data_2A3K
# 
_entry.id   2A3K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2A3K         
RCSB  RCSB033443   
WWPDB D_1000033443 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2A3K 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Barr, A.'                             1  
'Turnbull, A.P.'                       2  
'Das, S.'                              3  
'Eswaran, J.'                          4  
'Debreczeni, J.E.'                     5  
'Longmann, E.'                         6  
'Smee, C.'                             7  
'Burgess, N.'                          8  
'Gileadi, O.'                          9  
'Sundstrom, M.'                        10 
'Arrowsmith, C.'                       11 
'Edwards, A.'                          12 
'von Delft, F.'                        13 
'Knapp, S.'                            14 
'Structural Genomics Consortium (SGC)' 15 
# 
_citation.id                        primary 
_citation.title                     
'The crystal structure of human receptor protein tyrosine phosphatase kappa phosphatase domain 1.' 
_citation.journal_abbrev            'Protein Sci.' 
_citation.journal_volume            15 
_citation.page_first                1500 
_citation.page_last                 1505 
_citation.year                      2006 
_citation.journal_id_ASTM           PRCIEI 
_citation.country                   US 
_citation.journal_id_ISSN           0961-8368 
_citation.journal_id_CSD            0795 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16672235 
_citation.pdbx_database_id_DOI      10.1110/ps.062128706 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Eswaran, J.'      1 
primary 'Debreczeni, J.E.' 2 
primary 'Longman, E.'      3 
primary 'Barr, A.J.'       4 
primary 'Knapp, S.'        5 
# 
_cell.entry_id           2A3K 
_cell.length_a           39.125 
_cell.length_b           80.968 
_cell.length_c           100.392 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2A3K 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'protein tyrosine phosphatase, non-receptor type 7, isoform 1' 33777.250 1  ? ? ? ? 
2 non-polymer syn 'PHOSPHATE ION'                                                94.971    4  ? ? ? ? 
3 water       nat water                                                          18.015    32 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;SMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQ
SQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRI
QDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFI
ATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEP
;
_entity_poly.pdbx_seq_one_letter_code_can   
;SMNTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQ
SQEDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRI
QDMKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFI
ATRIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEP
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   MET n 
1 3   ASN n 
1 4   THR n 
1 5   PRO n 
1 6   ARG n 
1 7   GLU n 
1 8   VAL n 
1 9   THR n 
1 10  LEU n 
1 11  HIS n 
1 12  PHE n 
1 13  LEU n 
1 14  ARG n 
1 15  THR n 
1 16  ALA n 
1 17  GLY n 
1 18  HIS n 
1 19  PRO n 
1 20  LEU n 
1 21  THR n 
1 22  ARG n 
1 23  TRP n 
1 24  ALA n 
1 25  LEU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  PRO n 
1 30  PRO n 
1 31  SER n 
1 32  PRO n 
1 33  LYS n 
1 34  GLN n 
1 35  LEU n 
1 36  GLU n 
1 37  GLU n 
1 38  GLU n 
1 39  PHE n 
1 40  LEU n 
1 41  LYS n 
1 42  ILE n 
1 43  PRO n 
1 44  SER n 
1 45  ASN n 
1 46  PHE n 
1 47  VAL n 
1 48  SER n 
1 49  PRO n 
1 50  GLU n 
1 51  ASP n 
1 52  LEU n 
1 53  ASP n 
1 54  ILE n 
1 55  PRO n 
1 56  GLY n 
1 57  HIS n 
1 58  ALA n 
1 59  SER n 
1 60  LYS n 
1 61  ASP n 
1 62  ARG n 
1 63  TYR n 
1 64  LYS n 
1 65  THR n 
1 66  ILE n 
1 67  LEU n 
1 68  PRO n 
1 69  ASN n 
1 70  PRO n 
1 71  GLN n 
1 72  SER n 
1 73  ARG n 
1 74  VAL n 
1 75  CYS n 
1 76  LEU n 
1 77  GLY n 
1 78  ARG n 
1 79  ALA n 
1 80  GLN n 
1 81  SER n 
1 82  GLN n 
1 83  GLU n 
1 84  ASP n 
1 85  GLY n 
1 86  ASP n 
1 87  TYR n 
1 88  ILE n 
1 89  ASN n 
1 90  ALA n 
1 91  ASN n 
1 92  TYR n 
1 93  ILE n 
1 94  ARG n 
1 95  GLY n 
1 96  TYR n 
1 97  ASP n 
1 98  GLY n 
1 99  LYS n 
1 100 GLU n 
1 101 LYS n 
1 102 VAL n 
1 103 TYR n 
1 104 ILE n 
1 105 ALA n 
1 106 THR n 
1 107 GLN n 
1 108 GLY n 
1 109 PRO n 
1 110 MET n 
1 111 PRO n 
1 112 ASN n 
1 113 THR n 
1 114 VAL n 
1 115 SER n 
1 116 ASP n 
1 117 PHE n 
1 118 TRP n 
1 119 GLU n 
1 120 MET n 
1 121 VAL n 
1 122 TRP n 
1 123 GLN n 
1 124 GLU n 
1 125 GLU n 
1 126 VAL n 
1 127 SER n 
1 128 LEU n 
1 129 ILE n 
1 130 VAL n 
1 131 MET n 
1 132 LEU n 
1 133 THR n 
1 134 GLN n 
1 135 LEU n 
1 136 ARG n 
1 137 GLU n 
1 138 GLY n 
1 139 LYS n 
1 140 GLU n 
1 141 LYS n 
1 142 CYS n 
1 143 VAL n 
1 144 HIS n 
1 145 TYR n 
1 146 TRP n 
1 147 PRO n 
1 148 THR n 
1 149 GLU n 
1 150 GLU n 
1 151 GLU n 
1 152 THR n 
1 153 TYR n 
1 154 GLY n 
1 155 PRO n 
1 156 PHE n 
1 157 GLN n 
1 158 ILE n 
1 159 ARG n 
1 160 ILE n 
1 161 GLN n 
1 162 ASP n 
1 163 MET n 
1 164 LYS n 
1 165 GLU n 
1 166 CYS n 
1 167 PRO n 
1 168 GLU n 
1 169 TYR n 
1 170 THR n 
1 171 VAL n 
1 172 ARG n 
1 173 GLN n 
1 174 LEU n 
1 175 THR n 
1 176 ILE n 
1 177 GLN n 
1 178 TYR n 
1 179 GLN n 
1 180 GLU n 
1 181 GLU n 
1 182 ARG n 
1 183 ARG n 
1 184 SER n 
1 185 VAL n 
1 186 LYS n 
1 187 HIS n 
1 188 ILE n 
1 189 LEU n 
1 190 PHE n 
1 191 SER n 
1 192 ALA n 
1 193 TRP n 
1 194 PRO n 
1 195 ASP n 
1 196 HIS n 
1 197 GLN n 
1 198 THR n 
1 199 PRO n 
1 200 GLU n 
1 201 SER n 
1 202 ALA n 
1 203 GLY n 
1 204 PRO n 
1 205 LEU n 
1 206 LEU n 
1 207 ARG n 
1 208 LEU n 
1 209 VAL n 
1 210 ALA n 
1 211 GLU n 
1 212 VAL n 
1 213 GLU n 
1 214 GLU n 
1 215 SER n 
1 216 PRO n 
1 217 GLU n 
1 218 THR n 
1 219 ALA n 
1 220 ALA n 
1 221 HIS n 
1 222 PRO n 
1 223 GLY n 
1 224 PRO n 
1 225 ILE n 
1 226 VAL n 
1 227 VAL n 
1 228 HIS n 
1 229 CYS n 
1 230 SER n 
1 231 ALA n 
1 232 GLY n 
1 233 ILE n 
1 234 GLY n 
1 235 ARG n 
1 236 THR n 
1 237 GLY n 
1 238 CYS n 
1 239 PHE n 
1 240 ILE n 
1 241 ALA n 
1 242 THR n 
1 243 ARG n 
1 244 ILE n 
1 245 GLY n 
1 246 CYS n 
1 247 GLN n 
1 248 GLN n 
1 249 LEU n 
1 250 LYS n 
1 251 ALA n 
1 252 ARG n 
1 253 GLY n 
1 254 GLU n 
1 255 VAL n 
1 256 ASP n 
1 257 ILE n 
1 258 LEU n 
1 259 GLY n 
1 260 ILE n 
1 261 VAL n 
1 262 CYS n 
1 263 GLN n 
1 264 LEU n 
1 265 ARG n 
1 266 LEU n 
1 267 ASP n 
1 268 ARG n 
1 269 GLY n 
1 270 GLY n 
1 271 MET n 
1 272 ILE n 
1 273 GLN n 
1 274 THR n 
1 275 ALA n 
1 276 GLU n 
1 277 GLN n 
1 278 TYR n 
1 279 GLN n 
1 280 PHE n 
1 281 LEU n 
1 282 HIS n 
1 283 HIS n 
1 284 THR n 
1 285 LEU n 
1 286 ALA n 
1 287 LEU n 
1 288 TYR n 
1 289 ALA n 
1 290 GLY n 
1 291 GLN n 
1 292 LEU n 
1 293 PRO n 
1 294 GLU n 
1 295 GLU n 
1 296 PRO n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 PTPN7 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21 (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'PNIC SGC' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    GB 
_struct_ref.db_code                    NP_002823 
_struct_ref.pdbx_db_accession          18375658 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;NTPREVTLHFLRTAGHPLTRWALQRQPPSPKQLEEEFLKIPSNFVSPEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQ
EDGDYINANYIRGYDGKEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTEEETYGPFQIRIQD
MKECPEYTVRQLTIQYQEERRSVKHILFSAWPDHQTPESAGPLLRLVAEVEESPETAAHPGPIVVHCSAGIGRTGCFIAT
RIGCQQLKARGEVDILGIVCQLRLDRGGMIQTAEQYQFLHHTLALYAGQLPEEP
;
_struct_ref.pdbx_align_begin           65 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2A3K 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 296 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             18375658 
_struct_ref_seq.db_align_beg                  65 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  358 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       65 
_struct_ref_seq.pdbx_auth_seq_align_end       358 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2A3K SER A 1 ? GB 18375658 ? ? 'CLONING ARTIFACT' 63 1 
1 2A3K MET A 2 ? GB 18375658 ? ? 'CLONING ARTIFACT' 64 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PO4 non-polymer         . 'PHOSPHATE ION' ? 'O4 P -3'        94.971  
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2A3K 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.4 
_exptl_crystal.density_percent_sol   47.4 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    
'0.1M Tris-HCl, 2.0M ammonium dihydrogen phosphate, pH 8.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2005-06-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9207 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9207 
# 
_reflns.entry_id                     2A3K 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.d_resolution_high            2.55 
_reflns.d_resolution_low             50 
_reflns.number_all                   10833 
_reflns.number_obs                   10833 
_reflns.percent_possible_obs         99.4 
_reflns.pdbx_Rmerge_I_obs            0.128 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.55 
_reflns_shell.d_res_low              2.64 
_reflns_shell.percent_possible_all   96.9 
_reflns_shell.Rmerge_I_obs           0.48 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2A3K 
_refine.ls_number_reflns_obs                     10366 
_refine.ls_number_reflns_all                     10366 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             42.68 
_refine.ls_d_res_high                            2.55 
_refine.ls_percent_reflns_obs                    99.23 
_refine.ls_R_factor_obs                          0.22184 
_refine.ls_R_factor_all                          0.22184 
_refine.ls_R_factor_R_work                       0.21897 
_refine.ls_R_factor_R_free                       0.27466 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  522 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.923 
_refine.correlation_coeff_Fo_to_Fc_free          0.890 
_refine.B_iso_mean                               29.008 
_refine.aniso_B[1][1]                            -4.02 
_refine.aniso_B[2][2]                            0.15 
_refine.aniso_B[3][3]                            3.87 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JLN' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.660 
_refine.pdbx_overall_ESU_R_Free                  0.327 
_refine.overall_SU_ML                            0.254 
_refine.overall_SU_B                             23.061 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2134 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         20 
_refine_hist.number_atoms_solvent             32 
_refine_hist.number_atoms_total               2186 
_refine_hist.d_res_high                       2.55 
_refine_hist.d_res_low                        42.68 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         0.011  0.022  ? 2205 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      1.270  1.965  ? 3008 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   6.512  5.000  ? 268  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   38.519 23.700 ? 100  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   17.276 15.000 ? 343  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   19.021 15.000 ? 15   'X-RAY DIFFRACTION' ? 
r_chiral_restr           0.082  0.200  ? 329  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     0.004  0.020  ? 1691 'X-RAY DIFFRACTION' ? 
r_nbd_refined            0.210  0.200  ? 954  'X-RAY DIFFRACTION' ? 
r_nbtor_refined          0.306  0.200  ? 1483 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    0.163  0.200  ? 75   'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   0.175  0.200  ? 40   'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 0.238  0.200  ? 9    'X-RAY DIFFRACTION' ? 
r_mcbond_it              0.457  1.500  ? 1395 'X-RAY DIFFRACTION' ? 
r_mcangle_it             0.817  2.000  ? 2202 'X-RAY DIFFRACTION' ? 
r_scbond_it              1.207  3.000  ? 923  'X-RAY DIFFRACTION' ? 
r_scangle_it             1.913  4.500  ? 806  'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.55 
_refine_ls_shell.d_res_low                        2.614 
_refine_ls_shell.number_reflns_R_work             698 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               93.08 
_refine_ls_shell.R_factor_R_free                  0.369 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             42 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2A3K 
_struct.title                     
'Crystal Structure of the Human Protein Tyrosine Phosphatase, PTPN7 (HePTP, Hematopoietic Protein Tyrosine Phosphatase)' 
_struct.pdbx_descriptor           'protein tyrosine phosphatase, non-receptor type 7, isoform 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2A3K 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
'PTPN7; PHOSPHATASE; HYDROLASE, Structural Genomics, Structural Genomics Consortium, SGC, SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 3 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 3   ? ALA A 16  ? ASN A 65  ALA A 78  1 ? 14 
HELX_P HELX_P2  2  ARG A 22  ? GLN A 28  ? ARG A 84  GLN A 90  1 ? 7  
HELX_P HELX_P3  3  SER A 31  ? LYS A 41  ? SER A 93  LYS A 103 1 ? 11 
HELX_P HELX_P4  4  HIS A 57  ? ASP A 61  ? HIS A 119 ASP A 123 5 ? 5  
HELX_P HELX_P5  5  GLY A 95  ? LYS A 99  ? GLY A 157 LYS A 161 5 ? 5  
HELX_P HELX_P6  6  THR A 113 ? GLU A 124 ? THR A 175 GLU A 186 1 ? 12 
HELX_P HELX_P7  7  ALA A 202 ? GLU A 213 ? ALA A 264 GLU A 275 1 ? 12 
HELX_P HELX_P8  8  ILE A 233 ? GLY A 253 ? ILE A 295 GLY A 315 1 ? 21 
HELX_P HELX_P9  9  ILE A 257 ? ARG A 268 ? ILE A 319 ARG A 330 1 ? 12 
HELX_P HELX_P10 10 THR A 274 ? LEU A 292 ? THR A 336 LEU A 354 1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? parallel      
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
B 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PRO A 19  ? THR A 21  ? PRO A 81  THR A 83  
A 2 GLU A 254 ? ASP A 256 ? GLU A 316 ASP A 318 
B 1 ALA A 90  ? ILE A 93  ? ALA A 152 ILE A 155 
B 2 TYR A 103 ? GLN A 107 ? TYR A 165 GLN A 169 
B 3 ILE A 225 ? CYS A 229 ? ILE A 287 CYS A 291 
B 4 LEU A 128 ? LEU A 132 ? LEU A 190 LEU A 194 
B 5 GLU A 181 ? PHE A 190 ? GLU A 243 PHE A 252 
B 6 TYR A 169 ? TYR A 178 ? TYR A 231 TYR A 240 
B 7 PHE A 156 ? GLU A 165 ? PHE A 218 GLU A 227 
B 8 GLU A 150 ? TYR A 153 ? GLU A 212 TYR A 215 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 20  ? N LEU A 82  O VAL A 255 ? O VAL A 317 
B 1 2 N ILE A 93  ? N ILE A 155 O TYR A 103 ? O TYR A 165 
B 2 3 N ILE A 104 ? N ILE A 166 O VAL A 227 ? O VAL A 289 
B 3 4 O VAL A 226 ? O VAL A 288 N VAL A 130 ? N VAL A 192 
B 4 5 N MET A 131 ? N MET A 193 O PHE A 190 ? O PHE A 252 
B 5 6 O HIS A 187 ? O HIS A 249 N ARG A 172 ? N ARG A 234 
B 6 7 O GLN A 173 ? O GLN A 235 N GLN A 161 ? N GLN A 223 
B 7 8 O PHE A 156 ? O PHE A 218 N TYR A 153 ? N TYR A 215 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PO4 A 501' 
AC2 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE PO4 A 502' 
AC3 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PO4 A 503' 
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE PO4 A 504' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 HOH F .   ? HOH A 14  . ? 1_555 ? 
2  AC1 10 ASP A 195 ? ASP A 257 . ? 1_555 ? 
3  AC1 10 CYS A 229 ? CYS A 291 . ? 1_555 ? 
4  AC1 10 SER A 230 ? SER A 292 . ? 1_555 ? 
5  AC1 10 ALA A 231 ? ALA A 293 . ? 1_555 ? 
6  AC1 10 GLY A 232 ? GLY A 294 . ? 1_555 ? 
7  AC1 10 ILE A 233 ? ILE A 295 . ? 1_555 ? 
8  AC1 10 GLY A 234 ? GLY A 296 . ? 1_555 ? 
9  AC1 10 ARG A 235 ? ARG A 297 . ? 1_555 ? 
10 AC1 10 GLN A 273 ? GLN A 335 . ? 1_555 ? 
11 AC2 5  HOH F .   ? HOH A 17  . ? 1_555 ? 
12 AC2 5  THR A 133 ? THR A 195 . ? 1_555 ? 
13 AC2 5  GLN A 134 ? GLN A 196 . ? 1_555 ? 
14 AC2 5  SER A 230 ? SER A 292 . ? 1_555 ? 
15 AC2 5  ARG A 235 ? ARG A 297 . ? 1_555 ? 
16 AC3 10 PRO A 19  ? PRO A 81  . ? 4_545 ? 
17 AC3 10 LEU A 20  ? LEU A 82  . ? 4_545 ? 
18 AC3 10 THR A 21  ? THR A 83  . ? 4_545 ? 
19 AC3 10 ALA A 24  ? ALA A 86  . ? 4_545 ? 
20 AC3 10 SER A 201 ? SER A 263 . ? 1_555 ? 
21 AC3 10 ALA A 202 ? ALA A 264 . ? 1_555 ? 
22 AC3 10 GLY A 203 ? GLY A 265 . ? 1_555 ? 
23 AC3 10 HIS A 283 ? HIS A 345 . ? 1_555 ? 
24 AC3 10 LEU A 287 ? LEU A 349 . ? 1_555 ? 
25 AC3 10 PO4 E .   ? PO4 A 504 . ? 1_555 ? 
26 AC4 3  HIS A 18  ? HIS A 80  . ? 4_545 ? 
27 AC4 3  GLY A 203 ? GLY A 265 . ? 1_555 ? 
28 AC4 3  PO4 D .   ? PO4 A 503 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2A3K 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2A3K 
_atom_sites.fract_transf_matrix[1][1]   0.025559 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012351 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009961 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASN A 1 3   ? -19.679 -43.084 -19.851 1.00 33.45 ? 65  ASN A N   1 
ATOM   2    C CA  . ASN A 1 3   ? -18.453 -42.405 -19.329 1.00 33.43 ? 65  ASN A CA  1 
ATOM   3    C C   . ASN A 1 3   ? -18.625 -41.593 -18.013 1.00 33.23 ? 65  ASN A C   1 
ATOM   4    O O   . ASN A 1 3   ? -18.448 -40.370 -17.995 1.00 33.37 ? 65  ASN A O   1 
ATOM   5    C CB  . ASN A 1 3   ? -17.804 -41.557 -20.440 1.00 33.55 ? 65  ASN A CB  1 
ATOM   6    C CG  . ASN A 1 3   ? -16.282 -41.359 -20.245 1.00 33.74 ? 65  ASN A CG  1 
ATOM   7    O OD1 . ASN A 1 3   ? -15.693 -41.777 -19.232 1.00 32.61 ? 65  ASN A OD1 1 
ATOM   8    N ND2 . ASN A 1 3   ? -15.647 -40.713 -21.229 1.00 31.82 ? 65  ASN A ND2 1 
ATOM   9    N N   . THR A 1 4   ? -18.950 -42.291 -16.919 1.00 32.95 ? 66  THR A N   1 
ATOM   10   C CA  . THR A 1 4   ? -18.811 -41.755 -15.547 1.00 32.29 ? 66  THR A CA  1 
ATOM   11   C C   . THR A 1 4   ? -17.352 -41.367 -15.221 1.00 31.98 ? 66  THR A C   1 
ATOM   12   O O   . THR A 1 4   ? -17.127 -40.345 -14.575 1.00 32.58 ? 66  THR A O   1 
ATOM   13   C CB  . THR A 1 4   ? -19.323 -42.766 -14.460 1.00 32.40 ? 66  THR A CB  1 
ATOM   14   O OG1 . THR A 1 4   ? -20.634 -43.229 -14.793 1.00 32.32 ? 66  THR A OG1 1 
ATOM   15   C CG2 . THR A 1 4   ? -19.359 -42.138 -13.045 1.00 32.45 ? 66  THR A CG2 1 
ATOM   16   N N   . PRO A 1 5   ? -16.359 -42.204 -15.610 1.00 31.47 ? 67  PRO A N   1 
ATOM   17   C CA  . PRO A 1 5   ? -14.947 -41.843 -15.410 1.00 31.02 ? 67  PRO A CA  1 
ATOM   18   C C   . PRO A 1 5   ? -14.524 -40.461 -15.902 1.00 30.56 ? 67  PRO A C   1 
ATOM   19   O O   . PRO A 1 5   ? -13.702 -39.829 -15.261 1.00 30.47 ? 67  PRO A O   1 
ATOM   20   C CB  . PRO A 1 5   ? -14.196 -42.935 -16.177 1.00 31.11 ? 67  PRO A CB  1 
ATOM   21   C CG  . PRO A 1 5   ? -15.083 -44.113 -16.088 1.00 30.96 ? 67  PRO A CG  1 
ATOM   22   C CD  . PRO A 1 5   ? -16.478 -43.564 -16.178 1.00 31.47 ? 67  PRO A CD  1 
ATOM   23   N N   . ARG A 1 6   ? -15.069 -39.990 -17.018 1.00 30.65 ? 68  ARG A N   1 
ATOM   24   C CA  . ARG A 1 6   ? -14.798 -38.615 -17.441 1.00 30.73 ? 68  ARG A CA  1 
ATOM   25   C C   . ARG A 1 6   ? -15.378 -37.657 -16.392 1.00 30.80 ? 68  ARG A C   1 
ATOM   26   O O   . ARG A 1 6   ? -14.747 -36.658 -16.035 1.00 30.33 ? 68  ARG A O   1 
ATOM   27   C CB  . ARG A 1 6   ? -15.368 -38.330 -18.842 1.00 30.83 ? 68  ARG A CB  1 
ATOM   28   C CG  . ARG A 1 6   ? -14.830 -37.053 -19.514 1.00 30.47 ? 68  ARG A CG  1 
ATOM   29   N N   . GLU A 1 7   ? -16.555 -38.004 -15.868 1.00 30.82 ? 69  GLU A N   1 
ATOM   30   C CA  . GLU A 1 7   ? -17.261 -37.141 -14.930 1.00 31.21 ? 69  GLU A CA  1 
ATOM   31   C C   . GLU A 1 7   ? -16.685 -37.115 -13.525 1.00 30.79 ? 69  GLU A C   1 
ATOM   32   O O   . GLU A 1 7   ? -16.735 -36.082 -12.862 1.00 31.01 ? 69  GLU A O   1 
ATOM   33   C CB  . GLU A 1 7   ? -18.762 -37.434 -14.906 1.00 31.54 ? 69  GLU A CB  1 
ATOM   34   C CG  . GLU A 1 7   ? -19.571 -36.411 -15.707 1.00 33.97 ? 69  GLU A CG  1 
ATOM   35   C CD  . GLU A 1 7   ? -19.503 -36.634 -17.221 1.00 37.00 ? 69  GLU A CD  1 
ATOM   36   O OE1 . GLU A 1 7   ? -19.176 -35.678 -17.959 1.00 37.94 ? 69  GLU A OE1 1 
ATOM   37   O OE2 . GLU A 1 7   ? -19.794 -37.763 -17.677 1.00 39.34 ? 69  GLU A OE2 1 
ATOM   38   N N   . VAL A 1 8   ? -16.142 -38.240 -13.065 1.00 30.28 ? 70  VAL A N   1 
ATOM   39   C CA  . VAL A 1 8   ? -15.437 -38.273 -11.783 1.00 29.28 ? 70  VAL A CA  1 
ATOM   40   C C   . VAL A 1 8   ? -14.235 -37.344 -11.889 1.00 29.26 ? 70  VAL A C   1 
ATOM   41   O O   . VAL A 1 8   ? -13.928 -36.575 -10.963 1.00 29.17 ? 70  VAL A O   1 
ATOM   42   C CB  . VAL A 1 8   ? -15.000 -39.704 -11.407 1.00 29.17 ? 70  VAL A CB  1 
ATOM   43   C CG1 . VAL A 1 8   ? -14.018 -39.682 -10.257 1.00 28.86 ? 70  VAL A CG1 1 
ATOM   44   C CG2 . VAL A 1 8   ? -16.209 -40.538 -11.039 1.00 28.52 ? 70  VAL A CG2 1 
ATOM   45   N N   . THR A 1 9   ? -13.586 -37.401 -13.051 1.00 28.96 ? 71  THR A N   1 
ATOM   46   C CA  . THR A 1 9   ? -12.416 -36.579 -13.345 1.00 28.70 ? 71  THR A CA  1 
ATOM   47   C C   . THR A 1 9   ? -12.768 -35.082 -13.357 1.00 28.44 ? 71  THR A C   1 
ATOM   48   O O   . THR A 1 9   ? -12.047 -34.260 -12.774 1.00 28.89 ? 71  THR A O   1 
ATOM   49   C CB  . THR A 1 9   ? -11.744 -37.072 -14.653 1.00 28.59 ? 71  THR A CB  1 
ATOM   50   O OG1 . THR A 1 9   ? -11.042 -38.286 -14.375 1.00 29.30 ? 71  THR A OG1 1 
ATOM   51   C CG2 . THR A 1 9   ? -10.767 -36.063 -15.231 1.00 28.61 ? 71  THR A CG2 1 
ATOM   52   N N   . LEU A 1 10  ? -13.888 -34.745 -13.990 1.00 28.10 ? 72  LEU A N   1 
ATOM   53   C CA  . LEU A 1 10  ? -14.334 -33.358 -14.105 1.00 27.69 ? 72  LEU A CA  1 
ATOM   54   C C   . LEU A 1 10  ? -14.865 -32.797 -12.787 1.00 27.62 ? 72  LEU A C   1 
ATOM   55   O O   . LEU A 1 10  ? -14.710 -31.605 -12.524 1.00 27.98 ? 72  LEU A O   1 
ATOM   56   C CB  . LEU A 1 10  ? -15.377 -33.221 -15.205 1.00 27.68 ? 72  LEU A CB  1 
ATOM   57   C CG  . LEU A 1 10  ? -14.860 -33.442 -16.628 1.00 27.68 ? 72  LEU A CG  1 
ATOM   58   C CD1 . LEU A 1 10  ? -16.023 -33.658 -17.568 1.00 28.48 ? 72  LEU A CD1 1 
ATOM   59   C CD2 . LEU A 1 10  ? -14.014 -32.272 -17.090 1.00 28.79 ? 72  LEU A CD2 1 
ATOM   60   N N   . HIS A 1 11  ? -15.454 -33.657 -11.955 1.00 27.11 ? 73  HIS A N   1 
ATOM   61   C CA  . HIS A 1 11  ? -15.982 -33.264 -10.651 1.00 26.84 ? 73  HIS A CA  1 
ATOM   62   C C   . HIS A 1 11  ? -14.840 -32.921 -9.689  1.00 26.58 ? 73  HIS A C   1 
ATOM   63   O O   . HIS A 1 11  ? -14.927 -31.941 -8.926  1.00 26.67 ? 73  HIS A O   1 
ATOM   64   C CB  . HIS A 1 11  ? -16.875 -34.372 -10.076 1.00 26.99 ? 73  HIS A CB  1 
ATOM   65   C CG  . HIS A 1 11  ? -17.379 -34.096 -8.690  1.00 28.96 ? 73  HIS A CG  1 
ATOM   66   N ND1 . HIS A 1 11  ? -18.640 -33.596 -8.439  1.00 31.30 ? 73  HIS A ND1 1 
ATOM   67   C CD2 . HIS A 1 11  ? -16.790 -34.249 -7.478  1.00 29.81 ? 73  HIS A CD2 1 
ATOM   68   C CE1 . HIS A 1 11  ? -18.809 -33.458 -7.135  1.00 30.79 ? 73  HIS A CE1 1 
ATOM   69   N NE2 . HIS A 1 11  ? -17.703 -33.854 -6.529  1.00 31.01 ? 73  HIS A NE2 1 
ATOM   70   N N   . PHE A 1 12  ? -13.780 -33.735 -9.719  1.00 25.56 ? 74  PHE A N   1 
ATOM   71   C CA  . PHE A 1 12  ? -12.581 -33.454 -8.949  1.00 24.44 ? 74  PHE A CA  1 
ATOM   72   C C   . PHE A 1 12  ? -12.050 -32.078 -9.326  1.00 24.39 ? 74  PHE A C   1 
ATOM   73   O O   . PHE A 1 12  ? -11.849 -31.238 -8.461  1.00 23.59 ? 74  PHE A O   1 
ATOM   74   C CB  . PHE A 1 12  ? -11.503 -34.523 -9.173  1.00 23.97 ? 74  PHE A CB  1 
ATOM   75   C CG  . PHE A 1 12  ? -10.285 -34.341 -8.304  1.00 23.93 ? 74  PHE A CG  1 
ATOM   76   C CD1 . PHE A 1 12  ? -10.260 -34.848 -6.994  1.00 23.59 ? 74  PHE A CD1 1 
ATOM   77   C CD2 . PHE A 1 12  ? -9.167  -33.625 -8.776  1.00 23.06 ? 74  PHE A CD2 1 
ATOM   78   C CE1 . PHE A 1 12  ? -9.130  -34.670 -6.157  1.00 21.90 ? 74  PHE A CE1 1 
ATOM   79   C CE2 . PHE A 1 12  ? -8.038  -33.440 -7.953  1.00 22.39 ? 74  PHE A CE2 1 
ATOM   80   C CZ  . PHE A 1 12  ? -8.029  -33.970 -6.634  1.00 22.09 ? 74  PHE A CZ  1 
ATOM   81   N N   . LEU A 1 13  ? -11.873 -31.837 -10.628 1.00 24.71 ? 75  LEU A N   1 
ATOM   82   C CA  . LEU A 1 13  ? -11.247 -30.594 -11.100 1.00 24.61 ? 75  LEU A CA  1 
ATOM   83   C C   . LEU A 1 13  ? -12.025 -29.369 -10.673 1.00 25.35 ? 75  LEU A C   1 
ATOM   84   O O   . LEU A 1 13  ? -11.450 -28.294 -10.436 1.00 25.74 ? 75  LEU A O   1 
ATOM   85   C CB  . LEU A 1 13  ? -11.061 -30.608 -12.618 1.00 24.24 ? 75  LEU A CB  1 
ATOM   86   C CG  . LEU A 1 13  ? -10.111 -31.677 -13.187 1.00 23.35 ? 75  LEU A CG  1 
ATOM   87   C CD1 . LEU A 1 13  ? -10.247 -31.746 -14.698 1.00 19.96 ? 75  LEU A CD1 1 
ATOM   88   C CD2 . LEU A 1 13  ? -8.642  -31.453 -12.758 1.00 20.37 ? 75  LEU A CD2 1 
ATOM   89   N N   . ARG A 1 14  ? -13.339 -29.532 -10.570 1.00 26.06 ? 76  ARG A N   1 
ATOM   90   C CA  . ARG A 1 14  ? -14.215 -28.424 -10.213 1.00 26.61 ? 76  ARG A CA  1 
ATOM   91   C C   . ARG A 1 14  ? -14.308 -28.194 -8.692  1.00 26.29 ? 76  ARG A C   1 
ATOM   92   O O   . ARG A 1 14  ? -14.680 -27.103 -8.254  1.00 26.16 ? 76  ARG A O   1 
ATOM   93   C CB  . ARG A 1 14  ? -15.601 -28.654 -10.811 1.00 26.80 ? 76  ARG A CB  1 
ATOM   94   C CG  . ARG A 1 14  ? -15.691 -28.357 -12.310 1.00 28.71 ? 76  ARG A CG  1 
ATOM   95   C CD  . ARG A 1 14  ? -16.856 -29.140 -12.946 1.00 31.27 ? 76  ARG A CD  1 
ATOM   96   N NE  . ARG A 1 14  ? -16.881 -29.035 -14.410 1.00 32.41 ? 76  ARG A NE  1 
ATOM   97   C CZ  . ARG A 1 14  ? -17.672 -29.764 -15.198 1.00 34.58 ? 76  ARG A CZ  1 
ATOM   98   N NH1 . ARG A 1 14  ? -18.499 -30.678 -14.680 1.00 33.33 ? 76  ARG A NH1 1 
ATOM   99   N NH2 . ARG A 1 14  ? -17.640 -29.585 -16.513 1.00 35.63 ? 76  ARG A NH2 1 
ATOM   100  N N   . THR A 1 15  ? -13.978 -29.207 -7.897  1.00 25.89 ? 77  THR A N   1 
ATOM   101  C CA  . THR A 1 15  ? -14.236 -29.126 -6.458  1.00 26.13 ? 77  THR A CA  1 
ATOM   102  C C   . THR A 1 15  ? -13.014 -29.152 -5.570  1.00 26.08 ? 77  THR A C   1 
ATOM   103  O O   . THR A 1 15  ? -13.075 -28.653 -4.470  1.00 27.24 ? 77  THR A O   1 
ATOM   104  C CB  . THR A 1 15  ? -15.219 -30.206 -5.958  1.00 26.15 ? 77  THR A CB  1 
ATOM   105  O OG1 . THR A 1 15  ? -14.615 -31.499 -6.069  1.00 26.43 ? 77  THR A OG1 1 
ATOM   106  C CG2 . THR A 1 15  ? -16.561 -30.154 -6.736  1.00 25.61 ? 77  THR A CG2 1 
ATOM   107  N N   . ALA A 1 16  ? -11.915 -29.726 -6.040  1.00 25.92 ? 78  ALA A N   1 
ATOM   108  C CA  . ALA A 1 16  ? -10.652 -29.724 -5.307  1.00 25.74 ? 78  ALA A CA  1 
ATOM   109  C C   . ALA A 1 16  ? -10.164 -28.327 -4.919  1.00 26.06 ? 78  ALA A C   1 
ATOM   110  O O   . ALA A 1 16  ? -10.400 -27.331 -5.624  1.00 26.23 ? 78  ALA A O   1 
ATOM   111  C CB  . ALA A 1 16  ? -9.575  -30.459 -6.104  1.00 25.28 ? 78  ALA A CB  1 
ATOM   112  N N   . GLY A 1 17  ? -9.456  -28.265 -3.799  1.00 26.42 ? 79  GLY A N   1 
ATOM   113  C CA  . GLY A 1 17  ? -8.969  -27.005 -3.276  1.00 26.70 ? 79  GLY A CA  1 
ATOM   114  C C   . GLY A 1 17  ? -8.143  -27.178 -2.023  1.00 27.12 ? 79  GLY A C   1 
ATOM   115  O O   . GLY A 1 17  ? -8.446  -28.019 -1.169  1.00 27.17 ? 79  GLY A O   1 
ATOM   116  N N   . HIS A 1 18  ? -7.072  -26.393 -1.939  1.00 27.35 ? 80  HIS A N   1 
ATOM   117  C CA  . HIS A 1 18  ? -6.235  -26.315 -0.752  1.00 27.44 ? 80  HIS A CA  1 
ATOM   118  C C   . HIS A 1 18  ? -5.715  -24.878 -0.598  1.00 27.34 ? 80  HIS A C   1 
ATOM   119  O O   . HIS A 1 18  ? -4.530  -24.623 -0.797  1.00 27.19 ? 80  HIS A O   1 
ATOM   120  C CB  . HIS A 1 18  ? -5.092  -27.355 -0.807  1.00 27.20 ? 80  HIS A CB  1 
ATOM   121  C CG  . HIS A 1 18  ? -4.306  -27.477 0.468   1.00 26.87 ? 80  HIS A CG  1 
ATOM   122  N ND1 . HIS A 1 18  ? -3.194  -28.286 0.576   1.00 26.43 ? 80  HIS A ND1 1 
ATOM   123  C CD2 . HIS A 1 18  ? -4.456  -26.881 1.677   1.00 25.78 ? 80  HIS A CD2 1 
ATOM   124  C CE1 . HIS A 1 18  ? -2.704  -28.195 1.801   1.00 26.37 ? 80  HIS A CE1 1 
ATOM   125  N NE2 . HIS A 1 18  ? -3.447  -27.343 2.486   1.00 26.17 ? 80  HIS A NE2 1 
ATOM   126  N N   . PRO A 1 19  ? -6.612  -23.935 -0.249  1.00 27.85 ? 81  PRO A N   1 
ATOM   127  C CA  . PRO A 1 19  ? -6.192  -22.553 -0.047  1.00 28.11 ? 81  PRO A CA  1 
ATOM   128  C C   . PRO A 1 19  ? -5.240  -22.445 1.141   1.00 28.55 ? 81  PRO A C   1 
ATOM   129  O O   . PRO A 1 19  ? -5.521  -22.963 2.234   1.00 28.61 ? 81  PRO A O   1 
ATOM   130  C CB  . PRO A 1 19  ? -7.505  -21.822 0.236   1.00 27.78 ? 81  PRO A CB  1 
ATOM   131  C CG  . PRO A 1 19  ? -8.411  -22.851 0.737   1.00 27.55 ? 81  PRO A CG  1 
ATOM   132  C CD  . PRO A 1 19  ? -8.061  -24.090 -0.015  1.00 28.18 ? 81  PRO A CD  1 
