU A 1 45  ? 65.417 19.096  62.553 1.00 28.06  ? 43   LEU A C   1 
ATOM   325  O  O   . LEU A 1 45  ? 64.338 18.754  63.048 1.00 28.34  ? 43   LEU A O   1 
ATOM   326  C  CB  . LEU A 1 45  ? 65.579 21.145  61.059 1.00 25.21  ? 43   LEU A CB  1 
ATOM   327  C  CG  . LEU A 1 45  ? 64.786 22.441  60.824 1.00 35.29  ? 43   LEU A CG  1 
ATOM   328  C  CD1 . LEU A 1 45  ? 64.525 23.193  62.121 1.00 32.40  ? 43   LEU A CD1 1 
ATOM   329  C  CD2 . LEU A 1 45  ? 65.523 23.291  59.800 1.00 30.84  ? 43   LEU A CD2 1 
ATOM   330  N  N   . GLU A 1 46  ? 66.282 18.214  62.061 1.00 26.59  ? 44   GLU A N   1 
ATOM   331  C  CA  . GLU A 1 46  ? 66.030 16.765  62.092 1.00 27.59  ? 44   GLU A CA  1 
ATOM   332  C  C   . GLU A 1 46  ? 65.863 16.293  63.550 1.00 24.30  ? 44   GLU A C   1 
ATOM   333  O  O   . GLU A 1 46  ? 64.945 15.548  63.882 1.00 31.58  ? 44   GLU A O   1 
ATOM   334  C  CB  . GLU A 1 46  ? 67.224 16.028  61.456 1.00 31.78  ? 44   GLU A CB  1 
ATOM   335  C  CG  . GLU A 1 46  ? 67.172 14.519  61.566 1.00 43.59  ? 44   GLU A CG  1 
ATOM   336  C  CD  . GLU A 1 46  ? 68.556 13.890  61.516 1.00 56.22  ? 44   GLU A CD  1 
ATOM   337  O  OE1 . GLU A 1 46  ? 69.407 14.379  60.748 1.00 57.87  ? 44   GLU A OE1 1 
ATOM   338  O  OE2 . GLU A 1 46  ? 68.793 12.904  62.238 1.00 62.51  ? 44   GLU A OE2 1 
ATOM   339  N  N   . PHE A 1 47  ? 66.775 16.741  64.392 1.00 23.05  ? 45   PHE A N   1 
ATOM   340  C  CA  . PHE A 1 47  ? 66.809 16.437  65.826 1.00 27.52  ? 45   PHE A CA  1 
ATOM   341  C  C   . PHE A 1 47  ? 65.493 16.871  66.459 1.00 28.15  ? 45   PHE A C   1 
ATOM   342  O  O   . PHE A 1 47  ? 64.882 16.148  67.252 1.00 28.11  ? 45   PHE A O   1 
ATOM   343  C  CB  . PHE A 1 47  ? 67.954 17.229  66.453 1.00 34.17  ? 45   PHE A CB  1 
ATOM   344  C  CG  . PHE A 1 47  ? 68.165 16.984  67.919 1.00 31.66  ? 45   PHE A CG  1 
ATOM   345  C  CD1 . PHE A 1 47  ? 68.626 15.753  68.381 1.00 36.80  ? 45   PHE A CD1 1 
ATOM   346  C  CD2 . PHE A 1 47  ? 67.974 18.014  68.834 1.00 38.20  ? 45   PHE A CD2 1 
ATOM   347  C  CE1 . PHE A 1 47  ? 68.907 15.554  69.731 1.00 27.63  ? 45   PHE A CE1 1 
ATOM   348  C  CE2 . PHE A 1 47  ? 68.252 17.826  70.186 1.00 32.37  ? 45   PHE A CE2 1 
ATOM   349  C  CZ  . PHE A 1 47  ? 68.718 16.592  70.630 1.00 30.45  ? 45   PHE A CZ  1 
ATOM   350  N  N   . LEU A 1 48  ? 65.057 18.071  66.108 1.00 28.17  ? 46   LEU A N   1 
ATOM   351  C  CA  . LEU A 1 48  ? 63.804 18.575  66.644 1.00 21.80  ? 46   LEU A CA  1 
ATOM   352  C  C   . LEU A 1 48  ? 62.626 17.774  66.093 1.00 25.09  ? 46   LEU A C   1 
ATOM   353  O  O   . LEU A 1 48  ? 61.780 17.319  66.858 1.00 27.88  ? 46   LEU A O   1 
ATOM   354  C  CB  . LEU A 1 48  ? 63.613 20.042  66.289 1.00 29.62  ? 46   LEU A CB  1 
ATOM   355  C  CG  . LEU A 1 48  ? 62.277 20.643  66.766 1.00 25.69  ? 46   LEU A CG  1 
ATOM   356  C  CD1 . LEU A 1 48  ? 62.206 20.596  68.301 1.00 25.59  ? 46   LEU A CD1 1 
ATOM   357  C  CD2 . LEU A 1 48  ? 62.177 22.092  66.266 1.00 26.00  ? 46   LEU A CD2 1 
ATOM   358  N  N   . GLY A 1 49  ? 62.596 17.584  64.775 1.00 22.32  ? 47   GLY A N   1 
ATOM   359  C  CA  . GLY A 1 49  ? 61.500 16.867  64.160 1.00 18.58  ? 47   GLY A CA  1 
ATOM   360  C  C   . GLY A 1 49  ? 61.341 15.455  64.693 1.00 29.42  ? 47   GLY A C   1 
ATOM   361  O  O   . GLY A 1 49  ? 60.213 14.931  64.771 1.00 25.22  ? 47   GLY A O   1 
ATOM   362  N  N   . ASP A 1 50  ? 62.468 14.843  65.070 1.00 28.05  ? 48   ASP A N   1 
ATOM   363  C  CA  . ASP A 1 50  ? 62.465 13.485  65.596 1.00 28.76  ? 48   ASP A CA  1 
ATOM   364  C  C   . ASP A 1 50  ? 61.699 13.441  66.926 1.00 25.54  ? 48   ASP A C   1 
ATOM   365  O  O   . ASP A 1 50  ? 60.879 12.558  67.154 1.00 27.05  ? 48   ASP A O   1 
ATOM   366  C  CB  . ASP A 1 50  ? 63.902 12.988  65.797 1.00 31.21  ? 48   ASP A CB  1 
ATOM   367  C  CG  . ASP A 1 50  ? 63.950 11.500  66.115 1.00 40.13  ? 48   ASP A CG  1 
ATOM   368  O  OD1 . ASP A 1 50  ? 63.895 10.700  65.173 1.00 52.53  ? 48   ASP A OD1 1 
ATOM   369  O  OD2 . ASP A 1 50  ? 64.004 11.133  67.296 1.00 46.01  ? 48   ASP A OD2 1 
ATOM   370  N  N   . ALA A 1 51  ? 61.956 14.402  67.798 1.00 28.43  ? 49   ALA A N   1 
ATOM   371  C  CA  . ALA A 1 51  ? 61.238 14.443  69.077 1.00 29.30  ? 49   ALA A CA  1 
ATOM   372  C  C   . ALA A 1 51  ? 59.734 14.768  68.870 1.00 24.12  ? 49   ALA A C   1 
ATOM   373  O  O   . ALA A 1 51  ? 58.864 14.226  69.566 1.00 27.82  ? 49   ALA A O   1 
ATOM   374  C  CB  . ALA A 1 51  ? 61.883 15.470  69.993 1.00 25.20  ? 49   ALA A CB  1 
ATOM   375  N  N   . VAL A 1 52  ? 59.432 15.651  67.919 1.00 26.52  ? 50   VAL A N   1 
ATOM   376  C  CA  . VAL A 1 52  ? 58.034 16.022  67.620 1.00 23.84  ? 50   VAL A CA  1 
ATOM   377  C  C   . VAL A 1 52  ? 57.280 14.790  67.086 1.00 27.95  ? 50   VAL A C   1 
ATOM   378  O  O   . VAL A 1 52  ? 56.175 14.474  67.534 1.00 32.80  ? 50   VAL A O   1 
ATOM   379  C  CB  . VAL A 1 52  ? 57.949 17.176  66.560 1.00 23.44  ? 50   VAL A CB  1 
ATOM   380  C  CG1 . VAL A 1 52  ? 56.481 17.404  66.119 1.00 28.58  ? 50   VAL A CG1 1 
ATOM   381  C  CG2 . VAL A 1 52  ? 58.437 18.462  67.159 1.00 22.41  ? 50   VAL A CG2 1 
ATOM   382  N  N   . LEU A 1 53  ? 57.883 14.101  66.120 1.00 28.28  ? 51   LEU A N   1 
ATOM   383  C  CA  . LEU A 1 53  ? 57.289 12.898  65.562 1.00 25.34  ? 51   LEU A CA  1 
ATOM   384  C  C   . LEU A 1 53  ? 57.158 11.836  66.668 1.00 30.58  ? 51   LEU A C   1 
ATOM   385  O  O   . LEU A 1 53  ? 56.122 11.153  66.777 1.00 28.09  ? 51   LEU A O   1 
ATOM   386  C  CB  . LEU A 1 53  ? 58.164 12.325  64.433 1.00 23.88  ? 51   LEU A CB  1 
ATOM   387  C  CG  . LEU A 1 53  ? 57.640 11.022  63.817 1.00 30.04  ? 51   LEU A CG  1 
ATOM   388  C  CD1 . LEU A 1 53  ? 56.334 11.304  63.133 1.00 29.97  ? 51   LEU A CD1 1 
ATOM   389  C  CD2 . LEU A 1 53  ? 58.645 10.438  62.820 1.00 37.20  ? 51   LEU A CD2 1 
ATOM   390  N  N   . GLY A 1 54  ? 58.204 11.703  67.481 1.00 26.30  ? 52   GLY A N   1 
ATOM   391  C  CA  . GLY A 1 54  ? 58.187 10.721  68.550 1.00 25.29  ? 52   GLY A CA  1 
ATOM   392  C  C   . GLY A 1 54  ? 57.010 10.915  69.509 1.00 34.09  ? 52   GLY A C   1 
ATOM   393  O  O   . GLY A 1 54  ? 56.288 9.957   69.816 1.00 28.69  ? 52   GLY A O   1 
ATOM   394  N  N   . LEU A 1 55  ? 56.793 12.147  69.972 1.00 28.27  ? 53   LEU A N   1 
ATOM   395  C  CA  . LEU A 1 55  ? 55.684 12.390  70.897 1.00 31.72  ? 53   LEU A CA  1 
ATOM   396  C  C   . LEU A 1 55  ? 54.338 12.148  70.208 1.00 35.88  ? 53   LEU A C   1 
ATOM   397  O  O   . LEU A 1 55  ? 53.473 11.449  70.745 1.00 36.52  ? 53   LEU A O   1 
ATOM   398  C  CB  . LEU A 1 55  ? 55.716 13.817  71.454 1.00 28.15  ? 53   LEU A CB  1 
ATOM   399  C  CG  . LEU A 1 55  ? 54.458 14.153  72.264 1.00 34.76  ? 53   LEU A CG  1 
ATOM   400  C  CD1 . LEU A 1 55  ? 54.356 13.225  73.480 1.00 31.21  ? 53   LEU A CD1 1 
ATOM   401  C  CD2 . LEU A 1 55  ? 54.506 15.589  72.726 1.00 22.49  ? 53   LEU A CD2 1 
ATOM   402  N  N   . THR A 1 56  ? 54.166 12.702  69.014 1.00 31.15  ? 54   THR A N   1 
ATOM   403  C  CA  . THR A 1 56  ? 52.902 12.537  68.294 1.00 36.50  ? 54   THR A CA  1 
ATOM   404  C  C   . THR A 1 56  ? 52.510 11.072  68.087 1.00 37.13  ? 54   THR A C   1 
ATOM   405  O  O   . THR A 1 56  ? 51.376 10.681  68.344 1.00 34.56  ? 54   THR A O   1 
ATOM   406  C  CB  . THR A 1 56  ? 52.936 13.245  66.914 1.00 38.12  ? 54   THR A CB  1 
ATOM   407  O  OG1 . THR A 1 56  ? 53.223 14.643  67.088 1.00 37.12  ? 54   THR A OG1 1 
ATOM   408  C  CG2 . THR A 1 56  ? 51.596 13.108  66.224 1.00 36.10  ? 54   THR A CG2 1 
ATOM   409  N  N   . ILE A 1 57  ? 53.440 10.253  67.623 1.00 36.83  ? 55   ILE A N   1 
ATOM   410  C  CA  . ILE A 1 57  ? 53.122 8.849   67.404 1.00 34.16  ? 55   ILE A CA  1 
ATOM   411  C  C   . ILE A 1 57  ? 52.902 8.124   68.739 1.00 41.37  ? 55   ILE A C   1 
ATOM   412  O  O   . ILE A 1 57  ? 52.070 7.222   68.833 1.00 38.96  ? 55   ILE A O   1 
ATOM   413  C  CB  . ILE A 1 57  ? 54.256 8.149   66.623 1.00 37.43  ? 55   ILE A CB  1 
ATOM   414  C  CG1 . ILE A 1 57  ? 54.371 8.754   65.214 1.00 43.77  ? 55   ILE A CG1 1 
ATOM   415  C  CG2 . ILE A 1 57  ? 54.013 6.652   66.568 1.00 38.24  ? 55   ILE A CG2 1 
ATOM   416  C  CD1 . ILE A 1 57  ? 53.033 8.862   64.464 1.00 39.92  ? 55   ILE A CD1 1 
ATOM   417  N  N   . THR A 1 58  ? 53.642 8.538   69.769 1.00 35.98  ? 56   THR A N   1 
ATOM   418  C  CA  . THR A 1 58  ? 53.536 7.920   71.080 1.00 34.55  ? 56   THR A CA  1 
ATOM   419  C  C   . THR A 1 58  ? 52.154 8.200   71.623 1.00 37.27  ? 56   THR A C   1 
ATOM   420  O  O   . THR A 1 58  ? 51.474 7.293   72.102 1.00 38.64  ? 56   THR A O   1 
ATOM   421  C  CB  . THR A 1 58  ? 54.610 8.480   72.071 1.00 32.07  ? 56   THR A CB  1 
ATOM   422  O  OG1 . THR A 1 58  ? 55.917 8.078   71.643 1.00 28.83  ? 56   THR A OG1 1 
ATOM   423  C  CG2 . THR A 1 58  ? 54.376 7.945   73.484 1.00 27.39  ? 56   THR A CG2 1 
ATOM   424  N  N   . ASP A 1 59  ? 51.757 9.469   71.529 1.00 34.17  ? 57   ASP A N   1 
ATOM   425  C  CA  . ASP A 1 59  ? 50.469 9.970   71.999 1.00 37.49  ? 57   ASP A CA  1 
ATOM   426  C  C   . ASP A 1 59  ? 49.313 9.231   71.303 1.00 41.97  ? 57   ASP A C   1 
ATOM   427  O  O   . ASP A 1 59  ? 48.370 8.792   71.947 1.00 41.70  ? 57   ASP A O   1 
ATOM   428  C  CB  . ASP A 1 59  ? 50.401 11.484  71.714 1.00 41.55  ? 57   ASP A CB  1 
ATOM   429  C  CG  . ASP A 1 59  ? 49.145 12.143  72.246 1.00 39.13  ? 57   ASP A CG  1 
ATOM   430  O  OD1 . ASP A 1 59  ? 48.069 11.523  72.194 1.00 59.21  ? 57   ASP A OD1 1 
ATOM   431  O  OD2 . ASP A 1 59  ? 49.226 13.298  72.701 1.00 42.68  ? 57   ASP A OD2 1 
ATOM   432  N  N   . ALA A 1 60  ? 49.400 9.088   69.988 1.00 41.01  ? 58   ALA A N   1 
ATOM   433  C  CA  . ALA A 1 60  ? 48.355 8.407   69.218 1.00 49.60  ? 58   ALA A CA  1 
ATOM   434  C  C   . ALA A 1 60  ? 48.195 6.938   69.609 1.00 46.72  ? 58   ALA A C   1 
ATOM   435  O  O   . ALA A 1 60  ? 47.098 6.482   69.925 1.00 50.21  ? 58   ALA A O   1 
ATOM   436  C  CB  . ALA A 1 60  ? 48.651 8.510   67.713 1.00 39.63  ? 58   ALA A CB  1 
ATOM   437  N  N   . LEU A 1 61  ? 49.293 6.199   69.563 1.00 44.09  ? 59   LEU A N   1 
ATOM   438  C  CA  . LEU A 1 61  ? 49.264 4.794   69.922 1.00 40.93  ? 59   LEU A CA  1 
ATOM   439  C  C   . LEU A 1 61  ? 48.730 4.635   71.348 1.00 44.24  ? 59   LEU A C   1 
ATOM   440  O  O   . LEU A 1 61  ? 47.968 3.711   71.623 1.00 43.13  ? 59   LEU A O   1 
ATOM   441  C  CB  . LEU A 1 61  ? 50.664 4.194   69.811 1.00 44.32  ? 59   LEU A CB  1 
ATOM   442  C  CG  . LEU A 1 61  ? 51.269 4.133   68.409 1.00 42.48  ? 59   LEU A CG  1 
ATOM   443  C  CD1 . LEU A 1 61  ? 52.703 3.664   68.487 1.00 42.30  ? 59   LEU A CD1 1 
ATOM   444  C  CD2 . LEU A 1 61  ? 50.448 3.180   67.546 1.00 57.00  ? 59   LEU A CD2 1 
ATOM   445  N  N   . PHE A 1 62  ? 49.122 5.539   72.247 1.00 38.85  ? 60   PHE A N   1 
ATOM   446  C  CA  . PHE A 1 62  ? 48.664 5.500   73.639 1.00 37.50  ? 60   PHE A CA  1 
ATOM   447  C  C   . PHE A 1 62  ? 47.143 5.506   73.689 1.00 43.61  ? 60   PHE A C   1 
ATOM   448  O  O   . PHE A 1 62  ? 46.539 4.715   74.409 1.00 41.85  ? 60   PHE A O   1 
ATOM   449  C  CB  . PHE A 1 62  ? 49.176 6.722   74.405 1.00 29.70  ? 60   PHE A CB  1 
ATOM   450  C  CG  . PHE A 1 62  ? 48.787 6.760   75.867 1.00 26.48  ? 60   PHE A CG  1 
ATOM   451  C  CD1 . PHE A 1 62  ? 49.634 6.224   76.836 1.00 28.31  ? 60   PHE A CD1 1 
ATOM   452  C  CD2 . PHE A 1 62  ? 47.608 7.377   76.277 1.00 31.33  ? 60   PHE A CD2 1 
ATOM   453  C  CE1 . PHE A 1 62  ? 49.321 6.302   78.187 1.00 25.45  ? 60   PHE A CE1 1 
ATOM   454  C  CE2 . PHE A 1 62  ? 47.277 7.462   77.623 1.00 26.90  ? 60   PHE A CE2 1 
ATOM   455  C  CZ  . PHE A 1 62  ? 48.139 6.920   78.588 1.00 36.47  ? 60   PHE A CZ  1 
ATOM   456  N  N   . HIS A 1 63  ? 46.531 6.414   72.937 1.00 41.47  ? 61   HIS A N   1 
ATOM   457  C  CA  . HIS A 1 63  ? 45.073 6.526   72.920 1.00 47.44  ? 61   HIS A CA  1 
ATOM   458  C  C   . HIS A 1 63  ? 44.369 5.406   72.141 1.00 52.67  ? 61   HIS A C   1 
ATOM   459  O  O   . HIS A 1 63  ? 43.348 4.872   72.570 1.00 53.82  ? 61   HIS A O   1 
ATOM   460  C  CB  . HIS A 1 63  ? 44.663 7.869   72.326 1.00 44.75  ? 61   HIS A CB  1 
ATOM   461  C  CG  . HIS A 1 63  ? 44.957 9.053   73.202 1.00 47.45  ? 61   HIS A CG  1 
ATOM   462  N  ND1 . HIS A 1 63  ? 44.024 9.598   74.059 1.00 42.09  ? 61   HIS A ND1 1 
ATOM   463  C  CD2 . HIS A 1 63  ? 46.065 9.824   73.321 1.00 38.63  ? 61   HIS A CD2 1 
ATOM   464  C  CE1 . HIS A 1 63  ? 44.542 10.654  74.663 1.00 42.32  ? 61   HIS A CE1 1 
ATOM   465  N  NE2 . HIS A 1 63  ? 45.780 10.813  74.232 1.00 41.44  ? 61   HIS A NE2 1 
ATOM   466  N  N   . ARG A 1 64  ? 44.934 5.029   71.008 1.00 54.15  ? 62   ARG A N   1 
ATOM   467  C  CA  . ARG A 1 64  ? 44.327 3.997   70.180 1.00 59.04  ? 62   ARG A CA  1 
ATOM   468  C  C   . ARG A 1 64  ? 44.383 2.577   70.725 1.00 61.15  ? 62   ARG A C   1 
ATOM   469  O  O   . ARG A 1 64  ? 43.657 1.706   70.256 1.00 60.66  ? 62   ARG A O   1 
ATOM   470  C  CB  . ARG A 1 64  ? 44.966 4.000   68.797 1.00 59.02  ? 62   ARG A CB  1 
ATOM   471  C  CG  . ARG A 1 64  ? 44.741 5.271   68.008 1.00 59.79  ? 62   ARG A CG  1 
ATOM   472  C  CD  . ARG A 1 64  ? 45.229 5.093   66.585 1.00 67.48  ? 62   ARG A CD  1 
ATOM   473  N  NE  . ARG A 1 64  ? 44.861 6.229   65.745 1.00 70.28  ? 62   ARG A NE  1 
ATOM   474  C  CZ  . ARG A 1 64  ? 44.917 6.222   64.420 1.00 69.33  ? 62   ARG A CZ  1 
ATOM   475  N  NH1 . ARG A 1 64  ? 45.324 5.135   63.792 1.00 59.12  ? 62   ARG A NH1 1 
ATOM   476  N  NH2 . ARG A 1 64  ? 44.565 7.299   63.731 1.00 63.97  ? 62   ARG A NH2 1 
ATOM   477  N  N   . HIS A 1 65  ? 45.265 2.333   71.685 1.00 55.78  ? 63   HIS A N   1 
ATOM   478  C  CA  . HIS A 1 65  ? 45.413 1.005   72.262 1.00 55.03  ? 63   HIS A CA  1 
ATOM   479  C  C   . HIS A 1 65  ? 45.558 1.121   73.774 1.00 53.26  ? 63   HIS A C   1 
ATOM   480  O  O   . HIS A 1 65  ? 46.632 0.878   74.321 1.00 50.12  ? 63   HIS A O   1 
ATOM   481  C  CB  . HIS A 1 65  ? 46.650 0.316   71.694 1.00 56.99  ? 63   HIS A CB  1 
ATOM   482  C  CG  . HIS A 1 65  ? 46.722 0.323   70.198 1.00 68.70  ? 63   HIS A CG  1 
