data_2AA0
# 
_entry.id   2AA0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.351 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   2AA0         pdb_00002aa0 10.2210/pdb2aa0/pdb 
RCSB  RCSB033671   ?            ?                   
WWPDB D_1000033671 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 1DGM 'the same protein'                                             unspecified 
PDB 1LII 'the same protein complexed with adenosine and AMP-PCP'        unspecified 
PDB 1LIJ 'the same protein complexed with 7-iodotubercidin and AMP-PCP' unspecified 
PDB 1LIK 'the same protein bound to adenosine'                          unspecified 
PDB 1LIO 'the same protein'                                             unspecified 
PDB 2A9Y .                                                              unspecified 
PDB 2A9Z .                                                              unspecified 
PDB 2AB8 .                                                              unspecified 
PDB 2ABS .                                                              unspecified 
# 
_pdbx_database_status.entry_id                        2AA0 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Zhang, Y.'      1 
'el Kouni, M.H.' 2 
'Ealick, S.E.'   3 
# 
_citation.id                        primary 
_citation.title                     
'Substrate analogs induce an intermediate conformational change in Toxoplasma gondii adenosine kinase' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            63 
_citation.page_first                126 
_citation.page_last                 134 
_citation.year                      2007 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   17242506 
_citation.pdbx_database_id_DOI      10.1107/S0907444906043654 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhang, Y.'      1 ? 
primary 'El Kouni, M.H.' 2 ? 
primary 'Ealick, S.E.'   3 ? 
# 
_cell.entry_id           2AA0 
_cell.length_a           60.348 
_cell.length_b           61.701 
_cell.length_c           91.958 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2AA0 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.cell_setting                     orthorhombic 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'adenosine kinase'                                                          40584.105 1   2.7.1.20 
'G270S, S360F, L361T, P362S, C363G' ? ? 
2 non-polymer syn 'CHLORIDE ION'                                                              35.453    1   ?        ? ? ? 
3 non-polymer syn 'SODIUM ION'                                                                22.990    2   ?        ? ? ? 
4 non-polymer syn 'ACETATE ION'                                                               59.044    1   ?        ? ? ? 
5 non-polymer syn '2-HYDROXYMETHYL-5-(6-METHYLSULFANYL-PURIN-9-YL)-TETRAHYDRO-FURAN-3,4-DIOL' 298.318   2   ?        ? ? ? 
6 water       nat water                                                                       18.015    249 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;AK; Adenosine 5'-phosphotransferase
;
# 
_entity_name_sys.entity_id   1 
_entity_name_sys.name        E.C.2.7.1.20 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQ
FNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCT
HLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNIL
FGNEEEFAHLAKVHNLVAAEKTALSTANKEHAVEVCTGALRLLTAGQNTSATKLVVMTRGHNPVIAAEQTADGTVVVHEV
GVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTFTSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQ
FNPTSLPGGSALNSVRVVQKLLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCT
HLGACGSFRLPEDWTTFASGALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNIL
FGNEEEFAHLAKVHNLVAAEKTALSTANKEHAVEVCTGALRLLTAGQNTSATKLVVMTRGHNPVIAAEQTADGTVVVHEV
GVPVVAAEKIVDTNGAGDAFVGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTFTSG
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  ALA n 
1 23  VAL n 
1 24  ASP n 
1 25  SER n 
1 26  SER n 
1 27  ASN n 
1 28  SER n 
1 29  ALA n 
1 30  THR n 
1 31  GLY n 
1 32  PRO n 
1 33  MET n 
1 34  ARG n 
1 35  VAL n 
1 36  PHE n 
1 37  ALA n 
1 38  ILE n 
1 39  GLY n 
1 40  ASN n 
1 41  PRO n 
1 42  ILE n 
1 43  LEU n 
1 44  ASP n 
1 45  LEU n 
1 46  VAL n 
1 47  ALA n 
1 48  GLU n 
1 49  VAL n 
1 50  PRO n 
1 51  SER n 
1 52  SER n 
1 53  PHE n 
1 54  LEU n 
1 55  ASP n 
1 56  GLU n 
1 57  PHE n 
1 58  PHE n 
1 59  LEU n 
1 60  LYS n 
1 61  ARG n 
1 62  GLY n 
1 63  ASP n 
1 64  ALA n 
1 65  THR n 
1 66  LEU n 
1 67  ALA n 
1 68  THR n 
1 69  PRO n 
1 70  GLU n 
1 71  GLN n 
1 72  MET n 
1 73  ARG n 
1 74  ILE n 
1 75  TYR n 
1 76  SER n 
1 77  THR n 
1 78  LEU n 
1 79  ASP n 
1 80  GLN n 
1 81  PHE n 
1 82  ASN n 
1 83  PRO n 
1 84  THR n 
1 85  SER n 
1 86  LEU n 
1 87  PRO n 
1 88  GLY n 
1 89  GLY n 
1 90  SER n 
1 91  ALA n 
1 92  LEU n 
1 93  ASN n 
1 94  SER n 
1 95  VAL n 
1 96  ARG n 
1 97  VAL n 
1 98  VAL n 
1 99  GLN n 
1 100 LYS n 
1 101 LEU n 
1 102 LEU n 
1 103 ARG n 
1 104 LYS n 
1 105 PRO n 
1 106 GLY n 
1 107 SER n 
1 108 ALA n 
1 109 GLY n 
1 110 TYR n 
1 111 MET n 
1 112 GLY n 
1 113 ALA n 
1 114 ILE n 
1 115 GLY n 
1 116 ASP n 
1 117 ASP n 
1 118 PRO n 
1 119 ARG n 
1 120 GLY n 
1 121 GLN n 
1 122 VAL n 
1 123 LEU n 
1 124 LYS n 
1 125 GLU n 
1 126 LEU n 
1 127 CYS n 
1 128 ASP n 
1 129 LYS n 
1 130 GLU n 
1 131 GLY n 
1 132 LEU n 
1 133 ALA n 
1 134 THR n 
1 135 ARG n 
1 136 PHE n 
1 137 MET n 
1 138 VAL n 
1 139 ALA n 
1 140 PRO n 
1 141 GLY n 
1 142 GLN n 
1 143 SER n 
1 144 THR n 
1 145 GLY n 
1 146 VAL n 
1 147 CYS n 
1 148 ALA n 
1 149 VAL n 
1 150 LEU n 
1 151 ILE n 
1 152 ASN n 
1 153 GLU n 
1 154 LYS n 
1 155 GLU n 
1 156 ARG n 
1 157 THR n 
1 158 LEU n 
1 159 CYS n 
1 160 THR n 
1 161 HIS n 
1 162 LEU n 
1 163 GLY n 
1 164 ALA n 
1 165 CYS n 
1 166 GLY n 
1 167 SER n 
1 168 PHE n 
1 169 ARG n 
1 170 LEU n 
1 171 PRO n 
1 172 GLU n 
1 173 ASP n 
1 174 TRP n 
1 175 THR n 
1 176 THR n 
1 177 PHE n 
1 178 ALA n 
1 179 SER n 
1 180 GLY n 
1 181 ALA n 
1 182 LEU n 
1 183 ILE n 
1 184 PHE n 
1 185 TYR n 
1 186 ALA n 
1 187 THR n 
1 188 ALA n 
1 189 TYR n 
1 190 THR n 
1 191 LEU n 
1 192 THR n 
1 193 ALA n 
1 194 THR n 
1 195 PRO n 
1 196 LYS n 
1 197 ASN n 
1 198 ALA n 
1 199 LEU n 
1 200 GLU n 
1 201 VAL n 
1 202 ALA n 
1 203 GLY n 
1 204 TYR n 
1 205 ALA n 
1 206 HIS n 
1 207 GLY n 
1 208 ILE n 
1 209 PRO n 
1 210 ASN n 
1 211 ALA n 
1 212 ILE n 
1 213 PHE n 
1 214 THR n 
1 215 LEU n 
1 216 ASN n 
1 217 LEU n 
1 218 SER n 
1 219 ALA n 
1 220 PRO n 
1 221 PHE n 
1 222 CYS n 
1 223 VAL n 
1 224 GLU n 
1 225 LEU n 
1 226 TYR n 
1 227 LYS n 
1 228 ASP n 
1 229 ALA n 
1 230 MET n 
1 231 GLN n 
1 232 SER n 
1 233 LEU n 
1 234 LEU n 
1 235 LEU n 
1 236 HIS n 
1 237 THR n 
1 238 ASN n 
1 239 ILE n 
1 240 LEU n 
1 241 PHE n 
1 242 GLY n 
1 243 ASN n 
1 244 GLU n 
1 245 GLU n 
1 246 GLU n 
1 247 PHE n 
1 248 ALA n 
1 249 HIS n 
1 250 LEU n 
1 251 ALA n 
1 252 LYS n 
1 253 VAL n 
1 254 HIS n 
1 255 ASN n 
1 256 LEU n 
1 257 VAL n 
1 258 ALA n 
1 259 ALA n 
1 260 GLU n 
1 261 LYS n 
1 262 THR n 
1 263 ALA n 
1 264 LEU n 
1 265 SER n 
1 266 THR n 
1 267 ALA n 
1 268 ASN n 
1 269 LYS n 
1 270 GLU n 
1 271 HIS n 
1 272 ALA n 
1 273 VAL n 
1 274 GLU n 
1 275 VAL n 
1 276 CYS n 
1 277 THR n 
1 278 GLY n 
1 279 ALA n 
1 280 LEU n 
1 281 ARG n 
1 282 LEU n 
1 283 LEU n 
1 284 THR n 
1 285 ALA n 
1 286 GLY n 
1 287 GLN n 
1 288 ASN n 
1 289 THR n 
1 290 SER n 
1 291 ALA n 
1 292 THR n 
1 293 LYS n 
1 294 LEU n 
1 295 VAL n 
1 296 VAL n 
1 297 MET n 
1 298 THR n 
1 299 ARG n 
1 300 GLY n 
1 301 HIS n 
1 302 ASN n 
1 303 PRO n 
1 304 VAL n 
1 305 ILE n 
1 306 ALA n 
1 307 ALA n 
1 308 GLU n 
1 309 GLN n 
1 310 THR n 
1 311 ALA n 
1 312 ASP n 
1 313 GLY n 
1 314 THR n 
1 315 VAL n 
1 316 VAL n 
1 317 VAL n 
1 318 HIS n 
1 319 GLU n 
1 320 VAL n 
1 321 GLY n 
1 322 VAL n 
1 323 PRO n 
1 324 VAL n 
1 325 VAL n 
1 326 ALA n 
1 327 ALA n 
1 328 GLU n 
1 329 LYS n 
1 330 ILE n 
1 331 VAL n 
1 332 ASP n 
1 333 THR n 
1 334 ASN n 
1 335 GLY n 
1 336 ALA n 
1 337 GLY n 
1 338 ASP n 
1 339 ALA n 
1 340 PHE n 
1 341 VAL n 
1 342 GLY n 
1 343 GLY n 
1 344 PHE n 
1 345 LEU n 
1 346 TYR n 
1 347 ALA n 
1 348 LEU n 
1 349 SER n 
1 350 GLN n 
1 351 GLY n 
1 352 LYS n 
1 353 THR n 
1 354 VAL n 
1 355 LYS n 
1 356 GLN n 
1 357 CYS n 
1 358 ILE n 
1 359 MET n 
1 360 CYS n 
1 361 GLY n 
1 362 ASN n 
1 363 ALA n 
1 364 CYS n 
1 365 ALA n 
1 366 GLN n 
1 367 ASP n 
1 368 VAL n 
1 369 ILE n 
1 370 GLN n 
1 371 HIS n 
1 372 VAL n 
1 373 GLY n 
1 374 PHE n 
1 375 SER n 
1 376 LEU n 
1 377 SER n 
1 378 PHE n 
1 379 THR n 
1 380 PHE n 
1 381 THR n 
1 382 SER n 
1 383 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Toxoplasma 
_entity_src_gen.pdbx_gene_src_gene                 AK 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Toxoplasma gondii' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5811 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.entity_id                  1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ADK_TOXGO 
_struct_ref.pdbx_db_accession          Q9TVW2 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MAVDSSNSATGPMRVFAIGNPILDLVAEVPSSFLDEFFLKRGDATLATPEQMRIYSTLDQFNPTSLPGGSALNSVRVVQK
LLRKPGSAGYMGAIGDDPRGQVLKELCDKEGLATRFMVAPGQSTGVCAVLINEKERTLCTHLGACGSFRLPEDWTTFASG
ALIFYATAYTLTATPKNALEVAGYAHGIPNAIFTLNLSAPFCVELYKDAMQSLLLHTNILFGNEEEFAHLAKVHNLVAAE
KTALSTANKEHAVEVCTGALRLLTAGQNTGATKLVVMTRGHNPVIAAEQTADGTVVVHEVGVPVVAAEKIVDTNGAGDAF
VGGFLYALSQGKTVKQCIMCGNACAQDVIQHVGFSLSFTSLPC
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2AA0 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 21 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 383 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9TVW2 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  363 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       363 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2AA0 MET A 1   ? UNP Q9TVW2 ?   ?   'expression tag'      -19 1  
1 2AA0 GLY A 2   ? UNP Q9TVW2 ?   ?   'expression tag'      -18 2  
1 2AA0 SER A 3   ? UNP Q9TVW2 ?   ?   'expression tag'      -17 3  
1 2AA0 SER A 4   ? UNP Q9TVW2 ?   ?   'expression tag'      -16 4  
1 2AA0 HIS A 5   ? UNP Q9TVW2 ?   ?   'expression tag'      -15 5  
1 2AA0 HIS A 6   ? UNP Q9TVW2 ?   ?   'expression tag'      -14 6  
1 2AA0 HIS A 7   ? UNP Q9TVW2 ?   ?   'expression tag'      -13 7  
1 2AA0 HIS A 8   ? UNP Q9TVW2 ?   ?   'expression tag'      -12 8  
1 2AA0 HIS A 9   ? UNP Q9TVW2 ?   ?   'expression tag'      -11 9  
1 2AA0 HIS A 10  ? UNP Q9TVW2 ?   ?   'expression tag'      -10 10 
1 2AA0 SER A 11  ? UNP Q9TVW2 ?   ?   'expression tag'      -9  11 
1 2AA0 SER A 12  ? UNP Q9TVW2 ?   ?   'expression tag'      -8  12 
1 2AA0 GLY A 13  ? UNP Q9TVW2 ?   ?   'expression tag'      -7  13 
1 2AA0 LEU A 14  ? UNP Q9TVW2 ?   ?   'expression tag'      -6  14 
1 2AA0 VAL A 15  ? UNP Q9TVW2 ?   ?   'expression tag'      -5  15 
1 2AA0 PRO A 16  ? UNP Q9TVW2 ?   ?   'expression tag'      -4  16 
1 2AA0 ARG A 17  ? UNP Q9TVW2 ?   ?   'expression tag'      -3  17 
1 2AA0 GLY A 18  ? UNP Q9TVW2 ?   ?   'expression tag'      -2  18 
1 2AA0 SER A 19  ? UNP Q9TVW2 ?   ?   'expression tag'      -1  19 
1 2AA0 HIS A 20  ? UNP Q9TVW2 ?   ?   'expression tag'      0   20 
1 2AA0 SER A 290 ? UNP Q9TVW2 GLY 270 'engineered mutation' 270 21 
1 2AA0 PHE A 380 ? UNP Q9TVW2 SER 360 'engineered mutation' 360 22 
1 2AA0 THR A 381 ? UNP Q9TVW2 LEU 361 'engineered mutation' 361 23 
1 2AA0 SER A 382 ? UNP Q9TVW2 PRO 362 'engineered mutation' 362 24 
1 2AA0 GLY A 383 ? UNP Q9TVW2 CYS 363 'engineered mutation' 363 25 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACT non-polymer         . 'ACETATE ION'                                                               ? 'C2 H3 O2 -1'     59.044  
ALA 'L-peptide linking' y ALANINE                                                                     ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                                                                    ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                  ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                             ? 'C4 H7 N O4'      133.103 
CL  non-polymer         . 'CHLORIDE ION'                                                              ? 'Cl -1'           35.453  
CYS 'L-peptide linking' y CYSTEINE                                                                    ? 'C3 H7 N O2 S'    121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                   ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                             ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                                                                     ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                   ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                                                       ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                  ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                                                                     ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                                                                      ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                                                                  ? 'C5 H11 N O2 S'   149.211 
MTP non-polymer         . '2-HYDROXYMETHYL-5-(6-METHYLSULFANYL-PURIN-9-YL)-TETRAHYDRO-FURAN-3,4-DIOL' 
9-BETA-D-RIBOFURANOSYL-6-METHYLTHIOPURINE 'C11 H14 N4 O4 S' 298.318 
NA  non-polymer         . 'SODIUM ION'                                                                ? 'Na 1'            22.990  
PHE 'L-peptide linking' y PHENYLALANINE                                                               ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                                                                     ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                                                                      ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                                                                   ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                  ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                                                                    ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                                                                      ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          2AA0 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.1 
_exptl_crystal.density_percent_sol   41.8 
_exptl_crystal.density_meas          ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'PEG 4000, ammonium acetate, sodium citrate, pH 6.5, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2004-10-26 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    GRAPHITE 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9790 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 8-BM' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   8-BM 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.9790 
# 
_reflns.entry_id                     2AA0 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.75 
_reflns.number_obs                   32789 
_reflns.number_all                   32789 
_reflns.percent_possible_obs         92.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.097 
_reflns.pdbx_netI_over_sigmaI        12.4 
_reflns.B_iso_Wilson_estimate        19.3 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.75 
_reflns_shell.d_res_low              1.81 
_reflns_shell.percent_possible_all   99.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.413 
_reflns_shell.meanI_over_sigI_obs    4.2 
_reflns_shell.pdbx_redundancy        3.6 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3482 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 2AA0 
_refine.ls_number_reflns_obs                     30495 
_refine.ls_number_reflns_all                     30495 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               922931.75 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.45 
_refine.ls_d_res_high                            1.75 
_refine.ls_percent_reflns_obs                    86.2 
_refine.ls_R_factor_obs                          0.207 
_refine.ls_R_factor_all                          0.207 
_refine.ls_R_factor_R_work                       0.204 
_refine.ls_R_factor_R_free                       0.24 
_refine.ls_R_factor_R_free_error                 0.005 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 8.0 
_refine.ls_number_reflns_R_free                  2439 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               32.6 
_refine.aniso_B[1][1]                            13.42 
_refine.aniso_B[2][2]                            -8.70 
_refine.aniso_B[3][3]                            -4.72 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.347877 
_refine.solvent_model_param_bsol                 55.8055 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 1LIO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2AA0 
_refine_analyze.Luzzati_coordinate_error_obs    0.22 
_refine_analyze.Luzzati_sigma_a_obs             0.24 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.27 
_refine_analyze.Luzzati_sigma_a_free            0.25 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2658 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         47 
_refine_hist.number_atoms_solvent             249 
_refine_hist.number_atoms_total               2954 
_refine_hist.d_res_high                       1.75 
_refine_hist.d_res_low                        27.45 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.005 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.2   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.3  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 0.76  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        2.63  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       3.33  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        4.44  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       5.70  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       1.75 
_refine_ls_shell.d_res_low                        1.86 
_refine_ls_shell.number_reflns_R_work             4696 
_refine_ls_shell.R_factor_R_work                  0.267 
_refine_ls_shell.percent_reflns_obs               87.9 
_refine_ls_shell.R_factor_R_free                  0.305 
_refine_ls_shell.R_factor_R_free_error            0.015 
_refine_ls_shell.percent_reflns_R_free            7.9 
_refine_ls_shell.number_reflns_R_free             404 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top    'X-RAY DIFFRACTION' 
2 water_rep.param   water_rep.top  'X-RAY DIFFRACTION' 
3 act_param.txt     mta_prodrg.top 'X-RAY DIFFRACTION' 
4 mtp_prodrg.param  act_top.txt    'X-RAY DIFFRACTION' 
5 ion.param         ion.top        'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2AA0 
_struct.title                     'Crystal structure of T. gondii adenosine kinase complexed with 6-methylmercaptopurine riboside' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AA0 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN,TRANSFERASE' 
_struct_keywords.text            'ribokinase fold; alpha/beta; intermediate conformation, SIGNALING PROTEIN, TRANSFERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 5 ? 
H N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  PRO A 50  ? PHE A 57  ? PRO A 30  PHE A 37  1 ? 8  
HELX_P HELX_P2  2  THR A 68  ? MET A 72  ? THR A 48  MET A 52  5 ? 5  
HELX_P HELX_P3  3  ARG A 73  ? ASP A 79  ? ARG A 53  ASP A 59  1 ? 7  
HELX_P HELX_P4  4  GLN A 80  ? ASN A 82  ? GLN A 60  ASN A 62  5 ? 3  
HELX_P HELX_P5  5  GLY A 89  ? ARG A 103 ? GLY A 69  ARG A 83  1 ? 15 
HELX_P HELX_P6  6  ASP A 117 ? LYS A 129 ? ASP A 97  LYS A 109 1 ? 13 
HELX_P HELX_P7  7  LEU A 162 ? PHE A 168 ? LEU A 142 PHE A 148 5 ? 7  
HELX_P HELX_P8  8  ASP A 173 ? ALA A 178 ? ASP A 153 ALA A 158 1 ? 6  
HELX_P HELX_P9  9  TYR A 189 ? ALA A 193 ? TYR A 169 ALA A 173 5 ? 5  
HELX_P HELX_P10 10 PRO A 195 ? HIS A 206 ? PRO A 175 HIS A 186 1 ? 12 
HELX_P HELX_P11 11 ALA A 219 ? TYR A 226 ? ALA A 199 TYR A 206 1 ? 8  
HELX_P HELX_P12 12 TYR A 226 ? HIS A 236 ? TYR A 206 HIS A 216 1 ? 11 
HELX_P HELX_P13 13 GLU A 244 ? HIS A 254 ? GLU A 224 HIS A 234 1 ? 11 
HELX_P HELX_P14 14 ASN A 268 ? ALA A 285 ? ASN A 248 ALA A 265 1 ? 18 
HELX_P HELX_P15 15 ALA A 326 ? ILE A 330 ? ALA A 306 ILE A 310 5 ? 5  
HELX_P HELX_P16 16 GLY A 335 ? GLN A 350 ? GLY A 315 GLN A 330 1 ? 16 
HELX_P HELX_P17 17 THR A 353 ? ILE A 369 ? THR A 333 ILE A 349 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1 metalc ? ? A ASN 288 OD1 ? ? ? 1_555 C NA  . NA ? ? A ASN 268  A NA  2002 1_555 ? ? ? ? ? ? ? 2.392 ? ? 
metalc2 metalc ? ? A THR 289 O   ? ? ? 1_555 C NA  . NA ? ? A THR 269  A NA  2002 1_555 ? ? ? ? ? ? ? 2.523 ? ? 
metalc3 metalc ? ? A THR 310 O   ? ? ? 1_555 C NA  . NA ? ? A THR 290  A NA  2002 1_555 ? ? ? ? ? ? ? 2.547 ? ? 
metalc4 metalc ? ? A VAL 368 O   ? ? ? 1_555 D NA  . NA ? ? A VAL 348  A NA  2003 1_555 ? ? ? ? ? ? ? 2.275 ? ? 
metalc5 metalc ? ? A HIS 371 O   ? ? ? 1_555 D NA  . NA ? ? A HIS 351  A NA  2003 1_555 ? ? ? ? ? ? ? 2.240 ? ? 
metalc6 metalc ? ? A GLY 373 O   ? ? ? 1_555 D NA  . NA ? ? A GLY 353  A NA  2003 1_555 ? ? ? ? ? ? ? 2.302 ? ? 
metalc7 metalc ? ? C NA  .   NA  ? ? ? 1_555 H HOH . O  ? ? A NA  2002 A HOH 3081 1_555 ? ? ? ? ? ? ? 2.375 ? ? 
metalc8 metalc ? ? D NA  .   NA  ? ? ? 1_555 H HOH . O  ? ? A NA  2003 A HOH 3234 1_555 ? ? ? ? ? ? ? 2.277 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           31 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            11 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    32 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     12 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -0.05 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? parallel      
A 3 4 ? parallel      
A 4 5 ? parallel      
A 5 6 ? parallel      
A 6 7 ? parallel      
A 7 8 ? anti-parallel 
A 8 9 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ALA A 133 ? ALA A 139 ? ALA A 113 ALA A 119 
A 2 ALA A 108 ? GLY A 115 ? ALA A 88  GLY A 95  
A 3 VAL A 35  ? ILE A 38  ? VAL A 15  ILE A 18  
A 4 ILE A 183 ? THR A 187 ? ILE A 163 THR A 167 
A 5 ILE A 212 ? ASN A 216 ? ILE A 192 ASN A 196 
A 6 ILE A 239 ? ASN A 243 ? ILE A 219 ASN A 223 
A 7 LEU A 294 ? ARG A 299 ? LEU A 274 ARG A 279 
A 8 ASN A 302 ? GLN A 309 ? ASN A 282 GLN A 289 
A 9 VAL A 315 ? VAL A 320 ? VAL A 295 VAL A 300 
B 1 ALA A 64  ? LEU A 66  ? ALA A 44  LEU A 46  
B 2 GLU A 155 ? HIS A 161 ? GLU A 135 HIS A 141 
B 3 GLY A 145 ? ASN A 152 ? GLY A 125 ASN A 132 
B 4 ILE A 42  ? GLU A 48  ? ILE A 22  GLU A 28  
B 5 THR A 84  ? GLY A 88  ? THR A 64  GLY A 68  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O MET A 137 ? O MET A 117 N ILE A 114 ? N ILE A 94  
A 2 3 O GLY A 109 ? O GLY A 89  N VAL A 35  ? N VAL A 15  
A 3 4 N PHE A 36  ? N PHE A 16  O TYR A 185 ? O TYR A 165 
A 4 5 N PHE A 184 ? N PHE A 164 O ILE A 212 ? O ILE A 192 
A 5 6 N LEU A 215 ? N LEU A 195 O PHE A 241 ? O PHE A 221 
A 6 7 N LEU A 240 ? N LEU A 220 O VAL A 296 ? O VAL A 276 
A 7 8 N MET A 297 ? N MET A 277 O ILE A 305 ? O ILE A 285 
A 8 9 N ALA A 306 ? N ALA A 286 O HIS A 318 ? O HIS A 298 
B 1 2 N THR A 65  ? N THR A 45  O THR A 160 ? O THR A 140 
B 2 3 O THR A 157 ? O THR A 137 N LEU A 150 ? N LEU A 130 
B 3 4 O CYS A 147 ? O CYS A 127 N LEU A 45  ? N LEU A 25  
B 4 5 N ASP A 44  ? N ASP A 24  O LEU A 86  ? O LEU A 66  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL  2001 ? 5  'BINDING SITE FOR RESIDUE CL A 2001'  
AC2 Software A NA  2002 ? 6  'BINDING SITE FOR RESIDUE NA A 2002'  
AC3 Software A NA  2003 ? 4  'BINDING SITE FOR RESIDUE NA A 2003'  
AC4 Software A ACT 3001 ? 4  'BINDING SITE FOR RESIDUE ACT A 3001' 
AC5 Software A MTP 1001 ? 13 'BINDING SITE FOR RESIDUE MTP A 1001' 
AC6 Software A MTP 1002 ? 11 'BINDING SITE FOR RESIDUE MTP A 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  ASN A 40  ? ASN A 20   . ? 1_555 ? 
2  AC1 5  ALA A 91  ? ALA A 71   . ? 1_555 ? 
3  AC1 5  THR A 187 ? THR A 167  . ? 1_555 ? 
4  AC1 5  MTP F .   ? MTP A 1001 . ? 1_555 ? 
5  AC1 5  HOH H .   ? HOH A 3005 . ? 1_555 ? 
6  AC2 6  ASN A 288 ? ASN A 268  . ? 1_555 ? 
7  AC2 6  THR A 289 ? THR A 269  . ? 1_555 ? 
8  AC2 6  GLN A 309 ? GLN A 289  . ? 1_555 ? 
9  AC2 6  THR A 310 ? THR A 290  . ? 1_555 ? 
10 AC2 6  ALA A 311 ? ALA A 291  . ? 1_555 ? 
11 AC2 6  HOH H .   ? HOH A 3081 . ? 1_555 ? 
12 AC3 4  VAL A 368 ? VAL A 348  . ? 1_555 ? 
13 AC3 4  HIS A 371 ? HIS A 351  . ? 1_555 ? 
14 AC3 4  GLY A 373 ? GLY A 353  . ? 1_555 ? 
15 AC3 4  HOH H .   ? HOH A 3234 . ? 1_555 ? 
16 AC4 4  THR A 298 ? THR A 278  . ? 1_555 ? 
17 AC4 4  GLY A 337 ? GLY A 317  . ? 1_555 ? 
18 AC4 4  HOH H .   ? HOH A 3067 . ? 1_555 ? 
19 AC4 4  HOH H .   ? HOH A 3068 . ? 1_555 ? 
20 AC5 13 ASN A 40  ? ASN A 20   . ? 1_555 ? 
21 AC5 13 ILE A 42  ? ILE A 22   . ? 1_555 ? 
22 AC5 13 ASP A 44  ? ASP A 24   . ? 1_555 ? 
23 AC5 13 GLY A 89  ? GLY A 69   . ? 1_555 ? 
24 AC5 13 SER A 90  ? SER A 70   . ? 1_555 ? 
25 AC5 13 ASN A 93  ? ASN A 73   . ? 1_555 ? 
26 AC5 13 THR A 160 ? THR A 140  . ? 1_555 ? 
27 AC5 13 TYR A 189 ? TYR A 169  . ? 1_555 ? 
28 AC5 13 ASP A 338 ? ASP A 318  . ? 1_555 ? 
29 AC5 13 PHE A 374 ? PHE A 354  . ? 1_555 ? 
30 AC5 13 CL  B .   ? CL  A 2001 . ? 1_555 ? 
31 AC5 13 HOH H .   ? HOH A 3109 . ? 1_555 ? 
32 AC5 13 HOH H .   ? HOH A 3151 . ? 1_555 ? 
33 AC6 11 GLY A 300 ? GLY A 280  . ? 1_555 ? 
34 AC6 11 VAL A 304 ? VAL A 284  . ? 1_555 ? 
35 AC6 11 VAL A 322 ? VAL A 302  . ? 1_555 ? 
36 AC6 11 VAL A 325 ? VAL A 305  . ? 1_555 ? 
37 AC6 11 ALA A 336 ? ALA A 316  . ? 1_555 ? 
38 AC6 11 GLY A 337 ? GLY A 317  . ? 1_555 ? 
39 AC6 11 ASN A 362 ? ASN A 342  . ? 1_555 ? 
40 AC6 11 ALA A 365 ? ALA A 345  . ? 1_555 ? 
41 AC6 11 GLN A 366 ? GLN A 346  . ? 1_555 ? 
42 AC6 11 HOH H .   ? HOH A 3074 . ? 1_555 ? 
43 AC6 11 HOH H .   ? HOH A 3247 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2AA0 
_atom_sites.fract_transf_matrix[1][1]   0.016571 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016207 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010875 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 30  ? -4.775  -68.819 -95.074  1.00 54.44 ? 10   THR A N     1 
ATOM   2    C  CA    . THR A 1 30  ? -3.422  -68.671 -95.683  1.00 51.83 ? 10   THR A CA    1 
ATOM   3    C  C     . THR A 1 30  ? -3.431  -69.098 -97.147  1.00 48.58 ? 10   THR A C     1 
ATOM   4    O  O     . THR A 1 30  ? -2.690  -69.997 -97.543  1.00 55.86 ? 10   THR A O     1 
ATOM   5    C  CB    . THR A 1 30  ? -2.410  -69.502 -94.905  1.00 49.47 ? 10   THR A CB    1 
ATOM   6    N  N     . GLY A 1 31  ? -4.270  -68.448 -97.948  1.00 44.51 ? 11   GLY A N     1 
ATOM   7    C  CA    . GLY A 1 31  ? -4.353  -68.781 -99.359  1.00 35.60 ? 11   GLY A CA    1 
ATOM   8    C  C     . GLY A 1 31  ? -5.433  -69.805 -99.654  1.00 37.02 ? 11   GLY A C     1 
ATOM   9    O  O     . GLY A 1 31  ? -6.175  -70.201 -98.752  1.00 37.42 ? 11   GLY A O     1 
ATOM   10   N  N     . PRO A 1 32  ? -5.553  -70.253 -100.913 1.00 30.27 ? 12   PRO A N     1 
ATOM   11   C  CA    . PRO A 1 32  ? -4.712  -69.823 -102.036 1.00 27.89 ? 12   PRO A CA    1 
ATOM   12   C  C     . PRO A 1 32  ? -5.112  -68.443 -102.543 1.00 27.19 ? 12   PRO A C     1 
ATOM   13   O  O     . PRO A 1 32  ? -6.291  -68.082 -102.520 1.00 27.50 ? 12   PRO A O     1 
ATOM   14   C  CB    . PRO A 1 32  ? -4.952  -70.911 -103.072 1.00 22.93 ? 12   PRO A CB    1 
ATOM   15   C  CG    . PRO A 1 32  ? -6.394  -71.235 -102.854 1.00 35.73 ? 12   PRO A CG    1 
ATOM   16   C  CD    . PRO A 1 32  ? -6.492  -71.305 -101.341 1.00 33.90 ? 12   PRO A CD    1 
ATOM   17   N  N     . MET A 1 33  ? -4.129  -67.664 -102.990 1.00 23.92 ? 13   MET A N     1 
ATOM   18   C  CA    . MET A 1 33  ? -4.417  -66.332 -103.503 1.00 23.45 ? 13   MET A CA    1 
ATOM   19   C  C     . MET A 1 33  ? -4.966  -66.459 -104.921 1.00 23.95 ? 13   MET A C     1 
ATOM   20   O  O     . MET A 1 33  ? -4.335  -67.060 -105.788 1.00 25.94 ? 13   MET A O     1 
ATOM   21   C  CB    . MET A 1 33  ? -3.156  -65.467 -103.498 1.00 18.52 ? 13   MET A CB    1 
ATOM   22   C  CG    . MET A 1 33  ? -3.438  -63.990 -103.771 1.00 22.41 ? 13   MET A CG    1 
ATOM   23   S  SD    . MET A 1 33  ? -1.964  -62.933 -103.709 1.00 23.93 ? 13   MET A SD    1 
ATOM   24   C  CE    . MET A 1 33  ? -1.380  -63.210 -101.993 1.00 25.68 ? 13   MET A CE    1 
ATOM   25   N  N     . ARG A 1 34  ? -6.142  -65.885 -105.151 1.00 21.77 ? 14   ARG A N     1 
ATOM   26   C  CA    . ARG A 1 34  ? -6.781  -65.976 -106.460 1.00 21.50 ? 14   ARG A CA    1 
ATOM   27   C  C     . ARG A 1 34  ? -6.672  -64.709 -107.290 1.00 21.32 ? 14   ARG A C     1 
ATOM   28   O  O     . ARG A 1 34  ? -6.767  -64.756 -108.516 1.00 20.84 ? 14   ARG A O     1 
ATOM   29   C  CB    . ARG A 1 34  ? -8.259  -66.335 -106.288 1.00 26.52 ? 14   ARG A CB    1 
ATOM   30   C  CG    . ARG A 1 34  ? -8.502  -67.612 -105.497 1.00 26.81 ? 14   ARG A CG    1 
ATOM   31   C  CD    . ARG A 1 34  ? -7.761  -68.794 -106.122 1.00 31.85 ? 14   ARG A CD    1 
ATOM   32   N  NE    . ARG A 1 34  ? -8.267  -70.071 -105.625 1.00 47.78 ? 14   ARG A NE    1 
ATOM   33   C  CZ    . ARG A 1 34  ? -7.758  -71.258 -105.941 1.00 45.19 ? 14   ARG A CZ    1 
ATOM   34   N  NH1   . ARG A 1 34  ? -6.714  -71.344 -106.757 1.00 46.35 ? 14   ARG A NH1   1 
ATOM   35   N  NH2   . ARG A 1 34  ? -8.302  -72.363 -105.448 1.00 41.63 ? 14   ARG A NH2   1 
ATOM   36   N  N     . VAL A 1 35  ? -6.487  -63.578 -106.615 1.00 20.28 ? 15   VAL A N     1 
ATOM   37   C  CA    . VAL A 1 35  ? -6.389  -62.291 -107.289 1.00 19.04 ? 15   VAL A CA    1 
ATOM   38   C  C     . VAL A 1 35  ? -5.341  -61.415 -106.617 1.00 23.90 ? 15   VAL A C     1 
ATOM   39   O  O     . VAL A 1 35  ? -5.265  -61.366 -105.391 1.00 23.12 ? 15   VAL A O     1 
ATOM   40   C  CB    . VAL A 1 35  ? -7.741  -61.530 -107.237 1.00 22.57 ? 15   VAL A CB    1 
ATOM   41   C  CG1   . VAL A 1 35  ? -7.604  -60.160 -107.895 1.00 26.62 ? 15   VAL A CG1   1 
ATOM   42   C  CG2   . VAL A 1 35  ? -8.823  -62.342 -107.924 1.00 25.69 ? 15   VAL A CG2   1 
ATOM   43   N  N     . PHE A 1 36  ? -4.529  -60.741 -107.427 1.00 18.33 ? 16   PHE A N     1 
ATOM   44   C  CA    . PHE A 1 36  ? -3.518  -59.819 -106.912 1.00 17.02 ? 16   PHE A CA    1 
ATOM   45   C  C     . PHE A 1 36  ? -3.762  -58.461 -107.548 1.00 19.71 ? 16   PHE A C     1 
ATOM   46   O  O     . PHE A 1 36  ? -3.964  -58.376 -108.753 1.00 21.39 ? 16   PHE A O     1 
ATOM   47   C  CB    . PHE A 1 36  ? -2.104  -60.256 -107.279 1.00 18.84 ? 16   PHE A CB    1 
ATOM   48   C  CG    . PHE A 1 36  ? -1.053  -59.261 -106.868 1.00 20.87 ? 16   PHE A CG    1 
ATOM   49   C  CD1   . PHE A 1 36  ? -0.749  -59.069 -105.521 1.00 25.46 ? 16   PHE A CD1   1 
ATOM   50   C  CD2   . PHE A 1 36  ? -0.397  -58.484 -107.824 1.00 22.59 ? 16   PHE A CD2   1 
ATOM   51   C  CE1   . PHE A 1 36  ? 0.191   -58.115 -105.124 1.00 24.25 ? 16   PHE A CE1   1 
ATOM   52   C  CE2   . PHE A 1 36  ? 0.545   -57.525 -107.441 1.00 22.72 ? 16   PHE A CE2   1 
ATOM   53   C  CZ    . PHE A 1 36  ? 0.841   -57.340 -106.086 1.00 23.61 ? 16   PHE A CZ    1 
ATOM   54   N  N     . ALA A 1 37  ? -3.734  -57.399 -106.747 1.00 18.77 ? 17   ALA A N     1 
ATOM   55   C  CA    . ALA A 1 37  ? -3.951  -56.063 -107.292 1.00 19.01 ? 17   ALA A CA    1 
ATOM   56   C  C     . ALA A 1 37  ? -2.999  -55.041 -106.688 1.00 19.39 ? 17   ALA A C     1 
ATOM   57   O  O     . ALA A 1 37  ? -2.469  -55.242 -105.601 1.00 24.00 ? 17   ALA A O     1 
ATOM   58   C  CB    . ALA A 1 37  ? -5.383  -55.621 -107.038 1.00 20.13 ? 17   ALA A CB    1 
ATOM   59   N  N     . ILE A 1 38  ? -2.763  -53.961 -107.428 1.00 20.42 ? 18   ILE A N     1 
ATOM   60   C  CA    . ILE A 1 38  ? -1.937  -52.863 -106.949 1.00 18.21 ? 18   ILE A CA    1 
ATOM   61   C  C     . ILE A 1 38  ? -2.864  -51.653 -106.961 1.00 20.24 ? 18   ILE A C     1 
ATOM   62   O  O     . ILE A 1 38  ? -3.789  -51.582 -107.773 1.00 19.66 ? 18   ILE A O     1 
ATOM   63   C  CB    . ILE A 1 38  ? -0.716  -52.580 -107.863 1.00 22.72 ? 18   ILE A CB    1 
ATOM   64   C  CG1   . ILE A 1 38  ? -1.166  -52.332 -109.306 1.00 23.72 ? 18   ILE A CG1   1 
ATOM   65   C  CG2   . ILE A 1 38  ? 0.263   -53.734 -107.783 1.00 22.11 ? 18   ILE A CG2   1 
ATOM   66   C  CD1   . ILE A 1 38  ? -0.041  -51.874 -110.222 1.00 25.82 ? 18   ILE A CD1   1 
ATOM   67   N  N     . GLY A 1 39  ? -2.651  -50.713 -106.052 1.00 18.23 ? 19   GLY A N     1 
ATOM   68   C  CA    . GLY A 1 39  ? -3.508  -49.545 -106.046 1.00 18.51 ? 19   GLY A CA    1 
ATOM   69   C  C     . GLY A 1 39  ? -2.997  -48.432 -105.163 1.00 20.58 ? 19   GLY A C     1 
ATOM   70   O  O     . GLY A 1 39  ? -1.856  -48.470 -104.698 1.00 23.67 ? 19   GLY A O     1 
ATOM   71   N  N     . ASN A 1 40  ? -3.844  -47.428 -104.961 1.00 19.96 ? 20   ASN A N     1 
ATOM   72   C  CA    . ASN A 1 40  ? -3.528  -46.298 -104.098 1.00 20.18 ? 20   ASN A CA    1 
ATOM   73   C  C     . ASN A 1 40  ? -4.345  -46.549 -102.838 1.00 19.99 ? 20   ASN A C     1 
ATOM   74   O  O     . ASN A 1 40  ? -5.561  -46.394 -102.847 1.00 22.94 ? 20   ASN A O     1 
ATOM   75   C  CB    . ASN A 1 40  ? -3.968  -44.970 -104.731 1.00 18.09 ? 20   ASN A CB    1 
ATOM   76   C  CG    . ASN A 1 40  ? -3.207  -44.643 -105.999 1.00 22.46 ? 20   ASN A CG    1 
ATOM   77   O  OD1   . ASN A 1 40  ? -2.002  -44.888 -106.091 1.00 26.50 ? 20   ASN A OD1   1 
ATOM   78   N  ND2   . ASN A 1 40  ? -3.901  -44.063 -106.981 1.00 19.60 ? 20   ASN A ND2   1 
ATOM   79   N  N     . PRO A 1 41  ? -3.691  -46.988 -101.750 1.00 21.34 ? 21   PRO A N     1 
ATOM   80   C  CA    . PRO A 1 41  ? -4.388  -47.259 -100.489 1.00 24.23 ? 21   PRO A CA    1 
ATOM   81   C  C     . PRO A 1 41  ? -4.776  -45.946 -99.830  1.00 24.26 ? 21   PRO A C     1 
ATOM   82   O  O     . PRO A 1 41  ? -3.924  -45.127 -99.492  1.00 23.73 ? 21   PRO A O     1 
ATOM   83   C  CB    . PRO A 1 41  ? -3.361  -48.063 -99.696  1.00 26.91 ? 21   PRO A CB    1 
ATOM   84   C  CG    . PRO A 1 41  ? -2.072  -47.519 -100.175 1.00 30.55 ? 21   PRO A CG    1 
ATOM   85   C  CD    . PRO A 1 41  ? -2.280  -47.395 -101.665 1.00 21.13 ? 21   PRO A CD    1 
ATOM   86   N  N     . ILE A 1 42  ? -6.078  -45.757 -99.657  1.00 23.55 ? 22   ILE A N     1 
ATOM   87   C  CA    . ILE A 1 42  ? -6.616  -44.530 -99.097  1.00 26.24 ? 22   ILE A CA    1 
ATOM   88   C  C     . ILE A 1 42  ? -7.602  -44.781 -97.957  1.00 24.69 ? 22   ILE A C     1 
ATOM   89   O  O     . ILE A 1 42  ? -8.424  -45.691 -98.026  1.00 29.44 ? 22   ILE A O     1 
ATOM   90   C  CB    . ILE A 1 42  ? -7.357  -43.737 -100.196 1.00 24.70 ? 22   ILE A CB    1 
ATOM   91   C  CG1   . ILE A 1 42  ? -6.372  -43.298 -101.278 1.00 19.35 ? 22   ILE A CG1   1 
ATOM   92   C  CG2   . ILE A 1 42  ? -8.075  -42.532 -99.596  1.00 30.25 ? 22   ILE A CG2   1 
ATOM   93   C  CD1   . ILE A 1 42  ? -7.039  -42.774 -102.536 1.00 21.10 ? 22   ILE A CD1   1 
ATOM   94   N  N     . LEU A 1 43  ? -7.519  -43.966 -96.912  1.00 21.07 ? 23   LEU A N     1 
ATOM   95   C  CA    . LEU A 1 43  ? -8.452  -44.090 -95.796  1.00 25.27 ? 23   LEU A CA    1 
ATOM   96   C  C     . LEU A 1 43  ? -9.577  -43.096 -96.061  1.00 23.99 ? 23   LEU A C     1 
ATOM   97   O  O     . LEU A 1 43  ? -9.332  -41.901 -96.214  1.00 27.54 ? 23   LEU A O     1 
ATOM   98   C  CB    . LEU A 1 43  ? -7.775  -43.749 -94.461  1.00 28.23 ? 23   LEU A CB    1 
ATOM   99   C  CG    . LEU A 1 43  ? -8.679  -43.888 -93.223  1.00 26.65 ? 23   LEU A CG    1 
ATOM   100  C  CD1   . LEU A 1 43  ? -8.907  -45.363 -92.929  1.00 29.58 ? 23   LEU A CD1   1 
ATOM   101  C  CD2   . LEU A 1 43  ? -8.041  -43.217 -92.018  1.00 27.77 ? 23   LEU A CD2   1 
ATOM   102  N  N     . ASP A 1 44  ? -10.806 -43.594 -96.146  1.00 28.16 ? 24   ASP A N     1 
ATOM   103  C  CA    . ASP A 1 44  ? -11.960 -42.735 -96.378  1.00 26.20 ? 24   ASP A CA    1 
ATOM   104  C  C     . ASP A 1 44  ? -12.487 -42.184 -95.060  1.00 24.33 ? 24   ASP A C     1 
ATOM   105  O  O     . ASP A 1 44  ? -12.685 -42.933 -94.103  1.00 27.38 ? 24   ASP A O     1 
ATOM   106  C  CB    . ASP A 1 44  ? -13.093 -43.509 -97.066  1.00 23.84 ? 24   ASP A CB    1 
ATOM   107  C  CG    . ASP A 1 44  ? -12.863 -43.693 -98.551  1.00 32.92 ? 24   ASP A CG    1 
ATOM   108  O  OD1   . ASP A 1 44  ? -11.905 -43.091 -99.090  1.00 31.63 ? 24   ASP A OD1   1 
ATOM   109  O  OD2   . ASP A 1 44  ? -13.653 -44.433 -99.181  1.00 28.70 ? 24   ASP A OD2   1 
ATOM   110  N  N     . LEU A 1 45  ? -12.713 -40.876 -95.017  1.00 27.47 ? 25   LEU A N     1 
ATOM   111  C  CA    . LEU A 1 45  ? -13.246 -40.224 -93.825  1.00 30.12 ? 25   LEU A CA    1 
ATOM   112  C  C     . LEU A 1 45  ? -14.643 -39.754 -94.195  1.00 30.53 ? 25   LEU A C     1 
ATOM   113  O  O     . LEU A 1 45  ? -14.807 -38.766 -94.909  1.00 29.25 ? 25   LEU A O     1 
ATOM   114  C  CB    . LEU A 1 45  ? -12.372 -39.036 -93.423  1.00 29.23 ? 25   LEU A CB    1 
ATOM   115  C  CG    . LEU A 1 45  ? -10.921 -39.342 -93.038  1.00 35.48 ? 25   LEU A CG    1 
ATOM   116  C  CD1   . LEU A 1 45  ? -10.220 -38.050 -92.644  1.00 32.19 ? 25   LEU A CD1   1 
ATOM   117  C  CD2   . LEU A 1 45  ? -10.875 -40.344 -91.896  1.00 33.20 ? 25   LEU A CD2   1 
ATOM   118  N  N     . VAL A 1 46  ? -15.648 -40.479 -93.716  1.00 34.78 ? 26   VAL A N     1 
ATOM   119  C  CA    . VAL A 1 46  ? -17.037 -40.168 -94.027  1.00 32.71 ? 26   VAL A CA    1 
ATOM   120  C  C     . VAL A 1 46  ? -17.707 -39.347 -92.932  1.00 36.68 ? 26   VAL A C     1 
ATOM   121  O  O     . VAL A 1 46  ? -17.532 -39.616 -91.742  1.00 32.47 ? 26   VAL A O     1 
ATOM   122  C  CB    . VAL A 1 46  ? -17.843 -41.468 -94.253  1.00 35.39 ? 26   VAL A CB    1 
ATOM   123  C  CG1   . VAL A 1 46  ? -19.267 -41.142 -94.683  1.00 36.67 ? 26   VAL A CG1   1 
ATOM   124  C  CG2   . VAL A 1 46  ? -17.152 -42.321 -95.308  1.00 39.30 ? 26   VAL A CG2   1 
ATOM   125  N  N     . ALA A 1 47  ? -18.478 -38.345 -93.343  1.00 33.98 ? 27   ALA A N     1 
ATOM   126  C  CA    . ALA A 1 47  ? -19.167 -37.487 -92.389  1.00 37.46 ? 27   ALA A CA    1 
ATOM   127  C  C     . ALA A 1 47  ? -20.133 -36.530 -93.065  1.00 39.39 ? 27   ALA A C     1 
ATOM   128  O  O     . ALA A 1 47  ? -19.868 -36.040 -94.162  1.00 35.72 ? 27   ALA A O     1 
ATOM   129  C  CB    . ALA A 1 47  ? -18.149 -36.695 -91.575  1.00 31.71 ? 27   ALA A CB    1 
ATOM   130  N  N     . GLU A 1 48  ? -21.256 -36.272 -92.398  1.00 38.85 ? 28   GLU A N     1 
ATOM   131  C  CA    . GLU A 1 48  ? -22.261 -35.340 -92.898  1.00 41.23 ? 28   GLU A CA    1 
ATOM   132  C  C     . GLU A 1 48  ? -21.762 -33.944 -92.531  1.00 39.47 ? 28   GLU A C     1 
ATOM   133  O  O     . GLU A 1 48  ? -21.237 -33.741 -91.436  1.00 40.75 ? 28   GLU A O     1 
ATOM   134  C  CB    . GLU A 1 48  ? -23.618 -35.597 -92.226  1.00 45.31 ? 28   GLU A CB    1 
ATOM   135  C  CG    . GLU A 1 48  ? -24.198 -36.985 -92.479  1.00 51.41 ? 28   GLU A CG    1 
ATOM   136  C  CD    . GLU A 1 48  ? -25.525 -37.204 -91.767  1.00 59.32 ? 28   GLU A CD    1 
ATOM   137  O  OE1   . GLU A 1 48  ? -25.562 -37.088 -90.522  1.00 57.71 ? 28   GLU A OE1   1 
ATOM   138  O  OE2   . GLU A 1 48  ? -26.530 -37.492 -92.454  1.00 58.41 ? 28   GLU A OE2   1 
ATOM   139  N  N     . VAL A 1 49  ? -21.916 -32.987 -93.441  1.00 38.34 ? 29   VAL A N     1 
ATOM   140  C  CA    . VAL A 1 49  ? -21.454 -31.628 -93.183  1.00 39.48 ? 29   VAL A CA    1 
ATOM   141  C  C     . VAL A 1 49  ? -22.415 -30.560 -93.693  1.00 37.88 ? 29   VAL A C     1 
ATOM   142  O  O     . VAL A 1 49  ? -23.227 -30.810 -94.585  1.00 40.33 ? 29   VAL A O     1 
ATOM   143  C  CB    . VAL A 1 49  ? -20.070 -31.378 -93.831  1.00 39.29 ? 29   VAL A CB    1 
ATOM   144  C  CG1   . VAL A 1 49  ? -19.036 -32.313 -93.230  1.00 38.66 ? 29   VAL A CG1   1 
ATOM   145  C  CG2   . VAL A 1 49  ? -20.155 -31.582 -95.335  1.00 35.83 ? 29   VAL A CG2   1 
ATOM   146  N  N     . PRO A 1 50  ? -22.333 -29.350 -93.122  1.00 39.78 ? 30   PRO A N     1 
ATOM   147  C  CA    . PRO A 1 50  ? -23.184 -28.218 -93.506  1.00 44.61 ? 30   PRO A CA    1 
ATOM   148  C  C     . PRO A 1 50  ? -22.761 -27.691 -94.876  1.00 46.59 ? 30   PRO A C     1 
ATOM   149  O  O     . PRO A 1 50  ? -21.616 -27.878 -95.290  1.00 46.63 ? 30   PRO A O     1 
ATOM   150  C  CB    . PRO A 1 50  ? -22.914 -27.188 -92.405  1.00 42.83 ? 30   PRO A CB    1 
ATOM   151  C  CG    . PRO A 1 50  ? -22.438 -28.017 -91.246  1.00 48.96 ? 30   PRO A CG    1 
ATOM   152  C  CD    . PRO A 1 50  ? -21.552 -29.023 -91.919  1.00 40.26 ? 30   PRO A CD    1 
ATOM   153  N  N     . SER A 1 51  ? -23.673 -27.029 -95.576  1.00 44.42 ? 31   SER A N     1 
ATOM   154  C  CA    . SER A 1 51  ? -23.344 -26.482 -96.886  1.00 45.58 ? 31   SER A CA    1 
ATOM   155  C  C     . SER A 1 51  ? -22.252 -25.420 -96.778  1.00 43.62 ? 31   SER A C     1 
ATOM   156  O  O     . SER A 1 51  ? -21.540 -25.150 -97.745  1.00 41.11 ? 31   SER A O     1 
ATOM   157  C  CB    . SER A 1 51  ? -24.590 -25.887 -97.542  1.00 47.69 ? 31   SER A CB    1 
ATOM   158  O  OG    . SER A 1 51  ? -25.519 -26.908 -97.859  1.00 48.21 ? 31   SER A OG    1 
ATOM   159  N  N     . SER A 1 52  ? -22.123 -24.817 -95.599  1.00 38.64 ? 32   SER A N     1 
ATOM   160  C  CA    . SER A 1 52  ? -21.107 -23.794 -95.381  1.00 43.88 ? 32   SER A CA    1 
ATOM   161  C  C     . SER A 1 52  ? -19.719 -24.425 -95.459  1.00 39.47 ? 32   SER A C     1 
ATOM   162  O  O     . SER A 1 52  ? -18.734 -23.748 -95.754  1.00 42.85 ? 32   SER A O     1 
ATOM   163  C  CB    . SER A 1 52  ? -21.303 -23.120 -94.014  1.00 38.14 ? 32   SER A CB    1 
ATOM   164  O  OG    . SER A 1 52  ? -21.269 -24.064 -92.956  1.00 36.33 ? 32   SER A OG    1 
ATOM   165  N  N     . PHE A 1 53  ? -19.650 -25.726 -95.199  1.00 37.66 ? 33   PHE A N     1 
ATOM   166  C  CA    . PHE A 1 53  ? -18.385 -26.448 -95.250  1.00 39.88 ? 33   PHE A CA    1 
