data_2A4X
# 
_entry.id   2A4X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2A4X         
RCSB  RCSB033492   
WWPDB D_1000033492 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2A4X 
_pdbx_database_status.recvd_initial_deposition_date   2005-06-30 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Danshiitsoodol, N.' 1 
'de Pinho, C.A.'     2 
'Matoba, Y.'         3 
'Kumagai, T.'        4 
'Sugiyama, M.'       5 
# 
_citation.id                        primary 
_citation.title                     
;The Mitomycin C (MMC)-binding Protein from MMC-producing Microorganisms Protects from the Lethal Effect of Bleomycin: Crystallographic Analysis to Elucidate the Binding Mode of the Antibiotic to the Protein
;
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            360 
_citation.page_first                398 
_citation.page_last                 408 
_citation.year                      2006 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16756991 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2006.05.017 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Danshiitsoodol, N.' 1 
primary 'de Pinho, C.A.'     2 
primary 'Matoba, Y.'         3 
primary 'Kumagai, T.'        4 
primary 'Sugiyama, M.'       5 
# 
_cell.entry_id           2A4X 
_cell.length_a           47.248 
_cell.length_b           52.405 
_cell.length_c           107.862 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2A4X 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mitomycin-Binding Protein' 15466.281 2   ? ? ? ? 
2 non-polymer syn 'BLEOMYCIN A2'              1416.560  1   ? ? ? ? 
3 water       nat water                       18.015    293 ? ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFP
DTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGNVVDLFAPLPLEHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSARISLFAVVVEDMAKSLEFYRKLGVEIPAEADSAPHTEAVLDGGIRLAWDTVETVRSYDPEWQAPTGGHRFAIAFEFP
DTASVDKKYAELVDAGYEGHLKPWNAVWGQRYAIVKDPDGNVVDLFAPLPLEHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   ARG n 
1 5   ILE n 
1 6   SER n 
1 7   LEU n 
1 8   PHE n 
1 9   ALA n 
1 10  VAL n 
1 11  VAL n 
1 12  VAL n 
1 13  GLU n 
1 14  ASP n 
1 15  MET n 
1 16  ALA n 
1 17  LYS n 
1 18  SER n 
1 19  LEU n 
1 20  GLU n 
1 21  PHE n 
1 22  TYR n 
1 23  ARG n 
1 24  LYS n 
1 25  LEU n 
1 26  GLY n 
1 27  VAL n 
1 28  GLU n 
1 29  ILE n 
1 30  PRO n 
1 31  ALA n 
1 32  GLU n 
1 33  ALA n 
1 34  ASP n 
1 35  SER n 
1 36  ALA n 
1 37  PRO n 
1 38  HIS n 
1 39  THR n 
1 40  GLU n 
1 41  ALA n 
1 42  VAL n 
1 43  LEU n 
1 44  ASP n 
1 45  GLY n 
1 46  GLY n 
1 47  ILE n 
1 48  ARG n 
1 49  LEU n 
1 50  ALA n 
1 51  TRP n 
1 52  ASP n 
1 53  THR n 
1 54  VAL n 
1 55  GLU n 
1 56  THR n 
1 57  VAL n 
1 58  ARG n 
1 59  SER n 
1 60  TYR n 
1 61  ASP n 
1 62  PRO n 
1 63  GLU n 
1 64  TRP n 
1 65  GLN n 
1 66  ALA n 
1 67  PRO n 
1 68  THR n 
1 69  GLY n 
1 70  GLY n 
1 71  HIS n 
1 72  ARG n 
1 73  PHE n 
1 74  ALA n 
1 75  ILE n 
1 76  ALA n 
1 77  PHE n 
1 78  GLU n 
1 79  PHE n 
1 80  PRO n 
1 81  ASP n 
1 82  THR n 
1 83  ALA n 
1 84  SER n 
1 85  VAL n 
1 86  ASP n 
1 87  LYS n 
1 88  LYS n 
1 89  TYR n 
1 90  ALA n 
1 91  GLU n 
1 92  LEU n 
1 93  VAL n 
1 94  ASP n 
1 95  ALA n 
1 96  GLY n 
1 97  TYR n 
1 98  GLU n 
1 99  GLY n 
1 100 HIS n 
1 101 LEU n 
1 102 LYS n 
1 103 PRO n 
1 104 TRP n 
1 105 ASN n 
1 106 ALA n 
1 107 VAL n 
1 108 TRP n 
1 109 GLY n 
1 110 GLN n 
1 111 ARG n 
1 112 TYR n 
1 113 ALA n 
1 114 ILE n 
1 115 VAL n 
1 116 LYS n 
1 117 ASP n 
1 118 PRO n 
1 119 ASP n 
1 120 GLY n 
1 121 ASN n 
1 122 VAL n 
1 123 VAL n 
1 124 ASP n 
1 125 LEU n 
1 126 PHE n 
1 127 ALA n 
1 128 PRO n 
1 129 LEU n 
1 130 PRO n 
1 131 LEU n 
1 132 GLU n 
1 133 HIS n 
1 134 HIS n 
1 135 HIS n 
1 136 HIS n 
1 137 HIS n 
1 138 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Streptomyces 
_entity_src_gen.pdbx_gene_src_gene                 mrd 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Streptomyces caespitosus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     53502 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)pLysS' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET-mrd 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    2A4X 
_struct_ref.pdbx_db_accession          2A4X 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2A4X A 1 ? 138 ? 2A4X 1   ? 138 ? 1   138 
2 1 2A4X B 1 ? 138 ? 2A4X 201 ? 338 ? 201 338 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                                                'C3 H7 N O2'         89.093   
ARG 'L-peptide linking' y ARGININE        ?                                                'C6 H15 N4 O2 1'     175.209  
ASN 'L-peptide linking' y ASPARAGINE      ?                                                'C4 H8 N2 O3'        132.118  
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                                                'C4 H7 N O4'         133.103  
BLM non-polymer         . 'BLEOMYCIN A2'  'N1-[3-(DIMETHYLSULFONIO)-PROPYL]BLEOMYCINAMIDE' 'C55 H85 N17 O21 S3' 1416.560 
GLN 'L-peptide linking' y GLUTAMINE       ?                                                'C5 H10 N2 O3'       146.144  
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                                                'C5 H9 N O4'         147.129  
GLY 'peptide linking'   y GLYCINE         ?                                                'C2 H5 N O2'         75.067   
HIS 'L-peptide linking' y HISTIDINE       ?                                                'C6 H10 N3 O2 1'     156.162  
HOH non-polymer         . WATER           ?                                                'H2 O'               18.015   
ILE 'L-peptide linking' y ISOLEUCINE      ?                                                'C6 H13 N O2'        131.173  
LEU 'L-peptide linking' y LEUCINE         ?                                                'C6 H13 N O2'        131.173  
LYS 'L-peptide linking' y LYSINE          ?                                                'C6 H15 N2 O2 1'     147.195  
MET 'L-peptide linking' y METHIONINE      ?                                                'C5 H11 N O2 S'      149.211  
PHE 'L-peptide linking' y PHENYLALANINE   ?                                                'C9 H11 N O2'        165.189  
PRO 'L-peptide linking' y PROLINE         ?                                                'C5 H9 N O2'         115.130  
SER 'L-peptide linking' y SERINE          ?                                                'C3 H7 N O3'         105.093  
THR 'L-peptide linking' y THREONINE       ?                                                'C4 H9 N O3'         119.119  
TRP 'L-peptide linking' y TRYPTOPHAN      ?                                                'C11 H12 N2 O2'      204.225  
TYR 'L-peptide linking' y TYROSINE        ?                                                'C9 H11 N O3'        181.189  
VAL 'L-peptide linking' y VALINE          ?                                                'C5 H11 N O2'        117.146  
# 
_exptl.entry_id          2A4X 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.16 
_exptl_crystal.density_percent_sol   43.17 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pdbx_details    'PEG8000, MES, pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 298K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2003-02-17 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SPRING-8 BEAMLINE BL38B1' 
_diffrn_source.pdbx_synchrotron_site       SPring-8 
_diffrn_source.pdbx_synchrotron_beamline   BL38B1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9000 
# 
_reflns.entry_id                     2A4X 
_reflns.observed_criterion_sigma_I   1 
_reflns.observed_criterion_sigma_F   1 
_reflns.d_resolution_low             200 
_reflns.d_resolution_high            1.37 
_reflns.number_obs                   52971 
_reflns.number_all                   57018 
_reflns.percent_possible_obs         91.3 
_reflns.pdbx_Rmerge_I_obs            0.041 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        52.7 
_reflns.B_iso_Wilson_estimate        15.5 
_reflns.pdbx_redundancy              16.0 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.37 
_reflns_shell.d_res_low              1.42 
_reflns_shell.percent_possible_all   72.0 
_reflns_shell.Rmerge_I_obs           0.481 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    4.1 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4107 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2A4X 
_refine.ls_number_reflns_obs                     47057 
_refine.ls_number_reflns_all                     47057 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          2.0 
_refine.pdbx_data_cutoff_high_absF               10000000.00 
_refine.pdbx_data_cutoff_low_absF                0.001000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             10.00 
_refine.ls_d_res_high                            1.40 
_refine.ls_percent_reflns_obs                    88.1 
_refine.ls_R_factor_obs                          0.222 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.222 
_refine.ls_R_factor_R_free                       0.264 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  2348 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               17.9 
_refine.aniso_B[1][1]                            0.00 
_refine.aniso_B[2][2]                            0.00 
_refine.aniso_B[3][3]                            0.00 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2A4X 
_refine_analyze.Luzzati_coordinate_error_obs    0.19 
_refine_analyze.Luzzati_sigma_a_obs             0.18 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.19 
_refine_analyze.Luzzati_sigma_a_free            0.20 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2030 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         29 
_refine_hist.number_atoms_solvent             293 
_refine_hist.number_atoms_total               2352 
_refine_hist.d_res_high                       1.40 
_refine_hist.d_res_low                        10.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d           0.006 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg        1.3   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d 26.5  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d 0.72  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it        1.11  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it       1.76  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it        2.20  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it       3.46  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.40 
_refine_ls_shell.d_res_low                        1.49 
_refine_ls_shell.number_reflns_R_work             5686 
_refine_ls_shell.R_factor_R_work                  0.292 
_refine_ls_shell.percent_reflns_obs               68.3 
_refine_ls_shell.R_factor_R_free                  0.299 
_refine_ls_shell.R_factor_R_free_error            0.017 
_refine_ls_shell.percent_reflns_R_free            5.1 
_refine_ls_shell.number_reflns_R_free             306 
_refine_ls_shell.number_reflns_obs                6120 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param tophcsdx.pro.top 'X-RAY DIFFRACTION' 
2 bleo-5.param      toph19.pep.top   'X-RAY DIFFRACTION' 
3 ?                 bm2.top          'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2A4X 
_struct.title                     'Crystal Structure Of Mitomycin C-Binding Protein Complexed with Metal-Free Bleomycin A2' 
_struct.pdbx_descriptor           'Mitomycin-Binding Protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2A4X 
_struct_keywords.pdbx_keywords   'ANTIMICROBIAL PROTEIN' 
_struct_keywords.text            
'alfa/beta protein, Mitomycin C-binding protein, Bleomycin A2, ANTIMICROBIAL PROTEIN, Structural Genomics' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.pdbx_parent_biol_id   ? 
_struct_biol.details               ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 14 ? LYS A 24 ? ASP A 14  LYS A 24  1 ? 11 
HELX_P HELX_P2 2 PRO A 30 ? ALA A 36 ? PRO A 30  ALA A 36  5 ? 7  
HELX_P HELX_P3 3 VAL A 54 ? ASP A 61 ? VAL A 54  ASP A 61  1 ? 8  
HELX_P HELX_P4 4 ASP A 81 ? ALA A 95 ? ASP A 81  ALA A 95  1 ? 15 
HELX_P HELX_P5 5 ASP B 14 ? LYS B 24 ? ASP B 214 LYS B 224 1 ? 11 
HELX_P HELX_P6 6 PRO B 30 ? ALA B 36 ? PRO B 230 ALA B 236 5 ? 7  
HELX_P HELX_P7 7 ASP B 44 ? GLY B 46 ? ASP B 244 GLY B 246 5 ? 3  
HELX_P HELX_P8 8 VAL B 54 ? TYR B 60 ? VAL B 254 TYR B 260 1 ? 7  
HELX_P HELX_P9 9 ASP B 81 ? ALA B 95 ? ASP B 281 ALA B 295 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? parallel      
A 3 4 ? anti-parallel 
A 4 5 ? parallel      
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? parallel      
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 HIS A 38  ? VAL A 42  ? HIS A 38  VAL A 42  
A 2 ARG A 48  ? THR A 53  ? ARG A 48  THR A 53  
A 3 ARG A 4   ? VAL A 12  ? ARG A 4   VAL A 12  
A 4 PHE B 73  ? GLU B 78  ? PHE B 273 GLU B 278 
A 5 VAL B 122 ? PRO B 128 ? VAL B 322 PRO B 328 
A 6 GLN B 110 ? LYS B 116 ? GLN B 310 LYS B 316 
A 7 GLU B 98  ? ALA B 106 ? GLU B 298 ALA B 306 
B 1 GLY A 99  ? ALA A 106 ? GLY A 99  ALA A 106 
B 2 GLN A 110 ? LYS A 116 ? GLN A 110 LYS A 116 
B 3 VAL A 122 ? PRO A 128 ? VAL A 122 PRO A 128 
B 4 PHE A 73  ? GLU A 78  ? PHE A 73  GLU A 78  
B 5 ARG B 4   ? VAL B 12  ? ARG B 204 VAL B 212 
B 6 ARG B 48  ? THR B 53  ? ARG B 248 THR B 253 
B 7 HIS B 38  ? VAL B 42  ? HIS B 238 VAL B 242 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 39  ? N THR A 39  O TRP A 51  ? O TRP A 51  
A 2 3 O ALA A 50  ? O ALA A 50  N PHE A 8   ? N PHE A 8   
A 3 4 N LEU A 7   ? N LEU A 7   O ALA B 76  ? O ALA B 276 
A 4 5 N PHE B 77  ? N PHE B 277 O ASP B 124 ? O ASP B 324 
A 5 6 O LEU B 125 ? O LEU B 325 N ALA B 113 ? N ALA B 313 
A 6 7 O TYR B 112 ? O TYR B 312 N TRP B 104 ? N TRP B 304 
B 1 2 N TRP A 104 ? N TRP A 104 O TYR A 112 ? O TYR A 112 
B 2 3 N ALA A 113 ? N ALA A 113 O LEU A 125 ? O LEU A 125 
B 3 4 O ASP A 124 ? O ASP A 124 N PHE A 77  ? N PHE A 77  
B 4 5 N GLU A 78  ? N GLU A 78  O ARG B 4   ? O ARG B 204 
B 5 6 N PHE B 8   ? N PHE B 208 O ALA B 50  ? O ALA B 250 
B 6 7 O TRP B 51  ? O TRP B 251 N THR B 39  ? N THR B 239 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    10 
_struct_site.details              'BINDING SITE FOR RESIDUE BLM A 700' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 10 GLU A 78  ? GLU A 78  . ? 1_555 ? 
2  AC1 10 TRP A 108 ? TRP A 108 . ? 1_555 ? 
3  AC1 10 GLN A 110 ? GLN A 110 . ? 1_555 ? 
4  AC1 10 TYR A 112 ? TYR A 112 . ? 1_555 ? 
5  AC1 10 VAL A 122 ? VAL A 122 . ? 1_555 ? 
6  AC1 10 ASP A 124 ? ASP A 124 . ? 1_555 ? 
7  AC1 10 PHE A 126 ? PHE A 126 . ? 1_555 ? 
8  AC1 10 HOH D .   ? HOH A 532 . ? 1_555 ? 
9  AC1 10 GLU B 40  ? GLU B 240 . ? 1_555 ? 
10 AC1 10 ARG B 48  ? ARG B 248 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2A4X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2A4X 
_atom_sites.fract_transf_matrix[1][1]   0.021165 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019082 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009271 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 2   ? 13.405  -20.844 35.473 1.00 32.37 ? 2   SER A N   1 
ATOM   2    C CA  . SER A 1 2   ? 13.774  -19.426 35.181 1.00 31.06 ? 2   SER A CA  1 
ATOM   3    C C   . SER A 1 2   ? 12.903  -18.475 35.995 1.00 28.27 ? 2   SER A C   1 
ATOM   4    O O   . SER A 1 2   ? 11.693  -18.669 36.107 1.00 30.19 ? 2   SER A O   1 
ATOM   5    C CB  . SER A 1 2   ? 13.606  -19.135 33.686 1.00 33.16 ? 2   SER A CB  1 
ATOM   6    O OG  . SER A 1 2   ? 13.836  -17.764 33.395 1.00 34.41 ? 2   SER A OG  1 
ATOM   7    N N   . ALA A 1 3   ? 13.527  -17.444 36.553 1.00 24.98 ? 3   ALA A N   1 
ATOM   8    C CA  . ALA A 1 3   ? 12.825  -16.465 37.376 1.00 20.25 ? 3   ALA A CA  1 
ATOM   9    C C   . ALA A 1 3   ? 11.919  -15.529 36.582 1.00 18.25 ? 3   ALA A C   1 
ATOM   10   O O   . ALA A 1 3   ? 12.071  -15.362 35.373 1.00 16.34 ? 3   ALA A O   1 
ATOM   11   C CB  . ALA A 1 3   ? 13.839  -15.644 38.159 1.00 20.17 ? 3   ALA A CB  1 
ATOM   12   N N   . ARG A 1 4   ? 10.958  -14.930 37.273 1.00 15.82 ? 4   ARG A N   1 
ATOM   13   C CA  . ARG A 1 4   ? 10.073  -13.966 36.639 1.00 14.54 ? 4   ARG A CA  1 
ATOM   14   C C   . ARG A 1 4   ? 9.756   -12.870 37.652 1.00 11.71 ? 4   ARG A C   1 
ATOM   15   O O   . ARG A 1 4   ? 9.624   -13.142 38.848 1.00 9.96  ? 4   ARG A O   1 
ATOM   16   C CB  . ARG A 1 4   ? 8.813   -14.659 36.103 1.00 16.63 ? 4   ARG A CB  1 
ATOM   17   C CG  . ARG A 1 4   ? 7.609   -14.691 37.000 1.00 21.01 ? 4   ARG A CG  1 
ATOM   18   C CD  . ARG A 1 4   ? 6.360   -14.968 36.162 1.00 24.88 ? 4   ARG A CD  1 
ATOM   19   N NE  . ARG A 1 4   ? 6.416   -16.283 35.524 1.00 29.42 ? 4   ARG A NE  1 
ATOM   20   C CZ  . ARG A 1 4   ? 6.175   -16.513 34.234 1.00 31.52 ? 4   ARG A CZ  1 
ATOM   21   N NH1 . ARG A 1 4   ? 5.856   -15.512 33.419 1.00 31.82 ? 4   ARG A NH1 1 
ATOM   22   N NH2 . ARG A 1 4   ? 6.245   -17.750 33.758 1.00 30.09 ? 4   ARG A NH2 1 
ATOM   23   N N   . ILE A 1 5   ? 9.689   -11.628 37.178 1.00 10.23 ? 5   ILE A N   1 
ATOM   24   C CA  . ILE A 1 5   ? 9.398   -10.497 38.057 1.00 9.29  ? 5   ILE A CA  1 
ATOM   25   C C   . ILE A 1 5   ? 7.962   -10.610 38.541 1.00 9.50  ? 5   ILE A C   1 
ATOM   26   O O   . ILE A 1 5   ? 7.021   -10.618 37.750 1.00 9.97  ? 5   ILE A O   1 
ATOM   27   C CB  . ILE A 1 5   ? 9.628   -9.144  37.339 1.00 8.73  ? 5   ILE A CB  1 
ATOM   28   C CG1 . ILE A 1 5   ? 11.121  -8.969  37.051 1.00 10.91 ? 5   ILE A CG1 1 
ATOM   29   C CG2 . ILE A 1 5   ? 9.158   -7.997  38.213 1.00 9.35  ? 5   ILE A CG2 1 
ATOM   30   C CD1 . ILE A 1 5   ? 11.466  -7.822  36.102 1.00 11.34 ? 5   ILE A CD1 1 
ATOM   31   N N   . SER A 1 6   ? 7.806   -10.712 39.856 1.00 9.03  ? 6   SER A N   1 
ATOM   32   C CA  . SER A 1 6   ? 6.495   -10.870 40.471 1.00 9.20  ? 6   SER A CA  1 
ATOM   33   C C   . SER A 1 6   ? 5.990   -9.606  41.160 1.00 8.49  ? 6   SER A C   1 
ATOM   34   O O   . SER A 1 6   ? 4.781   -9.374  41.233 1.00 8.01  ? 6   SER A O   1 
ATOM   35   C CB  . SER A 1 6   ? 6.547   -12.025 41.481 1.00 8.74  ? 6   SER A CB  1 
ATOM   36   O OG  . SER A 1 6   ? 5.369   -12.088 42.251 1.00 9.02  ? 6   SER A OG  1 
ATOM   37   N N   . LEU A 1 7   ? 6.913   -8.796  41.676 1.00 7.92  ? 7   LEU A N   1 
ATOM   38   C CA  . LEU A 1 7   ? 6.520   -7.567  42.352 1.00 7.81  ? 7   LEU A CA  1 
ATOM   39   C C   . LEU A 1 7   ? 7.601   -6.499  42.417 1.00 6.43  ? 7   LEU A C   1 
ATOM   40   O O   . LEU A 1 7   ? 8.791   -6.783  42.307 1.00 6.67  ? 7   LEU A O   1 
ATOM   41   C CB  . LEU A 1 7   ? 5.969   -7.891  43.758 1.00 12.50 ? 7   LEU A CB  1 
ATOM   42   C CG  . LEU A 1 7   ? 6.640   -7.876  45.140 1.00 16.02 ? 7   LEU A CG  1 
ATOM   43   C CD1 . LEU A 1 7   ? 7.387   -6.590  45.441 1.00 13.81 ? 7   LEU A CD1 1 
ATOM   44   C CD2 . LEU A 1 7   ? 5.524   -8.079  46.174 1.00 12.99 ? 7   LEU A CD2 1 
ATOM   45   N N   . PHE A 1 8   ? 7.151   -5.259  42.556 1.00 6.21  ? 8   PHE A N   1 
ATOM   46   C CA  . PHE A 1 8   ? 8.019   -4.101  42.661 1.00 6.42  ? 8   PHE A CA  1 
ATOM   47   C C   . PHE A 1 8   ? 7.633   -3.501  44.006 1.00 7.06  ? 8   PHE A C   1 
ATOM   48   O O   . PHE A 1 8   ? 6.457   -3.486  44.351 1.00 7.73  ? 8   PHE A O   1 
ATOM   49   C CB  . PHE A 1 8   ? 7.721   -3.108  41.531 1.00 6.53  ? 8   PHE A CB  1 
ATOM   50   C CG  . PHE A 1 8   ? 8.132   -3.598  40.162 1.00 7.54  ? 8   PHE A CG  1 
ATOM   51   C CD1 . PHE A 1 8   ? 9.438   -3.430  39.711 1.00 8.16  ? 8   PHE A CD1 1 
ATOM   52   C CD2 . PHE A 1 8   ? 7.210   -4.221  39.318 1.00 8.19  ? 8   PHE A CD2 1 
ATOM   53   C CE1 . PHE A 1 8   ? 9.821   -3.872  38.441 1.00 6.63  ? 8   PHE A CE1 1 
ATOM   54   C CE2 . PHE A 1 8   ? 7.585   -4.664  38.051 1.00 6.53  ? 8   PHE A CE2 1 
ATOM   55   C CZ  . PHE A 1 8   ? 8.891   -4.488  37.614 1.00 7.11  ? 8   PHE A CZ  1 
ATOM   56   N N   . ALA A 1 9   ? 8.600   -3.016  44.772 1.00 7.26  ? 9   ALA A N   1 
ATOM   57   C CA  . ALA A 1 9   ? 8.269   -2.461  46.073 1.00 6.58  ? 9   ALA A CA  1 
ATOM   58   C C   . ALA A 1 9   ? 8.948   -1.131  46.328 1.00 6.74  ? 9   ALA A C   1 
ATOM   59   O O   . ALA A 1 9   ? 10.036  -0.876  45.819 1.00 6.53  ? 9   ALA A O   1 
ATOM   60   C CB  . ALA A 1 9   ? 8.646   -3.451  47.153 1.00 5.97  ? 9   ALA A CB  1 
ATOM   61   N N   . VAL A 1 10  ? 8.279   -0.278  47.099 1.00 5.99  ? 10  VAL A N   1 
ATOM   62   C CA  . VAL A 1 10  ? 8.832   1.018   47.468 1.00 7.91  ? 10  VAL A CA  1 
ATOM   63   C C   . VAL A 1 10  ? 8.832   1.139   48.995 1.00 8.38  ? 10  VAL A C   1 
ATOM   64   O O   . VAL A 1 10  ? 7.911   0.661   49.662 1.00 8.90  ? 10  VAL A O   1 
ATOM   65   C CB  . VAL A 1 10  ? 8.023   2.200   46.853 1.00 9.57  ? 10  VAL A CB  1 
ATOM   66   C CG1 . VAL A 1 10  ? 8.088   2.141   45.329 1.00 11.10 ? 10  VAL A CG1 1 
ATOM   67   C CG2 . VAL A 1 10  ? 6.585   2.167   47.326 1.00 11.29 ? 10  VAL A CG2 1 
ATOM   68   N N   . VAL A 1 11  ? 9.875   1.756   49.541 1.00 7.77  ? 11  VAL A N   1 
ATOM   69   C CA  . VAL A 1 11  ? 9.988   1.952   50.989 1.00 8.40  ? 11  VAL A CA  1 
ATOM   70   C C   . VAL A 1 11  ? 9.359   3.303   51.317 1.00 9.89  ? 11  VAL A C   1 
ATOM   71   O O   . VAL A 1 11  ? 9.707   4.319   50.710 1.00 9.93  ? 11  VAL A O   1 
ATOM   72   C CB  . VAL A 1 11  ? 11.460  1.954   51.443 1.00 7.50  ? 11  VAL A CB  1 
ATOM   73   C CG1 . VAL A 1 11  ? 11.540  2.077   52.970 1.00 8.18  ? 11  VAL A CG1 1 
ATOM   74   C CG2 . VAL A 1 11  ? 12.146  0.690   50.970 1.00 7.53  ? 11  VAL A CG2 1 
ATOM   75   N N   . VAL A 1 12  ? 8.441   3.312   52.282 1.00 9.83  ? 12  VAL A N   1 
ATOM   76   C CA  . VAL A 1 12  ? 7.740   4.536   52.655 1.00 10.82 ? 12  VAL A CA  1 
ATOM   77   C C   . VAL A 1 12  ? 7.912   4.933   54.115 1.00 11.33 ? 12  VAL A C   1 
ATOM   78   O O   . VAL A 1 12  ? 7.944   4.086   55.008 1.00 11.81 ? 12  VAL A O   1 
ATOM   79   C CB  . VAL A 1 12  ? 6.220   4.411   52.370 1.00 9.87  ? 12  VAL A CB  1 
ATOM   80   C CG1 . VAL A 1 12  ? 5.998   4.116   50.902 1.00 11.28 ? 12  VAL A CG1 1 
ATOM   81   C CG2 . VAL A 1 12  ? 5.603   3.305   53.232 1.00 10.67 ? 12  VAL A CG2 1 
ATOM   82   N N   . GLU A 1 13  ? 8.011   6.237   54.344 1.00 12.56 ? 13  GLU A N   1 
ATOM   83   C CA  . GLU A 1 13  ? 8.154   6.782   55.684 1.00 15.37 ? 13  GLU A CA  1 
ATOM   84   C C   . GLU A 1 13  ? 6.789   6.725   56.372 1.00 14.57 ? 13  GLU A C   1 
ATOM   85   O O   . GLU A 1 13  ? 6.699   6.428   57.567 1.00 15.63 ? 13  GLU A O   1 
ATOM   86   C CB  . GLU A 1 13  ? 8.668   8.225   55.589 1.00 19.59 ? 13  GLU A CB  1 
ATOM   87   C CG  . GLU A 1 13  ? 8.209   9.177   56.687 1.00 29.56 ? 13  GLU A CG  1 
ATOM   88   C CD  . GLU A 1 13  ? 8.094   10.622  56.197 1.00 34.52 ? 13  GLU A CD  1 
ATOM   89   O OE1 . GLU A 1 13  ? 9.015   11.084  55.480 1.00 37.01 ? 13  GLU A OE1 1 
ATOM   90   O OE2 . GLU A 1 13  ? 7.081   11.289  56.527 1.00 35.90 ? 13  GLU A OE2 1 
ATOM   91   N N   . ASP A 1 14  ? 5.734   6.997   55.603 1.00 12.56 ? 14  ASP A N   1 
ATOM   92   C CA  . ASP A 1 14  ? 4.356   6.984   56.101 1.00 13.04 ? 14  ASP A CA  1 
ATOM   93   C C   . ASP A 1 14  ? 3.460   6.210   55.130 1.00 11.75 ? 14  ASP A C   1 
ATOM   94   O O   . ASP A 1 14  ? 3.256   6.631   53.991 1.00 10.90 ? 14  ASP A O   1 
ATOM   95   C CB  . ASP A 1 14  ? 3.840   8.423   56.244 1.00 14.42 ? 14  ASP A CB  1 
ATOM   96   C CG  . ASP A 1 14  ? 2.503   8.504   56.964 1.00 18.02 ? 14  ASP A CG  1 
ATOM   97   O OD1 . ASP A 1 14  ? 1.500   7.964   56.453 1.00 17.60 ? 14  ASP A OD1 1 
ATOM   98   O OD2 . ASP A 1 14  ? 2.452   9.121   58.051 1.00 25.14 ? 14  ASP A OD2 1 
ATOM   99   N N   . MET A 1 15  ? 2.919   5.083   55.580 1.00 11.20 ? 15  MET A N   1 
ATOM   100  C CA  . MET A 1 15  ? 2.068   4.272   54.718 1.00 11.38 ? 15  MET A CA  1 
ATOM   101  C C   . MET A 1 15  ? 0.817   5.006   54.235 1.00 11.10 ? 15  MET A C   1 
ATOM   102  O O   . MET A 1 15  ? 0.547   5.061   53.038 1.00 11.76 ? 15  MET A O   1 
ATOM   103  C CB  . MET A 1 15  ? 1.665   2.986   55.438 1.00 10.59 ? 15  MET A CB  1 
ATOM   104  C CG  . MET A 1 15  ? 0.766   2.082   54.624 1.00 11.09 ? 15  MET A CG  1 
ATOM   105  S SD  . MET A 1 15  ? 1.661   1.252   53.303 1.00 11.01 ? 15  MET A SD  1 
ATOM   106  C CE  . MET A 1 15  ? 2.772   0.237   54.199 1.00 9.15  ? 15  MET A CE  1 
ATOM   107  N N   . ALA A 1 16  ? 0.056   5.582   55.158 1.00 12.12 ? 16  ALA A N   1 
ATOM   108  C CA  . ALA A 1 16  ? -1.169  6.282   54.770 1.00 11.67 ? 16  ALA A CA  1 
ATOM   109  C C   . ALA A 1 16  ? -0.908  7.387   53.745 1.00 11.30 ? 16  ALA A C   1 
ATOM   110  O O   . ALA A 1 16  ? -1.630  7.500   52.755 1.00 11.75 ? 16  ALA A O   1 
ATOM   111  C CB  . ALA A 1 16  ? -1.865  6.857   56.011 1.00 12.38 ? 16  ALA A CB  1 
ATOM   112  N N   . LYS A 1 17  ? 0.125   8.190   53.977 1.00 10.49 ? 17  LYS A N   1 
ATOM   113  C CA  . LYS A 1 17  ? 0.451   9.287   53.071 1.00 11.86 ? 17  LYS A CA  1 
ATOM   114  C C   . LYS A 1 17  ? 0.823   8.797   51.675 1.00 11.01 ? 17  LYS A C   1 
ATOM   115  O O   . LYS A 1 17  ? 0.378   9.358   50.677 1.00 12.17 ? 17  LYS A O   1 
ATOM   116  C CB  . LYS A 1 17  ? 1.593   10.127  53.642 1.00 13.29 ? 17  LYS A CB  1 
ATOM   117  C CG  . LYS A 1 17  ? 1.140   11.104  54.703 1.00 17.82 ? 17  LYS A CG  1 
ATOM   118  C CD  . LYS A 1 17  ? 2.318   11.612  55.510 1.00 22.05 ? 17  LYS A CD  1 
ATOM   119  C CE  . LYS A 1 17  ? 1.911   12.767  56.412 1.00 25.28 ? 17  LYS A CE  1 
ATOM   120  N NZ  . LYS A 1 17  ? 3.105   13.407  57.046 1.00 26.81 ? 17  LYS A NZ  1 
ATOM   121  N N   . SER A 1 18  ? 1.639   7.753   51.605 1.00 10.34 ? 18  SER A N   1 
ATOM   122  C CA  . SER A 1 18  ? 2.039   7.210   50.324 1.00 9.38  ? 18  SER A CA  1 
ATOM   123  C C   . SER A 1 18  ? 0.837   6.612   49.598 1.00 10.34 ? 18  SER A C   1 
ATOM   124  O O   . SER A 1 18  ? 0.625   6.871   48.412 1.00 10.21 ? 18  SER A O   1 
ATOM   125  C CB  . SER A 1 18  ? 3.108   6.141   50.516 1.00 10.68 ? 18  SER A CB  1 
ATOM   126  O OG  . SER A 1 18  ? 3.473   5.579   49.267 1.00 10.30 ? 18  SER A OG  1 
ATOM   127  N N   . LEU A 1 19  ? 0.043   5.822   50.315 1.00 9.63  ? 19  LEU A N   1 
ATOM   128  C CA  . LEU A 1 19  ? -1.127  5.191   49.722 1.00 10.57 ? 19  LEU A CA  1 
ATOM   129  C C   . LEU A 1 19  ? -2.122  6.193   49.141 1.00 10.74 ? 19  LEU A C   1 
ATOM   130  O O   . LEU A 1 19  ? -2.665  5.966   48.063 1.00 12.63 ? 19  LEU A O   1 
ATOM   131  C CB  . LEU A 1 19  ? -1.833  4.297   50.751 1.00 9.76  ? 19  LEU A CB  1 
ATOM   132  C CG  . LEU A 1 19  ? -1.039  3.075   51.221 1.00 10.03 ? 19  LEU A CG  1 
ATOM   133  C CD1 . LEU A 1 19  ? -1.942  2.165   52.046 1.00 10.38 ? 19  LEU A CD1 1 
ATOM   134  C CD2 . LEU A 1 19  ? -0.473  2.327   50.019 1.00 10.76 ? 19  LEU A CD2 1 
ATOM   135  N N   . GLU A 1 20  ? -2.364  7.302   49.830 1.00 11.46 ? 20  GLU A N   1 
ATOM   136  C CA  . GLU A 1 20  ? -3.319  8.275   49.299 1.00 14.08 ? 20  GLU A CA  1 
ATOM   137  C C   . GLU A 1 20  ? -2.846  8.865   47.972 1.00 12.93 ? 20  GLU A C   1 
ATOM   138  O O   . GLU A 1 20  ? -3.654  9.126   47.082 1.00 13.91 ? 20  GLU A O   1 
ATOM   139  C CB  . GLU A 1 20  ? -3.584  9.390   50.309 1.00 18.55 ? 20  GLU A CB  1 
ATOM   140  C CG  . GLU A 1 20  ? -4.952  10.079  50.131 1.00 24.74 ? 20  GLU A CG  1 
ATOM   141  C CD  . GLU A 1 20  ? -6.047  9.153   49.569 1.00 28.85 ? 20  GLU A CD  1 
ATOM   142  O OE1 . GLU A 1 20  ? -6.394  8.141   50.229 1.00 29.57 ? 20  GLU A OE1 1 
ATOM   143  O OE2 . GLU A 1 20  ? -6.568  9.446   48.466 1.00 30.71 ? 20  GLU A OE2 1 
ATOM   144  N N   . PHE A 1 21  ? -1.541  9.074   47.831 1.00 10.72 ? 21  PHE A N   1 
ATOM   145  C CA  . PHE A 1 21  ? -1.010  9.608   46.579 1.00 10.55 ? 21  PHE A CA  1 
ATOM   146  C C   . PHE A 1 21  ? -1.298  8.621   45.437 1.00 10.74 ? 21  PHE A C   1 
ATOM   147  O O   . PHE A 1 21  ? -1.822  9.001   44.392 1.00 12.46 ? 21  PHE A O   1 
ATOM   148  C CB  . PHE A 1 21  ? 0.503   9.845   46.712 1.00 9.75  ? 21  PHE A CB  1 
ATOM   149  C CG  . PHE A 1 21  ? 1.204   10.148  45.401 1.00 11.51 ? 21  PHE A CG  1 
ATOM   150  C CD1 . PHE A 1 21  ? 1.350   11.464  44.961 1.00 11.66 ? 21  PHE A CD1 1 
ATOM   151  C CD2 . PHE A 1 21  ? 1.740   9.117   44.622 1.00 12.43 ? 21  PHE A CD2 1 
ATOM   152  C CE1 . PHE A 1 21  ? 2.018   11.751  43.771 1.00 10.71 ? 21  PHE A CE1 1 
ATOM   153  C CE2 . PHE A 1 21  ? 2.412   9.391   43.427 1.00 11.04 ? 21  PHE A CE2 1 
ATOM   154  C CZ  . PHE A 1 21  ? 2.552   10.709  43.000 1.00 12.47 ? 21  PHE A CZ  1 
ATOM   155  N N   . TYR A 1 22  ? -0.975  7.347   45.638 1.00 10.39 ? 22  TYR A N   1 
ATOM   156  C CA  . TYR A 1 22  ? -1.196  6.361   44.588 1.00 11.07 ? 22  TYR A CA  1 
ATOM   157  C C   . TYR A 1 22  ? -2.665  6.090   44.299 1.00 11.36 ? 22  TYR A C   1 
ATOM   158  O O   . TYR A 1 22  ? -3.016  5.716   43.182 1.00 12.29 ? 22  TYR A O   1 
ATOM   159  C CB  . TYR A 1 22  ? -0.440  5.066   44.911 1.00 10.19 ? 22  TYR A CB  1 
ATOM   160  C CG  . TYR A 1 22  ? 1.041   5.257   44.728 1.00 8.99  ? 22  TYR A CG  1 
ATOM   161  C CD1 . TYR A 1 22  ? 1.618   5.178   43.462 1.00 9.26  ? 22  TYR A CD1 1 
ATOM   162  C CD2 . TYR A 1 22  ? 1.855   5.624   45.800 1.00 8.54  ? 22  TYR A CD2 1 
ATOM   163  C CE1 . TYR A 1 22  ? 2.967   5.470   43.261 1.00 10.07 ? 22  TYR A CE1 1 
ATOM   164  C CE2 . TYR A 1 22  ? 3.212   5.920   45.613 1.00 9.75  ? 22  TYR A CE2 1 
ATOM   165  C CZ  . TYR A 1 22  ? 3.758   5.847   44.338 1.00 9.56  ? 22  TYR A CZ  1 
ATOM   166  O OH  . TYR A 1 22  ? 5.077   6.194   44.130 1.00 10.47 ? 22  TYR A OH  1 
ATOM   167  N N   . ARG A 1 23  ? -3.522  6.286   45.297 1.00 12.37 ? 23  ARG A N   1 
ATOM   168  C CA  . ARG A 1 23  ? -4.952  6.083   45.094 1.00 12.69 ? 23  ARG A CA  1 
ATOM   169  C C   . ARG A 1 23  ? -5.395  7.178   44.131 1.00 14.83 ? 23  ARG A C   1 
ATOM   170  O O   . ARG A 1 23  ? -6.303  6.986   43.317 1.00 14.33 ? 23  ARG A O   1 
ATOM   171  C CB  . ARG A 1 23  ? -5.720  6.223   46.409 1.00 12.45 ? 23  ARG A CB  1 
ATOM   172  C CG  . ARG A 1 23  ? -5.783  4.952   47.258 1.00 11.62 ? 23  ARG A CG  1 
ATOM   173  C CD  . ARG A 1 23  ? -6.623  5.186   48.525 1.00 13.63 ? 23  ARG A CD  1 
ATOM   174  N NE  . ARG A 1 23  ? -6.343  4.206   49.572 1.00 12.64 ? 23  ARG A NE  1 
ATOM   175  C CZ  . ARG A 1 23  ? -5.750  4.492   50.727 1.00 12.37 ? 23  ARG A CZ  1 
ATOM   176  N NH1 . ARG A 1 23  ? -5.371  5.732   50.989 1.00 14.63 ? 23  ARG A NH1 1 
ATOM   177  N NH2 . ARG A 1 23  ? -5.521  3.535   51.617 1.00 12.11 ? 23  ARG A NH2 1 
ATOM   178  N N   . LYS A 1 24  ? -4.731  8.326   44.235 1.00 16.26 ? 24  LYS A N   1 