ATOM   483  N  ND1 . HIS A 1 65  ? 47.128 -0.776  69.470 1.00 70.62  ? 63   HIS A ND1 1 
ATOM   484  C  CD2 . HIS A 1 65  ? 46.484 1.300   69.293 1.00 70.45  ? 63   HIS A CD2 1 
ATOM   485  C  CE1 . HIS A 1 65  ? 47.137 -0.475  68.185 1.00 67.29  ? 63   HIS A CE1 1 
ATOM   486  N  NE2 . HIS A 1 65  ? 46.750 0.780   68.050 1.00 70.23  ? 63   HIS A NE2 1 
ATOM   487  N  N   . PRO A 1 66  ? 44.466 1.478   74.464 1.00 52.79  ? 64   PRO A N   1 
ATOM   488  C  CA  . PRO A 1 66  ? 44.400 1.653   75.917 1.00 55.14  ? 64   PRO A CA  1 
ATOM   489  C  C   . PRO A 1 66  ? 44.751 0.407   76.697 1.00 58.66  ? 64   PRO A C   1 
ATOM   490  O  O   . PRO A 1 66  ? 45.184 0.484   77.843 1.00 57.38  ? 64   PRO A O   1 
ATOM   491  C  CB  . PRO A 1 66  ? 42.943 2.038   76.167 1.00 55.03  ? 64   PRO A CB  1 
ATOM   492  C  CG  . PRO A 1 66  ? 42.424 2.463   74.815 1.00 55.14  ? 64   PRO A CG  1 
ATOM   493  C  CD  . PRO A 1 66  ? 43.118 1.538   73.878 1.00 54.75  ? 64   PRO A CD  1 
ATOM   494  N  N   . ASP A 1 67  ? 44.564 -0.745  76.073 1.00 59.25  ? 65   ASP A N   1 
ATOM   495  C  CA  . ASP A 1 67  ? 44.813 -1.994  76.758 1.00 62.96  ? 65   ASP A CA  1 
ATOM   496  C  C   . ASP A 1 67  ? 46.150 -2.640  76.491 1.00 59.74  ? 65   ASP A C   1 
ATOM   497  O  O   . ASP A 1 67  ? 46.428 -3.710  77.027 1.00 64.96  ? 65   ASP A O   1 
ATOM   498  C  CB  . ASP A 1 67  ? 43.692 -2.979  76.435 1.00 73.86  ? 65   ASP A CB  1 
ATOM   499  C  CG  . ASP A 1 67  ? 42.317 -2.409  76.743 1.00 82.96  ? 65   ASP A CG  1 
ATOM   500  O  OD1 . ASP A 1 67  ? 42.079 -2.013  77.908 1.00 84.67  ? 65   ASP A OD1 1 
ATOM   501  O  OD2 . ASP A 1 67  ? 41.478 -2.354  75.816 1.00 90.27  ? 65   ASP A OD2 1 
ATOM   502  N  N   . ARG A 1 68  ? 46.982 -2.006  75.673 1.00 52.49  ? 66   ARG A N   1 
ATOM   503  C  CA  . ARG A 1 68  ? 48.294 -2.565  75.379 1.00 51.72  ? 66   ARG A CA  1 
ATOM   504  C  C   . ARG A 1 68  ? 49.391 -2.022  76.297 1.00 50.30  ? 66   ARG A C   1 
ATOM   505  O  O   . ARG A 1 68  ? 49.373 -0.855  76.681 1.00 49.24  ? 66   ARG A O   1 
ATOM   506  C  CB  . ARG A 1 68  ? 48.630 -2.338  73.906 1.00 60.97  ? 66   ARG A CB  1 
ATOM   507  C  CG  . ARG A 1 68  ? 47.968 -3.369  72.979 1.00 66.88  ? 66   ARG A CG  1 
ATOM   508  C  CD  . ARG A 1 68  ? 47.613 -2.771  71.631 1.00 76.64  ? 66   ARG A CD  1 
ATOM   509  N  NE  . ARG A 1 68  ? 47.730 -3.724  70.532 1.00 82.20  ? 66   ARG A NE  1 
ATOM   510  C  CZ  . ARG A 1 68  ? 48.833 -4.415  70.260 1.00 87.11  ? 66   ARG A CZ  1 
ATOM   511  N  NH1 . ARG A 1 68  ? 49.913 -4.267  71.015 1.00 92.81  ? 66   ARG A NH1 1 
ATOM   512  N  NH2 . ARG A 1 68  ? 48.867 -5.229  69.215 1.00 85.18  ? 66   ARG A NH2 1 
ATOM   513  N  N   . SER A 1 69  ? 50.333 -2.894  76.649 1.00 46.58  ? 67   SER A N   1 
ATOM   514  C  CA  . SER A 1 69  ? 51.433 -2.570  77.552 1.00 44.64  ? 67   SER A CA  1 
ATOM   515  C  C   . SER A 1 69  ? 52.489 -1.639  76.970 1.00 41.13  ? 67   SER A C   1 
ATOM   516  O  O   . SER A 1 69  ? 52.619 -1.505  75.754 1.00 41.35  ? 67   SER A O   1 
ATOM   517  C  CB  . SER A 1 69  ? 52.124 -3.862  77.999 1.00 43.83  ? 67   SER A CB  1 
ATOM   518  O  OG  . SER A 1 69  ? 52.928 -4.389  76.946 1.00 48.42  ? 67   SER A OG  1 
ATOM   519  N  N   . GLU A 1 70  ? 53.271 -1.023  77.849 1.00 34.52  ? 68   GLU A N   1 
ATOM   520  C  CA  . GLU A 1 70  ? 54.318 -0.136  77.388 1.00 38.96  ? 68   GLU A CA  1 
ATOM   521  C  C   . GLU A 1 70  ? 55.135 -0.844  76.318 1.00 43.70  ? 68   GLU A C   1 
ATOM   522  O  O   . GLU A 1 70  ? 55.331 -0.313  75.225 1.00 43.60  ? 68   GLU A O   1 
ATOM   523  C  CB  . GLU A 1 70  ? 55.224 0.279   78.546 1.00 37.91  ? 68   GLU A CB  1 
ATOM   524  C  CG  . GLU A 1 70  ? 56.700 0.364   78.167 1.00 57.02  ? 68   GLU A CG  1 
ATOM   525  C  CD  . GLU A 1 70  ? 57.535 1.114   79.188 1.00 69.61  ? 68   GLU A CD  1 
ATOM   526  O  OE1 . GLU A 1 70  ? 57.386 0.852   80.405 1.00 74.40  ? 68   GLU A OE1 1 
ATOM   527  O  OE2 . GLU A 1 70  ? 58.348 1.968   78.771 1.00 77.10  ? 68   GLU A OE2 1 
ATOM   528  N  N   . GLY A 1 71  ? 55.598 -2.052  76.641 1.00 47.21  ? 69   GLY A N   1 
ATOM   529  C  CA  . GLY A 1 71  ? 56.405 -2.832  75.719 1.00 42.19  ? 69   GLY A CA  1 
ATOM   530  C  C   . GLY A 1 71  ? 55.774 -2.965  74.355 1.00 44.26  ? 69   GLY A C   1 
ATOM   531  O  O   . GLY A 1 71  ? 56.431 -2.770  73.334 1.00 51.75  ? 69   GLY A O   1 
ATOM   532  N  N   . ASP A 1 72  ? 54.496 -3.309  74.329 1.00 43.57  ? 70   ASP A N   1 
ATOM   533  C  CA  . ASP A 1 72  ? 53.798 -3.445  73.063 1.00 49.85  ? 70   ASP A CA  1 
ATOM   534  C  C   . ASP A 1 72  ? 53.747 -2.089  72.370 1.00 49.20  ? 70   ASP A C   1 
ATOM   535  O  O   . ASP A 1 72  ? 54.000 -1.988  71.168 1.00 55.89  ? 70   ASP A O   1 
ATOM   536  C  CB  . ASP A 1 72  ? 52.374 -3.972  73.276 1.00 58.28  ? 70   ASP A CB  1 
ATOM   537  C  CG  . ASP A 1 72  ? 52.326 -5.487  73.470 1.00 69.91  ? 70   ASP A CG  1 
ATOM   538  O  OD1 . ASP A 1 72  ? 53.404 -6.122  73.524 1.00 74.28  ? 70   ASP A OD1 1 
ATOM   539  O  OD2 . ASP A 1 72  ? 51.208 -6.044  73.554 1.00 75.10  ? 70   ASP A OD2 1 
ATOM   540  N  N   . LEU A 1 73  ? 53.416 -1.050  73.133 1.00 42.59  ? 71   LEU A N   1 
ATOM   541  C  CA  . LEU A 1 73  ? 53.349 0.283   72.582 1.00 39.86  ? 71   LEU A CA  1 
ATOM   542  C  C   . LEU A 1 73  ? 54.710 0.625   71.967 1.00 41.35  ? 71   LEU A C   1 
ATOM   543  O  O   . LEU A 1 73  ? 54.773 1.154   70.866 1.00 37.74  ? 71   LEU A O   1 
ATOM   544  C  CB  . LEU A 1 73  ? 52.961 1.283   73.666 1.00 34.13  ? 71   LEU A CB  1 
ATOM   545  C  CG  . LEU A 1 73  ? 51.493 1.240   74.104 1.00 37.94  ? 71   LEU A CG  1 
ATOM   546  C  CD1 . LEU A 1 73  ? 51.218 2.335   75.139 1.00 32.65  ? 71   LEU A CD1 1 
ATOM   547  C  CD2 . LEU A 1 73  ? 50.596 1.443   72.889 1.00 39.64  ? 71   LEU A CD2 1 
ATOM   548  N  N   . ALA A 1 74  ? 55.797 0.302   72.660 1.00 38.69  ? 72   ALA A N   1 
ATOM   549  C  CA  . ALA A 1 74  ? 57.120 0.585   72.122 1.00 43.45  ? 72   ALA A CA  1 
ATOM   550  C  C   . ALA A 1 74  ? 57.332 -0.167  70.805 1.00 52.97  ? 72   ALA A C   1 
ATOM   551  O  O   . ALA A 1 74  ? 57.994 0.328   69.890 1.00 49.33  ? 72   ALA A O   1 
ATOM   552  C  CB  . ALA A 1 74  ? 58.185 0.191   73.114 1.00 43.62  ? 72   ALA A CB  1 
ATOM   553  N  N   . LYS A 1 75  ? 56.768 -1.366  70.710 1.00 57.99  ? 73   LYS A N   1 
ATOM   554  C  CA  . LYS A 1 75  ? 56.909 -2.155  69.488 1.00 60.10  ? 73   LYS A CA  1 
ATOM   555  C  C   . LYS A 1 75  ? 56.063 -1.556  68.357 1.00 56.91  ? 73   LYS A C   1 
ATOM   556  O  O   . LYS A 1 75  ? 56.526 -1.455  67.215 1.00 57.68  ? 73   LYS A O   1 
ATOM   557  C  CB  . LYS A 1 75  ? 56.522 -3.619  69.747 1.00 60.60  ? 73   LYS A CB  1 
ATOM   558  C  CG  . LYS A 1 75  ? 57.583 -4.594  69.278 1.00 65.00  ? 73   LYS A CG  1 
ATOM   559  C  CD  . LYS A 1 75  ? 57.378 -6.007  69.817 1.00 74.13  ? 73   LYS A CD  1 
ATOM   560  C  CE  . LYS A 1 75  ? 57.580 -6.089  71.323 1.00 74.24  ? 73   LYS A CE  1 
ATOM   561  N  NZ  . LYS A 1 75  ? 56.551 -6.935  71.984 1.00 79.91  ? 73   LYS A NZ  1 
ATOM   562  N  N   . LEU A 1 76  ? 54.835 -1.152  68.672 1.00 52.34  ? 74   LEU A N   1 
ATOM   563  C  CA  . LEU A 1 76  ? 53.964 -0.536  67.671 1.00 56.87  ? 74   LEU A CA  1 
ATOM   564  C  C   . LEU A 1 76  ? 54.549 0.782   67.146 1.00 60.21  ? 74   LEU A C   1 
ATOM   565  O  O   . LEU A 1 76  ? 54.369 1.126   65.980 1.00 63.88  ? 74   LEU A O   1 
ATOM   566  C  CB  . LEU A 1 76  ? 52.586 -0.247  68.261 1.00 59.37  ? 74   LEU A CB  1 
ATOM   567  C  CG  . LEU A 1 76  ? 51.509 -1.335  68.252 1.00 66.91  ? 74   LEU A CG  1 
ATOM   568  C  CD1 . LEU A 1 76  ? 52.019 -2.581  68.951 1.00 73.54  ? 74   LEU A CD1 1 
ATOM   569  C  CD2 . LEU A 1 76  ? 50.260 -0.801  68.941 1.00 61.45  ? 74   LEU A CD2 1 
ATOM   570  N  N   . ARG A 1 77  ? 55.233 1.528   68.008 1.00 55.11  ? 75   ARG A N   1 
ATOM   571  C  CA  . ARG A 1 77  ? 55.814 2.794   67.591 1.00 52.13  ? 75   ARG A CA  1 
ATOM   572  C  C   . ARG A 1 77  ? 56.968 2.563   66.622 1.00 52.16  ? 75   ARG A C   1 
ATOM   573  O  O   . ARG A 1 77  ? 57.065 3.218   65.584 1.00 50.50  ? 75   ARG A O   1 
ATOM   574  C  CB  . ARG A 1 77  ? 56.301 3.590   68.811 1.00 46.00  ? 75   ARG A CB  1 
ATOM   575  C  CG  . ARG A 1 77  ? 56.933 4.945   68.458 1.00 41.12  ? 75   ARG A CG  1 
ATOM   576  C  CD  . ARG A 1 77  ? 57.276 5.737   69.706 1.00 35.50  ? 75   ARG A CD  1 
ATOM   577  N  NE  . ARG A 1 77  ? 58.295 5.054   70.496 1.00 35.02  ? 75   ARG A NE  1 
ATOM   578  C  CZ  . ARG A 1 77  ? 58.623 5.366   71.747 1.00 39.03  ? 75   ARG A CZ  1 
ATOM   579  N  NH1 . ARG A 1 77  ? 57.999 6.364   72.380 1.00 35.40  ? 75   ARG A NH1 1 
ATOM   580  N  NH2 . ARG A 1 77  ? 59.588 4.681   72.366 1.00 30.34  ? 75   ARG A NH2 1 
ATOM   581  N  N   . ALA A 1 78  ? 57.841 1.627   66.971 1.00 53.36  ? 76   ALA A N   1 
ATOM   582  C  CA  . ALA A 1 78  ? 58.994 1.306   66.145 1.00 58.84  ? 76   ALA A CA  1 
ATOM   583  C  C   . ALA A 1 78  ? 58.597 0.945   64.715 1.00 61.43  ? 76   ALA A C   1 
ATOM   584  O  O   . ALA A 1 78  ? 59.399 1.063   63.785 1.00 64.81  ? 76   ALA A O   1 
ATOM   585  C  CB  . ALA A 1 78  ? 59.768 0.164   66.773 1.00 59.98  ? 76   ALA A CB  1 
ATOM   586  N  N   . SER A 1 79  ? 57.356 0.516   64.538 1.00 59.50  ? 77   SER A N   1 
ATOM   587  C  CA  . SER A 1 79  ? 56.875 0.137   63.218 1.00 65.42  ? 77   SER A CA  1 
ATOM   588  C  C   . SER A 1 79  ? 56.678 1.378   62.373 1.00 63.57  ? 77   SER A C   1 
ATOM   589  O  O   . SER A 1 79  ? 57.039 1.422   61.196 1.00 66.61  ? 77   SER A O   1 
ATOM   590  C  CB  . SER A 1 79  ? 55.530 -0.581  63.334 1.00 65.97  ? 77   SER A CB  1 
ATOM   591  O  OG  . SER A 1 79  ? 55.344 -1.095  64.637 1.00 79.90  ? 77   SER A OG  1 
ATOM   592  N  N   . VAL A 1 80  ? 56.096 2.383   63.009 1.00 62.36  ? 78   VAL A N   1 
ATOM   593  C  CA  . VAL A 1 80  ? 55.775 3.640   62.374 1.00 56.94  ? 78   VAL A CA  1 
ATOM   594  C  C   . VAL A 1 80  ? 56.914 4.626   62.170 1.00 55.01  ? 78   VAL A C   1 
ATOM   595  O  O   . VAL A 1 80  ? 56.886 5.379   61.207 1.00 57.37  ? 78   VAL A O   1 
ATOM   596  C  CB  . VAL A 1 80  ? 54.667 4.335   63.156 1.00 58.79  ? 78   VAL A CB  1 
ATOM   597  C  CG1 . VAL A 1 80  ? 54.238 5.606   62.451 1.00 61.36  ? 78   VAL A CG1 1 
ATOM   598  C  CG2 . VAL A 1 80  ? 53.497 3.386   63.322 1.00 63.94  ? 78   VAL A CG2 1 
ATOM   599  N  N   . VAL A 1 81  ? 57.931 4.630   63.027 1.00 52.41  ? 79   VAL A N   1 
ATOM   600  C  CA  . VAL A 1 81  ? 58.988 5.623   62.838 1.00 50.89  ? 79   VAL A CA  1 
ATOM   601  C  C   . VAL A 1 81  ? 60.387 5.167   62.433 1.00 53.71  ? 79   VAL A C   1 
ATOM   602  O  O   . VAL A 1 81  ? 61.341 5.949   62.500 1.00 55.94  ? 79   VAL A O   1 
ATOM   603  C  CB  . VAL A 1 81  ? 59.114 6.519   64.087 1.00 51.81  ? 79   VAL A CB  1 
ATOM   604  C  CG1 . VAL A 1 81  ? 57.767 7.148   64.410 1.00 44.10  ? 79   VAL A CG1 1 
ATOM   605  C  CG2 . VAL A 1 81  ? 59.613 5.704   65.266 1.00 49.64  ? 79   VAL A CG2 1 
ATOM   606  N  N   . ASN A 1 82  ? 60.522 3.927   61.984 1.00 52.39  ? 80   ASN A N   1 
ATOM   607  C  CA  . ASN A 1 82  ? 61.829 3.422   61.569 1.00 53.38  ? 80   ASN A CA  1 
ATOM   608  C  C   . ASN A 1 82  ? 62.310 4.104   60.277 1.00 50.12  ? 80   ASN A C   1 
ATOM   609  O  O   . ASN A 1 82  ? 61.503 4.652   59.518 1.00 46.48  ? 80   ASN A O   1 
ATOM   610  C  CB  . ASN A 1 82  ? 61.738 1.920   61.344 1.00 58.76  ? 80   ASN A CB  1 
ATOM   611  C  CG  . ASN A 1 82  ? 60.882 1.577   60.157 1.00 60.26  ? 80   ASN A CG  1 
ATOM   612  O  OD1 . ASN A 1 82  ? 61.350 1.589   59.023 1.00 63.80  ? 80   ASN A OD1 1 
ATOM   613  N  ND2 . ASN A 1 82  ? 59.610 1.300   60.405 1.00 67.23  ? 80   ASN A ND2 1 
ATOM   614  N  N   . THR A 1 83  ? 63.620 4.067   60.033 1.00 50.42  ? 81   THR A N   1 
ATOM   615  C  CA  . THR A 1 83  ? 64.189 4.675   58.828 1.00 52.22  ? 81   THR A CA  1 
ATOM   616  C  C   . THR A 1 83  ? 63.392 4.326   57.568 1.00 60.74  ? 81   THR A C   1 
ATOM   617  O  O   . THR A 1 83  ? 63.015 5.218   56.805 1.00 61.11  ? 81   THR A O   1 
ATOM   618  C  CB  . THR A 1 83  ? 65.644 4.246   58.617 1.00 52.85  ? 81   THR A CB  1 
ATOM   619  O  OG1 . THR A 1 83  ? 66.417 4.582   59.775 1.00 61.09  ? 81   THR A OG1 1 
ATOM   620  C  CG2 . THR A 1 83  ? 66.238 4.960   57.417 1.00 57.85  ? 81   THR A CG2 1 
ATOM   621  N  N   . GLN A 1 84  ? 63.125 3.034   57.359 1.00 64.84  ? 82   GLN A N   1 
ATOM   622  C  CA  . GLN A 1 84  ? 62.364 2.575   56.191 1.00 66.24  ? 82   GLN A CA  1 
ATOM   623  C  C   . GLN A 1 84  ? 61.001 3.229   56.050 1.00 61.77  ? 82   GLN A C   1 
ATOM   624  O  O   . GLN A 1 84  ? 60.637 3.689   54.973 1.00 62.82  ? 82   GLN A O   1 
ATOM   625  C  CB  . GLN A 1 84  ? 62.155 1.051   56.222 1.00 71.49  ? 82   GLN A CB  1 
ATOM   626  C  CG  . GLN A 1 84  ? 63.207 0.235   55.470 1.00 79.99  ? 82   GLN A CG  1 
ATOM   627  C  CD  . GLN A 1 84  ? 63.420 0.699   54.027 1.00 84.06  ? 82   GLN A CD  1 
ATOM   628  O  OE1 . GLN A 1 84  ? 62.486 0.733   53.220 1.00 89.09  ? 82   GLN A OE1 1 
ATOM   629  N  NE2 . GLN A 1 84  ? 64.659 1.053   53.700 1.00 82.69  ? 82   GLN A NE2 1 
ATOM   630  N  N   . ALA A 1 85  ? 60.241 3.252   57.136 1.00 58.71  ? 83   ALA A N   1 
ATOM   631  C  CA  . ALA A 1 85  ? 58.910 3.831   57.108 1.00 54.89  ? 83   ALA A CA  1 
ATOM   632  C  C   . ALA A 1 85  ? 58.936 5.327   56.809 1.00 59.17  ? 83   ALA A C   1 
ATOM   633  O  O   . ALA A 1 85  ? 58.077 5.841   56.091 1.00 62.66  ? 83   ALA A O   1 
ATOM   634  C  CB  . ALA A 1 85  ? 58.212 3.569   58.431 1.00 54.07  ? 83   ALA A CB  1 
ATOM   635  N  N   . LEU A 1 86  ? 59.918 6.029   57.364 1.00 56.81  ? 84   LEU A N   1 
ATOM   636  C  CA  . LEU A 1 86  ? 60.037 7.465   57.138 1.00 55.25  ? 84   LEU A CA  1 
ATOM   637  C  C   . LEU A 1 86  ? 60.362 7.773   55.678 1.00 55.21  ? 84   LEU A C   1 
ATOM   638  O  O   . LEU A 1 86  ? 59.740 8.634   55.052 1.00 50.93  ? 84   LEU A O   1 
ATOM   639  C  CB  . LEU A 1 86  ? 61.139 8.048   58.024 1.00 57.70  ? 84   LEU A CB  1 
ATOM   640  C  CG  . LEU A 1 86  ? 60.742 8.825   59.282 1.00 56.90  ? 84   LEU A CG  1 