ATOM   167  C  C     . PHE A 1 53  ? -17.911 -26.492 -96.704  1.00 36.85 ? 33   PHE A C     1 
ATOM   168  O  O     . PHE A 1 53  ? -16.778 -26.122 -97.012  1.00 37.20 ? 33   PHE A O     1 
ATOM   169  C  CB    . PHE A 1 53  ? -18.568 -27.873 -94.723  1.00 36.01 ? 33   PHE A CB    1 
ATOM   170  C  CG    . PHE A 1 53  ? -17.277 -28.597 -94.464  1.00 34.56 ? 33   PHE A CG    1 
ATOM   171  C  CD1   . PHE A 1 53  ? -16.624 -28.465 -93.244  1.00 36.86 ? 33   PHE A CD1   1 
ATOM   172  C  CD2   . PHE A 1 53  ? -16.713 -29.410 -95.441  1.00 32.75 ? 33   PHE A CD2   1 
ATOM   173  C  CE1   . PHE A 1 53  ? -15.428 -29.134 -92.996  1.00 38.86 ? 33   PHE A CE1   1 
ATOM   174  C  CE2   . PHE A 1 53  ? -15.519 -30.082 -95.207  1.00 35.81 ? 33   PHE A CE2   1 
ATOM   175  C  CZ    . PHE A 1 53  ? -14.874 -29.944 -93.980  1.00 39.84 ? 33   PHE A CZ    1 
ATOM   176  N  N     A LEU A 1 54  ? -18.787 -26.947 -97.593  0.50 36.82 ? 34   LEU A N     1 
ATOM   177  N  N     B LEU A 1 54  ? -18.787 -26.947 -97.592  0.50 36.57 ? 34   LEU A N     1 
ATOM   178  C  CA    A LEU A 1 54  ? -18.456 -27.033 -99.010  0.50 40.38 ? 34   LEU A CA    1 
ATOM   179  C  CA    B LEU A 1 54  ? -18.459 -27.033 -99.010  0.50 39.94 ? 34   LEU A CA    1 
ATOM   180  C  C     A LEU A 1 54  ? -18.093 -25.658 -99.563  0.50 40.32 ? 34   LEU A C     1 
ATOM   181  C  C     B LEU A 1 54  ? -18.093 -25.659 -99.562  0.50 40.06 ? 34   LEU A C     1 
ATOM   182  O  O     A LEU A 1 54  ? -17.166 -25.527 -100.362 0.50 40.63 ? 34   LEU A O     1 
ATOM   183  O  O     B LEU A 1 54  ? -17.165 -25.528 -100.360 0.50 40.50 ? 34   LEU A O     1 
ATOM   184  C  CB    A LEU A 1 54  ? -19.634 -27.612 -99.801  0.50 37.99 ? 34   LEU A CB    1 
ATOM   185  C  CB    B LEU A 1 54  ? -19.642 -27.605 -99.796  0.50 36.38 ? 34   LEU A CB    1 
ATOM   186  C  CG    A LEU A 1 54  ? -20.034 -29.066 -99.531  0.50 43.23 ? 34   LEU A CG    1 
ATOM   187  C  CG    B LEU A 1 54  ? -20.099 -29.021 -99.436  0.50 41.12 ? 34   LEU A CG    1 
ATOM   188  C  CD1   A LEU A 1 54  ? -20.555 -29.214 -98.109  0.50 44.99 ? 34   LEU A CD1   1 
ATOM   189  C  CD1   B LEU A 1 54  ? -21.297 -29.401 -100.292 0.50 41.23 ? 34   LEU A CD1   1 
ATOM   190  C  CD2   A LEU A 1 54  ? -21.102 -29.485 -100.529 0.50 42.91 ? 34   LEU A CD2   1 
ATOM   191  C  CD2   B LEU A 1 54  ? -18.959 -30.003 -99.650  0.50 37.92 ? 34   LEU A CD2   1 
ATOM   192  N  N     . ASP A 1 55  ? -18.826 -24.635 -99.132  1.00 40.49 ? 35   ASP A N     1 
ATOM   193  C  CA    . ASP A 1 55  ? -18.574 -23.270 -99.587  1.00 41.37 ? 35   ASP A CA    1 
ATOM   194  C  C     . ASP A 1 55  ? -17.237 -22.741 -99.078  1.00 38.45 ? 35   ASP A C     1 
ATOM   195  O  O     . ASP A 1 55  ? -16.487 -22.111 -99.825  1.00 38.94 ? 35   ASP A O     1 
ATOM   196  C  CB    . ASP A 1 55  ? -19.695 -22.329 -99.130  1.00 44.11 ? 35   ASP A CB    1 
ATOM   197  C  CG    . ASP A 1 55  ? -21.041 -22.681 -99.737  1.00 55.10 ? 35   ASP A CG    1 
ATOM   198  O  OD1   . ASP A 1 55  ? -21.129 -22.787 -100.978 1.00 57.88 ? 35   ASP A OD1   1 
ATOM   199  O  OD2   . ASP A 1 55  ? -22.014 -22.845 -98.970  1.00 64.26 ? 35   ASP A OD2   1 
ATOM   200  N  N     . GLU A 1 56  ? -16.950 -22.992 -97.803  1.00 33.40 ? 36   GLU A N     1 
ATOM   201  C  CA    . GLU A 1 56  ? -15.705 -22.541 -97.189  1.00 38.89 ? 36   GLU A CA    1 
ATOM   202  C  C     . GLU A 1 56  ? -14.470 -23.124 -97.868  1.00 33.42 ? 36   GLU A C     1 
ATOM   203  O  O     . GLU A 1 56  ? -13.425 -22.478 -97.928  1.00 38.71 ? 36   GLU A O     1 
ATOM   204  C  CB    . GLU A 1 56  ? -15.685 -22.913 -95.706  1.00 36.85 ? 36   GLU A CB    1 
ATOM   205  C  CG    . GLU A 1 56  ? -16.538 -22.018 -94.823  1.00 51.11 ? 36   GLU A CG    1 
ATOM   206  C  CD    . GLU A 1 56  ? -16.727 -22.594 -93.434  1.00 55.37 ? 36   GLU A CD    1 
ATOM   207  O  OE1   . GLU A 1 56  ? -15.727 -23.034 -92.830  1.00 61.20 ? 36   GLU A OE1   1 
ATOM   208  O  OE2   . GLU A 1 56  ? -17.877 -22.601 -92.946  1.00 63.03 ? 36   GLU A OE2   1 
ATOM   209  N  N     . PHE A 1 57  ? -14.593 -24.347 -98.374  1.00 36.77 ? 37   PHE A N     1 
ATOM   210  C  CA    . PHE A 1 57  ? -13.474 -25.009 -99.038  1.00 34.77 ? 37   PHE A CA    1 
ATOM   211  C  C     . PHE A 1 57  ? -13.593 -25.003 -100.556 1.00 36.72 ? 37   PHE A C     1 
ATOM   212  O  O     . PHE A 1 57  ? -12.887 -25.739 -101.249 1.00 35.42 ? 37   PHE A O     1 
ATOM   213  C  CB    . PHE A 1 57  ? -13.337 -26.442 -98.524  1.00 34.44 ? 37   PHE A CB    1 
ATOM   214  C  CG    . PHE A 1 57  ? -12.746 -26.530 -97.150  1.00 33.41 ? 37   PHE A CG    1 
ATOM   215  C  CD1   . PHE A 1 57  ? -11.412 -26.193 -96.932  1.00 33.95 ? 37   PHE A CD1   1 
ATOM   216  C  CD2   . PHE A 1 57  ? -13.526 -26.913 -96.064  1.00 32.72 ? 37   PHE A CD2   1 
ATOM   217  C  CE1   . PHE A 1 57  ? -10.863 -26.236 -95.652  1.00 31.61 ? 37   PHE A CE1   1 
ATOM   218  C  CE2   . PHE A 1 57  ? -12.987 -26.957 -94.781  1.00 31.54 ? 37   PHE A CE2   1 
ATOM   219  C  CZ    . PHE A 1 57  ? -11.654 -26.618 -94.574  1.00 32.48 ? 37   PHE A CZ    1 
ATOM   220  N  N     . PHE A 1 58  ? -14.498 -24.172 -101.062 1.00 38.50 ? 38   PHE A N     1 
ATOM   221  C  CA    . PHE A 1 58  ? -14.713 -24.025 -102.496 1.00 40.07 ? 38   PHE A CA    1 
ATOM   222  C  C     . PHE A 1 58  ? -14.931 -25.344 -103.230 1.00 39.89 ? 38   PHE A C     1 
ATOM   223  O  O     . PHE A 1 58  ? -14.329 -25.597 -104.273 1.00 38.27 ? 38   PHE A O     1 
ATOM   224  C  CB    . PHE A 1 58  ? -13.530 -23.271 -103.101 1.00 43.12 ? 38   PHE A CB    1 
ATOM   225  C  CG    . PHE A 1 58  ? -13.315 -21.915 -102.497 1.00 46.40 ? 38   PHE A CG    1 
ATOM   226  C  CD1   . PHE A 1 58  ? -14.212 -20.881 -102.744 1.00 44.01 ? 38   PHE A CD1   1 
ATOM   227  C  CD2   . PHE A 1 58  ? -12.234 -21.678 -101.654 1.00 47.35 ? 38   PHE A CD2   1 
ATOM   228  C  CE1   . PHE A 1 58  ? -14.039 -19.630 -102.162 1.00 49.78 ? 38   PHE A CE1   1 
ATOM   229  C  CE2   . PHE A 1 58  ? -12.050 -20.430 -101.063 1.00 50.71 ? 38   PHE A CE2   1 
ATOM   230  C  CZ    . PHE A 1 58  ? -12.954 -19.404 -101.318 1.00 54.89 ? 38   PHE A CZ    1 
ATOM   231  N  N     . LEU A 1 59  ? -15.802 -26.180 -102.680 1.00 37.00 ? 39   LEU A N     1 
ATOM   232  C  CA    . LEU A 1 59  ? -16.118 -27.469 -103.281 1.00 39.48 ? 39   LEU A CA    1 
ATOM   233  C  C     . LEU A 1 59  ? -17.469 -27.402 -103.986 1.00 39.92 ? 39   LEU A C     1 
ATOM   234  O  O     . LEU A 1 59  ? -18.351 -26.657 -103.570 1.00 42.23 ? 39   LEU A O     1 
ATOM   235  C  CB    . LEU A 1 59  ? -16.169 -28.553 -102.200 1.00 37.77 ? 39   LEU A CB    1 
ATOM   236  C  CG    . LEU A 1 59  ? -14.846 -28.990 -101.567 1.00 36.97 ? 39   LEU A CG    1 
ATOM   237  C  CD1   . LEU A 1 59  ? -15.116 -29.773 -100.288 1.00 41.50 ? 39   LEU A CD1   1 
ATOM   238  C  CD2   . LEU A 1 59  ? -14.065 -29.838 -102.561 1.00 34.88 ? 39   LEU A CD2   1 
ATOM   239  N  N     . LYS A 1 60  ? -17.624 -28.170 -105.061 1.00 44.84 ? 40   LYS A N     1 
ATOM   240  C  CA    . LYS A 1 60  ? -18.893 -28.210 -105.776 1.00 45.56 ? 40   LYS A CA    1 
ATOM   241  C  C     . LYS A 1 60  ? -19.563 -29.544 -105.465 1.00 46.68 ? 40   LYS A C     1 
ATOM   242  O  O     . LYS A 1 60  ? -19.037 -30.610 -105.790 1.00 43.77 ? 40   LYS A O     1 
ATOM   243  C  CB    . LYS A 1 60  ? -18.697 -28.053 -107.290 1.00 46.54 ? 40   LYS A CB    1 
ATOM   244  C  CG    . LYS A 1 60  ? -17.812 -29.092 -107.951 1.00 55.82 ? 40   LYS A CG    1 
ATOM   245  C  CD    . LYS A 1 60  ? -16.374 -28.619 -108.027 1.00 59.96 ? 40   LYS A CD    1 
ATOM   246  C  CE    . LYS A 1 60  ? -15.509 -29.609 -108.787 1.00 55.07 ? 40   LYS A CE    1 
ATOM   247  N  NZ    . LYS A 1 60  ? -14.105 -29.134 -108.885 1.00 58.61 ? 40   LYS A NZ    1 
ATOM   248  N  N     . ARG A 1 61  ? -20.721 -29.474 -104.820 1.00 45.93 ? 41   ARG A N     1 
ATOM   249  C  CA    . ARG A 1 61  ? -21.467 -30.665 -104.433 1.00 48.82 ? 41   ARG A CA    1 
ATOM   250  C  C     . ARG A 1 61  ? -21.575 -31.704 -105.547 1.00 49.24 ? 41   ARG A C     1 
ATOM   251  O  O     . ARG A 1 61  ? -21.945 -31.382 -106.675 1.00 48.12 ? 41   ARG A O     1 
ATOM   252  C  CB    . ARG A 1 61  ? -22.871 -30.268 -103.960 1.00 48.60 ? 41   ARG A CB    1 
ATOM   253  C  CG    . ARG A 1 61  ? -23.701 -31.434 -103.447 1.00 50.92 ? 41   ARG A CG    1 
ATOM   254  C  CD    . ARG A 1 61  ? -25.093 -31.010 -102.984 1.00 49.83 ? 41   ARG A CD    1 
ATOM   255  N  NE    . ARG A 1 61  ? -25.064 -30.089 -101.851 1.00 51.44 ? 41   ARG A NE    1 
ATOM   256  C  CZ    . ARG A 1 61  ? -25.019 -28.765 -101.957 1.00 53.73 ? 41   ARG A CZ    1 
ATOM   257  N  NH1   . ARG A 1 61  ? -25.000 -28.190 -103.152 1.00 50.51 ? 41   ARG A NH1   1 
ATOM   258  N  NH2   . ARG A 1 61  ? -24.999 -28.012 -100.865 1.00 56.39 ? 41   ARG A NH2   1 
ATOM   259  N  N     . GLY A 1 62  ? -21.237 -32.950 -105.223 1.00 47.19 ? 42   GLY A N     1 
ATOM   260  C  CA    . GLY A 1 62  ? -21.334 -34.023 -106.197 1.00 46.17 ? 42   GLY A CA    1 
ATOM   261  C  C     . GLY A 1 62  ? -20.097 -34.353 -107.013 1.00 49.21 ? 42   GLY A C     1 
ATOM   262  O  O     . GLY A 1 62  ? -20.087 -35.347 -107.736 1.00 46.15 ? 42   GLY A O     1 
ATOM   263  N  N     . ASP A 1 63  ? -19.055 -33.537 -106.912 1.00 48.40 ? 43   ASP A N     1 
ATOM   264  C  CA    . ASP A 1 63  ? -17.838 -33.798 -107.670 1.00 46.77 ? 43   ASP A CA    1 
ATOM   265  C  C     . ASP A 1 63  ? -16.746 -34.465 -106.839 1.00 43.95 ? 43   ASP A C     1 
ATOM   266  O  O     . ASP A 1 63  ? -16.701 -34.317 -105.617 1.00 38.89 ? 43   ASP A O     1 
ATOM   267  C  CB    . ASP A 1 63  ? -17.303 -32.498 -108.274 1.00 54.83 ? 43   ASP A CB    1 
ATOM   268  C  CG    . ASP A 1 63  ? -18.139 -32.011 -109.443 1.00 60.30 ? 43   ASP A CG    1 
ATOM   269  O  OD1   . ASP A 1 63  ? -19.357 -31.803 -109.264 1.00 65.57 ? 43   ASP A OD1   1 
ATOM   270  O  OD2   . ASP A 1 63  ? -17.577 -31.836 -110.544 1.00 66.97 ? 43   ASP A OD2   1 
ATOM   271  N  N     . ALA A 1 64  ? -15.879 -35.211 -107.520 1.00 37.85 ? 44   ALA A N     1 
ATOM   272  C  CA    . ALA A 1 64  ? -14.760 -35.902 -106.885 1.00 37.38 ? 44   ALA A CA    1 
ATOM   273  C  C     . ALA A 1 64  ? -13.492 -35.244 -107.413 1.00 38.81 ? 44   ALA A C     1 
ATOM   274  O  O     . ALA A 1 64  ? -13.259 -35.218 -108.623 1.00 40.08 ? 44   ALA A O     1 
ATOM   275  C  CB    . ALA A 1 64  ? -14.777 -37.382 -107.249 1.00 39.22 ? 44   ALA A CB    1 
ATOM   276  N  N     . THR A 1 65  ? -12.671 -34.719 -106.509 1.00 33.24 ? 45   THR A N     1 
ATOM   277  C  CA    . THR A 1 65  ? -11.456 -34.028 -106.916 1.00 31.68 ? 45   THR A CA    1 
ATOM   278  C  C     . THR A 1 65  ? -10.259 -34.293 -106.012 1.00 31.45 ? 45   THR A C     1 
ATOM   279  O  O     . THR A 1 65  ? -10.370 -34.951 -104.978 1.00 28.19 ? 45   THR A O     1 
ATOM   280  C  CB    . THR A 1 65  ? -11.690 -32.509 -106.935 1.00 37.53 ? 45   THR A CB    1 
ATOM   281  O  OG1   . THR A 1 65  ? -12.129 -32.086 -105.638 1.00 35.61 ? 45   THR A OG1   1 
ATOM   282  C  CG2   . THR A 1 65  ? -12.750 -32.140 -107.961 1.00 36.54 ? 45   THR A CG2   1 
ATOM   283  N  N     . LEU A 1 66  ? -9.107  -33.781 -106.430 1.00 26.72 ? 46   LEU A N     1 
ATOM   284  C  CA    . LEU A 1 66  ? -7.883  -33.904 -105.657 1.00 23.59 ? 46   LEU A CA    1 
ATOM   285  C  C     . LEU A 1 66  ? -7.746  -32.580 -104.914 1.00 20.96 ? 46   LEU A C     1 
ATOM   286  O  O     . LEU A 1 66  ? -7.935  -31.512 -105.503 1.00 24.95 ? 46   LEU A O     1 
ATOM   287  C  CB    . LEU A 1 66  ? -6.679  -34.121 -106.579 1.00 25.94 ? 46   LEU A CB    1 
ATOM   288  C  CG    . LEU A 1 66  ? -6.609  -35.460 -107.318 1.00 30.84 ? 46   LEU A CG    1 
ATOM   289  C  CD1   . LEU A 1 66  ? -5.351  -35.495 -108.185 1.00 29.75 ? 46   LEU A CD1   1 
ATOM   290  C  CD2   . LEU A 1 66  ? -6.589  -36.610 -106.313 1.00 24.61 ? 46   LEU A CD2   1 
ATOM   291  N  N     . ALA A 1 67  ? -7.417  -32.660 -103.631 1.00 23.74 ? 47   ALA A N     1 
ATOM   292  C  CA    . ALA A 1 67  ? -7.270  -31.487 -102.772 1.00 22.60 ? 47   ALA A CA    1 
ATOM   293  C  C     . ALA A 1 67  ? -6.368  -30.416 -103.372 1.00 30.14 ? 47   ALA A C     1 
ATOM   294  O  O     . ALA A 1 67  ? -5.280  -30.717 -103.871 1.00 25.05 ? 47   ALA A O     1 
ATOM   295  C  CB    . ALA A 1 67  ? -6.726  -31.910 -101.413 1.00 25.98 ? 47   ALA A CB    1 
ATOM   296  N  N     . THR A 1 68  ? -6.834  -29.169 -103.315 1.00 26.30 ? 48   THR A N     1 
ATOM   297  C  CA    . THR A 1 68  ? -6.076  -28.026 -103.812 1.00 26.53 ? 48   THR A CA    1 
ATOM   298  C  C     . THR A 1 68  ? -5.302  -27.476 -102.620 1.00 26.01 ? 48   THR A C     1 
ATOM   299  O  O     . THR A 1 68  ? -5.570  -27.849 -101.478 1.00 28.58 ? 48   THR A O     1 
ATOM   300  C  CB    . THR A 1 68  ? -7.005  -26.918 -104.354 1.00 32.13 ? 48   THR A CB    1 
ATOM   301  O  OG1   . THR A 1 68  ? -7.848  -26.443 -103.296 1.00 31.03 ? 48   THR A OG1   1 
ATOM   302  C  CG2   . THR A 1 68  ? -7.878  -27.455 -105.479 1.00 33.01 ? 48   THR A CG2   1 
ATOM   303  N  N     . PRO A 1 69  ? -4.331  -26.584 -102.863 1.00 24.58 ? 49   PRO A N     1 
ATOM   304  C  CA    . PRO A 1 69  ? -3.540  -26.007 -101.774 1.00 28.99 ? 49   PRO A CA    1 
ATOM   305  C  C     . PRO A 1 69  ? -4.377  -25.342 -100.680 1.00 33.54 ? 49   PRO A C     1 
ATOM   306  O  O     . PRO A 1 69  ? -4.050  -25.439 -99.496  1.00 35.54 ? 49   PRO A O     1 
ATOM   307  C  CB    . PRO A 1 69  ? -2.636  -25.012 -102.499 1.00 30.14 ? 49   PRO A CB    1 
ATOM   308  C  CG    . PRO A 1 69  ? -2.424  -25.674 -103.828 1.00 33.46 ? 49   PRO A CG    1 
ATOM   309  C  CD    . PRO A 1 69  ? -3.824  -26.132 -104.172 1.00 31.05 ? 49   PRO A CD    1 
ATOM   310  N  N     . GLU A 1 70  ? -5.465  -24.685 -101.069 1.00 31.27 ? 50   GLU A N     1 
ATOM   311  C  CA    . GLU A 1 70  ? -6.309  -24.004 -100.093 1.00 37.28 ? 50   GLU A CA    1 
ATOM   312  C  C     . GLU A 1 70  ? -7.287  -24.939 -99.376  1.00 35.48 ? 50   GLU A C     1 
ATOM   313  O  O     . GLU A 1 70  ? -8.109  -24.493 -98.580  1.00 39.42 ? 50   GLU A O     1 
ATOM   314  C  CB    . GLU A 1 70  ? -7.072  -22.860 -100.769 1.00 42.56 ? 50   GLU A CB    1 
ATOM   315  C  CG    . GLU A 1 70  ? -8.191  -23.306 -101.695 1.00 52.50 ? 50   GLU A CG    1 
ATOM   316  C  CD    . GLU A 1 70  ? -8.843  -22.141 -102.421 1.00 59.27 ? 50   GLU A CD    1 
ATOM   317  O  OE1   . GLU A 1 70  ? -9.090  -21.097 -101.778 1.00 61.30 ? 50   GLU A OE1   1 
ATOM   318  O  OE2   . GLU A 1 70  ? -9.117  -22.273 -103.633 1.00 58.15 ? 50   GLU A OE2   1 
ATOM   319  N  N     . GLN A 1 71  ? -7.188  -26.236 -99.651  1.00 35.43 ? 51   GLN A N     1 
ATOM   320  C  CA    . GLN A 1 71  ? -8.061  -27.226 -99.023  1.00 34.01 ? 51   GLN A CA    1 
ATOM   321  C  C     . GLN A 1 71  ? -7.264  -28.189 -98.155  1.00 33.45 ? 51   GLN A C     1 
ATOM   322  O  O     . GLN A 1 71  ? -7.795  -29.185 -97.675  1.00 38.50 ? 51   GLN A O     1 
ATOM   323  C  CB    . GLN A 1 71  ? -8.807  -28.026 -100.095 1.00 25.75 ? 51   GLN A CB    1 
ATOM   324  C  CG    . GLN A 1 71  ? -9.852  -27.236 -100.845 1.00 30.41 ? 51   GLN A CG    1 
ATOM   325  C  CD    . GLN A 1 71  ? -10.390 -27.979 -102.048 1.00 28.96 ? 51   GLN A CD    1 
ATOM   326  O  OE1   . GLN A 1 71  ? -11.432 -27.621 -102.594 1.00 39.48 ? 51   GLN A OE1   1 
ATOM   327  N  NE2   . GLN A 1 71  ? -9.674  -29.012 -102.479 1.00 24.57 ? 51   GLN A NE2   1 
ATOM   328  N  N     . MET A 1 72  ? -5.990  -27.888 -97.948  1.00 38.73 ? 52   MET A N     1 
ATOM   329  C  CA    . MET A 1 72  ? -5.135  -28.767 -97.163  1.00 41.01 ? 52   MET A CA    1 
ATOM   330  C  C     . MET A 1 72  ? -5.505  -28.900 -95.690  1.00 41.75 ? 52   MET A C     1 
ATOM   331  O  O     . MET A 1 72  ? -5.039  -29.815 -95.013  1.00 41.34 ? 52   MET A O     1 
ATOM   332  C  CB    . MET A 1 72  ? -3.678  -28.332 -97.309  1.00 46.46 ? 52   MET A CB    1 
ATOM   333  C  CG    . MET A 1 72  ? -2.799  -29.413 -97.928  1.00 52.74 ? 52   MET A CG    1 
ATOM   334  S  SD    . MET A 1 72  ? -3.591  -30.301 -99.294  1.00 45.28 ? 52   MET A SD    1 
ATOM   335  C  CE    . MET A 1 72  ? -4.184  -31.763 -98.449  1.00 51.77 ? 52   MET A CE    1 
ATOM   336  N  N     . ARG A 1 73  ? -6.343  -28.001 -95.189  1.00 40.19 ? 53   ARG A N     1 
ATOM   337  C  CA    . ARG A 1 73  ? -6.755  -28.078 -93.794  1.00 39.89 ? 53   ARG A CA    1 
ATOM   338  C  C     . ARG A 1 73  ? -8.135  -28.721 -93.690  1.00 34.65 ? 53   ARG A C     1 
ATOM   339  O  O     . ARG A 1 73  ? -8.725  -28.773 -92.615  1.00 31.15 ? 53   ARG A O     1 
ATOM   340  C  CB    . ARG A 1 73  ? -6.769  -26.681 -93.165  1.00 41.51 ? 53   ARG A CB    1 
ATOM   341  N  N     . ILE A 1 74  ? -8.636  -29.234 -94.810  1.00 34.47 ? 54   ILE A N     1 
ATOM   342  C  CA    . ILE A 1 74  ? -9.957  -29.852 -94.834  1.00 29.55 ? 54   ILE A CA    1 
ATOM   343  C  C     . ILE A 1 74  ? -10.065 -31.107 -93.970  1.00 31.74 ? 54   ILE A C     1 
ATOM   344  O  O     . ILE A 1 74  ? -11.075 -31.322 -93.302  1.00 27.32 ? 54   ILE A O     1 
ATOM   345  C  CB    . ILE A 1 74  ? -10.381 -30.195 -96.286  1.00 34.68 ? 54   ILE A CB    1 
ATOM   346  C  CG1   . ILE A 1 74  ? -11.851 -30.614 -96.316  1.00 37.22 ? 54   ILE A CG1   1 
ATOM   347  C  CG2   . ILE A 1 74  ? -9.512  -31.317 -96.841  1.00 31.04 ? 54   ILE A CG2   1 
ATOM   348  C  CD1   . ILE A 1 74  ? -12.410 -30.758 -97.716  1.00 38.74 ? 54   ILE A CD1   1 
ATOM   349  N  N     . TYR A 1 75  ? -9.025  -31.934 -93.968  1.00 32.08 ? 55   TYR A N     1 
ATOM   350  C  CA    . TYR A 1 75  ? -9.067  -33.160 -93.183  1.00 31.79 ? 55   TYR A CA    1 
ATOM   351  C  C     . TYR A 1 75  ? -9.050  -32.908 -91.676  1.00 34.85 ? 55   TYR A C     1 
ATOM   352  O  O     . TYR A 1 75  ? -9.810  -33.532 -90.934  1.00 34.91 ? 55   TYR A O     1 
ATOM   353  C  CB    . TYR A 1 75  ? -7.921  -34.081 -93.611  1.00 34.95 ? 55   TYR A CB    1 
ATOM   354  C  CG    . TYR A 1 75  ? -7.927  -34.305 -95.107  1.00 26.86 ? 55   TYR A CG    1 
ATOM   355  C  CD1   . TYR A 1 75  ? -6.983  -33.686 -95.928  1.00 28.70 ? 55   TYR A CD1   1 
ATOM   356  C  CD2   . TYR A 1 75  ? -8.941  -35.046 -95.713  1.00 29.69 ? 55   TYR A CD2   1 
ATOM   357  C  CE1   . TYR A 1 75  ? -7.051  -33.788 -97.309  1.00 22.18 ? 55   TYR A CE1   1 
ATOM   358  C  CE2   . TYR A 1 75  ? -9.024  -35.157 -97.098  1.00 24.07 ? 55   TYR A CE2   1 
ATOM   359  C  CZ    . TYR A 1 75  ? -8.079  -34.523 -97.890  1.00 26.47 ? 55   TYR A CZ    1 
ATOM   360  O  OH    . TYR A 1 75  ? -8.182  -34.594 -99.258  1.00 28.45 ? 55   TYR A OH    1 
ATOM   361  N  N     . SER A 1 76  ? -8.202  -31.992 -91.218  1.00 36.08 ? 56   SER A N     1 
ATOM   362  C  CA    . SER A 1 76  ? -8.150  -31.687 -89.792  1.00 36.93 ? 56   SER A CA    1 
ATOM   363  C  C     . SER A 1 76  ? -9.438  -30.968 -89.380  1.00 34.32 ? 56   SER A C     1 
ATOM   364  O  O     . SER A 1 76  ? -9.936  -31.151 -88.270  1.00 34.54 ? 56   SER A O     1 
ATOM   365  C  CB    . SER A 1 76  ? -6.931  -30.814 -89.470  1.00 36.03 ? 56   SER A CB    1 
ATOM   366  O  OG    . SER A 1 76  ? -6.967  -29.597 -90.192  1.00 45.56 ? 56   SER A OG    1 
ATOM   367  N  N     . THR A 1 77  ? -9.978  -30.158 -90.285  1.00 36.30 ? 57   THR A N     1 
ATOM   368  C  CA    . THR A 1 77  ? -11.213 -29.420 -90.018  1.00 37.06 ? 57   THR A CA    1 
ATOM   369  C  C     . THR A 1 77  ? -12.409 -30.365 -90.016  1.00 38.75 ? 57   THR A C     1 
ATOM   370  O  O     . THR A 1 77  ? -13.441 -30.084 -89.405  1.00 39.01 ? 57   THR A O     1 
ATOM   371  C  CB    . THR A 1 77  ? -11.465 -28.340 -91.092  1.00 33.03 ? 57   THR A CB    1 
ATOM   372  O  OG1   . THR A 1 77  ? -10.387 -27.397 -91.087  1.00 35.61 ? 57   THR A OG1   1 
ATOM   373  C  CG2   . THR A 1 77  ? -12.773 -27.610 -90.821  1.00 35.03 ? 57   THR A CG2   1 
ATOM   374  N  N     A LEU A 1 78  ? -12.265 -31.491 -90.705  0.50 37.44 ? 58   LEU A N     1 
ATOM   375  N  N     B LEU A 1 78  ? -12.259 -31.492 -90.702  0.50 38.18 ? 58   LEU A N     1 
ATOM   376  C  CA    A LEU A 1 78  ? -13.337 -32.473 -90.787  0.50 36.91 ? 58   LEU A CA    1 
ATOM   377  C  CA    B LEU A 1 78  ? -13.323 -32.479 -90.801  0.50 38.49 ? 58   LEU A CA    1 
ATOM   378  C  C     A LEU A 1 78  ? -13.575 -33.140 -89.436  0.50 40.75 ? 58   LEU A C     1 
ATOM   379  C  C     B LEU A 1 78  ? -13.561 -33.175 -89.459  0.50 41.62 ? 58   LEU A C     1 
ATOM   380  O  O     A LEU A 1 78  ? -14.697 -33.540 -89.121  0.50 39.87 ? 58   LEU A O     1 
ATOM   381  O  O     B LEU A 1 78  ? -14.671 -33.625 -89.174  0.50 40.83 ? 58   LEU A O     1 
ATOM   382  C  CB    A LEU A 1 78  ? -12.994 -33.537 -91.834  0.50 33.55 ? 58   LEU A CB    1 
ATOM   383  C  CB    B LEU A 1 78  ? -12.965 -33.503 -91.886  0.50 37.32 ? 58   LEU A CB    1 
ATOM   384  C  CG    A LEU A 1 78  ? -14.063 -34.586 -92.150  0.50 31.39 ? 58   LEU A CG    1 
ATOM   385  C  CG    B LEU A 1 78  ? -14.091 -34.246 -92.612  0.50 37.58 ? 58   LEU A CG    1 
ATOM   386  C  CD1   A LEU A 1 78  ? -15.322 -33.900 -92.656  0.50 29.57 ? 58   LEU A CD1   1 
ATOM   387  C  CD1   B LEU A 1 78  ? -14.671 -35.314 -91.727  0.50 36.32 ? 58   LEU A CD1   1 
ATOM   388  C  CD2   A LEU A 1 78  ? -13.530 -35.554 -93.198  0.50 30.09 ? 58   LEU A CD2   1 
ATOM   389  C  CD2   B LEU A 1 78  ? -15.164 -33.262 -93.040  0.50 38.48 ? 58   LEU A CD2   1 
ATOM   390  N  N     . ASP A 1 79  ? -12.517 -33.249 -88.637  1.00 42.00 ? 59   ASP A N     1 
ATOM   391  C  CA    . ASP A 1 79  ? -12.609 -33.885 -87.323  1.00 46.14 ? 59   ASP A CA    1 
ATOM   392  C  C     . ASP A 1 79  ? -13.723 -33.371 -86.416  1.00 46.61 ? 59   ASP A C     1 
ATOM   393  O  O     . ASP A 1 79  ? -14.264 -34.126 -85.610  1.00 47.96 ? 59   ASP A O     1 
ATOM   394  C  CB    . ASP A 1 79  ? -11.273 -33.777 -86.584  1.00 51.78 ? 59   ASP A CB    1 
ATOM   395  C  CG    . ASP A 1 79  ? -10.253 -34.783 -87.080  1.00 63.41 ? 59   ASP A CG    1 
ATOM   396  O  OD1   . ASP A 1 79  ? -10.581 -35.989 -87.112  1.00 69.35 ? 59   ASP A OD1   1 
ATOM   397  O  OD2   . ASP A 1 79  ? -9.126  -34.373 -87.432  1.00 69.24 ? 59   ASP A OD2   1 
ATOM   398  N  N     . GLN A 1 80  ? -14.067 -32.094 -86.537  1.00 46.12 ? 60   GLN A N     1 
ATOM   399  C  CA    . GLN A 1 80  ? -15.121 -31.535 -85.699  1.00 46.61 ? 60   GLN A CA    1 
ATOM   400  C  C     . GLN A 1 80  ? -16.508 -31.983 -86.147  1.00 43.68 ? 60   GLN A C     1 
ATOM   401  O  O     . GLN A 1 80  ? -17.520 -31.524 -85.618  1.00 43.60 ? 60   GLN A O     1 
ATOM   402  C  CB    . GLN A 1 80  ? -15.028 -30.006 -85.683  1.00 51.32 ? 60   GLN A CB    1 
ATOM   403  C  CG    . GLN A 1 80  ? -15.025 -29.357 -87.052  1.00 53.94 ? 60   GLN A CG    1 
ATOM   404  C  CD    . GLN A 1 80  ? -14.605 -27.898 -87.004  1.00 56.20 ? 60   GLN A CD    1 
ATOM   405  O  OE1   . GLN A 1 80  ? -14.517 -27.234 -88.034  1.00 58.70 ? 60   GLN A OE1   1 
ATOM   406  N  NE2   . GLN A 1 80  ? -14.340 -27.395 -85.804  1.00 61.27 ? 60   GLN A NE2   1 
ATOM   407  N  N     . PHE A 1 81  ? -16.557 -32.887 -87.120  1.00 41.54 ? 61   PHE A N     1 
ATOM   408  C  CA    . PHE A 1 81  ? -17.833 -33.393 -87.609  1.00 41.32 ? 61   PHE A CA    1 
ATOM   409  C  C     . PHE A 1 81  ? -17.988 -34.891 -87.373  1.00 41.77 ? 61   PHE A C     1 
ATOM   410  O  O     . PHE A 1 81  ? -18.791 -35.553 -88.027  1.00 40.12 ? 61   PHE A O     1 
ATOM   411  C  CB    . PHE A 1 81  ? -17.997 -33.062 -89.094  1.00 45.02 ? 61   PHE A CB    1 
ATOM   412  C  CG    . PHE A 1 81  ? -18.232 -31.603 -89.356  1.00 44.78 ? 61   PHE A CG    1 
ATOM   413  C  CD1   . PHE A 1 81  ? -19.458 -31.021 -89.048  1.00 47.97 ? 61   PHE A CD1   1 
ATOM   414  C  CD2   . PHE A 1 81  ? -17.214 -30.798 -89.854  1.00 40.93 ? 61   PHE A CD2   1 
ATOM   415  C  CE1   . PHE A 1 81  ? -19.665 -29.653 -89.229  1.00 46.30 ? 61   PHE A CE1   1 
ATOM   416  C  CE2   . PHE A 1 81  ? -17.411 -29.430 -90.039  1.00 43.48 ? 61   PHE A CE2   1 
ATOM   417  C  CZ    . PHE A 1 81  ? -18.638 -28.856 -89.725  1.00 47.45 ? 61   PHE A CZ    1 
ATOM   418  N  N     . ASN A 1 82  ? -17.212 -35.418 -86.431  1.00 41.29 ? 62   ASN A N     1 
ATOM   419  C  CA    . ASN A 1 82  ? -17.276 -36.835 -86.082  1.00 45.98 ? 62   ASN A CA    1 
ATOM   420  C  C     . ASN A 1 82  ? -17.160 -37.750 -87.305  1.00 45.96 ? 62   ASN A C     1 
ATOM   421  O  O     . ASN A 1 82  ? -18.119 -38.421 -87.689  1.00 46.84 ? 62   ASN A O     1 
ATOM   422  C  CB    . ASN A 1 82  ? -18.588 -37.120 -85.342  1.00 51.89 ? 62   ASN A CB    1 
ATOM   423  C  CG    . ASN A 1 82  ? -18.731 -38.576 -84.947  1.00 63.93 ? 62   ASN A CG    1 
ATOM   424  O  OD1   . ASN A 1 82  ? -17.912 -39.113 -84.201  1.00 69.45 ? 62   ASN A OD1   1 
ATOM   425  N  ND2   . ASN A 1 82  ? -19.777 -39.226 -85.449  1.00 66.37 ? 62   ASN A ND2   1 
ATOM   426  N  N     . PRO A 1 83  ? -15.971 -37.788 -87.928  1.00 43.48 ? 63   PRO A N     1 
ATOM   427  C  CA    . PRO A 1 83  ? -15.680 -38.605 -89.114  1.00 42.06 ? 63   PRO A CA    1 
ATOM   428  C  C     . PRO A 1 83  ? -15.543 -40.098 -88.819  1.00 40.05 ? 63   PRO A C     1 
ATOM   429  O  O     . PRO A 1 83  ? -14.986 -40.485 -87.794  1.00 39.01 ? 63   PRO A O     1 
ATOM   430  C  CB    . PRO A 1 83  ? -14.359 -38.022 -89.625  1.00 39.44 ? 63   PRO A CB    1 
ATOM   431  C  CG    . PRO A 1 83  ? -14.282 -36.660 -88.983  1.00 45.81 ? 63   PRO A CG    1 
ATOM   432  C  CD    . PRO A 1 83  ? -14.839 -36.900 -87.626  1.00 45.63 ? 63   PRO A CD    1 
ATOM   433  N  N     . THR A 1 84  ? -16.045 -40.925 -89.731  1.00 39.83 ? 64   THR A N     1 
ATOM   434  C  CA    . THR A 1 84  ? -15.955 -42.377 -89.602  1.00 40.70 ? 64   THR A CA    1 
ATOM   435  C  C     . THR A 1 84  ? -14.848 -42.860 -90.540  1.00 42.77 ? 64   THR A C     1 
ATOM   436  O  O     . THR A 1 84  ? -14.912 -42.621 -91.745  1.00 45.46 ? 64   THR A O     1 
ATOM   437  C  CB    . THR A 1 84  ? -17.272 -43.067 -90.021  1.00 42.95 ? 64   THR A CB    1 
ATOM   438  O  OG1   . THR A 1 84  ? -18.339 -42.626 -89.174  1.00 51.40 ? 64   THR A OG1   1 
ATOM   439  C  CG2   . THR A 1 84  ? -17.138 -44.581 -89.913  1.00 47.49 ? 64   THR A CG2   1 
ATOM   440  N  N     . SER A 1 85  ? -13.841 -43.534 -89.990  1.00 37.29 ? 65   SER A N     1 
ATOM   441  C  CA    . SER A 1 85  ? -12.727 -44.035 -90.793  1.00 36.14 ? 65   SER A CA    1 
ATOM   442  C  C     . SER A 1 85  ? -13.002 -45.421 -91.374  1.00 38.47 ? 65   SER A C     1 
ATOM   443  O  O     . SER A 1 85  ? -13.248 -46.380 -90.640  1.00 34.28 ? 65   SER A O     1 
ATOM   444  C  CB    . SER A 1 85  ? -11.450 -44.081 -89.951  1.00 37.18 ? 65   SER A CB    1 
ATOM   445  O  OG    . SER A 1 85  ? -11.102 -42.789 -89.490  1.00 41.28 ? 65   SER A OG    1 
ATOM   446  N  N     . LEU A 1 86  ? -12.946 -45.518 -92.699  1.00 31.65 ? 66   LEU A N     1 
ATOM   447  C  CA    . LEU A 1 86  ? -13.188 -46.776 -93.390  1.00 32.18 ? 66   LEU A CA    1 
ATOM   448  C  C     . LEU A 1 86  ? -12.139 -46.980 -94.480  1.00 30.68 ? 66   LEU A C     1 
ATOM   449  O  O     . LEU A 1 86  ? -11.674 -46.020 -95.098  1.00 28.74 ? 66   LEU A O     1 
ATOM   450  C  CB    . LEU A 1 86  ? -14.586 -46.768 -94.014  1.00 37.58 ? 66   LEU A CB    1 
ATOM   451  C  CG    . LEU A 1 86  ? -15.747 -46.567 -93.036  1.00 39.98 ? 66   LEU A CG    1 
ATOM   452  C  CD1   . LEU A 1 86  ? -17.051 -46.446 -93.804  1.00 43.73 ? 66   LEU A CD1   1 
ATOM   453  C  CD2   . LEU A 1 86  ? -15.804 -47.734 -92.060  1.00 44.52 ? 66   LEU A CD2   1 
ATOM   454  N  N     . PRO A 1 87  ? -11.746 -48.235 -94.728  1.00 29.81 ? 67   PRO A N     1 
ATOM   455  C  CA    . PRO A 1 87  ? -10.742 -48.448 -95.773  1.00 29.88 ? 67   PRO A CA    1 
ATOM   456  C  C     . PRO A 1 87  ? -11.301 -47.978 -97.112  1.00 31.32 ? 67   PRO A C     1 
ATOM   457  O  O     . PRO A 1 87  ? -12.475 -48.201 -97.416  1.00 32.30 ? 67   PRO A O     1 
ATOM   458  C  CB    . PRO A 1 87  ? -10.500 -49.955 -95.713  1.00 28.71 ? 67   PRO A CB    1 
ATOM   459  C  CG    . PRO A 1 87  ? -11.828 -50.491 -95.289  1.00 33.43 ? 67   PRO A CG    1 
ATOM   460  C  CD    . PRO A 1 87  ? -12.258 -49.518 -94.213  1.00 28.94 ? 67   PRO A CD    1 
ATOM   461  N  N     . GLY A 1 88  ? -10.464 -47.308 -97.898  1.00 25.63 ? 68   GLY A N     1 
ATOM   462  C  CA    . GLY A 1 88  ? -10.902 -46.809 -99.187  1.00 25.33 ? 68   GLY A CA    1 
ATOM   463  C  C     . GLY A 1 88  ? -9.893  -47.088 -100.284 1.00 24.17 ? 68   GLY A C     1 
ATOM   464  O  O     . GLY A 1 88  ? -9.022  -47.938 -100.127 1.00 25.01 ? 68   GLY A O     1 
ATOM   465  N  N     . GLY A 1 89  ? -9.994  -46.351 -101.385 1.00 23.64 ? 69   GLY A N     1 
ATOM   466  C  CA    . GLY A 1 89  ? -9.100  -46.569 -102.510 1.00 22.06 ? 69   GLY A CA    1 
ATOM   467  C  C     . GLY A 1 89  ? -9.858  -47.466 -103.472 1.00 26.11 ? 69   GLY A C     1 
ATOM   468  O  O     . GLY A 1 89  ? -10.416 -48.481 -103.054 1.00 25.56 ? 69   GLY A O     1 
ATOM   469  N  N     . SER A 1 90  ? -9.887  -47.100 -104.751 1.00 25.25 ? 70   SER A N     1 
ATOM   470  C  CA    . SER A 1 90  ? -10.617 -47.874 -105.756 1.00 22.41 ? 70   SER A CA    1 
ATOM   471  C  C     . SER A 1 90  ? -10.230 -49.354 -105.834 1.00 21.65 ? 70   SER A C     1 
ATOM   472  O  O     . SER A 1 90  ? -11.075 -50.230 -105.621 1.00 21.68 ? 70   SER A O     1 
ATOM   473  C  CB    . SER A 1 90  ? -10.469 -47.208 -107.131 1.00 20.97 ? 70   SER A CB    1 
ATOM   474  O  OG    . SER A 1 90  ? -11.162 -47.928 -108.140 1.00 21.40 ? 70   SER A OG    1 
ATOM   475  N  N     . ALA A 1 91  ? -8.970  -49.648 -106.136 1.00 21.72 ? 71   ALA A N     1 
ATOM   476  C  CA    . ALA A 1 91  ? -8.538  -51.041 -106.227 1.00 24.16 ? 71   ALA A CA    1 
ATOM   477  C  C     . ALA A 1 91  ? -8.706  -51.788 -104.908 1.00 22.58 ? 71   ALA A C     1 
ATOM   478  O  O     . ALA A 1 91  ? -9.062  -52.964 -104.901 1.00 22.50 ? 71   ALA A O     1 
ATOM   479  C  CB    . ALA A 1 91  ? -7.084  -51.122 -106.681 1.00 25.04 ? 71   ALA A CB    1 
ATOM   480  N  N     . LEU A 1 92  ? -8.449  -51.108 -103.793 1.00 22.49 ? 72   LEU A N     1 
ATOM   481  C  CA    . LEU A 1 92  ? -8.575  -51.737 -102.476 1.00 21.84 ? 72   LEU A CA    1 
ATOM   482  C  C     . LEU A 1 92  ? -10.020 -52.134 -102.204 1.00 24.51 ? 72   LEU A C     1 
ATOM   483  O  O     . LEU A 1 92  ? -10.287 -53.173 -101.591 1.00 24.25 ? 72   LEU A O     1 
ATOM   484  C  CB    . LEU A 1 92  ? -8.068  -50.787 -101.382 1.00 22.90 ? 72   LEU A CB    1 
ATOM   485  C  CG    . LEU A 1 92  ? -7.908  -51.395 -99.984  1.00 24.66 ? 72   LEU A CG    1 
ATOM   486  C  CD1   . LEU A 1 92  ? -7.030  -52.650 -100.051 1.00 23.84 ? 72   LEU A CD1   1 
ATOM   487  C  CD2   . LEU A 1 92  ? -7.293  -50.360 -99.056  1.00 25.74 ? 72   LEU A CD2   1 
ATOM   488  N  N     . ASN A 1 93  ? -10.951 -51.305 -102.662 1.00 19.96 ? 73   ASN A N     1 
ATOM   489  C  CA    . ASN A 1 93  ? -12.373 -51.585 -102.500 1.00 22.81 ? 73   ASN A CA    1 
ATOM   490  C  C     . ASN A 1 93  ? -12.752 -52.824 -103.319 1.00 27.25 ? 73   ASN A C     1 
ATOM   491  O  O     . ASN A 1 93  ? -13.522 -53.673 -102.863 1.00 25.64 ? 73   ASN A O     1 
ATOM   492  C  CB    . ASN A 1 93  ? -13.205 -50.378 -102.949 1.00 20.25 ? 73   ASN A CB    1 
ATOM   493  C  CG    . ASN A 1 93  ? -13.322 -49.220 -102.132 1.00 26.13 ? 73   ASN A CG    1 
ATOM   494  O  OD1   . ASN A 1 93  ? -12.907 -49.327 -100.977 1.00 0.00  ? 73   ASN A OD1   1 
ATOM   495  N  ND2   . ASN A 1 93  ? -13.873 -48.104 -102.594 1.00 0.00  ? 73   ASN A ND2   1 
ATOM   496  N  N     . SER A 1 94  ? -12.197 -52.935 -104.521 1.00 22.19 ? 74   SER A N     1 
ATOM   497  C  CA    . SER A 1 94  ? -12.484 -54.080 -105.379 1.00 21.22 ? 74   SER A CA    1 
ATOM   498  C  C     . SER A 1 94  ? -11.910 -55.386 -104.831 1.00 23.99 ? 74   SER A C     1 
ATOM   499  O  O     . SER A 1 94  ? -12.575 -56.413 -104.888 1.00 24.64 ? 74   SER A O     1 
ATOM   500  C  CB    . SER A 1 94  ? -11.954 -53.842 -106.796 1.00 20.62 ? 74   SER A CB    1 
ATOM   501  O  OG    . SER A 1 94  ? -12.637 -52.770 -107.423 1.00 23.96 ? 74   SER A OG    1 
ATOM   502  N  N     . VAL A 1 95  ? -10.687 -55.372 -104.303 1.00 23.27 ? 75   VAL A N     1 
ATOM   503  C  CA    . VAL A 1 95  ? -10.141 -56.621 -103.765 1.00 23.36 ? 75   VAL A CA    1 
ATOM   504  C  C     . VAL A 1 95  ? -10.780 -56.992 -102.430 1.00 24.92 ? 75   VAL A C     1 
ATOM   505  O  O     . VAL A 1 95  ? -10.797 -58.164 -102.059 1.00 26.12 ? 75   VAL A O     1 
ATOM   506  C  CB    . VAL A 1 95  ? -8.602  -56.593 -103.592 1.00 26.75 ? 75   VAL A CB    1 
ATOM   507  C  CG1   . VAL A 1 95  ? -7.932  -56.609 -104.947 1.00 31.32 ? 75   VAL A CG1   1 
ATOM   508  C  CG2   . VAL A 1 95  ? -8.183  -55.384 -102.788 1.00 26.47 ? 75   VAL A CG2   1 
ATOM   509  N  N     . ARG A 1 96  ? -11.305 -56.009 -101.701 1.00 22.01 ? 76   ARG A N     1 
ATOM   510  C  CA    . ARG A 1 96  ? -11.962 -56.333 -100.439 1.00 26.41 ? 76   ARG A CA    1 
ATOM   511  C  C     . ARG A 1 96  ? -13.249 -57.090 -100.769 1.00 21.34 ? 76   ARG A C     1 
ATOM   512  O  O     . ARG A 1 96  ? -13.664 -57.972 -100.020 1.00 26.83 ? 76   ARG A O     1 
ATOM   513  C  CB    . ARG A 1 96  ? -12.255 -55.072 -99.614  1.00 25.89 ? 76   ARG A CB    1 
ATOM   514  C  CG    . ARG A 1 96  ? -11.016 -54.515 -98.912  1.00 27.77 ? 76   ARG A CG    1 
ATOM   515  C  CD    . ARG A 1 96  ? -11.373 -53.507 -97.815  1.00 30.93 ? 76   ARG A CD    1 
ATOM   516  N  NE    . ARG A 1 96  ? -12.172 -52.394 -98.321  1.00 37.12 ? 76   ARG A NE    1 
ATOM   517  C  CZ    . ARG A 1 96  ? -13.422 -52.140 -97.948  1.00 39.76 ? 76   ARG A CZ    1 
ATOM   518  N  NH1   . ARG A 1 96  ? -14.022 -52.921 -97.058  1.00 37.69 ? 76   ARG A NH1   1 
ATOM   519  N  NH2   . ARG A 1 96  ? -14.071 -51.103 -98.462  1.00 42.48 ? 76   ARG A NH2   1 
ATOM   520  N  N     . VAL A 1 97  ? -13.879 -56.745 -101.889 1.00 23.18 ? 77   VAL A N     1 
ATOM   521  C  CA    . VAL A 1 97  ? -15.086 -57.451 -102.314 1.00 24.00 ? 77   VAL A CA    1 
ATOM   522  C  C     . VAL A 1 97  ? -14.704 -58.898 -102.635 1.00 28.65 ? 77   VAL A C     1 
ATOM   523  O  O     . VAL A 1 97  ? -15.388 -59.841 -102.229 1.00 27.46 ? 77   VAL A O     1 
ATOM   524  C  CB    . VAL A 1 97  ? -15.719 -56.811 -103.582 1.00 24.08 ? 77   VAL A CB    1 
ATOM   525  C  CG1   . VAL A 1 97  ? -16.746 -57.758 -104.185 1.00 25.16 ? 77   VAL A CG1   1 
ATOM   526  C  CG2   . VAL A 1 97  ? -16.379 -55.486 -103.234 1.00 22.40 ? 77   VAL A CG2   1 
ATOM   527  N  N     . VAL A 1 98  ? -13.603 -59.070 -103.362 1.00 26.81 ? 78   VAL A N     1 
ATOM   528  C  CA    . VAL A 1 98  ? -13.143 -60.404 -103.725 1.00 25.94 ? 78   VAL A CA    1 
ATOM   529  C  C     . VAL A 1 98  ? -12.848 -61.234 -102.478 1.00 26.69 ? 78   VAL A C     1 
ATOM   530  O  O     . VAL A 1 98  ? -13.274 -62.385 -102.367 1.00 26.71 ? 78   VAL A O     1 
ATOM   531  C  CB    . VAL A 1 98  ? -11.862 -60.350 -104.590 1.00 24.42 ? 78   VAL A CB    1 
ATOM   532  C  CG1   . VAL A 1 98  ? -11.446 -61.759 -104.969 1.00 25.32 ? 78   VAL A CG1   1 
ATOM   533  C  CG2   . VAL A 1 98  ? -12.103 -59.509 -105.836 1.00 24.62 ? 78   VAL A CG2   1 
ATOM   534  N  N     . GLN A 1 99  ? -12.114 -60.642 -101.540 1.00 25.26 ? 79   GLN A N     1 
ATOM   535  C  CA    . GLN A 1 99  ? -11.763 -61.322 -100.299 1.00 26.81 ? 79   GLN A CA    1 
ATOM   536  C  C     . GLN A 1 99  ? -13.001 -61.715 -99.492  1.00 26.68 ? 79   GLN A C     1 
ATOM   537  O  O     . GLN A 1 99  ? -13.061 -62.808 -98.928  1.00 30.34 ? 79   GLN A O     1 
ATOM   538  C  CB    . GLN A 1 99  ? -10.860 -60.423 -99.450  1.00 30.81 ? 79   GLN A CB    1 
ATOM   539  C  CG    . GLN A 1 99  ? -10.515 -60.970 -98.069  1.00 27.79 ? 79   GLN A CG    1 
ATOM   540  C  CD    . GLN A 1 99  ? -9.752  -62.282 -98.117  1.00 28.02 ? 79   GLN A CD    1 
ATOM   541  O  OE1   . GLN A 1 99  ? -8.788  -62.426 -98.865  1.00 28.37 ? 79   GLN A OE1   1 
ATOM   542  N  NE2   . GLN A 1 99  ? -10.168 -63.238 -97.296  1.00 26.31 ? 79   GLN A NE2   1 
ATOM   543  N  N     . LYS A 1 100 ? -13.986 -60.824 -99.435  1.00 27.04 ? 80   LYS A N     1 
ATOM   544  C  CA    . LYS A 1 100 ? -15.210 -61.092 -98.688  1.00 28.32 ? 80   LYS A CA    1 
ATOM   545  C  C     . LYS A 1 100 ? -15.943 -62.298 -99.264  1.00 31.25 ? 80   LYS A C     1 
ATOM   546  O  O     . LYS A 1 100 ? -16.470 -63.130 -98.521  1.00 29.87 ? 80   LYS A O     1 
ATOM   547  C  CB    . LYS A 1 100 ? -16.121 -59.863 -98.712  1.00 32.22 ? 80   LYS A CB    1 
ATOM   548  N  N     . LEU A 1 101 ? -15.972 -62.394 -100.588 1.00 25.52 ? 81   LEU A N     1 
ATOM   549  C  CA    . LEU A 1 101 ? -16.650 -63.499 -101.254 1.00 28.32 ? 81   LEU A CA    1 
ATOM   550  C  C     . LEU A 1 101 ? -15.897 -64.832 -101.181 1.00 32.44 ? 81   LEU A C     1 
ATOM   551  O  O     . LEU A 1 101 ? -16.517 -65.896 -101.124 1.00 32.86 ? 81   LEU A O     1 
ATOM   552  C  CB    . LEU A 1 101 ? -16.932 -63.130 -102.713 1.00 28.42 ? 81   LEU A CB    1 
ATOM   553  C  CG    . LEU A 1 101 ? -17.868 -61.927 -102.862 1.00 26.05 ? 81   LEU A CG    1 
ATOM   554  C  CD1   . LEU A 1 101 ? -18.059 -61.584 -104.328 1.00 34.08 ? 81   LEU A CD1   1 
ATOM   555  C  CD2   . LEU A 1 101 ? -19.205 -62.243 -102.210 1.00 37.96 ? 81   LEU A CD2   1 
ATOM   556  N  N     . LEU A 1 102 ? -14.569 -64.781 -101.184 1.00 29.31 ? 82   LEU A N     1 
ATOM   557  C  CA    . LEU A 1 102 ? -13.776 -66.003 -101.110 1.00 32.44 ? 82   LEU A CA    1 
ATOM   558  C  C     . LEU A 1 102 ? -13.622 -66.489 -99.668  1.00 35.81 ? 82   LEU A C     1 
ATOM   559  O  O     . LEU A 1 102 ? -13.397 -67.677 -99.430  1.00 34.36 ? 82   LEU A O     1 
ATOM   560  C  CB    . LEU A 1 102 ? -12.408 -65.795 -101.771 1.00 28.43 ? 82   LEU A CB    1 
ATOM   561  C  CG    . LEU A 1 102 ? -12.466 -65.821 -103.305 1.00 29.13 ? 82   LEU A CG    1 
ATOM   562  C  CD1   . LEU A 1 102 ? -11.124 -65.413 -103.911 1.00 26.51 ? 82   LEU A CD1   1 
ATOM   563  C  CD2   . LEU A 1 102 ? -12.862 -67.213 -103.764 1.00 32.87 ? 82   LEU A CD2   1 
ATOM   564  N  N     . ARG A 1 103 ? -13.733 -65.561 -98.719  1.00 30.53 ? 83   ARG A N     1 
ATOM   565  C  CA    . ARG A 1 103 ? -13.673 -65.864 -97.289  1.00 34.66 ? 83   ARG A CA    1 
ATOM   566  C  C     . ARG A 1 103 ? -12.349 -66.352 -96.697  1.00 31.34 ? 83   ARG A C     1 
ATOM   567  O  O     . ARG A 1 103 ? -11.906 -65.846 -95.666  1.00 34.56 ? 83   ARG A O     1 
ATOM   568  C  CB    . ARG A 1 103 ? -14.786 -66.862 -96.952  1.00 39.68 ? 83   ARG A CB    1 
ATOM   569  C  CG    . ARG A 1 103 ? -16.166 -66.367 -97.365  1.00 46.98 ? 83   ARG A CG    1 
ATOM   570  C  CD    . ARG A 1 103 ? -17.230 -67.448 -97.266  1.00 61.94 ? 83   ARG A CD    1 
ATOM   571  N  NE    . ARG A 1 103 ? -17.436 -67.903 -95.895  1.00 72.90 ? 83   ARG A NE    1 
ATOM   572  C  CZ    . ARG A 1 103 ? -18.404 -68.736 -95.523  1.00 77.24 ? 83   ARG A CZ    1 
ATOM   573  N  NH1   . ARG A 1 103 ? -19.259 -69.207 -96.422  1.00 77.39 ? 83   ARG A NH1   1 
ATOM   574  N  NH2   . ARG A 1 103 ? -18.519 -69.096 -94.252  1.00 79.24 ? 83   ARG A NH2   1 
ATOM   575  N  N     . LYS A 1 104 ? -11.717 -67.333 -97.326  1.00 31.24 ? 84   LYS A N     1 
ATOM   576  C  CA    . LYS A 1 104 ? -10.455 -67.843 -96.801  1.00 31.40 ? 84   LYS A CA    1 
ATOM   577  C  C     . LYS A 1 104 ? -9.428  -66.723 -96.711  1.00 33.98 ? 84   LYS A C     1 
ATOM   578  O  O     . LYS A 1 104 ? -9.232  -65.968 -97.664  1.00 31.66 ? 84   LYS A O     1 
ATOM   579  C  CB    . LYS A 1 104 ? -9.925  -68.968 -97.692  1.00 37.32 ? 84   LYS A CB    1 
ATOM   580  C  CG    . LYS A 1 104 ? -10.904 -70.114 -97.853  1.00 42.17 ? 84   LYS A CG    1 
ATOM   581  C  CD    . LYS A 1 104 ? -10.295 -71.275 -98.611  1.00 50.12 ? 84   LYS A CD    1 
ATOM   582  C  CE    . LYS A 1 104 ? -11.303 -72.405 -98.752  1.00 52.93 ? 84   LYS A CE    1 
ATOM   583  N  NZ    . LYS A 1 104 ? -11.833 -72.829 -97.423  1.00 57.17 ? 84   LYS A NZ    1 
ATOM   584  N  N     . PRO A 1 105 ? -8.764  -66.588 -95.555  1.00 34.91 ? 85   PRO A N     1 
ATOM   585  C  CA    . PRO A 1 105 ? -7.760  -65.533 -95.394  1.00 30.42 ? 85   PRO A CA    1 
ATOM   586  C  C     . PRO A 1 105 ? -6.722  -65.588 -96.510  1.00 29.28 ? 85   PRO A C     1 
ATOM   587  O  O     . PRO A 1 105 ? -6.296  -66.667 -96.917  1.00 26.79 ? 85   PRO A O     1 
ATOM   588  C  CB    . PRO A 1 105 ? -7.159  -65.842 -94.025  1.00 35.57 ? 85   PRO A CB    1 
ATOM   589  C  CG    . PRO A 1 105 ? -8.337  -66.393 -93.278  1.00 35.81 ? 85   PRO A CG    1 
ATOM   590  C  CD    . PRO A 1 105 ? -8.951  -67.331 -94.296  1.00 38.34 ? 85   PRO A CD    1 
ATOM   591  N  N     . GLY A 1 106 ? -6.336  -64.421 -97.013  1.00 29.68 ? 86   GLY A N     1 
ATOM   592  C  CA    . GLY A 1 106 ? -5.342  -64.371 -98.067  1.00 23.86 ? 86   GLY A CA    1 
ATOM   593  C  C     . GLY A 1 106 ? -5.845  -64.780 -99.436  1.00 24.55 ? 86   GLY A C     1 
ATOM   594  O  O     . GLY A 1 106 ? -5.047  -65.120 -100.304 1.00 24.75 ? 86   GLY A O     1 
ATOM   595  N  N     . SER A 1 107 ? -7.158  -64.751 -99.642  1.00 25.95 ? 87   SER A N     1 
ATOM   596  C  CA    . SER A 1 107 ? -7.717  -65.124 -100.939 1.00 24.62 ? 87   SER A CA    1 
ATOM   597  C  C     . SER A 1 107 ? -7.363  -64.080 -101.996 1.00 22.75 ? 87   SER A C     1 
ATOM   598  O  O     . SER A 1 107 ? -7.270  -64.389 -103.182 1.00 23.52 ? 87   SER A O     1 
ATOM   599  C  CB    . SER A 1 107 ? -9.236  -65.273 -100.845 1.00 27.39 ? 87   SER A CB    1 
ATOM   600  O  OG    . SER A 1 107 ? -9.586  -66.439 -100.119 1.00 26.18 ? 87   SER A OG    1 
ATOM   601  N  N     . ALA A 1 108 ? -7.181  -62.840 -101.553 1.00 23.18 ? 88   ALA A N     1 
ATOM   602  C  CA    . ALA A 1 108 ? -6.814  -61.750 -102.448 1.00 22.93 ? 88   ALA A CA    1 
ATOM   603  C  C     . ALA A 1 108 ? -5.605  -61.033 -101.857 1.00 27.68 ? 88   ALA A C     1 
ATOM   604  O  O     . ALA A 1 108 ? -5.490  -60.898 -100.639 1.00 25.66 ? 88   ALA A O     1 
ATOM   605  C  CB    . ALA A 1 108 ? -7.984  -60.777 -102.611 1.00 22.67 ? 88   ALA A CB    1 
ATOM   606  N  N     . GLY A 1 109 ? -4.702  -60.593 -102.729 1.00 22.43 ? 89   GLY A N     1 
ATOM   607  C  CA    . GLY A 1 109 ? -3.510  -59.894 -102.288 1.00 21.47 ? 89   GLY A CA    1 
ATOM   608  C  C     . GLY A 1 109 ? -3.501  -58.480 -102.831 1.00 19.21 ? 89   GLY A C     1 
ATOM   609  O  O     . GLY A 1 109 ? -4.076  -58.214 -103.893 1.00 19.84 ? 89   GLY A O     1 