ATOM   179  C CA  . LYS A 1 24  ? -5.024  9.477   43.388 1.00 19.03 ? 24  LYS A CA  1 
ATOM   180  C C   . LYS A 1 24  ? -4.621  9.219   41.939 1.00 19.40 ? 24  LYS A C   1 
ATOM   181  O O   . LYS A 1 24  ? -5.082  9.910   41.032 1.00 20.83 ? 24  LYS A O   1 
ATOM   182  C CB  . LYS A 1 24  ? -4.295  10.717  43.911 1.00 20.32 ? 24  LYS A CB  1 
ATOM   183  C CG  . LYS A 1 24  ? -5.219  11.833  44.353 1.00 22.67 ? 24  LYS A CG  1 
ATOM   184  C CD  . LYS A 1 24  ? -4.776  12.424  45.679 1.00 24.87 ? 24  LYS A CD  1 
ATOM   185  C CE  . LYS A 1 24  ? -5.934  13.104  46.397 1.00 27.62 ? 24  LYS A CE  1 
ATOM   186  N NZ  . LYS A 1 24  ? -5.978  12.788  47.859 1.00 29.90 ? 24  LYS A NZ  1 
ATOM   187  N N   . LEU A 1 25  ? -3.763  8.224   41.723 1.00 18.92 ? 25  LEU A N   1 
ATOM   188  C CA  . LEU A 1 25  ? -3.310  7.884   40.376 1.00 18.67 ? 25  LEU A CA  1 
ATOM   189  C C   . LEU A 1 25  ? -4.004  6.644   39.802 1.00 20.59 ? 25  LEU A C   1 
ATOM   190  O O   . LEU A 1 25  ? -3.519  6.041   38.838 1.00 22.74 ? 25  LEU A O   1 
ATOM   191  C CB  . LEU A 1 25  ? -1.795  7.688   40.370 1.00 15.59 ? 25  LEU A CB  1 
ATOM   192  C CG  . LEU A 1 25  ? -1.041  8.995   40.137 1.00 14.84 ? 25  LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 25  ? 0.407   8.842   40.541 1.00 13.70 ? 25  LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 25  ? -1.160  9.388   38.673 1.00 14.47 ? 25  LEU A CD2 1 
ATOM   195  N N   . GLY A 1 26  ? -5.132  6.265   40.403 1.00 20.48 ? 26  GLY A N   1 
ATOM   196  C CA  . GLY A 1 26  ? -5.893  5.120   39.925 1.00 19.39 ? 26  GLY A CA  1 
ATOM   197  C C   . GLY A 1 26  ? -5.594  3.751   40.518 1.00 19.34 ? 26  GLY A C   1 
ATOM   198  O O   . GLY A 1 26  ? -6.261  2.775   40.161 1.00 19.57 ? 26  GLY A O   1 
ATOM   199  N N   . VAL A 1 27  ? -4.605  3.660   41.410 1.00 18.02 ? 27  VAL A N   1 
ATOM   200  C CA  . VAL A 1 27  ? -4.262  2.376   42.015 1.00 16.92 ? 27  VAL A CA  1 
ATOM   201  C C   . VAL A 1 27  ? -5.287  1.993   43.072 1.00 17.37 ? 27  VAL A C   1 
ATOM   202  O O   . VAL A 1 27  ? -5.553  2.754   44.004 1.00 17.06 ? 27  VAL A O   1 
ATOM   203  C CB  . VAL A 1 27  ? -2.860  2.393   42.664 1.00 15.87 ? 27  VAL A CB  1 
ATOM   204  C CG1 . VAL A 1 27  ? -2.469  0.975   43.069 1.00 14.95 ? 27  VAL A CG1 1 
ATOM   205  C CG2 . VAL A 1 27  ? -1.834  2.957   41.686 1.00 15.74 ? 27  VAL A CG2 1 
ATOM   206  N N   . GLU A 1 28  ? -5.861  0.804   42.911 1.00 18.93 ? 28  GLU A N   1 
ATOM   207  C CA  . GLU A 1 28  ? -6.874  0.302   43.831 1.00 21.09 ? 28  GLU A CA  1 
ATOM   208  C C   . GLU A 1 28  ? -6.278  -0.166  45.151 1.00 18.19 ? 28  GLU A C   1 
ATOM   209  O O   . GLU A 1 28  ? -5.654  -1.229  45.218 1.00 18.76 ? 28  GLU A O   1 
ATOM   210  C CB  . GLU A 1 28  ? -7.644  -0.843  43.176 1.00 24.99 ? 28  GLU A CB  1 
ATOM   211  C CG  . GLU A 1 28  ? -8.891  -0.381  42.451 1.00 33.43 ? 28  GLU A CG  1 
ATOM   212  C CD  . GLU A 1 28  ? -9.780  0.479   43.333 1.00 38.65 ? 28  GLU A CD  1 
ATOM   213  O OE1 . GLU A 1 28  ? -10.754 -0.056  43.910 1.00 41.65 ? 28  GLU A OE1 1 
ATOM   214  O OE2 . GLU A 1 28  ? -9.502  1.694   43.453 1.00 43.15 ? 28  GLU A OE2 1 
ATOM   215  N N   . ILE A 1 29  ? -6.477  0.633   46.196 1.00 16.39 ? 29  ILE A N   1 
ATOM   216  C CA  . ILE A 1 29  ? -5.955  0.302   47.518 1.00 16.07 ? 29  ILE A CA  1 
ATOM   217  C C   . ILE A 1 29  ? -6.982  0.556   48.622 1.00 16.03 ? 29  ILE A C   1 
ATOM   218  O O   . ILE A 1 29  ? -7.480  1.671   48.773 1.00 16.65 ? 29  ILE A O   1 
ATOM   219  C CB  . ILE A 1 29  ? -4.681  1.131   47.846 1.00 14.65 ? 29  ILE A CB  1 
ATOM   220  C CG1 . ILE A 1 29  ? -3.731  1.146   46.646 1.00 14.05 ? 29  ILE A CG1 1 
ATOM   221  C CG2 . ILE A 1 29  ? -3.985  0.553   49.066 1.00 15.01 ? 29  ILE A CG2 1 
ATOM   222  C CD1 . ILE A 1 29  ? -2.643  2.190   46.739 1.00 12.49 ? 29  ILE A CD1 1 
ATOM   223  N N   . PRO A 1 30  ? -7.323  -0.486  49.402 1.00 16.02 ? 30  PRO A N   1 
ATOM   224  C CA  . PRO A 1 30  ? -8.299  -0.299  50.485 1.00 16.35 ? 30  PRO A CA  1 
ATOM   225  C C   . PRO A 1 30  ? -7.843  0.723   51.532 1.00 14.79 ? 30  PRO A C   1 
ATOM   226  O O   . PRO A 1 30  ? -6.651  0.886   51.782 1.00 15.63 ? 30  PRO A O   1 
ATOM   227  C CB  . PRO A 1 30  ? -8.457  -1.697  51.091 1.00 17.16 ? 30  PRO A CB  1 
ATOM   228  C CG  . PRO A 1 30  ? -7.322  -2.496  50.579 1.00 16.80 ? 30  PRO A CG  1 
ATOM   229  C CD  . PRO A 1 30  ? -6.858  -1.881  49.299 1.00 15.75 ? 30  PRO A CD  1 
ATOM   230  N N   . ALA A 1 31  ? -8.802  1.415   52.136 1.00 14.30 ? 31  ALA A N   1 
ATOM   231  C CA  . ALA A 1 31  ? -8.511  2.410   53.159 1.00 13.07 ? 31  ALA A CA  1 
ATOM   232  C C   . ALA A 1 31  ? -7.864  1.720   54.349 1.00 12.59 ? 31  ALA A C   1 
ATOM   233  O O   . ALA A 1 31  ? -7.006  2.285   55.017 1.00 12.14 ? 31  ALA A O   1 
ATOM   234  C CB  . ALA A 1 31  ? -9.800  3.093   53.592 1.00 14.80 ? 31  ALA A CB  1 
ATOM   235  N N   . GLU A 1 32  ? -8.293  0.486   54.595 1.00 13.27 ? 32  GLU A N   1 
ATOM   236  C CA  . GLU A 1 32  ? -7.795  -0.328  55.696 1.00 13.72 ? 32  GLU A CA  1 
ATOM   237  C C   . GLU A 1 32  ? -6.283  -0.547  55.653 1.00 13.44 ? 32  GLU A C   1 
ATOM   238  O O   . GLU A 1 32  ? -5.662  -0.818  56.683 1.00 14.01 ? 32  GLU A O   1 
ATOM   239  C CB  . GLU A 1 32  ? -8.503  -1.685  55.690 1.00 12.84 ? 32  GLU A CB  1 
ATOM   240  C CG  . GLU A 1 32  ? -9.936  -1.644  56.186 1.00 13.87 ? 32  GLU A CG  1 
ATOM   241  C CD  . GLU A 1 32  ? -10.889 -0.936  55.227 1.00 15.05 ? 32  GLU A CD  1 
ATOM   242  O OE1 . GLU A 1 32  ? -10.624 -0.928  54.003 1.00 15.05 ? 32  GLU A OE1 1 
ATOM   243  O OE2 . GLU A 1 32  ? -11.911 -0.389  55.707 1.00 14.17 ? 32  GLU A OE2 1 
ATOM   244  N N   . ALA A 1 33  ? -5.698  -0.431  54.462 1.00 13.27 ? 33  ALA A N   1 
ATOM   245  C CA  . ALA A 1 33  ? -4.261  -0.633  54.280 1.00 13.04 ? 33  ALA A CA  1 
ATOM   246  C C   . ALA A 1 33  ? -3.415  0.470   54.923 1.00 13.21 ? 33  ALA A C   1 
ATOM   247  O O   . ALA A 1 33  ? -2.198  0.332   55.064 1.00 12.54 ? 33  ALA A O   1 
ATOM   248  C CB  . ALA A 1 33  ? -3.936  -0.746  52.782 1.00 11.20 ? 33  ALA A CB  1 
ATOM   249  N N   . ASP A 1 34  ? -4.062  1.563   55.314 1.00 13.65 ? 34  ASP A N   1 
ATOM   250  C CA  . ASP A 1 34  ? -3.360  2.673   55.942 1.00 14.66 ? 34  ASP A CA  1 
ATOM   251  C C   . ASP A 1 34  ? -2.711  2.273   57.265 1.00 14.99 ? 34  ASP A C   1 
ATOM   252  O O   . ASP A 1 34  ? -1.706  2.858   57.658 1.00 14.91 ? 34  ASP A O   1 
ATOM   253  C CB  . ASP A 1 34  ? -4.319  3.838   56.177 1.00 16.13 ? 34  ASP A CB  1 
ATOM   254  C CG  . ASP A 1 34  ? -4.634  4.602   54.903 1.00 18.18 ? 34  ASP A CG  1 
ATOM   255  O OD1 . ASP A 1 34  ? -4.128  4.210   53.830 1.00 18.10 ? 34  ASP A OD1 1 
ATOM   256  O OD2 . ASP A 1 34  ? -5.394  5.596   54.978 1.00 20.13 ? 34  ASP A OD2 1 
ATOM   257  N N   . SER A 1 35  ? -3.286  1.280   57.942 1.00 15.66 ? 35  SER A N   1 
ATOM   258  C CA  . SER A 1 35  ? -2.765  0.803   59.231 1.00 16.93 ? 35  SER A CA  1 
ATOM   259  C C   . SER A 1 35  ? -1.819  -0.392  59.088 1.00 16.31 ? 35  SER A C   1 
ATOM   260  O O   . SER A 1 35  ? -1.383  -0.967  60.085 1.00 17.95 ? 35  SER A O   1 
ATOM   261  C CB  . SER A 1 35  ? -3.911  0.394   60.163 1.00 16.15 ? 35  SER A CB  1 
ATOM   262  O OG  . SER A 1 35  ? -4.989  1.308   60.104 1.00 19.56 ? 35  SER A OG  1 
ATOM   263  N N   . ALA A 1 36  ? -1.500  -0.765  57.856 1.00 13.67 ? 36  ALA A N   1 
ATOM   264  C CA  . ALA A 1 36  ? -0.624  -1.902  57.618 1.00 12.19 ? 36  ALA A CA  1 
ATOM   265  C C   . ALA A 1 36  ? 0.848   -1.514  57.491 1.00 12.12 ? 36  ALA A C   1 
ATOM   266  O O   . ALA A 1 36  ? 1.179   -0.433  56.999 1.00 12.62 ? 36  ALA A O   1 
ATOM   267  C CB  . ALA A 1 36  ? -1.071  -2.640  56.357 1.00 11.71 ? 36  ALA A CB  1 
ATOM   268  N N   . PRO A 1 37  ? 1.751   -2.385  57.971 1.00 11.89 ? 37  PRO A N   1 
ATOM   269  C CA  . PRO A 1 37  ? 3.195   -2.135  57.891 1.00 12.02 ? 37  PRO A CA  1 
ATOM   270  C C   . PRO A 1 37  ? 3.700   -2.498  56.489 1.00 10.74 ? 37  PRO A C   1 
ATOM   271  O O   . PRO A 1 37  ? 4.806   -2.126  56.094 1.00 11.49 ? 37  PRO A O   1 
ATOM   272  C CB  . PRO A 1 37  ? 3.777   -3.061  58.955 1.00 12.21 ? 37  PRO A CB  1 
ATOM   273  C CG  . PRO A 1 37  ? 2.816   -4.201  59.010 1.00 11.97 ? 37  PRO A CG  1 
ATOM   274  C CD  . PRO A 1 37  ? 1.450   -3.639  58.688 1.00 12.32 ? 37  PRO A CD  1 
ATOM   275  N N   . HIS A 1 38  ? 2.872   -3.237  55.757 1.00 9.89  ? 38  HIS A N   1 
ATOM   276  C CA  . HIS A 1 38  ? 3.193   -3.683  54.403 1.00 9.55  ? 38  HIS A CA  1 
ATOM   277  C C   . HIS A 1 38  ? 1.894   -3.800  53.617 1.00 10.01 ? 38  HIS A C   1 
ATOM   278  O O   . HIS A 1 38  ? 0.932   -4.427  54.072 1.00 10.12 ? 38  HIS A O   1 
ATOM   279  C CB  . HIS A 1 38  ? 3.897   -5.048  54.440 1.00 10.13 ? 38  HIS A CB  1 
ATOM   280  C CG  . HIS A 1 38  ? 3.917   -5.763  53.120 1.00 11.89 ? 38  HIS A CG  1 
ATOM   281  N ND1 . HIS A 1 38  ? 4.961   -5.650  52.229 1.00 12.20 ? 38  HIS A ND1 1 
ATOM   282  C CD2 . HIS A 1 38  ? 3.021   -6.601  52.545 1.00 13.64 ? 38  HIS A CD2 1 
ATOM   283  C CE1 . HIS A 1 38  ? 4.712   -6.386  51.161 1.00 12.18 ? 38  HIS A CE1 1 
ATOM   284  N NE2 . HIS A 1 38  ? 3.540   -6.974  51.326 1.00 14.86 ? 38  HIS A NE2 1 
ATOM   285  N N   . THR A 1 39  ? 1.876   -3.203  52.434 1.00 9.50  ? 39  THR A N   1 
ATOM   286  C CA  . THR A 1 39  ? 0.695   -3.239  51.589 1.00 10.51 ? 39  THR A CA  1 
ATOM   287  C C   . THR A 1 39  ? 1.073   -3.673  50.175 1.00 10.78 ? 39  THR A C   1 
ATOM   288  O O   . THR A 1 39  ? 2.169   -3.368  49.703 1.00 9.28  ? 39  THR A O   1 
ATOM   289  C CB  . THR A 1 39  ? 0.023   -1.848  51.555 1.00 12.25 ? 39  THR A CB  1 
ATOM   290  O OG1 . THR A 1 39  ? -0.460  -1.521  52.870 1.00 12.45 ? 39  THR A OG1 1 
ATOM   291  C CG2 . THR A 1 39  ? -1.138  -1.832  50.572 1.00 11.13 ? 39  THR A CG2 1 
ATOM   292  N N   . GLU A 1 40  ? 0.166   -4.402  49.521 1.00 10.90 ? 40  GLU A N   1 
ATOM   293  C CA  . GLU A 1 40  ? 0.365   -4.892  48.154 1.00 11.77 ? 40  GLU A CA  1 
ATOM   294  C C   . GLU A 1 40  ? -0.890  -4.641  47.334 1.00 12.15 ? 40  GLU A C   1 
ATOM   295  O O   . GLU A 1 40  ? -1.998  -4.852  47.821 1.00 14.36 ? 40  GLU A O   1 
ATOM   296  C CB  . GLU A 1 40  ? 0.596   -6.403  48.133 1.00 14.00 ? 40  GLU A CB  1 
ATOM   297  C CG  . GLU A 1 40  ? 1.945   -6.883  48.576 1.00 17.54 ? 40  GLU A CG  1 
ATOM   298  C CD  . GLU A 1 40  ? 1.953   -8.381  48.832 1.00 15.72 ? 40  GLU A CD  1 
ATOM   299  O OE1 . GLU A 1 40  ? 1.037   -9.095  48.348 1.00 15.70 ? 40  GLU A OE1 1 
ATOM   300  O OE2 . GLU A 1 40  ? 2.879   -8.845  49.518 1.00 18.71 ? 40  GLU A OE2 1 
ATOM   301  N N   . ALA A 1 41  ? -0.717  -4.208  46.090 1.00 11.47 ? 41  ALA A N   1 
ATOM   302  C CA  . ALA A 1 41  ? -1.843  -3.988  45.189 1.00 10.23 ? 41  ALA A CA  1 
ATOM   303  C C   . ALA A 1 41  ? -1.525  -4.812  43.948 1.00 9.65  ? 41  ALA A C   1 
ATOM   304  O O   . ALA A 1 41  ? -0.377  -4.863  43.509 1.00 9.92  ? 41  ALA A O   1 
ATOM   305  C CB  . ALA A 1 41  ? -1.978  -2.505  44.832 1.00 11.61 ? 41  ALA A CB  1 
ATOM   306  N N   . VAL A 1 42  ? -2.530  -5.478  43.397 1.00 10.13 ? 42  VAL A N   1 
ATOM   307  C CA  . VAL A 1 42  ? -2.317  -6.294  42.211 1.00 11.47 ? 42  VAL A CA  1 
ATOM   308  C C   . VAL A 1 42  ? -2.585  -5.489  40.932 1.00 12.84 ? 42  VAL A C   1 
ATOM   309  O O   . VAL A 1 42  ? -3.692  -4.985  40.722 1.00 15.26 ? 42  VAL A O   1 
ATOM   310  C CB  . VAL A 1 42  ? -3.224  -7.548  42.243 1.00 11.75 ? 42  VAL A CB  1 
ATOM   311  C CG1 . VAL A 1 42  ? -3.026  -8.370  40.984 1.00 13.08 ? 42  VAL A CG1 1 
ATOM   312  C CG2 . VAL A 1 42  ? -2.902  -8.388  43.470 1.00 12.34 ? 42  VAL A CG2 1 
ATOM   313  N N   . LEU A 1 43  ? -1.566  -5.360  40.087 1.00 11.22 ? 43  LEU A N   1 
ATOM   314  C CA  . LEU A 1 43  ? -1.697  -4.624  38.829 1.00 9.90  ? 43  LEU A CA  1 
ATOM   315  C C   . LEU A 1 43  ? -2.254  -5.548  37.747 1.00 11.28 ? 43  LEU A C   1 
ATOM   316  O O   . LEU A 1 43  ? -2.183  -6.769  37.876 1.00 11.51 ? 43  LEU A O   1 
ATOM   317  C CB  . LEU A 1 43  ? -0.334  -4.070  38.404 1.00 10.65 ? 43  LEU A CB  1 
ATOM   318  C CG  . LEU A 1 43  ? 0.438   -3.331  39.510 1.00 12.19 ? 43  LEU A CG  1 
ATOM   319  C CD1 . LEU A 1 43  ? 1.755   -2.800  38.966 1.00 11.54 ? 43  LEU A CD1 1 
ATOM   320  C CD2 . LEU A 1 43  ? -0.418  -2.190  40.068 1.00 12.86 ? 43  LEU A CD2 1 
ATOM   321  N N   . ASP A 1 44  ? -2.825  -4.973  36.692 1.00 11.59 ? 44  ASP A N   1 
ATOM   322  C CA  . ASP A 1 44  ? -3.388  -5.775  35.598 1.00 14.14 ? 44  ASP A CA  1 
ATOM   323  C C   . ASP A 1 44  ? -2.324  -6.739  35.050 1.00 12.34 ? 44  ASP A C   1 
ATOM   324  O O   . ASP A 1 44  ? -1.257  -6.318  34.601 1.00 12.76 ? 44  ASP A O   1 
ATOM   325  C CB  . ASP A 1 44  ? -3.900  -4.850  34.480 1.00 16.14 ? 44  ASP A CB  1 
ATOM   326  C CG  . ASP A 1 44  ? -4.986  -5.499  33.607 1.00 21.63 ? 44  ASP A CG  1 
ATOM   327  O OD1 . ASP A 1 44  ? -4.963  -5.272  32.372 1.00 21.53 ? 44  ASP A OD1 1 
ATOM   328  O OD2 . ASP A 1 44  ? -5.863  -6.222  34.145 1.00 23.58 ? 44  ASP A OD2 1 
ATOM   329  N N   . GLY A 1 45  ? -2.614  -8.035  35.103 1.00 12.51 ? 45  GLY A N   1 
ATOM   330  C CA  . GLY A 1 45  ? -1.665  -9.018  34.617 1.00 12.27 ? 45  GLY A CA  1 
ATOM   331  C C   . GLY A 1 45  ? -1.085  -9.883  35.725 1.00 12.79 ? 45  GLY A C   1 
ATOM   332  O O   . GLY A 1 45  ? -0.536  -10.959 35.461 1.00 12.34 ? 45  GLY A O   1 
ATOM   333  N N   . GLY A 1 46  ? -1.183  -9.415  36.967 1.00 11.77 ? 46  GLY A N   1 
ATOM   334  C CA  . GLY A 1 46  ? -0.673  -10.203 38.076 1.00 10.38 ? 46  GLY A CA  1 
ATOM   335  C C   . GLY A 1 46  ? 0.479   -9.624  38.879 1.00 9.87  ? 46  GLY A C   1 
ATOM   336  O O   . GLY A 1 46  ? 0.616   -9.932  40.058 1.00 8.62  ? 46  GLY A O   1 
ATOM   337  N N   . ILE A 1 47  ? 1.321   -8.811  38.253 1.00 8.62  ? 47  ILE A N   1 
ATOM   338  C CA  . ILE A 1 47  ? 2.442   -8.216  38.971 1.00 9.29  ? 47  ILE A CA  1 
ATOM   339  C C   . ILE A 1 47  ? 1.878   -7.328  40.080 1.00 9.30  ? 47  ILE A C   1 
ATOM   340  O O   . ILE A 1 47  ? 0.833   -6.697  39.910 1.00 8.21  ? 47  ILE A O   1 
ATOM   341  C CB  . ILE A 1 47  ? 3.326   -7.373  38.018 1.00 10.26 ? 47  ILE A CB  1 
ATOM   342  C CG1 . ILE A 1 47  ? 4.109   -8.312  37.086 1.00 9.94  ? 47  ILE A CG1 1 
ATOM   343  C CG2 . ILE A 1 47  ? 4.291   -6.483  38.820 1.00 11.17 ? 47  ILE A CG2 1 
ATOM   344  C CD1 . ILE A 1 47  ? 4.982   -7.587  36.055 1.00 10.88 ? 47  ILE A CD1 1 
ATOM   345  N N   . ARG A 1 48  ? 2.564   -7.294  41.220 1.00 8.17  ? 48  ARG A N   1 
ATOM   346  C CA  . ARG A 1 48  ? 2.121   -6.490  42.350 1.00 7.80  ? 48  ARG A CA  1 
ATOM   347  C C   . ARG A 1 48  ? 3.013   -5.287  42.600 1.00 7.82  ? 48  ARG A C   1 
ATOM   348  O O   . ARG A 1 48  ? 4.195   -5.297  42.267 1.00 7.85  ? 48  ARG A O   1 
ATOM   349  C CB  . ARG A 1 48  ? 2.113   -7.333  43.626 1.00 9.46  ? 48  ARG A CB  1 
ATOM   350  C CG  . ARG A 1 48  ? 0.963   -8.314  43.739 1.00 10.97 ? 48  ARG A CG  1 
ATOM   351  C CD  . ARG A 1 48  ? 1.250   -9.357  44.809 1.00 9.54  ? 48  ARG A CD  1 
ATOM   352  N NE  . ARG A 1 48  ? 2.367   -10.215 44.425 1.00 11.83 ? 48  ARG A NE  1 
ATOM   353  C CZ  . ARG A 1 48  ? 3.159   -10.847 45.287 1.00 13.68 ? 48  ARG A CZ  1 
ATOM   354  N NH1 . ARG A 1 48  ? 2.958   -10.717 46.594 1.00 14.64 ? 48  ARG A NH1 1 
ATOM   355  N NH2 . ARG A 1 48  ? 4.146   -11.617 44.845 1.00 11.19 ? 48  ARG A NH2 1 
ATOM   356  N N   . LEU A 1 49  ? 2.425   -4.243  43.170 1.00 8.24  ? 49  LEU A N   1 
ATOM   357  C CA  . LEU A 1 49  ? 3.171   -3.059  43.564 1.00 7.95  ? 49  LEU A CA  1 
ATOM   358  C C   . LEU A 1 49  ? 3.023   -3.132  45.079 1.00 7.82  ? 49  LEU A C   1 
ATOM   359  O O   . LEU A 1 49  ? 1.909   -3.300  45.576 1.00 8.36  ? 49  LEU A O   1 
ATOM   360  C CB  . LEU A 1 49  ? 2.525   -1.776  43.042 1.00 7.25  ? 49  LEU A CB  1 
ATOM   361  C CG  . LEU A 1 49  ? 3.145   -0.484  43.584 1.00 7.91  ? 49  LEU A CG  1 
ATOM   362  C CD1 . LEU A 1 49  ? 4.655   -0.480  43.375 1.00 9.14  ? 49  LEU A CD1 1 
ATOM   363  C CD2 . LEU A 1 49  ? 2.516   0.707   42.882 1.00 9.80  ? 49  LEU A CD2 1 
ATOM   364  N N   . ALA A 1 50  ? 4.129   -3.036  45.809 1.00 7.40  ? 50  ALA A N   1 
ATOM   365  C CA  . ALA A 1 50  ? 4.067   -3.113  47.262 1.00 8.04  ? 50  ALA A CA  1 
ATOM   366  C C   . ALA A 1 50  ? 4.698   -1.913  47.960 1.00 8.52  ? 50  ALA A C   1 
ATOM   367  O O   . ALA A 1 50  ? 5.542   -1.214  47.395 1.00 6.66  ? 50  ALA A O   1 
ATOM   368  C CB  . ALA A 1 50  ? 4.731   -4.404  47.744 1.00 8.56  ? 50  ALA A CB  1 
ATOM   369  N N   . TRP A 1 51  ? 4.273   -1.698  49.201 1.00 6.93  ? 51  TRP A N   1 
ATOM   370  C CA  . TRP A 1 51  ? 4.772   -0.611  50.033 1.00 8.48  ? 51  TRP A CA  1 
ATOM   371  C C   . TRP A 1 51  ? 5.172   -1.202  51.383 1.00 8.33  ? 51  TRP A C   1 
ATOM   372  O O   . TRP A 1 51  ? 4.411   -1.960  51.977 1.00 9.10  ? 51  TRP A O   1 
ATOM   373  C CB  . TRP A 1 51  ? 3.682   0.442   50.271 1.00 8.35  ? 51  TRP A CB  1 
ATOM   374  C CG  . TRP A 1 51  ? 3.174   1.149   49.045 1.00 9.49  ? 51  TRP A CG  1 
ATOM   375  C CD1 . TRP A 1 51  ? 3.541   2.392   48.603 1.00 10.48 ? 51  TRP A CD1 1 
ATOM   376  C CD2 . TRP A 1 51  ? 2.172   0.680   48.129 1.00 9.22  ? 51  TRP A CD2 1 
ATOM   377  N NE1 . TRP A 1 51  ? 2.830   2.724   47.474 1.00 11.39 ? 51  TRP A NE1 1 
ATOM   378  C CE2 . TRP A 1 51  ? 1.983   1.692   47.162 1.00 10.03 ? 51  TRP A CE2 1 
ATOM   379  C CE3 . TRP A 1 51  ? 1.414   -0.498  48.035 1.00 9.32  ? 51  TRP A CE3 1 
ATOM   380  C CZ2 . TRP A 1 51  ? 1.067   1.563   46.110 1.00 9.43  ? 51  TRP A CZ2 1 
ATOM   381  C CZ3 . TRP A 1 51  ? 0.502   -0.623  46.988 1.00 9.32  ? 51  TRP A CZ3 1 
ATOM   382  C CH2 . TRP A 1 51  ? 0.340   0.403   46.042 1.00 9.79  ? 51  TRP A CH2 1 
ATOM   383  N N   . ASP A 1 52  ? 6.364   -0.859  51.856 1.00 7.78  ? 52  ASP A N   1 
ATOM   384  C CA  . ASP A 1 52  ? 6.850   -1.334  53.150 1.00 7.98  ? 52  ASP A CA  1 
ATOM   385  C C   . ASP A 1 52  ? 7.340   -0.144  53.952 1.00 8.77  ? 52  ASP A C   1 
ATOM   386  O O   . ASP A 1 52  ? 8.078   0.691   53.435 1.00 8.54  ? 52  ASP A O   1 
ATOM   387  C CB  . ASP A 1 52  ? 8.023   -2.293  52.970 1.00 11.02 ? 52  ASP A CB  1 
ATOM   388  C CG  . ASP A 1 52  ? 7.614   -3.602  52.348 1.00 11.74 ? 52  ASP A CG  1 
ATOM   389  O OD1 . ASP A 1 52  ? 6.858   -4.350  52.998 1.00 14.85 ? 52  ASP A OD1 1 
ATOM   390  O OD2 . ASP A 1 52  ? 8.052   -3.884  51.213 1.00 13.54 ? 52  ASP A OD2 1 
ATOM   391  N N   . THR A 1 53  ? 6.934   -0.051  55.212 1.00 9.46  ? 53  THR A N   1 
ATOM   392  C CA  . THR A 1 53  ? 7.397   1.051   56.039 1.00 8.86  ? 53  THR A CA  1 
ATOM   393  C C   . THR A 1 53  ? 8.872   0.828   56.364 1.00 9.21  ? 53  THR A C   1 
ATOM   394  O O   . THR A 1 53  ? 9.380   -0.294  56.266 1.00 10.08 ? 53  THR A O   1 
ATOM   395  C CB  . THR A 1 53  ? 6.622   1.127   57.350 1.00 10.24 ? 53  THR A CB  1 
ATOM   396  O OG1 . THR A 1 53  ? 6.849   -0.073  58.095 1.00 11.38 ? 53  THR A OG1 1 
ATOM   397  C CG2 . THR A 1 53  ? 5.135   1.289   57.083 1.00 12.27 ? 53  THR A CG2 1 
ATOM   398  N N   . VAL A 1 54  ? 9.564   1.895   56.751 1.00 11.07 ? 54  VAL A N   1 
ATOM   399  C CA  . VAL A 1 54  ? 10.979  1.799   57.095 1.00 11.42 ? 54  VAL A CA  1 
ATOM   400  C C   . VAL A 1 54  ? 11.205  0.760   58.197 1.00 10.82 ? 54  VAL A C   1 
ATOM   401  O O   . VAL A 1 54  ? 12.158  -0.011  58.139 1.00 12.22 ? 54  VAL A O   1 
ATOM   402  C CB  . VAL A 1 54  ? 11.532  3.184   57.537 1.00 11.61 ? 54  VAL A CB  1 
ATOM   403  C CG1 . VAL A 1 54  ? 12.920  3.042   58.151 1.00 12.82 ? 54  VAL A CG1 1 
ATOM   404  C CG2 . VAL A 1 54  ? 11.586  4.113   56.331 1.00 11.88 ? 54  VAL A CG2 1 
ATOM   405  N N   . GLU A 1 55  ? 10.322  0.726   59.192 1.00 12.96 ? 55  GLU A N   1 
ATOM   406  C CA  . GLU A 1 55  ? 10.453  -0.238  60.282 1.00 13.21 ? 55  GLU A CA  1 
ATOM   407  C C   . GLU A 1 55  ? 10.356  -1.672  59.757 1.00 13.06 ? 55  GLU A C   1 
ATOM   408  O O   . GLU A 1 55  ? 11.090  -2.556  60.206 1.00 13.62 ? 55  GLU A O   1 
ATOM   409  C CB  . GLU A 1 55  ? 9.372   -0.004  61.350 1.00 18.16 ? 55  GLU A CB  1 
ATOM   410  C CG  . GLU A 1 55  ? 9.340   1.409   61.949 1.00 28.57 ? 55  GLU A CG  1 
ATOM   411  C CD  . GLU A 1 55  ? 10.683  1.862   62.529 1.00 34.53 ? 55  GLU A CD  1 
ATOM   412  O OE1 . GLU A 1 55  ? 11.333  2.753   61.922 1.00 36.38 ? 55  GLU A OE1 1 
ATOM   413  O OE2 . GLU A 1 55  ? 11.082  1.335   63.597 1.00 39.06 ? 55  GLU A OE2 1 
ATOM   414  N N   . THR A 1 56  ? 9.449   -1.911  58.813 1.00 11.58 ? 56  THR A N   1 
ATOM   415  C CA  . THR A 1 56  ? 9.300   -3.246  58.241 1.00 12.03 ? 56  THR A CA  1 
ATOM   416  C C   . THR A 1 56  ? 10.590  -3.661  57.530 1.00 12.36 ? 56  THR A C   1 
ATOM   417  O O   . THR A 1 56  ? 11.061  -4.789  57.682 1.00 11.81 ? 56  THR A O   1 
ATOM   418  C CB  . THR A 1 56  ? 8.152   -3.293  57.236 1.00 13.61 ? 56  THR A CB  1 
ATOM   419  O OG1 . THR A 1 56  ? 6.914   -3.125  57.934 1.00 14.07 ? 56  THR A OG1 1 
ATOM   420  C CG2 . THR A 1 56  ? 8.142   -4.623  56.491 1.00 12.45 ? 56  THR A CG2 1 
ATOM   421  N N   . VAL A 1 57  ? 11.157  -2.742  56.753 1.00 10.78 ? 57  VAL A N   1 
ATOM   422  C CA  . VAL A 1 57  ? 12.394  -3.020  56.040 1.00 10.37 ? 57  VAL A CA  1 
ATOM   423  C C   . VAL A 1 57  ? 13.512  -3.348  57.033 1.00 11.88 ? 57  VAL A C   1 
ATOM   424  O O   . VAL A 1 57  ? 14.232  -4.336  56.873 1.00 12.13 ? 57  VAL A O   1 
ATOM   425  C CB  . VAL A 1 57  ? 12.821  -1.809  55.189 1.00 11.27 ? 57  VAL A CB  1 
ATOM   426  C CG1 . VAL A 1 57  ? 14.226  -2.032  54.631 1.00 9.62  ? 57  VAL A CG1 1 
ATOM   427  C CG2 . VAL A 1 57  ? 11.814  -1.589  54.070 1.00 11.46 ? 57  VAL A CG2 1 
ATOM   428  N N   . ARG A 1 58  ? 13.642  -2.526  58.067 1.00 12.26 ? 58  ARG A N   1 
ATOM   429  C CA  . ARG A 1 58  ? 14.677  -2.740  59.066 1.00 15.08 ? 58  ARG A CA  1 
ATOM   430  C C   . ARG A 1 58  ? 14.515  -4.029  59.867 1.00 17.48 ? 58  ARG A C   1 
ATOM   431  O O   . ARG A 1 58  ? 15.465  -4.485  60.502 1.00 18.77 ? 58  ARG A O   1 
ATOM   432  C CB  . ARG A 1 58  ? 14.740  -1.549  60.012 1.00 15.29 ? 58  ARG A CB  1 
ATOM   433  C CG  . ARG A 1 58  ? 15.308  -0.318  59.352 1.00 18.22 ? 58  ARG A CG  1 
ATOM   434  C CD  . ARG A 1 58  ? 16.242  0.432   60.277 1.00 21.42 ? 58  ARG A CD  1 
ATOM   435  N NE  . ARG A 1 58  ? 16.832  1.586   59.608 1.00 24.27 ? 58  ARG A NE  1 
ATOM   436  C CZ  . ARG A 1 58  ? 16.563  2.852   59.916 1.00 26.27 ? 58  ARG A CZ  1 
ATOM   437  N NH1 . ARG A 1 58  ? 15.709  3.139   60.890 1.00 28.42 ? 58  ARG A NH1 1 
ATOM   438  N NH2 . ARG A 1 58  ? 17.145  3.835   59.241 1.00 28.49 ? 58  ARG A NH2 1 
ATOM   439  N N   . SER A 1 59  ? 13.327  -4.625  59.840 1.00 18.67 ? 59  SER A N   1 
ATOM   440  C CA  . SER A 1 59  ? 13.116  -5.869  60.577 1.00 22.58 ? 59  SER A CA  1 
ATOM   441  C C   . SER A 1 59  ? 14.052  -6.967  60.061 1.00 24.47 ? 59  SER A C   1 
ATOM   442  O O   . SER A 1 59  ? 14.544  -7.781  60.844 1.00 25.45 ? 59  SER A O   1 
ATOM   443  C CB  . SER A 1 59  ? 11.647  -6.314  60.487 1.00 24.37 ? 59  SER A CB  1 
ATOM   444  O OG  . SER A 1 59  ? 11.342  -6.910  59.239 1.00 29.81 ? 59  SER A OG  1 
ATOM   445  N N   . TYR A 1 60  ? 14.309  -6.981  58.751 1.00 24.95 ? 60  TYR A N   1 
ATOM   446  C CA  . TYR A 1 60  ? 15.207  -7.978  58.165 1.00 25.17 ? 60  TYR A CA  1 
ATOM   447  C C   . TYR A 1 60  ? 16.427  -7.346  57.491 1.00 25.23 ? 60  TYR A C   1 
ATOM   448  O O   . TYR A 1 60  ? 17.351  -8.048  57.080 1.00 26.08 ? 60  TYR A O   1 
ATOM   449  C CB  . TYR A 1 60  ? 14.456  -8.874  57.165 1.00 26.50 ? 60  TYR A CB  1 
ATOM   450  C CG  . TYR A 1 60  ? 13.588  -8.144  56.158 1.00 28.55 ? 60  TYR A CG  1 
ATOM   451  C CD1 . TYR A 1 60  ? 14.138  -7.585  55.003 1.00 29.43 ? 60  TYR A CD1 1 
ATOM   452  C CD2 . TYR A 1 60  ? 12.209  -8.040  56.346 1.00 28.28 ? 60  TYR A CD2 1 
ATOM   453  C CE1 . TYR A 1 60  ? 13.331  -6.940  54.055 1.00 29.01 ? 60  TYR A CE1 1 
ATOM   454  C CE2 . TYR A 1 60  ? 11.397  -7.400  55.409 1.00 28.77 ? 60  TYR A CE2 1 
ATOM   455  C CZ  . TYR A 1 60  ? 11.961  -6.854  54.265 1.00 29.59 ? 60  TYR A CZ  1 
ATOM   456  O OH  . TYR A 1 60  ? 11.150  -6.242  53.330 1.00 27.96 ? 60  TYR A OH  1 
ATOM   457  N N   . ASP A 1 61  ? 16.417  -6.019  57.376 1.00 24.21 ? 61  ASP A N   1 
ATOM   458  C CA  . ASP A 1 61  ? 17.520  -5.259  56.782 1.00 24.34 ? 61  ASP A CA  1 
ATOM   459  C C   . ASP A 1 61  ? 17.800  -4.118  57.765 1.00 24.14 ? 61  ASP A C   1 
ATOM   460  O O   . ASP A 1 61  ? 17.532  -2.949  57.481 1.00 24.59 ? 61  ASP A O   1 
ATOM   461  C CB  . ASP A 1 61  ? 17.107  -4.693  55.419 1.00 25.47 ? 61  ASP A CB  1 
ATOM   462  C CG  . ASP A 1 61  ? 18.295  -4.420  54.507 1.00 26.63 ? 61  ASP A CG  1 
ATOM   463  O OD1 . ASP A 1 61  ? 19.448  -4.434  54.991 1.00 27.81 ? 61  ASP A OD1 1 
ATOM   464  O OD2 . ASP A 1 61  ? 18.071  -4.192  53.299 1.00 28.14 ? 61  ASP A OD2 1 
ATOM   465  N N   . PRO A 1 62  ? 18.353  -4.455  58.941 1.00 23.21 ? 62  PRO A N   1 
ATOM   466  C CA  . PRO A 1 62  ? 18.686  -3.519  60.023 1.00 23.30 ? 62  PRO A CA  1 
ATOM   467  C C   . PRO A 1 62  ? 19.533  -2.285  59.726 1.00 22.02 ? 62  PRO A C   1 
ATOM   468  O O   . PRO A 1 62  ? 19.360  -1.257  60.377 1.00 21.83 ? 62  PRO A O   1 
ATOM   469  C CB  . PRO A 1 62  ? 19.341  -4.407  61.090 1.00 23.86 ? 62  PRO A CB  1 
ATOM   470  C CG  . PRO A 1 62  ? 19.735  -5.657  60.377 1.00 24.14 ? 62  PRO A CG  1 
ATOM   471  C CD  . PRO A 1 62  ? 18.718  -5.838  59.291 1.00 25.04 ? 62  PRO A CD  1 
ATOM   472  N N   . GLU A 1 63  ? 20.441  -2.372  58.759 1.00 22.89 ? 63  GLU A N   1 
ATOM   473  C CA  . GLU A 1 63  ? 21.311  -1.236  58.450 1.00 23.88 ? 63  GLU A CA  1 
ATOM   474  C C   . GLU A 1 63  ? 20.777  -0.288  57.379 1.00 21.95 ? 63  GLU A C   1 
ATOM   475  O O   . GLU A 1 63  ? 21.463  0.646   56.966 1.00 21.22 ? 63  GLU A O   1 
ATOM   476  C CB  . GLU A 1 63  ? 22.706  -1.734  58.044 1.00 28.23 ? 63  GLU A CB  1 
ATOM   477  C CG  . GLU A 1 63  ? 23.302  -2.797  58.972 1.00 34.30 ? 63  GLU A CG  1 
ATOM   478  C CD  . GLU A 1 63  ? 23.683  -2.252  60.346 1.00 38.56 ? 63  GLU A CD  1 
ATOM   479  O OE1 . GLU A 1 63  ? 23.552  -3.005  61.340 1.00 40.86 ? 63  GLU A OE1 1 
ATOM   480  O OE2 . GLU A 1 63  ? 24.112  -1.077  60.433 1.00 40.76 ? 63  GLU A OE2 1 
ATOM   481  N N   . TRP A 1 64  ? 19.548  -0.525  56.936 1.00 21.39 ? 64  TRP A N   1 
ATOM   482  C CA  . TRP A 1 64  ? 18.943  0.314   55.913 1.00 18.68 ? 64  TRP A CA  1 
ATOM   483  C C   . TRP A 1 64  ? 18.920  1.776   56.325 1.00 19.01 ? 64  TRP A C   1 
ATOM   484  O O   . TRP A 1 64  ? 18.563  2.107   57.458 1.00 19.61 ? 64  TRP A O   1 
ATOM   485  C CB  . TRP A 1 64  ? 17.514  -0.138  55.627 1.00 16.50 ? 64  TRP A CB  1 
ATOM   486  C CG  . TRP A 1 64  ? 16.883  0.636   54.516 1.00 15.70 ? 64  TRP A CG  1 
ATOM   487  C CD1 . TRP A 1 64  ? 16.882  0.310   53.191 1.00 14.55 ? 64  TRP A CD1 1 
ATOM   488  C CD2 . TRP A 1 64  ? 16.177  1.879   54.625 1.00 14.08 ? 64  TRP A CD2 1 
ATOM   489  N NE1 . TRP A 1 64  ? 16.222  1.272   52.468 1.00 13.22 ? 64  TRP A NE1 1 
ATOM   490  C CE2 . TRP A 1 64  ? 15.777  2.246   53.320 1.00 11.91 ? 64  TRP A CE2 1 
ATOM   491  C CE3 . TRP A 1 64  ? 15.844  2.719   55.696 1.00 14.69 ? 64  TRP A CE3 1 
ATOM   492  C CZ2 . TRP A 1 64  ? 15.059  3.417   53.055 1.00 12.38 ? 64  TRP A CZ2 1 
ATOM   493  C CZ3 . TRP A 1 64  ? 15.128  3.887   55.434 1.00 13.30 ? 64  TRP A CZ3 1 
ATOM   494  C CH2 . TRP A 1 64  ? 14.744  4.223   54.121 1.00 14.40 ? 64  TRP A CH2 1 
ATOM   495  N N   . GLN A 1 65  ? 19.303  2.645   55.396 1.00 18.93 ? 65  GLN A N   1 
ATOM   496  C CA  . GLN A 1 65  ? 19.312  4.087   55.625 1.00 19.01 ? 65  GLN A CA  1 
ATOM   497  C C   . GLN A 1 65  ? 18.784  4.770   54.367 1.00 20.18 ? 65  GLN A C   1 
ATOM   498  O O   . GLN A 1 65  ? 19.126  4.368   53.252 1.00 20.03 ? 65  GLN A O   1 
ATOM   499  C CB  . GLN A 1 65  ? 20.735  4.592   55.918 1.00 21.36 ? 65  GLN A CB  1 
ATOM   500  C CG  . GLN A 1 65  ? 21.372  4.048   57.199 1.00 20.19 ? 65  GLN A CG  1 
ATOM   501  C CD  . GLN A 1 65  ? 20.729  4.575   58.480 1.00 21.30 ? 65  GLN A CD  1 
ATOM   502  O OE1 . GLN A 1 65  ? 21.070  4.127   59.578 1.00 22.70 ? 65  GLN A OE1 1 
ATOM   503  N NE2 . GLN A 1 65  ? 19.800  5.520   58.347 1.00 18.88 ? 65  GLN A NE2 1 
ATOM   504  N N   . ALA A 1 66  ? 17.944  5.788   54.540 1.00 19.79 ? 66  ALA A N   1 
ATOM   505  C CA  . ALA A 1 66  ? 17.393  6.504   53.393 1.00 21.07 ? 66  ALA A CA  1 
ATOM   506  C C   . ALA A 1 66  ? 18.549  7.018   52.540 1.00 21.25 ? 66  ALA A C   1 
ATOM   507  O O   . ALA A 1 66  ? 19.486  7.636   53.055 1.00 21.67 ? 66  ALA A O   1 
ATOM   508  C CB  . ALA A 1 66  ? 16.527  7.664   53.859 1.00 21.68 ? 66  ALA A CB  1 
ATOM   509  N N   . PRO A 1 67  ? 18.503  6.765   51.222 1.00 20.05 ? 67  PRO A N   1 
ATOM   510  C CA  . PRO A 1 67  ? 19.588  7.232   50.352 1.00 18.93 ? 67  PRO A CA  1 
ATOM   511  C C   . PRO A 1 67  ? 19.541  8.733   50.102 1.00 18.96 ? 67  PRO A C   1 
ATOM   512  O O   . PRO A 1 67  ? 18.481  9.354   50.205 1.00 20.10 ? 67  PRO A O   1 
ATOM   513  C CB  . PRO A 1 67  ? 19.366  6.451   49.062 1.00 16.51 ? 67  PRO A CB  1 
ATOM   514  C CG  . PRO A 1 67  ? 17.872  6.251   49.024 1.00 18.27 ? 67  PRO A CG  1 
ATOM   515  C CD  . PRO A 1 67  ? 17.459  6.048   50.463 1.00 18.77 ? 67  PRO A CD  1 
ATOM   516  N N   . THR A 1 68  ? 20.696  9.310   49.783 1.00 18.32 ? 68  THR A N   1 
ATOM   517  C CA  . THR A 1 68  ? 20.787  10.730  49.459 1.00 18.27 ? 68  THR A CA  1 
ATOM   518  C C   . THR A 1 68  ? 21.348  10.774  48.045 1.00 16.68 ? 68  THR A C   1 
ATOM   519  O O   . THR A 1 68  ? 22.053  9.857   47.634 1.00 16.07 ? 68  THR A O   1 
ATOM   520  C CB  . THR A 1 68  ? 21.745  11.507  50.414 1.00 19.48 ? 68  THR A CB  1 
ATOM   521  O OG1 . THR A 1 68  ? 23.018  10.849  50.473 1.00 19.45 ? 68  THR A OG1 1 
ATOM   522  C CG2 . THR A 1 68  ? 21.144  11.604  51.814 1.00 19.92 ? 68  THR A CG2 1 
ATOM   523  N N   . GLY A 1 69  ? 21.035  11.829  47.304 1.00 17.44 ? 69  GLY A N   1 
ATOM   524  C CA  . GLY A 1 69  ? 21.521  11.924  45.939 1.00 18.00 ? 69  GLY A CA  1 
ATOM   525  C C   . GLY A 1 69  ? 20.409  11.707  44.923 1.00 18.44 ? 69  GLY A C   1 
ATOM   526  O O   . GLY A 1 69  ? 19.226  11.717  45.272 1.00 18.70 ? 69  GLY A O   1 
ATOM   527  N N   . GLY A 1 70  ? 20.789  11.496  43.666 1.00 17.39 ? 70  GLY A N   1 
ATOM   528  C CA  . GLY A 1 70  ? 19.813  11.302  42.611 1.00 16.13 ? 70  GLY A CA  1 
ATOM   529  C C   . GLY A 1 70  ? 18.928  10.077  42.739 1.00 15.88 ? 70  GLY A C   1 
ATOM   530  O O   . GLY A 1 70  ? 19.321  9.061   43.313 1.00 16.21 ? 70  GLY A O   1 
