data_2AAZ
# 
_entry.id   2AAZ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AAZ         
RCSB  RCSB033696   
WWPDB D_1000033696 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          2A9W 
_pdbx_database_related.details        'Crystal structure of E. Coli Ts Complexed With Dump and Inhibitor Ga9' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AAZ 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-14 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Finer-Moore, J.S.' 1 
'Anderson, A.C.'    2 
;O'Neil, R.H.
;
3 
'Costi, M.P.'       4 
'Ferrari, S.'       5 
'Krucinski, J.'     6 
'Stroud, R.M.'      7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 
;The structure of Cryptococcus neoformans thymidylate synthase suggests strategies for using target dynamics for species-specific inhibition.
;
'Acta Crystallogr.,Sect.D' 61 1320 1334 2005 ABCRE6 DK 0907-4449 0766 ? 16204883 10.1107/S0907444905022638 
1       'Phthalein derivatives as a new tool for selectivity in thymidylate synthase inhibition' J.Med.Chem.                42 
2112 2124 1999 JMCMAR US 0022-2623 0151 ? 10377217 10.1021/jm9900016         
2       'Structure-based design of inhibitors specific for bacterial thymidylate synthase' Biochemistry               38 1607 1617 
1999 BICHAW US 0006-2960 0033 ? 9931028  10.1021/bi9815896         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Finer-Moore, J.S.' 1  
primary 'Anderson, A.C.'    2  
primary 
;O'Neil, R.H.
;
3  
primary 'Costi, M.P.'       4  
primary 'Ferrari, S.'       5  
primary 'Krucinski, J.'     6  
primary 'Stroud, R.M.'      7  
1       'Costi, P.M.'       8  
1       'Rinaldi, M.'       9  
1       'Tondi, D.'         10 
1       'Pecorari, P.'      11 
1       'Barlocco, D.'      12 
1       'Ghelli, S.'        13 
1       'Stroud, R.M.'      14 
1       'Santi, D.V.'       15 
1       'Stout, T.J.'       16 
1       'Musiu, C.'         17 
1       'Marangiu, E.M.'    18 
1       'Pani, A.'          19 
1       'Congiu, D.'        20 
1       'Loi, G.A.'         21 
1       'La Colla, P.'      22 
2       'Stout, T.J.'       23 
2       'Tondi, D.'         24 
2       'Rinaldi, M.'       25 
2       'Barlocco, D.'      26 
2       'Pecorari, P.'      27 
2       'Santi, D.V.'       28 
2       'Kuntz, I.D.'       29 
2       'Stroud, R.M.'      30 
2       'Shoichet, B.K.'    31 
2       'Costi, M.P.'       32 
# 
_cell.entry_id           2AAZ 
_cell.length_a           179.400 
_cell.length_b           179.500 
_cell.length_c           209.100 
_cell.angle_alpha        90.00 
_cell.angle_beta         89.80 
_cell.angle_gamma        90.00 
_cell.Z_PDB              64 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2AAZ 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Thymidylate synthase'               35911.977 16   2.1.1.45 ? ? ? 
2 non-polymer syn 
;2'-DEOXYURIDINE 5'-MONOPHOSPHATE
;
308.182   16   ?        ? ? ? 
3 non-polymer syn '10-PROPARGYL-5,8-DIDEAZAFOLIC ACID' 477.469   8    ?        ? ? ? 
4 water       nat water                                18.015    1212 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'TS, TSase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLADNTLPLLTTKRVFLRGVIAEL
LWFVSGCTDAKMLSSQGVGIWDGNGSKEFLEKVGLGHRREGDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTI
KNNPTDRRIILSAWNPKDLPLMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIAL
ITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRDFPKLKWARSKEEIGDIDGFKVEDFVVEGYKPWGKIDMKMSA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLADNTLPLLTTKRVFLRGVIAEL
LWFVSGCTDAKMLSSQGVGIWDGNGSKEFLEKVGLGHRREGDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTI
KNNPTDRRIILSAWNPKDLPLMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIAL
ITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRDFPKLKWARSKEEIGDIDGFKVEDFVVEGYKPWGKIDMKMSA
;
_entity_poly.pdbx_strand_id                 A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   ALA n 
1 4   THR n 
1 5   ILE n 
1 6   ASP n 
1 7   ASP n 
1 8   GLN n 
1 9   GLU n 
1 10  LYS n 
1 11  ASN n 
1 12  GLN n 
1 13  ARG n 
1 14  SER n 
1 15  ASN n 
1 16  PRO n 
1 17  ASP n 
1 18  HIS n 
1 19  GLU n 
1 20  GLU n 
1 21  TYR n 
1 22  GLN n 
1 23  TYR n 
1 24  LEU n 
1 25  ASP n 
1 26  LEU n 
1 27  ILE n 
1 28  ARG n 
1 29  ARG n 
1 30  ILE n 
1 31  ILE n 
1 32  ASN n 
1 33  VAL n 
1 34  GLY n 
1 35  GLU n 
1 36  VAL n 
1 37  ARG n 
1 38  PRO n 
1 39  ASP n 
1 40  ARG n 
1 41  THR n 
1 42  GLY n 
1 43  THR n 
1 44  GLY n 
1 45  THR n 
1 46  VAL n 
1 47  ALA n 
1 48  LEU n 
1 49  PHE n 
1 50  ALA n 
1 51  PRO n 
1 52  PRO n 
1 53  SER n 
1 54  PHE n 
1 55  ARG n 
1 56  PHE n 
1 57  SER n 
1 58  LEU n 
1 59  ALA n 
1 60  ASP n 
1 61  ASN n 
1 62  THR n 
1 63  LEU n 
1 64  PRO n 
1 65  LEU n 
1 66  LEU n 
1 67  THR n 
1 68  THR n 
1 69  LYS n 
1 70  ARG n 
1 71  VAL n 
1 72  PHE n 
1 73  LEU n 
1 74  ARG n 
1 75  GLY n 
1 76  VAL n 
1 77  ILE n 
1 78  ALA n 
1 79  GLU n 
1 80  LEU n 
1 81  LEU n 
1 82  TRP n 
1 83  PHE n 
1 84  VAL n 
1 85  SER n 
1 86  GLY n 
1 87  CYS n 
1 88  THR n 
1 89  ASP n 
1 90  ALA n 
1 91  LYS n 
1 92  MET n 
1 93  LEU n 
1 94  SER n 
1 95  SER n 
1 96  GLN n 
1 97  GLY n 
1 98  VAL n 
1 99  GLY n 
1 100 ILE n 
1 101 TRP n 
1 102 ASP n 
1 103 GLY n 
1 104 ASN n 
1 105 GLY n 
1 106 SER n 
1 107 LYS n 
1 108 GLU n 
1 109 PHE n 
1 110 LEU n 
1 111 GLU n 
1 112 LYS n 
1 113 VAL n 
1 114 GLY n 
1 115 LEU n 
1 116 GLY n 
1 117 HIS n 
1 118 ARG n 
1 119 ARG n 
1 120 GLU n 
1 121 GLY n 
1 122 ASP n 
1 123 LEU n 
1 124 GLY n 
1 125 PRO n 
1 126 VAL n 
1 127 TYR n 
1 128 GLY n 
1 129 PHE n 
1 130 GLN n 
1 131 TRP n 
1 132 ARG n 
1 133 HIS n 
1 134 PHE n 
1 135 GLY n 
1 136 ALA n 