ATOM   641  C  CD1 . LEU A 1 86  ? 59.561 8.170   59.957 1.00 61.63  ? 84   LEU A CD1 1 
ATOM   642  C  CD2 . LEU A 1 86  ? 61.943 8.890   60.221 1.00 48.26  ? 84   LEU A CD2 1 
ATOM   643  N  N   . ALA A 1 87  ? 61.345 7.060   55.145 1.00 55.35  ? 85   ALA A N   1 
ATOM   644  C  CA  . ALA A 1 87  ? 61.773 7.259   53.769 1.00 62.55  ? 85   ALA A CA  1 
ATOM   645  C  C   . ALA A 1 87  ? 60.609 7.082   52.794 1.00 64.93  ? 85   ALA A C   1 
ATOM   646  O  O   . ALA A 1 87  ? 60.420 7.894   51.883 1.00 64.14  ? 85   ALA A O   1 
ATOM   647  C  CB  . ALA A 1 87  ? 62.906 6.291   53.435 1.00 61.70  ? 85   ALA A CB  1 
ATOM   648  N  N   . ASP A 1 88  ? 59.816 6.035   52.994 1.00 66.27  ? 86   ASP A N   1 
ATOM   649  C  CA  . ASP A 1 88  ? 58.683 5.793   52.118 1.00 68.41  ? 86   ASP A CA  1 
ATOM   650  C  C   . ASP A 1 88  ? 57.685 6.943   52.156 1.00 69.19  ? 86   ASP A C   1 
ATOM   651  O  O   . ASP A 1 88  ? 57.027 7.227   51.153 1.00 75.30  ? 86   ASP A O   1 
ATOM   652  C  CB  . ASP A 1 88  ? 57.996 4.476   52.483 1.00 74.90  ? 86   ASP A CB  1 
ATOM   653  C  CG  . ASP A 1 88  ? 58.895 3.268   52.252 1.00 85.29  ? 86   ASP A CG  1 
ATOM   654  O  OD1 . ASP A 1 88  ? 58.416 2.124   52.410 1.00 89.15  ? 86   ASP A OD1 1 
ATOM   655  O  OD2 . ASP A 1 88  ? 60.086 3.462   51.914 1.00 85.59  ? 86   ASP A OD2 1 
ATOM   656  N  N   . VAL A 1 89  ? 57.562 7.606   53.302 1.00 61.94  ? 87   VAL A N   1 
ATOM   657  C  CA  . VAL A 1 89  ? 56.638 8.727   53.401 1.00 59.38  ? 87   VAL A CA  1 
ATOM   658  C  C   . VAL A 1 89  ? 57.204 9.889   52.577 1.00 62.23  ? 87   VAL A C   1 
ATOM   659  O  O   . VAL A 1 89  ? 56.467 10.653  51.952 1.00 58.15  ? 87   VAL A O   1 
ATOM   660  C  CB  . VAL A 1 89  ? 56.436 9.158   54.883 1.00 59.39  ? 87   VAL A CB  1 
ATOM   661  C  CG1 . VAL A 1 89  ? 55.563 10.395  54.970 1.00 45.23  ? 87   VAL A CG1 1 
ATOM   662  C  CG2 . VAL A 1 89  ? 55.784 8.034   55.656 1.00 59.59  ? 87   VAL A CG2 1 
ATOM   663  N  N   . ALA A 1 90  ? 58.525 10.010  52.571 1.00 63.21  ? 88   ALA A N   1 
ATOM   664  C  CA  . ALA A 1 90  ? 59.178 11.068  51.812 1.00 63.62  ? 88   ALA A CA  1 
ATOM   665  C  C   . ALA A 1 90  ? 59.062 10.786  50.315 1.00 64.87  ? 88   ALA A C   1 
ATOM   666  O  O   . ALA A 1 90  ? 58.790 11.690  49.529 1.00 65.60  ? 88   ALA A O   1 
ATOM   667  C  CB  . ALA A 1 90  ? 60.642 11.172  52.210 1.00 58.09  ? 88   ALA A CB  1 
ATOM   668  N  N   . ARG A 1 91  ? 59.273 9.533   49.925 1.00 65.34  ? 89   ARG A N   1 
ATOM   669  C  CA  . ARG A 1 91  ? 59.193 9.152   48.522 1.00 67.38  ? 89   ARG A CA  1 
ATOM   670  C  C   . ARG A 1 91  ? 57.821 9.416   47.909 1.00 71.05  ? 89   ARG A C   1 
ATOM   671  O  O   . ARG A 1 91  ? 57.719 9.746   46.728 1.00 71.38  ? 89   ARG A O   1 
ATOM   672  C  CB  . ARG A 1 91  ? 59.534 7.670   48.348 1.00 65.47  ? 89   ARG A CB  1 
ATOM   673  C  CG  . ARG A 1 91  ? 60.982 7.307   48.664 1.00 69.07  ? 89   ARG A CG  1 
ATOM   674  C  CD  . ARG A 1 91  ? 61.256 5.848   48.347 1.00 62.58  ? 89   ARG A CD  1 
ATOM   675  N  NE  . ARG A 1 91  ? 62.065 5.186   49.370 1.00 71.74  ? 89   ARG A NE  1 
ATOM   676  C  CZ  . ARG A 1 91  ? 63.389 5.269   49.467 1.00 71.13  ? 89   ARG A CZ  1 
ATOM   677  N  NH1 . ARG A 1 91  ? 64.073 5.990   48.594 1.00 74.24  ? 89   ARG A NH1 1 
ATOM   678  N  NH2 . ARG A 1 91  ? 64.028 4.626   50.438 1.00 67.70  ? 89   ARG A NH2 1 
ATOM   679  N  N   . ARG A 1 92  ? 56.765 9.274   48.702 1.00 71.40  ? 90   ARG A N   1 
ATOM   680  C  CA  . ARG A 1 92  ? 55.424 9.485   48.182 1.00 70.17  ? 90   ARG A CA  1 
ATOM   681  C  C   . ARG A 1 92  ? 54.764 10.745  48.699 1.00 69.28  ? 90   ARG A C   1 
ATOM   682  O  O   . ARG A 1 92  ? 53.595 10.993  48.422 1.00 69.43  ? 90   ARG A O   1 
ATOM   683  C  CB  . ARG A 1 92  ? 54.555 8.274   48.501 1.00 76.18  ? 90   ARG A CB  1 
ATOM   684  C  CG  . ARG A 1 92  ? 55.047 7.002   47.831 1.00 88.74  ? 90   ARG A CG  1 
ATOM   685  C  CD  . ARG A 1 92  ? 55.580 5.974   48.827 1.00 95.99  ? 90   ARG A CD  1 
ATOM   686  N  NE  . ARG A 1 92  ? 54.508 5.347   49.597 1.00 102.84 ? 90   ARG A NE  1 
ATOM   687  C  CZ  . ARG A 1 92  ? 54.673 4.286   50.382 1.00 106.77 ? 90   ARG A CZ  1 
ATOM   688  N  NH1 . ARG A 1 92  ? 55.872 3.726   50.504 1.00 106.85 ? 90   ARG A NH1 1 
ATOM   689  N  NH2 . ARG A 1 92  ? 53.639 3.783   51.047 1.00 105.59 ? 90   ARG A NH2 1 
ATOM   690  N  N   . LEU A 1 93  ? 55.514 11.541  49.449 1.00 72.37  ? 91   LEU A N   1 
ATOM   691  C  CA  . LEU A 1 93  ? 54.985 12.782  50.000 1.00 72.82  ? 91   LEU A CA  1 
ATOM   692  C  C   . LEU A 1 93  ? 54.348 13.605  48.890 1.00 75.37  ? 91   LEU A C   1 
ATOM   693  O  O   . LEU A 1 93  ? 53.288 14.200  49.067 1.00 77.83  ? 91   LEU A O   1 
ATOM   694  C  CB  . LEU A 1 93  ? 56.108 13.578  50.669 1.00 65.86  ? 91   LEU A CB  1 
ATOM   695  C  CG  . LEU A 1 93  ? 55.742 14.953  51.220 1.00 60.66  ? 91   LEU A CG  1 
ATOM   696  C  CD1 . LEU A 1 93  ? 54.614 14.835  52.227 1.00 60.37  ? 91   LEU A CD1 1 
ATOM   697  C  CD2 . LEU A 1 93  ? 56.964 15.573  51.853 1.00 54.55  ? 91   LEU A CD2 1 
ATOM   698  N  N   . CYS A 1 94  ? 55.007 13.639  47.741 1.00 78.90  ? 92   CYS A N   1 
ATOM   699  C  CA  . CYS A 1 94  ? 54.497 14.381  46.598 1.00 78.54  ? 92   CYS A CA  1 
ATOM   700  C  C   . CYS A 1 94  ? 54.934 13.676  45.319 1.00 77.84  ? 92   CYS A C   1 
ATOM   701  O  O   . CYS A 1 94  ? 55.821 12.817  45.346 1.00 74.75  ? 92   CYS A O   1 
ATOM   702  C  CB  . CYS A 1 94  ? 55.002 15.833  46.632 1.00 75.76  ? 92   CYS A CB  1 
ATOM   703  S  SG  . CYS A 1 94  ? 56.801 16.034  46.711 1.00 78.02  ? 92   CYS A SG  1 
ATOM   704  N  N   . ALA A 1 95  ? 54.294 14.032  44.209 1.00 77.30  ? 93   ALA A N   1 
ATOM   705  C  CA  . ALA A 1 95  ? 54.588 13.434  42.912 1.00 76.43  ? 93   ALA A CA  1 
ATOM   706  C  C   . ALA A 1 95  ? 56.065 13.109  42.708 1.00 76.05  ? 93   ALA A C   1 
ATOM   707  O  O   . ALA A 1 95  ? 56.450 11.943  42.602 1.00 73.51  ? 93   ALA A O   1 
ATOM   708  C  CB  . ALA A 1 95  ? 54.105 14.354  41.805 1.00 75.61  ? 93   ALA A CB  1 
ATOM   709  N  N   . GLU A 1 96  ? 56.886 14.149  42.651 1.00 74.66  ? 94   GLU A N   1 
ATOM   710  C  CA  . GLU A 1 96  ? 58.316 13.983  42.446 1.00 80.14  ? 94   GLU A CA  1 
ATOM   711  C  C   . GLU A 1 96  ? 58.959 13.194  43.579 1.00 80.48  ? 94   GLU A C   1 
ATOM   712  O  O   . GLU A 1 96  ? 59.946 12.484  43.375 1.00 83.31  ? 94   GLU A O   1 
ATOM   713  C  CB  . GLU A 1 96  ? 59.004 15.351  42.350 1.00 83.35  ? 94   GLU A CB  1 
ATOM   714  C  CG  . GLU A 1 96  ? 58.111 16.506  41.907 1.00 88.42  ? 94   GLU A CG  1 
ATOM   715  C  CD  . GLU A 1 96  ? 57.171 16.984  43.004 1.00 86.86  ? 94   GLU A CD  1 
ATOM   716  O  OE1 . GLU A 1 96  ? 56.163 16.299  43.279 1.00 81.02  ? 94   GLU A OE1 1 
ATOM   717  O  OE2 . GLU A 1 96  ? 57.450 18.050  43.595 1.00 87.41  ? 94   GLU A OE2 1 
ATOM   718  N  N   . GLY A 1 97  ? 58.388 13.321  44.771 1.00 77.95  ? 95   GLY A N   1 
ATOM   719  C  CA  . GLY A 1 97  ? 58.943 12.658  45.930 1.00 74.53  ? 95   GLY A CA  1 
ATOM   720  C  C   . GLY A 1 97  ? 59.808 13.694  46.627 1.00 75.82  ? 95   GLY A C   1 
ATOM   721  O  O   . GLY A 1 97  ? 60.061 14.770  46.072 1.00 75.65  ? 95   GLY A O   1 
ATOM   722  N  N   . LEU A 1 98  ? 60.272 13.401  47.834 1.00 70.58  ? 96   LEU A N   1 
ATOM   723  C  CA  . LEU A 1 98  ? 61.095 14.372  48.534 1.00 62.14  ? 96   LEU A CA  1 
ATOM   724  C  C   . LEU A 1 98  ? 62.519 14.394  47.994 1.00 62.48  ? 96   LEU A C   1 
ATOM   725  O  O   . LEU A 1 98  ? 63.122 15.459  47.872 1.00 61.36  ? 96   LEU A O   1 
ATOM   726  C  CB  . LEU A 1 98  ? 61.121 14.070  50.033 1.00 58.96  ? 96   LEU A CB  1 
ATOM   727  C  CG  . LEU A 1 98  ? 61.954 15.034  50.880 1.00 48.73  ? 96   LEU A CG  1 
ATOM   728  C  CD1 . LEU A 1 98  ? 61.382 16.453  50.794 1.00 40.48  ? 96   LEU A CD1 1 
ATOM   729  C  CD2 . LEU A 1 98  ? 61.961 14.540  52.316 1.00 54.59  ? 96   LEU A CD2 1 
ATOM   730  N  N   . GLY A 1 99  ? 63.048 13.218  47.670 1.00 59.45  ? 97   GLY A N   1 
ATOM   731  C  CA  . GLY A 1 99  ? 64.412 13.118  47.175 1.00 58.31  ? 97   GLY A CA  1 
ATOM   732  C  C   . GLY A 1 99  ? 64.798 14.188  46.172 1.00 58.48  ? 97   GLY A C   1 
ATOM   733  O  O   . GLY A 1 99  ? 65.909 14.720  46.188 1.00 59.01  ? 97   GLY A O   1 
ATOM   734  N  N   . VAL A 1 100 ? 63.860 14.514  45.301 1.00 58.53  ? 98   VAL A N   1 
ATOM   735  C  CA  . VAL A 1 100 ? 64.089 15.506  44.277 1.00 58.38  ? 98   VAL A CA  1 
ATOM   736  C  C   . VAL A 1 100 ? 64.418 16.900  44.808 1.00 58.43  ? 98   VAL A C   1 
ATOM   737  O  O   . VAL A 1 100 ? 65.202 17.632  44.201 1.00 59.72  ? 98   VAL A O   1 
ATOM   738  C  CB  . VAL A 1 100 ? 62.859 15.568  43.360 1.00 59.02  ? 98   VAL A CB  1 
ATOM   739  C  CG1 . VAL A 1 100 ? 62.337 17.002  43.251 1.00 58.63  ? 98   VAL A CG1 1 
ATOM   740  C  CG2 . VAL A 1 100 ? 63.214 14.996  42.013 1.00 51.34  ? 98   VAL A CG2 1 
ATOM   741  N  N   . HIS A 1 101 ? 63.840 17.259  45.946 1.00 52.44  ? 99   HIS A N   1 
ATOM   742  C  CA  . HIS A 1 101 ? 64.048 18.583  46.513 1.00 49.45  ? 99   HIS A CA  1 
ATOM   743  C  C   . HIS A 1 101 ? 65.203 18.736  47.480 1.00 47.68  ? 99   HIS A C   1 
ATOM   744  O  O   . HIS A 1 101 ? 65.542 19.863  47.867 1.00 46.60  ? 99   HIS A O   1 
ATOM   745  C  CB  . HIS A 1 101 ? 62.777 19.034  47.207 1.00 49.98  ? 99   HIS A CB  1 
ATOM   746  C  CG  . HIS A 1 101 ? 61.574 19.025  46.321 1.00 53.61  ? 99   HIS A CG  1 
ATOM   747  N  ND1 . HIS A 1 101 ? 61.164 20.132  45.610 1.00 56.36  ? 99   HIS A ND1 1 
ATOM   748  C  CD2 . HIS A 1 101 ? 60.685 18.043  46.041 1.00 54.18  ? 99   HIS A CD2 1 
ATOM   749  C  CE1 . HIS A 1 101 ? 60.070 19.833  44.931 1.00 59.88  ? 99   HIS A CE1 1 
ATOM   750  N  NE2 . HIS A 1 101 ? 59.760 18.572  45.175 1.00 60.71  ? 99   HIS A NE2 1 
ATOM   751  N  N   . VAL A 1 102 ? 65.812 17.624  47.874 1.00 44.32  ? 100  VAL A N   1 
ATOM   752  C  CA  . VAL A 1 102 ? 66.930 17.685  48.813 1.00 45.02  ? 100  VAL A CA  1 
ATOM   753  C  C   . VAL A 1 102 ? 68.175 18.258  48.141 1.00 46.82  ? 100  VAL A C   1 
ATOM   754  O  O   . VAL A 1 102 ? 68.514 17.879  47.022 1.00 47.43  ? 100  VAL A O   1 
ATOM   755  C  CB  . VAL A 1 102 ? 67.288 16.270  49.382 1.00 44.50  ? 100  VAL A CB  1 
ATOM   756  C  CG1 . VAL A 1 102 ? 68.479 16.368  50.314 1.00 45.37  ? 100  VAL A CG1 1 
ATOM   757  C  CG2 . VAL A 1 102 ? 66.112 15.687  50.122 1.00 46.17  ? 100  VAL A CG2 1 
ATOM   758  N  N   . LEU A 1 103 ? 68.851 19.168  48.831 1.00 43.50  ? 101  LEU A N   1 
ATOM   759  C  CA  . LEU A 1 103 ? 70.076 19.754  48.317 1.00 47.96  ? 101  LEU A CA  1 
ATOM   760  C  C   . LEU A 1 103 ? 71.228 18.830  48.724 1.00 54.16  ? 101  LEU A C   1 
ATOM   761  O  O   . LEU A 1 103 ? 71.492 18.650  49.916 1.00 48.99  ? 101  LEU A O   1 
ATOM   762  C  CB  . LEU A 1 103 ? 70.276 21.143  48.913 1.00 41.76  ? 101  LEU A CB  1 
ATOM   763  C  CG  . LEU A 1 103 ? 69.168 22.147  48.592 1.00 45.75  ? 101  LEU A CG  1 
ATOM   764  C  CD1 . LEU A 1 103 ? 69.442 23.454  49.308 1.00 38.54  ? 101  LEU A CD1 1 
ATOM   765  C  CD2 . LEU A 1 103 ? 69.082 22.360  47.079 1.00 40.93  ? 101  LEU A CD2 1 
ATOM   766  N  N   . LEU A 1 104 ? 71.905 18.251  47.730 1.00 58.63  ? 102  LEU A N   1 
ATOM   767  C  CA  . LEU A 1 104 ? 73.015 17.324  47.972 1.00 57.54  ? 102  LEU A CA  1 
ATOM   768  C  C   . LEU A 1 104 ? 74.322 17.739  47.281 1.00 61.50  ? 102  LEU A C   1 
ATOM   769  O  O   . LEU A 1 104 ? 74.305 18.445  46.268 1.00 56.89  ? 102  LEU A O   1 
ATOM   770  C  CB  . LEU A 1 104 ? 72.627 15.925  47.496 1.00 57.30  ? 102  LEU A CB  1 
ATOM   771  C  CG  . LEU A 1 104 ? 71.387 15.261  48.106 1.00 62.67  ? 102  LEU A CG  1 
ATOM   772  C  CD1 . LEU A 1 104 ? 71.049 13.987  47.330 1.00 59.03  ? 102  LEU A CD1 1 
ATOM   773  C  CD2 . LEU A 1 104 ? 71.635 14.941  49.567 1.00 59.62  ? 102  LEU A CD2 1 
ATOM   774  N  N   . GLY A 1 105 ? 75.448 17.288  47.840 1.00 61.82  ? 103  GLY A N   1 
ATOM   775  C  CA  . GLY A 1 105 ? 76.761 17.592  47.281 1.00 64.85  ? 103  GLY A CA  1 
ATOM   776  C  C   . GLY A 1 105 ? 77.016 16.782  46.024 1.00 64.02  ? 103  GLY A C   1 
ATOM   777  O  O   . GLY A 1 105 ? 76.319 15.791  45.809 1.00 63.77  ? 103  GLY A O   1 
ATOM   778  N  N   . ARG A 1 106 ? 77.999 17.181  45.205 1.00 68.20  ? 104  ARG A N   1 
ATOM   779  C  CA  . ARG A 1 106 ? 78.308 16.459  43.951 1.00 66.36  ? 104  ARG A CA  1 
ATOM   780  C  C   . ARG A 1 106 ? 78.437 14.976  44.228 1.00 59.42  ? 104  ARG A C   1 
ATOM   781  O  O   . ARG A 1 106 ? 77.717 14.154  43.659 1.00 56.94  ? 104  ARG A O   1 
ATOM   782  C  CB  . ARG A 1 106 ? 79.630 16.922  43.307 1.00 72.74  ? 104  ARG A CB  1 
ATOM   783  C  CG  . ARG A 1 106 ? 79.848 18.421  43.175 1.00 73.38  ? 104  ARG A CG  1 
ATOM   784  C  CD  . ARG A 1 106 ? 78.575 19.198  42.858 1.00 77.94  ? 104  ARG A CD  1 
ATOM   785  N  NE  . ARG A 1 106 ? 77.923 18.834  41.602 1.00 86.83  ? 104  ARG A NE  1 
ATOM   786  C  CZ  . ARG A 1 106 ? 77.398 19.723  40.762 1.00 91.18  ? 104  ARG A CZ  1 
ATOM   787  N  NH1 . ARG A 1 106 ? 77.465 21.013  41.052 1.00 92.96  ? 104  ARG A NH1 1 
ATOM   788  N  NH2 . ARG A 1 106 ? 76.792 19.330  39.647 1.00 94.03  ? 104  ARG A NH2 1 
ATOM   789  N  N   . GLY A 1 107 ? 79.370 14.654  45.115 1.00 57.83  ? 105  GLY A N   1 
ATOM   790  C  CA  . GLY A 1 107 ? 79.600 13.273  45.481 1.00 61.54  ? 105  GLY A CA  1 
ATOM   791  C  C   . GLY A 1 107 ? 78.298 12.567  45.797 1.00 62.86  ? 105  GLY A C   1 
ATOM   792  O  O   . GLY A 1 107 ? 77.791 11.780  45.000 1.00 62.51  ? 105  GLY A O   1 
ATOM   793  N  N   . GLU A 1 108 ? 77.753 12.871  46.966 1.00 64.14  ? 106  GLU A N   1 
ATOM   794  C  CA  . GLU A 1 108 ? 76.506 12.282  47.432 1.00 64.99  ? 106  GLU A CA  1 
ATOM   795  C  C   . GLU A 1 108 ? 75.461 12.221  46.316 1.00 63.95  ? 106  GLU A C   1 
ATOM   796  O  O   . GLU A 1 108 ? 74.730 11.242  46.182 1.00 63.79  ? 106  GLU A O   1 
ATOM   797  C  CB  . GLU A 1 108 ? 75.976 13.115  48.608 1.00 66.13  ? 106  GLU A CB  1 
ATOM   798  C  CG  . GLU A 1 108 ? 74.889 12.451  49.419 1.00 63.91  ? 106  GLU A CG  1 
ATOM   799  C  CD  . GLU A 1 108 ? 75.399 11.257  50.201 1.00 64.41  ? 106  GLU A CD  1 