ATOM   531  N N   . HIS A 1 71  ? 17.720  10.177  42.194 1.00 15.59 ? 71  HIS A N   1 
ATOM   532  C CA  . HIS A 1 71  ? 16.770  9.073   42.228 1.00 13.57 ? 71  HIS A CA  1 
ATOM   533  C C   . HIS A 1 71  ? 17.334  7.895   41.442 1.00 12.35 ? 71  HIS A C   1 
ATOM   534  O O   . HIS A 1 71  ? 18.009  8.075   40.431 1.00 12.60 ? 71  HIS A O   1 
ATOM   535  C CB  . HIS A 1 71  ? 15.403  9.510   41.654 1.00 13.67 ? 71  HIS A CB  1 
ATOM   536  C CG  . HIS A 1 71  ? 15.420  9.838   40.191 1.00 14.66 ? 71  HIS A CG  1 
ATOM   537  N ND1 . HIS A 1 71  ? 15.870  11.046  39.699 1.00 14.82 ? 71  HIS A ND1 1 
ATOM   538  C CD2 . HIS A 1 71  ? 14.993  9.134   39.115 1.00 15.51 ? 71  HIS A CD2 1 
ATOM   539  C CE1 . HIS A 1 71  ? 15.716  11.071  38.386 1.00 14.29 ? 71  HIS A CE1 1 
ATOM   540  N NE2 . HIS A 1 71  ? 15.186  9.923   38.008 1.00 13.40 ? 71  HIS A NE2 1 
ATOM   541  N N   . ARG A 1 72  ? 17.069  6.688   41.925 1.00 11.09 ? 72  ARG A N   1 
ATOM   542  C CA  . ARG A 1 72  ? 17.563  5.480   41.272 1.00 10.60 ? 72  ARG A CA  1 
ATOM   543  C C   . ARG A 1 72  ? 16.532  4.909   40.306 1.00 9.28  ? 72  ARG A C   1 
ATOM   544  O O   . ARG A 1 72  ? 16.861  4.071   39.468 1.00 9.67  ? 72  ARG A O   1 
ATOM   545  C CB  . ARG A 1 72  ? 17.870  4.396   42.314 1.00 9.30  ? 72  ARG A CB  1 
ATOM   546  C CG  . ARG A 1 72  ? 19.150  4.591   43.114 1.00 11.64 ? 72  ARG A CG  1 
ATOM   547  C CD  . ARG A 1 72  ? 19.601  3.264   43.715 1.00 12.65 ? 72  ARG A CD  1 
ATOM   548  N NE  . ARG A 1 72  ? 20.785  3.390   44.563 1.00 13.13 ? 72  ARG A NE  1 
ATOM   549  C CZ  . ARG A 1 72  ? 20.751  3.533   45.887 1.00 14.08 ? 72  ARG A CZ  1 
ATOM   550  N NH1 . ARG A 1 72  ? 19.592  3.573   46.532 1.00 11.97 ? 72  ARG A NH1 1 
ATOM   551  N NH2 . ARG A 1 72  ? 21.882  3.630   46.571 1.00 14.39 ? 72  ARG A NH2 1 
ATOM   552  N N   . PHE A 1 73  ? 15.290  5.364   40.424 1.00 8.70  ? 73  PHE A N   1 
ATOM   553  C CA  . PHE A 1 73  ? 14.218  4.811   39.607 1.00 7.85  ? 73  PHE A CA  1 
ATOM   554  C C   . PHE A 1 73  ? 13.069  5.792   39.438 1.00 7.96  ? 73  PHE A C   1 
ATOM   555  O O   . PHE A 1 73  ? 13.076  6.879   40.011 1.00 8.57  ? 73  PHE A O   1 
ATOM   556  C CB  . PHE A 1 73  ? 13.676  3.548   40.293 1.00 6.87  ? 73  PHE A CB  1 
ATOM   557  C CG  . PHE A 1 73  ? 12.756  3.848   41.458 1.00 7.18  ? 73  PHE A CG  1 
ATOM   558  C CD1 . PHE A 1 73  ? 13.248  4.445   42.619 1.00 7.48  ? 73  PHE A CD1 1 
ATOM   559  C CD2 . PHE A 1 73  ? 11.387  3.599   41.366 1.00 7.90  ? 73  PHE A CD2 1 
ATOM   560  C CE1 . PHE A 1 73  ? 12.390  4.793   43.663 1.00 8.80  ? 73  PHE A CE1 1 
ATOM   561  C CE2 . PHE A 1 73  ? 10.521  3.943   42.401 1.00 7.29  ? 73  PHE A CE2 1 
ATOM   562  C CZ  . PHE A 1 73  ? 11.023  4.543   43.553 1.00 9.32  ? 73  PHE A CZ  1 
ATOM   563  N N   . ALA A 1 74  ? 12.072  5.374   38.659 1.00 7.67  ? 74  ALA A N   1 
ATOM   564  C CA  . ALA A 1 74  ? 10.865  6.162   38.425 1.00 7.81  ? 74  ALA A CA  1 
ATOM   565  C C   . ALA A 1 74  ? 9.719   5.216   38.088 1.00 7.66  ? 74  ALA A C   1 
ATOM   566  O O   . ALA A 1 74  ? 9.936   4.143   37.527 1.00 8.88  ? 74  ALA A O   1 
ATOM   567  C CB  . ALA A 1 74  ? 11.080  7.147   37.277 1.00 8.26  ? 74  ALA A CB  1 
ATOM   568  N N   . ILE A 1 75  ? 8.506   5.611   38.455 1.00 7.87  ? 75  ILE A N   1 
ATOM   569  C CA  . ILE A 1 75  ? 7.305   4.830   38.159 1.00 7.63  ? 75  ILE A CA  1 
ATOM   570  C C   . ILE A 1 75  ? 6.493   5.664   37.168 1.00 9.13  ? 75  ILE A C   1 
ATOM   571  O O   . ILE A 1 75  ? 6.126   6.809   37.455 1.00 10.48 ? 75  ILE A O   1 
ATOM   572  C CB  . ILE A 1 75  ? 6.446   4.578   39.421 1.00 9.14  ? 75  ILE A CB  1 
ATOM   573  C CG1 . ILE A 1 75  ? 7.258   3.818   40.478 1.00 8.37  ? 75  ILE A CG1 1 
ATOM   574  C CG2 . ILE A 1 75  ? 5.201   3.770   39.048 1.00 9.28  ? 75  ILE A CG2 1 
ATOM   575  C CD1 . ILE A 1 75  ? 6.512   3.605   41.780 1.00 8.59  ? 75  ILE A CD1 1 
ATOM   576  N N   . ALA A 1 76  ? 6.208   5.085   36.005 1.00 8.69  ? 76  ALA A N   1 
ATOM   577  C CA  . ALA A 1 76  ? 5.472   5.788   34.960 1.00 8.57  ? 76  ALA A CA  1 
ATOM   578  C C   . ALA A 1 76  ? 4.035   5.300   34.773 1.00 8.38  ? 76  ALA A C   1 
ATOM   579  O O   . ALA A 1 76  ? 3.790   4.109   34.578 1.00 7.66  ? 76  ALA A O   1 
ATOM   580  C CB  . ALA A 1 76  ? 6.234   5.677   33.646 1.00 6.86  ? 76  ALA A CB  1 
ATOM   581  N N   . PHE A 1 77  ? 3.092   6.239   34.828 1.00 8.16  ? 77  PHE A N   1 
ATOM   582  C CA  . PHE A 1 77  ? 1.677   5.933   34.647 1.00 8.07  ? 77  PHE A CA  1 
ATOM   583  C C   . PHE A 1 77  ? 1.233   6.392   33.267 1.00 9.44  ? 77  PHE A C   1 
ATOM   584  O O   . PHE A 1 77  ? 1.565   7.496   32.821 1.00 8.73  ? 77  PHE A O   1 
ATOM   585  C CB  . PHE A 1 77  ? 0.822   6.648   35.696 1.00 9.86  ? 77  PHE A CB  1 
ATOM   586  C CG  . PHE A 1 77  ? 0.993   6.117   37.090 1.00 9.98  ? 77  PHE A CG  1 
ATOM   587  C CD1 . PHE A 1 77  ? 2.156   6.386   37.816 1.00 11.06 ? 77  PHE A CD1 1 
ATOM   588  C CD2 . PHE A 1 77  ? -0.011  5.362   37.687 1.00 11.55 ? 77  PHE A CD2 1 
ATOM   589  C CE1 . PHE A 1 77  ? 2.313   5.909   39.119 1.00 11.57 ? 77  PHE A CE1 1 
ATOM   590  C CE2 . PHE A 1 77  ? 0.136   4.881   38.991 1.00 12.10 ? 77  PHE A CE2 1 
ATOM   591  C CZ  . PHE A 1 77  ? 1.300   5.156   39.706 1.00 11.55 ? 77  PHE A CZ  1 
ATOM   592  N N   . GLU A 1 78  ? 0.476   5.533   32.598 1.00 10.05 ? 78  GLU A N   1 
ATOM   593  C CA  . GLU A 1 78  ? -0.026  5.846   31.274 1.00 11.76 ? 78  GLU A CA  1 
ATOM   594  C C   . GLU A 1 78  ? -1.483  6.300   31.321 1.00 11.05 ? 78  GLU A C   1 
ATOM   595  O O   . GLU A 1 78  ? -2.302  5.751   32.063 1.00 10.50 ? 78  GLU A O   1 
ATOM   596  C CB  . GLU A 1 78  ? 0.101   4.632   30.365 1.00 11.99 ? 78  GLU A CB  1 
ATOM   597  C CG  . GLU A 1 78  ? -0.529  4.843   29.011 1.00 15.28 ? 78  GLU A CG  1 
ATOM   598  C CD  . GLU A 1 78  ? -0.131  3.782   28.017 1.00 18.97 ? 78  GLU A CD  1 
ATOM   599  O OE1 . GLU A 1 78  ? -0.168  4.066   26.800 1.00 22.40 ? 78  GLU A OE1 1 
ATOM   600  O OE2 . GLU A 1 78  ? 0.218   2.664   28.451 1.00 22.98 ? 78  GLU A OE2 1 
ATOM   601  N N   . PHE A 1 79  ? -1.791  7.313   30.519 1.00 10.30 ? 79  PHE A N   1 
ATOM   602  C CA  . PHE A 1 79  ? -3.134  7.863   30.429 1.00 11.38 ? 79  PHE A CA  1 
ATOM   603  C C   . PHE A 1 79  ? -3.613  7.714   28.984 1.00 10.22 ? 79  PHE A C   1 
ATOM   604  O O   . PHE A 1 79  ? -2.809  7.538   28.072 1.00 9.99  ? 79  PHE A O   1 
ATOM   605  C CB  . PHE A 1 79  ? -3.128  9.344   30.822 1.00 10.70 ? 79  PHE A CB  1 
ATOM   606  C CG  . PHE A 1 79  ? -2.775  9.584   32.252 1.00 11.00 ? 79  PHE A CG  1 
ATOM   607  C CD1 . PHE A 1 79  ? -1.461  9.443   32.688 1.00 11.29 ? 79  PHE A CD1 1 
ATOM   608  C CD2 . PHE A 1 79  ? -3.753  9.922   33.170 1.00 11.48 ? 79  PHE A CD2 1 
ATOM   609  C CE1 . PHE A 1 79  ? -1.125  9.631   34.024 1.00 10.39 ? 79  PHE A CE1 1 
ATOM   610  C CE2 . PHE A 1 79  ? -3.432  10.115  34.511 1.00 13.90 ? 79  PHE A CE2 1 
ATOM   611  C CZ  . PHE A 1 79  ? -2.109  9.967   34.936 1.00 12.62 ? 79  PHE A CZ  1 
ATOM   612  N N   . PRO A 1 80  ? -4.933  7.760   28.764 1.00 11.28 ? 80  PRO A N   1 
ATOM   613  C CA  . PRO A 1 80  ? -5.429  7.620   27.394 1.00 12.73 ? 80  PRO A CA  1 
ATOM   614  C C   . PRO A 1 80  ? -5.134  8.796   26.454 1.00 13.17 ? 80  PRO A C   1 
ATOM   615  O O   . PRO A 1 80  ? -4.929  8.603   25.259 1.00 15.26 ? 80  PRO A O   1 
ATOM   616  C CB  . PRO A 1 80  ? -6.926  7.390   27.575 1.00 13.90 ? 80  PRO A CB  1 
ATOM   617  C CG  . PRO A 1 80  ? -7.251  8.014   28.872 1.00 14.85 ? 80  PRO A CG  1 
ATOM   618  C CD  . PRO A 1 80  ? -6.029  7.890   29.738 1.00 11.44 ? 80  PRO A CD  1 
ATOM   619  N N   . ASP A 1 81  ? -5.097  10.010  26.988 1.00 14.42 ? 81  ASP A N   1 
ATOM   620  C CA  . ASP A 1 81  ? -4.860  11.177  26.143 1.00 14.60 ? 81  ASP A CA  1 
ATOM   621  C C   . ASP A 1 81  ? -4.193  12.350  26.853 1.00 12.98 ? 81  ASP A C   1 
ATOM   622  O O   . ASP A 1 81  ? -3.953  12.316  28.059 1.00 13.42 ? 81  ASP A O   1 
ATOM   623  C CB  . ASP A 1 81  ? -6.188  11.639  25.517 1.00 16.66 ? 81  ASP A CB  1 
ATOM   624  C CG  . ASP A 1 81  ? -7.314  11.770  26.539 1.00 18.03 ? 81  ASP A CG  1 
ATOM   625  O OD1 . ASP A 1 81  ? -8.466  11.410  26.203 1.00 21.20 ? 81  ASP A OD1 1 
ATOM   626  O OD2 . ASP A 1 81  ? -7.055  12.237  27.672 1.00 17.33 ? 81  ASP A OD2 1 
ATOM   627  N N   . THR A 1 82  ? -3.902  13.396  26.087 1.00 11.58 ? 82  THR A N   1 
ATOM   628  C CA  . THR A 1 82  ? -3.252  14.586  26.622 1.00 11.27 ? 82  THR A CA  1 
ATOM   629  C C   . THR A 1 82  ? -4.092  15.229  27.722 1.00 10.27 ? 82  THR A C   1 
ATOM   630  O O   . THR A 1 82  ? -3.574  15.600  28.776 1.00 9.58  ? 82  THR A O   1 
ATOM   631  C CB  . THR A 1 82  ? -2.998  15.633  25.501 1.00 10.38 ? 82  THR A CB  1 
ATOM   632  O OG1 . THR A 1 82  ? -1.993  15.141  24.605 1.00 11.09 ? 82  THR A OG1 1 
ATOM   633  C CG2 . THR A 1 82  ? -2.525  16.947  26.094 1.00 10.63 ? 82  THR A CG2 1 
ATOM   634  N N   . ALA A 1 83  ? -5.390  15.358  27.470 1.00 10.54 ? 83  ALA A N   1 
ATOM   635  C CA  . ALA A 1 83  ? -6.291  15.968  28.433 1.00 10.04 ? 83  ALA A CA  1 
ATOM   636  C C   . ALA A 1 83  ? -6.205  15.326  29.814 1.00 10.59 ? 83  ALA A C   1 
ATOM   637  O O   . ALA A 1 83  ? -6.151  16.026  30.819 1.00 11.25 ? 83  ALA A O   1 
ATOM   638  C CB  . ALA A 1 83  ? -7.728  15.899  27.924 1.00 10.76 ? 83  ALA A CB  1 
ATOM   639  N N   . SER A 1 84  ? -6.189  13.997  29.866 1.00 11.95 ? 84  SER A N   1 
ATOM   640  C CA  . SER A 1 84  ? -6.143  13.304  31.152 1.00 12.02 ? 84  SER A CA  1 
ATOM   641  C C   . SER A 1 84  ? -4.807  13.467  31.869 1.00 10.21 ? 84  SER A C   1 
ATOM   642  O O   . SER A 1 84  ? -4.768  13.520  33.096 1.00 10.62 ? 84  SER A O   1 
ATOM   643  C CB  . SER A 1 84  ? -6.500  11.819  30.977 1.00 13.04 ? 84  SER A CB  1 
ATOM   644  O OG  . SER A 1 84  ? -5.710  11.199  29.982 1.00 17.02 ? 84  SER A OG  1 
ATOM   645  N N   . VAL A 1 85  ? -3.720  13.561  31.106 1.00 9.88  ? 85  VAL A N   1 
ATOM   646  C CA  . VAL A 1 85  ? -2.396  13.750  31.689 1.00 10.10 ? 85  VAL A CA  1 
ATOM   647  C C   . VAL A 1 85  ? -2.351  15.120  32.367 1.00 10.70 ? 85  VAL A C   1 
ATOM   648  O O   . VAL A 1 85  ? -2.059  15.231  33.554 1.00 10.32 ? 85  VAL A O   1 
ATOM   649  C CB  . VAL A 1 85  ? -1.287  13.697  30.610 1.00 10.29 ? 85  VAL A CB  1 
ATOM   650  C CG1 . VAL A 1 85  ? 0.053   14.148  31.204 1.00 12.01 ? 85  VAL A CG1 1 
ATOM   651  C CG2 . VAL A 1 85  ? -1.174  12.294  30.057 1.00 10.68 ? 85  VAL A CG2 1 
ATOM   652  N N   . ASP A 1 86  ? -2.655  16.161  31.596 1.00 11.38 ? 86  ASP A N   1 
ATOM   653  C CA  . ASP A 1 86  ? -2.646  17.531  32.100 1.00 11.22 ? 86  ASP A CA  1 
ATOM   654  C C   . ASP A 1 86  ? -3.579  17.715  33.294 1.00 10.42 ? 86  ASP A C   1 
ATOM   655  O O   . ASP A 1 86  ? -3.224  18.358  34.277 1.00 11.64 ? 86  ASP A O   1 
ATOM   656  C CB  . ASP A 1 86  ? -3.038  18.503  30.980 1.00 11.38 ? 86  ASP A CB  1 
ATOM   657  C CG  . ASP A 1 86  ? -1.988  18.588  29.885 1.00 14.15 ? 86  ASP A CG  1 
ATOM   658  O OD1 . ASP A 1 86  ? -1.218  17.621  29.702 1.00 11.91 ? 86  ASP A OD1 1 
ATOM   659  O OD2 . ASP A 1 86  ? -1.927  19.630  29.201 1.00 18.20 ? 86  ASP A OD2 1 
ATOM   660  N N   . LYS A 1 87  ? -4.771  17.141  33.207 1.00 11.88 ? 87  LYS A N   1 
ATOM   661  C CA  . LYS A 1 87  ? -5.747  17.249  34.284 1.00 12.91 ? 87  LYS A CA  1 
ATOM   662  C C   . LYS A 1 87  ? -5.240  16.604  35.573 1.00 11.55 ? 87  LYS A C   1 
ATOM   663  O O   . LYS A 1 87  ? -5.433  17.139  36.665 1.00 11.62 ? 87  LYS A O   1 
ATOM   664  C CB  . LYS A 1 87  ? -7.055  16.590  33.854 1.00 13.41 ? 87  LYS A CB  1 
ATOM   665  C CG  . LYS A 1 87  ? -8.214  16.821  34.797 1.00 21.74 ? 87  LYS A CG  1 
ATOM   666  C CD  . LYS A 1 87  ? -9.535  16.419  34.139 1.00 27.14 ? 87  LYS A CD  1 
ATOM   667  C CE  . LYS A 1 87  ? -10.488 15.751  35.127 1.00 30.37 ? 87  LYS A CE  1 
ATOM   668  N NZ  . LYS A 1 87  ? -10.682 16.573  36.356 1.00 35.55 ? 87  LYS A NZ  1 
ATOM   669  N N   . LYS A 1 88  ? -4.594  15.449  35.444 1.00 11.02 ? 88  LYS A N   1 
ATOM   670  C CA  . LYS A 1 88  ? -4.070  14.739  36.608 1.00 10.25 ? 88  LYS A CA  1 
ATOM   671  C C   . LYS A 1 88  ? -2.929  15.522  37.253 1.00 9.98  ? 88  LYS A C   1 
ATOM   672  O O   . LYS A 1 88  ? -2.853  15.628  38.479 1.00 10.74 ? 88  LYS A O   1 
ATOM   673  C CB  . LYS A 1 88  ? -3.592  13.338  36.207 1.00 8.69  ? 88  LYS A CB  1 
ATOM   674  C CG  . LYS A 1 88  ? -3.090  12.473  37.366 1.00 9.93  ? 88  LYS A CG  1 
ATOM   675  C CD  . LYS A 1 88  ? -4.123  12.344  38.467 1.00 10.06 ? 88  LYS A CD  1 
ATOM   676  C CE  . LYS A 1 88  ? -5.285  11.468  38.043 1.00 10.92 ? 88  LYS A CE  1 
ATOM   677  N NZ  . LYS A 1 88  ? -6.335  11.411  39.105 1.00 13.67 ? 88  LYS A NZ  1 
ATOM   678  N N   . TYR A 1 89  ? -2.044  16.070  36.425 1.00 9.66  ? 89  TYR A N   1 
ATOM   679  C CA  . TYR A 1 89  ? -0.923  16.849  36.930 1.00 10.20 ? 89  TYR A CA  1 
ATOM   680  C C   . TYR A 1 89  ? -1.449  17.982  37.805 1.00 11.00 ? 89  TYR A C   1 
ATOM   681  O O   . TYR A 1 89  ? -1.020  18.152  38.941 1.00 10.59 ? 89  TYR A O   1 
ATOM   682  C CB  . TYR A 1 89  ? -0.109  17.431  35.774 1.00 9.62  ? 89  TYR A CB  1 
ATOM   683  C CG  . TYR A 1 89  ? 1.099   18.224  36.222 1.00 10.69 ? 89  TYR A CG  1 
ATOM   684  C CD1 . TYR A 1 89  ? 1.026   19.607  36.404 1.00 11.08 ? 89  TYR A CD1 1 
ATOM   685  C CD2 . TYR A 1 89  ? 2.322   17.594  36.457 1.00 10.81 ? 89  TYR A CD2 1 
ATOM   686  C CE1 . TYR A 1 89  ? 2.140   20.340  36.804 1.00 10.86 ? 89  TYR A CE1 1 
ATOM   687  C CE2 . TYR A 1 89  ? 3.439   18.321  36.856 1.00 11.68 ? 89  TYR A CE2 1 
ATOM   688  C CZ  . TYR A 1 89  ? 3.341   19.690  37.024 1.00 9.61  ? 89  TYR A CZ  1 
ATOM   689  O OH  . TYR A 1 89  ? 4.456   20.398  37.382 1.00 12.43 ? 89  TYR A OH  1 
ATOM   690  N N   . ALA A 1 90  ? -2.391  18.746  37.264 1.00 12.21 ? 90  ALA A N   1 
ATOM   691  C CA  . ALA A 1 90  ? -2.978  19.868  37.981 1.00 13.00 ? 90  ALA A CA  1 
ATOM   692  C C   . ALA A 1 90  ? -3.677  19.395  39.251 1.00 14.63 ? 90  ALA A C   1 
ATOM   693  O O   . ALA A 1 90  ? -3.595  20.043  40.291 1.00 16.03 ? 90  ALA A O   1 
ATOM   694  C CB  . ALA A 1 90  ? -3.958  20.596  37.088 1.00 12.06 ? 90  ALA A CB  1 
ATOM   695  N N   . GLU A 1 91  ? -4.364  18.261  39.162 1.00 15.22 ? 91  GLU A N   1 
ATOM   696  C CA  . GLU A 1 91  ? -5.068  17.699  40.311 1.00 15.03 ? 91  GLU A CA  1 
ATOM   697  C C   . GLU A 1 91  ? -4.094  17.328  41.432 1.00 14.45 ? 91  GLU A C   1 
ATOM   698  O O   . GLU A 1 91  ? -4.352  17.604  42.606 1.00 14.69 ? 91  GLU A O   1 
ATOM   699  C CB  . GLU A 1 91  ? -5.860  16.462  39.878 1.00 16.00 ? 91  GLU A CB  1 
ATOM   700  C CG  . GLU A 1 91  ? -6.698  15.845  40.971 1.00 20.29 ? 91  GLU A CG  1 
ATOM   701  C CD  . GLU A 1 91  ? -6.949  14.362  40.746 1.00 23.76 ? 91  GLU A CD  1 
ATOM   702  O OE1 . GLU A 1 91  ? -6.979  13.935  39.569 1.00 21.67 ? 91  GLU A OE1 1 
ATOM   703  O OE2 . GLU A 1 91  ? -7.115  13.626  41.750 1.00 25.06 ? 91  GLU A OE2 1 
ATOM   704  N N   . LEU A 1 92  ? -2.973  16.708  41.070 1.00 12.97 ? 92  LEU A N   1 
ATOM   705  C CA  . LEU A 1 92  ? -1.977  16.313  42.062 1.00 12.84 ? 92  LEU A CA  1 
ATOM   706  C C   . LEU A 1 92  ? -1.306  17.532  42.686 1.00 13.31 ? 92  LEU A C   1 
ATOM   707  O O   . LEU A 1 92  ? -1.121  17.596  43.905 1.00 12.58 ? 92  LEU A O   1 
ATOM   708  C CB  . LEU A 1 92  ? -0.924  15.406  41.423 1.00 11.81 ? 92  LEU A CB  1 
ATOM   709  C CG  . LEU A 1 92  ? -1.389  13.989  41.079 1.00 10.24 ? 92  LEU A CG  1 
ATOM   710  C CD1 . LEU A 1 92  ? -0.236  13.215  40.467 1.00 9.22  ? 92  LEU A CD1 1 
ATOM   711  C CD2 . LEU A 1 92  ? -1.918  13.288  42.334 1.00 11.27 ? 92  LEU A CD2 1 
ATOM   712  N N   . VAL A 1 93  ? -0.941  18.499  41.850 1.00 14.41 ? 93  VAL A N   1 
ATOM   713  C CA  . VAL A 1 93  ? -0.306  19.715  42.350 1.00 15.76 ? 93  VAL A CA  1 
ATOM   714  C C   . VAL A 1 93  ? -1.283  20.456  43.264 1.00 15.80 ? 93  VAL A C   1 
ATOM   715  O O   . VAL A 1 93  ? -0.903  20.951  44.324 1.00 15.94 ? 93  VAL A O   1 
ATOM   716  C CB  . VAL A 1 93  ? 0.124   20.633  41.181 1.00 15.73 ? 93  VAL A CB  1 
ATOM   717  C CG1 . VAL A 1 93  ? 0.294   22.061  41.662 1.00 17.27 ? 93  VAL A CG1 1 
ATOM   718  C CG2 . VAL A 1 93  ? 1.424   20.122  40.582 1.00 14.92 ? 93  VAL A CG2 1 
ATOM   719  N N   . ASP A 1 94  ? -2.543  20.519  42.850 1.00 15.27 ? 94  ASP A N   1 
ATOM   720  C CA  . ASP A 1 94  ? -3.575  21.188  43.631 1.00 18.33 ? 94  ASP A CA  1 
ATOM   721  C C   . ASP A 1 94  ? -3.815  20.476  44.961 1.00 19.51 ? 94  ASP A C   1 
ATOM   722  O O   . ASP A 1 94  ? -4.344  21.066  45.903 1.00 18.47 ? 94  ASP A O   1 
ATOM   723  C CB  . ASP A 1 94  ? -4.884  21.239  42.843 1.00 19.91 ? 94  ASP A CB  1 
ATOM   724  C CG  . ASP A 1 94  ? -4.878  22.314  41.769 1.00 24.85 ? 94  ASP A CG  1 
ATOM   725  O OD1 . ASP A 1 94  ? -3.890  23.083  41.691 1.00 27.09 ? 94  ASP A OD1 1 
ATOM   726  O OD2 . ASP A 1 94  ? -5.866  22.386  40.999 1.00 25.94 ? 94  ASP A OD2 1 
ATOM   727  N N   . ALA A 1 95  ? -3.427  19.204  45.024 1.00 18.87 ? 95  ALA A N   1 
ATOM   728  C CA  . ALA A 1 95  ? -3.596  18.400  46.226 1.00 18.39 ? 95  ALA A CA  1 
ATOM   729  C C   . ALA A 1 95  ? -2.388  18.528  47.149 1.00 17.48 ? 95  ALA A C   1 
ATOM   730  O O   . ALA A 1 95  ? -2.326  17.879  48.194 1.00 19.10 ? 95  ALA A O   1 
ATOM   731  C CB  . ALA A 1 95  ? -3.823  16.928  45.850 1.00 18.61 ? 95  ALA A CB  1 
ATOM   732  N N   . GLY A 1 96  ? -1.420  19.350  46.760 1.00 16.84 ? 96  GLY A N   1 
ATOM   733  C CA  . GLY A 1 96  ? -0.251  19.545  47.600 1.00 16.47 ? 96  GLY A CA  1 
ATOM   734  C C   . GLY A 1 96  ? 0.996   18.770  47.213 1.00 17.32 ? 96  GLY A C   1 
ATOM   735  O O   . GLY A 1 96  ? 2.035   18.898  47.867 1.00 16.40 ? 96  GLY A O   1 
ATOM   736  N N   . TYR A 1 97  ? 0.908   17.968  46.154 1.00 16.53 ? 97  TYR A N   1 
ATOM   737  C CA  . TYR A 1 97  ? 2.063   17.191  45.708 1.00 15.24 ? 97  TYR A CA  1 
ATOM   738  C C   . TYR A 1 97  ? 2.976   18.022  44.815 1.00 14.59 ? 97  TYR A C   1 
ATOM   739  O O   . TYR A 1 97  ? 2.540   18.987  44.189 1.00 14.32 ? 97  TYR A O   1 
ATOM   740  C CB  . TYR A 1 97  ? 1.597   15.925  44.986 1.00 14.66 ? 97  TYR A CB  1 
ATOM   741  C CG  . TYR A 1 97  ? 0.752   15.051  45.879 1.00 12.78 ? 97  TYR A CG  1 
ATOM   742  C CD1 . TYR A 1 97  ? 1.267   14.552  47.082 1.00 13.12 ? 97  TYR A CD1 1 
ATOM   743  C CD2 . TYR A 1 97  ? -0.570  14.759  45.555 1.00 14.10 ? 97  TYR A CD2 1 
ATOM   744  C CE1 . TYR A 1 97  ? 0.486   13.788  47.940 1.00 11.84 ? 97  TYR A CE1 1 
ATOM   745  C CE2 . TYR A 1 97  ? -1.360  13.993  46.409 1.00 14.34 ? 97  TYR A CE2 1 
ATOM   746  C CZ  . TYR A 1 97  ? -0.824  13.512  47.600 1.00 12.08 ? 97  TYR A CZ  1 
ATOM   747  O OH  . TYR A 1 97  ? -1.598  12.750  48.444 1.00 13.60 ? 97  TYR A OH  1 
ATOM   748  N N   . GLU A 1 98  ? 4.247   17.643  44.766 1.00 13.92 ? 98  GLU A N   1 
ATOM   749  C CA  . GLU A 1 98  ? 5.228   18.367  43.977 1.00 15.65 ? 98  GLU A CA  1 
ATOM   750  C C   . GLU A 1 98  ? 5.138   18.161  42.471 1.00 16.08 ? 98  GLU A C   1 
ATOM   751  O O   . GLU A 1 98  ? 5.282   17.042  41.981 1.00 15.75 ? 98  GLU A O   1 
ATOM   752  C CB  . GLU A 1 98  ? 6.635   18.000  44.443 1.00 19.22 ? 98  GLU A CB  1 
ATOM   753  C CG  . GLU A 1 98  ? 7.738   18.617  43.603 1.00 26.75 ? 98  GLU A CG  1 
ATOM   754  C CD  . GLU A 1 98  ? 9.115   18.414  44.212 1.00 31.93 ? 98  GLU A CD  1 
ATOM   755  O OE1 . GLU A 1 98  ? 9.202   18.280  45.454 1.00 34.87 ? 98  GLU A OE1 1 
ATOM   756  O OE2 . GLU A 1 98  ? 10.109  18.387  43.446 1.00 35.91 ? 98  GLU A OE2 1 
ATOM   757  N N   . GLY A 1 99  ? 4.892   19.252  41.748 1.00 15.42 ? 99  GLY A N   1 
ATOM   758  C CA  . GLY A 1 99  ? 4.837   19.201  40.300 1.00 14.78 ? 99  GLY A CA  1 
ATOM   759  C C   . GLY A 1 99  ? 6.251   19.529  39.861 1.00 16.07 ? 99  GLY A C   1 
ATOM   760  O O   . GLY A 1 99  ? 6.659   20.693  39.875 1.00 17.88 ? 99  GLY A O   1 
ATOM   761  N N   . HIS A 1 100 ? 7.003   18.504  39.479 1.00 14.30 ? 100 HIS A N   1 
ATOM   762  C CA  . HIS A 1 100 ? 8.398   18.659  39.075 1.00 15.20 ? 100 HIS A CA  1 
ATOM   763  C C   . HIS A 1 100 ? 8.604   19.260  37.678 1.00 14.82 ? 100 HIS A C   1 
ATOM   764  O O   . HIS A 1 100 ? 9.359   20.218  37.510 1.00 15.01 ? 100 HIS A O   1 
ATOM   765  C CB  . HIS A 1 100 ? 9.094   17.297  39.181 1.00 17.09 ? 100 HIS A CB  1 
ATOM   766  C CG  . HIS A 1 100 ? 10.565  17.347  38.926 1.00 19.29 ? 100 HIS A CG  1 
ATOM   767  N ND1 . HIS A 1 100 ? 11.440  18.025  39.744 1.00 22.54 ? 100 HIS A ND1 1 
ATOM   768  C CD2 . HIS A 1 100 ? 11.314  16.807  37.935 1.00 21.00 ? 100 HIS A CD2 1 
ATOM   769  C CE1 . HIS A 1 100 ? 12.667  17.904  39.269 1.00 23.54 ? 100 HIS A CE1 1 
ATOM   770  N NE2 . HIS A 1 100 ? 12.619  17.170  38.171 1.00 23.81 ? 100 HIS A NE2 1 
ATOM   771  N N   . LEU A 1 101 ? 7.946   18.684  36.680 1.00 13.56 ? 101 LEU A N   1 
ATOM   772  C CA  . LEU A 1 101 ? 8.046   19.175  35.307 1.00 13.41 ? 101 LEU A CA  1 
ATOM   773  C C   . LEU A 1 101 ? 6.641   19.184  34.746 1.00 11.81 ? 101 LEU A C   1 
ATOM   774  O O   . LEU A 1 101 ? 6.018   18.133  34.618 1.00 11.14 ? 101 LEU A O   1 
ATOM   775  C CB  . LEU A 1 101 ? 8.931   18.257  34.454 1.00 14.61 ? 101 LEU A CB  1 
ATOM   776  C CG  . LEU A 1 101 ? 10.445  18.502  34.405 1.00 17.67 ? 101 LEU A CG  1 
ATOM   777  C CD1 . LEU A 1 101 ? 11.072  17.528  33.411 1.00 17.34 ? 101 LEU A CD1 1 
ATOM   778  C CD2 . LEU A 1 101 ? 10.743  19.949  34.004 1.00 17.62 ? 101 LEU A CD2 1 
ATOM   779  N N   . LYS A 1 102 ? 6.143   20.372  34.421 1.00 11.59 ? 102 LYS A N   1 
ATOM   780  C CA  . LYS A 1 102 ? 4.795   20.520  33.881 1.00 12.13 ? 102 LYS A CA  1 
ATOM   781  C C   . LYS A 1 102 ? 4.656   19.823  32.520 1.00 10.96 ? 102 LYS A C   1 
ATOM   782  O O   . LYS A 1 102 ? 5.636   19.661  31.788 1.00 11.18 ? 102 LYS A O   1 
ATOM   783  C CB  . LYS A 1 102 ? 4.441   22.002  33.761 1.00 13.38 ? 102 LYS A CB  1 
ATOM   784  C CG  . LYS A 1 102 ? 5.251   22.738  32.720 1.00 17.02 ? 102 LYS A CG  1 
ATOM   785  C CD  . LYS A 1 102 ? 4.921   24.218  32.719 1.00 22.69 ? 102 LYS A CD  1 
ATOM   786  C CE  . LYS A 1 102 ? 5.897   24.992  31.838 1.00 27.10 ? 102 LYS A CE  1 
ATOM   787  N NZ  . LYS A 1 102 ? 5.208   25.572  30.654 1.00 31.34 ? 102 LYS A NZ  1 
ATOM   788  N N   . PRO A 1 103 ? 3.425   19.424  32.157 1.00 10.66 ? 103 PRO A N   1 
ATOM   789  C CA  . PRO A 1 103 ? 3.187   18.737  30.885 1.00 10.73 ? 103 PRO A CA  1 
ATOM   790  C C   . PRO A 1 103 ? 3.806   19.390  29.659 1.00 10.34 ? 103 PRO A C   1 
ATOM   791  O O   . PRO A 1 103 ? 3.727   20.602  29.484 1.00 11.59 ? 103 PRO A O   1 
ATOM   792  C CB  . PRO A 1 103 ? 1.666   18.669  30.790 1.00 9.85  ? 103 PRO A CB  1 
ATOM   793  C CG  . PRO A 1 103 ? 1.212   18.700  32.208 1.00 11.35 ? 103 PRO A CG  1 
ATOM   794  C CD  . PRO A 1 103 ? 2.172   19.627  32.906 1.00 11.62 ? 103 PRO A CD  1 
ATOM   795  N N   . TRP A 1 104 ? 4.426   18.565  28.823 1.00 9.57  ? 104 TRP A N   1 
ATOM   796  C CA  . TRP A 1 104 ? 5.045   19.015  27.583 1.00 9.68  ? 104 TRP A CA  1 
ATOM   797  C C   . TRP A 1 104 ? 4.965   17.878  26.572 1.00 10.84 ? 104 TRP A C   1 
ATOM   798  O O   . TRP A 1 104 ? 4.638   16.744  26.925 1.00 9.77  ? 104 TRP A O   1 
ATOM   799  C CB  . TRP A 1 104 ? 6.505   19.460  27.827 1.00 10.98 ? 104 TRP A CB  1 
ATOM   800  C CG  . TRP A 1 104 ? 7.567   18.385  27.780 1.00 11.97 ? 104 TRP A CG  1 
ATOM   801  C CD1 . TRP A 1 104 ? 8.318   18.022  26.698 1.00 13.72 ? 104 TRP A CD1 1 
ATOM   802  C CD2 . TRP A 1 104 ? 8.016   17.563  28.869 1.00 12.96 ? 104 TRP A CD2 1 
ATOM   803  N NE1 . TRP A 1 104 ? 9.204   17.029  27.039 1.00 12.89 ? 104 TRP A NE1 1 
ATOM   804  C CE2 . TRP A 1 104 ? 9.041   16.726  28.365 1.00 13.38 ? 104 TRP A CE2 1 
ATOM   805  C CE3 . TRP A 1 104 ? 7.652   17.450  30.222 1.00 11.70 ? 104 TRP A CE3 1 
ATOM   806  C CZ2 . TRP A 1 104 ? 9.709   15.787  29.167 1.00 13.17 ? 104 TRP A CZ2 1 
ATOM   807  C CZ3 . TRP A 1 104 ? 8.315   16.517  31.018 1.00 10.52 ? 104 TRP A CZ3 1 
ATOM   808  C CH2 . TRP A 1 104 ? 9.333   15.698  30.486 1.00 12.18 ? 104 TRP A CH2 1 
ATOM   809  N N   . ASN A 1 105 ? 5.222   18.184  25.305 1.00 10.84 ? 105 ASN A N   1 
ATOM   810  C CA  . ASN A 1 105 ? 5.184   17.165  24.270 1.00 10.54 ? 105 ASN A CA  1 
ATOM   811  C C   . ASN A 1 105 ? 6.613   16.700  24.069 1.00 12.11 ? 105 ASN A C   1 
ATOM   812  O O   . ASN A 1 105 ? 7.419   17.380  23.432 1.00 12.69 ? 105 ASN A O   1 
ATOM   813  C CB  . ASN A 1 105 ? 4.599   17.746  22.981 1.00 11.01 ? 105 ASN A CB  1 
ATOM   814  C CG  . ASN A 1 105 ? 3.197   18.278  23.182 1.00 12.64 ? 105 ASN A CG  1 
ATOM   815  O OD1 . ASN A 1 105 ? 2.340   17.596  23.760 1.00 11.64 ? 105 ASN A OD1 1 
ATOM   816  N ND2 . ASN A 1 105 ? 2.952   19.504  22.722 1.00 13.96 ? 105 ASN A ND2 1 
ATOM   817  N N   . ALA A 1 106 ? 6.916   15.540  24.643 1.00 13.26 ? 106 ALA A N   1 
ATOM   818  C CA  . ALA A 1 106 ? 8.247   14.956  24.592 1.00 13.75 ? 106 ALA A CA  1 
ATOM   819  C C   . ALA A 1 106 ? 8.667   14.544  23.200 1.00 15.47 ? 106 ALA A C   1 
ATOM   820  O O   . ALA A 1 106 ? 7.855   14.066  22.402 1.00 15.52 ? 106 ALA A O   1 
ATOM   821  C CB  . ALA A 1 106 ? 8.322   13.766  25.527 1.00 14.02 ? 106 ALA A CB  1 
ATOM   822  N N   . VAL A 1 107 ? 9.954   14.723  22.925 1.00 17.44 ? 107 VAL A N   1 
ATOM   823  C CA  . VAL A 1 107 ? 10.531  14.397  21.627 1.00 19.79 ? 107 VAL A CA  1 
ATOM   824  C C   . VAL A 1 107 ? 10.297  12.945  21.209 1.00 18.86 ? 107 VAL A C   1 
ATOM   825  O O   . VAL A 1 107 ? 10.347  12.625  20.021 1.00 19.63 ? 107 VAL A O   1 
ATOM   826  C CB  . VAL A 1 107 ? 12.058  14.715  21.611 1.00 21.17 ? 107 VAL A CB  1 
ATOM   827  C CG1 . VAL A 1 107 ? 12.803  13.795  22.566 1.00 21.74 ? 107 VAL A CG1 1 
ATOM   828  C CG2 . VAL A 1 107 ? 12.608  14.589  20.198 1.00 24.27 ? 107 VAL A CG2 1 
ATOM   829  N N   . TRP A 1 108 ? 10.031  12.068  22.175 1.00 17.68 ? 108 TRP A N   1 
ATOM   830  C CA  . TRP A 1 108 ? 9.787   10.668  21.860 1.00 15.14 ? 108 TRP A CA  1 
ATOM   831  C C   . TRP A 1 108 ? 8.313   10.391  21.532 1.00 14.67 ? 108 TRP A C   1 
ATOM   832  O O   . TRP A 1 108 ? 7.885   9.239   21.460 1.00 15.98 ? 108 TRP A O   1 
ATOM   833  C CB  . TRP A 1 108 ? 10.287  9.757   22.997 1.00 15.14 ? 108 TRP A CB  1 
ATOM   834  C CG  . TRP A 1 108 ? 9.784   10.084  24.374 1.00 12.29 ? 108 TRP A CG  1 
ATOM   835  C CD1 . TRP A 1 108 ? 8.679   9.572   24.977 1.00 13.47 ? 108 TRP A CD1 1 
ATOM   836  C CD2 . TRP A 1 108 ? 10.386  10.968  25.330 1.00 12.33 ? 108 TRP A CD2 1 
ATOM   837  N NE1 . TRP A 1 108 ? 8.550   10.076  26.243 1.00 11.98 ? 108 TRP A NE1 1 
ATOM   838  C CE2 . TRP A 1 108 ? 9.584   10.936  26.488 1.00 12.30 ? 108 TRP A CE2 1 
ATOM   839  C CE3 . TRP A 1 108 ? 11.525  11.785  25.319 1.00 13.28 ? 108 TRP A CE3 1 
ATOM   840  C CZ2 . TRP A 1 108 ? 9.881   11.690  27.634 1.00 12.87 ? 108 TRP A CZ2 1 
ATOM   841  C CZ3 . TRP A 1 108 ? 11.821  12.539  26.458 1.00 13.22 ? 108 TRP A CZ3 1 
ATOM   842  C CH2 . TRP A 1 108 ? 10.999  12.484  27.600 1.00 13.21 ? 108 TRP A CH2 1 
ATOM   843  N N   . GLY A 1 109 ? 7.539   11.456  21.337 1.00 13.42 ? 109 GLY A N   1 
ATOM   844  C CA  . GLY A 1 109 ? 6.147   11.302  20.951 1.00 11.82 ? 109 GLY A CA  1 
ATOM   845  C C   . GLY A 1 109 ? 5.086   11.009  21.987 1.00 12.08 ? 109 GLY A C   1 
ATOM   846  O O   . GLY A 1 109 ? 4.151   10.250  21.725 1.00 12.71 ? 109 GLY A O   1 
ATOM   847  N N   . GLN A 1 110 ? 5.215   11.610  23.161 1.00 12.15 ? 110 GLN A N   1 
ATOM   848  C CA  . GLN A 1 110 ? 4.238   11.417  24.223 1.00 10.79 ? 110 GLN A CA  1 
ATOM   849  C C   . GLN A 1 110 ? 4.041   12.708  24.989 1.00 10.45 ? 110 GLN A C   1 
ATOM   850  O O   . GLN A 1 110 ? 4.974   13.505  25.126 1.00 10.83 ? 110 GLN A O   1 
ATOM   851  C CB  . GLN A 1 110 ? 4.711   10.368  25.240 1.00 11.26 ? 110 GLN A CB  1 
ATOM   852  C CG  . GLN A 1 110 ? 5.018   8.996   24.682 1.00 13.25 ? 110 GLN A CG  1 
ATOM   853  C CD  . GLN A 1 110 ? 5.457   8.022   25.760 1.00 15.13 ? 110 GLN A CD  1 
ATOM   854  O OE1 . GLN A 1 110 ? 6.126   8.394   26.729 1.00 14.14 ? 110 GLN A OE1 1 
ATOM   855  N NE2 . GLN A 1 110 ? 5.080   6.763   25.595 1.00 16.46 ? 110 GLN A NE2 1 
ATOM   856  N N   . ARG A 1 111 ? 2.821   12.917  25.474 1.00 10.35 ? 111 ARG A N   1 
ATOM   857  C CA  . ARG A 1 111 ? 2.549   14.060  26.329 1.00 10.50 ? 111 ARG A CA  1 
ATOM   858  C C   . ARG A 1 111 ? 3.211   13.542  27.615 1.00 10.66 ? 111 ARG A C   1 
ATOM   859  O O   . ARG A 1 111 ? 2.945   12.412  28.036 1.00 10.68 ? 111 ARG A O   1 
ATOM   860  C CB  . ARG A 1 111 ? 1.044   14.241  26.534 1.00 10.15 ? 111 ARG A CB  1 
ATOM   861  C CG  . ARG A 1 111 ? 0.681   15.461  27.366 1.00 10.55 ? 111 ARG A CG  1 
ATOM   862  C CD  . ARG A 1 111 ? 1.118   16.758  26.695 1.00 9.47  ? 111 ARG A CD  1 
ATOM   863  N NE  . ARG A 1 111 ? 0.584   17.923  27.396 1.00 10.13 ? 111 ARG A NE  1 
ATOM   864  C CZ  . ARG A 1 111 ? 0.814   19.185  27.040 1.00 10.35 ? 111 ARG A CZ  1 
ATOM   865  N NH1 . ARG A 1 111 ? 1.573   19.456  25.986 1.00 9.28  ? 111 ARG A NH1 1 
ATOM   866  N NH2 . ARG A 1 111 ? 0.283   20.178  27.744 1.00 9.70  ? 111 ARG A NH2 1 
ATOM   867  N N   . TYR A 1 112 ? 4.074   14.348  28.224 1.00 8.46  ? 112 TYR A N   1 
ATOM   868  C CA  . TYR A 1 112 ? 4.800   13.921  29.409 1.00 8.47  ? 112 TYR A CA  1 
ATOM   869  C C   . TYR A 1 112 ? 4.801   14.945  30.548 1.00 9.33  ? 112 TYR A C   1 
ATOM   870  O O   . TYR A 1 112 ? 4.748   16.149  30.318 1.00 9.12  ? 112 TYR A O   1 
ATOM   871  C CB  . TYR A 1 112 ? 6.242   13.603  28.996 1.00 7.79  ? 112 TYR A CB  1 
ATOM   872  C CG  . TYR A 1 112 ? 6.857   12.400  29.675 1.00 9.30  ? 112 TYR A CG  1 
ATOM   873  C CD1 . TYR A 1 112 ? 7.729   12.559  30.754 1.00 9.95  ? 112 TYR A CD1 1 
ATOM   874  C CD2 . TYR A 1 112 ? 6.589   11.108  29.228 1.00 8.76  ? 112 TYR A CD2 1 
ATOM   875  C CE1 . TYR A 1 112 ? 8.320   11.465  31.371 1.00 10.51 ? 112 TYR A CE1 1 
ATOM   876  C CE2 . TYR A 1 112 ? 7.177   10.000  29.841 1.00 10.95 ? 112 TYR A CE2 1 
ATOM   877  C CZ  . TYR A 1 112 ? 8.043   10.192  30.912 1.00 11.39 ? 112 TYR A CZ  1 
ATOM   878  O OH  . TYR A 1 112 ? 8.640   9.114   31.516 1.00 13.19 ? 112 TYR A OH  1 
ATOM   879  N N   . ALA A 1 113 ? 4.858   14.451  31.780 1.00 8.36  ? 113 ALA A N   1 
ATOM   880  C CA  . ALA A 1 113 ? 4.895   15.316  32.957 1.00 8.98  ? 113 ALA A CA  1 
ATOM   881  C C   . ALA A 1 113 ? 5.535   14.547  34.102 1.00 9.04  ? 113 ALA A C   1 
ATOM   882  O O   . ALA A 1 113 ? 5.541   13.318  34.102 1.00 9.08  ? 113 ALA A O   1 