ATOM   133  N N   . LEU A 1 20  ? -4.100  -21.814 0.896   1.00 28.39 ? 82  LEU A N   1 
ATOM   134  C CA  . LEU A 1 20  ? -3.099  -21.637 1.918   1.00 28.22 ? 82  LEU A CA  1 
ATOM   135  C C   . LEU A 1 20  ? -3.137  -20.191 2.385   1.00 28.04 ? 82  LEU A C   1 
ATOM   136  O O   . LEU A 1 20  ? -3.263  -19.289 1.554   1.00 27.98 ? 82  LEU A O   1 
ATOM   137  C CB  . LEU A 1 20  ? -1.726  -21.987 1.346   1.00 28.23 ? 82  LEU A CB  1 
ATOM   138  C CG  . LEU A 1 20  ? -1.541  -23.422 0.822   1.00 28.55 ? 82  LEU A CG  1 
ATOM   139  C CD1 . LEU A 1 20  ? -0.254  -23.529 -0.003  1.00 27.14 ? 82  LEU A CD1 1 
ATOM   140  C CD2 . LEU A 1 20  ? -1.548  -24.462 1.970   1.00 28.06 ? 82  LEU A CD2 1 
ATOM   141  N N   . THR A 1 21  ? -3.054  -19.960 3.700   1.00 27.90 ? 83  THR A N   1 
ATOM   142  C CA  . THR A 1 21  ? -2.815  -18.594 4.181   1.00 27.80 ? 83  THR A CA  1 
ATOM   143  C C   . THR A 1 21  ? -1.404  -18.174 3.740   1.00 28.52 ? 83  THR A C   1 
ATOM   144  O O   . THR A 1 21  ? -0.526  -19.024 3.499   1.00 28.31 ? 83  THR A O   1 
ATOM   145  C CB  . THR A 1 21  ? -2.974  -18.403 5.735   1.00 27.75 ? 83  THR A CB  1 
ATOM   146  O OG1 . THR A 1 21  ? -2.089  -19.271 6.455   1.00 27.52 ? 83  THR A OG1 1 
ATOM   147  C CG2 . THR A 1 21  ? -4.403  -18.641 6.192   1.00 26.89 ? 83  THR A CG2 1 
ATOM   148  N N   . ARG A 1 22  ? -1.205  -16.864 3.606   1.00 29.01 ? 84  ARG A N   1 
ATOM   149  C CA  . ARG A 1 22  ? 0.103   -16.285 3.297   1.00 28.75 ? 84  ARG A CA  1 
ATOM   150  C C   . ARG A 1 22  ? 1.137   -16.767 4.308   1.00 28.40 ? 84  ARG A C   1 
ATOM   151  O O   . ARG A 1 22  ? 2.247   -17.170 3.946   1.00 28.29 ? 84  ARG A O   1 
ATOM   152  C CB  . ARG A 1 22  ? 0.028   -14.754 3.333   1.00 28.82 ? 84  ARG A CB  1 
ATOM   153  C CG  . ARG A 1 22  ? 1.223   -14.085 2.688   1.00 29.60 ? 84  ARG A CG  1 
ATOM   154  C CD  . ARG A 1 22  ? 1.228   -12.602 2.904   1.00 30.32 ? 84  ARG A CD  1 
ATOM   155  N NE  . ARG A 1 22  ? 2.558   -12.069 2.630   1.00 30.97 ? 84  ARG A NE  1 
ATOM   156  C CZ  . ARG A 1 22  ? 2.919   -10.807 2.816   1.00 30.88 ? 84  ARG A CZ  1 
ATOM   157  N NH1 . ARG A 1 22  ? 2.046   -9.927  3.295   1.00 30.37 ? 84  ARG A NH1 1 
ATOM   158  N NH2 . ARG A 1 22  ? 4.163   -10.430 2.540   1.00 31.88 ? 84  ARG A NH2 1 
ATOM   159  N N   . TRP A 1 23  ? 0.764   -16.749 5.582   1.00 28.02 ? 85  TRP A N   1 
ATOM   160  C CA  . TRP A 1 23  ? 1.688   -17.194 6.620   1.00 27.87 ? 85  TRP A CA  1 
ATOM   161  C C   . TRP A 1 23  ? 2.152   -18.643 6.398   1.00 27.66 ? 85  TRP A C   1 
ATOM   162  O O   . TRP A 1 23  ? 3.346   -18.920 6.356   1.00 27.55 ? 85  TRP A O   1 
ATOM   163  C CB  . TRP A 1 23  ? 1.100   -17.016 8.022   1.00 27.05 ? 85  TRP A CB  1 
ATOM   164  C CG  . TRP A 1 23  ? 2.082   -17.455 9.042   1.00 27.95 ? 85  TRP A CG  1 
ATOM   165  C CD1 . TRP A 1 23  ? 3.124   -16.728 9.540   1.00 27.01 ? 85  TRP A CD1 1 
ATOM   166  C CD2 . TRP A 1 23  ? 2.166   -18.755 9.660   1.00 28.41 ? 85  TRP A CD2 1 
ATOM   167  N NE1 . TRP A 1 23  ? 3.828   -17.478 10.452  1.00 28.20 ? 85  TRP A NE1 1 
ATOM   168  C CE2 . TRP A 1 23  ? 3.264   -18.725 10.544  1.00 28.26 ? 85  TRP A CE2 1 
ATOM   169  C CE3 . TRP A 1 23  ? 1.408   -19.931 9.564   1.00 28.37 ? 85  TRP A CE3 1 
ATOM   170  C CZ2 . TRP A 1 23  ? 3.626   -19.827 11.327  1.00 28.09 ? 85  TRP A CZ2 1 
ATOM   171  C CZ3 . TRP A 1 23  ? 1.773   -21.029 10.343  1.00 27.49 ? 85  TRP A CZ3 1 
ATOM   172  C CH2 . TRP A 1 23  ? 2.879   -20.970 11.201  1.00 26.76 ? 85  TRP A CH2 1 
ATOM   173  N N   . ALA A 1 24  ? 1.184   -19.544 6.262   1.00 27.68 ? 86  ALA A N   1 
ATOM   174  C CA  . ALA A 1 24  ? 1.421   -20.964 6.010   1.00 27.60 ? 86  ALA A CA  1 
ATOM   175  C C   . ALA A 1 24  ? 2.320   -21.201 4.805   1.00 27.16 ? 86  ALA A C   1 
ATOM   176  O O   . ALA A 1 24  ? 3.302   -21.951 4.899   1.00 27.05 ? 86  ALA A O   1 
ATOM   177  C CB  . ALA A 1 24  ? 0.080   -21.714 5.835   1.00 27.52 ? 86  ALA A CB  1 
ATOM   178  N N   . LEU A 1 25  ? 1.992   -20.554 3.690   1.00 26.33 ? 87  LEU A N   1 
ATOM   179  C CA  . LEU A 1 25  ? 2.817   -20.626 2.478   1.00 26.07 ? 87  LEU A CA  1 
ATOM   180  C C   . LEU A 1 25  ? 4.272   -20.228 2.733   1.00 25.75 ? 87  LEU A C   1 
ATOM   181  O O   . LEU A 1 25  ? 5.196   -20.864 2.237   1.00 25.93 ? 87  LEU A O   1 
ATOM   182  C CB  . LEU A 1 25  ? 2.234   -19.725 1.379   1.00 25.84 ? 87  LEU A CB  1 
ATOM   183  C CG  . LEU A 1 25  ? 3.015   -19.642 0.069   1.00 26.27 ? 87  LEU A CG  1 
ATOM   184  C CD1 . LEU A 1 25  ? 2.877   -20.941 -0.746  1.00 27.17 ? 87  LEU A CD1 1 
ATOM   185  C CD2 . LEU A 1 25  ? 2.565   -18.453 -0.727  1.00 26.28 ? 87  LEU A CD2 1 
ATOM   186  N N   . GLN A 1 26  ? 4.466   -19.173 3.512   1.00 25.30 ? 88  GLN A N   1 
ATOM   187  C CA  . GLN A 1 26  ? 5.797   -18.619 3.713   1.00 25.19 ? 88  GLN A CA  1 
ATOM   188  C C   . GLN A 1 26  ? 6.606   -19.376 4.761   1.00 24.92 ? 88  GLN A C   1 
ATOM   189  O O   . GLN A 1 26  ? 7.803   -19.566 4.595   1.00 24.41 ? 88  GLN A O   1 
ATOM   190  C CB  . GLN A 1 26  ? 5.718   -17.129 4.095   1.00 25.05 ? 88  GLN A CB  1 
ATOM   191  C CG  . GLN A 1 26  ? 5.335   -16.182 2.964   1.00 24.41 ? 88  GLN A CG  1 
ATOM   192  C CD  . GLN A 1 26  ? 5.493   -14.735 3.379   1.00 25.25 ? 88  GLN A CD  1 
ATOM   193  O OE1 . GLN A 1 26  ? 4.600   -14.154 3.989   1.00 27.48 ? 88  GLN A OE1 1 
ATOM   194  N NE2 . GLN A 1 26  ? 6.644   -14.150 3.072   1.00 25.11 ? 88  GLN A NE2 1 
ATOM   195  N N   . ARG A 1 27  ? 5.942   -19.813 5.826   1.00 25.06 ? 89  ARG A N   1 
ATOM   196  C CA  . ARG A 1 27  ? 6.627   -20.167 7.064   1.00 25.43 ? 89  ARG A CA  1 
ATOM   197  C C   . ARG A 1 27  ? 6.370   -21.590 7.509   1.00 26.51 ? 89  ARG A C   1 
ATOM   198  O O   . ARG A 1 27  ? 6.974   -22.066 8.453   1.00 26.94 ? 89  ARG A O   1 
ATOM   199  C CB  . ARG A 1 27  ? 6.195   -19.221 8.181   1.00 25.04 ? 89  ARG A CB  1 
ATOM   200  C CG  . ARG A 1 27  ? 6.466   -17.732 7.937   1.00 24.21 ? 89  ARG A CG  1 
ATOM   201  C CD  . ARG A 1 27  ? 7.907   -17.360 8.255   1.00 21.94 ? 89  ARG A CD  1 
ATOM   202  N NE  . ARG A 1 27  ? 8.256   -16.006 7.819   1.00 20.02 ? 89  ARG A NE  1 
ATOM   203  C CZ  . ARG A 1 27  ? 8.317   -14.938 8.609   1.00 17.80 ? 89  ARG A CZ  1 
ATOM   204  N NH1 . ARG A 1 27  ? 8.051   -15.037 9.902   1.00 16.73 ? 89  ARG A NH1 1 
ATOM   205  N NH2 . ARG A 1 27  ? 8.655   -13.759 8.099   1.00 18.96 ? 89  ARG A NH2 1 
ATOM   206  N N   . GLN A 1 28  ? 5.462   -22.269 6.829   1.00 28.08 ? 90  GLN A N   1 
ATOM   207  C CA  . GLN A 1 28  ? 5.055   -23.599 7.224   1.00 29.08 ? 90  GLN A CA  1 
ATOM   208  C C   . GLN A 1 28  ? 4.444   -24.275 6.016   1.00 29.55 ? 90  GLN A C   1 
ATOM   209  O O   . GLN A 1 28  ? 3.264   -24.609 6.047   1.00 29.49 ? 90  GLN A O   1 
ATOM   210  C CB  . GLN A 1 28  ? 4.004   -23.505 8.326   1.00 29.20 ? 90  GLN A CB  1 
ATOM   211  C CG  . GLN A 1 28  ? 3.903   -24.738 9.187   1.00 31.05 ? 90  GLN A CG  1 
ATOM   212  C CD  . GLN A 1 28  ? 2.473   -25.031 9.575   1.00 35.74 ? 90  GLN A CD  1 
ATOM   213  O OE1 . GLN A 1 28  ? 1.697   -25.562 8.763   1.00 37.09 ? 90  GLN A OE1 1 
ATOM   214  N NE2 . GLN A 1 28  ? 2.107   -24.694 10.821  1.00 35.50 ? 90  GLN A NE2 1 
ATOM   215  N N   . PRO A 1 29  ? 5.230   -24.445 4.932   1.00 30.09 ? 91  PRO A N   1 
ATOM   216  C CA  . PRO A 1 29  ? 4.680   -25.001 3.708   1.00 31.16 ? 91  PRO A CA  1 
ATOM   217  C C   . PRO A 1 29  ? 4.342   -26.486 3.826   1.00 32.37 ? 91  PRO A C   1 
ATOM   218  O O   . PRO A 1 29  ? 4.756   -27.132 4.789   1.00 32.73 ? 91  PRO A O   1 
ATOM   219  C CB  . PRO A 1 29  ? 5.808   -24.778 2.690   1.00 31.17 ? 91  PRO A CB  1 
ATOM   220  C CG  . PRO A 1 29  ? 7.042   -24.806 3.510   1.00 30.42 ? 91  PRO A CG  1 
ATOM   221  C CD  . PRO A 1 29  ? 6.654   -24.101 4.777   1.00 30.09 ? 91  PRO A CD  1 
ATOM   222  N N   . PRO A 1 30  ? 3.600   -27.036 2.844   1.00 33.58 ? 92  PRO A N   1 
ATOM   223  C CA  . PRO A 1 30  ? 3.375   -28.480 2.876   1.00 34.02 ? 92  PRO A CA  1 
ATOM   224  C C   . PRO A 1 30  ? 4.690   -29.128 2.499   1.00 34.36 ? 92  PRO A C   1 
ATOM   225  O O   . PRO A 1 30  ? 5.361   -28.611 1.593   1.00 34.57 ? 92  PRO A O   1 
ATOM   226  C CB  . PRO A 1 30  ? 2.345   -28.716 1.763   1.00 34.70 ? 92  PRO A CB  1 
ATOM   227  C CG  . PRO A 1 30  ? 1.862   -27.336 1.315   1.00 34.73 ? 92  PRO A CG  1 
ATOM   228  C CD  . PRO A 1 30  ? 2.992   -26.397 1.657   1.00 34.08 ? 92  PRO A CD  1 
ATOM   229  N N   . SER A 1 31  ? 5.081   -30.201 3.200   1.00 33.87 ? 93  SER A N   1 
ATOM   230  C CA  . SER A 1 31  ? 6.339   -30.903 2.906   1.00 33.83 ? 93  SER A CA  1 
ATOM   231  C C   . SER A 1 31  ? 6.395   -31.321 1.428   1.00 33.46 ? 93  SER A C   1 
ATOM   232  O O   . SER A 1 31  ? 5.354   -31.509 0.821   1.00 34.22 ? 93  SER A O   1 
ATOM   233  C CB  . SER A 1 31  ? 6.530   -32.122 3.828   1.00 33.79 ? 93  SER A CB  1 
ATOM   234  O OG  . SER A 1 31  ? 5.507   -33.089 3.665   1.00 33.90 ? 93  SER A OG  1 
ATOM   235  N N   . PRO A 1 32  ? 7.600   -31.432 0.836   1.00 33.10 ? 94  PRO A N   1 
ATOM   236  C CA  . PRO A 1 32  ? 7.731   -31.934 -0.546  1.00 32.68 ? 94  PRO A CA  1 
ATOM   237  C C   . PRO A 1 32  ? 6.926   -33.201 -0.864  1.00 32.30 ? 94  PRO A C   1 
ATOM   238  O O   . PRO A 1 32  ? 6.348   -33.297 -1.949  1.00 31.67 ? 94  PRO A O   1 
ATOM   239  C CB  . PRO A 1 32  ? 9.234   -32.200 -0.667  1.00 32.28 ? 94  PRO A CB  1 
ATOM   240  C CG  . PRO A 1 32  ? 9.826   -31.156 0.187   1.00 32.27 ? 94  PRO A CG  1 
ATOM   241  C CD  . PRO A 1 32  ? 8.919   -31.059 1.387   1.00 32.96 ? 94  PRO A CD  1 
ATOM   242  N N   . LYS A 1 33  ? 6.889   -34.149 0.078   1.00 32.38 ? 95  LYS A N   1 
ATOM   243  C CA  . LYS A 1 33  ? 6.115   -35.385 -0.080  1.00 32.04 ? 95  LYS A CA  1 
ATOM   244  C C   . LYS A 1 33  ? 4.610   -35.106 -0.132  1.00 31.89 ? 95  LYS A C   1 
ATOM   245  O O   . LYS A 1 33  ? 3.923   -35.641 -0.992  1.00 31.42 ? 95  LYS A O   1 
ATOM   246  C CB  . LYS A 1 33  ? 6.443   -36.395 1.026   1.00 32.21 ? 95  LYS A CB  1 
ATOM   247  C CG  . LYS A 1 33  ? 6.261   -37.873 0.621   1.00 31.93 ? 95  LYS A CG  1 
ATOM   248  N N   . GLN A 1 34  ? 4.110   -34.271 0.780   1.00 31.54 ? 96  GLN A N   1 
ATOM   249  C CA  . GLN A 1 34  ? 2.705   -33.866 0.754   1.00 32.15 ? 96  GLN A CA  1 
ATOM   250  C C   . GLN A 1 34  ? 2.326   -33.246 -0.595  1.00 31.46 ? 96  GLN A C   1 
ATOM   251  O O   . GLN A 1 34  ? 1.225   -33.443 -1.085  1.00 31.61 ? 96  GLN A O   1 
ATOM   252  C CB  . GLN A 1 34  ? 2.394   -32.847 1.855   1.00 32.30 ? 96  GLN A CB  1 
ATOM   253  C CG  . GLN A 1 34  ? 2.388   -33.344 3.318   1.00 33.13 ? 96  GLN A CG  1 
ATOM   254  C CD  . GLN A 1 34  ? 1.961   -32.212 4.292   1.00 33.84 ? 96  GLN A CD  1 
ATOM   255  O OE1 . GLN A 1 34  ? 2.804   -31.523 4.880   1.00 35.17 ? 96  GLN A OE1 1 
ATOM   256  N NE2 . GLN A 1 34  ? 0.647   -31.992 4.411   1.00 35.52 ? 96  GLN A NE2 1 
ATOM   257  N N   . LEU A 1 35  ? 3.241   -32.492 -1.189  1.00 30.99 ? 97  LEU A N   1 
ATOM   258  C CA  . LEU A 1 35  ? 2.969   -31.832 -2.454  1.00 30.84 ? 97  LEU A CA  1 
ATOM   259  C C   . LEU A 1 35  ? 2.937   -32.793 -3.643  1.00 30.83 ? 97  LEU A C   1 
ATOM   260  O O   . LEU A 1 35  ? 2.152   -32.585 -4.564  1.00 30.76 ? 97  LEU A O   1 
ATOM   261  C CB  . LEU A 1 35  ? 3.962   -30.693 -2.699  1.00 30.86 ? 97  LEU A CB  1 
ATOM   262  C CG  . LEU A 1 35  ? 3.863   -29.498 -1.742  1.00 30.59 ? 97  LEU A CG  1 
ATOM   263  C CD1 . LEU A 1 35  ? 5.058   -28.537 -1.887  1.00 29.62 ? 97  LEU A CD1 1 
ATOM   264  C CD2 . LEU A 1 35  ? 2.536   -28.764 -1.925  1.00 28.01 ? 97  LEU A CD2 1 
ATOM   265  N N   . GLU A 1 36  ? 3.783   -33.829 -3.615  1.00 30.78 ? 98  GLU A N   1 
ATOM   266  C CA  . GLU A 1 36  ? 3.792   -34.887 -4.641  1.00 31.26 ? 98  GLU A CA  1 
ATOM   267  C C   . GLU A 1 36  ? 2.486   -35.659 -4.649  1.00 30.99 ? 98  GLU A C   1 
ATOM   268  O O   . GLU A 1 36  ? 1.824   -35.765 -5.681  1.00 30.90 ? 98  GLU A O   1 
ATOM   269  C CB  . GLU A 1 36  ? 4.954   -35.872 -4.444  1.00 31.25 ? 98  GLU A CB  1 
ATOM   270  C CG  . GLU A 1 36  ? 6.279   -35.298 -4.822  1.00 34.50 ? 98  GLU A CG  1 
ATOM   271  C CD  . GLU A 1 36  ? 7.329   -36.345 -5.116  1.00 39.15 ? 98  GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 36  ? 7.279   -36.972 -6.204  1.00 40.17 ? 98  GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 36  ? 8.228   -36.514 -4.261  1.00 41.49 ? 98  GLU A OE2 1 
ATOM   274  N N   . GLU A 1 37  ? 2.135   -36.199 -3.487  1.00 30.82 ? 99  GLU A N   1 
ATOM   275  C CA  . GLU A 1 37  ? 0.859   -36.851 -3.283  1.00 30.89 ? 99  GLU A CA  1 
ATOM   276  C C   . GLU A 1 37  ? -0.282  -36.009 -3.871  1.00 30.33 ? 99  GLU A C   1 
ATOM   277  O O   . GLU A 1 37  ? -1.008  -36.472 -4.750  1.00 30.37 ? 99  GLU A O   1 
ATOM   278  C CB  . GLU A 1 37  ? 0.641   -37.142 -1.796  1.00 30.20 ? 99  GLU A CB  1 
ATOM   279  C CG  . GLU A 1 37  ? 1.573   -38.216 -1.262  1.00 30.70 ? 99  GLU A CG  1 
ATOM   280  C CD  . GLU A 1 37  ? 1.702   -38.225 0.275   1.00 32.04 ? 99  GLU A CD  1 
ATOM   281  O OE1 . GLU A 1 37  ? 1.309   -37.233 0.941   1.00 34.20 ? 99  GLU A OE1 1 
ATOM   282  O OE2 . GLU A 1 37  ? 2.208   -39.235 0.818   1.00 32.31 ? 99  GLU A OE2 1 
ATOM   283  N N   . GLU A 1 38  ? -0.400  -34.774 -3.406  1.00 29.71 ? 100 GLU A N   1 
ATOM   284  C CA  . GLU A 1 38  ? -1.419  -33.840 -3.878  1.00 29.28 ? 100 GLU A CA  1 
ATOM   285  C C   . GLU A 1 38  ? -1.438  -33.695 -5.396  1.00 28.71 ? 100 GLU A C   1 
ATOM   286  O O   . GLU A 1 38  ? -2.501  -33.766 -6.006  1.00 28.97 ? 100 GLU A O   1 
ATOM   287  C CB  . GLU A 1 38  ? -1.202  -32.479 -3.225  1.00 29.12 ? 100 GLU A CB  1 
ATOM   288  C CG  . GLU A 1 38  ? -2.258  -31.441 -3.503  1.00 29.31 ? 100 GLU A CG  1 
ATOM   289  C CD  . GLU A 1 38  ? -1.964  -30.154 -2.741  1.00 29.83 ? 100 GLU A CD  1 
ATOM   290  O OE1 . GLU A 1 38  ? -2.220  -30.106 -1.509  1.00 29.68 ? 100 GLU A OE1 1 
ATOM   291  O OE2 . GLU A 1 38  ? -1.451  -29.207 -3.366  1.00 27.97 ? 100 GLU A OE2 1 
ATOM   292  N N   . PHE A 1 39  ? -0.268  -33.488 -5.994  1.00 28.31 ? 101 PHE A N   1 
ATOM   293  C CA  . PHE A 1 39  ? -0.124  -33.385 -7.463  1.00 27.81 ? 101 PHE A CA  1 
ATOM   294  C C   . PHE A 1 39  ? -0.545  -34.671 -8.186  1.00 27.14 ? 101 PHE A C   1 
ATOM   295  O O   . PHE A 1 39  ? -1.177  -34.626 -9.235  1.00 27.69 ? 101 PHE A O   1 
ATOM   296  C CB  . PHE A 1 39  ? 1.327   -33.030 -7.843  1.00 27.38 ? 101 PHE A CB  1 
ATOM   297  C CG  . PHE A 1 39  ? 1.516   -32.695 -9.303  1.00 26.56 ? 101 PHE A CG  1 
ATOM   298  C CD1 . PHE A 1 39  ? 1.121   -31.450 -9.804  1.00 25.82 ? 101 PHE A CD1 1 
ATOM   299  C CD2 . PHE A 1 39  ? 2.091   -33.618 -10.172 1.00 24.21 ? 101 PHE A CD2 1 
ATOM   300  C CE1 . PHE A 1 39  ? 1.293   -31.133 -11.147 1.00 24.43 ? 101 PHE A CE1 1 
ATOM   301  C CE2 . PHE A 1 39  ? 2.279   -33.310 -11.518 1.00 23.19 ? 101 PHE A CE2 1 
ATOM   302  C CZ  . PHE A 1 39  ? 1.878   -32.065 -12.006 1.00 24.18 ? 101 PHE A CZ  1 
ATOM   303  N N   . LEU A 1 40  ? -0.201  -35.807 -7.604  1.00 26.63 ? 102 LEU A N   1 
ATOM   304  C CA  . LEU A 1 40  ? -0.454  -37.097 -8.219  1.00 26.59 ? 102 LEU A CA  1 
ATOM   305  C C   . LEU A 1 40  ? -1.931  -37.441 -8.355  1.00 26.73 ? 102 LEU A C   1 
ATOM   306  O O   . LEU A 1 40  ? -2.298  -38.188 -9.271  1.00 26.33 ? 102 LEU A O   1 
ATOM   307  C CB  . LEU A 1 40  ? 0.269   -38.202 -7.466  1.00 26.42 ? 102 LEU A CB  1 
ATOM   308  C CG  . LEU A 1 40  ? 1.743   -38.351 -7.821  1.00 27.43 ? 102 LEU A CG  1 
ATOM   309  C CD1 . LEU A 1 40  ? 2.289   -39.464 -6.980  1.00 27.29 ? 102 LEU A CD1 1 
ATOM   310  C CD2 . LEU A 1 40  ? 1.959   -38.640 -9.318  1.00 27.74 ? 102 LEU A CD2 1 
ATOM   311  N N   . LYS A 1 41  ? -2.755  -36.897 -7.453  1.00 26.68 ? 103 LYS A N   1 
ATOM   312  C CA  . LYS A 1 41  ? -4.211  -37.054 -7.493  1.00 26.99 ? 103 LYS A CA  1 
ATOM   313  C C   . LYS A 1 41  ? -4.826  -36.186 -8.584  1.00 27.03 ? 103 LYS A C   1 
ATOM   314  O O   . LYS A 1 41  ? -5.993  -36.354 -8.897  1.00 27.25 ? 103 LYS A O   1 
ATOM   315  C CB  . LYS A 1 41  ? -4.862  -36.613 -6.176  1.00 27.20 ? 103 LYS A CB  1 
ATOM   316  C CG  . LYS A 1 41  ? -4.692  -37.510 -4.956  1.00 27.35 ? 103 LYS A CG  1 
ATOM   317  C CD  . LYS A 1 41  ? -5.058  -36.681 -3.703  1.00 27.26 ? 103 LYS A CD  1 
ATOM   318  N N   . ILE A 1 42  ? -4.078  -35.231 -9.130  1.00 27.08 ? 104 ILE A N   1 
ATOM   319  C CA  . ILE A 1 42  ? -4.683  -34.311 -10.102 1.00 27.42 ? 104 ILE A CA  1 
ATOM   320  C C   . ILE A 1 42  ? -4.758  -34.974 -11.475 1.00 27.00 ? 104 ILE A C   1 
ATOM   321  O O   . ILE A 1 42  ? -3.738  -35.230 -12.091 1.00 27.48 ? 104 ILE A O   1 
ATOM   322  C CB  . ILE A 1 42  ? -3.943  -32.943 -10.224 1.00 27.29 ? 104 ILE A CB  1 
ATOM   323  C CG1 . ILE A 1 42  ? -3.716  -32.299 -8.856  1.00 26.87 ? 104 ILE A CG1 1 
ATOM   324  C CG2 . ILE A 1 42  ? -4.729  -31.982 -11.126 1.00 26.98 ? 104 ILE A CG2 1 
ATOM   325  C CD1 . ILE A 1 42  ? -3.176  -30.852 -8.983  1.00 27.74 ? 104 ILE A CD1 1 
ATOM   326  N N   . PRO A 1 43  ? -5.971  -35.222 -11.972 1.00 26.75 ? 105 PRO A N   1 
ATOM   327  C CA  . PRO A 1 43  ? -6.100  -35.946 -13.242 1.00 26.74 ? 105 PRO A CA  1 
ATOM   328  C C   . PRO A 1 43  ? -5.621  -35.095 -14.423 1.00 26.82 ? 105 PRO A C   1 
ATOM   329  O O   . PRO A 1 43  ? -5.617  -33.862 -14.353 1.00 26.58 ? 105 PRO A O   1 
ATOM   330  C CB  . PRO A 1 43  ? -7.600  -36.224 -13.342 1.00 26.96 ? 105 PRO A CB  1 
ATOM   331  C CG  . PRO A 1 43  ? -8.184  -35.833 -11.955 1.00 27.02 ? 105 PRO A CG  1 
ATOM   332  C CD  . PRO A 1 43  ? -7.268  -34.815 -11.415 1.00 26.33 ? 105 PRO A CD  1 
ATOM   333  N N   . SER A 1 44  ? -5.199  -35.759 -15.487 1.00 26.77 ? 106 SER A N   1 
ATOM   334  C CA  . SER A 1 44  ? -4.575  -35.080 -16.611 1.00 26.83 ? 106 SER A CA  1 
ATOM   335  C C   . SER A 1 44  ? -5.558  -34.286 -17.460 1.00 26.69 ? 106 SER A C   1 
ATOM   336  O O   . SER A 1 44  ? -5.283  -33.138 -17.818 1.00 26.83 ? 106 SER A O   1 
ATOM   337  C CB  . SER A 1 44  ? -3.797  -36.078 -17.473 1.00 27.14 ? 106 SER A CB  1 
ATOM   338  O OG  . SER A 1 44  ? -2.504  -36.328 -16.927 1.00 27.54 ? 106 SER A OG  1 
ATOM   339  N N   . ASN A 1 45  ? -6.698  -34.905 -17.767 1.00 26.64 ? 107 ASN A N   1 
ATOM   340  C CA  . ASN A 1 45  ? -7.758  -34.316 -18.594 1.00 26.37 ? 107 ASN A CA  1 
ATOM   341  C C   . ASN A 1 45  ? -7.353  -34.167 -20.072 1.00 26.40 ? 107 ASN A C   1 
ATOM   342  O O   . ASN A 1 45  ? -7.843  -33.280 -20.779 1.00 26.54 ? 107 ASN A O   1 
ATOM   343  C CB  . ASN A 1 45  ? -8.269  -32.990 -17.987 1.00 26.24 ? 107 ASN A CB  1 
ATOM   344  C CG  . ASN A 1 45  ? -9.655  -32.559 -18.534 1.00 25.99 ? 107 ASN A CG  1 
ATOM   345  O OD1 . ASN A 1 45  ? -10.463 -33.386 -18.955 1.00 25.46 ? 107 ASN A OD1 1 
ATOM   346  N ND2 . ASN A 1 45  ? -9.916  -31.257 -18.518 1.00 24.44 ? 107 ASN A ND2 1 
ATOM   347  N N   . PHE A 1 46  ? -6.466  -35.041 -20.532 1.00 26.68 ? 108 PHE A N   1 
ATOM   348  C CA  . PHE A 1 46  ? -6.023  -35.024 -21.926 1.00 27.47 ? 108 PHE A CA  1 
ATOM   349  C C   . PHE A 1 46  ? -7.165  -35.444 -22.824 1.00 27.58 ? 108 PHE A C   1 
ATOM   350  O O   . PHE A 1 46  ? -7.954  -36.307 -22.449 1.00 27.17 ? 108 PHE A O   1 
ATOM   351  C CB  . PHE A 1 46  ? -4.865  -35.998 -22.171 1.00 27.55 ? 108 PHE A CB  1 
ATOM   352  C CG  . PHE A 1 46  ? -3.534  -35.518 -21.674 1.00 27.60 ? 108 PHE A CG  1 
ATOM   353  C CD1 . PHE A 1 46  ? -2.794  -36.302 -20.794 1.00 28.48 ? 108 PHE A CD1 1 
ATOM   354  C CD2 . PHE A 1 46  ? -3.008  -34.301 -22.097 1.00 28.61 ? 108 PHE A CD2 1 
ATOM   355  C CE1 . PHE A 1 46  ? -1.549  -35.871 -20.320 1.00 29.92 ? 108 PHE A CE1 1 
ATOM   356  C CE2 . PHE A 1 46  ? -1.763  -33.858 -21.637 1.00 29.27 ? 108 PHE A CE2 1 
ATOM   357  C CZ  . PHE A 1 46  ? -1.033  -34.646 -20.743 1.00 29.46 ? 108 PHE A CZ  1 
ATOM   358  N N   . VAL A 1 47  ? -7.234  -34.823 -24.000 1.00 28.16 ? 109 VAL A N   1 
ATOM   359  C CA  . VAL A 1 47  ? -8.138  -35.245 -25.068 1.00 29.16 ? 109 VAL A CA  1 
ATOM   360  C C   . VAL A 1 47  ? -7.616  -36.503 -25.736 1.00 29.72 ? 109 VAL A C   1 
ATOM   361  O O   . VAL A 1 47  ? -6.421  -36.608 -26.036 1.00 29.16 ? 109 VAL A O   1 
ATOM   362  C CB  . VAL A 1 47  ? -8.245  -34.207 -26.231 1.00 29.01 ? 109 VAL A CB  1 
ATOM   363  C CG1 . VAL A 1 47  ? -9.663  -34.167 -26.762 1.00 29.60 ? 109 VAL A CG1 1 
ATOM   364  C CG2 . VAL A 1 47  ? -7.785  -32.836 -25.818 1.00 29.43 ? 109 VAL A CG2 1 
ATOM   365  N N   . SER A 1 48  ? -8.522  -37.446 -25.978 1.00 30.98 ? 110 SER A N   1 
ATOM   366  C CA  . SER A 1 48  ? -8.278  -38.522 -26.930 1.00 32.61 ? 110 SER A CA  1 
ATOM   367  C C   . SER A 1 48  ? -8.222  -37.947 -28.355 1.00 33.50 ? 110 SER A C   1 
ATOM   368  O O   . SER A 1 48  ? -8.994  -37.054 -28.688 1.00 33.36 ? 110 SER A O   1 
ATOM   369  C CB  . SER A 1 48  ? -9.394  -39.571 -26.835 1.00 32.74 ? 110 SER A CB  1 
ATOM   370  O OG  . SER A 1 48  ? -10.676 -38.982 -27.029 1.00 33.05 ? 110 SER A OG  1 
ATOM   371  N N   . PRO A 1 49  ? -7.298  -38.447 -29.197 1.00 34.93 ? 111 PRO A N   1 
ATOM   372  C CA  . PRO A 1 49  ? -7.309  -38.130 -30.640 1.00 36.03 ? 111 PRO A CA  1 
ATOM   373  C C   . PRO A 1 49  ? -8.648  -38.441 -31.322 1.00 36.98 ? 111 PRO A C   1 
ATOM   374  O O   . PRO A 1 49  ? -9.035  -37.762 -32.276 1.00 37.10 ? 111 PRO A O   1 
ATOM   375  C CB  . PRO A 1 49  ? -6.221  -39.049 -31.210 1.00 35.98 ? 111 PRO A CB  1 
ATOM   376  C CG  . PRO A 1 49  ? -5.303  -39.288 -30.074 1.00 35.92 ? 111 PRO A CG  1 
ATOM   377  C CD  . PRO A 1 49  ? -6.164  -39.316 -28.836 1.00 35.09 ? 111 PRO A CD  1 
ATOM   378  N N   . GLU A 1 50  ? -9.352  -39.455 -30.828 1.00 38.16 ? 112 GLU A N   1 
ATOM   379  C CA  . GLU A 1 50  ? -10.635 -39.847 -31.416 1.00 39.31 ? 112 GLU A CA  1 
ATOM   380  C C   . GLU A 1 50  ? -11.776 -38.900 -30.985 1.00 39.73 ? 112 GLU A C   1 
ATOM   381  O O   . GLU A 1 50  ? -12.724 -38.678 -31.748 1.00 39.93 ? 112 GLU A O   1 
ATOM   382  C CB  . GLU A 1 50  ? -10.959 -41.324 -31.119 1.00 39.23 ? 112 GLU A CB  1 
ATOM   383  C CG  . GLU A 1 50  ? -9.732  -42.258 -31.056 1.00 40.19 ? 112 GLU A CG  1 
ATOM   384  C CD  . GLU A 1 50  ? -9.216  -42.480 -29.616 1.00 42.19 ? 112 GLU A CD  1 
ATOM   385  O OE1 . GLU A 1 50  ? -9.879  -43.197 -28.833 1.00 42.21 ? 112 GLU A OE1 1 
ATOM   386  O OE2 . GLU A 1 50  ? -8.140  -41.950 -29.261 1.00 43.09 ? 112 GLU A OE2 1 
ATOM   387  N N   . ASP A 1 51  ? -11.660 -38.323 -29.786 1.00 40.08 ? 113 ASP A N   1 
ATOM   388  C CA  . ASP A 1 51  ? -12.706 -37.456 -29.217 1.00 40.53 ? 113 ASP A CA  1 
ATOM   389  C C   . ASP A 1 51  ? -12.614 -35.984 -29.651 1.00 40.85 ? 113 ASP A C   1 
ATOM   390  O O   . ASP A 1 51  ? -13.330 -35.119 -29.132 1.00 40.74 ? 113 ASP A O   1 
ATOM   391  N N   . LEU A 1 52  ? -11.727 -35.706 -30.598 1.00 41.07 ? 114 LEU A N   1 
ATOM   392  C CA  . LEU A 1 52  ? -11.542 -34.354 -31.113 1.00 41.04 ? 114 LEU A CA  1 
ATOM   393  C C   . LEU A 1 52  ? -12.237 -34.218 -32.466 1.00 41.18 ? 114 LEU A C   1 
ATOM   394  O O   . LEU A 1 52  ? -12.839 -33.184 -32.755 1.00 41.27 ? 114 LEU A O   1 
ATOM   395  C CB  . LEU A 1 52  ? -10.050 -34.029 -31.216 1.00 40.88 ? 114 LEU A CB  1 
ATOM   396  C CG  . LEU A 1 52  ? -9.622  -32.718 -31.872 1.00 40.50 ? 114 LEU A CG  1 
ATOM   397  C CD1 . LEU A 1 52  ? -9.851  -31.504 -30.977 1.00 39.58 ? 114 LEU A CD1 1 
ATOM   398  C CD2 . LEU A 1 52  ? -8.172  -32.821 -32.262 1.00 40.74 ? 114 LEU A CD2 1 
ATOM   399  N N   . ASP A 1 53  ? -12.151 -35.275 -33.276 1.00 41.26 ? 115 ASP A N   1 
ATOM   400  C CA  . ASP A 1 53  ? -12.837 -35.377 -34.572 1.00 41.37 ? 115 ASP A CA  1 
ATOM   401  C C   . ASP A 1 53  ? -12.914 -34.076 -35.371 1.00 41.32 ? 115 ASP A C   1 
ATOM   402  O O   . ASP A 1 53  ? -13.984 -33.479 -35.516 1.00 41.37 ? 115 ASP A O   1 
ATOM   403  C CB  . ASP A 1 53  ? -14.234 -36.003 -34.415 1.00 41.58 ? 115 ASP A CB  1 
ATOM   404  N N   . ILE A 1 54  ? -11.758 -33.647 -35.868 1.00 41.23 ? 116 ILE A N   1 
ATOM   405  C CA  . ILE A 1 54  ? -11.654 -32.557 -36.837 1.00 41.00 ? 116 ILE A CA  1 
ATOM   406  C C   . ILE A 1 54  ? -10.540 -32.897 -37.853 1.00 40.89 ? 116 ILE A C   1 
ATOM   407  O O   . ILE A 1 54  ? -9.348  -32.845 -37.529 1.00 40.66 ? 116 ILE A O   1 
ATOM   408  C CB  . ILE A 1 54  ? -11.480 -31.149 -36.159 1.00 41.15 ? 116 ILE A CB  1 
ATOM   409  C CG1 . ILE A 1 54  ? -10.428 -31.174 -35.056 1.00 40.49 ? 116 ILE A CG1 1 
ATOM   410  C CG2 . ILE A 1 54  ? -12.808 -30.656 -35.552 1.00 41.37 ? 116 ILE A CG2 1 
ATOM   411  C CD1 . ILE A 1 54  ? -10.410 -29.917 -34.242 1.00 40.60 ? 116 ILE A CD1 1 
ATOM   412  N N   . PRO A 1 55  ? -10.939 -33.236 -39.096 1.00 40.86 ? 117 PRO A N   1 
ATOM   413  C CA  . PRO A 1 55  ? -10.121 -33.940 -40.110 1.00 40.62 ? 117 PRO A CA  1 
ATOM   414  C C   . PRO A 1 55  ? -8.798  -33.263 -40.519 1.00 40.30 ? 117 PRO A C   1 
ATOM   415  O O   . PRO A 1 55  ? -8.785  -32.076 -40.876 1.00 40.36 ? 117 PRO A O   1 
ATOM   416  C CB  . PRO A 1 55  ? -11.063 -34.023 -41.319 1.00 40.71 ? 117 PRO A CB  1 
ATOM   417  C CG  . PRO A 1 55  ? -12.038 -32.902 -41.107 1.00 40.95 ? 117 PRO A CG  1 
ATOM   418  C CD  . PRO A 1 55  ? -12.265 -32.878 -39.631 1.00 40.80 ? 117 PRO A CD  1 
ATOM   419  N N   . GLY A 1 56  ? -7.706  -34.032 -40.472 1.00 39.72 ? 118 GLY A N   1 
ATOM   420  C CA  . GLY A 1 56  ? -6.392  -33.591 -40.958 1.00 38.84 ? 118 GLY A CA  1 
ATOM   421  C C   . GLY A 1 56  ? -5.681  -32.584 -40.072 1.00 38.26 ? 118 GLY A C   1 
ATOM   422  O O   . GLY A 1 56  ? -4.822  -31.834 -40.540 1.00 38.01 ? 118 GLY A O   1 
ATOM   423  N N   . HIS A 1 57  ? -6.034  -32.573 -38.789 1.00 37.61 ? 119 HIS A N   1 
ATOM   424  C CA  . HIS A 1 57  ? -5.428  -31.666 -37.816 1.00 37.13 ? 119 HIS A CA  1 
ATOM   425  C C   . HIS A 1 57  ? -4.008  -32.095 -37.447 1.00 36.77 ? 119 HIS A C   1 
ATOM   426  O O   . HIS A 1 57  ? -3.248  -31.298 -36.897 1.00 36.62 ? 119 HIS A O   1 
ATOM   427  C CB  . HIS A 1 57  ? -6.280  -31.612 -36.538 1.00 37.16 ? 119 HIS A CB  1 
ATOM   428  C CG  . HIS A 1 57  ? -6.245  -32.884 -35.747 1.00 37.12 ? 119 HIS A CG  1 
ATOM   429  N ND1 . HIS A 1 57  ? -5.420  -33.060 -34.659 1.00 36.68 ? 119 HIS A ND1 1 
ATOM   430  C CD2 . HIS A 1 57  ? -6.895  -34.060 -35.920 1.00 36.65 ? 119 HIS A CD2 1 
ATOM   431  C CE1 . HIS A 1 57  ? -5.577  -34.284 -34.185 1.00 36.54 ? 119 HIS A CE1 1 
ATOM   432  N NE2 . HIS A 1 57  ? -6.470  -34.909 -34.928 1.00 35.28 ? 119 HIS A NE2 1 
ATOM   433  N N   . ALA A 1 58  ? -3.671  -33.353 -37.746 1.00 36.32 ? 120 ALA A N   1 
ATOM   434  C CA  . ALA A 1 58  ? -2.451  -34.015 -37.242 1.00 35.99 ? 120 ALA A CA  1 
ATOM   435  C C   . ALA A 1 58  ? -1.136  -33.266 -37.496 1.00 35.66 ? 120 ALA A C   1 
ATOM   436  O O   . ALA A 1 58  ? -0.283  -33.194 -36.599 1.00 35.31 ? 120 ALA A O   1 
ATOM   437  C CB  . ALA A 1 58  ? -2.358  -35.463 -37.763 1.00 35.76 ? 120 ALA A CB  1 
ATOM   438  N N   . SER A 1 59  ? -0.992  -32.694 -38.696 1.00 35.23 ? 121 SER A N   1 
ATOM   439  C CA  . SER A 1 59  ? 0.253   -32.024 -39.104 1.00 35.00 ? 121 SER A CA  1 
ATOM   440  C C   . SER A 1 59  ? 0.348   -30.545 -38.681 1.00 34.67 ? 121 SER A C   1 
ATOM   441  O O   . SER A 1 59  ? 1.158   -29.779 -39.222 1.00 34.95 ? 121 SER A O   1 
ATOM   442  C CB  . SER A 1 59  ? 0.479   -32.176 -40.613 1.00 34.97 ? 121 SER A CB  1 
ATOM   443  O OG  . SER A 1 59  ? -0.534  -31.517 -41.350 1.00 35.30 ? 121 SER A OG  1 
ATOM   444  N N   . LYS A 1 60  ? -0.482  -30.159 -37.716 1.00 34.08 ? 122 LYS A N   1 
ATOM   445  C CA  . LYS A 1 60  ? -0.457  -28.819 -37.127 1.00 33.58 ? 122 LYS A CA  1 
ATOM   446  C C   . LYS A 1 60  ? -0.305  -28.920 -35.598 1.00 33.33 ? 122 LYS A C   1 
ATOM   447  O O   . LYS A 1 60  ? -0.344  -27.920 -34.885 1.00 32.91 ? 122 LYS A O   1 
ATOM   448  C CB  . LYS A 1 60  ? -1.703  -28.016 -37.548 1.00 33.64 ? 122 LYS A CB  1 
ATOM   449  C CG  . LYS A 1 60  ? -1.695  -27.546 -39.020 1.00 33.49 ? 122 LYS A CG  1 
ATOM   450  C CD  . LYS A 1 60  ? -3.108  -27.328 -39.576 1.00 33.59 ? 122 LYS A CD  1 
ATOM   451  N N   . ASP A 1 61  ? -0.137  -30.155 -35.123 1.00 33.47 ? 123 ASP A N   1 
ATOM   452  C CA  . ASP A 1 61  ? 0.308   -30.447 -33.760 1.00 33.73 ? 123 ASP A CA  1 
ATOM   453  C C   . ASP A 1 61  ? 1.764   -30.896 -33.817 1.00 33.95 ? 123 ASP A C   1 
ATOM   454  O O   . ASP A 1 61  ? 2.178   -31.581 -34.762 1.00 33.53 ? 123 ASP A O   1 
ATOM   455  C CB  . ASP A 1 61  ? -0.540  -31.549 -33.117 1.00 33.34 ? 123 ASP A CB  1 