ATOM   800  O  OE1 . GLU A 1 108 ? 76.370 11.426  50.973 1.00 55.82  ? 106  GLU A OE1 1 
ATOM   801  O  OE2 . GLU A 1 108 ? 74.825 10.154  50.046 1.00 68.05  ? 106  GLU A OE2 1 
ATOM   802  N  N   . ALA A 1 109 ? 75.405 13.273  45.510 1.00 70.76  ? 107  ALA A N   1 
ATOM   803  C  CA  . ALA A 1 109 ? 74.440 13.359  44.419 1.00 79.11  ? 107  ALA A CA  1 
ATOM   804  C  C   . ALA A 1 109 ? 74.433 12.176  43.444 1.00 83.21  ? 107  ALA A C   1 
ATOM   805  O  O   . ALA A 1 109 ? 73.424 11.482  43.309 1.00 85.03  ? 107  ALA A O   1 
ATOM   806  C  CB  . ALA A 1 109 ? 74.652 14.666  43.647 1.00 76.55  ? 107  ALA A CB  1 
ATOM   807  N  N   . ASN A 1 110 ? 75.551 11.946  42.762 1.00 87.56  ? 108  ASN A N   1 
ATOM   808  C  CA  . ASN A 1 110 ? 75.631 10.862  41.777 1.00 89.81  ? 108  ASN A CA  1 
ATOM   809  C  C   . ASN A 1 110 ? 75.826 9.458   42.343 1.00 87.70  ? 108  ASN A C   1 
ATOM   810  O  O   . ASN A 1 110 ? 75.949 8.500   41.583 1.00 88.81  ? 108  ASN A O   1 
ATOM   811  C  CB  . ASN A 1 110 ? 76.745 11.161  40.777 1.00 93.52  ? 108  ASN A CB  1 
ATOM   812  C  CG  . ASN A 1 110 ? 78.075 11.381  41.456 1.00 99.76  ? 108  ASN A CG  1 
ATOM   813  O  OD1 . ASN A 1 110 ? 79.040 11.819  40.835 1.00 103.06 ? 108  ASN A OD1 1 
ATOM   814  N  ND2 . ASN A 1 110 ? 78.136 11.071  42.746 1.00 102.06 ? 108  ASN A ND2 1 
ATOM   815  N  N   . THR A 1 111 ? 75.864 9.336   43.667 1.00 83.52  ? 109  THR A N   1 
ATOM   816  C  CA  . THR A 1 111 ? 76.021 8.036   44.305 1.00 78.32  ? 109  THR A CA  1 
ATOM   817  C  C   . THR A 1 111 ? 74.656 7.508   44.727 1.00 74.47  ? 109  THR A C   1 
ATOM   818  O  O   . THR A 1 111 ? 74.556 6.572   45.518 1.00 73.38  ? 109  THR A O   1 
ATOM   819  C  CB  . THR A 1 111 ? 76.912 8.131   45.548 1.00 80.51  ? 109  THR A CB  1 
ATOM   820  O  OG1 . THR A 1 111 ? 77.123 9.507   45.873 1.00 78.80  ? 109  THR A OG1 1 
ATOM   821  C  CG2 . THR A 1 111 ? 78.248 7.451   45.307 1.00 84.39  ? 109  THR A CG2 1 
ATOM   822  N  N   . GLY A 1 112 ? 73.607 8.120   44.191 1.00 71.26  ? 110  GLY A N   1 
ATOM   823  C  CA  . GLY A 1 112 ? 72.259 7.707   44.528 1.00 68.38  ? 110  GLY A CA  1 
ATOM   824  C  C   . GLY A 1 112 ? 71.677 8.505   45.687 1.00 68.31  ? 110  GLY A C   1 
ATOM   825  O  O   . GLY A 1 112 ? 70.514 8.326   46.043 1.00 65.91  ? 110  GLY A O   1 
ATOM   826  N  N   . GLY A 1 113 ? 72.486 9.391   46.265 1.00 65.72  ? 111  GLY A N   1 
ATOM   827  C  CA  . GLY A 1 113 ? 72.046 10.209  47.386 1.00 66.46  ? 111  GLY A CA  1 
ATOM   828  C  C   . GLY A 1 113 ? 70.563 10.545  47.463 1.00 67.91  ? 111  GLY A C   1 
ATOM   829  O  O   . GLY A 1 113 ? 69.940 10.350  48.509 1.00 68.48  ? 111  GLY A O   1 
ATOM   830  N  N   . ALA A 1 114 ? 70.001 11.043  46.361 1.00 65.31  ? 112  ALA A N   1 
ATOM   831  C  CA  . ALA A 1 114 ? 68.591 11.433  46.278 1.00 63.27  ? 112  ALA A CA  1 
ATOM   832  C  C   . ALA A 1 114 ? 67.593 10.311  46.511 1.00 61.09  ? 112  ALA A C   1 
ATOM   833  O  O   . ALA A 1 114 ? 66.383 10.546  46.494 1.00 60.96  ? 112  ALA A O   1 
ATOM   834  C  CB  . ALA A 1 114 ? 68.312 12.083  44.929 1.00 63.42  ? 112  ALA A CB  1 
ATOM   835  N  N   . ASP A 1 115 ? 68.086 9.094   46.712 1.00 61.67  ? 113  ASP A N   1 
ATOM   836  C  CA  . ASP A 1 115 ? 67.198 7.963   46.954 1.00 63.41  ? 113  ASP A CA  1 
ATOM   837  C  C   . ASP A 1 115 ? 67.604 7.204   48.210 1.00 62.13  ? 113  ASP A C   1 
ATOM   838  O  O   . ASP A 1 115 ? 66.922 6.268   48.624 1.00 57.37  ? 113  ASP A O   1 
ATOM   839  C  CB  . ASP A 1 115 ? 67.192 6.990   45.777 1.00 67.94  ? 113  ASP A CB  1 
ATOM   840  C  CG  . ASP A 1 115 ? 66.028 6.011   45.851 1.00 74.97  ? 113  ASP A CG  1 
ATOM   841  O  OD1 . ASP A 1 115 ? 66.148 4.874   45.338 1.00 71.51  ? 113  ASP A OD1 1 
ATOM   842  O  OD2 . ASP A 1 115 ? 64.981 6.397   46.420 1.00 76.71  ? 113  ASP A OD2 1 
ATOM   843  N  N   . LYS A 1 116 ? 68.724 7.599   48.803 1.00 61.33  ? 114  LYS A N   1 
ATOM   844  C  CA  . LYS A 1 116 ? 69.191 6.965   50.025 1.00 64.50  ? 114  LYS A CA  1 
ATOM   845  C  C   . LYS A 1 116 ? 68.125 7.149   51.122 1.00 68.64  ? 114  LYS A C   1 
ATOM   846  O  O   . LYS A 1 116 ? 67.920 8.255   51.631 1.00 69.77  ? 114  LYS A O   1 
ATOM   847  C  CB  . LYS A 1 116 ? 70.508 7.601   50.460 1.00 69.26  ? 114  LYS A CB  1 
ATOM   848  C  CG  . LYS A 1 116 ? 71.596 6.613   50.793 1.00 74.86  ? 114  LYS A CG  1 
ATOM   849  C  CD  . LYS A 1 116 ? 72.347 7.052   52.036 1.00 85.98  ? 114  LYS A CD  1 
ATOM   850  C  CE  . LYS A 1 116 ? 73.480 6.096   52.367 1.00 89.53  ? 114  LYS A CE  1 
ATOM   851  N  NZ  . LYS A 1 116 ? 73.413 5.639   53.784 1.00 89.34  ? 114  LYS A NZ  1 
ATOM   852  N  N   . SER A 1 117 ? 67.437 6.060   51.462 1.00 68.23  ? 115  SER A N   1 
ATOM   853  C  CA  . SER A 1 117 ? 66.392 6.068   52.483 1.00 65.87  ? 115  SER A CA  1 
ATOM   854  C  C   . SER A 1 117 ? 66.854 6.853   53.707 1.00 63.75  ? 115  SER A C   1 
ATOM   855  O  O   . SER A 1 117 ? 66.091 7.612   54.310 1.00 63.72  ? 115  SER A O   1 
ATOM   856  C  CB  . SER A 1 117 ? 66.077 4.639   52.890 1.00 62.59  ? 115  SER A CB  1 
ATOM   857  O  OG  . SER A 1 117 ? 67.235 4.043   53.443 1.00 80.12  ? 115  SER A OG  1 
ATOM   858  N  N   . SER A 1 118 ? 68.116 6.648   54.060 1.00 59.66  ? 116  SER A N   1 
ATOM   859  C  CA  . SER A 1 118 ? 68.744 7.315   55.187 1.00 57.40  ? 116  SER A CA  1 
ATOM   860  C  C   . SER A 1 118 ? 68.568 8.830   55.081 1.00 58.04  ? 116  SER A C   1 
ATOM   861  O  O   . SER A 1 118 ? 68.139 9.505   56.027 1.00 49.05  ? 116  SER A O   1 
ATOM   862  C  CB  . SER A 1 118 ? 70.234 6.959   55.208 1.00 57.50  ? 116  SER A CB  1 
ATOM   863  O  OG  . SER A 1 118 ? 70.986 7.857   56.007 1.00 64.76  ? 116  SER A OG  1 
ATOM   864  N  N   . ILE A 1 119 ? 68.913 9.354   53.915 1.00 53.78  ? 117  ILE A N   1 
ATOM   865  C  CA  . ILE A 1 119 ? 68.804 10.767  53.675 1.00 48.89  ? 117  ILE A CA  1 
ATOM   866  C  C   . ILE A 1 119 ? 67.341 11.181  53.622 1.00 47.36  ? 117  ILE A C   1 
ATOM   867  O  O   . ILE A 1 119 ? 66.976 12.216  54.168 1.00 45.58  ? 117  ILE A O   1 
ATOM   868  C  CB  . ILE A 1 119 ? 69.532 11.156  52.367 1.00 51.64  ? 117  ILE A CB  1 
ATOM   869  C  CG1 . ILE A 1 119 ? 71.044 10.985  52.552 1.00 51.81  ? 117  ILE A CG1 1 
ATOM   870  C  CG2 . ILE A 1 119 ? 69.223 12.599  51.997 1.00 46.06  ? 117  ILE A CG2 1 
ATOM   871  C  CD1 . ILE A 1 119 ? 71.872 11.359  51.335 1.00 48.26  ? 117  ILE A CD1 1 
ATOM   872  N  N   . LEU A 1 120 ? 66.501 10.369  52.989 1.00 44.46  ? 118  LEU A N   1 
ATOM   873  C  CA  . LEU A 1 120 ? 65.078 10.686  52.894 1.00 38.12  ? 118  LEU A CA  1 
ATOM   874  C  C   . LEU A 1 120 ? 64.400 10.720  54.270 1.00 44.21  ? 118  LEU A C   1 
ATOM   875  O  O   . LEU A 1 120 ? 63.544 11.569  54.543 1.00 40.77  ? 118  LEU A O   1 
ATOM   876  C  CB  . LEU A 1 120 ? 64.364 9.667   52.009 1.00 44.33  ? 118  LEU A CB  1 
ATOM   877  C  CG  . LEU A 1 120 ? 64.546 9.732   50.484 1.00 52.78  ? 118  LEU A CG  1 
ATOM   878  C  CD1 . LEU A 1 120 ? 63.755 8.601   49.840 1.00 48.72  ? 118  LEU A CD1 1 
ATOM   879  C  CD2 . LEU A 1 120 ? 64.050 11.074  49.944 1.00 42.76  ? 118  LEU A CD2 1 
ATOM   880  N  N   . ALA A 1 121 ? 64.777 9.789   55.137 1.00 41.51  ? 119  ALA A N   1 
ATOM   881  C  CA  . ALA A 1 121 ? 64.193 9.738   56.474 1.00 46.07  ? 119  ALA A CA  1 
ATOM   882  C  C   . ALA A 1 121 ? 64.591 11.006  57.252 1.00 40.79  ? 119  ALA A C   1 
ATOM   883  O  O   . ALA A 1 121 ? 63.748 11.675  57.857 1.00 42.23  ? 119  ALA A O   1 
ATOM   884  C  CB  . ALA A 1 121 ? 64.678 8.476   57.214 1.00 38.34  ? 119  ALA A CB  1 
ATOM   885  N  N   . ASP A 1 122 ? 65.880 11.331  57.231 1.00 42.22  ? 120  ASP A N   1 
ATOM   886  C  CA  . ASP A 1 122 ? 66.363 12.505  57.926 1.00 40.45  ? 120  ASP A CA  1 
ATOM   887  C  C   . ASP A 1 122 ? 65.644 13.754  57.413 1.00 43.24  ? 120  ASP A C   1 
ATOM   888  O  O   . ASP A 1 122 ? 65.238 14.622  58.206 1.00 36.59  ? 120  ASP A O   1 
ATOM   889  C  CB  . ASP A 1 122 ? 67.881 12.644  57.747 1.00 44.22  ? 120  ASP A CB  1 
ATOM   890  C  CG  . ASP A 1 122 ? 68.655 11.605  58.549 1.00 52.60  ? 120  ASP A CG  1 
ATOM   891  O  OD1 . ASP A 1 122 ? 68.059 10.981  59.445 1.00 58.60  ? 120  ASP A OD1 1 
ATOM   892  O  OD2 . ASP A 1 122 ? 69.856 11.415  58.300 1.00 57.09  ? 120  ASP A OD2 1 
ATOM   893  N  N   . GLY A 1 123 ? 65.508 13.831  56.088 1.00 39.41  ? 121  GLY A N   1 
ATOM   894  C  CA  . GLY A 1 123 ? 64.860 14.961  55.441 1.00 34.16  ? 121  GLY A CA  1 
ATOM   895  C  C   . GLY A 1 123 ? 63.422 15.109  55.900 1.00 33.86  ? 121  GLY A C   1 
ATOM   896  O  O   . GLY A 1 123 ? 62.972 16.203  56.236 1.00 34.66  ? 121  GLY A O   1 
ATOM   897  N  N   . MET A 1 124 ? 62.695 14.002  55.923 1.00 32.17  ? 122  MET A N   1 
ATOM   898  C  CA  . MET A 1 124 ? 61.312 14.006  56.365 1.00 32.27  ? 122  MET A CA  1 
ATOM   899  C  C   . MET A 1 124 ? 61.241 14.570  57.775 1.00 35.93  ? 122  MET A C   1 
ATOM   900  O  O   . MET A 1 124 ? 60.398 15.424  58.076 1.00 41.39  ? 122  MET A O   1 
ATOM   901  C  CB  . MET A 1 124 ? 60.754 12.585  56.340 1.00 37.04  ? 122  MET A CB  1 
ATOM   902  C  CG  . MET A 1 124 ? 59.242 12.516  56.396 1.00 46.19  ? 122  MET A CG  1 
ATOM   903  S  SD  . MET A 1 124 ? 58.448 13.410  55.041 1.00 50.09  ? 122  MET A SD  1 
ATOM   904  C  CE  . MET A 1 124 ? 57.581 14.630  55.901 1.00 39.19  ? 122  MET A CE  1 
ATOM   905  N  N   . GLU A 1 125 ? 62.138 14.107  58.641 1.00 33.38  ? 123  GLU A N   1 
ATOM   906  C  CA  . GLU A 1 125 ? 62.147 14.593  60.009 1.00 34.58  ? 123  GLU A CA  1 
ATOM   907  C  C   . GLU A 1 125 ? 62.461 16.085  60.100 1.00 29.86  ? 123  GLU A C   1 
ATOM   908  O  O   . GLU A 1 125 ? 61.898 16.788  60.934 1.00 30.90  ? 123  GLU A O   1 
ATOM   909  C  CB  . GLU A 1 125 ? 63.108 13.747  60.873 1.00 29.57  ? 123  GLU A CB  1 
ATOM   910  C  CG  . GLU A 1 125 ? 62.528 12.338  61.167 1.00 36.48  ? 123  GLU A CG  1 
ATOM   911  C  CD  . GLU A 1 125 ? 63.414 11.490  62.072 1.00 44.05  ? 123  GLU A CD  1 
ATOM   912  O  OE1 . GLU A 1 125 ? 64.645 11.655  62.004 1.00 41.41  ? 123  GLU A OE1 1 
ATOM   913  O  OE2 . GLU A 1 125 ? 62.876 10.660  62.839 1.00 47.60  ? 123  GLU A OE2 1 
ATOM   914  N  N   . SER A 1 126 ? 63.347 16.573  59.240 1.00 29.10  ? 124  SER A N   1 
ATOM   915  C  CA  . SER A 1 126 ? 63.697 18.000  59.215 1.00 24.20  ? 124  SER A CA  1 
ATOM   916  C  C   . SER A 1 126 ? 62.472 18.870  58.883 1.00 26.75  ? 124  SER A C   1 
ATOM   917  O  O   . SER A 1 126 ? 62.255 19.924  59.469 1.00 27.35  ? 124  SER A O   1 
ATOM   918  C  CB  . SER A 1 126 ? 64.773 18.256  58.162 1.00 31.23  ? 124  SER A CB  1 
ATOM   919  O  OG  . SER A 1 126 ? 65.974 17.587  58.501 1.00 45.08  ? 124  SER A OG  1 
ATOM   920  N  N   . LEU A 1 127 ? 61.675 18.420  57.928 1.00 27.10  ? 125  LEU A N   1 
ATOM   921  C  CA  . LEU A 1 127 ? 60.483 19.168  57.554 1.00 32.08  ? 125  LEU A CA  1 
ATOM   922  C  C   . LEU A 1 127 ? 59.495 19.253  58.737 1.00 32.00  ? 125  LEU A C   1 
ATOM   923  O  O   . LEU A 1 127 ? 58.938 20.326  59.027 1.00 31.88  ? 125  LEU A O   1 
ATOM   924  C  CB  . LEU A 1 127 ? 59.823 18.501  56.356 1.00 29.56  ? 125  LEU A CB  1 
ATOM   925  C  CG  . LEU A 1 127 ? 60.618 18.520  55.049 1.00 40.36  ? 125  LEU A CG  1 
ATOM   926  C  CD1 . LEU A 1 127 ? 59.882 17.688  54.005 1.00 37.62  ? 125  LEU A CD1 1 
ATOM   927  C  CD2 . LEU A 1 127 ? 60.790 19.954  54.565 1.00 39.41  ? 125  LEU A CD2 1 
ATOM   928  N  N   . LEU A 1 128 ? 59.299 18.124  59.424 1.00 30.82  ? 126  LEU A N   1 
ATOM   929  C  CA  . LEU A 1 128 ? 58.391 18.076  60.573 1.00 30.75  ? 126  LEU A CA  1 
ATOM   930  C  C   . LEU A 1 128 ? 58.945 19.055  61.588 1.00 35.49  ? 126  LEU A C   1 
ATOM   931  O  O   . LEU A 1 128 ? 58.198 19.789  62.245 1.00 33.34  ? 126  LEU A O   1 
ATOM   932  C  CB  . LEU A 1 128 ? 58.332 16.656  61.157 1.00 26.11  ? 126  LEU A CB  1 
ATOM   933  C  CG  . LEU A 1 128 ? 57.753 15.656  60.151 1.00 37.01  ? 126  LEU A CG  1 
ATOM   934  C  CD1 . LEU A 1 128 ? 57.684 14.252  60.716 1.00 31.98  ? 126  LEU A CD1 1 
ATOM   935  C  CD2 . LEU A 1 128 ? 56.361 16.137  59.757 1.00 30.23  ? 126  LEU A CD2 1 
ATOM   936  N  N   . GLY A 1 129 ? 60.275 19.081  61.684 1.00 29.40  ? 127  GLY A N   1 
ATOM   937  C  CA  . GLY A 1 129 ? 60.919 19.998  62.597 1.00 29.55  ? 127  GLY A CA  1 
ATOM   938  C  C   . GLY A 1 129 ? 60.618 21.438  62.188 1.00 35.05  ? 127  GLY A C   1 
ATOM   939  O  O   . GLY A 1 129 ? 60.291 22.262  63.033 1.00 38.06  ? 127  GLY A O   1 
ATOM   940  N  N   . ALA A 1 130 ? 60.717 21.751  60.900 1.00 28.96  ? 128  ALA A N   1 
ATOM   941  C  CA  . ALA A 1 130 ? 60.456 23.114  60.461 1.00 36.05  ? 128  ALA A CA  1 
ATOM   942  C  C   . ALA A 1 130 ? 58.990 23.494  60.701 1.00 32.91  ? 128  ALA A C   1 
ATOM   943  O  O   . ALA A 1 130 ? 58.698 24.584  61.173 1.00 34.34  ? 128  ALA A O   1 
ATOM   944  C  CB  . ALA A 1 130 ? 60.805 23.270  58.980 1.00 33.53  ? 128  ALA A CB  1 
ATOM   945  N  N   . ILE A 1 131 ? 58.075 22.588  60.380 1.00 36.38  ? 129  ILE A N   1 
ATOM   946  C  CA  . ILE A 1 131 ? 56.660 22.863  60.580 1.00 34.97  ? 129  ILE A CA  1 
ATOM   947  C  C   . ILE A 1 131 ? 56.352 23.192  62.026 1.00 41.29  ? 129  ILE A C   1 
ATOM   948  O  O   . ILE A 1 131 ? 55.670 24.184  62.325 1.00 39.12  ? 129  ILE A O   1 
ATOM   949  C  CB  . ILE A 1 131 ? 55.813 21.681  60.154 1.00 35.60  ? 129  ILE A CB  1 
ATOM   950  C  CG1 . ILE A 1 131 ? 55.887 21.546  58.632 1.00 29.77  ? 129  ILE A CG1 1 
ATOM   951  C  CG2 . ILE A 1 131 ? 54.397 21.864  60.648 1.00 39.22  ? 129  ILE A CG2 1 
ATOM   952  C  CD1 . ILE A 1 131 ? 55.304 20.284  58.058 1.00 28.45  ? 129  ILE A CD1 1 
ATOM   953  N  N   . TYR A 1 132 ? 56.883 22.378  62.927 1.00 35.87  ? 130  TYR A N   1 
ATOM   954  C  CA  . TYR A 1 132 ? 56.667 22.587  64.345 1.00 32.96  ? 130  TYR A CA  1 
ATOM   955  C  C   . TYR A 1 132 ? 57.273 23.908  64.784 1.00 38.01  ? 130  TYR A C   1 
ATOM   956  O  O   . TYR A 1 132 ? 56.722 24.607  65.635 1.00 37.88  ? 130  TYR A O   1 
ATOM   957  C  CB  . TYR A 1 132 ? 57.335 21.471  65.142 1.00 36.06  ? 130  TYR A CB  1 