ATOM   610  N  N     . TYR A 1 110 ? -2.842  -57.574 -102.114 1.00 20.32 ? 90   TYR A N     1 
ATOM   611  C  CA    . TYR A 1 110 ? -2.797  -56.172 -102.514 1.00 19.74 ? 90   TYR A CA    1 
ATOM   612  C  C     . TYR A 1 110 ? -1.508  -55.469 -102.096 1.00 21.88 ? 90   TYR A C     1 
ATOM   613  O  O     . TYR A 1 110 ? -0.981  -55.724 -101.016 1.00 21.66 ? 90   TYR A O     1 
ATOM   614  C  CB    . TYR A 1 110 ? -3.981  -55.438 -101.872 1.00 20.67 ? 90   TYR A CB    1 
ATOM   615  C  CG    . TYR A 1 110 ? -4.054  -53.952 -102.153 1.00 20.84 ? 90   TYR A CG    1 
ATOM   616  C  CD1   . TYR A 1 110 ? -4.900  -53.455 -103.140 1.00 17.32 ? 90   TYR A CD1   1 
ATOM   617  C  CD2   . TYR A 1 110 ? -3.312  -53.038 -101.400 1.00 19.07 ? 90   TYR A CD2   1 
ATOM   618  C  CE1   . TYR A 1 110 ? -5.019  -52.094 -103.369 1.00 18.94 ? 90   TYR A CE1   1 
ATOM   619  C  CE2   . TYR A 1 110 ? -3.418  -51.666 -101.627 1.00 19.55 ? 90   TYR A CE2   1 
ATOM   620  C  CZ    . TYR A 1 110 ? -4.277  -51.203 -102.607 1.00 23.42 ? 90   TYR A CZ    1 
ATOM   621  O  OH    . TYR A 1 110 ? -4.427  -49.853 -102.800 1.00 24.53 ? 90   TYR A OH    1 
ATOM   622  N  N     . MET A 1 111 ? -1.006  -54.588 -102.962 1.00 20.77 ? 91   MET A N     1 
ATOM   623  C  CA    . MET A 1 111 ? 0.184   -53.794 -102.663 1.00 22.20 ? 91   MET A CA    1 
ATOM   624  C  C     . MET A 1 111 ? -0.030  -52.327 -103.037 1.00 21.01 ? 91   MET A C     1 
ATOM   625  O  O     . MET A 1 111 ? -0.659  -52.006 -104.045 1.00 21.43 ? 91   MET A O     1 
ATOM   626  C  CB    . MET A 1 111 ? 1.420   -54.320 -103.396 1.00 21.99 ? 91   MET A CB    1 
ATOM   627  C  CG    . MET A 1 111 ? 2.073   -55.528 -102.742 1.00 22.85 ? 91   MET A CG    1 
ATOM   628  S  SD    . MET A 1 111 ? 3.698   -55.811 -103.461 1.00 28.36 ? 91   MET A SD    1 
ATOM   629  C  CE    . MET A 1 111 ? 4.100   -57.410 -102.788 1.00 22.01 ? 91   MET A CE    1 
ATOM   630  N  N     . GLY A 1 112 ? 0.495   -51.444 -102.193 1.00 22.82 ? 92   GLY A N     1 
ATOM   631  C  CA    . GLY A 1 112 ? 0.398   -50.014 -102.411 1.00 21.14 ? 92   GLY A CA    1 
ATOM   632  C  C     . GLY A 1 112 ? 1.335   -49.379 -101.400 1.00 21.73 ? 92   GLY A C     1 
ATOM   633  O  O     . GLY A 1 112 ? 1.989   -50.096 -100.637 1.00 22.99 ? 92   GLY A O     1 
ATOM   634  N  N     . ALA A 1 113 ? 1.415   -48.054 -101.385 1.00 20.71 ? 93   ALA A N     1 
ATOM   635  C  CA    . ALA A 1 113 ? 2.286   -47.367 -100.436 1.00 21.31 ? 93   ALA A CA    1 
ATOM   636  C  C     . ALA A 1 113 ? 1.483   -46.532 -99.437  1.00 22.58 ? 93   ALA A C     1 
ATOM   637  O  O     . ALA A 1 113 ? 0.460   -45.946 -99.786  1.00 23.66 ? 93   ALA A O     1 
ATOM   638  C  CB    . ALA A 1 113 ? 3.280   -46.470 -101.188 1.00 18.25 ? 93   ALA A CB    1 
ATOM   639  N  N     . ILE A 1 114 ? 1.951   -46.496 -98.191  1.00 20.59 ? 94   ILE A N     1 
ATOM   640  C  CA    . ILE A 1 114 ? 1.303   -45.714 -97.141  1.00 23.51 ? 94   ILE A CA    1 
ATOM   641  C  C     . ILE A 1 114 ? 2.369   -44.854 -96.474  1.00 22.17 ? 94   ILE A C     1 
ATOM   642  O  O     . ILE A 1 114 ? 3.557   -44.995 -96.771  1.00 21.47 ? 94   ILE A O     1 
ATOM   643  C  CB    . ILE A 1 114 ? 0.646   -46.614 -96.054  1.00 24.15 ? 94   ILE A CB    1 
ATOM   644  C  CG1   . ILE A 1 114 ? 1.702   -47.507 -95.398  1.00 22.72 ? 94   ILE A CG1   1 
ATOM   645  C  CG2   . ILE A 1 114 ? -0.476  -47.442 -96.669  1.00 28.57 ? 94   ILE A CG2   1 
ATOM   646  C  CD1   . ILE A 1 114 ? 1.181   -48.309 -94.221  1.00 27.35 ? 94   ILE A CD1   1 
ATOM   647  N  N     . GLY A 1 115 ? 1.946   -43.956 -95.591  1.00 24.52 ? 95   GLY A N     1 
ATOM   648  C  CA    . GLY A 1 115 ? 2.900   -43.109 -94.901  1.00 26.21 ? 95   GLY A CA    1 
ATOM   649  C  C     . GLY A 1 115 ? 3.275   -43.736 -93.575  1.00 24.68 ? 95   GLY A C     1 
ATOM   650  O  O     . GLY A 1 115 ? 2.710   -44.755 -93.193  1.00 27.08 ? 95   GLY A O     1 
ATOM   651  N  N     . ASP A 1 116 ? 4.225   -43.138 -92.864  1.00 27.63 ? 96   ASP A N     1 
ATOM   652  C  CA    . ASP A 1 116 ? 4.639   -43.666 -91.568  1.00 30.93 ? 96   ASP A CA    1 
ATOM   653  C  C     . ASP A 1 116 ? 3.911   -42.899 -90.468  1.00 32.01 ? 96   ASP A C     1 
ATOM   654  O  O     . ASP A 1 116 ? 4.511   -42.472 -89.481  1.00 30.79 ? 96   ASP A O     1 
ATOM   655  C  CB    . ASP A 1 116 ? 6.161   -43.540 -91.409  1.00 35.13 ? 96   ASP A CB    1 
ATOM   656  C  CG    . ASP A 1 116 ? 6.641   -42.095 -91.414  1.00 42.14 ? 96   ASP A CG    1 
ATOM   657  O  OD1   . ASP A 1 116 ? 5.960   -41.232 -92.001  1.00 40.61 ? 96   ASP A OD1   1 
ATOM   658  O  OD2   . ASP A 1 116 ? 7.717   -41.825 -90.838  1.00 49.89 ? 96   ASP A OD2   1 
ATOM   659  N  N     . ASP A 1 117 ? 2.603   -42.749 -90.649  1.00 30.67 ? 97   ASP A N     1 
ATOM   660  C  CA    . ASP A 1 117 ? 1.761   -42.008 -89.717  1.00 30.96 ? 97   ASP A CA    1 
ATOM   661  C  C     . ASP A 1 117 ? 0.661   -42.862 -89.093  1.00 27.72 ? 97   ASP A C     1 
ATOM   662  O  O     . ASP A 1 117 ? 0.445   -44.006 -89.492  1.00 31.71 ? 97   ASP A O     1 
ATOM   663  C  CB    . ASP A 1 117 ? 1.125   -40.826 -90.450  1.00 27.39 ? 97   ASP A CB    1 
ATOM   664  C  CG    . ASP A 1 117 ? 0.365   -41.255 -91.691  1.00 31.86 ? 97   ASP A CG    1 
ATOM   665  O  OD1   . ASP A 1 117 ? -0.218  -40.383 -92.365  1.00 31.00 ? 97   ASP A OD1   1 
ATOM   666  O  OD2   . ASP A 1 117 ? 0.353   -42.468 -91.993  1.00 30.68 ? 97   ASP A OD2   1 
ATOM   667  N  N     . PRO A 1 118 ? -0.048  -42.312 -88.093  1.00 28.68 ? 98   PRO A N     1 
ATOM   668  C  CA    . PRO A 1 118 ? -1.128  -43.046 -87.431  1.00 28.16 ? 98   PRO A CA    1 
ATOM   669  C  C     . PRO A 1 118 ? -2.178  -43.548 -88.422  1.00 27.18 ? 98   PRO A C     1 
ATOM   670  O  O     . PRO A 1 118 ? -2.657  -44.678 -88.316  1.00 30.31 ? 98   PRO A O     1 
ATOM   671  C  CB    . PRO A 1 118 ? -1.696  -42.012 -86.463  1.00 30.60 ? 98   PRO A CB    1 
ATOM   672  C  CG    . PRO A 1 118 ? -0.474  -41.258 -86.052  1.00 32.60 ? 98   PRO A CG    1 
ATOM   673  C  CD    . PRO A 1 118 ? 0.236   -41.052 -87.381  1.00 33.26 ? 98   PRO A CD    1 
ATOM   674  N  N     A ARG A 1 119 ? -2.526  -42.704 -89.387  0.50 30.52 ? 99   ARG A N     1 
ATOM   675  N  N     B ARG A 1 119 ? -2.525  -42.702 -89.387  0.50 30.27 ? 99   ARG A N     1 
ATOM   676  C  CA    A ARG A 1 119 ? -3.526  -43.050 -90.392  0.50 27.19 ? 99   ARG A CA    1 
ATOM   677  C  CA    B ARG A 1 119 ? -3.519  -43.044 -90.399  0.50 26.61 ? 99   ARG A CA    1 
ATOM   678  C  C     A ARG A 1 119 ? -3.133  -44.302 -91.172  0.50 27.47 ? 99   ARG A C     1 
ATOM   679  C  C     B ARG A 1 119 ? -3.132  -44.305 -91.165  0.50 27.16 ? 99   ARG A C     1 
ATOM   680  O  O     A ARG A 1 119 ? -3.990  -45.091 -91.566  0.50 26.78 ? 99   ARG A O     1 
ATOM   681  O  O     B ARG A 1 119 ? -3.989  -45.102 -91.542  0.50 26.54 ? 99   ARG A O     1 
ATOM   682  C  CB    A ARG A 1 119 ? -3.724  -41.869 -91.346  0.50 29.66 ? 99   ARG A CB    1 
ATOM   683  C  CB    B ARG A 1 119 ? -3.689  -41.875 -91.374  0.50 28.46 ? 99   ARG A CB    1 
ATOM   684  C  CG    A ARG A 1 119 ? -5.002  -41.926 -92.160  0.50 34.47 ? 99   ARG A CG    1 
ATOM   685  C  CG    B ARG A 1 119 ? -4.811  -42.051 -92.378  0.50 31.80 ? 99   ARG A CG    1 
ATOM   686  C  CD    A ARG A 1 119 ? -5.462  -40.518 -92.511  0.50 35.99 ? 99   ARG A CD    1 
ATOM   687  C  CD    B ARG A 1 119 ? -5.062  -40.757 -93.144  0.50 34.73 ? 99   ARG A CD    1 
ATOM   688  N  NE    A ARG A 1 119 ? -4.519  -39.844 -93.395  0.50 30.54 ? 99   ARG A NE    1 
ATOM   689  N  NE    B ARG A 1 119 ? -5.194  -39.607 -92.249  0.50 36.63 ? 99   ARG A NE    1 
ATOM   690  C  CZ    A ARG A 1 119 ? -4.392  -38.525 -93.497  0.50 23.21 ? 99   ARG A CZ    1 
ATOM   691  C  CZ    B ARG A 1 119 ? -6.095  -39.504 -91.273  0.50 39.11 ? 99   ARG A CZ    1 
ATOM   692  N  NH1   A ARG A 1 119 ? -5.147  -37.713 -92.765  0.50 20.52 ? 99   ARG A NH1   1 
ATOM   693  N  NH1   B ARG A 1 119 ? -6.961  -40.480 -91.052  0.50 37.31 ? 99   ARG A NH1   1 
ATOM   694  N  NH2   A ARG A 1 119 ? -3.507  -38.018 -94.338  0.50 22.75 ? 99   ARG A NH2   1 
ATOM   695  N  NH2   B ARG A 1 119 ? -6.123  -38.422 -90.509  0.50 42.62 ? 99   ARG A NH2   1 
ATOM   696  N  N     . GLY A 1 120 ? -1.836  -44.482 -91.391  1.00 25.88 ? 100  GLY A N     1 
ATOM   697  C  CA    . GLY A 1 120 ? -1.374  -45.653 -92.114  1.00 28.79 ? 100  GLY A CA    1 
ATOM   698  C  C     . GLY A 1 120 ? -1.637  -46.912 -91.310  1.00 30.69 ? 100  GLY A C     1 
ATOM   699  O  O     . GLY A 1 120 ? -2.037  -47.941 -91.856  1.00 28.71 ? 100  GLY A O     1 
ATOM   700  N  N     . GLN A 1 121 ? -1.410  -46.824 -90.003  1.00 29.13 ? 101  GLN A N     1 
ATOM   701  C  CA    . GLN A 1 121 ? -1.618  -47.951 -89.102  1.00 31.14 ? 101  GLN A CA    1 
ATOM   702  C  C     . GLN A 1 121 ? -3.108  -48.285 -89.017  1.00 28.81 ? 101  GLN A C     1 
ATOM   703  O  O     . GLN A 1 121 ? -3.491  -49.453 -88.925  1.00 29.09 ? 101  GLN A O     1 
ATOM   704  C  CB    . GLN A 1 121 ? -1.076  -47.611 -87.711  1.00 37.46 ? 101  GLN A CB    1 
ATOM   705  C  CG    . GLN A 1 121 ? -1.031  -48.789 -86.747  1.00 46.26 ? 101  GLN A CG    1 
ATOM   706  C  CD    . GLN A 1 121 ? 0.028   -49.817 -87.115  1.00 54.60 ? 101  GLN A CD    1 
ATOM   707  O  OE1   . GLN A 1 121 ? 0.139   -50.862 -86.473  1.00 57.45 ? 101  GLN A OE1   1 
ATOM   708  N  NE2   . GLN A 1 121 ? 0.815   -49.523 -88.148  1.00 48.18 ? 101  GLN A NE2   1 
ATOM   709  N  N     . VAL A 1 122 ? -3.947  -47.252 -89.051  1.00 29.67 ? 102  VAL A N     1 
ATOM   710  C  CA    . VAL A 1 122 ? -5.392  -47.442 -88.991  1.00 29.76 ? 102  VAL A CA    1 
ATOM   711  C  C     . VAL A 1 122 ? -5.887  -48.194 -90.222  1.00 34.14 ? 102  VAL A C     1 
ATOM   712  O  O     . VAL A 1 122 ? -6.735  -49.077 -90.120  1.00 29.61 ? 102  VAL A O     1 
ATOM   713  C  CB    . VAL A 1 122 ? -6.134  -46.087 -88.904  1.00 32.39 ? 102  VAL A CB    1 
ATOM   714  C  CG1   . VAL A 1 122 ? -7.635  -46.297 -89.055  1.00 31.93 ? 102  VAL A CG1   1 
ATOM   715  C  CG2   . VAL A 1 122 ? -5.824  -45.414 -87.574  1.00 32.05 ? 102  VAL A CG2   1 
ATOM   716  N  N     . LEU A 1 123 ? -5.346  -47.847 -91.386  1.00 29.65 ? 103  LEU A N     1 
ATOM   717  C  CA    . LEU A 1 123 ? -5.746  -48.489 -92.637  1.00 28.41 ? 103  LEU A CA    1 
ATOM   718  C  C     . LEU A 1 123 ? -5.289  -49.941 -92.675  1.00 29.07 ? 103  LEU A C     1 
ATOM   719  O  O     . LEU A 1 123 ? -6.044  -50.837 -93.057  1.00 28.43 ? 103  LEU A O     1 
ATOM   720  C  CB    . LEU A 1 123 ? -5.153  -47.722 -93.828  1.00 27.77 ? 103  LEU A CB    1 
ATOM   721  C  CG    . LEU A 1 123 ? -5.518  -48.177 -95.245  1.00 26.38 ? 103  LEU A CG    1 
ATOM   722  C  CD1   . LEU A 1 123 ? -7.019  -48.113 -95.436  1.00 29.59 ? 103  LEU A CD1   1 
ATOM   723  C  CD2   . LEU A 1 123 ? -4.816  -47.273 -96.260  1.00 30.13 ? 103  LEU A CD2   1 
ATOM   724  N  N     . LYS A 1 124 ? -4.045  -50.172 -92.275  1.00 28.95 ? 104  LYS A N     1 
ATOM   725  C  CA    . LYS A 1 124 ? -3.490  -51.516 -92.268  1.00 33.19 ? 104  LYS A CA    1 
ATOM   726  C  C     . LYS A 1 124 ? -4.302  -52.438 -91.365  1.00 32.59 ? 104  LYS A C     1 
ATOM   727  O  O     . LYS A 1 124 ? -4.571  -53.587 -91.720  1.00 34.53 ? 104  LYS A O     1 
ATOM   728  C  CB    . LYS A 1 124 ? -2.030  -51.478 -91.808  1.00 33.28 ? 104  LYS A CB    1 
ATOM   729  C  CG    . LYS A 1 124 ? -1.370  -52.848 -91.710  1.00 41.96 ? 104  LYS A CG    1 
ATOM   730  C  CD    . LYS A 1 124 ? 0.140   -52.731 -91.543  1.00 48.70 ? 104  LYS A CD    1 
ATOM   731  C  CE    . LYS A 1 124 ? 0.777   -52.102 -92.777  1.00 54.06 ? 104  LYS A CE    1 
ATOM   732  N  NZ    . LYS A 1 124 ? 2.268   -52.129 -92.746  1.00 58.56 ? 104  LYS A NZ    1 
ATOM   733  N  N     . GLU A 1 125 ? -4.703  -51.928 -90.205  1.00 31.37 ? 105  GLU A N     1 
ATOM   734  C  CA    . GLU A 1 125 ? -5.480  -52.720 -89.256  1.00 34.75 ? 105  GLU A CA    1 
ATOM   735  C  C     . GLU A 1 125 ? -6.846  -53.087 -89.826  1.00 31.21 ? 105  GLU A C     1 
ATOM   736  O  O     . GLU A 1 125 ? -7.294  -54.227 -89.692  1.00 29.87 ? 105  GLU A O     1 
ATOM   737  C  CB    . GLU A 1 125 ? -5.650  -51.953 -87.947  1.00 36.76 ? 105  GLU A CB    1 
ATOM   738  N  N     . LEU A 1 126 ? -7.505  -52.120 -90.457  1.00 31.33 ? 106  LEU A N     1 
ATOM   739  C  CA    . LEU A 1 126 ? -8.820  -52.352 -91.047  1.00 32.30 ? 106  LEU A CA    1 
ATOM   740  C  C     . LEU A 1 126 ? -8.751  -53.437 -92.114  1.00 33.88 ? 106  LEU A C     1 
ATOM   741  O  O     . LEU A 1 126 ? -9.687  -54.218 -92.269  1.00 35.09 ? 106  LEU A O     1 
ATOM   742  C  CB    . LEU A 1 126 ? -9.372  -51.059 -91.660  1.00 35.11 ? 106  LEU A CB    1 
ATOM   743  C  CG    . LEU A 1 126 ? -10.135 -50.078 -90.761  1.00 38.95 ? 106  LEU A CG    1 
ATOM   744  C  CD1   . LEU A 1 126 ? -11.467 -50.688 -90.359  1.00 45.01 ? 106  LEU A CD1   1 
ATOM   745  C  CD2   . LEU A 1 126 ? -9.319  -49.742 -89.534  1.00 51.04 ? 106  LEU A CD2   1 
ATOM   746  N  N     . CYS A 1 127 ? -7.639  -53.486 -92.844  1.00 26.78 ? 107  CYS A N     1 
ATOM   747  C  CA    . CYS A 1 127 ? -7.464  -54.492 -93.890  1.00 30.85 ? 107  CYS A CA    1 
ATOM   748  C  C     . CYS A 1 127 ? -7.150  -55.875 -93.323  1.00 30.74 ? 107  CYS A C     1 
ATOM   749  O  O     . CYS A 1 127 ? -7.697  -56.880 -93.781  1.00 32.30 ? 107  CYS A O     1 
ATOM   750  C  CB    . CYS A 1 127 ? -6.353  -54.072 -94.853  1.00 23.19 ? 107  CYS A CB    1 
ATOM   751  S  SG    . CYS A 1 127 ? -6.797  -52.673 -95.925  1.00 30.85 ? 107  CYS A SG    1 
ATOM   752  N  N     . ASP A 1 128 ? -6.271  -55.925 -92.328  1.00 31.82 ? 108  ASP A N     1 
ATOM   753  C  CA    . ASP A 1 128 ? -5.891  -57.193 -91.714  1.00 38.54 ? 108  ASP A CA    1 
ATOM   754  C  C     . ASP A 1 128 ? -7.069  -57.923 -91.083  1.00 38.45 ? 108  ASP A C     1 
ATOM   755  O  O     . ASP A 1 128 ? -7.146  -59.150 -91.138  1.00 41.30 ? 108  ASP A O     1 
ATOM   756  C  CB    . ASP A 1 128 ? -4.816  -56.977 -90.645  1.00 40.09 ? 108  ASP A CB    1 
ATOM   757  C  CG    . ASP A 1 128 ? -3.489  -56.550 -91.231  1.00 50.66 ? 108  ASP A CG    1 
ATOM   758  O  OD1   . ASP A 1 128 ? -3.044  -57.177 -92.215  1.00 55.28 ? 108  ASP A OD1   1 
ATOM   759  O  OD2   . ASP A 1 128 ? -2.886  -55.592 -90.701  1.00 63.04 ? 108  ASP A OD2   1 
ATOM   760  N  N     . LYS A 1 129 ? -7.988  -57.177 -90.482  1.00 34.72 ? 109  LYS A N     1 
ATOM   761  C  CA    . LYS A 1 129 ? -9.124  -57.816 -89.843  1.00 37.19 ? 109  LYS A CA    1 
ATOM   762  C  C     . LYS A 1 129 ? -10.123 -58.395 -90.841  1.00 37.43 ? 109  LYS A C     1 
ATOM   763  O  O     . LYS A 1 129 ? -10.980 -59.199 -90.468  1.00 35.45 ? 109  LYS A O     1 
ATOM   764  C  CB    . LYS A 1 129 ? -9.817  -56.844 -88.884  1.00 42.61 ? 109  LYS A CB    1 
ATOM   765  C  CG    . LYS A 1 129 ? -10.822 -55.901 -89.499  1.00 41.11 ? 109  LYS A CG    1 
ATOM   766  C  CD    . LYS A 1 129 ? -11.468 -55.068 -88.398  1.00 41.03 ? 109  LYS A CD    1 
ATOM   767  C  CE    . LYS A 1 129 ? -12.703 -54.329 -88.892  1.00 48.31 ? 109  LYS A CE    1 
ATOM   768  N  NZ    . LYS A 1 129 ? -13.359 -53.571 -87.791  1.00 45.62 ? 109  LYS A NZ    1 
ATOM   769  N  N     . GLU A 1 130 ? -10.016 -57.999 -92.107  1.00 35.57 ? 110  GLU A N     1 
ATOM   770  C  CA    . GLU A 1 130 ? -10.920 -58.529 -93.123  1.00 32.53 ? 110  GLU A CA    1 
ATOM   771  C  C     . GLU A 1 130 ? -10.303 -59.773 -93.758  1.00 32.22 ? 110  GLU A C     1 
ATOM   772  O  O     . GLU A 1 130 ? -10.952 -60.470 -94.536  1.00 36.78 ? 110  GLU A O     1 
ATOM   773  C  CB    . GLU A 1 130 ? -11.222 -57.481 -94.202  1.00 33.31 ? 110  GLU A CB    1 
ATOM   774  C  CG    . GLU A 1 130 ? -12.130 -56.347 -93.735  1.00 40.07 ? 110  GLU A CG    1 
ATOM   775  C  CD    . GLU A 1 130 ? -12.632 -55.476 -94.877  1.00 42.80 ? 110  GLU A CD    1 
ATOM   776  O  OE1   . GLU A 1 130 ? -13.288 -54.448 -94.603  1.00 41.42 ? 110  GLU A OE1   1 
ATOM   777  O  OE2   . GLU A 1 130 ? -12.376 -55.818 -96.050  1.00 42.99 ? 110  GLU A OE2   1 
ATOM   778  N  N     . GLY A 1 131 ? -9.049  -60.048 -93.415  1.00 30.90 ? 111  GLY A N     1 
ATOM   779  C  CA    . GLY A 1 131 ? -8.367  -61.217 -93.946  1.00 31.06 ? 111  GLY A CA    1 
ATOM   780  C  C     . GLY A 1 131 ? -7.600  -60.997 -95.239  1.00 30.47 ? 111  GLY A C     1 
ATOM   781  O  O     . GLY A 1 131 ? -7.070  -61.942 -95.823  1.00 30.02 ? 111  GLY A O     1 
ATOM   782  N  N     . LEU A 1 132 ? -7.530  -59.754 -95.693  1.00 26.50 ? 112  LEU A N     1 
ATOM   783  C  CA    . LEU A 1 132 ? -6.824  -59.450 -96.934  1.00 23.13 ? 112  LEU A CA    1 
ATOM   784  C  C     . LEU A 1 132 ? -5.315  -59.596 -96.767  1.00 28.16 ? 112  LEU A C     1 
ATOM   785  O  O     . LEU A 1 132 ? -4.760  -59.214 -95.736  1.00 28.68 ? 112  LEU A O     1 
ATOM   786  C  CB    . LEU A 1 132 ? -7.156  -58.022 -97.378  1.00 25.59 ? 112  LEU A CB    1 
ATOM   787  C  CG    . LEU A 1 132 ? -6.700  -57.549 -98.760  1.00 30.06 ? 112  LEU A CG    1 
ATOM   788  C  CD1   . LEU A 1 132 ? -7.498  -58.273 -99.845  1.00 31.76 ? 112  LEU A CD1   1 
ATOM   789  C  CD2   . LEU A 1 132 ? -6.910  -56.041 -98.872  1.00 29.80 ? 112  LEU A CD2   1 
ATOM   790  N  N     . ALA A 1 133 ? -4.652  -60.165 -97.772  1.00 21.57 ? 113  ALA A N     1 
ATOM   791  C  CA    . ALA A 1 133 ? -3.205  -60.311 -97.723  1.00 25.70 ? 113  ALA A CA    1 
ATOM   792  C  C     . ALA A 1 133 ? -2.688  -59.014 -98.319  1.00 28.81 ? 113  ALA A C     1 
ATOM   793  O  O     . ALA A 1 133 ? -3.045  -58.663 -99.440  1.00 25.45 ? 113  ALA A O     1 
ATOM   794  C  CB    . ALA A 1 133 ? -2.753  -61.499 -98.566  1.00 25.17 ? 113  ALA A CB    1 
ATOM   795  N  N     . THR A 1 134 ? -1.864  -58.294 -97.566  1.00 28.12 ? 114  THR A N     1 
ATOM   796  C  CA    . THR A 1 134 ? -1.346  -57.027 -98.053  1.00 27.79 ? 114  THR A CA    1 
ATOM   797  C  C     . THR A 1 134 ? 0.083   -56.744 -97.655  1.00 29.42 ? 114  THR A C     1 
ATOM   798  O  O     . THR A 1 134 ? 0.610   -57.304 -96.696  1.00 28.51 ? 114  THR A O     1 
ATOM   799  C  CB    . THR A 1 134 ? -2.154  -55.827 -97.504  1.00 32.03 ? 114  THR A CB    1 
ATOM   800  O  OG1   . THR A 1 134 ? -2.018  -55.783 -96.077  1.00 29.55 ? 114  THR A OG1   1 
ATOM   801  C  CG2   . THR A 1 134 ? -3.622  -55.936 -97.863  1.00 30.66 ? 114  THR A CG2   1 
ATOM   802  N  N     A ARG A 1 135 ? 0.715   -55.875 -98.430  0.50 26.75 ? 115  ARG A N     1 
ATOM   803  N  N     B ARG A 1 135 ? 0.719   -55.866 -98.418  0.50 27.38 ? 115  ARG A N     1 
ATOM   804  C  CA    A ARG A 1 135 ? 2.061   -55.422 -98.145  0.50 27.59 ? 115  ARG A CA    1 
ATOM   805  C  CA    B ARG A 1 135 ? 2.078   -55.435 -98.137  0.50 28.57 ? 115  ARG A CA    1 
ATOM   806  C  C     A ARG A 1 135 ? 2.043   -53.949 -98.488  0.50 30.04 ? 115  ARG A C     1 
ATOM   807  C  C     B ARG A 1 135 ? 2.095   -53.956 -98.484  0.50 30.83 ? 115  ARG A C     1 
ATOM   808  O  O     A ARG A 1 135 ? 2.031   -53.575 -99.659  0.50 29.01 ? 115  ARG A O     1 
ATOM   809  O  O     B ARG A 1 135 ? 2.160   -53.586 -99.655  0.50 31.69 ? 115  ARG A O     1 
ATOM   810  C  CB    A ARG A 1 135 ? 3.125   -56.111 -98.996  0.50 30.36 ? 115  ARG A CB    1 
ATOM   811  C  CB    B ARG A 1 135 ? 3.103   -56.191 -98.988  0.50 32.08 ? 115  ARG A CB    1 
ATOM   812  C  CG    A ARG A 1 135 ? 4.517   -55.593 -98.636  0.50 31.84 ? 115  ARG A CG    1 
ATOM   813  C  CG    B ARG A 1 135 ? 4.546   -55.810 -98.656  0.50 35.94 ? 115  ARG A CG    1 
ATOM   814  C  CD    A ARG A 1 135 ? 5.594   -56.004 -99.614  0.50 28.10 ? 115  ARG A CD    1 
ATOM   815  C  CD    B ARG A 1 135 ? 5.560   -56.697 -99.365  0.50 36.12 ? 115  ARG A CD    1 
ATOM   816  N  NE    A ARG A 1 135 ? 5.810   -57.444 -99.627  0.50 23.44 ? 115  ARG A NE    1 
ATOM   817  N  NE    B ARG A 1 135 ? 5.443   -58.095 -98.961  0.50 37.98 ? 115  ARG A NE    1 
ATOM   818  C  CZ    A ARG A 1 135 ? 6.772   -58.036 -100.322 0.50 15.43 ? 115  ARG A CZ    1 
ATOM   819  C  CZ    B ARG A 1 135 ? 5.657   -58.546 -97.729  0.50 36.13 ? 115  ARG A CZ    1 
ATOM   820  N  NH1   A ARG A 1 135 ? 7.600   -57.302 -101.051 0.50 15.08 ? 115  ARG A NH1   1 
ATOM   821  N  NH1   B ARG A 1 135 ? 6.008   -57.712 -96.757  0.50 39.51 ? 115  ARG A NH1   1 
ATOM   822  N  NH2   A ARG A 1 135 ? 6.891   -59.355 -100.302 0.50 18.64 ? 115  ARG A NH2   1 
ATOM   823  N  NH2   B ARG A 1 135 ? 5.514   -59.837 -97.465  0.50 41.86 ? 115  ARG A NH2   1 
ATOM   824  N  N     . PHE A 1 136 ? 2.003   -53.115 -97.459  1.00 26.32 ? 116  PHE A N     1 
ATOM   825  C  CA    . PHE A 1 136 ? 1.994   -51.680 -97.654  1.00 25.80 ? 116  PHE A CA    1 
ATOM   826  C  C     . PHE A 1 136 ? 3.402   -51.154 -97.481  1.00 30.26 ? 116  PHE A C     1 
ATOM   827  O  O     . PHE A 1 136 ? 4.023   -51.334 -96.430  1.00 31.98 ? 116  PHE A O     1 
ATOM   828  C  CB    . PHE A 1 136 ? 1.075   -51.005 -96.641  1.00 21.76 ? 116  PHE A CB    1 
ATOM   829  C  CG    . PHE A 1 136 ? -0.371  -51.389 -96.779  1.00 30.31 ? 116  PHE A CG    1 
ATOM   830  C  CD1   . PHE A 1 136 ? -0.990  -52.170 -95.811  1.00 32.33 ? 116  PHE A CD1   1 
ATOM   831  C  CD2   . PHE A 1 136 ? -1.118  -50.954 -97.869  1.00 32.17 ? 116  PHE A CD2   1 
ATOM   832  C  CE1   . PHE A 1 136 ? -2.339  -52.512 -95.922  1.00 35.56 ? 116  PHE A CE1   1 
ATOM   833  C  CE2   . PHE A 1 136 ? -2.469  -51.290 -97.991  1.00 31.04 ? 116  PHE A CE2   1 
ATOM   834  C  CZ    . PHE A 1 136 ? -3.079  -52.067 -97.017  1.00 33.32 ? 116  PHE A CZ    1 
ATOM   835  N  N     A MET A 1 137 ? 3.900   -50.499 -98.522  0.50 28.94 ? 117  MET A N     1 
ATOM   836  N  N     B MET A 1 137 ? 3.918   -50.514 -98.521  0.50 29.69 ? 117  MET A N     1 
ATOM   837  C  CA    A MET A 1 137 ? 5.234   -49.925 -98.502  0.50 29.15 ? 117  MET A CA    1 
ATOM   838  C  CA    B MET A 1 137 ? 5.260   -49.960 -98.469  0.50 30.56 ? 117  MET A CA    1 
ATOM   839  C  C     A MET A 1 137 ? 5.169   -48.591 -97.771  0.50 28.17 ? 117  MET A C     1 
ATOM   840  C  C     B MET A 1 137 ? 5.199   -48.598 -97.793  0.50 29.11 ? 117  MET A C     1 
ATOM   841  O  O     A MET A 1 137 ? 4.387   -47.716 -98.136  0.50 30.92 ? 117  MET A O     1 
ATOM   842  O  O     B MET A 1 137 ? 4.455   -47.715 -98.216  0.50 31.76 ? 117  MET A O     1 
ATOM   843  C  CB    A MET A 1 137 ? 5.731   -49.711 -99.932  0.50 30.18 ? 117  MET A CB    1 
ATOM   844  C  CB    B MET A 1 137 ? 5.831   -49.852 -99.881  0.50 33.61 ? 117  MET A CB    1 
ATOM   845  C  CG    A MET A 1 137 ? 5.601   -50.938 -100.823 0.50 35.86 ? 117  MET A CG    1 
ATOM   846  C  CG    B MET A 1 137 ? 5.812   -51.185 -100.618 0.50 41.36 ? 117  MET A CG    1 
ATOM   847  S  SD    A MET A 1 137 ? 6.402   -52.392 -100.119 0.50 33.99 ? 117  MET A SD    1 
ATOM   848  S  SD    B MET A 1 137 ? 6.867   -51.233 -102.067 0.50 43.24 ? 117  MET A SD    1 
ATOM   849  C  CE    A MET A 1 137 ? 8.110   -52.057 -100.531 0.50 37.92 ? 117  MET A CE    1 
ATOM   850  C  CE    B MET A 1 137 ? 8.451   -51.510 -101.295 0.50 42.96 ? 117  MET A CE    1 
ATOM   851  N  N     . VAL A 1 138 ? 5.985   -48.440 -96.734  1.00 27.80 ? 118  VAL A N     1 
ATOM   852  C  CA    . VAL A 1 138 ? 6.009   -47.200 -95.965  1.00 29.48 ? 118  VAL A CA    1 
ATOM   853  C  C     . VAL A 1 138 ? 6.931   -46.144 -96.559  1.00 26.44 ? 118  VAL A C     1 
ATOM   854  O  O     . VAL A 1 138 ? 8.077   -46.422 -96.921  1.00 26.44 ? 118  VAL A O     1 
ATOM   855  C  CB    . VAL A 1 138 ? 6.427   -47.466 -94.497  1.00 33.25 ? 118  VAL A CB    1 
ATOM   856  C  CG1   . VAL A 1 138 ? 6.534   -46.151 -93.728  1.00 29.11 ? 118  VAL A CG1   1 
ATOM   857  C  CG2   . VAL A 1 138 ? 5.406   -48.380 -93.830  1.00 34.80 ? 118  VAL A CG2   1 
ATOM   858  N  N     . ALA A 1 139 ? 6.407   -44.930 -96.665  1.00 25.60 ? 119  ALA A N     1 
ATOM   859  C  CA    . ALA A 1 139 ? 7.165   -43.805 -97.194  1.00 27.39 ? 119  ALA A CA    1 
ATOM   860  C  C     . ALA A 1 139 ? 7.405   -42.835 -96.042  1.00 23.46 ? 119  ALA A C     1 
ATOM   861  O  O     . ALA A 1 139 ? 6.525   -42.050 -95.686  1.00 23.79 ? 119  ALA A O     1 
ATOM   862  C  CB    . ALA A 1 139 ? 6.372   -43.117 -98.309  1.00 25.88 ? 119  ALA A CB    1 
ATOM   863  N  N     . PRO A 1 140 ? 8.597   -42.880 -95.433  1.00 28.41 ? 120  PRO A N     1 
ATOM   864  C  CA    . PRO A 1 140 ? 8.841   -41.955 -94.320  1.00 27.61 ? 120  PRO A CA    1 
ATOM   865  C  C     . PRO A 1 140 ? 8.637   -40.487 -94.686  1.00 28.43 ? 120  PRO A C     1 
ATOM   866  O  O     . PRO A 1 140 ? 9.000   -40.047 -95.781  1.00 30.15 ? 120  PRO A O     1 
ATOM   867  C  CB    . PRO A 1 140 ? 10.282  -42.268 -93.915  1.00 27.60 ? 120  PRO A CB    1 
ATOM   868  C  CG    . PRO A 1 140 ? 10.904  -42.735 -95.203  1.00 40.35 ? 120  PRO A CG    1 
ATOM   869  C  CD    . PRO A 1 140 ? 9.822   -43.611 -95.800  1.00 28.93 ? 120  PRO A CD    1 
ATOM   870  N  N     . GLY A 1 141 ? 8.033   -39.741 -93.766  1.00 23.70 ? 121  GLY A N     1 
ATOM   871  C  CA    . GLY A 1 141 ? 7.805   -38.324 -93.990  1.00 20.52 ? 121  GLY A CA    1 
ATOM   872  C  C     . GLY A 1 141 ? 6.577   -37.976 -94.802  1.00 20.16 ? 121  GLY A C     1 
ATOM   873  O  O     . GLY A 1 141 ? 6.211   -36.804 -94.896  1.00 25.43 ? 121  GLY A O     1 
ATOM   874  N  N     . GLN A 1 142 ? 5.930   -38.978 -95.390  1.00 23.53 ? 122  GLN A N     1 
ATOM   875  C  CA    . GLN A 1 142 ? 4.742   -38.716 -96.200  1.00 22.80 ? 122  GLN A CA    1 
ATOM   876  C  C     . GLN A 1 142 ? 3.476   -39.151 -95.468  1.00 25.38 ? 122  GLN A C     1 
ATOM   877  O  O     . GLN A 1 142 ? 3.533   -39.965 -94.550  1.00 24.16 ? 122  GLN A O     1 
ATOM   878  C  CB    . GLN A 1 142 ? 4.874   -39.427 -97.552  1.00 21.13 ? 122  GLN A CB    1 
ATOM   879  C  CG    . GLN A 1 142 ? 6.133   -38.964 -98.314  1.00 23.09 ? 122  GLN A CG    1 
ATOM   880  C  CD    . GLN A 1 142 ? 6.295   -39.580 -99.689  1.00 27.67 ? 122  GLN A CD    1 
ATOM   881  O  OE1   . GLN A 1 142 ? 7.352   -39.452 -100.316 1.00 32.19 ? 122  GLN A OE1   1 
ATOM   882  N  NE2   . GLN A 1 142 ? 5.251   -40.240 -100.175 1.00 20.59 ? 122  GLN A NE2   1 
ATOM   883  N  N     . SER A 1 143 ? 2.337   -38.592 -95.860  1.00 22.34 ? 123  SER A N     1 
ATOM   884  C  CA    . SER A 1 143 ? 1.081   -38.937 -95.207  1.00 25.85 ? 123  SER A CA    1 
ATOM   885  C  C     . SER A 1 143 ? 0.274   -39.950 -96.022  1.00 26.47 ? 123  SER A C     1 
ATOM   886  O  O     . SER A 1 143 ? 0.229   -39.879 -97.245  1.00 27.33 ? 123  SER A O     1 
ATOM   887  C  CB    . SER A 1 143 ? 0.254   -37.670 -94.967  1.00 34.38 ? 123  SER A CB    1 
ATOM   888  O  OG    . SER A 1 143 ? 0.044   -36.957 -96.174  1.00 42.84 ? 123  SER A OG    1 
ATOM   889  N  N     . THR A 1 144 ? -0.353  -40.895 -95.328  1.00 22.13 ? 124  THR A N     1 
ATOM   890  C  CA    . THR A 1 144 ? -1.162  -41.922 -95.972  1.00 21.49 ? 124  THR A CA    1 
ATOM   891  C  C     . THR A 1 144 ? -2.306  -41.284 -96.762  1.00 21.28 ? 124  THR A C     1 
ATOM   892  O  O     . THR A 1 144 ? -2.870  -40.273 -96.344  1.00 24.89 ? 124  THR A O     1 
ATOM   893  C  CB    . THR A 1 144 ? -1.746  -42.900 -94.914  1.00 23.41 ? 124  THR A CB    1 
ATOM   894  O  OG1   . THR A 1 144 ? -0.673  -43.603 -94.271  1.00 27.32 ? 124  THR A OG1   1 
ATOM   895  C  CG2   . THR A 1 144 ? -2.681  -43.904 -95.564  1.00 24.33 ? 124  THR A CG2   1 
ATOM   896  N  N     . GLY A 1 145 ? -2.639  -41.878 -97.906  1.00 23.06 ? 125  GLY A N     1 
ATOM   897  C  CA    . GLY A 1 145 ? -3.711  -41.348 -98.731  1.00 21.24 ? 125  GLY A CA    1 
ATOM   898  C  C     . GLY A 1 145 ? -4.977  -41.171 -97.920  1.00 23.32 ? 125  GLY A C     1 
ATOM   899  O  O     . GLY A 1 145 ? -5.271  -41.980 -97.044  1.00 22.53 ? 125  GLY A O     1 
ATOM   900  N  N     . VAL A 1 146 ? -5.731  -40.121 -98.208  1.00 20.90 ? 126  VAL A N     1 
ATOM   901  C  CA    . VAL A 1 146 ? -6.955  -39.865 -97.470  1.00 23.72 ? 126  VAL A CA    1 
ATOM   902  C  C     . VAL A 1 146 ? -8.014  -39.242 -98.373  1.00 25.77 ? 126  VAL A C     1 
ATOM   903  O  O     . VAL A 1 146 ? -7.706  -38.414 -99.234  1.00 26.14 ? 126  VAL A O     1 
ATOM   904  C  CB    . VAL A 1 146 ? -6.672  -38.932 -96.269  1.00 21.35 ? 126  VAL A CB    1 
ATOM   905  C  CG1   . VAL A 1 146 ? -6.124  -37.596 -96.767  1.00 20.75 ? 126  VAL A CG1   1 
ATOM   906  C  CG2   . VAL A 1 146 ? -7.943  -38.720 -95.463  1.00 28.61 ? 126  VAL A CG2   1 
ATOM   907  N  N     . CYS A 1 147 ? -9.264  -39.649 -98.181  1.00 24.56 ? 127  CYS A N     1 
ATOM   908  C  CA    . CYS A 1 147 ? -10.355 -39.120 -98.983  1.00 25.64 ? 127  CYS A CA    1 
ATOM   909  C  C     . CYS A 1 147 ? -11.514 -38.655 -98.114  1.00 28.26 ? 127  CYS A C     1 
ATOM   910  O  O     . CYS A 1 147 ? -12.065 -39.432 -97.330  1.00 29.53 ? 127  CYS A O     1 
ATOM   911  C  CB    . CYS A 1 147 ? -10.863 -40.179 -99.962  1.00 27.03 ? 127  CYS A CB    1 
ATOM   912  S  SG    . CYS A 1 147 ? -12.254 -39.621 -100.970 1.00 29.04 ? 127  CYS A SG    1 
ATOM   913  N  N     . ALA A 1 148 ? -11.879 -37.386 -98.250  1.00 26.35 ? 128  ALA A N     1 
ATOM   914  C  CA    . ALA A 1 148 ? -12.996 -36.851 -97.487  1.00 27.40 ? 128  ALA A CA    1 
ATOM   915  C  C     . ALA A 1 148 ? -14.276 -37.136 -98.259  1.00 26.44 ? 128  ALA A C     1 
ATOM   916  O  O     . ALA A 1 148 ? -14.470 -36.634 -99.362  1.00 27.18 ? 128  ALA A O     1 
ATOM   917  C  CB    . ALA A 1 148 ? -12.834 -35.348 -97.281  1.00 26.40 ? 128  ALA A CB    1 
ATOM   918  N  N     . VAL A 1 149 ? -15.133 -37.971 -97.683  1.00 29.89 ? 129  VAL A N     1 
ATOM   919  C  CA    . VAL A 1 149 ? -16.414 -38.304 -98.291  1.00 27.09 ? 129  VAL A CA    1 
ATOM   920  C  C     . VAL A 1 149 ? -17.410 -37.423 -97.550  1.00 29.18 ? 129  VAL A C     1 
ATOM   921  O  O     . VAL A 1 149 ? -17.866 -37.767 -96.464  1.00 33.41 ? 129  VAL A O     1 
ATOM   922  C  CB    . VAL A 1 149 ? -16.780 -39.786 -98.070  1.00 28.16 ? 129  VAL A CB    1 
ATOM   923  C  CG1   . VAL A 1 149 ? -18.124 -40.094 -98.713  1.00 33.53 ? 129  VAL A CG1   1 
ATOM   924  C  CG2   . VAL A 1 149 ? -15.701 -40.679 -98.663  1.00 35.60 ? 129  VAL A CG2   1 
ATOM   925  N  N     . LEU A 1 150 ? -17.731 -36.283 -98.146  1.00 33.54 ? 130  LEU A N     1 
ATOM   926  C  CA    . LEU A 1 150 ? -18.636 -35.317 -97.541  1.00 32.60 ? 130  LEU A CA    1 
ATOM   927  C  C     . LEU A 1 150 ? -20.089 -35.523 -97.958  1.00 38.11 ? 130  LEU A C     1 
ATOM   928  O  O     . LEU A 1 150 ? -20.422 -35.428 -99.136  1.00 32.15 ? 130  LEU A O     1 
ATOM   929  C  CB    . LEU A 1 150 ? -18.173 -33.910 -97.920  1.00 34.57 ? 130  LEU A CB    1 
ATOM   930  C  CG    . LEU A 1 150 ? -16.665 -33.692 -97.735  1.00 32.85 ? 130  LEU A CG    1 
ATOM   931  C  CD1   . LEU A 1 150 ? -16.253 -32.342 -98.307  1.00 32.90 ? 130  LEU A CD1   1 
ATOM   932  C  CD2   . LEU A 1 150 ? -16.318 -33.790 -96.259  1.00 32.28 ? 130  LEU A CD2   1 
ATOM   933  N  N     . ILE A 1 151 ? -20.946 -35.806 -96.979  1.00 41.62 ? 131  ILE A N     1 
ATOM   934  C  CA    . ILE A 1 151 ? -22.368 -36.024 -97.232  1.00 44.38 ? 131  ILE A CA    1 
ATOM   935  C  C     . ILE A 1 151 ? -23.164 -34.745 -96.968  1.00 47.61 ? 131  ILE A C     1 
ATOM   936  O  O     . ILE A 1 151 ? -23.217 -34.255 -95.838  1.00 42.77 ? 131  ILE A O     1 
ATOM   937  C  CB    . ILE A 1 151 ? -22.918 -37.155 -96.334  1.00 45.82 ? 131  ILE A CB    1 
ATOM   938  C  CG1   . ILE A 1 151 ? -22.121 -38.438 -96.581  1.00 43.59 ? 131  ILE A CG1   1 
ATOM   939  C  CG2   . ILE A 1 151 ? -24.396 -37.382 -96.620  1.00 43.71 ? 131  ILE A CG2   1 
ATOM   940  C  CD1   . ILE A 1 151 ? -22.480 -39.585 -95.654  1.00 43.04 ? 131  ILE A CD1   1 
ATOM   941  N  N     . ASN A 1 152 ? -23.779 -34.206 -98.017  1.00 47.43 ? 132  ASN A N     1 
ATOM   942  C  CA    . ASN A 1 152 ? -24.563 -32.982 -97.892  1.00 50.99 ? 132  ASN A CA    1 
ATOM   943  C  C     . ASN A 1 152 ? -25.675 -32.915 -98.931  1.00 49.88 ? 132  ASN A C     1 
ATOM   944  O  O     . ASN A 1 152 ? -25.432 -33.068 -100.127 1.00 50.93 ? 132  ASN A O     1 
ATOM   945  C  CB    . ASN A 1 152 ? -23.650 -31.758 -98.020  1.00 48.95 ? 132  ASN A CB    1 
ATOM   946  C  CG    . ASN A 1 152 ? -24.419 -30.452 -98.017  1.00 51.06 ? 132  ASN A CG    1 
ATOM   947  O  OD1   . ASN A 1 152 ? -25.050 -30.086 -99.010  1.00 45.83 ? 132  ASN A OD1   1 
ATOM   948  N  ND2   . ASN A 1 152 ? -24.376 -29.744 -96.894  1.00 49.04 ? 132  ASN A ND2   1 
ATOM   949  N  N     . GLU A 1 153 ? -26.897 -32.689 -98.459  1.00 53.99 ? 133  GLU A N     1 
ATOM   950  C  CA    . GLU A 1 153 ? -28.065 -32.601 -99.326  1.00 58.12 ? 133  GLU A CA    1 
ATOM   951  C  C     . GLU A 1 153 ? -28.221 -33.805 -100.253 1.00 57.22 ? 133  GLU A C     1 
ATOM   952  O  O     . GLU A 1 153 ? -28.419 -33.656 -101.459 1.00 55.48 ? 133  GLU A O     1 
ATOM   953  C  CB    . GLU A 1 153 ? -28.018 -31.306 -100.141 1.00 63.70 ? 133  GLU A CB    1 
ATOM   954  C  CG    . GLU A 1 153 ? -28.266 -30.059 -99.305  1.00 69.15 ? 133  GLU A CG    1 
ATOM   955  C  CD    . GLU A 1 153 ? -28.186 -28.781 -100.115 1.00 73.76 ? 133  GLU A CD    1 
ATOM   956  O  OE1   . GLU A 1 153 ? -28.870 -28.690 -101.155 1.00 77.55 ? 133  GLU A OE1   1 
ATOM   957  O  OE2   . GLU A 1 153 ? -27.443 -27.865 -99.706  1.00 76.54 ? 133  GLU A OE2   1 
ATOM   958  N  N     . LYS A 1 154 ? -28.129 -34.997 -99.670  1.00 56.59 ? 134  LYS A N     1 
ATOM   959  C  CA    . LYS A 1 154 ? -28.279 -36.249 -100.404 1.00 57.94 ? 134  LYS A CA    1 
ATOM   960  C  C     . LYS A 1 154 ? -27.204 -36.512 -101.453 1.00 57.85 ? 134  LYS A C     1 
ATOM   961  O  O     . LYS A 1 154 ? -27.366 -37.390 -102.300 1.00 60.88 ? 134  LYS A O     1 
ATOM   962  C  CB    . LYS A 1 154 ? -29.661 -36.305 -101.053 1.00 57.71 ? 134  LYS A CB    1 
ATOM   963  N  N     . GLU A 1 155 ? -26.110 -35.760 -101.403 1.00 56.62 ? 135  GLU A N     1 
ATOM   964  C  CA    . GLU A 1 155 ? -25.030 -35.959 -102.364 1.00 53.31 ? 135  GLU A CA    1 
ATOM   965  C  C     . GLU A 1 155 ? -23.695 -36.225 -101.683 1.00 53.14 ? 135  GLU A C     1 
ATOM   966  O  O     . GLU A 1 155 ? -23.481 -35.836 -100.533 1.00 48.14 ? 135  GLU A O     1 
ATOM   967  C  CB    . GLU A 1 155 ? -24.892 -34.745 -103.284 1.00 57.33 ? 135  GLU A CB    1 
ATOM   968  C  CG    . GLU A 1 155 ? -26.114 -34.466 -104.140 1.00 59.52 ? 135  GLU A CG    1 
ATOM   969  C  CD    . GLU A 1 155 ? -25.818 -33.490 -105.261 1.00 60.53 ? 135  GLU A CD    1 
ATOM   970  O  OE1   . GLU A 1 155 ? -25.017 -33.840 -106.153 1.00 64.57 ? 135  GLU A OE1   1 
ATOM   971  O  OE2   . GLU A 1 155 ? -26.382 -32.376 -105.251 1.00 58.76 ? 135  GLU A OE2   1 
ATOM   972  N  N     . ARG A 1 156 ? -22.807 -36.900 -102.406 1.00 46.11 ? 136  ARG A N     1 
ATOM   973  C  CA    . ARG A 1 156 ? -21.478 -37.224 -101.906 1.00 45.68 ? 136  ARG A CA    1 
ATOM   974  C  C     . ARG A 1 156 ? -20.434 -36.394 -102.638 1.00 44.03 ? 136  ARG A C     1 
ATOM   975  O  O     . ARG A 1 156 ? -20.362 -36.416 -103.867 1.00 48.06 ? 136  ARG A O     1 
ATOM   976  C  CB    . ARG A 1 156 ? -21.174 -38.711 -102.110 1.00 45.90 ? 136  ARG A CB    1 
ATOM   977  C  CG    . ARG A 1 156 ? -21.613 -39.617 -100.970 1.00 48.17 ? 136  ARG A CG    1 
ATOM   978  C  CD    . ARG A 1 156 ? -23.108 -39.553 -100.716 1.00 54.83 ? 136  ARG A CD    1 
ATOM   979  N  NE    . ARG A 1 156 ? -23.492 -40.417 -99.603  1.00 58.27 ? 136  ARG A NE    1 
ATOM   980  C  CZ    . ARG A 1 156 ? -24.710 -40.460 -99.070  1.00 57.47 ? 136  ARG A CZ    1 
ATOM   981  N  NH1   . ARG A 1 156 ? -25.674 -39.684 -99.546  1.00 58.89 ? 136  ARG A NH1   1 
ATOM   982  N  NH2   . ARG A 1 156 ? -24.962 -41.277 -98.056  1.00 59.06 ? 136  ARG A NH2   1 
ATOM   983  N  N     . THR A 1 157 ? -19.635 -35.656 -101.878 1.00 38.90 ? 137  THR A N     1 
ATOM   984  C  CA    . THR A 1 157 ? -18.584 -34.826 -102.451 1.00 34.24 ? 137  THR A CA    1 
ATOM   985  C  C     . THR A 1 157 ? -17.259 -35.360 -101.928 1.00 33.12 ? 137  THR A C     1 
ATOM   986  O  O     . THR A 1 157 ? -17.026 -35.384 -100.718 1.00 30.92 ? 137  THR A O     1 
ATOM   987  C  CB    . THR A 1 157 ? -18.755 -33.353 -102.039 1.00 34.72 ? 137  THR A CB    1 
ATOM   988  O  OG1   . THR A 1 157 ? -20.020 -32.874 -102.514 1.00 35.61 ? 137  THR A OG1   1 
ATOM   989  C  CG2   . THR A 1 157 ? -17.646 -32.498 -102.637 1.00 34.42 ? 137  THR A CG2   1 
ATOM   990  N  N     . LEU A 1 158 ? -16.400 -35.800 -102.843 1.00 36.62 ? 138  LEU A N     1 
ATOM   991  C  CA    . LEU A 1 158 ? -15.108 -36.369 -102.474 1.00 31.94 ? 138  LEU A CA    1 
ATOM   992  C  C     . LEU A 1 158 ? -13.922 -35.449 -102.733 1.00 32.02 ? 138  LEU A C     1 
ATOM   993  O  O     . LEU A 1 158 ? -13.838 -34.800 -103.776 1.00 31.12 ? 138  LEU A O     1 
ATOM   994  C  CB    . LEU A 1 158 ? -14.887 -37.691 -103.220 1.00 36.96 ? 138  LEU A CB    1 
ATOM   995  C  CG    . LEU A 1 158 ? -15.737 -38.907 -102.839 1.00 38.79 ? 138  LEU A CG    1 
ATOM   996  C  CD1   . LEU A 1 158 ? -17.218 -38.607 -103.021 1.00 38.06 ? 138  LEU A CD1   1 
ATOM   997  C  CD2   . LEU A 1 158 ? -15.324 -40.085 -103.710 1.00 34.63 ? 138  LEU A CD2   1 
ATOM   998  N  N     . CYS A 1 159 ? -13.005 -35.402 -101.770 1.00 29.37 ? 139  CYS A N     1 
ATOM   999  C  CA    . CYS A 1 159 ? -11.803 -34.584 -101.881 1.00 26.83 ? 139  CYS A CA    1 
ATOM   1000 C  C     . CYS A 1 159 ? -10.660 -35.478 -101.427 1.00 27.78 ? 139  CYS A C     1 
ATOM   1001 O  O     . CYS A 1 159 ? -10.525 -35.776 -100.241 1.00 27.74 ? 139  CYS A O     1 
ATOM   1002 C  CB    . CYS A 1 159 ? -11.903 -33.351 -100.986 1.00 29.66 ? 139  CYS A CB    1 
ATOM   1003 S  SG    . CYS A 1 159 ? -10.526 -32.209 -101.195 1.00 27.87 ? 139  CYS A SG    1 
ATOM   1004 N  N     . THR A 1 160 ? -9.842  -35.901 -102.386 1.00 23.03 ? 140  THR A N     1 
ATOM   1005 C  CA    . THR A 1 160 ? -8.745  -36.818 -102.126 1.00 23.11 ? 140  THR A CA    1 
ATOM   1006 C  C     . THR A 1 160 ? -7.352  -36.215 -102.159 1.00 22.57 ? 140  THR A C     1 
ATOM   1007 O  O     . THR A 1 160 ? -7.042  -35.382 -103.015 1.00 22.01 ? 140  THR A O     1 
ATOM   1008 C  CB    . THR A 1 160 ? -8.782  -37.978 -103.149 1.00 23.97 ? 140  THR A CB    1 
ATOM   1009 O  OG1   . THR A 1 160 ? -10.032 -38.672 -103.043 1.00 27.03 ? 140  THR A OG1   1 
ATOM   1010 C  CG2   . THR A 1 160 ? -7.639  -38.944 -102.911 1.00 25.94 ? 140  THR A CG2   1 
ATOM   1011 N  N     . HIS A 1 161 ? -6.523  -36.646 -101.214 1.00 23.58 ? 141  HIS A N     1 
ATOM   1012 C  CA    . HIS A 1 161 ? -5.133  -36.215 -101.128 1.00 28.32 ? 141  HIS A CA    1 
ATOM   1013 C  C     . HIS A 1 161 ? -4.321  -37.506 -101.158 1.00 23.78 ? 141  HIS A C     1 
ATOM   1014 O  O     . HIS A 1 161 ? -4.300  -38.250 -100.182 1.00 25.98 ? 141  HIS A O     1 
ATOM   1015 C  CB    . HIS A 1 161 ? -4.858  -35.466 -99.824  1.00 26.02 ? 141  HIS A CB    1 
ATOM   1016 C  CG    . HIS A 1 161 ? -3.456  -34.954 -99.721  1.00 30.93 ? 141  HIS A CG    1 
ATOM   1017 N  ND1   . HIS A 1 161 ? -2.987  -33.913 -100.493 1.00 39.72 ? 141  HIS A ND1   1 
ATOM   1018 C  CD2   . HIS A 1 161 ? -2.403  -35.377 -98.983  1.00 34.29 ? 141  HIS A CD2   1 
ATOM   1019 C  CE1   . HIS A 1 161 ? -1.706  -33.717 -100.235 1.00 32.98 ? 141  HIS A CE1   1 
ATOM   1020 N  NE2   . HIS A 1 161 ? -1.328  -34.594 -99.323  1.00 38.53 ? 141  HIS A NE2   1 
ATOM   1021 N  N     . LEU A 1 162 ? -3.647  -37.767 -102.276 1.00 22.55 ? 142  LEU A N     1 
ATOM   1022 C  CA    . LEU A 1 162 ? -2.890  -39.005 -102.436 1.00 22.74 ? 142  LEU A CA    1 
ATOM   1023 C  C     . LEU A 1 162 ? -1.714  -39.243 -101.496 1.00 23.86 ? 142  LEU A C     1 
ATOM   1024 O  O     . LEU A 1 162 ? -1.484  -40.376 -101.061 1.00 23.73 ? 142  LEU A O     1 
ATOM   1025 C  CB    . LEU A 1 162 ? -2.425  -39.136 -103.890 1.00 25.03 ? 142  LEU A CB    1 
ATOM   1026 C  CG    . LEU A 1 162 ? -3.542  -39.364 -104.915 1.00 26.26 ? 142  LEU A CG    1 
ATOM   1027 C  CD1   . LEU A 1 162 ? -2.989  -39.230 -106.320 1.00 28.45 ? 142  LEU A CD1   1 
ATOM   1028 C  CD2   . LEU A 1 162 ? -4.156  -40.746 -104.709 1.00 23.32 ? 142  LEU A CD2   1 
ATOM   1029 N  N     . GLY A 1 163 ? -0.962  -38.194 -101.188 1.00 22.77 ? 143  GLY A N     1 
ATOM   1030 C  CA    . GLY A 1 163 ? 0.173   -38.360 -100.297 1.00 20.03 ? 143  GLY A CA    1 
ATOM   1031 C  C     . GLY A 1 163 ? 1.135   -39.471 -100.687 1.00 22.96 ? 143  GLY A C     1 
ATOM   1032 O  O     . GLY A 1 163 ? 1.580   -39.552 -101.835 1.00 23.32 ? 143  GLY A O     1 
ATOM   1033 N  N     . ALA A 1 164 ? 1.445   -40.341 -99.725  1.00 23.80 ? 144  ALA A N     1 
ATOM   1034 C  CA    . ALA A 1 164 ? 2.379   -41.447 -99.922  1.00 21.71 ? 144  ALA A CA    1 
ATOM   1035 C  C     . ALA A 1 164 ? 2.051   -42.400 -101.072 1.00 24.13 ? 144  ALA A C     1 
ATOM   1036 O  O     . ALA A 1 164 ? 2.945   -43.076 -101.583 1.00 22.44 ? 144  ALA A O     1 
ATOM   1037 C  CB    . ALA A 1 164 ? 2.524   -42.244 -98.621  1.00 23.59 ? 144  ALA A CB    1 
ATOM   1038 N  N     . CYS A 1 165 ? 0.789   -42.465 -101.485 1.00 23.76 ? 145  CYS A N     1 
ATOM   1039 C  CA    . CYS A 1 165 ? 0.423   -43.364 -102.585 1.00 23.96 ? 145  CYS A CA    1 
ATOM   1040 C  C     . CYS A 1 165 ? 1.340   -43.161 -103.780 1.00 22.06 ? 145  CYS A C     1 
ATOM   1041 O  O     . CYS A 1 165 ? 1.727   -44.118 -104.454 1.00 23.77 ? 145  CYS A O     1 
ATOM   1042 C  CB    . CYS A 1 165 ? -1.006  -43.112 -103.059 1.00 18.05 ? 145  CYS A CB    1 
ATOM   1043 S  SG    . CYS A 1 165 ? -2.306  -43.516 -101.869 1.00 24.07 ? 145  CYS A SG    1 
ATOM   1044 N  N     . GLY A 1 166 ? 1.672   -41.902 -104.044 1.00 22.02 ? 146  GLY A N     1 
ATOM   1045 C  CA    . GLY A 1 166 ? 2.510   -41.588 -105.183 1.00 21.05 ? 146  GLY A CA    1 
ATOM   1046 C  C     . GLY A 1 166 ? 3.925   -42.127 -105.152 1.00 23.61 ? 146  GLY A C     1 
ATOM   1047 O  O     . GLY A 1 166 ? 4.610   -42.094 -106.169 1.00 20.79 ? 146  GLY A O     1 
ATOM   1048 N  N     . SER A 1 167 ? 4.369   -42.630 -104.003 1.00 22.37 ? 147  SER A N     1 
ATOM   1049 C  CA    . SER A 1 167 ? 5.734   -43.142 -103.884 1.00 23.57 ? 147  SER A CA    1 
ATOM   1050 C  C     . SER A 1 167 ? 5.859   -44.633 -104.175 1.00 24.10 ? 147  SER A C     1 
ATOM   1051 O  O     . SER A 1 167 ? 6.968   -45.167 -104.254 1.00 22.88 ? 147  SER A O     1 