1 137 GLU n 
1 138 TYR n 
1 139 THR n 
1 140 ASP n 
1 141 ALA n 
1 142 ASP n 
1 143 GLY n 
1 144 ASP n 
1 145 TYR n 
1 146 LYS n 
1 147 GLY n 
1 148 LYS n 
1 149 GLY n 
1 150 VAL n 
1 151 ASP n 
1 152 GLN n 
1 153 LEU n 
1 154 GLN n 
1 155 ARG n 
1 156 VAL n 
1 157 ILE n 
1 158 ASP n 
1 159 THR n 
1 160 ILE n 
1 161 LYS n 
1 162 ASN n 
1 163 ASN n 
1 164 PRO n 
1 165 THR n 
1 166 ASP n 
1 167 ARG n 
1 168 ARG n 
1 169 ILE n 
1 170 ILE n 
1 171 LEU n 
1 172 SER n 
1 173 ALA n 
1 174 TRP n 
1 175 ASN n 
1 176 PRO n 
1 177 LYS n 
1 178 ASP n 
1 179 LEU n 
1 180 PRO n 
1 181 LEU n 
1 182 MET n 
1 183 ALA n 
1 184 LEU n 
1 185 PRO n 
1 186 PRO n 
1 187 CYS n 
1 188 HIS n 
1 189 MET n 
1 190 PHE n 
1 191 CYS n 
1 192 GLN n 
1 193 PHE n 
1 194 PHE n 
1 195 VAL n 
1 196 SER n 
1 197 LEU n 
1 198 PRO n 
1 199 PRO n 
1 200 ALA n 
1 201 ASP n 
1 202 SER n 
1 203 PRO n 
1 204 GLY n 
1 205 SER n 
1 206 LYS n 
1 207 PRO n 
1 208 LYS n 
1 209 LEU n 
1 210 SER n 
1 211 CYS n 
1 212 LEU n 
1 213 MET n 
1 214 TYR n 
1 215 GLN n 
1 216 ARG n 
1 217 SER n 
1 218 CYS n 
1 219 ASP n 
1 220 LEU n 
1 221 GLY n 
1 222 LEU n 
1 223 GLY n 
1 224 VAL n 
1 225 PRO n 
1 226 PHE n 
1 227 ASN n 
1 228 ILE n 
1 229 ALA n 
1 230 SER n 
1 231 TYR n 
1 232 ALA n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 HIS n 
1 237 MET n 
1 238 ILE n 
1 239 ALA n 
1 240 LEU n 
1 241 ILE n 
1 242 THR n 
1 243 ASP n 
1 244 THR n 
1 245 GLU n 
1 246 PRO n 
1 247 HIS n 
1 248 GLU n 
1 249 PHE n 
1 250 ILE n 
1 251 LEU n 
1 252 GLN n 
1 253 MET n 
1 254 GLY n 
1 255 ASP n 
1 256 ALA n 
1 257 HIS n 
1 258 VAL n 
1 259 TYR n 
1 260 ARG n 
1 261 ASP n 
1 262 HIS n 
1 263 VAL n 
1 264 GLU n 
1 265 PRO n 
1 266 LEU n 
1 267 LYS n 
1 268 THR n 
1 269 GLN n 
1 270 LEU n 
1 271 GLU n 
1 272 ARG n 
1 273 GLU n 
1 274 PRO n 
1 275 ARG n 
1 276 ASP n 
1 277 PHE n 
1 278 PRO n 
1 279 LYS n 
1 280 LEU n 
1 281 LYS n 
1 282 TRP n 
1 283 ALA n 
1 284 ARG n 
1 285 SER n 
1 286 LYS n 
1 287 GLU n 
1 288 GLU n 
1 289 ILE n 
1 290 GLY n 
1 291 ASP n 
1 292 ILE n 
1 293 ASP n 
1 294 GLY n 
1 295 PHE n 
1 296 LYS n 
1 297 VAL n 
1 298 GLU n 
1 299 ASP n 
1 300 PHE n 
1 301 VAL n 
1 302 VAL n 
1 303 GLU n 
1 304 GLY n 
1 305 TYR n 
1 306 LYS n 
1 307 PRO n 
1 308 TRP n 
1 309 GLY n 
1 310 LYS n 
1 311 ILE n 
1 312 ASP n 
1 313 MET n 
1 314 LYS n 
1 315 MET n 
1 316 SER n 
1 317 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Filobasidiella 
_entity_src_gen.pdbx_gene_src_gene                 TMP1 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Filobasidiella neoformans' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     5207 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   'Escherichia coli' 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       'pET CNTS' 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    TYSY_CRYNE 
_struct_ref.pdbx_db_accession          P45351 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MTATIDDQEKNQRSNPDHEEYQYLDLIRRIINVGEVRPDRTGTGTVALFAPPSFRFSLADNTLPLLTTKRVFLRGVIAEL
LWFVSGCTDAKMLSSQGVGIWDGNGSKEFLEKVGLGHRREGDLGPVYGFQWRHFGAEYTDADGDYKGKGVDQLQRVIDTI
KNNPTDRRIILSAWNPKDLPLMALPPCHMFCQFFVSLPPADSPGSKPKLSCLMYQRSCDLGLGVPFNIASYALLTHMIAL
ITDTEPHEFILQMGDAHVYRDHVEPLKTQLEREPRDFPKLKWARSKEEIGDIDGFKVEDFVVEGYKPWGKIDMKMSA
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 2AAZ A 1 ? 317 ? P45351 1 ? 317 ? 1 317 
2  1 2AAZ B 1 ? 317 ? P45351 1 ? 317 ? 1 317 
3  1 2AAZ C 1 ? 317 ? P45351 1 ? 317 ? 1 317 
4  1 2AAZ D 1 ? 317 ? P45351 1 ? 317 ? 1 317 
5  1 2AAZ E 1 ? 317 ? P45351 1 ? 317 ? 1 317 
6  1 2AAZ F 1 ? 317 ? P45351 1 ? 317 ? 1 317 
7  1 2AAZ G 1 ? 317 ? P45351 1 ? 317 ? 1 317 
8  1 2AAZ H 1 ? 317 ? P45351 1 ? 317 ? 1 317 
9  1 2AAZ I 1 ? 317 ? P45351 1 ? 317 ? 1 317 
10 1 2AAZ J 1 ? 317 ? P45351 1 ? 317 ? 1 317 
11 1 2AAZ K 1 ? 317 ? P45351 1 ? 317 ? 1 317 
12 1 2AAZ L 1 ? 317 ? P45351 1 ? 317 ? 1 317 
13 1 2AAZ M 1 ? 317 ? P45351 1 ? 317 ? 1 317 
14 1 2AAZ N 1 ? 317 ? P45351 1 ? 317 ? 1 317 
15 1 2AAZ O 1 ? 317 ? P45351 1 ? 317 ? 1 317 
16 1 2AAZ P 1 ? 317 ? P45351 1 ? 317 ? 1 317 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?    'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                             ?    'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?    'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?    'C4 H7 N O4'     133.103 
CB3 non-polymer         . '10-PROPARGYL-5,8-DIDEAZAFOLIC ACID' ?    'C24 H23 N5 O6'  477.469 
CYS 'L-peptide linking' y CYSTEINE                             ?    'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                            ?    'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?    'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                              ?    'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?    'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                ?    'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?    'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                              ?    'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                               ?    'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                           ?    'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?    'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                              ?    'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                               ?    'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                            ?    'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?    'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                             ?    'C9 H11 N O3'    181.189 
UMP non-polymer         . 