ATOM   456  C CG  . ASP A 1 61  ? -2.025  -31.344 -33.339 1.00 34.26 ? 123 ASP A CG  1 
ATOM   457  O OD1 . ASP A 1 61  ? -2.590  -30.407 -32.738 1.00 34.86 ? 123 ASP A OD1 1 
ATOM   458  O OD2 . ASP A 1 61  ? -2.634  -32.114 -34.119 1.00 35.47 ? 123 ASP A OD2 1 
ATOM   459  N N   . ARG A 1 62  ? 2.545   -30.499 -32.817 1.00 34.23 ? 124 ARG A N   1 
ATOM   460  C CA  . ARG A 1 62  ? 3.914   -30.983 -32.705 1.00 34.71 ? 124 ARG A CA  1 
ATOM   461  C C   . ARG A 1 62  ? 3.930   -32.380 -32.061 1.00 34.59 ? 124 ARG A C   1 
ATOM   462  O O   . ARG A 1 62  ? 4.741   -33.236 -32.443 1.00 34.47 ? 124 ARG A O   1 
ATOM   463  C CB  . ARG A 1 62  ? 4.796   -29.983 -31.947 1.00 34.89 ? 124 ARG A CB  1 
ATOM   464  C CG  . ARG A 1 62  ? 6.239   -30.451 -31.743 1.00 36.82 ? 124 ARG A CG  1 
ATOM   465  C CD  . ARG A 1 62  ? 7.254   -29.317 -31.807 1.00 39.07 ? 124 ARG A CD  1 
ATOM   466  N NE  . ARG A 1 62  ? 6.800   -28.117 -31.108 1.00 40.45 ? 124 ARG A NE  1 
ATOM   467  C CZ  . ARG A 1 62  ? 6.675   -26.916 -31.668 1.00 41.06 ? 124 ARG A CZ  1 
ATOM   468  N NH1 . ARG A 1 62  ? 6.987   -26.724 -32.946 1.00 41.21 ? 124 ARG A NH1 1 
ATOM   469  N NH2 . ARG A 1 62  ? 6.247   -25.898 -30.936 1.00 41.21 ? 124 ARG A NH2 1 
ATOM   470  N N   . TYR A 1 63  ? 3.021   -32.612 -31.113 1.00 34.38 ? 125 TYR A N   1 
ATOM   471  C CA  . TYR A 1 63  ? 2.910   -33.925 -30.463 1.00 34.82 ? 125 TYR A CA  1 
ATOM   472  C C   . TYR A 1 63  ? 1.512   -34.529 -30.601 1.00 34.71 ? 125 TYR A C   1 
ATOM   473  O O   . TYR A 1 63  ? 0.512   -33.874 -30.315 1.00 35.14 ? 125 TYR A O   1 
ATOM   474  C CB  . TYR A 1 63  ? 3.298   -33.849 -28.977 1.00 34.69 ? 125 TYR A CB  1 
ATOM   475  C CG  . TYR A 1 63  ? 4.591   -33.113 -28.696 1.00 34.72 ? 125 TYR A CG  1 
ATOM   476  C CD1 . TYR A 1 63  ? 4.575   -31.776 -28.309 1.00 33.77 ? 125 TYR A CD1 1 
ATOM   477  C CD2 . TYR A 1 63  ? 5.834   -33.752 -28.820 1.00 34.84 ? 125 TYR A CD2 1 
ATOM   478  C CE1 . TYR A 1 63  ? 5.751   -31.092 -28.039 1.00 34.41 ? 125 TYR A CE1 1 
ATOM   479  C CE2 . TYR A 1 63  ? 7.029   -33.066 -28.559 1.00 34.62 ? 125 TYR A CE2 1 
ATOM   480  C CZ  . TYR A 1 63  ? 6.973   -31.734 -28.158 1.00 34.86 ? 125 TYR A CZ  1 
ATOM   481  O OH  . TYR A 1 63  ? 8.126   -31.021 -27.887 1.00 34.38 ? 125 TYR A OH  1 
ATOM   482  N N   . LYS A 1 64  ? 1.469   -35.785 -31.023 1.00 34.77 ? 126 LYS A N   1 
ATOM   483  C CA  . LYS A 1 64  ? 0.229   -36.543 -31.228 1.00 34.95 ? 126 LYS A CA  1 
ATOM   484  C C   . LYS A 1 64  ? -0.636  -36.688 -29.966 1.00 35.07 ? 126 LYS A C   1 
ATOM   485  O O   . LYS A 1 64  ? -1.859  -36.797 -30.059 1.00 35.31 ? 126 LYS A O   1 
ATOM   486  C CB  . LYS A 1 64  ? 0.553   -37.937 -31.791 1.00 34.78 ? 126 LYS A CB  1 
ATOM   487  C CG  . LYS A 1 64  ? 1.202   -37.938 -33.175 1.00 34.72 ? 126 LYS A CG  1 
ATOM   488  N N   . THR A 1 65  ? 0.003   -36.687 -28.797 1.00 35.24 ? 127 THR A N   1 
ATOM   489  C CA  . THR A 1 65  ? -0.677  -36.930 -27.507 1.00 35.15 ? 127 THR A CA  1 
ATOM   490  C C   . THR A 1 65  ? -1.042  -35.630 -26.738 1.00 35.04 ? 127 THR A C   1 
ATOM   491  O O   . THR A 1 65  ? -1.584  -35.671 -25.618 1.00 34.85 ? 127 THR A O   1 
ATOM   492  C CB  . THR A 1 65  ? 0.183   -37.844 -26.599 1.00 35.08 ? 127 THR A CB  1 
ATOM   493  O OG1 . THR A 1 65  ? 1.443   -37.209 -26.348 1.00 35.53 ? 127 THR A OG1 1 
ATOM   494  C CG2 . THR A 1 65  ? 0.418   -39.213 -27.248 1.00 34.41 ? 127 THR A CG2 1 
ATOM   495  N N   . ILE A 1 66  ? -0.746  -34.484 -27.349 1.00 34.47 ? 128 ILE A N   1 
ATOM   496  C CA  . ILE A 1 66  ? -1.036  -33.188 -26.738 1.00 34.09 ? 128 ILE A CA  1 
ATOM   497  C C   . ILE A 1 66  ? -2.004  -32.396 -27.627 1.00 33.62 ? 128 ILE A C   1 
ATOM   498  O O   . ILE A 1 66  ? -1.588  -31.712 -28.580 1.00 33.71 ? 128 ILE A O   1 
ATOM   499  C CB  . ILE A 1 66  ? 0.282   -32.407 -26.406 1.00 34.23 ? 128 ILE A CB  1 
ATOM   500  C CG1 . ILE A 1 66  ? 1.049   -33.124 -25.284 1.00 34.27 ? 128 ILE A CG1 1 
ATOM   501  C CG2 . ILE A 1 66  ? -0.011  -30.964 -26.003 1.00 34.27 ? 128 ILE A CG2 1 
ATOM   502  C CD1 . ILE A 1 66  ? 2.573   -32.946 -25.325 1.00 33.63 ? 128 ILE A CD1 1 
ATOM   503  N N   . LEU A 1 67  ? -3.299  -32.520 -27.324 1.00 32.93 ? 129 LEU A N   1 
ATOM   504  C CA  . LEU A 1 67  ? -4.355  -31.904 -28.136 1.00 32.48 ? 129 LEU A CA  1 
ATOM   505  C C   . LEU A 1 67  ? -5.168  -30.856 -27.370 1.00 32.33 ? 129 LEU A C   1 
ATOM   506  O O   . LEU A 1 67  ? -5.305  -30.947 -26.147 1.00 31.92 ? 129 LEU A O   1 
ATOM   507  C CB  . LEU A 1 67  ? -5.280  -32.966 -28.731 1.00 32.26 ? 129 LEU A CB  1 
ATOM   508  C CG  . LEU A 1 67  ? -4.602  -34.086 -29.524 1.00 32.27 ? 129 LEU A CG  1 
ATOM   509  C CD1 . LEU A 1 67  ? -5.474  -35.309 -29.534 1.00 31.30 ? 129 LEU A CD1 1 
ATOM   510  C CD2 . LEU A 1 67  ? -4.224  -33.653 -30.949 1.00 33.31 ? 129 LEU A CD2 1 
ATOM   511  N N   . PRO A 1 68  ? -5.692  -29.839 -28.094 1.00 32.34 ? 130 PRO A N   1 
ATOM   512  C CA  . PRO A 1 68  ? -6.578  -28.838 -27.495 1.00 32.17 ? 130 PRO A CA  1 
ATOM   513  C C   . PRO A 1 68  ? -7.962  -29.392 -27.137 1.00 31.93 ? 130 PRO A C   1 
ATOM   514  O O   . PRO A 1 68  ? -8.622  -30.004 -27.988 1.00 31.90 ? 130 PRO A O   1 
ATOM   515  C CB  . PRO A 1 68  ? -6.697  -27.783 -28.596 1.00 32.00 ? 130 PRO A CB  1 
ATOM   516  C CG  . PRO A 1 68  ? -6.459  -28.532 -29.853 1.00 32.04 ? 130 PRO A CG  1 
ATOM   517  C CD  . PRO A 1 68  ? -5.446  -29.558 -29.522 1.00 32.17 ? 130 PRO A CD  1 
ATOM   518  N N   . ASN A 1 69  ? -8.377  -29.178 -25.888 1.00 31.61 ? 131 ASN A N   1 
ATOM   519  C CA  . ASN A 1 69  ? -9.718  -29.539 -25.428 1.00 31.64 ? 131 ASN A CA  1 
ATOM   520  C C   . ASN A 1 69  ? -10.807 -28.826 -26.244 1.00 31.62 ? 131 ASN A C   1 
ATOM   521  O O   . ASN A 1 69  ? -10.671 -27.624 -26.530 1.00 31.80 ? 131 ASN A O   1 
ATOM   522  C CB  . ASN A 1 69  ? -9.873  -29.263 -23.927 1.00 31.43 ? 131 ASN A CB  1 
ATOM   523  C CG  . ASN A 1 69  ? -8.987  -30.163 -23.072 1.00 32.02 ? 131 ASN A CG  1 
ATOM   524  O OD1 . ASN A 1 69  ? -7.856  -30.470 -23.440 1.00 31.79 ? 131 ASN A OD1 1 
ATOM   525  N ND2 . ASN A 1 69  ? -9.501  -30.581 -21.917 1.00 33.65 ? 131 ASN A ND2 1 
ATOM   526  N N   . PRO A 1 70  ? -11.884 -29.556 -26.623 1.00 31.26 ? 132 PRO A N   1 
ATOM   527  C CA  . PRO A 1 70  ? -12.841 -29.019 -27.605 1.00 30.95 ? 132 PRO A CA  1 
ATOM   528  C C   . PRO A 1 70  ? -13.652 -27.819 -27.094 1.00 30.33 ? 132 PRO A C   1 
ATOM   529  O O   . PRO A 1 70  ? -13.797 -26.816 -27.817 1.00 30.21 ? 132 PRO A O   1 
ATOM   530  C CB  . PRO A 1 70  ? -13.747 -30.221 -27.921 1.00 31.33 ? 132 PRO A CB  1 
ATOM   531  C CG  . PRO A 1 70  ? -13.650 -31.114 -26.697 1.00 31.66 ? 132 PRO A CG  1 
ATOM   532  C CD  . PRO A 1 70  ? -12.260 -30.907 -26.151 1.00 31.41 ? 132 PRO A CD  1 
ATOM   533  N N   . GLN A 1 71  ? -14.157 -27.918 -25.864 1.00 29.57 ? 133 GLN A N   1 
ATOM   534  C CA  . GLN A 1 71  ? -14.956 -26.849 -25.252 1.00 28.87 ? 133 GLN A CA  1 
ATOM   535  C C   . GLN A 1 71  ? -14.190 -25.515 -25.204 1.00 28.25 ? 133 GLN A C   1 
ATOM   536  O O   . GLN A 1 71  ? -14.779 -24.447 -25.358 1.00 28.30 ? 133 GLN A O   1 
ATOM   537  C CB  . GLN A 1 71  ? -15.435 -27.264 -23.852 1.00 28.57 ? 133 GLN A CB  1 
ATOM   538  N N   . SER A 1 72  ? -12.874 -25.582 -25.026 1.00 27.69 ? 134 SER A N   1 
ATOM   539  C CA  . SER A 1 72  ? -12.047 -24.373 -24.925 1.00 27.14 ? 134 SER A CA  1 
ATOM   540  C C   . SER A 1 72  ? -11.180 -24.065 -26.164 1.00 26.80 ? 134 SER A C   1 
ATOM   541  O O   . SER A 1 72  ? -10.492 -23.050 -26.196 1.00 27.18 ? 134 SER A O   1 
ATOM   542  C CB  . SER A 1 72  ? -11.175 -24.446 -23.668 1.00 26.71 ? 134 SER A CB  1 
ATOM   543  O OG  . SER A 1 72  ? -10.295 -25.558 -23.729 1.00 25.85 ? 134 SER A OG  1 
ATOM   544  N N   . ARG A 1 73  ? -11.218 -24.942 -27.164 1.00 26.72 ? 135 ARG A N   1 
ATOM   545  C CA  . ARG A 1 73  ? -10.474 -24.795 -28.430 1.00 26.73 ? 135 ARG A CA  1 
ATOM   546  C C   . ARG A 1 73  ? -10.593 -23.392 -29.043 1.00 26.86 ? 135 ARG A C   1 
ATOM   547  O O   . ARG A 1 73  ? -11.683 -22.828 -29.111 1.00 26.47 ? 135 ARG A O   1 
ATOM   548  C CB  . ARG A 1 73  ? -10.980 -25.858 -29.426 1.00 26.53 ? 135 ARG A CB  1 
ATOM   549  C CG  . ARG A 1 73  ? -10.186 -25.980 -30.725 1.00 27.10 ? 135 ARG A CG  1 
ATOM   550  C CD  . ARG A 1 73  ? -10.504 -27.282 -31.468 1.00 26.66 ? 135 ARG A CD  1 
ATOM   551  N NE  . ARG A 1 73  ? -11.685 -27.188 -32.336 1.00 27.22 ? 135 ARG A NE  1 
ATOM   552  C CZ  . ARG A 1 73  ? -11.701 -26.646 -33.563 1.00 27.43 ? 135 ARG A CZ  1 
ATOM   553  N NH1 . ARG A 1 73  ? -10.605 -26.121 -34.110 1.00 25.73 ? 135 ARG A NH1 1 
ATOM   554  N NH2 . ARG A 1 73  ? -12.830 -26.627 -34.256 1.00 28.28 ? 135 ARG A NH2 1 
ATOM   555  N N   . VAL A 1 74  ? -9.473  -22.821 -29.467 1.00 27.44 ? 136 VAL A N   1 
ATOM   556  C CA  . VAL A 1 74  ? -9.511  -21.572 -30.225 1.00 28.34 ? 136 VAL A CA  1 
ATOM   557  C C   . VAL A 1 74  ? -9.757  -21.910 -31.680 1.00 28.84 ? 136 VAL A C   1 
ATOM   558  O O   . VAL A 1 74  ? -9.080  -22.783 -32.232 1.00 28.89 ? 136 VAL A O   1 
ATOM   559  C CB  . VAL A 1 74  ? -8.181  -20.790 -30.177 1.00 28.28 ? 136 VAL A CB  1 
ATOM   560  C CG1 . VAL A 1 74  ? -8.191  -19.662 -31.223 1.00 28.63 ? 136 VAL A CG1 1 
ATOM   561  C CG2 . VAL A 1 74  ? -7.939  -20.217 -28.817 1.00 28.61 ? 136 VAL A CG2 1 
ATOM   562  N N   . CYS A 1 75  ? -10.701 -21.201 -32.296 1.00 29.56 ? 137 CYS A N   1 
ATOM   563  C CA  . CYS A 1 75  ? -11.001 -21.357 -33.725 1.00 30.33 ? 137 CYS A CA  1 
ATOM   564  C C   . CYS A 1 75  ? -10.573 -20.175 -34.574 1.00 30.18 ? 137 CYS A C   1 
ATOM   565  O O   . CYS A 1 75  ? -11.010 -19.043 -34.351 1.00 29.84 ? 137 CYS A O   1 
ATOM   566  C CB  . CYS A 1 75  ? -12.487 -21.576 -33.935 1.00 29.97 ? 137 CYS A CB  1 
ATOM   567  S SG  . CYS A 1 75  ? -12.913 -23.216 -33.537 1.00 33.98 ? 137 CYS A SG  1 
ATOM   568  N N   . LEU A 1 76  ? -9.730  -20.451 -35.562 1.00 30.48 ? 138 LEU A N   1 
ATOM   569  C CA  . LEU A 1 76  ? -9.398  -19.458 -36.566 1.00 30.62 ? 138 LEU A CA  1 
ATOM   570  C C   . LEU A 1 76  ? -10.687 -19.200 -37.325 1.00 30.85 ? 138 LEU A C   1 
ATOM   571  O O   . LEU A 1 76  ? -11.228 -20.101 -37.957 1.00 31.12 ? 138 LEU A O   1 
ATOM   572  C CB  . LEU A 1 76  ? -8.251  -19.949 -37.454 1.00 30.52 ? 138 LEU A CB  1 
ATOM   573  C CG  . LEU A 1 76  ? -6.968  -20.240 -36.648 1.00 29.64 ? 138 LEU A CG  1 
ATOM   574  C CD1 . LEU A 1 76  ? -5.924  -20.965 -37.467 1.00 29.47 ? 138 LEU A CD1 1 
ATOM   575  C CD2 . LEU A 1 76  ? -6.376  -18.978 -36.076 1.00 29.57 ? 138 LEU A CD2 1 
ATOM   576  N N   . GLY A 1 77  ? -11.214 -17.984 -37.181 1.00 31.11 ? 139 GLY A N   1 
ATOM   577  C CA  . GLY A 1 77  ? -12.567 -17.657 -37.645 1.00 31.38 ? 139 GLY A CA  1 
ATOM   578  C C   . GLY A 1 77  ? -12.628 -17.424 -39.142 1.00 31.37 ? 139 GLY A C   1 
ATOM   579  O O   . GLY A 1 77  ? -11.600 -17.455 -39.816 1.00 31.35 ? 139 GLY A O   1 
ATOM   580  N N   . ASP A 1 86  ? -9.363  -22.665 -40.235 1.00 30.13 ? 148 ASP A N   1 
ATOM   581  C CA  . ASP A 1 86  ? -9.860  -23.835 -39.513 1.00 30.48 ? 148 ASP A CA  1 
ATOM   582  C C   . ASP A 1 86  ? -9.119  -24.119 -38.162 1.00 30.07 ? 148 ASP A C   1 
ATOM   583  O O   . ASP A 1 86  ? -9.504  -23.595 -37.106 1.00 29.79 ? 148 ASP A O   1 
ATOM   584  C CB  . ASP A 1 86  ? -9.832  -25.058 -40.449 1.00 30.86 ? 148 ASP A CB  1 
ATOM   585  C CG  . ASP A 1 86  ? -10.842 -26.141 -40.047 1.00 32.90 ? 148 ASP A CG  1 
ATOM   586  O OD1 . ASP A 1 86  ? -12.062 -25.973 -40.323 1.00 34.73 ? 148 ASP A OD1 1 
ATOM   587  O OD2 . ASP A 1 86  ? -10.411 -27.174 -39.477 1.00 33.91 ? 148 ASP A OD2 1 
ATOM   588  N N   . TYR A 1 87  ? -8.048  -24.917 -38.205 1.00 29.30 ? 149 TYR A N   1 
ATOM   589  C CA  . TYR A 1 87  ? -7.476  -25.516 -36.990 1.00 28.59 ? 149 TYR A CA  1 
ATOM   590  C C   . TYR A 1 87  ? -6.130  -24.980 -36.492 1.00 28.32 ? 149 TYR A C   1 
ATOM   591  O O   . TYR A 1 87  ? -5.200  -24.762 -37.272 1.00 28.48 ? 149 TYR A O   1 
ATOM   592  C CB  . TYR A 1 87  ? -7.364  -27.039 -37.137 1.00 27.67 ? 149 TYR A CB  1 
ATOM   593  C CG  . TYR A 1 87  ? -6.744  -27.730 -35.919 1.00 27.63 ? 149 TYR A CG  1 
ATOM   594  C CD1 . TYR A 1 87  ? -7.531  -28.088 -34.812 1.00 25.65 ? 149 TYR A CD1 1 
ATOM   595  C CD2 . TYR A 1 87  ? -5.370  -28.022 -35.871 1.00 26.11 ? 149 TYR A CD2 1 
ATOM   596  C CE1 . TYR A 1 87  ? -6.975  -28.722 -33.716 1.00 23.98 ? 149 TYR A CE1 1 
ATOM   597  C CE2 . TYR A 1 87  ? -4.811  -28.654 -34.766 1.00 24.68 ? 149 TYR A CE2 1 
ATOM   598  C CZ  . TYR A 1 87  ? -5.620  -28.995 -33.700 1.00 24.55 ? 149 TYR A CZ  1 
ATOM   599  O OH  . TYR A 1 87  ? -5.073  -29.623 -32.617 1.00 25.06 ? 149 TYR A OH  1 
ATOM   600  N N   . ILE A 1 88  ? -6.052  -24.825 -35.168 1.00 27.81 ? 150 ILE A N   1 
ATOM   601  C CA  . ILE A 1 88  ? -4.827  -24.474 -34.452 1.00 27.24 ? 150 ILE A CA  1 
ATOM   602  C C   . ILE A 1 88  ? -4.793  -25.177 -33.068 1.00 27.04 ? 150 ILE A C   1 
ATOM   603  O O   . ILE A 1 88  ? -5.797  -25.207 -32.346 1.00 26.85 ? 150 ILE A O   1 
ATOM   604  C CB  . ILE A 1 88  ? -4.694  -22.940 -34.308 1.00 27.27 ? 150 ILE A CB  1 
ATOM   605  C CG1 . ILE A 1 88  ? -3.312  -22.551 -33.748 1.00 27.37 ? 150 ILE A CG1 1 
ATOM   606  C CG2 . ILE A 1 88  ? -5.873  -22.374 -33.480 1.00 26.56 ? 150 ILE A CG2 1 
ATOM   607  C CD1 . ILE A 1 88  ? -2.884  -21.115 -34.058 1.00 26.52 ? 150 ILE A CD1 1 
ATOM   608  N N   . ASN A 1 89  ? -3.649  -25.758 -32.717 1.00 26.55 ? 151 ASN A N   1 
ATOM   609  C CA  . ASN A 1 89  ? -3.480  -26.372 -31.400 1.00 26.59 ? 151 ASN A CA  1 
ATOM   610  C C   . ASN A 1 89  ? -3.371  -25.300 -30.312 1.00 26.91 ? 151 ASN A C   1 
ATOM   611  O O   . ASN A 1 89  ? -2.272  -24.862 -29.973 1.00 27.42 ? 151 ASN A O   1 
ATOM   612  C CB  . ASN A 1 89  ? -2.246  -27.268 -31.394 1.00 26.16 ? 151 ASN A CB  1 
ATOM   613  C CG  . ASN A 1 89  ? -2.218  -28.210 -30.218 1.00 25.89 ? 151 ASN A CG  1 
ATOM   614  O OD1 . ASN A 1 89  ? -2.509  -27.815 -29.087 1.00 23.60 ? 151 ASN A OD1 1 
ATOM   615  N ND2 . ASN A 1 89  ? -1.848  -29.475 -30.476 1.00 24.63 ? 151 ASN A ND2 1 
ATOM   616  N N   . ALA A 1 90  ? -4.514  -24.862 -29.786 1.00 26.92 ? 152 ALA A N   1 
ATOM   617  C CA  . ALA A 1 90  ? -4.561  -23.728 -28.855 1.00 27.05 ? 152 ALA A CA  1 
ATOM   618  C C   . ALA A 1 90  ? -5.858  -23.786 -28.072 1.00 27.15 ? 152 ALA A C   1 
ATOM   619  O O   . ALA A 1 90  ? -6.852  -24.311 -28.584 1.00 27.18 ? 152 ALA A O   1 
ATOM   620  C CB  . ALA A 1 90  ? -4.469  -22.401 -29.614 1.00 26.78 ? 152 ALA A CB  1 
ATOM   621  N N   . ASN A 1 91  ? -5.842  -23.234 -26.855 1.00 26.97 ? 153 ASN A N   1 
ATOM   622  C CA  . ASN A 1 91  ? -7.014  -23.194 -25.973 1.00 27.51 ? 153 ASN A CA  1 
ATOM   623  C C   . ASN A 1 91  ? -7.148  -21.912 -25.158 1.00 28.10 ? 153 ASN A C   1 
ATOM   624  O O   . ASN A 1 91  ? -6.176  -21.430 -24.542 1.00 28.44 ? 153 ASN A O   1 
ATOM   625  C CB  . ASN A 1 91  ? -6.966  -24.342 -24.969 1.00 27.36 ? 153 ASN A CB  1 
ATOM   626  C CG  . ASN A 1 91  ? -7.093  -25.681 -25.616 1.00 27.64 ? 153 ASN A CG  1 
ATOM   627  O OD1 . ASN A 1 91  ? -6.096  -26.356 -25.843 1.00 28.57 ? 153 ASN A OD1 1 
ATOM   628  N ND2 . ASN A 1 91  ? -8.323  -26.089 -25.913 1.00 27.56 ? 153 ASN A ND2 1 
ATOM   629  N N   . TYR A 1 92  ? -8.362  -21.387 -25.108 1.00 28.22 ? 154 TYR A N   1 
ATOM   630  C CA  . TYR A 1 92  ? -8.670  -20.341 -24.145 1.00 28.70 ? 154 TYR A CA  1 
ATOM   631  C C   . TYR A 1 92  ? -8.422  -20.816 -22.722 1.00 28.89 ? 154 TYR A C   1 
ATOM   632  O O   . TYR A 1 92  ? -8.690  -21.973 -22.393 1.00 29.74 ? 154 TYR A O   1 
ATOM   633  C CB  . TYR A 1 92  ? -10.115 -19.884 -24.309 1.00 28.69 ? 154 TYR A CB  1 
ATOM   634  C CG  . TYR A 1 92  ? -10.356 -19.199 -25.635 1.00 28.61 ? 154 TYR A CG  1 
ATOM   635  C CD1 . TYR A 1 92  ? -11.125 -19.803 -26.617 1.00 28.00 ? 154 TYR A CD1 1 
ATOM   636  C CD2 . TYR A 1 92  ? -9.796  -17.948 -25.905 1.00 28.80 ? 154 TYR A CD2 1 
ATOM   637  C CE1 . TYR A 1 92  ? -11.350 -19.178 -27.826 1.00 29.16 ? 154 TYR A CE1 1 
ATOM   638  C CE2 . TYR A 1 92  ? -10.008 -17.312 -27.116 1.00 29.49 ? 154 TYR A CE2 1 
ATOM   639  C CZ  . TYR A 1 92  ? -10.787 -17.932 -28.070 1.00 29.37 ? 154 TYR A CZ  1 
ATOM   640  O OH  . TYR A 1 92  ? -11.012 -17.311 -29.269 1.00 29.00 ? 154 TYR A OH  1 
ATOM   641  N N   . ILE A 1 93  ? -7.887  -19.932 -21.890 1.00 28.66 ? 155 ILE A N   1 
ATOM   642  C CA  . ILE A 1 93  ? -7.565  -20.280 -20.522 1.00 28.69 ? 155 ILE A CA  1 
ATOM   643  C C   . ILE A 1 93  ? -8.177  -19.231 -19.603 1.00 29.50 ? 155 ILE A C   1 
ATOM   644  O O   . ILE A 1 93  ? -8.055  -18.028 -19.852 1.00 29.77 ? 155 ILE A O   1 
ATOM   645  C CB  . ILE A 1 93  ? -6.005  -20.424 -20.286 1.00 28.71 ? 155 ILE A CB  1 
ATOM   646  C CG1 . ILE A 1 93  ? -5.365  -21.432 -21.255 1.00 26.73 ? 155 ILE A CG1 1 
ATOM   647  C CG2 . ILE A 1 93  ? -5.690  -20.861 -18.862 1.00 26.99 ? 155 ILE A CG2 1 
ATOM   648  C CD1 . ILE A 1 93  ? -5.688  -22.875 -21.016 1.00 21.34 ? 155 ILE A CD1 1 
ATOM   649  N N   . ARG A 1 94  ? -8.863  -19.694 -18.559 1.00 29.92 ? 156 ARG A N   1 
ATOM   650  C CA  . ARG A 1 94  ? -9.512  -18.798 -17.611 1.00 30.17 ? 156 ARG A CA  1 
ATOM   651  C C   . ARG A 1 94  ? -8.428  -18.196 -16.751 1.00 29.77 ? 156 ARG A C   1 
ATOM   652  O O   . ARG A 1 94  ? -7.386  -18.807 -16.597 1.00 29.90 ? 156 ARG A O   1 
ATOM   653  C CB  . ARG A 1 94  ? -10.504 -19.545 -16.718 1.00 30.48 ? 156 ARG A CB  1 
ATOM   654  C CG  . ARG A 1 94  ? -11.937 -19.476 -17.172 1.00 31.90 ? 156 ARG A CG  1 
ATOM   655  C CD  . ARG A 1 94  ? -12.466 -20.824 -17.599 1.00 34.20 ? 156 ARG A CD  1 
ATOM   656  N NE  . ARG A 1 94  ? -11.863 -21.945 -16.860 1.00 36.93 ? 156 ARG A NE  1 
ATOM   657  C CZ  . ARG A 1 94  ? -12.532 -22.814 -16.098 1.00 37.57 ? 156 ARG A CZ  1 
ATOM   658  N NH1 . ARG A 1 94  ? -13.842 -22.715 -15.937 1.00 38.16 ? 156 ARG A NH1 1 
ATOM   659  N NH2 . ARG A 1 94  ? -11.882 -23.794 -15.491 1.00 39.14 ? 156 ARG A NH2 1 
ATOM   660  N N   . GLY A 1 95  ? -8.681  -17.001 -16.210 1.00 29.41 ? 157 GLY A N   1 
ATOM   661  C CA  . GLY A 1 95  ? -7.738  -16.301 -15.349 1.00 28.86 ? 157 GLY A CA  1 
ATOM   662  C C   . GLY A 1 95  ? -8.201  -16.193 -13.907 1.00 28.83 ? 157 GLY A C   1 
ATOM   663  O O   . GLY A 1 95  ? -8.910  -17.074 -13.408 1.00 29.52 ? 157 GLY A O   1 
ATOM   664  N N   . TYR A 1 96  ? -7.787  -15.118 -13.237 1.00 28.26 ? 158 TYR A N   1 
ATOM   665  C CA  . TYR A 1 96  ? -8.130  -14.860 -11.838 1.00 28.46 ? 158 TYR A CA  1 
ATOM   666  C C   . TYR A 1 96  ? -9.640  -14.890 -11.637 1.00 28.85 ? 158 TYR A C   1 
ATOM   667  O O   . TYR A 1 96  ? -10.379 -14.351 -12.466 1.00 29.32 ? 158 TYR A O   1 
ATOM   668  C CB  . TYR A 1 96  ? -7.574  -13.492 -11.418 1.00 28.46 ? 158 TYR A CB  1 
ATOM   669  C CG  . TYR A 1 96  ? -7.870  -13.085 -9.991  1.00 27.68 ? 158 TYR A CG  1 
ATOM   670  C CD1 . TYR A 1 96  ? -7.349  -13.811 -8.920  1.00 25.77 ? 158 TYR A CD1 1 
ATOM   671  C CD2 . TYR A 1 96  ? -8.669  -11.977 -9.715  1.00 27.44 ? 158 TYR A CD2 1 
ATOM   672  C CE1 . TYR A 1 96  ? -7.615  -13.464 -7.620  1.00 26.50 ? 158 TYR A CE1 1 
ATOM   673  C CE2 . TYR A 1 96  ? -8.946  -11.612 -8.397  1.00 28.60 ? 158 TYR A CE2 1 
ATOM   674  C CZ  . TYR A 1 96  ? -8.406  -12.362 -7.351  1.00 28.42 ? 158 TYR A CZ  1 
ATOM   675  O OH  . TYR A 1 96  ? -8.658  -12.012 -6.039  1.00 27.39 ? 158 TYR A OH  1 
ATOM   676  N N   . ASP A 1 97  ? -10.097 -15.513 -10.546 1.00 28.97 ? 159 ASP A N   1 
ATOM   677  C CA  . ASP A 1 97  ? -11.536 -15.668 -10.259 1.00 29.21 ? 159 ASP A CA  1 
ATOM   678  C C   . ASP A 1 97  ? -12.350 -16.392 -11.364 1.00 29.49 ? 159 ASP A C   1 
ATOM   679  O O   . ASP A 1 97  ? -13.579 -16.372 -11.338 1.00 30.26 ? 159 ASP A O   1 
ATOM   680  C CB  . ASP A 1 97  ? -12.200 -14.312 -9.970  1.00 29.20 ? 159 ASP A CB  1 
ATOM   681  C CG  . ASP A 1 97  ? -12.143 -13.915 -8.508  1.00 30.32 ? 159 ASP A CG  1 
ATOM   682  O OD1 . ASP A 1 97  ? -11.699 -14.717 -7.660  1.00 33.02 ? 159 ASP A OD1 1 
ATOM   683  O OD2 . ASP A 1 97  ? -12.561 -12.779 -8.198  1.00 30.94 ? 159 ASP A OD2 1 
ATOM   684  N N   . GLY A 1 98  ? -11.696 -17.013 -12.336 1.00 29.06 ? 160 GLY A N   1 
ATOM   685  C CA  . GLY A 1 98  ? -12.446 -17.711 -13.373 1.00 29.06 ? 160 GLY A CA  1 
ATOM   686  C C   . GLY A 1 98  ? -12.801 -16.888 -14.602 1.00 29.15 ? 160 GLY A C   1 
ATOM   687  O O   . GLY A 1 98  ? -13.348 -17.424 -15.559 1.00 28.71 ? 160 GLY A O   1 
ATOM   688  N N   . LYS A 1 99  ? -12.479 -15.593 -14.593 1.00 29.65 ? 161 LYS A N   1 
ATOM   689  C CA  . LYS A 1 99  ? -12.705 -14.735 -15.754 1.00 29.96 ? 161 LYS A CA  1 
ATOM   690  C C   . LYS A 1 99  ? -12.286 -15.438 -17.053 1.00 30.50 ? 161 LYS A C   1 
ATOM   691  O O   . LYS A 1 99  ? -11.204 -16.021 -17.120 1.00 30.59 ? 161 LYS A O   1 
ATOM   692  C CB  . LYS A 1 99  ? -11.930 -13.449 -15.596 1.00 30.19 ? 161 LYS A CB  1 
ATOM   693  C CG  . LYS A 1 99  ? -12.254 -12.391 -16.650 1.00 31.35 ? 161 LYS A CG  1 
ATOM   694  C CD  . LYS A 1 99  ? -11.103 -11.432 -16.797 1.00 31.94 ? 161 LYS A CD  1 
ATOM   695  C CE  . LYS A 1 99  ? -11.586 -10.002 -16.865 1.00 34.03 ? 161 LYS A CE  1 
ATOM   696  N NZ  . LYS A 1 99  ? -10.429 -9.070  -16.677 1.00 34.56 ? 161 LYS A NZ  1 
ATOM   697  N N   . GLU A 1 100 ? -13.148 -15.393 -18.070 1.00 30.69 ? 162 GLU A N   1 
ATOM   698  C CA  . GLU A 1 100 ? -12.922 -16.135 -19.303 1.00 31.31 ? 162 GLU A CA  1 
ATOM   699  C C   . GLU A 1 100 ? -11.826 -15.488 -20.121 1.00 31.18 ? 162 GLU A C   1 
ATOM   700  O O   . GLU A 1 100 ? -11.659 -14.270 -20.078 1.00 31.82 ? 162 GLU A O   1 
ATOM   701  C CB  . GLU A 1 100 ? -14.196 -16.193 -20.168 1.00 31.91 ? 162 GLU A CB  1 
ATOM   702  C CG  . GLU A 1 100 ? -15.449 -16.874 -19.538 1.00 34.29 ? 162 GLU A CG  1 
ATOM   703  C CD  . GLU A 1 100 ? -15.235 -18.333 -19.106 1.00 37.67 ? 162 GLU A CD  1 
ATOM   704  O OE1 . GLU A 1 100 ? -15.879 -18.751 -18.117 1.00 39.06 ? 162 GLU A OE1 1 
ATOM   705  O OE2 . GLU A 1 100 ? -14.435 -19.064 -19.742 1.00 38.60 ? 162 GLU A OE2 1 
ATOM   706  N N   . LYS A 1 101 ? -11.086 -16.312 -20.862 1.00 30.66 ? 163 LYS A N   1 
ATOM   707  C CA  . LYS A 1 101 ? -10.230 -15.858 -21.962 1.00 29.97 ? 163 LYS A CA  1 
ATOM   708  C C   . LYS A 1 101 ? -9.074  -14.917 -21.621 1.00 29.78 ? 163 LYS A C   1 
ATOM   709  O O   . LYS A 1 101 ? -8.628  -14.175 -22.488 1.00 30.33 ? 163 LYS A O   1 
ATOM   710  C CB  . LYS A 1 101 ? -11.077 -15.240 -23.087 1.00 30.05 ? 163 LYS A CB  1 
ATOM   711  C CG  . LYS A 1 101 ? -12.089 -16.193 -23.725 1.00 30.03 ? 163 LYS A CG  1 
ATOM   712  C CD  . LYS A 1 101 ? -12.634 -15.641 -25.028 1.00 29.69 ? 163 LYS A CD  1 
ATOM   713  C CE  . LYS A 1 101 ? -13.873 -16.425 -25.489 1.00 32.29 ? 163 LYS A CE  1 
ATOM   714  N NZ  . LYS A 1 101 ? -14.506 -15.901 -26.761 1.00 29.73 ? 163 LYS A NZ  1 
ATOM   715  N N   . VAL A 1 102 ? -8.565  -14.942 -20.390 1.00 29.13 ? 164 VAL A N   1 
ATOM   716  C CA  . VAL A 1 102 ? -7.426  -14.086 -20.042 1.00 28.14 ? 164 VAL A CA  1 
ATOM   717  C C   . VAL A 1 102 ? -6.129  -14.499 -20.784 1.00 27.97 ? 164 VAL A C   1 
ATOM   718  O O   . VAL A 1 102 ? -5.287  -13.645 -21.094 1.00 27.71 ? 164 VAL A O   1 
ATOM   719  C CB  . VAL A 1 102 ? -7.204  -13.998 -18.501 1.00 28.30 ? 164 VAL A CB  1 
ATOM   720  C CG1 . VAL A 1 102 ? -6.011  -13.114 -18.158 1.00 25.95 ? 164 VAL A CG1 1 
ATOM   721  C CG2 . VAL A 1 102 ? -8.447  -13.457 -17.823 1.00 27.79 ? 164 VAL A CG2 1 
ATOM   722  N N   . TYR A 1 103 ? -5.981  -15.796 -21.057 1.00 27.15 ? 165 TYR A N   1 
ATOM   723  C CA  . TYR A 1 103 ? -4.821  -16.317 -21.779 1.00 26.92 ? 165 TYR A CA  1 
ATOM   724  C C   . TYR A 1 103 ? -5.265  -17.215 -22.907 1.00 26.81 ? 165 TYR A C   1 
ATOM   725  O O   . TYR A 1 103 ? -6.344  -17.812 -22.860 1.00 27.21 ? 165 TYR A O   1 
ATOM   726  C CB  . TYR A 1 103 ? -3.871  -17.121 -20.870 1.00 27.40 ? 165 TYR A CB  1 
ATOM   727  C CG  . TYR A 1 103 ? -3.600  -16.480 -19.539 1.00 27.38 ? 165 TYR A CG  1 
ATOM   728  C CD1 . TYR A 1 103 ? -4.372  -16.800 -18.431 1.00 27.04 ? 165 TYR A CD1 1 
ATOM   729  C CD2 . TYR A 1 103 ? -2.602  -15.528 -19.394 1.00 27.61 ? 165 TYR A CD2 1 
ATOM   730  C CE1 . TYR A 1 103 ? -4.161  -16.192 -17.213 1.00 27.32 ? 165 TYR A CE1 1 
ATOM   731  C CE2 . TYR A 1 103 ? -2.383  -14.913 -18.170 1.00 28.05 ? 165 TYR A CE2 1 
ATOM   732  C CZ  . TYR A 1 103 ? -3.166  -15.260 -17.084 1.00 28.15 ? 165 TYR A CZ  1 
ATOM   733  O OH  . TYR A 1 103 ? -2.965  -14.659 -15.860 1.00 29.57 ? 165 TYR A OH  1 
ATOM   734  N N   . ILE A 1 104 ? -4.423  -17.294 -23.928 1.00 26.37 ? 166 ILE A N   1 
ATOM   735  C CA  . ILE A 1 104 ? -4.463  -18.374 -24.901 1.00 26.12 ? 166 ILE A CA  1 
ATOM   736  C C   . ILE A 1 104 ? -3.150  -19.119 -24.714 1.00 26.07 ? 166 ILE A C   1 
ATOM   737  O O   . ILE A 1 104 ? -2.070  -18.522 -24.821 1.00 26.59 ? 166 ILE A O   1 
ATOM   738  C CB  . ILE A 1 104 ? -4.567  -17.861 -26.356 1.00 25.68 ? 166 ILE A CB  1 
ATOM   739  C CG1 . ILE A 1 104 ? -5.965  -17.313 -26.640 1.00 25.69 ? 166 ILE A CG1 1 
ATOM   740  C CG2 . ILE A 1 104 ? -4.248  -18.986 -27.351 1.00 26.01 ? 166 ILE A CG2 1 
ATOM   741  C CD1 . ILE A 1 104 ? -6.043  -16.405 -27.883 1.00 26.52 ? 166 ILE A CD1 1 
ATOM   742  N N   . ALA A 1 105 ? -3.247  -20.404 -24.391 1.00 25.53 ? 167 ALA A N   1 
ATOM   743  C CA  . ALA A 1 105 ? -2.086  -21.287 -24.343 1.00 24.68 ? 167 ALA A CA  1 
ATOM   744  C C   . ALA A 1 105 ? -2.065  -22.088 -25.630 1.00 24.26 ? 167 ALA A C   1 
ATOM   745  O O   . ALA A 1 105 ? -3.100  -22.562 -26.109 1.00 24.36 ? 167 ALA A O   1 
ATOM   746  C CB  . ALA A 1 105 ? -2.146  -22.218 -23.132 1.00 24.42 ? 167 ALA A CB  1 
ATOM   747  N N   . THR A 1 106 ? -0.874  -22.243 -26.180 1.00 24.09 ? 168 THR A N   1 
ATOM   748  C CA  . THR A 1 106 ? -0.701  -22.774 -27.517 1.00 23.98 ? 168 THR A CA  1 
ATOM   749  C C   . THR A 1 106 ? 0.694   -23.366 -27.565 1.00 24.04 ? 168 THR A C   1 
ATOM   750  O O   . THR A 1 106 ? 1.532   -23.082 -26.698 1.00 24.19 ? 168 THR A O   1 
ATOM   751  C CB  . THR A 1 106 ? -0.926  -21.647 -28.582 1.00 23.82 ? 168 THR A CB  1 
ATOM   752  O OG1 . THR A 1 106 ? -1.076  -22.210 -29.881 1.00 24.25 ? 168 THR A OG1 1 
ATOM   753  C CG2 . THR A 1 106 ? 0.206   -20.633 -28.595 1.00 23.90 ? 168 THR A CG2 1 
ATOM   754  N N   . GLN A 1 107 ? 0.925   -24.239 -28.536 1.00 24.19 ? 169 GLN A N   1 
ATOM   755  C CA  . GLN A 1 107 ? 2.251   -24.778 -28.785 1.00 24.53 ? 169 GLN A CA  1 
ATOM   756  C C   . GLN A 1 107 ? 3.052   -23.630 -29.375 1.00 24.98 ? 169 GLN A C   1 
ATOM   757  O O   . GLN A 1 107 ? 2.464   -22.640 -29.823 1.00 25.61 ? 169 GLN A O   1 
ATOM   758  C CB  . GLN A 1 107 ? 2.163   -25.958 -29.768 1.00 24.25 ? 169 GLN A CB  1 
ATOM   759  C CG  . GLN A 1 107 ? 1.839   -25.542 -31.203 1.00 24.29 ? 169 GLN A CG  1 
ATOM   760  C CD  . GLN A 1 107 ? 1.508   -26.700 -32.131 1.00 24.39 ? 169 GLN A CD  1 
ATOM   761  O OE1 . GLN A 1 107 ? 1.153   -27.795 -31.699 1.00 24.97 ? 169 GLN A OE1 1 
ATOM   762  N NE2 . GLN A 1 107 ? 1.606   -26.448 -33.425 1.00 24.97 ? 169 GLN A NE2 1 
ATOM   763  N N   . GLY A 1 108 ? 4.379   -23.717 -29.370 1.00 25.18 ? 170 GLY A N   1 
ATOM   764  C CA  . GLY A 1 108 ? 5.150   -22.800 -30.209 1.00 25.47 ? 170 GLY A CA  1 
ATOM   765  C C   . GLY A 1 108 ? 4.769   -23.161 -31.638 1.00 25.66 ? 170 GLY A C   1 
ATOM   766  O O   . GLY A 1 108 ? 4.585   -24.343 -31.919 1.00 25.85 ? 170 GLY A O   1 
ATOM   767  N N   . PRO A 1 109 ? 4.623   -22.163 -32.541 1.00 25.71 ? 171 PRO A N   1 
ATOM   768  C CA  . PRO A 1 109 ? 4.312   -22.422 -33.955 1.00 25.60 ? 171 PRO A CA  1 
ATOM   769  C C   . PRO A 1 109 ? 5.231   -23.437 -34.580 1.00 25.78 ? 171 PRO A C   1 
ATOM   770  O O   . PRO A 1 109 ? 6.369   -23.578 -34.142 1.00 26.07 ? 171 PRO A O   1 
ATOM   771  C CB  . PRO A 1 109 ? 4.561   -21.076 -34.633 1.00 25.22 ? 171 PRO A CB  1 
ATOM   772  C CG  . PRO A 1 109 ? 4.351   -20.088 -33.597 1.00 25.21 ? 171 PRO A CG  1 
ATOM   773  C CD  . PRO A 1 109 ? 4.718   -20.720 -32.267 1.00 25.93 ? 171 PRO A CD  1 
ATOM   774  N N   . MET A 1 110 ? 4.706   -24.153 -35.575 1.00 26.14 ? 172 MET A N   1 
ATOM   775  C CA  . MET A 1 110 ? 5.475   -24.978 -36.514 1.00 26.08 ? 172 MET A CA  1 
ATOM   776  C C   . MET A 1 110 ? 5.625   -24.147 -37.789 1.00 25.76 ? 172 MET A C   1 
ATOM   777  O O   . MET A 1 110 ? 4.906   -23.160 -37.945 1.00 25.41 ? 172 MET A O   1 
ATOM   778  C CB  . MET A 1 110 ? 4.716   -26.276 -36.832 1.00 25.98 ? 172 MET A CB  1 
ATOM   779  C CG  . MET A 1 110 ? 4.895   -27.393 -35.793 1.00 27.07 ? 172 MET A CG  1 