ATOM   1052 C  CB    . SER A 1 167 ? 6.262   -42.892 -102.473 1.00 27.37 ? 147  SER A CB    1 
ATOM   1053 O  OG    . SER A 1 167 ? 5.584   -43.722 -101.541 1.00 26.53 ? 147  SER A OG    1 
ATOM   1054 N  N     . PHE A 1 168 ? 4.723   -45.303 -104.327 1.00 22.86 ? 148  PHE A N     1 
ATOM   1055 C  CA    . PHE A 1 168 ? 4.722   -46.738 -104.564 1.00 22.67 ? 148  PHE A CA    1 
ATOM   1056 C  C     . PHE A 1 168 ? 5.547   -47.196 -105.754 1.00 21.86 ? 148  PHE A C     1 
ATOM   1057 O  O     . PHE A 1 168 ? 5.398   -46.698 -106.864 1.00 20.95 ? 148  PHE A O     1 
ATOM   1058 C  CB    . PHE A 1 168 ? 3.288   -47.258 -104.723 1.00 24.54 ? 148  PHE A CB    1 
ATOM   1059 C  CG    . PHE A 1 168 ? 3.204   -48.754 -104.912 1.00 19.34 ? 148  PHE A CG    1 
ATOM   1060 C  CD1   . PHE A 1 168 ? 3.832   -49.617 -104.015 1.00 26.35 ? 148  PHE A CD1   1 
ATOM   1061 C  CD2   . PHE A 1 168 ? 2.506   -49.296 -105.981 1.00 23.93 ? 148  PHE A CD2   1 
ATOM   1062 C  CE1   . PHE A 1 168 ? 3.767   -51.000 -104.183 1.00 24.68 ? 148  PHE A CE1   1 
ATOM   1063 C  CE2   . PHE A 1 168 ? 2.433   -50.682 -106.161 1.00 24.00 ? 148  PHE A CE2   1 
ATOM   1064 C  CZ    . PHE A 1 168 ? 3.067   -51.536 -105.257 1.00 28.29 ? 148  PHE A CZ    1 
ATOM   1065 N  N     . ARG A 1 169 ? 6.423   -48.157 -105.491 1.00 21.87 ? 149  ARG A N     1 
ATOM   1066 C  CA    . ARG A 1 169 ? 7.267   -48.756 -106.511 1.00 26.18 ? 149  ARG A CA    1 
ATOM   1067 C  C     . ARG A 1 169 ? 7.237   -50.257 -106.225 1.00 25.19 ? 149  ARG A C     1 
ATOM   1068 O  O     . ARG A 1 169 ? 7.732   -50.726 -105.200 1.00 28.70 ? 149  ARG A O     1 
ATOM   1069 C  CB    . ARG A 1 169 ? 8.692   -48.196 -106.437 1.00 25.35 ? 149  ARG A CB    1 
ATOM   1070 C  CG    . ARG A 1 169 ? 8.777   -46.688 -106.682 1.00 35.22 ? 149  ARG A CG    1 
ATOM   1071 C  CD    . ARG A 1 169 ? 8.226   -46.305 -108.058 1.00 35.05 ? 149  ARG A CD    1 
ATOM   1072 N  NE    . ARG A 1 169 ? 8.460   -44.896 -108.371 1.00 31.72 ? 149  ARG A NE    1 
ATOM   1073 C  CZ    . ARG A 1 169 ? 7.640   -43.892 -108.063 1.00 33.25 ? 149  ARG A CZ    1 
ATOM   1074 N  NH1   . ARG A 1 169 ? 6.488   -44.108 -107.427 1.00 19.73 ? 149  ARG A NH1   1 
ATOM   1075 N  NH2   . ARG A 1 169 ? 7.989   -42.654 -108.384 1.00 33.33 ? 149  ARG A NH2   1 
ATOM   1076 N  N     . LEU A 1 170 ? 6.631   -50.997 -107.146 1.00 23.01 ? 150  LEU A N     1 
ATOM   1077 C  CA    . LEU A 1 170 ? 6.485   -52.442 -107.033 1.00 24.09 ? 150  LEU A CA    1 
ATOM   1078 C  C     . LEU A 1 170 ? 7.808   -53.107 -106.652 1.00 24.67 ? 150  LEU A C     1 
ATOM   1079 O  O     . LEU A 1 170 ? 8.820   -52.941 -107.334 1.00 25.36 ? 150  LEU A O     1 
ATOM   1080 C  CB    . LEU A 1 170 ? 5.951   -53.030 -108.340 1.00 23.57 ? 150  LEU A CB    1 
ATOM   1081 C  CG    . LEU A 1 170 ? 5.414   -54.460 -108.269 1.00 20.00 ? 150  LEU A CG    1 
ATOM   1082 C  CD1   . LEU A 1 170 ? 4.255   -54.551 -107.288 1.00 12.53 ? 150  LEU A CD1   1 
ATOM   1083 C  CD2   . LEU A 1 170 ? 4.986   -54.941 -109.647 1.00 20.00 ? 150  LEU A CD2   1 
ATOM   1084 N  N     . PRO A 1 171 ? 7.821   -53.854 -105.537 1.00 23.95 ? 151  PRO A N     1 
ATOM   1085 C  CA    . PRO A 1 171 ? 9.048   -54.532 -105.100 1.00 22.98 ? 151  PRO A CA    1 
ATOM   1086 C  C     . PRO A 1 171 ? 9.428   -55.687 -106.025 1.00 28.05 ? 151  PRO A C     1 
ATOM   1087 O  O     . PRO A 1 171 ? 8.567   -56.325 -106.631 1.00 22.45 ? 151  PRO A O     1 
ATOM   1088 C  CB    . PRO A 1 171 ? 8.706   -54.994 -103.687 1.00 26.33 ? 151  PRO A CB    1 
ATOM   1089 C  CG    . PRO A 1 171 ? 7.237   -55.212 -103.749 1.00 29.87 ? 151  PRO A CG    1 
ATOM   1090 C  CD    . PRO A 1 171 ? 6.744   -54.028 -104.547 1.00 24.24 ? 151  PRO A CD    1 
ATOM   1091 N  N     . GLU A 1 172 ? 10.722  -55.956 -106.118 1.00 26.52 ? 152  GLU A N     1 
ATOM   1092 C  CA    . GLU A 1 172 ? 11.232  -57.008 -106.990 1.00 36.32 ? 152  GLU A CA    1 
ATOM   1093 C  C     . GLU A 1 172 ? 10.659  -58.401 -106.742 1.00 31.39 ? 152  GLU A C     1 
ATOM   1094 O  O     . GLU A 1 172 ? 10.584  -59.210 -107.665 1.00 32.03 ? 152  GLU A O     1 
ATOM   1095 C  CB    . GLU A 1 172 ? 12.759  -57.066 -106.889 1.00 43.83 ? 152  GLU A CB    1 
ATOM   1096 C  CG    . GLU A 1 172 ? 13.400  -58.118 -107.780 1.00 58.88 ? 152  GLU A CG    1 
ATOM   1097 C  CD    . GLU A 1 172 ? 14.910  -58.156 -107.642 1.00 68.87 ? 152  GLU A CD    1 
ATOM   1098 O  OE1   . GLU A 1 172 ? 15.554  -58.958 -108.352 1.00 72.96 ? 152  GLU A OE1   1 
ATOM   1099 O  OE2   . GLU A 1 172 ? 15.453  -57.384 -106.821 1.00 76.09 ? 152  GLU A OE2   1 
ATOM   1100 N  N     . ASP A 1 173 ? 10.249  -58.676 -105.509 1.00 27.65 ? 153  ASP A N     1 
ATOM   1101 C  CA    . ASP A 1 173 ? 9.713   -59.991 -105.148 1.00 27.24 ? 153  ASP A CA    1 
ATOM   1102 C  C     . ASP A 1 173 ? 8.187   -60.056 -105.133 1.00 22.64 ? 153  ASP A C     1 
ATOM   1103 O  O     . ASP A 1 173 ? 7.607   -60.928 -104.481 1.00 22.66 ? 153  ASP A O     1 
ATOM   1104 C  CB    . ASP A 1 173 ? 10.201  -60.405 -103.760 1.00 30.50 ? 153  ASP A CB    1 
ATOM   1105 C  CG    . ASP A 1 173 ? 9.776   -59.432 -102.678 1.00 35.24 ? 153  ASP A CG    1 
ATOM   1106 O  OD1   . ASP A 1 173 ? 9.448   -58.276 -103.015 1.00 35.84 ? 153  ASP A OD1   1 
ATOM   1107 O  OD2   . ASP A 1 173 ? 9.771   -59.826 -101.494 1.00 31.16 ? 153  ASP A OD2   1 
ATOM   1108 N  N     . TRP A 1 174 ? 7.534   -59.150 -105.851 1.00 24.51 ? 154  TRP A N     1 
ATOM   1109 C  CA    . TRP A 1 174 ? 6.075   -59.141 -105.864 1.00 24.12 ? 154  TRP A CA    1 
ATOM   1110 C  C     . TRP A 1 174 ? 5.473   -60.422 -106.440 1.00 22.19 ? 154  TRP A C     1 
ATOM   1111 O  O     . TRP A 1 174 ? 4.383   -60.837 -106.038 1.00 22.33 ? 154  TRP A O     1 
ATOM   1112 C  CB    . TRP A 1 174 ? 5.539   -57.928 -106.638 1.00 25.64 ? 154  TRP A CB    1 
ATOM   1113 C  CG    . TRP A 1 174 ? 5.674   -58.025 -108.127 1.00 29.59 ? 154  TRP A CG    1 
ATOM   1114 C  CD1   . TRP A 1 174 ? 6.761   -57.682 -108.879 1.00 23.48 ? 154  TRP A CD1   1 
ATOM   1115 C  CD2   . TRP A 1 174 ? 4.687   -58.507 -109.046 1.00 25.92 ? 154  TRP A CD2   1 
ATOM   1116 N  NE1   . TRP A 1 174 ? 6.512   -57.919 -110.206 1.00 25.44 ? 154  TRP A NE1   1 
ATOM   1117 C  CE2   . TRP A 1 174 ? 5.246   -58.425 -110.339 1.00 27.44 ? 154  TRP A CE2   1 
ATOM   1118 C  CE3   . TRP A 1 174 ? 3.383   -59.001 -108.902 1.00 27.96 ? 154  TRP A CE3   1 
ATOM   1119 C  CZ2   . TRP A 1 174 ? 4.548   -58.818 -111.485 1.00 22.86 ? 154  TRP A CZ2   1 
ATOM   1120 C  CZ3   . TRP A 1 174 ? 2.688   -59.392 -110.042 1.00 27.74 ? 154  TRP A CZ3   1 
ATOM   1121 C  CH2   . TRP A 1 174 ? 3.273   -59.298 -111.316 1.00 26.74 ? 154  TRP A CH2   1 
ATOM   1122 N  N     . THR A 1 175 ? 6.178   -61.059 -107.367 1.00 19.31 ? 155  THR A N     1 
ATOM   1123 C  CA    . THR A 1 175 ? 5.660   -62.288 -107.966 1.00 17.52 ? 155  THR A CA    1 
ATOM   1124 C  C     . THR A 1 175 ? 5.637   -63.430 -106.951 1.00 19.09 ? 155  THR A C     1 
ATOM   1125 O  O     . THR A 1 175 ? 4.836   -64.355 -107.066 1.00 22.17 ? 155  THR A O     1 
ATOM   1126 C  CB    . THR A 1 175 ? 6.485   -62.715 -109.197 1.00 25.33 ? 155  THR A CB    1 
ATOM   1127 O  OG1   . THR A 1 175 ? 7.851   -62.906 -108.820 1.00 20.77 ? 155  THR A OG1   1 
ATOM   1128 C  CG2   . THR A 1 175 ? 6.403   -61.651 -110.287 1.00 23.86 ? 155  THR A CG2   1 
ATOM   1129 N  N     . THR A 1 176 ? 6.514   -63.362 -105.954 1.00 21.34 ? 156  THR A N     1 
ATOM   1130 C  CA    . THR A 1 176 ? 6.555   -64.390 -104.922 1.00 23.05 ? 156  THR A CA    1 
ATOM   1131 C  C     . THR A 1 176 ? 5.396   -64.129 -103.970 1.00 25.62 ? 156  THR A C     1 
ATOM   1132 O  O     . THR A 1 176 ? 4.709   -65.053 -103.541 1.00 25.84 ? 156  THR A O     1 
ATOM   1133 C  CB    . THR A 1 176 ? 7.869   -64.336 -104.134 1.00 27.91 ? 156  THR A CB    1 
ATOM   1134 O  OG1   . THR A 1 176 ? 8.967   -64.395 -105.048 1.00 31.44 ? 156  THR A OG1   1 
ATOM   1135 C  CG2   . THR A 1 176 ? 7.959   -65.508 -103.165 1.00 26.53 ? 156  THR A CG2   1 
ATOM   1136 N  N     . PHE A 1 177 ? 5.187   -62.858 -103.642 1.00 25.21 ? 157  PHE A N     1 
ATOM   1137 C  CA    . PHE A 1 177 ? 4.095   -62.472 -102.761 1.00 25.75 ? 157  PHE A CA    1 
ATOM   1138 C  C     . PHE A 1 177 ? 2.772   -62.916 -103.389 1.00 23.87 ? 157  PHE A C     1 
ATOM   1139 O  O     . PHE A 1 177 ? 1.878   -63.400 -102.697 1.00 24.50 ? 157  PHE A O     1 
ATOM   1140 C  CB    . PHE A 1 177 ? 4.077   -60.952 -102.569 1.00 21.96 ? 157  PHE A CB    1 
ATOM   1141 C  CG    . PHE A 1 177 ? 2.890   -60.453 -101.790 1.00 28.59 ? 157  PHE A CG    1 
ATOM   1142 C  CD1   . PHE A 1 177 ? 2.885   -60.488 -100.401 1.00 25.97 ? 157  PHE A CD1   1 
ATOM   1143 C  CD2   . PHE A 1 177 ? 1.761   -59.972 -102.455 1.00 25.53 ? 157  PHE A CD2   1 
ATOM   1144 C  CE1   . PHE A 1 177 ? 1.773   -60.051 -99.679  1.00 28.40 ? 157  PHE A CE1   1 
ATOM   1145 C  CE2   . PHE A 1 177 ? 0.645   -59.533 -101.745 1.00 25.05 ? 157  PHE A CE2   1 
ATOM   1146 C  CZ    . PHE A 1 177 ? 0.651   -59.573 -100.353 1.00 28.60 ? 157  PHE A CZ    1 
ATOM   1147 N  N     . ALA A 1 178 ? 2.665   -62.762 -104.707 1.00 20.32 ? 158  ALA A N     1 
ATOM   1148 C  CA    . ALA A 1 178 ? 1.442   -63.123 -105.422 1.00 20.48 ? 158  ALA A CA    1 
ATOM   1149 C  C     . ALA A 1 178 ? 1.373   -64.567 -105.916 1.00 17.94 ? 158  ALA A C     1 
ATOM   1150 O  O     . ALA A 1 178 ? 0.457   -64.918 -106.662 1.00 20.70 ? 158  ALA A O     1 
ATOM   1151 C  CB    . ALA A 1 178 ? 1.235   -62.169 -106.597 1.00 23.68 ? 158  ALA A CB    1 
ATOM   1152 N  N     . SER A 1 179 ? 2.319   -65.407 -105.502 1.00 22.29 ? 159  SER A N     1 
ATOM   1153 C  CA    . SER A 1 179 ? 2.342   -66.806 -105.944 1.00 19.85 ? 159  SER A CA    1 
ATOM   1154 C  C     . SER A 1 179 ? 0.969   -67.464 -105.953 1.00 18.88 ? 159  SER A C     1 
ATOM   1155 O  O     . SER A 1 179 ? 0.209   -67.344 -104.990 1.00 23.48 ? 159  SER A O     1 
ATOM   1156 C  CB    . SER A 1 179 ? 3.279   -67.633 -105.059 1.00 18.07 ? 159  SER A CB    1 
ATOM   1157 O  OG    . SER A 1 179 ? 4.624   -67.219 -105.218 1.00 33.51 ? 159  SER A OG    1 
ATOM   1158 N  N     . GLY A 1 180 ? 0.650   -68.151 -107.045 1.00 20.80 ? 160  GLY A N     1 
ATOM   1159 C  CA    . GLY A 1 180 ? -0.637  -68.826 -107.143 1.00 19.92 ? 160  GLY A CA    1 
ATOM   1160 C  C     . GLY A 1 180 ? -1.734  -68.065 -107.868 1.00 21.12 ? 160  GLY A C     1 
ATOM   1161 O  O     . GLY A 1 180 ? -2.587  -68.671 -108.520 1.00 21.80 ? 160  GLY A O     1 
ATOM   1162 N  N     . ALA A 1 181 ? -1.726  -66.740 -107.758 1.00 19.79 ? 161  ALA A N     1 
ATOM   1163 C  CA    . ALA A 1 181 ? -2.747  -65.918 -108.411 1.00 23.89 ? 161  ALA A CA    1 
ATOM   1164 C  C     . ALA A 1 181 ? -2.563  -65.823 -109.923 1.00 21.86 ? 161  ALA A C     1 
ATOM   1165 O  O     . ALA A 1 181 ? -1.461  -65.539 -110.413 1.00 18.78 ? 161  ALA A O     1 
ATOM   1166 C  CB    . ALA A 1 181 ? -2.760  -64.506 -107.800 1.00 19.66 ? 161  ALA A CB    1 
ATOM   1167 N  N     . LEU A 1 182 ? -3.646  -66.065 -110.660 1.00 20.98 ? 162  LEU A N     1 
ATOM   1168 C  CA    . LEU A 1 182 ? -3.612  -65.979 -112.116 1.00 20.03 ? 162  LEU A CA    1 
ATOM   1169 C  C     . LEU A 1 182 ? -4.387  -64.761 -112.607 1.00 20.37 ? 162  LEU A C     1 
ATOM   1170 O  O     . LEU A 1 182 ? -4.359  -64.443 -113.796 1.00 20.83 ? 162  LEU A O     1 
ATOM   1171 C  CB    . LEU A 1 182 ? -4.186  -67.248 -112.758 1.00 21.32 ? 162  LEU A CB    1 
ATOM   1172 C  CG    . LEU A 1 182 ? -3.397  -68.548 -112.586 1.00 22.06 ? 162  LEU A CG    1 
ATOM   1173 C  CD1   . LEU A 1 182 ? -4.122  -69.672 -113.320 1.00 28.72 ? 162  LEU A CD1   1 
ATOM   1174 C  CD2   . LEU A 1 182 ? -1.995  -68.374 -113.155 1.00 24.84 ? 162  LEU A CD2   1 
ATOM   1175 N  N     . ILE A 1 183 ? -5.083  -64.085 -111.694 1.00 19.18 ? 163  ILE A N     1 
ATOM   1176 C  CA    . ILE A 1 183 ? -5.845  -62.889 -112.042 1.00 18.38 ? 163  ILE A CA    1 
ATOM   1177 C  C     . ILE A 1 183 ? -5.153  -61.679 -111.402 1.00 21.01 ? 163  ILE A C     1 
ATOM   1178 O  O     . ILE A 1 183 ? -5.021  -61.602 -110.186 1.00 19.28 ? 163  ILE A O     1 
ATOM   1179 C  CB    . ILE A 1 183 ? -7.303  -62.972 -111.528 1.00 19.14 ? 163  ILE A CB    1 
ATOM   1180 C  CG1   . ILE A 1 183 ? -8.025  -64.151 -112.188 1.00 21.89 ? 163  ILE A CG1   1 
ATOM   1181 C  CG2   . ILE A 1 183 ? -8.033  -61.660 -111.827 1.00 20.48 ? 163  ILE A CG2   1 
ATOM   1182 C  CD1   . ILE A 1 183 ? -9.340  -64.552 -111.490 1.00 22.89 ? 163  ILE A CD1   1 
ATOM   1183 N  N     . PHE A 1 184 ? -4.709  -60.744 -112.236 1.00 18.68 ? 164  PHE A N     1 
ATOM   1184 C  CA    . PHE A 1 184 ? -4.008  -59.548 -111.775 1.00 16.62 ? 164  PHE A CA    1 
ATOM   1185 C  C     . PHE A 1 184 ? -4.872  -58.341 -112.089 1.00 20.69 ? 164  PHE A C     1 
ATOM   1186 O  O     . PHE A 1 184 ? -5.534  -58.305 -113.123 1.00 22.93 ? 164  PHE A O     1 
ATOM   1187 C  CB    . PHE A 1 184 ? -2.675  -59.440 -112.508 1.00 20.16 ? 164  PHE A CB    1 
ATOM   1188 C  CG    . PHE A 1 184 ? -1.819  -60.669 -112.379 1.00 21.67 ? 164  PHE A CG    1 
ATOM   1189 C  CD1   . PHE A 1 184 ? -0.896  -60.785 -111.345 1.00 21.31 ? 164  PHE A CD1   1 
ATOM   1190 C  CD2   . PHE A 1 184 ? -1.956  -61.727 -113.275 1.00 21.79 ? 164  PHE A CD2   1 
ATOM   1191 C  CE1   . PHE A 1 184 ? -0.122  -61.938 -111.207 1.00 27.26 ? 164  PHE A CE1   1 
ATOM   1192 C  CE2   . PHE A 1 184 ? -1.188  -62.880 -113.143 1.00 28.85 ? 164  PHE A CE2   1 
ATOM   1193 C  CZ    . PHE A 1 184 ? -0.271  -62.987 -112.110 1.00 22.46 ? 164  PHE A CZ    1 
ATOM   1194 N  N     . TYR A 1 185 ? -4.862  -57.349 -111.207 1.00 17.64 ? 165  TYR A N     1 
ATOM   1195 C  CA    . TYR A 1 185 ? -5.687  -56.168 -111.422 1.00 19.50 ? 165  TYR A CA    1 
ATOM   1196 C  C     . TYR A 1 185 ? -4.982  -54.873 -111.056 1.00 18.86 ? 165  TYR A C     1 
ATOM   1197 O  O     . TYR A 1 185 ? -4.253  -54.800 -110.064 1.00 19.43 ? 165  TYR A O     1 
ATOM   1198 C  CB    . TYR A 1 185 ? -6.973  -56.288 -110.599 1.00 21.58 ? 165  TYR A CB    1 
ATOM   1199 C  CG    . TYR A 1 185 ? -7.888  -55.087 -110.686 1.00 21.65 ? 165  TYR A CG    1 
ATOM   1200 C  CD1   . TYR A 1 185 ? -8.464  -54.711 -111.901 1.00 21.59 ? 165  TYR A CD1   1 
ATOM   1201 C  CD2   . TYR A 1 185 ? -8.211  -54.348 -109.546 1.00 19.78 ? 165  TYR A CD2   1 
ATOM   1202 C  CE1   . TYR A 1 185 ? -9.345  -53.638 -111.980 1.00 25.26 ? 165  TYR A CE1   1 
ATOM   1203 C  CE2   . TYR A 1 185 ? -9.089  -53.273 -109.614 1.00 20.29 ? 165  TYR A CE2   1 
ATOM   1204 C  CZ    . TYR A 1 185 ? -9.655  -52.924 -110.832 1.00 20.37 ? 165  TYR A CZ    1 
ATOM   1205 O  OH    . TYR A 1 185 ? -10.535 -51.871 -110.905 1.00 25.70 ? 165  TYR A OH    1 
ATOM   1206 N  N     . ALA A 1 186 ? -5.201  -53.849 -111.871 1.00 18.97 ? 166  ALA A N     1 
ATOM   1207 C  CA    . ALA A 1 186 ? -4.638  -52.539 -111.612 1.00 21.34 ? 166  ALA A CA    1 
ATOM   1208 C  C     . ALA A 1 186 ? -5.626  -51.503 -112.113 1.00 20.52 ? 166  ALA A C     1 
ATOM   1209 O  O     . ALA A 1 186 ? -6.313  -51.715 -113.113 1.00 21.90 ? 166  ALA A O     1 
ATOM   1210 C  CB    . ALA A 1 186 ? -3.296  -52.368 -112.336 1.00 19.63 ? 166  ALA A CB    1 
ATOM   1211 N  N     . THR A 1 187 ? -5.708  -50.390 -111.396 1.00 20.75 ? 167  THR A N     1 
ATOM   1212 C  CA    . THR A 1 187 ? -6.562  -49.287 -111.792 1.00 17.60 ? 167  THR A CA    1 
ATOM   1213 C  C     . THR A 1 187 ? -5.659  -48.314 -112.551 1.00 18.43 ? 167  THR A C     1 
ATOM   1214 O  O     . THR A 1 187 ? -4.446  -48.269 -112.311 1.00 22.60 ? 167  THR A O     1 
ATOM   1215 C  CB    . THR A 1 187 ? -7.116  -48.540 -110.571 1.00 20.33 ? 167  THR A CB    1 
ATOM   1216 O  OG1   . THR A 1 187 ? -6.039  -48.244 -109.672 1.00 18.68 ? 167  THR A OG1   1 
ATOM   1217 C  CG2   . THR A 1 187 ? -8.171  -49.380 -109.856 1.00 18.31 ? 167  THR A CG2   1 
ATOM   1218 N  N     . ALA A 1 188 ? -6.244  -47.544 -113.458 1.00 21.22 ? 168  ALA A N     1 
ATOM   1219 C  CA    . ALA A 1 188 ? -5.485  -46.554 -114.205 1.00 17.75 ? 168  ALA A CA    1 
ATOM   1220 C  C     . ALA A 1 188 ? -5.004  -45.506 -113.192 1.00 21.29 ? 168  ALA A C     1 
ATOM   1221 O  O     . ALA A 1 188 ? -4.034  -44.781 -113.437 1.00 21.11 ? 168  ALA A O     1 
ATOM   1222 C  CB    . ALA A 1 188 ? -6.368  -45.908 -115.270 1.00 20.51 ? 168  ALA A CB    1 
ATOM   1223 N  N     . TYR A 1 189 ? -5.692  -45.423 -112.052 1.00 18.02 ? 169  TYR A N     1 
ATOM   1224 C  CA    . TYR A 1 189 ? -5.296  -44.485 -110.999 1.00 19.55 ? 169  TYR A CA    1 
ATOM   1225 C  C     . TYR A 1 189 ? -3.856  -44.747 -110.545 1.00 19.02 ? 169  TYR A C     1 
ATOM   1226 O  O     . TYR A 1 189 ? -3.186  -43.834 -110.040 1.00 19.36 ? 169  TYR A O     1 
ATOM   1227 C  CB    . TYR A 1 189 ? -6.200  -44.630 -109.771 1.00 24.56 ? 169  TYR A CB    1 
ATOM   1228 C  CG    . TYR A 1 189 ? -7.580  -44.016 -109.864 1.00 23.17 ? 169  TYR A CG    1 
ATOM   1229 C  CD1   . TYR A 1 189 ? -8.677  -44.661 -109.289 1.00 23.48 ? 169  TYR A CD1   1 
ATOM   1230 C  CD2   . TYR A 1 189 ? -7.779  -42.753 -110.424 1.00 27.08 ? 169  TYR A CD2   1 
ATOM   1231 C  CE1   . TYR A 1 189 ? -9.932  -44.064 -109.256 1.00 28.23 ? 169  TYR A CE1   1 
ATOM   1232 C  CE2   . TYR A 1 189 ? -9.039  -42.147 -110.398 1.00 27.35 ? 169  TYR A CE2   1 
ATOM   1233 C  CZ    . TYR A 1 189 ? -10.106 -42.812 -109.807 1.00 26.83 ? 169  TYR A CZ    1 
ATOM   1234 O  OH    . TYR A 1 189 ? -11.350 -42.221 -109.751 1.00 30.34 ? 169  TYR A OH    1 
ATOM   1235 N  N     . THR A 1 190 ? -3.384  -45.988 -110.697 1.00 22.38 ? 170  THR A N     1 
ATOM   1236 C  CA    . THR A 1 190 ? -2.021  -46.330 -110.267 1.00 19.76 ? 170  THR A CA    1 
ATOM   1237 C  C     . THR A 1 190 ? -0.979  -45.706 -111.180 1.00 19.74 ? 170  THR A C     1 
ATOM   1238 O  O     . THR A 1 190 ? 0.206   -45.673 -110.847 1.00 19.85 ? 170  THR A O     1 
ATOM   1239 C  CB    . THR A 1 190 ? -1.752  -47.870 -110.235 1.00 19.25 ? 170  THR A CB    1 
ATOM   1240 O  OG1   . THR A 1 190 ? -1.799  -48.404 -111.560 1.00 20.83 ? 170  THR A OG1   1 
ATOM   1241 C  CG2   . THR A 1 190 ? -2.771  -48.583 -109.353 1.00 18.40 ? 170  THR A CG2   1 
ATOM   1242 N  N     . LEU A 1 191 ? -1.419  -45.216 -112.333 1.00 17.49 ? 171  LEU A N     1 
ATOM   1243 C  CA    . LEU A 1 191 ? -0.496  -44.591 -113.281 1.00 16.99 ? 171  LEU A CA    1 
ATOM   1244 C  C     . LEU A 1 191 ? 0.005   -43.251 -112.747 1.00 20.19 ? 171  LEU A C     1 
ATOM   1245 O  O     . LEU A 1 191 ? 1.005   -42.714 -113.239 1.00 21.78 ? 171  LEU A O     1 
ATOM   1246 C  CB    . LEU A 1 191 ? -1.187  -44.388 -114.635 1.00 16.38 ? 171  LEU A CB    1 
ATOM   1247 C  CG    . LEU A 1 191 ? -1.716  -45.679 -115.286 1.00 20.45 ? 171  LEU A CG    1 
ATOM   1248 C  CD1   . LEU A 1 191 ? -2.470  -45.331 -116.566 1.00 19.38 ? 171  LEU A CD1   1 
ATOM   1249 C  CD2   . LEU A 1 191 ? -0.564  -46.641 -115.574 1.00 24.25 ? 171  LEU A CD2   1 
ATOM   1250 N  N     . THR A 1 192 ? -0.688  -42.723 -111.738 1.00 17.34 ? 172  THR A N     1 
ATOM   1251 C  CA    . THR A 1 192 ? -0.332  -41.435 -111.140 1.00 18.41 ? 172  THR A CA    1 
ATOM   1252 C  C     . THR A 1 192 ? 0.898   -41.496 -110.242 1.00 20.35 ? 172  THR A C     1 
ATOM   1253 O  O     . THR A 1 192 ? 1.430   -40.453 -109.860 1.00 23.58 ? 172  THR A O     1 
ATOM   1254 C  CB    . THR A 1 192 ? -1.497  -40.831 -110.329 1.00 15.77 ? 172  THR A CB    1 
ATOM   1255 O  OG1   . THR A 1 192 ? -1.801  -41.671 -109.211 1.00 18.57 ? 172  THR A OG1   1 
ATOM   1256 C  CG2   . THR A 1 192 ? -2.728  -40.683 -111.209 1.00 21.12 ? 172  THR A CG2   1 
ATOM   1257 N  N     . ALA A 1 193 ? 1.322   -42.706 -109.879 1.00 19.32 ? 173  ALA A N     1 
ATOM   1258 C  CA    . ALA A 1 193 ? 2.532   -42.875 -109.074 1.00 19.98 ? 173  ALA A CA    1 
ATOM   1259 C  C     . ALA A 1 193 ? 3.582   -43.064 -110.161 1.00 20.86 ? 173  ALA A C     1 
ATOM   1260 O  O     . ALA A 1 193 ? 4.511   -42.273 -110.290 1.00 22.89 ? 173  ALA A O     1 
ATOM   1261 C  CB    . ALA A 1 193 ? 2.427   -44.111 -108.186 1.00 17.47 ? 173  ALA A CB    1 
ATOM   1262 N  N     . THR A 1 194 ? 3.402   -44.116 -110.955 1.00 21.69 ? 174  THR A N     1 
ATOM   1263 C  CA    . THR A 1 194 ? 4.254   -44.401 -112.105 1.00 22.66 ? 174  THR A CA    1 
ATOM   1264 C  C     . THR A 1 194 ? 3.614   -45.516 -112.914 1.00 21.06 ? 174  THR A C     1 
ATOM   1265 O  O     . THR A 1 194 ? 3.187   -46.523 -112.353 1.00 21.00 ? 174  THR A O     1 
ATOM   1266 C  CB    . THR A 1 194 ? 5.683   -44.842 -111.732 1.00 22.19 ? 174  THR A CB    1 
ATOM   1267 O  OG1   . THR A 1 194 ? 6.387   -45.172 -112.938 1.00 26.40 ? 174  THR A OG1   1 
ATOM   1268 C  CG2   . THR A 1 194 ? 5.669   -46.059 -110.822 1.00 20.16 ? 174  THR A CG2   1 
ATOM   1269 N  N     . PRO A 1 195 ? 3.527   -45.344 -114.242 1.00 21.54 ? 175  PRO A N     1 
ATOM   1270 C  CA    . PRO A 1 195 ? 2.925   -46.376 -115.095 1.00 18.20 ? 175  PRO A CA    1 
ATOM   1271 C  C     . PRO A 1 195 ? 3.766   -47.649 -115.127 1.00 22.75 ? 175  PRO A C     1 
ATOM   1272 O  O     . PRO A 1 195 ? 3.310   -48.686 -115.597 1.00 18.89 ? 175  PRO A O     1 
ATOM   1273 C  CB    . PRO A 1 195 ? 2.840   -45.693 -116.458 1.00 20.66 ? 175  PRO A CB    1 
ATOM   1274 C  CG    . PRO A 1 195 ? 4.003   -44.756 -116.438 1.00 35.89 ? 175  PRO A CG    1 
ATOM   1275 C  CD    . PRO A 1 195 ? 3.933   -44.174 -115.042 1.00 25.20 ? 175  PRO A CD    1 
ATOM   1276 N  N     . LYS A 1 196 ? 4.990   -47.570 -114.607 1.00 22.51 ? 176  LYS A N     1 
ATOM   1277 C  CA    . LYS A 1 196 ? 5.880   -48.726 -114.586 1.00 22.11 ? 176  LYS A CA    1 
ATOM   1278 C  C     . LYS A 1 196 ? 5.366   -49.865 -113.698 1.00 21.69 ? 176  LYS A C     1 
ATOM   1279 O  O     . LYS A 1 196 ? 5.685   -51.029 -113.933 1.00 20.80 ? 176  LYS A O     1 
ATOM   1280 C  CB    . LYS A 1 196 ? 7.274   -48.307 -114.115 1.00 22.85 ? 176  LYS A CB    1 
ATOM   1281 C  CG    . LYS A 1 196 ? 8.051   -47.465 -115.119 1.00 28.56 ? 176  LYS A CG    1 
ATOM   1282 C  CD    . LYS A 1 196 ? 9.389   -47.018 -114.545 1.00 39.24 ? 176  LYS A CD    1 
ATOM   1283 C  CE    . LYS A 1 196 ? 10.252  -48.203 -114.139 1.00 48.31 ? 176  LYS A CE    1 
ATOM   1284 N  NZ    . LYS A 1 196 ? 11.580  -47.772 -113.618 1.00 55.28 ? 176  LYS A NZ    1 
ATOM   1285 N  N     . ASN A 1 197 ? 4.579   -49.530 -112.678 1.00 19.95 ? 177  ASN A N     1 
ATOM   1286 C  CA    . ASN A 1 197 ? 4.041   -50.545 -111.778 1.00 21.20 ? 177  ASN A CA    1 
ATOM   1287 C  C     . ASN A 1 197 ? 3.053   -51.424 -112.543 1.00 19.59 ? 177  ASN A C     1 
ATOM   1288 O  O     . ASN A 1 197 ? 3.225   -52.635 -112.600 1.00 17.19 ? 177  ASN A O     1 
ATOM   1289 C  CB    . ASN A 1 197 ? 3.339   -49.890 -110.585 1.00 17.49 ? 177  ASN A CB    1 
ATOM   1290 C  CG    . ASN A 1 197 ? 4.310   -49.188 -109.632 1.00 22.92 ? 177  ASN A CG    1 
ATOM   1291 O  OD1   . ASN A 1 197 ? 3.936   -48.237 -108.930 1.00 22.41 ? 177  ASN A OD1   1 
ATOM   1292 N  ND2   . ASN A 1 197 ? 5.550   -49.668 -109.585 1.00 16.70 ? 177  ASN A ND2   1 
ATOM   1293 N  N     . ALA A 1 198 ? 2.025   -50.817 -113.135 1.00 16.27 ? 178  ALA A N     1 
ATOM   1294 C  CA    . ALA A 1 198 ? 1.050   -51.591 -113.899 1.00 18.76 ? 178  ALA A CA    1 
ATOM   1295 C  C     . ALA A 1 198 ? 1.697   -52.277 -115.112 1.00 21.65 ? 178  ALA A C     1 
ATOM   1296 O  O     . ALA A 1 198 ? 1.315   -53.386 -115.483 1.00 21.49 ? 178  ALA A O     1 
ATOM   1297 C  CB    . ALA A 1 198 ? -0.107  -50.692 -114.350 1.00 19.95 ? 178  ALA A CB    1 
ATOM   1298 N  N     . LEU A 1 199 ? 2.672   -51.629 -115.741 1.00 17.33 ? 179  LEU A N     1 
ATOM   1299 C  CA    . LEU A 1 199 ? 3.319   -52.247 -116.895 1.00 17.90 ? 179  LEU A CA    1 
ATOM   1300 C  C     . LEU A 1 199 ? 4.115   -53.480 -116.501 1.00 20.22 ? 179  LEU A C     1 
ATOM   1301 O  O     . LEU A 1 199 ? 4.223   -54.428 -117.278 1.00 19.10 ? 179  LEU A O     1 
ATOM   1302 C  CB    . LEU A 1 199 ? 4.225   -51.246 -117.616 1.00 20.70 ? 179  LEU A CB    1 
ATOM   1303 C  CG    . LEU A 1 199 ? 3.490   -50.210 -118.475 1.00 23.88 ? 179  LEU A CG    1 
ATOM   1304 C  CD1   . LEU A 1 199 ? 4.460   -49.097 -118.842 1.00 27.95 ? 179  LEU A CD1   1 
ATOM   1305 C  CD2   . LEU A 1 199 ? 2.903   -50.862 -119.738 1.00 21.45 ? 179  LEU A CD2   1 
ATOM   1306 N  N     . GLU A 1 200 ? 4.669   -53.474 -115.296 1.00 20.14 ? 180  GLU A N     1 
ATOM   1307 C  CA    . GLU A 1 200 ? 5.447   -54.614 -114.840 1.00 22.05 ? 180  GLU A CA    1 
ATOM   1308 C  C     . GLU A 1 200 ? 4.532   -55.801 -114.541 1.00 21.82 ? 180  GLU A C     1 
ATOM   1309 O  O     . GLU A 1 200 ? 4.856   -56.940 -114.879 1.00 22.95 ? 180  GLU A O     1 
ATOM   1310 C  CB    . GLU A 1 200 ? 6.250   -54.249 -113.591 1.00 27.19 ? 180  GLU A CB    1 
ATOM   1311 C  CG    . GLU A 1 200 ? 7.361   -55.227 -113.292 1.00 43.35 ? 180  GLU A CG    1 
ATOM   1312 C  CD    . GLU A 1 200 ? 8.260   -54.755 -112.174 1.00 51.47 ? 180  GLU A CD    1 
ATOM   1313 O  OE1   . GLU A 1 200 ? 8.649   -53.567 -112.188 1.00 56.79 ? 180  GLU A OE1   1 
ATOM   1314 O  OE2   . GLU A 1 200 ? 8.586   -55.574 -111.289 1.00 58.85 ? 180  GLU A OE2   1 
ATOM   1315 N  N     . VAL A 1 201 ? 3.388   -55.528 -113.915 1.00 19.03 ? 181  VAL A N     1 
ATOM   1316 C  CA    . VAL A 1 201 ? 2.435   -56.582 -113.589 1.00 17.97 ? 181  VAL A CA    1 
ATOM   1317 C  C     . VAL A 1 201 ? 1.876   -57.165 -114.891 1.00 21.61 ? 181  VAL A C     1 
ATOM   1318 O  O     . VAL A 1 201 ? 1.858   -58.380 -115.076 1.00 21.57 ? 181  VAL A O     1 
ATOM   1319 C  CB    . VAL A 1 201 ? 1.264   -56.045 -112.721 1.00 22.14 ? 181  VAL A CB    1 
ATOM   1320 C  CG1   . VAL A 1 201 ? 0.238   -57.142 -112.507 1.00 17.75 ? 181  VAL A CG1   1 
ATOM   1321 C  CG2   . VAL A 1 201 ? 1.783   -55.563 -111.375 1.00 18.00 ? 181  VAL A CG2   1 
ATOM   1322 N  N     . ALA A 1 202 ? 1.430   -56.296 -115.796 1.00 19.61 ? 182  ALA A N     1 
ATOM   1323 C  CA    . ALA A 1 202 ? 0.892   -56.750 -117.072 1.00 17.18 ? 182  ALA A CA    1 
ATOM   1324 C  C     . ALA A 1 202 ? 1.961   -57.479 -117.897 1.00 23.27 ? 182  ALA A C     1 
ATOM   1325 O  O     . ALA A 1 202 ? 1.652   -58.413 -118.635 1.00 20.11 ? 182  ALA A O     1 
ATOM   1326 C  CB    . ALA A 1 202 ? 0.339   -55.561 -117.863 1.00 19.43 ? 182  ALA A CB    1 
ATOM   1327 N  N     . GLY A 1 203 ? 3.211   -57.044 -117.772 1.00 23.77 ? 183  GLY A N     1 
ATOM   1328 C  CA    . GLY A 1 203 ? 4.297   -57.673 -118.508 1.00 24.72 ? 183  GLY A CA    1 
ATOM   1329 C  C     . GLY A 1 203 ? 4.559   -59.103 -118.067 1.00 26.54 ? 183  GLY A C     1 
ATOM   1330 O  O     . GLY A 1 203 ? 5.012   -59.941 -118.856 1.00 24.19 ? 183  GLY A O     1 
ATOM   1331 N  N     . TYR A 1 204 ? 4.276   -59.379 -116.800 1.00 18.88 ? 184  TYR A N     1 
ATOM   1332 C  CA    . TYR A 1 204 ? 4.461   -60.711 -116.229 1.00 23.25 ? 184  TYR A CA    1 
ATOM   1333 C  C     . TYR A 1 204 ? 3.399   -61.656 -116.795 1.00 27.37 ? 184  TYR A C     1 
ATOM   1334 O  O     . TYR A 1 204 ? 3.684   -62.805 -117.136 1.00 26.38 ? 184  TYR A O     1 
ATOM   1335 C  CB    . TYR A 1 204 ? 4.344   -60.622 -114.703 1.00 23.49 ? 184  TYR A CB    1 
ATOM   1336 C  CG    . TYR A 1 204 ? 4.505   -61.927 -113.940 1.00 24.29 ? 184  TYR A CG    1 
ATOM   1337 C  CD1   . TYR A 1 204 ? 5.661   -62.700 -114.063 1.00 25.41 ? 184  TYR A CD1   1 
ATOM   1338 C  CD2   . TYR A 1 204 ? 3.519   -62.356 -113.049 1.00 22.30 ? 184  TYR A CD2   1 
ATOM   1339 C  CE1   . TYR A 1 204 ? 5.831   -63.866 -113.312 1.00 23.38 ? 184  TYR A CE1   1 
ATOM   1340 C  CE2   . TYR A 1 204 ? 3.679   -63.517 -112.296 1.00 19.47 ? 184  TYR A CE2   1 
ATOM   1341 C  CZ    . TYR A 1 204 ? 4.839   -64.265 -112.432 1.00 23.30 ? 184  TYR A CZ    1 
ATOM   1342 O  OH    . TYR A 1 204 ? 5.008   -65.399 -111.674 1.00 24.90 ? 184  TYR A OH    1 
ATOM   1343 N  N     . ALA A 1 205 ? 2.176   -61.152 -116.910 1.00 25.05 ? 185  ALA A N     1 
ATOM   1344 C  CA    . ALA A 1 205 ? 1.060   -61.938 -117.419 1.00 25.19 ? 185  ALA A CA    1 
ATOM   1345 C  C     . ALA A 1 205 ? 1.047   -62.106 -118.935 1.00 26.18 ? 185  ALA A C     1 
ATOM   1346 O  O     . ALA A 1 205 ? 0.509   -63.085 -119.444 1.00 22.66 ? 185  ALA A O     1 
ATOM   1347 C  CB    . ALA A 1 205 ? -0.255  -61.312 -116.967 1.00 24.42 ? 185  ALA A CB    1 
ATOM   1348 N  N     . HIS A 1 206 ? 1.639   -61.164 -119.661 1.00 24.34 ? 186  HIS A N     1 
ATOM   1349 C  CA    . HIS A 1 206 ? 1.621   -61.242 -121.115 1.00 26.28 ? 186  HIS A CA    1 
ATOM   1350 C  C     . HIS A 1 206 ? 2.285   -62.488 -121.700 1.00 23.96 ? 186  HIS A C     1 
ATOM   1351 O  O     . HIS A 1 206 ? 3.379   -62.870 -121.296 1.00 26.70 ? 186  HIS A O     1 
ATOM   1352 C  CB    . HIS A 1 206 ? 2.275   -60.009 -121.733 1.00 23.72 ? 186  HIS A CB    1 
ATOM   1353 C  CG    . HIS A 1 206 ? 2.160   -59.970 -123.221 1.00 25.04 ? 186  HIS A CG    1 
ATOM   1354 N  ND1   . HIS A 1 206 ? 1.000   -59.598 -123.868 1.00 22.20 ? 186  HIS A ND1   1 
ATOM   1355 C  CD2   . HIS A 1 206 ? 3.032   -60.333 -124.191 1.00 22.38 ? 186  HIS A CD2   1 
ATOM   1356 C  CE1   . HIS A 1 206 ? 1.162   -59.736 -125.172 1.00 24.38 ? 186  HIS A CE1   1 
ATOM   1357 N  NE2   . HIS A 1 206 ? 2.386   -60.182 -125.394 1.00 22.57 ? 186  HIS A NE2   1 
ATOM   1358 N  N     . GLY A 1 207 ? 1.614   -63.115 -122.660 1.00 22.23 ? 187  GLY A N     1 
ATOM   1359 C  CA    . GLY A 1 207 ? 2.184   -64.297 -123.288 1.00 23.49 ? 187  GLY A CA    1 
ATOM   1360 C  C     . GLY A 1 207 ? 1.823   -65.618 -122.629 1.00 27.89 ? 187  GLY A C     1 
ATOM   1361 O  O     . GLY A 1 207 ? 1.901   -66.668 -123.271 1.00 29.46 ? 187  GLY A O     1 
ATOM   1362 N  N     . ILE A 1 208 ? 1.451   -65.573 -121.350 1.00 27.03 ? 188  ILE A N     1 
ATOM   1363 C  CA    . ILE A 1 208 ? 1.057   -66.776 -120.607 1.00 22.07 ? 188  ILE A CA    1 
ATOM   1364 C  C     . ILE A 1 208 ? -0.443  -66.915 -120.834 1.00 25.14 ? 188  ILE A C     1 
ATOM   1365 O  O     . ILE A 1 208 ? -1.227  -66.117 -120.327 1.00 29.33 ? 188  ILE A O     1 
ATOM   1366 C  CB    . ILE A 1 208 ? 1.352   -66.617 -119.101 1.00 23.42 ? 188  ILE A CB    1 
ATOM   1367 C  CG1   . ILE A 1 208 ? 2.863   -66.460 -118.890 1.00 28.17 ? 188  ILE A CG1   1 
ATOM   1368 C  CG2   . ILE A 1 208 ? 0.829   -67.825 -118.327 1.00 22.06 ? 188  ILE A CG2   1 
ATOM   1369 C  CD1   . ILE A 1 208 ? 3.275   -66.302 -117.446 1.00 33.46 ? 188  ILE A CD1   1 
ATOM   1370 N  N     . PRO A 1 209 ? -0.861  -67.926 -121.609 1.00 23.20 ? 189  PRO A N     1 
ATOM   1371 C  CA    . PRO A 1 209 ? -2.278  -68.153 -121.913 1.00 21.31 ? 189  PRO A CA    1 
ATOM   1372 C  C     . PRO A 1 209 ? -3.315  -68.029 -120.792 1.00 27.40 ? 189  PRO A C     1 
ATOM   1373 O  O     . PRO A 1 209 ? -4.358  -67.403 -120.995 1.00 25.99 ? 189  PRO A O     1 
ATOM   1374 C  CB    . PRO A 1 209 ? -2.271  -69.532 -122.555 1.00 21.78 ? 189  PRO A CB    1 
ATOM   1375 C  CG    . PRO A 1 209 ? -0.970  -69.523 -123.301 1.00 22.82 ? 189  PRO A CG    1 
ATOM   1376 C  CD    . PRO A 1 209 ? -0.017  -68.930 -122.286 1.00 18.21 ? 189  PRO A CD    1 
ATOM   1377 N  N     . ASN A 1 210 ? -3.060  -68.611 -119.622 1.00 21.89 ? 190  ASN A N     1 
ATOM   1378 C  CA    . ASN A 1 210 ? -4.055  -68.515 -118.550 1.00 22.96 ? 190  ASN A CA    1 
ATOM   1379 C  C     . ASN A 1 210 ? -3.801  -67.445 -117.485 1.00 25.73 ? 190  ASN A C     1 
ATOM   1380 O  O     . ASN A 1 210 ? -4.456  -67.440 -116.439 1.00 23.50 ? 190  ASN A O     1 
ATOM   1381 C  CB    . ASN A 1 210 ? -4.287  -69.884 -117.887 1.00 18.66 ? 190  ASN A CB    1 
ATOM   1382 C  CG    . ASN A 1 210 ? -3.040  -70.453 -117.241 1.00 20.60 ? 190  ASN A CG    1 
ATOM   1383 O  OD1   . ASN A 1 210 ? -2.002  -69.800 -117.169 1.00 19.89 ? 190  ASN A OD1   1 
ATOM   1384 N  ND2   . ASN A 1 210 ? -3.144  -71.689 -116.762 1.00 20.15 ? 190  ASN A ND2   1 
ATOM   1385 N  N     . ALA A 1 211 ? -2.853  -66.548 -117.748 1.00 24.06 ? 191  ALA A N     1 
ATOM   1386 C  CA    . ALA A 1 211 ? -2.566  -65.442 -116.829 1.00 22.38 ? 191  ALA A CA    1 
ATOM   1387 C  C     . ALA A 1 211 ? -3.430  -64.294 -117.344 1.00 24.15 ? 191  ALA A C     1 
ATOM   1388 O  O     . ALA A 1 211 ? -3.354  -63.940 -118.519 1.00 28.66 ? 191  ALA A O     1 
ATOM   1389 C  CB    . ALA A 1 211 ? -1.091  -65.060 -116.884 1.00 25.99 ? 191  ALA A CB    1 
ATOM   1390 N  N     . ILE A 1 212 ? -4.245  -63.711 -116.470 1.00 20.22 ? 192  ILE A N     1 
ATOM   1391 C  CA    . ILE A 1 212 ? -5.145  -62.643 -116.880 1.00 18.57 ? 192  ILE A CA    1 
ATOM   1392 C  C     . ILE A 1 212 ? -4.886  -61.295 -116.219 1.00 16.57 ? 192  ILE A C     1 
ATOM   1393 O  O     . ILE A 1 212 ? -5.044  -61.149 -115.006 1.00 20.61 ? 192  ILE A O     1 
ATOM   1394 C  CB    . ILE A 1 212 ? -6.615  -63.024 -116.583 1.00 19.15 ? 192  ILE A CB    1 
ATOM   1395 C  CG1   . ILE A 1 212 ? -6.905  -64.444 -117.078 1.00 24.29 ? 192  ILE A CG1   1 
ATOM   1396 C  CG2   . ILE A 1 212 ? -7.559  -62.032 -117.260 1.00 24.73 ? 192  ILE A CG2   1 
ATOM   1397 C  CD1   . ILE A 1 212 ? -8.326  -64.905 -116.780 1.00 25.33 ? 192  ILE A CD1   1 
ATOM   1398 N  N     . PHE A 1 213 ? -4.492  -60.308 -117.016 1.00 19.71 ? 193  PHE A N     1 
ATOM   1399 C  CA    . PHE A 1 213 ? -4.284  -58.975 -116.481 1.00 21.13 ? 193  PHE A CA    1 
ATOM   1400 C  C     . PHE A 1 213 ? -5.533  -58.154 -116.774 1.00 23.91 ? 193  PHE A C     1 
ATOM   1401 O  O     . PHE A 1 213 ? -6.025  -58.125 -117.912 1.00 19.43 ? 193  PHE A O     1 
ATOM   1402 C  CB    . PHE A 1 213 ? -3.071  -58.285 -117.102 1.00 17.98 ? 193  PHE A CB    1 
ATOM   1403 C  CG    . PHE A 1 213 ? -2.870  -56.886 -116.592 1.00 21.06 ? 193  PHE A CG    1 
ATOM   1404 C  CD1   . PHE A 1 213 ? -3.279  -55.788 -117.346 1.00 19.68 ? 193  PHE A CD1   1 
ATOM   1405 C  CD2   . PHE A 1 213 ? -2.325  -56.669 -115.330 1.00 19.33 ? 193  PHE A CD2   1 
ATOM   1406 C  CE1   . PHE A 1 213 ? -3.151  -54.493 -116.850 1.00 14.74 ? 193  PHE A CE1   1 
ATOM   1407 C  CE2   . PHE A 1 213 ? -2.192  -55.368 -114.821 1.00 20.29 ? 193  PHE A CE2   1 
ATOM   1408 C  CZ    . PHE A 1 213 ? -2.606  -54.280 -115.584 1.00 23.38 ? 193  PHE A CZ    1 
ATOM   1409 N  N     . THR A 1 214 ? -6.040  -57.484 -115.745 1.00 22.71 ? 194  THR A N     1 
ATOM   1410 C  CA    . THR A 1 214 ? -7.243  -56.682 -115.882 1.00 21.15 ? 194  THR A CA    1 
ATOM   1411 C  C     . THR A 1 214 ? -6.960  -55.238 -115.488 1.00 20.66 ? 194  THR A C     1 
ATOM   1412 O  O     . THR A 1 214 ? -6.156  -54.977 -114.590 1.00 20.43 ? 194  THR A O     1 
ATOM   1413 C  CB    . THR A 1 214 ? -8.394  -57.300 -115.037 1.00 20.75 ? 194  THR A CB    1 
ATOM   1414 O  OG1   . THR A 1 214 ? -8.053  -57.282 -113.646 1.00 21.16 ? 194  THR A OG1   1 
ATOM   1415 C  CG2   . THR A 1 214 ? -8.610  -58.752 -115.450 1.00 22.40 ? 194  THR A CG2   1 
ATOM   1416 N  N     . LEU A 1 215 ? -7.622  -54.305 -116.168 1.00 19.07 ? 195  LEU A N     1 
ATOM   1417 C  CA    . LEU A 1 215 ? -7.400  -52.879 -115.941 1.00 19.64 ? 195  LEU A CA    1 
ATOM   1418 C  C     . LEU A 1 215 ? -8.688  -52.064 -115.911 1.00 18.60 ? 195  LEU A C     1 
ATOM   1419 O  O     . LEU A 1 215 ? -9.628  -52.364 -116.639 1.00 21.68 ? 195  LEU A O     1 
ATOM   1420 C  CB    . LEU A 1 215 ? -6.515  -52.334 -117.068 1.00 19.91 ? 195  LEU A CB    1 
ATOM   1421 C  CG    . LEU A 1 215 ? -6.170  -50.845 -117.101 1.00 19.35 ? 195  LEU A CG    1 
ATOM   1422 C  CD1   . LEU A 1 215 ? -5.179  -50.532 -115.991 1.00 23.77 ? 195  LEU A CD1   1 
ATOM   1423 C  CD2   . LEU A 1 215 ? -5.566  -50.490 -118.445 1.00 21.17 ? 195  LEU A CD2   1 
ATOM   1424 N  N     . ASN A 1 216 ? -8.713  -51.031 -115.072 1.00 18.34 ? 196  ASN A N     1 
ATOM   1425 C  CA    . ASN A 1 216 ? -9.865  -50.129 -114.970 1.00 20.47 ? 196  ASN A CA    1 
ATOM   1426 C  C     . ASN A 1 216 ? -9.422  -48.785 -115.561 1.00 22.10 ? 196  ASN A C     1 
ATOM   1427 O  O     . ASN A 1 216 ? -8.329  -48.306 -115.263 1.00 21.91 ? 196  ASN A O     1 
ATOM   1428 C  CB    . ASN A 1 216 ? -10.265 -49.943 -113.497 1.00 20.96 ? 196  ASN A CB    1 
ATOM   1429 C  CG    . ASN A 1 216 ? -11.649 -49.331 -113.332 1.00 21.13 ? 196  ASN A CG    1 
ATOM   1430 O  OD1   . ASN A 1 216 ? -11.992 -48.362 -114.000 1.00 24.33 ? 196  ASN A OD1   1 
ATOM   1431 N  ND2   . ASN A 1 216 ? -12.445 -49.897 -112.423 1.00 19.56 ? 196  ASN A ND2   1 
ATOM   1432 N  N     . LEU A 1 217 ? -10.250 -48.185 -116.412 1.00 21.44 ? 197  LEU A N     1 
ATOM   1433 C  CA    . LEU A 1 217 ? -9.908  -46.888 -117.009 1.00 19.69 ? 197  LEU A CA    1 
ATOM   1434 C  C     . LEU A 1 217 ? -9.858  -45.817 -115.921 1.00 18.80 ? 197  LEU A C     1 
ATOM   1435 O  O     . LEU A 1 217 ? -9.219  -44.778 -116.087 1.00 20.78 ? 197  LEU A O     1 
ATOM   1436 C  CB    . LEU A 1 217 ? -10.925 -46.509 -118.094 1.00 20.14 ? 197  LEU A CB    1 
ATOM   1437 C  CG    . LEU A 1 217 ? -10.882 -47.364 -119.366 1.00 24.24 ? 197  LEU A CG    1 
ATOM   1438 C  CD1   . LEU A 1 217 ? -11.989 -46.926 -120.321 1.00 22.09 ? 197  LEU A CD1   1 
ATOM   1439 C  CD2   . LEU A 1 217 ? -9.515  -47.229 -120.037 1.00 20.45 ? 197  LEU A CD2   1 
ATOM   1440 N  N     . SER A 1 218 ? -10.563 -46.087 -114.820 1.00 18.95 ? 198  SER A N     1 
ATOM   1441 C  CA    . SER A 1 218 ? -10.602 -45.228 -113.635 1.00 21.89 ? 198  SER A CA    1 
ATOM   1442 C  C     . SER A 1 218 ? -11.210 -43.835 -113.714 1.00 26.63 ? 198  SER A C     1 
ATOM   1443 O  O     . SER A 1 218 ? -12.048 -43.479 -112.884 1.00 25.20 ? 198  SER A O     1 
ATOM   1444 C  CB    . SER A 1 218 ? -9.196  -45.100 -113.047 1.00 18.80 ? 198  SER A CB    1 
ATOM   1445 O  OG    . SER A 1 218 ? -8.733  -46.346 -112.566 1.00 22.57 ? 198  SER A OG    1 
ATOM   1446 N  N     . ALA A 1 219 ? -10.773 -43.038 -114.681 1.00 22.20 ? 199  ALA A N     1 
ATOM   1447 C  CA    . ALA A 1 219 ? -11.284 -41.679 -114.805 1.00 25.12 ? 199  ALA A CA    1 
ATOM   1448 C  C     . ALA A 1 219 ? -10.878 -41.068 -116.131 1.00 25.85 ? 199  ALA A C     1 
ATOM   1449 O  O     . ALA A 1 219 ? -9.870  -41.457 -116.724 1.00 26.01 ? 199  ALA A O     1 
ATOM   1450 C  CB    . ALA A 1 219 ? -10.762 -40.818 -113.651 1.00 22.18 ? 199  ALA A CB    1 
ATOM   1451 N  N     . PRO A 1 220 ? -11.663 -40.098 -116.618 1.00 25.81 ? 200  PRO A N     1 
ATOM   1452 C  CA    . PRO A 1 220 ? -11.378 -39.428 -117.888 1.00 27.56 ? 200  PRO A CA    1 
ATOM   1453 C  C     . PRO A 1 220 ? -9.965  -38.861 -117.984 1.00 29.83 ? 200  PRO A C     1 
ATOM   1454 O  O     . PRO A 1 220 ? -9.313  -38.997 -119.017 1.00 31.65 ? 200  PRO A O     1 
ATOM   1455 C  CB    . PRO A 1 220 ? -12.441 -38.332 -117.944 1.00 27.95 ? 200  PRO A CB    1 
ATOM   1456 C  CG    . PRO A 1 220 ? -13.599 -38.969 -117.258 1.00 25.19 ? 200  PRO A CG    1 
ATOM   1457 C  CD    . PRO A 1 220 ? -12.949 -39.639 -116.060 1.00 27.04 ? 200  PRO A CD    1 
ATOM   1458 N  N     . PHE A 1 221 ? -9.481  -38.242 -116.910 1.00 29.71 ? 201  PHE A N     1 
ATOM   1459 C  CA    . PHE A 1 221 ? -8.152  -37.648 -116.953 1.00 28.97 ? 201  PHE A CA    1 
ATOM   1460 C  C     . PHE A 1 221 ? -7.025  -38.671 -117.109 1.00 29.41 ? 201  PHE A C     1 
ATOM   1461 O  O     . PHE A 1 221 ? -5.971  -38.352 -117.659 1.00 31.97 ? 201  PHE A O     1 
ATOM   1462 C  CB    . PHE A 1 221 ? -7.922  -36.744 -115.726 1.00 28.59 ? 201  PHE A CB    1 
ATOM   1463 C  CG    . PHE A 1 221 ? -7.468  -37.468 -114.486 1.00 31.56 ? 201  PHE A CG    1 
ATOM   1464 C  CD1   . PHE A 1 221 ? -6.124  -37.773 -114.295 1.00 31.15 ? 201  PHE A CD1   1 
ATOM   1465 C  CD2   . PHE A 1 221 ? -8.385  -37.835 -113.504 1.00 27.25 ? 201  PHE A CD2   1 
ATOM   1466 C  CE1   . PHE A 1 221 ? -5.697  -38.434 -113.142 1.00 34.55 ? 201  PHE A CE1   1 
ATOM   1467 C  CE2   . PHE A 1 221 ? -7.970  -38.497 -112.347 1.00 29.87 ? 201  PHE A CE2   1 
ATOM   1468 C  CZ    . PHE A 1 221 ? -6.623  -38.797 -112.165 1.00 27.81 ? 201  PHE A CZ    1 
ATOM   1469 N  N     . CYS A 1 222 ? -7.244  -39.901 -116.650 1.00 29.42 ? 202  CYS A N     1 
ATOM   1470 C  CA    . CYS A 1 222 ? -6.218  -40.931 -116.783 1.00 27.63 ? 202  CYS A CA    1 
ATOM   1471 C  C     . CYS A 1 222 ? -6.012  -41.285 -118.249 1.00 27.21 ? 202  CYS A C     1 
ATOM   1472 O  O     . CYS A 1 222 ? -4.895  -41.536 -118.684 1.00 25.31 ? 202  CYS A O     1 
ATOM   1473 C  CB    . CYS A 1 222 ? -6.605  -42.196 -116.004 1.00 26.31 ? 202  CYS A CB    1 
ATOM   1474 S  SG    . CYS A 1 222 ? -6.491  -42.026 -114.212 1.00 34.63 ? 202  CYS A SG    1 
ATOM   1475 N  N     . VAL A 1 223 ? -7.104  -41.298 -119.008 1.00 28.47 ? 203  VAL A N     1 
ATOM   1476 C  CA    . VAL A 1 223 ? -7.054  -41.625 -120.425 1.00 25.52 ? 203  VAL A CA    1 
ATOM   1477 C  C     . VAL A 1 223 ? -6.230  -40.609 -121.222 1.00 23.76 ? 203  VAL A C     1 
ATOM   1478 O  O     . VAL A 1 223 ? -5.491  -40.975 -122.132 1.00 27.08 ? 203  VAL A O     1 
ATOM   1479 C  CB    . VAL A 1 223 ? -8.486  -41.695 -121.015 1.00 24.29 ? 203  VAL A CB    1 
ATOM   1480 C  CG1   . VAL A 1 223 ? -8.435  -41.901 -122.515 1.00 32.13 ? 203  VAL A CG1   1 
ATOM   1481 C  CG2   . VAL A 1 223 ? -9.252  -42.809 -120.350 1.00 28.65 ? 203  VAL A CG2   1 
ATOM   1482 N  N     . GLU A 1 224 ? -6.353  -39.334 -120.874 1.00 26.22 ? 204  GLU A N     1 
ATOM   1483 C  CA    . GLU A 1 224 ? -5.617  -38.299 -121.590 1.00 23.79 ? 204  GLU A CA    1 
ATOM   1484 C  C     . GLU A 1 224 ? -4.193  -38.145 -121.080 1.00 20.36 ? 204  GLU A C     1 
ATOM   1485 O  O     . GLU A 1 224 ? -3.233  -38.186 -121.855 1.00 22.92 ? 204  GLU A O     1 
ATOM   1486 C  CB    . GLU A 1 224 ? -6.334  -36.952 -121.469 1.00 27.69 ? 204  GLU A CB    1 
ATOM   1487 C  CG    . GLU A 1 224 ? -7.800  -36.997 -121.869 1.00 32.13 ? 204  GLU A CG    1 
ATOM   1488 C  CD    . GLU A 1 224 ? -8.373  -35.618 -122.141 1.00 40.03 ? 204  GLU A CD    1 
ATOM   1489 O  OE1   . GLU A 1 224 ? -8.168  -34.709 -121.308 1.00 35.57 ? 204  GLU A OE1   1 
ATOM   1490 O  OE2   . GLU A 1 224 ? -9.035  -35.448 -123.187 1.00 39.27 ? 204  GLU A OE2   1 
ATOM   1491 N  N     . LEU A 1 225 ? -4.059  -37.967 -119.774 1.00 22.41 ? 205  LEU A N     1 
ATOM   1492 C  CA    . LEU A 1 225 ? -2.749  -37.762 -119.169 1.00 25.05 ? 205  LEU A CA    1 
ATOM   1493 C  C     . LEU A 1 225 ? -1.726  -38.867 -119.453 1.00 23.72 ? 205  LEU A C     1 
ATOM   1494 O  O     . LEU A 1 225 ? -0.537  -38.583 -119.629 1.00 23.51 ? 205  LEU A O     1 