;2'-DEOXYURIDINE 5'-MONOPHOSPHATE
;
DUMP 'C9 H13 N2 O8 P' 308.182 
VAL 'L-peptide linking' y VALINE                               ?    'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2AAZ 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.93 
_exptl_crystal.density_percent_sol   57.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.4 
_exptl_crystal_grow.pdbx_details    
;0.107 mM protein, dUMP,CB3, DTT, PEG4000/PEG6000, Tris, Na acetate/K acetate, pH 8.4, VAPOR DIFFUSION, HANGING DROP, temperature 293K
;
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           103 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2000-05-19 
_diffrn_detector.details                monochrometer 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SSRL BEAMLINE BL9-1' 
_diffrn_source.pdbx_synchrotron_site       SSRL 
_diffrn_source.pdbx_synchrotron_beamline   BL9-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.0 
# 
_reflns.entry_id                     2AAZ 
_reflns.observed_criterion_sigma_I   -3 
_reflns.observed_criterion_sigma_F   -3 
_reflns.d_resolution_low             99. 
_reflns.d_resolution_high            2.07 
_reflns.number_obs                   389001 
_reflns.number_all                   389001 
_reflns.percent_possible_obs         97.0 
_reflns.pdbx_Rmerge_I_obs            0.1 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        7.4 
_reflns.B_iso_Wilson_estimate        23.2 
_reflns.pdbx_redundancy              1.85 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.07 
_reflns_shell.d_res_low              2.14 
_reflns_shell.percent_possible_all   97.9 
_reflns_shell.Rmerge_I_obs           0.344 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.7 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2AAZ 
_refine.ls_number_reflns_obs                     348326 
_refine.ls_number_reflns_all                     383515 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               5580798.34 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             49.91 
_refine.ls_d_res_high                            2.08 
_refine.ls_percent_reflns_obs                    88.1 
_refine.ls_R_factor_obs                          0.29 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.29 
_refine.ls_R_factor_R_free                       0.305 
_refine.ls_R_factor_R_free_error                 0.002 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 10.0 
_refine.ls_number_reflns_R_free                  34851 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               28.5 
_refine.aniso_B[1][1]                            7.30 
_refine.aniso_B[2][2]                            -10.6 
_refine.aniso_B[3][3]                            -1.31 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -0.95 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.20613 
_refine.solvent_model_param_bsol                 49.4499 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;Tight NCS restraints used throughout refinement. Structures of all monomers in the asymmetric unit restrained to be equivalent except for the following C. neoformans thymidylate synthase inserts: residues 13-16, 107-108 200-202. The following residues not present in the model: 1-12 for chains A-H and side chain of K107 in chains A and C, residues 1-15 and 200-202 in chains I-P.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2AAZ 
_refine_analyze.Luzzati_coordinate_error_obs    0.37 
_refine_analyze.Luzzati_sigma_a_obs             0.23 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.40 
_refine_analyze.Luzzati_sigma_a_free            0.26 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        38536 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         600 
_refine_hist.number_atoms_solvent             1212 
_refine_hist.number_atoms_total               40348 
_refine_hist.d_res_high                       2.08 
_refine_hist.d_res_low                        49.91 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        1.6   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 23.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.51  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it        1.70  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it       2.27  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it        2.76  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it       3.55  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   CONSTR 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.08 
_refine_ls_shell.d_res_low                        2.21 
_refine_ls_shell.number_reflns_R_work             50830 
_refine_ls_shell.R_factor_R_work                  0.332 
_refine_ls_shell.percent_reflns_obs               86.3 
_refine_ls_shell.R_factor_R_free                  0.348 
_refine_ls_shell.R_factor_R_free_error            0.005 
_refine_ls_shell.percent_reflns_R_free            10.2 
_refine_ls_shell.number_reflns_R_free             5778 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 protein_rep.param protein.top 'X-RAY DIFFRACTION' 
2 water_rep.param   water.top   'X-RAY DIFFRACTION' 
3 paramed.lig       ump_po4.top 'X-RAY DIFFRACTION' 
4 ?                 topo.cb3    'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.pdbx_ens_id   1 
_struct_ncs_dom.details       ? 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  2AAZ 
_struct.title                     'Cryptococcus neoformans thymidylate synthase complexed with substrate and an antifolate' 
_struct.pdbx_descriptor           'Thymidylate synthase (E.C.2.1.1.45)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AAZ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            'Methyl transferase, Nucleotide biosynthesis, Transferase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 2 ? 
R  N N 3 ? 
S  N N 2 ? 
T  N N 3 ? 
U  N N 2 ? 
V  N N 3 ? 
W  N N 2 ? 
X  N N 3 ? 
Y  N N 2 ? 
Z  N N 3 ? 
AA N N 2 ? 
BA N N 3 ? 
CA N N 2 ? 
DA N N 3 ? 
EA N N 2 ? 
FA N N 3 ? 
GA N N 2 ? 
HA N N 2 ? 
IA N N 2 ? 
JA N N 2 ? 
KA N N 2 ? 
LA N N 2 ? 
MA N N 2 ? 
NA N N 2 ? 
OA N N 4 ? 
PA N N 4 ? 
QA N N 4 ? 
RA N N 4 ? 
SA N N 4 ? 
TA N N 4 ? 
UA N N 4 ? 