ATOM   958  C  CG  . TYR A 1 132 ? 57.295 21.662  66.640 1.00 30.73  ? 130  TYR A CG  1 
ATOM   959  C  CD1 . TYR A 1 132 ? 56.270 21.109  67.406 1.00 30.16  ? 130  TYR A CD1 1 
ATOM   960  C  CD2 . TYR A 1 132 ? 58.310 22.341  67.296 1.00 24.73  ? 130  TYR A CD2 1 
ATOM   961  C  CE1 . TYR A 1 132 ? 56.271 21.226  68.806 1.00 26.59  ? 130  TYR A CE1 1 
ATOM   962  C  CE2 . TYR A 1 132 ? 58.325 22.459  68.678 1.00 28.31  ? 130  TYR A CE2 1 
ATOM   963  C  CZ  . TYR A 1 132 ? 57.301 21.897  69.432 1.00 30.71  ? 130  TYR A CZ  1 
ATOM   964  O  OH  . TYR A 1 132 ? 57.323 21.989  70.810 1.00 30.93  ? 130  TYR A OH  1 
ATOM   965  N  N   . LEU A 1 133 ? 58.421 24.252  64.216 1.00 32.23  ? 131  LEU A N   1 
ATOM   966  C  CA  . LEU A 1 133 ? 59.081 25.484  64.614 1.00 35.88  ? 131  LEU A CA  1 
ATOM   967  C  C   . LEU A 1 133 ? 58.283 26.701  64.166 1.00 33.59  ? 131  LEU A C   1 
ATOM   968  O  O   . LEU A 1 133 ? 58.096 27.677  64.912 1.00 36.34  ? 131  LEU A O   1 
ATOM   969  C  CB  . LEU A 1 133 ? 60.491 25.532  64.024 1.00 37.60  ? 131  LEU A CB  1 
ATOM   970  C  CG  . LEU A 1 133 ? 61.385 26.626  64.596 1.00 44.29  ? 131  LEU A CG  1 
ATOM   971  C  CD1 . LEU A 1 133 ? 61.561 26.389  66.096 1.00 46.31  ? 131  LEU A CD1 1 
ATOM   972  C  CD2 . LEU A 1 133 ? 62.763 26.589  63.890 1.00 41.77  ? 131  LEU A CD2 1 
ATOM   973  N  N   . GLN A 1 134 ? 57.783 26.610  62.949 1.00 32.82  ? 132  GLN A N   1 
ATOM   974  C  CA  . GLN A 1 134 ? 57.039 27.709  62.362 1.00 44.28  ? 132  GLN A CA  1 
ATOM   975  C  C   . GLN A 1 134 ? 55.609 27.850  62.893 1.00 48.80  ? 132  GLN A C   1 
ATOM   976  O  O   . GLN A 1 134 ? 55.148 28.964  63.163 1.00 45.03  ? 132  GLN A O   1 
ATOM   977  C  CB  . GLN A 1 134 ? 57.001 27.548  60.832 1.00 36.88  ? 132  GLN A CB  1 
ATOM   978  C  CG  . GLN A 1 134 ? 56.527 28.760  60.042 1.00 43.70  ? 132  GLN A CG  1 
ATOM   979  C  CD  . GLN A 1 134 ? 57.383 29.989  60.298 1.00 46.55  ? 132  GLN A CD  1 
ATOM   980  O  OE1 . GLN A 1 134 ? 58.586 29.865  60.520 1.00 53.30  ? 132  GLN A OE1 1 
ATOM   981  N  NE2 . GLN A 1 134 ? 56.769 31.179  60.253 1.00 56.57  ? 132  GLN A NE2 1 
ATOM   982  N  N   . HIS A 1 135 ? 54.932 26.725  63.084 1.00 48.77  ? 133  HIS A N   1 
ATOM   983  C  CA  . HIS A 1 135 ? 53.546 26.764  63.493 1.00 52.13  ? 133  HIS A CA  1 
ATOM   984  C  C   . HIS A 1 135 ? 53.174 26.320  64.907 1.00 55.52  ? 133  HIS A C   1 
ATOM   985  O  O   . HIS A 1 135 ? 52.231 26.859  65.491 1.00 55.23  ? 133  HIS A O   1 
ATOM   986  C  CB  . HIS A 1 135 ? 52.750 25.969  62.475 1.00 52.02  ? 133  HIS A CB  1 
ATOM   987  C  CG  . HIS A 1 135 ? 52.986 26.392  61.059 1.00 59.26  ? 133  HIS A CG  1 
ATOM   988  N  ND1 . HIS A 1 135 ? 52.804 27.689  60.621 1.00 60.33  ? 133  HIS A ND1 1 
ATOM   989  C  CD2 . HIS A 1 135 ? 53.375 25.685  59.967 1.00 62.49  ? 133  HIS A CD2 1 
ATOM   990  C  CE1 . HIS A 1 135 ? 53.069 27.760  59.330 1.00 56.54  ? 133  HIS A CE1 1 
ATOM   991  N  NE2 . HIS A 1 135 ? 53.418 26.557  58.909 1.00 61.91  ? 133  HIS A NE2 1 
ATOM   992  N  N   . GLY A 1 136 ? 53.900 25.357  65.469 1.00 52.15  ? 134  GLY A N   1 
ATOM   993  C  CA  . GLY A 1 136 ? 53.564 24.907  66.808 1.00 39.62  ? 134  GLY A CA  1 
ATOM   994  C  C   . GLY A 1 136 ? 53.090 23.463  66.814 1.00 38.94  ? 134  GLY A C   1 
ATOM   995  O  O   . GLY A 1 136 ? 52.767 22.892  65.773 1.00 33.56  ? 134  GLY A O   1 
ATOM   996  N  N   . MET A 1 137 ? 53.031 22.875  68.003 1.00 43.19  ? 135  MET A N   1 
ATOM   997  C  CA  . MET A 1 137 ? 52.653 21.475  68.175 1.00 42.38  ? 135  MET A CA  1 
ATOM   998  C  C   . MET A 1 137 ? 51.362 20.977  67.518 1.00 43.13  ? 135  MET A C   1 
ATOM   999  O  O   . MET A 1 137 ? 51.366 19.962  66.825 1.00 46.99  ? 135  MET A O   1 
ATOM   1000 C  CB  . MET A 1 137 ? 52.610 21.150  69.678 1.00 45.82  ? 135  MET A CB  1 
ATOM   1001 C  CG  . MET A 1 137 ? 52.345 19.666  70.022 1.00 52.27  ? 135  MET A CG  1 
ATOM   1002 S  SD  . MET A 1 137 ? 53.698 18.536  69.452 1.00 44.72  ? 135  MET A SD  1 
ATOM   1003 C  CE  . MET A 1 137 ? 52.817 16.846  69.513 1.00 51.21  ? 135  MET A CE  1 
ATOM   1004 N  N   . GLU A 1 138 ? 50.245 21.663  67.719 1.00 47.05  ? 136  GLU A N   1 
ATOM   1005 C  CA  . GLU A 1 138 ? 48.995 21.146  67.153 1.00 45.17  ? 136  GLU A CA  1 
ATOM   1006 C  C   . GLU A 1 138 ? 48.953 21.036  65.637 1.00 42.04  ? 136  GLU A C   1 
ATOM   1007 O  O   . GLU A 1 138 ? 48.439 20.053  65.078 1.00 38.80  ? 136  GLU A O   1 
ATOM   1008 C  CB  . GLU A 1 138 ? 47.823 21.958  67.695 1.00 53.70  ? 136  GLU A CB  1 
ATOM   1009 C  CG  . GLU A 1 138 ? 47.809 21.987  69.233 1.00 57.59  ? 136  GLU A CG  1 
ATOM   1010 C  CD  . GLU A 1 138 ? 47.932 20.592  69.878 1.00 67.90  ? 136  GLU A CD  1 
ATOM   1011 O  OE1 . GLU A 1 138 ? 48.359 20.516  71.056 1.00 62.89  ? 136  GLU A OE1 1 
ATOM   1012 O  OE2 . GLU A 1 138 ? 47.607 19.575  69.221 1.00 66.13  ? 136  GLU A OE2 1 
ATOM   1013 N  N   . LYS A 1 139 ? 49.509 22.027  64.953 1.00 47.72  ? 137  LYS A N   1 
ATOM   1014 C  CA  . LYS A 1 139 ? 49.545 21.971  63.499 1.00 43.98  ? 137  LYS A CA  1 
ATOM   1015 C  C   . LYS A 1 139 ? 50.481 20.833  63.079 1.00 43.17  ? 137  LYS A C   1 
ATOM   1016 O  O   . LYS A 1 139 ? 50.149 20.031  62.194 1.00 45.38  ? 137  LYS A O   1 
ATOM   1017 C  CB  . LYS A 1 139 ? 50.022 23.307  62.923 1.00 51.52  ? 137  LYS A CB  1 
ATOM   1018 C  CG  . LYS A 1 139 ? 50.204 23.277  61.413 1.00 54.94  ? 137  LYS A CG  1 
ATOM   1019 C  CD  . LYS A 1 139 ? 48.958 22.802  60.667 1.00 57.27  ? 137  LYS A CD  1 
ATOM   1020 C  CE  . LYS A 1 139 ? 47.807 23.802  60.802 1.00 63.62  ? 137  LYS A CE  1 
ATOM   1021 N  NZ  . LYS A 1 139 ? 46.693 23.461  59.872 1.00 65.37  ? 137  LYS A NZ  1 
ATOM   1022 N  N   . ALA A 1 140 ? 51.645 20.746  63.724 1.00 40.92  ? 138  ALA A N   1 
ATOM   1023 C  CA  . ALA A 1 140 ? 52.579 19.670  63.402 1.00 37.49  ? 138  ALA A CA  1 
ATOM   1024 C  C   . ALA A 1 140 ? 51.863 18.363  63.655 1.00 33.85  ? 138  ALA A C   1 
ATOM   1025 O  O   . ALA A 1 140 ? 51.975 17.424  62.872 1.00 33.80  ? 138  ALA A O   1 
ATOM   1026 C  CB  . ALA A 1 140 ? 53.844 19.767  64.271 1.00 37.51  ? 138  ALA A CB  1 
ATOM   1027 N  N   . ARG A 1 141 ? 51.108 18.304  64.751 1.00 36.65  ? 139  ARG A N   1 
ATOM   1028 C  CA  . ARG A 1 141 ? 50.369 17.088  65.076 1.00 39.59  ? 139  ARG A CA  1 
ATOM   1029 C  C   . ARG A 1 141 ? 49.454 16.708  63.908 1.00 43.38  ? 139  ARG A C   1 
ATOM   1030 O  O   . ARG A 1 141 ? 49.492 15.576  63.419 1.00 39.85  ? 139  ARG A O   1 
ATOM   1031 C  CB  . ARG A 1 141 ? 49.527 17.283  66.346 1.00 47.95  ? 139  ARG A CB  1 
ATOM   1032 C  CG  . ARG A 1 141 ? 49.082 15.962  66.955 1.00 46.88  ? 139  ARG A CG  1 
ATOM   1033 C  CD  . ARG A 1 141 ? 47.974 16.113  67.990 1.00 42.45  ? 139  ARG A CD  1 
ATOM   1034 N  NE  . ARG A 1 141 ? 48.415 16.785  69.202 1.00 42.17  ? 139  ARG A NE  1 
ATOM   1035 C  CZ  . ARG A 1 141 ? 49.173 16.228  70.145 1.00 48.13  ? 139  ARG A CZ  1 
ATOM   1036 N  NH1 . ARG A 1 141 ? 49.585 14.966  70.028 1.00 50.85  ? 139  ARG A NH1 1 
ATOM   1037 N  NH2 . ARG A 1 141 ? 49.527 16.945  71.201 1.00 38.10  ? 139  ARG A NH2 1 
ATOM   1038 N  N   . GLU A 1 142 ? 48.639 17.665  63.460 1.00 45.33  ? 140  GLU A N   1 
ATOM   1039 C  CA  . GLU A 1 142 ? 47.724 17.432  62.335 1.00 47.60  ? 140  GLU A CA  1 
ATOM   1040 C  C   . GLU A 1 142 ? 48.460 16.828  61.167 1.00 50.47  ? 140  GLU A C   1 
ATOM   1041 O  O   . GLU A 1 142 ? 48.153 15.721  60.708 1.00 54.38  ? 140  GLU A O   1 
ATOM   1042 C  CB  . GLU A 1 142 ? 47.121 18.733  61.799 1.00 55.04  ? 140  GLU A CB  1 
ATOM   1043 C  CG  . GLU A 1 142 ? 46.423 19.636  62.782 1.00 66.20  ? 140  GLU A CG  1 
ATOM   1044 C  CD  . GLU A 1 142 ? 45.754 20.809  62.075 1.00 71.75  ? 140  GLU A CD  1 
ATOM   1045 O  OE1 . GLU A 1 142 ? 45.453 21.817  62.752 1.00 69.68  ? 140  GLU A OE1 1 
ATOM   1046 O  OE2 . GLU A 1 142 ? 45.528 20.714  60.842 1.00 62.84  ? 140  GLU A OE2 1 
ATOM   1047 N  N   . VAL A 1 143 ? 49.436 17.590  60.672 1.00 47.02  ? 141  VAL A N   1 
ATOM   1048 C  CA  . VAL A 1 143 ? 50.204 17.159  59.524 1.00 41.93  ? 141  VAL A CA  1 
ATOM   1049 C  C   . VAL A 1 143 ? 50.688 15.739  59.713 1.00 39.74  ? 141  VAL A C   1 
ATOM   1050 O  O   . VAL A 1 143 ? 50.513 14.896  58.839 1.00 43.87  ? 141  VAL A O   1 
ATOM   1051 C  CB  . VAL A 1 143 ? 51.410 18.085  59.280 1.00 42.19  ? 141  VAL A CB  1 
ATOM   1052 C  CG1 . VAL A 1 143 ? 52.179 17.601  58.086 1.00 41.51  ? 141  VAL A CG1 1 
ATOM   1053 C  CG2 . VAL A 1 143 ? 50.940 19.517  59.066 1.00 40.83  ? 141  VAL A CG2 1 
ATOM   1054 N  N   . ILE A 1 144 ? 51.287 15.467  60.866 1.00 42.89  ? 142  ILE A N   1 
ATOM   1055 C  CA  . ILE A 1 144 ? 51.801 14.131  61.142 1.00 40.13  ? 142  ILE A CA  1 
ATOM   1056 C  C   . ILE A 1 144 ? 50.677 13.084  61.213 1.00 40.30  ? 142  ILE A C   1 
ATOM   1057 O  O   . ILE A 1 144 ? 50.816 11.984  60.681 1.00 39.38  ? 142  ILE A O   1 
ATOM   1058 C  CB  . ILE A 1 144 ? 52.618 14.118  62.472 1.00 38.33  ? 142  ILE A CB  1 
ATOM   1059 C  CG1 . ILE A 1 144 ? 53.920 14.930  62.291 1.00 38.49  ? 142  ILE A CG1 1 
ATOM   1060 C  CG2 . ILE A 1 144 ? 52.920 12.673  62.879 1.00 31.27  ? 142  ILE A CG2 1 
ATOM   1061 C  CD1 . ILE A 1 144 ? 54.613 15.359  63.602 1.00 35.18  ? 142  ILE A CD1 1 
ATOM   1062 N  N   . LEU A 1 145 ? 49.565 13.394  61.875 1.00 42.42  ? 143  LEU A N   1 
ATOM   1063 C  CA  . LEU A 1 145 ? 48.509 12.386  61.928 1.00 52.10  ? 143  LEU A CA  1 
ATOM   1064 C  C   . LEU A 1 145 ? 48.077 12.033  60.493 1.00 55.67  ? 143  LEU A C   1 
ATOM   1065 O  O   . LEU A 1 145 ? 47.751 10.876  60.201 1.00 61.26  ? 143  LEU A O   1 
ATOM   1066 C  CB  . LEU A 1 145 ? 47.324 12.868  62.779 1.00 48.72  ? 143  LEU A CB  1 
ATOM   1067 C  CG  . LEU A 1 145 ? 47.246 12.387  64.246 1.00 48.85  ? 143  LEU A CG  1 
ATOM   1068 C  CD1 . LEU A 1 145 ? 48.316 11.319  64.527 1.00 42.87  ? 143  LEU A CD1 1 
ATOM   1069 C  CD2 . LEU A 1 145 ? 47.414 13.554  65.185 1.00 40.29  ? 143  LEU A CD2 1 
ATOM   1070 N  N   . ARG A 1 146 ? 48.127 13.018  59.592 1.00 57.41  ? 144  ARG A N   1 
ATOM   1071 C  CA  . ARG A 1 146 ? 47.766 12.794  58.192 1.00 55.38  ? 144  ARG A CA  1 
ATOM   1072 C  C   . ARG A 1 146 ? 48.790 11.955  57.435 1.00 56.17  ? 144  ARG A C   1 
ATOM   1073 O  O   . ARG A 1 146 ? 48.452 10.913  56.889 1.00 58.57  ? 144  ARG A O   1 
ATOM   1074 C  CB  . ARG A 1 146 ? 47.563 14.131  57.479 1.00 60.29  ? 144  ARG A CB  1 
ATOM   1075 C  CG  . ARG A 1 146 ? 47.174 14.012  56.006 1.00 59.92  ? 144  ARG A CG  1 
ATOM   1076 C  CD  . ARG A 1 146 ? 46.457 15.268  55.537 1.00 59.48  ? 144  ARG A CD  1 
ATOM   1077 N  NE  . ARG A 1 146 ? 47.221 16.485  55.806 1.00 62.53  ? 144  ARG A NE  1 
ATOM   1078 C  CZ  . ARG A 1 146 ? 48.389 16.773  55.239 1.00 63.94  ? 144  ARG A CZ  1 
ATOM   1079 N  NH1 . ARG A 1 146 ? 48.932 15.935  54.362 1.00 56.49  ? 144  ARG A NH1 1 
ATOM   1080 N  NH2 . ARG A 1 146 ? 49.025 17.890  55.563 1.00 65.21  ? 144  ARG A NH2 1 
ATOM   1081 N  N   . LEU A 1 147 ? 50.046 12.386  57.395 1.00 56.83  ? 145  LEU A N   1 
ATOM   1082 C  CA  . LEU A 1 147 ? 51.043 11.599  56.672 1.00 55.80  ? 145  LEU A CA  1 
ATOM   1083 C  C   . LEU A 1 147 ? 51.262 10.207  57.245 1.00 56.46  ? 145  LEU A C   1 
ATOM   1084 O  O   . LEU A 1 147 ? 51.557 9.268   56.507 1.00 55.84  ? 145  LEU A O   1 
ATOM   1085 C  CB  . LEU A 1 147 ? 52.401 12.293  56.654 1.00 57.08  ? 145  LEU A CB  1 
ATOM   1086 C  CG  . LEU A 1 147 ? 52.607 13.568  55.860 1.00 68.22  ? 145  LEU A CG  1 
ATOM   1087 C  CD1 . LEU A 1 147 ? 52.470 14.803  56.734 1.00 65.88  ? 145  LEU A CD1 1 
ATOM   1088 C  CD2 . LEU A 1 147 ? 54.012 13.496  55.304 1.00 71.62  ? 145  LEU A CD2 1 
ATOM   1089 N  N   . PHE A 1 148 ? 51.149 10.071  58.562 1.00 55.31  ? 146  PHE A N   1 
ATOM   1090 C  CA  . PHE A 1 148 ? 51.381 8.776   59.187 1.00 57.50  ? 146  PHE A CA  1 
ATOM   1091 C  C   . PHE A 1 148 ? 50.096 8.050   59.541 1.00 62.02  ? 146  PHE A C   1 
ATOM   1092 O  O   . PHE A 1 148 ? 50.122 6.991   60.167 1.00 65.68  ? 146  PHE A O   1 
ATOM   1093 C  CB  . PHE A 1 148 ? 52.248 8.966   60.423 1.00 45.52  ? 146  PHE A CB  1 
ATOM   1094 C  CG  . PHE A 1 148 ? 53.637 9.420   60.106 1.00 47.26  ? 146  PHE A CG  1 
ATOM   1095 C  CD1 . PHE A 1 148 ? 54.685 8.508   60.043 1.00 40.27  ? 146  PHE A CD1 1 
ATOM   1096 C  CD2 . PHE A 1 148 ? 53.899 10.757  59.847 1.00 42.79  ? 146  PHE A CD2 1 
ATOM   1097 C  CE1 . PHE A 1 148 ? 55.976 8.916   59.725 1.00 39.98  ? 146  PHE A CE1 1 
ATOM   1098 C  CE2 . PHE A 1 148 ? 55.190 11.174  59.527 1.00 43.82  ? 146  PHE A CE2 1 
ATOM   1099 C  CZ  . PHE A 1 148 ? 56.230 10.250  59.470 1.00 36.34  ? 146  PHE A CZ  1 
ATOM   1100 N  N   . GLY A 1 149 ? 48.973 8.626   59.127 1.00 64.32  ? 147  GLY A N   1 
ATOM   1101 C  CA  . GLY A 1 149 ? 47.685 8.021   59.396 1.00 67.73  ? 147  GLY A CA  1 
ATOM   1102 C  C   . GLY A 1 149 ? 47.590 6.563   58.987 1.00 67.52  ? 147  GLY A C   1 
ATOM   1103 O  O   . GLY A 1 149 ? 46.989 5.772   59.705 1.00 70.61  ? 147  GLY A O   1 
ATOM   1104 N  N   . PRO A 1 150 ? 48.159 6.177   57.836 1.00 70.82  ? 148  PRO A N   1 
ATOM   1105 C  CA  . PRO A 1 150 ? 48.125 4.797   57.342 1.00 69.87  ? 148  PRO A CA  1 
ATOM   1106 C  C   . PRO A 1 150 ? 49.079 3.885   58.079 1.00 70.66  ? 148  PRO A C   1 
ATOM   1107 O  O   . PRO A 1 150 ? 48.677 2.870   58.634 1.00 77.97  ? 148  PRO A O   1 
ATOM   1108 C  CB  . PRO A 1 150 ? 48.533 4.937   55.875 1.00 69.83  ? 148  PRO A CB  1 
ATOM   1109 C  CG  . PRO A 1 150 ? 48.168 6.343   55.540 1.00 73.36  ? 148  PRO A CG  1 
ATOM   1110 C  CD  . PRO A 1 150 ? 48.607 7.085   56.769 1.00 76.02  ? 148  PRO A CD  1 
ATOM   1111 N  N   . LEU A 1 151 ? 50.355 4.247   58.049 1.00 69.84  ? 149  LEU A N   1 
ATOM   1112 C  CA  . LEU A 1 151 ? 51.406 3.483   58.700 1.00 67.15  ? 149  LEU A CA  1 
ATOM   1113 C  C   . LEU A 1 151 ? 50.961 3.130   60.125 1.00 68.71  ? 149  LEU A C   1 
ATOM   1114 O  O   . LEU A 1 151 ? 51.319 2.076   60.667 1.00 62.65  ? 149  LEU A O   1 
ATOM   1115 C  CB  . LEU A 1 151 ? 52.687 4.317   58.708 1.00 62.55  ? 149  LEU A CB  1 