ATOM   1495 C  CB    . LEU A 1 225 ? -2.899  -37.578 -117.657 1.00 25.39 ? 205  LEU A CB    1 
ATOM   1496 C  CG    . LEU A 1 225 ? -1.730  -36.939 -116.900 1.00 25.05 ? 205  LEU A CG    1 
ATOM   1497 C  CD1   . LEU A 1 225 ? -1.448  -35.543 -117.466 1.00 21.30 ? 205  LEU A CD1   1 
ATOM   1498 C  CD2   . LEU A 1 225 ? -2.071  -36.845 -115.418 1.00 22.81 ? 205  LEU A CD2   1 
ATOM   1499 N  N     . TYR A 1 226 ? -2.183  -40.116 -119.512 1.00 17.56 ? 206  TYR A N     1 
ATOM   1500 C  CA    . TYR A 1 226 ? -1.281  -41.246 -119.742 1.00 18.85 ? 206  TYR A CA    1 
ATOM   1501 C  C     . TYR A 1 226 ? -1.510  -41.956 -121.068 1.00 21.07 ? 206  TYR A C     1 
ATOM   1502 O  O     . TYR A 1 226 ? -1.295  -43.160 -121.178 1.00 20.05 ? 206  TYR A O     1 
ATOM   1503 C  CB    . TYR A 1 226 ? -1.415  -42.256 -118.589 1.00 20.69 ? 206  TYR A CB    1 
ATOM   1504 C  CG    . TYR A 1 226 ? -1.138  -41.630 -117.245 1.00 24.71 ? 206  TYR A CG    1 
ATOM   1505 C  CD1   . TYR A 1 226 ? -2.184  -41.231 -116.405 1.00 18.89 ? 206  TYR A CD1   1 
ATOM   1506 C  CD2   . TYR A 1 226 ? 0.169   -41.325 -116.863 1.00 15.49 ? 206  TYR A CD2   1 
ATOM   1507 C  CE1   . TYR A 1 226 ? -1.931  -40.531 -115.220 1.00 20.01 ? 206  TYR A CE1   1 
ATOM   1508 C  CE2   . TYR A 1 226 ? 0.431   -40.621 -115.691 1.00 19.67 ? 206  TYR A CE2   1 
ATOM   1509 C  CZ    . TYR A 1 226 ? -0.621  -40.225 -114.877 1.00 20.52 ? 206  TYR A CZ    1 
ATOM   1510 O  OH    . TYR A 1 226 ? -0.352  -39.488 -113.743 1.00 21.51 ? 206  TYR A OH    1 
ATOM   1511 N  N     . LYS A 1 227 ? -1.910  -41.192 -122.080 1.00 20.21 ? 207  LYS A N     1 
ATOM   1512 C  CA    . LYS A 1 227 ? -2.202  -41.729 -123.403 1.00 19.17 ? 207  LYS A CA    1 
ATOM   1513 C  C     . LYS A 1 227 ? -1.276  -42.812 -123.946 1.00 23.39 ? 207  LYS A C     1 
ATOM   1514 O  O     . LYS A 1 227 ? -1.720  -43.910 -124.271 1.00 24.48 ? 207  LYS A O     1 
ATOM   1515 C  CB    . LYS A 1 227 ? -2.255  -40.596 -124.433 1.00 22.01 ? 207  LYS A CB    1 
ATOM   1516 C  CG    . LYS A 1 227 ? -2.455  -41.097 -125.857 1.00 27.66 ? 207  LYS A CG    1 
ATOM   1517 C  CD    . LYS A 1 227 ? -2.299  -39.979 -126.877 1.00 33.33 ? 207  LYS A CD    1 
ATOM   1518 C  CE    . LYS A 1 227 ? -2.477  -40.511 -128.290 1.00 36.65 ? 207  LYS A CE    1 
ATOM   1519 N  NZ    . LYS A 1 227 ? -2.239  -39.463 -129.318 1.00 41.38 ? 207  LYS A NZ    1 
ATOM   1520 N  N     . ASP A 1 228 ? 0.011   -42.505 -124.049 1.00 21.21 ? 208  ASP A N     1 
ATOM   1521 C  CA    . ASP A 1 228 ? 0.953   -43.459 -124.616 1.00 23.28 ? 208  ASP A CA    1 
ATOM   1522 C  C     . ASP A 1 228 ? 1.289   -44.634 -123.705 1.00 21.71 ? 208  ASP A C     1 
ATOM   1523 O  O     . ASP A 1 228 ? 1.425   -45.764 -124.173 1.00 23.02 ? 208  ASP A O     1 
ATOM   1524 C  CB    . ASP A 1 228 ? 2.200   -42.708 -125.068 1.00 22.53 ? 208  ASP A CB    1 
ATOM   1525 C  CG    . ASP A 1 228 ? 1.849   -41.474 -125.896 1.00 32.41 ? 208  ASP A CG    1 
ATOM   1526 O  OD1   . ASP A 1 228 ? 2.020   -40.344 -125.391 1.00 30.32 ? 208  ASP A OD1   1 
ATOM   1527 O  OD2   . ASP A 1 228 ? 1.370   -41.635 -127.039 1.00 29.03 ? 208  ASP A OD2   1 
ATOM   1528 N  N     . ALA A 1 229 ? 1.408   -44.379 -122.408 1.00 22.64 ? 209  ALA A N     1 
ATOM   1529 C  CA    . ALA A 1 229 ? 1.684   -45.464 -121.472 1.00 22.12 ? 209  ALA A CA    1 
ATOM   1530 C  C     . ALA A 1 229 ? 0.477   -46.401 -121.457 1.00 24.14 ? 209  ALA A C     1 
ATOM   1531 O  O     . ALA A 1 229 ? 0.627   -47.625 -121.396 1.00 22.10 ? 209  ALA A O     1 
ATOM   1532 C  CB    . ALA A 1 229 ? 1.933   -44.910 -120.079 1.00 22.86 ? 209  ALA A CB    1 
ATOM   1533 N  N     . MET A 1 230 ? -0.724  -45.834 -121.530 1.00 24.38 ? 210  MET A N     1 
ATOM   1534 C  CA    . MET A 1 230 ? -1.922  -46.666 -121.513 1.00 23.08 ? 210  MET A CA    1 
ATOM   1535 C  C     . MET A 1 230 ? -2.053  -47.482 -122.791 1.00 26.38 ? 210  MET A C     1 
ATOM   1536 O  O     . MET A 1 230 ? -2.507  -48.617 -122.752 1.00 21.51 ? 210  MET A O     1 
ATOM   1537 C  CB    . MET A 1 230 ? -3.189  -45.829 -121.321 1.00 26.48 ? 210  MET A CB    1 
ATOM   1538 C  CG    . MET A 1 230 ? -4.420  -46.691 -121.074 1.00 27.54 ? 210  MET A CG    1 
ATOM   1539 S  SD    . MET A 1 230 ? -5.925  -45.762 -120.709 1.00 26.78 ? 210  MET A SD    1 
ATOM   1540 C  CE    . MET A 1 230 ? -5.504  -45.028 -119.099 1.00 24.21 ? 210  MET A CE    1 
ATOM   1541 N  N     . GLN A 1 231 ? -1.654  -46.908 -123.921 1.00 23.58 ? 211  GLN A N     1 
ATOM   1542 C  CA    . GLN A 1 231 ? -1.745  -47.619 -125.189 1.00 26.48 ? 211  GLN A CA    1 
ATOM   1543 C  C     . GLN A 1 231 ? -0.870  -48.866 -125.124 1.00 24.32 ? 211  GLN A C     1 
ATOM   1544 O  O     . GLN A 1 231 ? -1.268  -49.937 -125.577 1.00 19.15 ? 211  GLN A O     1 
ATOM   1545 C  CB    . GLN A 1 231 ? -1.295  -46.716 -126.343 1.00 25.37 ? 211  GLN A CB    1 
ATOM   1546 C  CG    . GLN A 1 231 ? -1.601  -47.277 -127.722 1.00 29.13 ? 211  GLN A CG    1 
ATOM   1547 C  CD    . GLN A 1 231 ? -1.233  -46.318 -128.835 1.00 39.36 ? 211  GLN A CD    1 
ATOM   1548 O  OE1   . GLN A 1 231 ? -1.500  -45.121 -128.750 1.00 37.46 ? 211  GLN A OE1   1 
ATOM   1549 N  NE2   . GLN A 1 231 ? -0.627  -46.842 -129.893 1.00 49.27 ? 211  GLN A NE2   1 
ATOM   1550 N  N     . SER A 1 232 ? 0.320   -48.726 -124.550 1.00 23.23 ? 212  SER A N     1 
ATOM   1551 C  CA    . SER A 1 232 ? 1.227   -49.857 -124.427 1.00 20.78 ? 212  SER A CA    1 
ATOM   1552 C  C     . SER A 1 232 ? 0.645   -50.870 -123.451 1.00 24.43 ? 212  SER A C     1 
ATOM   1553 O  O     . SER A 1 232 ? 0.600   -52.066 -123.732 1.00 23.46 ? 212  SER A O     1 
ATOM   1554 C  CB    . SER A 1 232 ? 2.595   -49.400 -123.923 1.00 26.62 ? 212  SER A CB    1 
ATOM   1555 O  OG    . SER A 1 232 ? 3.410   -50.526 -123.657 1.00 29.94 ? 212  SER A OG    1 
ATOM   1556 N  N     . LEU A 1 233 ? 0.188   -50.375 -122.308 1.00 20.89 ? 213  LEU A N     1 
ATOM   1557 C  CA    . LEU A 1 233 ? -0.397  -51.231 -121.285 1.00 15.51 ? 213  LEU A CA    1 
ATOM   1558 C  C     . LEU A 1 233 ? -1.574  -52.033 -121.839 1.00 21.21 ? 213  LEU A C     1 
ATOM   1559 O  O     . LEU A 1 233 ? -1.719  -53.219 -121.543 1.00 21.98 ? 213  LEU A O     1 
ATOM   1560 C  CB    . LEU A 1 233 ? -0.859  -50.378 -120.105 1.00 14.79 ? 213  LEU A CB    1 
ATOM   1561 C  CG    . LEU A 1 233 ? -1.484  -51.094 -118.905 1.00 17.38 ? 213  LEU A CG    1 
ATOM   1562 C  CD1   . LEU A 1 233 ? -0.465  -52.052 -118.279 1.00 21.05 ? 213  LEU A CD1   1 
ATOM   1563 C  CD2   . LEU A 1 233 ? -1.924  -50.043 -117.878 1.00 20.94 ? 213  LEU A CD2   1 
ATOM   1564 N  N     . LEU A 1 234 ? -2.411  -51.395 -122.652 1.00 16.78 ? 214  LEU A N     1 
ATOM   1565 C  CA    . LEU A 1 234 ? -3.568  -52.082 -123.213 1.00 18.70 ? 214  LEU A CA    1 
ATOM   1566 C  C     . LEU A 1 234 ? -3.186  -53.261 -124.099 1.00 22.57 ? 214  LEU A C     1 
ATOM   1567 O  O     . LEU A 1 234 ? -3.924  -54.244 -124.169 1.00 20.29 ? 214  LEU A O     1 
ATOM   1568 C  CB    . LEU A 1 234 ? -4.460  -51.098 -123.975 1.00 18.55 ? 214  LEU A CB    1 
ATOM   1569 C  CG    . LEU A 1 234 ? -5.231  -50.119 -123.078 1.00 20.32 ? 214  LEU A CG    1 
ATOM   1570 C  CD1   . LEU A 1 234 ? -5.912  -49.058 -123.938 1.00 18.61 ? 214  LEU A CD1   1 
ATOM   1571 C  CD2   . LEU A 1 234 ? -6.258  -50.887 -122.238 1.00 18.94 ? 214  LEU A CD2   1 
ATOM   1572 N  N     . LEU A 1 235 ? -2.042  -53.183 -124.777 1.00 17.93 ? 215  LEU A N     1 
ATOM   1573 C  CA    . LEU A 1 235 ? -1.619  -54.310 -125.610 1.00 18.27 ? 215  LEU A CA    1 
ATOM   1574 C  C     . LEU A 1 235 ? -1.339  -55.529 -124.729 1.00 20.84 ? 215  LEU A C     1 
ATOM   1575 O  O     . LEU A 1 235 ? -1.412  -56.663 -125.200 1.00 22.98 ? 215  LEU A O     1 
ATOM   1576 C  CB    . LEU A 1 235 ? -0.351  -53.972 -126.409 1.00 17.84 ? 215  LEU A CB    1 
ATOM   1577 C  CG    . LEU A 1 235 ? -0.479  -52.905 -127.498 1.00 18.85 ? 215  LEU A CG    1 
ATOM   1578 C  CD1   . LEU A 1 235 ? 0.896   -52.549 -128.031 1.00 23.49 ? 215  LEU A CD1   1 
ATOM   1579 C  CD2   . LEU A 1 235 ? -1.363  -53.419 -128.627 1.00 20.95 ? 215  LEU A CD2   1 
ATOM   1580 N  N     . HIS A 1 236 ? -1.013  -55.291 -123.458 1.00 18.66 ? 216  HIS A N     1 
ATOM   1581 C  CA    . HIS A 1 236 ? -0.726  -56.376 -122.513 1.00 20.26 ? 216  HIS A CA    1 
ATOM   1582 C  C     . HIS A 1 236 ? -1.949  -56.678 -121.646 1.00 20.79 ? 216  HIS A C     1 
ATOM   1583 O  O     . HIS A 1 236 ? -1.841  -57.398 -120.651 1.00 22.44 ? 216  HIS A O     1 
ATOM   1584 C  CB    . HIS A 1 236 ? 0.409   -55.993 -121.548 1.00 20.55 ? 216  HIS A CB    1 
ATOM   1585 C  CG    . HIS A 1 236 ? 1.693   -55.606 -122.215 1.00 25.23 ? 216  HIS A CG    1 
ATOM   1586 N  ND1   . HIS A 1 236 ? 1.843   -54.440 -122.935 1.00 25.72 ? 216  HIS A ND1   1 
ATOM   1587 C  CD2   . HIS A 1 236 ? 2.907   -56.206 -122.216 1.00 23.57 ? 216  HIS A CD2   1 
ATOM   1588 C  CE1   . HIS A 1 236 ? 3.093   -54.338 -123.349 1.00 25.45 ? 216  HIS A CE1   1 
ATOM   1589 N  NE2   . HIS A 1 236 ? 3.759   -55.397 -122.926 1.00 28.73 ? 216  HIS A NE2   1 
ATOM   1590 N  N     . THR A 1 237 ? -3.104  -56.134 -122.008 1.00 18.06 ? 217  THR A N     1 
ATOM   1591 C  CA    . THR A 1 237 ? -4.303  -56.332 -121.190 1.00 21.72 ? 217  THR A CA    1 
ATOM   1592 C  C     . THR A 1 237 ? -5.277  -57.392 -121.709 1.00 21.61 ? 217  THR A C     1 
ATOM   1593 O  O     . THR A 1 237 ? -5.532  -57.471 -122.907 1.00 21.95 ? 217  THR A O     1 
ATOM   1594 C  CB    . THR A 1 237 ? -5.057  -54.994 -121.027 1.00 20.54 ? 217  THR A CB    1 
ATOM   1595 O  OG1   . THR A 1 237 ? -4.224  -54.059 -120.329 1.00 20.70 ? 217  THR A OG1   1 
ATOM   1596 C  CG2   . THR A 1 237 ? -6.352  -55.195 -120.249 1.00 21.81 ? 217  THR A CG2   1 
ATOM   1597 N  N     . ASN A 1 238 ? -5.831  -58.188 -120.795 1.00 19.81 ? 218  ASN A N     1 
ATOM   1598 C  CA    . ASN A 1 238 ? -6.775  -59.238 -121.160 1.00 19.73 ? 218  ASN A CA    1 
ATOM   1599 C  C     . ASN A 1 238 ? -8.216  -58.768 -120.996 1.00 21.09 ? 218  ASN A C     1 
ATOM   1600 O  O     . ASN A 1 238 ? -9.068  -59.049 -121.848 1.00 21.06 ? 218  ASN A O     1 
ATOM   1601 C  CB    . ASN A 1 238 ? -6.537  -60.493 -120.311 1.00 21.02 ? 218  ASN A CB    1 
ATOM   1602 C  CG    . ASN A 1 238 ? -5.148  -61.071 -120.511 1.00 20.61 ? 218  ASN A CG    1 
ATOM   1603 O  OD1   . ASN A 1 238 ? -4.227  -60.772 -119.759 1.00 22.06 ? 218  ASN A OD1   1 
ATOM   1604 N  ND2   . ASN A 1 238 ? -4.994  -61.894 -121.541 1.00 20.83 ? 218  ASN A ND2   1 
ATOM   1605 N  N     . ILE A 1 239 ? -8.485  -58.054 -119.904 1.00 19.24 ? 219  ILE A N     1 
ATOM   1606 C  CA    . ILE A 1 239 ? -9.826  -57.523 -119.660 1.00 17.75 ? 219  ILE A CA    1 
ATOM   1607 C  C     . ILE A 1 239 ? -9.746  -56.043 -119.274 1.00 24.38 ? 219  ILE A C     1 
ATOM   1608 O  O     . ILE A 1 239 ? -8.974  -55.659 -118.385 1.00 20.97 ? 219  ILE A O     1 
ATOM   1609 C  CB    . ILE A 1 239 ? -10.554 -58.286 -118.525 1.00 19.75 ? 219  ILE A CB    1 
ATOM   1610 C  CG1   . ILE A 1 239 ? -10.528 -59.787 -118.809 1.00 20.25 ? 219  ILE A CG1   1 
ATOM   1611 C  CG2   . ILE A 1 239 ? -12.003 -57.793 -118.416 1.00 20.33 ? 219  ILE A CG2   1 
ATOM   1612 C  CD1   . ILE A 1 239 ? -11.214 -60.637 -117.734 1.00 18.72 ? 219  ILE A CD1   1 
ATOM   1613 N  N     . LEU A 1 240 ? -10.533 -55.219 -119.963 1.00 18.48 ? 220  LEU A N     1 
ATOM   1614 C  CA    . LEU A 1 240 ? -10.575 -53.784 -119.698 1.00 16.76 ? 220  LEU A CA    1 
ATOM   1615 C  C     . LEU A 1 240 ? -11.952 -53.393 -119.181 1.00 22.77 ? 220  LEU A C     1 
ATOM   1616 O  O     . LEU A 1 240 ? -12.955 -53.681 -119.827 1.00 21.85 ? 220  LEU A O     1 
ATOM   1617 C  CB    . LEU A 1 240 ? -10.303 -52.983 -120.978 1.00 21.02 ? 220  LEU A CB    1 
ATOM   1618 C  CG    . LEU A 1 240 ? -10.462 -51.458 -120.833 1.00 17.01 ? 220  LEU A CG    1 
ATOM   1619 C  CD1   . LEU A 1 240 ? -9.427  -50.946 -119.854 1.00 17.28 ? 220  LEU A CD1   1 
ATOM   1620 C  CD2   . LEU A 1 240 ? -10.309 -50.758 -122.185 1.00 21.04 ? 220  LEU A CD2   1 
ATOM   1621 N  N     . PHE A 1 241 ? -11.987 -52.735 -118.024 1.00 22.02 ? 221  PHE A N     1 
ATOM   1622 C  CA    . PHE A 1 241 ? -13.240 -52.273 -117.431 1.00 23.27 ? 221  PHE A CA    1 
ATOM   1623 C  C     . PHE A 1 241 ? -13.322 -50.755 -117.536 1.00 25.94 ? 221  PHE A C     1 
ATOM   1624 O  O     . PHE A 1 241 ? -12.305 -50.065 -117.438 1.00 25.01 ? 221  PHE A O     1 
ATOM   1625 C  CB    . PHE A 1 241 ? -13.320 -52.623 -115.942 1.00 21.87 ? 221  PHE A CB    1 
ATOM   1626 C  CG    . PHE A 1 241 ? -13.232 -54.081 -115.644 1.00 23.27 ? 221  PHE A CG    1 
ATOM   1627 C  CD1   . PHE A 1 241 ? -12.065 -54.623 -115.112 1.00 23.39 ? 221  PHE A CD1   1 
ATOM   1628 C  CD2   . PHE A 1 241 ? -14.331 -54.910 -115.843 1.00 24.10 ? 221  PHE A CD2   1 
ATOM   1629 C  CE1   . PHE A 1 241 ? -11.996 -55.972 -114.778 1.00 21.36 ? 221  PHE A CE1   1 
ATOM   1630 C  CE2   . PHE A 1 241 ? -14.275 -56.257 -115.514 1.00 19.51 ? 221  PHE A CE2   1 
ATOM   1631 C  CZ    . PHE A 1 241 ? -13.105 -56.793 -114.980 1.00 24.64 ? 221  PHE A CZ    1 
ATOM   1632 N  N     . GLY A 1 242 ? -14.533 -50.235 -117.717 1.00 25.32 ? 222  GLY A N     1 
ATOM   1633 C  CA    . GLY A 1 242 ? -14.707 -48.794 -117.789 1.00 22.32 ? 222  GLY A CA    1 
ATOM   1634 C  C     . GLY A 1 242 ? -16.168 -48.392 -117.886 1.00 22.44 ? 222  GLY A C     1 
ATOM   1635 O  O     . GLY A 1 242 ? -17.006 -49.207 -118.280 1.00 25.09 ? 222  GLY A O     1 
ATOM   1636 N  N     . ASN A 1 243 ? -16.486 -47.155 -117.508 1.00 21.21 ? 223  ASN A N     1 
ATOM   1637 C  CA    . ASN A 1 243 ? -17.864 -46.680 -117.616 1.00 26.62 ? 223  ASN A CA    1 
ATOM   1638 C  C     . ASN A 1 243 ? -18.002 -45.887 -118.915 1.00 27.86 ? 223  ASN A C     1 
ATOM   1639 O  O     . ASN A 1 243 ? -17.030 -45.720 -119.653 1.00 27.68 ? 223  ASN A O     1 
ATOM   1640 C  CB    . ASN A 1 243 ? -18.259 -45.818 -116.411 1.00 24.37 ? 223  ASN A CB    1 
ATOM   1641 C  CG    . ASN A 1 243 ? -17.342 -44.630 -116.211 1.00 24.33 ? 223  ASN A CG    1 
ATOM   1642 O  OD1   . ASN A 1 243 ? -16.790 -44.085 -117.167 1.00 23.87 ? 223  ASN A OD1   1 
ATOM   1643 N  ND2   . ASN A 1 243 ? -17.188 -44.210 -114.959 1.00 30.35 ? 223  ASN A ND2   1 
ATOM   1644 N  N     . GLU A 1 244 ? -19.202 -45.394 -119.197 1.00 30.56 ? 224  GLU A N     1 
ATOM   1645 C  CA    . GLU A 1 244 ? -19.442 -44.658 -120.437 1.00 29.85 ? 224  GLU A CA    1 
ATOM   1646 C  C     . GLU A 1 244 ? -18.527 -43.460 -120.672 1.00 32.88 ? 224  GLU A C     1 
ATOM   1647 O  O     . GLU A 1 244 ? -17.928 -43.333 -121.740 1.00 33.54 ? 224  GLU A O     1 
ATOM   1648 C  CB    . GLU A 1 244 ? -20.904 -44.205 -120.494 1.00 32.15 ? 224  GLU A CB    1 
ATOM   1649 C  CG    . GLU A 1 244 ? -21.890 -45.356 -120.383 1.00 31.41 ? 224  GLU A CG    1 
ATOM   1650 C  CD    . GLU A 1 244 ? -23.329 -44.893 -120.275 1.00 36.38 ? 224  GLU A CD    1 
ATOM   1651 O  OE1   . GLU A 1 244 ? -23.946 -44.596 -121.320 1.00 34.34 ? 224  GLU A OE1   1 
ATOM   1652 O  OE2   . GLU A 1 244 ? -23.838 -44.821 -119.137 1.00 32.36 ? 224  GLU A OE2   1 
ATOM   1653 N  N     . GLU A 1 245 ? -18.415 -42.587 -119.678 1.00 30.08 ? 225  GLU A N     1 
ATOM   1654 C  CA    . GLU A 1 245 ? -17.591 -41.395 -119.810 1.00 33.70 ? 225  GLU A CA    1 
ATOM   1655 C  C     . GLU A 1 245 ? -16.126 -41.712 -120.085 1.00 31.15 ? 225  GLU A C     1 
ATOM   1656 O  O     . GLU A 1 245 ? -15.493 -41.060 -120.909 1.00 29.01 ? 225  GLU A O     1 
ATOM   1657 C  CB    . GLU A 1 245 ? -17.713 -40.530 -118.557 1.00 31.68 ? 225  GLU A CB    1 
ATOM   1658 C  CG    . GLU A 1 245 ? -16.830 -39.300 -118.579 1.00 46.03 ? 225  GLU A CG    1 
ATOM   1659 C  CD    . GLU A 1 245 ? -17.105 -38.370 -117.418 1.00 51.36 ? 225  GLU A CD    1 
ATOM   1660 O  OE1   . GLU A 1 245 ? -17.240 -38.868 -116.278 1.00 51.07 ? 225  GLU A OE1   1 
ATOM   1661 O  OE2   . GLU A 1 245 ? -17.178 -37.143 -117.646 1.00 51.45 ? 225  GLU A OE2   1 
ATOM   1662 N  N     . GLU A 1 246 ? -15.590 -42.713 -119.397 1.00 27.74 ? 226  GLU A N     1 
ATOM   1663 C  CA    . GLU A 1 246 ? -14.198 -43.099 -119.594 1.00 29.66 ? 226  GLU A CA    1 
ATOM   1664 C  C     . GLU A 1 246 ? -13.970 -43.604 -121.019 1.00 26.08 ? 226  GLU A C     1 
ATOM   1665 O  O     . GLU A 1 246 ? -13.007 -43.213 -121.682 1.00 24.85 ? 226  GLU A O     1 
ATOM   1666 C  CB    . GLU A 1 246 ? -13.809 -44.168 -118.563 1.00 27.54 ? 226  GLU A CB    1 
ATOM   1667 C  CG    . GLU A 1 246 ? -13.761 -43.627 -117.134 1.00 28.68 ? 226  GLU A CG    1 
ATOM   1668 C  CD    . GLU A 1 246 ? -13.933 -44.703 -116.071 1.00 25.00 ? 226  GLU A CD    1 
ATOM   1669 O  OE1   . GLU A 1 246 ? -13.829 -44.368 -114.870 1.00 29.42 ? 226  GLU A OE1   1 
ATOM   1670 O  OE2   . GLU A 1 246 ? -14.178 -45.875 -116.429 1.00 27.71 ? 226  GLU A OE2   1 
ATOM   1671 N  N     . PHE A 1 247 ? -14.869 -44.461 -121.495 1.00 24.28 ? 227  PHE A N     1 
ATOM   1672 C  CA    . PHE A 1 247 ? -14.762 -45.011 -122.841 1.00 26.39 ? 227  PHE A CA    1 
ATOM   1673 C  C     . PHE A 1 247 ? -14.943 -43.932 -123.910 1.00 30.00 ? 227  PHE A C     1 
ATOM   1674 O  O     . PHE A 1 247 ? -14.341 -44.003 -124.981 1.00 26.95 ? 227  PHE A O     1 
ATOM   1675 C  CB    . PHE A 1 247 ? -15.784 -46.143 -123.035 1.00 24.62 ? 227  PHE A CB    1 
ATOM   1676 C  CG    . PHE A 1 247 ? -15.252 -47.507 -122.670 1.00 22.84 ? 227  PHE A CG    1 
ATOM   1677 C  CD1   . PHE A 1 247 ? -14.273 -48.111 -123.452 1.00 29.55 ? 227  PHE A CD1   1 
ATOM   1678 C  CD2   . PHE A 1 247 ? -15.707 -48.174 -121.533 1.00 26.81 ? 227  PHE A CD2   1 
ATOM   1679 C  CE1   . PHE A 1 247 ? -13.749 -49.364 -123.107 1.00 25.90 ? 227  PHE A CE1   1 
ATOM   1680 C  CE2   . PHE A 1 247 ? -15.188 -49.432 -121.175 1.00 17.33 ? 227  PHE A CE2   1 
ATOM   1681 C  CZ    . PHE A 1 247 ? -14.208 -50.023 -121.968 1.00 24.15 ? 227  PHE A CZ    1 
ATOM   1682 N  N     . ALA A 1 248 ? -15.764 -42.926 -123.624 1.00 28.62 ? 228  ALA A N     1 
ATOM   1683 C  CA    . ALA A 1 248 ? -15.966 -41.855 -124.592 1.00 28.91 ? 228  ALA A CA    1 
ATOM   1684 C  C     . ALA A 1 248 ? -14.642 -41.128 -124.782 1.00 29.23 ? 228  ALA A C     1 
ATOM   1685 O  O     . ALA A 1 248 ? -14.257 -40.808 -125.906 1.00 28.77 ? 228  ALA A O     1 
ATOM   1686 C  CB    . ALA A 1 248 ? -17.042 -40.886 -124.104 1.00 30.08 ? 228  ALA A CB    1 
ATOM   1687 N  N     . HIS A 1 249 ? -13.940 -40.880 -123.676 1.00 29.96 ? 229  HIS A N     1 
ATOM   1688 C  CA    . HIS A 1 249 ? -12.646 -40.206 -123.723 1.00 28.44 ? 229  HIS A CA    1 
ATOM   1689 C  C     . HIS A 1 249 ? -11.617 -41.100 -124.416 1.00 26.24 ? 229  HIS A C     1 
ATOM   1690 O  O     . HIS A 1 249 ? -10.797 -40.627 -125.204 1.00 27.03 ? 229  HIS A O     1 
ATOM   1691 C  CB    . HIS A 1 249 ? -12.177 -39.862 -122.306 1.00 29.18 ? 229  HIS A CB    1 
ATOM   1692 C  CG    . HIS A 1 249 ? -12.818 -38.633 -121.738 1.00 34.35 ? 229  HIS A CG    1 
ATOM   1693 N  ND1   . HIS A 1 249 ? -12.263 -37.377 -121.863 1.00 36.49 ? 229  HIS A ND1   1 
ATOM   1694 C  CD2   . HIS A 1 249 ? -13.982 -38.463 -121.065 1.00 35.06 ? 229  HIS A CD2   1 
ATOM   1695 C  CE1   . HIS A 1 249 ? -13.056 -36.487 -121.293 1.00 39.62 ? 229  HIS A CE1   1 
ATOM   1696 N  NE2   . HIS A 1 249 ? -14.106 -37.119 -120.802 1.00 37.83 ? 229  HIS A NE2   1 
ATOM   1697 N  N     . LEU A 1 250 ? -11.661 -42.397 -124.128 1.00 24.74 ? 230  LEU A N     1 
ATOM   1698 C  CA    . LEU A 1 250 ? -10.728 -43.327 -124.758 1.00 25.99 ? 230  LEU A CA    1 
ATOM   1699 C  C     . LEU A 1 250 ? -10.929 -43.307 -126.271 1.00 28.86 ? 230  LEU A C     1 
ATOM   1700 O  O     . LEU A 1 250 ? -9.965  -43.290 -127.038 1.00 26.63 ? 230  LEU A O     1 
ATOM   1701 C  CB    . LEU A 1 250 ? -10.956 -44.749 -124.243 1.00 25.30 ? 230  LEU A CB    1 
ATOM   1702 C  CG    . LEU A 1 250 ? -9.937  -45.790 -124.721 1.00 26.19 ? 230  LEU A CG    1 
ATOM   1703 C  CD1   . LEU A 1 250 ? -8.642  -45.645 -123.926 1.00 25.38 ? 230  LEU A CD1   1 
ATOM   1704 C  CD2   . LEU A 1 250 ? -10.507 -47.179 -124.530 1.00 25.65 ? 230  LEU A CD2   1 
ATOM   1705 N  N     . ALA A 1 251 ? -12.192 -43.306 -126.689 1.00 26.72 ? 231  ALA A N     1 
ATOM   1706 C  CA    . ALA A 1 251 ? -12.537 -43.306 -128.109 1.00 28.42 ? 231  ALA A CA    1 
ATOM   1707 C  C     . ALA A 1 251 ? -12.065 -42.048 -128.832 1.00 30.92 ? 231  ALA A C     1 
ATOM   1708 O  O     . ALA A 1 251 ? -11.673 -42.099 -129.998 1.00 31.09 ? 231  ALA A O     1 
ATOM   1709 C  CB    . ALA A 1 251 ? -14.039 -43.469 -128.270 1.00 27.53 ? 231  ALA A CB    1 
ATOM   1710 N  N     . LYS A 1 252 ? -12.098 -40.919 -128.136 1.00 29.57 ? 232  LYS A N     1 
ATOM   1711 C  CA    . LYS A 1 252 ? -11.672 -39.656 -128.726 1.00 33.69 ? 232  LYS A CA    1 
ATOM   1712 C  C     . LYS A 1 252 ? -10.154 -39.548 -128.815 1.00 34.34 ? 232  LYS A C     1 
ATOM   1713 O  O     . LYS A 1 252 ? -9.615  -39.127 -129.838 1.00 38.43 ? 232  LYS A O     1 
ATOM   1714 C  CB    . LYS A 1 252 ? -12.221 -38.480 -127.913 1.00 37.74 ? 232  LYS A CB    1 
ATOM   1715 C  CG    . LYS A 1 252 ? -11.700 -37.123 -128.369 1.00 47.46 ? 232  LYS A CG    1 
ATOM   1716 C  CD    . LYS A 1 252 ? -12.276 -35.987 -127.539 1.00 55.95 ? 232  LYS A CD    1 
ATOM   1717 C  CE    . LYS A 1 252 ? -13.785 -35.882 -127.705 1.00 60.13 ? 232  LYS A CE    1 
ATOM   1718 N  NZ    . LYS A 1 252 ? -14.341 -34.707 -126.978 1.00 64.40 ? 232  LYS A NZ    1 
ATOM   1719 N  N     . VAL A 1 253 ? -9.466  -39.934 -127.746 1.00 28.87 ? 233  VAL A N     1 
ATOM   1720 C  CA    . VAL A 1 253 ? -8.012  -39.857 -127.710 1.00 30.39 ? 233  VAL A CA    1 
ATOM   1721 C  C     . VAL A 1 253 ? -7.337  -40.832 -128.672 1.00 30.02 ? 233  VAL A C     1 
ATOM   1722 O  O     . VAL A 1 253 ? -6.321  -40.507 -129.288 1.00 37.24 ? 233  VAL A O     1 
ATOM   1723 C  CB    . VAL A 1 253 ? -7.484  -40.104 -126.275 1.00 35.71 ? 233  VAL A CB    1 
ATOM   1724 C  CG1   . VAL A 1 253 ? -5.965  -40.169 -126.276 1.00 36.17 ? 233  VAL A CG1   1 
ATOM   1725 C  CG2   . VAL A 1 253 ? -7.959  -38.985 -125.350 1.00 33.34 ? 233  VAL A CG2   1 
ATOM   1726 N  N     . HIS A 1 254 ? -7.901  -42.025 -128.811 1.00 29.67 ? 234  HIS A N     1 
ATOM   1727 C  CA    . HIS A 1 254 ? -7.312  -43.022 -129.693 1.00 27.76 ? 234  HIS A CA    1 
ATOM   1728 C  C     . HIS A 1 254 ? -8.048  -43.169 -131.023 1.00 32.10 ? 234  HIS A C     1 
ATOM   1729 O  O     . HIS A 1 254 ? -7.850  -44.141 -131.750 1.00 33.48 ? 234  HIS A O     1 
ATOM   1730 C  CB    . HIS A 1 254 ? -7.230  -44.360 -128.955 1.00 29.44 ? 234  HIS A CB    1 
ATOM   1731 C  CG    . HIS A 1 254 ? -6.294  -44.333 -127.786 1.00 25.23 ? 234  HIS A CG    1 
ATOM   1732 N  ND1   . HIS A 1 254 ? -4.924  -44.286 -127.933 1.00 27.77 ? 234  HIS A ND1   1 
ATOM   1733 C  CD2   . HIS A 1 254 ? -6.531  -44.294 -126.455 1.00 32.28 ? 234  HIS A CD2   1 
ATOM   1734 C  CE1   . HIS A 1 254 ? -4.357  -44.218 -126.742 1.00 27.84 ? 234  HIS A CE1   1 
ATOM   1735 N  NE2   . HIS A 1 254 ? -5.310  -44.222 -125.827 1.00 31.35 ? 234  HIS A NE2   1 
ATOM   1736 N  N     . ASN A 1 255 ? -8.881  -42.183 -131.344 1.00 35.17 ? 235  ASN A N     1 
ATOM   1737 C  CA    . ASN A 1 255 ? -9.643  -42.175 -132.590 1.00 35.50 ? 235  ASN A CA    1 
ATOM   1738 C  C     . ASN A 1 255 ? -10.248 -43.541 -132.899 1.00 36.75 ? 235  ASN A C     1 
ATOM   1739 O  O     . ASN A 1 255 ? -10.026 -44.100 -133.975 1.00 41.14 ? 235  ASN A O     1 
ATOM   1740 C  CB    . ASN A 1 255 ? -8.741  -41.745 -133.754 1.00 37.61 ? 235  ASN A CB    1 
ATOM   1741 C  CG    . ASN A 1 255 ? -8.030  -40.431 -133.487 1.00 44.61 ? 235  ASN A CG    1 
ATOM   1742 O  OD1   . ASN A 1 255 ? -8.664  -39.411 -133.209 1.00 47.04 ? 235  ASN A OD1   1 
ATOM   1743 N  ND2   . ASN A 1 255 ? -6.704  -40.449 -133.570 1.00 43.29 ? 235  ASN A ND2   1 
ATOM   1744 N  N     . LEU A 1 256 ? -11.020 -44.071 -131.957 1.00 36.94 ? 236  LEU A N     1 
ATOM   1745 C  CA    . LEU A 1 256 ? -11.646 -45.375 -132.133 1.00 33.63 ? 236  LEU A CA    1 
ATOM   1746 C  C     . LEU A 1 256 ? -12.841 -45.328 -133.077 1.00 35.02 ? 236  LEU A C     1 
ATOM   1747 O  O     . LEU A 1 256 ? -13.219 -46.344 -133.653 1.00 34.71 ? 236  LEU A O     1 
ATOM   1748 C  CB    . LEU A 1 256 ? -12.081 -45.940 -130.780 1.00 34.98 ? 236  LEU A CB    1 
ATOM   1749 C  CG    . LEU A 1 256 ? -10.967 -46.234 -129.774 1.00 33.96 ? 236  LEU A CG    1 
ATOM   1750 C  CD1   . LEU A 1 256 ? -11.571 -46.872 -128.528 1.00 30.73 ? 236  LEU A CD1   1 
ATOM   1751 C  CD2   . LEU A 1 256 ? -9.940  -47.165 -130.397 1.00 35.75 ? 236  LEU A CD2   1 
ATOM   1752 N  N     . VAL A 1 257 ? -13.444 -44.152 -133.220 1.00 32.89 ? 237  VAL A N     1 
ATOM   1753 C  CA    . VAL A 1 257 ? -14.584 -43.986 -134.113 1.00 33.70 ? 237  VAL A CA    1 
ATOM   1754 C  C     . VAL A 1 257 ? -14.419 -42.681 -134.883 1.00 35.56 ? 237  VAL A C     1 
ATOM   1755 O  O     . VAL A 1 257 ? -13.576 -41.851 -134.541 1.00 33.93 ? 237  VAL A O     1 
ATOM   1756 C  CB    . VAL A 1 257 ? -15.935 -43.950 -133.344 1.00 33.27 ? 237  VAL A CB    1 
ATOM   1757 C  CG1   . VAL A 1 257 ? -16.102 -45.221 -132.522 1.00 40.68 ? 237  VAL A CG1   1 
ATOM   1758 C  CG2   . VAL A 1 257 ? -16.010 -42.717 -132.454 1.00 32.89 ? 237  VAL A CG2   1 
ATOM   1759 N  N     . ALA A 1 258 ? -15.215 -42.508 -135.931 1.00 36.49 ? 238  ALA A N     1 
ATOM   1760 C  CA    . ALA A 1 258 ? -15.142 -41.297 -136.738 1.00 39.63 ? 238  ALA A CA    1 
ATOM   1761 C  C     . ALA A 1 258 ? -15.497 -40.078 -135.894 1.00 38.29 ? 238  ALA A C     1 
ATOM   1762 O  O     . ALA A 1 258 ? -16.297 -40.172 -134.964 1.00 35.39 ? 238  ALA A O     1 
ATOM   1763 C  CB    . ALA A 1 258 ? -16.089 -41.405 -137.929 1.00 42.03 ? 238  ALA A CB    1 
ATOM   1764 N  N     . ALA A 1 259 ? -14.901 -38.936 -136.229 1.00 37.68 ? 239  ALA A N     1 
ATOM   1765 C  CA    . ALA A 1 259 ? -15.148 -37.690 -135.509 1.00 37.62 ? 239  ALA A CA    1 
ATOM   1766 C  C     . ALA A 1 259 ? -16.640 -37.405 -135.395 1.00 39.22 ? 239  ALA A C     1 
ATOM   1767 O  O     . ALA A 1 259 ? -17.100 -36.832 -134.407 1.00 41.56 ? 239  ALA A O     1 
ATOM   1768 C  CB    . ALA A 1 259 ? -14.449 -36.534 -136.218 1.00 39.07 ? 239  ALA A CB    1 
ATOM   1769 N  N     . GLU A 1 260 ? -17.391 -37.819 -136.409 1.00 41.02 ? 240  GLU A N     1 
ATOM   1770 C  CA    . GLU A 1 260 ? -18.833 -37.612 -136.443 1.00 41.62 ? 240  GLU A CA    1 
ATOM   1771 C  C     . GLU A 1 260 ? -19.554 -38.405 -135.349 1.00 43.03 ? 240  GLU A C     1 
ATOM   1772 O  O     . GLU A 1 260 ? -20.637 -38.025 -134.906 1.00 43.58 ? 240  GLU A O     1 
ATOM   1773 C  CB    . GLU A 1 260 ? -19.373 -38.026 -137.815 1.00 44.73 ? 240  GLU A CB    1 
ATOM   1774 C  CG    . GLU A 1 260 ? -20.804 -37.605 -138.091 1.00 46.96 ? 240  GLU A CG    1 
ATOM   1775 C  CD    . GLU A 1 260 ? -21.312 -38.124 -139.425 1.00 53.80 ? 240  GLU A CD    1 
ATOM   1776 O  OE1   . GLU A 1 260 ? -20.528 -38.139 -140.400 1.00 48.77 ? 240  GLU A OE1   1 
ATOM   1777 O  OE2   . GLU A 1 260 ? -22.498 -38.508 -139.501 1.00 57.94 ? 240  GLU A OE2   1 
ATOM   1778 N  N     . LYS A 1 261 ? -18.945 -39.502 -134.910 1.00 39.92 ? 241  LYS A N     1 
ATOM   1779 C  CA    . LYS A 1 261 ? -19.547 -40.355 -133.887 1.00 43.31 ? 241  LYS A CA    1 
ATOM   1780 C  C     . LYS A 1 261 ? -18.998 -40.125 -132.481 1.00 43.38 ? 241  LYS A C     1 
ATOM   1781 O  O     . LYS A 1 261 ? -19.607 -40.544 -131.496 1.00 44.04 ? 241  LYS A O     1 
ATOM   1782 C  CB    . LYS A 1 261 ? -19.350 -41.828 -134.256 1.00 41.35 ? 241  LYS A CB    1 
ATOM   1783 C  CG    . LYS A 1 261 ? -20.017 -42.249 -135.555 1.00 46.26 ? 241  LYS A CG    1 
ATOM   1784 C  CD    . LYS A 1 261 ? -19.755 -43.716 -135.839 1.00 47.75 ? 241  LYS A CD    1 
ATOM   1785 C  CE    . LYS A 1 261 ? -20.548 -44.206 -137.037 1.00 49.35 ? 241  LYS A CE    1 
ATOM   1786 N  NZ    . LYS A 1 261 ? -20.306 -45.653 -137.294 1.00 53.24 ? 241  LYS A NZ    1 
ATOM   1787 N  N     . THR A 1 262 ? -17.850 -39.464 -132.396 1.00 47.78 ? 242  THR A N     1 
ATOM   1788 C  CA    . THR A 1 262 ? -17.202 -39.197 -131.118 1.00 48.85 ? 242  THR A CA    1 
ATOM   1789 C  C     . THR A 1 262 ? -18.105 -38.546 -130.069 1.00 50.37 ? 242  THR A C     1 
ATOM   1790 O  O     . THR A 1 262 ? -17.844 -38.655 -128.872 1.00 51.44 ? 242  THR A O     1 
ATOM   1791 C  CB    . THR A 1 262 ? -15.948 -38.309 -131.316 1.00 46.76 ? 242  THR A CB    1 
ATOM   1792 O  OG1   . THR A 1 262 ? -15.047 -38.842 -132.161 1.00 54.25 ? 242  THR A OG1   1 
ATOM   1793 C  CG2   . THR A 1 262 ? -15.352 -37.990 -129.935 1.00 44.97 ? 242  THR A CG2   1 
ATOM   1794 N  N     . ALA A 1 263 ? -19.172 -37.886 -130.508 1.00 51.32 ? 243  ALA A N     1 
ATOM   1795 C  CA    . ALA A 1 263 ? -20.072 -37.215 -129.574 1.00 51.06 ? 243  ALA A CA    1 
ATOM   1796 C  C     . ALA A 1 263 ? -21.399 -37.937 -129.359 1.00 51.93 ? 243  ALA A C     1 
ATOM   1797 O  O     . ALA A 1 263 ? -22.207 -37.522 -128.526 1.00 49.98 ? 243  ALA A O     1 
ATOM   1798 C  CB    . ALA A 1 263 ? -20.331 -35.786 -130.043 1.00 55.65 ? 243  ALA A CB    1 
ATOM   1799 N  N     . LEU A 1 264 ? -21.623 -39.014 -130.102 1.00 50.30 ? 244  LEU A N     1 
ATOM   1800 C  CA    . LEU A 1 264 ? -22.863 -39.772 -129.981 1.00 50.51 ? 244  LEU A CA    1 
ATOM   1801 C  C     . LEU A 1 264 ? -23.016 -40.329 -128.564 1.00 48.81 ? 244  LEU A C     1 
ATOM   1802 O  O     . LEU A 1 264 ? -22.029 -40.580 -127.875 1.00 49.40 ? 244  LEU A O     1 
ATOM   1803 C  CB    . LEU A 1 264 ? -22.879 -40.911 -131.005 1.00 53.88 ? 244  LEU A CB    1 
ATOM   1804 C  CG    . LEU A 1 264 ? -24.204 -41.646 -131.223 1.00 63.36 ? 244  LEU A CG    1 
ATOM   1805 C  CD1   . LEU A 1 264 ? -25.265 -40.671 -131.725 1.00 63.79 ? 244  LEU A CD1   1 
ATOM   1806 C  CD2   . LEU A 1 264 ? -23.999 -42.769 -132.226 1.00 63.78 ? 244  LEU A CD2   1 
ATOM   1807 N  N     . SER A 1 265 ? -24.259 -40.513 -128.134 1.00 46.36 ? 245  SER A N     1 
ATOM   1808 C  CA    . SER A 1 265 ? -24.545 -41.031 -126.800 1.00 45.90 ? 245  SER A CA    1 
ATOM   1809 C  C     . SER A 1 265 ? -24.307 -42.534 -126.686 1.00 45.61 ? 245  SER A C     1 
ATOM   1810 O  O     . SER A 1 265 ? -24.760 -43.312 -127.531 1.00 41.45 ? 245  SER A O     1 
ATOM   1811 C  CB    . SER A 1 265 ? -25.996 -40.719 -126.421 1.00 47.88 ? 245  SER A CB    1 
ATOM   1812 O  OG    . SER A 1 265 ? -26.342 -41.319 -125.185 1.00 51.24 ? 245  SER A OG    1 
ATOM   1813 N  N     . THR A 1 266 ? -23.599 -42.939 -125.635 1.00 41.91 ? 246  THR A N     1 
ATOM   1814 C  CA    . THR A 1 266 ? -23.323 -44.352 -125.405 1.00 40.44 ? 246  THR A CA    1 
ATOM   1815 C  C     . THR A 1 266 ? -24.550 -45.018 -124.788 1.00 42.19 ? 246  THR A C     1 
ATOM   1816 O  O     . THR A 1 266 ? -24.531 -46.205 -124.466 1.00 41.08 ? 246  THR A O     1 
ATOM   1817 C  CB    . THR A 1 266 ? -22.111 -44.552 -124.469 1.00 38.92 ? 246  THR A CB    1 
ATOM   1818 O  OG1   . THR A 1 266 ? -22.275 -43.750 -123.294 1.00 41.93 ? 246  THR A OG1   1 
ATOM   1819 C  CG2   . THR A 1 266 ? -20.821 -44.161 -125.174 1.00 43.53 ? 246  THR A CG2   1 
ATOM   1820 N  N     . ALA A 1 267 ? -25.617 -44.241 -124.620 1.00 44.57 ? 247  ALA A N     1 
ATOM   1821 C  CA    . ALA A 1 267 ? -26.860 -44.766 -124.070 1.00 49.05 ? 247  ALA A CA    1 
ATOM   1822 C  C     . ALA A 1 267 ? -27.548 -45.491 -125.221 1.00 50.32 ? 247  ALA A C     1 
ATOM   1823 O  O     . ALA A 1 267 ? -28.556 -46.176 -125.042 1.00 50.61 ? 247  ALA A O     1 
ATOM   1824 C  CB    . ALA A 1 267 ? -27.733 -43.628 -123.551 1.00 49.52 ? 247  ALA A CB    1 
ATOM   1825 N  N     . ASN A 1 268 ? -26.971 -45.323 -126.408 1.00 51.65 ? 248  ASN A N     1 
ATOM   1826 C  CA    . ASN A 1 268 ? -27.453 -45.946 -127.636 1.00 51.78 ? 248  ASN A CA    1 
ATOM   1827 C  C     . ASN A 1 268 ? -26.644 -47.217 -127.875 1.00 50.08 ? 248  ASN A C     1 
ATOM   1828 O  O     . ASN A 1 268 ? -25.471 -47.151 -128.242 1.00 51.05 ? 248  ASN A O     1 
ATOM   1829 C  CB    . ASN A 1 268 ? -27.262 -44.987 -128.814 1.00 52.39 ? 248  ASN A CB    1 
ATOM   1830 C  CG    . ASN A 1 268 ? -27.438 -45.667 -130.159 1.00 55.69 ? 248  ASN A CG    1 
ATOM   1831 O  OD1   . ASN A 1 268 ? -28.529 -46.120 -130.504 1.00 61.40 ? 248  ASN A OD1   1 
ATOM   1832 N  ND2   . ASN A 1 268 ? -26.357 -45.743 -130.928 1.00 45.23 ? 248  ASN A ND2   1 
ATOM   1833 N  N     . LYS A 1 269 ? -27.275 -48.367 -127.662 1.00 48.74 ? 249  LYS A N     1 
ATOM   1834 C  CA    . LYS A 1 269 ? -26.624 -49.659 -127.842 1.00 44.82 ? 249  LYS A CA    1 
ATOM   1835 C  C     . LYS A 1 269 ? -25.660 -49.681 -129.029 1.00 43.56 ? 249  LYS A C     1 
ATOM   1836 O  O     . LYS A 1 269 ? -24.491 -50.037 -128.880 1.00 39.53 ? 249  LYS A O     1 
ATOM   1837 C  CB    . LYS A 1 269 ? -27.683 -50.752 -128.016 1.00 49.52 ? 249  LYS A CB    1 
ATOM   1838 C  CG    . LYS A 1 269 ? -27.121 -52.153 -128.214 1.00 55.25 ? 249  LYS A CG    1 
ATOM   1839 C  CD    . LYS A 1 269 ? -28.237 -53.157 -128.483 1.00 61.51 ? 249  LYS A CD    1 
ATOM   1840 C  CE    . LYS A 1 269 ? -27.690 -54.548 -128.772 1.00 64.28 ? 249  LYS A CE    1 
ATOM   1841 N  NZ    . LYS A 1 269 ? -26.932 -55.106 -127.618 1.00 68.50 ? 249  LYS A NZ    1 
ATOM   1842 N  N     . GLU A 1 270 ? -26.150 -49.296 -130.204 1.00 38.84 ? 250  GLU A N     1 
ATOM   1843 C  CA    . GLU A 1 270 ? -25.325 -49.287 -131.411 1.00 38.57 ? 250  GLU A CA    1 
ATOM   1844 C  C     . GLU A 1 270 ? -23.980 -48.590 -131.203 1.00 34.64 ? 250  GLU A C     1 
ATOM   1845 O  O     . GLU A 1 270 ? -22.928 -49.140 -131.538 1.00 31.77 ? 250  GLU A O     1 
ATOM   1846 C  CB    . GLU A 1 270 ? -26.088 -48.623 -132.564 1.00 37.08 ? 250  GLU A CB    1 
ATOM   1847 N  N     . HIS A 1 271 ? -24.014 -47.382 -130.653 1.00 31.65 ? 251  HIS A N     1 
ATOM   1848 C  CA    . HIS A 1 271 ? -22.788 -46.631 -130.420 1.00 31.50 ? 251  HIS A CA    1 
ATOM   1849 C  C     . HIS A 1 271 ? -21.893 -47.266 -129.354 1.00 32.02 ? 251  HIS A C     1 
ATOM   1850 O  O     . HIS A 1 271 ? -20.666 -47.259 -129.477 1.00 30.86 ? 251  HIS A O     1 
ATOM   1851 C  CB    . HIS A 1 271 ? -23.105 -45.198 -130.008 1.00 33.04 ? 251  HIS A CB    1 
ATOM   1852 C  CG    . HIS A 1 271 ? -21.885 -44.359 -129.799 1.00 31.82 ? 251  HIS A CG    1 
ATOM   1853 N  ND1   . HIS A 1 271 ? -20.948 -44.154 -130.789 1.00 35.59 ? 251  HIS A ND1   1 
ATOM   1854 C  CD2   . HIS A 1 271 ? -21.434 -43.694 -128.709 1.00 33.89 ? 251  HIS A CD2   1 
ATOM   1855 C  CE1   . HIS A 1 271 ? -19.971 -43.400 -130.317 1.00 29.70 ? 251  HIS A CE1   1 
ATOM   1856 N  NE2   . HIS A 1 271 ? -20.242 -43.106 -129.058 1.00 32.36 ? 251  HIS A NE2   1 
ATOM   1857 N  N     . ALA A 1 272 ? -22.511 -47.796 -128.304 1.00 27.68 ? 252  ALA A N     1 
ATOM   1858 C  CA    . ALA A 1 272 ? -21.772 -48.435 -127.227 1.00 29.93 ? 252  ALA A CA    1 
ATOM   1859 C  C     . ALA A 1 272 ? -21.011 -49.642 -127.766 1.00 30.98 ? 252  ALA A C     1 
ATOM   1860 O  O     . ALA A 1 272 ? -19.858 -49.880 -127.401 1.00 29.71 ? 252  ALA A O     1 
ATOM   1861 C  CB    . ALA A 1 272 ? -22.729 -48.868 -126.129 1.00 29.88 ? 252  ALA A CB    1 
ATOM   1862 N  N     . VAL A 1 273 ? -21.662 -50.405 -128.640 1.00 30.80 ? 253  VAL A N     1 
ATOM   1863 C  CA    . VAL A 1 273 ? -21.038 -51.588 -129.223 1.00 27.81 ? 253  VAL A CA    1 
ATOM   1864 C  C     . VAL A 1 273 ? -19.882 -51.216 -130.140 1.00 28.35 ? 253  VAL A C     1 
ATOM   1865 O  O     . VAL A 1 273 ? -18.860 -51.896 -130.149 1.00 29.02 ? 253  VAL A O     1 
ATOM   1866 C  CB    . VAL A 1 273 ? -22.063 -52.433 -130.011 1.00 29.25 ? 253  VAL A CB    1 
ATOM   1867 C  CG1   . VAL A 1 273 ? -21.367 -53.589 -130.719 1.00 30.01 ? 253  VAL A CG1   1 
ATOM   1868 C  CG2   . VAL A 1 273 ? -23.129 -52.954 -129.065 1.00 27.61 ? 253  VAL A CG2   1 
ATOM   1869 N  N     . GLU A 1 274 ? -20.033 -50.138 -130.905 1.00 29.53 ? 254  GLU A N     1 
ATOM   1870 C  CA    . GLU A 1 274 ? -18.963 -49.713 -131.804 1.00 31.81 ? 254  GLU A CA    1 
ATOM   1871 C  C     . GLU A 1 274 ? -17.751 -49.257 -131.004 1.00 31.57 ? 254  GLU A C     1 
ATOM   1872 O  O     . GLU A 1 274 ? -16.612 -49.502 -131.405 1.00 30.61 ? 254  GLU A O     1 
ATOM   1873 C  CB    . GLU A 1 274 ? -19.418 -48.563 -132.707 1.00 35.31 ? 254  GLU A CB    1 
ATOM   1874 C  CG    . GLU A 1 274 ? -20.680 -48.839 -133.496 1.00 49.17 ? 254  GLU A CG    1 
ATOM   1875 C  CD    . GLU A 1 274 ? -20.819 -47.920 -134.695 1.00 53.67 ? 254  GLU A CD    1 
ATOM   1876 O  OE1   . GLU A 1 274 ? -20.430 -46.737 -134.589 1.00 52.02 ? 254  GLU A OE1   1 
ATOM   1877 O  OE2   . GLU A 1 274 ? -21.325 -48.384 -135.741 1.00 57.80 ? 254  GLU A OE2   1 
ATOM   1878 N  N     . VAL A 1 275 ? -18.001 -48.588 -129.880 1.00 26.02 ? 255  VAL A N     1 
ATOM   1879 C  CA    . VAL A 1 275 ? -16.916 -48.104 -129.025 1.00 27.53 ? 255  VAL A CA    1 
ATOM   1880 C  C     . VAL A 1 275 ? -16.184 -49.274 -128.369 1.00 27.13 ? 255  VAL A C     1 
ATOM   1881 O  O     . VAL A 1 275 ? -14.954 -49.305 -128.342 1.00 25.23 ? 255  VAL A O     1 
ATOM   1882 C  CB    . VAL A 1 275 ? -17.446 -47.149 -127.921 1.00 29.50 ? 255  VAL A CB    1 
ATOM   1883 C  CG1   . VAL A 1 275 ? -16.317 -46.774 -126.959 1.00 27.25 ? 255  VAL A CG1   1 
ATOM   1884 C  CG2   . VAL A 1 275 ? -18.010 -45.888 -128.557 1.00 26.37 ? 255  VAL A CG2   1 
ATOM   1885 N  N     . CYS A 1 276 ? -16.939 -50.236 -127.845 1.00 25.01 ? 256  CYS A N     1 
ATOM   1886 C  CA    . CYS A 1 276 ? -16.339 -51.403 -127.208 1.00 25.74 ? 256  CYS A CA    1 
ATOM   1887 C  C     . CYS A 1 276 ? -15.527 -52.227 -128.198 1.00 28.69 ? 256  CYS A C     1 
ATOM   1888 O  O     . CYS A 1 276 ? -14.438 -52.698 -127.878 1.00 25.09 ? 256  CYS A O     1 
ATOM   1889 C  CB    . CYS A 1 276 ? -17.412 -52.295 -126.597 1.00 26.32 ? 256  CYS A CB    1 
ATOM   1890 S  SG    . CYS A 1 276 ? -18.136 -51.634 -125.107 1.00 29.17 ? 256  CYS A SG    1 
ATOM   1891 N  N     A THR A 1 277 ? -16.071 -52.397 -129.400 0.50 25.75 ? 257  THR A N     1 
ATOM   1892 N  N     B THR A 1 277 ? -16.063 -52.409 -129.401 0.50 27.52 ? 257  THR A N     1 
ATOM   1893 C  CA    A THR A 1 277 ? -15.407 -53.161 -130.448 0.50 26.39 ? 257  THR A CA    1 
ATOM   1894 C  CA    B THR A 1 277 ? -15.368 -53.181 -130.422 0.50 29.88 ? 257  THR A CA    1 
ATOM   1895 C  C     A THR A 1 277 ? -14.124 -52.463 -130.892 0.50 28.73 ? 257  THR A C     1 
ATOM   1896 C  C     B THR A 1 277 ? -14.098 -52.462 -130.865 0.50 30.46 ? 257  THR A C     1 
ATOM   1897 O  O     A THR A 1 277 ? -13.130 -53.115 -131.206 0.50 31.10 ? 257  THR A O     1 
ATOM   1898 O  O     B THR A 1 277 ? -13.088 -53.098 -131.157 0.50 32.55 ? 257  THR A O     1 
ATOM   1899 C  CB    A THR A 1 277 ? -16.339 -53.338 -131.664 0.50 27.71 ? 257  THR A CB    1 
ATOM   1900 C  CB    B THR A 1 277 ? -16.267 -53.426 -131.648 0.50 33.57 ? 257  THR A CB    1 
ATOM   1901 O  OG1   A THR A 1 277 ? -17.534 -54.012 -131.247 0.50 23.46 ? 257  THR A OG1   1 
ATOM   1902 O  OG1   B THR A 1 277 ? -16.660 -52.171 -132.217 0.50 34.86 ? 257  THR A OG1   1 
ATOM   1903 C  CG2   A THR A 1 277 ? -15.653 -54.152 -132.757 0.50 17.86 ? 257  THR A CG2   1 
ATOM   1904 C  CG2   B THR A 1 277 ? -17.506 -54.207 -131.241 0.50 29.97 ? 257  THR A CG2   1 
ATOM   1905 N  N     . GLY A 1 278 ? -14.154 -51.135 -130.910 1.00 29.48 ? 258  GLY A N     1 
ATOM   1906 C  CA    . GLY A 1 278 ? -12.986 -50.369 -131.305 1.00 29.55 ? 258  GLY A CA    1 
ATOM   1907 C  C     . GLY A 1 278 ? -11.919 -50.460 -130.228 1.00 29.50 ? 258  GLY A C     1 
ATOM   1908 O  O     . GLY A 1 278 ? -10.734 -50.609 -130.526 1.00 28.85 ? 258  GLY A O     1 
ATOM   1909 N  N     . ALA A 1 279 ? -12.338 -50.382 -128.968 1.00 29.00 ? 259  ALA A N     1 
ATOM   1910 C  CA    . ALA A 1 279 ? -11.402 -50.464 -127.847 1.00 26.17 ? 259  ALA A CA    1 
ATOM   1911 C  C     . ALA A 1 279 ? -10.754 -51.851 -127.766 1.00 27.34 ? 259  ALA A C     1 
ATOM   1912 O  O     . ALA A 1 279 ? -9.604  -51.987 -127.339 1.00 26.03 ? 259  ALA A O     1 
ATOM   1913 C  CB    . ALA A 1 279 ? -12.121 -50.139 -126.537 1.00 23.70 ? 259  ALA A CB    1 
ATOM   1914 N  N     . LEU A 1 280 ? -11.493 -52.879 -128.179 1.00 25.81 ? 260  LEU A N     1 
ATOM   1915 C  CA    . LEU A 1 280 ? -10.977 -54.245 -128.149 1.00 23.64 ? 260  LEU A CA    1 
ATOM   1916 C  C     . LEU A 1 280 ? -9.721  -54.349 -129.011 1.00 24.70 ? 260  LEU A C     1 
ATOM   1917 O  O     . LEU A 1 280 ? -8.793  -55.097 -128.693 1.00 22.95 ? 260  LEU A O     1 
ATOM   1918 C  CB    . LEU A 1 280 ? -12.052 -55.227 -128.642 1.00 28.60 ? 260  LEU A CB    1 
ATOM   1919 C  CG    . LEU A 1 280 ? -11.743 -56.728 -128.656 1.00 28.00 ? 260  LEU A CG    1 
ATOM   1920 C  CD1   . LEU A 1 280 ? -11.336 -57.214 -127.265 1.00 28.06 ? 260  LEU A CD1   1 
ATOM   1921 C  CD2   . LEU A 1 280 ? -12.980 -57.474 -129.144 1.00 24.76 ? 260  LEU A CD2   1 
ATOM   1922 N  N     . ARG A 1 281 ? -9.683  -53.576 -130.091 1.00 21.48 ? 261  ARG A N     1 
ATOM   1923 C  CA    . ARG A 1 281 ? -8.530  -53.595 -130.980 1.00 22.59 ? 261  ARG A CA    1 
ATOM   1924 C  C     . ARG A 1 281 ? -7.280  -53.094 -130.263 1.00 20.99 ? 261  ARG A C     1 
ATOM   1925 O  O     . ARG A 1 281 ? -6.157  -53.460 -130.616 1.00 23.43 ? 261  ARG A O     1 
ATOM   1926 C  CB    . ARG A 1 281 ? -8.810  -52.742 -132.220 1.00 31.08 ? 261  ARG A CB    1 
ATOM   1927 C  CG    . ARG A 1 281 ? -9.974  -53.253 -133.050 1.00 49.21 ? 261  ARG A CG    1 
ATOM   1928 C  CD    . ARG A 1 281 ? -10.404 -52.245 -134.105 1.00 63.32 ? 261  ARG A CD    1 
ATOM   1929 N  NE    . ARG A 1 281 ? -11.643 -52.652 -134.765 1.00 72.12 ? 261  ARG A NE    1 
ATOM   1930 C  CZ    . ARG A 1 281 ? -12.332 -51.888 -135.607 1.00 76.67 ? 261  ARG A CZ    1 
ATOM   1931 N  NH1   . ARG A 1 281 ? -11.908 -50.665 -135.900 1.00 75.10 ? 261  ARG A NH1   1 
ATOM   1932 N  NH2   . ARG A 1 281 ? -13.448 -52.348 -136.157 1.00 78.43 ? 261  ARG A NH2   1 
ATOM   1933 N  N     . LEU A 1 282 ? -7.468  -52.251 -129.255 1.00 21.43 ? 262  LEU A N     1 
ATOM   1934 C  CA    . LEU A 1 282 ? -6.328  -51.739 -128.503 1.00 18.71 ? 262  LEU A CA    1 
ATOM   1935 C  C     . LEU A 1 282 ? -5.706  -52.849 -127.655 1.00 19.59 ? 262  LEU A C     1 
ATOM   1936 O  O     . LEU A 1 282 ? -4.553  -52.743 -127.234 1.00 21.96 ? 262  LEU A O     1 
ATOM   1937 C  CB    . LEU A 1 282 ? -6.753  -50.575 -127.603 1.00 17.86 ? 262  LEU A CB    1 