ATOM   780  S SD  . MET A 1 110 ? 3.602   -28.664 -35.833 1.00 27.04 ? 172 MET A SD  1 
ATOM   781  C CE  . MET A 1 110 ? 4.032   -29.596 -37.312 1.00 28.83 ? 172 MET A CE  1 
ATOM   782  N N   . PRO A 1 111 ? 6.554   -24.532 -38.703 1.00 25.49 ? 173 PRO A N   1 
ATOM   783  C CA  . PRO A 1 111 ? 6.757   -23.778 -39.958 1.00 25.12 ? 173 PRO A CA  1 
ATOM   784  C C   . PRO A 1 111 ? 5.510   -23.645 -40.825 1.00 24.72 ? 173 PRO A C   1 
ATOM   785  O O   . PRO A 1 111 ? 5.379   -22.669 -41.551 1.00 24.15 ? 173 PRO A O   1 
ATOM   786  C CB  . PRO A 1 111 ? 7.830   -24.597 -40.696 1.00 25.38 ? 173 PRO A CB  1 
ATOM   787  C CG  . PRO A 1 111 ? 8.577   -25.308 -39.582 1.00 25.32 ? 173 PRO A CG  1 
ATOM   788  C CD  . PRO A 1 111 ? 7.501   -25.662 -38.592 1.00 25.23 ? 173 PRO A CD  1 
ATOM   789  N N   . ASN A 1 112 ? 4.607   -24.620 -40.743 1.00 24.68 ? 174 ASN A N   1 
ATOM   790  C CA  . ASN A 1 112 ? 3.349   -24.578 -41.498 1.00 24.47 ? 174 ASN A CA  1 
ATOM   791  C C   . ASN A 1 112 ? 2.186   -23.986 -40.683 1.00 24.13 ? 174 ASN A C   1 
ATOM   792  O O   . ASN A 1 112 ? 1.097   -23.782 -41.212 1.00 23.86 ? 174 ASN A O   1 
ATOM   793  C CB  . ASN A 1 112 ? 2.997   -25.969 -42.042 1.00 24.35 ? 174 ASN A CB  1 
ATOM   794  C CG  . ASN A 1 112 ? 2.671   -26.980 -40.935 1.00 25.79 ? 174 ASN A CG  1 
ATOM   795  O OD1 . ASN A 1 112 ? 3.137   -26.863 -39.788 1.00 28.32 ? 174 ASN A OD1 1 
ATOM   796  N ND2 . ASN A 1 112 ? 1.869   -27.981 -41.278 1.00 25.25 ? 174 ASN A ND2 1 
ATOM   797  N N   . THR A 1 113 ? 2.425   -23.714 -39.398 1.00 23.96 ? 175 THR A N   1 
ATOM   798  C CA  . THR A 1 113 ? 1.421   -23.074 -38.548 1.00 23.63 ? 175 THR A CA  1 
ATOM   799  C C   . THR A 1 113 ? 1.741   -21.610 -38.206 1.00 23.67 ? 175 THR A C   1 
ATOM   800  O O   . THR A 1 113 ? 1.039   -21.001 -37.398 1.00 24.47 ? 175 THR A O   1 
ATOM   801  C CB  . THR A 1 113 ? 1.104   -23.904 -37.232 1.00 23.82 ? 175 THR A CB  1 
ATOM   802  O OG1 . THR A 1 113 ? 2.099   -23.683 -36.214 1.00 23.73 ? 175 THR A OG1 1 
ATOM   803  C CG2 . THR A 1 113 ? 0.980   -25.393 -37.515 1.00 23.12 ? 175 THR A CG2 1 
ATOM   804  N N   . VAL A 1 114 ? 2.790   -21.045 -38.805 1.00 23.52 ? 176 VAL A N   1 
ATOM   805  C CA  . VAL A 1 114 ? 3.209   -19.657 -38.507 1.00 23.36 ? 176 VAL A CA  1 
ATOM   806  C C   . VAL A 1 114 ? 2.111   -18.631 -38.849 1.00 23.72 ? 176 VAL A C   1 
ATOM   807  O O   . VAL A 1 114 ? 1.707   -17.845 -37.985 1.00 23.66 ? 176 VAL A O   1 
ATOM   808  C CB  . VAL A 1 114 ? 4.554   -19.273 -39.212 1.00 23.46 ? 176 VAL A CB  1 
ATOM   809  C CG1 . VAL A 1 114 ? 4.858   -17.784 -39.069 1.00 22.52 ? 176 VAL A CG1 1 
ATOM   810  C CG2 . VAL A 1 114 ? 5.709   -20.088 -38.662 1.00 22.60 ? 176 VAL A CG2 1 
ATOM   811  N N   . SER A 1 115 ? 1.645   -18.646 -40.101 1.00 23.77 ? 177 SER A N   1 
ATOM   812  C CA  . SER A 1 115 ? 0.548   -17.790 -40.565 1.00 23.99 ? 177 SER A CA  1 
ATOM   813  C C   . SER A 1 115 ? -0.716  -17.876 -39.714 1.00 24.19 ? 177 SER A C   1 
ATOM   814  O O   . SER A 1 115 ? -1.396  -16.866 -39.510 1.00 24.03 ? 177 SER A O   1 
ATOM   815  C CB  . SER A 1 115 ? 0.185   -18.137 -42.011 1.00 23.94 ? 177 SER A CB  1 
ATOM   816  O OG  . SER A 1 115 ? 0.834   -17.268 -42.915 1.00 24.39 ? 177 SER A OG  1 
ATOM   817  N N   . ASP A 1 116 ? -1.036  -19.089 -39.250 1.00 24.41 ? 178 ASP A N   1 
ATOM   818  C CA  . ASP A 1 116 ? -2.192  -19.344 -38.374 1.00 24.25 ? 178 ASP A CA  1 
ATOM   819  C C   . ASP A 1 116 ? -2.018  -18.632 -37.047 1.00 24.15 ? 178 ASP A C   1 
ATOM   820  O O   . ASP A 1 116 ? -2.975  -18.081 -36.492 1.00 24.11 ? 178 ASP A O   1 
ATOM   821  C CB  . ASP A 1 116 ? -2.374  -20.849 -38.111 1.00 24.15 ? 178 ASP A CB  1 
ATOM   822  C CG  . ASP A 1 116 ? -2.640  -21.657 -39.391 1.00 24.55 ? 178 ASP A CG  1 
ATOM   823  O OD1 . ASP A 1 116 ? -2.864  -21.045 -40.461 1.00 24.46 ? 178 ASP A OD1 1 
ATOM   824  O OD2 . ASP A 1 116 ? -2.596  -22.908 -39.325 1.00 23.23 ? 178 ASP A OD2 1 
ATOM   825  N N   . PHE A 1 117 ? -0.788  -18.655 -36.545 1.00 24.18 ? 179 PHE A N   1 
ATOM   826  C CA  . PHE A 1 117 ? -0.470  -18.070 -35.255 1.00 24.56 ? 179 PHE A CA  1 
ATOM   827  C C   . PHE A 1 117 ? -0.739  -16.568 -35.290 1.00 25.08 ? 179 PHE A C   1 
ATOM   828  O O   . PHE A 1 117 ? -1.359  -16.027 -34.364 1.00 24.85 ? 179 PHE A O   1 
ATOM   829  C CB  . PHE A 1 117 ? 0.990   -18.356 -34.859 1.00 24.08 ? 179 PHE A CB  1 
ATOM   830  C CG  . PHE A 1 117 ? 1.400   -17.706 -33.571 1.00 22.96 ? 179 PHE A CG  1 
ATOM   831  C CD1 . PHE A 1 117 ? 1.256   -18.381 -32.358 1.00 22.64 ? 179 PHE A CD1 1 
ATOM   832  C CD2 . PHE A 1 117 ? 1.921   -16.416 -33.564 1.00 22.14 ? 179 PHE A CD2 1 
ATOM   833  C CE1 . PHE A 1 117 ? 1.633   -17.783 -31.152 1.00 21.05 ? 179 PHE A CE1 1 
ATOM   834  C CE2 . PHE A 1 117 ? 2.302   -15.805 -32.374 1.00 21.17 ? 179 PHE A CE2 1 
ATOM   835  C CZ  . PHE A 1 117 ? 2.154   -16.494 -31.158 1.00 22.53 ? 179 PHE A CZ  1 
ATOM   836  N N   . TRP A 1 118 ? -0.273  -15.905 -36.354 1.00 25.43 ? 180 TRP A N   1 
ATOM   837  C CA  . TRP A 1 118 ? -0.492  -14.469 -36.505 1.00 26.12 ? 180 TRP A CA  1 
ATOM   838  C C   . TRP A 1 118 ? -1.962  -14.152 -36.736 1.00 26.28 ? 180 TRP A C   1 
ATOM   839  O O   . TRP A 1 118 ? -2.493  -13.196 -36.159 1.00 26.65 ? 180 TRP A O   1 
ATOM   840  C CB  . TRP A 1 118 ? 0.392   -13.858 -37.595 1.00 26.47 ? 180 TRP A CB  1 
ATOM   841  C CG  . TRP A 1 118 ? 1.850   -13.784 -37.195 1.00 27.10 ? 180 TRP A CG  1 
ATOM   842  C CD1 . TRP A 1 118 ? 2.909   -14.352 -37.847 1.00 26.67 ? 180 TRP A CD1 1 
ATOM   843  C CD2 . TRP A 1 118 ? 2.397   -13.126 -36.037 1.00 27.63 ? 180 TRP A CD2 1 
ATOM   844  N NE1 . TRP A 1 118 ? 4.076   -14.082 -37.177 1.00 27.76 ? 180 TRP A NE1 1 
ATOM   845  C CE2 . TRP A 1 118 ? 3.793   -13.337 -36.060 1.00 27.91 ? 180 TRP A CE2 1 
ATOM   846  C CE3 . TRP A 1 118 ? 1.845   -12.366 -34.995 1.00 26.47 ? 180 TRP A CE3 1 
ATOM   847  C CZ2 . TRP A 1 118 ? 4.646   -12.812 -35.082 1.00 26.75 ? 180 TRP A CZ2 1 
ATOM   848  C CZ3 . TRP A 1 118 ? 2.693   -11.851 -34.027 1.00 26.32 ? 180 TRP A CZ3 1 
ATOM   849  C CH2 . TRP A 1 118 ? 4.078   -12.073 -34.080 1.00 26.43 ? 180 TRP A CH2 1 
ATOM   850  N N   . GLU A 1 119 ? -2.625  -14.984 -37.527 1.00 26.35 ? 181 GLU A N   1 
ATOM   851  C CA  . GLU A 1 119 ? -4.075  -14.881 -37.703 1.00 26.99 ? 181 GLU A CA  1 
ATOM   852  C C   . GLU A 1 119 ? -4.819  -14.936 -36.373 1.00 27.13 ? 181 GLU A C   1 
ATOM   853  O O   . GLU A 1 119 ? -5.721  -14.139 -36.125 1.00 26.94 ? 181 GLU A O   1 
ATOM   854  C CB  . GLU A 1 119 ? -4.575  -15.979 -38.644 1.00 26.97 ? 181 GLU A CB  1 
ATOM   855  C CG  . GLU A 1 119 ? -6.084  -16.135 -38.681 1.00 27.62 ? 181 GLU A CG  1 
ATOM   856  C CD  . GLU A 1 119 ? -6.531  -17.151 -39.691 1.00 29.39 ? 181 GLU A CD  1 
ATOM   857  O OE1 . GLU A 1 119 ? -7.723  -17.120 -40.076 1.00 31.01 ? 181 GLU A OE1 1 
ATOM   858  O OE2 . GLU A 1 119 ? -5.690  -17.974 -40.114 1.00 29.53 ? 181 GLU A OE2 1 
ATOM   859  N N   . MET A 1 120 ? -4.430  -15.882 -35.525 1.00 27.74 ? 182 MET A N   1 
ATOM   860  C CA  . MET A 1 120 ? -4.991  -15.979 -34.196 1.00 28.50 ? 182 MET A CA  1 
ATOM   861  C C   . MET A 1 120 ? -4.739  -14.680 -33.450 1.00 28.77 ? 182 MET A C   1 
ATOM   862  O O   . MET A 1 120 ? -5.667  -14.088 -32.918 1.00 29.61 ? 182 MET A O   1 
ATOM   863  C CB  . MET A 1 120 ? -4.397  -17.163 -33.438 1.00 28.20 ? 182 MET A CB  1 
ATOM   864  C CG  . MET A 1 120 ? -4.904  -17.287 -32.013 1.00 28.53 ? 182 MET A CG  1 
ATOM   865  S SD  . MET A 1 120 ? -4.326  -18.755 -31.132 1.00 29.40 ? 182 MET A SD  1 
ATOM   866  C CE  . MET A 1 120 ? -2.542  -18.493 -31.075 1.00 29.21 ? 182 MET A CE  1 
ATOM   867  N N   . VAL A 1 121 ? -3.493  -14.219 -33.438 1.00 29.08 ? 183 VAL A N   1 
ATOM   868  C CA  . VAL A 1 121 ? -3.137  -13.002 -32.707 1.00 28.95 ? 183 VAL A CA  1 
ATOM   869  C C   . VAL A 1 121 ? -4.002  -11.813 -33.132 1.00 29.19 ? 183 VAL A C   1 
ATOM   870  O O   . VAL A 1 121 ? -4.440  -11.013 -32.298 1.00 28.93 ? 183 VAL A O   1 
ATOM   871  C CB  . VAL A 1 121 ? -1.631  -12.689 -32.851 1.00 29.14 ? 183 VAL A CB  1 
ATOM   872  C CG1 . VAL A 1 121 ? -1.320  -11.224 -32.510 1.00 27.95 ? 183 VAL A CG1 1 
ATOM   873  C CG2 . VAL A 1 121 ? -0.815  -13.646 -31.976 1.00 28.40 ? 183 VAL A CG2 1 
ATOM   874  N N   . TRP A 1 122 ? -4.260  -11.717 -34.429 1.00 29.45 ? 184 TRP A N   1 
ATOM   875  C CA  . TRP A 1 122 ? -5.069  -10.638 -34.966 1.00 29.82 ? 184 TRP A CA  1 
ATOM   876  C C   . TRP A 1 122 ? -6.526  -10.769 -34.530 1.00 30.22 ? 184 TRP A C   1 
ATOM   877  O O   . TRP A 1 122 ? -7.081  -9.870  -33.892 1.00 30.37 ? 184 TRP A O   1 
ATOM   878  C CB  . TRP A 1 122 ? -4.985  -10.622 -36.488 1.00 29.66 ? 184 TRP A CB  1 
ATOM   879  C CG  . TRP A 1 122 ? -5.788  -9.517  -37.096 1.00 30.17 ? 184 TRP A CG  1 
ATOM   880  C CD1 . TRP A 1 122 ? -7.051  -9.606  -37.602 1.00 29.42 ? 184 TRP A CD1 1 
ATOM   881  C CD2 . TRP A 1 122 ? -5.386  -8.145  -37.255 1.00 30.64 ? 184 TRP A CD2 1 
ATOM   882  N NE1 . TRP A 1 122 ? -7.457  -8.382  -38.074 1.00 30.33 ? 184 TRP A NE1 1 
ATOM   883  C CE2 . TRP A 1 122 ? -6.459  -7.466  -37.867 1.00 30.05 ? 184 TRP A CE2 1 
ATOM   884  C CE3 . TRP A 1 122 ? -4.218  -7.427  -36.941 1.00 30.40 ? 184 TRP A CE3 1 
ATOM   885  C CZ2 . TRP A 1 122 ? -6.406  -6.108  -38.172 1.00 30.08 ? 184 TRP A CZ2 1 
ATOM   886  C CZ3 . TRP A 1 122 ? -4.167  -6.079  -37.242 1.00 29.65 ? 184 TRP A CZ3 1 
ATOM   887  C CH2 . TRP A 1 122 ? -5.254  -5.434  -37.854 1.00 29.94 ? 184 TRP A CH2 1 
ATOM   888  N N   . GLN A 1 123 ? -7.124  -11.905 -34.874 1.00 30.57 ? 185 GLN A N   1 
ATOM   889  C CA  . GLN A 1 123 ? -8.542  -12.163 -34.651 1.00 30.91 ? 185 GLN A CA  1 
ATOM   890  C C   . GLN A 1 123 ? -8.948  -12.102 -33.190 1.00 30.33 ? 185 GLN A C   1 
ATOM   891  O O   . GLN A 1 123 ? -10.018 -11.599 -32.868 1.00 29.89 ? 185 GLN A O   1 
ATOM   892  C CB  . GLN A 1 123 ? -8.942  -13.500 -35.282 1.00 30.86 ? 185 GLN A CB  1 
ATOM   893  C CG  . GLN A 1 123 ? -8.973  -13.419 -36.813 1.00 32.01 ? 185 GLN A CG  1 
ATOM   894  C CD  . GLN A 1 123 ? -9.408  -14.716 -37.490 1.00 32.44 ? 185 GLN A CD  1 
ATOM   895  O OE1 . GLN A 1 123 ? -9.881  -15.666 -36.835 1.00 34.36 ? 185 GLN A OE1 1 
ATOM   896  N NE2 . GLN A 1 123 ? -9.256  -14.759 -38.813 1.00 31.33 ? 185 GLN A NE2 1 
ATOM   897  N N   . GLU A 1 124 ? -8.084  -12.585 -32.305 1.00 30.28 ? 186 GLU A N   1 
ATOM   898  C CA  . GLU A 1 124 ? -8.387  -12.528 -30.871 1.00 30.63 ? 186 GLU A CA  1 
ATOM   899  C C   . GLU A 1 124 ? -7.928  -11.218 -30.217 1.00 30.45 ? 186 GLU A C   1 
ATOM   900  O O   . GLU A 1 124 ? -8.094  -11.023 -29.014 1.00 30.56 ? 186 GLU A O   1 
ATOM   901  C CB  . GLU A 1 124 ? -7.850  -13.770 -30.133 1.00 30.60 ? 186 GLU A CB  1 
ATOM   902  C CG  . GLU A 1 124 ? -8.345  -15.120 -30.699 1.00 31.70 ? 186 GLU A CG  1 
ATOM   903  C CD  . GLU A 1 124 ? -9.859  -15.201 -30.788 1.00 34.73 ? 186 GLU A CD  1 
ATOM   904  O OE1 . GLU A 1 124 ? -10.520 -14.755 -29.829 1.00 36.95 ? 186 GLU A OE1 1 
ATOM   905  O OE2 . GLU A 1 124 ? -10.404 -15.703 -31.804 1.00 35.51 ? 186 GLU A OE2 1 
ATOM   906  N N   . GLU A 1 125 ? -7.382  -10.312 -31.025 1.00 30.30 ? 187 GLU A N   1 
ATOM   907  C CA  . GLU A 1 125 ? -6.944  -9.004  -30.545 1.00 30.65 ? 187 GLU A CA  1 
ATOM   908  C C   . GLU A 1 125 ? -5.885  -9.130  -29.452 1.00 29.81 ? 187 GLU A C   1 
ATOM   909  O O   . GLU A 1 125 ? -6.009  -8.525  -28.386 1.00 29.35 ? 187 GLU A O   1 
ATOM   910  C CB  . GLU A 1 125 ? -8.126  -8.186  -30.022 1.00 31.27 ? 187 GLU A CB  1 
ATOM   911  C CG  . GLU A 1 125 ? -9.184  -7.879  -31.064 1.00 34.16 ? 187 GLU A CG  1 
ATOM   912  C CD  . GLU A 1 125 ? -9.909  -6.585  -30.774 1.00 37.22 ? 187 GLU A CD  1 
ATOM   913  O OE1 . GLU A 1 125 ? -11.161 -6.565  -30.854 1.00 38.51 ? 187 GLU A OE1 1 
ATOM   914  O OE2 . GLU A 1 125 ? -9.218  -5.586  -30.464 1.00 38.08 ? 187 GLU A OE2 1 
ATOM   915  N N   . VAL A 1 126 ? -4.858  -9.925  -29.741 1.00 28.92 ? 188 VAL A N   1 
ATOM   916  C CA  . VAL A 1 126 ? -3.758  -10.170 -28.830 1.00 28.57 ? 188 VAL A CA  1 
ATOM   917  C C   . VAL A 1 126 ? -2.792  -8.986  -28.850 1.00 28.96 ? 188 VAL A C   1 
ATOM   918  O O   . VAL A 1 126 ? -2.403  -8.500  -29.924 1.00 29.01 ? 188 VAL A O   1 
ATOM   919  C CB  . VAL A 1 126 ? -3.018  -11.484 -29.203 1.00 28.32 ? 188 VAL A CB  1 
ATOM   920  C CG1 . VAL A 1 126 ? -1.674  -11.562 -28.527 1.00 28.44 ? 188 VAL A CG1 1 
ATOM   921  C CG2 . VAL A 1 126 ? -3.854  -12.696 -28.862 1.00 26.58 ? 188 VAL A CG2 1 
ATOM   922  N N   . SER A 1 127 ? -2.409  -8.502  -27.671 1.00 28.98 ? 189 SER A N   1 
ATOM   923  C CA  . SER A 1 127 ? -1.387  -7.446  -27.619 1.00 29.00 ? 189 SER A CA  1 
ATOM   924  C C   . SER A 1 127 ? -0.121  -7.875  -26.861 1.00 29.04 ? 189 SER A C   1 
ATOM   925  O O   . SER A 1 127 ? 0.852   -7.126  -26.791 1.00 29.12 ? 189 SER A O   1 
ATOM   926  C CB  . SER A 1 127 ? -1.965  -6.153  -27.046 1.00 28.80 ? 189 SER A CB  1 
ATOM   927  O OG  . SER A 1 127 ? -2.248  -6.294  -25.672 1.00 28.29 ? 189 SER A OG  1 
ATOM   928  N N   . LEU A 1 128 ? -0.134  -9.101  -26.337 1.00 28.74 ? 190 LEU A N   1 
ATOM   929  C CA  . LEU A 1 128 ? 0.927   -9.587  -25.461 1.00 28.66 ? 190 LEU A CA  1 
ATOM   930  C C   . LEU A 1 128 ? 1.243   -11.071 -25.705 1.00 27.98 ? 190 LEU A C   1 
ATOM   931  O O   . LEU A 1 128 ? 0.365   -11.925 -25.637 1.00 28.12 ? 190 LEU A O   1 
ATOM   932  C CB  . LEU A 1 128 ? 0.518   -9.346  -24.008 1.00 28.47 ? 190 LEU A CB  1 
ATOM   933  C CG  . LEU A 1 128 ? 1.529   -9.391  -22.881 1.00 29.98 ? 190 LEU A CG  1 
ATOM   934  C CD1 . LEU A 1 128 ? 2.960   -9.019  -23.311 1.00 30.43 ? 190 LEU A CD1 1 
ATOM   935  C CD2 . LEU A 1 128 ? 1.021   -8.446  -21.799 1.00 32.10 ? 190 LEU A CD2 1 
ATOM   936  N N   . ILE A 1 129 ? 2.497   -11.367 -26.013 1.00 27.64 ? 191 ILE A N   1 
ATOM   937  C CA  . ILE A 1 129 ? 2.907   -12.752 -26.245 1.00 27.33 ? 191 ILE A CA  1 
ATOM   938  C C   . ILE A 1 129 ? 4.081   -13.079 -25.356 1.00 27.44 ? 191 ILE A C   1 
ATOM   939  O O   . ILE A 1 129 ? 5.093   -12.380 -25.371 1.00 27.41 ? 191 ILE A O   1 
ATOM   940  C CB  . ILE A 1 129 ? 3.312   -13.037 -27.717 1.00 26.91 ? 191 ILE A CB  1 
ATOM   941  C CG1 . ILE A 1 129 ? 2.145   -12.815 -28.678 1.00 25.98 ? 191 ILE A CG1 1 
ATOM   942  C CG2 . ILE A 1 129 ? 3.840   -14.462 -27.849 1.00 26.56 ? 191 ILE A CG2 1 
ATOM   943  C CD1 . ILE A 1 129 ? 2.565   -12.798 -30.121 1.00 27.16 ? 191 ILE A CD1 1 
ATOM   944  N N   . VAL A 1 130 ? 3.937   -14.149 -24.586 1.00 27.79 ? 192 VAL A N   1 
ATOM   945  C CA  . VAL A 1 130 ? 5.015   -14.653 -23.758 1.00 28.24 ? 192 VAL A CA  1 
ATOM   946  C C   . VAL A 1 130 ? 5.483   -15.974 -24.339 1.00 28.54 ? 192 VAL A C   1 
ATOM   947  O O   . VAL A 1 130 ? 4.675   -16.872 -24.587 1.00 28.57 ? 192 VAL A O   1 
ATOM   948  C CB  . VAL A 1 130 ? 4.567   -14.813 -22.289 1.00 28.30 ? 192 VAL A CB  1 
ATOM   949  C CG1 . VAL A 1 130 ? 5.669   -15.406 -21.448 1.00 29.16 ? 192 VAL A CG1 1 
ATOM   950  C CG2 . VAL A 1 130 ? 4.153   -13.477 -21.724 1.00 27.51 ? 192 VAL A CG2 1 
ATOM   951  N N   . MET A 1 131 ? 6.791   -16.059 -24.595 1.00 29.17 ? 193 MET A N   1 
ATOM   952  C CA  . MET A 1 131 ? 7.448   -17.277 -25.078 1.00 29.05 ? 193 MET A CA  1 
ATOM   953  C C   . MET A 1 131 ? 8.370   -17.841 -23.995 1.00 29.59 ? 193 MET A C   1 
ATOM   954  O O   . MET A 1 131 ? 9.223   -17.127 -23.479 1.00 29.82 ? 193 MET A O   1 
ATOM   955  C CB  . MET A 1 131 ? 8.249   -16.956 -26.334 1.00 29.18 ? 193 MET A CB  1 
ATOM   956  C CG  . MET A 1 131 ? 9.140   -18.083 -26.832 1.00 28.93 ? 193 MET A CG  1 
ATOM   957  S SD  . MET A 1 131 ? 9.617   -17.719 -28.523 1.00 28.13 ? 193 MET A SD  1 
ATOM   958  C CE  . MET A 1 131 ? 10.763  -19.052 -28.862 1.00 27.46 ? 193 MET A CE  1 
ATOM   959  N N   . LEU A 1 132 ? 8.180   -19.105 -23.633 1.00 29.84 ? 194 LEU A N   1 
ATOM   960  C CA  . LEU A 1 132 ? 9.059   -19.761 -22.666 1.00 30.39 ? 194 LEU A CA  1 
ATOM   961  C C   . LEU A 1 132 ? 9.900   -20.851 -23.336 1.00 30.91 ? 194 LEU A C   1 
ATOM   962  O O   . LEU A 1 132 ? 9.369   -21.838 -23.863 1.00 31.40 ? 194 LEU A O   1 
ATOM   963  C CB  . LEU A 1 132 ? 8.257   -20.338 -21.502 1.00 30.47 ? 194 LEU A CB  1 
ATOM   964  C CG  . LEU A 1 132 ? 7.144   -19.450 -20.948 1.00 30.25 ? 194 LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 132 ? 6.203   -20.314 -20.181 1.00 30.67 ? 194 LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 132 ? 7.676   -18.303 -20.082 1.00 28.54 ? 194 LEU A CD2 1 
ATOM   967  N N   . THR A 1 133 ? 11.215  -20.657 -23.325 1.00 31.07 ? 195 THR A N   1 
ATOM   968  C CA  . THR A 1 133 ? 12.125  -21.534 -24.039 1.00 31.25 ? 195 THR A CA  1 
ATOM   969  C C   . THR A 1 133 ? 13.422  -21.714 -23.256 1.00 31.96 ? 195 THR A C   1 
ATOM   970  O O   . THR A 1 133 ? 13.556  -21.245 -22.121 1.00 32.06 ? 195 THR A O   1 
ATOM   971  C CB  . THR A 1 133 ? 12.377  -21.006 -25.498 1.00 31.19 ? 195 THR A CB  1 
ATOM   972  O OG1 . THR A 1 133 ? 13.076  -21.990 -26.267 1.00 31.21 ? 195 THR A OG1 1 
ATOM   973  C CG2 . THR A 1 133 ? 13.162  -19.696 -25.513 1.00 30.17 ? 195 THR A CG2 1 
ATOM   974  N N   . GLN A 1 134 ? 14.364  -22.429 -23.851 1.00 33.00 ? 196 GLN A N   1 
ATOM   975  C CA  . GLN A 1 134 ? 15.742  -22.460 -23.360 1.00 33.78 ? 196 GLN A CA  1 
ATOM   976  C C   . GLN A 1 134 ? 16.722  -22.388 -24.533 1.00 33.73 ? 196 GLN A C   1 
ATOM   977  O O   . GLN A 1 134 ? 16.642  -23.191 -25.470 1.00 33.58 ? 196 GLN A O   1 
ATOM   978  C CB  . GLN A 1 134 ? 15.992  -23.688 -22.470 1.00 33.82 ? 196 GLN A CB  1 
ATOM   979  C CG  . GLN A 1 134 ? 17.473  -23.948 -22.144 1.00 36.29 ? 196 GLN A CG  1 
ATOM   980  C CD  . GLN A 1 134 ? 18.095  -22.855 -21.269 1.00 38.81 ? 196 GLN A CD  1 
ATOM   981  O OE1 . GLN A 1 134 ? 17.696  -22.660 -20.114 1.00 39.84 ? 196 GLN A OE1 1 
ATOM   982  N NE2 . GLN A 1 134 ? 19.083  -22.146 -21.818 1.00 39.31 ? 196 GLN A NE2 1 
ATOM   983  N N   . LEU A 1 135 ? 17.645  -21.425 -24.437 1.00 34.33 ? 197 LEU A N   1 
ATOM   984  C CA  . LEU A 1 135 ? 18.576  -21.016 -25.507 1.00 34.35 ? 197 LEU A CA  1 
ATOM   985  C C   . LEU A 1 135 ? 19.628  -22.052 -25.909 1.00 34.36 ? 197 LEU A C   1 
ATOM   986  O O   . LEU A 1 135 ? 20.007  -22.897 -25.100 1.00 33.97 ? 197 LEU A O   1 
ATOM   987  C CB  . LEU A 1 135 ? 19.281  -19.712 -25.101 1.00 34.65 ? 197 LEU A CB  1 
ATOM   988  N N   . ARG A 1 136 ? 20.105  -21.928 -27.160 1.00 34.56 ? 198 ARG A N   1 
ATOM   989  C CA  . ARG A 1 136 ? 21.068  -22.841 -27.818 1.00 34.37 ? 198 ARG A CA  1 
ATOM   990  C C   . ARG A 1 136 ? 21.174  -24.226 -27.177 1.00 34.37 ? 198 ARG A C   1 
ATOM   991  O O   . ARG A 1 136 ? 20.172  -24.925 -27.016 1.00 34.25 ? 198 ARG A O   1 
ATOM   992  C CB  . ARG A 1 136 ? 22.460  -22.197 -27.958 1.00 34.48 ? 198 ARG A CB  1 
ATOM   993  N N   . VAL A 1 143 ? 11.441  -22.290 -33.614 1.00 33.97 ? 205 VAL A N   1 
ATOM   994  C CA  . VAL A 1 143 ? 11.395  -21.618 -34.915 1.00 34.18 ? 205 VAL A CA  1 
ATOM   995  C C   . VAL A 1 143 ? 10.917  -20.161 -34.800 1.00 33.90 ? 205 VAL A C   1 
ATOM   996  O O   . VAL A 1 143 ? 9.977   -19.857 -34.064 1.00 33.97 ? 205 VAL A O   1 
ATOM   997  C CB  . VAL A 1 143 ? 10.544  -22.418 -35.990 1.00 34.46 ? 205 VAL A CB  1 
ATOM   998  C CG1 . VAL A 1 143 ? 10.194  -23.837 -35.501 1.00 34.63 ? 205 VAL A CG1 1 
ATOM   999  C CG2 . VAL A 1 143 ? 9.288   -21.638 -36.463 1.00 34.21 ? 205 VAL A CG2 1 
ATOM   1000 N N   . HIS A 1 144 ? 11.567  -19.281 -35.555 1.00 33.47 ? 206 HIS A N   1 
ATOM   1001 C CA  . HIS A 1 144 ? 11.336  -17.843 -35.484 1.00 33.44 ? 206 HIS A CA  1 
ATOM   1002 C C   . HIS A 1 144 ? 10.106  -17.422 -36.286 1.00 32.55 ? 206 HIS A C   1 
ATOM   1003 O O   . HIS A 1 144 ? 10.115  -17.470 -37.516 1.00 32.97 ? 206 HIS A O   1 
ATOM   1004 C CB  . HIS A 1 144 ? 12.576  -17.096 -36.001 1.00 34.09 ? 206 HIS A CB  1 
ATOM   1005 C CG  . HIS A 1 144 ? 13.783  -17.238 -35.120 1.00 36.06 ? 206 HIS A CG  1 
ATOM   1006 N ND1 . HIS A 1 144 ? 14.281  -18.462 -34.724 1.00 37.25 ? 206 HIS A ND1 1 
ATOM   1007 C CD2 . HIS A 1 144 ? 14.595  -16.305 -34.566 1.00 37.40 ? 206 HIS A CD2 1 
ATOM   1008 C CE1 . HIS A 1 144 ? 15.341  -18.277 -33.955 1.00 38.27 ? 206 HIS A CE1 1 
ATOM   1009 N NE2 . HIS A 1 144 ? 15.554  -16.977 -33.847 1.00 38.39 ? 206 HIS A NE2 1 
ATOM   1010 N N   . TYR A 1 145 ? 9.051   -17.006 -35.590 1.00 31.28 ? 207 TYR A N   1 
ATOM   1011 C CA  . TYR A 1 145 ? 7.816   -16.569 -36.243 1.00 29.83 ? 207 TYR A CA  1 
ATOM   1012 C C   . TYR A 1 145 ? 7.733   -15.044 -36.304 1.00 29.77 ? 207 TYR A C   1 
ATOM   1013 O O   . TYR A 1 145 ? 6.678   -14.475 -36.568 1.00 29.62 ? 207 TYR A O   1 
ATOM   1014 C CB  . TYR A 1 145 ? 6.588   -17.166 -35.536 1.00 28.61 ? 207 TYR A CB  1 
ATOM   1015 C CG  . TYR A 1 145 ? 6.484   -16.842 -34.060 1.00 26.75 ? 207 TYR A CG  1 
ATOM   1016 C CD1 . TYR A 1 145 ? 6.020   -15.602 -33.633 1.00 25.39 ? 207 TYR A CD1 1 
ATOM   1017 C CD2 . TYR A 1 145 ? 6.829   -17.779 -33.092 1.00 25.55 ? 207 TYR A CD2 1 
ATOM   1018 C CE1 . TYR A 1 145 ? 5.910   -15.296 -32.296 1.00 25.34 ? 207 TYR A CE1 1 
ATOM   1019 C CE2 . TYR A 1 145 ? 6.711   -17.480 -31.720 1.00 25.41 ? 207 TYR A CE2 1 
ATOM   1020 C CZ  . TYR A 1 145 ? 6.256   -16.236 -31.341 1.00 25.46 ? 207 TYR A CZ  1 
ATOM   1021 O OH  . TYR A 1 145 ? 6.138   -15.901 -30.021 1.00 25.21 ? 207 TYR A OH  1 
ATOM   1022 N N   . TRP A 1 146 ? 8.864   -14.401 -36.046 1.00 29.86 ? 208 TRP A N   1 
ATOM   1023 C CA  . TRP A 1 146 ? 8.965   -12.956 -35.944 1.00 29.95 ? 208 TRP A CA  1 
ATOM   1024 C C   . TRP A 1 146 ? 10.294  -12.624 -36.582 1.00 30.32 ? 208 TRP A C   1 
ATOM   1025 O O   . TRP A 1 146 ? 11.244  -13.397 -36.441 1.00 30.42 ? 208 TRP A O   1 
ATOM   1026 C CB  . TRP A 1 146 ? 8.963   -12.516 -34.472 1.00 29.79 ? 208 TRP A CB  1 
ATOM   1027 C CG  . TRP A 1 146 ? 10.221  -12.886 -33.757 1.00 29.31 ? 208 TRP A CG  1 
ATOM   1028 C CD1 . TRP A 1 146 ? 11.379  -12.169 -33.715 1.00 28.69 ? 208 TRP A CD1 1 
ATOM   1029 C CD2 . TRP A 1 146 ? 10.459  -14.082 -33.006 1.00 29.38 ? 208 TRP A CD2 1 
ATOM   1030 N NE1 . TRP A 1 146 ? 12.328  -12.842 -32.987 1.00 29.06 ? 208 TRP A NE1 1 
ATOM   1031 C CE2 . TRP A 1 146 ? 11.790  -14.019 -32.535 1.00 29.34 ? 208 TRP A CE2 1 
ATOM   1032 C CE3 . TRP A 1 146 ? 9.678   -15.202 -32.689 1.00 27.82 ? 208 TRP A CE3 1 
ATOM   1033 C CZ2 . TRP A 1 146 ? 12.357  -15.030 -31.755 1.00 28.98 ? 208 TRP A CZ2 1 
ATOM   1034 C CZ3 . TRP A 1 146 ? 10.233  -16.199 -31.921 1.00 28.58 ? 208 TRP A CZ3 1 
ATOM   1035 C CH2 . TRP A 1 146 ? 11.568  -16.112 -31.463 1.00 29.19 ? 208 TRP A CH2 1 
ATOM   1036 N N   . PRO A 1 147 ? 10.380  -11.471 -37.272 1.00 30.64 ? 209 PRO A N   1 
ATOM   1037 C CA  . PRO A 1 147 ? 11.549  -11.174 -38.088 1.00 30.63 ? 209 PRO A CA  1 
ATOM   1038 C C   . PRO A 1 147 ? 12.599  -10.405 -37.301 1.00 31.10 ? 209 PRO A C   1 
ATOM   1039 O O   . PRO A 1 147 ? 12.372  -10.057 -36.135 1.00 30.90 ? 209 PRO A O   1 
ATOM   1040 C CB  . PRO A 1 147 ? 10.969  -10.283 -39.190 1.00 30.59 ? 209 PRO A CB  1 
ATOM   1041 C CG  . PRO A 1 147 ? 9.817   -9.570  -38.533 1.00 30.48 ? 209 PRO A CG  1 
ATOM   1042 C CD  . PRO A 1 147 ? 9.399   -10.372 -37.313 1.00 30.36 ? 209 PRO A CD  1 
ATOM   1043 N N   . THR A 1 148 ? 13.732  -10.136 -37.942 1.00 31.57 ? 210 THR A N   1 
ATOM   1044 C CA  . THR A 1 148 ? 14.753  -9.288  -37.351 1.00 32.48 ? 210 THR A CA  1 
ATOM   1045 C C   . THR A 1 148 ? 14.333  -7.822  -37.462 1.00 33.00 ? 210 THR A C   1 
ATOM   1046 O O   . THR A 1 148 ? 14.524  -7.037  -36.523 1.00 33.21 ? 210 THR A O   1 
ATOM   1047 C CB  . THR A 1 148 ? 16.112  -9.510  -38.021 1.00 32.53 ? 210 THR A CB  1 
ATOM   1048 O OG1 . THR A 1 148 ? 16.337  -10.916 -38.162 1.00 32.73 ? 210 THR A OG1 1 
ATOM   1049 C CG2 . THR A 1 148 ? 17.239  -8.900  -37.186 1.00 32.81 ? 210 THR A CG2 1 
ATOM   1050 N N   . GLU A 1 149 ? 13.757  -7.467  -38.611 1.00 33.33 ? 211 GLU A N   1 
ATOM   1051 C CA  . GLU A 1 149 ? 13.263  -6.112  -38.850 1.00 33.60 ? 211 GLU A CA  1 
ATOM   1052 C C   . GLU A 1 149 ? 11.795  -6.164  -39.298 1.00 33.53 ? 211 GLU A C   1 
ATOM   1053 O O   . GLU A 1 149 ? 10.891  -5.708  -38.587 1.00 33.16 ? 211 GLU A O   1 
ATOM   1054 C CB  . GLU A 1 149 ? 14.168  -5.380  -39.865 1.00 33.61 ? 211 GLU A CB  1 
ATOM   1055 C CG  . GLU A 1 149 ? 13.859  -3.890  -40.132 1.00 34.20 ? 211 GLU A CG  1 
ATOM   1056 C CD  . GLU A 1 149 ? 13.480  -3.079  -38.885 1.00 35.54 ? 211 GLU A CD  1 
ATOM   1057 O OE1 . GLU A 1 149 ? 12.459  -2.350  -38.952 1.00 35.27 ? 211 GLU A OE1 1 
ATOM   1058 O OE2 . GLU A 1 149 ? 14.194  -3.165  -37.852 1.00 35.59 ? 211 GLU A OE2 1 
ATOM   1059 N N   . GLU A 1 150 ? 11.565  -6.739  -40.471 1.00 33.63 ? 212 GLU A N   1 
ATOM   1060 C CA  . GLU A 1 150 ? 10.217  -6.894  -40.979 1.00 33.68 ? 212 GLU A CA  1 
ATOM   1061 C C   . GLU A 1 150 ? 10.114  -8.084  -41.918 1.00 33.49 ? 212 GLU A C   1 
ATOM   1062 O O   . GLU A 1 150 ? 11.074  -8.439  -42.604 1.00 33.28 ? 212 GLU A O   1 
ATOM   1063 C CB  . GLU A 1 150 ? 9.747   -5.608  -41.689 1.00 33.92 ? 212 GLU A CB  1 
ATOM   1064 C CG  . GLU A 1 150 ? 10.105  -5.499  -43.174 1.00 34.46 ? 212 GLU A CG  1 
ATOM   1065 C CD  . GLU A 1 150 ? 9.220   -6.366  -44.069 1.00 36.10 ? 212 GLU A CD  1 
ATOM   1066 O OE1 . GLU A 1 150 ? 9.748   -6.967  -45.034 1.00 37.57 ? 212 GLU A OE1 1 
ATOM   1067 O OE2 . GLU A 1 150 ? 7.999   -6.464  -43.807 1.00 36.55 ? 212 GLU A OE2 1 
ATOM   1068 N N   . GLU A 1 151 ? 8.944   -8.711  -41.912 1.00 33.49 ? 213 GLU A N   1 
ATOM   1069 C CA  . GLU A 1 151 ? 8.473   -9.468  -43.066 1.00 33.33 ? 213 GLU A CA  1 
ATOM   1070 C C   . GLU A 1 151 ? 6.996   -9.835  -42.940 1.00 32.68 ? 213 GLU A C   1 
ATOM   1071 O O   . GLU A 1 151 ? 6.374   -9.602  -41.902 1.00 32.05 ? 213 GLU A O   1 
ATOM   1072 C CB  . GLU A 1 151 ? 9.363   -10.671 -43.380 1.00 33.81 ? 213 GLU A CB  1 
ATOM   1073 C CG  . GLU A 1 151 ? 9.031   -11.956 -42.661 1.00 35.12 ? 213 GLU A CG  1 
ATOM   1074 C CD  . GLU A 1 151 ? 9.564   -13.146 -43.433 1.00 37.29 ? 213 GLU A CD  1 
ATOM   1075 O OE1 . GLU A 1 151 ? 9.614   -13.062 -44.689 1.00 38.18 ? 213 GLU A OE1 1 
ATOM   1076 O OE2 . GLU A 1 151 ? 9.947   -14.147 -42.793 1.00 37.66 ? 213 GLU A OE2 1 
ATOM   1077 N N   . THR A 1 152 ? 6.458   -10.395 -44.020 1.00 32.02 ? 214 THR A N   1 
ATOM   1078 C CA  . THR A 1 152 ? 5.056   -10.759 -44.110 1.00 31.59 ? 214 THR A CA  1 
ATOM   1079 C C   . THR A 1 152 ? 4.860   -12.264 -43.894 1.00 31.21 ? 214 THR A C   1 
ATOM   1080 O O   . THR A 1 152 ? 5.662   -13.077 -44.338 1.00 31.34 ? 214 THR A O   1 
ATOM   1081 C CB  . THR A 1 152 ? 4.447   -10.340 -45.487 1.00 31.60 ? 214 THR A CB  1 
ATOM   1082 O OG1 . THR A 1 152 ? 5.018   -11.148 -46.524 1.00 31.93 ? 214 THR A OG1 1 
ATOM   1083 C CG2 . THR A 1 152 ? 4.707   -8.855  -45.791 1.00 30.80 ? 214 THR A CG2 1 
ATOM   1084 N N   . TYR A 1 153 ? 3.789   -12.621 -43.202 1.00 30.99 ? 215 TYR A N   1 
ATOM   1085 C CA  . TYR A 1 153 ? 3.423   -14.015 -42.993 1.00 30.95 ? 215 TYR A CA  1 
ATOM   1086 C C   . TYR A 1 153 ? 1.973   -14.136 -43.411 1.00 30.63 ? 215 TYR A C   1 
ATOM   1087 O O   . TYR A 1 153 ? 1.065   -13.813 -42.645 1.00 31.06 ? 215 TYR A O   1 
ATOM   1088 C CB  . TYR A 1 153 ? 3.609   -14.418 -41.521 1.00 31.32 ? 215 TYR A CB  1 
ATOM   1089 C CG  . TYR A 1 153 ? 4.995   -14.127 -40.983 1.00 31.59 ? 215 TYR A CG  1 
ATOM   1090 C CD1 . TYR A 1 153 ? 5.226   -13.022 -40.165 1.00 32.06 ? 215 TYR A CD1 1 
ATOM   1091 C CD2 . TYR A 1 153 ? 6.081   -14.938 -41.318 1.00 31.86 ? 215 TYR A CD2 1 
ATOM   1092 C CE1 . TYR A 1 153 ? 6.507   -12.738 -39.665 1.00 31.83 ? 215 TYR A CE1 1 
ATOM   1093 C CE2 . TYR A 1 153 ? 7.364   -14.664 -40.831 1.00 32.93 ? 215 TYR A CE2 1 
ATOM   1094 C CZ  . TYR A 1 153 ? 7.565   -13.561 -39.999 1.00 32.44 ? 215 TYR A CZ  1 
ATOM   1095 O OH  . TYR A 1 153 ? 8.828   -13.280 -39.525 1.00 32.08 ? 215 TYR A OH  1 
ATOM   1096 N N   . GLY A 1 154 ? 1.754   -14.568 -44.645 1.00 29.92 ? 216 GLY A N   1 
ATOM   1097 C CA  . GLY A 1 154 ? 0.423   -14.510 -45.220 1.00 29.29 ? 216 GLY A CA  1 
ATOM   1098 C C   . GLY A 1 154 ? -0.009  -13.066 -45.428 1.00 28.49 ? 216 GLY A C   1 
ATOM   1099 O O   . GLY A 1 154 ? 0.734   -12.281 -46.020 1.00 28.54 ? 216 GLY A O   1 
ATOM   1100 N N   . PRO A 1 155 ? -1.212  -12.706 -44.938 1.00 27.98 ? 217 PRO A N   1 
ATOM   1101 C CA  . PRO A 1 155 ? -1.749  -11.365 -45.162 1.00 27.45 ? 217 PRO A CA  1 
ATOM   1102 C C   . PRO A 1 155 ? -1.276  -10.345 -44.121 1.00 27.24 ? 217 PRO A C   1 