VA N N 4 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;The biological assembly is a dimer. There are 8 dimers in the asymmetric unit and four of these dimers are 4-fold statistically disordered. Pairs of chains that constitute the four fully-occupied biological dimers are (A,B), (C,D), (E,F) and (G,H). Dimers that are in four 1/4-occupied packing arrangements in the cell are chains (I,J), (K,L), (M,N) and (O,P)
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLU A 19  ? GLY A 34  ? GLU A 19  GLY A 34  1 ? 16 
HELX_P HELX_P2   2   PHE A 72  ? GLY A 86  ? PHE A 72  GLY A 86  1 ? 15 
HELX_P HELX_P3   3   ALA A 90  ? SER A 95  ? ALA A 90  SER A 95  1 ? 6  
HELX_P HELX_P4   4   TRP A 101 ? SER A 106 ? TRP A 101 SER A 106 1 ? 6  
HELX_P HELX_P5   5   SER A 106 ? VAL A 113 ? SER A 106 VAL A 113 1 ? 8  
HELX_P HELX_P6   6   VAL A 126 ? PHE A 134 ? VAL A 126 PHE A 134 1 ? 9  
HELX_P HELX_P7   7   ASP A 151 ? ASN A 163 ? ASP A 151 ASN A 163 1 ? 13 
HELX_P HELX_P8   8   ASP A 178 ? MET A 182 ? ASP A 178 MET A 182 5 ? 5  
HELX_P HELX_P9   9   LEU A 222 ? ASP A 243 ? LEU A 222 ASP A 243 1 ? 22 
HELX_P HELX_P10  10  HIS A 262 ? GLU A 271 ? HIS A 262 GLU A 271 1 ? 10 
HELX_P HELX_P11  11  SER A 285 ? GLY A 290 ? SER A 285 GLY A 290 1 ? 6  
HELX_P HELX_P12  12  LYS A 296 ? GLU A 298 ? LYS A 296 GLU A 298 5 ? 3  
HELX_P HELX_P13  13  GLU B 19  ? GLY B 34  ? GLU B 19  GLY B 34  1 ? 16 
HELX_P HELX_P14  14  PHE B 72  ? GLY B 86  ? PHE B 72  GLY B 86  1 ? 15 
HELX_P HELX_P15  15  ALA B 90  ? SER B 95  ? ALA B 90  SER B 95  1 ? 6  
HELX_P HELX_P16  16  TRP B 101 ? SER B 106 ? TRP B 101 SER B 106 1 ? 6  
HELX_P HELX_P17  17  SER B 106 ? VAL B 113 ? SER B 106 VAL B 113 1 ? 8  
HELX_P HELX_P18  18  VAL B 126 ? PHE B 134 ? VAL B 126 PHE B 134 1 ? 9  
HELX_P HELX_P19  19  ASP B 151 ? ASN B 163 ? ASP B 151 ASN B 163 1 ? 13 
HELX_P HELX_P20  20  ASP B 178 ? MET B 182 ? ASP B 178 MET B 182 5 ? 5  
HELX_P HELX_P21  21  LEU B 222 ? ASP B 243 ? LEU B 222 ASP B 243 1 ? 22 
HELX_P HELX_P22  22  HIS B 262 ? GLU B 271 ? HIS B 262 GLU B 271 1 ? 10 
HELX_P HELX_P23  23  SER B 285 ? GLY B 290 ? SER B 285 GLY B 290 1 ? 6  
HELX_P HELX_P24  24  ASP B 291 ? PHE B 295 ? ASP B 291 PHE B 295 5 ? 5  
HELX_P HELX_P25  25  LYS B 296 ? GLU B 298 ? LYS B 296 GLU B 298 5 ? 3  
HELX_P HELX_P26  26  GLU C 19  ? GLY C 34  ? GLU C 19  GLY C 34  1 ? 16 
HELX_P HELX_P27  27  ALA C 59  ? THR C 62  ? ALA C 59  THR C 62  5 ? 4  
HELX_P HELX_P28  28  PHE C 72  ? GLY C 86  ? PHE C 72  GLY C 86  1 ? 15 
HELX_P HELX_P29  29  ALA C 90  ? SER C 95  ? ALA C 90  SER C 95  1 ? 6  
HELX_P HELX_P30  30  TRP C 101 ? SER C 106 ? TRP C 101 SER C 106 1 ? 6  
HELX_P HELX_P31  31  SER C 106 ? VAL C 113 ? SER C 106 VAL C 113 1 ? 8  
HELX_P HELX_P32  32  VAL C 126 ? PHE C 134 ? VAL C 126 PHE C 134 1 ? 9  
HELX_P HELX_P33  33  ASP C 151 ? ASN C 163 ? ASP C 151 ASN C 163 1 ? 13 
HELX_P HELX_P34  34  ASP C 178 ? MET C 182 ? ASP C 178 MET C 182 5 ? 5  
HELX_P HELX_P35  35  LEU C 222 ? ASP C 243 ? LEU C 222 ASP C 243 1 ? 22 
HELX_P HELX_P36  36  HIS C 262 ? GLU C 271 ? HIS C 262 GLU C 271 1 ? 10 
HELX_P HELX_P37  37  SER C 285 ? GLY C 290 ? SER C 285 GLY C 290 1 ? 6  
HELX_P HELX_P38  38  LYS C 296 ? GLU C 298 ? LYS C 296 GLU C 298 5 ? 3  
HELX_P HELX_P39  39  GLU D 19  ? GLY D 34  ? GLU D 19  GLY D 34  1 ? 16 
HELX_P HELX_P40  40  PHE D 72  ? GLY D 86  ? PHE D 72  GLY D 86  1 ? 15 
HELX_P HELX_P41  41  ALA D 90  ? SER D 95  ? ALA D 90  SER D 95  1 ? 6  
HELX_P HELX_P42  42  TRP D 101 ? SER D 106 ? TRP D 101 SER D 106 1 ? 6  
HELX_P HELX_P43  43  SER D 106 ? VAL D 113 ? SER D 106 VAL D 113 1 ? 8  
HELX_P HELX_P44  44  VAL D 126 ? PHE D 134 ? VAL D 126 PHE D 134 1 ? 9  
HELX_P HELX_P45  45  ASP D 151 ? ASN D 163 ? ASP D 151 ASN D 163 1 ? 13 
HELX_P HELX_P46  46  ASP D 178 ? MET D 182 ? ASP D 178 MET D 182 5 ? 5  
HELX_P HELX_P47  47  LEU D 222 ? ASP D 243 ? LEU D 222 ASP D 243 1 ? 22 
HELX_P HELX_P48  48  HIS D 262 ? GLU D 271 ? HIS D 262 GLU D 271 1 ? 10 
HELX_P HELX_P49  49  SER D 285 ? GLY D 290 ? SER D 285 GLY D 290 1 ? 6  
HELX_P HELX_P50  50  LYS D 296 ? GLU D 298 ? LYS D 296 GLU D 298 5 ? 3  
HELX_P HELX_P51  51  GLU E 19  ? GLY E 34  ? GLU E 19  GLY E 34  1 ? 16 