ATOM   1938 C  CG    . LEU A 1 282 ? -7.237  -49.336 -128.361 1.00 21.87 ? 262  LEU A CG    1 
ATOM   1939 C  CD1   . LEU A 1 282 ? -7.706  -48.279 -127.370 1.00 25.11 ? 262  LEU A CD1   1 
ATOM   1940 C  CD2   . LEU A 1 282 ? -6.108  -48.799 -129.227 1.00 24.91 ? 262  LEU A CD2   1 
ATOM   1941 N  N     . LEU A 1 283 ? -6.478  -53.905 -127.397 1.00 21.10 ? 263  LEU A N     1 
ATOM   1942 C  CA    . LEU A 1 283 ? -5.988  -55.042 -126.615 1.00 17.94 ? 263  LEU A CA    1 
ATOM   1943 C  C     . LEU A 1 283 ? -5.498  -56.174 -127.512 1.00 21.24 ? 263  LEU A C     1 
ATOM   1944 O  O     . LEU A 1 283 ? -4.503  -56.834 -127.210 1.00 26.96 ? 263  LEU A O     1 
ATOM   1945 C  CB    . LEU A 1 283 ? -7.086  -55.605 -125.707 1.00 21.24 ? 263  LEU A CB    1 
ATOM   1946 C  CG    . LEU A 1 283 ? -7.527  -54.840 -124.462 1.00 23.80 ? 263  LEU A CG    1 
ATOM   1947 C  CD1   . LEU A 1 283 ? -8.153  -53.513 -124.843 1.00 27.19 ? 263  LEU A CD1   1 
ATOM   1948 C  CD2   . LEU A 1 283 ? -8.526  -55.707 -123.697 1.00 24.80 ? 263  LEU A CD2   1 
ATOM   1949 N  N     . THR A 1 284 ? -6.191  -56.389 -128.624 1.00 19.49 ? 264  THR A N     1 
ATOM   1950 C  CA    . THR A 1 284 ? -5.841  -57.476 -129.534 1.00 22.28 ? 264  THR A CA    1 
ATOM   1951 C  C     . THR A 1 284 ? -4.764  -57.172 -130.562 1.00 27.38 ? 264  THR A C     1 
ATOM   1952 O  O     . THR A 1 284 ? -4.037  -58.072 -130.982 1.00 30.21 ? 264  THR A O     1 
ATOM   1953 C  CB    . THR A 1 284 ? -7.079  -57.972 -130.290 1.00 21.52 ? 264  THR A CB    1 
ATOM   1954 O  OG1   . THR A 1 284 ? -7.577  -56.922 -131.123 1.00 24.28 ? 264  THR A OG1   1 
ATOM   1955 C  CG2   . THR A 1 284 ? -8.167  -58.391 -129.314 1.00 17.83 ? 264  THR A CG2   1 
ATOM   1956 N  N     . ALA A 1 285 ? -4.664  -55.911 -130.970 1.00 27.11 ? 265  ALA A N     1 
ATOM   1957 C  CA    . ALA A 1 285 ? -3.687  -55.509 -131.972 1.00 31.42 ? 265  ALA A CA    1 
ATOM   1958 C  C     . ALA A 1 285 ? -3.902  -56.331 -133.241 1.00 34.81 ? 265  ALA A C     1 
ATOM   1959 O  O     . ALA A 1 285 ? -2.966  -56.589 -133.996 1.00 35.54 ? 265  ALA A O     1 
ATOM   1960 C  CB    . ALA A 1 285 ? -2.264  -55.701 -131.445 1.00 30.05 ? 265  ALA A CB    1 
ATOM   1961 N  N     . GLY A 1 286 ? -5.146  -56.745 -133.460 1.00 34.54 ? 266  GLY A N     1 
ATOM   1962 C  CA    . GLY A 1 286 ? -5.479  -57.515 -134.646 1.00 38.62 ? 266  GLY A CA    1 
ATOM   1963 C  C     . GLY A 1 286 ? -5.053  -58.970 -134.645 1.00 40.75 ? 266  GLY A C     1 
ATOM   1964 O  O     . GLY A 1 286 ? -5.328  -59.697 -135.598 1.00 46.38 ? 266  GLY A O     1 
ATOM   1965 N  N     . GLN A 1 287 ? -4.391  -59.406 -133.581 1.00 34.82 ? 267  GLN A N     1 
ATOM   1966 C  CA    . GLN A 1 287 ? -3.937  -60.786 -133.501 1.00 37.20 ? 267  GLN A CA    1 
ATOM   1967 C  C     . GLN A 1 287 ? -4.862  -61.637 -132.642 1.00 32.65 ? 267  GLN A C     1 
ATOM   1968 O  O     . GLN A 1 287 ? -5.632  -61.113 -131.832 1.00 28.58 ? 267  GLN A O     1 
ATOM   1969 C  CB    . GLN A 1 287 ? -2.512  -60.813 -132.966 1.00 39.97 ? 267  GLN A CB    1 
ATOM   1970 C  CG    . GLN A 1 287 ? -1.591  -59.963 -133.821 1.00 54.84 ? 267  GLN A CG    1 
ATOM   1971 C  CD    . GLN A 1 287 ? -0.190  -59.878 -133.277 1.00 62.13 ? 267  GLN A CD    1 
ATOM   1972 O  OE1   . GLN A 1 287 ? 0.018   -59.487 -132.130 1.00 70.10 ? 267  GLN A OE1   1 
ATOM   1973 N  NE2   . GLN A 1 287 ? 0.787   -60.236 -134.103 1.00 64.35 ? 267  GLN A NE2   1 
ATOM   1974 N  N     . ASN A 1 288 ? -4.793  -62.951 -132.834 1.00 23.36 ? 268  ASN A N     1 
ATOM   1975 C  CA    . ASN A 1 288 ? -5.635  -63.869 -132.078 1.00 21.90 ? 268  ASN A CA    1 
ATOM   1976 C  C     . ASN A 1 288 ? -4.867  -65.027 -131.456 1.00 27.37 ? 268  ASN A C     1 
ATOM   1977 O  O     . ASN A 1 288 ? -4.186  -65.776 -132.157 1.00 26.02 ? 268  ASN A O     1 
ATOM   1978 C  CB    . ASN A 1 288 ? -6.733  -64.444 -132.973 1.00 21.65 ? 268  ASN A CB    1 
ATOM   1979 C  CG    . ASN A 1 288 ? -7.689  -65.332 -132.207 1.00 22.52 ? 268  ASN A CG    1 
ATOM   1980 O  OD1   . ASN A 1 288 ? -8.307  -64.895 -131.240 1.00 21.95 ? 268  ASN A OD1   1 
ATOM   1981 N  ND2   . ASN A 1 288 ? -7.818  -66.582 -132.633 1.00 27.15 ? 268  ASN A ND2   1 
ATOM   1982 N  N     . THR A 1 289 ? -4.990  -65.172 -130.138 1.00 27.26 ? 269  THR A N     1 
ATOM   1983 C  CA    . THR A 1 289 ? -4.340  -66.263 -129.418 1.00 25.05 ? 269  THR A CA    1 
ATOM   1984 C  C     . THR A 1 289 ? -5.391  -66.936 -128.541 1.00 25.31 ? 269  THR A C     1 
ATOM   1985 O  O     . THR A 1 289 ? -6.590  -66.672 -128.679 1.00 25.84 ? 269  THR A O     1 
ATOM   1986 C  CB    . THR A 1 289 ? -3.179  -65.764 -128.520 1.00 26.35 ? 269  THR A CB    1 
ATOM   1987 O  OG1   . THR A 1 289 ? -3.701  -65.008 -127.419 1.00 29.93 ? 269  THR A OG1   1 
ATOM   1988 C  CG2   . THR A 1 289 ? -2.226  -64.892 -129.326 1.00 32.50 ? 269  THR A CG2   1 
ATOM   1989 N  N     . SER A 1 290 ? -4.957  -67.813 -127.647 1.00 26.68 ? 270  SER A N     1 
ATOM   1990 C  CA    . SER A 1 290 ? -5.907  -68.488 -126.773 1.00 22.69 ? 270  SER A CA    1 
ATOM   1991 C  C     . SER A 1 290 ? -6.171  -67.641 -125.531 1.00 26.65 ? 270  SER A C     1 
ATOM   1992 O  O     . SER A 1 290 ? -7.029  -67.980 -124.711 1.00 29.88 ? 270  SER A O     1 
ATOM   1993 C  CB    . SER A 1 290 ? -5.364  -69.853 -126.344 1.00 24.98 ? 270  SER A CB    1 
ATOM   1994 O  OG    . SER A 1 290 ? -4.273  -69.700 -125.451 1.00 32.34 ? 270  SER A OG    1 
ATOM   1995 N  N     . ALA A 1 291 ? -5.427  -66.545 -125.392 1.00 26.79 ? 271  ALA A N     1 
ATOM   1996 C  CA    . ALA A 1 291 ? -5.575  -65.662 -124.237 1.00 29.61 ? 271  ALA A CA    1 
ATOM   1997 C  C     . ALA A 1 291 ? -6.881  -64.887 -124.258 1.00 26.14 ? 271  ALA A C     1 
ATOM   1998 O  O     . ALA A 1 291 ? -7.458  -64.645 -125.317 1.00 29.81 ? 271  ALA A O     1 
ATOM   1999 C  CB    . ALA A 1 291 ? -4.397  -64.683 -124.162 1.00 27.18 ? 271  ALA A CB    1 
ATOM   2000 N  N     . THR A 1 292 ? -7.333  -64.488 -123.075 1.00 29.31 ? 272  THR A N     1 
ATOM   2001 C  CA    . THR A 1 292 ? -8.567  -63.724 -122.940 1.00 26.30 ? 272  THR A CA    1 
ATOM   2002 C  C     . THR A 1 292 ? -8.349  -62.288 -123.405 1.00 24.43 ? 272  THR A C     1 
ATOM   2003 O  O     . THR A 1 292 ? -7.341  -61.663 -123.064 1.00 23.04 ? 272  THR A O     1 
ATOM   2004 C  CB    . THR A 1 292 ? -9.043  -63.687 -121.469 1.00 28.59 ? 272  THR A CB    1 
ATOM   2005 O  OG1   . THR A 1 292 ? -9.272  -65.022 -121.007 1.00 23.79 ? 272  THR A OG1   1 
ATOM   2006 C  CG2   . THR A 1 292 ? -10.341 -62.892 -121.341 1.00 29.58 ? 272  THR A CG2   1 
ATOM   2007 N  N     . LYS A 1 293 ? -9.292  -61.787 -124.201 1.00 22.56 ? 273  LYS A N     1 
ATOM   2008 C  CA    . LYS A 1 293 ? -9.271  -60.413 -124.714 1.00 21.47 ? 273  LYS A CA    1 
ATOM   2009 C  C     . LYS A 1 293 ? -10.723 -59.957 -124.646 1.00 23.24 ? 273  LYS A C     1 
ATOM   2010 O  O     . LYS A 1 293 ? -11.573 -60.398 -125.426 1.00 22.64 ? 273  LYS A O     1 
ATOM   2011 C  CB    . LYS A 1 293 ? -8.737  -60.377 -126.147 1.00 24.31 ? 273  LYS A CB    1 
ATOM   2012 C  CG    . LYS A 1 293 ? -7.234  -60.647 -126.231 1.00 21.62 ? 273  LYS A CG    1 
ATOM   2013 C  CD    . LYS A 1 293 ? -6.427  -59.537 -125.565 1.00 20.16 ? 273  LYS A CD    1 
ATOM   2014 C  CE    . LYS A 1 293 ? -4.927  -59.857 -125.526 1.00 22.59 ? 273  LYS A CE    1 
ATOM   2015 N  NZ    . LYS A 1 293 ? -4.124  -58.738 -124.903 1.00 19.59 ? 273  LYS A NZ    1 
ATOM   2016 N  N     . LEU A 1 294 ? -10.995 -59.062 -123.703 1.00 23.33 ? 274  LEU A N     1 
ATOM   2017 C  CA    . LEU A 1 294 ? -12.354 -58.614 -123.443 1.00 20.57 ? 274  LEU A CA    1 
ATOM   2018 C  C     . LEU A 1 294 ? -12.462 -57.175 -122.946 1.00 20.30 ? 274  LEU A C     1 
ATOM   2019 O  O     . LEU A 1 294 ? -11.660 -56.741 -122.124 1.00 21.06 ? 274  LEU A O     1 
ATOM   2020 C  CB    . LEU A 1 294 ? -12.944 -59.551 -122.384 1.00 19.91 ? 274  LEU A CB    1 
ATOM   2021 C  CG    . LEU A 1 294 ? -14.315 -59.290 -121.761 1.00 23.44 ? 274  LEU A CG    1 
ATOM   2022 C  CD1   . LEU A 1 294 ? -15.415 -59.564 -122.796 1.00 21.63 ? 274  LEU A CD1   1 
ATOM   2023 C  CD2   . LEU A 1 294 ? -14.488 -60.197 -120.547 1.00 24.39 ? 274  LEU A CD2   1 
ATOM   2024 N  N     A VAL A 1 295 ? -13.451 -56.442 -123.449 0.50 22.22 ? 275  VAL A N     1 
ATOM   2025 N  N     B VAL A 1 295 ? -13.459 -56.450 -123.448 0.50 21.59 ? 275  VAL A N     1 
ATOM   2026 C  CA    A VAL A 1 295 ? -13.677 -55.069 -123.010 0.50 21.28 ? 275  VAL A CA    1 
ATOM   2027 C  CA    B VAL A 1 295 ? -13.701 -55.061 -123.058 0.50 19.83 ? 275  VAL A CA    1 
ATOM   2028 C  C     A VAL A 1 295 ? -15.089 -55.012 -122.428 0.50 26.16 ? 275  VAL A C     1 
ATOM   2029 C  C     B VAL A 1 295 ? -15.105 -54.984 -122.446 0.50 25.54 ? 275  VAL A C     1 
ATOM   2030 O  O     A VAL A 1 295 ? -16.047 -55.475 -123.051 0.50 26.39 ? 275  VAL A O     1 
ATOM   2031 O  O     B VAL A 1 295 ? -16.078 -55.404 -123.075 0.50 26.73 ? 275  VAL A O     1 
ATOM   2032 C  CB    A VAL A 1 295 ? -13.549 -54.054 -124.175 0.50 24.07 ? 275  VAL A CB    1 
ATOM   2033 C  CB    B VAL A 1 295 ? -13.617 -54.125 -124.292 0.50 21.36 ? 275  VAL A CB    1 
ATOM   2034 C  CG1   A VAL A 1 295 ? -12.151 -54.119 -124.767 0.50 22.98 ? 275  VAL A CG1   1 
ATOM   2035 C  CG1   B VAL A 1 295 ? -14.015 -52.709 -123.920 0.50 15.91 ? 275  VAL A CG1   1 
ATOM   2036 C  CG2   A VAL A 1 295 ? -14.597 -54.331 -125.240 0.50 27.22 ? 275  VAL A CG2   1 
ATOM   2037 C  CG2   B VAL A 1 295 ? -12.203 -54.141 -124.854 0.50 20.47 ? 275  VAL A CG2   1 
ATOM   2038 N  N     . VAL A 1 296 ? -15.209 -54.460 -121.225 1.00 25.36 ? 276  VAL A N     1 
ATOM   2039 C  CA    . VAL A 1 296 ? -16.501 -54.363 -120.543 1.00 25.91 ? 276  VAL A CA    1 
ATOM   2040 C  C     . VAL A 1 296 ? -16.884 -52.922 -120.224 1.00 27.24 ? 276  VAL A C     1 
ATOM   2041 O  O     . VAL A 1 296 ? -16.147 -52.217 -119.537 1.00 26.78 ? 276  VAL A O     1 
ATOM   2042 C  CB    . VAL A 1 296 ? -16.483 -55.185 -119.223 1.00 25.48 ? 276  VAL A CB    1 
ATOM   2043 C  CG1   . VAL A 1 296 ? -17.848 -55.149 -118.556 1.00 24.37 ? 276  VAL A CG1   1 
ATOM   2044 C  CG2   . VAL A 1 296 ? -16.077 -56.622 -119.513 1.00 23.34 ? 276  VAL A CG2   1 
ATOM   2045 N  N     . MET A 1 297 ? -18.040 -52.489 -120.719 1.00 22.52 ? 277  MET A N     1 
ATOM   2046 C  CA    . MET A 1 297 ? -18.499 -51.123 -120.473 1.00 21.49 ? 277  MET A CA    1 
ATOM   2047 C  C     . MET A 1 297 ? -19.757 -51.083 -119.608 1.00 25.69 ? 277  MET A C     1 
ATOM   2048 O  O     . MET A 1 297 ? -20.804 -51.582 -120.013 1.00 25.21 ? 277  MET A O     1 
ATOM   2049 C  CB    . MET A 1 297 ? -18.794 -50.411 -121.799 1.00 26.72 ? 277  MET A CB    1 
ATOM   2050 C  CG    . MET A 1 297 ? -19.277 -48.968 -121.634 1.00 24.38 ? 277  MET A CG    1 
ATOM   2051 S  SD    . MET A 1 297 ? -20.096 -48.266 -123.108 1.00 31.78 ? 277  MET A SD    1 
ATOM   2052 C  CE    . MET A 1 297 ? -18.695 -48.136 -124.283 1.00 21.91 ? 277  MET A CE    1 
ATOM   2053 N  N     . THR A 1 298 ? -19.659 -50.499 -118.417 1.00 26.20 ? 278  THR A N     1 
ATOM   2054 C  CA    . THR A 1 298 ? -20.836 -50.390 -117.559 1.00 24.73 ? 278  THR A CA    1 
ATOM   2055 C  C     . THR A 1 298 ? -21.549 -49.136 -118.049 1.00 28.24 ? 278  THR A C     1 
ATOM   2056 O  O     . THR A 1 298 ? -20.904 -48.176 -118.475 1.00 27.40 ? 278  THR A O     1 
ATOM   2057 C  CB    . THR A 1 298 ? -20.468 -50.239 -116.063 1.00 27.66 ? 278  THR A CB    1 
ATOM   2058 O  OG1   . THR A 1 298 ? -19.664 -49.072 -115.877 1.00 23.41 ? 278  THR A OG1   1 
ATOM   2059 C  CG2   . THR A 1 298 ? -19.698 -51.465 -115.574 1.00 28.11 ? 278  THR A CG2   1 
ATOM   2060 N  N     . ARG A 1 299 ? -22.876 -49.144 -118.000 1.00 24.40 ? 279  ARG A N     1 
ATOM   2061 C  CA    . ARG A 1 299 ? -23.653 -48.009 -118.484 1.00 29.32 ? 279  ARG A CA    1 
ATOM   2062 C  C     . ARG A 1 299 ? -24.766 -47.590 -117.528 1.00 34.28 ? 279  ARG A C     1 
ATOM   2063 O  O     . ARG A 1 299 ? -25.911 -47.404 -117.943 1.00 34.92 ? 279  ARG A O     1 
ATOM   2064 C  CB    . ARG A 1 299 ? -24.249 -48.350 -119.854 1.00 29.96 ? 279  ARG A CB    1 
ATOM   2065 C  CG    . ARG A 1 299 ? -23.207 -48.662 -120.916 1.00 30.13 ? 279  ARG A CG    1 
ATOM   2066 C  CD    . ARG A 1 299 ? -23.803 -49.483 -122.054 1.00 35.94 ? 279  ARG A CD    1 
ATOM   2067 N  NE    . ARG A 1 299 ? -24.678 -48.710 -122.932 1.00 29.33 ? 279  ARG A NE    1 
ATOM   2068 C  CZ    . ARG A 1 299 ? -25.851 -49.147 -123.389 1.00 32.58 ? 279  ARG A CZ    1 
ATOM   2069 N  NH1   . ARG A 1 299 ? -26.302 -50.346 -123.044 1.00 31.42 ? 279  ARG A NH1   1 
ATOM   2070 N  NH2   . ARG A 1 299 ? -26.566 -48.396 -124.216 1.00 34.73 ? 279  ARG A NH2   1 
ATOM   2071 N  N     . GLY A 1 300 ? -24.424 -47.432 -116.253 1.00 33.17 ? 280  GLY A N     1 
ATOM   2072 C  CA    . GLY A 1 300 ? -25.414 -47.026 -115.270 1.00 36.25 ? 280  GLY A CA    1 
ATOM   2073 C  C     . GLY A 1 300 ? -26.572 -47.999 -115.165 1.00 37.73 ? 280  GLY A C     1 
ATOM   2074 O  O     . GLY A 1 300 ? -26.367 -49.188 -114.911 1.00 36.41 ? 280  GLY A O     1 
ATOM   2075 N  N     . HIS A 1 301 ? -27.793 -47.505 -115.354 1.00 36.96 ? 281  HIS A N     1 
ATOM   2076 C  CA    . HIS A 1 301 ? -28.964 -48.367 -115.268 1.00 37.00 ? 281  HIS A CA    1 
ATOM   2077 C  C     . HIS A 1 301 ? -29.180 -49.161 -116.553 1.00 36.66 ? 281  HIS A C     1 
ATOM   2078 O  O     . HIS A 1 301 ? -29.907 -50.156 -116.551 1.00 39.68 ? 281  HIS A O     1 
ATOM   2079 C  CB    . HIS A 1 301 ? -30.224 -47.554 -114.941 1.00 40.81 ? 281  HIS A CB    1 
ATOM   2080 C  CG    . HIS A 1 301 ? -30.780 -46.796 -116.106 1.00 45.02 ? 281  HIS A CG    1 
ATOM   2081 N  ND1   . HIS A 1 301 ? -30.160 -45.687 -116.639 1.00 51.66 ? 281  HIS A ND1   1 
ATOM   2082 C  CD2   . HIS A 1 301 ? -31.894 -46.998 -116.848 1.00 47.43 ? 281  HIS A CD2   1 
ATOM   2083 C  CE1   . HIS A 1 301 ? -30.869 -45.237 -117.659 1.00 52.68 ? 281  HIS A CE1   1 
ATOM   2084 N  NE2   . HIS A 1 301 ? -31.926 -46.015 -117.807 1.00 51.50 ? 281  HIS A NE2   1 
ATOM   2085 N  N     . ASN A 1 302 ? -28.557 -48.722 -117.647 1.00 35.71 ? 282  ASN A N     1 
ATOM   2086 C  CA    . ASN A 1 302 ? -28.689 -49.425 -118.924 1.00 35.47 ? 282  ASN A CA    1 
ATOM   2087 C  C     . ASN A 1 302 ? -27.851 -50.701 -118.909 1.00 35.34 ? 282  ASN A C     1 
ATOM   2088 O  O     . ASN A 1 302 ? -26.919 -50.830 -118.121 1.00 29.29 ? 282  ASN A O     1 
ATOM   2089 C  CB    . ASN A 1 302 ? -28.251 -48.536 -120.096 1.00 36.39 ? 282  ASN A CB    1 
ATOM   2090 C  CG    . ASN A 1 302 ? -29.302 -47.508 -120.473 1.00 44.05 ? 282  ASN A CG    1 
ATOM   2091 O  OD1   . ASN A 1 302 ? -30.482 -47.831 -120.593 1.00 41.51 ? 282  ASN A OD1   1 
ATOM   2092 N  ND2   . ASN A 1 302 ? -28.876 -46.267 -120.676 1.00 42.39 ? 282  ASN A ND2   1 
ATOM   2093 N  N     . PRO A 1 303 ? -28.178 -51.661 -119.787 1.00 33.02 ? 283  PRO A N     1 
ATOM   2094 C  CA    . PRO A 1 303 ? -27.463 -52.938 -119.877 1.00 31.06 ? 283  PRO A CA    1 
ATOM   2095 C  C     . PRO A 1 303 ? -25.957 -52.812 -120.076 1.00 25.78 ? 283  PRO A C     1 
ATOM   2096 O  O     . PRO A 1 303 ? -25.482 -51.944 -120.810 1.00 27.82 ? 283  PRO A O     1 
ATOM   2097 C  CB    . PRO A 1 303 ? -28.136 -53.626 -121.064 1.00 36.29 ? 283  PRO A CB    1 
ATOM   2098 C  CG    . PRO A 1 303 ? -29.527 -53.096 -121.015 1.00 32.40 ? 283  PRO A CG    1 
ATOM   2099 C  CD    . PRO A 1 303 ? -29.299 -51.628 -120.744 1.00 35.66 ? 283  PRO A CD    1 
ATOM   2100 N  N     . VAL A 1 304 ? -25.208 -53.681 -119.407 1.00 25.62 ? 284  VAL A N     1 
ATOM   2101 C  CA    . VAL A 1 304 ? -23.766 -53.685 -119.559 1.00 24.62 ? 284  VAL A CA    1 
ATOM   2102 C  C     . VAL A 1 304 ? -23.485 -54.253 -120.948 1.00 25.40 ? 284  VAL A C     1 
ATOM   2103 O  O     . VAL A 1 304 ? -24.139 -55.206 -121.382 1.00 26.95 ? 284  VAL A O     1 
ATOM   2104 C  CB    . VAL A 1 304 ? -23.087 -54.575 -118.494 1.00 23.79 ? 284  VAL A CB    1 
ATOM   2105 C  CG1   . VAL A 1 304 ? -21.598 -54.695 -118.792 1.00 27.33 ? 284  VAL A CG1   1 
ATOM   2106 C  CG2   . VAL A 1 304 ? -23.304 -53.980 -117.107 1.00 25.81 ? 284  VAL A CG2   1 
ATOM   2107 N  N     . ILE A 1 305 ? -22.528 -53.652 -121.650 1.00 23.87 ? 285  ILE A N     1 
ATOM   2108 C  CA    . ILE A 1 305 ? -22.149 -54.094 -122.991 1.00 25.90 ? 285  ILE A CA    1 
ATOM   2109 C  C     . ILE A 1 305 ? -20.693 -54.551 -122.949 1.00 25.98 ? 285  ILE A C     1 
ATOM   2110 O  O     . ILE A 1 305 ? -19.870 -53.944 -122.266 1.00 29.29 ? 285  ILE A O     1 
ATOM   2111 C  CB    . ILE A 1 305 ? -22.278 -52.940 -124.018 1.00 25.80 ? 285  ILE A CB    1 
ATOM   2112 C  CG1   . ILE A 1 305 ? -23.749 -52.544 -124.184 1.00 30.86 ? 285  ILE A CG1   1 
ATOM   2113 C  CG2   . ILE A 1 305 ? -21.688 -53.359 -125.361 1.00 28.86 ? 285  ILE A CG2   1 
ATOM   2114 C  CD1   . ILE A 1 305 ? -24.624 -53.629 -124.798 1.00 32.23 ? 285  ILE A CD1   1 
ATOM   2115 N  N     . ALA A 1 306 ? -20.380 -55.626 -123.665 1.00 26.42 ? 286  ALA A N     1 
ATOM   2116 C  CA    . ALA A 1 306 ? -19.013 -56.134 -123.695 1.00 24.55 ? 286  ALA A CA    1 
ATOM   2117 C  C     . ALA A 1 306 ? -18.682 -56.724 -125.054 1.00 25.38 ? 286  ALA A C     1 
ATOM   2118 O  O     . ALA A 1 306 ? -19.540 -57.325 -125.707 1.00 27.79 ? 286  ALA A O     1 
ATOM   2119 C  CB    . ALA A 1 306 ? -18.815 -57.187 -122.610 1.00 23.17 ? 286  ALA A CB    1 
ATOM   2120 N  N     . ALA A 1 307 ? -17.437 -56.536 -125.481 1.00 21.59 ? 287  ALA A N     1 
ATOM   2121 C  CA    . ALA A 1 307 ? -16.967 -57.064 -126.759 1.00 19.58 ? 287  ALA A CA    1 
ATOM   2122 C  C     . ALA A 1 307 ? -15.882 -58.078 -126.413 1.00 24.38 ? 287  ALA A C     1 
ATOM   2123 O  O     . ALA A 1 307 ? -14.902 -57.740 -125.745 1.00 22.09 ? 287  ALA A O     1 
ATOM   2124 C  CB    . ALA A 1 307 ? -16.392 -55.935 -127.626 1.00 19.09 ? 287  ALA A CB    1 
ATOM   2125 N  N     . GLU A 1 308 ? -16.057 -59.317 -126.865 1.00 22.89 ? 288  GLU A N     1 
ATOM   2126 C  CA    . GLU A 1 308 ? -15.108 -60.386 -126.565 1.00 25.52 ? 288  GLU A CA    1 
ATOM   2127 C  C     . GLU A 1 308 ? -14.509 -61.042 -127.803 1.00 26.83 ? 288  GLU A C     1 
ATOM   2128 O  O     . GLU A 1 308 ? -15.233 -61.386 -128.739 1.00 25.20 ? 288  GLU A O     1 
ATOM   2129 C  CB    . GLU A 1 308 ? -15.810 -61.466 -125.731 1.00 25.96 ? 288  GLU A CB    1 
ATOM   2130 C  CG    . GLU A 1 308 ? -14.937 -62.669 -125.394 1.00 31.81 ? 288  GLU A CG    1 
ATOM   2131 C  CD    . GLU A 1 308 ? -15.734 -63.854 -124.863 1.00 41.02 ? 288  GLU A CD    1 
ATOM   2132 O  OE1   . GLU A 1 308 ? -15.114 -64.794 -124.319 1.00 42.04 ? 288  GLU A OE1   1 
ATOM   2133 O  OE2   . GLU A 1 308 ? -16.977 -63.855 -124.998 1.00 44.83 ? 288  GLU A OE2   1 
ATOM   2134 N  N     . GLN A 1 309 ? -13.189 -61.208 -127.822 1.00 23.25 ? 289  GLN A N     1 
ATOM   2135 C  CA    . GLN A 1 309 ? -12.560 -61.893 -128.948 1.00 23.25 ? 289  GLN A CA    1 
ATOM   2136 C  C     . GLN A 1 309 ? -12.555 -63.353 -128.528 1.00 27.20 ? 289  GLN A C     1 
ATOM   2137 O  O     . GLN A 1 309 ? -11.918 -63.714 -127.538 1.00 28.27 ? 289  GLN A O     1 
ATOM   2138 C  CB    . GLN A 1 309 ? -11.121 -61.427 -129.182 1.00 26.64 ? 289  GLN A CB    1 
ATOM   2139 C  CG    . GLN A 1 309 ? -10.425 -62.224 -130.288 1.00 23.01 ? 289  GLN A CG    1 
ATOM   2140 C  CD    . GLN A 1 309 ? -8.982  -61.815 -130.499 1.00 22.16 ? 289  GLN A CD    1 
ATOM   2141 O  OE1   . GLN A 1 309 ? -8.623  -61.277 -131.547 1.00 30.22 ? 289  GLN A OE1   1 
ATOM   2142 N  NE2   . GLN A 1 309 ? -8.146  -62.070 -129.503 1.00 26.65 ? 289  GLN A NE2   1 
ATOM   2143 N  N     . THR A 1 310 ? -13.272 -64.192 -129.267 1.00 22.13 ? 290  THR A N     1 
ATOM   2144 C  CA    . THR A 1 310 ? -13.358 -65.607 -128.924 1.00 25.04 ? 290  THR A CA    1 
ATOM   2145 C  C     . THR A 1 310 ? -12.141 -66.424 -129.352 1.00 29.10 ? 290  THR A C     1 
ATOM   2146 O  O     . THR A 1 310 ? -11.213 -65.905 -129.971 1.00 23.84 ? 290  THR A O     1 
ATOM   2147 C  CB    . THR A 1 310 ? -14.627 -66.233 -129.526 1.00 26.78 ? 290  THR A CB    1 
ATOM   2148 O  OG1   . THR A 1 310 ? -14.535 -66.218 -130.952 1.00 30.10 ? 290  THR A OG1   1 
ATOM   2149 C  CG2   . THR A 1 310 ? -15.858 -65.434 -129.099 1.00 32.12 ? 290  THR A CG2   1 
ATOM   2150 N  N     . ALA A 1 311 ? -12.158 -67.708 -129.006 1.00 29.90 ? 291  ALA A N     1 
ATOM   2151 C  CA    . ALA A 1 311 ? -11.065 -68.617 -129.322 1.00 29.82 ? 291  ALA A CA    1 
ATOM   2152 C  C     . ALA A 1 311 ? -10.567 -68.536 -130.768 1.00 27.29 ? 291  ALA A C     1 
ATOM   2153 O  O     . ALA A 1 311 ? -9.364  -68.446 -130.997 1.00 24.84 ? 291  ALA A O     1 
ATOM   2154 C  CB    . ALA A 1 311 ? -11.474 -70.057 -128.985 1.00 27.34 ? 291  ALA A CB    1 
ATOM   2155 N  N     . ASP A 1 312 ? -11.474 -68.557 -131.745 1.00 26.09 ? 292  ASP A N     1 
ATOM   2156 C  CA    . ASP A 1 312 ? -11.033 -68.499 -133.135 1.00 25.78 ? 292  ASP A CA    1 
ATOM   2157 C  C     . ASP A 1 312 ? -10.860 -67.092 -133.710 1.00 20.74 ? 292  ASP A C     1 
ATOM   2158 O  O     . ASP A 1 312 ? -10.654 -66.937 -134.911 1.00 25.50 ? 292  ASP A O     1 
ATOM   2159 C  CB    . ASP A 1 312 ? -11.965 -69.314 -134.044 1.00 26.02 ? 292  ASP A CB    1 
ATOM   2160 C  CG    . ASP A 1 312 ? -13.337 -68.691 -134.197 1.00 37.93 ? 292  ASP A CG    1 
ATOM   2161 O  OD1   . ASP A 1 312 ? -13.503 -67.491 -133.880 1.00 32.49 ? 292  ASP A OD1   1 
ATOM   2162 O  OD2   . ASP A 1 312 ? -14.253 -69.409 -134.655 1.00 38.81 ? 292  ASP A OD2   1 
ATOM   2163 N  N     . GLY A 1 313 ? -10.942 -66.072 -132.860 1.00 23.57 ? 293  GLY A N     1 
ATOM   2164 C  CA    . GLY A 1 313 ? -10.757 -64.707 -133.330 1.00 23.12 ? 293  GLY A CA    1 
ATOM   2165 C  C     . GLY A 1 313 ? -12.008 -63.910 -133.663 1.00 25.94 ? 293  GLY A C     1 
ATOM   2166 O  O     . GLY A 1 313 ? -11.936 -62.692 -133.858 1.00 25.70 ? 293  GLY A O     1 
ATOM   2167 N  N     . THR A 1 314 ? -13.155 -64.576 -133.742 1.00 23.50 ? 294  THR A N     1 
ATOM   2168 C  CA    . THR A 1 314 ? -14.387 -63.864 -134.047 1.00 26.25 ? 294  THR A CA    1 
ATOM   2169 C  C     . THR A 1 314 ? -14.793 -63.059 -132.815 1.00 27.92 ? 294  THR A C     1 
ATOM   2170 O  O     . THR A 1 314 ? -14.591 -63.497 -131.681 1.00 28.10 ? 294  THR A O     1 
ATOM   2171 C  CB    . THR A 1 314 ? -15.525 -64.837 -134.446 1.00 31.70 ? 294  THR A CB    1 
ATOM   2172 O  OG1   . THR A 1 314 ? -15.787 -65.746 -133.372 1.00 40.10 ? 294  THR A OG1   1 
ATOM   2173 C  CG2   . THR A 1 314 ? -15.130 -65.635 -135.689 1.00 38.85 ? 294  THR A CG2   1 
ATOM   2174 N  N     . VAL A 1 315 ? -15.339 -61.872 -133.040 1.00 23.43 ? 295  VAL A N     1 
ATOM   2175 C  CA    . VAL A 1 315 ? -15.763 -61.006 -131.944 1.00 25.17 ? 295  VAL A CA    1 
ATOM   2176 C  C     . VAL A 1 315 ? -17.242 -61.190 -131.637 1.00 29.43 ? 295  VAL A C     1 
ATOM   2177 O  O     . VAL A 1 315 ? -18.081 -61.173 -132.540 1.00 30.69 ? 295  VAL A O     1 
ATOM   2178 C  CB    . VAL A 1 315 ? -15.502 -59.518 -132.280 1.00 27.53 ? 295  VAL A CB    1 
ATOM   2179 C  CG1   . VAL A 1 315 ? -16.087 -58.622 -131.192 1.00 25.57 ? 295  VAL A CG1   1 
ATOM   2180 C  CG2   . VAL A 1 315 ? -14.005 -59.273 -132.416 1.00 24.63 ? 295  VAL A CG2   1 
ATOM   2181 N  N     . VAL A 1 316 ? -17.553 -61.377 -130.360 1.00 25.20 ? 296  VAL A N     1 
ATOM   2182 C  CA    . VAL A 1 316 ? -18.934 -61.553 -129.924 1.00 27.28 ? 296  VAL A CA    1 
ATOM   2183 C  C     . VAL A 1 316 ? -19.298 -60.423 -128.965 1.00 30.59 ? 296  VAL A C     1 
ATOM   2184 O  O     . VAL A 1 316 ? -18.488 -60.019 -128.130 1.00 30.30 ? 296  VAL A O     1 
ATOM   2185 C  CB    . VAL A 1 316 ? -19.132 -62.913 -129.217 1.00 32.53 ? 296  VAL A CB    1 
ATOM   2186 C  CG1   . VAL A 1 316 ? -20.526 -62.996 -128.620 1.00 39.36 ? 296  VAL A CG1   1 
ATOM   2187 C  CG2   . VAL A 1 316 ? -18.936 -64.047 -130.213 1.00 29.16 ? 296  VAL A CG2   1 
ATOM   2188 N  N     . VAL A 1 317 ? -20.514 -59.904 -129.101 1.00 27.58 ? 297  VAL A N     1 
ATOM   2189 C  CA    . VAL A 1 317 ? -20.986 -58.819 -128.255 1.00 25.23 ? 297  VAL A CA    1 
ATOM   2190 C  C     . VAL A 1 317 ? -21.955 -59.336 -127.199 1.00 32.67 ? 297  VAL A C     1 
ATOM   2191 O  O     . VAL A 1 317 ? -22.873 -60.095 -127.509 1.00 32.85 ? 297  VAL A O     1 
ATOM   2192 C  CB    . VAL A 1 317 ? -21.704 -57.737 -129.097 1.00 27.95 ? 297  VAL A CB    1 
ATOM   2193 C  CG1   . VAL A 1 317 ? -22.266 -56.646 -128.188 1.00 27.58 ? 297  VAL A CG1   1 
ATOM   2194 C  CG2   . VAL A 1 317 ? -20.736 -57.141 -130.108 1.00 32.45 ? 297  VAL A CG2   1 
ATOM   2195 N  N     . HIS A 1 318 ? -21.738 -58.930 -125.951 1.00 29.56 ? 298  HIS A N     1 
ATOM   2196 C  CA    . HIS A 1 318 ? -22.604 -59.334 -124.846 1.00 34.02 ? 298  HIS A CA    1 
ATOM   2197 C  C     . HIS A 1 318 ? -23.405 -58.143 -124.347 1.00 33.21 ? 298  HIS A C     1 
ATOM   2198 O  O     . HIS A 1 318 ? -22.893 -57.026 -124.278 1.00 31.73 ? 298  HIS A O     1 
ATOM   2199 C  CB    . HIS A 1 318 ? -21.792 -59.869 -123.659 1.00 33.27 ? 298  HIS A CB    1 
ATOM   2200 C  CG    . HIS A 1 318 ? -20.977 -61.082 -123.969 1.00 35.47 ? 298  HIS A CG    1 
ATOM   2201 N  ND1   . HIS A 1 318 ? -19.722 -61.011 -124.532 1.00 41.39 ? 298  HIS A ND1   1 
ATOM   2202 C  CD2   . HIS A 1 318 ? -21.235 -62.399 -123.788 1.00 30.53 ? 298  HIS A CD2   1 
ATOM   2203 C  CE1   . HIS A 1 318 ? -19.241 -62.232 -124.684 1.00 39.70 ? 298  HIS A CE1   1 
ATOM   2204 N  NE2   . HIS A 1 318 ? -20.140 -63.092 -124.241 1.00 35.13 ? 298  HIS A NE2   1 
ATOM   2205 N  N     . GLU A 1 319 ? -24.663 -58.387 -124.000 1.00 32.02 ? 299  GLU A N     1 
ATOM   2206 C  CA    . GLU A 1 319 ? -25.518 -57.344 -123.453 1.00 32.18 ? 299  GLU A CA    1 
ATOM   2207 C  C     . GLU A 1 319 ? -26.197 -57.954 -122.236 1.00 36.80 ? 299  GLU A C     1 
ATOM   2208 O  O     . GLU A 1 319 ? -26.988 -58.887 -122.361 1.00 34.28 ? 299  GLU A O     1 
ATOM   2209 C  CB    . GLU A 1 319 ? -26.576 -56.903 -124.461 1.00 37.60 ? 299  GLU A CB    1 
ATOM   2210 C  CG    . GLU A 1 319 ? -27.561 -55.894 -123.891 1.00 35.24 ? 299  GLU A CG    1 
ATOM   2211 C  CD    . GLU A 1 319 ? -28.666 -55.537 -124.865 1.00 41.87 ? 299  GLU A CD    1 
ATOM   2212 O  OE1   . GLU A 1 319 ? -29.290 -56.465 -125.418 1.00 44.35 ? 299  GLU A OE1   1 
ATOM   2213 O  OE2   . GLU A 1 319 ? -28.916 -54.331 -125.072 1.00 44.15 ? 299  GLU A OE2   1 
ATOM   2214 N  N     . VAL A 1 320 ? -25.876 -57.436 -121.057 1.00 31.98 ? 300  VAL A N     1 
ATOM   2215 C  CA    . VAL A 1 320 ? -26.456 -57.956 -119.830 1.00 33.54 ? 300  VAL A CA    1 
ATOM   2216 C  C     . VAL A 1 320 ? -27.289 -56.897 -119.127 1.00 32.25 ? 300  VAL A C     1 
ATOM   2217 O  O     . VAL A 1 320 ? -26.761 -55.912 -118.614 1.00 33.06 ? 300  VAL A O     1 
ATOM   2218 C  CB    . VAL A 1 320 ? -25.356 -58.453 -118.876 1.00 30.26 ? 300  VAL A CB    1 
ATOM   2219 C  CG1   . VAL A 1 320 ? -25.980 -59.086 -117.646 1.00 34.90 ? 300  VAL A CG1   1 
ATOM   2220 C  CG2   . VAL A 1 320 ? -24.465 -59.453 -119.602 1.00 29.00 ? 300  VAL A CG2   1 
ATOM   2221 N  N     . GLY A 1 321 ? -28.598 -57.108 -119.106 1.00 34.73 ? 301  GLY A N     1 
ATOM   2222 C  CA    . GLY A 1 321 ? -29.480 -56.154 -118.463 1.00 32.06 ? 301  GLY A CA    1 
ATOM   2223 C  C     . GLY A 1 321 ? -29.170 -55.986 -116.992 1.00 31.69 ? 301  GLY A C     1 
ATOM   2224 O  O     . GLY A 1 321 ? -28.708 -56.918 -116.332 1.00 35.31 ? 301  GLY A O     1 
ATOM   2225 N  N     . VAL A 1 322 ? -29.420 -54.788 -116.476 1.00 31.49 ? 302  VAL A N     1 
ATOM   2226 C  CA    . VAL A 1 322 ? -29.179 -54.502 -115.070 1.00 35.64 ? 302  VAL A CA    1 
ATOM   2227 C  C     . VAL A 1 322 ? -30.506 -54.505 -114.320 1.00 37.59 ? 302  VAL A C     1 
ATOM   2228 O  O     . VAL A 1 322 ? -31.442 -53.801 -114.698 1.00 37.06 ? 302  VAL A O     1 
ATOM   2229 C  CB    . VAL A 1 322 ? -28.507 -53.127 -114.887 1.00 34.34 ? 302  VAL A CB    1 
ATOM   2230 C  CG1   . VAL A 1 322 ? -28.403 -52.793 -113.411 1.00 29.04 ? 302  VAL A CG1   1 
ATOM   2231 C  CG2   . VAL A 1 322 ? -27.125 -53.137 -115.526 1.00 37.54 ? 302  VAL A CG2   1 
ATOM   2232 N  N     . PRO A 1 323 ? -30.606 -55.310 -113.251 1.00 40.06 ? 303  PRO A N     1 
ATOM   2233 C  CA    . PRO A 1 323 ? -31.844 -55.377 -112.469 1.00 41.20 ? 303  PRO A CA    1 
ATOM   2234 C  C     . PRO A 1 323 ? -32.292 -53.979 -112.055 1.00 41.61 ? 303  PRO A C     1 
ATOM   2235 O  O     . PRO A 1 323 ? -31.493 -53.184 -111.556 1.00 37.96 ? 303  PRO A O     1 
ATOM   2236 C  CB    . PRO A 1 323 ? -31.449 -56.240 -111.274 1.00 40.97 ? 303  PRO A CB    1 
ATOM   2237 C  CG    . PRO A 1 323 ? -30.437 -57.169 -111.864 1.00 45.72 ? 303  PRO A CG    1 
ATOM   2238 C  CD    . PRO A 1 323 ? -29.593 -56.230 -112.707 1.00 40.12 ? 303  PRO A CD    1 
ATOM   2239 N  N     . VAL A 1 324 ? -33.568 -53.684 -112.273 1.00 41.41 ? 304  VAL A N     1 
ATOM   2240 C  CA    . VAL A 1 324 ? -34.119 -52.379 -111.933 1.00 44.36 ? 304  VAL A CA    1 
ATOM   2241 C  C     . VAL A 1 324 ? -34.106 -52.112 -110.433 1.00 44.36 ? 304  VAL A C     1 
ATOM   2242 O  O     . VAL A 1 324 ? -34.372 -53.003 -109.629 1.00 49.46 ? 304  VAL A O     1 
ATOM   2243 C  CB    . VAL A 1 324 ? -35.576 -52.240 -112.443 1.00 49.11 ? 304  VAL A CB    1 
ATOM   2244 C  CG1   . VAL A 1 324 ? -36.173 -50.917 -111.974 1.00 47.07 ? 304  VAL A CG1   1 
ATOM   2245 C  CG2   . VAL A 1 324 ? -35.604 -52.321 -113.965 1.00 46.81 ? 304  VAL A CG2   1 
ATOM   2246 N  N     . VAL A 1 325 ? -33.782 -50.877 -110.064 1.00 45.49 ? 305  VAL A N     1 
ATOM   2247 C  CA    . VAL A 1 325 ? -33.764 -50.470 -108.665 1.00 47.87 ? 305  VAL A CA    1 
ATOM   2248 C  C     . VAL A 1 325 ? -34.343 -49.061 -108.569 1.00 47.44 ? 305  VAL A C     1 
ATOM   2249 O  O     . VAL A 1 325 ? -33.795 -48.114 -109.136 1.00 44.50 ? 305  VAL A O     1 
ATOM   2250 C  CB    . VAL A 1 325 ? -32.334 -50.481 -108.079 1.00 47.73 ? 305  VAL A CB    1 
ATOM   2251 C  CG1   . VAL A 1 325 ? -31.457 -49.498 -108.822 1.00 54.76 ? 305  VAL A CG1   1 
ATOM   2252 C  CG2   . VAL A 1 325 ? -32.380 -50.141 -106.597 1.00 50.88 ? 305  VAL A CG2   1 
ATOM   2253 N  N     . ALA A 1 326 ? -35.463 -48.937 -107.862 1.00 50.43 ? 306  ALA A N     1 
ATOM   2254 C  CA    . ALA A 1 326 ? -36.137 -47.653 -107.693 1.00 50.44 ? 306  ALA A CA    1 
ATOM   2255 C  C     . ALA A 1 326 ? -35.153 -46.560 -107.295 1.00 52.28 ? 306  ALA A C     1 
ATOM   2256 O  O     . ALA A 1 326 ? -34.327 -46.752 -106.401 1.00 53.87 ? 306  ALA A O     1 
ATOM   2257 C  CB    . ALA A 1 326 ? -37.235 -47.776 -106.641 1.00 52.20 ? 306  ALA A CB    1 
ATOM   2258 N  N     . ALA A 1 327 ? -35.247 -45.415 -107.964 1.00 52.69 ? 307  ALA A N     1 
ATOM   2259 C  CA    . ALA A 1 327 ? -34.363 -44.288 -107.686 1.00 52.88 ? 307  ALA A CA    1 
ATOM   2260 C  C     . ALA A 1 327 ? -34.457 -43.871 -106.223 1.00 53.06 ? 307  ALA A C     1 
ATOM   2261 O  O     . ALA A 1 327 ? -33.549 -43.229 -105.692 1.00 51.85 ? 307  ALA A O     1 
ATOM   2262 C  CB    . ALA A 1 327 ? -34.716 -43.112 -108.588 1.00 55.61 ? 307  ALA A CB    1 
ATOM   2263 N  N     . GLU A 1 328 ? -35.559 -44.241 -105.576 1.00 50.55 ? 308  GLU A N     1 
ATOM   2264 C  CA    . GLU A 1 328 ? -35.777 -43.909 -104.173 1.00 51.90 ? 308  GLU A CA    1 
ATOM   2265 C  C     . GLU A 1 328 ? -34.933 -44.784 -103.246 1.00 50.03 ? 308  GLU A C     1 
ATOM   2266 O  O     . GLU A 1 328 ? -34.731 -44.447 -102.077 1.00 51.14 ? 308  GLU A O     1 
ATOM   2267 C  CB    . GLU A 1 328 ? -37.257 -44.059 -103.827 1.00 52.82 ? 308  GLU A CB    1 
ATOM   2268 N  N     . LYS A 1 329 ? -34.440 -45.903 -103.769 1.00 44.10 ? 309  LYS A N     1 
ATOM   2269 C  CA    . LYS A 1 329 ? -33.628 -46.821 -102.976 1.00 40.27 ? 309  LYS A CA    1 
ATOM   2270 C  C     . LYS A 1 329 ? -32.133 -46.632 -103.214 1.00 44.20 ? 309  LYS A C     1 
ATOM   2271 O  O     . LYS A 1 329 ? -31.310 -47.317 -102.604 1.00 42.50 ? 309  LYS A O     1 
ATOM   2272 C  CB    . LYS A 1 329 ? -34.026 -48.259 -103.281 1.00 41.20 ? 309  LYS A CB    1 
ATOM   2273 N  N     . ILE A 1 330 ? -31.787 -45.701 -104.098 1.00 41.03 ? 310  ILE A N     1 
ATOM   2274 C  CA    . ILE A 1 330 ? -30.390 -45.428 -104.411 1.00 44.15 ? 310  ILE A CA    1 
ATOM   2275 C  C     . ILE A 1 330 ? -29.815 -44.391 -103.456 1.00 47.65 ? 310  ILE A C     1 
ATOM   2276 O  O     . ILE A 1 330 ? -30.221 -43.230 -103.467 1.00 50.71 ? 310  ILE A O     1 
ATOM   2277 C  CB    . ILE A 1 330 ? -30.234 -44.913 -105.855 1.00 45.78 ? 310  ILE A CB    1 
ATOM   2278 C  CG1   . ILE A 1 330 ? -30.827 -45.930 -106.833 1.00 50.62 ? 310  ILE A CG1   1 
ATOM   2279 C  CG2   . ILE A 1 330 ? -28.763 -44.660 -106.162 1.00 44.52 ? 310  ILE A CG2   1 
ATOM   2280 C  CD1   . ILE A 1 330 ? -30.242 -47.325 -106.701 1.00 53.51 ? 310  ILE A CD1   1 
ATOM   2281 N  N     . VAL A 1 331 ? -28.862 -44.819 -102.635 1.00 46.54 ? 311  VAL A N     1 
ATOM   2282 C  CA    . VAL A 1 331 ? -28.224 -43.942 -101.661 1.00 44.01 ? 311  VAL A CA    1 
ATOM   2283 C  C     . VAL A 1 331 ? -27.066 -43.142 -102.251 1.00 46.76 ? 311  VAL A C     1 
ATOM   2284 O  O     . VAL A 1 331 ? -26.881 -41.969 -101.919 1.00 44.58 ? 311  VAL A O     1 
ATOM   2285 C  CB    . VAL A 1 331 ? -27.682 -44.756 -100.469 1.00 45.61 ? 311  VAL A CB    1 
ATOM   2286 C  CG1   . VAL A 1 331 ? -26.964 -43.840 -99.490  1.00 48.59 ? 311  VAL A CG1   1 
ATOM   2287 C  CG2   . VAL A 1 331 ? -28.821 -45.489 -99.783  1.00 48.79 ? 311  VAL A CG2   1 
ATOM   2288 N  N     . ASP A 1 332 ? -26.291 -43.778 -103.126 1.00 45.77 ? 312  ASP A N     1 
ATOM   2289 C  CA    . ASP A 1 332 ? -25.129 -43.136 -103.739 1.00 47.53 ? 312  ASP A CA    1 
ATOM   2290 C  C     . ASP A 1 332 ? -24.515 -44.084 -104.768 1.00 43.82 ? 312  ASP A C     1 
ATOM   2291 O  O     . ASP A 1 332 ? -24.387 -45.278 -104.507 1.00 40.53 ? 312  ASP A O     1 
ATOM   2292 C  CB    . ASP A 1 332 ? -24.099 -42.819 -102.647 1.00 51.68 ? 312  ASP A CB    1 
ATOM   2293 C  CG    . ASP A 1 332 ? -22.806 -42.253 -103.198 1.00 55.19 ? 312  ASP A CG    1 
ATOM   2294 O  OD1   . ASP A 1 332 ? -21.827 -42.181 -102.427 1.00 55.91 ? 312  ASP A OD1   1 
ATOM   2295 O  OD2   . ASP A 1 332 ? -22.766 -41.877 -104.388 1.00 60.18 ? 312  ASP A OD2   1 
ATOM   2296 N  N     . THR A 1 333 ? -24.133 -43.556 -105.930 1.00 39.75 ? 313  THR A N     1 
ATOM   2297 C  CA    . THR A 1 333 ? -23.541 -44.393 -106.969 1.00 40.78 ? 313  THR A CA    1 
ATOM   2298 C  C     . THR A 1 333 ? -22.022 -44.496 -106.861 1.00 40.58 ? 313  THR A C     1 
ATOM   2299 O  O     . THR A 1 333 ? -21.388 -45.213 -107.636 1.00 40.93 ? 313  THR A O     1 
ATOM   2300 C  CB    . THR A 1 333 ? -23.904 -43.890 -108.383 1.00 43.81 ? 313  THR A CB    1 
ATOM   2301 O  OG1   . THR A 1 333 ? -23.390 -42.566 -108.575 1.00 49.47 ? 313  THR A OG1   1 
ATOM   2302 C  CG2   . THR A 1 333 ? -25.414 -43.882 -108.569 1.00 48.50 ? 313  THR A CG2   1 
ATOM   2303 N  N     . ASN A 1 334 ? -21.437 -43.776 -105.908 1.00 41.64 ? 314  ASN A N     1 
ATOM   2304 C  CA    . ASN A 1 334 ? -19.993 -43.834 -105.707 1.00 40.33 ? 314  ASN A CA    1 
ATOM   2305 C  C     . ASN A 1 334 ? -19.660 -45.234 -105.202 1.00 34.78 ? 314  ASN A C     1 
ATOM   2306 O  O     . ASN A 1 334 ? -20.372 -45.780 -104.356 1.00 36.54 ? 314  ASN A O     1 
ATOM   2307 C  CB    . ASN A 1 334 ? -19.544 -42.799 -104.667 1.00 43.17 ? 314  ASN A CB    1 
ATOM   2308 C  CG    . ASN A 1 334 ? -19.534 -41.381 -105.209 1.00 46.14 ? 314  ASN A CG    1 
ATOM   2309 O  OD1   . ASN A 1 334 ? -18.718 -41.035 -106.064 1.00 48.14 ? 314  ASN A OD1   1 
ATOM   2310 N  ND2   . ASN A 1 334 ? -20.441 -40.553 -104.712 1.00 44.54 ? 314  ASN A ND2   1 
ATOM   2311 N  N     . GLY A 1 335 ? -18.590 -45.819 -105.731 1.00 33.80 ? 315  GLY A N     1 
ATOM   2312 C  CA    . GLY A 1 335 ? -18.190 -47.148 -105.302 1.00 27.29 ? 315  GLY A CA    1 
ATOM   2313 C  C     . GLY A 1 335 ? -18.864 -48.288 -106.044 1.00 26.35 ? 315  GLY A C     1 
ATOM   2314 O  O     . GLY A 1 335 ? -18.481 -49.448 -105.885 1.00 26.04 ? 315  GLY A O     1 
ATOM   2315 N  N     . ALA A 1 336 ? -19.869 -47.969 -106.853 1.00 28.08 ? 316  ALA A N     1 
ATOM   2316 C  CA    . ALA A 1 336 ? -20.580 -48.992 -107.611 1.00 28.00 ? 316  ALA A CA    1 
ATOM   2317 C  C     . ALA A 1 336 ? -19.631 -49.656 -108.597 1.00 25.43 ? 316  ALA A C     1 
ATOM   2318 O  O     . ALA A 1 336 ? -19.638 -50.875 -108.764 1.00 29.90 ? 316  ALA A O     1 
ATOM   2319 C  CB    . ALA A 1 336 ? -21.753 -48.369 -108.357 1.00 31.06 ? 316  ALA A CB    1 
ATOM   2320 N  N     . GLY A 1 337 ? -18.814 -48.841 -109.250 1.00 23.11 ? 317  GLY A N     1 
ATOM   2321 C  CA    . GLY A 1 337 ? -17.873 -49.368 -110.218 1.00 28.56 ? 317  GLY A CA    1 
ATOM   2322 C  C     . GLY A 1 337 ? -16.862 -50.311 -109.598 1.00 25.54 ? 317  GLY A C     1 
ATOM   2323 O  O     . GLY A 1 337 ? -16.579 -51.374 -110.155 1.00 24.11 ? 317  GLY A O     1 
ATOM   2324 N  N     . ASP A 1 338 ? -16.309 -49.924 -108.449 1.00 24.33 ? 318  ASP A N     1 
ATOM   2325 C  CA    . ASP A 1 338 ? -15.326 -50.760 -107.770 1.00 21.29 ? 318  ASP A CA    1 
ATOM   2326 C  C     . ASP A 1 338 ? -15.948 -52.088 -107.354 1.00 23.94 ? 318  ASP A C     1 
ATOM   2327 O  O     . ASP A 1 338 ? -15.319 -53.138 -107.466 1.00 26.06 ? 318  ASP A O     1 
ATOM   2328 C  CB    . ASP A 1 338 ? -14.768 -50.061 -106.524 1.00 23.91 ? 318  ASP A CB    1 
ATOM   2329 C  CG    . ASP A 1 338 ? -14.104 -48.728 -106.834 1.00 32.02 ? 318  ASP A CG    1 
ATOM   2330 O  OD1   . ASP A 1 338 ? -13.545 -48.569 -107.940 1.00 31.82 ? 318  ASP A OD1   1 
ATOM   2331 O  OD2   . ASP A 1 338 ? -14.127 -47.844 -105.950 1.00 29.50 ? 318  ASP A OD2   1 
ATOM   2332 N  N     . ALA A 1 339 ? -17.182 -52.035 -106.860 1.00 22.74 ? 319  ALA A N     1 
ATOM   2333 C  CA    . ALA A 1 339 ? -17.882 -53.238 -106.426 1.00 23.11 ? 319  ALA A CA    1 
ATOM   2334 C  C     . ALA A 1 339 ? -18.172 -54.136 -107.629 1.00 22.89 ? 319  ALA A C     1 
ATOM   2335 O  O     . ALA A 1 339 ? -18.052 -55.358 -107.541 1.00 29.22 ? 319  ALA A O     1 
ATOM   2336 C  CB    . ALA A 1 339 ? -19.184 -52.860 -105.716 1.00 20.97 ? 319  ALA A CB    1 
ATOM   2337 N  N     . PHE A 1 340 ? -18.557 -53.525 -108.747 1.00 23.23 ? 320  PHE A N     1 
ATOM   2338 C  CA    . PHE A 1 340 ? -18.836 -54.280 -109.963 1.00 25.41 ? 320  PHE A CA    1 
ATOM   2339 C  C     . PHE A 1 340 ? -17.605 -55.094 -110.353 1.00 20.88 ? 320  PHE A C     1 
ATOM   2340 O  O     . PHE A 1 340 ? -17.702 -56.291 -110.619 1.00 22.77 ? 320  PHE A O     1 
ATOM   2341 C  CB    . PHE A 1 340 ? -19.190 -53.342 -111.120 1.00 27.06 ? 320  PHE A CB    1 
ATOM   2342 C  CG    . PHE A 1 340 ? -19.336 -54.046 -112.445 1.00 29.19 ? 320  PHE A CG    1 
ATOM   2343 C  CD1   . PHE A 1 340 ? -20.547 -54.628 -112.809 1.00 27.61 ? 320  PHE A CD1   1 
ATOM   2344 C  CD2   . PHE A 1 340 ? -18.247 -54.168 -113.308 1.00 21.97 ? 320  PHE A CD2   1 
ATOM   2345 C  CE1   . PHE A 1 340 ? -20.675 -55.324 -114.011 1.00 28.01 ? 320  PHE A CE1   1 
ATOM   2346 C  CE2   . PHE A 1 340 ? -18.362 -54.864 -114.514 1.00 30.87 ? 320  PHE A CE2   1 
ATOM   2347 C  CZ    . PHE A 1 340 ? -19.578 -55.444 -114.867 1.00 27.01 ? 320  PHE A CZ    1 
ATOM   2348 N  N     . VAL A 1 341 ? -16.449 -54.433 -110.401 1.00 23.20 ? 321  VAL A N     1 
ATOM   2349 C  CA    . VAL A 1 341 ? -15.201 -55.100 -110.769 1.00 22.32 ? 321  VAL A CA    1 
ATOM   2350 C  C     . VAL A 1 341 ? -14.885 -56.225 -109.789 1.00 23.17 ? 321  VAL A C     1 
ATOM   2351 O  O     . VAL A 1 341 ? -14.492 -57.322 -110.198 1.00 23.72 ? 321  VAL A O     1 
ATOM   2352 C  CB    . VAL A 1 341 ? -14.023 -54.088 -110.810 1.00 23.40 ? 321  VAL A CB    1 
ATOM   2353 C  CG1   . VAL A 1 341 ? -12.686 -54.821 -110.954 1.00 23.13 ? 321  VAL A CG1   1 
ATOM   2354 C  CG2   . VAL A 1 341 ? -14.218 -53.139 -111.982 1.00 24.68 ? 321  VAL A CG2   1 
ATOM   2355 N  N     . GLY A 1 342 ? -15.063 -55.952 -108.500 1.00 21.78 ? 322  GLY A N     1 
ATOM   2356 C  CA    . GLY A 1 342 ? -14.811 -56.959 -107.484 1.00 19.32 ? 322  GLY A CA    1 
ATOM   2357 C  C     . GLY A 1 342 ? -15.632 -58.211 -107.741 1.00 27.06 ? 322  GLY A C     1 
ATOM   2358 O  O     . GLY A 1 342 ? -15.111 -59.327 -107.707 1.00 23.26 ? 322  GLY A O     1 
ATOM   2359 N  N     . GLY A 1 343 ? -16.922 -58.024 -108.007 1.00 23.54 ? 323  GLY A N     1 
ATOM   2360 C  CA    . GLY A 1 343 ? -17.797 -59.155 -108.281 1.00 28.11 ? 323  GLY A CA    1 
ATOM   2361 C  C     . GLY A 1 343 ? -17.379 -59.917 -109.528 1.00 28.86 ? 323  GLY A C     1 
ATOM   2362 O  O     . GLY A 1 343 ? -17.333 -61.149 -109.537 1.00 25.49 ? 323  GLY A O     1 
ATOM   2363 N  N     . PHE A 1 344 ? -17.075 -59.178 -110.590 1.00 26.65 ? 324  PHE A N     1 
ATOM   2364 C  CA    . PHE A 1 344 ? -16.651 -59.779 -111.849 1.00 26.20 ? 324  PHE A CA    1 
ATOM   2365 C  C     . PHE A 1 344 ? -15.416 -60.647 -111.643 1.00 23.94 ? 324  PHE A C     1 
ATOM   2366 O  O     . PHE A 1 344 ? -15.350 -61.775 -112.127 1.00 23.50 ? 324  PHE A O     1 
ATOM   2367 C  CB    . PHE A 1 344 ? -16.324 -58.688 -112.871 1.00 21.09 ? 324  PHE A CB    1 
ATOM   2368 C  CG    . PHE A 1 344 ? -16.041 -59.216 -114.255 1.00 24.80 ? 324  PHE A CG    1 
ATOM   2369 C  CD1   . PHE A 1 344 ? -16.962 -59.033 -115.286 1.00 26.82 ? 324  PHE A CD1   1 
ATOM   2370 C  CD2   . PHE A 1 344 ? -14.853 -59.895 -114.531 1.00 24.84 ? 324  PHE A CD2   1 
ATOM   2371 C  CE1   . PHE A 1 344 ? -16.703 -59.518 -116.571 1.00 29.43 ? 324  PHE A CE1   1 
ATOM   2372 C  CE2   . PHE A 1 344 ? -14.588 -60.382 -115.808 1.00 24.79 ? 324  PHE A CE2   1 
ATOM   2373 C  CZ    . PHE A 1 344 ? -15.518 -60.191 -116.831 1.00 28.33 ? 324  PHE A CZ    1 
ATOM   2374 N  N     . LEU A 1 345 ? -14.433 -60.116 -110.924 1.00 21.33 ? 325  LEU A N     1 
ATOM   2375 C  CA    . LEU A 1 345 ? -13.199 -60.852 -110.694 1.00 20.01 ? 325  LEU A CA    1 
ATOM   2376 C  C     . LEU A 1 345 ? -13.419 -62.070 -109.806 1.00 24.36 ? 325  LEU A C     1 
ATOM   2377 O  O     . LEU A 1 345 ? -12.787 -63.101 -109.998 1.00 22.82 ? 325  LEU A O     1 
ATOM   2378 C  CB    . LEU A 1 345 ? -12.139 -59.927 -110.086 1.00 23.56 ? 325  LEU A CB    1 
ATOM   2379 C  CG    . LEU A 1 345 ? -11.641 -58.823 -111.031 1.00 25.39 ? 325  LEU A CG    1 
ATOM   2380 C  CD1   . LEU A 1 345 ? -10.563 -57.992 -110.336 1.00 26.05 ? 325  LEU A CD1   1 