ATOM   1103 O O   . PRO A 1 155 ? -1.676  -9.189  -44.170 1.00 27.14 ? 217 PRO A O   1 
ATOM   1104 C CB  . PRO A 1 155 ? -3.262  -11.581 -45.081 1.00 27.15 ? 217 PRO A CB  1 
ATOM   1105 C CG  . PRO A 1 155 ? -3.432  -12.773 -44.162 1.00 27.56 ? 217 PRO A CG  1 
ATOM   1106 C CD  . PRO A 1 155 ? -2.138  -13.550 -44.153 1.00 27.75 ? 217 PRO A CD  1 
ATOM   1107 N N   . PHE A 1 156 ? -0.416  -10.775 -43.203 1.00 27.42 ? 218 PHE A N   1 
ATOM   1108 C CA  . PHE A 1 156 ? 0.053   -9.916  -42.120 1.00 27.76 ? 218 PHE A CA  1 
ATOM   1109 C C   . PHE A 1 156 ? 1.508   -9.512  -42.327 1.00 27.85 ? 218 PHE A C   1 
ATOM   1110 O O   . PHE A 1 156 ? 2.352   -10.345 -42.648 1.00 27.61 ? 218 PHE A O   1 
ATOM   1111 C CB  . PHE A 1 156 ? -0.094  -10.602 -40.744 1.00 27.81 ? 218 PHE A CB  1 
ATOM   1112 C CG  . PHE A 1 156 ? -1.408  -11.302 -40.546 1.00 27.93 ? 218 PHE A CG  1 
ATOM   1113 C CD1 . PHE A 1 156 ? -1.501  -12.682 -40.685 1.00 28.39 ? 218 PHE A CD1 1 
ATOM   1114 C CD2 . PHE A 1 156 ? -2.553  -10.587 -40.218 1.00 28.74 ? 218 PHE A CD2 1 
ATOM   1115 C CE1 . PHE A 1 156 ? -2.730  -13.346 -40.508 1.00 28.93 ? 218 PHE A CE1 1 
ATOM   1116 C CE2 . PHE A 1 156 ? -3.794  -11.240 -40.035 1.00 29.10 ? 218 PHE A CE2 1 
ATOM   1117 C CZ  . PHE A 1 156 ? -3.876  -12.622 -40.182 1.00 28.53 ? 218 PHE A CZ  1 
ATOM   1118 N N   . GLN A 1 157 ? 1.782   -8.226  -42.127 1.00 27.78 ? 219 GLN A N   1 
ATOM   1119 C CA  . GLN A 1 157 ? 3.138   -7.712  -42.064 1.00 27.75 ? 219 GLN A CA  1 
ATOM   1120 C C   . GLN A 1 157 ? 3.513   -7.484  -40.596 1.00 27.52 ? 219 GLN A C   1 
ATOM   1121 O O   . GLN A 1 157 ? 2.739   -6.916  -39.823 1.00 27.45 ? 219 GLN A O   1 
ATOM   1122 C CB  . GLN A 1 157 ? 3.251   -6.411  -42.869 1.00 27.74 ? 219 GLN A CB  1 
ATOM   1123 C CG  . GLN A 1 157 ? 4.683   -6.005  -43.240 1.00 28.23 ? 219 GLN A CG  1 
ATOM   1124 C CD  . GLN A 1 157 ? 4.742   -4.761  -44.116 1.00 28.26 ? 219 GLN A CD  1 
ATOM   1125 O OE1 . GLN A 1 157 ? 5.299   -3.736  -43.714 1.00 28.28 ? 219 GLN A OE1 1 
ATOM   1126 N NE2 . GLN A 1 157 ? 4.172   -4.847  -45.322 1.00 28.55 ? 219 GLN A NE2 1 
ATOM   1127 N N   . ILE A 1 158 ? 4.688   -7.962  -40.205 1.00 27.46 ? 220 ILE A N   1 
ATOM   1128 C CA  . ILE A 1 158 ? 5.212   -7.688  -38.875 1.00 27.35 ? 220 ILE A CA  1 
ATOM   1129 C C   . ILE A 1 158 ? 6.462   -6.807  -38.981 1.00 27.09 ? 220 ILE A C   1 
ATOM   1130 O O   . ILE A 1 158 ? 7.325   -7.016  -39.843 1.00 27.33 ? 220 ILE A O   1 
ATOM   1131 C CB  . ILE A 1 158 ? 5.464   -8.984  -38.044 1.00 27.36 ? 220 ILE A CB  1 
ATOM   1132 C CG1 . ILE A 1 158 ? 4.203   -9.391  -37.276 1.00 27.77 ? 220 ILE A CG1 1 
ATOM   1133 C CG2 . ILE A 1 158 ? 6.535   -8.746  -36.988 1.00 28.04 ? 220 ILE A CG2 1 
ATOM   1134 C CD1 . ILE A 1 158 ? 3.332   -10.364 -37.974 1.00 28.99 ? 220 ILE A CD1 1 
ATOM   1135 N N   . ARG A 1 159 ? 6.520   -5.800  -38.119 1.00 26.56 ? 221 ARG A N   1 
ATOM   1136 C CA  . ARG A 1 159 ? 7.637   -4.875  -38.054 1.00 26.20 ? 221 ARG A CA  1 
ATOM   1137 C C   . ARG A 1 159 ? 8.024   -4.735  -36.599 1.00 25.96 ? 221 ARG A C   1 
ATOM   1138 O O   . ARG A 1 159 ? 7.177   -4.493  -35.747 1.00 25.44 ? 221 ARG A O   1 
ATOM   1139 C CB  . ARG A 1 159 ? 7.234   -3.508  -38.597 1.00 26.15 ? 221 ARG A CB  1 
ATOM   1140 C CG  . ARG A 1 159 ? 6.568   -3.533  -39.966 1.00 26.63 ? 221 ARG A CG  1 
ATOM   1141 C CD  . ARG A 1 159 ? 6.623   -2.167  -40.605 1.00 27.89 ? 221 ARG A CD  1 
ATOM   1142 N NE  . ARG A 1 159 ? 8.012   -1.739  -40.697 1.00 30.66 ? 221 ARG A NE  1 
ATOM   1143 C CZ  . ARG A 1 159 ? 8.771   -1.858  -41.786 1.00 32.35 ? 221 ARG A CZ  1 
ATOM   1144 N NH1 . ARG A 1 159 ? 8.264   -2.361  -42.921 1.00 30.85 ? 221 ARG A NH1 1 
ATOM   1145 N NH2 . ARG A 1 159 ? 10.040  -1.450  -41.738 1.00 31.88 ? 221 ARG A NH2 1 
ATOM   1146 N N   . ILE A 1 160 ? 9.301   -4.899  -36.298 1.00 26.04 ? 222 ILE A N   1 
ATOM   1147 C CA  . ILE A 1 160 ? 9.721   -4.716  -34.914 1.00 26.49 ? 222 ILE A CA  1 
ATOM   1148 C C   . ILE A 1 160 ? 10.103  -3.261  -34.655 1.00 26.68 ? 222 ILE A C   1 
ATOM   1149 O O   . ILE A 1 160 ? 10.785  -2.620  -35.459 1.00 26.62 ? 222 ILE A O   1 
ATOM   1150 C CB  . ILE A 1 160 ? 10.767  -5.802  -34.415 1.00 26.28 ? 222 ILE A CB  1 
ATOM   1151 C CG1 . ILE A 1 160 ? 11.782  -5.198  -33.443 1.00 26.04 ? 222 ILE A CG1 1 
ATOM   1152 C CG2 . ILE A 1 160 ? 11.449  -6.507  -35.574 1.00 26.29 ? 222 ILE A CG2 1 
ATOM   1153 C CD1 . ILE A 1 160 ? 12.744  -6.201  -32.826 1.00 26.89 ? 222 ILE A CD1 1 
ATOM   1154 N N   . GLN A 1 161 ? 9.606   -2.733  -33.547 1.00 27.02 ? 223 GLN A N   1 
ATOM   1155 C CA  . GLN A 1 161 ? 9.776   -1.328  -33.215 1.00 27.61 ? 223 GLN A CA  1 
ATOM   1156 C C   . GLN A 1 161 ? 10.977  -1.115  -32.313 1.00 28.43 ? 223 GLN A C   1 
ATOM   1157 O O   . GLN A 1 161 ? 11.649  -0.090  -32.402 1.00 28.38 ? 223 GLN A O   1 
ATOM   1158 C CB  . GLN A 1 161 ? 8.511   -0.802  -32.511 1.00 27.39 ? 223 GLN A CB  1 
ATOM   1159 C CG  . GLN A 1 161 ? 7.226   -0.927  -33.338 1.00 27.03 ? 223 GLN A CG  1 
ATOM   1160 C CD  . GLN A 1 161 ? 7.335   -0.187  -34.686 1.00 26.87 ? 223 GLN A CD  1 
ATOM   1161 O OE1 . GLN A 1 161 ? 7.267   -0.802  -35.748 1.00 26.88 ? 223 GLN A OE1 1 
ATOM   1162 N NE2 . GLN A 1 161 ? 7.519   1.131   -34.632 1.00 25.13 ? 223 GLN A NE2 1 
ATOM   1163 N N   . ASP A 1 162 ? 11.245  -2.103  -31.460 1.00 29.33 ? 224 ASP A N   1 
ATOM   1164 C CA  . ASP A 1 162 ? 12.070  -1.910  -30.290 1.00 30.40 ? 224 ASP A CA  1 
ATOM   1165 C C   . ASP A 1 162 ? 12.493  -3.284  -29.716 1.00 30.85 ? 224 ASP A C   1 
ATOM   1166 O O   . ASP A 1 162 ? 11.671  -4.183  -29.553 1.00 30.42 ? 224 ASP A O   1 
ATOM   1167 C CB  . ASP A 1 162 ? 11.245  -1.104  -29.269 1.00 30.71 ? 224 ASP A CB  1 
ATOM   1168 C CG  . ASP A 1 162 ? 12.097  -0.300  -28.283 1.00 32.58 ? 224 ASP A CG  1 
ATOM   1169 O OD1 . ASP A 1 162 ? 13.048  0.403   -28.699 1.00 33.40 ? 224 ASP A OD1 1 
ATOM   1170 O OD2 . ASP A 1 162 ? 11.771  -0.343  -27.073 1.00 34.68 ? 224 ASP A OD2 1 
ATOM   1171 N N   . MET A 1 163 ? 13.783  -3.438  -29.429 1.00 31.62 ? 225 MET A N   1 
ATOM   1172 C CA  . MET A 1 163 ? 14.301  -4.633  -28.774 1.00 32.66 ? 225 MET A CA  1 
ATOM   1173 C C   . MET A 1 163 ? 15.144  -4.240  -27.560 1.00 32.79 ? 225 MET A C   1 
ATOM   1174 O O   . MET A 1 163 ? 16.079  -3.454  -27.682 1.00 33.17 ? 225 MET A O   1 
ATOM   1175 C CB  . MET A 1 163 ? 15.152  -5.452  -29.742 1.00 32.32 ? 225 MET A CB  1 
ATOM   1176 C CG  . MET A 1 163 ? 15.055  -6.953  -29.519 1.00 33.30 ? 225 MET A CG  1 
ATOM   1177 S SD  . MET A 1 163 ? 16.427  -7.949  -30.149 1.00 34.24 ? 225 MET A SD  1 
ATOM   1178 C CE  . MET A 1 163 ? 17.180  -6.857  -31.374 1.00 34.18 ? 225 MET A CE  1 
ATOM   1179 N N   . LYS A 1 164 ? 14.801  -4.771  -26.392 1.00 33.05 ? 226 LYS A N   1 
ATOM   1180 C CA  . LYS A 1 164 ? 15.607  -4.565  -25.195 1.00 33.70 ? 226 LYS A CA  1 
ATOM   1181 C C   . LYS A 1 164 ? 15.947  -5.904  -24.539 1.00 34.22 ? 226 LYS A C   1 
ATOM   1182 O O   . LYS A 1 164 ? 15.058  -6.672  -24.169 1.00 34.10 ? 226 LYS A O   1 
ATOM   1183 C CB  . LYS A 1 164 ? 14.913  -3.618  -24.205 1.00 33.43 ? 226 LYS A CB  1 
ATOM   1184 N N   . GLU A 1 165 ? 17.243  -6.183  -24.417 1.00 35.17 ? 227 GLU A N   1 
ATOM   1185 C CA  . GLU A 1 165 ? 17.720  -7.430  -23.818 1.00 35.96 ? 227 GLU A CA  1 
ATOM   1186 C C   . GLU A 1 165 ? 17.863  -7.305  -22.295 1.00 36.42 ? 227 GLU A C   1 
ATOM   1187 O O   . GLU A 1 165 ? 18.468  -6.370  -21.801 1.00 36.41 ? 227 GLU A O   1 
ATOM   1188 C CB  . GLU A 1 165 ? 19.042  -7.875  -24.472 1.00 36.07 ? 227 GLU A CB  1 
ATOM   1189 C CG  . GLU A 1 165 ? 18.887  -8.675  -25.764 1.00 35.15 ? 227 GLU A CG  1 
ATOM   1190 N N   . CYS A 1 166 ? 17.271  -8.248  -21.572 1.00 37.57 ? 228 CYS A N   1 
ATOM   1191 C CA  . CYS A 1 166 ? 17.364  -8.347  -20.110 1.00 38.66 ? 228 CYS A CA  1 
ATOM   1192 C C   . CYS A 1 166 ? 18.034  -9.658  -19.710 1.00 38.94 ? 228 CYS A C   1 
ATOM   1193 O O   . CYS A 1 166 ? 18.220  -10.548 -20.554 1.00 38.72 ? 228 CYS A O   1 
ATOM   1194 C CB  . CYS A 1 166 ? 15.970  -8.372  -19.489 1.00 38.62 ? 228 CYS A CB  1 
ATOM   1195 S SG  . CYS A 1 166 ? 15.153  -6.815  -19.440 1.00 41.33 ? 228 CYS A SG  1 
ATOM   1196 N N   . PRO A 1 167 ? 18.356  -9.800  -18.405 1.00 39.33 ? 229 PRO A N   1 
ATOM   1197 C CA  . PRO A 1 167 ? 18.862  -11.079 -17.932 1.00 39.07 ? 229 PRO A CA  1 
ATOM   1198 C C   . PRO A 1 167 ? 17.709  -12.058 -17.877 1.00 38.66 ? 229 PRO A C   1 
ATOM   1199 O O   . PRO A 1 167 ? 16.750  -11.854 -17.117 1.00 38.80 ? 229 PRO A O   1 
ATOM   1200 C CB  . PRO A 1 167 ? 19.386  -10.765 -16.521 1.00 39.44 ? 229 PRO A CB  1 
ATOM   1201 C CG  . PRO A 1 167 ? 19.367  -9.250  -16.401 1.00 39.92 ? 229 PRO A CG  1 
ATOM   1202 C CD  . PRO A 1 167 ? 18.266  -8.817  -17.309 1.00 39.48 ? 229 PRO A CD  1 
ATOM   1203 N N   . GLU A 1 168 ? 17.804  -13.085 -18.723 1.00 38.02 ? 230 GLU A N   1 
ATOM   1204 C CA  . GLU A 1 168 ? 16.826  -14.184 -18.823 1.00 37.40 ? 230 GLU A CA  1 
ATOM   1205 C C   . GLU A 1 168 ? 15.732  -13.997 -19.895 1.00 36.40 ? 230 GLU A C   1 
ATOM   1206 O O   . GLU A 1 168 ? 15.218  -14.992 -20.421 1.00 36.09 ? 230 GLU A O   1 
ATOM   1207 C CB  . GLU A 1 168 ? 16.228  -14.572 -17.450 1.00 37.25 ? 230 GLU A CB  1 
ATOM   1208 N N   . TYR A 1 169 ? 15.390  -12.744 -20.217 1.00 35.27 ? 231 TYR A N   1 
ATOM   1209 C CA  . TYR A 1 169 ? 14.376  -12.462 -21.260 1.00 33.94 ? 231 TYR A CA  1 
ATOM   1210 C C   . TYR A 1 169 ? 14.638  -11.239 -22.149 1.00 33.18 ? 231 TYR A C   1 
ATOM   1211 O O   . TYR A 1 169 ? 15.297  -10.292 -21.741 1.00 32.92 ? 231 TYR A O   1 
ATOM   1212 C CB  . TYR A 1 169 ? 12.949  -12.424 -20.682 1.00 33.55 ? 231 TYR A CB  1 
ATOM   1213 C CG  . TYR A 1 169 ? 12.631  -11.245 -19.782 1.00 33.66 ? 231 TYR A CG  1 
ATOM   1214 C CD1 . TYR A 1 169 ? 12.640  -11.383 -18.386 1.00 34.08 ? 231 TYR A CD1 1 
ATOM   1215 C CD2 . TYR A 1 169 ? 12.296  -10.000 -20.320 1.00 32.53 ? 231 TYR A CD2 1 
ATOM   1216 C CE1 . TYR A 1 169 ? 12.338  -10.313 -17.553 1.00 32.77 ? 231 TYR A CE1 1 
ATOM   1217 C CE2 . TYR A 1 169 ? 11.999  -8.934  -19.503 1.00 32.59 ? 231 TYR A CE2 1 
ATOM   1218 C CZ  . TYR A 1 169 ? 12.021  -9.094  -18.117 1.00 33.06 ? 231 TYR A CZ  1 
ATOM   1219 O OH  . TYR A 1 169 ? 11.719  -8.026  -17.306 1.00 32.95 ? 231 TYR A OH  1 
ATOM   1220 N N   . THR A 1 170 ? 14.103  -11.286 -23.368 1.00 32.46 ? 232 THR A N   1 
ATOM   1221 C CA  . THR A 1 170 ? 14.208  -10.215 -24.344 1.00 31.15 ? 232 THR A CA  1 
ATOM   1222 C C   . THR A 1 170 ? 12.817  -9.674  -24.681 1.00 30.79 ? 232 THR A C   1 
ATOM   1223 O O   . THR A 1 170 ? 11.905  -10.433 -25.040 1.00 30.79 ? 232 THR A O   1 
ATOM   1224 C CB  . THR A 1 170 ? 14.890  -10.704 -25.613 1.00 31.40 ? 232 THR A CB  1 
ATOM   1225 O OG1 . THR A 1 170 ? 16.133  -11.331 -25.271 1.00 32.05 ? 232 THR A OG1 1 
ATOM   1226 C CG2 . THR A 1 170 ? 15.154  -9.538  -26.586 1.00 31.47 ? 232 THR A CG2 1 
ATOM   1227 N N   . VAL A 1 171 ? 12.678  -8.353  -24.558 1.00 29.72 ? 233 VAL A N   1 
ATOM   1228 C CA  . VAL A 1 171 ? 11.430  -7.637  -24.783 1.00 28.47 ? 233 VAL A CA  1 
ATOM   1229 C C   . VAL A 1 171 ? 11.413  -7.045  -26.196 1.00 27.48 ? 233 VAL A C   1 
ATOM   1230 O O   . VAL A 1 171 ? 12.162  -6.105  -26.495 1.00 27.39 ? 233 VAL A O   1 
ATOM   1231 C CB  . VAL A 1 171 ? 11.260  -6.493  -23.733 1.00 28.57 ? 233 VAL A CB  1 
ATOM   1232 C CG1 . VAL A 1 171 ? 9.989   -5.676  -24.006 1.00 29.12 ? 233 VAL A CG1 1 
ATOM   1233 C CG2 . VAL A 1 171 ? 11.236  -7.053  -22.325 1.00 28.97 ? 233 VAL A CG2 1 
ATOM   1234 N N   . ARG A 1 172 ? 10.562  -7.595  -27.059 1.00 26.32 ? 234 ARG A N   1 
ATOM   1235 C CA  . ARG A 1 172 ? 10.395  -7.089  -28.435 1.00 25.16 ? 234 ARG A CA  1 
ATOM   1236 C C   . ARG A 1 172 ? 9.095   -6.322  -28.642 1.00 24.74 ? 234 ARG A C   1 
ATOM   1237 O O   . ARG A 1 172 ? 8.002   -6.882  -28.531 1.00 24.86 ? 234 ARG A O   1 
ATOM   1238 C CB  . ARG A 1 172 ? 10.465  -8.218  -29.455 1.00 24.81 ? 234 ARG A CB  1 
ATOM   1239 C CG  . ARG A 1 172 ? 11.824  -8.484  -29.974 1.00 23.81 ? 234 ARG A CG  1 
ATOM   1240 C CD  . ARG A 1 172 ? 11.809  -9.719  -30.836 1.00 23.75 ? 234 ARG A CD  1 
ATOM   1241 N NE  . ARG A 1 172 ? 13.154  -10.269 -31.028 1.00 23.99 ? 234 ARG A NE  1 
ATOM   1242 C CZ  . ARG A 1 172 ? 13.756  -11.098 -30.173 1.00 23.27 ? 234 ARG A CZ  1 
ATOM   1243 N NH1 . ARG A 1 172 ? 13.145  -11.471 -29.051 1.00 21.80 ? 234 ARG A NH1 1 
ATOM   1244 N NH2 . ARG A 1 172 ? 14.978  -11.549 -30.436 1.00 21.85 ? 234 ARG A NH2 1 
ATOM   1245 N N   . GLN A 1 173 ? 9.222   -5.036  -28.933 1.00 24.01 ? 235 GLN A N   1 
ATOM   1246 C CA  . GLN A 1 173 ? 8.079   -4.197  -29.274 1.00 23.44 ? 235 GLN A CA  1 
ATOM   1247 C C   . GLN A 1 173 ? 7.880   -4.258  -30.779 1.00 22.60 ? 235 GLN A C   1 
ATOM   1248 O O   . GLN A 1 173 ? 8.816   -4.030  -31.543 1.00 22.02 ? 235 GLN A O   1 
ATOM   1249 C CB  . GLN A 1 173 ? 8.358   -2.761  -28.864 1.00 23.76 ? 235 GLN A CB  1 
ATOM   1250 C CG  . GLN A 1 173 ? 7.171   -2.026  -28.395 1.00 24.88 ? 235 GLN A CG  1 
ATOM   1251 C CD  . GLN A 1 173 ? 6.556   -2.677  -27.177 1.00 24.97 ? 235 GLN A CD  1 
ATOM   1252 O OE1 . GLN A 1 173 ? 7.202   -2.823  -26.121 1.00 24.11 ? 235 GLN A OE1 1 
ATOM   1253 N NE2 . GLN A 1 173 ? 5.293   -3.069  -27.312 1.00 24.08 ? 235 GLN A NE2 1 
ATOM   1254 N N   . LEU A 1 174 ? 6.662   -4.583  -31.197 1.00 22.24 ? 236 LEU A N   1 
ATOM   1255 C CA  . LEU A 1 174 ? 6.366   -4.784  -32.614 1.00 21.94 ? 236 LEU A CA  1 
ATOM   1256 C C   . LEU A 1 174 ? 4.961   -4.335  -32.975 1.00 21.59 ? 236 LEU A C   1 
ATOM   1257 O O   . LEU A 1 174 ? 4.130   -4.101  -32.090 1.00 22.11 ? 236 LEU A O   1 
ATOM   1258 C CB  . LEU A 1 174 ? 6.594   -6.248  -33.025 1.00 21.85 ? 236 LEU A CB  1 
ATOM   1259 C CG  . LEU A 1 174 ? 5.670   -7.342  -32.486 1.00 22.43 ? 236 LEU A CG  1 
ATOM   1260 C CD1 . LEU A 1 174 ? 4.483   -7.616  -33.439 1.00 22.86 ? 236 LEU A CD1 1 
ATOM   1261 C CD2 . LEU A 1 174 ? 6.466   -8.618  -32.208 1.00 21.60 ? 236 LEU A CD2 1 
ATOM   1262 N N   . THR A 1 175 ? 4.721   -4.209  -34.280 1.00 20.98 ? 237 THR A N   1 
ATOM   1263 C CA  . THR A 1 175 ? 3.410   -3.903  -34.816 1.00 20.42 ? 237 THR A CA  1 
ATOM   1264 C C   . THR A 1 175 ? 2.997   -5.002  -35.792 1.00 20.88 ? 237 THR A C   1 
ATOM   1265 O O   . THR A 1 175 ? 3.846   -5.718  -36.343 1.00 20.97 ? 237 THR A O   1 
ATOM   1266 C CB  . THR A 1 175 ? 3.351   -2.524  -35.539 1.00 20.33 ? 237 THR A CB  1 
ATOM   1267 O OG1 . THR A 1 175 ? 4.223   -2.535  -36.671 1.00 20.05 ? 237 THR A OG1 1 
ATOM   1268 C CG2 . THR A 1 175 ? 3.724   -1.375  -34.606 1.00 18.85 ? 237 THR A CG2 1 
ATOM   1269 N N   . ILE A 1 176 ? 1.684   -5.137  -35.982 1.00 20.96 ? 238 ILE A N   1 
ATOM   1270 C CA  . ILE A 1 176 ? 1.118   -6.062  -36.951 1.00 20.61 ? 238 ILE A CA  1 
ATOM   1271 C C   . ILE A 1 176 ? 0.099   -5.337  -37.813 1.00 21.04 ? 238 ILE A C   1 
ATOM   1272 O O   . ILE A 1 176 ? -0.740  -4.569  -37.318 1.00 20.48 ? 238 ILE A O   1 
ATOM   1273 C CB  . ILE A 1 176 ? 0.487   -7.317  -36.279 1.00 20.61 ? 238 ILE A CB  1 
ATOM   1274 C CG1 . ILE A 1 176 ? -0.210  -8.200  -37.330 1.00 19.85 ? 238 ILE A CG1 1 
ATOM   1275 C CG2 . ILE A 1 176 ? -0.443  -6.915  -35.109 1.00 20.16 ? 238 ILE A CG2 1 
ATOM   1276 C CD1 . ILE A 1 176 ? -0.447  -9.628  -36.898 1.00 19.91 ? 238 ILE A CD1 1 
ATOM   1277 N N   . GLN A 1 177 ? 0.191   -5.587  -39.113 1.00 21.54 ? 239 GLN A N   1 
ATOM   1278 C CA  . GLN A 1 177 ? -0.665  -4.926  -40.073 1.00 22.11 ? 239 GLN A CA  1 
ATOM   1279 C C   . GLN A 1 177 ? -1.392  -5.926  -40.952 1.00 22.84 ? 239 GLN A C   1 
ATOM   1280 O O   . GLN A 1 177 ? -0.803  -6.889  -41.465 1.00 22.78 ? 239 GLN A O   1 
ATOM   1281 C CB  . GLN A 1 177 ? 0.116   -3.925  -40.928 1.00 21.63 ? 239 GLN A CB  1 
ATOM   1282 C CG  . GLN A 1 177 ? -0.801  -2.959  -41.655 1.00 20.90 ? 239 GLN A CG  1 
ATOM   1283 C CD  . GLN A 1 177 ? -0.117  -2.173  -42.762 1.00 20.34 ? 239 GLN A CD  1 
ATOM   1284 O OE1 . GLN A 1 177 ? 1.098   -1.954  -42.733 1.00 21.08 ? 239 GLN A OE1 1 
ATOM   1285 N NE2 . GLN A 1 177 ? -0.899  -1.733  -43.736 1.00 16.01 ? 239 GLN A NE2 1 
ATOM   1286 N N   . TYR A 1 178 ? -2.686  -5.668  -41.105 1.00 23.86 ? 240 TYR A N   1 
ATOM   1287 C CA  . TYR A 1 178 ? -3.576  -6.456  -41.936 1.00 24.74 ? 240 TYR A CA  1 
ATOM   1288 C C   . TYR A 1 178 ? -4.472  -5.462  -42.651 1.00 25.15 ? 240 TYR A C   1 
ATOM   1289 O O   . TYR A 1 178 ? -5.084  -4.610  -42.011 1.00 25.14 ? 240 TYR A O   1 
ATOM   1290 C CB  . TYR A 1 178 ? -4.389  -7.420  -41.068 1.00 24.90 ? 240 TYR A CB  1 
ATOM   1291 C CG  . TYR A 1 178 ? -5.473  -8.170  -41.807 1.00 25.38 ? 240 TYR A CG  1 
ATOM   1292 C CD1 . TYR A 1 178 ? -5.167  -9.255  -42.625 1.00 24.80 ? 240 TYR A CD1 1 
ATOM   1293 C CD2 . TYR A 1 178 ? -6.814  -7.803  -41.669 1.00 26.09 ? 240 TYR A CD2 1 
ATOM   1294 C CE1 . TYR A 1 178 ? -6.170  -9.944  -43.302 1.00 25.53 ? 240 TYR A CE1 1 
ATOM   1295 C CE2 . TYR A 1 178 ? -7.824  -8.488  -42.337 1.00 25.50 ? 240 TYR A CE2 1 
ATOM   1296 C CZ  . TYR A 1 178 ? -7.496  -9.556  -43.151 1.00 25.58 ? 240 TYR A CZ  1 
ATOM   1297 O OH  . TYR A 1 178 ? -8.500  -10.234 -43.820 1.00 25.71 ? 240 TYR A OH  1 
ATOM   1298 N N   . GLN A 1 179 ? -4.522  -5.568  -43.979 1.00 25.98 ? 241 GLN A N   1 
ATOM   1299 C CA  . GLN A 1 179 ? -5.227  -4.611  -44.845 1.00 26.72 ? 241 GLN A CA  1 
ATOM   1300 C C   . GLN A 1 179 ? -4.800  -3.163  -44.563 1.00 26.66 ? 241 GLN A C   1 
ATOM   1301 O O   . GLN A 1 179 ? -3.664  -2.792  -44.863 1.00 26.64 ? 241 GLN A O   1 
ATOM   1302 C CB  . GLN A 1 179 ? -6.742  -4.828  -44.783 1.00 26.89 ? 241 GLN A CB  1 
ATOM   1303 C CG  . GLN A 1 179 ? -7.128  -6.232  -45.241 1.00 29.02 ? 241 GLN A CG  1 
ATOM   1304 C CD  . GLN A 1 179 ? -8.615  -6.405  -45.481 1.00 31.69 ? 241 GLN A CD  1 
ATOM   1305 O OE1 . GLN A 1 179 ? -9.427  -6.271  -44.563 1.00 32.76 ? 241 GLN A OE1 1 
ATOM   1306 N NE2 . GLN A 1 179 ? -8.980  -6.724  -46.723 1.00 32.53 ? 241 GLN A NE2 1 
ATOM   1307 N N   . GLU A 1 180 ? -5.674  -2.360  -43.962 1.00 26.67 ? 242 GLU A N   1 
ATOM   1308 C CA  . GLU A 1 180 ? -5.303  -0.989  -43.609 1.00 26.48 ? 242 GLU A CA  1 
ATOM   1309 C C   . GLU A 1 180 ? -5.423  -0.692  -42.116 1.00 26.41 ? 242 GLU A C   1 
ATOM   1310 O O   . GLU A 1 180 ? -5.839  0.396   -41.727 1.00 26.61 ? 242 GLU A O   1 
ATOM   1311 C CB  . GLU A 1 180 ? -6.100  0.033   -44.435 1.00 26.51 ? 242 GLU A CB  1 
ATOM   1312 C CG  . GLU A 1 180 ? -5.960  -0.115  -45.951 1.00 26.89 ? 242 GLU A CG  1 
ATOM   1313 C CD  . GLU A 1 180 ? -4.511  -0.097  -46.433 1.00 28.38 ? 242 GLU A CD  1 
ATOM   1314 O OE1 . GLU A 1 180 ? -4.132  -0.991  -47.219 1.00 29.04 ? 242 GLU A OE1 1 
ATOM   1315 O OE2 . GLU A 1 180 ? -3.744  0.800   -46.027 1.00 29.15 ? 242 GLU A OE2 1 
ATOM   1316 N N   . GLU A 1 181 ? -5.041  -1.653  -41.285 1.00 26.23 ? 243 GLU A N   1 
ATOM   1317 C CA  . GLU A 1 181 ? -5.026  -1.454  -39.837 1.00 26.54 ? 243 GLU A CA  1 
ATOM   1318 C C   . GLU A 1 181 ? -3.728  -1.937  -39.217 1.00 26.26 ? 243 GLU A C   1 
ATOM   1319 O O   . GLU A 1 181 ? -3.118  -2.878  -39.721 1.00 26.36 ? 243 GLU A O   1 
ATOM   1320 C CB  . GLU A 1 181 ? -6.175  -2.199  -39.180 1.00 26.63 ? 243 GLU A CB  1 
ATOM   1321 C CG  . GLU A 1 181 ? -7.437  -1.401  -39.112 1.00 28.24 ? 243 GLU A CG  1 
ATOM   1322 C CD  . GLU A 1 181 ? -8.666  -2.281  -39.190 1.00 29.01 ? 243 GLU A CD  1 
ATOM   1323 O OE1 . GLU A 1 181 ? -8.778  -3.269  -38.411 1.00 27.55 ? 243 GLU A OE1 1 
ATOM   1324 O OE2 . GLU A 1 181 ? -9.512  -1.967  -40.052 1.00 29.18 ? 243 GLU A OE2 1 
ATOM   1325 N N   . ARG A 1 182 ? -3.339  -1.310  -38.104 1.00 25.66 ? 244 ARG A N   1 
ATOM   1326 C CA  . ARG A 1 182 ? -2.073  -1.597  -37.447 1.00 25.27 ? 244 ARG A CA  1 
ATOM   1327 C C   . ARG A 1 182 ? -2.229  -1.696  -35.922 1.00 25.00 ? 244 ARG A C   1 
ATOM   1328 O O   . ARG A 1 182 ? -2.844  -0.848  -35.291 1.00 24.73 ? 244 ARG A O   1 
ATOM   1329 C CB  . ARG A 1 182 ? -1.044  -0.534  -37.826 1.00 24.83 ? 244 ARG A CB  1 
ATOM   1330 C CG  . ARG A 1 182 ? 0.387   -0.859  -37.426 1.00 25.20 ? 244 ARG A CG  1 
ATOM   1331 C CD  . ARG A 1 182 ? 1.063   0.365   -36.802 1.00 24.09 ? 244 ARG A CD  1 
ATOM   1332 N NE  . ARG A 1 182 ? 1.503   1.305   -37.824 1.00 23.66 ? 244 ARG A NE  1 
ATOM   1333 C CZ  . ARG A 1 182 ? 1.894   2.552   -37.601 1.00 22.26 ? 244 ARG A CZ  1 
ATOM   1334 N NH1 . ARG A 1 182 ? 1.911   3.068   -36.382 1.00 20.31 ? 244 ARG A NH1 1 
ATOM   1335 N NH2 . ARG A 1 182 ? 2.256   3.294   -38.629 1.00 23.65 ? 244 ARG A NH2 1 
ATOM   1336 N N   . ARG A 1 183 ? -1.667  -2.746  -35.342 1.00 25.28 ? 245 ARG A N   1 
ATOM   1337 C CA  . ARG A 1 183 ? -1.761  -2.976  -33.898 1.00 25.63 ? 245 ARG A CA  1 
ATOM   1338 C C   . ARG A 1 183 ? -0.396  -3.217  -33.287 1.00 25.66 ? 245 ARG A C   1 
ATOM   1339 O O   . ARG A 1 183 ? 0.467   -3.855  -33.893 1.00 25.54 ? 245 ARG A O   1 
ATOM   1340 C CB  . ARG A 1 183 ? -2.676  -4.157  -33.574 1.00 25.30 ? 245 ARG A CB  1 
ATOM   1341 C CG  . ARG A 1 183 ? -4.144  -3.866  -33.780 1.00 25.48 ? 245 ARG A CG  1 
ATOM   1342 C CD  . ARG A 1 183 ? -5.000  -5.075  -33.465 1.00 25.55 ? 245 ARG A CD  1 
ATOM   1343 N NE  . ARG A 1 183 ? -6.266  -4.972  -34.183 1.00 25.67 ? 245 ARG A NE  1 
ATOM   1344 C CZ  . ARG A 1 183 ? -6.985  -5.999  -34.625 1.00 23.90 ? 245 ARG A CZ  1 
ATOM   1345 N NH1 . ARG A 1 183 ? -6.570  -7.244  -34.433 1.00 21.99 ? 245 ARG A NH1 1 
ATOM   1346 N NH2 . ARG A 1 183 ? -8.116  -5.764  -35.280 1.00 23.42 ? 245 ARG A NH2 1 
ATOM   1347 N N   . SER A 1 184 ? -0.204  -2.687  -32.092 1.00 25.59 ? 246 SER A N   1 
ATOM   1348 C CA  . SER A 1 184 ? 1.022   -2.940  -31.369 1.00 26.25 ? 246 SER A CA  1 
ATOM   1349 C C   . SER A 1 184 ? 0.921   -4.215  -30.513 1.00 26.34 ? 246 SER A C   1 
ATOM   1350 O O   . SER A 1 184 ? -0.088  -4.471  -29.856 1.00 26.11 ? 246 SER A O   1 
ATOM   1351 C CB  . SER A 1 184 ? 1.484   -1.705  -30.561 1.00 26.42 ? 246 SER A CB  1 
ATOM   1352 O OG  . SER A 1 184 ? 0.413   -0.997  -29.955 1.00 26.30 ? 246 SER A OG  1 
ATOM   1353 N N   . VAL A 1 185 ? 1.969   -5.029  -30.585 1.00 26.45 ? 247 VAL A N   1 
ATOM   1354 C CA  . VAL A 1 185 ? 2.112   -6.196  -29.733 1.00 26.63 ? 247 VAL A CA  1 
ATOM   1355 C C   . VAL A 1 185 ? 3.455   -6.092  -28.978 1.00 26.58 ? 247 VAL A C   1 
ATOM   1356 O O   . VAL A 1 185 ? 4.487   -5.693  -29.540 1.00 26.31 ? 247 VAL A O   1 
ATOM   1357 C CB  . VAL A 1 185 ? 2.048   -7.536  -30.538 1.00 26.62 ? 247 VAL A CB  1 
ATOM   1358 C CG1 . VAL A 1 185 ? 2.017   -8.731  -29.596 1.00 26.98 ? 247 VAL A CG1 1 
ATOM   1359 C CG2 . VAL A 1 185 ? 0.831   -7.587  -31.467 1.00 26.66 ? 247 VAL A CG2 1 
ATOM   1360 N N   . LYS A 1 186 ? 3.412   -6.437  -27.701 1.00 26.25 ? 248 LYS A N   1 
ATOM   1361 C CA  . LYS A 1 186 ? 4.599   -6.650  -26.909 1.00 26.41 ? 248 LYS A CA  1 
ATOM   1362 C C   . LYS A 1 186 ? 4.909   -8.145  -26.946 1.00 26.57 ? 248 LYS A C   1 
ATOM   1363 O O   . LYS A 1 186 ? 4.036   -8.973  -26.667 1.00 26.88 ? 248 LYS A O   1 
ATOM   1364 C CB  . LYS A 1 186 ? 4.336   -6.194  -25.475 1.00 26.18 ? 248 LYS A CB  1 
ATOM   1365 C CG  . LYS A 1 186 ? 5.464   -6.448  -24.474 1.00 26.81 ? 248 LYS A CG  1 
ATOM   1366 C CD  . LYS A 1 186 ? 5.139   -5.749  -23.164 1.00 25.81 ? 248 LYS A CD  1 
ATOM   1367 C CE  . LYS A 1 186 ? 6.379   -5.354  -22.413 1.00 25.83 ? 248 LYS A CE  1 
ATOM   1368 N NZ  . LYS A 1 186 ? 6.032   -4.878  -21.026 1.00 26.36 ? 248 LYS A NZ  1 
ATOM   1369 N N   . HIS A 1 187 ? 6.141   -8.492  -27.302 1.00 26.58 ? 249 HIS A N   1 
ATOM   1370 C CA  . HIS A 1 187 ? 6.576   -9.881  -27.279 1.00 26.87 ? 249 HIS A CA  1 
ATOM   1371 C C   . HIS A 1 187 ? 7.707   -10.079 -26.267 1.00 26.96 ? 249 HIS A C   1 
ATOM   1372 O O   . HIS A 1 187 ? 8.700   -9.355  -26.289 1.00 27.02 ? 249 HIS A O   1 
ATOM   1373 C CB  . HIS A 1 187 ? 6.997   -10.341 -28.675 1.00 26.68 ? 249 HIS A CB  1 
ATOM   1374 C CG  . HIS A 1 187 ? 7.554   -11.734 -28.716 1.00 27.46 ? 249 HIS A CG  1 
ATOM   1375 N ND1 . HIS A 1 187 ? 8.872   -12.020 -28.418 1.00 26.64 ? 249 HIS A ND1 1 
ATOM   1376 C CD2 . HIS A 1 187 ? 6.977   -12.917 -29.041 1.00 27.43 ? 249 HIS A CD2 1 
ATOM   1377 C CE1 . HIS A 1 187 ? 9.081   -13.318 -28.553 1.00 26.58 ? 249 HIS A CE1 1 
ATOM   1378 N NE2 . HIS A 1 187 ? 7.949   -13.885 -28.930 1.00 27.60 ? 249 HIS A NE2 1 
ATOM   1379 N N   . ILE A 1 188 ? 7.548   -11.055 -25.380 1.00 26.83 ? 250 ILE A N   1 
ATOM   1380 C CA  . ILE A 1 188 ? 8.573   -11.339 -24.380 1.00 27.26 ? 250 ILE A CA  1 
ATOM   1381 C C   . ILE A 1 188 ? 9.062   -12.765 -24.546 1.00 27.77 ? 250 ILE A C   1 
ATOM   1382 O O   . ILE A 1 188 ? 8.268   -13.704 -24.550 1.00 28.67 ? 250 ILE A O   1 
ATOM   1383 C CB  . ILE A 1 188 ? 8.079   -11.108 -22.933 1.00 26.90 ? 250 ILE A CB  1 
ATOM   1384 C CG1 . ILE A 1 188 ? 7.351   -9.764  -22.823 1.00 26.49 ? 250 ILE A CG1 1 
ATOM   1385 C CG2 . ILE A 1 188 ? 9.245   -11.121 -21.983 1.00 25.81 ? 250 ILE A CG2 1 
ATOM   1386 C CD1 . ILE A 1 188 ? 6.459   -9.612  -21.603 1.00 26.21 ? 250 ILE A CD1 1 
ATOM   1387 N N   . LEU A 1 189 ? 10.372  -12.916 -24.715 1.00 28.17 ? 251 LEU A N   1 
ATOM   1388 C CA  . LEU A 1 189 ? 10.989  -14.225 -24.868 1.00 27.90 ? 251 LEU A CA  1 
ATOM   1389 C C   . LEU A 1 189 ? 11.801  -14.542 -23.611 1.00 28.08 ? 251 LEU A C   1 
ATOM   1390 O O   . LEU A 1 189 ? 12.856  -13.955 -23.389 1.00 27.61 ? 251 LEU A O   1 
ATOM   1391 C CB  . LEU A 1 189 ? 11.871  -14.254 -26.123 1.00 27.70 ? 251 LEU A CB  1 
ATOM   1392 C CG  . LEU A 1 189 ? 12.280  -15.629 -26.665 1.00 27.34 ? 251 LEU A CG  1 
ATOM   1393 C CD1 . LEU A 1 189 ? 12.666  -15.550 -28.120 1.00 25.55 ? 251 LEU A CD1 1 
ATOM   1394 C CD2 . LEU A 1 189 ? 13.418  -16.225 -25.864 1.00 28.09 ? 251 LEU A CD2 1 
ATOM   1395 N N   . PHE A 1 190 ? 11.281  -15.453 -22.787 1.00 28.44 ? 252 PHE A N   1 
ATOM   1396 C CA  . PHE A 1 190 ? 12.014  -15.996 -21.645 1.00 29.19 ? 252 PHE A CA  1 
ATOM   1397 C C   . PHE A 1 190 ? 12.867  -17.175 -22.129 1.00 29.66 ? 252 PHE A C   1 
ATOM   1398 O O   . PHE A 1 190 ? 12.355  -18.127 -22.728 1.00 29.87 ? 252 PHE A O   1 
ATOM   1399 C CB  . PHE A 1 190 ? 11.040  -16.429 -20.558 1.00 29.26 ? 252 PHE A CB  1 
ATOM   1400 C CG  . PHE A 1 190 ? 11.688  -16.749 -19.238 1.00 29.57 ? 252 PHE A CG  1 
ATOM   1401 C CD1 . PHE A 1 190 ? 11.819  -15.769 -18.260 1.00 29.74 ? 252 PHE A CD1 1 
ATOM   1402 C CD2 . PHE A 1 190 ? 12.129  -18.036 -18.959 1.00 31.18 ? 252 PHE A CD2 1 
ATOM   1403 C CE1 . PHE A 1 190 ? 12.392  -16.050 -17.039 1.00 30.19 ? 252 PHE A CE1 1 
ATOM   1404 C CE2 . PHE A 1 190 ? 12.709  -18.338 -17.726 1.00 31.18 ? 252 PHE A CE2 1 
ATOM   1405 C CZ  . PHE A 1 190 ? 12.849  -17.338 -16.768 1.00 30.91 ? 252 PHE A CZ  1 
ATOM   1406 N N   . SER A 1 191 ? 14.171  -17.102 -21.891 1.00 29.97 ? 253 SER A N   1 
ATOM   1407 C CA  . SER A 1 191 ? 15.089  -18.060 -22.496 1.00 30.21 ? 253 SER A CA  1 
ATOM   1408 C C   . SER A 1 191 ? 15.817  -18.977 -21.510 1.00 30.45 ? 253 SER A C   1 
ATOM   1409 O O   . SER A 1 191 ? 16.704  -19.725 -21.921 1.00 30.53 ? 253 SER A O   1 
ATOM   1410 C CB  . SER A 1 191 ? 16.100  -17.331 -23.383 1.00 29.92 ? 253 SER A CB  1 
ATOM   1411 O OG  . SER A 1 191 ? 16.806  -16.344 -22.645 1.00 30.21 ? 253 SER A OG  1 
ATOM   1412 N N   . ALA A 1 192 ? 15.443  -18.934 -20.231 1.00 30.62 ? 254 ALA A N   1 
ATOM   1413 C CA  . ALA A 1 192 ? 16.115  -19.752 -19.215 1.00 31.24 ? 254 ALA A CA  1 
ATOM   1414 C C   . ALA A 1 192 ? 15.188  -20.770 -18.536 1.00 31.66 ? 254 ALA A C   1 
ATOM   1415 O O   . ALA A 1 192 ? 15.174  -20.891 -17.308 1.00 31.75 ? 254 ALA A O   1 
ATOM   1416 C CB  . ALA A 1 192 ? 16.796  -18.854 -18.175 1.00 31.12 ? 254 ALA A CB  1 
ATOM   1417 N N   . TRP A 1 193 ? 14.408  -21.496 -19.334 1.00 32.23 ? 255 TRP A N   1 
ATOM   1418 C CA  . TRP A 1 193 ? 13.531  -22.522 -18.788 1.00 32.59 ? 255 TRP A CA  1 
ATOM   1419 C C   . TRP A 1 193 ? 13.617  -23.795 -19.609 1.00 32.51 ? 255 TRP A C   1 
ATOM   1420 O O   . TRP A 1 193 ? 12.967  -23.890 -20.649 1.00 32.85 ? 255 TRP A O   1 
ATOM   1421 C CB  . TRP A 1 193 ? 12.091  -22.045 -18.788 1.00 33.38 ? 255 TRP A CB  1 
ATOM   1422 C CG  . TRP A 1 193 ? 11.223  -22.718 -17.783 1.00 33.44 ? 255 TRP A CG  1 
ATOM   1423 C CD1 . TRP A 1 193 ? 11.331  -24.000 -17.306 1.00 34.45 ? 255 TRP A CD1 1 
ATOM   1424 C CD2 . TRP A 1 193 ? 10.088  -22.145 -17.139 1.00 34.45 ? 255 TRP A CD2 1 
ATOM   1425 N NE1 . TRP A 1 193 ? 10.331  -24.253 -16.394 1.00 34.24 ? 255 TRP A NE1 1 