ATOM   883  C CB  . ALA A 1 113 ? 3.486   15.757  33.347 1.00 8.45  ? 113 ALA A CB  1 
ATOM   884  N N   . ILE A 1 114 ? 6.079   15.267  35.075 1.00 8.69  ? 114 ILE A N   1 
ATOM   885  C CA  . ILE A 1 114 ? 6.705   14.604  36.214 1.00 10.47 ? 114 ILE A CA  1 
ATOM   886  C C   . ILE A 1 114 ? 6.316   15.224  37.561 1.00 10.16 ? 114 ILE A C   1 
ATOM   887  O O   . ILE A 1 114 ? 6.307   16.448  37.726 1.00 9.76  ? 114 ILE A O   1 
ATOM   888  C CB  . ILE A 1 114 ? 8.250   14.606  36.074 1.00 9.71  ? 114 ILE A CB  1 
ATOM   889  C CG1 . ILE A 1 114 ? 8.634   14.065  34.694 1.00 10.67 ? 114 ILE A CG1 1 
ATOM   890  C CG2 . ILE A 1 114 ? 8.881   13.754  37.174 1.00 10.43 ? 114 ILE A CG2 1 
ATOM   891  C CD1 . ILE A 1 114 ? 10.105  14.061  34.417 1.00 14.21 ? 114 ILE A CD1 1 
ATOM   892  N N   . VAL A 1 115 ? 5.968   14.361  38.507 1.00 9.09  ? 115 VAL A N   1 
ATOM   893  C CA  . VAL A 1 115 ? 5.614   14.785  39.855 1.00 10.27 ? 115 VAL A CA  1 
ATOM   894  C C   . VAL A 1 115 ? 6.440   13.920  40.810 1.00 9.55  ? 115 VAL A C   1 
ATOM   895  O O   . VAL A 1 115 ? 7.167   13.030  40.372 1.00 9.78  ? 115 VAL A O   1 
ATOM   896  C CB  . VAL A 1 115 ? 4.104   14.576  40.151 1.00 10.00 ? 115 VAL A CB  1 
ATOM   897  C CG1 . VAL A 1 115 ? 3.264   15.483  39.253 1.00 10.79 ? 115 VAL A CG1 1 
ATOM   898  C CG2 . VAL A 1 115 ? 3.726   13.112  39.959 1.00 9.23  ? 115 VAL A CG2 1 
ATOM   899  N N   . LYS A 1 116 ? 6.344   14.187  42.106 1.00 9.26  ? 116 LYS A N   1 
ATOM   900  C CA  . LYS A 1 116 ? 7.076   13.396  43.089 1.00 9.18  ? 116 LYS A CA  1 
ATOM   901  C C   . LYS A 1 116 ? 6.070   12.820  44.065 1.00 10.05 ? 116 LYS A C   1 
ATOM   902  O O   . LYS A 1 116 ? 5.092   13.490  44.392 1.00 10.13 ? 116 LYS A O   1 
ATOM   903  C CB  . LYS A 1 116 ? 8.062   14.269  43.863 1.00 11.09 ? 116 LYS A CB  1 
ATOM   904  C CG  . LYS A 1 116 ? 9.018   15.041  42.999 1.00 15.92 ? 116 LYS A CG  1 
ATOM   905  C CD  . LYS A 1 116 ? 10.234  14.214  42.688 1.00 19.98 ? 116 LYS A CD  1 
ATOM   906  C CE  . LYS A 1 116 ? 11.290  15.042  41.995 1.00 22.75 ? 116 LYS A CE  1 
ATOM   907  N NZ  . LYS A 1 116 ? 11.833  14.306  40.822 1.00 27.10 ? 116 LYS A NZ  1 
ATOM   908  N N   . ASP A 1 117 ? 6.288   11.588  44.525 1.00 8.79  ? 117 ASP A N   1 
ATOM   909  C CA  . ASP A 1 117 ? 5.357   11.023  45.494 1.00 9.60  ? 117 ASP A CA  1 
ATOM   910  C C   . ASP A 1 117 ? 5.722   11.523  46.895 1.00 9.78  ? 117 ASP A C   1 
ATOM   911  O O   . ASP A 1 117 ? 6.722   12.230  47.067 1.00 9.70  ? 117 ASP A O   1 
ATOM   912  C CB  . ASP A 1 117 ? 5.307   9.481   45.394 1.00 10.07 ? 117 ASP A CB  1 
ATOM   913  C CG  . ASP A 1 117 ? 6.497   8.779   46.031 1.00 9.08  ? 117 ASP A CG  1 
ATOM   914  O OD1 . ASP A 1 117 ? 7.397   9.430   46.603 1.00 8.70  ? 117 ASP A OD1 1 
ATOM   915  O OD2 . ASP A 1 117 ? 6.518   7.532   45.952 1.00 10.71 ? 117 ASP A OD2 1 
ATOM   916  N N   . PRO A 1 118 ? 4.919   11.177  47.915 1.00 10.41 ? 118 PRO A N   1 
ATOM   917  C CA  . PRO A 1 118 ? 5.233   11.654  49.268 1.00 10.91 ? 118 PRO A CA  1 
ATOM   918  C C   . PRO A 1 118 ? 6.632   11.352  49.800 1.00 12.46 ? 118 PRO A C   1 
ATOM   919  O O   . PRO A 1 118 ? 7.107   12.028  50.714 1.00 13.18 ? 118 PRO A O   1 
ATOM   920  C CB  . PRO A 1 118 ? 4.136   11.032  50.127 1.00 11.19 ? 118 PRO A CB  1 
ATOM   921  C CG  . PRO A 1 118 ? 3.017   10.774  49.163 1.00 10.71 ? 118 PRO A CG  1 
ATOM   922  C CD  . PRO A 1 118 ? 3.699   10.353  47.905 1.00 10.02 ? 118 PRO A CD  1 
ATOM   923  N N   . ASP A 1 119 ? 7.292   10.343  49.238 1.00 11.73 ? 119 ASP A N   1 
ATOM   924  C CA  . ASP A 1 119 ? 8.634   9.988   49.688 1.00 11.40 ? 119 ASP A CA  1 
ATOM   925  C C   . ASP A 1 119 ? 9.716   10.565  48.774 1.00 11.16 ? 119 ASP A C   1 
ATOM   926  O O   . ASP A 1 119 ? 10.895  10.224  48.900 1.00 11.18 ? 119 ASP A O   1 
ATOM   927  C CB  . ASP A 1 119 ? 8.759   8.465   49.808 1.00 11.38 ? 119 ASP A CB  1 
ATOM   928  C CG  . ASP A 1 119 ? 7.993   7.916   51.002 1.00 10.52 ? 119 ASP A CG  1 
ATOM   929  O OD1 . ASP A 1 119 ? 6.808   7.551   50.846 1.00 12.58 ? 119 ASP A OD1 1 
ATOM   930  O OD2 . ASP A 1 119 ? 8.571   7.860   52.104 1.00 11.27 ? 119 ASP A OD2 1 
ATOM   931  N N   . GLY A 1 120 ? 9.295   11.447  47.866 1.00 10.52 ? 120 GLY A N   1 
ATOM   932  C CA  . GLY A 1 120 ? 10.212  12.107  46.955 1.00 10.37 ? 120 GLY A CA  1 
ATOM   933  C C   . GLY A 1 120 ? 10.604  11.324  45.721 1.00 10.28 ? 120 GLY A C   1 
ATOM   934  O O   . GLY A 1 120 ? 11.511  11.726  44.991 1.00 11.88 ? 120 GLY A O   1 
ATOM   935  N N   . ASN A 1 121 ? 9.933   10.204  45.484 1.00 9.17  ? 121 ASN A N   1 
ATOM   936  C CA  . ASN A 1 121 ? 10.232  9.371   44.320 1.00 8.95  ? 121 ASN A CA  1 
ATOM   937  C C   . ASN A 1 121 ? 9.686   10.014  43.047 1.00 7.94  ? 121 ASN A C   1 
ATOM   938  O O   . ASN A 1 121 ? 8.646   10.670  43.066 1.00 8.86  ? 121 ASN A O   1 
ATOM   939  C CB  . ASN A 1 121 ? 9.610   7.980   44.477 1.00 8.04  ? 121 ASN A CB  1 
ATOM   940  C CG  . ASN A 1 121 ? 10.163  7.228   45.660 1.00 8.58  ? 121 ASN A CG  1 
ATOM   941  O OD1 . ASN A 1 121 ? 11.362  7.252   45.917 1.00 9.13  ? 121 ASN A OD1 1 
ATOM   942  N ND2 . ASN A 1 121 ? 9.285   6.553   46.394 1.00 9.16  ? 121 ASN A ND2 1 
ATOM   943  N N   . VAL A 1 122 ? 10.388  9.799   41.942 1.00 7.67  ? 122 VAL A N   1 
ATOM   944  C CA  . VAL A 1 122 ? 9.982   10.354  40.660 1.00 8.79  ? 122 VAL A CA  1 
ATOM   945  C C   . VAL A 1 122 ? 8.860   9.530   40.041 1.00 8.54  ? 122 VAL A C   1 
ATOM   946  O O   . VAL A 1 122 ? 8.960   8.311   39.928 1.00 8.08  ? 122 VAL A O   1 
ATOM   947  C CB  . VAL A 1 122 ? 11.166  10.395  39.685 1.00 9.26  ? 122 VAL A CB  1 
ATOM   948  C CG1 . VAL A 1 122 ? 10.690  10.835  38.318 1.00 9.56  ? 122 VAL A CG1 1 
ATOM   949  C CG2 . VAL A 1 122 ? 12.240  11.343  40.219 1.00 10.19 ? 122 VAL A CG2 1 
ATOM   950  N N   . VAL A 1 123 ? 7.783   10.211  39.658 1.00 8.86  ? 123 VAL A N   1 
ATOM   951  C CA  . VAL A 1 123 ? 6.635   9.561   39.039 1.00 7.92  ? 123 VAL A CA  1 
ATOM   952  C C   . VAL A 1 123 ? 6.302   10.290  37.740 1.00 8.49  ? 123 VAL A C   1 
ATOM   953  O O   . VAL A 1 123 ? 6.029   11.492  37.730 1.00 8.38  ? 123 VAL A O   1 
ATOM   954  C CB  . VAL A 1 123 ? 5.396   9.580   39.981 1.00 9.06  ? 123 VAL A CB  1 
ATOM   955  C CG1 . VAL A 1 123 ? 4.182   9.011   39.268 1.00 8.92  ? 123 VAL A CG1 1 
ATOM   956  C CG2 . VAL A 1 123 ? 5.693   8.769   41.242 1.00 7.84  ? 123 VAL A CG2 1 
ATOM   957  N N   . ASP A 1 124 ? 6.339   9.549   36.639 1.00 9.70  ? 124 ASP A N   1 
ATOM   958  C CA  . ASP A 1 124 ? 6.044   10.111  35.330 1.00 9.30  ? 124 ASP A CA  1 
ATOM   959  C C   . ASP A 1 124 ? 4.589   9.881   34.958 1.00 10.72 ? 124 ASP A C   1 
ATOM   960  O O   . ASP A 1 124 ? 4.004   8.845   35.277 1.00 10.30 ? 124 ASP A O   1 
ATOM   961  C CB  . ASP A 1 124 ? 6.916   9.463   34.251 1.00 9.97  ? 124 ASP A CB  1 
ATOM   962  C CG  . ASP A 1 124 ? 8.379   9.401   34.632 1.00 11.61 ? 124 ASP A CG  1 
ATOM   963  O OD1 . ASP A 1 124 ? 8.995   10.467  34.813 1.00 10.86 ? 124 ASP A OD1 1 
ATOM   964  O OD2 . ASP A 1 124 ? 8.916   8.276   34.744 1.00 14.10 ? 124 ASP A OD2 1 
ATOM   965  N N   . LEU A 1 125 ? 4.010   10.867  34.284 1.00 10.22 ? 125 LEU A N   1 
ATOM   966  C CA  . LEU A 1 125 ? 2.639   10.786  33.801 1.00 10.06 ? 125 LEU A CA  1 
ATOM   967  C C   . LEU A 1 125 ? 2.778   10.939  32.287 1.00 10.18 ? 125 LEU A C   1 
ATOM   968  O O   . LEU A 1 125 ? 3.462   11.849  31.817 1.00 10.81 ? 125 LEU A O   1 
ATOM   969  C CB  . LEU A 1 125 ? 1.796   11.934  34.374 1.00 11.01 ? 125 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 125 ? 1.901   12.186  35.880 1.00 8.97  ? 125 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 125 ? 0.966   13.314  36.284 1.00 9.63  ? 125 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 125 ? 1.564   10.908  36.631 1.00 12.34 ? 125 LEU A CD2 1 
ATOM   973  N N   . PHE A 1 126 ? 2.165   10.052  31.514 1.00 9.82  ? 126 PHE A N   1 
ATOM   974  C CA  . PHE A 1 126 ? 2.283   10.184  30.069 1.00 9.88  ? 126 PHE A CA  1 
ATOM   975  C C   . PHE A 1 126 ? 1.098   9.638   29.281 1.00 10.68 ? 126 PHE A C   1 
ATOM   976  O O   . PHE A 1 126 ? 0.293   8.865   29.793 1.00 10.24 ? 126 PHE A O   1 
ATOM   977  C CB  . PHE A 1 126 ? 3.585   9.521   29.586 1.00 9.59  ? 126 PHE A CB  1 
ATOM   978  C CG  . PHE A 1 126 ? 3.527   8.018   29.535 1.00 9.45  ? 126 PHE A CG  1 
ATOM   979  C CD1 . PHE A 1 126 ? 3.918   7.255   30.634 1.00 10.32 ? 126 PHE A CD1 1 
ATOM   980  C CD2 . PHE A 1 126 ? 3.082   7.362   28.390 1.00 10.32 ? 126 PHE A CD2 1 
ATOM   981  C CE1 . PHE A 1 126 ? 3.865   5.860   30.592 1.00 12.10 ? 126 PHE A CE1 1 
ATOM   982  C CE2 . PHE A 1 126 ? 3.023   5.973   28.339 1.00 9.75  ? 126 PHE A CE2 1 
ATOM   983  C CZ  . PHE A 1 126 ? 3.415   5.219   29.444 1.00 10.73 ? 126 PHE A CZ  1 
ATOM   984  N N   . ALA A 1 127 ? 0.997   10.077  28.030 1.00 9.28  ? 127 ALA A N   1 
ATOM   985  C CA  . ALA A 1 127 ? -0.046  9.629   27.126 1.00 9.51  ? 127 ALA A CA  1 
ATOM   986  C C   . ALA A 1 127 ? 0.567   9.637   25.739 1.00 10.84 ? 127 ALA A C   1 
ATOM   987  O O   . ALA A 1 127 ? 1.410   10.473  25.426 1.00 9.90  ? 127 ALA A O   1 
ATOM   988  C CB  . ALA A 1 127 ? -1.240  10.567  27.172 1.00 10.04 ? 127 ALA A CB  1 
ATOM   989  N N   . PRO A 1 128 ? 0.178   8.685   24.890 1.00 12.09 ? 128 PRO A N   1 
ATOM   990  C CA  . PRO A 1 128 ? 0.777   8.723   23.559 1.00 11.74 ? 128 PRO A CA  1 
ATOM   991  C C   . PRO A 1 128 ? 0.200   9.871   22.727 1.00 11.02 ? 128 PRO A C   1 
ATOM   992  O O   . PRO A 1 128 ? -0.885  10.377  23.010 1.00 11.37 ? 128 PRO A O   1 
ATOM   993  C CB  . PRO A 1 128 ? 0.426   7.357   22.967 1.00 14.10 ? 128 PRO A CB  1 
ATOM   994  C CG  . PRO A 1 128 ? -0.803  6.939   23.686 1.00 14.75 ? 128 PRO A CG  1 
ATOM   995  C CD  . PRO A 1 128 ? -0.751  7.556   25.062 1.00 13.84 ? 128 PRO A CD  1 
ATOM   996  N N   . LEU A 1 129 ? 0.960   10.286  21.722 1.00 10.64 ? 129 LEU A N   1 
ATOM   997  C CA  . LEU A 1 129 ? 0.540   11.324  20.788 1.00 10.86 ? 129 LEU A CA  1 
ATOM   998  C C   . LEU A 1 129 ? 0.490   10.563  19.453 1.00 11.21 ? 129 LEU A C   1 
ATOM   999  O O   . LEU A 1 129 ? 1.413   10.642  18.641 1.00 11.49 ? 129 LEU A O   1 
ATOM   1000 C CB  . LEU A 1 129 ? 1.577   12.446  20.743 1.00 10.70 ? 129 LEU A CB  1 
ATOM   1001 C CG  . LEU A 1 129 ? 1.654   13.310  22.005 1.00 9.38  ? 129 LEU A CG  1 
ATOM   1002 C CD1 . LEU A 1 129 ? 2.884   14.201  21.940 1.00 10.11 ? 129 LEU A CD1 1 
ATOM   1003 C CD2 . LEU A 1 129 ? 0.394   14.148  22.139 1.00 9.08  ? 129 LEU A CD2 1 
ATOM   1004 N N   . PRO A 1 130 ? -0.611  9.831   19.212 1.00 11.93 ? 130 PRO A N   1 
ATOM   1005 C CA  . PRO A 1 130 ? -0.806  9.031   18.000 1.00 13.42 ? 130 PRO A CA  1 
ATOM   1006 C C   . PRO A 1 130 ? -0.809  9.744   16.651 1.00 14.54 ? 130 PRO A C   1 
ATOM   1007 O O   . PRO A 1 130 ? -0.609  9.104   15.621 1.00 16.19 ? 130 PRO A O   1 
ATOM   1008 C CB  . PRO A 1 130 ? -2.115  8.286   18.266 1.00 13.22 ? 130 PRO A CB  1 
ATOM   1009 C CG  . PRO A 1 130 ? -2.829  9.109   19.247 1.00 13.95 ? 130 PRO A CG  1 
ATOM   1010 C CD  . PRO A 1 130 ? -1.786  9.772   20.099 1.00 12.71 ? 130 PRO A CD  1 
ATOM   1011 N N   . LEU A 1 131 ? -1.032  11.053  16.644 1.00 13.38 ? 131 LEU A N   1 
ATOM   1012 C CA  . LEU A 1 131 ? -1.048  11.794  15.390 1.00 13.68 ? 131 LEU A CA  1 
ATOM   1013 C C   . LEU A 1 131 ? 0.359   12.029  14.832 1.00 15.44 ? 131 LEU A C   1 
ATOM   1014 O O   . LEU A 1 131 ? 0.515   12.314  13.646 1.00 14.81 ? 131 LEU A O   1 
ATOM   1015 C CB  . LEU A 1 131 ? -1.755  13.140  15.579 1.00 12.70 ? 131 LEU A CB  1 
ATOM   1016 C CG  . LEU A 1 131 ? -3.241  13.113  15.947 1.00 12.77 ? 131 LEU A CG  1 
ATOM   1017 C CD1 . LEU A 1 131 ? -3.732  14.533  16.153 1.00 11.31 ? 131 LEU A CD1 1 
ATOM   1018 C CD2 . LEU A 1 131 ? -4.045  12.406  14.860 1.00 13.08 ? 131 LEU A CD2 1 
ATOM   1019 N N   . GLU A 1 132 ? 1.376   11.905  15.685 1.00 17.51 ? 132 GLU A N   1 
ATOM   1020 C CA  . GLU A 1 132 ? 2.768   12.117  15.272 1.00 19.87 ? 132 GLU A CA  1 
ATOM   1021 C C   . GLU A 1 132 ? 3.365   10.923  14.535 1.00 22.26 ? 132 GLU A C   1 
ATOM   1022 O O   . GLU A 1 132 ? 2.960   9.780   14.839 1.00 24.00 ? 132 GLU A O   1 
ATOM   1023 C CB  . GLU A 1 132 ? 3.640   12.431  16.487 1.00 18.50 ? 132 GLU A CB  1 
ATOM   1024 C CG  . GLU A 1 132 ? 3.263   13.705  17.214 1.00 17.69 ? 132 GLU A CG  1 
ATOM   1025 C CD  . GLU A 1 132 ? 4.269   14.069  18.280 1.00 18.03 ? 132 GLU A CD  1 
ATOM   1026 O OE1 . GLU A 1 132 ? 5.272   13.340  18.419 1.00 20.49 ? 132 GLU A OE1 1 
ATOM   1027 O OE2 . GLU A 1 132 ? 4.060   15.081  18.976 1.00 21.43 ? 132 GLU A OE2 1 
ATOM   1028 N N   . SER B 1 2   ? -8.683  5.408   34.361 1.00 32.86 ? 202 SER B N   1 
ATOM   1029 C CA  . SER B 1 2   ? -8.077  6.192   33.250 1.00 30.83 ? 202 SER B CA  1 
ATOM   1030 C C   . SER B 1 2   ? -6.555  6.049   33.260 1.00 28.86 ? 202 SER B C   1 
ATOM   1031 O O   . SER B 1 2   ? -5.926  6.035   32.204 1.00 30.58 ? 202 SER B O   1 
ATOM   1032 C CB  . SER B 1 2   ? -8.474  7.667   33.376 1.00 34.22 ? 202 SER B CB  1 
ATOM   1033 O OG  . SER B 1 2   ? -8.066  8.423   32.246 1.00 36.64 ? 202 SER B OG  1 
ATOM   1034 N N   . ALA B 1 3   ? -5.965  5.942   34.449 1.00 24.79 ? 203 ALA B N   1 
ATOM   1035 C CA  . ALA B 1 3   ? -4.514  5.787   34.567 1.00 21.88 ? 203 ALA B CA  1 
ATOM   1036 C C   . ALA B 1 3   ? -4.122  4.374   34.997 1.00 20.20 ? 203 ALA B C   1 
ATOM   1037 O O   . ALA B 1 3   ? -4.829  3.723   35.770 1.00 19.35 ? 203 ALA B O   1 
ATOM   1038 C CB  . ALA B 1 3   ? -3.948  6.795   35.563 1.00 22.84 ? 203 ALA B CB  1 
ATOM   1039 N N   . ARG B 1 4   ? -2.984  3.906   34.498 1.00 17.24 ? 204 ARG B N   1 
ATOM   1040 C CA  . ARG B 1 4   ? -2.506  2.579   34.852 1.00 16.15 ? 204 ARG B CA  1 
ATOM   1041 C C   . ARG B 1 4   ? -0.992  2.562   34.852 1.00 14.35 ? 204 ARG B C   1 
ATOM   1042 O O   . ARG B 1 4   ? -0.358  3.234   34.042 1.00 11.67 ? 204 ARG B O   1 
ATOM   1043 C CB  . ARG B 1 4   ? -3.036  1.538   33.864 1.00 19.33 ? 204 ARG B CB  1 
ATOM   1044 C CG  . ARG B 1 4   ? -2.406  1.608   32.493 1.00 22.81 ? 204 ARG B CG  1 
ATOM   1045 C CD  . ARG B 1 4   ? -2.499  0.279   31.789 1.00 29.01 ? 204 ARG B CD  1 
ATOM   1046 N NE  . ARG B 1 4   ? -1.918  0.358   30.449 1.00 36.79 ? 204 ARG B NE  1 
ATOM   1047 C CZ  . ARG B 1 4   ? -2.322  -0.373  29.414 1.00 39.25 ? 204 ARG B CZ  1 
ATOM   1048 N NH1 . ARG B 1 4   ? -3.310  -1.245  29.569 1.00 39.81 ? 204 ARG B NH1 1 
ATOM   1049 N NH2 . ARG B 1 4   ? -1.763  -0.216  28.216 1.00 40.09 ? 204 ARG B NH2 1 
ATOM   1050 N N   . ILE B 1 5   ? -0.411  1.809   35.778 1.00 13.34 ? 205 ILE B N   1 
ATOM   1051 C CA  . ILE B 1 5   ? 1.032   1.713   35.844 1.00 13.64 ? 205 ILE B CA  1 
ATOM   1052 C C   . ILE B 1 5   ? 1.456   1.029   34.560 1.00 13.12 ? 205 ILE B C   1 
ATOM   1053 O O   . ILE B 1 5   ? 0.883   0.014   34.165 1.00 14.24 ? 205 ILE B O   1 
ATOM   1054 C CB  . ILE B 1 5   ? 1.497   0.905   37.076 1.00 14.34 ? 205 ILE B CB  1 
ATOM   1055 C CG1 . ILE B 1 5   ? 1.098   1.653   38.354 1.00 16.17 ? 205 ILE B CG1 1 
ATOM   1056 C CG2 . ILE B 1 5   ? 3.011   0.699   37.020 1.00 14.76 ? 205 ILE B CG2 1 
ATOM   1057 C CD1 . ILE B 1 5   ? 2.012   1.408   39.549 1.00 17.23 ? 205 ILE B CD1 1 
ATOM   1058 N N   . SER B 1 6   ? 2.453   1.598   33.900 1.00 12.45 ? 206 SER B N   1 
ATOM   1059 C CA  . SER B 1 6   ? 2.908   1.057   32.634 1.00 12.86 ? 206 SER B CA  1 
ATOM   1060 C C   . SER B 1 6   ? 4.393   0.702   32.624 1.00 13.78 ? 206 SER B C   1 
ATOM   1061 O O   . SER B 1 6   ? 4.803   -0.258  31.969 1.00 12.56 ? 206 SER B O   1 
ATOM   1062 C CB  . SER B 1 6   ? 2.593   2.076   31.526 1.00 13.97 ? 206 SER B CB  1 
ATOM   1063 O OG  . SER B 1 6   ? 3.292   1.807   30.324 1.00 17.61 ? 206 SER B OG  1 
ATOM   1064 N N   . LEU B 1 7   ? 5.197   1.447   33.378 1.00 10.90 ? 207 LEU B N   1 
ATOM   1065 C CA  . LEU B 1 7   ? 6.627   1.210   33.366 1.00 10.16 ? 207 LEU B CA  1 
ATOM   1066 C C   . LEU B 1 7   ? 7.346   1.496   34.694 1.00 9.26  ? 207 LEU B C   1 
ATOM   1067 O O   . LEU B 1 7   ? 6.942   2.370   35.461 1.00 8.38  ? 207 LEU B O   1 
ATOM   1068 C CB  . LEU B 1 7   ? 7.214   2.075   32.246 1.00 12.47 ? 207 LEU B CB  1 
ATOM   1069 C CG  . LEU B 1 7   ? 8.674   2.103   31.830 1.00 15.62 ? 207 LEU B CG  1 
ATOM   1070 C CD1 . LEU B 1 7   ? 8.765   2.102   30.305 1.00 15.71 ? 207 LEU B CD1 1 
ATOM   1071 C CD2 . LEU B 1 7   ? 9.323   3.355   32.386 1.00 19.40 ? 207 LEU B CD2 1 
ATOM   1072 N N   . PHE B 1 8   ? 8.391   0.716   34.959 1.00 8.72  ? 208 PHE B N   1 
ATOM   1073 C CA  . PHE B 1 8   ? 9.245   0.892   36.132 1.00 9.37  ? 208 PHE B CA  1 
ATOM   1074 C C   . PHE B 1 8   ? 10.626  1.049   35.510 1.00 8.51  ? 208 PHE B C   1 
ATOM   1075 O O   . PHE B 1 8   ? 11.107  0.153   34.818 1.00 9.07  ? 208 PHE B O   1 
ATOM   1076 C CB  . PHE B 1 8   ? 9.216   -0.337  37.040 1.00 7.80  ? 208 PHE B CB  1 
ATOM   1077 C CG  . PHE B 1 8   ? 7.963   -0.455  37.852 1.00 7.59  ? 208 PHE B CG  1 
ATOM   1078 C CD1 . PHE B 1 8   ? 7.839   0.213   39.072 1.00 6.41  ? 208 PHE B CD1 1 
ATOM   1079 C CD2 . PHE B 1 8   ? 6.901   -1.228  37.400 1.00 7.35  ? 208 PHE B CD2 1 
ATOM   1080 C CE1 . PHE B 1 8   ? 6.668   0.105   39.825 1.00 7.27  ? 208 PHE B CE1 1 
ATOM   1081 C CE2 . PHE B 1 8   ? 5.724   -1.341  38.145 1.00 7.68  ? 208 PHE B CE2 1 
ATOM   1082 C CZ  . PHE B 1 8   ? 5.606   -0.676  39.358 1.00 7.19  ? 208 PHE B CZ  1 
ATOM   1083 N N   . ALA B 1 9   ? 11.262  2.192   35.745 1.00 8.24  ? 209 ALA B N   1 
ATOM   1084 C CA  . ALA B 1 9   ? 12.569  2.460   35.159 1.00 9.12  ? 209 ALA B CA  1 
ATOM   1085 C C   . ALA B 1 9   ? 13.665  2.658   36.189 1.00 8.35  ? 209 ALA B C   1 
ATOM   1086 O O   . ALA B 1 9   ? 13.425  3.202   37.260 1.00 11.41 ? 209 ALA B O   1 
ATOM   1087 C CB  . ALA B 1 9   ? 12.482  3.703   34.257 1.00 9.28  ? 209 ALA B CB  1 
ATOM   1088 N N   . VAL B 1 10  ? 14.867  2.203   35.864 1.00 8.98  ? 210 VAL B N   1 
ATOM   1089 C CA  . VAL B 1 10  ? 15.998  2.385   36.755 1.00 9.41  ? 210 VAL B CA  1 
ATOM   1090 C C   . VAL B 1 10  ? 17.091  3.146   36.015 1.00 10.22 ? 210 VAL B C   1 
ATOM   1091 O O   . VAL B 1 10  ? 17.286  2.970   34.809 1.00 9.85  ? 210 VAL B O   1 
ATOM   1092 C CB  . VAL B 1 10  ? 16.556  1.043   37.278 1.00 11.01 ? 210 VAL B CB  1 
ATOM   1093 C CG1 . VAL B 1 10  ? 15.452  0.274   37.982 1.00 11.08 ? 210 VAL B CG1 1 
ATOM   1094 C CG2 . VAL B 1 10  ? 17.135  0.230   36.143 1.00 11.28 ? 210 VAL B CG2 1 
ATOM   1095 N N   . VAL B 1 11  ? 17.776  4.015   36.746 1.00 9.65  ? 211 VAL B N   1 
ATOM   1096 C CA  . VAL B 1 11  ? 18.859  4.829   36.203 1.00 11.40 ? 211 VAL B CA  1 
ATOM   1097 C C   . VAL B 1 11  ? 20.141  3.998   36.231 1.00 12.57 ? 211 VAL B C   1 
ATOM   1098 O O   . VAL B 1 11  ? 20.499  3.448   37.274 1.00 15.46 ? 211 VAL B O   1 
ATOM   1099 C CB  . VAL B 1 11  ? 19.042  6.108   37.055 1.00 9.22  ? 211 VAL B CB  1 
ATOM   1100 C CG1 . VAL B 1 11  ? 20.189  6.944   36.519 1.00 9.99  ? 211 VAL B CG1 1 
ATOM   1101 C CG2 . VAL B 1 11  ? 17.745  6.902   37.070 1.00 9.90  ? 211 VAL B CG2 1 
ATOM   1102 N N   . VAL B 1 12  ? 20.824  3.886   35.092 1.00 11.90 ? 212 VAL B N   1 
ATOM   1103 C CA  . VAL B 1 12  ? 22.053  3.095   35.037 1.00 12.37 ? 212 VAL B CA  1 
ATOM   1104 C C   . VAL B 1 12  ? 23.277  3.931   34.676 1.00 14.32 ? 212 VAL B C   1 
ATOM   1105 O O   . VAL B 1 12  ? 23.226  4.770   33.777 1.00 13.54 ? 212 VAL B O   1 
ATOM   1106 C CB  . VAL B 1 12  ? 21.930  1.899   34.031 1.00 11.50 ? 212 VAL B CB  1 
ATOM   1107 C CG1 . VAL B 1 12  ? 20.739  1.025   34.393 1.00 11.08 ? 212 VAL B CG1 1 
ATOM   1108 C CG2 . VAL B 1 12  ? 21.783  2.404   32.618 1.00 11.79 ? 212 VAL B CG2 1 
ATOM   1109 N N   . GLU B 1 13  ? 24.372  3.715   35.400 1.00 15.78 ? 213 GLU B N   1 
ATOM   1110 C CA  . GLU B 1 13  ? 25.610  4.429   35.126 1.00 18.38 ? 213 GLU B CA  1 
ATOM   1111 C C   . GLU B 1 13  ? 26.210  3.796   33.872 1.00 19.22 ? 213 GLU B C   1 
ATOM   1112 O O   . GLU B 1 13  ? 26.876  4.468   33.087 1.00 19.56 ? 213 GLU B O   1 
ATOM   1113 C CB  . GLU B 1 13  ? 26.586  4.297   36.302 1.00 22.09 ? 213 GLU B CB  1 
ATOM   1114 C CG  . GLU B 1 13  ? 28.054  4.511   35.929 1.00 29.63 ? 213 GLU B CG  1 
ATOM   1115 C CD  . GLU B 1 13  ? 28.996  3.561   36.663 1.00 35.34 ? 213 GLU B CD  1 
ATOM   1116 O OE1 . GLU B 1 13  ? 29.113  3.689   37.904 1.00 38.97 ? 213 GLU B OE1 1 
ATOM   1117 O OE2 . GLU B 1 13  ? 29.621  2.690   36.005 1.00 37.56 ? 213 GLU B OE2 1 
ATOM   1118 N N   . ASP B 1 14  ? 25.963  2.499   33.698 1.00 18.62 ? 214 ASP B N   1 
ATOM   1119 C CA  . ASP B 1 14  ? 26.447  1.750   32.544 1.00 19.56 ? 214 ASP B CA  1 
ATOM   1120 C C   . ASP B 1 14  ? 25.395  0.745   32.080 1.00 19.35 ? 214 ASP B C   1 
ATOM   1121 O O   . ASP B 1 14  ? 25.173  -0.287  32.734 1.00 17.68 ? 214 ASP B O   1 
ATOM   1122 C CB  . ASP B 1 14  ? 27.734  0.995   32.881 1.00 23.22 ? 214 ASP B CB  1 
ATOM   1123 C CG  . ASP B 1 14  ? 28.397  0.395   31.646 1.00 24.91 ? 214 ASP B CG  1 
ATOM   1124 O OD1 . ASP B 1 14  ? 28.019  -0.722  31.231 1.00 25.33 ? 214 ASP B OD1 1 
ATOM   1125 O OD2 . ASP B 1 14  ? 29.296  1.054   31.083 1.00 31.58 ? 214 ASP B OD2 1 
ATOM   1126 N N   . MET B 1 15  ? 24.766  1.044   30.944 1.00 18.05 ? 215 MET B N   1 
ATOM   1127 C CA  . MET B 1 15  ? 23.726  0.189   30.373 1.00 16.38 ? 215 MET B CA  1 
ATOM   1128 C C   . MET B 1 15  ? 24.155  -1.271  30.248 1.00 16.42 ? 215 MET B C   1 
ATOM   1129 O O   . MET B 1 15  ? 23.430  -2.174  30.665 1.00 14.29 ? 215 MET B O   1 
ATOM   1130 C CB  . MET B 1 15  ? 23.299  0.721   28.999 1.00 16.26 ? 215 MET B CB  1 
ATOM   1131 C CG  . MET B 1 15  ? 22.146  -0.045  28.362 1.00 14.90 ? 215 MET B CG  1 
ATOM   1132 S SD  . MET B 1 15  ? 20.596  0.117   29.270 1.00 14.17 ? 215 MET B SD  1 
ATOM   1133 C CE  . MET B 1 15  ? 20.236  1.874   28.994 1.00 12.83 ? 215 MET B CE  1 
ATOM   1134 N N   . ALA B 1 16  ? 25.334  -1.494  29.676 1.00 16.61 ? 216 ALA B N   1 
ATOM   1135 C CA  . ALA B 1 16  ? 25.851  -2.845  29.495 1.00 16.40 ? 216 ALA B CA  1 
ATOM   1136 C C   . ALA B 1 16  ? 25.996  -3.595  30.822 1.00 16.41 ? 216 ALA B C   1 
ATOM   1137 O O   . ALA B 1 16  ? 25.600  -4.759  30.927 1.00 15.83 ? 216 ALA B O   1 
ATOM   1138 C CB  . ALA B 1 16  ? 27.197  -2.794  28.770 1.00 16.96 ? 216 ALA B CB  1 
ATOM   1139 N N   . LYS B 1 17  ? 26.565  -2.928  31.827 1.00 17.39 ? 217 LYS B N   1 
ATOM   1140 C CA  . LYS B 1 17  ? 26.765  -3.542  33.140 1.00 17.72 ? 217 LYS B CA  1 
ATOM   1141 C C   . LYS B 1 17  ? 25.436  -3.918  33.771 1.00 16.69 ? 217 LYS B C   1 
ATOM   1142 O O   . LYS B 1 17  ? 25.301  -4.982  34.370 1.00 16.20 ? 217 LYS B O   1 
ATOM   1143 C CB  . LYS B 1 17  ? 27.503  -2.589  34.084 1.00 21.29 ? 217 LYS B CB  1 
ATOM   1144 C CG  . LYS B 1 17  ? 28.892  -2.155  33.631 1.00 28.28 ? 217 LYS B CG  1 
ATOM   1145 C CD  . LYS B 1 17  ? 29.666  -3.273  32.957 1.00 32.46 ? 217 LYS B CD  1 
ATOM   1146 C CE  . LYS B 1 17  ? 31.165  -3.015  33.034 1.00 35.77 ? 217 LYS B CE  1 
ATOM   1147 N NZ  . LYS B 1 17  ? 31.961  -4.233  32.696 1.00 39.47 ? 217 LYS B NZ  1 
ATOM   1148 N N   . SER B 1 18  ? 24.453  -3.035  33.631 1.00 15.37 ? 218 SER B N   1 
ATOM   1149 C CA  . SER B 1 18  ? 23.134  -3.276  34.200 1.00 14.54 ? 218 SER B CA  1 
ATOM   1150 C C   . SER B 1 18  ? 22.402  -4.421  33.504 1.00 13.57 ? 218 SER B C   1 
ATOM   1151 O O   . SER B 1 18  ? 21.927  -5.356  34.152 1.00 12.31 ? 218 SER B O   1 
ATOM   1152 C CB  . SER B 1 18  ? 22.293  -1.996  34.120 1.00 12.68 ? 218 SER B CB  1 
ATOM   1153 O OG  . SER B 1 18  ? 21.029  -2.184  34.724 1.00 12.42 ? 218 SER B OG  1 
ATOM   1154 N N   . LEU B 1 19  ? 22.323  -4.346  32.177 1.00 15.62 ? 219 LEU B N   1 
ATOM   1155 C CA  . LEU B 1 19  ? 21.630  -5.355  31.384 1.00 14.48 ? 219 LEU B CA  1 
ATOM   1156 C C   . LEU B 1 19  ? 22.176  -6.763  31.560 1.00 14.99 ? 219 LEU B C   1 
ATOM   1157 O O   . LEU B 1 19  ? 21.407  -7.721  31.561 1.00 15.75 ? 219 LEU B O   1 
ATOM   1158 C CB  . LEU B 1 19  ? 21.655  -4.972  29.900 1.00 14.31 ? 219 LEU B CB  1 
ATOM   1159 C CG  . LEU B 1 19  ? 20.865  -3.708  29.530 1.00 14.21 ? 219 LEU B CG  1 
ATOM   1160 C CD1 . LEU B 1 19  ? 20.717  -3.632  28.009 1.00 15.14 ? 219 LEU B CD1 1 
ATOM   1161 C CD2 . LEU B 1 19  ? 19.495  -3.710  30.208 1.00 12.05 ? 219 LEU B CD2 1 
ATOM   1162 N N   . GLU B 1 20  ? 23.493  -6.897  31.712 1.00 15.69 ? 220 GLU B N   1 
ATOM   1163 C CA  . GLU B 1 20  ? 24.079  -8.220  31.882 1.00 16.20 ? 220 GLU B CA  1 
ATOM   1164 C C   . GLU B 1 20  ? 23.679  -8.832  33.226 1.00 14.60 ? 220 GLU B C   1 
ATOM   1165 O O   . GLU B 1 20  ? 23.584  -10.048 33.354 1.00 16.59 ? 220 GLU B O   1 
ATOM   1166 C CB  . GLU B 1 20  ? 25.601  -8.165  31.716 1.00 17.99 ? 220 GLU B CB  1 
ATOM   1167 C CG  . GLU B 1 20  ? 26.376  -7.450  32.796 1.00 24.27 ? 220 GLU B CG  1 
ATOM   1168 C CD  . GLU B 1 20  ? 27.866  -7.768  32.724 1.00 26.79 ? 220 GLU B CD  1 
ATOM   1169 O OE1 . GLU B 1 20  ? 28.694  -6.893  33.060 1.00 28.25 ? 220 GLU B OE1 1 
ATOM   1170 O OE2 . GLU B 1 20  ? 28.208  -8.901  32.323 1.00 27.58 ? 220 GLU B OE2 1 
ATOM   1171 N N   . PHE B 1 21  ? 23.422  -7.984  34.214 1.00 12.63 ? 221 PHE B N   1 
ATOM   1172 C CA  . PHE B 1 21  ? 22.991  -8.454  35.522 1.00 12.08 ? 221 PHE B CA  1 
ATOM   1173 C C   . PHE B 1 21  ? 21.580  -9.015  35.371 1.00 11.65 ? 221 PHE B C   1 
ATOM   1174 O O   . PHE B 1 21  ? 21.291  -10.137 35.781 1.00 11.63 ? 221 PHE B O   1 
ATOM   1175 C CB  . PHE B 1 21  ? 22.985  -7.290  36.527 1.00 12.35 ? 221 PHE B CB  1 
ATOM   1176 C CG  . PHE B 1 21  ? 22.274  -7.599  37.825 1.00 12.06 ? 221 PHE B CG  1 
ATOM   1177 C CD1 . PHE B 1 21  ? 22.949  -8.204  38.880 1.00 13.35 ? 221 PHE B CD1 1 
ATOM   1178 C CD2 . PHE B 1 21  ? 20.925  -7.291  37.990 1.00 13.68 ? 221 PHE B CD2 1 
ATOM   1179 C CE1 . PHE B 1 21  ? 22.286  -8.502  40.086 1.00 12.61 ? 221 PHE B CE1 1 
ATOM   1180 C CE2 . PHE B 1 21  ? 20.254  -7.584  39.190 1.00 12.22 ? 221 PHE B CE2 1 
ATOM   1181 C CZ  . PHE B 1 21  ? 20.939  -8.191  40.238 1.00 11.77 ? 221 PHE B CZ  1 
ATOM   1182 N N   . TYR B 1 22  ? 20.702  -8.236  34.756 1.00 11.02 ? 222 TYR B N   1 
ATOM   1183 C CA  . TYR B 1 22  ? 19.328  -8.666  34.589 1.00 10.02 ? 222 TYR B CA  1 
ATOM   1184 C C   . TYR B 1 22  ? 19.140  -9.857  33.658 1.00 10.91 ? 222 TYR B C   1 
ATOM   1185 O O   . TYR B 1 22  ? 18.208  -10.639 33.833 1.00 11.14 ? 222 TYR B O   1 
ATOM   1186 C CB  . TYR B 1 22  ? 18.471  -7.472  34.152 1.00 10.16 ? 222 TYR B CB  1 
ATOM   1187 C CG  . TYR B 1 22  ? 18.205  -6.540  35.316 1.00 9.35  ? 222 TYR B CG  1 
ATOM   1188 C CD1 . TYR B 1 22  ? 17.230  -6.850  36.270 1.00 9.07  ? 222 TYR B CD1 1 
ATOM   1189 C CD2 . TYR B 1 22  ? 19.004  -5.421  35.536 1.00 9.12  ? 222 TYR B CD2 1 
ATOM   1190 C CE1 . TYR B 1 22  ? 17.069  -6.078  37.418 1.00 8.06  ? 222 TYR B CE1 1 
ATOM   1191 C CE2 . TYR B 1 22  ? 18.848  -4.640  36.686 1.00 9.11  ? 222 TYR B CE2 1 
ATOM   1192 C CZ  . TYR B 1 22  ? 17.883  -4.981  37.619 1.00 7.95  ? 222 TYR B CZ  1 
ATOM   1193 O OH  . TYR B 1 22  ? 17.750  -4.250  38.767 1.00 8.36  ? 222 TYR B OH  1 
ATOM   1194 N N   . ARG B 1 23  ? 20.015  -10.001 32.668 1.00 11.92 ? 223 ARG B N   1 
ATOM   1195 C CA  . ARG B 1 23  ? 19.907  -11.132 31.756 1.00 12.53 ? 223 ARG B CA  1 
ATOM   1196 C C   . ARG B 1 23  ? 20.192  -12.393 32.573 1.00 13.57 ? 223 ARG B C   1 
ATOM   1197 O O   . ARG B 1 23  ? 19.706  -13.482 32.256 1.00 13.66 ? 223 ARG B O   1 
ATOM   1198 C CB  . ARG B 1 23  ? 20.914  -10.997 30.610 1.00 13.10 ? 223 ARG B CB  1 
ATOM   1199 C CG  . ARG B 1 23  ? 20.412  -10.170 29.448 1.00 12.41 ? 223 ARG B CG  1 
ATOM   1200 C CD  . ARG B 1 23  ? 21.439  -10.155 28.331 1.00 17.19 ? 223 ARG B CD  1 
ATOM   1201 N NE  . ARG B 1 23  ? 21.232  -9.047  27.404 1.00 15.40 ? 223 ARG B NE  1 
ATOM   1202 C CZ  . ARG B 1 23  ? 22.005  -7.969  27.347 1.00 17.10 ? 223 ARG B CZ  1 
ATOM   1203 N NH1 . ARG B 1 23  ? 23.042  -7.849  28.164 1.00 18.16 ? 223 ARG B NH1 1 
ATOM   1204 N NH2 . ARG B 1 23  ? 21.741  -7.005  26.473 1.00 17.75 ? 223 ARG B NH2 1 
ATOM   1205 N N   . LYS B 1 24  ? 20.971  -12.224 33.642 1.00 14.06 ? 224 LYS B N   1 
ATOM   1206 C CA  . LYS B 1 24  ? 21.318  -13.327 34.530 1.00 15.47 ? 224 LYS B CA  1 
ATOM   1207 C C   . LYS B 1 24  ? 20.109  -13.743 35.366 1.00 15.20 ? 224 LYS B C   1 
ATOM   1208 O O   . LYS B 1 24  ? 20.089  -14.825 35.952 1.00 15.23 ? 224 LYS B O   1 
ATOM   1209 C CB  . LYS B 1 24  ? 22.470  -12.918 35.448 1.00 17.60 ? 224 LYS B CB  1 
ATOM   1210 C CG  . LYS B 1 24  ? 23.822  -12.945 34.780 1.00 18.81 ? 224 LYS B CG  1 
ATOM   1211 C CD  . LYS B 1 24  ? 24.901  -13.367 35.754 1.00 23.53 ? 224 LYS B CD  1 
ATOM   1212 C CE  . LYS B 1 24  ? 26.145  -13.833 35.018 1.00 25.74 ? 224 LYS B CE  1 
ATOM   1213 N NZ  . LYS B 1 24  ? 26.828  -12.700 34.341 1.00 30.19 ? 224 LYS B NZ  1 
ATOM   1214 N N   . LEU B 1 25  ? 19.103  -12.876 35.430 1.00 14.85 ? 225 LEU B N   1 
ATOM   1215 C CA  . LEU B 1 25  ? 17.889  -13.175 36.181 1.00 14.27 ? 225 LEU B CA  1 
ATOM   1216 C C   . LEU B 1 25  ? 16.749  -13.568 35.245 1.00 14.95 ? 225 LEU B C   1 
ATOM   1217 O O   . LEU B 1 25  ? 15.576  -13.509 35.613 1.00 16.64 ? 225 LEU B O   1 
ATOM   1218 C CB  . LEU B 1 25  ? 17.484  -11.971 37.028 1.00 13.22 ? 225 LEU B CB  1 
ATOM   1219 C CG  . LEU B 1 25  ? 18.368  -11.776 38.261 1.00 13.54 ? 225 LEU B CG  1 
ATOM   1220 C CD1 . LEU B 1 25  ? 18.193  -10.375 38.807 1.00 12.37 ? 225 LEU B CD1 1 
ATOM   1221 C CD2 . LEU B 1 25  ? 18.000  -12.809 39.310 1.00 13.96 ? 225 LEU B CD2 1 
ATOM   1222 N N   . GLY B 1 26  ? 17.099  -13.955 34.023 1.00 14.82 ? 226 GLY B N   1 
ATOM   1223 C CA  . GLY B 1 26  ? 16.087  -14.380 33.072 1.00 16.27 ? 226 GLY B CA  1 
ATOM   1224 C C   . GLY B 1 26  ? 15.373  -13.306 32.274 1.00 16.71 ? 226 GLY B C   1 
ATOM   1225 O O   . GLY B 1 26  ? 14.421  -13.606 31.553 1.00 17.07 ? 226 GLY B O   1 
ATOM   1226 N N   . VAL B 1 27  ? 15.803  -12.054 32.393 1.00 16.83 ? 227 VAL B N   1 
ATOM   1227 C CA  . VAL B 1 27  ? 15.152  -11.000 31.629 1.00 17.52 ? 227 VAL B CA  1 
ATOM   1228 C C   . VAL B 1 27  ? 15.690  -11.045 30.198 1.00 18.66 ? 227 VAL B C   1 
ATOM   1229 O O   . VAL B 1 27  ? 16.902  -10.975 29.967 1.00 18.59 ? 227 VAL B O   1 
ATOM   1230 C CB  . VAL B 1 27  ? 15.401  -9.603  32.241 1.00 15.76 ? 227 VAL B CB  1 
ATOM   1231 C CG1 . VAL B 1 27  ? 14.494  -8.581  31.567 1.00 14.89 ? 227 VAL B CG1 1 
ATOM   1232 C CG2 . VAL B 1 27  ? 15.132  -9.634  33.743 1.00 16.60 ? 227 VAL B CG2 1 
ATOM   1233 N N   . GLU B 1 28  ? 14.784  -11.185 29.239 1.00 22.16 ? 228 GLU B N   1 
ATOM   1234 C CA  . GLU B 1 28  ? 15.182  -11.263 27.837 1.00 24.72 ? 228 GLU B CA  1 