ATOM   2381 C  CD2   . LEU A 1 345 ? -11.084 -59.445 -112.308 1.00 25.60 ? 325  LEU A CD2   1 
ATOM   2382 N  N     . TYR A 1 346 ? -14.311 -61.954 -108.828 1.00 21.48 ? 326  TYR A N     1 
ATOM   2383 C  CA    . TYR A 1 346 ? -14.592 -63.095 -107.962 1.00 21.52 ? 326  TYR A CA    1 
ATOM   2384 C  C     . TYR A 1 346 ? -15.162 -64.215 -108.834 1.00 21.81 ? 326  TYR A C     1 
ATOM   2385 O  O     . TYR A 1 346 ? -14.710 -65.362 -108.781 1.00 26.22 ? 326  TYR A O     1 
ATOM   2386 C  CB    . TYR A 1 346 ? -15.619 -62.727 -106.892 1.00 21.62 ? 326  TYR A CB    1 
ATOM   2387 C  CG    . TYR A 1 346 ? -16.272 -63.944 -106.269 1.00 21.68 ? 326  TYR A CG    1 
ATOM   2388 C  CD1   . TYR A 1 346 ? -15.547 -64.815 -105.459 1.00 27.84 ? 326  TYR A CD1   1 
ATOM   2389 C  CD2   . TYR A 1 346 ? -17.607 -64.247 -106.532 1.00 33.34 ? 326  TYR A CD2   1 
ATOM   2390 C  CE1   . TYR A 1 346 ? -16.138 -65.964 -104.927 1.00 29.07 ? 326  TYR A CE1   1 
ATOM   2391 C  CE2   . TYR A 1 346 ? -18.204 -65.391 -106.009 1.00 32.99 ? 326  TYR A CE2   1 
ATOM   2392 C  CZ    . TYR A 1 346 ? -17.465 -66.242 -105.211 1.00 33.55 ? 326  TYR A CZ    1 
ATOM   2393 O  OH    . TYR A 1 346 ? -18.055 -67.382 -104.715 1.00 38.25 ? 326  TYR A OH    1 
ATOM   2394 N  N     . ALA A 1 347 ? -16.156 -63.867 -109.643 1.00 19.54 ? 327  ALA A N     1 
ATOM   2395 C  CA    . ALA A 1 347 ? -16.795 -64.835 -110.528 1.00 24.04 ? 327  ALA A CA    1 
ATOM   2396 C  C     . ALA A 1 347 ? -15.777 -65.431 -111.493 1.00 26.73 ? 327  ALA A C     1 
ATOM   2397 O  O     . ALA A 1 347 ? -15.790 -66.634 -111.761 1.00 28.43 ? 327  ALA A O     1 
ATOM   2398 C  CB    . ALA A 1 347 ? -17.925 -64.169 -111.298 1.00 28.43 ? 327  ALA A CB    1 
ATOM   2399 N  N     . LEU A 1 348 ? -14.889 -64.590 -112.010 1.00 24.07 ? 328  LEU A N     1 
ATOM   2400 C  CA    . LEU A 1 348 ? -13.867 -65.053 -112.939 1.00 20.33 ? 328  LEU A CA    1 
ATOM   2401 C  C     . LEU A 1 348 ? -12.965 -66.101 -112.289 1.00 25.22 ? 328  LEU A C     1 
ATOM   2402 O  O     . LEU A 1 348 ? -12.586 -67.080 -112.931 1.00 27.38 ? 328  LEU A O     1 
ATOM   2403 C  CB    . LEU A 1 348 ? -13.021 -63.873 -113.428 1.00 20.68 ? 328  LEU A CB    1 
ATOM   2404 C  CG    . LEU A 1 348 ? -11.932 -64.178 -114.462 1.00 27.63 ? 328  LEU A CG    1 
ATOM   2405 C  CD1   . LEU A 1 348 ? -12.562 -64.631 -115.776 1.00 28.98 ? 328  LEU A CD1   1 
ATOM   2406 C  CD2   . LEU A 1 348 ? -11.086 -62.932 -114.684 1.00 29.51 ? 328  LEU A CD2   1 
ATOM   2407 N  N     . SER A 1 349 ? -12.619 -65.897 -111.019 1.00 25.28 ? 329  SER A N     1 
ATOM   2408 C  CA    . SER A 1 349 ? -11.763 -66.849 -110.314 1.00 30.10 ? 329  SER A CA    1 
ATOM   2409 C  C     . SER A 1 349 ? -12.492 -68.172 -110.135 1.00 32.53 ? 329  SER A C     1 
ATOM   2410 O  O     . SER A 1 349 ? -11.866 -69.209 -109.915 1.00 35.08 ? 329  SER A O     1 
ATOM   2411 C  CB    . SER A 1 349 ? -11.350 -66.304 -108.940 1.00 27.31 ? 329  SER A CB    1 
ATOM   2412 O  OG    . SER A 1 349 ? -12.427 -66.344 -108.019 1.00 28.47 ? 329  SER A OG    1 
ATOM   2413 N  N     . GLN A 1 350 ? -13.818 -68.137 -110.226 1.00 31.86 ? 330  GLN A N     1 
ATOM   2414 C  CA    . GLN A 1 350 ? -14.615 -69.351 -110.079 1.00 34.32 ? 330  GLN A CA    1 
ATOM   2415 C  C     . GLN A 1 350 ? -14.892 -69.980 -111.445 1.00 36.10 ? 330  GLN A C     1 
ATOM   2416 O  O     . GLN A 1 350 ? -15.705 -70.897 -111.558 1.00 34.25 ? 330  GLN A O     1 
ATOM   2417 C  CB    . GLN A 1 350 ? -15.945 -69.042 -109.382 1.00 41.06 ? 330  GLN A CB    1 
ATOM   2418 C  CG    . GLN A 1 350 ? -15.823 -68.372 -108.016 1.00 43.09 ? 330  GLN A CG    1 
ATOM   2419 C  CD    . GLN A 1 350 ? -15.030 -69.190 -107.018 1.00 50.44 ? 330  GLN A CD    1 
ATOM   2420 O  OE1   . GLN A 1 350 ? -13.803 -69.276 -107.097 1.00 51.41 ? 330  GLN A OE1   1 
ATOM   2421 N  NE2   . GLN A 1 350 ? -15.731 -69.804 -106.072 1.00 54.45 ? 330  GLN A NE2   1 
ATOM   2422 N  N     . GLY A 1 351 ? -14.222 -69.469 -112.477 1.00 32.60 ? 331  GLY A N     1 
ATOM   2423 C  CA    . GLY A 1 351 ? -14.390 -69.984 -113.825 1.00 32.08 ? 331  GLY A CA    1 
ATOM   2424 C  C     . GLY A 1 351 ? -15.756 -69.789 -114.466 1.00 32.43 ? 331  GLY A C     1 
ATOM   2425 O  O     . GLY A 1 351 ? -16.148 -70.566 -115.337 1.00 32.21 ? 331  GLY A O     1 
ATOM   2426 N  N     . LYS A 1 352 ? -16.484 -68.756 -114.059 1.00 26.96 ? 332  LYS A N     1 
ATOM   2427 C  CA    . LYS A 1 352 ? -17.807 -68.506 -114.625 1.00 27.57 ? 332  LYS A CA    1 
ATOM   2428 C  C     . LYS A 1 352 ? -17.719 -67.881 -116.018 1.00 29.28 ? 332  LYS A C     1 
ATOM   2429 O  O     . LYS A 1 352 ? -16.678 -67.365 -116.409 1.00 27.60 ? 332  LYS A O     1 
ATOM   2430 C  CB    . LYS A 1 352 ? -18.614 -67.608 -113.684 1.00 30.52 ? 332  LYS A CB    1 
ATOM   2431 C  CG    . LYS A 1 352 ? -18.723 -68.176 -112.277 1.00 42.54 ? 332  LYS A CG    1 
ATOM   2432 C  CD    . LYS A 1 352 ? -19.573 -67.308 -111.358 1.00 55.03 ? 332  LYS A CD    1 
ATOM   2433 C  CE    . LYS A 1 352 ? -21.046 -67.335 -111.745 1.00 61.31 ? 332  LYS A CE    1 
ATOM   2434 N  NZ    . LYS A 1 352 ? -21.882 -66.581 -110.764 1.00 58.59 ? 332  LYS A NZ    1 
ATOM   2435 N  N     . THR A 1 353 ? -18.811 -67.943 -116.774 1.00 26.14 ? 333  THR A N     1 
ATOM   2436 C  CA    . THR A 1 353 ? -18.830 -67.370 -118.116 1.00 30.08 ? 333  THR A CA    1 
ATOM   2437 C  C     . THR A 1 353 ? -18.781 -65.843 -118.031 1.00 28.40 ? 333  THR A C     1 
ATOM   2438 O  O     . THR A 1 353 ? -18.952 -65.268 -116.956 1.00 32.09 ? 333  THR A O     1 
ATOM   2439 C  CB    . THR A 1 353 ? -20.104 -67.772 -118.874 1.00 34.50 ? 333  THR A CB    1 
ATOM   2440 O  OG1   . THR A 1 353 ? -21.241 -67.183 -118.230 1.00 30.56 ? 333  THR A OG1   1 
ATOM   2441 C  CG2   . THR A 1 353 ? -20.262 -69.297 -118.891 1.00 32.49 ? 333  THR A CG2   1 
ATOM   2442 N  N     . VAL A 1 354 ? -18.551 -65.189 -119.164 1.00 31.08 ? 334  VAL A N     1 
ATOM   2443 C  CA    . VAL A 1 354 ? -18.486 -63.733 -119.192 1.00 31.32 ? 334  VAL A CA    1 
ATOM   2444 C  C     . VAL A 1 354 ? -19.802 -63.126 -118.712 1.00 32.42 ? 334  VAL A C     1 
ATOM   2445 O  O     . VAL A 1 354 ? -19.813 -62.191 -117.917 1.00 27.92 ? 334  VAL A O     1 
ATOM   2446 C  CB    . VAL A 1 354 ? -18.175 -63.215 -120.610 1.00 35.61 ? 334  VAL A CB    1 
ATOM   2447 C  CG1   . VAL A 1 354 ? -18.246 -61.698 -120.641 1.00 32.75 ? 334  VAL A CG1   1 
ATOM   2448 C  CG2   . VAL A 1 354 ? -16.797 -63.682 -121.036 1.00 31.53 ? 334  VAL A CG2   1 
ATOM   2449 N  N     . LYS A 1 355 ? -20.918 -63.663 -119.187 1.00 33.34 ? 335  LYS A N     1 
ATOM   2450 C  CA    . LYS A 1 355 ? -22.208 -63.139 -118.765 1.00 35.89 ? 335  LYS A CA    1 
ATOM   2451 C  C     . LYS A 1 355 ? -22.398 -63.320 -117.265 1.00 27.37 ? 335  LYS A C     1 
ATOM   2452 O  O     . LYS A 1 355 ? -22.857 -62.409 -116.583 1.00 26.64 ? 335  LYS A O     1 
ATOM   2453 C  CB    . LYS A 1 355 ? -23.341 -63.816 -119.538 1.00 39.28 ? 335  LYS A CB    1 
ATOM   2454 C  CG    . LYS A 1 355 ? -23.319 -63.480 -121.024 1.00 50.12 ? 335  LYS A CG    1 
ATOM   2455 C  CD    . LYS A 1 355 ? -24.572 -63.960 -121.732 1.00 60.61 ? 335  LYS A CD    1 
ATOM   2456 C  CE    . LYS A 1 355 ? -24.509 -63.661 -123.220 1.00 62.02 ? 335  LYS A CE    1 
ATOM   2457 N  NZ    . LYS A 1 355 ? -23.409 -64.416 -123.883 1.00 64.36 ? 335  LYS A NZ    1 
ATOM   2458 N  N     . GLN A 1 356 ? -22.028 -64.486 -116.749 1.00 30.34 ? 336  GLN A N     1 
ATOM   2459 C  CA    . GLN A 1 356 ? -22.161 -64.757 -115.325 1.00 28.01 ? 336  GLN A CA    1 
ATOM   2460 C  C     . GLN A 1 356 ? -21.283 -63.815 -114.500 1.00 28.15 ? 336  GLN A C     1 
ATOM   2461 O  O     . GLN A 1 356 ? -21.677 -63.379 -113.420 1.00 28.48 ? 336  GLN A O     1 
ATOM   2462 C  CB    . GLN A 1 356 ? -21.809 -66.217 -115.030 1.00 31.97 ? 336  GLN A CB    1 
ATOM   2463 C  CG    . GLN A 1 356 ? -22.872 -67.197 -115.506 1.00 38.65 ? 336  GLN A CG    1 
ATOM   2464 C  CD    . GLN A 1 356 ? -22.379 -68.632 -115.569 1.00 46.00 ? 336  GLN A CD    1 
ATOM   2465 O  OE1   . GLN A 1 356 ? -23.143 -69.544 -115.886 1.00 53.47 ? 336  GLN A OE1   1 
ATOM   2466 N  NE2   . GLN A 1 356 ? -21.098 -68.839 -115.275 1.00 34.86 ? 336  GLN A NE2   1 
ATOM   2467 N  N     . CYS A 1 357 ? -20.099 -63.492 -115.009 1.00 26.51 ? 337  CYS A N     1 
ATOM   2468 C  CA    . CYS A 1 357 ? -19.211 -62.582 -114.290 1.00 25.65 ? 337  CYS A CA    1 
ATOM   2469 C  C     . CYS A 1 357 ? -19.833 -61.195 -114.210 1.00 27.05 ? 337  CYS A C     1 
ATOM   2470 O  O     . CYS A 1 357 ? -19.749 -60.521 -113.183 1.00 26.36 ? 337  CYS A O     1 
ATOM   2471 C  CB    . CYS A 1 357 ? -17.856 -62.483 -114.987 1.00 24.51 ? 337  CYS A CB    1 
ATOM   2472 S  SG    . CYS A 1 357 ? -16.867 -63.982 -114.878 1.00 27.77 ? 337  CYS A SG    1 
ATOM   2473 N  N     . ILE A 1 358 ? -20.457 -60.767 -115.300 1.00 23.93 ? 338  ILE A N     1 
ATOM   2474 C  CA    . ILE A 1 358 ? -21.082 -59.458 -115.327 1.00 24.34 ? 338  ILE A CA    1 
ATOM   2475 C  C     . ILE A 1 358 ? -22.260 -59.412 -114.347 1.00 25.25 ? 338  ILE A C     1 
ATOM   2476 O  O     . ILE A 1 358 ? -22.441 -58.431 -113.620 1.00 23.02 ? 338  ILE A O     1 
ATOM   2477 C  CB    . ILE A 1 358 ? -21.555 -59.105 -116.756 1.00 29.15 ? 338  ILE A CB    1 
ATOM   2478 C  CG1   . ILE A 1 358 ? -20.343 -59.044 -117.696 1.00 25.20 ? 338  ILE A CG1   1 
ATOM   2479 C  CG2   . ILE A 1 358 ? -22.304 -57.779 -116.747 1.00 28.58 ? 338  ILE A CG2   1 
ATOM   2480 C  CD1   . ILE A 1 358 ? -20.679 -58.849 -119.167 1.00 27.49 ? 338  ILE A CD1   1 
ATOM   2481 N  N     A MET A 1 359 ? -23.050 -60.480 -114.319 0.50 27.05 ? 339  MET A N     1 
ATOM   2482 N  N     B MET A 1 359 ? -23.054 -60.477 -114.316 0.50 27.18 ? 339  MET A N     1 
ATOM   2483 C  CA    A MET A 1 359 ? -24.200 -60.540 -113.425 0.50 27.58 ? 339  MET A CA    1 
ATOM   2484 C  CA    B MET A 1 359 ? -24.202 -60.518 -113.416 0.50 27.67 ? 339  MET A CA    1 
ATOM   2485 C  C     A MET A 1 359 ? -23.778 -60.457 -111.961 0.50 28.09 ? 339  MET A C     1 
ATOM   2486 C  C     B MET A 1 359 ? -23.765 -60.432 -111.958 0.50 28.19 ? 339  MET A C     1 
ATOM   2487 O  O     A MET A 1 359 ? -24.454 -59.821 -111.150 0.50 29.07 ? 339  MET A O     1 
ATOM   2488 O  O     B MET A 1 359 ? -24.418 -59.772 -111.148 0.50 29.15 ? 339  MET A O     1 
ATOM   2489 C  CB    A MET A 1 359 ? -24.994 -61.822 -113.680 0.50 29.85 ? 339  MET A CB    1 
ATOM   2490 C  CB    B MET A 1 359 ? -25.017 -61.792 -113.641 0.50 29.96 ? 339  MET A CB    1 
ATOM   2491 C  CG    A MET A 1 359 ? -25.547 -61.903 -115.091 0.50 30.89 ? 339  MET A CG    1 
ATOM   2492 C  CG    B MET A 1 359 ? -25.461 -61.982 -115.078 0.50 32.03 ? 339  MET A CG    1 
ATOM   2493 S  SD    A MET A 1 359 ? -26.436 -63.431 -115.418 0.50 37.44 ? 339  MET A SD    1 
ATOM   2494 S  SD    B MET A 1 359 ? -26.677 -63.295 -115.259 0.50 39.10 ? 339  MET A SD    1 
ATOM   2495 C  CE    A MET A 1 359 ? -27.986 -63.090 -114.582 0.50 34.87 ? 339  MET A CE    1 
ATOM   2496 C  CE    B MET A 1 359 ? -25.690 -64.730 -114.852 0.50 35.56 ? 339  MET A CE    1 
ATOM   2497 N  N     . CYS A 1 360 ? -22.663 -61.097 -111.623 1.00 25.02 ? 340  CYS A N     1 
ATOM   2498 C  CA    . CYS A 1 360 ? -22.156 -61.065 -110.254 1.00 27.63 ? 340  CYS A CA    1 
ATOM   2499 C  C     . CYS A 1 360 ? -21.692 -59.643 -109.955 1.00 26.08 ? 340  CYS A C     1 
ATOM   2500 O  O     . CYS A 1 360 ? -21.928 -59.121 -108.868 1.00 26.08 ? 340  CYS A O     1 
ATOM   2501 C  CB    . CYS A 1 360 ? -20.988 -62.037 -110.073 1.00 29.95 ? 340  CYS A CB    1 
ATOM   2502 S  SG    . CYS A 1 360 ? -20.302 -62.043 -108.391 1.00 31.05 ? 340  CYS A SG    1 
ATOM   2503 N  N     . GLY A 1 361 ? -21.026 -59.017 -110.923 1.00 23.59 ? 341  GLY A N     1 
ATOM   2504 C  CA    . GLY A 1 361 ? -20.583 -57.649 -110.722 1.00 24.03 ? 341  GLY A CA    1 
ATOM   2505 C  C     . GLY A 1 361 ? -21.799 -56.766 -110.481 1.00 24.18 ? 341  GLY A C     1 
ATOM   2506 O  O     . GLY A 1 361 ? -21.782 -55.886 -109.620 1.00 21.25 ? 341  GLY A O     1 
ATOM   2507 N  N     . ASN A 1 362 ? -22.864 -57.001 -111.242 1.00 23.80 ? 342  ASN A N     1 
ATOM   2508 C  CA    . ASN A 1 362 ? -24.092 -56.219 -111.092 1.00 27.32 ? 342  ASN A CA    1 
ATOM   2509 C  C     . ASN A 1 362 ? -24.681 -56.402 -109.694 1.00 26.04 ? 342  ASN A C     1 
ATOM   2510 O  O     . ASN A 1 362 ? -25.109 -55.434 -109.059 1.00 28.90 ? 342  ASN A O     1 
ATOM   2511 C  CB    . ASN A 1 362 ? -25.132 -56.643 -112.136 1.00 24.17 ? 342  ASN A CB    1 
ATOM   2512 C  CG    . ASN A 1 362 ? -24.920 -55.987 -113.494 1.00 28.36 ? 342  ASN A CG    1 
ATOM   2513 O  OD1   . ASN A 1 362 ? -25.566 -56.358 -114.474 1.00 32.45 ? 342  ASN A OD1   1 
ATOM   2514 N  ND2   . ASN A 1 362 ? -24.029 -55.006 -113.556 1.00 22.70 ? 342  ASN A ND2   1 
ATOM   2515 N  N     . ALA A 1 363 ? -24.704 -57.643 -109.218 1.00 26.35 ? 343  ALA A N     1 
ATOM   2516 C  CA    . ALA A 1 363 ? -25.254 -57.943 -107.898 1.00 27.37 ? 343  ALA A CA    1 
ATOM   2517 C  C     . ALA A 1 363 ? -24.492 -57.209 -106.799 1.00 31.78 ? 343  ALA A C     1 
ATOM   2518 O  O     . ALA A 1 363 ? -25.092 -56.670 -105.865 1.00 33.95 ? 343  ALA A O     1 
ATOM   2519 C  CB    . ALA A 1 363 ? -25.218 -59.446 -107.645 1.00 29.23 ? 343  ALA A CB    1 
ATOM   2520 N  N     . CYS A 1 364 ? -23.168 -57.189 -106.914 1.00 30.82 ? 344  CYS A N     1 
ATOM   2521 C  CA    . CYS A 1 364 ? -22.328 -56.519 -105.928 1.00 28.75 ? 344  CYS A CA    1 
ATOM   2522 C  C     . CYS A 1 364 ? -22.519 -55.010 -105.979 1.00 27.69 ? 344  CYS A C     1 
ATOM   2523 O  O     . CYS A 1 364 ? -22.611 -54.351 -104.943 1.00 29.57 ? 344  CYS A O     1 
ATOM   2524 C  CB    . CYS A 1 364 ? -20.861 -56.871 -106.167 1.00 26.81 ? 344  CYS A CB    1 
ATOM   2525 S  SG    . CYS A 1 364 ? -20.457 -58.588 -105.799 1.00 28.29 ? 344  CYS A SG    1 
ATOM   2526 N  N     . ALA A 1 365 ? -22.585 -54.467 -107.191 1.00 24.50 ? 345  ALA A N     1 
ATOM   2527 C  CA    . ALA A 1 365 ? -22.777 -53.038 -107.376 1.00 25.64 ? 345  ALA A CA    1 
ATOM   2528 C  C     . ALA A 1 365 ? -24.137 -52.629 -106.816 1.00 33.67 ? 345  ALA A C     1 
ATOM   2529 O  O     . ALA A 1 365 ? -24.268 -51.598 -106.156 1.00 29.44 ? 345  ALA A O     1 
ATOM   2530 C  CB    . ALA A 1 365 ? -22.698 -52.692 -108.854 1.00 28.85 ? 345  ALA A CB    1 
ATOM   2531 N  N     . GLN A 1 366 ? -25.147 -53.452 -107.078 1.00 33.25 ? 346  GLN A N     1 
ATOM   2532 C  CA    . GLN A 1 366 ? -26.499 -53.166 -106.613 1.00 37.78 ? 346  GLN A CA    1 
ATOM   2533 C  C     . GLN A 1 366 ? -26.573 -53.130 -105.092 1.00 35.21 ? 346  GLN A C     1 
ATOM   2534 O  O     . GLN A 1 366 ? -27.300 -52.319 -104.517 1.00 32.50 ? 346  GLN A O     1 
ATOM   2535 C  CB    . GLN A 1 366 ? -27.474 -54.206 -107.168 1.00 38.45 ? 346  GLN A CB    1 
ATOM   2536 C  CG    . GLN A 1 366 ? -28.700 -53.596 -107.817 1.00 49.27 ? 346  GLN A CG    1 
ATOM   2537 C  CD    . GLN A 1 366 ? -28.988 -54.183 -109.185 1.00 40.86 ? 346  GLN A CD    1 
ATOM   2538 O  OE1   . GLN A 1 366 ? -29.189 -55.387 -109.325 1.00 48.58 ? 346  GLN A OE1   1 
ATOM   2539 N  NE2   . GLN A 1 366 ? -29.009 -53.329 -110.205 1.00 42.10 ? 346  GLN A NE2   1 
ATOM   2540 N  N     . ASP A 1 367 ? -25.817 -54.005 -104.438 1.00 34.73 ? 347  ASP A N     1 
ATOM   2541 C  CA    . ASP A 1 367 ? -25.805 -54.041 -102.979 1.00 37.67 ? 347  ASP A CA    1 
ATOM   2542 C  C     . ASP A 1 367 ? -25.211 -52.753 -102.407 1.00 36.78 ? 347  ASP A C     1 
ATOM   2543 O  O     . ASP A 1 367 ? -25.811 -52.102 -101.548 1.00 34.05 ? 347  ASP A O     1 
ATOM   2544 C  CB    . ASP A 1 367 ? -24.981 -55.230 -102.479 1.00 38.73 ? 347  ASP A CB    1 
ATOM   2545 C  CG    . ASP A 1 367 ? -24.872 -55.263 -100.966 1.00 44.06 ? 347  ASP A CG    1 
ATOM   2546 O  OD1   . ASP A 1 367 ? -25.845 -55.689 -100.308 1.00 43.05 ? 347  ASP A OD1   1 
ATOM   2547 O  OD2   . ASP A 1 367 ? -23.818 -54.851 -100.433 1.00 42.41 ? 347  ASP A OD2   1 
ATOM   2548 N  N     . VAL A 1 368 ? -24.031 -52.388 -102.898 1.00 30.99 ? 348  VAL A N     1 
ATOM   2549 C  CA    . VAL A 1 368 ? -23.324 -51.199 -102.430 1.00 30.65 ? 348  VAL A CA    1 
ATOM   2550 C  C     . VAL A 1 368 ? -24.035 -49.853 -102.620 1.00 31.66 ? 348  VAL A C     1 
ATOM   2551 O  O     . VAL A 1 368 ? -23.947 -48.979 -101.759 1.00 34.99 ? 348  VAL A O     1 
ATOM   2552 C  CB    . VAL A 1 368 ? -21.914 -51.119 -103.084 1.00 36.05 ? 348  VAL A CB    1 
ATOM   2553 C  CG1   . VAL A 1 368 ? -21.231 -49.806 -102.727 1.00 35.96 ? 348  VAL A CG1   1 
ATOM   2554 C  CG2   . VAL A 1 368 ? -21.063 -52.281 -102.609 1.00 29.61 ? 348  VAL A CG2   1 
ATOM   2555 N  N     . ILE A 1 369 ? -24.739 -49.670 -103.731 1.00 31.38 ? 349  ILE A N     1 
ATOM   2556 C  CA    . ILE A 1 369 ? -25.405 -48.390 -103.963 1.00 31.91 ? 349  ILE A CA    1 
ATOM   2557 C  C     . ILE A 1 369 ? -26.669 -48.180 -103.134 1.00 35.44 ? 349  ILE A C     1 
ATOM   2558 O  O     . ILE A 1 369 ? -27.246 -47.090 -103.141 1.00 35.06 ? 349  ILE A O     1 
ATOM   2559 C  CB    . ILE A 1 369 ? -25.780 -48.210 -105.446 1.00 34.76 ? 349  ILE A CB    1 
ATOM   2560 C  CG1   . ILE A 1 369 ? -26.797 -49.275 -105.858 1.00 35.25 ? 349  ILE A CG1   1 
ATOM   2561 C  CG2   . ILE A 1 369 ? -24.529 -48.296 -106.308 1.00 33.52 ? 349  ILE A CG2   1 
ATOM   2562 C  CD1   . ILE A 1 369 ? -27.311 -49.119 -107.277 1.00 39.98 ? 349  ILE A CD1   1 
ATOM   2563 N  N     . GLN A 1 370 ? -27.097 -49.209 -102.412 1.00 34.65 ? 350  GLN A N     1 
ATOM   2564 C  CA    . GLN A 1 370 ? -28.316 -49.092 -101.622 1.00 37.22 ? 350  GLN A CA    1 
ATOM   2565 C  C     . GLN A 1 370 ? -28.101 -48.809 -100.141 1.00 37.95 ? 350  GLN A C     1 
ATOM   2566 O  O     . GLN A 1 370 ? -29.048 -48.827 -99.358  1.00 37.47 ? 350  GLN A O     1 
ATOM   2567 C  CB    . GLN A 1 370 ? -29.180 -50.343 -101.811 1.00 40.18 ? 350  GLN A CB    1 
ATOM   2568 C  CG    . GLN A 1 370 ? -29.599 -50.555 -103.262 1.00 39.26 ? 350  GLN A CG    1 
ATOM   2569 C  CD    . GLN A 1 370 ? -30.643 -51.644 -103.435 1.00 49.46 ? 350  GLN A CD    1 
ATOM   2570 O  OE1   . GLN A 1 370 ? -31.810 -51.466 -103.080 1.00 42.88 ? 350  GLN A OE1   1 
ATOM   2571 N  NE2   . GLN A 1 370 ? -30.226 -52.781 -103.984 1.00 44.42 ? 350  GLN A NE2   1 
ATOM   2572 N  N     . HIS A 1 371 ? -26.857 -48.542 -99.757  1.00 37.19 ? 351  HIS A N     1 
ATOM   2573 C  CA    . HIS A 1 371 ? -26.554 -48.222 -98.367  1.00 41.09 ? 351  HIS A CA    1 
ATOM   2574 C  C     . HIS A 1 371 ? -25.283 -47.389 -98.273  1.00 42.04 ? 351  HIS A C     1 
ATOM   2575 O  O     . HIS A 1 371 ? -24.506 -47.320 -99.225  1.00 37.05 ? 351  HIS A O     1 
ATOM   2576 C  CB    . HIS A 1 371 ? -26.405 -49.497 -97.527  1.00 43.76 ? 351  HIS A CB    1 
ATOM   2577 C  CG    . HIS A 1 371 ? -25.207 -50.324 -97.876  1.00 44.63 ? 351  HIS A CG    1 
ATOM   2578 N  ND1   . HIS A 1 371 ? -25.209 -51.247 -98.899  1.00 50.33 ? 351  HIS A ND1   1 
ATOM   2579 C  CD2   . HIS A 1 371 ? -23.970 -50.375 -97.327  1.00 46.95 ? 351  HIS A CD2   1 
ATOM   2580 C  CE1   . HIS A 1 371 ? -24.027 -51.833 -98.964  1.00 46.45 ? 351  HIS A CE1   1 
ATOM   2581 N  NE2   . HIS A 1 371 ? -23.256 -51.321 -98.021  1.00 50.14 ? 351  HIS A NE2   1 
ATOM   2582 N  N     . VAL A 1 372 ? -25.081 -46.741 -97.130  1.00 41.40 ? 352  VAL A N     1 
ATOM   2583 C  CA    . VAL A 1 372 ? -23.893 -45.919 -96.932  1.00 44.50 ? 352  VAL A CA    1 
ATOM   2584 C  C     . VAL A 1 372 ? -22.653 -46.806 -96.894  1.00 42.39 ? 352  VAL A C     1 
ATOM   2585 O  O     . VAL A 1 372 ? -22.674 -47.889 -96.310  1.00 44.48 ? 352  VAL A O     1 
ATOM   2586 C  CB    . VAL A 1 372 ? -23.980 -45.107 -95.617  1.00 45.78 ? 352  VAL A CB    1 
ATOM   2587 C  CG1   . VAL A 1 372 ? -25.059 -44.043 -95.736  1.00 48.37 ? 352  VAL A CG1   1 
ATOM   2588 C  CG2   . VAL A 1 372 ? -24.289 -46.032 -94.453  1.00 45.82 ? 352  VAL A CG2   1 
ATOM   2589 N  N     . GLY A 1 373 ? -21.577 -46.343 -97.521  1.00 38.37 ? 353  GLY A N     1 
ATOM   2590 C  CA    . GLY A 1 373 ? -20.353 -47.121 -97.545  1.00 43.38 ? 353  GLY A CA    1 
ATOM   2591 C  C     . GLY A 1 373 ? -20.077 -47.722 -98.911  1.00 42.23 ? 353  GLY A C     1 
ATOM   2592 O  O     . GLY A 1 373 ? -20.976 -47.832 -99.746  1.00 38.55 ? 353  GLY A O     1 
ATOM   2593 N  N     . PHE A 1 374 ? -18.831 -48.123 -99.136  1.00 37.18 ? 354  PHE A N     1 
ATOM   2594 C  CA    . PHE A 1 374 ? -18.431 -48.702 -100.414 1.00 37.02 ? 354  PHE A CA    1 
ATOM   2595 C  C     . PHE A 1 374 ? -18.124 -50.188 -100.294 1.00 38.99 ? 354  PHE A C     1 
ATOM   2596 O  O     . PHE A 1 374 ? -17.434 -50.763 -101.142 1.00 37.65 ? 354  PHE A O     1 
ATOM   2597 C  CB    . PHE A 1 374 ? -17.204 -47.960 -100.946 1.00 35.05 ? 354  PHE A CB    1 
ATOM   2598 C  CG    . PHE A 1 374 ? -17.422 -46.483 -101.129 1.00 37.42 ? 354  PHE A CG    1 
ATOM   2599 C  CD1   . PHE A 1 374 ? -16.420 -45.575 -100.802 1.00 38.20 ? 354  PHE A CD1   1 
ATOM   2600 C  CD2   . PHE A 1 374 ? -18.631 -45.998 -101.626 1.00 34.95 ? 354  PHE A CD2   1 
ATOM   2601 C  CE1   . PHE A 1 374 ? -16.618 -44.205 -100.963 1.00 40.87 ? 354  PHE A CE1   1 
ATOM   2602 C  CE2   . PHE A 1 374 ? -18.838 -44.632 -101.791 1.00 35.58 ? 354  PHE A CE2   1 
ATOM   2603 C  CZ    . PHE A 1 374 ? -17.829 -43.733 -101.458 1.00 38.56 ? 354  PHE A CZ    1 
ATOM   2604 N  N     . SER A 1 375 ? -18.639 -50.810 -99.240  1.00 35.89 ? 355  SER A N     1 
ATOM   2605 C  CA    . SER A 1 375 ? -18.411 -52.230 -99.015  1.00 39.45 ? 355  SER A CA    1 
ATOM   2606 C  C     . SER A 1 375 ? -19.717 -53.009 -99.103  1.00 32.65 ? 355  SER A C     1 
ATOM   2607 O  O     . SER A 1 375 ? -20.799 -52.433 -99.001  1.00 38.11 ? 355  SER A O     1 
ATOM   2608 C  CB    . SER A 1 375 ? -17.774 -52.445 -97.641  1.00 41.08 ? 355  SER A CB    1 
ATOM   2609 O  OG    . SER A 1 375 ? -16.552 -51.736 -97.534  1.00 44.34 ? 355  SER A OG    1 
ATOM   2610 N  N     . LEU A 1 376 ? -19.612 -54.319 -99.297  1.00 29.05 ? 356  LEU A N     1 
ATOM   2611 C  CA    . LEU A 1 376 ? -20.800 -55.161 -99.381  1.00 30.94 ? 356  LEU A CA    1 
ATOM   2612 C  C     . LEU A 1 376 ? -21.409 -55.266 -97.992  1.00 33.50 ? 356  LEU A C     1 
ATOM   2613 O  O     . LEU A 1 376 ? -20.695 -55.253 -96.991  1.00 31.35 ? 356  LEU A O     1 
ATOM   2614 C  CB    . LEU A 1 376 ? -20.440 -56.570 -99.867  1.00 29.70 ? 356  LEU A CB    1 
ATOM   2615 C  CG    . LEU A 1 376 ? -19.907 -56.799 -101.285 1.00 27.35 ? 356  LEU A CG    1 
ATOM   2616 C  CD1   . LEU A 1 376 ? -19.561 -58.272 -101.444 1.00 31.08 ? 356  LEU A CD1   1 
ATOM   2617 C  CD2   . LEU A 1 376 ? -20.939 -56.387 -102.319 1.00 28.08 ? 356  LEU A CD2   1 
ATOM   2618 N  N     A SER A 1 377 ? -22.732 -55.370 -97.932  0.50 34.04 ? 357  SER A N     1 
ATOM   2619 N  N     B SER A 1 377 ? -22.731 -55.375 -97.933  0.50 34.84 ? 357  SER A N     1 
ATOM   2620 C  CA    A SER A 1 377 ? -23.425 -55.488 -96.656  0.50 33.18 ? 357  SER A CA    1 
ATOM   2621 C  CA    B SER A 1 377 ? -23.427 -55.490 -96.658  0.50 34.84 ? 357  SER A CA    1 
ATOM   2622 C  C     A SER A 1 377 ? -23.000 -56.771 -95.947  0.50 32.45 ? 357  SER A C     1 
ATOM   2623 C  C     B SER A 1 377 ? -23.003 -56.773 -95.947  0.50 33.38 ? 357  SER A C     1 
ATOM   2624 O  O     A SER A 1 377 ? -22.625 -57.753 -96.592  0.50 34.34 ? 357  SER A O     1 
ATOM   2625 O  O     B SER A 1 377 ? -22.632 -57.756 -96.592  0.50 35.00 ? 357  SER A O     1 
ATOM   2626 C  CB    A SER A 1 377 ? -24.938 -55.493 -96.880  0.50 31.99 ? 357  SER A CB    1 
ATOM   2627 C  CB    B SER A 1 377 ? -24.939 -55.495 -96.887  0.50 35.07 ? 357  SER A CB    1 
ATOM   2628 O  OG    A SER A 1 377 ? -25.308 -56.486 -97.818  0.50 30.11 ? 357  SER A OG    1 
ATOM   2629 O  OG    B SER A 1 377 ? -25.349 -54.318 -97.562  0.50 39.63 ? 357  SER A OG    1 
ATOM   2630 N  N     . PHE A 1 378 ? -23.052 -56.755 -94.619  1.00 32.66 ? 358  PHE A N     1 
ATOM   2631 C  CA    . PHE A 1 378 ? -22.672 -57.921 -93.820  1.00 35.84 ? 358  PHE A CA    1 
ATOM   2632 C  C     . PHE A 1 378 ? -23.451 -59.160 -94.244  1.00 40.34 ? 358  PHE A C     1 
ATOM   2633 O  O     . PHE A 1 378 ? -22.892 -60.253 -94.351  1.00 38.96 ? 358  PHE A O     1 
ATOM   2634 C  CB    . PHE A 1 378 ? -22.935 -57.660 -92.331  1.00 38.84 ? 358  PHE A CB    1 
ATOM   2635 C  CG    . PHE A 1 378 ? -22.701 -58.865 -91.452  1.00 37.37 ? 358  PHE A CG    1 
ATOM   2636 C  CD1   . PHE A 1 378 ? -21.413 -59.232 -91.075  1.00 37.36 ? 358  PHE A CD1   1 
ATOM   2637 C  CD2   . PHE A 1 378 ? -23.770 -59.652 -91.030  1.00 36.47 ? 358  PHE A CD2   1 
ATOM   2638 C  CE1   . PHE A 1 378 ? -21.191 -60.365 -90.291  1.00 32.72 ? 358  PHE A CE1   1 
ATOM   2639 C  CE2   . PHE A 1 378 ? -23.558 -60.789 -90.247  1.00 30.59 ? 358  PHE A CE2   1 
ATOM   2640 C  CZ    . PHE A 1 378 ? -22.262 -61.145 -89.877  1.00 31.70 ? 358  PHE A CZ    1 
ATOM   2641 N  N     . THR A 1 379 ? -24.746 -58.975 -94.481  1.00 44.46 ? 359  THR A N     1 
ATOM   2642 C  CA    . THR A 1 379 ? -25.633 -60.066 -94.867  1.00 50.57 ? 359  THR A CA    1 
ATOM   2643 C  C     . THR A 1 379 ? -25.426 -60.579 -96.287  1.00 49.64 ? 359  THR A C     1 
ATOM   2644 O  O     . THR A 1 379 ? -25.786 -61.716 -96.594  1.00 51.89 ? 359  THR A O     1 
ATOM   2645 C  CB    . THR A 1 379 ? -27.105 -59.650 -94.714  1.00 51.91 ? 359  THR A CB    1 
ATOM   2646 O  OG1   . THR A 1 379 ? -27.359 -58.490 -95.515  1.00 61.21 ? 359  THR A OG1   1 
ATOM   2647 C  CG2   . THR A 1 379 ? -27.418 -59.331 -93.258  1.00 57.92 ? 359  THR A CG2   1 
ATOM   2648 N  N     . PHE A 1 380 ? -24.850 -59.747 -97.151  1.00 47.36 ? 360  PHE A N     1 
ATOM   2649 C  CA    . PHE A 1 380 ? -24.614 -60.139 -98.537  1.00 46.14 ? 360  PHE A CA    1 
ATOM   2650 C  C     . PHE A 1 380 ? -23.917 -61.492 -98.623  1.00 46.89 ? 360  PHE A C     1 
ATOM   2651 O  O     . PHE A 1 380 ? -24.397 -62.344 -99.399  1.00 46.85 ? 360  PHE A O     1 
ATOM   2652 C  CB    . PHE A 1 380 ? -23.768 -59.092 -99.265  1.00 42.40 ? 360  PHE A CB    1 
ATOM   2653 C  CG    . PHE A 1 380 ? -23.760 -59.258 -100.761 1.00 42.68 ? 360  PHE A CG    1 
ATOM   2654 C  CD1   . PHE A 1 380 ? -24.875 -58.905 -101.517 1.00 41.55 ? 360  PHE A CD1   1 
ATOM   2655 C  CD2   . PHE A 1 380 ? -22.650 -59.788 -101.412 1.00 41.88 ? 360  PHE A CD2   1 
ATOM   2656 C  CE1   . PHE A 1 380 ? -24.885 -59.075 -102.899 1.00 42.69 ? 360  PHE A CE1   1 
ATOM   2657 C  CE2   . PHE A 1 380 ? -22.649 -59.963 -102.795 1.00 42.31 ? 360  PHE A CE2   1 
ATOM   2658 C  CZ    . PHE A 1 380 ? -23.768 -59.606 -103.540 1.00 43.03 ? 360  PHE A CZ    1 
HETATM 2659 CL CL    . CL  B 2 .   ? -6.552  -47.526 -106.777 1.00 21.82 ? 2001 CL  A CL    1 
HETATM 2660 NA NA    . NA  C 3 .   ? -8.861  -65.632 -129.033 1.00 37.01 ? 2002 NA  A NA    1 
HETATM 2661 NA NA    . NA  D 3 .   ? -22.919 -47.190 -100.801 1.00 37.33 ? 2003 NA  A NA    1 
HETATM 2662 C  C     . ACT E 4 .   ? -16.719 -48.781 -113.549 1.00 51.73 ? 3001 ACT A C     1 
HETATM 2663 O  O     . ACT E 4 .   ? -18.009 -48.741 -113.906 1.00 47.86 ? 3001 ACT A O     1 
HETATM 2664 O  OXT   . ACT E 4 .   ? -16.254 -47.894 -112.868 1.00 47.74 ? 3001 ACT A OXT   1 
HETATM 2665 C  CH3   . ACT E 4 .   ? -15.851 -49.929 -113.991 1.00 49.08 ? 3001 ACT A CH3   1 
HETATM 2666 O  "O5'" . MTP F 5 .   ? -14.947 -45.117 -105.814 1.00 43.46 ? 1001 MTP A "O5'" 1 
HETATM 2667 C  "C5'" . MTP F 5 .   ? -14.865 -44.659 -104.462 1.00 37.52 ? 1001 MTP A "C5'" 1 
HETATM 2668 C  "C4'" . MTP F 5 .   ? -13.404 -44.691 -104.010 1.00 36.13 ? 1001 MTP A "C4'" 1 
HETATM 2669 O  "O4'" . MTP F 5 .   ? -12.631 -43.851 -104.882 1.00 30.89 ? 1001 MTP A "O4'" 1 
HETATM 2670 C  "C1'" . MTP F 5 .   ? -11.425 -43.674 -104.128 1.00 26.09 ? 1001 MTP A "C1'" 1 
HETATM 2671 N  N9    . MTP F 5 .   ? -10.499 -42.718 -104.780 1.00 31.48 ? 1001 MTP A N9    1 
HETATM 2672 C  C8    . MTP F 5 .   ? -10.682 -41.408 -104.940 1.00 33.49 ? 1001 MTP A C8    1 
HETATM 2673 N  N7    . MTP F 5 .   ? -9.673  -40.897 -105.643 1.00 28.36 ? 1001 MTP A N7    1 
HETATM 2674 C  C5    . MTP F 5 .   ? -8.836  -41.888 -105.934 1.00 26.57 ? 1001 MTP A C5    1 
HETATM 2675 C  C6    . MTP F 5 .   ? -7.636  -41.985 -106.629 1.00 23.33 ? 1001 MTP A C6    1 
HETATM 2676 S  S6    . MTP F 5 .   ? -6.896  -40.574 -107.355 1.00 26.98 ? 1001 MTP A S6    1 
HETATM 2677 C  CS    . MTP F 5 .   ? -5.521  -41.157 -108.323 1.00 25.34 ? 1001 MTP A CS    1 
HETATM 2678 N  N1    . MTP F 5 .   ? -7.040  -43.183 -106.735 1.00 23.83 ? 1001 MTP A N1    1 
HETATM 2679 C  C2    . MTP F 5 .   ? -7.569  -44.268 -106.197 1.00 20.73 ? 1001 MTP A C2    1 
HETATM 2680 N  N3    . MTP F 5 .   ? -8.710  -44.211 -105.531 1.00 23.31 ? 1001 MTP A N3    1 
HETATM 2681 C  C4    . MTP F 5 .   ? -9.361  -43.049 -105.382 1.00 26.67 ? 1001 MTP A C4    1 
HETATM 2682 C  "C2'" . MTP F 5 .   ? -11.964 -43.238 -102.765 1.00 31.70 ? 1001 MTP A "C2'" 1 
HETATM 2683 O  "O2'" . MTP F 5 .   ? -11.029 -43.506 -101.718 1.00 32.12 ? 1001 MTP A "O2'" 1 
HETATM 2684 C  "C3'" . MTP F 5 .   ? -13.250 -44.056 -102.626 1.00 33.08 ? 1001 MTP A "C3'" 1 
HETATM 2685 O  "O3'" . MTP F 5 .   ? -13.057 -45.093 -101.660 1.00 33.73 ? 1001 MTP A "O3'" 1 
HETATM 2686 O  "O5'" . MTP G 5 .   ? -20.784 -49.674 -111.273 1.00 66.02 ? 1002 MTP A "O5'" 1 
HETATM 2687 C  "C5'" . MTP G 5 .   ? -21.623 -49.873 -112.414 1.00 52.79 ? 1002 MTP A "C5'" 1 
HETATM 2688 C  "C4'" . MTP G 5 .   ? -22.757 -50.837 -112.059 1.00 44.67 ? 1002 MTP A "C4'" 1 
HETATM 2689 O  "O4'" . MTP G 5 .   ? -23.523 -50.289 -110.973 1.00 46.85 ? 1002 MTP A "O4'" 1 
HETATM 2690 C  "C1'" . MTP G 5 .   ? -24.882 -50.740 -111.130 1.00 44.74 ? 1002 MTP A "C1'" 1 
HETATM 2691 N  N9    . MTP G 5 .   ? -25.749 -49.542 -111.221 1.00 47.88 ? 1002 MTP A N9    1 
HETATM 2692 C  C8    . MTP G 5 .   ? -25.343 -48.279 -111.340 1.00 49.82 ? 1002 MTP A C8    1 
HETATM 2693 N  N7    . MTP G 5 .   ? -26.399 -47.469 -111.391 1.00 51.89 ? 1002 MTP A N7    1 
HETATM 2694 C  C5    . MTP G 5 .   ? -27.491 -48.222 -111.305 1.00 54.75 ? 1002 MTP A C5    1 
HETATM 2695 C  C6    . MTP G 5 .   ? -28.857 -47.965 -111.312 1.00 57.76 ? 1002 MTP A C6    1 
HETATM 2696 S  S6    . MTP G 5 .   ? -29.450 -46.324 -111.448 1.00 62.71 ? 1002 MTP A S6    1 
HETATM 2697 C  CS    . MTP G 5 .   ? -31.226 -46.411 -111.537 1.00 65.13 ? 1002 MTP A CS    1 
HETATM 2698 N  N1    . MTP G 5 .   ? -29.715 -48.993 -111.215 1.00 58.11 ? 1002 MTP A N1    1 
HETATM 2699 C  C2    . MTP G 5 .   ? -29.287 -50.240 -111.112 1.00 54.34 ? 1002 MTP A C2    1 
HETATM 2700 N  N3    . MTP G 5 .   ? -27.995 -50.519 -111.101 1.00 52.78 ? 1002 MTP A N3    1 
HETATM 2701 C  C4    . MTP G 5 .   ? -27.079 -49.544 -111.196 1.00 51.02 ? 1002 MTP A C4    1 
HETATM 2702 C  "C2'" . MTP G 5 .   ? -24.927 -51.541 -112.435 1.00 39.18 ? 1002 MTP A "C2'" 1 
HETATM 2703 O  "O2'" . MTP G 5 .   ? -24.640 -52.910 -112.135 1.00 38.28 ? 1002 MTP A "O2'" 1 
HETATM 2704 C  "C3'" . MTP G 5 .   ? -23.763 -50.922 -113.205 1.00 45.06 ? 1002 MTP A "C3'" 1 
HETATM 2705 O  "O3'" . MTP G 5 .   ? -23.285 -51.852 -114.181 1.00 36.01 ? 1002 MTP A "O3'" 1 
HETATM 2706 O  O     . HOH H 6 .   ? -2.078  -59.774 -123.432 1.00 26.87 ? 3002 HOH A O     1 
HETATM 2707 O  O     . HOH H 6 .   ? -6.094  -31.219 -93.221  1.00 30.03 ? 3003 HOH A O     1 
HETATM 2708 O  O     . HOH H 6 .   ? 2.053   -39.898 -119.659 1.00 27.70 ? 3004 HOH A O     1 
HETATM 2709 O  O     . HOH H 6 .   ? -6.644  -48.642 -103.887 1.00 21.82 ? 3005 HOH A O     1 
HETATM 2710 O  O     . HOH H 6 .   ? -2.668  -49.912 -129.997 1.00 28.85 ? 3006 HOH A O     1 
HETATM 2711 O  O     . HOH H 6 .   ? 0.080   -46.650 -103.675 1.00 22.11 ? 3007 HOH A O     1 
HETATM 2712 O  O     . HOH H 6 .   ? -1.547  -44.255 -98.656  1.00 25.25 ? 3008 HOH A O     1 
HETATM 2713 O  O     . HOH H 6 .   ? -21.700 -47.324 -115.351 1.00 31.97 ? 3009 HOH A O     1 
HETATM 2714 O  O     . HOH H 6 .   ? -2.222  -63.517 -121.061 1.00 33.35 ? 3010 HOH A O     1 
HETATM 2715 O  O     . HOH H 6 .   ? -10.732 -47.223 -110.939 1.00 24.91 ? 3011 HOH A O     1 
HETATM 2716 O  O     . HOH H 6 .   ? -6.260  -67.050 -109.839 1.00 24.54 ? 3012 HOH A O     1 
HETATM 2717 O  O     . HOH H 6 .   ? -0.451  -42.228 -106.689 1.00 22.98 ? 3013 HOH A O     1 
HETATM 2718 O  O     . HOH H 6 .   ? 0.813   -66.034 -102.582 1.00 24.70 ? 3014 HOH A O     1 
HETATM 2719 O  O     . HOH H 6 .   ? 1.460   -38.085 -126.646 1.00 28.79 ? 3015 HOH A O     1 
HETATM 2720 O  O     . HOH H 6 .   ? -11.723 -37.538 -104.941 1.00 30.73 ? 3016 HOH A O     1 
HETATM 2721 O  O     . HOH H 6 .   ? -0.397  -47.122 -106.823 1.00 24.68 ? 3017 HOH A O     1 
HETATM 2722 O  O     . HOH H 6 .   ? -4.775  -33.168 -91.942  1.00 45.61 ? 3018 HOH A O     1 
HETATM 2723 O  O     . HOH H 6 .   ? -11.276 -50.815 -108.657 1.00 21.08 ? 3019 HOH A O     1 
HETATM 2724 O  O     . HOH H 6 .   ? 2.422   -37.545 -103.409 1.00 26.35 ? 3020 HOH A O     1 
HETATM 2725 O  O     . HOH H 6 .   ? 0.924   -64.683 -109.443 1.00 23.75 ? 3021 HOH A O     1 
HETATM 2726 O  O     . HOH H 6 .   ? 5.692   -62.460 -120.060 1.00 37.73 ? 3022 HOH A O     1 
HETATM 2727 O  O     . HOH H 6 .   ? -10.293 -30.229 -104.819 1.00 33.55 ? 3023 HOH A O     1 
HETATM 2728 O  O     . HOH H 6 .   ? -11.493 -63.814 -124.599 1.00 24.81 ? 3024 HOH A O     1 
HETATM 2729 O  O     . HOH H 6 .   ? -8.689  -68.747 -101.380 1.00 28.23 ? 3025 HOH A O     1 
HETATM 2730 O  O     . HOH H 6 .   ? -15.312 -60.905 -135.818 1.00 27.60 ? 3026 HOH A O     1 
HETATM 2731 O  O     . HOH H 6 .   ? -3.184  -50.338 -127.340 1.00 25.79 ? 3027 HOH A O     1 
HETATM 2732 O  O     . HOH H 6 .   ? -16.517 -46.837 -108.066 1.00 29.40 ? 3028 HOH A O     1 
HETATM 2733 O  O     . HOH H 6 .   ? 1.810   -41.492 -121.951 1.00 24.86 ? 3029 HOH A O     1 
HETATM 2734 O  O     . HOH H 6 .   ? -6.860  -68.129 -115.561 1.00 26.78 ? 3030 HOH A O     1 
HETATM 2735 O  O     . HOH H 6 .   ? -1.815  -57.789 -127.629 1.00 28.12 ? 3031 HOH A O     1 
HETATM 2736 O  O     . HOH H 6 .   ? -18.755 -25.079 -92.038  1.00 45.59 ? 3032 HOH A O     1 
HETATM 2737 O  O     . HOH H 6 .   ? 9.872   -41.042 -98.002  1.00 29.69 ? 3033 HOH A O     1 
HETATM 2738 O  O     . HOH H 6 .   ? -20.231 -42.699 -117.173 1.00 30.92 ? 3034 HOH A O     1 
HETATM 2739 O  O     . HOH H 6 .   ? -14.799 -32.235 -104.903 1.00 35.76 ? 3035 HOH A O     1 
HETATM 2740 O  O     . HOH H 6 .   ? 5.853   -40.502 -108.921 1.00 33.83 ? 3036 HOH A O     1 
HETATM 2741 O  O     . HOH H 6 .   ? 9.863   -51.005 -103.910 1.00 34.91 ? 3037 HOH A O     1 
HETATM 2742 O  O     . HOH H 6 .   ? -5.365  -43.511 -123.053 1.00 22.81 ? 3038 HOH A O     1 
HETATM 2743 O  O     . HOH H 6 .   ? 3.249   -66.521 -125.580 1.00 25.56 ? 3039 HOH A O     1 
HETATM 2744 O  O     . HOH H 6 .   ? -0.182  -55.720 -94.073  1.00 35.16 ? 3040 HOH A O     1 
HETATM 2745 O  O     . HOH H 6 .   ? -3.143  -63.941 -134.916 1.00 32.94 ? 3041 HOH A O     1 
HETATM 2746 O  O     . HOH H 6 .   ? -1.767  -60.610 -120.511 1.00 30.71 ? 3042 HOH A O     1 
HETATM 2747 O  O     . HOH H 6 .   ? -2.508  -65.906 -99.516  1.00 32.52 ? 3043 HOH A O     1 
HETATM 2748 O  O     . HOH H 6 .   ? -14.556 -46.453 -97.803  1.00 44.72 ? 3044 HOH A O     1 
HETATM 2749 O  O     . HOH H 6 .   ? 1.523   -48.672 -127.842 1.00 44.01 ? 3045 HOH A O     1 
HETATM 2750 O  O     . HOH H 6 .   ? -23.325 -64.743 -111.862 1.00 39.99 ? 3046 HOH A O     1 
HETATM 2751 O  O     . HOH H 6 .   ? -0.923  -35.571 -102.711 1.00 33.61 ? 3047 HOH A O     1 
HETATM 2752 O  O     . HOH H 6 .   ? -27.281 -58.949 -113.656 1.00 36.25 ? 3048 HOH A O     1 
HETATM 2753 O  O     . HOH H 6 .   ? 7.390   -57.799 -115.879 1.00 37.27 ? 3049 HOH A O     1 
HETATM 2754 O  O     . HOH H 6 .   ? -27.225 -59.639 -111.102 1.00 35.07 ? 3050 HOH A O     1 
HETATM 2755 O  O     . HOH H 6 .   ? -22.230 -61.001 -131.235 1.00 37.74 ? 3051 HOH A O     1 
HETATM 2756 O  O     . HOH H 6 .   ? -16.688 -55.298 -99.605  1.00 31.45 ? 3052 HOH A O     1 
HETATM 2757 O  O     . HOH H 6 .   ? 5.733   -50.085 -122.407 1.00 35.32 ? 3053 HOH A O     1 
HETATM 2758 O  O     . HOH H 6 .   ? -10.618 -50.120 -99.455  1.00 35.17 ? 3054 HOH A O     1 
HETATM 2759 O  O     . HOH H 6 .   ? -13.819 -68.802 -127.192 1.00 39.28 ? 3055 HOH A O     1 
HETATM 2760 O  O     . HOH H 6 .   ? -7.655  -34.766 -118.762 1.00 32.97 ? 3056 HOH A O     1 
HETATM 2761 O  O     . HOH H 6 .   ? 7.653   -51.490 -115.963 1.00 39.51 ? 3057 HOH A O     1 
HETATM 2762 O  O     . HOH H 6 .   ? -18.724 -65.892 -124.654 1.00 64.92 ? 3058 HOH A O     1 
HETATM 2763 O  O     . HOH H 6 .   ? -18.401 -41.976 -127.398 1.00 36.06 ? 3059 HOH A O     1 
HETATM 2764 O  O     . HOH H 6 .   ? -25.552 -60.974 -124.767 1.00 37.42 ? 3060 HOH A O     1 
HETATM 2765 O  O     . HOH H 6 .   ? -19.022 -55.678 -133.173 1.00 39.97 ? 3061 HOH A O     1 
HETATM 2766 O  O     . HOH H 6 .   ? 8.115   -49.831 -110.682 1.00 37.50 ? 3062 HOH A O     1 
HETATM 2767 O  O     . HOH H 6 .   ? -5.707  -23.538 -103.820 1.00 35.51 ? 3063 HOH A O     1 
HETATM 2768 O  O     . HOH H 6 .   ? -33.119 -50.781 -100.890 1.00 46.27 ? 3064 HOH A O     1 
HETATM 2769 O  O     . HOH H 6 .   ? -15.379 -65.177 -118.427 1.00 57.85 ? 3065 HOH A O     1 
HETATM 2770 O  O     . HOH H 6 .   ? -12.789 -58.047 -97.388  1.00 31.66 ? 3066 HOH A O     1 
HETATM 2771 O  O     . HOH H 6 .   ? -14.429 -48.599 -110.688 1.00 29.88 ? 3067 HOH A O     1 
HETATM 2772 O  O     . HOH H 6 .   ? -14.078 -46.534 -113.354 1.00 34.36 ? 3068 HOH A O     1 
HETATM 2773 O  O     . HOH H 6 .   ? 2.491   -46.427 -126.613 1.00 36.68 ? 3069 HOH A O     1 
HETATM 2774 O  O     . HOH H 6 .   ? -21.649 -44.995 -117.279 1.00 37.47 ? 3070 HOH A O     1 
HETATM 2775 O  O     . HOH H 6 .   ? -4.365  -29.109 -90.742  1.00 46.61 ? 3071 HOH A O     1 
HETATM 2776 O  O     . HOH H 6 .   ? -3.898  -51.801 -131.616 1.00 39.07 ? 3072 HOH A O     1 
HETATM 2777 O  O     . HOH H 6 .   ? -2.057  -39.841 -89.211  1.00 35.22 ? 3073 HOH A O     1 
HETATM 2778 O  O     . HOH H 6 .   ? -24.766 -50.838 -116.575 1.00 33.70 ? 3074 HOH A O     1 
HETATM 2779 O  O     . HOH H 6 .   ? -13.023 -45.471 -111.031 1.00 28.73 ? 3075 HOH A O     1 
HETATM 2780 O  O     . HOH H 6 .   ? 6.294   -56.126 -121.362 1.00 37.12 ? 3076 HOH A O     1 
HETATM 2781 O  O     . HOH H 6 .   ? -20.349 -71.458 -115.836 1.00 44.12 ? 3077 HOH A O     1 
HETATM 2782 O  O     . HOH H 6 .   ? -14.470 -38.964 -85.294  1.00 42.91 ? 3078 HOH A O     1 
HETATM 2783 O  O     . HOH H 6 .   ? -6.516  -63.573 -128.093 1.00 44.75 ? 3079 HOH A O     1 
HETATM 2784 O  O     . HOH H 6 .   ? 7.303   -48.215 -102.577 1.00 28.98 ? 3080 HOH A O     1 
HETATM 2785 O  O     . HOH H 6 .   ? -9.512  -65.955 -126.772 1.00 35.59 ? 3081 HOH A O     1 
HETATM 2786 O  O     . HOH H 6 .   ? -31.673 -51.121 -114.681 1.00 33.86 ? 3082 HOH A O     1 
HETATM 2787 O  O     . HOH H 6 .   ? 3.458   -50.210 -91.526  1.00 43.12 ? 3083 HOH A O     1 
HETATM 2788 O  O     . HOH H 6 .   ? -23.643 -37.671 -104.892 1.00 47.42 ? 3084 HOH A O     1 
HETATM 2789 O  O     . HOH H 6 .   ? 6.015   -59.078 -121.232 1.00 39.07 ? 3085 HOH A O     1 
HETATM 2790 O  O     . HOH H 6 .   ? -13.587 -66.708 -125.770 1.00 43.17 ? 3086 HOH A O     1 
HETATM 2791 O  O     . HOH H 6 .   ? -13.299 -59.942 -95.678  1.00 37.85 ? 3087 HOH A O     1 
HETATM 2792 O  O     . HOH H 6 .   ? -30.530 -52.641 -117.973 1.00 36.83 ? 3088 HOH A O     1 
HETATM 2793 O  O     . HOH H 6 .   ? -10.265 -60.589 -133.623 1.00 39.78 ? 3089 HOH A O     1 
HETATM 2794 O  O     . HOH H 6 .   ? 1.898   -64.024 -99.952  1.00 38.12 ? 3090 HOH A O     1 
HETATM 2795 O  O     . HOH H 6 .   ? -27.500 -57.101 -105.018 1.00 34.73 ? 3091 HOH A O     1 
HETATM 2796 O  O     . HOH H 6 .   ? 4.308   -52.109 -125.965 1.00 42.75 ? 3092 HOH A O     1 
HETATM 2797 O  O     . HOH H 6 .   ? -10.489 -60.498 -87.827  1.00 39.02 ? 3093 HOH A O     1 
HETATM 2798 O  O     . HOH H 6 .   ? -3.643  -33.022 -103.438 1.00 27.30 ? 3094 HOH A O     1 
HETATM 2799 O  O     . HOH H 6 .   ? 6.065   -54.416 -119.396 1.00 34.58 ? 3095 HOH A O     1 
HETATM 2800 O  O     . HOH H 6 .   ? -11.143 -68.047 -115.159 1.00 33.14 ? 3096 HOH A O     1 
HETATM 2801 O  O     . HOH H 6 .   ? 2.424   -54.420 -94.860  1.00 33.65 ? 3097 HOH A O     1 
HETATM 2802 O  O     . HOH H 6 .   ? -31.659 -48.462 -100.249 1.00 34.34 ? 3098 HOH A O     1 
HETATM 2803 O  O     . HOH H 6 .   ? -5.187  -69.381 -108.612 1.00 35.52 ? 3099 HOH A O     1 
HETATM 2804 O  O     . HOH H 6 .   ? 8.649   -40.380 -102.869 1.00 30.19 ? 3100 HOH A O     1 
HETATM 2805 O  O     . HOH H 6 .   ? -13.281 -64.244 -122.428 1.00 46.25 ? 3101 HOH A O     1 
HETATM 2806 O  O     . HOH H 6 .   ? -29.910 -59.230 -120.098 1.00 40.35 ? 3102 HOH A O     1 
HETATM 2807 O  O     . HOH H 6 .   ? -7.126  -25.376 -95.789  1.00 42.74 ? 3103 HOH A O     1 
HETATM 2808 O  O     . HOH H 6 .   ? -11.206 -65.501 -119.146 1.00 43.29 ? 3104 HOH A O     1 
HETATM 2809 O  O     . HOH H 6 .   ? -10.773 -70.481 -104.602 1.00 45.81 ? 3105 HOH A O     1 
HETATM 2810 O  O     . HOH H 6 .   ? -18.889 -45.969 -109.663 1.00 31.99 ? 3106 HOH A O     1 
HETATM 2811 O  O     . HOH H 6 .   ? -31.706 -49.200 -122.587 1.00 49.05 ? 3107 HOH A O     1 
HETATM 2812 O  O     . HOH H 6 .   ? -2.186  -37.771 -97.548  1.00 34.45 ? 3108 HOH A O     1 
HETATM 2813 O  O     . HOH H 6 .   ? -17.087 -43.830 -107.156 1.00 48.55 ? 3109 HOH A O     1 
HETATM 2814 O  O     . HOH H 6 .   ? -22.557 -51.311 -133.647 1.00 46.11 ? 3110 HOH A O     1 
HETATM 2815 O  O     . HOH H 6 .   ? 1.289   -47.424 -108.979 1.00 20.99 ? 3111 HOH A O     1 
HETATM 2816 O  O     . HOH H 6 .   ? 3.537   -65.471 -109.397 1.00 22.44 ? 3112 HOH A O     1 
HETATM 2817 O  O     . HOH H 6 .   ? 0.905   -48.209 -112.575 1.00 22.23 ? 3113 HOH A O     1 
HETATM 2818 O  O     . HOH H 6 .   ? -10.127 -70.440 -114.537 1.00 36.45 ? 3114 HOH A O     1 
HETATM 2819 O  O     . HOH H 6 .   ? -6.248  -72.411 -116.552 1.00 35.50 ? 3115 HOH A O     1 
HETATM 2820 O  O     . HOH H 6 .   ? 9.422   -42.452 -100.331 1.00 36.03 ? 3116 HOH A O     1 
HETATM 2821 O  O     . HOH H 6 .   ? -2.163  -67.601 -131.952 1.00 30.18 ? 3117 HOH A O     1 
HETATM 2822 O  O     . HOH H 6 .   ? -11.247 -36.999 -114.836 1.00 31.31 ? 3118 HOH A O     1 