ATOM   1426 C CE2 . TRP A 1 193 ? 9.556   -23.128 -16.271 1.00 34.46 ? 255 TRP A CE2 1 
ATOM   1427 C CE3 . TRP A 1 193 ? 9.466   -20.883 -17.202 1.00 35.45 ? 255 TRP A CE3 1 
ATOM   1428 C CZ2 . TRP A 1 193 ? 8.437   -22.886 -15.471 1.00 34.39 ? 255 TRP A CZ2 1 
ATOM   1429 C CZ3 . TRP A 1 193 ? 8.355   -20.643 -16.410 1.00 34.24 ? 255 TRP A CZ3 1 
ATOM   1430 C CH2 . TRP A 1 193 ? 7.854   -21.640 -15.551 1.00 34.65 ? 255 TRP A CH2 1 
ATOM   1431 N N   . PRO A 1 194 ? 14.396  -24.787 -19.131 1.00 32.27 ? 256 PRO A N   1 
ATOM   1432 C CA  . PRO A 1 194 ? 14.611  -26.020 -19.897 1.00 31.94 ? 256 PRO A CA  1 
ATOM   1433 C C   . PRO A 1 194 ? 13.357  -26.867 -19.899 1.00 31.19 ? 256 PRO A C   1 
ATOM   1434 O O   . PRO A 1 194 ? 12.641  -26.873 -18.907 1.00 31.13 ? 256 PRO A O   1 
ATOM   1435 C CB  . PRO A 1 194 ? 15.749  -26.736 -19.135 1.00 32.12 ? 256 PRO A CB  1 
ATOM   1436 C CG  . PRO A 1 194 ? 16.236  -25.747 -18.080 1.00 32.50 ? 256 PRO A CG  1 
ATOM   1437 C CD  . PRO A 1 194 ? 15.091  -24.818 -17.827 1.00 32.36 ? 256 PRO A CD  1 
ATOM   1438 N N   . ASP A 1 195 ? 13.092  -27.557 -21.010 1.00 30.74 ? 257 ASP A N   1 
ATOM   1439 C CA  . ASP A 1 195 ? 11.901  -28.408 -21.138 1.00 29.89 ? 257 ASP A CA  1 
ATOM   1440 C C   . ASP A 1 195 ? 11.828  -29.457 -20.021 1.00 29.64 ? 257 ASP A C   1 
ATOM   1441 O O   . ASP A 1 195 ? 12.837  -30.041 -19.641 1.00 29.03 ? 257 ASP A O   1 
ATOM   1442 C CB  . ASP A 1 195 ? 11.859  -29.088 -22.515 1.00 29.51 ? 257 ASP A CB  1 
ATOM   1443 C CG  . ASP A 1 195 ? 10.458  -29.579 -22.894 1.00 29.43 ? 257 ASP A CG  1 
ATOM   1444 O OD1 . ASP A 1 195 ? 9.520   -29.405 -22.083 1.00 26.72 ? 257 ASP A OD1 1 
ATOM   1445 O OD2 . ASP A 1 195 ? 10.290  -30.141 -24.013 1.00 29.51 ? 257 ASP A OD2 1 
ATOM   1446 N N   . HIS A 1 196 ? 10.620  -29.671 -19.505 1.00 30.01 ? 258 HIS A N   1 
ATOM   1447 C CA  . HIS A 1 196 ? 10.319  -30.679 -18.472 1.00 30.72 ? 258 HIS A CA  1 
ATOM   1448 C C   . HIS A 1 196 ? 10.954  -30.351 -17.133 1.00 31.14 ? 258 HIS A C   1 
ATOM   1449 O O   . HIS A 1 196 ? 10.985  -31.206 -16.250 1.00 31.09 ? 258 HIS A O   1 
ATOM   1450 C CB  . HIS A 1 196 ? 10.739  -32.108 -18.884 1.00 30.43 ? 258 HIS A CB  1 
ATOM   1451 C CG  . HIS A 1 196 ? 10.488  -32.429 -20.323 1.00 30.78 ? 258 HIS A CG  1 
ATOM   1452 N ND1 . HIS A 1 196 ? 9.221   -32.480 -20.867 1.00 30.87 ? 258 HIS A ND1 1 
ATOM   1453 C CD2 . HIS A 1 196 ? 11.344  -32.716 -21.333 1.00 30.15 ? 258 HIS A CD2 1 
ATOM   1454 C CE1 . HIS A 1 196 ? 9.309   -32.785 -22.150 1.00 30.62 ? 258 HIS A CE1 1 
ATOM   1455 N NE2 . HIS A 1 196 ? 10.585  -32.941 -22.455 1.00 30.01 ? 258 HIS A NE2 1 
ATOM   1456 N N   . GLN A 1 197 ? 11.418  -29.110 -16.979 1.00 31.67 ? 259 GLN A N   1 
ATOM   1457 C CA  . GLN A 1 197 ? 12.292  -28.742 -15.874 1.00 32.64 ? 259 GLN A CA  1 
ATOM   1458 C C   . GLN A 1 197 ? 11.785  -27.460 -15.216 1.00 32.84 ? 259 GLN A C   1 
ATOM   1459 O O   . GLN A 1 197 ? 10.680  -27.009 -15.523 1.00 33.49 ? 259 GLN A O   1 
ATOM   1460 C CB  . GLN A 1 197 ? 13.694  -28.531 -16.434 1.00 32.86 ? 259 GLN A CB  1 
ATOM   1461 C CG  . GLN A 1 197 ? 14.806  -29.013 -15.570 1.00 35.71 ? 259 GLN A CG  1 
ATOM   1462 C CD  . GLN A 1 197 ? 15.113  -30.471 -15.790 1.00 38.60 ? 259 GLN A CD  1 
ATOM   1463 O OE1 . GLN A 1 197 ? 15.643  -30.852 -16.839 1.00 40.32 ? 259 GLN A OE1 1 
ATOM   1464 N NE2 . GLN A 1 197 ? 14.799  -31.302 -14.791 1.00 39.11 ? 259 GLN A NE2 1 
ATOM   1465 N N   . THR A 1 198 ? 12.570  -26.872 -14.313 1.00 32.71 ? 260 THR A N   1 
ATOM   1466 C CA  . THR A 1 198 ? 12.303  -25.497 -13.863 1.00 32.55 ? 260 THR A CA  1 
ATOM   1467 C C   . THR A 1 198 ? 13.524  -24.581 -14.000 1.00 32.34 ? 260 THR A C   1 
ATOM   1468 O O   . THR A 1 198 ? 14.641  -25.072 -14.178 1.00 32.28 ? 260 THR A O   1 
ATOM   1469 C CB  . THR A 1 198 ? 11.729  -25.415 -12.430 1.00 32.95 ? 260 THR A CB  1 
ATOM   1470 O OG1 . THR A 1 198 ? 12.351  -26.377 -11.566 1.00 32.17 ? 260 THR A OG1 1 
ATOM   1471 C CG2 . THR A 1 198 ? 10.196  -25.602 -12.453 1.00 33.65 ? 260 THR A CG2 1 
ATOM   1472 N N   . PRO A 1 199 ? 13.312  -23.244 -13.945 1.00 32.01 ? 261 PRO A N   1 
ATOM   1473 C CA  . PRO A 1 199 ? 14.438  -22.300 -13.941 1.00 31.44 ? 261 PRO A CA  1 
ATOM   1474 C C   . PRO A 1 199 ? 15.260  -22.494 -12.660 1.00 31.09 ? 261 PRO A C   1 
ATOM   1475 O O   . PRO A 1 199 ? 14.734  -23.016 -11.677 1.00 31.23 ? 261 PRO A O   1 
ATOM   1476 C CB  . PRO A 1 199 ? 13.749  -20.926 -13.924 1.00 31.57 ? 261 PRO A CB  1 
ATOM   1477 C CG  . PRO A 1 199 ? 12.346  -21.165 -14.312 1.00 31.22 ? 261 PRO A CG  1 
ATOM   1478 C CD  . PRO A 1 199 ? 12.014  -22.547 -13.874 1.00 31.66 ? 261 PRO A CD  1 
ATOM   1479 N N   . GLU A 1 200 ? 16.529  -22.094 -12.666 1.00 30.47 ? 262 GLU A N   1 
ATOM   1480 C CA  . GLU A 1 200 ? 17.412  -22.349 -11.522 1.00 30.12 ? 262 GLU A CA  1 
ATOM   1481 C C   . GLU A 1 200 ? 17.000  -21.579 -10.259 1.00 29.17 ? 262 GLU A C   1 
ATOM   1482 O O   . GLU A 1 200 ? 17.229  -22.035 -9.133  1.00 28.84 ? 262 GLU A O   1 
ATOM   1483 C CB  . GLU A 1 200 ? 18.869  -22.041 -11.891 1.00 30.29 ? 262 GLU A CB  1 
ATOM   1484 C CG  . GLU A 1 200 ? 19.565  -23.088 -12.766 1.00 30.75 ? 262 GLU A CG  1 
ATOM   1485 C CD  . GLU A 1 200 ? 20.702  -22.494 -13.621 1.00 31.68 ? 262 GLU A CD  1 
ATOM   1486 O OE1 . GLU A 1 200 ? 20.811  -21.239 -13.708 1.00 32.85 ? 262 GLU A OE1 1 
ATOM   1487 O OE2 . GLU A 1 200 ? 21.483  -23.284 -14.212 1.00 32.72 ? 262 GLU A OE2 1 
ATOM   1488 N N   . SER A 1 201 ? 16.402  -20.409 -10.467 1.00 28.64 ? 263 SER A N   1 
ATOM   1489 C CA  . SER A 1 201 ? 15.827  -19.589 -9.406  1.00 28.14 ? 263 SER A CA  1 
ATOM   1490 C C   . SER A 1 201 ? 14.482  -19.011 -9.853  1.00 28.19 ? 263 SER A C   1 
ATOM   1491 O O   . SER A 1 201 ? 14.054  -19.214 -11.002 1.00 28.25 ? 263 SER A O   1 
ATOM   1492 C CB  . SER A 1 201 ? 16.789  -18.473 -9.015  1.00 27.98 ? 263 SER A CB  1 
ATOM   1493 O OG  . SER A 1 201 ? 16.968  -17.578 -10.088 1.00 27.10 ? 263 SER A OG  1 
ATOM   1494 N N   . ALA A 1 202 ? 13.817  -18.290 -8.947  1.00 27.87 ? 264 ALA A N   1 
ATOM   1495 C CA  . ALA A 1 202 ? 12.440  -17.823 -9.171  1.00 27.24 ? 264 ALA A CA  1 
ATOM   1496 C C   . ALA A 1 202 ? 12.337  -16.320 -9.417  1.00 27.01 ? 264 ALA A C   1 
ATOM   1497 O O   . ALA A 1 202 ? 11.357  -15.853 -9.966  1.00 27.15 ? 264 ALA A O   1 
ATOM   1498 C CB  . ALA A 1 202 ? 11.561  -18.224 -7.988  1.00 27.54 ? 264 ALA A CB  1 
ATOM   1499 N N   . GLY A 1 203 ? 13.349  -15.571 -8.995  1.00 26.97 ? 265 GLY A N   1 
ATOM   1500 C CA  . GLY A 1 203 ? 13.379  -14.123 -9.158  1.00 26.81 ? 265 GLY A CA  1 
ATOM   1501 C C   . GLY A 1 203 ? 13.148  -13.666 -10.581 1.00 26.57 ? 265 GLY A C   1 
ATOM   1502 O O   . GLY A 1 203 ? 12.251  -12.875 -10.833 1.00 26.19 ? 265 GLY A O   1 
ATOM   1503 N N   . PRO A 1 204 ? 13.978  -14.140 -11.524 1.00 27.01 ? 266 PRO A N   1 
ATOM   1504 C CA  . PRO A 1 204 ? 13.767  -13.776 -12.927 1.00 27.39 ? 266 PRO A CA  1 
ATOM   1505 C C   . PRO A 1 204 ? 12.353  -14.068 -13.434 1.00 27.91 ? 266 PRO A C   1 
ATOM   1506 O O   . PRO A 1 204 ? 11.821  -13.298 -14.243 1.00 27.76 ? 266 PRO A O   1 
ATOM   1507 C CB  . PRO A 1 204 ? 14.817  -14.612 -13.657 1.00 27.37 ? 266 PRO A CB  1 
ATOM   1508 C CG  . PRO A 1 204 ? 15.908  -14.761 -12.616 1.00 26.93 ? 266 PRO A CG  1 
ATOM   1509 C CD  . PRO A 1 204 ? 15.185  -14.974 -11.351 1.00 26.52 ? 266 PRO A CD  1 
ATOM   1510 N N   . LEU A 1 205 ? 11.753  -15.157 -12.950 1.00 28.34 ? 267 LEU A N   1 
ATOM   1511 C CA  . LEU A 1 205 ? 10.379  -15.509 -13.313 1.00 28.72 ? 267 LEU A CA  1 
ATOM   1512 C C   . LEU A 1 205 ? 9.373   -14.462 -12.840 1.00 29.13 ? 267 LEU A C   1 
ATOM   1513 O O   . LEU A 1 205 ? 8.416   -14.166 -13.550 1.00 29.42 ? 267 LEU A O   1 
ATOM   1514 C CB  . LEU A 1 205 ? 9.989   -16.902 -12.778 1.00 28.49 ? 267 LEU A CB  1 
ATOM   1515 C CG  . LEU A 1 205 ? 8.584   -17.450 -13.101 1.00 28.38 ? 267 LEU A CG  1 
ATOM   1516 C CD1 . LEU A 1 205 ? 8.252   -17.434 -14.589 1.00 26.05 ? 267 LEU A CD1 1 
ATOM   1517 C CD2 . LEU A 1 205 ? 8.443   -18.849 -12.571 1.00 28.40 ? 267 LEU A CD2 1 
ATOM   1518 N N   . LEU A 1 206 ? 9.598   -13.910 -11.646 1.00 29.28 ? 268 LEU A N   1 
ATOM   1519 C CA  . LEU A 1 206 ? 8.696   -12.918 -11.062 1.00 29.18 ? 268 LEU A CA  1 
ATOM   1520 C C   . LEU A 1 206 ? 8.819   -11.591 -11.781 1.00 29.25 ? 268 LEU A C   1 
ATOM   1521 O O   . LEU A 1 206 ? 7.831   -10.869 -11.942 1.00 29.93 ? 268 LEU A O   1 
ATOM   1522 C CB  . LEU A 1 206 ? 8.969   -12.738 -9.568  1.00 28.47 ? 268 LEU A CB  1 
ATOM   1523 C CG  . LEU A 1 206 ? 8.532   -13.910 -8.696  1.00 28.89 ? 268 LEU A CG  1 
ATOM   1524 C CD1 . LEU A 1 206 ? 8.796   -13.580 -7.231  1.00 28.92 ? 268 LEU A CD1 1 
ATOM   1525 C CD2 . LEU A 1 206 ? 7.053   -14.244 -8.897  1.00 28.10 ? 268 LEU A CD2 1 
ATOM   1526 N N   . ARG A 1 207 ? 10.035  -11.272 -12.205 1.00 29.06 ? 269 ARG A N   1 
ATOM   1527 C CA  . ARG A 1 207 ? 10.291  -10.081 -13.000 1.00 28.98 ? 269 ARG A CA  1 
ATOM   1528 C C   . ARG A 1 207 ? 9.550   -10.132 -14.332 1.00 29.29 ? 269 ARG A C   1 
ATOM   1529 O O   . ARG A 1 207 ? 9.086   -9.108  -14.835 1.00 29.29 ? 269 ARG A O   1 
ATOM   1530 C CB  . ARG A 1 207 ? 11.792  -9.900  -13.221 1.00 28.85 ? 269 ARG A CB  1 
ATOM   1531 C CG  . ARG A 1 207 ? 12.514  -9.353  -12.000 1.00 28.47 ? 269 ARG A CG  1 
ATOM   1532 C CD  . ARG A 1 207 ? 13.791  -8.616  -12.383 1.00 29.56 ? 269 ARG A CD  1 
ATOM   1533 N N   . LEU A 1 208 ? 9.443   -11.337 -14.884 1.00 29.76 ? 270 LEU A N   1 
ATOM   1534 C CA  . LEU A 1 208 ? 8.760   -11.583 -16.139 1.00 30.25 ? 270 LEU A CA  1 
ATOM   1535 C C   . LEU A 1 208 ? 7.259   -11.383 -15.974 1.00 31.20 ? 270 LEU A C   1 
ATOM   1536 O O   . LEU A 1 208 ? 6.571   -10.854 -16.863 1.00 31.06 ? 270 LEU A O   1 
ATOM   1537 C CB  . LEU A 1 208 ? 9.026   -13.020 -16.560 1.00 29.83 ? 270 LEU A CB  1 
ATOM   1538 C CG  . LEU A 1 208 ? 8.284   -13.553 -17.777 1.00 29.97 ? 270 LEU A CG  1 
ATOM   1539 C CD1 . LEU A 1 208 ? 8.732   -12.833 -19.064 1.00 29.21 ? 270 LEU A CD1 1 
ATOM   1540 C CD2 . LEU A 1 208 ? 8.493   -15.059 -17.891 1.00 30.07 ? 270 LEU A CD2 1 
ATOM   1541 N N   . VAL A 1 209 ? 6.758   -11.827 -14.827 1.00 32.08 ? 271 VAL A N   1 
ATOM   1542 C CA  . VAL A 1 209 ? 5.364   -11.658 -14.481 1.00 33.10 ? 271 VAL A CA  1 
ATOM   1543 C C   . VAL A 1 209 ? 5.068   -10.164 -14.345 1.00 33.99 ? 271 VAL A C   1 
ATOM   1544 O O   . VAL A 1 209 ? 4.059   -9.695  -14.869 1.00 34.40 ? 271 VAL A O   1 
ATOM   1545 C CB  . VAL A 1 209 ? 5.003   -12.485 -13.207 1.00 33.21 ? 271 VAL A CB  1 
ATOM   1546 C CG1 . VAL A 1 209 ? 3.628   -12.142 -12.680 1.00 33.06 ? 271 VAL A CG1 1 
ATOM   1547 C CG2 . VAL A 1 209 ? 5.079   -13.978 -13.522 1.00 32.55 ? 271 VAL A CG2 1 
ATOM   1548 N N   . ALA A 1 210 ? 5.971   -9.420  -13.696 1.00 34.80 ? 272 ALA A N   1 
ATOM   1549 C CA  . ALA A 1 210 ? 5.819   -7.973  -13.527 1.00 35.69 ? 272 ALA A CA  1 
ATOM   1550 C C   . ALA A 1 210 ? 5.839   -7.266  -14.873 1.00 36.58 ? 272 ALA A C   1 
ATOM   1551 O O   . ALA A 1 210 ? 5.174   -6.249  -15.067 1.00 36.87 ? 272 ALA A O   1 
ATOM   1552 C CB  . ALA A 1 210 ? 6.897   -7.417  -12.617 1.00 35.35 ? 272 ALA A CB  1 
ATOM   1553 N N   . GLU A 1 211 ? 6.603   -7.820  -15.801 1.00 37.59 ? 273 GLU A N   1 
ATOM   1554 C CA  . GLU A 1 211 ? 6.664   -7.318  -17.162 1.00 38.76 ? 273 GLU A CA  1 
ATOM   1555 C C   . GLU A 1 211 ? 5.331   -7.525  -17.899 1.00 39.40 ? 273 GLU A C   1 
ATOM   1556 O O   . GLU A 1 211 ? 4.917   -6.692  -18.711 1.00 39.57 ? 273 GLU A O   1 
ATOM   1557 C CB  . GLU A 1 211 ? 7.799   -8.023  -17.901 1.00 38.88 ? 273 GLU A CB  1 
ATOM   1558 C CG  . GLU A 1 211 ? 8.288   -7.294  -19.113 1.00 40.30 ? 273 GLU A CG  1 
ATOM   1559 C CD  . GLU A 1 211 ? 9.098   -6.069  -18.759 1.00 41.27 ? 273 GLU A CD  1 
ATOM   1560 O OE1 . GLU A 1 211 ? 8.641   -4.965  -19.110 1.00 41.66 ? 273 GLU A OE1 1 
ATOM   1561 O OE2 . GLU A 1 211 ? 10.182  -6.211  -18.137 1.00 40.00 ? 273 GLU A OE2 1 
ATOM   1562 N N   . VAL A 1 212 ? 4.658   -8.633  -17.608 1.00 40.25 ? 274 VAL A N   1 
ATOM   1563 C CA  . VAL A 1 212 ? 3.331   -8.931  -18.188 1.00 41.14 ? 274 VAL A CA  1 
ATOM   1564 C C   . VAL A 1 212 ? 2.197   -7.982  -17.716 1.00 41.66 ? 274 VAL A C   1 
ATOM   1565 O O   . VAL A 1 212 ? 1.120   -7.940  -18.310 1.00 41.86 ? 274 VAL A O   1 
ATOM   1566 C CB  . VAL A 1 212 ? 2.971   -10.424 -17.970 1.00 41.05 ? 274 VAL A CB  1 
ATOM   1567 C CG1 . VAL A 1 212 ? 1.505   -10.713 -18.267 1.00 41.71 ? 274 VAL A CG1 1 
ATOM   1568 C CG2 . VAL A 1 212 ? 3.871   -11.304 -18.830 1.00 40.96 ? 274 VAL A CG2 1 
ATOM   1569 N N   . GLU A 1 213 ? 2.462   -7.213  -16.666 1.00 42.62 ? 275 GLU A N   1 
ATOM   1570 C CA  . GLU A 1 213 ? 1.506   -6.259  -16.109 1.00 43.27 ? 275 GLU A CA  1 
ATOM   1571 C C   . GLU A 1 213 ? 1.767   -4.871  -16.663 1.00 43.75 ? 275 GLU A C   1 
ATOM   1572 O O   . GLU A 1 213 ? 1.894   -3.921  -15.892 1.00 44.18 ? 275 GLU A O   1 
ATOM   1573 C CB  . GLU A 1 213 ? 1.632   -6.221  -14.582 1.00 42.93 ? 275 GLU A CB  1 
ATOM   1574 C CG  . GLU A 1 213 ? 1.513   -7.586  -13.922 1.00 44.06 ? 275 GLU A CG  1 
ATOM   1575 N N   . GLU A 1 214 ? 1.884   -4.758  -17.988 1.00 44.16 ? 276 GLU A N   1 
ATOM   1576 C CA  . GLU A 1 214 ? 2.120   -3.462  -18.663 1.00 44.56 ? 276 GLU A CA  1 
ATOM   1577 C C   . GLU A 1 214 ? 1.484   -3.453  -20.053 1.00 44.51 ? 276 GLU A C   1 
ATOM   1578 O O   . GLU A 1 214 ? 1.535   -4.456  -20.777 1.00 44.53 ? 276 GLU A O   1 
ATOM   1579 C CB  . GLU A 1 214 ? 3.618   -3.147  -18.789 1.00 44.47 ? 276 GLU A CB  1 
ATOM   1580 C CG  . GLU A 1 214 ? 4.439   -3.258  -17.491 1.00 45.03 ? 276 GLU A CG  1 
ATOM   1581 C CD  . GLU A 1 214 ? 5.838   -2.650  -17.606 1.00 45.16 ? 276 GLU A CD  1 
ATOM   1582 O OE1 . GLU A 1 214 ? 6.204   -1.820  -16.744 1.00 46.79 ? 276 GLU A OE1 1 
ATOM   1583 O OE2 . GLU A 1 214 ? 6.574   -2.984  -18.556 1.00 45.77 ? 276 GLU A OE2 1 
ATOM   1584 N N   . GLY A 1 223 ? -7.784  -7.994  -24.746 1.00 30.73 ? 285 GLY A N   1 
ATOM   1585 C CA  . GLY A 1 223 ? -7.799  -9.308  -25.372 1.00 30.43 ? 285 GLY A CA  1 
ATOM   1586 C C   . GLY A 1 223 ? -6.780  -10.237 -24.730 1.00 30.31 ? 285 GLY A C   1 
ATOM   1587 O O   . GLY A 1 223 ? -5.922  -9.775  -23.971 1.00 30.29 ? 285 GLY A O   1 
ATOM   1588 N N   . PRO A 1 224 ? -6.845  -11.549 -25.058 1.00 30.05 ? 286 PRO A N   1 
ATOM   1589 C CA  . PRO A 1 224 ? -6.103  -12.613 -24.373 1.00 29.63 ? 286 PRO A CA  1 
ATOM   1590 C C   . PRO A 1 224 ? -4.593  -12.475 -24.510 1.00 29.31 ? 286 PRO A C   1 
ATOM   1591 O O   . PRO A 1 224 ? -4.102  -11.900 -25.494 1.00 29.52 ? 286 PRO A O   1 
ATOM   1592 C CB  . PRO A 1 224 ? -6.565  -13.893 -25.097 1.00 29.45 ? 286 PRO A CB  1 
ATOM   1593 C CG  . PRO A 1 224 ? -7.797  -13.528 -25.821 1.00 29.50 ? 286 PRO A CG  1 
ATOM   1594 C CD  . PRO A 1 224 ? -7.640  -12.088 -26.180 1.00 30.16 ? 286 PRO A CD  1 
ATOM   1595 N N   . ILE A 1 225 ? -3.878  -13.021 -23.530 1.00 28.96 ? 287 ILE A N   1 
ATOM   1596 C CA  . ILE A 1 225 ? -2.413  -13.033 -23.493 1.00 28.75 ? 287 ILE A CA  1 
ATOM   1597 C C   . ILE A 1 225 ? -1.948  -14.367 -24.069 1.00 28.79 ? 287 ILE A C   1 
ATOM   1598 O O   . ILE A 1 225 ? -2.212  -15.414 -23.477 1.00 28.74 ? 287 ILE A O   1 
ATOM   1599 C CB  . ILE A 1 225 ? -1.880  -12.887 -22.011 1.00 28.67 ? 287 ILE A CB  1 
ATOM   1600 C CG1 . ILE A 1 225 ? -2.388  -11.582 -21.371 1.00 28.20 ? 287 ILE A CG1 1 
ATOM   1601 C CG2 . ILE A 1 225 ? -0.358  -13.005 -21.963 1.00 27.37 ? 287 ILE A CG2 1 
ATOM   1602 C CD1 . ILE A 1 225 ? -2.110  -11.429 -19.874 1.00 28.23 ? 287 ILE A CD1 1 
ATOM   1603 N N   . VAL A 1 226 ? -1.274  -14.350 -25.216 1.00 28.71 ? 288 VAL A N   1 
ATOM   1604 C CA  . VAL A 1 226 ? -0.730  -15.607 -25.747 1.00 28.83 ? 288 VAL A CA  1 
ATOM   1605 C C   . VAL A 1 226 ? 0.484   -16.058 -24.927 1.00 28.79 ? 288 VAL A C   1 
ATOM   1606 O O   . VAL A 1 226 ? 1.392   -15.277 -24.682 1.00 29.18 ? 288 VAL A O   1 
ATOM   1607 C CB  . VAL A 1 226 ? -0.374  -15.537 -27.264 1.00 28.89 ? 288 VAL A CB  1 
ATOM   1608 C CG1 . VAL A 1 226 ? 0.573   -16.693 -27.663 1.00 28.66 ? 288 VAL A CG1 1 
ATOM   1609 C CG2 . VAL A 1 226 ? -1.635  -15.574 -28.124 1.00 27.46 ? 288 VAL A CG2 1 
ATOM   1610 N N   . VAL A 1 227 ? 0.475   -17.311 -24.487 1.00 28.32 ? 289 VAL A N   1 
ATOM   1611 C CA  . VAL A 1 227 ? 1.619   -17.900 -23.796 1.00 28.13 ? 289 VAL A CA  1 
ATOM   1612 C C   . VAL A 1 227 ? 1.908   -19.223 -24.474 1.00 28.08 ? 289 VAL A C   1 
ATOM   1613 O O   . VAL A 1 227 ? 0.989   -20.002 -24.727 1.00 27.63 ? 289 VAL A O   1 
ATOM   1614 C CB  . VAL A 1 227 ? 1.342   -18.170 -22.289 1.00 27.80 ? 289 VAL A CB  1 
ATOM   1615 C CG1 . VAL A 1 227 ? 2.592   -18.694 -21.597 1.00 26.99 ? 289 VAL A CG1 1 
ATOM   1616 C CG2 . VAL A 1 227 ? 0.875   -16.917 -21.610 1.00 28.73 ? 289 VAL A CG2 1 
ATOM   1617 N N   . HIS A 1 228 ? 3.177   -19.482 -24.770 1.00 28.05 ? 290 HIS A N   1 
ATOM   1618 C CA  . HIS A 1 228 ? 3.535   -20.727 -25.437 1.00 28.42 ? 290 HIS A CA  1 
ATOM   1619 C C   . HIS A 1 228 ? 4.938   -21.214 -25.103 1.00 29.09 ? 290 HIS A C   1 
ATOM   1620 O O   . HIS A 1 228 ? 5.816   -20.436 -24.706 1.00 29.26 ? 290 HIS A O   1 
ATOM   1621 C CB  . HIS A 1 228 ? 3.347   -20.617 -26.959 1.00 27.69 ? 290 HIS A CB  1 
ATOM   1622 C CG  . HIS A 1 228 ? 4.364   -19.763 -27.637 1.00 27.28 ? 290 HIS A CG  1 
ATOM   1623 N ND1 . HIS A 1 228 ? 5.660   -20.181 -27.849 1.00 27.13 ? 290 HIS A ND1 1 
ATOM   1624 C CD2 . HIS A 1 228 ? 4.278   -18.513 -28.156 1.00 26.98 ? 290 HIS A CD2 1 
ATOM   1625 C CE1 . HIS A 1 228 ? 6.331   -19.220 -28.466 1.00 27.82 ? 290 HIS A CE1 1 
ATOM   1626 N NE2 . HIS A 1 228 ? 5.514   -18.201 -28.669 1.00 27.16 ? 290 HIS A NE2 1 
ATOM   1627 N N   . CYS A 1 229 ? 5.109   -22.524 -25.263 1.00 29.63 ? 291 CYS A N   1 
ATOM   1628 C CA  . CYS A 1 229 ? 6.380   -23.220 -25.153 1.00 30.14 ? 291 CYS A CA  1 
ATOM   1629 C C   . CYS A 1 229 ? 6.163   -24.421 -26.039 1.00 30.44 ? 291 CYS A C   1 
ATOM   1630 O O   . CYS A 1 229 ? 5.046   -24.646 -26.496 1.00 30.76 ? 291 CYS A O   1 
ATOM   1631 C CB  . CYS A 1 229 ? 6.661   -23.651 -23.710 1.00 30.02 ? 291 CYS A CB  1 
ATOM   1632 S SG  . CYS A 1 229 ? 5.317   -24.578 -22.966 1.00 31.09 ? 291 CYS A SG  1 
ATOM   1633 N N   . SER A 1 230 ? 7.215   -25.192 -26.275 1.00 31.15 ? 292 SER A N   1 
ATOM   1634 C CA  . SER A 1 230 ? 7.201   -26.265 -27.273 1.00 31.54 ? 292 SER A CA  1 
ATOM   1635 C C   . SER A 1 230 ? 5.868   -27.035 -27.390 1.00 31.44 ? 292 SER A C   1 
ATOM   1636 O O   . SER A 1 230 ? 5.256   -27.037 -28.454 1.00 31.56 ? 292 SER A O   1 
ATOM   1637 C CB  . SER A 1 230 ? 8.363   -27.222 -27.030 1.00 31.45 ? 292 SER A CB  1 
ATOM   1638 O OG  . SER A 1 230 ? 8.378   -28.207 -28.045 1.00 33.06 ? 292 SER A OG  1 
ATOM   1639 N N   . ALA A 1 231 ? 5.432   -27.668 -26.300 1.00 30.97 ? 293 ALA A N   1 
ATOM   1640 C CA  . ALA A 1 231 ? 4.167   -28.398 -26.261 1.00 30.62 ? 293 ALA A CA  1 
ATOM   1641 C C   . ALA A 1 231 ? 2.978   -27.514 -25.828 1.00 30.58 ? 293 ALA A C   1 
ATOM   1642 O O   . ALA A 1 231 ? 1.837   -27.725 -26.257 1.00 30.22 ? 293 ALA A O   1 
ATOM   1643 C CB  . ALA A 1 231 ? 4.295   -29.599 -25.333 1.00 30.30 ? 293 ALA A CB  1 
ATOM   1644 N N   . GLY A 1 232 ? 3.250   -26.549 -24.952 1.00 30.40 ? 294 GLY A N   1 
ATOM   1645 C CA  . GLY A 1 232 ? 2.246   -25.571 -24.534 1.00 30.16 ? 294 GLY A CA  1 
ATOM   1646 C C   . GLY A 1 232 ? 1.427   -26.005 -23.337 1.00 30.06 ? 294 GLY A C   1 
ATOM   1647 O O   . GLY A 1 232 ? 0.272   -25.599 -23.213 1.00 29.92 ? 294 GLY A O   1 
ATOM   1648 N N   . ILE A 1 233 ? 2.020   -26.830 -22.464 1.00 29.77 ? 295 ILE A N   1 
ATOM   1649 C CA  . ILE A 1 233 ? 1.338   -27.346 -21.270 1.00 29.59 ? 295 ILE A CA  1 
ATOM   1650 C C   . ILE A 1 233 ? 2.169   -27.297 -19.980 1.00 29.16 ? 295 ILE A C   1 
ATOM   1651 O O   . ILE A 1 233 ? 1.682   -26.842 -18.944 1.00 28.94 ? 295 ILE A O   1 
ATOM   1652 C CB  . ILE A 1 233 ? 0.762   -28.797 -21.469 1.00 29.48 ? 295 ILE A CB  1 
ATOM   1653 C CG1 . ILE A 1 233 ? 1.871   -29.818 -21.728 1.00 30.03 ? 295 ILE A CG1 1 
ATOM   1654 C CG2 . ILE A 1 233 ? -0.267  -28.829 -22.594 1.00 29.17 ? 295 ILE A CG2 1 
ATOM   1655 C CD1 . ILE A 1 233 ? 1.490   -31.245 -21.360 1.00 30.13 ? 295 ILE A CD1 1 
ATOM   1656 N N   . GLY A 1 234 ? 3.409   -27.776 -20.043 1.00 29.04 ? 296 GLY A N   1 
ATOM   1657 C CA  . GLY A 1 234 ? 4.287   -27.798 -18.879 1.00 28.72 ? 296 GLY A CA  1 
ATOM   1658 C C   . GLY A 1 234 ? 4.649   -26.389 -18.451 1.00 29.02 ? 296 GLY A C   1 
ATOM   1659 O O   . GLY A 1 234 ? 4.075   -25.848 -17.518 1.00 28.70 ? 296 GLY A O   1 
ATOM   1660 N N   . ARG A 1 235 ? 5.584   -25.771 -19.159 1.00 29.46 ? 297 ARG A N   1 
ATOM   1661 C CA  . ARG A 1 235 ? 6.044   -24.442 -18.772 1.00 29.83 ? 297 ARG A CA  1 
ATOM   1662 C C   . ARG A 1 235 ? 4.945   -23.376 -18.897 1.00 29.97 ? 297 ARG A C   1 
ATOM   1663 O O   . ARG A 1 235 ? 4.773   -22.523 -17.997 1.00 30.86 ? 297 ARG A O   1 
ATOM   1664 C CB  . ARG A 1 235 ? 7.289   -24.071 -19.560 1.00 29.92 ? 297 ARG A CB  1 
ATOM   1665 C CG  . ARG A 1 235 ? 8.494   -24.936 -19.203 1.00 30.12 ? 297 ARG A CG  1 
ATOM   1666 C CD  . ARG A 1 235 ? 9.545   -24.892 -20.295 1.00 32.70 ? 297 ARG A CD  1 
ATOM   1667 N NE  . ARG A 1 235 ? 9.146   -25.609 -21.513 1.00 32.66 ? 297 ARG A NE  1 
ATOM   1668 C CZ  . ARG A 1 235 ? 9.931   -25.775 -22.577 1.00 32.50 ? 297 ARG A CZ  1 
ATOM   1669 N NH1 . ARG A 1 235 ? 11.164  -25.272 -22.591 1.00 30.12 ? 297 ARG A NH1 1 
ATOM   1670 N NH2 . ARG A 1 235 ? 9.481   -26.449 -23.630 1.00 33.06 ? 297 ARG A NH2 1 
ATOM   1671 N N   . THR A 1 236 ? 4.183   -23.449 -19.983 1.00 29.07 ? 298 THR A N   1 
ATOM   1672 C CA  . THR A 1 236 ? 3.013   -22.589 -20.169 1.00 28.58 ? 298 THR A CA  1 
ATOM   1673 C C   . THR A 1 236 ? 2.054   -22.647 -18.988 1.00 28.11 ? 298 THR A C   1 
ATOM   1674 O O   . THR A 1 236 ? 1.487   -21.620 -18.606 1.00 27.86 ? 298 THR A O   1 
ATOM   1675 C CB  . THR A 1 236 ? 2.255   -22.976 -21.442 1.00 28.73 ? 298 THR A CB  1 
ATOM   1676 O OG1 . THR A 1 236 ? 3.110   -22.758 -22.578 1.00 30.16 ? 298 THR A OG1 1 
ATOM   1677 C CG2 . THR A 1 236 ? 1.005   -22.154 -21.589 1.00 27.04 ? 298 THR A CG2 1 
ATOM   1678 N N   . GLY A 1 237 ? 1.885   -23.849 -18.429 1.00 27.66 ? 299 GLY A N   1 
ATOM   1679 C CA  . GLY A 1 237 ? 1.035   -24.089 -17.272 1.00 27.09 ? 299 GLY A CA  1 
ATOM   1680 C C   . GLY A 1 237 ? 1.610   -23.467 -16.018 1.00 27.52 ? 299 GLY A C   1 
ATOM   1681 O O   . GLY A 1 237 ? 0.869   -22.881 -15.214 1.00 26.90 ? 299 GLY A O   1 
ATOM   1682 N N   . CYS A 1 238 ? 2.935   -23.565 -15.863 1.00 27.80 ? 300 CYS A N   1 
ATOM   1683 C CA  . CYS A 1 238 ? 3.627   -22.997 -14.702 1.00 28.72 ? 300 CYS A CA  1 
ATOM   1684 C C   . CYS A 1 238 ? 3.600   -21.476 -14.693 1.00 28.72 ? 300 CYS A C   1 
ATOM   1685 O O   . CYS A 1 238 ? 3.432   -20.851 -13.639 1.00 27.92 ? 300 CYS A O   1 
ATOM   1686 C CB  . CYS A 1 238 ? 5.081   -23.435 -14.660 1.00 28.94 ? 300 CYS A CB  1 
ATOM   1687 S SG  . CYS A 1 238 ? 5.351   -25.177 -14.497 1.00 31.23 ? 300 CYS A SG  1 
ATOM   1688 N N   . PHE A 1 239 ? 3.782   -20.881 -15.869 1.00 29.32 ? 301 PHE A N   1 
ATOM   1689 C CA  . PHE A 1 239 ? 3.801   -19.424 -15.951 1.00 29.51 ? 301 PHE A CA  1 
ATOM   1690 C C   . PHE A 1 239 ? 2.453   -18.895 -15.535 1.00 29.29 ? 301 PHE A C   1 
ATOM   1691 O O   . PHE A 1 239 ? 2.361   -18.022 -14.652 1.00 29.71 ? 301 PHE A O   1 
ATOM   1692 C CB  . PHE A 1 239 ? 4.153   -18.911 -17.357 1.00 29.78 ? 301 PHE A CB  1 
ATOM   1693 C CG  . PHE A 1 239 ? 3.945   -17.428 -17.515 1.00 29.44 ? 301 PHE A CG  1 
ATOM   1694 C CD1 . PHE A 1 239 ? 4.870   -16.528 -17.010 1.00 29.68 ? 301 PHE A CD1 1 
ATOM   1695 C CD2 . PHE A 1 239 ? 2.810   -16.937 -18.120 1.00 29.65 ? 301 PHE A CD2 1 
ATOM   1696 C CE1 . PHE A 1 239 ? 4.679   -15.166 -17.133 1.00 29.40 ? 301 PHE A CE1 1 
ATOM   1697 C CE2 . PHE A 1 239 ? 2.609   -15.569 -18.243 1.00 30.61 ? 301 PHE A CE2 1 
ATOM   1698 C CZ  . PHE A 1 239 ? 3.554   -14.685 -17.753 1.00 29.52 ? 301 PHE A CZ  1 
ATOM   1699 N N   . ILE A 1 240 ? 1.406   -19.435 -16.154 1.00 28.69 ? 302 ILE A N   1 
ATOM   1700 C CA  . ILE A 1 240 ? 0.058   -18.940 -15.896 1.00 28.33 ? 302 ILE A CA  1 
ATOM   1701 C C   . ILE A 1 240 ? -0.359  -19.176 -14.441 1.00 28.77 ? 302 ILE A C   1 
ATOM   1702 O O   . ILE A 1 240 ? -0.946  -18.291 -13.806 1.00 29.49 ? 302 ILE A O   1 
ATOM   1703 C CB  . ILE A 1 240 ? -0.953  -19.533 -16.886 1.00 28.33 ? 302 ILE A CB  1 
ATOM   1704 C CG1 . ILE A 1 240 ? -0.609  -19.079 -18.321 1.00 27.61 ? 302 ILE A CG1 1 
ATOM   1705 C CG2 . ILE A 1 240 ? -2.368  -19.114 -16.511 1.00 27.68 ? 302 ILE A CG2 1 
ATOM   1706 C CD1 . ILE A 1 240 ? -1.275  -19.882 -19.432 1.00 25.61 ? 302 ILE A CD1 1 
ATOM   1707 N N   . ALA A 1 241 ? -0.038  -20.349 -13.890 1.00 28.74 ? 303 ALA A N   1 
ATOM   1708 C CA  . ALA A 1 241 ? -0.420  -20.627 -12.516 1.00 28.60 ? 303 ALA A CA  1 
ATOM   1709 C C   . ALA A 1 241 ? 0.286   -19.646 -11.583 1.00 28.74 ? 303 ALA A C   1 
ATOM   1710 O O   . ALA A 1 241 ? -0.232  -19.300 -10.519 1.00 28.82 ? 303 ALA A O   1 
ATOM   1711 C CB  . ALA A 1 241 ? -0.131  -22.058 -12.146 1.00 28.53 ? 303 ALA A CB  1 
ATOM   1712 N N   . THR A 1 242 ? 1.445   -19.157 -12.019 1.00 28.83 ? 304 THR A N   1 
ATOM   1713 C CA  . THR A 1 242 ? 2.213   -18.183 -11.249 1.00 28.25 ? 304 THR A CA  1 
ATOM   1714 C C   . THR A 1 242 ? 1.563   -16.812 -11.273 1.00 28.50 ? 304 THR A C   1 
ATOM   1715 O O   . THR A 1 242 ? 1.545   -16.129 -10.239 1.00 28.70 ? 304 THR A O   1 
ATOM   1716 C CB  . THR A 1 242 ? 3.667   -18.068 -11.752 1.00 28.51 ? 304 THR A CB  1 
ATOM   1717 O OG1 . THR A 1 242 ? 4.287   -19.361 -11.754 1.00 27.25 ? 304 THR A OG1 1 
ATOM   1718 C CG2 . THR A 1 242 ? 4.475   -17.110 -10.881 1.00 28.25 ? 304 THR A CG2 1 
ATOM   1719 N N   . ARG A 1 243 ? 1.064   -16.388 -12.441 1.00 28.26 ? 305 ARG A N   1 
ATOM   1720 C CA  . ARG A 1 243 ? 0.375   -15.101 -12.527 1.00 28.10 ? 305 ARG A CA  1 
ATOM   1721 C C   . ARG A 1 243 ? -0.792  -15.138 -11.558 1.00 28.20 ? 305 ARG A C   1 
ATOM   1722 O O   . ARG A 1 243 ? -0.822  -14.371 -10.583 1.00 28.47 ? 305 ARG A O   1 
ATOM   1723 C CB  . ARG A 1 243 ? -0.133  -14.802 -13.941 1.00 28.19 ? 305 ARG A CB  1 
ATOM   1724 C CG  . ARG A 1 243 ? 0.581   -13.677 -14.659 1.00 29.08 ? 305 ARG A CG  1 
ATOM   1725 C CD  . ARG A 1 243 ? -0.104  -12.313 -14.474 1.00 29.19 ? 305 ARG A CD  1 
ATOM   1726 N NE  . ARG A 1 243 ? -1.337  -12.239 -15.248 1.00 31.14 ? 305 ARG A NE  1 
ATOM   1727 C CZ  . ARG A 1 243 ? -1.972  -11.127 -15.607 1.00 30.08 ? 305 ARG A CZ  1 
ATOM   1728 N NH1 . ARG A 1 243 ? -1.509  -9.929  -15.287 1.00 27.52 ? 305 ARG A NH1 1 
ATOM   1729 N NH2 . ARG A 1 243 ? -3.094  -11.236 -16.307 1.00 31.99 ? 305 ARG A NH2 1 
ATOM   1730 N N   . ILE A 1 244 ? -1.730  -16.059 -11.808 1.00 27.84 ? 306 ILE A N   1 
ATOM   1731 C CA  . ILE A 1 244 ? -2.947  -16.170 -11.001 1.00 27.15 ? 306 ILE A CA  1 
ATOM   1732 C C   . ILE A 1 244 ? -2.643  -16.237 -9.501  1.00 27.18 ? 306 ILE A C   1 
ATOM   1733 O O   . ILE A 1 244 ? -3.281  -15.529 -8.726  1.00 27.52 ? 306 ILE A O   1 
ATOM   1734 C CB  . ILE A 1 244 ? -3.809  -17.365 -11.445 1.00 27.35 ? 306 ILE A CB  1 
ATOM   1735 C CG1 . ILE A 1 244 ? -4.116  -17.251 -12.945 1.00 26.71 ? 306 ILE A CG1 1 
ATOM   1736 C CG2 . ILE A 1 244 ? -5.082  -17.487 -10.594 1.00 25.67 ? 306 ILE A CG2 1 
ATOM   1737 C CD1 . ILE A 1 244 ? -4.817  -18.458 -13.504 1.00 26.02 ? 306 ILE A CD1 1 
ATOM   1738 N N   . GLY A 1 245 ? -1.662  -17.059 -9.113  1.00 26.83 ? 307 GLY A N   1 
ATOM   1739 C CA  . GLY A 1 245 ? -1.209  -17.164 -7.735  1.00 26.60 ? 307 GLY A CA  1 
ATOM   1740 C C   . GLY A 1 245 ? -0.772  -15.833 -7.151  1.00 27.27 ? 307 GLY A C   1 
ATOM   1741 O O   . GLY A 1 245 ? -1.142  -15.477 -6.018  1.00 26.97 ? 307 GLY A O   1 
ATOM   1742 N N   . CYS A 1 246 ? 0.018   -15.087 -7.922  1.00 27.36 ? 308 CYS A N   1 
ATOM   1743 C CA  . CYS A 1 246 ? 0.414   -13.748 -7.515  1.00 27.45 ? 308 CYS A CA  1 
ATOM   1744 C C   . CYS A 1 246 ? -0.802  -12.844 -7.387  1.00 27.03 ? 308 CYS A C   1 
ATOM   1745 O O   . CYS A 1 246 ? -0.942  -12.111 -6.393  1.00 27.30 ? 308 CYS A O   1 
ATOM   1746 C CB  . CYS A 1 246 ? 1.441   -13.161 -8.480  1.00 27.79 ? 308 CYS A CB  1 
ATOM   1747 S SG  . CYS A 1 246 ? 3.066   -13.985 -8.421  1.00 31.05 ? 308 CYS A SG  1 
ATOM   1748 N N   . GLN A 1 247 ? -1.700  -12.906 -8.369  1.00 26.40 ? 309 GLN A N   1 