ATOM   1235 C C   . GLU B 1 28  ? 15.539  -9.881  27.300 1.00 22.40 ? 228 GLU B C   1 
ATOM   1236 O O   . GLU B 1 28  ? 14.667  -9.035  27.110 1.00 22.90 ? 228 GLU B O   1 
ATOM   1237 C CB  . GLU B 1 28  ? 14.050  -11.880 27.007 1.00 29.02 ? 228 GLU B CB  1 
ATOM   1238 C CG  . GLU B 1 28  ? 13.072  -12.733 27.826 1.00 37.29 ? 228 GLU B CG  1 
ATOM   1239 C CD  . GLU B 1 28  ? 12.935  -14.169 27.307 1.00 41.71 ? 228 GLU B CD  1 
ATOM   1240 O OE1 . GLU B 1 28  ? 12.126  -14.392 26.370 1.00 44.24 ? 228 GLU B OE1 1 
ATOM   1241 O OE2 . GLU B 1 28  ? 13.629  -15.072 27.840 1.00 43.04 ? 228 GLU B OE2 1 
ATOM   1242 N N   . ILE B 1 29  ? 16.824  -9.645  27.065 1.00 20.72 ? 229 ILE B N   1 
ATOM   1243 C CA  . ILE B 1 29  ? 17.254  -8.355  26.550 1.00 20.64 ? 229 ILE B CA  1 
ATOM   1244 C C   . ILE B 1 29  ? 18.226  -8.511  25.394 1.00 21.49 ? 229 ILE B C   1 
ATOM   1245 O O   . ILE B 1 29  ? 19.271  -9.139  25.532 1.00 21.88 ? 229 ILE B O   1 
ATOM   1246 C CB  . ILE B 1 29  ? 17.939  -7.497  27.644 1.00 19.52 ? 229 ILE B CB  1 
ATOM   1247 C CG1 . ILE B 1 29  ? 17.042  -7.393  28.879 1.00 18.27 ? 229 ILE B CG1 1 
ATOM   1248 C CG2 . ILE B 1 29  ? 18.221  -6.106  27.106 1.00 16.49 ? 229 ILE B CG2 1 
ATOM   1249 C CD1 . ILE B 1 29  ? 17.783  -6.955  30.124 1.00 18.77 ? 229 ILE B CD1 1 
ATOM   1250 N N   . PRO B 1 30  ? 17.887  -7.934  24.231 1.00 23.63 ? 230 PRO B N   1 
ATOM   1251 C CA  . PRO B 1 30  ? 18.744  -8.007  23.042 1.00 24.73 ? 230 PRO B CA  1 
ATOM   1252 C C   . PRO B 1 30  ? 20.149  -7.473  23.326 1.00 25.97 ? 230 PRO B C   1 
ATOM   1253 O O   . PRO B 1 30  ? 20.317  -6.463  24.013 1.00 25.65 ? 230 PRO B O   1 
ATOM   1254 C CB  . PRO B 1 30  ? 18.003  -7.158  22.011 1.00 25.40 ? 230 PRO B CB  1 
ATOM   1255 C CG  . PRO B 1 30  ? 16.582  -7.153  22.474 1.00 25.05 ? 230 PRO B CG  1 
ATOM   1256 C CD  . PRO B 1 30  ? 16.653  -7.173  23.971 1.00 24.71 ? 230 PRO B CD  1 
ATOM   1257 N N   . ALA B 1 31  ? 21.150  -8.158  22.785 1.00 26.36 ? 231 ALA B N   1 
ATOM   1258 C CA  . ALA B 1 31  ? 22.548  -7.794  22.981 1.00 26.56 ? 231 ALA B CA  1 
ATOM   1259 C C   . ALA B 1 31  ? 22.888  -6.366  22.565 1.00 27.09 ? 231 ALA B C   1 
ATOM   1260 O O   . ALA B 1 31  ? 23.711  -5.705  23.198 1.00 27.15 ? 231 ALA B O   1 
ATOM   1261 C CB  . ALA B 1 31  ? 23.444  -8.780  22.226 1.00 26.59 ? 231 ALA B CB  1 
ATOM   1262 N N   . GLU B 1 32  ? 22.258  -5.892  21.500 1.00 27.08 ? 232 GLU B N   1 
ATOM   1263 C CA  . GLU B 1 32  ? 22.528  -4.554  21.003 1.00 28.81 ? 232 GLU B CA  1 
ATOM   1264 C C   . GLU B 1 32  ? 21.988  -3.456  21.905 1.00 27.39 ? 232 GLU B C   1 
ATOM   1265 O O   . GLU B 1 32  ? 22.308  -2.287  21.709 1.00 28.00 ? 232 GLU B O   1 
ATOM   1266 C CB  . GLU B 1 32  ? 21.942  -4.396  19.604 1.00 31.38 ? 232 GLU B CB  1 
ATOM   1267 C CG  . GLU B 1 32  ? 20.450  -4.641  19.550 1.00 36.15 ? 232 GLU B CG  1 
ATOM   1268 C CD  . GLU B 1 32  ? 20.110  -6.074  19.202 1.00 39.63 ? 232 GLU B CD  1 
ATOM   1269 O OE1 . GLU B 1 32  ? 19.018  -6.301  18.637 1.00 41.75 ? 232 GLU B OE1 1 
ATOM   1270 O OE2 . GLU B 1 32  ? 20.934  -6.972  19.491 1.00 42.18 ? 232 GLU B OE2 1 
ATOM   1271 N N   . ALA B 1 33  ? 21.172  -3.826  22.888 1.00 26.39 ? 233 ALA B N   1 
ATOM   1272 C CA  . ALA B 1 33  ? 20.601  -2.844  23.807 1.00 24.74 ? 233 ALA B CA  1 
ATOM   1273 C C   . ALA B 1 33  ? 21.688  -2.283  24.717 1.00 24.50 ? 233 ALA B C   1 
ATOM   1274 O O   . ALA B 1 33  ? 21.519  -1.227  25.337 1.00 22.68 ? 233 ALA B O   1 
ATOM   1275 C CB  . ALA B 1 33  ? 19.491  -3.483  24.639 1.00 24.09 ? 233 ALA B CB  1 
ATOM   1276 N N   . ASP B 1 34  ? 22.807  -3.000  24.782 1.00 24.24 ? 234 ASP B N   1 
ATOM   1277 C CA  . ASP B 1 34  ? 23.948  -2.605  25.603 1.00 25.56 ? 234 ASP B CA  1 
ATOM   1278 C C   . ASP B 1 34  ? 24.450  -1.217  25.228 1.00 25.28 ? 234 ASP B C   1 
ATOM   1279 O O   . ASP B 1 34  ? 24.938  -0.473  26.076 1.00 25.94 ? 234 ASP B O   1 
ATOM   1280 C CB  . ASP B 1 34  ? 25.101  -3.602  25.426 1.00 27.80 ? 234 ASP B CB  1 
ATOM   1281 C CG  . ASP B 1 34  ? 25.031  -4.772  26.398 1.00 29.75 ? 234 ASP B CG  1 
ATOM   1282 O OD1 . ASP B 1 34  ? 23.916  -5.123  26.853 1.00 29.59 ? 234 ASP B OD1 1 
ATOM   1283 O OD2 . ASP B 1 34  ? 26.103  -5.346  26.701 1.00 31.11 ? 234 ASP B OD2 1 
ATOM   1284 N N   . SER B 1 35  ? 24.331  -0.879  23.948 1.00 24.76 ? 235 SER B N   1 
ATOM   1285 C CA  . SER B 1 35  ? 24.800  0.408   23.453 1.00 25.47 ? 235 SER B CA  1 
ATOM   1286 C C   . SER B 1 35  ? 23.696  1.449   23.278 1.00 24.14 ? 235 SER B C   1 
ATOM   1287 O O   . SER B 1 35  ? 23.899  2.484   22.641 1.00 25.58 ? 235 SER B O   1 
ATOM   1288 C CB  . SER B 1 35  ? 25.546  0.198   22.131 1.00 28.07 ? 235 SER B CB  1 
ATOM   1289 O OG  . SER B 1 35  ? 26.491  -0.855  22.258 1.00 30.68 ? 235 SER B OG  1 
ATOM   1290 N N   . ALA B 1 36  ? 22.531  1.174   23.854 1.00 22.14 ? 236 ALA B N   1 
ATOM   1291 C CA  . ALA B 1 36  ? 21.405  2.089   23.773 1.00 19.92 ? 236 ALA B CA  1 
ATOM   1292 C C   . ALA B 1 36  ? 21.349  2.945   25.036 1.00 19.31 ? 236 ALA B C   1 
ATOM   1293 O O   . ALA B 1 36  ? 21.819  2.526   26.093 1.00 19.51 ? 236 ALA B O   1 
ATOM   1294 C CB  . ALA B 1 36  ? 20.110  1.301   23.621 1.00 20.23 ? 236 ALA B CB  1 
ATOM   1295 N N   . PRO B 1 37  ? 20.806  4.173   24.932 1.00 19.25 ? 237 PRO B N   1 
ATOM   1296 C CA  . PRO B 1 37  ? 20.687  5.085   26.079 1.00 18.81 ? 237 PRO B CA  1 
ATOM   1297 C C   . PRO B 1 37  ? 19.426  4.752   26.873 1.00 17.96 ? 237 PRO B C   1 
ATOM   1298 O O   . PRO B 1 37  ? 19.230  5.231   27.990 1.00 16.57 ? 237 PRO B O   1 
ATOM   1299 C CB  . PRO B 1 37  ? 20.589  6.464   25.432 1.00 19.91 ? 237 PRO B CB  1 
ATOM   1300 C CG  . PRO B 1 37  ? 19.870  6.193   24.137 1.00 20.42 ? 237 PRO B CG  1 
ATOM   1301 C CD  . PRO B 1 37  ? 20.307  4.799   23.690 1.00 21.38 ? 237 PRO B CD  1 
ATOM   1302 N N   . HIS B 1 38  ? 18.575  3.930   26.269 1.00 17.33 ? 238 HIS B N   1 
ATOM   1303 C CA  . HIS B 1 38  ? 17.324  3.512   26.880 1.00 17.59 ? 238 HIS B CA  1 
ATOM   1304 C C   . HIS B 1 38  ? 16.980  2.106   26.407 1.00 17.18 ? 238 HIS B C   1 
ATOM   1305 O O   . HIS B 1 38  ? 17.096  1.790   25.221 1.00 18.21 ? 238 HIS B O   1 
ATOM   1306 C CB  . HIS B 1 38  ? 16.209  4.484   26.490 1.00 18.38 ? 238 HIS B CB  1 
ATOM   1307 C CG  . HIS B 1 38  ? 14.832  4.011   26.841 1.00 21.46 ? 238 HIS B CG  1 
ATOM   1308 N ND1 . HIS B 1 38  ? 14.206  4.350   28.023 1.00 23.06 ? 238 HIS B ND1 1 
ATOM   1309 C CD2 . HIS B 1 38  ? 13.940  3.266   26.144 1.00 21.94 ? 238 HIS B CD2 1 
ATOM   1310 C CE1 . HIS B 1 38  ? 12.988  3.837   28.038 1.00 23.76 ? 238 HIS B CE1 1 
ATOM   1311 N NE2 . HIS B 1 38  ? 12.802  3.175   26.910 1.00 23.26 ? 238 HIS B NE2 1 
ATOM   1312 N N   . THR B 1 39  ? 16.566  1.263   27.343 1.00 15.37 ? 239 THR B N   1 
ATOM   1313 C CA  . THR B 1 39  ? 16.189  -0.109  27.031 1.00 16.16 ? 239 THR B CA  1 
ATOM   1314 C C   . THR B 1 39  ? 14.877  -0.445  27.748 1.00 15.67 ? 239 THR B C   1 
ATOM   1315 O O   . THR B 1 39  ? 14.585  0.109   28.808 1.00 15.26 ? 239 THR B O   1 
ATOM   1316 C CB  . THR B 1 39  ? 17.288  -1.090  27.475 1.00 15.83 ? 239 THR B CB  1 
ATOM   1317 O OG1 . THR B 1 39  ? 18.515  -0.751  26.818 1.00 18.50 ? 239 THR B OG1 1 
ATOM   1318 C CG2 . THR B 1 39  ? 16.908  -2.512  27.125 1.00 15.40 ? 239 THR B CG2 1 
ATOM   1319 N N   . GLU B 1 40  ? 14.086  -1.341  27.165 1.00 15.01 ? 240 GLU B N   1 
ATOM   1320 C CA  . GLU B 1 40  ? 12.801  -1.737  27.745 1.00 15.29 ? 240 GLU B CA  1 
ATOM   1321 C C   . GLU B 1 40  ? 12.584  -3.236  27.591 1.00 14.15 ? 240 GLU B C   1 
ATOM   1322 O O   . GLU B 1 40  ? 13.040  -3.831  26.616 1.00 14.81 ? 240 GLU B O   1 
ATOM   1323 C CB  . GLU B 1 40  ? 11.649  -1.021  27.033 1.00 17.61 ? 240 GLU B CB  1 
ATOM   1324 C CG  . GLU B 1 40  ? 11.198  0.268   27.678 1.00 24.14 ? 240 GLU B CG  1 
ATOM   1325 C CD  . GLU B 1 40  ? 10.184  1.023   26.831 1.00 25.49 ? 240 GLU B CD  1 
ATOM   1326 O OE1 . GLU B 1 40  ? 10.100  2.257   26.986 1.00 28.90 ? 240 GLU B OE1 1 
ATOM   1327 O OE2 . GLU B 1 40  ? 9.467   0.390   26.020 1.00 26.81 ? 240 GLU B OE2 1 
ATOM   1328 N N   . ALA B 1 41  ? 11.885  -3.843  28.546 1.00 11.27 ? 241 ALA B N   1 
ATOM   1329 C CA  . ALA B 1 41  ? 11.573  -5.268  28.483 1.00 9.82  ? 241 ALA B CA  1 
ATOM   1330 C C   . ALA B 1 41  ? 10.127  -5.412  28.922 1.00 10.54 ? 241 ALA B C   1 
ATOM   1331 O O   . ALA B 1 41  ? 9.737   -4.883  29.959 1.00 11.75 ? 241 ALA B O   1 
ATOM   1332 C CB  . ALA B 1 41  ? 12.496  -6.067  29.393 1.00 9.60  ? 241 ALA B CB  1 
ATOM   1333 N N   . VAL B 1 42  ? 9.328   -6.107  28.117 1.00 9.56  ? 242 VAL B N   1 
ATOM   1334 C CA  . VAL B 1 42  ? 7.916   -6.299  28.418 1.00 8.94  ? 242 VAL B CA  1 
ATOM   1335 C C   . VAL B 1 42  ? 7.713   -7.498  29.340 1.00 9.70  ? 242 VAL B C   1 
ATOM   1336 O O   . VAL B 1 42  ? 8.170   -8.606  29.056 1.00 9.13  ? 242 VAL B O   1 
ATOM   1337 C CB  . VAL B 1 42  ? 7.087   -6.502  27.118 1.00 9.91  ? 242 VAL B CB  1 
ATOM   1338 C CG1 . VAL B 1 42  ? 5.609   -6.659  27.450 1.00 8.90  ? 242 VAL B CG1 1 
ATOM   1339 C CG2 . VAL B 1 42  ? 7.285   -5.313  26.191 1.00 10.92 ? 242 VAL B CG2 1 
ATOM   1340 N N   . LEU B 1 43  ? 7.023   -7.252  30.449 1.00 9.16  ? 243 LEU B N   1 
ATOM   1341 C CA  . LEU B 1 43  ? 6.747   -8.272  31.456 1.00 9.26  ? 243 LEU B CA  1 
ATOM   1342 C C   . LEU B 1 43  ? 5.279   -8.707  31.435 1.00 10.03 ? 243 LEU B C   1 
ATOM   1343 O O   . LEU B 1 43  ? 4.506   -8.316  30.559 1.00 10.41 ? 243 LEU B O   1 
ATOM   1344 C CB  . LEU B 1 43  ? 7.101   -7.735  32.854 1.00 8.61  ? 243 LEU B CB  1 
ATOM   1345 C CG  . LEU B 1 43  ? 8.339   -6.838  32.962 1.00 8.60  ? 243 LEU B CG  1 
ATOM   1346 C CD1 . LEU B 1 43  ? 8.447   -6.283  34.383 1.00 9.23  ? 243 LEU B CD1 1 
ATOM   1347 C CD2 . LEU B 1 43  ? 9.594   -7.624  32.601 1.00 8.60  ? 243 LEU B CD2 1 
ATOM   1348 N N   . ASP B 1 44  ? 4.905   -9.522  32.412 1.00 9.82  ? 244 ASP B N   1 
ATOM   1349 C CA  . ASP B 1 44  ? 3.539   -10.024 32.522 1.00 11.01 ? 244 ASP B CA  1 
ATOM   1350 C C   . ASP B 1 44  ? 2.514   -8.892  32.488 1.00 10.66 ? 244 ASP B C   1 
ATOM   1351 O O   . ASP B 1 44  ? 2.653   -7.897  33.199 1.00 10.23 ? 244 ASP B O   1 
ATOM   1352 C CB  . ASP B 1 44  ? 3.374   -10.813 33.830 1.00 12.02 ? 244 ASP B CB  1 
ATOM   1353 C CG  . ASP B 1 44  ? 3.952   -12.217 33.747 1.00 15.94 ? 244 ASP B CG  1 
ATOM   1354 O OD1 . ASP B 1 44  ? 3.174   -13.163 33.515 1.00 18.44 ? 244 ASP B OD1 1 
ATOM   1355 O OD2 . ASP B 1 44  ? 5.181   -12.377 33.915 1.00 17.64 ? 244 ASP B OD2 1 
ATOM   1356 N N   . GLY B 1 45  ? 1.489   -9.048  31.657 1.00 9.67  ? 245 GLY B N   1 
ATOM   1357 C CA  . GLY B 1 45  ? 0.452   -8.038  31.583 1.00 9.82  ? 245 GLY B CA  1 
ATOM   1358 C C   . GLY B 1 45  ? 0.772   -6.787  30.788 1.00 8.87  ? 245 GLY B C   1 
ATOM   1359 O O   . GLY B 1 45  ? -0.061  -5.886  30.698 1.00 10.59 ? 245 GLY B O   1 
ATOM   1360 N N   . GLY B 1 46  ? 1.971   -6.711  30.224 1.00 9.32  ? 246 GLY B N   1 
ATOM   1361 C CA  . GLY B 1 46  ? 2.323   -5.544  29.431 1.00 9.97  ? 246 GLY B CA  1 
ATOM   1362 C C   . GLY B 1 46  ? 3.144   -4.491  30.149 1.00 10.82 ? 246 GLY B C   1 
ATOM   1363 O O   . GLY B 1 46  ? 3.643   -3.550  29.526 1.00 10.64 ? 246 GLY B O   1 
ATOM   1364 N N   . ILE B 1 47  ? 3.278   -4.624  31.463 1.00 10.34 ? 247 ILE B N   1 
ATOM   1365 C CA  . ILE B 1 47  ? 4.077   -3.674  32.230 1.00 10.82 ? 247 ILE B CA  1 
ATOM   1366 C C   . ILE B 1 47  ? 5.531   -3.837  31.783 1.00 9.56  ? 247 ILE B C   1 
ATOM   1367 O O   . ILE B 1 47  ? 5.981   -4.946  31.491 1.00 9.87  ? 247 ILE B O   1 
ATOM   1368 C CB  . ILE B 1 47  ? 3.947   -3.933  33.755 1.00 9.62  ? 247 ILE B CB  1 
ATOM   1369 C CG1 . ILE B 1 47  ? 2.587   -3.436  34.234 1.00 11.57 ? 247 ILE B CG1 1 
ATOM   1370 C CG2 . ILE B 1 47  ? 5.076   -3.231  34.523 1.00 8.77  ? 247 ILE B CG2 1 
ATOM   1371 C CD1 . ILE B 1 47  ? 2.272   -3.804  35.660 1.00 12.78 ? 247 ILE B CD1 1 
ATOM   1372 N N   . ARG B 1 48  ? 6.264   -2.734  31.724 1.00 9.57  ? 248 ARG B N   1 
ATOM   1373 C CA  . ARG B 1 48  ? 7.639   -2.790  31.283 1.00 10.50 ? 248 ARG B CA  1 
ATOM   1374 C C   . ARG B 1 48  ? 8.642   -2.371  32.339 1.00 10.02 ? 248 ARG B C   1 
ATOM   1375 O O   . ARG B 1 48  ? 8.333   -1.585  33.226 1.00 9.99  ? 248 ARG B O   1 
ATOM   1376 C CB  . ARG B 1 48  ? 7.810   -1.904  30.041 1.00 13.60 ? 248 ARG B CB  1 
ATOM   1377 C CG  . ARG B 1 48  ? 7.529   -2.628  28.731 1.00 20.20 ? 248 ARG B CG  1 
ATOM   1378 C CD  . ARG B 1 48  ? 7.306   -1.667  27.573 1.00 25.14 ? 248 ARG B CD  1 
ATOM   1379 N NE  . ARG B 1 48  ? 7.067   -0.303  28.026 1.00 30.42 ? 248 ARG B NE  1 
ATOM   1380 C CZ  . ARG B 1 48  ? 5.925   0.116   28.559 1.00 35.01 ? 248 ARG B CZ  1 
ATOM   1381 N NH1 . ARG B 1 48  ? 4.905   -0.729  28.708 1.00 37.42 ? 248 ARG B NH1 1 
ATOM   1382 N NH2 . ARG B 1 48  ? 5.802   1.381   28.953 1.00 38.80 ? 248 ARG B NH2 1 
ATOM   1383 N N   . LEU B 1 49  ? 9.828   -2.961  32.254 1.00 8.82  ? 249 LEU B N   1 
ATOM   1384 C CA  . LEU B 1 49  ? 10.937  -2.602  33.112 1.00 8.66  ? 249 LEU B CA  1 
ATOM   1385 C C   . LEU B 1 49  ? 11.826  -1.853  32.121 1.00 9.19  ? 249 LEU B C   1 
ATOM   1386 O O   . LEU B 1 49  ? 12.061  -2.330  31.010 1.00 9.49  ? 249 LEU B O   1 
ATOM   1387 C CB  . LEU B 1 49  ? 11.663  -3.837  33.648 1.00 9.59  ? 249 LEU B CB  1 
ATOM   1388 C CG  . LEU B 1 49  ? 12.991  -3.590  34.390 1.00 9.45  ? 249 LEU B CG  1 
ATOM   1389 C CD1 . LEU B 1 49  ? 12.762  -2.634  35.546 1.00 8.66  ? 249 LEU B CD1 1 
ATOM   1390 C CD2 . LEU B 1 49  ? 13.550  -4.906  34.894 1.00 10.31 ? 249 LEU B CD2 1 
ATOM   1391 N N   . ALA B 1 50  ? 12.298  -0.673  32.502 1.00 8.97  ? 250 ALA B N   1 
ATOM   1392 C CA  . ALA B 1 50  ? 13.140  0.111   31.612 1.00 9.43  ? 250 ALA B CA  1 
ATOM   1393 C C   . ALA B 1 50  ? 14.442  0.540   32.276 1.00 10.23 ? 250 ALA B C   1 
ATOM   1394 O O   . ALA B 1 50  ? 14.555  0.553   33.503 1.00 9.31  ? 250 ALA B O   1 
ATOM   1395 C CB  . ALA B 1 50  ? 12.377  1.339   31.128 1.00 8.74  ? 250 ALA B CB  1 
ATOM   1396 N N   . TRP B 1 51  ? 15.423  0.883   31.444 1.00 10.44 ? 251 TRP B N   1 
ATOM   1397 C CA  . TRP B 1 51  ? 16.733  1.337   31.898 1.00 10.42 ? 251 TRP B CA  1 
ATOM   1398 C C   . TRP B 1 51  ? 17.075  2.616   31.129 1.00 12.86 ? 251 TRP B C   1 
ATOM   1399 O O   . TRP B 1 51  ? 16.852  2.702   29.918 1.00 13.61 ? 251 TRP B O   1 
ATOM   1400 C CB  . TRP B 1 51  ? 17.817  0.290   31.608 1.00 10.08 ? 251 TRP B CB  1 
ATOM   1401 C CG  . TRP B 1 51  ? 17.629  -1.027  32.288 1.00 10.04 ? 251 TRP B CG  1 
ATOM   1402 C CD1 . TRP B 1 51  ? 18.273  -1.469  33.406 1.00 12.06 ? 251 TRP B CD1 1 
ATOM   1403 C CD2 . TRP B 1 51  ? 16.780  -2.098  31.864 1.00 11.04 ? 251 TRP B CD2 1 
ATOM   1404 N NE1 . TRP B 1 51  ? 17.883  -2.752  33.704 1.00 11.22 ? 251 TRP B NE1 1 
ATOM   1405 C CE2 . TRP B 1 51  ? 16.966  -3.164  32.772 1.00 11.79 ? 251 TRP B CE2 1 
ATOM   1406 C CE3 . TRP B 1 51  ? 15.879  -2.264  30.800 1.00 10.77 ? 251 TRP B CE3 1 
ATOM   1407 C CZ2 . TRP B 1 51  ? 16.286  -4.380  32.652 1.00 11.84 ? 251 TRP B CZ2 1 
ATOM   1408 C CZ3 . TRP B 1 51  ? 15.202  -3.473  30.679 1.00 11.55 ? 251 TRP B CZ3 1 
ATOM   1409 C CH2 . TRP B 1 51  ? 15.409  -4.516  31.602 1.00 11.30 ? 251 TRP B CH2 1 
ATOM   1410 N N   . ASP B 1 52  ? 17.607  3.606   31.835 1.00 11.88 ? 252 ASP B N   1 
ATOM   1411 C CA  . ASP B 1 52  ? 17.986  4.873   31.218 1.00 12.88 ? 252 ASP B CA  1 
ATOM   1412 C C   . ASP B 1 52  ? 19.345  5.291   31.737 1.00 12.35 ? 252 ASP B C   1 
ATOM   1413 O O   . ASP B 1 52  ? 19.553  5.351   32.947 1.00 13.78 ? 252 ASP B O   1 
ATOM   1414 C CB  . ASP B 1 52  ? 16.968  5.960   31.563 1.00 15.24 ? 252 ASP B CB  1 
ATOM   1415 C CG  . ASP B 1 52  ? 15.631  5.731   30.902 1.00 17.74 ? 252 ASP B CG  1 
ATOM   1416 O OD1 . ASP B 1 52  ? 15.591  5.704   29.653 1.00 18.86 ? 252 ASP B OD1 1 
ATOM   1417 O OD2 . ASP B 1 52  ? 14.627  5.577   31.633 1.00 18.52 ? 252 ASP B OD2 1 
ATOM   1418 N N   . THR B 1 53  ? 20.275  5.583   30.837 1.00 12.25 ? 253 THR B N   1 
ATOM   1419 C CA  . THR B 1 53  ? 21.601  6.004   31.268 1.00 13.59 ? 253 THR B CA  1 
ATOM   1420 C C   . THR B 1 53  ? 21.535  7.302   32.060 1.00 13.11 ? 253 THR B C   1 
ATOM   1421 O O   . THR B 1 53  ? 20.592  8.089   31.931 1.00 13.29 ? 253 THR B O   1 
ATOM   1422 C CB  . THR B 1 53  ? 22.538  6.247   30.082 1.00 13.35 ? 253 THR B CB  1 
ATOM   1423 O OG1 . THR B 1 53  ? 21.990  7.283   29.256 1.00 15.11 ? 253 THR B OG1 1 
ATOM   1424 C CG2 . THR B 1 53  ? 22.725  4.968   29.277 1.00 14.43 ? 253 THR B CG2 1 
ATOM   1425 N N   . VAL B 1 54  ? 22.554  7.533   32.873 1.00 13.63 ? 254 VAL B N   1 
ATOM   1426 C CA  . VAL B 1 54  ? 22.607  8.746   33.666 1.00 16.41 ? 254 VAL B CA  1 
ATOM   1427 C C   . VAL B 1 54  ? 22.569  9.994   32.772 1.00 17.26 ? 254 VAL B C   1 
ATOM   1428 O O   . VAL B 1 54  ? 21.978  11.005  33.139 1.00 17.71 ? 254 VAL B O   1 
ATOM   1429 C CB  . VAL B 1 54  ? 23.876  8.762   34.547 1.00 17.10 ? 254 VAL B CB  1 
ATOM   1430 C CG1 . VAL B 1 54  ? 24.059  10.130  35.170 1.00 18.51 ? 254 VAL B CG1 1 
ATOM   1431 C CG2 . VAL B 1 54  ? 23.759  7.702   35.637 1.00 18.93 ? 254 VAL B CG2 1 
ATOM   1432 N N   . GLU B 1 55  ? 23.195  9.919   31.599 1.00 20.08 ? 255 GLU B N   1 
ATOM   1433 C CA  . GLU B 1 55  ? 23.219  11.052  30.665 1.00 22.88 ? 255 GLU B CA  1 
ATOM   1434 C C   . GLU B 1 55  ? 21.810  11.365  30.173 1.00 22.94 ? 255 GLU B C   1 
ATOM   1435 O O   . GLU B 1 55  ? 21.410  12.529  30.078 1.00 22.28 ? 255 GLU B O   1 
ATOM   1436 C CB  . GLU B 1 55  ? 24.111  10.732  29.462 1.00 27.04 ? 255 GLU B CB  1 
ATOM   1437 C CG  . GLU B 1 55  ? 25.561  10.474  29.822 1.00 34.22 ? 255 GLU B CG  1 
ATOM   1438 C CD  . GLU B 1 55  ? 25.900  8.992   29.886 1.00 38.14 ? 255 GLU B CD  1 
ATOM   1439 O OE1 . GLU B 1 55  ? 25.005  8.151   29.638 1.00 39.97 ? 255 GLU B OE1 1 
ATOM   1440 O OE2 . GLU B 1 55  ? 27.072  8.670   30.183 1.00 42.22 ? 255 GLU B OE2 1 
ATOM   1441 N N   . THR B 1 56  ? 21.072  10.309  29.842 1.00 23.61 ? 256 THR B N   1 
ATOM   1442 C CA  . THR B 1 56  ? 19.699  10.436  29.381 1.00 24.24 ? 256 THR B CA  1 
ATOM   1443 C C   . THR B 1 56  ? 18.951  11.153  30.502 1.00 25.65 ? 256 THR B C   1 
ATOM   1444 O O   . THR B 1 56  ? 18.225  12.115  30.262 1.00 26.33 ? 256 THR B O   1 
ATOM   1445 C CB  . THR B 1 56  ? 19.069  9.033   29.128 1.00 23.43 ? 256 THR B CB  1 
ATOM   1446 O OG1 . THR B 1 56  ? 19.841  8.333   28.147 1.00 20.47 ? 256 THR B OG1 1 
ATOM   1447 C CG2 . THR B 1 56  ? 17.635  9.154   28.623 1.00 24.66 ? 256 THR B CG2 1 
ATOM   1448 N N   . VAL B 1 57  ? 19.161  10.689  31.734 1.00 26.19 ? 257 VAL B N   1 
ATOM   1449 C CA  . VAL B 1 57  ? 18.514  11.270  32.909 1.00 26.93 ? 257 VAL B CA  1 
ATOM   1450 C C   . VAL B 1 57  ? 18.930  12.720  33.159 1.00 26.93 ? 257 VAL B C   1 
ATOM   1451 O O   . VAL B 1 57  ? 18.077  13.581  33.345 1.00 26.73 ? 257 VAL B O   1 
ATOM   1452 C CB  . VAL B 1 57  ? 18.810  10.426  34.191 1.00 26.18 ? 257 VAL B CB  1 
ATOM   1453 C CG1 . VAL B 1 57  ? 18.389  11.192  35.451 1.00 24.78 ? 257 VAL B CG1 1 
ATOM   1454 C CG2 . VAL B 1 57  ? 18.078  9.094   34.109 1.00 24.90 ? 257 VAL B CG2 1 
ATOM   1455 N N   . ARG B 1 58  ? 20.235  12.983  33.165 1.00 28.90 ? 258 ARG B N   1 
ATOM   1456 C CA  . ARG B 1 58  ? 20.747  14.328  33.402 1.00 30.42 ? 258 ARG B CA  1 
ATOM   1457 C C   . ARG B 1 58  ? 20.304  15.305  32.323 1.00 32.10 ? 258 ARG B C   1 
ATOM   1458 O O   . ARG B 1 58  ? 20.569  16.502  32.419 1.00 32.24 ? 258 ARG B O   1 
ATOM   1459 C CB  . ARG B 1 58  ? 22.273  14.308  33.496 1.00 31.14 ? 258 ARG B CB  1 
ATOM   1460 C CG  . ARG B 1 58  ? 22.788  13.760  34.815 1.00 32.10 ? 258 ARG B CG  1 
ATOM   1461 C CD  . ARG B 1 58  ? 24.297  13.921  34.949 1.00 34.41 ? 258 ARG B CD  1 
ATOM   1462 N NE  . ARG B 1 58  ? 24.732  13.781  36.337 1.00 34.80 ? 258 ARG B NE  1 
ATOM   1463 C CZ  . ARG B 1 58  ? 25.695  12.960  36.743 1.00 36.51 ? 258 ARG B CZ  1 
ATOM   1464 N NH1 . ARG B 1 58  ? 26.334  12.196  35.869 1.00 37.35 ? 258 ARG B NH1 1 
ATOM   1465 N NH2 . ARG B 1 58  ? 26.017  12.893  38.029 1.00 38.66 ? 258 ARG B NH2 1 
ATOM   1466 N N   . SER B 1 59  ? 19.636  14.788  31.296 1.00 33.64 ? 259 SER B N   1 
ATOM   1467 C CA  . SER B 1 59  ? 19.122  15.622  30.216 1.00 35.95 ? 259 SER B CA  1 
ATOM   1468 C C   . SER B 1 59  ? 18.070  16.532  30.840 1.00 38.64 ? 259 SER B C   1 
ATOM   1469 O O   . SER B 1 59  ? 18.137  17.755  30.704 1.00 40.43 ? 259 SER B O   1 
ATOM   1470 C CB  . SER B 1 59  ? 18.457  14.761  29.141 1.00 33.85 ? 259 SER B CB  1 
ATOM   1471 O OG  . SER B 1 59  ? 19.257  14.668  27.984 1.00 33.87 ? 259 SER B OG  1 
ATOM   1472 N N   . TYR B 1 60  ? 17.107  15.907  31.523 1.00 40.44 ? 260 TYR B N   1 
ATOM   1473 C CA  . TYR B 1 60  ? 16.004  16.593  32.206 1.00 41.66 ? 260 TYR B CA  1 
ATOM   1474 C C   . TYR B 1 60  ? 16.266  16.700  33.713 1.00 42.46 ? 260 TYR B C   1 
ATOM   1475 O O   . TYR B 1 60  ? 15.334  16.868  34.503 1.00 43.04 ? 260 TYR B O   1 
ATOM   1476 C CB  . TYR B 1 60  ? 14.690  15.828  31.986 1.00 41.29 ? 260 TYR B CB  1 
ATOM   1477 C CG  . TYR B 1 60  ? 14.308  15.664  30.537 1.00 43.32 ? 260 TYR B CG  1 
ATOM   1478 C CD1 . TYR B 1 60  ? 14.584  14.483  29.851 1.00 43.74 ? 260 TYR B CD1 1 
ATOM   1479 C CD2 . TYR B 1 60  ? 13.707  16.708  29.837 1.00 45.19 ? 260 TYR B CD2 1 
ATOM   1480 C CE1 . TYR B 1 60  ? 14.276  14.347  28.497 1.00 45.74 ? 260 TYR B CE1 1 
ATOM   1481 C CE2 . TYR B 1 60  ? 13.395  16.587  28.485 1.00 46.47 ? 260 TYR B CE2 1 
ATOM   1482 C CZ  . TYR B 1 60  ? 13.684  15.406  27.818 1.00 47.08 ? 260 TYR B CZ  1 
ATOM   1483 O OH  . TYR B 1 60  ? 13.400  15.305  26.470 1.00 48.25 ? 260 TYR B OH  1 
ATOM   1484 N N   . ASP B 1 61  ? 17.537  16.608  34.099 1.00 43.50 ? 261 ASP B N   1 
ATOM   1485 C CA  . ASP B 1 61  ? 17.946  16.667  35.502 1.00 44.53 ? 261 ASP B CA  1 
ATOM   1486 C C   . ASP B 1 61  ? 19.476  16.736  35.538 1.00 44.90 ? 261 ASP B C   1 
ATOM   1487 O O   . ASP B 1 61  ? 20.144  15.783  35.946 1.00 45.80 ? 261 ASP B O   1 
ATOM   1488 C CB  . ASP B 1 61  ? 17.459  15.406  36.224 1.00 45.58 ? 261 ASP B CB  1 
ATOM   1489 C CG  . ASP B 1 61  ? 17.605  15.495  37.727 1.00 47.27 ? 261 ASP B CG  1 
ATOM   1490 O OD1 . ASP B 1 61  ? 18.297  16.416  38.213 1.00 46.90 ? 261 ASP B OD1 1 
ATOM   1491 O OD2 . ASP B 1 61  ? 17.021  14.635  38.421 1.00 47.80 ? 261 ASP B OD2 1 
ATOM   1492 N N   . PRO B 1 62  ? 20.047  17.877  35.120 1.00 44.43 ? 262 PRO B N   1 
ATOM   1493 C CA  . PRO B 1 62  ? 21.503  18.079  35.091 1.00 43.54 ? 262 PRO B CA  1 
ATOM   1494 C C   . PRO B 1 62  ? 22.155  17.965  36.454 1.00 42.58 ? 262 PRO B C   1 
ATOM   1495 O O   . PRO B 1 62  ? 23.371  17.788  36.562 1.00 42.70 ? 262 PRO B O   1 
ATOM   1496 C CB  . PRO B 1 62  ? 21.674  19.483  34.506 1.00 44.42 ? 262 PRO B CB  1 
ATOM   1497 C CG  . PRO B 1 62  ? 20.351  19.834  33.907 1.00 45.78 ? 262 PRO B CG  1 
ATOM   1498 C CD  . PRO B 1 62  ? 19.315  19.073  34.672 1.00 44.96 ? 262 PRO B CD  1 
ATOM   1499 N N   . GLU B 1 63  ? 21.334  18.071  37.493 1.00 41.82 ? 263 GLU B N   1 
ATOM   1500 C CA  . GLU B 1 63  ? 21.813  18.001  38.869 1.00 41.05 ? 263 GLU B CA  1 
ATOM   1501 C C   . GLU B 1 63  ? 22.105  16.581  39.331 1.00 37.40 ? 263 GLU B C   1 
ATOM   1502 O O   . GLU B 1 63  ? 23.034  16.359  40.108 1.00 36.80 ? 263 GLU B O   1 
ATOM   1503 C CB  . GLU B 1 63  ? 20.787  18.627  39.816 1.00 45.20 ? 263 GLU B CB  1 
ATOM   1504 C CG  . GLU B 1 63  ? 19.683  19.408  39.124 1.00 50.95 ? 263 GLU B CG  1 
ATOM   1505 C CD  . GLU B 1 63  ? 19.159  20.541  39.988 1.00 54.48 ? 263 GLU B CD  1 
ATOM   1506 O OE1 . GLU B 1 63  ? 19.660  21.683  39.845 1.00 55.52 ? 263 GLU B OE1 1 
ATOM   1507 O OE2 . GLU B 1 63  ? 18.249  20.285  40.812 1.00 55.95 ? 263 GLU B OE2 1 
ATOM   1508 N N   . TRP B 1 64  ? 21.306  15.631  38.857 1.00 33.47 ? 264 TRP B N   1 
ATOM   1509 C CA  . TRP B 1 64  ? 21.461  14.232  39.231 1.00 30.43 ? 264 TRP B CA  1 
ATOM   1510 C C   . TRP B 1 64  ? 22.882  13.852  39.623 1.00 31.20 ? 264 TRP B C   1 
ATOM   1511 O O   . TRP B 1 64  ? 23.837  14.105  38.887 1.00 30.44 ? 264 TRP B O   1 
ATOM   1512 C CB  . TRP B 1 64  ? 21.002  13.320  38.094 1.00 26.45 ? 264 TRP B CB  1 
ATOM   1513 C CG  . TRP B 1 64  ? 20.689  11.927  38.554 1.00 22.33 ? 264 TRP B CG  1 
ATOM   1514 C CD1 . TRP B 1 64  ? 19.465  11.442  38.910 1.00 23.07 ? 264 TRP B CD1 1 
ATOM   1515 C CD2 . TRP B 1 64  ? 21.614  10.839  38.721 1.00 20.38 ? 264 TRP B CD2 1 
ATOM   1516 N NE1 . TRP B 1 64  ? 19.566  10.124  39.290 1.00 20.18 ? 264 TRP B NE1 1 
ATOM   1517 C CE2 . TRP B 1 64  ? 20.872  9.727   39.183 1.00 18.99 ? 264 TRP B CE2 1 
ATOM   1518 C CE3 . TRP B 1 64  ? 22.994  10.695  38.527 1.00 19.01 ? 264 TRP B CE3 1 
ATOM   1519 C CZ2 . TRP B 1 64  ? 21.465  8.487   39.453 1.00 17.45 ? 264 TRP B CZ2 1 
ATOM   1520 C CZ3 . TRP B 1 64  ? 23.584  9.460   38.796 1.00 15.37 ? 264 TRP B CZ3 1 
ATOM   1521 C CH2 . TRP B 1 64  ? 22.818  8.373   39.254 1.00 14.95 ? 264 TRP B CH2 1 
ATOM   1522 N N   . GLN B 1 65  ? 23.004  13.243  40.797 1.00 32.25 ? 265 GLN B N   1 
ATOM   1523 C CA  . GLN B 1 65  ? 24.287  12.789  41.321 1.00 32.81 ? 265 GLN B CA  1 
ATOM   1524 C C   . GLN B 1 65  ? 24.075  11.379  41.857 1.00 30.36 ? 265 GLN B C   1 
ATOM   1525 O O   . GLN B 1 65  ? 23.087  11.114  42.543 1.00 30.06 ? 265 GLN B O   1 
ATOM   1526 C CB  . GLN B 1 65  ? 24.762  13.704  42.458 1.00 37.27 ? 265 GLN B CB  1 
ATOM   1527 C CG  . GLN B 1 65  ? 25.920  14.627  42.090 1.00 43.26 ? 265 GLN B CG  1 
ATOM   1528 C CD  . GLN B 1 65  ? 25.853  15.969  42.808 1.00 47.11 ? 265 GLN B CD  1 
ATOM   1529 O OE1 . GLN B 1 65  ? 25.444  16.979  42.229 1.00 50.09 ? 265 GLN B OE1 1 
ATOM   1530 N NE2 . GLN B 1 65  ? 26.257  15.985  44.078 1.00 49.32 ? 265 GLN B NE2 1 
ATOM   1531 N N   . ALA B 1 66  ? 24.993  10.474  41.537 1.00 27.37 ? 266 ALA B N   1 
ATOM   1532 C CA  . ALA B 1 66  ? 24.882  9.098   42.000 1.00 24.68 ? 266 ALA B CA  1 
ATOM   1533 C C   . ALA B 1 66  ? 24.547  9.119   43.484 1.00 23.61 ? 266 ALA B C   1 
ATOM   1534 O O   . ALA B 1 66  ? 25.208  9.807   44.262 1.00 23.96 ? 266 ALA B O   1 
ATOM   1535 C CB  . ALA B 1 66  ? 26.187  8.362   41.764 1.00 24.90 ? 266 ALA B CB  1 
ATOM   1536 N N   . PRO B 1 67  ? 23.501  8.380   43.895 1.00 21.27 ? 267 PRO B N   1 
ATOM   1537 C CA  . PRO B 1 67  ? 23.127  8.359   45.309 1.00 19.61 ? 267 PRO B CA  1 
ATOM   1538 C C   . PRO B 1 67  ? 23.961  7.389   46.131 1.00 18.97 ? 267 PRO B C   1 
ATOM   1539 O O   . PRO B 1 67  ? 24.806  6.663   45.615 1.00 19.45 ? 267 PRO B O   1 
ATOM   1540 C CB  . PRO B 1 67  ? 21.670  7.928   45.273 1.00 19.16 ? 267 PRO B CB  1 
ATOM   1541 C CG  . PRO B 1 67  ? 21.628  6.977   44.120 1.00 18.67 ? 267 PRO B CG  1 
ATOM   1542 C CD  . PRO B 1 67  ? 22.594  7.540   43.089 1.00 20.49 ? 267 PRO B CD  1 
ATOM   1543 N N   . THR B 1 68  ? 23.709  7.395   47.428 1.00 19.38 ? 268 THR B N   1 
ATOM   1544 C CA  . THR B 1 68  ? 24.378  6.487   48.338 1.00 20.16 ? 268 THR B CA  1 
ATOM   1545 C C   . THR B 1 68  ? 23.368  6.197   49.436 1.00 18.63 ? 268 THR B C   1 
ATOM   1546 O O   . THR B 1 68  ? 22.586  7.070   49.829 1.00 18.23 ? 268 THR B O   1 
ATOM   1547 C CB  . THR B 1 68  ? 25.659  7.100   48.946 1.00 22.40 ? 268 THR B CB  1 
ATOM   1548 O OG1 . THR B 1 68  ? 25.370  8.403   49.459 1.00 26.94 ? 268 THR B OG1 1 
ATOM   1549 C CG2 . THR B 1 68  ? 26.755  7.204   47.890 1.00 23.58 ? 268 THR B CG2 1 
ATOM   1550 N N   . GLY B 1 69  ? 23.370  4.959   49.908 1.00 18.36 ? 269 GLY B N   1 
ATOM   1551 C CA  . GLY B 1 69  ? 22.444  4.572   50.949 1.00 17.09 ? 269 GLY B CA  1 
ATOM   1552 C C   . GLY B 1 69  ? 21.554  3.425   50.516 1.00 16.08 ? 269 GLY B C   1 
ATOM   1553 O O   . GLY B 1 69  ? 21.719  2.852   49.427 1.00 14.72 ? 269 GLY B O   1 
ATOM   1554 N N   . GLY B 1 70  ? 20.604  3.091   51.382 1.00 14.79 ? 270 GLY B N   1 
ATOM   1555 C CA  . GLY B 1 70  ? 19.687  2.010   51.098 1.00 12.50 ? 270 GLY B CA  1 
ATOM   1556 C C   . GLY B 1 70  ? 18.777  2.291   49.920 1.00 13.18 ? 270 GLY B C   1 
ATOM   1557 O O   . GLY B 1 70  ? 18.793  3.366   49.320 1.00 12.67 ? 270 GLY B O   1 
ATOM   1558 N N   . HIS B 1 71  ? 17.956  1.305   49.603 1.00 12.19 ? 271 HIS B N   1 
ATOM   1559 C CA  . HIS B 1 71  ? 17.035  1.405   48.486 1.00 10.84 ? 271 HIS B CA  1 
ATOM   1560 C C   . HIS B 1 71  ? 15.710  2.059   48.854 1.00 10.24 ? 271 HIS B C   1 
ATOM   1561 O O   . HIS B 1 71  ? 15.266  2.001   49.998 1.00 10.42 ? 271 HIS B O   1 
ATOM   1562 C CB  . HIS B 1 71  ? 16.750  0.001   47.953 1.00 10.33 ? 271 HIS B CB  1 
ATOM   1563 C CG  . HIS B 1 71  ? 16.007  -0.863  48.925 1.00 10.86 ? 271 HIS B CG  1 
ATOM   1564 N ND1 . HIS B 1 71  ? 16.515  -1.199  50.162 1.00 11.68 ? 271 HIS B ND1 1 
ATOM   1565 C CD2 . HIS B 1 71  ? 14.780  -1.431  48.856 1.00 11.61 ? 271 HIS B CD2 1 
ATOM   1566 C CE1 . HIS B 1 71  ? 15.633  -1.937  50.813 1.00 11.10 ? 271 HIS B CE1 1 
ATOM   1567 N NE2 . HIS B 1 71  ? 14.571  -2.092  50.042 1.00 11.98 ? 271 HIS B NE2 1 
ATOM   1568 N N   . ARG B 1 72  ? 15.085  2.677   47.861 1.00 9.88  ? 272 ARG B N   1 
ATOM   1569 C CA  . ARG B 1 72  ? 13.775  3.288   48.015 1.00 8.99  ? 272 ARG B CA  1 
ATOM   1570 C C   . ARG B 1 72  ? 12.873  2.416   47.146 1.00 8.13  ? 272 ARG B C   1 
ATOM   1571 O O   . ARG B 1 72  ? 11.648  2.511   47.195 1.00 8.26  ? 272 ARG B O   1 
ATOM   1572 C CB  . ARG B 1 72  ? 13.770  4.699   47.433 1.00 11.63 ? 272 ARG B CB  1 
ATOM   1573 C CG  . ARG B 1 72  ? 14.391  5.764   48.307 1.00 14.16 ? 272 ARG B CG  1 
ATOM   1574 C CD  . ARG B 1 72  ? 13.358  6.829   48.610 1.00 16.09 ? 272 ARG B CD  1 
ATOM   1575 N NE  . ARG B 1 72  ? 12.368  6.352   49.567 1.00 17.38 ? 272 ARG B NE  1 
ATOM   1576 C CZ  . ARG B 1 72  ? 12.505  6.439   50.887 1.00 18.22 ? 272 ARG B CZ  1 
ATOM   1577 N NH1 . ARG B 1 72  ? 13.594  6.985   51.406 1.00 18.92 ? 272 ARG B NH1 1 
ATOM   1578 N NH2 . ARG B 1 72  ? 11.550  5.988   51.689 1.00 18.50 ? 272 ARG B NH2 1 
ATOM   1579 N N   . PHE B 1 73  ? 13.515  1.545   46.368 1.00 9.12  ? 273 PHE B N   1 
ATOM   1580 C CA  . PHE B 1 73  ? 12.839  0.683   45.403 1.00 7.20  ? 273 PHE B CA  1 
ATOM   1581 C C   . PHE B 1 73  ? 13.498  -0.702  45.271 1.00 6.75  ? 273 PHE B C   1 
ATOM   1582 O O   . PHE B 1 73  ? 14.732  -0.825  45.263 1.00 6.81  ? 273 PHE B O   1 
ATOM   1583 C CB  . PHE B 1 73  ? 12.849  1.436   44.064 1.00 7.38  ? 273 PHE B CB  1 
ATOM   1584 C CG  . PHE B 1 73  ? 12.449  0.619   42.867 1.00 7.85  ? 273 PHE B CG  1 
ATOM   1585 C CD1 . PHE B 1 73  ? 13.411  0.210   41.941 1.00 6.87  ? 273 PHE B CD1 1 
ATOM   1586 C CD2 . PHE B 1 73  ? 11.107  0.343   42.611 1.00 8.67  ? 273 PHE B CD2 1 
ATOM   1587 C CE1 . PHE B 1 73  ? 13.042  -0.453  40.782 1.00 8.07  ? 273 PHE B CE1 1 