ATOM   1116 C  CG  . LEU A 1 151 ? 53.999 3.547   58.700 1.00 61.49  ? 149  LEU A CG  1 
ATOM   1117 C  CD1 . LEU A 1 151 ? 53.952 2.443   57.668 1.00 61.82  ? 149  LEU A CD1 1 
ATOM   1118 C  CD2 . LEU A 1 151 ? 55.124 4.506   58.409 1.00 64.91  ? 149  LEU A CD2 1 
ATOM   1119 N  N   . LEU A 1 152 ? 50.163 4.017   60.718 1.00 68.21  ? 150  LEU A N   1 
ATOM   1120 C  CA  . LEU A 1 152 ? 49.634 3.799   62.055 1.00 68.15  ? 150  LEU A CA  1 
ATOM   1121 C  C   . LEU A 1 152 ? 48.698 2.589   62.059 1.00 72.27  ? 150  LEU A C   1 
ATOM   1122 O  O   . LEU A 1 152 ? 48.934 1.622   62.788 1.00 71.24  ? 150  LEU A O   1 
ATOM   1123 C  CB  . LEU A 1 152 ? 48.869 5.038   62.544 1.00 60.47  ? 150  LEU A CB  1 
ATOM   1124 C  CG  . LEU A 1 152 ? 49.694 6.150   63.200 1.00 61.40  ? 150  LEU A CG  1 
ATOM   1125 C  CD1 . LEU A 1 152 ? 48.796 7.272   63.692 1.00 52.04  ? 150  LEU A CD1 1 
ATOM   1126 C  CD2 . LEU A 1 152 ? 50.473 5.559   64.357 1.00 56.22  ? 150  LEU A CD2 1 
ATOM   1127 N  N   . ASP A 1 153 ? 47.639 2.649   61.247 1.00 71.79  ? 151  ASP A N   1 
ATOM   1128 C  CA  . ASP A 1 153 ? 46.662 1.564   61.171 1.00 70.69  ? 151  ASP A CA  1 
ATOM   1129 C  C   . ASP A 1 153 ? 47.337 0.259   60.842 1.00 71.73  ? 151  ASP A C   1 
ATOM   1130 O  O   . ASP A 1 153 ? 46.845 -0.812  61.183 1.00 72.26  ? 151  ASP A O   1 
ATOM   1131 C  CB  . ASP A 1 153 ? 45.605 1.849   60.110 1.00 66.00  ? 151  ASP A CB  1 
ATOM   1132 C  CG  . ASP A 1 153 ? 44.941 3.192   60.296 1.00 71.72  ? 151  ASP A CG  1 
ATOM   1133 O  OD1 . ASP A 1 153 ? 44.564 3.526   61.439 1.00 70.48  ? 151  ASP A OD1 1 
ATOM   1134 O  OD2 . ASP A 1 153 ? 44.786 3.913   59.291 1.00 70.19  ? 151  ASP A OD2 1 
ATOM   1135 N  N   . ALA A 1 154 ? 48.473 0.356   60.172 1.00 76.08  ? 152  ALA A N   1 
ATOM   1136 C  CA  . ALA A 1 154 ? 49.225 -0.825  59.779 1.00 81.09  ? 152  ALA A CA  1 
ATOM   1137 C  C   . ALA A 1 154 ? 49.969 -1.424  60.966 1.00 82.39  ? 152  ALA A C   1 
ATOM   1138 O  O   . ALA A 1 154 ? 50.017 -2.646  61.130 1.00 82.20  ? 152  ALA A O   1 
ATOM   1139 C  CB  . ALA A 1 154 ? 50.220 -0.463  58.661 1.00 82.13  ? 152  ALA A CB  1 
ATOM   1140 N  N   . ALA A 1 155 ? 50.544 -0.552  61.790 1.00 82.32  ? 153  ALA A N   1 
ATOM   1141 C  CA  . ALA A 1 155 ? 51.320 -0.973  62.952 1.00 80.75  ? 153  ALA A CA  1 
ATOM   1142 C  C   . ALA A 1 155 ? 50.746 -2.165  63.724 1.00 77.40  ? 153  ALA A C   1 
ATOM   1143 O  O   . ALA A 1 155 ? 51.488 -3.084  64.072 1.00 67.56  ? 153  ALA A O   1 
ATOM   1144 C  CB  . ALA A 1 155 ? 51.531 0.213   63.893 1.00 81.77  ? 153  ALA A CB  1 
ATOM   1145 N  N   . PRO A 1 156 ? 49.426 -2.167  64.000 1.00 78.62  ? 154  PRO A N   1 
ATOM   1146 C  CA  . PRO A 1 156 ? 48.791 -3.268  64.737 1.00 83.62  ? 154  PRO A CA  1 
ATOM   1147 C  C   . PRO A 1 156 ? 49.025 -4.671  64.160 1.00 89.78  ? 154  PRO A C   1 
ATOM   1148 O  O   . PRO A 1 156 ? 48.762 -5.670  64.832 1.00 91.71  ? 154  PRO A O   1 
ATOM   1149 C  CB  . PRO A 1 156 ? 47.315 -2.876  64.731 1.00 82.05  ? 154  PRO A CB  1 
ATOM   1150 C  CG  . PRO A 1 156 ? 47.377 -1.388  64.784 1.00 79.36  ? 154  PRO A CG  1 
ATOM   1151 C  CD  . PRO A 1 156 ? 48.455 -1.083  63.764 1.00 78.94  ? 154  PRO A CD  1 
ATOM   1152 N  N   . THR A 1 157 ? 49.525 -4.748  62.929 1.00 92.31  ? 155  THR A N   1 
ATOM   1153 C  CA  . THR A 1 157 ? 49.779 -6.034  62.289 1.00 93.35  ? 155  THR A CA  1 
ATOM   1154 C  C   . THR A 1 157 ? 51.242 -6.231  61.890 1.00 94.64  ? 155  THR A C   1 
ATOM   1155 O  O   . THR A 1 157 ? 51.562 -6.021  60.704 1.00 95.71  ? 155  THR A O   1 
ATOM   1156 C  CB  . THR A 1 157 ? 48.905 -6.201  61.044 1.00 95.93  ? 155  THR A CB  1 
ATOM   1157 O  OG1 . THR A 1 157 ? 47.533 -5.974  61.392 1.00 95.25  ? 155  THR A OG1 1 
ATOM   1158 C  CG2 . THR A 1 157 ? 49.059 -7.609  60.479 1.00 97.71  ? 155  THR A CG2 1 
HETATM 1159 CA CA  . CA  B 2 .   ? 67.276 11.309  62.850 1.00 71.98  ? 1001 CA  A CA  1 
HETATM 1160 CA CA  . CA  C 2 .   ? 72.624 11.378  61.887 1.00 76.58  ? 1002 CA  A CA  1 
HETATM 1161 O  O   . HOH D 3 .   ? 59.487 13.089  71.995 0.5  32.38  ? 1003 HOH A O   1 
HETATM 1162 O  O   . HOH D 3 .   ? 72.009 13.566  61.699 1.00 70.57  ? 1004 HOH A O   1 
HETATM 1163 O  O   . HOH D 3 .   ? 73.171 10.859  59.487 1.00 88.77  ? 1005 HOH A O   1 
HETATM 1164 O  O   . HOH D 3 .   ? 75.440 11.560  62.011 1.00 75.59  ? 1006 HOH A O   1 
HETATM 1165 O  O   . HOH D 3 .   ? 72.244 11.220  64.334 1.00 91.49  ? 1007 HOH A O   1 
HETATM 1166 O  O   . HOH D 3 .   ? 67.901 12.953  65.083 1.00 48.06  ? 1008 HOH A O   1 
HETATM 1167 O  O   . HOH D 3 .   ? 65.887 9.276   63.698 1.00 60.21  ? 1009 HOH A O   1 
HETATM 1168 O  O   . HOH D 3 .   ? 69.897 10.206  63.328 1.00 67.31  ? 1010 HOH A O   1 
HETATM 1169 O  O   . HOH D 3 .   ? 68.730 22.516  61.109 1.00 24.76  ? 1011 HOH A O   1 
HETATM 1170 O  O   . HOH D 3 .   ? 65.449 13.989  68.808 1.00 26.63  ? 1012 HOH A O   1 
HETATM 1171 O  O   . HOH D 3 .   ? 72.337 16.651  56.827 1.00 29.92  ? 1013 HOH A O   1 
HETATM 1172 O  O   . HOH D 3 .   ? 66.441 26.630  62.614 1.00 31.53  ? 1014 HOH A O   1 
HETATM 1173 O  O   . HOH D 3 .   ? 68.502 24.902  62.734 1.00 36.98  ? 1015 HOH A O   1 
HETATM 1174 O  O   . HOH D 3 .   ? 83.449 18.132  46.612 1.00 40.17  ? 1016 HOH A O   1 
HETATM 1175 O  O   . HOH D 3 .   ? 48.902 12.270  68.357 1.00 37.56  ? 1017 HOH A O   1 
HETATM 1176 O  O   . HOH D 3 .   ? 60.514 9.796   66.246 1.00 42.10  ? 1018 HOH A O   1 
HETATM 1177 O  O   . HOH D 3 .   ? 63.673 12.387  70.049 1.00 40.62  ? 1019 HOH A O   1 
HETATM 1178 O  O   . HOH D 3 .   ? 68.773 14.630  55.025 1.00 44.49  ? 1020 HOH A O   1 
HETATM 1179 O  O   . HOH D 3 .   ? 72.387 21.715  61.950 1.00 45.81  ? 1021 HOH A O   1 
HETATM 1180 O  O   . HOH D 3 .   ? 70.750 26.194  61.852 1.00 47.78  ? 1022 HOH A O   1 
HETATM 1181 O  O   . HOH D 3 .   ? 69.214 15.344  58.346 1.00 44.64  ? 1023 HOH A O   1 
HETATM 1182 O  O   . HOH D 3 .   ? 68.231 15.618  45.597 1.00 51.35  ? 1024 HOH A O   1 
HETATM 1183 O  O   . HOH D 3 .   ? 65.877 8.561   66.141 1.00 49.19  ? 1025 HOH A O   1 
HETATM 1184 O  O   . HOH D 3 .   ? 70.510 28.756  59.952 1.00 52.28  ? 1026 HOH A O   1 
HETATM 1185 O  O   . HOH D 3 .   ? 71.553 25.918  54.744 1.00 48.78  ? 1027 HOH A O   1 
HETATM 1186 O  O   . HOH D 3 .   ? 78.649 24.820  42.408 1.00 54.31  ? 1028 HOH A O   1 
HETATM 1187 O  O   . HOH D 3 .   ? 69.587 29.287  57.875 1.00 75.97  ? 1029 HOH A O   1 
HETATM 1188 O  O   . HOH D 3 .   ? 59.477 10.142  71.468 1.00 49.51  ? 1030 HOH A O   1 
HETATM 1189 O  O   . HOH D 3 .   ? 83.175 22.230  47.217 1.00 50.30  ? 1031 HOH A O   1 
HETATM 1190 O  O   . HOH D 3 .   ? 78.919 14.782  48.165 1.00 56.81  ? 1032 HOH A O   1 
HETATM 1191 O  O   . HOH D 3 .   ? 80.482 24.873  58.422 1.00 56.10  ? 1033 HOH A O   1 
HETATM 1192 O  O   . HOH D 3 .   ? 46.596 3.404   63.323 1.00 49.05  ? 1034 HOH A O   1 
HETATM 1193 O  O   . HOH D 3 .   ? 71.021 13.206  56.578 1.00 53.87  ? 1035 HOH A O   1 
HETATM 1194 O  O   . HOH D 3 .   ? 64.531 0.628   59.191 1.00 53.76  ? 1036 HOH A O   1 
HETATM 1195 O  O   . HOH D 3 .   ? 65.767 28.705  61.364 1.00 55.79  ? 1037 HOH A O   1 
HETATM 1196 O  O   . HOH D 3 .   ? 82.931 21.291  43.976 1.00 50.86  ? 1038 HOH A O   1 
HETATM 1197 O  O   . HOH D 3 .   ? 42.146 5.923   74.849 1.00 56.14  ? 1039 HOH A O   1 
HETATM 1198 O  O   . HOH D 3 .   ? 44.015 -1.798  73.091 1.00 54.41  ? 1040 HOH A O   1 
HETATM 1199 O  O   . HOH D 3 .   ? 68.123 28.856  54.679 1.00 57.72  ? 1041 HOH A O   1 
HETATM 1200 O  O   . HOH D 3 .   ? 81.105 18.141  48.428 1.00 56.80  ? 1042 HOH A O   1 
HETATM 1201 O  O   . HOH D 3 .   ? 77.254 18.977  59.848 1.00 58.73  ? 1043 HOH A O   1 
HETATM 1202 O  O   . HOH D 3 .   ? 49.688 24.015  66.035 1.00 58.48  ? 1044 HOH A O   1 
HETATM 1203 O  O   . HOH D 3 .   ? 61.131 -0.177  73.930 1.00 63.91  ? 1045 HOH A O   1 
HETATM 1204 O  O   . HOH D 3 .   ? 44.718 7.587   61.043 1.00 62.64  ? 1046 HOH A O   1 
HETATM 1205 O  O   . HOH D 3 .   ? 56.171 6.057   39.797 1.00 60.14  ? 1047 HOH A O   1 
HETATM 1206 O  O   . HOH D 3 .   ? 67.424 27.102  48.156 1.00 58.16  ? 1048 HOH A O   1 
HETATM 1207 O  O   . HOH D 3 .   ? 61.932 10.425  69.353 1.00 59.60  ? 1049 HOH A O   1 
HETATM 1208 O  O   . HOH D 3 .   ? 75.683 20.625  44.332 1.00 56.33  ? 1050 HOH A O   1 
HETATM 1209 O  O   . HOH D 3 .   ? 63.179 2.024   65.134 1.00 70.86  ? 1051 HOH A O   1 
HETATM 1210 O  O   . HOH D 3 .   ? 81.943 15.813  47.090 1.00 67.86  ? 1052 HOH A O   1 
HETATM 1211 O  O   . HOH D 3 .   ? 50.517 24.662  69.204 1.00 55.57  ? 1053 HOH A O   1 
HETATM 1212 O  O   . HOH D 3 .   ? 75.250 23.310  60.490 1.00 59.17  ? 1054 HOH A O   1 
HETATM 1213 O  O   . HOH D 3 .   ? 64.556 8.969   45.941 1.00 59.44  ? 1055 HOH A O   1 
HETATM 1214 O  O   . HOH D 3 .   ? 59.248 -2.769  73.728 1.00 63.19  ? 1056 HOH A O   1 
HETATM 1215 O  O   . HOH D 3 .   ? 65.641 3.100   62.324 1.00 63.45  ? 1057 HOH A O   1 
HETATM 1216 O  O   . HOH D 3 .   ? 71.061 18.713  44.676 1.00 60.67  ? 1058 HOH A O   1 
HETATM 1217 O  O   . HOH D 3 .   ? 40.261 3.763   71.874 1.00 64.31  ? 1059 HOH A O   1 
HETATM 1218 O  O   . HOH D 3 .   ? 62.956 21.977  45.555 1.00 69.14  ? 1060 HOH A O   1 
HETATM 1219 O  O   . HOH D 3 .   ? 78.745 12.799  62.126 1.00 61.78  ? 1061 HOH A O   1 
HETATM 1220 O  O   . HOH D 3 .   ? 66.213 13.259  41.809 1.00 67.07  ? 1062 HOH A O   1 
HETATM 1221 O  O   . HOH D 3 .   ? 58.151 -9.769  76.214 1.00 66.51  ? 1063 HOH A O   1 
HETATM 1222 O  O   . HOH D 3 .   ? 77.529 27.834  46.243 1.00 62.25  ? 1064 HOH A O   1 
HETATM 1223 O  O   . HOH D 3 .   ? 50.847 9.289   44.159 1.00 64.19  ? 1065 HOH A O   1 
HETATM 1224 O  O   . HOH D 3 .   ? 68.207 29.357  60.973 1.00 69.04  ? 1066 HOH A O   1 
HETATM 1225 O  O   . HOH D 3 .   ? 44.339 24.467  60.200 1.00 65.13  ? 1067 HOH A O   1 
HETATM 1226 O  O   . HOH D 3 .   ? 64.734 -0.116  67.073 1.00 68.87  ? 1068 HOH A O   1 
HETATM 1227 O  O   . HOH D 3 .   ? 41.449 0.863   79.704 1.00 59.98  ? 1069 HOH A O   1 
HETATM 1228 O  O   . HOH D 3 .   ? 73.585 11.219  55.668 1.00 62.76  ? 1070 HOH A O   1 
HETATM 1229 O  O   . HOH D 3 .   ? 68.022 4.071   67.014 1.00 63.44  ? 1071 HOH A O   1 
HETATM 1230 O  O   . HOH D 3 .   ? 77.519 23.398  40.555 1.00 74.41  ? 1072 HOH A O   1 
HETATM 1231 O  O   . HOH D 3 .   ? 60.201 7.658   68.159 1.00 61.70  ? 1073 HOH A O   1 
HETATM 1232 O  O   . HOH D 3 .   ? 45.634 19.837  67.746 1.00 66.39  ? 1074 HOH A O   1 
HETATM 1233 O  O   . HOH D 3 .   ? 45.659 22.228  65.202 1.00 63.82  ? 1075 HOH A O   1 
HETATM 1234 O  O   . HOH D 3 .   ? 67.536 27.273  64.953 1.00 59.32  ? 1076 HOH A O   1 
HETATM 1235 O  O   . HOH D 3 .   ? 79.923 16.668  50.244 1.00 67.44  ? 1077 HOH A O   1 
HETATM 1236 O  O   . HOH D 3 .   ? 73.484 29.883  50.824 1.00 73.32  ? 1078 HOH A O   1 
HETATM 1237 O  O   . HOH D 3 .   ? 59.857 6.512   39.176 1.00 67.39  ? 1079 HOH A O   1 
HETATM 1238 O  O   . HOH D 3 .   ? 42.501 1.393   57.227 1.00 77.20  ? 1080 HOH A O   1 
HETATM 1239 O  O   . HOH D 3 .   ? 57.912 36.535  49.764 1.00 70.16  ? 1081 HOH A O   1 
HETATM 1240 O  O   . HOH D 3 .   ? 43.875 21.643  67.160 1.00 69.06  ? 1082 HOH A O   1 
HETATM 1241 O  O   . HOH D 3 .   ? 72.578 24.316  61.473 1.00 67.40  ? 1083 HOH A O   1 
HETATM 1242 O  O   . HOH D 3 .   ? 60.280 16.743  38.948 1.00 68.79  ? 1084 HOH A O   1 
HETATM 1243 O  O   . HOH D 3 .   ? 52.992 -8.820  69.165 1.00 62.87  ? 1085 HOH A O   1 
HETATM 1244 O  O   . HOH D 3 .   ? 52.324 -11.005 61.782 1.00 81.08  ? 1086 HOH A O   1 
HETATM 1245 O  O   . HOH D 3 .   ? 69.019 14.185  42.814 1.00 67.89  ? 1087 HOH A O   1 
HETATM 1246 O  O   . HOH D 3 .   ? 60.918 -1.345  58.057 1.00 65.70  ? 1088 HOH A O   1 
HETATM 1247 O  O   . HOH D 3 .   ? 51.794 6.640   56.390 1.00 64.84  ? 1089 HOH A O   1 
HETATM 1248 O  O   . HOH D 3 .   ? 80.024 23.074  43.698 1.00 73.64  ? 1090 HOH A O   1 
HETATM 1249 O  O   . HOH D 3 .   ? 77.335 25.882  60.612 1.00 67.26  ? 1091 HOH A O   1 
HETATM 1250 O  O   . HOH D 3 .   ? 41.728 2.188   67.804 1.00 62.70  ? 1092 HOH A O   1 
HETATM 1251 O  O   . HOH D 3 .   ? 44.609 19.149  58.853 1.00 67.09  ? 1093 HOH A O   1 
HETATM 1252 O  O   . HOH D 3 .   ? 43.626 3.011   79.737 1.00 65.28  ? 1094 HOH A O   1 
HETATM 1253 O  O   . HOH D 3 .   ? 63.067 -6.277  58.206 1.00 76.54  ? 1095 HOH A O   1 
HETATM 1254 O  O   . HOH D 3 .   ? 63.331 -0.735  63.595 1.00 66.20  ? 1096 HOH A O   1 
HETATM 1255 O  O   . HOH D 3 .   ? 52.955 34.717  58.307 1.00 69.67  ? 1097 HOH A O   1 
HETATM 1256 O  O   . HOH D 3 .   ? 71.271 7.725   62.588 1.00 72.84  ? 1098 HOH A O   1 
HETATM 1257 O  O   . HOH D 3 .   ? 82.697 19.998  45.945 1.00 67.07  ? 1099 HOH A O   1 
HETATM 1258 O  O   . HOH D 3 .   ? 79.523 13.075  50.320 1.00 67.31  ? 1100 HOH A O   1 
HETATM 1259 O  O   . HOH D 3 .   ? 68.118 3.711   64.346 1.00 68.91  ? 1101 HOH A O   1 
HETATM 1260 O  O   . HOH D 3 .   ? 59.441 -2.702  60.464 1.00 63.88  ? 1102 HOH A O   1 
HETATM 1261 O  O   . HOH D 3 .   ? 75.349 18.599  42.643 1.00 69.77  ? 1103 HOH A O   1 
HETATM 1262 O  O   . HOH D 3 .   ? 65.573 7.305   61.021 1.00 67.65  ? 1104 HOH A O   1 
HETATM 1263 O  O   . HOH D 3 .   ? 54.931 17.010  39.660 1.00 79.92  ? 1105 HOH A O   1 
HETATM 1264 O  O   . HOH D 3 .   ? 72.742 2.842   48.748 1.00 67.01  ? 1106 HOH A O   1 
HETATM 1265 O  O   . HOH D 3 .   ? 66.894 0.737   61.160 1.00 68.03  ? 1107 HOH A O   1 
HETATM 1266 O  O   . HOH D 3 .   ? 76.233 2.910   43.728 1.00 60.07  ? 1108 HOH A O   1 
HETATM 1267 O  O   . HOH D 3 .   ? 76.239 4.944   41.310 1.00 66.03  ? 1109 HOH A O   1 
HETATM 1268 O  O   . HOH D 3 .   ? 74.744 4.012   47.253 1.00 72.43  ? 1110 HOH A O   1 
HETATM 1269 O  O   . HOH D 3 .   ? 51.019 32.810  46.323 1.00 67.65  ? 1111 HOH A O   1 
HETATM 1270 O  O   . HOH D 3 .   ? 49.021 32.386  48.070 1.00 73.28  ? 1112 HOH A O   1 
HETATM 1271 O  O   . HOH D 3 .   ? 78.504 34.683  57.970 1.00 68.74  ? 1113 HOH A O   1 
HETATM 1272 O  O   . HOH D 3 .   ? 77.628 30.030  56.257 1.00 76.93  ? 1114 HOH A O   1 
HETATM 1273 O  O   . HOH D 3 .   ? 54.264 10.460  44.678 1.00 65.99  ? 1115 HOH A O   1 
HETATM 1274 O  O   . HOH D 3 .   ? 72.516 30.242  61.239 1.00 82.93  ? 1116 HOH A O   1 