ATOM   1749 C CA  . GLN A 1 247 ? -2.950  -12.142 -8.285  1.00 25.73 ? 309 GLN A CA  1 
ATOM   1750 C C   . GLN A 1 247 ? -3.729  -12.458 -7.000  1.00 25.51 ? 309 GLN A C   1 
ATOM   1751 O O   . GLN A 1 247 ? -4.194  -11.528 -6.323  1.00 25.71 ? 309 GLN A O   1 
ATOM   1752 C CB  . GLN A 1 247 ? -3.817  -12.331 -9.526  1.00 25.32 ? 309 GLN A CB  1 
ATOM   1753 C CG  . GLN A 1 247 ? -3.291  -11.576 -10.726 1.00 25.78 ? 309 GLN A CG  1 
ATOM   1754 C CD  . GLN A 1 247 ? -3.932  -12.009 -12.044 1.00 26.71 ? 309 GLN A CD  1 
ATOM   1755 O OE1 . GLN A 1 247 ? -4.278  -13.177 -12.229 1.00 28.19 ? 309 GLN A OE1 1 
ATOM   1756 N NE2 . GLN A 1 247 ? -4.082  -11.067 -12.966 1.00 24.82 ? 309 GLN A NE2 1 
ATOM   1757 N N   . GLN A 1 248 ? -3.825  -13.748 -6.651  1.00 24.95 ? 310 GLN A N   1 
ATOM   1758 C CA  . GLN A 1 248 ? -4.542  -14.187 -5.459  1.00 24.98 ? 310 GLN A CA  1 
ATOM   1759 C C   . GLN A 1 248 ? -3.899  -13.612 -4.209  1.00 25.07 ? 310 GLN A C   1 
ATOM   1760 O O   . GLN A 1 248 ? -4.576  -13.044 -3.364  1.00 25.18 ? 310 GLN A O   1 
ATOM   1761 C CB  . GLN A 1 248 ? -4.614  -15.713 -5.385  1.00 24.66 ? 310 GLN A CB  1 
ATOM   1762 C CG  . GLN A 1 248 ? -5.564  -16.349 -6.450  1.00 26.70 ? 310 GLN A CG  1 
ATOM   1763 C CD  . GLN A 1 248 ? -5.866  -17.850 -6.229  1.00 25.94 ? 310 GLN A CD  1 
ATOM   1764 O OE1 . GLN A 1 248 ? -5.415  -18.455 -5.266  1.00 29.12 ? 310 GLN A OE1 1 
ATOM   1765 N NE2 . GLN A 1 248 ? -6.634  -18.438 -7.132  1.00 25.37 ? 310 GLN A NE2 1 
ATOM   1766 N N   . LEU A 1 249 ? -2.577  -13.716 -4.126  1.00 25.16 ? 311 LEU A N   1 
ATOM   1767 C CA  . LEU A 1 249 ? -1.839  -13.276 -2.967  1.00 25.03 ? 311 LEU A CA  1 
ATOM   1768 C C   . LEU A 1 249 ? -1.908  -11.764 -2.769  1.00 25.60 ? 311 LEU A C   1 
ATOM   1769 O O   . LEU A 1 249 ? -2.093  -11.288 -1.642  1.00 24.99 ? 311 LEU A O   1 
ATOM   1770 C CB  . LEU A 1 249 ? -0.390  -13.763 -3.057  1.00 25.20 ? 311 LEU A CB  1 
ATOM   1771 C CG  . LEU A 1 249 ? -0.050  -15.165 -2.533  1.00 23.93 ? 311 LEU A CG  1 
ATOM   1772 C CD1 . LEU A 1 249 ? 1.417   -15.488 -2.797  1.00 23.16 ? 311 LEU A CD1 1 
ATOM   1773 C CD2 . LEU A 1 249 ? -0.363  -15.316 -1.050  1.00 21.48 ? 311 LEU A CD2 1 
ATOM   1774 N N   . LYS A 1 250 ? -1.784  -11.016 -3.866  1.00 26.36 ? 312 LYS A N   1 
ATOM   1775 C CA  . LYS A 1 250 ? -1.933  -9.559  -3.824  1.00 27.01 ? 312 LYS A CA  1 
ATOM   1776 C C   . LYS A 1 250 ? -3.339  -9.154  -3.361  1.00 27.23 ? 312 LYS A C   1 
ATOM   1777 O O   . LYS A 1 250 ? -3.471  -8.290  -2.495  1.00 27.79 ? 312 LYS A O   1 
ATOM   1778 C CB  . LYS A 1 250 ? -1.585  -8.904  -5.181  1.00 26.97 ? 312 LYS A CB  1 
ATOM   1779 C CG  . LYS A 1 250 ? -1.227  -7.413  -5.079  1.00 26.88 ? 312 LYS A CG  1 
ATOM   1780 C CD  . LYS A 1 250 ? -1.022  -6.756  -6.446  1.00 27.41 ? 312 LYS A CD  1 
ATOM   1781 N N   . ALA A 1 251 ? -4.380  -9.783  -3.910  1.00 27.29 ? 313 ALA A N   1 
ATOM   1782 C CA  . ALA A 1 251 ? -5.755  -9.384  -3.580  1.00 27.73 ? 313 ALA A CA  1 
ATOM   1783 C C   . ALA A 1 251 ? -6.209  -9.802  -2.173  1.00 28.56 ? 313 ALA A C   1 
ATOM   1784 O O   . ALA A 1 251 ? -6.731  -8.980  -1.424  1.00 28.15 ? 313 ALA A O   1 
ATOM   1785 C CB  . ALA A 1 251 ? -6.733  -9.897  -4.621  1.00 27.17 ? 313 ALA A CB  1 
ATOM   1786 N N   . ARG A 1 252 ? -5.978  -11.068 -1.822  1.00 29.29 ? 314 ARG A N   1 
ATOM   1787 C CA  . ARG A 1 252 ? -6.615  -11.689 -0.671  1.00 30.36 ? 314 ARG A CA  1 
ATOM   1788 C C   . ARG A 1 252 ? -5.661  -12.155 0.443   1.00 29.86 ? 314 ARG A C   1 
ATOM   1789 O O   . ARG A 1 252 ? -6.102  -12.444 1.553   1.00 29.67 ? 314 ARG A O   1 
ATOM   1790 C CB  . ARG A 1 252 ? -7.463  -12.876 -1.139  1.00 30.58 ? 314 ARG A CB  1 
ATOM   1791 C CG  . ARG A 1 252 ? -8.243  -12.667 -2.440  1.00 31.88 ? 314 ARG A CG  1 
ATOM   1792 C CD  . ARG A 1 252 ? -9.316  -13.744 -2.596  1.00 32.51 ? 314 ARG A CD  1 
ATOM   1793 N NE  . ARG A 1 252 ? -9.430  -14.243 -3.971  1.00 37.44 ? 314 ARG A NE  1 
ATOM   1794 C CZ  . ARG A 1 252 ? -9.129  -15.487 -4.367  1.00 39.51 ? 314 ARG A CZ  1 
ATOM   1795 N NH1 . ARG A 1 252 ? -8.693  -16.400 -3.494  1.00 39.85 ? 314 ARG A NH1 1 
ATOM   1796 N NH2 . ARG A 1 252 ? -9.283  -15.832 -5.649  1.00 40.51 ? 314 ARG A NH2 1 
ATOM   1797 N N   . GLY A 1 253 ? -4.365  -12.230 0.153   1.00 29.96 ? 315 GLY A N   1 
ATOM   1798 C CA  . GLY A 1 253 ? -3.384  -12.726 1.130   1.00 29.89 ? 315 GLY A CA  1 
ATOM   1799 C C   . GLY A 1 253 ? -3.507  -14.224 1.373   1.00 30.12 ? 315 GLY A C   1 
ATOM   1800 O O   . GLY A 1 253 ? -3.209  -14.727 2.457   1.00 29.97 ? 315 GLY A O   1 
ATOM   1801 N N   . GLU A 1 254 ? -3.969  -14.932 0.355   1.00 30.22 ? 316 GLU A N   1 
ATOM   1802 C CA  . GLU A 1 254 ? -4.154  -16.360 0.423   1.00 31.17 ? 316 GLU A CA  1 
ATOM   1803 C C   . GLU A 1 254 ? -3.930  -16.835 -1.004  1.00 30.75 ? 316 GLU A C   1 
ATOM   1804 O O   . GLU A 1 254 ? -4.048  -16.039 -1.951  1.00 31.43 ? 316 GLU A O   1 
ATOM   1805 C CB  . GLU A 1 254 ? -5.580  -16.685 0.897   1.00 31.19 ? 316 GLU A CB  1 
ATOM   1806 C CG  . GLU A 1 254 ? -6.636  -16.686 -0.228  1.00 32.83 ? 316 GLU A CG  1 
ATOM   1807 C CD  . GLU A 1 254 ? -8.097  -16.700 0.262   1.00 33.44 ? 316 GLU A CD  1 
ATOM   1808 O OE1 . GLU A 1 254 ? -8.447  -17.523 1.158   1.00 36.48 ? 316 GLU A OE1 1 
ATOM   1809 O OE2 . GLU A 1 254 ? -8.905  -15.893 -0.283  1.00 34.62 ? 316 GLU A OE2 1 
ATOM   1810 N N   . VAL A 1 255 ? -3.589  -18.106 -1.169  1.00 30.00 ? 317 VAL A N   1 
ATOM   1811 C CA  . VAL A 1 255 ? -3.504  -18.693 -2.501  1.00 29.51 ? 317 VAL A CA  1 
ATOM   1812 C C   . VAL A 1 255 ? -3.938  -20.146 -2.479  1.00 29.61 ? 317 VAL A C   1 
ATOM   1813 O O   . VAL A 1 255 ? -3.593  -20.905 -1.566  1.00 29.55 ? 317 VAL A O   1 
ATOM   1814 C CB  . VAL A 1 255 ? -2.079  -18.573 -3.127  1.00 29.93 ? 317 VAL A CB  1 
ATOM   1815 C CG1 . VAL A 1 255 ? -1.082  -19.543 -2.457  1.00 28.18 ? 317 VAL A CG1 1 
ATOM   1816 C CG2 . VAL A 1 255 ? -2.138  -18.809 -4.638  1.00 29.08 ? 317 VAL A CG2 1 
ATOM   1817 N N   . ASP A 1 256 ? -4.689  -20.535 -3.494  1.00 29.60 ? 318 ASP A N   1 
ATOM   1818 C CA  . ASP A 1 256 ? -5.105  -21.926 -3.616  1.00 29.80 ? 318 ASP A CA  1 
ATOM   1819 C C   . ASP A 1 256 ? -4.491  -22.508 -4.864  1.00 29.21 ? 318 ASP A C   1 
ATOM   1820 O O   . ASP A 1 256 ? -5.051  -22.405 -5.960  1.00 28.49 ? 318 ASP A O   1 
ATOM   1821 C CB  . ASP A 1 256 ? -6.624  -22.032 -3.660  1.00 29.84 ? 318 ASP A CB  1 
ATOM   1822 C CG  . ASP A 1 256 ? -7.106  -23.462 -3.678  1.00 31.47 ? 318 ASP A CG  1 
ATOM   1823 O OD1 . ASP A 1 256 ? -8.349  -23.640 -3.740  1.00 32.96 ? 318 ASP A OD1 1 
ATOM   1824 O OD2 . ASP A 1 256 ? -6.260  -24.399 -3.655  1.00 30.89 ? 318 ASP A OD2 1 
ATOM   1825 N N   . ILE A 1 257 ? -3.326  -23.118 -4.678  1.00 28.92 ? 319 ILE A N   1 
ATOM   1826 C CA  . ILE A 1 257 ? -2.510  -23.557 -5.805  1.00 28.41 ? 319 ILE A CA  1 
ATOM   1827 C C   . ILE A 1 257 ? -3.113  -24.765 -6.514  1.00 28.29 ? 319 ILE A C   1 
ATOM   1828 O O   . ILE A 1 257 ? -3.288  -24.733 -7.746  1.00 28.57 ? 319 ILE A O   1 
ATOM   1829 C CB  . ILE A 1 257 ? -1.043  -23.749 -5.406  1.00 27.98 ? 319 ILE A CB  1 
ATOM   1830 C CG1 . ILE A 1 257 ? -0.467  -22.410 -4.955  1.00 27.62 ? 319 ILE A CG1 1 
ATOM   1831 C CG2 . ILE A 1 257 ? -0.246  -24.271 -6.580  1.00 27.63 ? 319 ILE A CG2 1 
ATOM   1832 C CD1 . ILE A 1 257 ? 0.879   -22.505 -4.254  1.00 27.25 ? 319 ILE A CD1 1 
ATOM   1833 N N   . LEU A 1 258 ? -3.436  -25.804 -5.732  1.00 28.21 ? 320 LEU A N   1 
ATOM   1834 C CA  . LEU A 1 258 ? -4.257  -26.964 -6.174  1.00 27.92 ? 320 LEU A CA  1 
ATOM   1835 C C   . LEU A 1 258 ? -5.415  -26.524 -7.062  1.00 28.49 ? 320 LEU A C   1 
ATOM   1836 O O   . LEU A 1 258 ? -5.524  -26.964 -8.213  1.00 29.23 ? 320 LEU A O   1 
ATOM   1837 C CB  . LEU A 1 258 ? -4.808  -27.727 -4.965  1.00 27.78 ? 320 LEU A CB  1 
ATOM   1838 C CG  . LEU A 1 258 ? -5.706  -28.967 -5.118  1.00 27.57 ? 320 LEU A CG  1 
ATOM   1839 C CD1 . LEU A 1 258 ? -5.091  -30.012 -6.039  1.00 25.52 ? 320 LEU A CD1 1 
ATOM   1840 C CD2 . LEU A 1 258 ? -6.005  -29.585 -3.736  1.00 26.57 ? 320 LEU A CD2 1 
ATOM   1841 N N   . GLY A 1 259 ? -6.253  -25.633 -6.538  1.00 28.04 ? 321 GLY A N   1 
ATOM   1842 C CA  . GLY A 1 259 ? -7.389  -25.153 -7.293  1.00 28.38 ? 321 GLY A CA  1 
ATOM   1843 C C   . GLY A 1 259 ? -7.017  -24.478 -8.604  1.00 28.52 ? 321 GLY A C   1 
ATOM   1844 O O   . GLY A 1 259 ? -7.699  -24.664 -9.620  1.00 28.82 ? 321 GLY A O   1 
ATOM   1845 N N   . ILE A 1 260 ? -5.943  -23.691 -8.588  1.00 28.33 ? 322 ILE A N   1 
ATOM   1846 C CA  . ILE A 1 260 ? -5.490  -23.008 -9.792  1.00 28.20 ? 322 ILE A CA  1 
ATOM   1847 C C   . ILE A 1 260 ? -5.156  -24.036 -10.856 1.00 28.65 ? 322 ILE A C   1 
ATOM   1848 O O   . ILE A 1 260 ? -5.552  -23.882 -12.022 1.00 28.85 ? 322 ILE A O   1 
ATOM   1849 C CB  . ILE A 1 260 ? -4.272  -22.105 -9.520  1.00 28.65 ? 322 ILE A CB  1 
ATOM   1850 C CG1 . ILE A 1 260 ? -4.718  -20.781 -8.872  1.00 27.64 ? 322 ILE A CG1 1 
ATOM   1851 C CG2 . ILE A 1 260 ? -3.474  -21.852 -10.802 1.00 26.28 ? 322 ILE A CG2 1 
ATOM   1852 C CD1 . ILE A 1 260 ? -3.644  -20.154 -8.044  1.00 27.07 ? 322 ILE A CD1 1 
ATOM   1853 N N   . VAL A 1 261 ? -4.453  -25.089 -10.443 1.00 28.50 ? 323 VAL A N   1 
ATOM   1854 C CA  . VAL A 1 261 ? -3.999  -26.123 -11.361 1.00 28.53 ? 323 VAL A CA  1 
ATOM   1855 C C   . VAL A 1 261 ? -5.193  -26.941 -11.865 1.00 28.61 ? 323 VAL A C   1 
ATOM   1856 O O   . VAL A 1 261 ? -5.236  -27.361 -13.021 1.00 28.50 ? 323 VAL A O   1 
ATOM   1857 C CB  . VAL A 1 261 ? -2.950  -27.055 -10.683 1.00 28.77 ? 323 VAL A CB  1 
ATOM   1858 C CG1 . VAL A 1 261 ? -2.477  -28.138 -11.645 1.00 26.46 ? 323 VAL A CG1 1 
ATOM   1859 C CG2 . VAL A 1 261 ? -1.772  -26.237 -10.155 1.00 28.71 ? 323 VAL A CG2 1 
ATOM   1860 N N   . CYS A 1 262 ? -6.166  -27.156 -10.986 1.00 28.56 ? 324 CYS A N   1 
ATOM   1861 C CA  . CYS A 1 262 ? -7.408  -27.818 -11.379 1.00 28.26 ? 324 CYS A CA  1 
ATOM   1862 C C   . CYS A 1 262 ? -8.123  -26.988 -12.452 1.00 28.07 ? 324 CYS A C   1 
ATOM   1863 O O   . CYS A 1 262 ? -8.593  -27.524 -13.448 1.00 28.31 ? 324 CYS A O   1 
ATOM   1864 C CB  . CYS A 1 262 ? -8.297  -28.060 -10.151 1.00 27.86 ? 324 CYS A CB  1 
ATOM   1865 S SG  . CYS A 1 262 ? -7.683  -29.427 -9.081  1.00 27.82 ? 324 CYS A SG  1 
ATOM   1866 N N   . GLN A 1 263 ? -8.167  -25.679 -12.254 1.00 28.11 ? 325 GLN A N   1 
ATOM   1867 C CA  . GLN A 1 263 ? -8.836  -24.787 -13.181 1.00 28.56 ? 325 GLN A CA  1 
ATOM   1868 C C   . GLN A 1 263 ? -8.203  -24.825 -14.561 1.00 28.53 ? 325 GLN A C   1 
ATOM   1869 O O   . GLN A 1 263 ? -8.910  -24.779 -15.556 1.00 28.49 ? 325 GLN A O   1 
ATOM   1870 C CB  . GLN A 1 263 ? -8.836  -23.352 -12.657 1.00 28.51 ? 325 GLN A CB  1 
ATOM   1871 C CG  . GLN A 1 263 ? -9.770  -22.439 -13.439 1.00 29.09 ? 325 GLN A CG  1 
ATOM   1872 C CD  . GLN A 1 263 ? -9.765  -21.033 -12.909 1.00 30.62 ? 325 GLN A CD  1 
ATOM   1873 O OE1 . GLN A 1 263 ? -8.878  -20.237 -13.225 1.00 34.34 ? 325 GLN A OE1 1 
ATOM   1874 N NE2 . GLN A 1 263 ? -10.752 -20.713 -12.091 1.00 30.41 ? 325 GLN A NE2 1 
ATOM   1875 N N   . LEU A 1 264 ? -6.877  -24.897 -14.614 1.00 28.77 ? 326 LEU A N   1 
ATOM   1876 C CA  . LEU A 1 264 ? -6.162  -24.895 -15.893 1.00 29.23 ? 326 LEU A CA  1 
ATOM   1877 C C   . LEU A 1 264 ? -6.376  -26.203 -16.626 1.00 28.99 ? 326 LEU A C   1 
ATOM   1878 O O   . LEU A 1 264 ? -6.640  -26.201 -17.850 1.00 28.90 ? 326 LEU A O   1 
ATOM   1879 C CB  . LEU A 1 264 ? -4.663  -24.637 -15.700 1.00 29.65 ? 326 LEU A CB  1 
ATOM   1880 C CG  . LEU A 1 264 ? -4.253  -23.285 -15.087 1.00 30.58 ? 326 LEU A CG  1 
ATOM   1881 C CD1 . LEU A 1 264 ? -2.813  -23.319 -14.625 1.00 29.55 ? 326 LEU A CD1 1 
ATOM   1882 C CD2 . LEU A 1 264 ? -4.478  -22.149 -16.068 1.00 29.97 ? 326 LEU A CD2 1 
ATOM   1883 N N   . ARG A 1 265 ? -6.276  -27.301 -15.867 1.00 28.62 ? 327 ARG A N   1 
ATOM   1884 C CA  . ARG A 1 265 ? -6.482  -28.659 -16.383 1.00 28.65 ? 327 ARG A CA  1 
ATOM   1885 C C   . ARG A 1 265 ? -7.866  -28.769 -16.979 1.00 28.82 ? 327 ARG A C   1 
ATOM   1886 O O   . ARG A 1 265 ? -8.087  -29.541 -17.898 1.00 28.94 ? 327 ARG A O   1 
ATOM   1887 C CB  . ARG A 1 265 ? -6.323  -29.709 -15.283 1.00 28.69 ? 327 ARG A CB  1 
ATOM   1888 C CG  . ARG A 1 265 ? -4.925  -29.821 -14.658 1.00 28.97 ? 327 ARG A CG  1 
ATOM   1889 C CD  . ARG A 1 265 ? -4.147  -30.977 -15.227 1.00 28.95 ? 327 ARG A CD  1 
ATOM   1890 N NE  . ARG A 1 265 ? -2.743  -30.967 -14.814 1.00 27.43 ? 327 ARG A NE  1 
ATOM   1891 C CZ  . ARG A 1 265 ? -2.135  -31.953 -14.165 1.00 28.58 ? 327 ARG A CZ  1 
ATOM   1892 N NH1 . ARG A 1 265 ? -2.786  -33.057 -13.820 1.00 29.26 ? 327 ARG A NH1 1 
ATOM   1893 N NH2 . ARG A 1 265 ? -0.856  -31.840 -13.866 1.00 30.80 ? 327 ARG A NH2 1 
ATOM   1894 N N   . LEU A 1 266 ? -8.802  -27.991 -16.449 1.00 29.07 ? 328 LEU A N   1 
ATOM   1895 C CA  . LEU A 1 266 ? -10.125 -27.896 -17.045 1.00 29.28 ? 328 LEU A CA  1 
ATOM   1896 C C   . LEU A 1 266 ? -10.094 -27.245 -18.424 1.00 29.03 ? 328 LEU A C   1 
ATOM   1897 O O   . LEU A 1 266 ? -10.871 -27.639 -19.277 1.00 29.16 ? 328 LEU A O   1 
ATOM   1898 C CB  . LEU A 1 266 ? -11.116 -27.157 -16.117 1.00 29.54 ? 328 LEU A CB  1 
ATOM   1899 C CG  . LEU A 1 266 ? -11.826 -28.003 -15.050 1.00 29.89 ? 328 LEU A CG  1 
ATOM   1900 C CD1 . LEU A 1 266 ? -12.478 -27.127 -13.961 1.00 29.48 ? 328 LEU A CD1 1 
ATOM   1901 C CD2 . LEU A 1 266 ? -12.829 -28.967 -15.680 1.00 26.24 ? 328 LEU A CD2 1 
ATOM   1902 N N   . ASP A 1 267 ? -9.199  -26.280 -18.645 1.00 29.00 ? 329 ASP A N   1 
ATOM   1903 C CA  . ASP A 1 267 ? -9.149  -25.529 -19.926 1.00 29.39 ? 329 ASP A CA  1 
ATOM   1904 C C   . ASP A 1 267 ? -8.246  -26.138 -21.013 1.00 29.15 ? 329 ASP A C   1 
ATOM   1905 O O   . ASP A 1 267 ? -8.496  -25.968 -22.209 1.00 28.97 ? 329 ASP A O   1 
ATOM   1906 C CB  . ASP A 1 267 ? -8.736  -24.080 -19.677 1.00 29.49 ? 329 ASP A CB  1 
ATOM   1907 C CG  . ASP A 1 267 ? -9.604  -23.395 -18.632 1.00 30.95 ? 329 ASP A CG  1 
ATOM   1908 O OD1 . ASP A 1 267 ? -9.048  -22.736 -17.725 1.00 30.35 ? 329 ASP A OD1 1 
ATOM   1909 O OD2 . ASP A 1 267 ? -10.849 -23.523 -18.715 1.00 32.68 ? 329 ASP A OD2 1 
ATOM   1910 N N   . ARG A 1 268 ? -7.181  -26.811 -20.591 1.00 28.84 ? 330 ARG A N   1 
ATOM   1911 C CA  . ARG A 1 268 ? -6.275  -27.515 -21.496 1.00 28.42 ? 330 ARG A CA  1 
ATOM   1912 C C   . ARG A 1 268 ? -5.642  -28.636 -20.696 1.00 28.43 ? 330 ARG A C   1 
ATOM   1913 O O   . ARG A 1 268 ? -5.107  -28.400 -19.616 1.00 28.46 ? 330 ARG A O   1 
ATOM   1914 C CB  . ARG A 1 268 ? -5.197  -26.571 -22.027 1.00 28.35 ? 330 ARG A CB  1 
ATOM   1915 C CG  . ARG A 1 268 ? -4.234  -27.168 -23.081 1.00 28.15 ? 330 ARG A CG  1 
ATOM   1916 C CD  . ARG A 1 268 ? -3.477  -26.035 -23.773 1.00 27.13 ? 330 ARG A CD  1 
ATOM   1917 N NE  . ARG A 1 268 ? -2.289  -26.433 -24.532 1.00 25.39 ? 330 ARG A NE  1 
ATOM   1918 C CZ  . ARG A 1 268 ? -2.287  -26.780 -25.819 1.00 23.25 ? 330 ARG A CZ  1 
ATOM   1919 N NH1 . ARG A 1 268 ? -3.413  -26.821 -26.515 1.00 20.07 ? 330 ARG A NH1 1 
ATOM   1920 N NH2 . ARG A 1 268 ? -1.145  -27.087 -26.409 1.00 22.77 ? 330 ARG A NH2 1 
ATOM   1921 N N   . GLY A 1 269 ? -5.727  -29.861 -21.202 1.00 28.46 ? 331 GLY A N   1 
ATOM   1922 C CA  . GLY A 1 269 ? -5.176  -31.005 -20.487 1.00 28.42 ? 331 GLY A CA  1 
ATOM   1923 C C   . GLY A 1 269 ? -3.690  -30.864 -20.202 1.00 28.69 ? 331 GLY A C   1 
ATOM   1924 O O   . GLY A 1 269 ? -2.937  -30.355 -21.043 1.00 28.58 ? 331 GLY A O   1 
ATOM   1925 N N   . GLY A 1 270 ? -3.281  -31.286 -19.001 1.00 28.78 ? 332 GLY A N   1 
ATOM   1926 C CA  . GLY A 1 270 ? -1.872  -31.502 -18.671 1.00 28.63 ? 332 GLY A CA  1 
ATOM   1927 C C   . GLY A 1 270 ? -1.061  -30.283 -18.275 1.00 28.97 ? 332 GLY A C   1 
ATOM   1928 O O   . GLY A 1 270 ? 0.162   -30.367 -18.169 1.00 29.52 ? 332 GLY A O   1 
ATOM   1929 N N   . MET A 1 271 ? -1.722  -29.147 -18.063 1.00 28.93 ? 333 MET A N   1 
ATOM   1930 C CA  . MET A 1 271 ? -1.035  -27.930 -17.639 1.00 28.88 ? 333 MET A CA  1 
ATOM   1931 C C   . MET A 1 271 ? -0.222  -28.229 -16.392 1.00 28.57 ? 333 MET A C   1 
ATOM   1932 O O   . MET A 1 271 ? -0.746  -28.817 -15.451 1.00 28.72 ? 333 MET A O   1 
ATOM   1933 C CB  . MET A 1 271 ? -2.020  -26.792 -17.377 1.00 28.88 ? 333 MET A CB  1 
ATOM   1934 C CG  . MET A 1 271 ? -2.844  -26.386 -18.603 1.00 30.75 ? 333 MET A CG  1 
ATOM   1935 S SD  . MET A 1 271 ? -1.966  -25.398 -19.855 1.00 34.10 ? 333 MET A SD  1 
ATOM   1936 C CE  . MET A 1 271 ? -2.226  -23.736 -19.243 1.00 30.06 ? 333 MET A CE  1 
ATOM   1937 N N   . ILE A 1 272 ? 1.057   -27.840 -16.405 1.00 27.87 ? 334 ILE A N   1 
ATOM   1938 C CA  . ILE A 1 272 ? 2.006   -28.198 -15.351 1.00 27.63 ? 334 ILE A CA  1 
ATOM   1939 C C   . ILE A 1 272 ? 2.316   -29.691 -15.421 1.00 27.63 ? 334 ILE A C   1 
ATOM   1940 O O   . ILE A 1 272 ? 1.478   -30.542 -15.110 1.00 27.47 ? 334 ILE A O   1 
ATOM   1941 C CB  . ILE A 1 272 ? 1.512   -27.789 -13.919 1.00 27.94 ? 334 ILE A CB  1 
ATOM   1942 C CG1 . ILE A 1 272 ? 1.100   -26.300 -13.901 1.00 28.75 ? 334 ILE A CG1 1 
ATOM   1943 C CG2 . ILE A 1 272 ? 2.539   -28.194 -12.848 1.00 25.28 ? 334 ILE A CG2 1 
ATOM   1944 C CD1 . ILE A 1 272 ? 1.178   -25.638 -12.547 1.00 30.81 ? 334 ILE A CD1 1 
ATOM   1945 N N   . GLN A 1 273 ? 3.534   -30.001 -15.830 1.00 27.64 ? 335 GLN A N   1 
ATOM   1946 C CA  . GLN A 1 273 ? 3.871   -31.359 -16.215 1.00 27.73 ? 335 GLN A CA  1 
ATOM   1947 C C   . GLN A 1 273 ? 4.317   -32.204 -15.033 1.00 27.57 ? 335 GLN A C   1 
ATOM   1948 O O   . GLN A 1 273 ? 3.764   -33.270 -14.806 1.00 27.73 ? 335 GLN A O   1 
ATOM   1949 C CB  . GLN A 1 273 ? 4.922   -31.353 -17.323 1.00 27.78 ? 335 GLN A CB  1 
ATOM   1950 C CG  . GLN A 1 273 ? 5.343   -32.714 -17.776 1.00 28.30 ? 335 GLN A CG  1 
ATOM   1951 C CD  . GLN A 1 273 ? 6.377   -32.685 -18.884 1.00 30.21 ? 335 GLN A CD  1 
ATOM   1952 O OE1 . GLN A 1 273 ? 7.021   -33.698 -19.152 1.00 32.22 ? 335 GLN A OE1 1 
ATOM   1953 N NE2 . GLN A 1 273 ? 6.541   -31.536 -19.539 1.00 29.46 ? 335 GLN A NE2 1 
ATOM   1954 N N   . THR A 1 274 ? 5.294   -31.727 -14.271 1.00 27.42 ? 336 THR A N   1 
ATOM   1955 C CA  . THR A 1 274 ? 5.925   -32.568 -13.245 1.00 27.34 ? 336 THR A CA  1 
ATOM   1956 C C   . THR A 1 274 ? 5.659   -32.115 -11.817 1.00 27.34 ? 336 THR A C   1 
ATOM   1957 O O   . THR A 1 274 ? 5.404   -30.933 -11.578 1.00 26.87 ? 336 THR A O   1 
ATOM   1958 C CB  . THR A 1 274 ? 7.465   -32.655 -13.443 1.00 27.42 ? 336 THR A CB  1 
ATOM   1959 O OG1 . THR A 1 274 ? 8.066   -31.366 -13.222 1.00 27.03 ? 336 THR A OG1 1 
ATOM   1960 C CG2 . THR A 1 274 ? 7.809   -33.171 -14.832 1.00 25.76 ? 336 THR A CG2 1 
ATOM   1961 N N   . ALA A 1 275 ? 5.765   -33.057 -10.872 1.00 27.86 ? 337 ALA A N   1 
ATOM   1962 C CA  . ALA A 1 275 ? 5.629   -32.754 -9.431  1.00 28.41 ? 337 ALA A CA  1 
ATOM   1963 C C   . ALA A 1 275 ? 6.589   -31.646 -8.992  1.00 29.14 ? 337 ALA A C   1 
ATOM   1964 O O   . ALA A 1 275 ? 6.184   -30.729 -8.269  1.00 29.66 ? 337 ALA A O   1 
ATOM   1965 C CB  . ALA A 1 275 ? 5.830   -34.010 -8.584  1.00 27.89 ? 337 ALA A CB  1 
ATOM   1966 N N   . GLU A 1 276 ? 7.845   -31.744 -9.449  1.00 30.05 ? 338 GLU A N   1 
ATOM   1967 C CA  . GLU A 1 276 ? 8.902   -30.740 -9.243  1.00 31.07 ? 338 GLU A CA  1 
ATOM   1968 C C   . GLU A 1 276 ? 8.500   -29.320 -9.665  1.00 31.20 ? 338 GLU A C   1 
ATOM   1969 O O   . GLU A 1 276 ? 8.716   -28.357 -8.914  1.00 31.18 ? 338 GLU A O   1 
ATOM   1970 C CB  . GLU A 1 276 ? 10.186  -31.158 -9.979  1.00 31.37 ? 338 GLU A CB  1 
ATOM   1971 C CG  . GLU A 1 276 ? 11.458  -30.470 -9.476  1.00 34.06 ? 338 GLU A CG  1 
ATOM   1972 C CD  . GLU A 1 276 ? 12.534  -30.310 -10.551 1.00 37.02 ? 338 GLU A CD  1 
ATOM   1973 O OE1 . GLU A 1 276 ? 13.647  -30.839 -10.366 1.00 38.63 ? 338 GLU A OE1 1 
ATOM   1974 O OE2 . GLU A 1 276 ? 12.280  -29.648 -11.581 1.00 39.83 ? 338 GLU A OE2 1 
ATOM   1975 N N   . GLN A 1 277 ? 7.934   -29.199 -10.868 1.00 31.47 ? 339 GLN A N   1 
ATOM   1976 C CA  . GLN A 1 277 ? 7.401   -27.924 -11.372 1.00 31.63 ? 339 GLN A CA  1 
ATOM   1977 C C   . GLN A 1 277 ? 6.342   -27.372 -10.422 1.00 31.34 ? 339 GLN A C   1 
ATOM   1978 O O   . GLN A 1 277 ? 6.226   -26.150 -10.251 1.00 31.60 ? 339 GLN A O   1 
ATOM   1979 C CB  . GLN A 1 277 ? 6.788   -28.091 -12.780 1.00 31.50 ? 339 GLN A CB  1 
ATOM   1980 C CG  . GLN A 1 277 ? 7.791   -28.135 -13.924 1.00 31.18 ? 339 GLN A CG  1 
ATOM   1981 C CD  . GLN A 1 277 ? 7.152   -28.452 -15.260 1.00 32.18 ? 339 GLN A CD  1 
ATOM   1982 O OE1 . GLN A 1 277 ? 5.950   -28.721 -15.340 1.00 34.12 ? 339 GLN A OE1 1 
ATOM   1983 N NE2 . GLN A 1 277 ? 7.951   -28.417 -16.327 1.00 31.21 ? 339 GLN A NE2 1 
ATOM   1984 N N   . TYR A 1 278 ? 5.566   -28.279 -9.826  1.00 30.80 ? 340 TYR A N   1 
ATOM   1985 C CA  . TYR A 1 278 ? 4.516   -27.912 -8.861  1.00 30.58 ? 340 TYR A CA  1 
ATOM   1986 C C   . TYR A 1 278 ? 5.089   -27.462 -7.500  1.00 30.24 ? 340 TYR A C   1 
ATOM   1987 O O   . TYR A 1 278 ? 4.576   -26.526 -6.884  1.00 30.01 ? 340 TYR A O   1 
ATOM   1988 C CB  . TYR A 1 278 ? 3.550   -29.081 -8.708  1.00 30.61 ? 340 TYR A CB  1 
ATOM   1989 C CG  . TYR A 1 278 ? 2.296   -28.878 -7.874  1.00 29.78 ? 340 TYR A CG  1 
ATOM   1990 C CD1 . TYR A 1 278 ? 1.226   -28.117 -8.354  1.00 28.69 ? 340 TYR A CD1 1 
ATOM   1991 C CD2 . TYR A 1 278 ? 2.146   -29.540 -6.640  1.00 29.01 ? 340 TYR A CD2 1 
ATOM   1992 C CE1 . TYR A 1 278 ? 0.056   -27.974 -7.609  1.00 29.25 ? 340 TYR A CE1 1 
ATOM   1993 C CE2 . TYR A 1 278 ? 0.987   -29.400 -5.873  1.00 29.05 ? 340 TYR A CE2 1 
ATOM   1994 C CZ  . TYR A 1 278 ? -0.058  -28.620 -6.367  1.00 30.20 ? 340 TYR A CZ  1 
ATOM   1995 O OH  . TYR A 1 278 ? -1.208  -28.492 -5.641  1.00 29.39 ? 340 TYR A OH  1 
ATOM   1996 N N   . GLN A 1 279 ? 6.147   -28.133 -7.048  1.00 29.94 ? 341 GLN A N   1 
ATOM   1997 C CA  . GLN A 1 279 ? 6.924   -27.703 -5.881  1.00 30.15 ? 341 GLN A CA  1 
ATOM   1998 C C   . GLN A 1 279 ? 7.535   -26.294 -6.047  1.00 29.49 ? 341 GLN A C   1 
ATOM   1999 O O   . GLN A 1 279 ? 7.634   -25.519 -5.075  1.00 30.07 ? 341 GLN A O   1 
ATOM   2000 C CB  . GLN A 1 279 ? 8.028   -28.725 -5.596  1.00 30.46 ? 341 GLN A CB  1 
ATOM   2001 C CG  . GLN A 1 279 ? 7.660   -29.755 -4.525  1.00 33.13 ? 341 GLN A CG  1 
ATOM   2002 C CD  . GLN A 1 279 ? 8.201   -31.168 -4.794  1.00 36.58 ? 341 GLN A CD  1 
ATOM   2003 O OE1 . GLN A 1 279 ? 9.092   -31.382 -5.646  1.00 36.78 ? 341 GLN A OE1 1 
ATOM   2004 N NE2 . GLN A 1 279 ? 7.659   -32.147 -4.055  1.00 35.63 ? 341 GLN A NE2 1 
ATOM   2005 N N   . PHE A 1 280 ? 7.919   -25.972 -7.280  1.00 28.02 ? 342 PHE A N   1 
ATOM   2006 C CA  . PHE A 1 280 ? 8.640   -24.751 -7.596  1.00 26.90 ? 342 PHE A CA  1 
ATOM   2007 C C   . PHE A 1 280 ? 7.657   -23.618 -7.599  1.00 26.84 ? 342 PHE A C   1 
ATOM   2008 O O   . PHE A 1 280 ? 8.000   -22.463 -7.309  1.00 26.47 ? 342 PHE A O   1 
ATOM   2009 C CB  . PHE A 1 280 ? 9.296   -24.869 -8.991  1.00 26.67 ? 342 PHE A CB  1 
ATOM   2010 C CG  . PHE A 1 280 ? 10.064  -23.640 -9.415  1.00 24.93 ? 342 PHE A CG  1 
ATOM   2011 C CD1 . PHE A 1 280 ? 11.327  -23.380 -8.898  1.00 23.41 ? 342 PHE A CD1 1 
ATOM   2012 C CD2 . PHE A 1 280 ? 9.502   -22.723 -10.302 1.00 24.41 ? 342 PHE A CD2 1 
ATOM   2013 C CE1 . PHE A 1 280 ? 12.028  -22.241 -9.269  1.00 23.64 ? 342 PHE A CE1 1 
ATOM   2014 C CE2 . PHE A 1 280 ? 10.195  -21.572 -10.683 1.00 23.30 ? 342 PHE A CE2 1 
ATOM   2015 C CZ  . PHE A 1 280 ? 11.456  -21.332 -10.174 1.00 24.24 ? 342 PHE A CZ  1 
ATOM   2016 N N   . LEU A 1 281 ? 6.426   -23.967 -7.956  1.00 26.53 ? 343 LEU A N   1 
ATOM   2017 C CA  . LEU A 1 281 ? 5.344   -23.027 -8.010  1.00 26.36 ? 343 LEU A CA  1 
ATOM   2018 C C   . LEU A 1 281 ? 5.076   -22.503 -6.602  1.00 26.52 ? 343 LEU A C   1 
ATOM   2019 O O   . LEU A 1 281 ? 4.950   -21.290 -6.399  1.00 26.93 ? 343 LEU A O   1 
ATOM   2020 C CB  . LEU A 1 281 ? 4.117   -23.728 -8.555  1.00 26.49 ? 343 LEU A CB  1 
ATOM   2021 C CG  . LEU A 1 281 ? 3.199   -23.010 -9.524  1.00 27.22 ? 343 LEU A CG  1 
ATOM   2022 C CD1 . LEU A 1 281 ? 1.865   -23.724 -9.463  1.00 27.46 ? 343 LEU A CD1 1 
ATOM   2023 C CD2 . LEU A 1 281 ? 3.040   -21.523 -9.202  1.00 28.47 ? 343 LEU A CD2 1 
ATOM   2024 N N   . HIS A 1 282 ? 4.999   -23.411 -5.628  1.00 26.28 ? 344 HIS A N   1 
ATOM   2025 C CA  . HIS A 1 282 ? 4.892   -23.010 -4.232  1.00 25.81 ? 344 HIS A CA  1 
ATOM   2026 C C   . HIS A 1 282 ? 6.045   -22.121 -3.868  1.00 25.42 ? 344 HIS A C   1 
ATOM   2027 O O   . HIS A 1 282 ? 5.845   -21.098 -3.217  1.00 25.57 ? 344 HIS A O   1 
ATOM   2028 C CB  . HIS A 1 282 ? 4.844   -24.224 -3.302  1.00 26.29 ? 344 HIS A CB  1 
ATOM   2029 C CG  . HIS A 1 282 ? 3.544   -24.962 -3.356  1.00 26.20 ? 344 HIS A CG  1 
ATOM   2030 N ND1 . HIS A 1 282 ? 3.159   -25.712 -4.449  1.00 26.86 ? 344 HIS A ND1 1 
ATOM   2031 C CD2 . HIS A 1 282 ? 2.539   -25.058 -2.460  1.00 25.08 ? 344 HIS A CD2 1 
ATOM   2032 C CE1 . HIS A 1 282 ? 1.968   -26.233 -4.223  1.00 26.40 ? 344 HIS A CE1 1 
ATOM   2033 N NE2 . HIS A 1 282 ? 1.570   -25.852 -3.023  1.00 26.61 ? 344 HIS A NE2 1 
ATOM   2034 N N   . HIS A 1 283 ? 7.249   -22.512 -4.282  1.00 24.85 ? 345 HIS A N   1 
ATOM   2035 C CA  . HIS A 1 283 ? 8.430   -21.698 -4.048  1.00 24.86 ? 345 HIS A CA  1 
ATOM   2036 C C   . HIS A 1 283 ? 8.309   -20.318 -4.708  1.00 24.95 ? 345 HIS A C   1 
ATOM   2037 O O   . HIS A 1 283 ? 8.488   -19.302 -4.045  1.00 24.86 ? 345 HIS A O   1 
ATOM   2038 C CB  . HIS A 1 283 ? 9.709   -22.403 -4.516  1.00 24.77 ? 345 HIS A CB  1 
ATOM   2039 C CG  . HIS A 1 283 ? 10.930  -21.541 -4.422  1.00 24.54 ? 345 HIS A CG  1 
ATOM   2040 N ND1 . HIS A 1 283 ? 11.545  -21.252 -3.223  1.00 24.24 ? 345 HIS A ND1 1 
ATOM   2041 C CD2 . HIS A 1 283 ? 11.630  -20.878 -5.376  1.00 25.53 ? 345 HIS A CD2 1 
ATOM   2042 C CE1 . HIS A 1 283 ? 12.578  -20.456 -3.444  1.00 26.30 ? 345 HIS A CE1 1 
ATOM   2043 N NE2 . HIS A 1 283 ? 12.651  -20.213 -4.742  1.00 25.21 ? 345 HIS A NE2 1 
ATOM   2044 N N   . THR A 1 284 ? 7.986   -20.282 -6.003  1.00 25.10 ? 346 THR A N   1 
ATOM   2045 C CA  . THR A 1 284 ? 7.876   -19.021 -6.727  1.00 25.20 ? 346 THR A CA  1 
ATOM   2046 C C   . THR A 1 284 ? 6.936   -18.088 -5.988  1.00 25.84 ? 346 THR A C   1 
ATOM   2047 O O   . THR A 1 284 ? 7.176   -16.878 -5.916  1.00 26.27 ? 346 THR A O   1 
ATOM   2048 C CB  . THR A 1 284 ? 7.374   -19.246 -8.156  1.00 25.29 ? 346 THR A CB  1 
ATOM   2049 O OG1 . THR A 1 284 ? 8.192   -20.239 -8.788  1.00 26.83 ? 346 THR A OG1 1 
ATOM   2050 C CG2 . THR A 1 284 ? 7.445   -17.980 -8.982  1.00 24.40 ? 346 THR A CG2 1 
ATOM   2051 N N   . LEU A 1 285 ? 5.879   -18.657 -5.406  1.00 26.22 ? 347 LEU A N   1 
ATOM   2052 C CA  . LEU A 1 285 ? 4.832   -17.863 -4.775  1.00 26.13 ? 347 LEU A CA  1 
ATOM   2053 C C   . LEU A 1 285 ? 5.149   -17.476 -3.329  1.00 26.42 ? 347 LEU A C   1 
ATOM   2054 O O   . LEU A 1 285 ? 4.697   -16.432 -2.857  1.00 26.84 ? 347 LEU A O   1 
ATOM   2055 C CB  . LEU A 1 285 ? 3.474   -18.556 -4.884  1.00 26.42 ? 347 LEU A CB  1 
ATOM   2056 C CG  . LEU A 1 285 ? 2.846   -18.684 -6.276  1.00 26.08 ? 347 LEU A CG  1 
ATOM   2057 C CD1 . LEU A 1 285 ? 1.628   -19.544 -6.180  1.00 26.33 ? 347 LEU A CD1 1 
ATOM   2058 C CD2 . LEU A 1 285 ? 2.486   -17.343 -6.873  1.00 24.37 ? 347 LEU A CD2 1 
ATOM   2059 N N   . ALA A 1 286 ? 5.934   -18.295 -2.634  1.00 25.92 ? 348 ALA A N   1 
ATOM   2060 C CA  . ALA A 1 286 ? 6.455   -17.902 -1.327  1.00 25.50 ? 348 ALA A CA  1 
ATOM   2061 C C   . ALA A 1 286 ? 7.346   -16.667 -1.463  1.00 25.29 ? 348 ALA A C   1 
ATOM   2062 O O   . ALA A 1 286 ? 7.355   -15.784 -0.577  1.00 25.35 ? 348 ALA A O   1 
ATOM   2063 C CB  . ALA A 1 286 ? 7.243   -19.039 -0.709  1.00 25.55 ? 348 ALA A CB  1 
ATOM   2064 N N   . LEU A 1 287 ? 8.111   -16.625 -2.560  1.00 24.75 ? 349 LEU A N   1 
ATOM   2065 C CA  . LEU A 1 287 ? 8.978   -15.488 -2.869  1.00 24.56 ? 349 LEU A CA  1 
ATOM   2066 C C   . LEU A 1 287 ? 8.127   -14.254 -3.209  1.00 24.68 ? 349 LEU A C   1 
ATOM   2067 O O   . LEU A 1 287 ? 8.431   -13.152 -2.778  1.00 23.97 ? 349 LEU A O   1 
ATOM   2068 C CB  . LEU A 1 287 ? 9.966   -15.834 -4.002  1.00 24.60 ? 349 LEU A CB  1 
ATOM   2069 C CG  . LEU A 1 287 ? 10.942  -14.785 -4.588  1.00 24.09 ? 349 LEU A CG  1 
ATOM   2070 C CD1 . LEU A 1 287 ? 11.971  -14.329 -3.585  1.00 22.32 ? 349 LEU A CD1 1 
ATOM   2071 C CD2 . LEU A 1 287 ? 11.628  -15.312 -5.856  1.00 24.02 ? 349 LEU A CD2 1 