ATOM   1588 C CE2 . PHE B 1 73  ? 10.727  -0.324  41.446 1.00 8.75  ? 273 PHE B CE2 1 
ATOM   1589 C CZ  . PHE B 1 73  ? 11.698  -0.721  40.531 1.00 7.22  ? 273 PHE B CZ  1 
ATOM   1590 N N   . ALA B 1 74  ? 12.662  -1.736  45.172 1.00 6.48  ? 274 ALA B N   1 
ATOM   1591 C CA  . ALA B 1 74  ? 13.139  -3.111  45.021 1.00 5.98  ? 274 ALA B CA  1 
ATOM   1592 C C   . ALA B 1 74  ? 12.341  -3.865  43.963 1.00 6.26  ? 274 ALA B C   1 
ATOM   1593 O O   . ALA B 1 74  ? 11.161  -3.596  43.743 1.00 6.66  ? 274 ALA B O   1 
ATOM   1594 C CB  . ALA B 1 74  ? 13.051  -3.850  46.352 1.00 7.36  ? 274 ALA B CB  1 
ATOM   1595 N N   . ILE B 1 75  ? 13.014  -4.807  43.312 1.00 6.58  ? 275 ILE B N   1 
ATOM   1596 C CA  . ILE B 1 75  ? 12.409  -5.651  42.281 1.00 8.41  ? 275 ILE B CA  1 
ATOM   1597 C C   . ILE B 1 75  ? 12.477  -7.090  42.798 1.00 6.76  ? 275 ILE B C   1 
ATOM   1598 O O   . ILE B 1 75  ? 13.559  -7.579  43.118 1.00 7.73  ? 275 ILE B O   1 
ATOM   1599 C CB  . ILE B 1 75  ? 13.193  -5.560  40.947 1.00 7.86  ? 275 ILE B CB  1 
ATOM   1600 C CG1 . ILE B 1 75  ? 13.245  -4.109  40.465 1.00 8.32  ? 275 ILE B CG1 1 
ATOM   1601 C CG2 . ILE B 1 75  ? 12.537  -6.438  39.898 1.00 9.00  ? 275 ILE B CG2 1 
ATOM   1602 C CD1 . ILE B 1 75  ? 14.080  -3.912  39.208 1.00 8.81  ? 275 ILE B CD1 1 
ATOM   1603 N N   . ALA B 1 76  ? 11.334  -7.763  42.891 1.00 6.83  ? 276 ALA B N   1 
ATOM   1604 C CA  . ALA B 1 76  ? 11.308  -9.136  43.396 1.00 7.82  ? 276 ALA B CA  1 
ATOM   1605 C C   . ALA B 1 76  ? 11.050  -10.191 42.320 1.00 8.08  ? 276 ALA B C   1 
ATOM   1606 O O   . ALA B 1 76  ? 10.037  -10.155 41.625 1.00 7.89  ? 276 ALA B O   1 
ATOM   1607 C CB  . ALA B 1 76  ? 10.265  -9.260  44.509 1.00 7.72  ? 276 ALA B CB  1 
ATOM   1608 N N   . PHE B 1 77  ? 11.978  -11.135 42.212 1.00 7.74  ? 277 PHE B N   1 
ATOM   1609 C CA  . PHE B 1 77  ? 11.907  -12.232 41.244 1.00 8.73  ? 277 PHE B CA  1 
ATOM   1610 C C   . PHE B 1 77  ? 11.461  -13.534 41.910 1.00 8.88  ? 277 PHE B C   1 
ATOM   1611 O O   . PHE B 1 77  ? 12.065  -13.966 42.900 1.00 8.63  ? 277 PHE B O   1 
ATOM   1612 C CB  . PHE B 1 77  ? 13.282  -12.482 40.615 1.00 7.80  ? 277 PHE B CB  1 
ATOM   1613 C CG  . PHE B 1 77  ? 13.694  -11.456 39.611 1.00 9.83  ? 277 PHE B CG  1 
ATOM   1614 C CD1 . PHE B 1 77  ? 14.123  -10.200 40.016 1.00 9.48  ? 277 PHE B CD1 1 
ATOM   1615 C CD2 . PHE B 1 77  ? 13.688  -11.757 38.256 1.00 10.82 ? 277 PHE B CD2 1 
ATOM   1616 C CE1 . PHE B 1 77  ? 14.547  -9.252  39.082 1.00 10.53 ? 277 PHE B CE1 1 
ATOM   1617 C CE2 . PHE B 1 77  ? 14.110  -10.817 37.315 1.00 11.73 ? 277 PHE B CE2 1 
ATOM   1618 C CZ  . PHE B 1 77  ? 14.541  -9.561  37.731 1.00 10.31 ? 277 PHE B CZ  1 
ATOM   1619 N N   . GLU B 1 78  ? 10.423  -14.160 41.361 1.00 8.93  ? 278 GLU B N   1 
ATOM   1620 C CA  . GLU B 1 78  ? 9.932   -15.426 41.891 1.00 11.58 ? 278 GLU B CA  1 
ATOM   1621 C C   . GLU B 1 78  ? 10.551  -16.591 41.124 1.00 11.50 ? 278 GLU B C   1 
ATOM   1622 O O   . GLU B 1 78  ? 10.660  -16.549 39.899 1.00 10.84 ? 278 GLU B O   1 
ATOM   1623 C CB  . GLU B 1 78  ? 8.406   -15.517 41.790 1.00 13.95 ? 278 GLU B CB  1 
ATOM   1624 C CG  . GLU B 1 78  ? 7.859   -16.806 42.405 1.00 16.60 ? 278 GLU B CG  1 
ATOM   1625 C CD  . GLU B 1 78  ? 6.376   -17.021 42.167 1.00 19.87 ? 278 GLU B CD  1 
ATOM   1626 O OE1 . GLU B 1 78  ? 5.817   -16.437 41.211 1.00 20.78 ? 278 GLU B OE1 1 
ATOM   1627 O OE2 . GLU B 1 78  ? 5.769   -17.789 42.949 1.00 22.13 ? 278 GLU B OE2 1 
ATOM   1628 N N   . PHE B 1 79  ? 10.957  -17.624 41.860 1.00 11.87 ? 279 PHE B N   1 
ATOM   1629 C CA  . PHE B 1 79  ? 11.561  -18.813 41.274 1.00 12.25 ? 279 PHE B CA  1 
ATOM   1630 C C   . PHE B 1 79  ? 10.651  -20.037 41.383 1.00 12.81 ? 279 PHE B C   1 
ATOM   1631 O O   . PHE B 1 79  ? 9.783   -20.105 42.258 1.00 11.92 ? 279 PHE B O   1 
ATOM   1632 C CB  . PHE B 1 79  ? 12.908  -19.089 41.944 1.00 12.24 ? 279 PHE B CB  1 
ATOM   1633 C CG  . PHE B 1 79  ? 13.966  -18.088 41.583 1.00 12.10 ? 279 PHE B CG  1 
ATOM   1634 C CD1 . PHE B 1 79  ? 13.977  -16.828 42.171 1.00 10.87 ? 279 PHE B CD1 1 
ATOM   1635 C CD2 . PHE B 1 79  ? 14.928  -18.388 40.626 1.00 11.55 ? 279 PHE B CD2 1 
ATOM   1636 C CE1 . PHE B 1 79  ? 14.928  -15.882 41.809 1.00 10.66 ? 279 PHE B CE1 1 
ATOM   1637 C CE2 . PHE B 1 79  ? 15.883  -17.449 40.258 1.00 11.73 ? 279 PHE B CE2 1 
ATOM   1638 C CZ  . PHE B 1 79  ? 15.883  -16.192 40.851 1.00 11.48 ? 279 PHE B CZ  1 
ATOM   1639 N N   . PRO B 1 80  ? 10.840  -21.019 40.485 1.00 14.48 ? 280 PRO B N   1 
ATOM   1640 C CA  . PRO B 1 80  ? 10.040  -22.252 40.461 1.00 17.17 ? 280 PRO B CA  1 
ATOM   1641 C C   . PRO B 1 80  ? 10.152  -23.129 41.714 1.00 17.72 ? 280 PRO B C   1 
ATOM   1642 O O   . PRO B 1 80  ? 9.210   -23.844 42.066 1.00 20.03 ? 280 PRO B O   1 
ATOM   1643 C CB  . PRO B 1 80  ? 10.522  -22.973 39.199 1.00 16.82 ? 280 PRO B CB  1 
ATOM   1644 C CG  . PRO B 1 80  ? 11.887  -22.431 38.941 1.00 18.53 ? 280 PRO B CG  1 
ATOM   1645 C CD  . PRO B 1 80  ? 11.854  -21.001 39.415 1.00 16.96 ? 280 PRO B CD  1 
ATOM   1646 N N   . ASP B 1 81  ? 11.302  -23.085 42.377 1.00 16.48 ? 281 ASP B N   1 
ATOM   1647 C CA  . ASP B 1 81  ? 11.499  -23.860 43.592 1.00 14.97 ? 281 ASP B CA  1 
ATOM   1648 C C   . ASP B 1 81  ? 12.501  -23.155 44.490 1.00 14.02 ? 281 ASP B C   1 
ATOM   1649 O O   . ASP B 1 81  ? 13.155  -22.198 44.079 1.00 12.20 ? 281 ASP B O   1 
ATOM   1650 C CB  . ASP B 1 81  ? 11.976  -25.280 43.266 1.00 17.09 ? 281 ASP B CB  1 
ATOM   1651 C CG  . ASP B 1 81  ? 13.097  -25.303 42.252 1.00 20.08 ? 281 ASP B CG  1 
ATOM   1652 O OD1 . ASP B 1 81  ? 12.872  -25.796 41.125 1.00 23.87 ? 281 ASP B OD1 1 
ATOM   1653 O OD2 . ASP B 1 81  ? 14.204  -24.833 42.579 1.00 19.36 ? 281 ASP B OD2 1 
ATOM   1654 N N   . THR B 1 82  ? 12.617  -23.631 45.723 1.00 13.63 ? 282 THR B N   1 
ATOM   1655 C CA  . THR B 1 82  ? 13.517  -23.022 46.685 1.00 13.19 ? 282 THR B CA  1 
ATOM   1656 C C   . THR B 1 82  ? 15.000  -23.220 46.361 1.00 11.94 ? 282 THR B C   1 
ATOM   1657 O O   . THR B 1 82  ? 15.809  -22.324 46.608 1.00 11.26 ? 282 THR B O   1 
ATOM   1658 C CB  . THR B 1 82  ? 13.219  -23.543 48.103 1.00 14.49 ? 282 THR B CB  1 
ATOM   1659 O OG1 . THR B 1 82  ? 13.289  -24.975 48.113 1.00 16.08 ? 282 THR B OG1 1 
ATOM   1660 C CG2 . THR B 1 82  ? 11.827  -23.106 48.540 1.00 12.40 ? 282 THR B CG2 1 
ATOM   1661 N N   . ALA B 1 83  ? 15.357  -24.377 45.802 1.00 11.88 ? 283 ALA B N   1 
ATOM   1662 C CA  . ALA B 1 83  ? 16.754  -24.653 45.450 1.00 11.38 ? 283 ALA B CA  1 
ATOM   1663 C C   . ALA B 1 83  ? 17.270  -23.643 44.428 1.00 11.24 ? 283 ALA B C   1 
ATOM   1664 O O   . ALA B 1 83  ? 18.456  -23.329 44.401 1.00 11.31 ? 283 ALA B O   1 
ATOM   1665 C CB  . ALA B 1 83  ? 16.891  -26.065 44.898 1.00 11.16 ? 283 ALA B CB  1 
ATOM   1666 N N   . SER B 1 84  ? 16.364  -23.142 43.592 1.00 11.32 ? 284 SER B N   1 
ATOM   1667 C CA  . SER B 1 84  ? 16.713  -22.162 42.569 1.00 12.11 ? 284 SER B CA  1 
ATOM   1668 C C   . SER B 1 84  ? 17.131  -20.814 43.170 1.00 10.71 ? 284 SER B C   1 
ATOM   1669 O O   . SER B 1 84  ? 17.936  -20.091 42.579 1.00 11.16 ? 284 SER B O   1 
ATOM   1670 C CB  . SER B 1 84  ? 15.528  -21.958 41.621 1.00 12.32 ? 284 SER B CB  1 
ATOM   1671 O OG  . SER B 1 84  ? 15.459  -23.016 40.681 1.00 18.38 ? 284 SER B OG  1 
ATOM   1672 N N   . VAL B 1 85  ? 16.583  -20.480 44.337 1.00 9.29  ? 285 VAL B N   1 
ATOM   1673 C CA  . VAL B 1 85  ? 16.907  -19.226 45.015 1.00 9.23  ? 285 VAL B CA  1 
ATOM   1674 C C   . VAL B 1 85  ? 18.364  -19.250 45.490 1.00 10.03 ? 285 VAL B C   1 
ATOM   1675 O O   . VAL B 1 85  ? 19.144  -18.339 45.198 1.00 10.83 ? 285 VAL B O   1 
ATOM   1676 C CB  . VAL B 1 85  ? 15.971  -18.999 46.231 1.00 9.59  ? 285 VAL B CB  1 
ATOM   1677 C CG1 . VAL B 1 85  ? 16.395  -17.749 46.994 1.00 9.09  ? 285 VAL B CG1 1 
ATOM   1678 C CG2 . VAL B 1 85  ? 14.528  -18.864 45.762 1.00 8.31  ? 285 VAL B CG2 1 
ATOM   1679 N N   . ASP B 1 86  ? 18.729  -20.298 46.223 1.00 10.29 ? 286 ASP B N   1 
ATOM   1680 C CA  . ASP B 1 86  ? 20.095  -20.456 46.718 1.00 11.40 ? 286 ASP B CA  1 
ATOM   1681 C C   . ASP B 1 86  ? 21.098  -20.500 45.563 1.00 11.73 ? 286 ASP B C   1 
ATOM   1682 O O   . ASP B 1 86  ? 22.171  -19.896 45.624 1.00 12.35 ? 286 ASP B O   1 
ATOM   1683 C CB  . ASP B 1 86  ? 20.214  -21.758 47.517 1.00 10.60 ? 286 ASP B CB  1 
ATOM   1684 C CG  . ASP B 1 86  ? 19.490  -21.693 48.828 1.00 11.18 ? 286 ASP B CG  1 
ATOM   1685 O OD1 . ASP B 1 86  ? 18.247  -21.605 48.810 1.00 14.25 ? 286 ASP B OD1 1 
ATOM   1686 O OD2 . ASP B 1 86  ? 20.161  -21.727 49.878 1.00 11.74 ? 286 ASP B OD2 1 
ATOM   1687 N N   . LYS B 1 87  ? 20.735  -21.228 44.514 1.00 11.97 ? 287 LYS B N   1 
ATOM   1688 C CA  . LYS B 1 87  ? 21.589  -21.376 43.351 1.00 13.30 ? 287 LYS B CA  1 
ATOM   1689 C C   . LYS B 1 87  ? 21.834  -20.041 42.653 1.00 13.17 ? 287 LYS B C   1 
ATOM   1690 O O   . LYS B 1 87  ? 22.977  -19.692 42.354 1.00 13.21 ? 287 LYS B O   1 
ATOM   1691 C CB  . LYS B 1 87  ? 20.961  -22.372 42.376 1.00 16.06 ? 287 LYS B CB  1 
ATOM   1692 C CG  . LYS B 1 87  ? 21.810  -22.662 41.139 1.00 23.90 ? 287 LYS B CG  1 
ATOM   1693 C CD  . LYS B 1 87  ? 23.251  -23.029 41.514 1.00 28.83 ? 287 LYS B CD  1 
ATOM   1694 C CE  . LYS B 1 87  ? 24.274  -22.092 40.858 1.00 30.24 ? 287 LYS B CE  1 
ATOM   1695 N NZ  . LYS B 1 87  ? 25.186  -21.457 41.858 1.00 24.85 ? 287 LYS B NZ  1 
ATOM   1696 N N   . LYS B 1 88  ? 20.768  -19.289 42.394 1.00 11.57 ? 288 LYS B N   1 
ATOM   1697 C CA  . LYS B 1 88  ? 20.922  -18.000 41.727 1.00 10.77 ? 288 LYS B CA  1 
ATOM   1698 C C   . LYS B 1 88  ? 21.726  -17.018 42.577 1.00 10.69 ? 288 LYS B C   1 
ATOM   1699 O O   . LYS B 1 88  ? 22.522  -16.245 42.048 1.00 11.49 ? 288 LYS B O   1 
ATOM   1700 C CB  . LYS B 1 88  ? 19.554  -17.404 41.389 1.00 11.47 ? 288 LYS B CB  1 
ATOM   1701 C CG  . LYS B 1 88  ? 19.621  -16.088 40.619 1.00 12.03 ? 288 LYS B CG  1 
ATOM   1702 C CD  . LYS B 1 88  ? 20.379  -16.231 39.302 1.00 14.02 ? 288 LYS B CD  1 
ATOM   1703 C CE  . LYS B 1 88  ? 19.632  -17.117 38.323 1.00 15.25 ? 288 LYS B CE  1 
ATOM   1704 N NZ  . LYS B 1 88  ? 20.448  -17.381 37.106 1.00 15.67 ? 288 LYS B NZ  1 
ATOM   1705 N N   . TYR B 1 89  ? 21.526  -17.050 43.893 1.00 9.88  ? 289 TYR B N   1 
ATOM   1706 C CA  . TYR B 1 89  ? 22.257  -16.156 44.784 1.00 10.83 ? 289 TYR B CA  1 
ATOM   1707 C C   . TYR B 1 89  ? 23.762  -16.400 44.698 1.00 11.23 ? 289 TYR B C   1 
ATOM   1708 O O   . TYR B 1 89  ? 24.559  -15.462 44.611 1.00 12.20 ? 289 TYR B O   1 
ATOM   1709 C CB  . TYR B 1 89  ? 21.794  -16.352 46.230 1.00 11.13 ? 289 TYR B CB  1 
ATOM   1710 C CG  . TYR B 1 89  ? 22.418  -15.374 47.204 1.00 11.63 ? 289 TYR B CG  1 
ATOM   1711 C CD1 . TYR B 1 89  ? 23.609  -15.682 47.869 1.00 11.06 ? 289 TYR B CD1 1 
ATOM   1712 C CD2 . TYR B 1 89  ? 21.806  -14.147 47.480 1.00 12.31 ? 289 TYR B CD2 1 
ATOM   1713 C CE1 . TYR B 1 89  ? 24.172  -14.795 48.786 1.00 11.20 ? 289 TYR B CE1 1 
ATOM   1714 C CE2 . TYR B 1 89  ? 22.359  -13.252 48.394 1.00 10.51 ? 289 TYR B CE2 1 
ATOM   1715 C CZ  . TYR B 1 89  ? 23.543  -13.584 49.046 1.00 12.09 ? 289 TYR B CZ  1 
ATOM   1716 O OH  . TYR B 1 89  ? 24.089  -12.717 49.961 1.00 11.68 ? 289 TYR B OH  1 
ATOM   1717 N N   . ALA B 1 90  ? 24.142  -17.673 44.731 1.00 13.29 ? 290 ALA B N   1 
ATOM   1718 C CA  . ALA B 1 90  ? 25.542  -18.064 44.667 1.00 13.07 ? 290 ALA B CA  1 
ATOM   1719 C C   . ALA B 1 90  ? 26.141  -17.668 43.322 1.00 13.13 ? 290 ALA B C   1 
ATOM   1720 O O   . ALA B 1 90  ? 27.271  -17.189 43.256 1.00 13.86 ? 290 ALA B O   1 
ATOM   1721 C CB  . ALA B 1 90  ? 25.663  -19.567 44.880 1.00 12.84 ? 290 ALA B CB  1 
ATOM   1722 N N   . GLU B 1 91  ? 25.370  -17.865 42.258 1.00 14.00 ? 291 GLU B N   1 
ATOM   1723 C CA  . GLU B 1 91  ? 25.812  -17.537 40.910 1.00 15.18 ? 291 GLU B CA  1 
ATOM   1724 C C   . GLU B 1 91  ? 26.067  -16.047 40.762 1.00 14.31 ? 291 GLU B C   1 
ATOM   1725 O O   . GLU B 1 91  ? 27.097  -15.634 40.237 1.00 14.78 ? 291 GLU B O   1 
ATOM   1726 C CB  . GLU B 1 91  ? 24.768  -17.978 39.881 1.00 16.08 ? 291 GLU B CB  1 
ATOM   1727 C CG  . GLU B 1 91  ? 25.059  -17.481 38.476 1.00 20.95 ? 291 GLU B CG  1 
ATOM   1728 C CD  . GLU B 1 91  ? 23.894  -17.679 37.532 1.00 24.14 ? 291 GLU B CD  1 
ATOM   1729 O OE1 . GLU B 1 91  ? 23.957  -17.163 36.390 1.00 24.54 ? 291 GLU B OE1 1 
ATOM   1730 O OE2 . GLU B 1 91  ? 22.916  -18.353 37.930 1.00 25.34 ? 291 GLU B OE2 1 
ATOM   1731 N N   . LEU B 1 92  ? 25.127  -15.234 41.227 1.00 13.71 ? 292 LEU B N   1 
ATOM   1732 C CA  . LEU B 1 92  ? 25.284  -13.790 41.114 1.00 14.27 ? 292 LEU B CA  1 
ATOM   1733 C C   . LEU B 1 92  ? 26.466  -13.291 41.937 1.00 14.09 ? 292 LEU B C   1 
ATOM   1734 O O   . LEU B 1 92  ? 27.215  -12.426 41.491 1.00 14.79 ? 292 LEU B O   1 
ATOM   1735 C CB  . LEU B 1 92  ? 23.995  -13.079 41.539 1.00 12.80 ? 292 LEU B CB  1 
ATOM   1736 C CG  . LEU B 1 92  ? 22.785  -13.298 40.620 1.00 13.08 ? 292 LEU B CG  1 
ATOM   1737 C CD1 . LEU B 1 92  ? 21.602  -12.511 41.158 1.00 13.91 ? 292 LEU B CD1 1 
ATOM   1738 C CD2 . LEU B 1 92  ? 23.103  -12.868 39.195 1.00 13.29 ? 292 LEU B CD2 1 
ATOM   1739 N N   . VAL B 1 93  ? 26.634  -13.835 43.137 1.00 15.67 ? 293 VAL B N   1 
ATOM   1740 C CA  . VAL B 1 93  ? 27.744  -13.433 43.989 1.00 16.17 ? 293 VAL B CA  1 
ATOM   1741 C C   . VAL B 1 93  ? 29.062  -13.852 43.334 1.00 17.33 ? 293 VAL B C   1 
ATOM   1742 O O   . VAL B 1 93  ? 30.067  -13.157 43.445 1.00 18.63 ? 293 VAL B O   1 
ATOM   1743 C CB  . VAL B 1 93  ? 27.630  -14.080 45.385 1.00 16.21 ? 293 VAL B CB  1 
ATOM   1744 C CG1 . VAL B 1 93  ? 28.948  -13.918 46.149 1.00 17.26 ? 293 VAL B CG1 1 
ATOM   1745 C CG2 . VAL B 1 93  ? 26.479  -13.443 46.151 1.00 14.88 ? 293 VAL B CG2 1 
ATOM   1746 N N   . ASP B 1 94  ? 29.046  -14.989 42.648 1.00 19.52 ? 294 ASP B N   1 
ATOM   1747 C CA  . ASP B 1 94  ? 30.238  -15.485 41.971 1.00 22.29 ? 294 ASP B CA  1 
ATOM   1748 C C   . ASP B 1 94  ? 30.542  -14.632 40.733 1.00 21.86 ? 294 ASP B C   1 
ATOM   1749 O O   . ASP B 1 94  ? 31.698  -14.499 40.321 1.00 22.54 ? 294 ASP B O   1 
ATOM   1750 C CB  . ASP B 1 94  ? 30.047  -16.948 41.565 1.00 25.75 ? 294 ASP B CB  1 
ATOM   1751 C CG  . ASP B 1 94  ? 31.337  -17.588 41.068 1.00 33.02 ? 294 ASP B CG  1 
ATOM   1752 O OD1 . ASP B 1 94  ? 32.299  -17.703 41.864 1.00 36.61 ? 294 ASP B OD1 1 
ATOM   1753 O OD2 . ASP B 1 94  ? 31.392  -17.971 39.876 1.00 35.87 ? 294 ASP B OD2 1 
ATOM   1754 N N   . ALA B 1 95  ? 29.500  -14.055 40.145 1.00 20.01 ? 295 ALA B N   1 
ATOM   1755 C CA  . ALA B 1 95  ? 29.657  -13.208 38.974 1.00 17.63 ? 295 ALA B CA  1 
ATOM   1756 C C   . ALA B 1 95  ? 30.172  -11.837 39.408 1.00 17.32 ? 295 ALA B C   1 
ATOM   1757 O O   . ALA B 1 95  ? 30.410  -10.965 38.579 1.00 19.53 ? 295 ALA B O   1 
ATOM   1758 C CB  . ALA B 1 95  ? 28.323  -13.067 38.249 1.00 17.72 ? 295 ALA B CB  1 
ATOM   1759 N N   . GLY B 1 96  ? 30.324  -11.647 40.715 1.00 15.29 ? 296 GLY B N   1 
ATOM   1760 C CA  . GLY B 1 96  ? 30.827  -10.385 41.232 1.00 15.95 ? 296 GLY B CA  1 
ATOM   1761 C C   . GLY B 1 96  ? 29.791  -9.389  41.730 1.00 15.40 ? 296 GLY B C   1 
ATOM   1762 O O   . GLY B 1 96  ? 30.120  -8.253  42.077 1.00 16.92 ? 296 GLY B O   1 
ATOM   1763 N N   . TYR B 1 97  ? 28.532  -9.801  41.775 1.00 15.73 ? 297 TYR B N   1 
ATOM   1764 C CA  . TYR B 1 97  ? 27.478  -8.908  42.230 1.00 13.88 ? 297 TYR B CA  1 
ATOM   1765 C C   . TYR B 1 97  ? 27.352  -8.927  43.752 1.00 14.40 ? 297 TYR B C   1 
ATOM   1766 O O   . TYR B 1 97  ? 27.781  -9.870  44.411 1.00 14.37 ? 297 TYR B O   1 
ATOM   1767 C CB  . TYR B 1 97  ? 26.160  -9.289  41.550 1.00 14.08 ? 297 TYR B CB  1 
ATOM   1768 C CG  . TYR B 1 97  ? 26.244  -9.193  40.038 1.00 13.21 ? 297 TYR B CG  1 
ATOM   1769 C CD1 . TYR B 1 97  ? 26.523  -7.971  39.413 1.00 12.85 ? 297 TYR B CD1 1 
ATOM   1770 C CD2 . TYR B 1 97  ? 26.075  -10.320 39.237 1.00 13.47 ? 297 TYR B CD2 1 
ATOM   1771 C CE1 . TYR B 1 97  ? 26.631  -7.877  38.029 1.00 12.93 ? 297 TYR B CE1 1 
ATOM   1772 C CE2 . TYR B 1 97  ? 26.181  -10.237 37.845 1.00 14.03 ? 297 TYR B CE2 1 
ATOM   1773 C CZ  . TYR B 1 97  ? 26.459  -9.012  37.252 1.00 13.69 ? 297 TYR B CZ  1 
ATOM   1774 O OH  . TYR B 1 97  ? 26.571  -8.922  35.882 1.00 15.14 ? 297 TYR B OH  1 
ATOM   1775 N N   . GLU B 1 98  ? 26.759  -7.874  44.297 1.00 13.52 ? 298 GLU B N   1 
ATOM   1776 C CA  . GLU B 1 98  ? 26.604  -7.722  45.735 1.00 14.28 ? 298 GLU B CA  1 
ATOM   1777 C C   . GLU B 1 98  ? 25.552  -8.592  46.413 1.00 13.64 ? 298 GLU B C   1 
ATOM   1778 O O   . GLU B 1 98  ? 24.360  -8.425  46.184 1.00 13.56 ? 298 GLU B O   1 
ATOM   1779 C CB  . GLU B 1 98  ? 26.311  -6.260  46.042 1.00 15.42 ? 298 GLU B CB  1 
ATOM   1780 C CG  . GLU B 1 98  ? 26.113  -5.950  47.501 1.00 18.63 ? 298 GLU B CG  1 
ATOM   1781 C CD  . GLU B 1 98  ? 25.973  -4.461  47.746 1.00 21.69 ? 298 GLU B CD  1 
ATOM   1782 O OE1 . GLU B 1 98  ? 26.033  -3.686  46.765 1.00 24.07 ? 298 GLU B OE1 1 
ATOM   1783 O OE2 . GLU B 1 98  ? 25.800  -4.065  48.916 1.00 22.35 ? 298 GLU B OE2 1 
ATOM   1784 N N   . GLY B 1 99  ? 26.005  -9.519  47.252 1.00 12.69 ? 299 GLY B N   1 
ATOM   1785 C CA  . GLY B 1 99  ? 25.087  -10.366 47.986 1.00 13.03 ? 299 GLY B CA  1 
ATOM   1786 C C   . GLY B 1 99  ? 24.756  -9.627  49.274 1.00 13.68 ? 299 GLY B C   1 
ATOM   1787 O O   . GLY B 1 99  ? 25.606  -9.499  50.161 1.00 15.14 ? 299 GLY B O   1 
ATOM   1788 N N   . HIS B 1 100 ? 23.526  -9.142  49.386 1.00 11.92 ? 300 HIS B N   1 
ATOM   1789 C CA  . HIS B 1 100 ? 23.104  -8.376  50.557 1.00 12.95 ? 300 HIS B CA  1 
ATOM   1790 C C   . HIS B 1 100 ? 22.713  -9.221  51.774 1.00 12.74 ? 300 HIS B C   1 
ATOM   1791 O O   . HIS B 1 100 ? 23.242  -9.026  52.873 1.00 13.69 ? 300 HIS B O   1 
ATOM   1792 C CB  . HIS B 1 100 ? 21.946  -7.447  50.169 1.00 13.14 ? 300 HIS B CB  1 
ATOM   1793 C CG  . HIS B 1 100 ? 21.664  -6.378  51.177 1.00 13.93 ? 300 HIS B CG  1 
ATOM   1794 N ND1 . HIS B 1 100 ? 22.656  -5.588  51.722 1.00 15.13 ? 300 HIS B ND1 1 
ATOM   1795 C CD2 . HIS B 1 100 ? 20.507  -5.984  51.760 1.00 15.93 ? 300 HIS B CD2 1 
ATOM   1796 C CE1 . HIS B 1 100 ? 22.120  -4.756  52.597 1.00 15.87 ? 300 HIS B CE1 1 
ATOM   1797 N NE2 . HIS B 1 100 ? 20.818  -4.975  52.639 1.00 16.18 ? 300 HIS B NE2 1 
ATOM   1798 N N   . LEU B 1 101 ? 21.776  -10.143 51.578 1.00 10.48 ? 301 LEU B N   1 
ATOM   1799 C CA  . LEU B 1 101 ? 21.324  -11.020 52.652 1.00 10.77 ? 301 LEU B CA  1 
ATOM   1800 C C   . LEU B 1 101 ? 21.251  -12.425 52.076 1.00 10.18 ? 301 LEU B C   1 
ATOM   1801 O O   . LEU B 1 101 ? 20.512  -12.668 51.119 1.00 10.22 ? 301 LEU B O   1 
ATOM   1802 C CB  . LEU B 1 101 ? 19.944  -10.579 53.162 1.00 11.49 ? 301 LEU B CB  1 
ATOM   1803 C CG  . LEU B 1 101 ? 19.929  -9.352  54.080 1.00 14.38 ? 301 LEU B CG  1 
ATOM   1804 C CD1 . LEU B 1 101 ? 18.495  -9.002  54.441 1.00 16.26 ? 301 LEU B CD1 1 
ATOM   1805 C CD2 . LEU B 1 101 ? 20.737  -9.637  55.339 1.00 15.42 ? 301 LEU B CD2 1 
ATOM   1806 N N   . LYS B 1 102 ? 22.027  -13.346 52.644 1.00 8.97  ? 302 LYS B N   1 
ATOM   1807 C CA  . LYS B 1 102 ? 22.044  -14.716 52.147 1.00 10.02 ? 302 LYS B CA  1 
ATOM   1808 C C   . LYS B 1 102 ? 20.702  -15.436 52.331 1.00 9.76  ? 302 LYS B C   1 
ATOM   1809 O O   . LYS B 1 102 ? 19.896  -15.074 53.194 1.00 10.07 ? 302 LYS B O   1 
ATOM   1810 C CB  . LYS B 1 102 ? 23.181  -15.513 52.800 1.00 12.13 ? 302 LYS B CB  1 
ATOM   1811 C CG  . LYS B 1 102 ? 23.181  -15.519 54.314 1.00 15.82 ? 302 LYS B CG  1 
ATOM   1812 C CD  . LYS B 1 102 ? 24.561  -15.913 54.846 1.00 19.88 ? 302 LYS B CD  1 
ATOM   1813 C CE  . LYS B 1 102 ? 24.471  -16.410 56.274 1.00 22.07 ? 302 LYS B CE  1 
ATOM   1814 N NZ  . LYS B 1 102 ? 24.061  -15.331 57.214 1.00 23.08 ? 302 LYS B NZ  1 
ATOM   1815 N N   . PRO B 1 103 ? 20.447  -16.469 51.512 1.00 9.49  ? 303 PRO B N   1 
ATOM   1816 C CA  . PRO B 1 103 ? 19.191  -17.215 51.600 1.00 9.55  ? 303 PRO B CA  1 
ATOM   1817 C C   . PRO B 1 103 ? 18.781  -17.641 52.999 1.00 10.25 ? 303 PRO B C   1 
ATOM   1818 O O   . PRO B 1 103 ? 19.603  -18.084 53.804 1.00 10.02 ? 303 PRO B O   1 
ATOM   1819 C CB  . PRO B 1 103 ? 19.415  -18.407 50.674 1.00 9.35  ? 303 PRO B CB  1 
ATOM   1820 C CG  . PRO B 1 103 ? 20.405  -17.901 49.676 1.00 9.75  ? 303 PRO B CG  1 
ATOM   1821 C CD  . PRO B 1 103 ? 21.327  -17.017 50.462 1.00 8.78  ? 303 PRO B CD  1 
ATOM   1822 N N   . TRP B 1 104 ? 17.490  -17.502 53.271 1.00 10.76 ? 304 TRP B N   1 
ATOM   1823 C CA  . TRP B 1 104 ? 16.933  -17.882 54.556 1.00 10.94 ? 304 TRP B CA  1 
ATOM   1824 C C   . TRP B 1 104 ? 15.451  -18.183 54.386 1.00 12.53 ? 304 TRP B C   1 
ATOM   1825 O O   . TRP B 1 104 ? 14.852  -17.826 53.369 1.00 11.43 ? 304 TRP B O   1 
ATOM   1826 C CB  . TRP B 1 104 ? 17.180  -16.765 55.590 1.00 11.98 ? 304 TRP B CB  1 
ATOM   1827 C CG  . TRP B 1 104 ? 16.162  -15.645 55.667 1.00 11.54 ? 304 TRP B CG  1 
ATOM   1828 C CD1 . TRP B 1 104 ? 15.118  -15.551 56.542 1.00 11.59 ? 304 TRP B CD1 1 
ATOM   1829 C CD2 . TRP B 1 104 ? 16.155  -14.426 54.907 1.00 12.67 ? 304 TRP B CD2 1 
ATOM   1830 N NE1 . TRP B 1 104 ? 14.464  -14.353 56.380 1.00 12.70 ? 304 TRP B NE1 1 
ATOM   1831 C CE2 . TRP B 1 104 ? 15.077  -13.641 55.384 1.00 12.27 ? 304 TRP B CE2 1 
ATOM   1832 C CE3 . TRP B 1 104 ? 16.957  -13.918 53.871 1.00 13.53 ? 304 TRP B CE3 1 
ATOM   1833 C CZ2 . TRP B 1 104 ? 14.777  -12.375 54.863 1.00 12.58 ? 304 TRP B CZ2 1 
ATOM   1834 C CZ3 . TRP B 1 104 ? 16.657  -12.653 53.349 1.00 14.26 ? 304 TRP B CZ3 1 
ATOM   1835 C CH2 . TRP B 1 104 ? 15.575  -11.899 53.850 1.00 13.87 ? 304 TRP B CH2 1 
ATOM   1836 N N   . ASN B 1 105 ? 14.873  -18.890 55.352 1.00 12.49 ? 305 ASN B N   1 
ATOM   1837 C CA  . ASN B 1 105 ? 13.447  -19.210 55.306 1.00 12.68 ? 305 ASN B CA  1 
ATOM   1838 C C   . ASN B 1 105 ? 12.724  -18.053 56.005 1.00 11.85 ? 305 ASN B C   1 
ATOM   1839 O O   . ASN B 1 105 ? 12.634  -18.023 57.233 1.00 11.80 ? 305 ASN B O   1 
ATOM   1840 C CB  . ASN B 1 105 ? 13.175  -20.528 56.043 1.00 12.39 ? 305 ASN B CB  1 
ATOM   1841 C CG  . ASN B 1 105 ? 13.317  -21.751 55.145 1.00 11.65 ? 305 ASN B CG  1 
ATOM   1842 O OD1 . ASN B 1 105 ? 12.697  -22.790 55.393 1.00 13.45 ? 305 ASN B OD1 1 
ATOM   1843 N ND2 . ASN B 1 105 ? 14.130  -21.638 54.106 1.00 9.96  ? 305 ASN B ND2 1 
ATOM   1844 N N   . ALA B 1 106 ? 12.230  -17.096 55.224 1.00 11.87 ? 306 ALA B N   1 
ATOM   1845 C CA  . ALA B 1 106 ? 11.539  -15.936 55.780 1.00 12.61 ? 306 ALA B CA  1 
ATOM   1846 C C   . ALA B 1 106 ? 10.275  -16.334 56.541 1.00 14.23 ? 306 ALA B C   1 
ATOM   1847 O O   . ALA B 1 106 ? 9.599   -17.296 56.175 1.00 13.59 ? 306 ALA B O   1 
ATOM   1848 C CB  . ALA B 1 106 ? 11.196  -14.959 54.673 1.00 12.57 ? 306 ALA B CB  1 
ATOM   1849 N N   . VAL B 1 107 ? 9.956   -15.583 57.594 1.00 15.68 ? 307 VAL B N   1 
ATOM   1850 C CA  . VAL B 1 107 ? 8.781   -15.875 58.415 1.00 16.84 ? 307 VAL B CA  1 
ATOM   1851 C C   . VAL B 1 107 ? 7.460   -15.789 57.651 1.00 17.27 ? 307 VAL B C   1 
ATOM   1852 O O   . VAL B 1 107 ? 6.446   -16.332 58.103 1.00 16.88 ? 307 VAL B O   1 
ATOM   1853 C CB  . VAL B 1 107 ? 8.697   -14.944 59.653 1.00 16.30 ? 307 VAL B CB  1 
ATOM   1854 C CG1 . VAL B 1 107 ? 9.883   -15.195 60.567 1.00 16.36 ? 307 VAL B CG1 1 
ATOM   1855 C CG2 . VAL B 1 107 ? 8.634   -13.490 59.218 1.00 16.26 ? 307 VAL B CG2 1 
ATOM   1856 N N   . TRP B 1 108 ? 7.463   -15.114 56.501 1.00 16.14 ? 308 TRP B N   1 
ATOM   1857 C CA  . TRP B 1 108 ? 6.241   -15.005 55.716 1.00 14.88 ? 308 TRP B CA  1 
ATOM   1858 C C   . TRP B 1 108 ? 6.006   -16.215 54.810 1.00 14.60 ? 308 TRP B C   1 
ATOM   1859 O O   . TRP B 1 108 ? 5.064   -16.227 54.013 1.00 18.21 ? 308 TRP B O   1 
ATOM   1860 C CB  . TRP B 1 108 ? 6.218   -13.701 54.905 1.00 14.40 ? 308 TRP B CB  1 
ATOM   1861 C CG  . TRP B 1 108 ? 7.415   -13.440 54.036 1.00 14.64 ? 308 TRP B CG  1 
ATOM   1862 C CD1 . TRP B 1 108 ? 7.580   -13.827 52.734 1.00 13.54 ? 308 TRP B CD1 1 
ATOM   1863 C CD2 . TRP B 1 108 ? 8.572   -12.656 54.371 1.00 13.65 ? 308 TRP B CD2 1 
ATOM   1864 N NE1 . TRP B 1 108 ? 8.760   -13.330 52.238 1.00 11.98 ? 308 TRP B NE1 1 
ATOM   1865 C CE2 . TRP B 1 108 ? 9.391   -12.607 53.218 1.00 13.62 ? 308 TRP B CE2 1 
ATOM   1866 C CE3 . TRP B 1 108 ? 8.995   -11.988 55.529 1.00 14.88 ? 308 TRP B CE3 1 
ATOM   1867 C CZ2 . TRP B 1 108 ? 10.612  -11.916 53.189 1.00 12.68 ? 308 TRP B CZ2 1 
ATOM   1868 C CZ3 . TRP B 1 108 ? 10.216  -11.297 55.500 1.00 15.61 ? 308 TRP B CZ3 1 
ATOM   1869 C CH2 . TRP B 1 108 ? 11.006  -11.270 54.335 1.00 14.11 ? 308 TRP B CH2 1 
ATOM   1870 N N   . GLY B 1 109 ? 6.859   -17.232 54.935 1.00 12.74 ? 309 GLY B N   1 
ATOM   1871 C CA  . GLY B 1 109 ? 6.684   -18.453 54.161 1.00 13.23 ? 309 GLY B CA  1 
ATOM   1872 C C   . GLY B 1 109 ? 7.373   -18.583 52.814 1.00 13.65 ? 309 GLY B C   1 
ATOM   1873 O O   . GLY B 1 109 ? 6.833   -19.212 51.903 1.00 14.55 ? 309 GLY B O   1 
ATOM   1874 N N   . GLN B 1 110 ? 8.570   -18.016 52.685 1.00 12.81 ? 310 GLN B N   1 
ATOM   1875 C CA  . GLN B 1 110 ? 9.308   -18.085 51.433 1.00 11.07 ? 310 GLN B CA  1 
ATOM   1876 C C   . GLN B 1 110 ? 10.806  -18.213 51.642 1.00 10.28 ? 310 GLN B C   1 
ATOM   1877 O O   . GLN B 1 110 ? 11.348  -17.665 52.598 1.00 10.28 ? 310 GLN B O   1 
ATOM   1878 C CB  . GLN B 1 110 ? 9.073   -16.818 50.604 1.00 10.11 ? 310 GLN B CB  1 
ATOM   1879 C CG  . GLN B 1 110 ? 7.657   -16.636 50.093 1.00 10.38 ? 310 GLN B CG  1 
ATOM   1880 C CD  . GLN B 1 110 ? 7.452   -15.301 49.391 1.00 11.40 ? 310 GLN B CD  1 
ATOM   1881 O OE1 . GLN B 1 110 ? 6.431   -15.090 48.737 1.00 15.09 ? 310 GLN B OE1 1 
ATOM   1882 N NE2 . GLN B 1 110 ? 8.416   -14.399 49.525 1.00 8.44  ? 310 GLN B NE2 1 
ATOM   1883 N N   . ARG B 1 111 ? 11.464  -18.957 50.753 1.00 10.63 ? 311 ARG B N   1 
ATOM   1884 C CA  . ARG B 1 111 ? 12.919  -19.052 50.780 1.00 9.85  ? 311 ARG B CA  1 
ATOM   1885 C C   . ARG B 1 111 ? 13.226  -17.681 50.175 1.00 9.31  ? 311 ARG B C   1 
ATOM   1886 O O   . ARG B 1 111 ? 12.753  -17.358 49.084 1.00 9.86  ? 311 ARG B O   1 
ATOM   1887 C CB  . ARG B 1 111 ? 13.431  -20.172 49.867 1.00 9.31  ? 311 ARG B CB  1 
ATOM   1888 C CG  . ARG B 1 111 ? 14.953  -20.354 49.884 1.00 9.22  ? 311 ARG B CG  1 
ATOM   1889 C CD  . ARG B 1 111 ? 15.446  -20.770 51.263 1.00 9.51  ? 311 ARG B CD  1 
ATOM   1890 N NE  . ARG B 1 111 ? 16.855  -21.156 51.272 1.00 9.12  ? 311 ARG B NE  1 
ATOM   1891 C CZ  . ARG B 1 111 ? 17.523  -21.488 52.372 1.00 9.20  ? 311 ARG B CZ  1 
ATOM   1892 N NH1 . ARG B 1 111 ? 16.913  -21.480 53.547 1.00 8.44  ? 311 ARG B NH1 1 
ATOM   1893 N NH2 . ARG B 1 111 ? 18.803  -21.829 52.299 1.00 9.52  ? 311 ARG B NH2 1 
ATOM   1894 N N   . TYR B 1 112 ? 13.996  -16.875 50.892 1.00 9.32  ? 312 TYR B N   1 
ATOM   1895 C CA  . TYR B 1 112 ? 14.286  -15.514 50.467 1.00 8.91  ? 312 TYR B CA  1 
ATOM   1896 C C   . TYR B 1 112 ? 15.773  -15.157 50.472 1.00 8.89  ? 312 TYR B C   1 
ATOM   1897 O O   . TYR B 1 112 ? 16.529  -15.645 51.305 1.00 10.22 ? 312 TYR B O   1 
ATOM   1898 C CB  . TYR B 1 112 ? 13.529  -14.563 51.400 1.00 8.56  ? 312 TYR B CB  1 
ATOM   1899 C CG  . TYR B 1 112 ? 12.963  -13.317 50.754 1.00 7.63  ? 312 TYR B CG  1 
ATOM   1900 C CD1 . TYR B 1 112 ? 13.655  -12.109 50.814 1.00 9.30  ? 312 TYR B CD1 1 
ATOM   1901 C CD2 . TYR B 1 112 ? 11.716  -13.336 50.122 1.00 9.23  ? 312 TYR B CD2 1 
ATOM   1902 C CE1 . TYR B 1 112 ? 13.123  -10.945 50.267 1.00 9.48  ? 312 TYR B CE1 1 
ATOM   1903 C CE2 . TYR B 1 112 ? 11.172  -12.171 49.566 1.00 8.57  ? 312 TYR B CE2 1 
ATOM   1904 C CZ  . TYR B 1 112 ? 11.884  -10.983 49.647 1.00 9.76  ? 312 TYR B CZ  1 
ATOM   1905 O OH  . TYR B 1 112 ? 11.361  -9.827  49.125 1.00 10.10 ? 312 TYR B OH  1 
ATOM   1906 N N   . ALA B 1 113 ? 16.176  -14.295 49.541 1.00 8.79  ? 313 ALA B N   1 
ATOM   1907 C CA  . ALA B 1 113 ? 17.560  -13.835 49.434 1.00 7.58  ? 313 ALA B CA  1 
ATOM   1908 C C   . ALA B 1 113 ? 17.555  -12.443 48.800 1.00 7.61  ? 313 ALA B C   1 
ATOM   1909 O O   . ALA B 1 113 ? 16.659  -12.118 48.024 1.00 8.00  ? 313 ALA B O   1 
ATOM   1910 C CB  . ALA B 1 113 ? 18.378  -14.801 48.586 1.00 8.81  ? 313 ALA B CB  1 
ATOM   1911 N N   . ILE B 1 114 ? 18.546  -11.624 49.130 1.00 7.26  ? 314 ILE B N   1 
ATOM   1912 C CA  . ILE B 1 114 ? 18.607  -10.274 48.586 1.00 8.15  ? 314 ILE B CA  1 
ATOM   1913 C C   . ILE B 1 114 ? 19.984  -9.913  48.057 1.00 9.09  ? 314 ILE B C   1 
ATOM   1914 O O   . ILE B 1 114 ? 21.002  -10.157 48.701 1.00 8.77  ? 314 ILE B O   1 
ATOM   1915 C CB  . ILE B 1 114 ? 18.211  -9.214  49.657 1.00 10.77 ? 314 ILE B CB  1 
ATOM   1916 C CG1 . ILE B 1 114 ? 16.844  -9.558  50.253 1.00 11.16 ? 314 ILE B CG1 1 
ATOM   1917 C CG2 . ILE B 1 114 ? 18.180  -7.812  49.033 1.00 8.24  ? 314 ILE B CG2 1 
ATOM   1918 C CD1 . ILE B 1 114 ? 16.461  -8.732  51.458 1.00 13.14 ? 314 ILE B CD1 1 
ATOM   1919 N N   . VAL B 1 115 ? 20.007  -9.331  46.870 1.00 9.60  ? 315 VAL B N   1 
ATOM   1920 C CA  . VAL B 1 115 ? 21.248  -8.891  46.255 1.00 11.16 ? 315 VAL B CA  1 
ATOM   1921 C C   . VAL B 1 115 ? 20.989  -7.456  45.806 1.00 11.24 ? 315 VAL B C   1 
ATOM   1922 O O   . VAL B 1 115 ? 19.871  -6.951  45.952 1.00 11.08 ? 315 VAL B O   1 
ATOM   1923 C CB  . VAL B 1 115 ? 21.613  -9.754  45.022 1.00 12.00 ? 315 VAL B CB  1 
ATOM   1924 C CG1 . VAL B 1 115 ? 21.740  -11.217 45.421 1.00 12.09 ? 315 VAL B CG1 1 
ATOM   1925 C CG2 . VAL B 1 115 ? 20.550  -9.596  43.937 1.00 12.67 ? 315 VAL B CG2 1 
ATOM   1926 N N   . LYS B 1 116 ? 22.015  -6.795  45.286 1.00 10.39 ? 316 LYS B N   1 
ATOM   1927 C CA  . LYS B 1 116 ? 21.857  -5.436  44.790 1.00 10.42 ? 316 LYS B CA  1 
ATOM   1928 C C   . LYS B 1 116 ? 22.358  -5.430  43.367 1.00 10.48 ? 316 LYS B C   1 
ATOM   1929 O O   . LYS B 1 116 ? 23.345  -6.088  43.060 1.00 9.68  ? 316 LYS B O   1 
ATOM   1930 C CB  . LYS B 1 116 ? 22.655  -4.455  45.639 1.00 11.37 ? 316 LYS B CB  1 
ATOM   1931 C CG  . LYS B 1 116 ? 22.156  -4.398  47.069 1.00 14.68 ? 316 LYS B CG  1 
ATOM   1932 C CD  . LYS B 1 116 ? 21.752  -3.003  47.459 1.00 17.81 ? 316 LYS B CD  1 
ATOM   1933 C CE  . LYS B 1 116 ? 22.503  -2.560  48.687 1.00 21.07 ? 316 LYS B CE  1 
ATOM   1934 N NZ  . LYS B 1 116 ? 21.669  -1.681  49.538 1.00 22.48 ? 316 LYS B NZ  1 
ATOM   1935 N N   . ASP B 1 117 ? 21.665  -4.716  42.490 1.00 10.34 ? 317 ASP B N   1 
ATOM   1936 C CA  . ASP B 1 117 ? 22.090  -4.665  41.096 1.00 11.07 ? 317 ASP B CA  1 
ATOM   1937 C C   . ASP B 1 117 ? 23.272  -3.703  40.976 1.00 11.62 ? 317 ASP B C   1 
ATOM   1938 O O   . ASP B 1 117 ? 23.634  -3.053  41.952 1.00 13.04 ? 317 ASP B O   1 
ATOM   1939 C CB  . ASP B 1 117 ? 20.906  -4.275  40.184 1.00 9.66  ? 317 ASP B CB  1 