HELX_P HELX_P52  52  ALA E 59  ? THR E 62  ? ALA E 59  THR E 62  5 ? 4  
HELX_P HELX_P53  53  PHE E 72  ? SER E 85  ? PHE E 72  SER E 85  1 ? 14 
HELX_P HELX_P54  54  ALA E 90  ? SER E 95  ? ALA E 90  SER E 95  1 ? 6  
HELX_P HELX_P55  55  TRP E 101 ? SER E 106 ? TRP E 101 SER E 106 1 ? 6  
HELX_P HELX_P56  56  SER E 106 ? VAL E 113 ? SER E 106 VAL E 113 1 ? 8  
HELX_P HELX_P57  57  VAL E 126 ? PHE E 134 ? VAL E 126 PHE E 134 1 ? 9  
HELX_P HELX_P58  58  ASP E 151 ? ASN E 163 ? ASP E 151 ASN E 163 1 ? 13 
HELX_P HELX_P59  59  ASP E 178 ? MET E 182 ? ASP E 178 MET E 182 5 ? 5  
HELX_P HELX_P60  60  LEU E 222 ? ASP E 243 ? LEU E 222 ASP E 243 1 ? 22 
HELX_P HELX_P61  61  HIS E 262 ? GLU E 271 ? HIS E 262 GLU E 271 1 ? 10 
HELX_P HELX_P62  62  SER E 285 ? GLY E 290 ? SER E 285 GLY E 290 1 ? 6  
HELX_P HELX_P63  63  LYS E 296 ? GLU E 298 ? LYS E 296 GLU E 298 5 ? 3  
HELX_P HELX_P64  64  GLU F 19  ? GLY F 34  ? GLU F 19  GLY F 34  1 ? 16 
HELX_P HELX_P65  65  PHE F 72  ? GLY F 86  ? PHE F 72  GLY F 86  1 ? 15 
HELX_P HELX_P66  66  ALA F 90  ? SER F 95  ? ALA F 90  SER F 95  1 ? 6  
HELX_P HELX_P67  67  TRP F 101 ? SER F 106 ? TRP F 101 SER F 106 1 ? 6  
HELX_P HELX_P68  68  SER F 106 ? VAL F 113 ? SER F 106 VAL F 113 1 ? 8  
HELX_P HELX_P69  69  VAL F 126 ? PHE F 134 ? VAL F 126 PHE F 134 1 ? 9  
HELX_P HELX_P70  70  ASP F 151 ? ASN F 163 ? ASP F 151 ASN F 163 1 ? 13 
HELX_P HELX_P71  71  ASP F 178 ? MET F 182 ? ASP F 178 MET F 182 5 ? 5  
HELX_P HELX_P72  72  LEU F 222 ? ASP F 243 ? LEU F 222 ASP F 243 1 ? 22 
HELX_P HELX_P73  73  HIS F 262 ? GLU F 271 ? HIS F 262 GLU F 271 1 ? 10 
HELX_P HELX_P74  74  SER F 285 ? GLY F 290 ? SER F 285 GLY F 290 1 ? 6  
HELX_P HELX_P75  75  LYS F 296 ? GLU F 298 ? LYS F 296 GLU F 298 5 ? 3  
HELX_P HELX_P76  76  GLU G 19  ? GLY G 34  ? GLU G 19  GLY G 34  1 ? 16 
HELX_P HELX_P77  77  ALA G 59  ? THR G 62  ? ALA G 59  THR G 62  5 ? 4  
HELX_P HELX_P78  78  PHE G 72  ? GLY G 86  ? PHE G 72  GLY G 86  1 ? 15 
HELX_P HELX_P79  79  ALA G 90  ? SER G 95  ? ALA G 90  SER G 95  1 ? 6  
HELX_P HELX_P80  80  TRP G 101 ? SER G 106 ? TRP G 101 SER G 106 1 ? 6  
HELX_P HELX_P81  81  SER G 106 ? VAL G 113 ? SER G 106 VAL G 113 1 ? 8  
HELX_P HELX_P82  82  VAL G 126 ? PHE G 134 ? VAL G 126 PHE G 134 1 ? 9  
HELX_P HELX_P83  83  ASP G 151 ? ASN G 163 ? ASP G 151 ASN G 163 1 ? 13 
HELX_P HELX_P84  84  ASP G 178 ? MET G 182 ? ASP G 178 MET G 182 5 ? 5  
HELX_P HELX_P85  85  LEU G 222 ? ASP G 243 ? LEU G 222 ASP G 243 1 ? 22 
HELX_P HELX_P86  86  HIS G 262 ? GLU G 271 ? HIS G 262 GLU G 271 1 ? 10 
HELX_P HELX_P87  87  SER G 285 ? GLY G 290 ? SER G 285 GLY G 290 1 ? 6  
HELX_P HELX_P88  88  LYS G 296 ? GLU G 298 ? LYS G 296 GLU G 298 5 ? 3  
HELX_P HELX_P89  89  GLU H 19  ? GLY H 34  ? GLU H 19  GLY H 34  1 ? 16 
HELX_P HELX_P90  90  PHE H 72  ? GLY H 86  ? PHE H 72  GLY H 86  1 ? 15 
HELX_P HELX_P91  91  ALA H 90  ? SER H 95  ? ALA H 90  SER H 95  1 ? 6  
HELX_P HELX_P92  92  TRP H 101 ? SER H 106 ? TRP H 101 SER H 106 1 ? 6  
HELX_P HELX_P93  93  SER H 106 ? VAL H 113 ? SER H 106 VAL H 113 1 ? 8  
HELX_P HELX_P94  94  VAL H 126 ? PHE H 134 ? VAL H 126 PHE H 134 1 ? 9  
HELX_P HELX_P95  95  ASP H 151 ? ASN H 163 ? ASP H 151 ASN H 163 1 ? 13 
HELX_P HELX_P96  96  ASP H 178 ? MET H 182 ? ASP H 178 MET H 182 5 ? 5  
HELX_P HELX_P97  97  LEU H 222 ? THR H 242 ? LEU H 222 THR H 242 1 ? 21 
HELX_P HELX_P98  98  HIS H 262 ? GLU H 271 ? HIS H 262 GLU H 271 1 ? 10 
HELX_P HELX_P99  99  SER H 285 ? GLY H 290 ? SER H 285 GLY H 290 1 ? 6  
HELX_P HELX_P100 100 LYS H 296 ? GLU H 298 ? LYS H 296 GLU H 298 5 ? 3  
HELX_P HELX_P101 101 GLU I 19  ? GLY I 34  ? GLU I 19  GLY I 34  1 ? 16 
HELX_P HELX_P102 102 ALA I 59  ? THR I 62  ? ALA I 59  THR I 62  5 ? 4  
HELX_P HELX_P103 103 PHE I 72  ? GLY I 86  ? PHE I 72  GLY I 86  1 ? 15 
HELX_P HELX_P104 104 ALA I 90  ? SER I 95  ? ALA I 90  SER I 95  1 ? 6  
HELX_P HELX_P105 105 TRP I 101 ? SER I 106 ? TRP I 101 SER I 106 1 ? 6  
HELX_P HELX_P106 106 SER I 106 ? VAL I 113 ? SER I 106 VAL I 113 1 ? 8  
HELX_P HELX_P107 107 VAL I 126 ? PHE I 134 ? VAL I 126 PHE I 134 1 ? 9  
HELX_P HELX_P108 108 ASP I 151 ? ASN I 163 ? ASP I 151 ASN I 163 1 ? 13 
HELX_P HELX_P109 109 ASP I 178 ? MET I 182 ? ASP I 178 MET I 182 5 ? 5  