HETATM 2823 O  O     . HOH H 6 .   ? -20.948 -65.594 -121.383 1.00 36.41 ? 3119 HOH A O     1 
HETATM 2824 O  O     . HOH H 6 .   ? 6.622   -46.338 -100.788 1.00 34.02 ? 3120 HOH A O     1 
HETATM 2825 O  O     . HOH H 6 .   ? 8.831   -54.999 -100.298 1.00 42.12 ? 3121 HOH A O     1 
HETATM 2826 O  O     . HOH H 6 .   ? -4.917  -60.917 -129.138 1.00 36.39 ? 3122 HOH A O     1 
HETATM 2827 O  O     . HOH H 6 .   ? 1.084   -35.462 -104.782 1.00 41.04 ? 3123 HOH A O     1 
HETATM 2828 O  O     . HOH H 6 .   ? 9.904   -48.722 -102.652 1.00 38.12 ? 3124 HOH A O     1 
HETATM 2829 O  O     . HOH H 6 .   ? 6.150   -61.173 -122.615 1.00 35.09 ? 3125 HOH A O     1 
HETATM 2830 O  O     . HOH H 6 .   ? 9.739   -51.124 -109.146 1.00 39.08 ? 3126 HOH A O     1 
HETATM 2831 O  O     . HOH H 6 .   ? 7.743   -40.100 -110.975 1.00 32.38 ? 3127 HOH A O     1 
HETATM 2832 O  O     . HOH H 6 .   ? -14.315 -69.257 -131.313 1.00 36.99 ? 3128 HOH A O     1 
HETATM 2833 O  O     . HOH H 6 .   ? -22.284 -39.126 -86.473  1.00 45.48 ? 3129 HOH A O     1 
HETATM 2834 O  O     . HOH H 6 .   ? 3.903   -41.600 -118.846 1.00 38.48 ? 3130 HOH A O     1 
HETATM 2835 O  O     . HOH H 6 .   ? -7.444  -70.765 -114.727 1.00 29.96 ? 3131 HOH A O     1 
HETATM 2836 O  O     . HOH H 6 .   ? -0.570  -67.480 -100.587 1.00 43.85 ? 3132 HOH A O     1 
HETATM 2837 O  O     . HOH H 6 .   ? -12.678 -55.656 -132.324 1.00 38.95 ? 3133 HOH A O     1 
HETATM 2838 O  O     . HOH H 6 .   ? -7.991  -68.162 -112.027 1.00 40.26 ? 3134 HOH A O     1 
HETATM 2839 O  O     . HOH H 6 .   ? -11.366 -48.392 -134.519 1.00 36.80 ? 3135 HOH A O     1 
HETATM 2840 O  O     . HOH H 6 .   ? -15.432 -53.085 -100.870 1.00 40.50 ? 3136 HOH A O     1 
HETATM 2841 O  O     . HOH H 6 .   ? 3.686   -39.232 -123.819 1.00 45.32 ? 3137 HOH A O     1 
HETATM 2842 O  O     . HOH H 6 .   ? -13.343 -63.752 -119.593 1.00 42.67 ? 3138 HOH A O     1 
HETATM 2843 O  O     . HOH H 6 .   ? -5.459  -65.013 -120.563 1.00 34.66 ? 3139 HOH A O     1 
HETATM 2844 O  O     . HOH H 6 .   ? 8.034   -43.535 -114.102 1.00 42.66 ? 3140 HOH A O     1 
HETATM 2845 O  O     . HOH H 6 .   ? 0.835   -34.018 -96.782  1.00 42.98 ? 3141 HOH A O     1 
HETATM 2846 O  O     . HOH H 6 .   ? 11.789  -51.281 -105.410 1.00 43.50 ? 3142 HOH A O     1 
HETATM 2847 O  O     . HOH H 6 .   ? -17.816 -66.875 -121.446 1.00 34.54 ? 3143 HOH A O     1 
HETATM 2848 O  O     . HOH H 6 .   ? -0.766  -64.168 -98.582  1.00 40.97 ? 3144 HOH A O     1 
HETATM 2849 O  O     . HOH H 6 .   ? 6.395   -38.787 -107.114 1.00 43.58 ? 3145 HOH A O     1 
HETATM 2850 O  O     . HOH H 6 .   ? -1.551  -62.430 -123.822 1.00 33.83 ? 3146 HOH A O     1 
HETATM 2851 O  O     . HOH H 6 .   ? -2.830  -36.669 -128.824 1.00 50.98 ? 3147 HOH A O     1 
HETATM 2852 O  O     . HOH H 6 .   ? -15.193 -41.793 -114.385 1.00 49.36 ? 3148 HOH A O     1 
HETATM 2853 O  O     . HOH H 6 .   ? -0.256  -38.017 -91.360  1.00 48.80 ? 3149 HOH A O     1 
HETATM 2854 O  O     . HOH H 6 .   ? -21.425 -52.493 -95.806  1.00 41.76 ? 3150 HOH A O     1 
HETATM 2855 O  O     . HOH H 6 .   ? -12.983 -43.487 -107.651 1.00 35.13 ? 3151 HOH A O     1 
HETATM 2856 O  O     . HOH H 6 .   ? 7.890   -50.086 -118.148 1.00 41.72 ? 3152 HOH A O     1 
HETATM 2857 O  O     . HOH H 6 .   ? -7.564  -67.180 -120.108 1.00 40.37 ? 3153 HOH A O     1 
HETATM 2858 O  O     . HOH H 6 .   ? -29.539 -48.636 -124.572 1.00 45.09 ? 3154 HOH A O     1 
HETATM 2859 O  O     . HOH H 6 .   ? -3.970  -56.903 -94.713  1.00 41.05 ? 3155 HOH A O     1 
HETATM 2860 O  O     . HOH H 6 .   ? 9.364   -44.368 -103.867 1.00 37.46 ? 3156 HOH A O     1 
HETATM 2861 O  O     . HOH H 6 .   ? -21.735 -59.198 -133.144 1.00 44.77 ? 3157 HOH A O     1 
HETATM 2862 O  O     . HOH H 6 .   ? 3.945   -35.732 -94.167  1.00 34.85 ? 3158 HOH A O     1 
HETATM 2863 O  O     . HOH H 6 .   ? -15.728 -50.288 -133.892 1.00 39.09 ? 3159 HOH A O     1 
HETATM 2864 O  O     . HOH H 6 .   ? 3.989   -51.078 -128.906 1.00 51.00 ? 3160 HOH A O     1 
HETATM 2865 O  O     . HOH H 6 .   ? -16.344 -55.953 -97.065  1.00 40.61 ? 3161 HOH A O     1 
HETATM 2866 O  O     . HOH H 6 .   ? -23.376 -37.229 -88.315  1.00 38.04 ? 3162 HOH A O     1 
HETATM 2867 O  O     . HOH H 6 .   ? -33.173 -52.422 -119.381 1.00 50.34 ? 3163 HOH A O     1 
HETATM 2868 O  O     . HOH H 6 .   ? -16.082 -63.685 -95.741  1.00 47.82 ? 3164 HOH A O     1 
HETATM 2869 O  O     . HOH H 6 .   ? -3.463  -47.550 -131.152 1.00 42.13 ? 3165 HOH A O     1 
HETATM 2870 O  O     . HOH H 6 .   ? -8.807  -42.793 -87.957  1.00 40.01 ? 3166 HOH A O     1 
HETATM 2871 O  O     . HOH H 6 .   ? -19.261 -25.033 -89.487  1.00 50.66 ? 3167 HOH A O     1 
HETATM 2872 O  O     . HOH H 6 .   ? -12.564 -41.496 -87.553  1.00 38.78 ? 3168 HOH A O     1 
HETATM 2873 O  O     . HOH H 6 .   ? -17.949 -46.845 -135.359 1.00 46.73 ? 3169 HOH A O     1 
HETATM 2874 O  O     . HOH H 6 .   ? -12.704 -62.730 -95.238  1.00 47.86 ? 3170 HOH A O     1 
HETATM 2875 O  O     . HOH H 6 .   ? -12.642 -61.046 -91.747  1.00 50.43 ? 3171 HOH A O     1 
HETATM 2876 O  O     . HOH H 6 .   ? -16.385 -35.318 -110.457 1.00 53.13 ? 3172 HOH A O     1 
HETATM 2877 O  O     . HOH H 6 .   ? -27.724 -31.936 -95.865  1.00 42.87 ? 3173 HOH A O     1 
HETATM 2878 O  O     . HOH H 6 .   ? -10.113 -57.315 -132.071 1.00 38.68 ? 3174 HOH A O     1 
HETATM 2879 O  O     . HOH H 6 .   ? 6.171   -63.745 -117.759 1.00 46.37 ? 3175 HOH A O     1 
HETATM 2880 O  O     . HOH H 6 .   ? -8.002  -59.066 -136.846 1.00 52.22 ? 3176 HOH A O     1 
HETATM 2881 O  O     . HOH H 6 .   ? 12.599  -54.732 -104.431 1.00 45.67 ? 3177 HOH A O     1 
HETATM 2882 O  O     . HOH H 6 .   ? 0.456   -57.897 -129.349 1.00 40.63 ? 3178 HOH A O     1 
HETATM 2883 O  O     . HOH H 6 .   ? -27.615 -52.920 -99.746  1.00 45.14 ? 3179 HOH A O     1 
HETATM 2884 O  O     . HOH H 6 .   ? 6.082   -41.710 -116.968 1.00 35.86 ? 3180 HOH A O     1 
HETATM 2885 O  O     . HOH H 6 .   ? -9.648  -44.995 -86.223  1.00 40.27 ? 3181 HOH A O     1 
HETATM 2886 O  O     . HOH H 6 .   ? -8.337  -59.396 -86.185  1.00 43.04 ? 3182 HOH A O     1 
HETATM 2887 O  O     . HOH H 6 .   ? -24.752 -24.206 -93.754  1.00 45.46 ? 3183 HOH A O     1 
HETATM 2888 O  O     . HOH H 6 .   ? -12.820 -28.243 -105.594 1.00 41.15 ? 3184 HOH A O     1 
HETATM 2889 O  O     . HOH H 6 .   ? 9.074   -45.344 -100.136 1.00 45.16 ? 3185 HOH A O     1 
HETATM 2890 O  O     . HOH H 6 .   ? -5.299  -36.969 -128.053 1.00 43.23 ? 3186 HOH A O     1 
HETATM 2891 O  O     . HOH H 6 .   ? -35.475 -49.590 -99.236  1.00 43.67 ? 3187 HOH A O     1 
HETATM 2892 O  O     . HOH H 6 .   ? -9.407  -69.114 -109.429 1.00 44.52 ? 3188 HOH A O     1 
HETATM 2893 O  O     . HOH H 6 .   ? -1.850  -35.913 -92.137  1.00 49.99 ? 3189 HOH A O     1 
HETATM 2894 O  O     . HOH H 6 .   ? -25.754 -34.410 -94.529  1.00 48.85 ? 3190 HOH A O     1 
HETATM 2895 O  O     . HOH H 6 .   ? -27.029 -53.486 -95.767  1.00 41.51 ? 3191 HOH A O     1 
HETATM 2896 O  O     . HOH H 6 .   ? -0.959  -59.587 -94.881  1.00 41.65 ? 3192 HOH A O     1 
HETATM 2897 O  O     . HOH H 6 .   ? -13.836 -41.617 -111.843 1.00 41.10 ? 3193 HOH A O     1 
HETATM 2898 O  O     . HOH H 6 .   ? 10.221  -63.029 -101.414 1.00 46.60 ? 3194 HOH A O     1 
HETATM 2899 O  O     . HOH H 6 .   ? 7.773   -43.737 -116.776 1.00 40.38 ? 3195 HOH A O     1 
HETATM 2900 O  O     . HOH H 6 .   ? -23.271 -54.195 -93.379  1.00 42.34 ? 3196 HOH A O     1 
HETATM 2901 O  O     . HOH H 6 .   ? -11.009 -39.352 -110.342 1.00 40.64 ? 3197 HOH A O     1 
HETATM 2902 O  O     . HOH H 6 .   ? -12.329 -53.345 -92.210  1.00 43.23 ? 3198 HOH A O     1 
HETATM 2903 O  O     . HOH H 6 .   ? 8.100   -62.012 -117.426 1.00 44.83 ? 3199 HOH A O     1 
HETATM 2904 O  O     . HOH H 6 .   ? 2.832   -58.393 -95.819  1.00 50.35 ? 3200 HOH A O     1 
HETATM 2905 O  O     . HOH H 6 .   ? -9.223  -67.576 -122.993 1.00 44.17 ? 3201 HOH A O     1 
HETATM 2906 O  O     . HOH H 6 .   ? 11.156  -42.588 -102.207 1.00 49.89 ? 3202 HOH A O     1 
HETATM 2907 O  O     . HOH H 6 .   ? 13.030  -41.557 -97.813  1.00 44.16 ? 3203 HOH A O     1 
HETATM 2908 O  O     . HOH H 6 .   ? -12.884 -70.011 -100.981 1.00 42.80 ? 3204 HOH A O     1 
HETATM 2909 O  O     . HOH H 6 .   ? -6.548  -42.260 -89.109  1.00 41.54 ? 3205 HOH A O     1 
HETATM 2910 O  O     . HOH H 6 .   ? -13.419 -56.055 -134.843 1.00 43.57 ? 3206 HOH A O     1 
HETATM 2911 O  O     . HOH H 6 .   ? 9.900   -41.955 -111.261 1.00 47.98 ? 3207 HOH A O     1 
HETATM 2912 O  O     . HOH H 6 .   ? -8.193  -68.601 -118.057 1.00 37.40 ? 3208 HOH A O     1 
HETATM 2913 O  O     . HOH H 6 .   ? -12.067 -39.719 -134.557 1.00 45.71 ? 3209 HOH A O     1 
HETATM 2914 O  O     . HOH H 6 .   ? -16.950 -50.855 -103.683 1.00 51.20 ? 3210 HOH A O     1 
HETATM 2915 O  O     . HOH H 6 .   ? -16.262 -43.135 -111.289 1.00 42.62 ? 3211 HOH A O     1 
HETATM 2916 O  O     . HOH H 6 .   ? -23.508 -40.763 -123.669 1.00 45.31 ? 3212 HOH A O     1 
HETATM 2917 O  O     . HOH H 6 .   ? -16.223 -40.475 -128.055 1.00 49.22 ? 3213 HOH A O     1 
HETATM 2918 O  O     . HOH H 6 .   ? -26.366 -45.347 -119.889 1.00 53.70 ? 3214 HOH A O     1 
HETATM 2919 O  O     . HOH H 6 .   ? -0.099  -49.373 -129.907 1.00 45.58 ? 3215 HOH A O     1 
HETATM 2920 O  O     . HOH H 6 .   ? -19.393 -39.450 -81.940  1.00 48.07 ? 3216 HOH A O     1 
HETATM 2921 O  O     . HOH H 6 .   ? -7.848  -44.502 -84.287  1.00 45.37 ? 3217 HOH A O     1 
HETATM 2922 O  O     . HOH H 6 .   ? -4.308  -40.998 -131.403 1.00 48.08 ? 3218 HOH A O     1 
HETATM 2923 O  O     . HOH H 6 .   ? -28.314 -39.723 -123.538 1.00 54.17 ? 3219 HOH A O     1 
HETATM 2924 O  O     . HOH H 6 .   ? 0.902   -39.811 -129.013 1.00 52.16 ? 3220 HOH A O     1 
HETATM 2925 O  O     . HOH H 6 .   ? -14.037 -71.437 -136.430 1.00 47.08 ? 3221 HOH A O     1 
HETATM 2926 O  O     . HOH H 6 .   ? -9.072  -32.777 -109.200 1.00 43.53 ? 3222 HOH A O     1 
HETATM 2927 O  O     . HOH H 6 .   ? 6.168   -61.806 -99.303  1.00 53.69 ? 3223 HOH A O     1 
HETATM 2928 O  O     . HOH H 6 .   ? -23.512 -67.681 -119.752 1.00 45.81 ? 3224 HOH A O     1 
HETATM 2929 O  O     . HOH H 6 .   ? -13.295 -35.445 -124.232 1.00 53.00 ? 3225 HOH A O     1 
HETATM 2930 O  O     . HOH H 6 .   ? -19.270 -41.103 -115.201 1.00 46.09 ? 3226 HOH A O     1 
HETATM 2931 O  O     . HOH H 6 .   ? -13.948 -51.344 -92.055  1.00 44.76 ? 3227 HOH A O     1 
HETATM 2932 O  O     . HOH H 6 .   ? -11.313 -33.832 -121.394 1.00 46.24 ? 3228 HOH A O     1 
HETATM 2933 O  O     . HOH H 6 .   ? -2.000  -60.637 -127.630 1.00 44.54 ? 3229 HOH A O     1 
HETATM 2934 O  O     . HOH H 6 .   ? -1.515  -64.001 -126.196 1.00 44.81 ? 3230 HOH A O     1 
HETATM 2935 O  O     . HOH H 6 .   ? -15.132 -29.802 -105.819 1.00 40.56 ? 3231 HOH A O     1 
HETATM 2936 O  O     . HOH H 6 .   ? -21.763 -42.695 -98.133  1.00 44.55 ? 3232 HOH A O     1 
HETATM 2937 O  O     . HOH H 6 .   ? 1.860   -44.040 -128.153 1.00 48.57 ? 3233 HOH A O     1 
HETATM 2938 O  O     . HOH H 6 .   ? -22.584 -46.183 -102.815 1.00 43.76 ? 3234 HOH A O     1 
HETATM 2939 O  O     . HOH H 6 .   ? -15.513 -37.278 -124.134 1.00 38.81 ? 3235 HOH A O     1 
HETATM 2940 O  O     . HOH H 6 .   ? -35.973 -51.135 -106.286 1.00 47.50 ? 3236 HOH A O     1 
HETATM 2941 O  O     . HOH H 6 .   ? -22.085 -33.234 -100.884 1.00 44.96 ? 3237 HOH A O     1 
HETATM 2942 O  O     . HOH H 6 .   ? -27.690 -35.704 -96.535  1.00 43.68 ? 3238 HOH A O     1 
HETATM 2943 O  O     . HOH H 6 .   ? 10.517  -58.445 -99.154  1.00 49.76 ? 3239 HOH A O     1 
HETATM 2944 O  O     . HOH H 6 .   ? -1.462  -25.376 -98.506  1.00 46.26 ? 3240 HOH A O     1 
HETATM 2945 O  O     . HOH H 6 .   ? -19.014 -64.365 -98.216  1.00 42.86 ? 3241 HOH A O     1 
HETATM 2946 O  O     . HOH H 6 .   ? -4.974  -41.385 -87.196  1.00 53.74 ? 3242 HOH A O     1 
HETATM 2947 O  O     . HOH H 6 .   ? -6.585  -55.627 -87.108  1.00 46.16 ? 3243 HOH A O     1 
HETATM 2948 O  O     . HOH H 6 .   ? -7.826  -36.575 -91.015  1.00 50.07 ? 3244 HOH A O     1 
HETATM 2949 O  O     . HOH H 6 .   ? -24.182 -63.902 -109.040 1.00 50.95 ? 3245 HOH A O     1 
HETATM 2950 O  O     . HOH H 6 .   ? -19.798 -52.033 -134.137 1.00 46.69 ? 3246 HOH A O     1 
HETATM 2951 O  O     . HOH H 6 .   ? -25.958 -44.668 -112.306 1.00 43.74 ? 3247 HOH A O     1 
HETATM 2952 O  O     . HOH H 6 .   ? -3.036  -34.962 -94.709  1.00 47.82 ? 3248 HOH A O     1 
HETATM 2953 O  O     . HOH H 6 .   ? -11.060 -67.022 -124.952 1.00 42.21 ? 3249 HOH A O     1 
HETATM 2954 O  O     . HOH H 6 .   ? -12.242 -44.088 -136.315 1.00 46.70 ? 3250 HOH A O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   ?   ?   ?   A . n 
A 1 22  ALA 22  2   ?   ?   ?   A . n 
A 1 23  VAL 23  3   ?   ?   ?   A . n 
A 1 24  ASP 24  4   ?   ?   ?   A . n 
A 1 25  SER 25  5   ?   ?   ?   A . n 
A 1 26  SER 26  6   ?   ?   ?   A . n 
A 1 27  ASN 27  7   ?   ?   ?   A . n 
A 1 28  SER 28  8   ?   ?   ?   A . n 
A 1 29  ALA 29  9   ?   ?   ?   A . n 
A 1 30  THR 30  10  10  THR THR A . n 
A 1 31  GLY 31  11  11  GLY GLY A . n 
A 1 32  PRO 32  12  12  PRO PRO A . n 
A 1 33  MET 33  13  13  MET MET A . n 
A 1 34  ARG 34  14  14  ARG ARG A . n 
A 1 35  VAL 35  15  15  VAL VAL A . n 
A 1 36  PHE 36  16  16  PHE PHE A . n 
A 1 37  ALA 37  17  17  ALA ALA A . n 
A 1 38  ILE 38  18  18  ILE ILE A . n 
A 1 39  GLY 39  19  19  GLY GLY A . n 
A 1 40  ASN 40  20  20  ASN ASN A . n 
A 1 41  PRO 41  21  21  PRO PRO A . n 
A 1 42  ILE 42  22  22  ILE ILE A . n 
A 1 43  LEU 43  23  23  LEU LEU A . n 
A 1 44  ASP 44  24  24  ASP ASP A . n 
A 1 45  LEU 45  25  25  LEU LEU A . n 
A 1 46  VAL 46  26  26  VAL VAL A . n 
A 1 47  ALA 47  27  27  ALA ALA A . n 
A 1 48  GLU 48  28  28  GLU GLU A . n 
A 1 49  VAL 49  29  29  VAL VAL A . n 
A 1 50  PRO 50  30  30  PRO PRO A . n 
A 1 51  SER 51  31  31  SER SER A . n 
A 1 52  SER 52  32  32  SER SER A . n 
A 1 53  PHE 53  33  33  PHE PHE A . n 
A 1 54  LEU 54  34  34  LEU LEU A . n 
A 1 55  ASP 55  35  35  ASP ASP A . n 
A 1 56  GLU 56  36  36  GLU GLU A . n 
A 1 57  PHE 57  37  37  PHE PHE A . n 
A 1 58  PHE 58  38  38  PHE PHE A . n 
A 1 59  LEU 59  39  39  LEU LEU A . n 
A 1 60  LYS 60  40  40  LYS LYS A . n 
A 1 61  ARG 61  41  41  ARG ARG A . n 
A 1 62  GLY 62  42  42  GLY GLY A . n 
A 1 63  ASP 63  43  43  ASP ASP A . n 
A 1 64  ALA 64  44  44  ALA ALA A . n 
A 1 65  THR 65  45  45  THR THR A . n 
A 1 66  LEU 66  46  46  LEU LEU A . n 
A 1 67  ALA 67  47  47  ALA ALA A . n 
A 1 68  THR 68  48  48  THR THR A . n 
A 1 69  PRO 69  49  49  PRO PRO A . n 
A 1 70  GLU 70  50  50  GLU GLU A . n 
A 1 71  GLN 71  51  51  GLN GLN A . n 
A 1 72  MET 72  52  52  MET MET A . n 
A 1 73  ARG 73  53  53  ARG ARG A . n 
A 1 74  ILE 74  54  54  ILE ILE A . n 
A 1 75  TYR 75  55  55  TYR TYR A . n 
A 1 76  SER 76  56  56  SER SER A . n 
A 1 77  THR 77  57  57  THR THR A . n 
A 1 78  LEU 78  58  58  LEU LEU A . n 
A 1 79  ASP 79  59  59  ASP ASP A . n 
A 1 80  GLN 80  60  60  GLN GLN A . n 
A 1 81  PHE 81  61  61  PHE PHE A . n 
A 1 82  ASN 82  62  62  ASN ASN A . n 
A 1 83  PRO 83  63  63  PRO PRO A . n 
A 1 84  THR 84  64  64  THR THR A . n 
A 1 85  SER 85  65  65  SER SER A . n 
A 1 86  LEU 86  66  66  LEU LEU A . n 
A 1 87  PRO 87  67  67  PRO PRO A . n 
A 1 88  GLY 88  68  68  GLY GLY A . n 
A 1 89  GLY 89  69  69  GLY GLY A . n 
A 1 90  SER 90  70  70  SER SER A . n 
A 1 91  ALA 91  71  71  ALA ALA A . n 
A 1 92  LEU 92  72  72  LEU LEU A . n 
A 1 93  ASN 93  73  73  ASN ASN A . n 
A 1 94  SER 94  74  74  SER SER A . n 
A 1 95  VAL 95  75  75  VAL VAL A . n 
A 1 96  ARG 96  76  76  ARG ARG A . n 
A 1 97  VAL 97  77  77  VAL VAL A . n 
A 1 98  VAL 98  78  78  VAL VAL A . n 
A 1 99  GLN 99  79  79  GLN GLN A . n 
A 1 100 LYS 100 80  80  LYS LYS A . n 
A 1 101 LEU 101 81  81  LEU LEU A . n 
A 1 102 LEU 102 82  82  LEU LEU A . n 
A 1 103 ARG 103 83  83  ARG ARG A . n 
A 1 104 LYS 104 84  84  LYS LYS A . n 
A 1 105 PRO 105 85  85  PRO PRO A . n 
A 1 106 GLY 106 86  86  GLY GLY A . n 
A 1 107 SER 107 87  87  SER SER A . n 
A 1 108 ALA 108 88  88  ALA ALA A . n 
A 1 109 GLY 109 89  89  GLY GLY A . n 
A 1 110 TYR 110 90  90  TYR TYR A . n 
A 1 111 MET 111 91  91  MET MET A . n 
A 1 112 GLY 112 92  92  GLY GLY A . n 
A 1 113 ALA 113 93  93  ALA ALA A . n 
A 1 114 ILE 114 94  94  ILE ILE A . n 
A 1 115 GLY 115 95  95  GLY GLY A . n 
A 1 116 ASP 116 96  96  ASP ASP A . n 
A 1 117 ASP 117 97  97  ASP ASP A . n 
A 1 118 PRO 118 98  98  PRO PRO A . n 
A 1 119 ARG 119 99  99  ARG ARG A . n 
A 1 120 GLY 120 100 100 GLY GLY A . n 
A 1 121 GLN 121 101 101 GLN GLN A . n 
A 1 122 VAL 122 102 102 VAL VAL A . n 
A 1 123 LEU 123 103 103 LEU LEU A . n 
A 1 124 LYS 124 104 104 LYS LYS A . n 
A 1 125 GLU 125 105 105 GLU GLU A . n 
A 1 126 LEU 126 106 106 LEU LEU A . n 
A 1 127 CYS 127 107 107 CYS CYS A . n 
A 1 128 ASP 128 108 108 ASP ASP A . n 
A 1 129 LYS 129 109 109 LYS LYS A . n 
A 1 130 GLU 130 110 110 GLU GLU A . n 
A 1 131 GLY 131 111 111 GLY GLY A . n 
A 1 132 LEU 132 112 112 LEU LEU A . n 
A 1 133 ALA 133 113 113 ALA ALA A . n 
A 1 134 THR 134 114 114 THR THR A . n 
A 1 135 ARG 135 115 115 ARG ARG A . n 
A 1 136 PHE 136 116 116 PHE PHE A . n 
A 1 137 MET 137 117 117 MET MET A . n 
A 1 138 VAL 138 118 118 VAL VAL A . n 
A 1 139 ALA 139 119 119 ALA ALA A . n 
A 1 140 PRO 140 120 120 PRO PRO A . n 
A 1 141 GLY 141 121 121 GLY GLY A . n 
A 1 142 GLN 142 122 122 GLN GLN A . n 
A 1 143 SER 143 123 123 SER SER A . n 
A 1 144 THR 144 124 124 THR THR A . n 
A 1 145 GLY 145 125 125 GLY GLY A . n 
A 1 146 VAL 146 126 126 VAL VAL A . n 
A 1 147 CYS 147 127 127 CYS CYS A . n 
A 1 148 ALA 148 128 128 ALA ALA A . n 
A 1 149 VAL 149 129 129 VAL VAL A . n 
A 1 150 LEU 150 130 130 LEU LEU A . n 
A 1 151 ILE 151 131 131 ILE ILE A . n 
A 1 152 ASN 152 132 132 ASN ASN A . n 
A 1 153 GLU 153 133 133 GLU GLU A . n 
A 1 154 LYS 154 134 134 LYS LYS A . n 
A 1 155 GLU 155 135 135 GLU GLU A . n 
A 1 156 ARG 156 136 136 ARG ARG A . n 
A 1 157 THR 157 137 137 THR THR A . n 
A 1 158 LEU 158 138 138 LEU LEU A . n 
A 1 159 CYS 159 139 139 CYS CYS A . n 
A 1 160 THR 160 140 140 THR THR A . n 
A 1 161 HIS 161 141 141 HIS HIS A . n 
A 1 162 LEU 162 142 142 LEU LEU A . n 
A 1 163 GLY 163 143 143 GLY GLY A . n 
A 1 164 ALA 164 144 144 ALA ALA A . n 
A 1 165 CYS 165 145 145 CYS CYS A . n 
A 1 166 GLY 166 146 146 GLY GLY A . n 
A 1 167 SER 167 147 147 SER SER A . n 
A 1 168 PHE 168 148 148 PHE PHE A . n 
A 1 169 ARG 169 149 149 ARG ARG A . n 
A 1 170 LEU 170 150 150 LEU LEU A . n 
A 1 171 PRO 171 151 151 PRO PRO A . n 
A 1 172 GLU 172 152 152 GLU GLU A . n 
A 1 173 ASP 173 153 153 ASP ASP A . n 
A 1 174 TRP 174 154 154 TRP TRP A . n 
A 1 175 THR 175 155 155 THR THR A . n 
A 1 176 THR 176 156 156 THR THR A . n 
A 1 177 PHE 177 157 157 PHE PHE A . n 
A 1 178 ALA 178 158 158 ALA ALA A . n 
A 1 179 SER 179 159 159 SER SER A . n 
A 1 180 GLY 180 160 160 GLY GLY A . n 
A 1 181 ALA 181 161 161 ALA ALA A . n 
A 1 182 LEU 182 162 162 LEU LEU A . n 
A 1 183 ILE 183 163 163 ILE ILE A . n 
A 1 184 PHE 184 164 164 PHE PHE A . n 
A 1 185 TYR 185 165 165 TYR TYR A . n 
A 1 186 ALA 186 166 166 ALA ALA A . n 
A 1 187 THR 187 167 167 THR THR A . n 
A 1 188 ALA 188 168 168 ALA ALA A . n 
A 1 189 TYR 189 169 169 TYR TYR A . n 
A 1 190 THR 190 170 170 THR THR A . n 
A 1 191 LEU 191 171 171 LEU LEU A . n 
A 1 192 THR 192 172 172 THR THR A . n 
A 1 193 ALA 193 173 173 ALA ALA A . n 
A 1 194 THR 194 174 174 THR THR A . n 
A 1 195 PRO 195 175 175 PRO PRO A . n 
A 1 196 LYS 196 176 176 LYS LYS A . n 
A 1 197 ASN 197 177 177 ASN ASN A . n 
A 1 198 ALA 198 178 178 ALA ALA A . n 
A 1 199 LEU 199 179 179 LEU LEU A . n 
A 1 200 GLU 200 180 180 GLU GLU A . n 
A 1 201 VAL 201 181 181 VAL VAL A . n 
A 1 202 ALA 202 182 182 ALA ALA A . n 
A 1 203 GLY 203 183 183 GLY GLY A . n 
A 1 204 TYR 204 184 184 TYR TYR A . n 
A 1 205 ALA 205 185 185 ALA ALA A . n 
A 1 206 HIS 206 186 186 HIS HIS A . n 
A 1 207 GLY 207 187 187 GLY GLY A . n 
A 1 208 ILE 208 188 188 ILE ILE A . n 
A 1 209 PRO 209 189 189 PRO PRO A . n 
A 1 210 ASN 210 190 190 ASN ASN A . n 
A 1 211 ALA 211 191 191 ALA ALA A . n 
A 1 212 ILE 212 192 192 ILE ILE A . n 
A 1 213 PHE 213 193 193 PHE PHE A . n 
A 1 214 THR 214 194 194 THR THR A . n 
A 1 215 LEU 215 195 195 LEU LEU A . n 
A 1 216 ASN 216 196 196 ASN ASN A . n 
A 1 217 LEU 217 197 197 LEU LEU A . n 
A 1 218 SER 218 198 198 SER SER A . n 
A 1 219 ALA 219 199 199 ALA ALA A . n 
A 1 220 PRO 220 200 200 PRO PRO A . n 
A 1 221 PHE 221 201 201 PHE PHE A . n 
A 1 222 CYS 222 202 202 CYS CYS A . n 
A 1 223 VAL 223 203 203 VAL VAL A . n 
A 1 224 GLU 224 204 204 GLU GLU A . n 
A 1 225 LEU 225 205 205 LEU LEU A . n 
A 1 226 TYR 226 206 206 TYR TYR A . n 
A 1 227 LYS 227 207 207 LYS LYS A . n 
A 1 228 ASP 228 208 208 ASP ASP A . n 
A 1 229 ALA 229 209 209 ALA ALA A . n 
A 1 230 MET 230 210 210 MET MET A . n 
A 1 231 GLN 231 211 211 GLN GLN A . n 
A 1 232 SER 232 212 212 SER SER A . n 
A 1 233 LEU 233 213 213 LEU LEU A . n 
A 1 234 LEU 234 214 214 LEU LEU A . n 
A 1 235 LEU 235 215 215 LEU LEU A . n 
A 1 236 HIS 236 216 216 HIS HIS A . n 
A 1 237 THR 237 217 217 THR THR A . n 
A 1 238 ASN 238 218 218 ASN ASN A . n 
A 1 239 ILE 239 219 219 ILE ILE A . n 
A 1 240 LEU 240 220 220 LEU LEU A . n 
A 1 241 PHE 241 221 221 PHE PHE A . n 
A 1 242 GLY 242 222 222 GLY GLY A . n 
A 1 243 ASN 243 223 223 ASN ASN A . n 
A 1 244 GLU 244 224 224 GLU GLU A . n 
A 1 245 GLU 245 225 225 GLU GLU A . n 
A 1 246 GLU 246 226 226 GLU GLU A . n 
A 1 247 PHE 247 227 227 PHE PHE A . n 
A 1 248 ALA 248 228 228 ALA ALA A . n 
A 1 249 HIS 249 229 229 HIS HIS A . n 
A 1 250 LEU 250 230 230 LEU LEU A . n 
A 1 251 ALA 251 231 231 ALA ALA A . n 
A 1 252 LYS 252 232 232 LYS LYS A . n 
A 1 253 VAL 253 233 233 VAL VAL A . n 
A 1 254 HIS 254 234 234 HIS HIS A . n 
A 1 255 ASN 255 235 235 ASN ASN A . n 
A 1 256 LEU 256 236 236 LEU LEU A . n 
A 1 257 VAL 257 237 237 VAL VAL A . n 
A 1 258 ALA 258 238 238 ALA ALA A . n 
A 1 259 ALA 259 239 239 ALA ALA A . n 
A 1 260 GLU 260 240 240 GLU GLU A . n 
A 1 261 LYS 261 241 241 LYS LYS A . n 
A 1 262 THR 262 242 242 THR THR A . n 
A 1 263 ALA 263 243 243 ALA ALA A . n 
A 1 264 LEU 264 244 244 LEU LEU A . n 
A 1 265 SER 265 245 245 SER SER A . n 
A 1 266 THR 266 246 246 THR THR A . n 
A 1 267 ALA 267 247 247 ALA ALA A . n 
A 1 268 ASN 268 248 248 ASN ASN A . n 
A 1 269 LYS 269 249 249 LYS LYS A . n 
A 1 270 GLU 270 250 250 GLU GLU A . n 
A 1 271 HIS 271 251 251 HIS HIS A . n 
A 1 272 ALA 272 252 252 ALA ALA A . n 
A 1 273 VAL 273 253 253 VAL VAL A . n 
A 1 274 GLU 274 254 254 GLU GLU A . n 
A 1 275 VAL 275 255 255 VAL VAL A . n 
A 1 276 CYS 276 256 256 CYS CYS A . n 
A 1 277 THR 277 257 257 THR THR A . n 
A 1 278 GLY 278 258 258 GLY GLY A . n 
A 1 279 ALA 279 259 259 ALA ALA A . n 
A 1 280 LEU 280 260 260 LEU LEU A . n 
A 1 281 ARG 281 261 261 ARG ARG A . n 
A 1 282 LEU 282 262 262 LEU LEU A . n 
A 1 283 LEU 283 263 263 LEU LEU A . n 
A 1 284 THR 284 264 264 THR THR A . n 
A 1 285 ALA 285 265 265 ALA ALA A . n 
A 1 286 GLY 286 266 266 GLY GLY A . n 
A 1 287 GLN 287 267 267 GLN GLN A . n 
A 1 288 ASN 288 268 268 ASN ASN A . n 
A 1 289 THR 289 269 269 THR THR A . n 
A 1 290 SER 290 270 270 SER SER A . n 
A 1 291 ALA 291 271 271 ALA ALA A . n 
A 1 292 THR 292 272 272 THR THR A . n 
A 1 293 LYS 293 273 273 LYS LYS A . n 
A 1 294 LEU 294 274 274 LEU LEU A . n 
A 1 295 VAL 295 275 275 VAL VAL A . n 
A 1 296 VAL 296 276 276 VAL VAL A . n 
A 1 297 MET 297 277 277 MET MET A . n 
A 1 298 THR 298 278 278 THR THR A . n 
A 1 299 ARG 299 279 279 ARG ARG A . n 
A 1 300 GLY 300 280 280 GLY GLY A . n 
A 1 301 HIS 301 281 281 HIS HIS A . n 
A 1 302 ASN 302 282 282 ASN ASN A . n 
A 1 303 PRO 303 283 283 PRO PRO A . n 
A 1 304 VAL 304 284 284 VAL VAL A . n 
A 1 305 ILE 305 285 285 ILE ILE A . n 
A 1 306 ALA 306 286 286 ALA ALA A . n 
A 1 307 ALA 307 287 287 ALA ALA A . n 
A 1 308 GLU 308 288 288 GLU GLU A . n 
A 1 309 GLN 309 289 289 GLN GLN A . n 
A 1 310 THR 310 290 290 THR THR A . n 
A 1 311 ALA 311 291 291 ALA ALA A . n 
A 1 312 ASP 312 292 292 ASP ASP A . n 
A 1 313 GLY 313 293 293 GLY GLY A . n 
A 1 314 THR 314 294 294 THR THR A . n 
A 1 315 VAL 315 295 295 VAL VAL A . n 
A 1 316 VAL 316 296 296 VAL VAL A . n 
A 1 317 VAL 317 297 297 VAL VAL A . n 
A 1 318 HIS 318 298 298 HIS HIS A . n 
A 1 319 GLU 319 299 299 GLU GLU A . n 
A 1 320 VAL 320 300 300 VAL VAL A . n 
A 1 321 GLY 321 301 301 GLY GLY A . n 
A 1 322 VAL 322 302 302 VAL VAL A . n 
A 1 323 PRO 323 303 303 PRO PRO A . n 
A 1 324 VAL 324 304 304 VAL VAL A . n 
A 1 325 VAL 325 305 305 VAL VAL A . n 
A 1 326 ALA 326 306 306 ALA ALA A . n 
A 1 327 ALA 327 307 307 ALA ALA A . n 
A 1 328 GLU 328 308 308 GLU GLU A . n 
A 1 329 LYS 329 309 309 LYS LYS A . n 
A 1 330 ILE 330 310 310 ILE ILE A . n 
A 1 331 VAL 331 311 311 VAL VAL A . n 
A 1 332 ASP 332 312 312 ASP ASP A . n 
A 1 333 THR 333 313 313 THR THR A . n 
A 1 334 ASN 334 314 314 ASN ASN A . n 
A 1 335 GLY 335 315 315 GLY GLY A . n 
A 1 336 ALA 336 316 316 ALA ALA A . n 
A 1 337 GLY 337 317 317 GLY GLY A . n 
A 1 338 ASP 338 318 318 ASP ASP A . n 
A 1 339 ALA 339 319 319 ALA ALA A . n 
A 1 340 PHE 340 320 320 PHE PHE A . n 
A 1 341 VAL 341 321 321 VAL VAL A . n 
A 1 342 GLY 342 322 322 GLY GLY A . n 
A 1 343 GLY 343 323 323 GLY GLY A . n 
A 1 344 PHE 344 324 324 PHE PHE A . n 
A 1 345 LEU 345 325 325 LEU LEU A . n 
A 1 346 TYR 346 326 326 TYR TYR A . n 
A 1 347 ALA 347 327 327 ALA ALA A . n 
A 1 348 LEU 348 328 328 LEU LEU A . n 
A 1 349 SER 349 329 329 SER SER A . n 
A 1 350 GLN 350 330 330 GLN GLN A . n 
A 1 351 GLY 351 331 331 GLY GLY A . n 
A 1 352 LYS 352 332 332 LYS LYS A . n 
A 1 353 THR 353 333 333 THR THR A . n 
A 1 354 VAL 354 334 334 VAL VAL A . n 
A 1 355 LYS 355 335 335 LYS LYS A . n 
A 1 356 GLN 356 336 336 GLN GLN A . n 
A 1 357 CYS 357 337 337 CYS CYS A . n 
A 1 358 ILE 358 338 338 ILE ILE A . n 
A 1 359 MET 359 339 339 MET MET A . n 
A 1 360 CYS 360 340 340 CYS CYS A . n 
A 1 361 GLY 361 341 341 GLY GLY A . n 
A 1 362 ASN 362 342 342 ASN ASN A . n 
A 1 363 ALA 363 343 343 ALA ALA A . n 
A 1 364 CYS 364 344 344 CYS CYS A . n 
A 1 365 ALA 365 345 345 ALA ALA A . n 
A 1 366 GLN 366 346 346 GLN GLN A . n 
A 1 367 ASP 367 347 347 ASP ASP A . n 
A 1 368 VAL 368 348 348 VAL VAL A . n 
A 1 369 ILE 369 349 349 ILE ILE A . n 
A 1 370 GLN 370 350 350 GLN GLN A . n 
A 1 371 HIS 371 351 351 HIS HIS A . n 
A 1 372 VAL 372 352 352 VAL VAL A . n 
A 1 373 GLY 373 353 353 GLY GLY A . n 
A 1 374 PHE 374 354 354 PHE PHE A . n 
A 1 375 SER 375 355 355 SER SER A . n 
A 1 376 LEU 376 356 356 LEU LEU A . n 
A 1 377 SER 377 357 357 SER SER A . n 
A 1 378 PHE 378 358 358 PHE PHE A . n 
A 1 379 THR 379 359 359 THR THR A . n 
A 1 380 PHE 380 360 360 PHE PHE A . n 
A 1 381 THR 381 361 ?   ?   ?   A . n 
A 1 382 SER 382 362 ?   ?   ?   A . n 
A 1 383 GLY 383 363 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1   2001 2001 CL  CL  A . 
C 3 NA  1   2002 2002 NA  NA  A . 
D 3 NA  1   2003 2003 NA  NA  A . 
E 4 ACT 1   3001 3001 ACT ACT A . 
F 5 MTP 1   1001 1001 MTP MTP A . 
G 5 MTP 1   1002 1002 MTP MTP A . 
H 6 HOH 1   3002 2    HOH HOH A . 
H 6 HOH 2   3003 3    HOH HOH A . 
H 6 HOH 3   3004 4    HOH HOH A . 
H 6 HOH 4   3005 5    HOH HOH A . 
H 6 HOH 5   3006 6    HOH HOH A . 
H 6 HOH 6   3007 7    HOH HOH A . 
H 6 HOH 7   3008 8    HOH HOH A . 
H 6 HOH 8   3009 9    HOH HOH A . 
H 6 HOH 9   3010 10   HOH HOH A . 
H 6 HOH 10  3011 12   HOH HOH A . 
H 6 HOH 11  3012 13   HOH HOH A . 
H 6 HOH 12  3013 14   HOH HOH A . 
H 6 HOH 13  3014 15   HOH HOH A . 
H 6 HOH 14  3015 16   HOH HOH A . 
H 6 HOH 15  3016 17   HOH HOH A . 
H 6 HOH 16  3017 18   HOH HOH A . 
H 6 HOH 17  3018 19   HOH HOH A . 
H 6 HOH 18  3019 20   HOH HOH A . 
H 6 HOH 19  3020 22   HOH HOH A . 
H 6 HOH 20  3021 23   HOH HOH A . 
H 6 HOH 21  3022 24   HOH HOH A . 
H 6 HOH 22  3023 25   HOH HOH A . 
H 6 HOH 23  3024 26   HOH HOH A . 
H 6 HOH 24  3025 27   HOH HOH A . 
H 6 HOH 25  3026 29   HOH HOH A . 
H 6 HOH 26  3027 30   HOH HOH A . 
H 6 HOH 27  3028 31   HOH HOH A . 
H 6 HOH 28  3029 32   HOH HOH A . 
H 6 HOH 29  3030 33   HOH HOH A . 
H 6 HOH 30  3031 34   HOH HOH A . 
H 6 HOH 31  3032 35   HOH HOH A . 
H 6 HOH 32  3033 36   HOH HOH A . 
H 6 HOH 33  3034 37   HOH HOH A . 
H 6 HOH 34  3035 38   HOH HOH A . 
H 6 HOH 35  3036 39   HOH HOH A . 
H 6 HOH 36  3037 40   HOH HOH A . 
H 6 HOH 37  3038 41   HOH HOH A . 
H 6 HOH 38  3039 42   HOH HOH A . 
H 6 HOH 39  3040 43   HOH HOH A . 
H 6 HOH 40  3041 44   HOH HOH A . 
H 6 HOH 41  3042 46   HOH HOH A . 
H 6 HOH 42  3043 47   HOH HOH A . 
H 6 HOH 43  3044 48   HOH HOH A . 
H 6 HOH 44  3045 49   HOH HOH A . 
H 6 HOH 45  3046 50   HOH HOH A . 
H 6 HOH 46  3047 51   HOH HOH A . 
H 6 HOH 47  3048 52   HOH HOH A . 
H 6 HOH 48  3049 53   HOH HOH A . 
H 6 HOH 49  3050 54   HOH HOH A . 
H 6 HOH 50  3051 55   HOH HOH A . 
H 6 HOH 51  3052 56   HOH HOH A . 
H 6 HOH 52  3053 57   HOH HOH A . 
H 6 HOH 53  3054 58   HOH HOH A . 
H 6 HOH 54  3055 59   HOH HOH A . 
H 6 HOH 55  3056 60   HOH HOH A . 
H 6 HOH 56  3057 61   HOH HOH A . 
H 6 HOH 57  3058 62   HOH HOH A . 
H 6 HOH 58  3059 63   HOH HOH A . 
H 6 HOH 59  3060 64   HOH HOH A . 
H 6 HOH 60  3061 65   HOH HOH A . 
H 6 HOH 61  3062 66   HOH HOH A . 
H 6 HOH 62  3063 67   HOH HOH A . 
H 6 HOH 63  3064 68   HOH HOH A . 
H 6 HOH 64  3065 69   HOH HOH A . 
H 6 HOH 65  3066 70   HOH HOH A . 
H 6 HOH 66  3067 71   HOH HOH A . 
H 6 HOH 67  3068 72   HOH HOH A . 
H 6 HOH 68  3069 74   HOH HOH A . 
H 6 HOH 69  3070 75   HOH HOH A . 
H 6 HOH 70  3071 76   HOH HOH A . 
H 6 HOH 71  3072 77   HOH HOH A . 
H 6 HOH 72  3073 78   HOH HOH A . 
H 6 HOH 73  3074 79   HOH HOH A . 
H 6 HOH 74  3075 80   HOH HOH A . 
H 6 HOH 75  3076 81   HOH HOH A . 
H 6 HOH 76  3077 82   HOH HOH A . 
H 6 HOH 77  3078 83   HOH HOH A . 
H 6 HOH 78  3079 84   HOH HOH A . 
H 6 HOH 79  3080 85   HOH HOH A . 
H 6 HOH 80  3081 86   HOH HOH A . 
H 6 HOH 81  3082 87   HOH HOH A . 
H 6 HOH 82  3083 88   HOH HOH A . 
H 6 HOH 83  3084 89   HOH HOH A . 
H 6 HOH 84  3085 90   HOH HOH A . 
H 6 HOH 85  3086 91   HOH HOH A . 
H 6 HOH 86  3087 92   HOH HOH A . 
H 6 HOH 87  3088 93   HOH HOH A . 
H 6 HOH 88  3089 94   HOH HOH A . 
H 6 HOH 89  3090 95   HOH HOH A . 
H 6 HOH 90  3091 96   HOH HOH A . 
H 6 HOH 91  3092 97   HOH HOH A . 
H 6 HOH 92  3093 98   HOH HOH A . 
H 6 HOH 93  3094 99   HOH HOH A . 
H 6 HOH 94  3095 101  HOH HOH A . 
H 6 HOH 95  3096 102  HOH HOH A . 
H 6 HOH 96  3097 103  HOH HOH A . 
H 6 HOH 97  3098 104  HOH HOH A . 
H 6 HOH 98  3099 105  HOH HOH A . 
H 6 HOH 99  3100 106  HOH HOH A . 
H 6 HOH 100 3101 107  HOH HOH A . 
H 6 HOH 101 3102 108  HOH HOH A . 
H 6 HOH 102 3103 109  HOH HOH A . 
H 6 HOH 103 3104 110  HOH HOH A . 
H 6 HOH 104 3105 112  HOH HOH A . 
H 6 HOH 105 3106 113  HOH HOH A . 
H 6 HOH 106 3107 114  HOH HOH A . 
H 6 HOH 107 3108 115  HOH HOH A . 
H 6 HOH 108 3109 116  HOH HOH A . 
H 6 HOH 109 3110 119  HOH HOH A . 
H 6 HOH 110 3111 120  HOH HOH A . 
H 6 HOH 111 3112 121  HOH HOH A . 
H 6 HOH 112 3113 122  HOH HOH A . 
H 6 HOH 113 3114 125  HOH HOH A . 
H 6 HOH 114 3115 126  HOH HOH A . 
H 6 HOH 115 3116 127  HOH HOH A . 
H 6 HOH 116 3117 128  HOH HOH A . 
H 6 HOH 117 3118 129  HOH HOH A . 
H 6 HOH 118 3119 130  HOH HOH A . 
H 6 HOH 119 3120 131  HOH HOH A . 
H 6 HOH 120 3121 132  HOH HOH A . 
H 6 HOH 121 3122 133  HOH HOH A . 
H 6 HOH 122 3123 134  HOH HOH A . 
H 6 HOH 123 3124 135  HOH HOH A . 
H 6 HOH 124 3125 136  HOH HOH A . 
H 6 HOH 125 3126 137  HOH HOH A . 
H 6 HOH 126 3127 138  HOH HOH A . 
H 6 HOH 127 3128 139  HOH HOH A . 
H 6 HOH 128 3129 140  HOH HOH A . 
H 6 HOH 129 3130 141  HOH HOH A . 
H 6 HOH 130 3131 142  HOH HOH A . 
H 6 HOH 131 3132 143  HOH HOH A . 
H 6 HOH 132 3133 144  HOH HOH A . 
H 6 HOH 133 3134 145  HOH HOH A . 
H 6 HOH 134 3135 146  HOH HOH A . 
H 6 HOH 135 3136 147  HOH HOH A . 
H 6 HOH 136 3137 148  HOH HOH A . 
H 6 HOH 137 3138 149  HOH HOH A . 
H 6 HOH 138 3139 150  HOH HOH A . 
H 6 HOH 139 3140 151  HOH HOH A . 
H 6 HOH 140 3141 152  HOH HOH A . 
H 6 HOH 141 3142 153  HOH HOH A . 
H 6 HOH 142 3143 154  HOH HOH A . 
H 6 HOH 143 3144 155  HOH HOH A . 
H 6 HOH 144 3145 156  HOH HOH A . 
H 6 HOH 145 3146 157  HOH HOH A . 
H 6 HOH 146 3147 158  HOH HOH A . 
H 6 HOH 147 3148 159  HOH HOH A . 
H 6 HOH 148 3149 160  HOH HOH A . 
H 6 HOH 149 3150 161  HOH HOH A . 
H 6 HOH 150 3151 162  HOH HOH A . 
H 6 HOH 151 3152 163  HOH HOH A . 
H 6 HOH 152 3153 164  HOH HOH A . 
H 6 HOH 153 3154 165  HOH HOH A . 
H 6 HOH 154 3155 166  HOH HOH A . 
H 6 HOH 155 3156 167  HOH HOH A . 
H 6 HOH 156 3157 168  HOH HOH A . 
H 6 HOH 157 3158 169  HOH HOH A . 
H 6 HOH 158 3159 170  HOH HOH A . 
H 6 HOH 159 3160 171  HOH HOH A . 
H 6 HOH 160 3161 173  HOH HOH A . 
H 6 HOH 161 3162 174  HOH HOH A . 
H 6 HOH 162 3163 175  HOH HOH A . 
H 6 HOH 163 3164 176  HOH HOH A . 
H 6 HOH 164 3165 177  HOH HOH A . 
H 6 HOH 165 3166 178  HOH HOH A . 
H 6 HOH 166 3167 179  HOH HOH A . 
H 6 HOH 167 3168 180  HOH HOH A . 
H 6 HOH 168 3169 181  HOH HOH A . 
H 6 HOH 169 3170 182  HOH HOH A . 
H 6 HOH 170 3171 183  HOH HOH A . 
H 6 HOH 171 3172 184  HOH HOH A . 
H 6 HOH 172 3173 185  HOH HOH A . 
H 6 HOH 173 3174 186  HOH HOH A . 
H 6 HOH 174 3175 187  HOH HOH A . 
H 6 HOH 175 3176 188  HOH HOH A . 
H 6 HOH 176 3177 189  HOH HOH A . 
H 6 HOH 177 3178 190  HOH HOH A . 
H 6 HOH 178 3179 191  HOH HOH A . 
H 6 HOH 179 3180 192  HOH HOH A . 
H 6 HOH 180 3181 194  HOH HOH A . 
H 6 HOH 181 3182 195  HOH HOH A . 
H 6 HOH 182 3183 196  HOH HOH A . 
H 6 HOH 183 3184 197  HOH HOH A . 
H 6 HOH 184 3185 198  HOH HOH A . 
H 6 HOH 185 3186 199  HOH HOH A . 
H 6 HOH 186 3187 200  HOH HOH A . 
H 6 HOH 187 3188 201  HOH HOH A . 
H 6 HOH 188 3189 202  HOH HOH A . 
H 6 HOH 189 3190 203  HOH HOH A . 
H 6 HOH 190 3191 204  HOH HOH A . 
H 6 HOH 191 3192 205  HOH HOH A . 
H 6 HOH 192 3193 206  HOH HOH A . 
H 6 HOH 193 3194 207  HOH HOH A . 
H 6 HOH 194 3195 208  HOH HOH A . 
H 6 HOH 195 3196 209  HOH HOH A . 
H 6 HOH 196 3197 210  HOH HOH A . 
H 6 HOH 197 3198 211  HOH HOH A . 
H 6 HOH 198 3199 212  HOH HOH A . 
H 6 HOH 199 3200 213  HOH HOH A . 
H 6 HOH 200 3201 214  HOH HOH A . 
H 6 HOH 201 3202 215  HOH HOH A . 
H 6 HOH 202 3203 216  HOH HOH A . 
H 6 HOH 203 3204 217  HOH HOH A . 
H 6 HOH 204 3205 218  HOH HOH A . 
H 6 HOH 205 3206 219  HOH HOH A . 
H 6 HOH 206 3207 220  HOH HOH A . 
H 6 HOH 207 3208 221  HOH HOH A . 
H 6 HOH 208 3209 222  HOH HOH A . 
H 6 HOH 209 3210 223  HOH HOH A . 
H 6 HOH 210 3211 224  HOH HOH A . 
H 6 HOH 211 3212 225  HOH HOH A . 
H 6 HOH 212 3213 226  HOH HOH A . 
H 6 HOH 213 3214 227  HOH HOH A . 
H 6 HOH 214 3215 228  HOH HOH A . 
H 6 HOH 215 3216 229  HOH HOH A . 
H 6 HOH 216 3217 230  HOH HOH A . 
H 6 HOH 217 3218 231  HOH HOH A . 
H 6 HOH 218 3219 232  HOH HOH A . 
H 6 HOH 219 3220 233  HOH HOH A . 
H 6 HOH 220 3221 234  HOH HOH A . 
H 6 HOH 221 3222 235  HOH HOH A . 
H 6 HOH 222 3223 236  HOH HOH A . 
H 6 HOH 223 3224 237  HOH HOH A . 
H 6 HOH 224 3225 238  HOH HOH A . 
H 6 HOH 225 3226 239  HOH HOH A . 
H 6 HOH 226 3227 240  HOH HOH A . 
H 6 HOH 227 3228 241  HOH HOH A . 
H 6 HOH 228 3229 242  HOH HOH A . 
H 6 HOH 229 3230 243  HOH HOH A . 
H 6 HOH 230 3231 244  HOH HOH A . 
H 6 HOH 231 3232 245  HOH HOH A . 
H 6 HOH 232 3233 246  HOH HOH A . 
H 6 HOH 233 3234 247  HOH HOH A . 
H 6 HOH 234 3235 248  HOH HOH A . 
H 6 HOH 235 3236 249  HOH HOH A . 
H 6 HOH 236 3237 250  HOH HOH A . 
H 6 HOH 237 3238 251  HOH HOH A . 
H 6 HOH 238 3239 252  HOH HOH A . 
H 6 HOH 239 3240 253  HOH HOH A . 
H 6 HOH 240 3241 254  HOH HOH A . 
H 6 HOH 241 3242 255  HOH HOH A . 
H 6 HOH 242 3243 256  HOH HOH A . 
H 6 HOH 243 3244 257  HOH HOH A . 
H 6 HOH 244 3245 258  HOH HOH A . 
H 6 HOH 245 3246 259  HOH HOH A . 
H 6 HOH 246 3247 260  HOH HOH A . 
H 6 HOH 247 3248 261  HOH HOH A . 
H 6 HOH 248 3249 262  HOH HOH A . 
H 6 HOH 249 3250 263  HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 288 ? A ASN 268 ? 1_555 NA ? C NA . ? A NA 2002 ? 1_555 O ? A THR 289 ? A THR 269  ? 1_555 92.8  ? 
2  OD1 ? A ASN 288 ? A ASN 268 ? 1_555 NA ? C NA . ? A NA 2002 ? 1_555 O ? A THR 310 ? A THR 290  ? 1_555 84.7  ? 
3  O   ? A THR 289 ? A THR 269 ? 1_555 NA ? C NA . ? A NA 2002 ? 1_555 O ? A THR 310 ? A THR 290  ? 1_555 147.0 ? 
4  OD1 ? A ASN 288 ? A ASN 268 ? 1_555 NA ? C NA . ? A NA 2002 ? 1_555 O ? H HOH .   ? A HOH 3081 ? 1_555 169.7 ? 
5  O   ? A THR 289 ? A THR 269 ? 1_555 NA ? C NA . ? A NA 2002 ? 1_555 O ? H HOH .   ? A HOH 3081 ? 1_555 93.3  ? 
6  O   ? A THR 310 ? A THR 290 ? 1_555 NA ? C NA . ? A NA 2002 ? 1_555 O ? H HOH .   ? A HOH 3081 ? 1_555 94.8  ? 
7  O   ? A VAL 368 ? A VAL 348 ? 1_555 NA ? D NA . ? A NA 2003 ? 1_555 O ? A HIS 371 ? A HIS 351  ? 1_555 86.0  ? 
8  O   ? A VAL 368 ? A VAL 348 ? 1_555 NA ? D NA . ? A NA 2003 ? 1_555 O ? A GLY 373 ? A GLY 353  ? 1_555 110.8 ? 
9  O   ? A HIS 371 ? A HIS 351 ? 1_555 NA ? D NA . ? A NA 2003 ? 1_555 O ? A GLY 373 ? A GLY 353  ? 1_555 105.0 ? 
10 O   ? A VAL 368 ? A VAL 348 ? 1_555 NA ? D NA . ? A NA 2003 ? 1_555 O ? H HOH .   ? A HOH 3234 ? 1_555 92.4  ? 
11 O   ? A HIS 371 ? A HIS 351 ? 1_555 NA ? D NA . ? A NA 2003 ? 1_555 O ? H HOH .   ? A HOH 3234 ? 1_555 138.8 ? 
12 O   ? A GLY 373 ? A GLY 353 ? 1_555 NA ? D NA . ? A NA 2003 ? 1_555 O ? H HOH .   ? A HOH 3234 ? 1_555 113.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2006-07-25 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2021-10-20 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Database references'       
4 4 'Structure model' 'Derived calculations'      
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 4 'Structure model' database_2             
2 4 'Structure model' pdbx_struct_conn_angle 
3 4 'Structure model' struct_conn            
4 4 'Structure model' struct_ref_seq_dif     
5 4 'Structure model' struct_site            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  4 'Structure model' '_database_2.pdbx_DOI'                        
2  4 'Structure model' '_database_2.pdbx_database_accession'         
3  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
4  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
5  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
9  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 
12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 
13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
15 4 'Structure model' '_pdbx_struct_conn_angle.value'               
16 4 'Structure model' '_struct_conn.pdbx_dist_value'                
17 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
18 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
19 4 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
20 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
21 4 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
22 4 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
23 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
24 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
25 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
26 4 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
27 4 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
28 4 'Structure model' '_struct_conn.ptnr2_label_seq_id'             
29 4 'Structure model' '_struct_ref_seq_dif.details'                 
30 4 'Structure model' '_struct_site.pdbx_auth_asym_id'              
31 4 'Structure model' '_struct_site.pdbx_auth_comp_id'              
32 4 'Structure model' '_struct_site.pdbx_auth_seq_id'               
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000  'data collection' . ? 1 
SCALEPACK 'data scaling'    . ? 2 
CNS       refinement        . ? 3 
HKL-2000  'data reduction'  . ? 4 
CNS       phasing           . ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ALA A 27  ? ? -172.38 144.25  
2 1 ARG A 83  ? ? 67.40   -48.58  
3 1 ASP A 96  ? ? -97.40  47.37   
4 1 ALA A 173 ? ? -92.61  -60.84  
5 1 SER A 198 ? ? 64.98   -51.62  
6 1 THR A 269 ? ? -129.94 -169.47 
7 1 ASP A 312 ? ? -175.80 137.28  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A THR 10  ? OG1 ? A THR 30  OG1 
2  1 Y 1 A THR 10  ? CG2 ? A THR 30  CG2 
3  1 Y 1 A ARG 53  ? CG  ? A ARG 73  CG  
4  1 Y 1 A ARG 53  ? CD  ? A ARG 73  CD  
5  1 Y 1 A ARG 53  ? NE  ? A ARG 73  NE  
6  1 Y 1 A ARG 53  ? CZ  ? A ARG 73  CZ  
7  1 Y 1 A ARG 53  ? NH1 ? A ARG 73  NH1 
8  1 Y 1 A ARG 53  ? NH2 ? A ARG 73  NH2 
9  1 Y 1 A LYS 80  ? CG  ? A LYS 100 CG  
10 1 Y 1 A LYS 80  ? CD  ? A LYS 100 CD  
11 1 Y 1 A LYS 80  ? CE  ? A LYS 100 CE  
12 1 Y 1 A LYS 80  ? NZ  ? A LYS 100 NZ  
13 1 Y 1 A GLU 105 ? CG  ? A GLU 125 CG  
14 1 Y 1 A GLU 105 ? CD  ? A GLU 125 CD  
15 1 Y 1 A GLU 105 ? OE1 ? A GLU 125 OE1 
16 1 Y 1 A GLU 105 ? OE2 ? A GLU 125 OE2 
17 1 Y 1 A LYS 134 ? CG  ? A LYS 154 CG  
18 1 Y 1 A LYS 134 ? CD  ? A LYS 154 CD  
19 1 Y 1 A LYS 134 ? CE  ? A LYS 154 CE  
20 1 Y 1 A LYS 134 ? NZ  ? A LYS 154 NZ  
21 1 Y 1 A GLU 250 ? CG  ? A GLU 270 CG  
22 1 Y 1 A GLU 250 ? CD  ? A GLU 270 CD  
23 1 Y 1 A GLU 250 ? OE1 ? A GLU 270 OE1 
24 1 Y 1 A GLU 250 ? OE2 ? A GLU 270 OE2 
25 1 Y 1 A GLU 308 ? CG  ? A GLU 328 CG  
26 1 Y 1 A GLU 308 ? CD  ? A GLU 328 CD  
27 1 Y 1 A GLU 308 ? OE1 ? A GLU 328 OE1 
28 1 Y 1 A GLU 308 ? OE2 ? A GLU 328 OE2 
29 1 Y 1 A LYS 309 ? CG  ? A LYS 329 CG  
30 1 Y 1 A LYS 309 ? CD  ? A LYS 329 CD  
31 1 Y 1 A LYS 309 ? CE  ? A LYS 329 CE  
32 1 Y 1 A LYS 309 ? NZ  ? A LYS 329 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A HIS 0   ? A HIS 20  
21 1 Y 1 A MET 1   ? A MET 21  
22 1 Y 1 A ALA 2   ? A ALA 22  
23 1 Y 1 A VAL 3   ? A VAL 23  
24 1 Y 1 A ASP 4   ? A ASP 24  
25 1 Y 1 A SER 5   ? A SER 25  
26 1 Y 1 A SER 6   ? A SER 26  
27 1 Y 1 A ASN 7   ? A ASN 27  
28 1 Y 1 A SER 8   ? A SER 28  
29 1 Y 1 A ALA 9   ? A ALA 29  
30 1 Y 1 A THR 361 ? A THR 381 
31 1 Y 1 A SER 362 ? A SER 382 
32 1 Y 1 A GLY 363 ? A GLY 383 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION'                                                              CL  
3 'SODIUM ION'                                                                NA  
4 'ACETATE ION'                                                               ACT 
5 '2-HYDROXYMETHYL-5-(6-METHYLSULFANYL-PURIN-9-YL)-TETRAHYDRO-FURAN-3,4-DIOL' MTP 
6 water                                                                       HOH 
#