ATOM   1940 C CG  . ASP B 1 117 ? 20.608  -2.785  40.173 1.00 10.08 ? 317 ASP B CG  1 
ATOM   1941 O OD1 . ASP B 1 117 ? 21.276  -2.007  40.880 1.00 9.75  ? 317 ASP B OD1 1 
ATOM   1942 O OD2 . ASP B 1 117 ? 19.679  -2.386  39.437 1.00 10.78 ? 317 ASP B OD2 1 
ATOM   1943 N N   . PRO B 1 118 ? 23.910  -3.619  39.793 1.00 12.70 ? 318 PRO B N   1 
ATOM   1944 C CA  . PRO B 1 118 ? 25.058  -2.709  39.638 1.00 12.99 ? 318 PRO B CA  1 
ATOM   1945 C C   . PRO B 1 118 ? 24.860  -1.237  40.043 1.00 11.96 ? 318 PRO B C   1 
ATOM   1946 O O   . PRO B 1 118 ? 25.838  -0.524  40.286 1.00 12.59 ? 318 PRO B O   1 
ATOM   1947 C CB  . PRO B 1 118 ? 25.435  -2.859  38.155 1.00 13.67 ? 318 PRO B CB  1 
ATOM   1948 C CG  . PRO B 1 118 ? 24.903  -4.200  37.764 1.00 10.25 ? 318 PRO B CG  1 
ATOM   1949 C CD  . PRO B 1 118 ? 23.640  -4.373  38.553 1.00 11.08 ? 318 PRO B CD  1 
ATOM   1950 N N   . ASP B 1 119 ? 23.608  -0.790  40.135 1.00 10.79 ? 319 ASP B N   1 
ATOM   1951 C CA  . ASP B 1 119 ? 23.317  0.595   40.488 1.00 11.09 ? 319 ASP B CA  1 
ATOM   1952 C C   . ASP B 1 119 ? 22.737  0.833   41.890 1.00 10.51 ? 319 ASP B C   1 
ATOM   1953 O O   . ASP B 1 119 ? 22.236  1.922   42.194 1.00 10.92 ? 319 ASP B O   1 
ATOM   1954 C CB  . ASP B 1 119 ? 22.408  1.204   39.410 1.00 9.92  ? 319 ASP B CB  1 
ATOM   1955 C CG  . ASP B 1 119 ? 23.117  1.327   38.069 1.00 10.43 ? 319 ASP B CG  1 
ATOM   1956 O OD1 . ASP B 1 119 ? 23.886  2.296   37.893 1.00 12.29 ? 319 ASP B OD1 1 
ATOM   1957 O OD2 . ASP B 1 119 ? 22.930  0.451   37.204 1.00 11.28 ? 319 ASP B OD2 1 
ATOM   1958 N N   . GLY B 1 120 ? 22.817  -0.186  42.740 1.00 11.54 ? 320 GLY B N   1 
ATOM   1959 C CA  . GLY B 1 120 ? 22.329  -0.054  44.100 1.00 10.92 ? 320 GLY B CA  1 
ATOM   1960 C C   . GLY B 1 120 ? 20.874  -0.399  44.341 1.00 10.58 ? 320 GLY B C   1 
ATOM   1961 O O   . GLY B 1 120 ? 20.389  -0.237  45.457 1.00 11.10 ? 320 GLY B O   1 
ATOM   1962 N N   . ASN B 1 121 ? 20.165  -0.854  43.314 1.00 10.49 ? 321 ASN B N   1 
ATOM   1963 C CA  . ASN B 1 121 ? 18.764  -1.224  43.496 1.00 10.22 ? 321 ASN B CA  1 
ATOM   1964 C C   . ASN B 1 121 ? 18.719  -2.596  44.137 1.00 9.02  ? 321 ASN B C   1 
ATOM   1965 O O   . ASN B 1 121 ? 19.552  -3.454  43.853 1.00 9.64  ? 321 ASN B O   1 
ATOM   1966 C CB  . ASN B 1 121 ? 18.017  -1.243  42.160 1.00 8.94  ? 321 ASN B CB  1 
ATOM   1967 C CG  . ASN B 1 121 ? 18.018  0.111   41.484 1.00 7.86  ? 321 ASN B CG  1 
ATOM   1968 O OD1 . ASN B 1 121 ? 17.357  1.043   41.942 1.00 9.32  ? 321 ASN B OD1 1 
ATOM   1969 N ND2 . ASN B 1 121 ? 18.778  0.234   40.398 1.00 8.72  ? 321 ASN B ND2 1 
ATOM   1970 N N   . VAL B 1 122 ? 17.750  -2.789  45.019 1.00 9.38  ? 322 VAL B N   1 
ATOM   1971 C CA  . VAL B 1 122 ? 17.612  -4.055  45.710 1.00 9.61  ? 322 VAL B CA  1 
ATOM   1972 C C   . VAL B 1 122 ? 16.792  -5.033  44.886 1.00 8.96  ? 322 VAL B C   1 
ATOM   1973 O O   . VAL B 1 122 ? 15.756  -4.680  44.317 1.00 8.74  ? 322 VAL B O   1 
ATOM   1974 C CB  . VAL B 1 122 ? 16.978  -3.846  47.107 1.00 10.67 ? 322 VAL B CB  1 
ATOM   1975 C CG1 . VAL B 1 122 ? 16.336  -5.134  47.612 1.00 11.64 ? 322 VAL B CG1 1 
ATOM   1976 C CG2 . VAL B 1 122 ? 18.049  -3.386  48.072 1.00 10.83 ? 322 VAL B CG2 1 
ATOM   1977 N N   . VAL B 1 123 ? 17.295  -6.260  44.804 1.00 8.30  ? 323 VAL B N   1 
ATOM   1978 C CA  . VAL B 1 123 ? 16.640  -7.322  44.070 1.00 7.98  ? 323 VAL B CA  1 
ATOM   1979 C C   . VAL B 1 123 ? 16.395  -8.509  45.002 1.00 8.36  ? 323 VAL B C   1 
ATOM   1980 O O   . VAL B 1 123 ? 17.332  -9.084  45.557 1.00 8.41  ? 323 VAL B O   1 
ATOM   1981 C CB  . VAL B 1 123 ? 17.497  -7.769  42.867 1.00 9.29  ? 323 VAL B CB  1 
ATOM   1982 C CG1 . VAL B 1 123 ? 16.832  -8.933  42.150 1.00 8.38  ? 323 VAL B CG1 1 
ATOM   1983 C CG2 . VAL B 1 123 ? 17.691  -6.591  41.913 1.00 9.91  ? 323 VAL B CG2 1 
ATOM   1984 N N   . ASP B 1 124 ? 15.121  -8.840  45.190 1.00 7.95  ? 324 ASP B N   1 
ATOM   1985 C CA  . ASP B 1 124 ? 14.707  -9.953  46.038 1.00 8.27  ? 324 ASP B CA  1 
ATOM   1986 C C   . ASP B 1 124 ? 14.558  -11.230 45.202 1.00 9.30  ? 324 ASP B C   1 
ATOM   1987 O O   . ASP B 1 124 ? 14.048  -11.199 44.082 1.00 9.57  ? 324 ASP B O   1 
ATOM   1988 C CB  . ASP B 1 124 ? 13.363  -9.641  46.713 1.00 7.86  ? 324 ASP B CB  1 
ATOM   1989 C CG  . ASP B 1 124 ? 13.372  -8.322  47.469 1.00 10.43 ? 324 ASP B CG  1 
ATOM   1990 O OD1 . ASP B 1 124 ? 14.252  -8.138  48.335 1.00 10.78 ? 324 ASP B OD1 1 
ATOM   1991 O OD2 . ASP B 1 124 ? 12.500  -7.466  47.203 1.00 10.64 ? 324 ASP B OD2 1 
ATOM   1992 N N   . LEU B 1 125 ? 15.017  -12.345 45.756 1.00 8.57  ? 325 LEU B N   1 
ATOM   1993 C CA  . LEU B 1 125 ? 14.926  -13.645 45.100 1.00 8.72  ? 325 LEU B CA  1 
ATOM   1994 C C   . LEU B 1 125 ? 14.081  -14.498 46.033 1.00 8.06  ? 325 LEU B C   1 
ATOM   1995 O O   . LEU B 1 125 ? 14.414  -14.633 47.205 1.00 7.93  ? 325 LEU B O   1 
ATOM   1996 C CB  . LEU B 1 125 ? 16.315  -14.275 44.953 1.00 8.58  ? 325 LEU B CB  1 
ATOM   1997 C CG  . LEU B 1 125 ? 17.468  -13.401 44.453 1.00 8.42  ? 325 LEU B CG  1 
ATOM   1998 C CD1 . LEU B 1 125 ? 18.725  -14.248 44.366 1.00 10.64 ? 325 LEU B CD1 1 
ATOM   1999 C CD2 . LEU B 1 125 ? 17.130  -12.809 43.093 1.00 11.77 ? 325 LEU B CD2 1 
ATOM   2000 N N   . PHE B 1 126 ? 12.993  -15.074 45.529 1.00 7.77  ? 326 PHE B N   1 
ATOM   2001 C CA  . PHE B 1 126 ? 12.138  -15.881 46.393 1.00 8.06  ? 326 PHE B CA  1 
ATOM   2002 C C   . PHE B 1 126 ? 11.384  -17.029 45.726 1.00 8.89  ? 326 PHE B C   1 
ATOM   2003 O O   . PHE B 1 126 ? 11.208  -17.070 44.513 1.00 8.59  ? 326 PHE B O   1 
ATOM   2004 C CB  . PHE B 1 126 ? 11.130  -14.971 47.106 1.00 8.56  ? 326 PHE B CB  1 
ATOM   2005 C CG  . PHE B 1 126 ? 10.003  -14.498 46.222 1.00 9.37  ? 326 PHE B CG  1 
ATOM   2006 C CD1 . PHE B 1 126 ? 10.161  -13.381 45.406 1.00 8.33  ? 326 PHE B CD1 1 
ATOM   2007 C CD2 . PHE B 1 126 ? 8.788   -15.181 46.194 1.00 8.88  ? 326 PHE B CD2 1 
ATOM   2008 C CE1 . PHE B 1 126 ? 9.129   -12.953 44.579 1.00 9.87  ? 326 PHE B CE1 1 
ATOM   2009 C CE2 . PHE B 1 126 ? 7.749   -14.760 45.365 1.00 9.05  ? 326 PHE B CE2 1 
ATOM   2010 C CZ  . PHE B 1 126 ? 7.920   -13.646 44.558 1.00 8.78  ? 326 PHE B CZ  1 
ATOM   2011 N N   . ALA B 1 127 ? 10.943  -17.966 46.553 1.00 10.52 ? 327 ALA B N   1 
ATOM   2012 C CA  . ALA B 1 127 ? 10.163  -19.110 46.103 1.00 9.12  ? 327 ALA B CA  1 
ATOM   2013 C C   . ALA B 1 127 ? 9.350   -19.542 47.313 1.00 10.58 ? 327 ALA B C   1 
ATOM   2014 O O   . ALA B 1 127 ? 9.829   -19.472 48.446 1.00 10.82 ? 327 ALA B O   1 
ATOM   2015 C CB  . ALA B 1 127 ? 11.073  -20.235 45.644 1.00 9.89  ? 327 ALA B CB  1 
ATOM   2016 N N   . PRO B 1 128 ? 8.101   -19.980 47.100 1.00 11.87 ? 328 PRO B N   1 
ATOM   2017 C CA  . PRO B 1 128 ? 7.277   -20.406 48.239 1.00 13.15 ? 328 PRO B CA  1 
ATOM   2018 C C   . PRO B 1 128 ? 7.824   -21.663 48.906 1.00 13.64 ? 328 PRO B C   1 
ATOM   2019 O O   . PRO B 1 128 ? 8.375   -22.540 48.238 1.00 14.59 ? 328 PRO B O   1 
ATOM   2020 C CB  . PRO B 1 128 ? 5.898   -20.643 47.623 1.00 13.25 ? 328 PRO B CB  1 
ATOM   2021 C CG  . PRO B 1 128 ? 6.183   -20.970 46.192 1.00 14.68 ? 328 PRO B CG  1 
ATOM   2022 C CD  . PRO B 1 128 ? 7.390   -20.126 45.819 1.00 13.80 ? 328 PRO B CD  1 
ATOM   2023 N N   . LEU B 1 129 ? 7.684   -21.736 50.227 1.00 15.10 ? 329 LEU B N   1 
ATOM   2024 C CA  . LEU B 1 129 ? 8.153   -22.900 50.977 1.00 16.11 ? 329 LEU B CA  1 
ATOM   2025 C C   . LEU B 1 129 ? 7.085   -23.988 50.934 1.00 17.23 ? 329 LEU B C   1 
ATOM   2026 O O   . LEU B 1 129 ? 5.897   -23.636 51.118 1.00 18.89 ? 329 LEU B O   1 
ATOM   2027 C CB  . LEU B 1 129 ? 8.440   -22.525 52.432 1.00 14.06 ? 329 LEU B CB  1 
ATOM   2028 C CG  . LEU B 1 129 ? 9.585   -21.543 52.693 1.00 12.91 ? 329 LEU B CG  1 
ATOM   2029 C CD1 . LEU B 1 129 ? 9.581   -21.146 54.155 1.00 13.46 ? 329 LEU B CD1 1 
ATOM   2030 C CD2 . LEU B 1 129 ? 10.907  -22.175 52.307 1.00 11.82 ? 329 LEU B CD2 1 
HETATM 2031 N NL  . BLM C 2 .   ? 3.248   3.011   26.431 1.00 77.95 ? 700 BLM A NL  1 
HETATM 2032 C C37 . BLM C 2 .   ? 4.578   2.517   26.121 1.00 78.73 ? 700 BLM A C37 1 
HETATM 2033 C C40 . BLM C 2 .   ? 5.669   3.516   26.515 1.00 77.48 ? 700 BLM A C40 1 
HETATM 2034 O O40 . BLM C 2 .   ? 5.449   4.382   27.365 1.00 76.18 ? 700 BLM A O40 1 
HETATM 2035 C C38 . BLM C 2 .   ? 4.661   2.154   24.628 1.00 80.17 ? 700 BLM A C38 1 
HETATM 2036 O OH3 . BLM C 2 .   ? 3.975   3.180   23.918 1.00 81.47 ? 700 BLM A OH3 1 
HETATM 2037 C CD  . BLM C 2 .   ? 4.046   0.791   24.341 1.00 80.00 ? 700 BLM A CD  1 
HETATM 2038 N NM  . BLM C 2 .   ? 6.874   3.414   25.936 1.00 77.78 ? 700 BLM A NM  1 
HETATM 2039 C C42 . BLM C 2 .   ? 8.058   5.497   25.280 1.00 78.97 ? 700 BLM A C42 1 
HETATM 2040 C C49 . BLM C 2 .   ? 13.158  9.805   28.982 1.00 81.83 ? 700 BLM A C49 1 
HETATM 2041 O O49 . BLM C 2 .   ? 14.015  10.667  29.153 1.00 82.53 ? 700 BLM A O49 1 
HETATM 2042 C C43 . BLM C 2 .   ? 9.458   5.925   24.990 1.00 79.31 ? 700 BLM A C43 1 
HETATM 2043 C C41 . BLM C 2 .   ? 7.976   4.315   26.251 1.00 77.48 ? 700 BLM A C41 1 
HETATM 2044 S S43 . BLM C 2 .   ? 10.265  5.693   23.474 1.00 79.36 ? 700 BLM A S43 1 
HETATM 2045 C C44 . BLM C 2 .   ? 11.637  6.483   24.079 1.00 78.45 ? 700 BLM A C44 1 
HETATM 2046 C C45 . BLM C 2 .   ? 11.401  6.886   25.403 1.00 79.47 ? 700 BLM A C45 1 
HETATM 2047 N NN  . BLM C 2 .   ? 10.147  6.539   25.879 1.00 79.45 ? 700 BLM A NN  1 
HETATM 2048 C C47 . BLM C 2 .   ? 14.195  9.066   26.819 1.00 81.43 ? 700 BLM A C47 1 
HETATM 2049 C C48 . BLM C 2 .   ? 13.200  8.940   27.744 1.00 81.41 ? 700 BLM A C48 1 
HETATM 2050 N NO  . BLM C 2 .   ? 12.161  8.123   27.348 1.00 80.29 ? 700 BLM A NO  1 
HETATM 2051 C C46 . BLM C 2 .   ? 12.328  7.652   26.158 1.00 79.88 ? 700 BLM A C46 1 
HETATM 2052 S S46 . BLM C 2 .   ? 13.824  8.154   25.390 1.00 81.79 ? 700 BLM A S46 1 
HETATM 2053 N NP  . BLM C 2 .   ? 12.133  9.551   29.793 1.00 82.01 ? 700 BLM A NP  1 
HETATM 2054 C C50 . BLM C 2 .   ? 11.907  10.298  31.010 1.00 81.46 ? 700 BLM A C50 1 
HETATM 2055 C C51 . BLM C 2 .   ? 12.967  10.113  32.067 1.00 82.15 ? 700 BLM A C51 1 
HETATM 2056 C C52 . BLM C 2 .   ? 13.339  11.465  32.696 1.00 82.68 ? 700 BLM A C52 1 
HETATM 2057 S S53 . BLM C 2 .   ? 13.611  11.329  34.474 1.00 84.37 ? 700 BLM A S53 1 
HETATM 2058 C C55 . BLM C 2 .   ? 13.650  12.978  35.131 1.00 81.70 ? 700 BLM A C55 1 
HETATM 2059 C C54 . BLM C 2 .   ? 12.129  10.646  35.164 1.00 82.65 ? 700 BLM A C54 1 
HETATM 2060 O O   . HOH D 3 .   ? -4.412  7.566   53.083 1.00 19.37 ? 401 HOH A O   1 
HETATM 2061 O O   . HOH D 3 .   ? 17.144  13.465  44.689 1.00 31.81 ? 403 HOH A O   1 
HETATM 2062 O O   . HOH D 3 .   ? -11.499 0.535   51.284 1.00 19.54 ? 404 HOH A O   1 
HETATM 2063 O O   . HOH D 3 .   ? -8.458  11.367  41.669 1.00 30.04 ? 405 HOH A O   1 
HETATM 2064 O O   . HOH D 3 .   ? -5.304  26.116  40.347 1.00 48.47 ? 406 HOH A O   1 
HETATM 2065 O O   . HOH D 3 .   ? 15.559  8.975   50.256 1.00 19.27 ? 410 HOH A O   1 
HETATM 2066 O O   . HOH D 3 .   ? 18.428  -17.354 33.499 1.00 29.70 ? 412 HOH A O   1 
HETATM 2067 O O   . HOH D 3 .   ? 16.809  -17.070 36.152 1.00 30.87 ? 413 HOH A O   1 
HETATM 2068 O O   . HOH D 3 .   ? 5.442   7.269   48.563 1.00 9.62  ? 415 HOH A O   1 
HETATM 2069 O O   . HOH D 3 .   ? -2.591  12.596  23.308 1.00 12.96 ? 416 HOH A O   1 
HETATM 2070 O O   . HOH D 3 .   ? 8.047   15.009  47.519 1.00 21.88 ? 418 HOH A O   1 
HETATM 2071 O O   . HOH D 3 .   ? -3.512  9.179   22.951 1.00 30.58 ? 421 HOH A O   1 
HETATM 2072 O O   . HOH D 3 .   ? 19.449  13.769  48.996 1.00 23.98 ? 422 HOH A O   1 
HETATM 2073 O O   . HOH D 3 .   ? -0.730  10.200  57.759 1.00 38.32 ? 423 HOH A O   1 
HETATM 2074 O O   . HOH D 3 .   ? -0.686  11.797  50.729 1.00 16.35 ? 427 HOH A O   1 
HETATM 2075 O O   . HOH D 3 .   ? 10.468  4.884   48.263 1.00 10.65 ? 429 HOH A O   1 
HETATM 2076 O O   . HOH D 3 .   ? -5.251  -5.561  44.813 1.00 26.86 ? 430 HOH A O   1 
HETATM 2077 O O   . HOH D 3 .   ? 13.638  19.944  47.485 1.00 63.53 ? 431 HOH A O   1 
HETATM 2078 O O   . HOH D 3 .   ? -6.362  12.217  52.920 1.00 50.63 ? 432 HOH A O   1 
HETATM 2079 O O   . HOH D 3 .   ? 2.700   -11.008 41.596 1.00 9.86  ? 435 HOH A O   1 
HETATM 2080 O O   . HOH D 3 .   ? 1.859   -13.578 42.330 1.00 14.91 ? 436 HOH A O   1 
HETATM 2081 O O   . HOH D 3 .   ? -5.071  -8.955  37.239 1.00 25.11 ? 437 HOH A O   1 
HETATM 2082 O O   . HOH D 3 .   ? 17.562  11.416  52.448 1.00 37.64 ? 440 HOH A O   1 
HETATM 2083 O O   . HOH D 3 .   ? 12.509  8.024   42.395 1.00 8.85  ? 442 HOH A O   1 
HETATM 2084 O O   . HOH D 3 .   ? 16.791  3.676   45.591 1.00 9.67  ? 444 HOH A O   1 
HETATM 2085 O O   . HOH D 3 .   ? 18.106  7.725   45.596 1.00 11.39 ? 445 HOH A O   1 
HETATM 2086 O O   . HOH D 3 .   ? 16.017  6.103   44.735 1.00 11.49 ? 446 HOH A O   1 
HETATM 2087 O O   . HOH D 3 .   ? 13.764  7.714   44.861 1.00 10.25 ? 447 HOH A O   1 
HETATM 2088 O O   . HOH D 3 .   ? 9.377   -11.417 34.427 1.00 15.13 ? 448 HOH A O   1 
HETATM 2089 O O   . HOH D 3 .   ? -3.765  21.399  29.190 1.00 17.90 ? 449 HOH A O   1 
HETATM 2090 O O   . HOH D 3 .   ? 3.053   4.018   58.494 1.00 17.51 ? 451 HOH A O   1 
HETATM 2091 O O   . HOH D 3 .   ? -1.807  20.677  33.774 1.00 15.57 ? 453 HOH A O   1 
HETATM 2092 O O   . HOH D 3 .   ? 1.758   1.569   58.820 1.00 14.70 ? 454 HOH A O   1 
HETATM 2093 O O   . HOH D 3 .   ? 5.438   8.327   52.955 1.00 13.76 ? 455 HOH A O   1 
HETATM 2094 O O   . HOH D 3 .   ? -7.094  18.843  30.529 1.00 16.55 ? 456 HOH A O   1 
HETATM 2095 O O   . HOH D 3 .   ? 5.687   10.759  53.787 1.00 16.37 ? 457 HOH A O   1 
HETATM 2096 O O   . HOH D 3 .   ? -1.092  -11.575 41.406 1.00 13.24 ? 459 HOH A O   1 
HETATM 2097 O O   . HOH D 3 .   ? -1.335  -6.229  51.261 1.00 16.91 ? 469 HOH A O   1 
HETATM 2098 O O   . HOH D 3 .   ? 1.961   22.352  30.698 1.00 23.88 ? 471 HOH A O   1 
HETATM 2099 O O   . HOH D 3 .   ? 0.327   5.746   58.143 1.00 17.29 ? 472 HOH A O   1 
HETATM 2100 O O   . HOH D 3 .   ? 4.426   -14.629 42.774 1.00 17.07 ? 474 HOH A O   1 
HETATM 2101 O O   . HOH D 3 .   ? 21.079  14.891  43.472 1.00 25.05 ? 475 HOH A O   1 
HETATM 2102 O O   . HOH D 3 .   ? 2.909   -0.062  60.788 1.00 18.05 ? 476 HOH A O   1 
HETATM 2103 O O   . HOH D 3 .   ? 18.050  -10.516 58.302 1.00 22.93 ? 477 HOH A O   1 
HETATM 2104 O O   . HOH D 3 .   ? 7.914   20.830  31.138 1.00 14.54 ? 479 HOH A O   1 
HETATM 2105 O O   . HOH D 3 .   ? -0.920  21.596  31.463 1.00 22.87 ? 480 HOH A O   1 
HETATM 2106 O O   . HOH D 3 .   ? 5.218   15.432  46.341 1.00 12.40 ? 481 HOH A O   1 
HETATM 2107 O O   . HOH D 3 .   ? 5.092   22.718  28.501 1.00 26.15 ? 484 HOH A O   1 
HETATM 2108 O O   . HOH D 3 .   ? 9.156   -13.720 32.551 1.00 20.58 ? 485 HOH A O   1 
HETATM 2109 O O   . HOH D 3 .   ? 7.780   -5.814  49.427 1.00 24.12 ? 486 HOH A O   1 
HETATM 2110 O O   . HOH D 3 .   ? -1.027  22.503  35.583 1.00 21.07 ? 488 HOH A O   1 
HETATM 2111 O O   . HOH D 3 .   ? 4.721   22.845  37.901 1.00 29.07 ? 489 HOH A O   1 
HETATM 2112 O O   . HOH D 3 .   ? 17.786  9.838   47.153 1.00 21.14 ? 490 HOH A O   1 
HETATM 2113 O O   . HOH D 3 .   ? 9.496   -2.089  50.282 1.00 18.59 ? 492 HOH A O   1 
HETATM 2114 O O   . HOH D 3 .   ? 18.023  -12.540 56.860 1.00 17.26 ? 493 HOH A O   1 
HETATM 2115 O O   . HOH D 3 .   ? 22.460  6.995   53.305 1.00 28.96 ? 494 HOH A O   1 
HETATM 2116 O O   . HOH D 3 .   ? 13.706  10.621  47.954 1.00 25.22 ? 495 HOH A O   1 
HETATM 2117 O O   . HOH D 3 .   ? 15.269  -5.142  52.056 1.00 19.20 ? 496 HOH A O   1 
HETATM 2118 O O   . HOH D 3 .   ? -7.890  4.520   43.395 1.00 22.03 ? 498 HOH A O   1 
HETATM 2119 O O   . HOH D 3 .   ? -4.266  -3.508  48.642 1.00 31.23 ? 499 HOH A O   1 
HETATM 2120 O O   . HOH D 3 .   ? -4.452  15.793  49.502 1.00 43.11 ? 502 HOH A O   1 
HETATM 2121 O O   . HOH D 3 .   ? -7.108  19.109  37.440 1.00 19.59 ? 507 HOH A O   1 
HETATM 2122 O O   . HOH D 3 .   ? 24.080  1.021   47.187 1.00 28.33 ? 510 HOH A O   1 
HETATM 2123 O O   . HOH D 3 .   ? -6.802  -1.913  58.858 1.00 16.39 ? 512 HOH A O   1 
HETATM 2124 O O   . HOH D 3 .   ? 19.388  9.356   55.240 1.00 21.84 ? 513 HOH A O   1 
HETATM 2125 O O   . HOH D 3 .   ? -6.651  17.993  43.618 1.00 18.27 ? 514 HOH A O   1 
HETATM 2126 O O   . HOH D 3 .   ? 11.808  -1.138  48.307 1.00 24.84 ? 516 HOH A O   1 
HETATM 2127 O O   . HOH D 3 .   ? 10.735  9.538   53.337 1.00 27.38 ? 517 HOH A O   1 
HETATM 2128 O O   . HOH D 3 .   ? -7.527  7.984   38.404 1.00 45.65 ? 518 HOH A O   1 
HETATM 2129 O O   . HOH D 3 .   ? -7.830  6.035   53.616 1.00 25.13 ? 519 HOH A O   1 
HETATM 2130 O O   . HOH D 3 .   ? 5.672   -0.167  60.480 1.00 14.85 ? 520 HOH A O   1 
HETATM 2131 O O   . HOH D 3 .   ? 4.668   -4.066  62.185 1.00 19.67 ? 521 HOH A O   1 
HETATM 2132 O O   . HOH D 3 .   ? 14.809  10.033  45.740 1.00 22.35 ? 522 HOH A O   1 
HETATM 2133 O O   . HOH D 3 .   ? -9.453  12.767  32.719 1.00 35.99 ? 523 HOH A O   1 
HETATM 2134 O O   . HOH D 3 .   ? -2.738  5.271   26.419 1.00 16.03 ? 527 HOH A O   1 
HETATM 2135 O O   . HOH D 3 .   ? -6.948  12.547  34.624 1.00 17.21 ? 528 HOH A O   1 
HETATM 2136 O O   . HOH D 3 .   ? 4.392   22.063  43.596 1.00 46.63 ? 530 HOH A O   1 
HETATM 2137 O O   . HOH D 3 .   ? 5.865   15.537  20.695 1.00 21.11 ? 531 HOH A O   1 
HETATM 2138 O O   . HOH D 3 .   ? 6.861   6.557   28.444 1.00 17.26 ? 532 HOH A O   1 
HETATM 2139 O O   . HOH D 3 .   ? 1.615   13.619  51.807 1.00 18.56 ? 542 HOH A O   1 
HETATM 2140 O O   . HOH D 3 .   ? 8.539   3.115   59.934 1.00 25.82 ? 543 HOH A O   1 
HETATM 2141 O O   . HOH D 3 .   ? 12.114  -2.968  62.553 1.00 24.59 ? 544 HOH A O   1 
HETATM 2142 O O   . HOH D 3 .   ? 8.600   6.728   30.271 1.00 25.33 ? 547 HOH A O   1 
HETATM 2143 O O   . HOH D 3 .   ? 11.372  7.133   33.677 1.00 28.95 ? 548 HOH A O   1 
HETATM 2144 O O   . HOH D 3 .   ? -4.231  3.765   28.047 1.00 32.00 ? 549 HOH A O   1 
HETATM 2145 O O   . HOH D 3 .   ? -0.901  -3.732  33.388 1.00 17.70 ? 554 HOH A O   1 
HETATM 2146 O O   . HOH D 3 .   ? 6.844   -9.674  51.520 1.00 30.60 ? 555 HOH A O   1 
HETATM 2147 O O   . HOH D 3 .   ? -3.282  -0.455  38.589 1.00 20.51 ? 556 HOH A O   1 
HETATM 2148 O O   . HOH D 3 .   ? 6.075   20.810  24.424 1.00 20.81 ? 558 HOH A O   1 
HETATM 2149 O O   . HOH D 3 .   ? -4.295  4.811   23.963 1.00 24.29 ? 559 HOH A O   1 
HETATM 2150 O O   . HOH D 3 .   ? -3.002  -1.841  36.655 1.00 18.73 ? 561 HOH A O   1 
HETATM 2151 O O   . HOH D 3 .   ? 4.244   15.154  49.089 1.00 22.98 ? 562 HOH A O   1 
HETATM 2152 O O   . HOH D 3 .   ? 2.282   22.282  25.182 1.00 22.56 ? 563 HOH A O   1 
HETATM 2153 O O   . HOH D 3 .   ? -11.868 0.317   58.164 1.00 25.24 ? 564 HOH A O   1 
HETATM 2154 O O   . HOH D 3 .   ? -3.359  -7.289  47.456 1.00 18.54 ? 565 HOH A O   1 
HETATM 2155 O O   . HOH D 3 .   ? 7.191   -8.297  49.412 1.00 27.07 ? 566 HOH A O   1 
HETATM 2156 O O   . HOH D 3 .   ? 16.777  13.079  42.036 1.00 25.50 ? 570 HOH A O   1 
HETATM 2157 O O   . HOH D 3 .   ? 4.702   22.431  25.768 1.00 21.31 ? 572 HOH A O   1 
HETATM 2158 O O   . HOH D 3 .   ? -1.173  16.399  50.356 1.00 34.37 ? 575 HOH A O   1 
HETATM 2159 O O   . HOH D 3 .   ? -6.296  21.311  31.501 1.00 43.02 ? 576 HOH A O   1 
HETATM 2160 O O   . HOH D 3 .   ? 0.607   23.234  27.185 1.00 25.64 ? 577 HOH A O   1 
HETATM 2161 O O   . HOH D 3 .   ? -4.157  4.354   30.643 1.00 24.28 ? 579 HOH A O   1 
HETATM 2162 O O   . HOH D 3 .   ? 4.074   13.448  52.875 1.00 37.28 ? 580 HOH A O   1 
HETATM 2163 O O   . HOH D 3 .   ? -4.708  21.087  33.560 1.00 44.37 ? 583 HOH A O   1 
HETATM 2164 O O   . HOH D 3 .   ? 8.222   -6.971  53.815 1.00 43.18 ? 585 HOH A O   1 
HETATM 2165 O O   . HOH D 3 .   ? 14.254  8.385   35.994 1.00 36.30 ? 587 HOH A O   1 
HETATM 2166 O O   . HOH D 3 .   ? 11.888  11.189  51.716 1.00 34.56 ? 588 HOH A O   1 
HETATM 2167 O O   . HOH D 3 .   ? 2.180   16.300  50.261 1.00 27.82 ? 589 HOH A O   1 
HETATM 2168 O O   . HOH D 3 .   ? -3.502  6.770   21.916 1.00 25.72 ? 590 HOH A O   1 
HETATM 2169 O O   . HOH D 3 .   ? 13.189  -0.069  63.155 1.00 29.70 ? 591 HOH A O   1 
HETATM 2170 O O   . HOH D 3 .   ? -1.041  22.888  38.218 1.00 45.92 ? 593 HOH A O   1 
HETATM 2171 O O   . HOH D 3 .   ? -2.588  12.471  52.415 1.00 36.45 ? 594 HOH A O   1 
HETATM 2172 O O   . HOH D 3 .   ? 4.710   -9.966  54.261 1.00 42.30 ? 600 HOH A O   1 
HETATM 2173 O O   . HOH D 3 .   ? -9.838  4.112   49.810 1.00 35.09 ? 602 HOH A O   1 
HETATM 2174 O O   . HOH D 3 .   ? 10.130  19.596  29.996 1.00 30.52 ? 605 HOH A O   1 
HETATM 2175 O O   . HOH D 3 .   ? 1.506   23.600  34.031 1.00 28.70 ? 606 HOH A O   1 
HETATM 2176 O O   . HOH D 3 .   ? -1.499  -11.670 44.331 1.00 29.42 ? 607 HOH A O   1 
HETATM 2177 O O   . HOH D 3 .   ? -8.125  13.500  36.649 1.00 25.43 ? 608 HOH A O   1 
HETATM 2178 O O   . HOH D 3 .   ? -5.497  -1.294  35.370 1.00 45.99 ? 609 HOH A O   1 
HETATM 2179 O O   . HOH D 3 .   ? 24.452  3.013   45.156 1.00 39.37 ? 613 HOH A O   1 
HETATM 2180 O O   . HOH D 3 .   ? 23.554  9.350   52.556 1.00 36.88 ? 617 HOH A O   1 
HETATM 2181 O O   . HOH D 3 .   ? -8.665  -3.203  46.725 1.00 38.62 ? 618 HOH A O   1 
HETATM 2182 O O   . HOH D 3 .   ? 7.893   23.102  35.384 1.00 24.23 ? 619 HOH A O   1 
HETATM 2183 O O   . HOH D 3 .   ? 3.355   6.133   23.133 1.00 30.81 ? 620 HOH A O   1 
HETATM 2184 O O   . HOH D 3 .   ? -7.644  15.871  44.738 1.00 48.01 ? 623 HOH A O   1 
HETATM 2185 O O   . HOH D 3 .   ? -6.336  -6.795  38.952 1.00 42.76 ? 625 HOH A O   1 
HETATM 2186 O O   . HOH D 3 .   ? 3.754   25.629  28.164 1.00 37.18 ? 629 HOH A O   1 
HETATM 2187 O O   . HOH D 3 .   ? 7.474   22.804  29.432 1.00 22.26 ? 631 HOH A O   1 
HETATM 2188 O O   . HOH D 3 .   ? -5.647  -3.562  46.311 1.00 24.82 ? 635 HOH A O   1 
HETATM 2189 O O   . HOH D 3 .   ? -5.571  -8.127  46.480 1.00 43.08 ? 636 HOH A O   1 
HETATM 2190 O O   . HOH D 3 .   ? 5.892   25.707  37.071 1.00 50.29 ? 638 HOH A O   1 
HETATM 2191 O O   . HOH D 3 .   ? 10.309  -16.229 33.073 1.00 35.64 ? 641 HOH A O   1 
HETATM 2192 O O   . HOH D 3 .   ? 11.374  22.283  37.912 1.00 50.72 ? 643 HOH A O   1 
HETATM 2193 O O   . HOH D 3 .   ? 14.034  14.509  39.246 1.00 36.39 ? 644 HOH A O   1 
HETATM 2194 O O   . HOH D 3 .   ? -5.206  -10.770 39.066 1.00 38.29 ? 646 HOH A O   1 
HETATM 2195 O O   . HOH D 3 .   ? -4.812  -1.530  40.861 1.00 30.51 ? 648 HOH A O   1 
HETATM 2196 O O   . HOH D 3 .   ? 0.534   9.515   11.922 1.00 32.40 ? 649 HOH A O   1 
HETATM 2197 O O   . HOH D 3 .   ? -8.482  3.106   46.212 1.00 43.32 ? 650 HOH A O   1 
HETATM 2198 O O   . HOH D 3 .   ? -1.704  -9.581  47.301 1.00 33.54 ? 652 HOH A O   1 
HETATM 2199 O O   . HOH D 3 .   ? -0.404  3.065   60.164 1.00 40.54 ? 653 HOH A O   1 
HETATM 2200 O O   . HOH D 3 .   ? 23.024  7.454   56.520 1.00 31.86 ? 654 HOH A O   1 
HETATM 2201 O O   . HOH D 3 .   ? -9.769  -1.030  47.216 1.00 24.45 ? 657 HOH A O   1 
HETATM 2202 O O   . HOH D 3 .   ? 3.762   23.318  40.441 1.00 30.27 ? 661 HOH A O   1 
HETATM 2203 O O   . HOH D 3 .   ? -3.909  -11.671 42.044 1.00 28.47 ? 663 HOH A O   1 
HETATM 2204 O O   . HOH D 3 .   ? -12.738 17.132  38.071 1.00 55.73 ? 668 HOH A O   1 
HETATM 2205 O O   . HOH D 3 .   ? -0.948  5.518   20.489 1.00 25.94 ? 669 HOH A O   1 
HETATM 2206 O O   . HOH D 3 .   ? 8.893   21.608  24.687 1.00 36.08 ? 670 HOH A O   1 
HETATM 2207 O O   . HOH D 3 .   ? 15.505  16.524  47.595 1.00 47.60 ? 671 HOH A O   1 
HETATM 2208 O O   . HOH D 3 .   ? 3.777   15.361  55.059 1.00 41.17 ? 672 HOH A O   1 
HETATM 2209 O O   . HOH D 3 .   ? 9.728   21.871  27.654 1.00 42.53 ? 679 HOH A O   1 
HETATM 2210 O O   . HOH D 3 .   ? -8.568  19.252  41.865 1.00 39.79 ? 682 HOH A O   1 
HETATM 2211 O O   . HOH D 3 .   ? 5.067   7.030   60.011 1.00 38.44 ? 685 HOH A O   1 
HETATM 2212 O O   . HOH D 3 .   ? 1.628   24.076  38.655 1.00 40.77 ? 686 HOH A O   1 
HETATM 2213 O O   . HOH D 3 .   ? -6.804  -8.933  41.543 1.00 46.05 ? 687 HOH A O   1 
HETATM 2214 O O   . HOH D 3 .   ? 25.841  -5.492  61.132 1.00 45.14 ? 689 HOH A O   1 
HETATM 2215 O O   . HOH D 3 .   ? 2.801   4.366   62.284 1.00 40.12 ? 690 HOH A O   1 
HETATM 2216 O O   . HOH D 3 .   ? -10.936 12.696  40.300 1.00 45.96 ? 691 HOH A O   1 
HETATM 2217 O O   . HOH D 3 .   ? -2.643  24.475  35.681 1.00 43.57 ? 692 HOH A O   1 
HETATM 2218 O O   . HOH E 3 .   ? 16.093  -27.037 41.549 1.00 30.81 ? 402 HOH B O   1 
HETATM 2219 O O   . HOH E 3 .   ? 13.772  -13.352 22.790 1.00 40.34 ? 407 HOH B O   1 
HETATM 2220 O O   . HOH E 3 .   ? 24.319  -7.313  54.477 1.00 36.20 ? 408 HOH B O   1 
HETATM 2221 O O   . HOH E 3 .   ? 21.449  -1.731  37.396 1.00 11.25 ? 409 HOH B O   1 
HETATM 2222 O O   . HOH E 3 .   ? 20.175  -13.942 55.691 1.00 15.13 ? 411 HOH B O   1 
HETATM 2223 O O   . HOH E 3 .   ? 11.262  16.099  25.093 1.00 17.81 ? 414 HOH B O   1 
HETATM 2224 O O   . HOH E 3 .   ? 12.102  -13.673 58.398 1.00 15.00 ? 417 HOH B O   1 
HETATM 2225 O O   . HOH E 3 .   ? 21.040  0.424   47.962 1.00 16.05 ? 419 HOH B O   1 
HETATM 2226 O O   . HOH E 3 .   ? 27.492  0.183   36.738 1.00 21.78 ? 420 HOH B O   1 
HETATM 2227 O O   . HOH E 3 .   ? 32.249  -15.824 47.950 1.00 37.16 ? 424 HOH B O   1 
HETATM 2228 O O   . HOH E 3 .   ? 33.249  -8.038  39.321 1.00 58.53 ? 425 HOH B O   1 
HETATM 2229 O O   . HOH E 3 .   ? 18.252  -29.020 37.011 1.00 53.32 ? 426 HOH B O   1 
HETATM 2230 O O   . HOH E 3 .   ? 25.084  0.578   35.560 1.00 13.33 ? 428 HOH B O   1 
HETATM 2231 O O   . HOH E 3 .   ? -6.706  1.556   35.677 1.00 34.01 ? 433 HOH B O   1 
HETATM 2232 O O   . HOH E 3 .   ? 28.116  11.045  43.386 1.00 41.78 ? 434 HOH B O   1 
HETATM 2233 O O   . HOH E 3 .   ? 18.110  -13.822 29.929 1.00 22.38 ? 438 HOH B O   1 
HETATM 2234 O O   . HOH E 3 .   ? 28.839  0.576   19.857 1.00 44.72 ? 439 HOH B O   1 
HETATM 2235 O O   . HOH E 3 .   ? 21.150  -22.368 54.248 1.00 10.11 ? 441 HOH B O   1 
HETATM 2236 O O   . HOH E 3 .   ? 19.391  2.926   39.580 1.00 9.10  ? 443 HOH B O   1 
HETATM 2237 O O   . HOH E 3 .   ? 8.928   -9.857  48.089 1.00 14.41 ? 450 HOH B O   1 
HETATM 2238 O O   . HOH E 3 .   ? 10.842  -5.972  48.670 1.00 15.67 ? 452 HOH B O   1 
HETATM 2239 O O   . HOH E 3 .   ? 6.765   -10.720 34.930 1.00 13.92 ? 458 HOH B O   1 
HETATM 2240 O O   . HOH E 3 .   ? 26.431  -13.244 51.421 1.00 14.31 ? 460 HOH B O   1 
HETATM 2241 O O   . HOH E 3 .   ? 3.487   -2.923  26.953 1.00 18.51 ? 461 HOH B O   1 
HETATM 2242 O O   . HOH E 3 .   ? 18.592  -22.160 55.728 1.00 20.26 ? 462 HOH B O   1 
HETATM 2243 O O   . HOH E 3 .   ? 24.161  -12.253 54.484 1.00 15.99 ? 463 HOH B O   1 
HETATM 2244 O O   . HOH E 3 .   ? 16.428  1.220   44.626 1.00 11.61 ? 464 HOH B O   1 
HETATM 2245 O O   . HOH E 3 .   ? 26.018  -5.821  42.573 1.00 16.59 ? 465 HOH B O   1 
HETATM 2246 O O   . HOH E 3 .   ? 27.358  -6.474  35.233 1.00 21.90 ? 466 HOH B O   1 
HETATM 2247 O O   . HOH E 3 .   ? 4.873   -15.592 60.061 1.00 15.23 ? 467 HOH B O   1 
HETATM 2248 O O   . HOH E 3 .   ? 6.835   -11.025 29.179 1.00 12.24 ? 468 HOH B O   1 
HETATM 2249 O O   . HOH E 3 .   ? 13.091  -12.932 34.639 1.00 17.82 ? 470 HOH B O   1 
HETATM 2250 O O   . HOH E 3 .   ? 19.938  -18.625 56.654 1.00 18.79 ? 473 HOH B O   1 
HETATM 2251 O O   . HOH E 3 .   ? 11.687  -3.398  50.212 1.00 18.86 ? 478 HOH B O   1 
HETATM 2252 O O   . HOH E 3 .   ? 10.396  -7.190  25.617 1.00 16.97 ? 482 HOH B O   1 
HETATM 2253 O O   . HOH E 3 .   ? 25.257  -5.815  50.685 1.00 23.38 ? 483 HOH B O   1 
HETATM 2254 O O   . HOH E 3 .   ? 30.212  -10.525 45.318 1.00 16.99 ? 487 HOH B O   1 
HETATM 2255 O O   . HOH E 3 .   ? 13.951  -6.128  49.976 1.00 17.54 ? 491 HOH B O   1 
HETATM 2256 O O   . HOH E 3 .   ? 4.873   -13.366 58.381 1.00 13.27 ? 497 HOH B O   1 
HETATM 2257 O O   . HOH E 3 .   ? 15.742  -26.645 48.507 1.00 27.12 ? 500 HOH B O   1 
HETATM 2258 O O   . HOH E 3 .   ? 33.858  -10.941 43.185 1.00 29.53 ? 501 HOH B O   1 
HETATM 2259 O O   . HOH E 3 .   ? 25.801  3.133   29.033 1.00 21.38 ? 503 HOH B O   1 
HETATM 2260 O O   . HOH E 3 .   ? 2.516   -15.183 55.065 1.00 17.87 ? 504 HOH B O   1 
HETATM 2261 O O   . HOH E 3 .   ? 9.109   -18.642 38.484 1.00 19.06 ? 505 HOH B O   1 
HETATM 2262 O O   . HOH E 3 .   ? 12.017  -10.969 30.264 1.00 22.95 ? 506 HOH B O   1 
HETATM 2263 O O   . HOH E 3 .   ? 7.194   -20.543 42.484 1.00 21.38 ? 508 HOH B O   1 
HETATM 2264 O O   . HOH E 3 .   ? 17.819  -3.788  21.630 1.00 31.70 ? 509 HOH B O   1 
HETATM 2265 O O   . HOH E 3 .   ? -3.301  2.880   38.191 1.00 31.07 ? 511 HOH B O   1 
HETATM 2266 O O   . HOH E 3 .   ? 27.217  0.359   27.909 1.00 31.50 ? 515 HOH B O   1 
HETATM 2267 O O   . HOH E 3 .   ? 25.651  -2.563  43.973 1.00 23.81 ? 524 HOH B O   1 
HETATM 2268 O O   . HOH E 3 .   ? 1.104   -7.575  35.496 1.00 10.78 ? 525 HOH B O   1 
HETATM 2269 O O   . HOH E 3 .   ? 21.204  4.780   40.474 1.00 18.25 ? 526 HOH B O   1 
HETATM 2270 O O   . HOH E 3 .   ? -7.187  9.819   34.852 1.00 16.64 ? 529 HOH B O   1 
HETATM 2271 O O   . HOH E 3 .   ? 25.270  -9.036  25.615 1.00 29.39 ? 533 HOH B O   1 
HETATM 2272 O O   . HOH E 3 .   ? 14.592  -1.625  24.289 1.00 20.67 ? 534 HOH B O   1 
HETATM 2273 O O   . HOH E 3 .   ? 23.589  -19.473 47.834 1.00 13.73 ? 535 HOH B O   1 
HETATM 2274 O O   . HOH E 3 .   ? 22.550  -20.592 50.018 1.00 13.02 ? 536 HOH B O   1 
HETATM 2275 O O   . HOH E 3 .   ? 21.823  -19.648 53.714 1.00 13.86 ? 537 HOH B O   1 
HETATM 2276 O O   . HOH E 3 .   ? 23.927  -19.626 52.195 1.00 14.44 ? 538 HOH B O   1 
HETATM 2277 O O   . HOH E 3 .   ? 26.025  -18.145 51.213 1.00 18.93 ? 539 HOH B O   1 
HETATM 2278 O O   . HOH E 3 .   ? 25.984  -18.408 48.444 1.00 17.87 ? 540 HOH B O   1 
HETATM 2279 O O   . HOH E 3 .   ? 11.856  -11.173 58.745 1.00 29.86 ? 541 HOH B O   1 
HETATM 2280 O O   . HOH E 3 .   ? 3.255   -13.637 48.819 1.00 28.55 ? 545 HOH B O   1 
HETATM 2281 O O   . HOH E 3 .   ? 5.062   -13.062 47.190 1.00 21.95 ? 546 HOH B O   1 
HETATM 2282 O O   . HOH E 3 .   ? 11.515  -10.948 32.809 1.00 21.12 ? 550 HOH B O   1 
HETATM 2283 O O   . HOH E 3 .   ? 17.104  -0.463  23.587 1.00 25.54 ? 551 HOH B O   1 
HETATM 2284 O O   . HOH E 3 .   ? 1.084   -13.215 35.184 1.00 9.29  ? 552 HOH B O   1 
HETATM 2285 O O   . HOH E 3 .   ? 18.543  -20.456 39.813 1.00 15.29 ? 553 HOH B O   1 
HETATM 2286 O O   . HOH E 3 .   ? 16.036  -19.583 57.901 1.00 17.28 ? 557 HOH B O   1 
HETATM 2287 O O   . HOH E 3 .   ? -0.680  -1.678  35.348 1.00 22.57 ? 560 HOH B O   1 
HETATM 2288 O O   . HOH E 3 .   ? 10.545  -9.467  28.655 1.00 19.48 ? 567 HOH B O   1 
HETATM 2289 O O   . HOH E 3 .   ? 24.448  -11.912 31.454 1.00 20.59 ? 568 HOH B O   1 
HETATM 2290 O O   . HOH E 3 .   ? 18.922  -1.830  51.264 1.00 23.79 ? 569 HOH B O   1 
HETATM 2291 O O   . HOH E 3 .   ? 16.919  3.305   22.963 1.00 36.37 ? 571 HOH B O   1 
HETATM 2292 O O   . HOH E 3 .   ? 28.927  -19.436 50.997 1.00 37.76 ? 573 HOH B O   1 