HELX_P HELX_P110 110 LEU I 222 ? ASP I 243 ? LEU I 222 ASP I 243 1 ? 22 
HELX_P HELX_P111 111 HIS I 262 ? GLU I 271 ? HIS I 262 GLU I 271 1 ? 10 
HELX_P HELX_P112 112 SER I 285 ? GLY I 290 ? SER I 285 GLY I 290 1 ? 6  
HELX_P HELX_P113 113 LYS I 296 ? GLU I 298 ? LYS I 296 GLU I 298 5 ? 3  
HELX_P HELX_P114 114 GLU J 19  ? GLY J 34  ? GLU J 19  GLY J 34  1 ? 16 
HELX_P HELX_P115 115 PHE J 72  ? GLY J 86  ? PHE J 72  GLY J 86  1 ? 15 
HELX_P HELX_P116 116 ALA J 90  ? SER J 95  ? ALA J 90  SER J 95  1 ? 6  
HELX_P HELX_P117 117 TRP J 101 ? SER J 106 ? TRP J 101 SER J 106 1 ? 6  
HELX_P HELX_P118 118 SER J 106 ? VAL J 113 ? SER J 106 VAL J 113 1 ? 8  
HELX_P HELX_P119 119 VAL J 126 ? PHE J 134 ? VAL J 126 PHE J 134 1 ? 9  
HELX_P HELX_P120 120 ASP J 151 ? ASN J 163 ? ASP J 151 ASN J 163 1 ? 13 
HELX_P HELX_P121 121 ASP J 178 ? MET J 182 ? ASP J 178 MET J 182 5 ? 5  
HELX_P HELX_P122 122 LEU J 222 ? ASP J 243 ? LEU J 222 ASP J 243 1 ? 22 
HELX_P HELX_P123 123 HIS J 262 ? GLU J 271 ? HIS J 262 GLU J 271 1 ? 10 
HELX_P HELX_P124 124 SER J 285 ? GLY J 290 ? SER J 285 GLY J 290 1 ? 6  
HELX_P HELX_P125 125 LYS J 296 ? GLU J 298 ? LYS J 296 GLU J 298 5 ? 3  
HELX_P HELX_P126 126 GLU K 19  ? GLY K 34  ? GLU K 19  GLY K 34  1 ? 16 
HELX_P HELX_P127 127 PHE K 72  ? GLY K 86  ? PHE K 72  GLY K 86  1 ? 15 
HELX_P HELX_P128 128 ALA K 90  ? SER K 95  ? ALA K 90  SER K 95  1 ? 6  
HELX_P HELX_P129 129 TRP K 101 ? SER K 106 ? TRP K 101 SER K 106 1 ? 6  
HELX_P HELX_P130 130 SER K 106 ? VAL K 113 ? SER K 106 VAL K 113 1 ? 8  
HELX_P HELX_P131 131 VAL K 126 ? PHE K 134 ? VAL K 126 PHE K 134 1 ? 9  
HELX_P HELX_P132 132 ASP K 151 ? ASN K 163 ? ASP K 151 ASN K 163 1 ? 13 
HELX_P HELX_P133 133 ASP K 178 ? MET K 182 ? ASP K 178 MET K 182 5 ? 5  
HELX_P HELX_P134 134 LEU K 222 ? ASP K 243 ? LEU K 222 ASP K 243 1 ? 22 
HELX_P HELX_P135 135 HIS K 262 ? GLU K 271 ? HIS K 262 GLU K 271 1 ? 10 
HELX_P HELX_P136 136 SER K 285 ? GLY K 290 ? SER K 285 GLY K 290 1 ? 6  
HELX_P HELX_P137 137 LYS K 296 ? GLU K 298 ? LYS K 296 GLU K 298 5 ? 3  
HELX_P HELX_P138 138 GLU L 19  ? GLY L 34  ? GLU L 19  GLY L 34  1 ? 16 
HELX_P HELX_P139 139 PHE L 72  ? GLY L 86  ? PHE L 72  GLY L 86  1 ? 15 
HELX_P HELX_P140 140 ALA L 90  ? SER L 95  ? ALA L 90  SER L 95  1 ? 6  
HELX_P HELX_P141 141 TRP L 101 ? SER L 106 ? TRP L 101 SER L 106 1 ? 6  
HELX_P HELX_P142 142 SER L 106 ? VAL L 113 ? SER L 106 VAL L 113 1 ? 8  
HELX_P HELX_P143 143 VAL L 126 ? PHE L 134 ? VAL L 126 PHE L 134 1 ? 9  
HELX_P HELX_P144 144 ASP L 151 ? ASN L 163 ? ASP L 151 ASN L 163 1 ? 13 
HELX_P HELX_P145 145 ASP L 178 ? MET L 182 ? ASP L 178 MET L 182 5 ? 5  
HELX_P HELX_P146 146 LEU L 222 ? ASP L 243 ? LEU L 222 ASP L 243 1 ? 22 
HELX_P HELX_P147 147 HIS L 262 ? GLU L 271 ? HIS L 262 GLU L 271 1 ? 10 
HELX_P HELX_P148 148 SER L 285 ? GLY L 290 ? SER L 285 GLY L 290 1 ? 6  
HELX_P HELX_P149 149 LYS L 296 ? GLU L 298 ? LYS L 296 GLU L 298 5 ? 3  
HELX_P HELX_P150 150 GLU M 19  ? GLY M 34  ? GLU M 19  GLY M 34  1 ? 16 
HELX_P HELX_P151 151 PHE M 72  ? GLY M 86  ? PHE M 72  GLY M 86  1 ? 15 
HELX_P HELX_P152 152 ALA M 90  ? SER M 95  ? ALA M 90  SER M 95  1 ? 6  
HELX_P HELX_P153 153 TRP M 101 ? SER M 106 ? TRP M 101 SER M 106 1 ? 6  
HELX_P HELX_P154 154 SER M 106 ? VAL M 113 ? SER M 106 VAL M 113 1 ? 8  
HELX_P HELX_P155 155 VAL M 126 ? PHE M 134 ? VAL M 126 PHE M 134 1 ? 9  
HELX_P HELX_P156 156 ASP M 151 ? ASN M 163 ? ASP M 151 ASN M 163 1 ? 13 
HELX_P HELX_P157 157 ASP M 178 ? MET M 182 ? ASP M 178 MET M 182 5 ? 5  
HELX_P HELX_P158 158 LEU M 222 ? ASP M 243 ? LEU M 222 ASP M 243 1 ? 22 
HELX_P HELX_P159 159 HIS M 262 ? GLU M 271 ? HIS M 262 GLU M 271 1 ? 10 
HELX_P HELX_P160 160 SER M 285 ? GLY M 290 ? SER M 285 GLY M 290 1 ? 6  
HELX_P HELX_P161 161 LYS M 296 ? GLU M 298 ? LYS M 296 GLU M 298 5 ? 3  
HELX_P HELX_P162 162 GLU N 19  ? GLY N 34  ? GLU N 19  GLY N 34  1 ? 16 
HELX_P HELX_P163 163 PHE N 72  ? GLY N 86  ? PHE N 72  GLY N 86  1 ? 15 
HELX_P HELX_P164 164 ALA N 90  ? SER N 95  ? ALA N 90  SER N 95  1 ? 6  
HELX_P HELX_P165 165 TRP N 101 ? SER N 106 ? TRP N 101 SER N 106 1 ? 6  
HELX_P HELX_P166 166 SER N 106 ? VAL N 113 ? SER N 106 VAL N 113 1 ? 8  