HETATM 1275 O  O   . HOH D 3 .   ? 47.467 19.157  57.173 1.00 74.67  ? 1117 HOH A O   1 
HETATM 1276 O  O   . HOH D 3 .   ? 61.048 8.652   41.377 1.00 76.74  ? 1118 HOH A O   1 
HETATM 1277 O  O   . HOH D 3 .   ? 52.548 -12.087 68.390 1.00 66.01  ? 1119 HOH A O   1 
HETATM 1278 O  O   . HOH D 3 .   ? 65.830 1.324   56.260 1.00 67.24  ? 1120 HOH A O   1 
HETATM 1279 O  O   . HOH D 3 .   ? 52.782 1.351   54.910 1.00 76.79  ? 1121 HOH A O   1 
HETATM 1280 O  O   . HOH D 3 .   ? 42.945 5.639   59.765 1.00 77.02  ? 1122 HOH A O   1 
HETATM 1281 O  O   . HOH D 3 .   ? 65.670 6.734   63.450 1.00 73.24  ? 1123 HOH A O   1 
HETATM 1282 O  O   . HOH D 3 .   ? 61.642 -4.928  60.495 1.00 75.05  ? 1124 HOH A O   1 
HETATM 1283 O  O   . HOH D 3 .   ? 52.577 7.508   43.061 1.00 72.33  ? 1125 HOH A O   1 
HETATM 1284 O  O   . HOH D 3 .   ? 48.421 25.740  58.129 1.00 78.66  ? 1126 HOH A O   1 
HETATM 1285 O  O   . HOH D 3 .   ? 77.479 21.658  59.876 1.00 70.19  ? 1127 HOH A O   1 
HETATM 1286 O  O   . HOH D 3 .   ? 64.026 -4.270  61.089 1.00 72.24  ? 1128 HOH A O   1 
HETATM 1287 O  O   . HOH D 3 .   ? 74.547 29.108  48.284 1.00 81.33  ? 1129 HOH A O   1 
HETATM 1288 O  O   . HOH D 3 .   ? 54.201 31.638  58.210 1.00 78.03  ? 1130 HOH A O   1 
HETATM 1289 O  O   . HOH D 3 .   ? 44.786 1.103   80.273 1.00 76.90  ? 1131 HOH A O   1 
HETATM 1290 O  O   . HOH D 3 .   ? 46.431 24.656  64.385 1.00 77.83  ? 1132 HOH A O   1 
HETATM 1291 O  O   . HOH D 3 .   ? 51.086 -8.408  71.487 1.00 75.12  ? 1133 HOH A O   1 
HETATM 1292 O  O   . HOH D 3 .   ? 65.626 22.233  46.448 1.00 73.29  ? 1134 HOH A O   1 
HETATM 1293 O  O   . HOH D 3 .   ? 55.236 36.384  58.120 1.00 79.51  ? 1135 HOH A O   1 
HETATM 1294 O  O   . HOH D 3 .   ? 62.041 28.426  49.226 1.00 81.00  ? 1136 HOH A O   1 
HETATM 1295 O  O   . HOH D 3 .   ? 63.225 35.410  51.851 1.00 74.55  ? 1137 HOH A O   1 
HETATM 1296 O  O   . HOH D 3 .   ? 51.724 -5.456  69.815 1.00 82.75  ? 1138 HOH A O   1 
HETATM 1297 O  O   . HOH D 3 .   ? 59.811 -9.527  68.281 1.00 72.50  ? 1139 HOH A O   1 
HETATM 1298 O  O   . HOH D 3 .   ? 54.436 36.912  55.732 1.00 83.07  ? 1140 HOH A O   1 
HETATM 1299 O  O   . HOH D 3 .   ? 59.524 27.965  48.512 1.00 86.37  ? 1141 HOH A O   1 
HETATM 1300 O  O   . HOH D 3 .   ? 61.854 7.844   70.943 1.00 85.75  ? 1142 HOH A O   1 
HETATM 1301 O  O   . HOH D 3 .   ? 63.614 27.259  44.957 1.00 73.83  ? 1143 HOH A O   1 
HETATM 1302 O  O   . HOH D 3 .   ? 55.206 1.589   52.240 1.00 87.53  ? 1144 HOH A O   1 
HETATM 1303 O  O   . HOH D 3 .   ? 50.861 30.703  52.928 1.00 82.00  ? 1145 HOH A O   1 
HETATM 1304 O  O   . HOH D 3 .   ? 61.535 35.308  49.397 1.00 81.51  ? 1146 HOH A O   1 
HETATM 1305 O  O   . HOH D 3 .   ? 58.596 -7.733  66.215 1.00 79.40  ? 1147 HOH A O   1 
HETATM 1306 O  O   . HOH D 3 .   ? 50.191 28.916  46.886 1.00 75.94  ? 1148 HOH A O   1 
HETATM 1307 O  O   . HOH D 3 .   ? 57.185 37.827  53.409 1.00 81.42  ? 1149 HOH A O   1 
HETATM 1308 O  O   . HOH D 3 .   ? 76.857 32.080  57.540 1.00 82.27  ? 1150 HOH A O   1 
HETATM 1309 O  O   . HOH D 3 .   ? 65.874 30.679  50.365 1.00 85.35  ? 1151 HOH A O   1 
HETATM 1310 O  O   . HOH D 3 .   ? 63.565 9.071   41.901 1.00 88.07  ? 1152 HOH A O   1 
HETATM 1311 O  O   . HOH D 3 .   ? 68.288 32.579  61.972 1.00 74.40  ? 1153 HOH A O   1 
HETATM 1312 O  O   . HOH D 3 .   ? 66.100 25.056  43.013 1.00 75.43  ? 1154 HOH A O   1 
HETATM 1313 O  O   . HOH D 3 .   ? 56.630 -8.171  68.130 1.00 89.22  ? 1155 HOH A O   1 
HETATM 1314 O  O   . HOH D 3 .   ? 44.840 -2.916  70.836 1.00 84.08  ? 1156 HOH A O   1 
HETATM 1315 O  O   . HOH D 3 .   ? 76.936 7.285   51.755 1.00 85.53  ? 1157 HOH A O   1 
HETATM 1316 O  O   . HOH D 3 .   ? 49.481 31.620  50.788 1.00 83.52  ? 1158 HOH A O   1 
HETATM 1317 O  O   . HOH D 3 .   ? 46.889 22.821  56.692 1.00 77.21  ? 1159 HOH A O   1 
HETATM 1318 O  O   . HOH D 3 .   ? 41.527 4.458   66.847 1.00 77.00  ? 1160 HOH A O   1 
HETATM 1319 O  O   . HOH D 3 .   ? 71.923 27.326  48.405 1.00 70.73  ? 1161 HOH A O   1 
HETATM 1320 O  O   . HOH D 3 .   ? 45.335 21.578  54.772 1.00 83.39  ? 1162 HOH A O   1 
HETATM 1321 O  O   . HOH D 3 .   ? 67.466 12.417  67.656 1.00 50.70  ? 1163 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -1  ?   ?   ?   A . n 
A 1 2   ALA 2   0   ?   ?   ?   A . n 
A 1 3   MET 3   1   ?   ?   ?   A . n 
A 1 4   ILE 4   2   2   ILE ILE A . n 
A 1 5   ARG 5   3   3   ARG ARG A . n 
A 1 6   SER 6   4   4   SER SER A . n 
A 1 7   ARG 7   5   5   ARG ARG A . n 
A 1 8   GLN 8   6   6   GLN GLN A . n 
A 1 9   PRO 9   7   7   PRO PRO A . n 
A 1 10  LEU 10  8   8   LEU LEU A . n 
A 1 11  LEU 11  9   9   LEU LEU A . n 
A 1 12  ASP 12  10  10  ASP ASP A . n 
A 1 13  ALA 13  11  11  ALA ALA A . n 
A 1 14  LEU 14  12  12  LEU LEU A . n 
A 1 15  GLY 15  13  13  GLY GLY A . n 
A 1 16  VAL 16  14  14  VAL VAL A . n 
A 1 17  ASP 17  15  15  ASP ASP A . n 
A 1 18  LEU 18  16  16  LEU LEU A . n 
A 1 19  PRO 19  17  17  PRO PRO A . n 
A 1 20  ASP 20  18  18  ASP ASP A . n 
A 1 21  GLU 21  19  19  GLU GLU A . n 
A 1 22  LEU 22  20  20  LEU LEU A . n 
A 1 23  LEU 23  21  21  LEU LEU A . n 
A 1 24  SER 24  22  22  SER SER A . n 
A 1 25  LEU 25  23  23  LEU LEU A . n 
A 1 26  ALA 26  24  24  ALA ALA A . n 
A 1 27  LEU 27  25  25  LEU LEU A . n 
A 1 28  THR 28  26  26  THR THR A . n 
A 1 29  HIS 29  27  27  HIS HIS A . n 
A 1 30  ARG 30  28  28  ARG ARG A . n 
A 1 31  SER 31  29  29  SER SER A . n 
A 1 32  TYR 32  30  30  TYR TYR A . n 
A 1 33  ALA 33  31  31  ALA ALA A . n 
A 1 34  TYR 34  32  32  TYR TYR A . n 
A 1 35  GLU 35  33  33  GLU GLU A . n 
A 1 36  ASN 36  34  34  ASN ASN A . n 
A 1 37  GLY 37  35  35  GLY GLY A . n 
A 1 38  GLY 38  36  36  GLY GLY A . n 
A 1 39  LEU 39  37  37  LEU LEU A . n 
A 1 40  PRO 40  38  38  PRO PRO A . n 
A 1 41  THR 41  39  39  THR THR A . n 
A 1 42  ASN 42  40  40  ASN ASN A . n 
A 1 43  GLU 43  41  41  GLU GLU A . n 
A 1 44  ARG 44  42  42  ARG ARG A . n 
A 1 45  LEU 45  43  43  LEU LEU A . n 
A 1 46  GLU 46  44  44  GLU GLU A . n 
A 1 47  PHE 47  45  45  PHE PHE A . n 
A 1 48  LEU 48  46  46  LEU LEU A . n 
A 1 49  GLY 49  47  47  GLY GLY A . n 
A 1 50  ASP 50  48  48  ASP ASP A . n 
A 1 51  ALA 51  49  49  ALA ALA A . n 
A 1 52  VAL 52  50  50  VAL VAL A . n 
A 1 53  LEU 53  51  51  LEU LEU A . n 
A 1 54  GLY 54  52  52  GLY GLY A . n 
A 1 55  LEU 55  53  53  LEU LEU A . n 
A 1 56  THR 56  54  54  THR THR A . n 
A 1 57  ILE 57  55  55  ILE ILE A . n 
A 1 58  THR 58  56  56  THR THR A . n 
A 1 59  ASP 59  57  57  ASP ASP A . n 
A 1 60  ALA 60  58  58  ALA ALA A . n 
A 1 61  LEU 61  59  59  LEU LEU A . n 
A 1 62  PHE 62  60  60  PHE PHE A . n 
A 1 63  HIS 63  61  61  HIS HIS A . n 
A 1 64  ARG 64  62  62  ARG ARG A . n 
A 1 65  HIS 65  63  63  HIS HIS A . n 
A 1 66  PRO 66  64  64  PRO PRO A . n 
A 1 67  ASP 67  65  65  ASP ASP A . n 
A 1 68  ARG 68  66  66  ARG ARG A . n 
A 1 69  SER 69  67  67  SER SER A . n 
A 1 70  GLU 70  68  68  GLU GLU A . n 
A 1 71  GLY 71  69  69  GLY GLY A . n 
A 1 72  ASP 72  70  70  ASP ASP A . n 
A 1 73  LEU 73  71  71  LEU LEU A . n 
A 1 74  ALA 74  72  72  ALA ALA A . n 
A 1 75  LYS 75  73  73  LYS LYS A . n 
A 1 76  LEU 76  74  74  LEU LEU A . n 
A 1 77  ARG 77  75  75  ARG ARG A . n 
A 1 78  ALA 78  76  76  ALA ALA A . n 
A 1 79  SER 79  77  77  SER SER A . n 
A 1 80  VAL 80  78  78  VAL VAL A . n 
A 1 81  VAL 81  79  79  VAL VAL A . n 
A 1 82  ASN 82  80  80  ASN ASN A . n 
A 1 83  THR 83  81  81  THR THR A . n 
A 1 84  GLN 84  82  82  GLN GLN A . n 
A 1 85  ALA 85  83  83  ALA ALA A . n 
A 1 86  LEU 86  84  84  LEU LEU A . n 
A 1 87  ALA 87  85  85  ALA ALA A . n 
A 1 88  ASP 88  86  86  ASP ASP A . n 
A 1 89  VAL 89  87  87  VAL VAL A . n 
A 1 90  ALA 90  88  88  ALA ALA A . n 
A 1 91  ARG 91  89  89  ARG ARG A . n 
A 1 92  ARG 92  90  90  ARG ARG A . n 
A 1 93  LEU 93  91  91  LEU LEU A . n 
A 1 94  CYS 94  92  92  CYS CYS A . n 
A 1 95  ALA 95  93  93  ALA ALA A . n 
A 1 96  GLU 96  94  94  GLU GLU A . n 
A 1 97  GLY 97  95  95  GLY GLY A . n 
A 1 98  LEU 98  96  96  LEU LEU A . n 
A 1 99  GLY 99  97  97  GLY GLY A . n 
A 1 100 VAL 100 98  98  VAL VAL A . n 
A 1 101 HIS 101 99  99  HIS HIS A . n 
A 1 102 VAL 102 100 100 VAL VAL A . n 
A 1 103 LEU 103 101 101 LEU LEU A . n 
A 1 104 LEU 104 102 102 LEU LEU A . n 
A 1 105 GLY 105 103 103 GLY GLY A . n 
A 1 106 ARG 106 104 104 ARG ARG A . n 
A 1 107 GLY 107 105 105 GLY GLY A . n 
A 1 108 GLU 108 106 106 GLU GLU A . n 
A 1 109 ALA 109 107 107 ALA ALA A . n 
A 1 110 ASN 110 108 108 ASN ASN A . n 
A 1 111 THR 111 109 109 THR THR A . n 
A 1 112 GLY 112 110 110 GLY GLY A . n 
A 1 113 GLY 113 111 111 GLY GLY A . n 
A 1 114 ALA 114 112 112 ALA ALA A . n 
A 1 115 ASP 115 113 113 ASP ASP A . n 
A 1 116 LYS 116 114 114 LYS LYS A . n 
A 1 117 SER 117 115 115 SER SER A . n 
A 1 118 SER 118 116 116 SER SER A . n 
A 1 119 ILE 119 117 117 ILE ILE A . n 
A 1 120 LEU 120 118 118 LEU LEU A . n 
A 1 121 ALA 121 119 119 ALA ALA A . n 
A 1 122 ASP 122 120 120 ASP ASP A . n 
A 1 123 GLY 123 121 121 GLY GLY A . n 
A 1 124 MET 124 122 122 MET MET A . n 
A 1 125 GLU 125 123 123 GLU GLU A . n 
A 1 126 SER 126 124 124 SER SER A . n 
A 1 127 LEU 127 125 125 LEU LEU A . n 
A 1 128 LEU 128 126 126 LEU LEU A . n 
A 1 129 GLY 129 127 127 GLY GLY A . n 
A 1 130 ALA 130 128 128 ALA ALA A . n 
A 1 131 ILE 131 129 129 ILE ILE A . n 
A 1 132 TYR 132 130 130 TYR TYR A . n 
A 1 133 LEU 133 131 131 LEU LEU A . n 
A 1 134 GLN 134 132 132 GLN GLN A . n 
A 1 135 HIS 135 133 133 HIS HIS A . n 
A 1 136 GLY 136 134 134 GLY GLY A . n 
A 1 137 MET 137 135 135 MET MET A . n 
A 1 138 GLU 138 136 136 GLU GLU A . n 
A 1 139 LYS 139 137 137 LYS LYS A . n 
A 1 140 ALA 140 138 138 ALA ALA A . n 
A 1 141 ARG 141 139 139 ARG ARG A . n 
A 1 142 GLU 142 140 140 GLU GLU A . n 
A 1 143 VAL 143 141 141 VAL VAL A . n 
A 1 144 ILE 144 142 142 ILE ILE A . n 
A 1 145 LEU 145 143 143 LEU LEU A . n 
A 1 146 ARG 146 144 144 ARG ARG A . n 
A 1 147 LEU 147 145 145 LEU LEU A . n 
A 1 148 PHE 148 146 146 PHE PHE A . n 
A 1 149 GLY 149 147 147 GLY GLY A . n 
A 1 150 PRO 150 148 148 PRO PRO A . n 
A 1 151 LEU 151 149 149 LEU LEU A . n 
A 1 152 LEU 152 150 150 LEU LEU A . n 
A 1 153 ASP 153 151 151 ASP ASP A . n 
A 1 154 ALA 154 152 152 ALA ALA A . n 
A 1 155 ALA 155 153 153 ALA ALA A . n 
A 1 156 PRO 156 154 154 PRO PRO A . n 
A 1 157 THR 157 155 155 THR THR A . n 
A 1 158 LEU 158 156 ?   ?   ?   A . n 
A 1 159 GLY 159 157 ?   ?   ?   A . n 
A 1 160 ALA 160 158 ?   ?   ?   A . n 
A 1 161 GLY 161 159 ?   ?   ?   A . n 
A 1 162 LEU 162 160 ?   ?   ?   A . n 
A 1 163 ASP 163 161 ?   ?   ?   A . n 
A 1 164 TRP 164 162 ?   ?   ?   A . n 
A 1 165 LYS 165 163 ?   ?   ?   A . n 
A 1 166 THR 166 164 ?   ?   ?   A . n 
A 1 167 SER 167 165 ?   ?   ?   A . n 
A 1 168 LEU 168 166 ?   ?   ?   A . n 
A 1 169 GLN 169 167 ?   ?   ?   A . n 
A 1 170 GLU 170 168 ?   ?   ?   A . n 
A 1 171 LEU 171 169 ?   ?   ?   A . n 
A 1 172 THR 172 170 ?   ?   ?   A . n 
A 1 173 ALA 173 171 ?   ?   ?   A . n 
A 1 174 ALA 174 172 ?   ?   ?   A . n 
A 1 175 ARG 175 173 ?   ?   ?   A . n 
A 1 176 GLY 176 174 ?   ?   ?   A . n 
A 1 177 LEU 177 175 ?   ?   ?   A . n 
A 1 178 GLY 178 176 ?   ?   ?   A . n 
A 1 179 ALA 179 177 ?   ?   ?   A . n 
A 1 180 PRO 180 178 ?   ?   ?   A . n 
A 1 181 SER 181 179 ?   ?   ?   A . n 
A 1 182 TYR 182 180 ?   ?   ?   A . n 
A 1 183 LEU 183 181 ?   ?   ?   A . n 
A 1 184 VAL 184 182 ?   ?   ?   A . n 
A 1 185 THR 185 183 ?   ?   ?   A . n 
A 1 186 SER 186 184 ?   ?   ?   A . n 
A 1 187 THR 187 185 ?   ?   ?   A . n 
A 1 188 GLY 188 186 ?   ?   ?   A . n 
A 1 189 PRO 189 187 ?   ?   ?   A . n 
A 1 190 ASP 190 188 ?   ?   ?   A . n 
A 1 191 HIS 191 189 ?   ?   ?   A . n 
A 1 192 ASP 192 190 ?   ?   ?   A . n 
A 1 193 LYS 193 191 ?   ?   ?   A . n 
A 1 194 GLU 194 192 ?   ?   ?   A . n 
A 1 195 PHE 195 193 ?   ?   ?   A . n 
A 1 196 THR 196 194 ?   ?   ?   A . n 
A 1 197 ALA 197 195 ?   ?   ?   A . n 
A 1 198 VAL 198 196 ?   ?   ?   A . n 
A 1 199 VAL 199 197 ?   ?   ?   A . n 
A 1 200 VAL 200 198 ?   ?   ?   A . n 
A 1 201 VAL 201 199 ?   ?   ?   A . n 
A 1 202 MET 202 200 ?   ?   ?   A . n 
A 1 203 ASP 203 201 ?   ?   ?   A . n 
A 1 204 SER 204 202 ?   ?   ?   A . n 
A 1 205 GLU 205 203 ?   ?   ?   A . n 
A 1 206 TYR 206 204 ?   ?   ?   A . n 
A 1 207 GLY 207 205 ?   ?   ?   A . n 
A 1 208 SER 208 206 ?   ?   ?   A . n 
A 1 209 GLY 209 207 ?   ?   ?   A . n 
A 1 210 VAL 210 208 ?   ?   ?   A . n 
A 1 211 GLY 211 209 ?   ?   ?   A . n 
A 1 212 ARG 212 210 ?   ?   ?   A . n 
A 1 213 SER 213 211 ?   ?   ?   A . n 
A 1 214 LYS 214 212 ?   ?   ?   A . n 
A 1 215 LYS 215 213 ?   ?   ?   A . n 
A 1 216 GLU 216 214 ?   ?   ?   A . n 
A 1 217 ALA 217 215 ?   ?   ?   A . n 
A 1 218 GLU 218 216 ?   ?   ?   A . n 
A 1 219 GLN 219 217 ?   ?   ?   A . n 
A 1 220 LYS 220 218 ?   ?   ?   A . n 
A 1 221 ALA 221 219 ?   ?   ?   A . n 
A 1 222 ALA 222 220 ?   ?   ?   A . n 
A 1 223 ALA 223 221 ?   ?   ?   A . n 
A 1 224 ALA 224 222 ?   ?   ?   A . n 
A 1 225 ALA 225 223 ?   ?   ?   A . n 
A 1 226 TRP 226 224 ?   ?   ?   A . n 
A 1 227 LYS 227 225 ?   ?   ?   A . n 
A 1 228 ALA 228 226 ?   ?   ?   A . n 
A 1 229 LEU 229 227 ?   ?   ?   A . n 
A 1 230 GLU 230 228 ?   ?   ?   A . n 
A 1 231 VAL 231 229 ?   ?   ?   A . n 
A 1 232 LEU 232 230 ?   ?   ?   A . n 
A 1 233 ASP 233 231 ?   ?   ?   A . n 
A 1 234 ASN 234 232 ?   ?   ?   A . n 
A 1 235 ALA 235 233 ?   ?   ?   A . n 
A 1 236 MET 236 234 ?   ?   ?   A . n 
A 1 237 PRO 237 235 ?   ?   ?   A . n 
A 1 238 GLY 238 236 ?   ?   ?   A . n 
A 1 239 LYS 239 237 ?   ?   ?   A . n 
A 1 240 THR 240 238 ?   ?   ?   A . n 
A 1 241 SER 241 239 ?   ?   ?   A . n 
A 1 242 ALA 242 240 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Mycobacterium Tuberculosis Structural Proteomics Project' 
_pdbx_SG_project.initial_of_center     XMTB 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CA  1   1001 1001 CA  CA  A . 
C 2 CA  1   1002 1002 CA  CA  A . 
D 3 HOH 1   1003 1    HOH HOH A . 
D 3 HOH 2   1004 2    HOH HOH A . 
D 3 HOH 3   1005 3    HOH HOH A . 
D 3 HOH 4   1006 4    HOH HOH A . 
D 3 HOH 5   1007 5    HOH HOH A . 