HETATM 2293 O O   . HOH E 3 .   ? 16.757  -20.199 37.927 1.00 22.79 ? 574 HOH B O   1 
HETATM 2294 O O   . HOH E 3 .   ? 23.026  4.863   38.780 1.00 28.68 ? 578 HOH B O   1 
HETATM 2295 O O   . HOH E 3 .   ? 30.406  -8.340  37.923 1.00 26.93 ? 581 HOH B O   1 
HETATM 2296 O O   . HOH E 3 .   ? 6.011   -10.900 58.278 1.00 29.19 ? 582 HOH B O   1 
HETATM 2297 O O   . HOH E 3 .   ? 23.043  -14.220 31.060 1.00 27.99 ? 584 HOH B O   1 
HETATM 2298 O O   . HOH E 3 .   ? 7.811   -12.110 48.258 1.00 22.43 ? 586 HOH B O   1 
HETATM 2299 O O   . HOH E 3 .   ? 28.903  -1.588  37.795 1.00 31.73 ? 592 HOH B O   1 
HETATM 2300 O O   . HOH E 3 .   ? 10.302  -26.622 46.333 1.00 46.48 ? 595 HOH B O   1 
HETATM 2301 O O   . HOH E 3 .   ? 12.012  7.021   54.649 1.00 34.83 ? 596 HOH B O   1 
HETATM 2302 O O   . HOH E 3 .   ? 24.662  12.146  25.701 1.00 29.48 ? 597 HOH B O   1 
HETATM 2303 O O   . HOH E 3 .   ? 17.334  -14.975 59.279 1.00 37.02 ? 598 HOH B O   1 
HETATM 2304 O O   . HOH E 3 .   ? 19.266  -19.407 35.725 1.00 51.78 ? 599 HOH B O   1 
HETATM 2305 O O   . HOH E 3 .   ? 20.420  -16.233 57.253 1.00 38.04 ? 601 HOH B O   1 
HETATM 2306 O O   . HOH E 3 .   ? 10.386  -4.678  24.314 1.00 47.70 ? 603 HOH B O   1 
HETATM 2307 O O   . HOH E 3 .   ? 28.112  -16.778 48.109 1.00 42.79 ? 604 HOH B O   1 
HETATM 2308 O O   . HOH E 3 .   ? 24.635  2.971   26.512 1.00 34.40 ? 610 HOH B O   1 
HETATM 2309 O O   . HOH E 3 .   ? 28.327  -1.667  40.471 1.00 49.76 ? 611 HOH B O   1 
HETATM 2310 O O   . HOH E 3 .   ? 27.833  -8.054  50.686 1.00 31.30 ? 612 HOH B O   1 
HETATM 2311 O O   . HOH E 3 .   ? 5.168   -27.540 52.351 1.00 49.68 ? 614 HOH B O   1 
HETATM 2312 O O   . HOH E 3 .   ? 8.645   -23.464 45.669 1.00 33.20 ? 615 HOH B O   1 
HETATM 2313 O O   . HOH E 3 .   ? 23.705  14.821  29.692 1.00 36.28 ? 616 HOH B O   1 
HETATM 2314 O O   . HOH E 3 .   ? 0.664   -1.325  31.460 1.00 29.08 ? 621 HOH B O   1 
HETATM 2315 O O   . HOH E 3 .   ? 26.902  -6.932  53.132 1.00 33.87 ? 622 HOH B O   1 
HETATM 2316 O O   . HOH E 3 .   ? 28.110  -20.263 41.718 1.00 33.30 ? 624 HOH B O   1 
HETATM 2317 O O   . HOH E 3 .   ? 28.104  -17.017 38.236 1.00 26.00 ? 626 HOH B O   1 
HETATM 2318 O O   . HOH E 3 .   ? 13.901  -6.411  25.505 1.00 30.73 ? 627 HOH B O   1 
HETATM 2319 O O   . HOH E 3 .   ? 13.709  -14.913 60.220 1.00 31.91 ? 628 HOH B O   1 
HETATM 2320 O O   . HOH E 3 .   ? 24.889  3.251   48.470 1.00 28.21 ? 630 HOH B O   1 
HETATM 2321 O O   . HOH E 3 .   ? 18.197  -1.090  21.457 1.00 35.04 ? 632 HOH B O   1 
HETATM 2322 O O   . HOH E 3 .   ? 28.122  -4.672  40.954 1.00 34.69 ? 633 HOH B O   1 
HETATM 2323 O O   . HOH E 3 .   ? 31.657  -10.185 31.681 1.00 43.43 ? 634 HOH B O   1 
HETATM 2324 O O   . HOH E 3 .   ? 26.756  1.790   38.894 1.00 28.50 ? 637 HOH B O   1 
HETATM 2325 O O   . HOH E 3 .   ? 9.128   -19.547 57.778 1.00 29.41 ? 639 HOH B O   1 
HETATM 2326 O O   . HOH E 3 .   ? 22.139  -29.340 35.183 1.00 52.12 ? 640 HOH B O   1 
HETATM 2327 O O   . HOH E 3 .   ? 11.383  19.267  24.630 1.00 43.10 ? 642 HOH B O   1 
HETATM 2328 O O   . HOH E 3 .   ? 20.218  -10.460 20.953 1.00 40.52 ? 645 HOH B O   1 
HETATM 2329 O O   . HOH E 3 .   ? 24.184  6.150   26.129 1.00 54.75 ? 647 HOH B O   1 
HETATM 2330 O O   . HOH E 3 .   ? 18.333  -20.442 57.582 1.00 44.30 ? 651 HOH B O   1 
HETATM 2331 O O   . HOH E 3 .   ? 22.906  14.081  26.491 1.00 31.99 ? 655 HOH B O   1 
HETATM 2332 O O   . HOH E 3 .   ? 6.463   -12.614 31.206 1.00 38.33 ? 656 HOH B O   1 
HETATM 2333 O O   . HOH E 3 .   ? 23.011  0.427   20.278 1.00 48.12 ? 658 HOH B O   1 
HETATM 2334 O O   . HOH E 3 .   ? 4.138   -19.431 50.983 1.00 39.42 ? 659 HOH B O   1 
HETATM 2335 O O   . HOH E 3 .   ? 20.967  -1.202  53.089 1.00 49.67 ? 660 HOH B O   1 
HETATM 2336 O O   . HOH E 3 .   ? 14.074  -20.730 59.539 1.00 38.05 ? 662 HOH B O   1 
HETATM 2337 O O   . HOH E 3 .   ? 21.664  -20.255 39.045 1.00 34.54 ? 664 HOH B O   1 
HETATM 2338 O O   . HOH E 3 .   ? 26.140  -9.275  28.669 1.00 39.63 ? 665 HOH B O   1 
HETATM 2339 O O   . HOH E 3 .   ? 26.777  11.580  32.568 1.00 38.25 ? 666 HOH B O   1 
HETATM 2340 O O   . HOH E 3 .   ? 19.892  -13.676 27.663 1.00 45.71 ? 667 HOH B O   1 
HETATM 2341 O O   . HOH E 3 .   ? 17.982  3.060   20.325 1.00 45.94 ? 673 HOH B O   1 
HETATM 2342 O O   . HOH E 3 .   ? 13.632  7.435   56.974 1.00 39.98 ? 674 HOH B O   1 
HETATM 2343 O O   . HOH E 3 .   ? 23.428  0.439   51.901 1.00 48.78 ? 675 HOH B O   1 
HETATM 2344 O O   . HOH E 3 .   ? 8.994   -2.310  24.793 1.00 39.41 ? 676 HOH B O   1 
HETATM 2345 O O   . HOH E 3 .   ? 13.741  -17.684 60.312 1.00 42.78 ? 677 HOH B O   1 
HETATM 2346 O O   . HOH E 3 .   ? 3.923   -15.393 45.945 1.00 40.83 ? 678 HOH B O   1 
HETATM 2347 O O   . HOH E 3 .   ? 5.440   -1.921  25.422 1.00 44.94 ? 680 HOH B O   1 
HETATM 2348 O O   . HOH E 3 .   ? 29.993  -20.254 48.327 1.00 40.90 ? 681 HOH B O   1 
HETATM 2349 O O   . HOH E 3 .   ? 30.492  -7.298  46.318 1.00 37.50 ? 683 HOH B O   1 
HETATM 2350 O O   . HOH E 3 .   ? 32.821  -14.374 44.919 1.00 41.42 ? 684 HOH B O   1 
HETATM 2351 O O   . HOH E 3 .   ? 27.075  4.891   44.800 1.00 41.13 ? 688 HOH B O   1 
HETATM 2352 O O   . HOH E 3 .   ? 8.718   -27.258 43.728 1.00 42.65 ? 693 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   2   SER SER A . n 
A 1 3   ALA 3   3   3   ALA ALA A . n 
A 1 4   ARG 4   4   4   ARG ARG A . n 
A 1 5   ILE 5   5   5   ILE ILE A . n 
A 1 6   SER 6   6   6   SER SER A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ALA 9   9   9   ALA ALA A . n 
A 1 10  VAL 10  10  10  VAL VAL A . n 
A 1 11  VAL 11  11  11  VAL VAL A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  GLU 13  13  13  GLU GLU A . n 
A 1 14  ASP 14  14  14  ASP ASP A . n 
A 1 15  MET 15  15  15  MET MET A . n 
A 1 16  ALA 16  16  16  ALA ALA A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  SER 18  18  18  SER SER A . n 
A 1 19  LEU 19  19  19  LEU LEU A . n 
A 1 20  GLU 20  20  20  GLU GLU A . n 
A 1 21  PHE 21  21  21  PHE PHE A . n 
A 1 22  TYR 22  22  22  TYR TYR A . n 
A 1 23  ARG 23  23  23  ARG ARG A . n 
A 1 24  LYS 24  24  24  LYS LYS A . n 
A 1 25  LEU 25  25  25  LEU LEU A . n 
A 1 26  GLY 26  26  26  GLY GLY A . n 
A 1 27  VAL 27  27  27  VAL VAL A . n 
A 1 28  GLU 28  28  28  GLU GLU A . n 
A 1 29  ILE 29  29  29  ILE ILE A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  ALA 31  31  31  ALA ALA A . n 
A 1 32  GLU 32  32  32  GLU GLU A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  ASP 34  34  34  ASP ASP A . n 
A 1 35  SER 35  35  35  SER SER A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  PRO 37  37  37  PRO PRO A . n 
A 1 38  HIS 38  38  38  HIS HIS A . n 
A 1 39  THR 39  39  39  THR THR A . n 
A 1 40  GLU 40  40  40  GLU GLU A . n 
A 1 41  ALA 41  41  41  ALA ALA A . n 
A 1 42  VAL 42  42  42  VAL VAL A . n 
A 1 43  LEU 43  43  43  LEU LEU A . n 
A 1 44  ASP 44  44  44  ASP ASP A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  GLY 46  46  46  GLY GLY A . n 
A 1 47  ILE 47  47  47  ILE ILE A . n 
A 1 48  ARG 48  48  48  ARG ARG A . n 
A 1 49  LEU 49  49  49  LEU LEU A . n 
A 1 50  ALA 50  50  50  ALA ALA A . n 
A 1 51  TRP 51  51  51  TRP TRP A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  THR 53  53  53  THR THR A . n 
A 1 54  VAL 54  54  54  VAL VAL A . n 
A 1 55  GLU 55  55  55  GLU GLU A . n 
A 1 56  THR 56  56  56  THR THR A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  ARG 58  58  58  ARG ARG A . n 
A 1 59  SER 59  59  59  SER SER A . n 
A 1 60  TYR 60  60  60  TYR TYR A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  PRO 62  62  62  PRO PRO A . n 
A 1 63  GLU 63  63  63  GLU GLU A . n 
A 1 64  TRP 64  64  64  TRP TRP A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ALA 66  66  66  ALA ALA A . n 
A 1 67  PRO 67  67  67  PRO PRO A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  GLY 69  69  69  GLY GLY A . n 
A 1 70  GLY 70  70  70  GLY GLY A . n 
A 1 71  HIS 71  71  71  HIS HIS A . n 
A 1 72  ARG 72  72  72  ARG ARG A . n 
A 1 73  PHE 73  73  73  PHE PHE A . n 
A 1 74  ALA 74  74  74  ALA ALA A . n 
A 1 75  ILE 75  75  75  ILE ILE A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  PHE 77  77  77  PHE PHE A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  PHE 79  79  79  PHE PHE A . n 
A 1 80  PRO 80  80  80  PRO PRO A . n 
A 1 81  ASP 81  81  81  ASP ASP A . n 
A 1 82  THR 82  82  82  THR THR A . n 
A 1 83  ALA 83  83  83  ALA ALA A . n 
A 1 84  SER 84  84  84  SER SER A . n 
A 1 85  VAL 85  85  85  VAL VAL A . n 
A 1 86  ASP 86  86  86  ASP ASP A . n 
A 1 87  LYS 87  87  87  LYS LYS A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  TYR 89  89  89  TYR TYR A . n 
A 1 90  ALA 90  90  90  ALA ALA A . n 
A 1 91  GLU 91  91  91  GLU GLU A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  VAL 93  93  93  VAL VAL A . n 
A 1 94  ASP 94  94  94  ASP ASP A . n 
A 1 95  ALA 95  95  95  ALA ALA A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  TYR 97  97  97  TYR TYR A . n 
A 1 98  GLU 98  98  98  GLU GLU A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 HIS 100 100 100 HIS HIS A . n 
A 1 101 LEU 101 101 101 LEU LEU A . n 
A 1 102 LYS 102 102 102 LYS LYS A . n 
A 1 103 PRO 103 103 103 PRO PRO A . n 
A 1 104 TRP 104 104 104 TRP TRP A . n 
A 1 105 ASN 105 105 105 ASN ASN A . n 
A 1 106 ALA 106 106 106 ALA ALA A . n 
A 1 107 VAL 107 107 107 VAL VAL A . n 
A 1 108 TRP 108 108 108 TRP TRP A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 GLN 110 110 110 GLN GLN A . n 
A 1 111 ARG 111 111 111 ARG ARG A . n 
A 1 112 TYR 112 112 112 TYR TYR A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 VAL 115 115 115 VAL VAL A . n 
A 1 116 LYS 116 116 116 LYS LYS A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 PRO 118 118 118 PRO PRO A . n 
A 1 119 ASP 119 119 119 ASP ASP A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 ASN 121 121 121 ASN ASN A . n 
A 1 122 VAL 122 122 122 VAL VAL A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 LEU 125 125 125 LEU LEU A . n 
A 1 126 PHE 126 126 126 PHE PHE A . n 
A 1 127 ALA 127 127 127 ALA ALA A . n 
A 1 128 PRO 128 128 128 PRO PRO A . n 
A 1 129 LEU 129 129 129 LEU LEU A . n 
A 1 130 PRO 130 130 130 PRO PRO A . n 
A 1 131 LEU 131 131 131 LEU LEU A . n 
A 1 132 GLU 132 132 132 GLU GLU A . n 
A 1 133 HIS 133 133 ?   ?   ?   A . n 
A 1 134 HIS 134 134 ?   ?   ?   A . n 
A 1 135 HIS 135 135 ?   ?   ?   A . n 
A 1 136 HIS 136 136 ?   ?   ?   A . n 
A 1 137 HIS 137 137 ?   ?   ?   A . n 
A 1 138 HIS 138 138 ?   ?   ?   A . n 
B 1 1   MET 1   201 ?   ?   ?   B . n 
B 1 2   SER 2   202 202 SER SER B . n 
B 1 3   ALA 3   203 203 ALA ALA B . n 
B 1 4   ARG 4   204 204 ARG ARG B . n 
B 1 5   ILE 5   205 205 ILE ILE B . n 
B 1 6   SER 6   206 206 SER SER B . n 
B 1 7   LEU 7   207 207 LEU LEU B . n 
B 1 8   PHE 8   208 208 PHE PHE B . n 
B 1 9   ALA 9   209 209 ALA ALA B . n 
B 1 10  VAL 10  210 210 VAL VAL B . n 
B 1 11  VAL 11  211 211 VAL VAL B . n 
B 1 12  VAL 12  212 212 VAL VAL B . n 
B 1 13  GLU 13  213 213 GLU GLU B . n 
B 1 14  ASP 14  214 214 ASP ASP B . n 
B 1 15  MET 15  215 215 MET MET B . n 
B 1 16  ALA 16  216 216 ALA ALA B . n 
B 1 17  LYS 17  217 217 LYS LYS B . n 
B 1 18  SER 18  218 218 SER SER B . n 
B 1 19  LEU 19  219 219 LEU LEU B . n 
B 1 20  GLU 20  220 220 GLU GLU B . n 
B 1 21  PHE 21  221 221 PHE PHE B . n 
B 1 22  TYR 22  222 222 TYR TYR B . n 
B 1 23  ARG 23  223 223 ARG ARG B . n 
B 1 24  LYS 24  224 224 LYS LYS B . n 
B 1 25  LEU 25  225 225 LEU LEU B . n 
B 1 26  GLY 26  226 226 GLY GLY B . n 
B 1 27  VAL 27  227 227 VAL VAL B . n 
B 1 28  GLU 28  228 228 GLU GLU B . n 
B 1 29  ILE 29  229 229 ILE ILE B . n 
B 1 30  PRO 30  230 230 PRO PRO B . n 
B 1 31  ALA 31  231 231 ALA ALA B . n 
B 1 32  GLU 32  232 232 GLU GLU B . n 
B 1 33  ALA 33  233 233 ALA ALA B . n 
B 1 34  ASP 34  234 234 ASP ASP B . n 
B 1 35  SER 35  235 235 SER SER B . n 
B 1 36  ALA 36  236 236 ALA ALA B . n 
B 1 37  PRO 37  237 237 PRO PRO B . n 
B 1 38  HIS 38  238 238 HIS HIS B . n 
B 1 39  THR 39  239 239 THR THR B . n 
B 1 40  GLU 40  240 240 GLU GLU B . n 
B 1 41  ALA 41  241 241 ALA ALA B . n 
B 1 42  VAL 42  242 242 VAL VAL B . n 
B 1 43  LEU 43  243 243 LEU LEU B . n 
B 1 44  ASP 44  244 244 ASP ASP B . n 
B 1 45  GLY 45  245 245 GLY GLY B . n 
B 1 46  GLY 46  246 246 GLY GLY B . n 
B 1 47  ILE 47  247 247 ILE ILE B . n 
B 1 48  ARG 48  248 248 ARG ARG B . n 
B 1 49  LEU 49  249 249 LEU LEU B . n 
B 1 50  ALA 50  250 250 ALA ALA B . n 
B 1 51  TRP 51  251 251 TRP TRP B . n 
B 1 52  ASP 52  252 252 ASP ASP B . n 
B 1 53  THR 53  253 253 THR THR B . n 
B 1 54  VAL 54  254 254 VAL VAL B . n 
B 1 55  GLU 55  255 255 GLU GLU B . n 
B 1 56  THR 56  256 256 THR THR B . n 
B 1 57  VAL 57  257 257 VAL VAL B . n 
B 1 58  ARG 58  258 258 ARG ARG B . n 
B 1 59  SER 59  259 259 SER SER B . n 
B 1 60  TYR 60  260 260 TYR TYR B . n 
B 1 61  ASP 61  261 261 ASP ASP B . n 
B 1 62  PRO 62  262 262 PRO PRO B . n 
B 1 63  GLU 63  263 263 GLU GLU B . n 
B 1 64  TRP 64  264 264 TRP TRP B . n 
B 1 65  GLN 65  265 265 GLN GLN B . n 
B 1 66  ALA 66  266 266 ALA ALA B . n 
B 1 67  PRO 67  267 267 PRO PRO B . n 
B 1 68  THR 68  268 268 THR THR B . n 
B 1 69  GLY 69  269 269 GLY GLY B . n 
B 1 70  GLY 70  270 270 GLY GLY B . n 
B 1 71  HIS 71  271 271 HIS HIS B . n 
B 1 72  ARG 72  272 272 ARG ARG B . n 
B 1 73  PHE 73  273 273 PHE PHE B . n 
B 1 74  ALA 74  274 274 ALA ALA B . n 
B 1 75  ILE 75  275 275 ILE ILE B . n 
B 1 76  ALA 76  276 276 ALA ALA B . n 
B 1 77  PHE 77  277 277 PHE PHE B . n 
B 1 78  GLU 78  278 278 GLU GLU B . n 
B 1 79  PHE 79  279 279 PHE PHE B . n 
B 1 80  PRO 80  280 280 PRO PRO B . n 
B 1 81  ASP 81  281 281 ASP ASP B . n 
B 1 82  THR 82  282 282 THR THR B . n 
B 1 83  ALA 83  283 283 ALA ALA B . n 
B 1 84  SER 84  284 284 SER SER B . n 
B 1 85  VAL 85  285 285 VAL VAL B . n 
B 1 86  ASP 86  286 286 ASP ASP B . n 
B 1 87  LYS 87  287 287 LYS LYS B . n 
B 1 88  LYS 88  288 288 LYS LYS B . n 
B 1 89  TYR 89  289 289 TYR TYR B . n 
B 1 90  ALA 90  290 290 ALA ALA B . n 
B 1 91  GLU 91  291 291 GLU GLU B . n 
B 1 92  LEU 92  292 292 LEU LEU B . n 
B 1 93  VAL 93  293 293 VAL VAL B . n 
B 1 94  ASP 94  294 294 ASP ASP B . n 
B 1 95  ALA 95  295 295 ALA ALA B . n 
B 1 96  GLY 96  296 296 GLY GLY B . n 
B 1 97  TYR 97  297 297 TYR TYR B . n 
B 1 98  GLU 98  298 298 GLU GLU B . n 
B 1 99  GLY 99  299 299 GLY GLY B . n 
B 1 100 HIS 100 300 300 HIS HIS B . n 
B 1 101 LEU 101 301 301 LEU LEU B . n 
B 1 102 LYS 102 302 302 LYS LYS B . n 
B 1 103 PRO 103 303 303 PRO PRO B . n 
B 1 104 TRP 104 304 304 TRP TRP B . n 
B 1 105 ASN 105 305 305 ASN ASN B . n 
B 1 106 ALA 106 306 306 ALA ALA B . n 
B 1 107 VAL 107 307 307 VAL VAL B . n 
B 1 108 TRP 108 308 308 TRP TRP B . n 
B 1 109 GLY 109 309 309 GLY GLY B . n 
B 1 110 GLN 110 310 310 GLN GLN B . n 
B 1 111 ARG 111 311 311 ARG ARG B . n 
B 1 112 TYR 112 312 312 TYR TYR B . n 
B 1 113 ALA 113 313 313 ALA ALA B . n 
B 1 114 ILE 114 314 314 ILE ILE B . n 
B 1 115 VAL 115 315 315 VAL VAL B . n 
B 1 116 LYS 116 316 316 LYS LYS B . n 
B 1 117 ASP 117 317 317 ASP ASP B . n 
B 1 118 PRO 118 318 318 PRO PRO B . n 
B 1 119 ASP 119 319 319 ASP ASP B . n 
B 1 120 GLY 120 320 320 GLY GLY B . n 
B 1 121 ASN 121 321 321 ASN ASN B . n 
B 1 122 VAL 122 322 322 VAL VAL B . n 
B 1 123 VAL 123 323 323 VAL VAL B . n 
B 1 124 ASP 124 324 324 ASP ASP B . n 
B 1 125 LEU 125 325 325 LEU LEU B . n 
B 1 126 PHE 126 326 326 PHE PHE B . n 
B 1 127 ALA 127 327 327 ALA ALA B . n 
B 1 128 PRO 128 328 328 PRO PRO B . n 
B 1 129 LEU 129 329 329 LEU LEU B . n 
B 1 130 PRO 130 330 ?   ?   ?   B . n 
B 1 131 LEU 131 331 ?   ?   ?   B . n 
B 1 132 GLU 132 332 ?   ?   ?   B . n 
B 1 133 HIS 133 333 ?   ?   ?   B . n 
B 1 134 HIS 134 334 ?   ?   ?   B . n 
B 1 135 HIS 135 335 ?   ?   ?   B . n 
B 1 136 HIS 136 336 ?   ?   ?   B . n 
B 1 137 HIS 137 337 ?   ?   ?   B . n 
B 1 138 HIS 138 338 ?   ?   ?   B . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          'NPPSFA, National Project on Protein Structural and Functional Analyses' 
_pdbx_SG_project.full_name_of_center   ? 
_pdbx_SG_project.initial_of_center     ? 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5150  ? 
1 MORE         -29   ? 
1 'SSA (A^2)'  11750 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-18 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
X-PLOR    refinement       3.851 ? 1 
HKL-2000  'data reduction' .     ? 2 
SCALEPACK 'data scaling'   .     ? 3 
AMoRE     phasing          .     ? 4 
CNS       refinement       .     ? 5 
# 
_pdbx_entry_details.entry_id             2A4X 
_pdbx_entry_details.sequence_details     
;A SEQUENCE DATABASE REFERENCE FOR THIS PROTEIN
WHICH DERIVES FROM STREPTOMYCES CAESPITOSUS
DOES NOT CURRENTLY EXIST.
THE 8 C-TERMINAL RESIDUES WERE HIS TAGS.
;
_pdbx_entry_details.compound_details     ? 
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_1              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CB 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_2              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             CG 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             LEU 
_pdbx_validate_rmsd_angle.auth_seq_id_3              7 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                131.38 
_pdbx_validate_rmsd_angle.angle_target_value         115.30 
_pdbx_validate_rmsd_angle.angle_deviation            16.08 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASP B 261 ? ? -171.81 70.45  
2 1 TRP B 264 ? ? -27.03  127.57 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 N 1 A BLM 700 ? NA  ? C BLM 1 NA  
2  1 N 1 A BLM 700 ? C2  ? C BLM 1 C2  
3  1 N 1 A BLM 700 ? C1  ? C BLM 1 C1  
4  1 N 1 A BLM 700 ? O1  ? C BLM 1 O1  
5  1 N 1 A BLM 700 ? NC  ? C BLM 1 NC  
6  1 N 1 A BLM 700 ? C3  ? C BLM 1 C3  
7  1 N 1 A BLM 700 ? NB  ? C BLM 1 NB  
8  1 N 1 A BLM 700 ? ND  ? C BLM 1 ND  
9  1 N 1 A BLM 700 ? C5  ? C BLM 1 C5  
10 1 N 1 A BLM 700 ? C4  ? C BLM 1 C4  
11 1 N 1 A BLM 700 ? O4  ? C BLM 1 O4  
12 1 N 1 A BLM 700 ? C8  ? C BLM 1 C8  
13 1 N 1 A BLM 700 ? C9  ? C BLM 1 C9  
14 1 N 1 A BLM 700 ? C10 ? C BLM 1 C10 
15 1 N 1 A BLM 700 ? NG  ? C BLM 1 NG  
16 1 N 1 A BLM 700 ? C7  ? C BLM 1 C7  
17 1 N 1 A BLM 700 ? NE  ? C BLM 1 NE  
18 1 N 1 A BLM 700 ? C6  ? C BLM 1 C6  
19 1 N 1 A BLM 700 ? NF  ? C BLM 1 NF  
20 1 N 1 A BLM 700 ? CA  ? C BLM 1 CA  
21 1 N 1 A BLM 700 ? C12 ? C BLM 1 C12 
22 1 N 1 A BLM 700 ? O12 ? C BLM 1 O12 
23 1 N 1 A BLM 700 ? NH  ? C BLM 1 NH  
24 1 N 1 A BLM 700 ? C13 ? C BLM 1 C13 
25 1 N 1 A BLM 700 ? C30 ? C BLM 1 C30 
26 1 N 1 A BLM 700 ? O30 ? C BLM 1 O30 
27 1 N 1 A BLM 700 ? C14 ? C BLM 1 C14 
28 1 N 1 A BLM 700 ? C27 ? C BLM 1 C27 
29 1 N 1 A BLM 700 ? OH1 ? C BLM 1 OH1 
30 1 N 1 A BLM 700 ? NJ  ? C BLM 1 NJ  
31 1 N 1 A BLM 700 ? C28 ? C BLM 1 C28 
32 1 N 1 A BLM 700 ? C29 ? C BLM 1 C29 
33 1 N 1 A BLM 700 ? NI  ? C BLM 1 NI  
34 1 N 1 A BLM 700 ? NK  ? C BLM 1 NK  
35 1 N 1 A BLM 700 ? C34 ? C BLM 1 C34 
36 1 N 1 A BLM 700 ? C36 ? C BLM 1 C36 
37 1 N 1 A BLM 700 ? O36 ? C BLM 1 O36 
38 1 N 1 A BLM 700 ? OH2 ? C BLM 1 OH2 
39 1 N 1 A BLM 700 ? C31 ? C BLM 1 C31 
40 1 N 1 A BLM 700 ? CB  ? C BLM 1 CB  
41 1 N 1 A BLM 700 ? C33 ? C BLM 1 C33 
42 1 N 1 A BLM 700 ? CC  ? C BLM 1 CC  
43 1 N 1 A BLM 700 ? O59 ? C BLM 1 O59 
44 1 N 1 A BLM 700 ? O58 ? C BLM 1 O58 
45 1 N 1 A BLM 700 ? C61 ? C BLM 1 C61 
46 1 N 1 A BLM 700 ? O61 ? C BLM 1 O61 
47 1 N 1 A BLM 700 ? O56 ? C BLM 1 O56 
48 1 N 1 A BLM 700 ? C60 ? C BLM 1 C60 
49 1 N 1 A BLM 700 ? O62 ? C BLM 1 O62 
50 1 N 1 A BLM 700 ? C63 ? C BLM 1 C63 
51 1 N 1 A BLM 700 ? C57 ? C BLM 1 C57 
52 1 N 1 A BLM 700 ? C58 ? C BLM 1 C58 
53 1 N 1 A BLM 700 ? C59 ? C BLM 1 C59 
54 1 N 1 A BLM 700 ? C69 ? C BLM 1 C69 
55 1 N 1 A BLM 700 ? C68 ? C BLM 1 C68 
56 1 N 1 A BLM 700 ? C67 ? C BLM 1 C67 
57 1 N 1 A BLM 700 ? C65 ? C BLM 1 C65 
58 1 N 1 A BLM 700 ? O64 ? C BLM 1 O64 
59 1 N 1 A BLM 700 ? C64 ? C BLM 1 C64 
60 1 N 1 A BLM 700 ? O68 ? C BLM 1 O68 
61 1 N 1 A BLM 700 ? O67 ? C BLM 1 O67 
62 1 N 1 A BLM 700 ? O69 ? C BLM 1 O69 
63 1 N 1 A BLM 700 ? NQ  ? C BLM 1 NQ  
64 1 N 1 A BLM 700 ? C70 ? C BLM 1 C70 
65 1 N 1 A BLM 700 ? O70 ? C BLM 1 O70 
66 1 N 1 A BLM 700 ? O66 ? C BLM 1 O66 
67 1 N 1 A BLM 700 ? C66 ? C BLM 1 C66 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A HIS 133 ? A HIS 133 
3  1 Y 1 A HIS 134 ? A HIS 134 
4  1 Y 1 A HIS 135 ? A HIS 135 
5  1 Y 1 A HIS 136 ? A HIS 136 
6  1 Y 1 A HIS 137 ? A HIS 137 
7  1 Y 1 A HIS 138 ? A HIS 138 
8  1 Y 1 B MET 201 ? B MET 1   
9  1 Y 1 B PRO 330 ? B PRO 130 
10 1 Y 1 B LEU 331 ? B LEU 131 
11 1 Y 1 B GLU 332 ? B GLU 132 
12 1 Y 1 B HIS 333 ? B HIS 133 
13 1 Y 1 B HIS 334 ? B HIS 134 
14 1 Y 1 B HIS 335 ? B HIS 135 
15 1 Y 1 B HIS 336 ? B HIS 136 
16 1 Y 1 B HIS 337 ? B HIS 137 
17 1 Y 1 B HIS 338 ? B HIS 138 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'BLEOMYCIN A2' BLM 
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 BLM 1   700 700 BLM BM2 A . 
D 3 HOH 1   401 401 HOH HOH A . 
D 3 HOH 2   403 403 HOH HOH A . 
D 3 HOH 3   404 404 HOH HOH A . 
D 3 HOH 4   405 405 HOH HOH A . 
D 3 HOH 5   406 406 HOH HOH A . 
D 3 HOH 6   410 410 HOH HOH A . 
D 3 HOH 7   412 412 HOH HOH A . 
D 3 HOH 8   413 413 HOH HOH A . 
D 3 HOH 9   415 415 HOH HOH A . 
D 3 HOH 10  416 416 HOH HOH A . 
D 3 HOH 11  418 418 HOH HOH A . 
D 3 HOH 12  421 421 HOH HOH A . 
D 3 HOH 13  422 422 HOH HOH A . 
D 3 HOH 14  423 423 HOH HOH A . 
D 3 HOH 15  427 427 HOH HOH A . 
D 3 HOH 16  429 429 HOH HOH A . 
D 3 HOH 17  430 430 HOH HOH A . 
D 3 HOH 18  431 431 HOH HOH A . 
D 3 HOH 19  432 432 HOH HOH A . 
D 3 HOH 20  435 435 HOH HOH A . 
D 3 HOH 21  436 436 HOH HOH A . 
D 3 HOH 22  437 437 HOH HOH A . 
D 3 HOH 23  440 440 HOH HOH A . 
D 3 HOH 24  442 442 HOH HOH A . 
D 3 HOH 25  444 444 HOH HOH A . 
D 3 HOH 26  445 445 HOH HOH A . 
D 3 HOH 27  446 446 HOH HOH A . 
D 3 HOH 28  447 447 HOH HOH A . 
D 3 HOH 29  448 448 HOH HOH A . 
D 3 HOH 30  449 449 HOH HOH A . 
D 3 HOH 31  451 451 HOH HOH A . 
D 3 HOH 32  453 453 HOH HOH A . 
D 3 HOH 33  454 454 HOH HOH A . 
D 3 HOH 34  455 455 HOH HOH A . 
D 3 HOH 35  456 456 HOH HOH A . 
D 3 HOH 36  457 457 HOH HOH A . 
D 3 HOH 37  459 459 HOH HOH A . 
D 3 HOH 38  469 469 HOH HOH A . 
D 3 HOH 39  471 471 HOH HOH A . 
D 3 HOH 40  472 472 HOH HOH A . 
D 3 HOH 41  474 474 HOH HOH A . 
D 3 HOH 42  475 475 HOH HOH A . 
D 3 HOH 43  476 476 HOH HOH A . 
D 3 HOH 44  477 477 HOH HOH A . 
D 3 HOH 45  479 479 HOH HOH A . 
D 3 HOH 46  480 480 HOH HOH A . 
D 3 HOH 47  481 481 HOH HOH A . 
D 3 HOH 48  484 484 HOH HOH A . 
D 3 HOH 49  485 485 HOH HOH A . 
D 3 HOH 50  486 486 HOH HOH A . 
D 3 HOH 51  488 488 HOH HOH A . 
D 3 HOH 52  489 489 HOH HOH A . 
D 3 HOH 53  490 490 HOH HOH A . 
D 3 HOH 54  492 492 HOH HOH A . 
D 3 HOH 55  493 493 HOH HOH A . 
D 3 HOH 56  494 494 HOH HOH A . 
D 3 HOH 57  495 495 HOH HOH A . 
D 3 HOH 58  496 496 HOH HOH A . 
D 3 HOH 59  498 498 HOH HOH A . 
D 3 HOH 60  499 499 HOH HOH A . 
D 3 HOH 61  502 502 HOH HOH A . 
D 3 HOH 62  507 507 HOH HOH A . 
D 3 HOH 63  510 510 HOH HOH A . 
D 3 HOH 64  512 512 HOH HOH A . 
D 3 HOH 65  513 513 HOH HOH A . 
D 3 HOH 66  514 514 HOH HOH A . 
D 3 HOH 67  516 516 HOH HOH A . 
D 3 HOH 68  517 517 HOH HOH A . 
D 3 HOH 69  518 518 HOH HOH A . 
D 3 HOH 70  519 519 HOH HOH A . 
D 3 HOH 71  520 520 HOH HOH A . 
D 3 HOH 72  521 521 HOH HOH A . 
D 3 HOH 73  522 522 HOH HOH A . 
D 3 HOH 74  523 523 HOH HOH A . 
D 3 HOH 75  527 527 HOH HOH A . 
D 3 HOH 76  528 528 HOH HOH A . 
D 3 HOH 77  530 530 HOH HOH A . 
D 3 HOH 78  531 531 HOH HOH A . 
D 3 HOH 79  532 532 HOH HOH A . 
D 3 HOH 80  542 542 HOH HOH A . 
D 3 HOH 81  543 543 HOH HOH A . 
D 3 HOH 82  544 544 HOH HOH A . 
D 3 HOH 83  547 547 HOH HOH A . 
D 3 HOH 84  548 548 HOH HOH A . 
D 3 HOH 85  549 549 HOH HOH A . 
D 3 HOH 86  554 554 HOH HOH A . 
D 3 HOH 87  555 555 HOH HOH A . 
D 3 HOH 88  556 556 HOH HOH A . 
D 3 HOH 89  558 558 HOH HOH A . 
D 3 HOH 90  559 559 HOH HOH A . 
D 3 HOH 91  561 561 HOH HOH A . 
D 3 HOH 92  562 562 HOH HOH A . 
D 3 HOH 93  563 563 HOH HOH A . 
D 3 HOH 94  564 564 HOH HOH A . 
D 3 HOH 95  565 565 HOH HOH A . 
D 3 HOH 96  566 566 HOH HOH A . 
D 3 HOH 97  570 570 HOH HOH A . 
D 3 HOH 98  572 572 HOH HOH A . 
D 3 HOH 99  575 575 HOH HOH A . 
D 3 HOH 100 576 576 HOH HOH A . 
D 3 HOH 101 577 577 HOH HOH A . 
D 3 HOH 102 579 579 HOH HOH A . 
D 3 HOH 103 580 580 HOH HOH A . 
D 3 HOH 104 583 583 HOH HOH A . 
D 3 HOH 105 585 585 HOH HOH A . 
D 3 HOH 106 587 587 HOH HOH A . 
D 3 HOH 107 588 588 HOH HOH A . 
D 3 HOH 108 589 589 HOH HOH A . 
D 3 HOH 109 590 590 HOH HOH A . 
D 3 HOH 110 591 591 HOH HOH A . 
D 3 HOH 111 593 593 HOH HOH A . 
D 3 HOH 112 594 594 HOH HOH A . 
D 3 HOH 113 600 600 HOH HOH A . 
D 3 HOH 114 602 602 HOH HOH A . 
D 3 HOH 115 605 605 HOH HOH A . 
D 3 HOH 116 606 606 HOH HOH A . 
D 3 HOH 117 607 607 HOH HOH A . 
D 3 HOH 118 608 608 HOH HOH A . 
D 3 HOH 119 609 609 HOH HOH A . 
D 3 HOH 120 613 613 HOH HOH A . 
D 3 HOH 121 617 617 HOH HOH A . 
D 3 HOH 122 618 618 HOH HOH A . 
D 3 HOH 123 619 619 HOH HOH A . 
D 3 HOH 124 620 620 HOH HOH A . 
D 3 HOH 125 623 623 HOH HOH A . 
D 3 HOH 126 625 625 HOH HOH A . 
D 3 HOH 127 629 629 HOH HOH A . 
D 3 HOH 128 631 631 HOH HOH A . 
D 3 HOH 129 635 635 HOH HOH A . 
D 3 HOH 130 636 636 HOH HOH A . 
D 3 HOH 131 638 638 HOH HOH A . 
D 3 HOH 132 641 641 HOH HOH A . 
D 3 HOH 133 643 643 HOH HOH A . 
D 3 HOH 134 644 644 HOH HOH A . 
D 3 HOH 135 646 646 HOH HOH A . 
D 3 HOH 136 648 648 HOH HOH A . 
D 3 HOH 137 649 649 HOH HOH A . 
D 3 HOH 138 650 650 HOH HOH A . 
D 3 HOH 139 652 652 HOH HOH A . 
D 3 HOH 140 653 653 HOH HOH A . 
D 3 HOH 141 654 654 HOH HOH A . 
D 3 HOH 142 657 657 HOH HOH A . 
D 3 HOH 143 661 661 HOH HOH A . 
D 3 HOH 144 663 663 HOH HOH A . 
D 3 HOH 145 668 668 HOH HOH A . 
D 3 HOH 146 669 669 HOH HOH A . 
D 3 HOH 147 670 670 HOH HOH A . 
D 3 HOH 148 671 671 HOH HOH A . 
D 3 HOH 149 672 672 HOH HOH A . 
D 3 HOH 150 679 679 HOH HOH A . 
D 3 HOH 151 682 682 HOH HOH A . 
D 3 HOH 152 685 685 HOH HOH A . 
D 3 HOH 153 686 686 HOH HOH A . 
D 3 HOH 154 687 687 HOH HOH A . 
D 3 HOH 155 689 689 HOH HOH A . 
D 3 HOH 156 690 690 HOH HOH A . 
D 3 HOH 157 691 691 HOH HOH A . 
D 3 HOH 158 692 692 HOH HOH A . 
E 3 HOH 1   402 402 HOH HOH B . 
E 3 HOH 2   407 407 HOH HOH B . 
E 3 HOH 3   408 408 HOH HOH B . 
E 3 HOH 4   409 409 HOH HOH B . 
E 3 HOH 5   411 411 HOH HOH B . 
E 3 HOH 6   414 414 HOH HOH B . 
E 3 HOH 7   417 417 HOH HOH B . 
E 3 HOH 8   419 419 HOH HOH B . 
E 3 HOH 9   420 420 HOH HOH B . 
E 3 HOH 10  424 424 HOH HOH B . 
E 3 HOH 11  425 425 HOH HOH B . 
E 3 HOH 12  426 426 HOH HOH B . 
E 3 HOH 13  428 428 HOH HOH B . 
E 3 HOH 14  433 433 HOH HOH B . 
E 3 HOH 15  434 434 HOH HOH B . 
E 3 HOH 16  438 438 HOH HOH B . 
E 3 HOH 17  439 439 HOH HOH B . 
E 3 HOH 18  441 441 HOH HOH B . 
E 3 HOH 19  443 443 HOH HOH B . 
E 3 HOH 20  450 450 HOH HOH B . 
E 3 HOH 21  452 452 HOH HOH B . 
E 3 HOH 22  458 458 HOH HOH B . 
E 3 HOH 23  460 460 HOH HOH B . 
E 3 HOH 24  461 461 HOH HOH B . 
E 3 HOH 25  462 462 HOH HOH B . 
E 3 HOH 26  463 463 HOH HOH B . 
E 3 HOH 27  464 464 HOH HOH B . 
E 3 HOH 28  465 465 HOH HOH B . 
E 3 HOH 29  466 466 HOH HOH B . 
E 3 HOH 30  467 467 HOH HOH B . 
E 3 HOH 31  468 468 HOH HOH B . 
E 3 HOH 32  470 470 HOH HOH B . 
E 3 HOH 33  473 473 HOH HOH B . 
E 3 HOH 34  478 478 HOH HOH B . 
E 3 HOH 35  482 482 HOH HOH B . 
E 3 HOH 36  483 483 HOH HOH B . 
E 3 HOH 37  487 487 HOH HOH B . 
E 3 HOH 38  491 491 HOH HOH B . 
E 3 HOH 39  497 497 HOH HOH B . 
E 3 HOH 40  500 500 HOH HOH B . 
E 3 HOH 41  501 501 HOH HOH B . 
E 3 HOH 42  503 503 HOH HOH B . 
E 3 HOH 43  504 504 HOH HOH B . 
E 3 HOH 44  505 505 HOH HOH B . 
E 3 HOH 45  506 506 HOH HOH B . 
E 3 HOH 46  508 508 HOH HOH B . 
E 3 HOH 47  509 509 HOH HOH B . 
E 3 HOH 48  511 511 HOH HOH B . 
E 3 HOH 49  515 515 HOH HOH B . 
E 3 HOH 50  524 524 HOH HOH B . 
E 3 HOH 51  525 525 HOH HOH B . 
E 3 HOH 52  526 526 HOH HOH B . 
E 3 HOH 53  529 529 HOH HOH B . 
E 3 HOH 54  533 533 HOH HOH B . 
E 3 HOH 55  534 534 HOH HOH B . 
E 3 HOH 56  535 535 HOH HOH B . 
E 3 HOH 57  536 536 HOH HOH B . 
E 3 HOH 58  537 537 HOH HOH B . 
E 3 HOH 59  538 538 HOH HOH B . 
E 3 HOH 60  539 539 HOH HOH B . 
E 3 HOH 61  540 540 HOH HOH B . 
E 3 HOH 62  541 541 HOH HOH B . 
E 3 HOH 63  545 545 HOH HOH B . 
E 3 HOH 64  546 546 HOH HOH B . 
E 3 HOH 65  550 550 HOH HOH B . 
E 3 HOH 66  551 551 HOH HOH B . 
E 3 HOH 67  552 552 HOH HOH B . 
E 3 HOH 68  553 553 HOH HOH B . 
E 3 HOH 69  557 557 HOH HOH B . 
E 3 HOH 70  560 560 HOH HOH B . 
E 3 HOH 71  567 567 HOH HOH B . 
E 3 HOH 72  568 568 HOH HOH B . 
E 3 HOH 73  569 569 HOH HOH B . 
E 3 HOH 74  571 571 HOH HOH B . 
E 3 HOH 75  573 573 HOH HOH B . 
E 3 HOH 76  574 574 HOH HOH B . 
E 3 HOH 77  578 578 HOH HOH B . 
E 3 HOH 78  581 581 HOH HOH B . 
E 3 HOH 79  582 582 HOH HOH B . 
E 3 HOH 80  584 584 HOH HOH B . 
E 3 HOH 81  586 586 HOH HOH B . 
E 3 HOH 82  592 592 HOH HOH B . 
E 3 HOH 83  595 595 HOH HOH B . 
E 3 HOH 84  596 596 HOH HOH B . 
E 3 HOH 85  597 597 HOH HOH B . 
E 3 HOH 86  598 598 HOH HOH B . 
E 3 HOH 87  599 599 HOH HOH B . 
E 3 HOH 88  601 601 HOH HOH B . 
E 3 HOH 89  603 603 HOH HOH B . 
E 3 HOH 90  604 604 HOH HOH B . 
E 3 HOH 91  610 610 HOH HOH B . 
E 3 HOH 92  611 611 HOH HOH B . 
E 3 HOH 93  612 612 HOH HOH B . 
E 3 HOH 94  614 614 HOH HOH B . 
E 3 HOH 95  615 615 HOH HOH B . 
E 3 HOH 96  616 616 HOH HOH B . 
E 3 HOH 97  621 621 HOH HOH B . 
E 3 HOH 98  622 622 HOH HOH B . 
E 3 HOH 99  624 624 HOH HOH B . 
E 3 HOH 100 626 626 HOH HOH B . 
E 3 HOH 101 627 627 HOH HOH B . 
E 3 HOH 102 628 628 HOH HOH B . 
E 3 HOH 103 630 630 HOH HOH B . 
E 3 HOH 104 632 632 HOH HOH B . 
E 3 HOH 105 633 633 HOH HOH B . 
E 3 HOH 106 634 634 HOH HOH B . 
E 3 HOH 107 637 637 HOH HOH B . 
E 3 HOH 108 639 639 HOH HOH B . 
E 3 HOH 109 640 640 HOH HOH B . 
E 3 HOH 110 642 642 HOH HOH B . 
E 3 HOH 111 645 645 HOH HOH B . 
E 3 HOH 112 647 647 HOH HOH B . 
E 3 HOH 113 651 651 HOH HOH B . 
E 3 HOH 114 655 655 HOH HOH B . 
E 3 HOH 115 656 656 HOH HOH B . 
E 3 HOH 116 658 658 HOH HOH B . 
E 3 HOH 117 659 659 HOH HOH B . 
E 3 HOH 118 660 660 HOH HOH B . 
E 3 HOH 119 662 662 HOH HOH B . 
E 3 HOH 120 664 664 HOH HOH B . 
E 3 HOH 121 665 665 HOH HOH B . 
E 3 HOH 122 666 666 HOH HOH B . 
E 3 HOH 123 667 667 HOH HOH B . 
E 3 HOH 124 673 673 HOH HOH B . 
E 3 HOH 125 674 674 HOH HOH B . 
E 3 HOH 126 675 675 HOH HOH B . 
E 3 HOH 127 676 676 HOH HOH B . 
E 3 HOH 128 677 677 HOH HOH B . 
E 3 HOH 129 678 678 HOH HOH B . 
E 3 HOH 130 680 680 HOH HOH B . 
E 3 HOH 131 681 681 HOH HOH B . 
E 3 HOH 132 683 683 HOH HOH B . 
E 3 HOH 133 684 684 HOH HOH B . 
E 3 HOH 134 688 688 HOH HOH B . 
E 3 HOH 135 693 693 HOH HOH B . 
#