HELX_P HELX_P167 167 VAL N 126 ? PHE N 134 ? VAL N 126 PHE N 134 1 ? 9  
HELX_P HELX_P168 168 ASP N 151 ? ASN N 163 ? ASP N 151 ASN N 163 1 ? 13 
HELX_P HELX_P169 169 ASP N 178 ? MET N 182 ? ASP N 178 MET N 182 5 ? 5  
HELX_P HELX_P170 170 LEU N 222 ? ASP N 243 ? LEU N 222 ASP N 243 1 ? 22 
HELX_P HELX_P171 171 HIS N 262 ? GLU N 271 ? HIS N 262 GLU N 271 1 ? 10 
HELX_P HELX_P172 172 SER N 285 ? GLY N 290 ? SER N 285 GLY N 290 1 ? 6  
HELX_P HELX_P173 173 LYS N 296 ? GLU N 298 ? LYS N 296 GLU N 298 5 ? 3  
HELX_P HELX_P174 174 GLU O 19  ? GLY O 34  ? GLU O 19  GLY O 34  1 ? 16 
HELX_P HELX_P175 175 PHE O 72  ? GLY O 86  ? PHE O 72  GLY O 86  1 ? 15 
HELX_P HELX_P176 176 ALA O 90  ? SER O 95  ? ALA O 90  SER O 95  1 ? 6  
HELX_P HELX_P177 177 TRP O 101 ? SER O 106 ? TRP O 101 SER O 106 1 ? 6  
HELX_P HELX_P178 178 SER O 106 ? VAL O 113 ? SER O 106 VAL O 113 1 ? 8  
HELX_P HELX_P179 179 VAL O 126 ? PHE O 134 ? VAL O 126 PHE O 134 1 ? 9  
HELX_P HELX_P180 180 ASP O 151 ? ASN O 163 ? ASP O 151 ASN O 163 1 ? 13 
HELX_P HELX_P181 181 ASP O 178 ? MET O 182 ? ASP O 178 MET O 182 5 ? 5  
HELX_P HELX_P182 182 LEU O 222 ? ASP O 243 ? LEU O 222 ASP O 243 1 ? 22 
HELX_P HELX_P183 183 HIS O 262 ? GLU O 271 ? HIS O 262 GLU O 271 1 ? 10 
HELX_P HELX_P184 184 SER O 285 ? GLY O 290 ? SER O 285 GLY O 290 1 ? 6  
HELX_P HELX_P185 185 LYS O 296 ? GLU O 298 ? LYS O 296 GLU O 298 5 ? 3  
HELX_P HELX_P186 186 GLU P 19  ? GLY P 34  ? GLU P 19  GLY P 34  1 ? 16 
HELX_P HELX_P187 187 ALA P 59  ? THR P 62  ? ALA P 59  THR P 62  5 ? 4  
HELX_P HELX_P188 188 PHE P 72  ? GLY P 86  ? PHE P 72  GLY P 86  1 ? 15 
HELX_P HELX_P189 189 ALA P 90  ? SER P 95  ? ALA P 90  SER P 95  1 ? 6  
HELX_P HELX_P190 190 TRP P 101 ? SER P 106 ? TRP P 101 SER P 106 1 ? 6  
HELX_P HELX_P191 191 SER P 106 ? VAL P 113 ? SER P 106 VAL P 113 1 ? 8  
HELX_P HELX_P192 192 VAL P 126 ? PHE P 134 ? VAL P 126 PHE P 134 1 ? 9  
HELX_P HELX_P193 193 ASP P 151 ? ASN P 163 ? ASP P 151 ASN P 163 1 ? 13 
HELX_P HELX_P194 194 ASP P 178 ? MET P 182 ? ASP P 178 MET P 182 5 ? 5  
HELX_P HELX_P195 195 LEU P 222 ? ASP P 243 ? LEU P 222 ASP P 243 1 ? 22 
HELX_P HELX_P196 196 HIS P 262 ? GLU P 271 ? HIS P 262 GLU P 271 1 ? 10 
HELX_P HELX_P197 197 SER P 285 ? GLY P 290 ? SER P 285 GLY P 290 1 ? 6  
HELX_P HELX_P198 198 LYS P 296 ? GLU P 298 ? LYS P 296 GLU P 298 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A CYS 187 SG A ? ? 1_555 Q  UMP . C6 A ? A CYS 187 A UMP 350 1_555 ? ? ? ? ? ? ? 1.830 ? 
covale2  covale ? ? B CYS 187 SG A ? ? 1_555 S  UMP . C6 A ? B CYS 187 B UMP 400 1_555 ? ? ? ? ? ? ? 1.856 ? 
covale3  covale ? ? C CYS 187 SG A ? ? 1_555 U  UMP . C6 A ? C CYS 187 C UMP 450 1_555 ? ? ? ? ? ? ? 1.853 ? 
covale4  covale ? ? D CYS 187 SG A ? ? 1_555 W  UMP . C6 A ? D CYS 187 D UMP 500 1_555 ? ? ? ? ? ? ? 1.852 ? 
covale5  covale ? ? E CYS 187 SG A ? ? 1_555 Y  UMP . C6 A ? E CYS 187 E UMP 550 1_555 ? ? ? ? ? ? ? 1.875 ? 
covale6  covale ? ? F CYS 187 SG A ? ? 1_555 AA UMP . C6 A ? F CYS 187 F UMP 600 1_555 ? ? ? ? ? ? ? 1.827 ? 
covale7  covale ? ? G CYS 187 SG A ? ? 1_555 CA UMP . C6 A ? G CYS 187 G UMP 650 1_555 ? ? ? ? ? ? ? 1.848 ? 
covale8  covale ? ? H CYS 187 SG A ? ? 1_555 EA UMP . C6 A ? H CYS 187 H UMP 700 1_555 ? ? ? ? ? ? ? 1.873 ? 
covale9  covale ? ? I CYS 187 SG A ? ? 1_555 GA UMP . C6 A ? I CYS 187 I UMP 350 1_555 ? ? ? ? ? ? ? 1.815 ? 
covale10 covale ? ? J CYS 187 SG A ? ? 1_555 HA UMP . C6 A ? J CYS 187 J UMP 400 1_555 ? ? ? ? ? ? ? 1.817 ? 
covale11 covale ? ? K CYS 187 SG A ? ? 1_555 IA UMP . C6 A ? K CYS 187 K UMP 450 1_555 ? ? ? ? ? ? ? 1.810 ? 
covale12 covale ? ? L CYS 187 SG A ? ? 1_555 JA UMP . C6 A ? L CYS 187 L UMP 500 1_555 ? ? ? ? ? ? ? 1.817 ? 
covale13 covale ? ? M CYS 187 SG A ? ? 1_555 KA UMP . C6 A ? M CYS 187 M UMP 550 1_555 ? ? ? ? ? ? ? 1.804 ? 
covale14 covale ? ? N CYS 187 SG A ? ? 1_555 LA UMP . C6 A ? N CYS 187 N UMP 600 1_555 ? ? ? ? ? ? ? 1.810 ? 
covale15 covale ? ? O CYS 187 SG A ? ? 1_555 MA UMP . C6 A ? O CYS 187 O UMP 650 1_555 ? ? ? ? ? ? ? 1.836 ? 
covale16 covale ? ? P CYS 187 SG A ? ? 1_555 NA UMP . C6 A ? P CYS 187 P UMP 700 1_555 ? ? ? ? ? ? ? 1.820 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A  ? 4 ? 