D 3 HOH 6   1008 6    HOH HOH A . 
D 3 HOH 7   1009 7    HOH HOH A . 
D 3 HOH 8   1010 8    HOH HOH A . 
D 3 HOH 9   1011 9    HOH HOH A . 
D 3 HOH 10  1012 10   HOH HOH A . 
D 3 HOH 11  1013 11   HOH HOH A . 
D 3 HOH 12  1014 12   HOH HOH A . 
D 3 HOH 13  1015 13   HOH HOH A . 
D 3 HOH 14  1016 14   HOH HOH A . 
D 3 HOH 15  1017 15   HOH HOH A . 
D 3 HOH 16  1018 16   HOH HOH A . 
D 3 HOH 17  1019 17   HOH HOH A . 
D 3 HOH 18  1020 18   HOH HOH A . 
D 3 HOH 19  1021 19   HOH HOH A . 
D 3 HOH 20  1022 20   HOH HOH A . 
D 3 HOH 21  1023 21   HOH HOH A . 
D 3 HOH 22  1024 22   HOH HOH A . 
D 3 HOH 23  1025 23   HOH HOH A . 
D 3 HOH 24  1026 24   HOH HOH A . 
D 3 HOH 25  1027 25   HOH HOH A . 
D 3 HOH 26  1028 26   HOH HOH A . 
D 3 HOH 27  1029 27   HOH HOH A . 
D 3 HOH 28  1030 28   HOH HOH A . 
D 3 HOH 29  1031 29   HOH HOH A . 
D 3 HOH 30  1032 30   HOH HOH A . 
D 3 HOH 31  1033 31   HOH HOH A . 
D 3 HOH 32  1034 32   HOH HOH A . 
D 3 HOH 33  1035 33   HOH HOH A . 
D 3 HOH 34  1036 34   HOH HOH A . 
D 3 HOH 35  1037 35   HOH HOH A . 
D 3 HOH 36  1038 36   HOH HOH A . 
D 3 HOH 37  1039 37   HOH HOH A . 
D 3 HOH 38  1040 38   HOH HOH A . 
D 3 HOH 39  1041 39   HOH HOH A . 
D 3 HOH 40  1042 40   HOH HOH A . 
D 3 HOH 41  1043 41   HOH HOH A . 
D 3 HOH 42  1044 42   HOH HOH A . 
D 3 HOH 43  1045 43   HOH HOH A . 
D 3 HOH 44  1046 44   HOH HOH A . 
D 3 HOH 45  1047 45   HOH HOH A . 
D 3 HOH 46  1048 46   HOH HOH A . 
D 3 HOH 47  1049 47   HOH HOH A . 
D 3 HOH 48  1050 48   HOH HOH A . 
D 3 HOH 49  1051 49   HOH HOH A . 
D 3 HOH 50  1052 50   HOH HOH A . 
D 3 HOH 51  1053 51   HOH HOH A . 
D 3 HOH 52  1054 52   HOH HOH A . 
D 3 HOH 53  1055 53   HOH HOH A . 
D 3 HOH 54  1056 54   HOH HOH A . 
D 3 HOH 55  1057 55   HOH HOH A . 
D 3 HOH 56  1058 56   HOH HOH A . 
D 3 HOH 57  1059 57   HOH HOH A . 
D 3 HOH 58  1060 58   HOH HOH A . 
D 3 HOH 59  1061 59   HOH HOH A . 
D 3 HOH 60  1062 60   HOH HOH A . 
D 3 HOH 61  1063 61   HOH HOH A . 
D 3 HOH 62  1064 62   HOH HOH A . 
D 3 HOH 63  1065 63   HOH HOH A . 
D 3 HOH 64  1066 64   HOH HOH A . 
D 3 HOH 65  1067 65   HOH HOH A . 
D 3 HOH 66  1068 66   HOH HOH A . 
D 3 HOH 67  1069 67   HOH HOH A . 
D 3 HOH 68  1070 68   HOH HOH A . 
D 3 HOH 69  1071 69   HOH HOH A . 
D 3 HOH 70  1072 70   HOH HOH A . 
D 3 HOH 71  1073 71   HOH HOH A . 
D 3 HOH 72  1074 72   HOH HOH A . 
D 3 HOH 73  1075 73   HOH HOH A . 
D 3 HOH 74  1076 74   HOH HOH A . 
D 3 HOH 75  1077 75   HOH HOH A . 
D 3 HOH 76  1078 76   HOH HOH A . 
D 3 HOH 77  1079 77   HOH HOH A . 
D 3 HOH 78  1080 78   HOH HOH A . 
D 3 HOH 79  1081 79   HOH HOH A . 
D 3 HOH 80  1082 80   HOH HOH A . 
D 3 HOH 81  1083 81   HOH HOH A . 
D 3 HOH 82  1084 82   HOH HOH A . 
D 3 HOH 83  1085 83   HOH HOH A . 
D 3 HOH 84  1086 84   HOH HOH A . 
D 3 HOH 85  1087 85   HOH HOH A . 
D 3 HOH 86  1088 86   HOH HOH A . 
D 3 HOH 87  1089 87   HOH HOH A . 
D 3 HOH 88  1090 88   HOH HOH A . 
D 3 HOH 89  1091 89   HOH HOH A . 
D 3 HOH 90  1092 90   HOH HOH A . 
D 3 HOH 91  1093 91   HOH HOH A . 
D 3 HOH 92  1094 92   HOH HOH A . 
D 3 HOH 93  1095 93   HOH HOH A . 
D 3 HOH 94  1096 94   HOH HOH A . 
D 3 HOH 95  1097 95   HOH HOH A . 
D 3 HOH 96  1098 96   HOH HOH A . 
D 3 HOH 97  1099 97   HOH HOH A . 
D 3 HOH 98  1100 98   HOH HOH A . 
D 3 HOH 99  1101 99   HOH HOH A . 
D 3 HOH 100 1102 100  HOH HOH A . 
D 3 HOH 101 1103 101  HOH HOH A . 
D 3 HOH 102 1104 102  HOH HOH A . 
D 3 HOH 103 1105 103  HOH HOH A . 
D 3 HOH 104 1106 104  HOH HOH A . 
D 3 HOH 105 1107 105  HOH HOH A . 
D 3 HOH 106 1108 106  HOH HOH A . 
D 3 HOH 107 1109 107  HOH HOH A . 
D 3 HOH 108 1110 108  HOH HOH A . 
D 3 HOH 109 1111 109  HOH HOH A . 
D 3 HOH 110 1112 110  HOH HOH A . 
D 3 HOH 111 1113 111  HOH HOH A . 
D 3 HOH 112 1114 112  HOH HOH A . 
D 3 HOH 113 1115 113  HOH HOH A . 
D 3 HOH 114 1116 114  HOH HOH A . 
D 3 HOH 115 1117 115  HOH HOH A . 
D 3 HOH 116 1118 116  HOH HOH A . 
D 3 HOH 117 1119 117  HOH HOH A . 
D 3 HOH 118 1120 118  HOH HOH A . 
D 3 HOH 119 1121 119  HOH HOH A . 
D 3 HOH 120 1122 120  HOH HOH A . 
D 3 HOH 121 1123 121  HOH HOH A . 
D 3 HOH 122 1124 122  HOH HOH A . 
D 3 HOH 123 1125 123  HOH HOH A . 
D 3 HOH 124 1126 124  HOH HOH A . 
D 3 HOH 125 1127 125  HOH HOH A . 
D 3 HOH 126 1128 126  HOH HOH A . 
D 3 HOH 127 1129 127  HOH HOH A . 
D 3 HOH 128 1130 128  HOH HOH A . 
D 3 HOH 129 1131 129  HOH HOH A . 
D 3 HOH 130 1132 130  HOH HOH A . 
D 3 HOH 131 1133 131  HOH HOH A . 
D 3 HOH 132 1134 132  HOH HOH A . 
D 3 HOH 133 1135 133  HOH HOH A . 
D 3 HOH 134 1136 134  HOH HOH A . 
D 3 HOH 135 1137 135  HOH HOH A . 
D 3 HOH 136 1138 136  HOH HOH A . 
D 3 HOH 137 1139 137  HOH HOH A . 
D 3 HOH 138 1140 138  HOH HOH A . 
D 3 HOH 139 1141 139  HOH HOH A . 
D 3 HOH 140 1142 140  HOH HOH A . 
D 3 HOH 141 1143 141  HOH HOH A . 
D 3 HOH 142 1144 142  HOH HOH A . 
D 3 HOH 143 1145 143  HOH HOH A . 
D 3 HOH 144 1146 144  HOH HOH A . 
D 3 HOH 145 1147 145  HOH HOH A . 
D 3 HOH 146 1148 146  HOH HOH A . 
D 3 HOH 147 1149 147  HOH HOH A . 
D 3 HOH 148 1150 148  HOH HOH A . 
D 3 HOH 149 1151 149  HOH HOH A . 
D 3 HOH 150 1152 150  HOH HOH A . 
D 3 HOH 151 1153 151  HOH HOH A . 
D 3 HOH 152 1154 152  HOH HOH A . 
D 3 HOH 153 1155 153  HOH HOH A . 
D 3 HOH 154 1156 154  HOH HOH A . 
D 3 HOH 155 1157 155  HOH HOH A . 
D 3 HOH 156 1158 156  HOH HOH A . 
D 3 HOH 157 1159 157  HOH HOH A . 
D 3 HOH 158 1160 158  HOH HOH A . 
D 3 HOH 159 1161 159  HOH HOH A . 
D 3 HOH 160 1162 160  HOH HOH A . 
D 3 HOH 161 1163 161  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA,PQS 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2650  ? 
1 MORE         -44   ? 
1 'SSA (A^2)'  13760 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z            1.0000000000 0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 8_666 -y+1,-x+1,-z+3/2 0.0000000000 -1.0000000000 0.0000000000 72.5890000000 -1.0000000000 
0.0000000000 0.0000000000 72.5890000000 0.0000000000 0.0000000000 -1.0000000000 144.0195000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     1003 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OE2 ? A GLU 46  ? A GLU 44   ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 OE1 ? A GLU 125 ? A GLU 123  ? 1_555 117.3 ? 
2  OE2 ? A GLU 46  ? A GLU 44   ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1008 ? 1_555 70.2  ? 
3  OE1 ? A GLU 125 ? A GLU 123  ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1008 ? 1_555 112.0 ? 
4  OE2 ? A GLU 46  ? A GLU 44   ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1009 ? 1_555 170.5 ? 
5  OE1 ? A GLU 125 ? A GLU 123  ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1009 ? 1_555 72.1  ? 
6  O   ? D HOH .   ? A HOH 1008 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1009 ? 1_555 108.2 ? 
7  OE2 ? A GLU 46  ? A GLU 44   ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 73.0  ? 
8  OE1 ? A GLU 125 ? A GLU 123  ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 163.0 ? 
9  O   ? D HOH .   ? A HOH 1008 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 83.8  ? 
10 O   ? D HOH .   ? A HOH 1009 ? 1_555 CA ? B CA . ? A CA 1001 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 97.6  ? 
11 O   ? D HOH .   ? A HOH 1004 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1005 ? 1_555 100.2 ? 
12 O   ? D HOH .   ? A HOH 1004 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1006 ? 1_555 102.2 ? 
13 O   ? D HOH .   ? A HOH 1005 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1006 ? 1_555 80.7  ? 
14 O   ? D HOH .   ? A HOH 1004 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1007 ? 1_555 95.8  ? 
15 O   ? D HOH .   ? A HOH 1005 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1007 ? 1_555 163.9 ? 
16 O   ? D HOH .   ? A HOH 1006 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1007 ? 1_555 96.5  ? 
17 O   ? D HOH .   ? A HOH 1004 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 98.9  ? 
18 O   ? D HOH .   ? A HOH 1005 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 121.5 ? 
19 O   ? D HOH .   ? A HOH 1006 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 145.9 ? 
20 O   ? D HOH .   ? A HOH 1007 ? 1_555 CA ? C CA . ? A CA 1002 ? 1_555 O   ? D HOH .   ? A HOH 1010 ? 1_555 54.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-05 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-11-16 
5 'Structure model' 1 4 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Derived calculations'      
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Atomic model'              
5 5 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    5 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 5 'Structure model' '_software.classification' 
2 5 'Structure model' '_software.name'           
# 
loop_
_diffrn_reflns.diffrn_id 
_diffrn_reflns.pdbx_d_res_low 
_diffrn_reflns.pdbx_d_res_high 
_diffrn_reflns.number 
_diffrn_reflns.pdbx_percent_possible_obs 
_diffrn_reflns.pdbx_Rmerge_I_obs 
_diffrn_reflns.pdbx_chi_squared 
_diffrn_reflns.pdbx_redundancy 
_diffrn_reflns.pdbx_rejects 
_diffrn_reflns.pdbx_number_obs 
_diffrn_reflns.av_sigmaI_over_netI 
_diffrn_reflns.pdbx_Rsym_value 
1 30.00 2.50 16673 97.300 0.048 1.014 ? ? ? ? ? 
2 30.00 2.50 16477 96.100 0.047 1.028 ? ? ? ? ? 
# 
loop_
_pdbx_diffrn_reflns_shell.diffrn_id 
_pdbx_diffrn_reflns_shell.d_res_low 
_pdbx_diffrn_reflns_shell.d_res_high 
_pdbx_diffrn_reflns_shell.percent_possible_obs 
_pdbx_diffrn_reflns_shell.Rmerge_I_obs 
_pdbx_diffrn_reflns_shell.chi_squared 
_pdbx_diffrn_reflns_shell.redundancy 
_pdbx_diffrn_reflns_shell.rejects 
_pdbx_diffrn_reflns_shell.number_obs 
_pdbx_diffrn_reflns_shell.Rsym_value 
1 30.00 5.38 90.500 0.037 0.917 ? ? ? ? 
1 5.38  4.27 97.400 0.041 0.913 ? ? ? ? 
1 4.27  3.73 98.700 0.041 0.953 ? ? ? ? 
1 3.73  3.39 99.200 0.044 0.972 ? ? ? ? 
1 3.39  3.15 99.600 0.052 1.047 ? ? ? ? 
1 3.15  2.96 99.900 0.064 1.031 ? ? ? ? 
1 2.96  2.82 99.800 0.078 1.081 ? ? ? ? 
1 2.82  2.69 99.900 0.100 1.063 ? ? ? ? 
1 2.69  2.59 99.600 0.118 1.095 ? ? ? ? 
1 2.59  2.50 88.700 0.138 1.075 ? ? ? ? 
2 30.00 5.38 90.700 0.038 1.033 ? ? ? ? 
2 5.38  4.27 97.500 0.041 0.994 ? ? ? ? 
2 4.27  3.73 98.700 0.041 1.011 ? ? ? ? 
2 3.73  3.39 99.200 0.043 1.014 ? ? ? ? 
2 3.39  3.15 99.600 0.052 0.944 ? ? ? ? 
2 3.15  2.96 99.900 0.064 1.033 ? ? ? ? 
2 2.96  2.82 99.800 0.076 1.071 ? ? ? ? 
2 2.82  2.69 99.900 0.098 1.075 ? ? ? ? 
2 2.69  2.59 95.300 0.111 1.052 ? ? ? ? 
2 2.59  2.50 80.100 0.133 1.089 ? ? ? ? 
# 
_pdbx_phasing_MAD_set_site.id                 1 
_pdbx_phasing_MAD_set_site.atom_type_symbol   LAM1 
_pdbx_phasing_MAD_set_site.occupancy          0.900 
_pdbx_phasing_MAD_set_site.fract_x            0.763 
_pdbx_phasing_MAD_set_site.fract_y            0.754 
_pdbx_phasing_MAD_set_site.fract_z            0.028 
_pdbx_phasing_MAD_set_site.b_iso              60.000 
# 
_phasing.method   MAD 
# 
_phasing_MAD_clust.id           1 
_phasing_MAD_clust.expt_id      '2 wavelength' 
_phasing_MAD_clust.number_set   ? 
# 
_phasing_MAD_expt.id         '2 wavelength' 
_phasing_MAD_expt.mean_fom   ? 
# 
loop_
_phasing_MAD_set.clust_id 
_phasing_MAD_set.expt_id 
_phasing_MAD_set.set_id 
_phasing_MAD_set.wavelength 
_phasing_MAD_set.pdbx_f_prime_refined 
_phasing_MAD_set.pdbx_f_double_prime_refined 
1 '2 wavelength' 1 0.9793 -9.81 10.84 
1 '2 wavelength' 2 1.0000 -3.48 1.23  
# 
loop_
_phasing_set.id 
_phasing_set.pdbx_d_res_high 
_phasing_set.pdbx_d_res_low 
1 . . 
2 . . 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
Blu-Ice   'data collection' . ? 1 
DENZO     'data reduction'  . ? 2 
SCALEPACK 'data scaling'    . ? 3 
SOLVE     phasing           . ? 4 
CNS       refinement        . ? 5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 NH1 A ARG 28   ? ? OH A TYR 32   ? ? 2.04 
2 1 O   A HOH 1016 ? ? O  A HOH 1099 ? ? 2.12 
# 
_pdbx_validate_torsion.id              1 
_pdbx_validate_torsion.PDB_model_num   1 
_pdbx_validate_torsion.auth_comp_id    ARG 
_pdbx_validate_torsion.auth_asym_id    A 
_pdbx_validate_torsion.auth_seq_id     3 
_pdbx_validate_torsion.PDB_ins_code    ? 
_pdbx_validate_torsion.label_alt_id    ? 
_pdbx_validate_torsion.phi             24.57 
_pdbx_validate_torsion.psi             -70.62 
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    ARG 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     28 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.267 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY -1  ? A GLY 1   
2  1 Y 1 A ALA 0   ? A ALA 2   
3  1 Y 1 A MET 1   ? A MET 3   
4  1 Y 1 A LEU 156 ? A LEU 158 
5  1 Y 1 A GLY 157 ? A GLY 159 
6  1 Y 1 A ALA 158 ? A ALA 160 
7  1 Y 1 A GLY 159 ? A GLY 161 
8  1 Y 1 A LEU 160 ? A LEU 162 
9  1 Y 1 A ASP 161 ? A ASP 163 
10 1 Y 1 A TRP 162 ? A TRP 164 
11 1 Y 1 A LYS 163 ? A LYS 165 
12 1 Y 1 A THR 164 ? A THR 166 
13 1 Y 1 A SER 165 ? A SER 167 
14 1 Y 1 A LEU 166 ? A LEU 168 
15 1 Y 1 A GLN 167 ? A GLN 169 
16 1 Y 1 A GLU 168 ? A GLU 170 
17 1 Y 1 A LEU 169 ? A LEU 171 
18 1 Y 1 A THR 170 ? A THR 172 
19 1 Y 1 A ALA 171 ? A ALA 173 
20 1 Y 1 A ALA 172 ? A ALA 174 
21 1 Y 1 A ARG 173 ? A ARG 175 
22 1 Y 1 A GLY 174 ? A GLY 176 
23 1 Y 1 A LEU 175 ? A LEU 177 
24 1 Y 1 A GLY 176 ? A GLY 178 
25 1 Y 1 A ALA 177 ? A ALA 179 
26 1 Y 1 A PRO 178 ? A PRO 180 
27 1 Y 1 A SER 179 ? A SER 181 
28 1 Y 1 A TYR 180 ? A TYR 182 
29 1 Y 1 A LEU 181 ? A LEU 183 
30 1 Y 1 A VAL 182 ? A VAL 184 
31 1 Y 1 A THR 183 ? A THR 185 
32 1 Y 1 A SER 184 ? A SER 186 
33 1 Y 1 A THR 185 ? A THR 187 
34 1 Y 1 A GLY 186 ? A GLY 188 
35 1 Y 1 A PRO 187 ? A PRO 189 
36 1 Y 1 A ASP 188 ? A ASP 190 
37 1 Y 1 A HIS 189 ? A HIS 191 
38 1 Y 1 A ASP 190 ? A ASP 192 
39 1 Y 1 A LYS 191 ? A LYS 193 
40 1 Y 1 A GLU 192 ? A GLU 194 
41 1 Y 1 A PHE 193 ? A PHE 195 
42 1 Y 1 A THR 194 ? A THR 196 
43 1 Y 1 A ALA 195 ? A ALA 197 
44 1 Y 1 A VAL 196 ? A VAL 198 
45 1 Y 1 A VAL 197 ? A VAL 199 
46 1 Y 1 A VAL 198 ? A VAL 200 
47 1 Y 1 A VAL 199 ? A VAL 201 
48 1 Y 1 A MET 200 ? A MET 202 
49 1 Y 1 A ASP 201 ? A ASP 203 
50 1 Y 1 A SER 202 ? A SER 204 
51 1 Y 1 A GLU 203 ? A GLU 205 
52 1 Y 1 A TYR 204 ? A TYR 206 
53 1 Y 1 A GLY 205 ? A GLY 207 
54 1 Y 1 A SER 206 ? A SER 208 
55 1 Y 1 A GLY 207 ? A GLY 209 
56 1 Y 1 A VAL 208 ? A VAL 210 
57 1 Y 1 A GLY 209 ? A GLY 211 
58 1 Y 1 A ARG 210 ? A ARG 212 
59 1 Y 1 A SER 211 ? A SER 213 
60 1 Y 1 A LYS 212 ? A LYS 214 
61 1 Y 1 A LYS 213 ? A LYS 215 
62 1 Y 1 A GLU 214 ? A GLU 216 
63 1 Y 1 A ALA 215 ? A ALA 217 
64 1 Y 1 A GLU 216 ? A GLU 218 
65 1 Y 1 A GLN 217 ? A GLN 219 
66 1 Y 1 A LYS 218 ? A LYS 220 
67 1 Y 1 A ALA 219 ? A ALA 221 
68 1 Y 1 A ALA 220 ? A ALA 222 
69 1 Y 1 A ALA 221 ? A ALA 223 
70 1 Y 1 A ALA 222 ? A ALA 224 
71 1 Y 1 A ALA 223 ? A ALA 225 
72 1 Y 1 A TRP 224 ? A TRP 226 
73 1 Y 1 A LYS 225 ? A LYS 227 
74 1 Y 1 A ALA 226 ? A ALA 228 
75 1 Y 1 A LEU 227 ? A LEU 229 
76 1 Y 1 A GLU 228 ? A GLU 230 
77 1 Y 1 A VAL 229 ? A VAL 231 
78 1 Y 1 A LEU 230 ? A LEU 232 
79 1 Y 1 A ASP 231 ? A ASP 233 
80 1 Y 1 A ASN 232 ? A ASN 234 
81 1 Y 1 A ALA 233 ? A ALA 235 
82 1 Y 1 A MET 234 ? A MET 236 
83 1 Y 1 A PRO 235 ? A PRO 237 
84 1 Y 1 A GLY 236 ? A GLY 238 
85 1 Y 1 A LYS 237 ? A LYS 239 
86 1 Y 1 A THR 238 ? A THR 240 
87 1 Y 1 A SER 239 ? A SER 241 
88 1 Y 1 A ALA 240 ? A ALA 242 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CALCIUM ION' CA  
3 water         HOH 
#