ATOM   2072 N N   . TYR A 1 288 ? 7.042   -14.447 -3.955  1.00 25.14 ? 350 TYR A N   1 
ATOM   2073 C CA  . TYR A 1 288 ? 6.157   -13.323 -4.266  1.00 25.71 ? 350 TYR A CA  1 
ATOM   2074 C C   . TYR A 1 288 ? 5.563   -12.678 -3.004  1.00 25.77 ? 350 TYR A C   1 
ATOM   2075 O O   . TYR A 1 288 ? 5.491   -11.462 -2.900  1.00 26.06 ? 350 TYR A O   1 
ATOM   2076 C CB  . TYR A 1 288 ? 5.036   -13.754 -5.192  1.00 25.58 ? 350 TYR A CB  1 
ATOM   2077 C CG  . TYR A 1 288 ? 4.178   -12.605 -5.642  1.00 25.75 ? 350 TYR A CG  1 
ATOM   2078 C CD1 . TYR A 1 288 ? 4.603   -11.747 -6.655  1.00 26.14 ? 350 TYR A CD1 1 
ATOM   2079 C CD2 . TYR A 1 288 ? 2.934   -12.374 -5.059  1.00 25.79 ? 350 TYR A CD2 1 
ATOM   2080 C CE1 . TYR A 1 288 ? 3.801   -10.690 -7.076  1.00 26.28 ? 350 TYR A CE1 1 
ATOM   2081 C CE2 . TYR A 1 288 ? 2.139   -11.324 -5.458  1.00 25.87 ? 350 TYR A CE2 1 
ATOM   2082 C CZ  . TYR A 1 288 ? 2.572   -10.484 -6.466  1.00 26.42 ? 350 TYR A CZ  1 
ATOM   2083 O OH  . TYR A 1 288 ? 1.767   -9.439  -6.867  1.00 26.83 ? 350 TYR A OH  1 
ATOM   2084 N N   . ALA A 1 289 ? 5.127   -13.511 -2.074  1.00 25.79 ? 351 ALA A N   1 
ATOM   2085 C CA  . ALA A 1 289 ? 4.615   -13.074 -0.810  1.00 26.44 ? 351 ALA A CA  1 
ATOM   2086 C C   . ALA A 1 289 ? 5.669   -12.239 -0.109  1.00 27.28 ? 351 ALA A C   1 
ATOM   2087 O O   . ALA A 1 289 ? 5.419   -11.080 0.245   1.00 27.53 ? 351 ALA A O   1 
ATOM   2088 C CB  . ALA A 1 289 ? 4.247   -14.277 0.023   1.00 26.40 ? 351 ALA A CB  1 
ATOM   2089 N N   . GLY A 1 290 ? 6.862   -12.814 0.045   1.00 27.91 ? 352 GLY A N   1 
ATOM   2090 C CA  . GLY A 1 290 ? 7.938   -12.165 0.775   1.00 28.79 ? 352 GLY A CA  1 
ATOM   2091 C C   . GLY A 1 290 ? 8.369   -10.856 0.163   1.00 29.72 ? 352 GLY A C   1 
ATOM   2092 O O   . GLY A 1 290 ? 8.884   -9.988  0.858   1.00 30.19 ? 352 GLY A O   1 
ATOM   2093 N N   . GLN A 1 291 ? 8.149   -10.699 -1.135  1.00 30.66 ? 353 GLN A N   1 
ATOM   2094 C CA  . GLN A 1 291 ? 8.573   -9.492  -1.838  1.00 31.73 ? 353 GLN A CA  1 
ATOM   2095 C C   . GLN A 1 291 ? 7.474   -8.437  -2.060  1.00 32.54 ? 353 GLN A C   1 
ATOM   2096 O O   . GLN A 1 291 ? 7.764   -7.364  -2.575  1.00 32.59 ? 353 GLN A O   1 
ATOM   2097 C CB  . GLN A 1 291 ? 9.282   -9.838  -3.156  1.00 31.44 ? 353 GLN A CB  1 
ATOM   2098 N N   . LEU A 1 292 ? 6.234   -8.733  -1.667  1.00 33.92 ? 354 LEU A N   1 
ATOM   2099 C CA  . LEU A 1 292 ? 5.145   -7.732  -1.682  1.00 35.06 ? 354 LEU A CA  1 
ATOM   2100 C C   . LEU A 1 292 ? 5.500   -6.512  -0.818  1.00 36.23 ? 354 LEU A C   1 
ATOM   2101 O O   . LEU A 1 292 ? 6.049   -6.669  0.277   1.00 35.75 ? 354 LEU A O   1 
ATOM   2102 C CB  . LEU A 1 292 ? 3.815   -8.333  -1.197  1.00 34.75 ? 354 LEU A CB  1 
ATOM   2103 C CG  . LEU A 1 292 ? 3.013   -9.228  -2.146  1.00 34.56 ? 354 LEU A CG  1 
ATOM   2104 C CD1 . LEU A 1 292 ? 1.837   -9.896  -1.410  1.00 32.57 ? 354 LEU A CD1 1 
ATOM   2105 C CD2 . LEU A 1 292 ? 2.548   -8.453  -3.402  1.00 33.72 ? 354 LEU A CD2 1 
ATOM   2106 N N   . PRO A 1 293 ? 5.198   -5.292  -1.311  1.00 37.72 ? 355 PRO A N   1 
ATOM   2107 C CA  . PRO A 1 293 ? 5.607   -4.110  -0.543  1.00 38.95 ? 355 PRO A CA  1 
ATOM   2108 C C   . PRO A 1 293 ? 4.985   -4.128  0.842   1.00 40.05 ? 355 PRO A C   1 
ATOM   2109 O O   . PRO A 1 293 ? 3.784   -4.360  0.989   1.00 40.11 ? 355 PRO A O   1 
ATOM   2110 C CB  . PRO A 1 293 ? 5.074   -2.935  -1.376  1.00 38.92 ? 355 PRO A CB  1 
ATOM   2111 C CG  . PRO A 1 293 ? 4.938   -3.500  -2.782  1.00 38.52 ? 355 PRO A CG  1 
ATOM   2112 C CD  . PRO A 1 293 ? 4.495   -4.922  -2.558  1.00 37.94 ? 355 PRO A CD  1 
ATOM   2113 N N   . GLU A 1 294 ? 5.833   -3.956  1.848   1.00 41.54 ? 356 GLU A N   1 
ATOM   2114 C CA  . GLU A 1 294 ? 5.399   -3.830  3.226   1.00 42.92 ? 356 GLU A CA  1 
ATOM   2115 C C   . GLU A 1 294 ? 6.019   -2.542  3.772   1.00 44.07 ? 356 GLU A C   1 
ATOM   2116 O O   . GLU A 1 294 ? 6.458   -1.669  3.000   1.00 44.15 ? 356 GLU A O   1 
ATOM   2117 C CB  . GLU A 1 294 ? 5.821   -5.059  4.045   1.00 42.80 ? 356 GLU A CB  1 
ATOM   2118 N N   . GLU A 1 295 ? 6.024   -2.413  5.094   1.00 45.40 ? 357 GLU A N   1 
ATOM   2119 C CA  . GLU A 1 295 ? 6.760   -1.348  5.768   1.00 47.06 ? 357 GLU A CA  1 
ATOM   2120 C C   . GLU A 1 295 ? 7.605   -2.010  6.863   1.00 47.58 ? 357 GLU A C   1 
ATOM   2121 O O   . GLU A 1 295 ? 7.071   -2.764  7.686   1.00 47.72 ? 357 GLU A O   1 
ATOM   2122 C CB  . GLU A 1 295 ? 5.799   -0.291  6.342   1.00 46.93 ? 357 GLU A CB  1 
ATOM   2123 C CG  . GLU A 1 295 ? 6.473   0.980   6.871   1.00 47.68 ? 357 GLU A CG  1 
ATOM   2124 C CD  . GLU A 1 295 ? 5.508   2.165   7.022   1.00 48.25 ? 357 GLU A CD  1 
ATOM   2125 O OE1 . GLU A 1 295 ? 5.887   3.287   6.624   1.00 49.26 ? 357 GLU A OE1 1 
ATOM   2126 O OE2 . GLU A 1 295 ? 4.372   1.986   7.535   1.00 50.23 ? 357 GLU A OE2 1 
ATOM   2127 N N   . PRO A 1 296 ? 8.928   -1.750  6.858   1.00 48.17 ? 358 PRO A N   1 
ATOM   2128 C CA  . PRO A 1 296 ? 9.842   -2.301  7.874   1.00 48.56 ? 358 PRO A CA  1 
ATOM   2129 C C   . PRO A 1 296 ? 9.418   -1.994  9.319   1.00 48.92 ? 358 PRO A C   1 
ATOM   2130 O O   . PRO A 1 296 ? 8.798   -0.975  9.621   1.00 49.36 ? 358 PRO A O   1 
ATOM   2131 C CB  . PRO A 1 296 ? 11.185  -1.627  7.545   1.00 48.66 ? 358 PRO A CB  1 
ATOM   2132 C CG  . PRO A 1 296 ? 11.072  -1.244  6.081   1.00 48.49 ? 358 PRO A CG  1 
ATOM   2133 C CD  . PRO A 1 296 ? 9.630   -0.907  5.868   1.00 48.16 ? 358 PRO A CD  1 
ATOM   2134 O OXT . PRO A 1 296 ? 9.676   -2.760  10.249  1.00 49.36 ? 358 PRO A OXT 1 
HETATM 2135 P P   . PO4 B 2 .   ? 6.309   -28.199 -22.289 1.00 31.65 ? 501 PO4 A P   1 
HETATM 2136 O O1  . PO4 B 2 .   ? 6.739   -27.373 -23.481 1.00 31.62 ? 501 PO4 A O1  1 
HETATM 2137 O O2  . PO4 B 2 .   ? 4.821   -28.493 -22.377 1.00 29.43 ? 501 PO4 A O2  1 
HETATM 2138 O O3  . PO4 B 2 .   ? 7.058   -29.505 -22.229 1.00 29.97 ? 501 PO4 A O3  1 
HETATM 2139 O O4  . PO4 B 2 .   ? 6.600   -27.410 -21.020 1.00 30.93 ? 501 PO4 A O4  1 
HETATM 2140 P P   . PO4 C 2 .   ? 12.435  -25.667 -25.952 1.00 56.91 ? 502 PO4 A P   1 
HETATM 2141 O O1  . PO4 C 2 .   ? 13.081  -26.127 -27.245 1.00 56.42 ? 502 PO4 A O1  1 
HETATM 2142 O O2  . PO4 C 2 .   ? 11.865  -24.286 -26.196 1.00 56.60 ? 502 PO4 A O2  1 
HETATM 2143 O O3  . PO4 C 2 .   ? 11.335  -26.628 -25.551 1.00 57.56 ? 502 PO4 A O3  1 
HETATM 2144 O O4  . PO4 C 2 .   ? 13.437  -25.649 -24.818 1.00 56.19 ? 502 PO4 A O4  1 
HETATM 2145 P P   . PO4 D 2 .   ? 15.118  -17.047 -5.699  1.00 19.09 ? 503 PO4 A P   1 
HETATM 2146 O O1  . PO4 D 2 .   ? 16.482  -17.566 -5.294  1.00 21.73 ? 503 PO4 A O1  1 
HETATM 2147 O O2  . PO4 D 2 .   ? 15.184  -16.262 -6.979  1.00 18.85 ? 503 PO4 A O2  1 
HETATM 2148 O O3  . PO4 D 2 .   ? 14.205  -18.226 -5.833  1.00 22.47 ? 503 PO4 A O3  1 
HETATM 2149 O O4  . PO4 D 2 .   ? 14.644  -16.162 -4.587  1.00 20.67 ? 503 PO4 A O4  1 
HETATM 2150 P P   . PO4 E 2 .   ? 15.876  -12.747 -6.009  1.00 36.60 ? 504 PO4 A P   1 
HETATM 2151 O O1  . PO4 E 2 .   ? 16.635  -11.587 -6.572  1.00 36.71 ? 504 PO4 A O1  1 
HETATM 2152 O O2  . PO4 E 2 .   ? 14.506  -12.246 -5.621  1.00 36.42 ? 504 PO4 A O2  1 
HETATM 2153 O O3  . PO4 E 2 .   ? 15.791  -13.786 -7.108  1.00 36.68 ? 504 PO4 A O3  1 
HETATM 2154 O O4  . PO4 E 2 .   ? 16.549  -13.317 -4.787  1.00 35.55 ? 504 PO4 A O4  1 
HETATM 2155 O O   . HOH F 3 .   ? -3.052  -24.902 -2.760  1.00 11.92 ? 1   HOH A O   1 
HETATM 2156 O O   . HOH F 3 .   ? 8.442   -15.399 1.681   1.00 39.55 ? 2   HOH A O   1 
HETATM 2157 O O   . HOH F 3 .   ? 9.113   -15.862 5.542   1.00 17.57 ? 3   HOH A O   1 
HETATM 2158 O O   . HOH F 3 .   ? 0.595   -24.058 -33.946 1.00 29.20 ? 4   HOH A O   1 
HETATM 2159 O O   . HOH F 3 .   ? 8.874   -25.158 -30.133 1.00 27.60 ? 5   HOH A O   1 
HETATM 2160 O O   . HOH F 3 .   ? -6.118  -11.085 -21.081 1.00 19.21 ? 6   HOH A O   1 
HETATM 2161 O O   . HOH F 3 .   ? 7.677   -22.270 -27.977 1.00 31.49 ? 7   HOH A O   1 
HETATM 2162 O O   . HOH F 3 .   ? 8.458   -21.484 -31.220 1.00 34.00 ? 8   HOH A O   1 
HETATM 2163 O O   . HOH F 3 .   ? 0.126   -21.296 -41.424 1.00 21.58 ? 9   HOH A O   1 
HETATM 2164 O O   . HOH F 3 .   ? -2.853  -9.732  -24.850 1.00 23.77 ? 10  HOH A O   1 
HETATM 2165 O O   . HOH F 3 .   ? 11.044  -10.949 -27.689 1.00 30.15 ? 11  HOH A O   1 
HETATM 2166 O O   . HOH F 3 .   ? 16.815  -12.749 -27.585 1.00 19.89 ? 12  HOH A O   1 
HETATM 2167 O O   . HOH F 3 .   ? 0.846   1.374   -33.797 1.00 42.65 ? 13  HOH A O   1 
HETATM 2168 O O   . HOH F 3 .   ? 7.631   -28.683 -19.298 1.00 20.72 ? 14  HOH A O   1 
HETATM 2169 O O   . HOH F 3 .   ? 10.744  -33.590 -24.978 1.00 28.79 ? 15  HOH A O   1 
HETATM 2170 O O   . HOH F 3 .   ? -7.864  -15.309 2.940   1.00 24.03 ? 16  HOH A O   1 
HETATM 2171 O O   . HOH F 3 .   ? 11.980  -24.419 -28.848 1.00 30.15 ? 17  HOH A O   1 
HETATM 2172 O O   . HOH F 3 .   ? -19.720 -31.000 -11.437 1.00 31.89 ? 18  HOH A O   1 
HETATM 2173 O O   . HOH F 3 .   ? 8.893   -34.283 1.999   1.00 24.16 ? 19  HOH A O   1 
HETATM 2174 O O   . HOH F 3 .   ? 15.468  -10.268 -14.770 1.00 26.71 ? 20  HOH A O   1 
HETATM 2175 O O   . HOH F 3 .   ? 15.258  -27.814 -23.380 1.00 35.21 ? 21  HOH A O   1 
HETATM 2176 O O   . HOH F 3 .   ? -1.520  -15.135 6.473   1.00 26.90 ? 22  HOH A O   1 
HETATM 2177 O O   . HOH F 3 .   ? -15.734 -13.895 -17.537 1.00 25.83 ? 23  HOH A O   1 
HETATM 2178 O O   . HOH F 3 .   ? -8.814  -21.635 -9.404  1.00 23.06 ? 24  HOH A O   1 
HETATM 2179 O O   . HOH F 3 .   ? -11.720 -19.131 -21.063 1.00 24.03 ? 25  HOH A O   1 
HETATM 2180 O O   . HOH F 3 .   ? -2.501  -0.851  -31.550 1.00 26.61 ? 26  HOH A O   1 
HETATM 2181 O O   . HOH F 3 .   ? 11.416  -27.968 -7.205  1.00 24.30 ? 27  HOH A O   1 
HETATM 2182 O O   . HOH F 3 .   ? -1.154  -4.239  -23.666 1.00 32.64 ? 28  HOH A O   1 
HETATM 2183 O O   . HOH F 3 .   ? -6.529  -11.548 -15.059 1.00 29.67 ? 29  HOH A O   1 
HETATM 2184 O O   . HOH F 3 .   ? -1.321  -38.899 -4.539  1.00 29.12 ? 30  HOH A O   1 
HETATM 2185 O O   . HOH F 3 .   ? 0.690   -2.397  -23.474 1.00 35.86 ? 31  HOH A O   1 
HETATM 2186 O O   . HOH F 3 .   ? 3.063   -6.819  3.457   1.00 28.00 ? 32  HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   SER 1   63  ?   ?   ?   A . n 
A 1 2   MET 2   64  ?   ?   ?   A . n 
A 1 3   ASN 3   65  65  ASN ASN A . n 
A 1 4   THR 4   66  66  THR THR A . n 
A 1 5   PRO 5   67  67  PRO PRO A . n 
A 1 6   ARG 6   68  68  ARG ARG A . n 
A 1 7   GLU 7   69  69  GLU GLU A . n 
A 1 8   VAL 8   70  70  VAL VAL A . n 
A 1 9   THR 9   71  71  THR THR A . n 
A 1 10  LEU 10  72  72  LEU LEU A . n 
A 1 11  HIS 11  73  73  HIS HIS A . n 
A 1 12  PHE 12  74  74  PHE PHE A . n 
A 1 13  LEU 13  75  75  LEU LEU A . n 
A 1 14  ARG 14  76  76  ARG ARG A . n 
A 1 15  THR 15  77  77  THR THR A . n 
A 1 16  ALA 16  78  78  ALA ALA A . n 
A 1 17  GLY 17  79  79  GLY GLY A . n 
A 1 18  HIS 18  80  80  HIS HIS A . n 
A 1 19  PRO 19  81  81  PRO PRO A . n 
A 1 20  LEU 20  82  82  LEU LEU A . n 
A 1 21  THR 21  83  83  THR THR A . n 
A 1 22  ARG 22  84  84  ARG ARG A . n 
A 1 23  TRP 23  85  85  TRP TRP A . n 
A 1 24  ALA 24  86  86  ALA ALA A . n 
A 1 25  LEU 25  87  87  LEU LEU A . n 
A 1 26  GLN 26  88  88  GLN GLN A . n 
A 1 27  ARG 27  89  89  ARG ARG A . n 
A 1 28  GLN 28  90  90  GLN GLN A . n 
A 1 29  PRO 29  91  91  PRO PRO A . n 
A 1 30  PRO 30  92  92  PRO PRO A . n 
A 1 31  SER 31  93  93  SER SER A . n 
A 1 32  PRO 32  94  94  PRO PRO A . n 
A 1 33  LYS 33  95  95  LYS LYS A . n 
A 1 34  GLN 34  96  96  GLN GLN A . n 
A 1 35  LEU 35  97  97  LEU LEU A . n 
A 1 36  GLU 36  98  98  GLU GLU A . n 
A 1 37  GLU 37  99  99  GLU GLU A . n 
A 1 38  GLU 38  100 100 GLU GLU A . n 
A 1 39  PHE 39  101 101 PHE PHE A . n 
A 1 40  LEU 40  102 102 LEU LEU A . n 
A 1 41  LYS 41  103 103 LYS LYS A . n 
A 1 42  ILE 42  104 104 ILE ILE A . n 
A 1 43  PRO 43  105 105 PRO PRO A . n 
A 1 44  SER 44  106 106 SER SER A . n 
A 1 45  ASN 45  107 107 ASN ASN A . n 
A 1 46  PHE 46  108 108 PHE PHE A . n 
A 1 47  VAL 47  109 109 VAL VAL A . n 
A 1 48  SER 48  110 110 SER SER A . n 
A 1 49  PRO 49  111 111 PRO PRO A . n 
A 1 50  GLU 50  112 112 GLU GLU A . n 
A 1 51  ASP 51  113 113 ASP ASP A . n 
A 1 52  LEU 52  114 114 LEU LEU A . n 
A 1 53  ASP 53  115 115 ASP ASP A . n 
A 1 54  ILE 54  116 116 ILE ILE A . n 
A 1 55  PRO 55  117 117 PRO PRO A . n 
A 1 56  GLY 56  118 118 GLY GLY A . n 
A 1 57  HIS 57  119 119 HIS HIS A . n 
A 1 58  ALA 58  120 120 ALA ALA A . n 
A 1 59  SER 59  121 121 SER SER A . n 
A 1 60  LYS 60  122 122 LYS LYS A . n 
A 1 61  ASP 61  123 123 ASP ASP A . n 
A 1 62  ARG 62  124 124 ARG ARG A . n 
A 1 63  TYR 63  125 125 TYR TYR A . n 
A 1 64  LYS 64  126 126 LYS LYS A . n 
A 1 65  THR 65  127 127 THR THR A . n 
A 1 66  ILE 66  128 128 ILE ILE A . n 
A 1 67  LEU 67  129 129 LEU LEU A . n 
A 1 68  PRO 68  130 130 PRO PRO A . n 
A 1 69  ASN 69  131 131 ASN ASN A . n 
A 1 70  PRO 70  132 132 PRO PRO A . n 
A 1 71  GLN 71  133 133 GLN GLN A . n 
A 1 72  SER 72  134 134 SER SER A . n 
A 1 73  ARG 73  135 135 ARG ARG A . n 
A 1 74  VAL 74  136 136 VAL VAL A . n 
A 1 75  CYS 75  137 137 CYS CYS A . n 
A 1 76  LEU 76  138 138 LEU LEU A . n 
A 1 77  GLY 77  139 139 GLY GLY A . n 
A 1 78  ARG 78  140 ?   ?   ?   A . n 
A 1 79  ALA 79  141 ?   ?   ?   A . n 
A 1 80  GLN 80  142 ?   ?   ?   A . n 
A 1 81  SER 81  143 ?   ?   ?   A . n 
A 1 82  GLN 82  144 ?   ?   ?   A . n 
A 1 83  GLU 83  145 ?   ?   ?   A . n 
A 1 84  ASP 84  146 ?   ?   ?   A . n 
A 1 85  GLY 85  147 ?   ?   ?   A . n 
A 1 86  ASP 86  148 148 ASP ASP A . n 
A 1 87  TYR 87  149 149 TYR TYR A . n 
A 1 88  ILE 88  150 150 ILE ILE A . n 
A 1 89  ASN 89  151 151 ASN ASN A . n 
A 1 90  ALA 90  152 152 ALA ALA A . n 
A 1 91  ASN 91  153 153 ASN ASN A . n 
A 1 92  TYR 92  154 154 TYR TYR A . n 
A 1 93  ILE 93  155 155 ILE ILE A . n 
A 1 94  ARG 94  156 156 ARG ARG A . n 
A 1 95  GLY 95  157 157 GLY GLY A . n 
A 1 96  TYR 96  158 158 TYR TYR A . n 
A 1 97  ASP 97  159 159 ASP ASP A . n 
A 1 98  GLY 98  160 160 GLY GLY A . n 
A 1 99  LYS 99  161 161 LYS LYS A . n 
A 1 100 GLU 100 162 162 GLU GLU A . n 
A 1 101 LYS 101 163 163 LYS LYS A . n 
A 1 102 VAL 102 164 164 VAL VAL A . n 
A 1 103 TYR 103 165 165 TYR TYR A . n 
A 1 104 ILE 104 166 166 ILE ILE A . n 
A 1 105 ALA 105 167 167 ALA ALA A . n 
A 1 106 THR 106 168 168 THR THR A . n 
A 1 107 GLN 107 169 169 GLN GLN A . n 
A 1 108 GLY 108 170 170 GLY GLY A . n 
A 1 109 PRO 109 171 171 PRO PRO A . n 
A 1 110 MET 110 172 172 MET MET A . n 
A 1 111 PRO 111 173 173 PRO PRO A . n 
A 1 112 ASN 112 174 174 ASN ASN A . n 
A 1 113 THR 113 175 175 THR THR A . n 
A 1 114 VAL 114 176 176 VAL VAL A . n 
A 1 115 SER 115 177 177 SER SER A . n 
A 1 116 ASP 116 178 178 ASP ASP A . n 
A 1 117 PHE 117 179 179 PHE PHE A . n 
A 1 118 TRP 118 180 180 TRP TRP A . n 
A 1 119 GLU 119 181 181 GLU GLU A . n 
A 1 120 MET 120 182 182 MET MET A . n 
A 1 121 VAL 121 183 183 VAL VAL A . n 
A 1 122 TRP 122 184 184 TRP TRP A . n 
A 1 123 GLN 123 185 185 GLN GLN A . n 
A 1 124 GLU 124 186 186 GLU GLU A . n 
A 1 125 GLU 125 187 187 GLU GLU A . n 
A 1 126 VAL 126 188 188 VAL VAL A . n 
A 1 127 SER 127 189 189 SER SER A . n 
A 1 128 LEU 128 190 190 LEU LEU A . n 
A 1 129 ILE 129 191 191 ILE ILE A . n 
A 1 130 VAL 130 192 192 VAL VAL A . n 
A 1 131 MET 131 193 193 MET MET A . n 
A 1 132 LEU 132 194 194 LEU LEU A . n 
A 1 133 THR 133 195 195 THR THR A . n 
A 1 134 GLN 134 196 196 GLN GLN A . n 
A 1 135 LEU 135 197 197 LEU LEU A . n 
A 1 136 ARG 136 198 198 ARG ARG A . n 
A 1 137 GLU 137 199 ?   ?   ?   A . n 
A 1 138 GLY 138 200 ?   ?   ?   A . n 
A 1 139 LYS 139 201 ?   ?   ?   A . n 
A 1 140 GLU 140 202 ?   ?   ?   A . n 
A 1 141 LYS 141 203 ?   ?   ?   A . n 
A 1 142 CYS 142 204 ?   ?   ?   A . n 
A 1 143 VAL 143 205 205 VAL VAL A . n 
A 1 144 HIS 144 206 206 HIS HIS A . n 
A 1 145 TYR 145 207 207 TYR TYR A . n 
A 1 146 TRP 146 208 208 TRP TRP A . n 
A 1 147 PRO 147 209 209 PRO PRO A . n 
A 1 148 THR 148 210 210 THR THR A . n 
A 1 149 GLU 149 211 211 GLU GLU A . n 
A 1 150 GLU 150 212 212 GLU GLU A . n 
A 1 151 GLU 151 213 213 GLU GLU A . n 
A 1 152 THR 152 214 214 THR THR A . n 
A 1 153 TYR 153 215 215 TYR TYR A . n 
A 1 154 GLY 154 216 216 GLY GLY A . n 
A 1 155 PRO 155 217 217 PRO PRO A . n 
A 1 156 PHE 156 218 218 PHE PHE A . n 
A 1 157 GLN 157 219 219 GLN GLN A . n 
A 1 158 ILE 158 220 220 ILE ILE A . n 
A 1 159 ARG 159 221 221 ARG ARG A . n 
A 1 160 ILE 160 222 222 ILE ILE A . n 
A 1 161 GLN 161 223 223 GLN GLN A . n 
A 1 162 ASP 162 224 224 ASP ASP A . n 
A 1 163 MET 163 225 225 MET MET A . n 
A 1 164 LYS 164 226 226 LYS LYS A . n 
A 1 165 GLU 165 227 227 GLU GLU A . n 
A 1 166 CYS 166 228 228 CYS CYS A . n 
A 1 167 PRO 167 229 229 PRO PRO A . n 
A 1 168 GLU 168 230 230 GLU GLU A . n 
A 1 169 TYR 169 231 231 TYR TYR A . n 
A 1 170 THR 170 232 232 THR THR A . n 
A 1 171 VAL 171 233 233 VAL VAL A . n 
A 1 172 ARG 172 234 234 ARG ARG A . n 
A 1 173 GLN 173 235 235 GLN GLN A . n 
A 1 174 LEU 174 236 236 LEU LEU A . n 
A 1 175 THR 175 237 237 THR THR A . n 
A 1 176 ILE 176 238 238 ILE ILE A . n 
A 1 177 GLN 177 239 239 GLN GLN A . n 
A 1 178 TYR 178 240 240 TYR TYR A . n 
A 1 179 GLN 179 241 241 GLN GLN A . n 
A 1 180 GLU 180 242 242 GLU GLU A . n 
A 1 181 GLU 181 243 243 GLU GLU A . n 
A 1 182 ARG 182 244 244 ARG ARG A . n 
A 1 183 ARG 183 245 245 ARG ARG A . n 
A 1 184 SER 184 246 246 SER SER A . n 
A 1 185 VAL 185 247 247 VAL VAL A . n 
A 1 186 LYS 186 248 248 LYS LYS A . n 
A 1 187 HIS 187 249 249 HIS HIS A . n 
A 1 188 ILE 188 250 250 ILE ILE A . n 
A 1 189 LEU 189 251 251 LEU LEU A . n 
A 1 190 PHE 190 252 252 PHE PHE A . n 
A 1 191 SER 191 253 253 SER SER A . n 
A 1 192 ALA 192 254 254 ALA ALA A . n 
A 1 193 TRP 193 255 255 TRP TRP A . n 
A 1 194 PRO 194 256 256 PRO PRO A . n 
A 1 195 ASP 195 257 257 ASP ASP A . n 
A 1 196 HIS 196 258 258 HIS HIS A . n 
A 1 197 GLN 197 259 259 GLN GLN A . n 
A 1 198 THR 198 260 260 THR THR A . n 
A 1 199 PRO 199 261 261 PRO PRO A . n 
A 1 200 GLU 200 262 262 GLU GLU A . n 
A 1 201 SER 201 263 263 SER SER A . n 
A 1 202 ALA 202 264 264 ALA ALA A . n 
A 1 203 GLY 203 265 265 GLY GLY A . n 
A 1 204 PRO 204 266 266 PRO PRO A . n 
A 1 205 LEU 205 267 267 LEU LEU A . n 
A 1 206 LEU 206 268 268 LEU LEU A . n 
A 1 207 ARG 207 269 269 ARG ARG A . n 
A 1 208 LEU 208 270 270 LEU LEU A . n 
A 1 209 VAL 209 271 271 VAL VAL A . n 
A 1 210 ALA 210 272 272 ALA ALA A . n 
A 1 211 GLU 211 273 273 GLU GLU A . n 
A 1 212 VAL 212 274 274 VAL VAL A . n 
A 1 213 GLU 213 275 275 GLU GLU A . n 
A 1 214 GLU 214 276 276 GLU GLU A . n 
A 1 215 SER 215 277 ?   ?   ?   A . n 
A 1 216 PRO 216 278 ?   ?   ?   A . n 
A 1 217 GLU 217 279 ?   ?   ?   A . n 
A 1 218 THR 218 280 ?   ?   ?   A . n 
A 1 219 ALA 219 281 ?   ?   ?   A . n 
A 1 220 ALA 220 282 ?   ?   ?   A . n 
A 1 221 HIS 221 283 ?   ?   ?   A . n 
A 1 222 PRO 222 284 ?   ?   ?   A . n 
A 1 223 GLY 223 285 285 GLY GLY A . n 
A 1 224 PRO 224 286 286 PRO PRO A . n 
A 1 225 ILE 225 287 287 ILE ILE A . n 
A 1 226 VAL 226 288 288 VAL VAL A . n 
A 1 227 VAL 227 289 289 VAL VAL A . n 
A 1 228 HIS 228 290 290 HIS HIS A . n 
A 1 229 CYS 229 291 291 CYS CYS A . n 
A 1 230 SER 230 292 292 SER SER A . n 
A 1 231 ALA 231 293 293 ALA ALA A . n 
A 1 232 GLY 232 294 294 GLY GLY A . n 
A 1 233 ILE 233 295 295 ILE ILE A . n 
A 1 234 GLY 234 296 296 GLY GLY A . n 
A 1 235 ARG 235 297 297 ARG ARG A . n 
A 1 236 THR 236 298 298 THR THR A . n 
A 1 237 GLY 237 299 299 GLY GLY A . n 
A 1 238 CYS 238 300 300 CYS CYS A . n 
A 1 239 PHE 239 301 301 PHE PHE A . n 
A 1 240 ILE 240 302 302 ILE ILE A . n 
A 1 241 ALA 241 303 303 ALA ALA A . n 
A 1 242 THR 242 304 304 THR THR A . n 
A 1 243 ARG 243 305 305 ARG ARG A . n 
A 1 244 ILE 244 306 306 ILE ILE A . n 
A 1 245 GLY 245 307 307 GLY GLY A . n 
A 1 246 CYS 246 308 308 CYS CYS A . n 
A 1 247 GLN 247 309 309 GLN GLN A . n 
A 1 248 GLN 248 310 310 GLN GLN A . n 
A 1 249 LEU 249 311 311 LEU LEU A . n 
A 1 250 LYS 250 312 312 LYS LYS A . n 
A 1 251 ALA 251 313 313 ALA ALA A . n 
A 1 252 ARG 252 314 314 ARG ARG A . n 
A 1 253 GLY 253 315 315 GLY GLY A . n 
A 1 254 GLU 254 316 316 GLU GLU A . n 
A 1 255 VAL 255 317 317 VAL VAL A . n 
A 1 256 ASP 256 318 318 ASP ASP A . n 
A 1 257 ILE 257 319 319 ILE ILE A . n 
A 1 258 LEU 258 320 320 LEU LEU A . n 
A 1 259 GLY 259 321 321 GLY GLY A . n 
A 1 260 ILE 260 322 322 ILE ILE A . n 
A 1 261 VAL 261 323 323 VAL VAL A . n 
A 1 262 CYS 262 324 324 CYS CYS A . n 
A 1 263 GLN 263 325 325 GLN GLN A . n 
A 1 264 LEU 264 326 326 LEU LEU A . n 
A 1 265 ARG 265 327 327 ARG ARG A . n 
A 1 266 LEU 266 328 328 LEU LEU A . n 
A 1 267 ASP 267 329 329 ASP ASP A . n 
A 1 268 ARG 268 330 330 ARG ARG A . n 
A 1 269 GLY 269 331 331 GLY GLY A . n 
A 1 270 GLY 270 332 332 GLY GLY A . n 
A 1 271 MET 271 333 333 MET MET A . n 
A 1 272 ILE 272 334 334 ILE ILE A . n 
A 1 273 GLN 273 335 335 GLN GLN A . n 
A 1 274 THR 274 336 336 THR THR A . n 
A 1 275 ALA 275 337 337 ALA ALA A . n 
A 1 276 GLU 276 338 338 GLU GLU A . n 
A 1 277 GLN 277 339 339 GLN GLN A . n 
A 1 278 TYR 278 340 340 TYR TYR A . n 
A 1 279 GLN 279 341 341 GLN GLN A . n 
A 1 280 PHE 280 342 342 PHE PHE A . n 
A 1 281 LEU 281 343 343 LEU LEU A . n 
A 1 282 HIS 282 344 344 HIS HIS A . n 
A 1 283 HIS 283 345 345 HIS HIS A . n 
A 1 284 THR 284 346 346 THR THR A . n 
A 1 285 LEU 285 347 347 LEU LEU A . n 
A 1 286 ALA 286 348 348 ALA ALA A . n 
A 1 287 LEU 287 349 349 LEU LEU A . n 
A 1 288 TYR 288 350 350 TYR TYR A . n 
A 1 289 ALA 289 351 351 ALA ALA A . n 
A 1 290 GLY 290 352 352 GLY GLY A . n 
A 1 291 GLN 291 353 353 GLN GLN A . n 
A 1 292 LEU 292 354 354 LEU LEU A . n 
A 1 293 PRO 293 355 355 PRO PRO A . n 
A 1 294 GLU 294 356 356 GLU GLU A . n 
A 1 295 GLU 295 357 357 GLU GLU A . n 
A 1 296 PRO 296 358 358 PRO PRO A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 PO4 1  501 1  PO4 PO4 A . 
C 2 PO4 1  502 2  PO4 PO4 A . 
D 2 PO4 1  503 3  PO4 PO4 A . 
E 2 PO4 1  504 4  PO4 PO4 A . 
F 3 HOH 1  1   1  HOH HOH A . 
F 3 HOH 2  2   2  HOH HOH A . 
F 3 HOH 3  3   3  HOH HOH A . 
F 3 HOH 4  4   4  HOH HOH A . 
F 3 HOH 5  5   5  HOH HOH A . 
F 3 HOH 6  6   6  HOH HOH A . 
F 3 HOH 7  7   7  HOH HOH A . 
F 3 HOH 8  8   8  HOH HOH A . 
F 3 HOH 9  9   9  HOH HOH A . 
F 3 HOH 10 10  10 HOH HOH A . 
F 3 HOH 11 11  11 HOH HOH A . 
F 3 HOH 12 12  12 HOH HOH A . 
F 3 HOH 13 13  13 HOH HOH A . 
F 3 HOH 14 14  14 HOH HOH A . 
F 3 HOH 15 15  15 HOH HOH A . 
F 3 HOH 16 16  16 HOH HOH A . 
F 3 HOH 17 17  17 HOH HOH A . 
F 3 HOH 18 18  18 HOH HOH A . 
F 3 HOH 19 19  19 HOH HOH A . 
F 3 HOH 20 20  20 HOH HOH A . 
F 3 HOH 21 21  21 HOH HOH A . 
F 3 HOH 22 22  22 HOH HOH A . 
F 3 HOH 23 23  23 HOH HOH A . 
F 3 HOH 24 24  24 HOH HOH A . 
F 3 HOH 25 25  25 HOH HOH A . 
F 3 HOH 26 26  26 HOH HOH A . 
F 3 HOH 27 27  27 HOH HOH A . 
F 3 HOH 28 28  28 HOH HOH A . 
F 3 HOH 29 29  29 HOH HOH A . 
F 3 HOH 30 30  30 HOH HOH A . 
F 3 HOH 31 31  31 HOH HOH A . 
F 3 HOH 32 32  32 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-07-19 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         0.5937 
_pdbx_refine_tls.origin_y         -20.2486 
_pdbx_refine_tls.origin_z         -20.5802 
_pdbx_refine_tls.T[1][1]          -0.0627 
_pdbx_refine_tls.T[2][2]          -0.0602 
_pdbx_refine_tls.T[3][3]          -0.0330 
_pdbx_refine_tls.T[1][2]          0.0142 
_pdbx_refine_tls.T[1][3]          -0.0120 
_pdbx_refine_tls.T[2][3]          -0.0121 
_pdbx_refine_tls.L[1][1]          0.9888 
_pdbx_refine_tls.L[2][2]          1.1878 
_pdbx_refine_tls.L[3][3]          2.5728 
_pdbx_refine_tls.L[1][2]          0.2251 
_pdbx_refine_tls.L[1][3]          -0.4369 
_pdbx_refine_tls.L[2][3]          -1.0577 
_pdbx_refine_tls.S[1][1]          -0.0333 
_pdbx_refine_tls.S[1][2]          0.1676 
_pdbx_refine_tls.S[1][3]          0.0885 
_pdbx_refine_tls.S[2][1]          -0.2605 
_pdbx_refine_tls.S[2][2]          0.0314 
_pdbx_refine_tls.S[2][3]          0.0195 
_pdbx_refine_tls.S[3][1]          0.1906 
_pdbx_refine_tls.S[3][2]          0.0944 
_pdbx_refine_tls.S[3][3]          0.0019 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    A 
_pdbx_refine_tls_group.beg_auth_seq_id     65 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    3 
_pdbx_refine_tls_group.end_auth_asym_id    A 
_pdbx_refine_tls_group.end_auth_seq_id     356 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    294 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
REFMAC    refinement       5.2.0005 ? 1 
HKL-2000  'data reduction' .        ? 2 
SCALEPACK 'data scaling'   .        ? 3 
PHASER    phasing          .        ? 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLN A 90  ? ? -159.04 61.00   
2  1 ASP A 115 ? ? 37.07   70.01   
3  1 ASP A 159 ? ? 57.22   11.73   
4  1 GLU A 211 ? ? -126.59 -65.74  
5  1 GLU A 230 ? ? 94.13   -27.83  
6  1 GLN A 241 ? ? 52.20   -109.01 
7  1 GLU A 275 ? ? -96.27  49.94   
8  1 ILE A 295 ? ? -135.05 -48.56  
9  1 ILE A 334 ? ? 69.78   109.73  
10 1 GLU A 356 ? ? -126.72 -163.73 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ARG 68  ? CD  ? A ARG 6   CD  
2  1 Y 1 A ARG 68  ? NE  ? A ARG 6   NE  
3  1 Y 1 A ARG 68  ? CZ  ? A ARG 6   CZ  
4  1 Y 1 A ARG 68  ? NH1 ? A ARG 6   NH1 
5  1 Y 1 A ARG 68  ? NH2 ? A ARG 6   NH2 
6  1 Y 1 A LYS 95  ? CD  ? A LYS 33  CD  
7  1 Y 1 A LYS 95  ? CE  ? A LYS 33  CE  
8  1 Y 1 A LYS 95  ? NZ  ? A LYS 33  NZ  
9  1 Y 1 A LYS 103 ? CE  ? A LYS 41  CE  
10 1 Y 1 A LYS 103 ? NZ  ? A LYS 41  NZ  
11 1 Y 1 A ASP 113 ? CB  ? A ASP 51  CB  
12 1 Y 1 A ASP 113 ? CG  ? A ASP 51  CG  
13 1 Y 1 A ASP 113 ? OD1 ? A ASP 51  OD1 
14 1 Y 1 A ASP 113 ? OD2 ? A ASP 51  OD2 
15 1 Y 1 A ASP 115 ? CG  ? A ASP 53  CG  
16 1 Y 1 A ASP 115 ? OD1 ? A ASP 53  OD1 
17 1 Y 1 A ASP 115 ? OD2 ? A ASP 53  OD2 
18 1 Y 1 A LYS 122 ? CE  ? A LYS 60  CE  
19 1 Y 1 A LYS 122 ? NZ  ? A LYS 60  NZ  
20 1 Y 1 A LYS 126 ? CD  ? A LYS 64  CD  
21 1 Y 1 A LYS 126 ? CE  ? A LYS 64  CE  
22 1 Y 1 A LYS 126 ? NZ  ? A LYS 64  NZ  
23 1 Y 1 A GLN 133 ? CG  ? A GLN 71  CG  
24 1 Y 1 A GLN 133 ? CD  ? A GLN 71  CD  
25 1 Y 1 A GLN 133 ? OE1 ? A GLN 71  OE1 
26 1 Y 1 A GLN 133 ? NE2 ? A GLN 71  NE2 
27 1 Y 1 A LEU 197 ? CG  ? A LEU 135 CG  
28 1 Y 1 A LEU 197 ? CD1 ? A LEU 135 CD1 
29 1 Y 1 A LEU 197 ? CD2 ? A LEU 135 CD2 
30 1 Y 1 A ARG 198 ? CG  ? A ARG 136 CG  
31 1 Y 1 A ARG 198 ? CD  ? A ARG 136 CD  
32 1 Y 1 A ARG 198 ? NE  ? A ARG 136 NE  
33 1 Y 1 A ARG 198 ? CZ  ? A ARG 136 CZ  
34 1 Y 1 A ARG 198 ? NH1 ? A ARG 136 NH1 
35 1 Y 1 A ARG 198 ? NH2 ? A ARG 136 NH2 
36 1 Y 1 A LYS 226 ? CG  ? A LYS 164 CG  
37 1 Y 1 A LYS 226 ? CD  ? A LYS 164 CD  
38 1 Y 1 A LYS 226 ? CE  ? A LYS 164 CE  
39 1 Y 1 A LYS 226 ? NZ  ? A LYS 164 NZ  
40 1 Y 1 A GLU 227 ? CD  ? A GLU 165 CD  
41 1 Y 1 A GLU 227 ? OE1 ? A GLU 165 OE1 
42 1 Y 1 A GLU 227 ? OE2 ? A GLU 165 OE2 
43 1 Y 1 A GLU 230 ? CG  ? A GLU 168 CG  
44 1 Y 1 A GLU 230 ? CD  ? A GLU 168 CD  
45 1 Y 1 A GLU 230 ? OE1 ? A GLU 168 OE1 
46 1 Y 1 A GLU 230 ? OE2 ? A GLU 168 OE2 
47 1 Y 1 A ARG 269 ? NE  ? A ARG 207 NE  
48 1 Y 1 A ARG 269 ? CZ  ? A ARG 207 CZ  
49 1 Y 1 A ARG 269 ? NH1 ? A ARG 207 NH1 
50 1 Y 1 A ARG 269 ? NH2 ? A ARG 207 NH2 
51 1 Y 1 A GLU 275 ? CD  ? A GLU 213 CD  
52 1 Y 1 A GLU 275 ? OE1 ? A GLU 213 OE1 
53 1 Y 1 A GLU 275 ? OE2 ? A GLU 213 OE2 
54 1 Y 1 A LYS 312 ? CE  ? A LYS 250 CE  
55 1 Y 1 A LYS 312 ? NZ  ? A LYS 250 NZ  
56 1 Y 1 A GLN 353 ? CG  ? A GLN 291 CG  
57 1 Y 1 A GLN 353 ? CD  ? A GLN 291 CD  
58 1 Y 1 A GLN 353 ? OE1 ? A GLN 291 OE1 
59 1 Y 1 A GLN 353 ? NE2 ? A GLN 291 NE2 
60 1 Y 1 A GLU 356 ? CG  ? A GLU 294 CG  
61 1 Y 1 A GLU 356 ? CD  ? A GLU 294 CD  
62 1 Y 1 A GLU 356 ? OE1 ? A GLU 294 OE1 
63 1 Y 1 A GLU 356 ? OE2 ? A GLU 294 OE2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A SER 63  ? A SER 1   
2  1 Y 1 A MET 64  ? A MET 2   
3  1 Y 1 A ARG 140 ? A ARG 78  
4  1 Y 1 A ALA 141 ? A ALA 79  
5  1 Y 1 A GLN 142 ? A GLN 80  
6  1 Y 1 A SER 143 ? A SER 81  
7  1 Y 1 A GLN 144 ? A GLN 82  
8  1 Y 1 A GLU 145 ? A GLU 83  
9  1 Y 1 A ASP 146 ? A ASP 84  
10 1 Y 1 A GLY 147 ? A GLY 85  
11 1 Y 1 A GLU 199 ? A GLU 137 
12 1 Y 1 A GLY 200 ? A GLY 138 
13 1 Y 1 A LYS 201 ? A LYS 139 
14 1 Y 1 A GLU 202 ? A GLU 140 
15 1 Y 1 A LYS 203 ? A LYS 141 
16 1 Y 1 A CYS 204 ? A CYS 142 
17 1 Y 1 A SER 277 ? A SER 215 
18 1 Y 1 A PRO 278 ? A PRO 216 
19 1 Y 1 A GLU 279 ? A GLU 217 
20 1 Y 1 A THR 280 ? A THR 218 
21 1 Y 1 A ALA 281 ? A ALA 219 
22 1 Y 1 A ALA 282 ? A ALA 220 
23 1 Y 1 A HIS 283 ? A HIS 221 
24 1 Y 1 A PRO 284 ? A PRO 222 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'PHOSPHATE ION' PO4 
3 water           HOH 
#