B  ? 6 ? 
C  ? 2 ? 
D  ? 4 ? 
E  ? 6 ? 
F  ? 2 ? 
G  ? 4 ? 
H  ? 6 ? 
I  ? 2 ? 
J  ? 4 ? 
K  ? 6 ? 
L  ? 2 ? 
M  ? 4 ? 
N  ? 6 ? 
O  ? 2 ? 
P  ? 4 ? 
Q  ? 6 ? 
R  ? 2 ? 
S  ? 4 ? 
T  ? 6 ? 
U  ? 2 ? 
V  ? 4 ? 
W  ? 6 ? 
X  ? 2 ? 
Y  ? 4 ? 
Z  ? 6 ? 
AA ? 2 ? 
AB ? 4 ? 
AC ? 6 ? 
AD ? 2 ? 
AE ? 4 ? 
AF ? 6 ? 
AG ? 2 ? 
AH ? 4 ? 
AI ? 6 ? 
AJ ? 2 ? 
AK ? 4 ? 
AL ? 6 ? 
AM ? 2 ? 
AN ? 4 ? 
AO ? 6 ? 
AP ? 2 ? 
AQ ? 4 ? 
AR ? 6 ? 
AS ? 2 ? 
AT ? 4 ? 
AU ? 6 ? 
AV ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A  1 2 ? anti-parallel 
A  2 3 ? anti-parallel 
A  3 4 ? anti-parallel 
B  1 2 ? anti-parallel 
B  2 3 ? anti-parallel 
B  3 4 ? parallel      
B  4 5 ? anti-parallel 
B  5 6 ? anti-parallel 
C  1 2 ? anti-parallel 
D  1 2 ? anti-parallel 
D  2 3 ? anti-parallel 
D  3 4 ? anti-parallel 
E  1 2 ? anti-parallel 
E  2 3 ? anti-parallel 
E  3 4 ? parallel      
E  4 5 ? anti-parallel 
E  5 6 ? anti-parallel 
F  1 2 ? anti-parallel 
G  1 2 ? anti-parallel 
G  2 3 ? anti-parallel 
G  3 4 ? anti-parallel 
H  1 2 ? anti-parallel 
H  2 3 ? anti-parallel 
H  3 4 ? parallel      
H  4 5 ? anti-parallel 
H  5 6 ? anti-parallel 
I  1 2 ? anti-parallel 
J  1 2 ? anti-parallel 
J  2 3 ? anti-parallel 
J  3 4 ? anti-parallel 
K  1 2 ? anti-parallel 
K  2 3 ? anti-parallel 
K  3 4 ? parallel      
K  4 5 ? anti-parallel 
K  5 6 ? anti-parallel 
L  1 2 ? anti-parallel 
M  1 2 ? anti-parallel 
M  2 3 ? anti-parallel 
M  3 4 ? anti-parallel 
N  1 2 ? anti-parallel 
N  2 3 ? anti-parallel 
N  3 4 ? parallel      
N  4 5 ? anti-parallel 
N  5 6 ? anti-parallel 
O  1 2 ? anti-parallel 
P  1 2 ? anti-parallel 
P  2 3 ? anti-parallel 
P  3 4 ? anti-parallel 
Q  1 2 ? anti-parallel 
Q  2 3 ? anti-parallel 
Q  3 4 ? parallel      
Q  4 5 ? anti-parallel 
Q  5 6 ? anti-parallel 
R  1 2 ? anti-parallel 
S  1 2 ? anti-parallel 
S  2 3 ? anti-parallel 
S  3 4 ? anti-parallel 
T  1 2 ? anti-parallel 
T  2 3 ? anti-parallel 
T  3 4 ? parallel      
T  4 5 ? anti-parallel 
T  5 6 ? anti-parallel 
U  1 2 ? anti-parallel 
V  1 2 ? anti-parallel 
V  2 3 ? anti-parallel 
V  3 4 ? anti-parallel 
W  1 2 ? anti-parallel 
W  2 3 ? anti-parallel 
W  3 4 ? parallel      
W  4 5 ? anti-parallel 
W  5 6 ? anti-parallel 
X  1 2 ? anti-parallel 
Y  1 2 ? anti-parallel 
Y  2 3 ? anti-parallel 
Y  3 4 ? anti-parallel 
Z  1 2 ? anti-parallel 
Z  2 3 ? anti-parallel 
Z  3 4 ? parallel      
Z  4 5 ? anti-parallel 
Z  5 6 ? anti-parallel 
AA 1 2 ? anti-parallel 
AB 1 2 ? anti-parallel 
AB 2 3 ? anti-parallel 
AB 3 4 ? anti-parallel 
AC 1 2 ? anti-parallel 
AC 2 3 ? anti-parallel 
AC 3 4 ? parallel      
AC 4 5 ? anti-parallel 
AC 5 6 ? anti-parallel 
AD 1 2 ? anti-parallel 
AE 1 2 ? anti-parallel 
AE 2 3 ? anti-parallel 
AE 3 4 ? anti-parallel 
AF 1 2 ? anti-parallel 
AF 2 3 ? anti-parallel 
AF 3 4 ? parallel      
AF 4 5 ? anti-parallel 
AF 5 6 ? anti-parallel 
AG 1 2 ? anti-parallel 
AH 1 2 ? anti-parallel 
AH 2 3 ? anti-parallel 
AH 3 4 ? anti-parallel 
AI 1 2 ? anti-parallel 
AI 2 3 ? anti-parallel 
AI 3 4 ? parallel      
AI 4 5 ? anti-parallel 
AI 5 6 ? anti-parallel 
AJ 1 2 ? anti-parallel 
AK 1 2 ? anti-parallel 
AK 2 3 ? anti-parallel 
AK 3 4 ? anti-parallel 
AL 1 2 ? anti-parallel 
AL 2 3 ? anti-parallel 
AL 3 4 ? parallel      
AL 4 5 ? anti-parallel 
AL 5 6 ? anti-parallel 
AM 1 2 ? anti-parallel 
AN 1 2 ? anti-parallel 
AN 2 3 ? anti-parallel 
AN 3 4 ? anti-parallel 
AO 1 2 ? anti-parallel 
AO 2 3 ? anti-parallel 
AO 3 4 ? parallel      
AO 4 5 ? anti-parallel 
AO 5 6 ? anti-parallel 
AP 1 2 ? anti-parallel 
AQ 1 2 ? anti-parallel 
AQ 2 3 ? anti-parallel 
AQ 3 4 ? anti-parallel 
AR 1 2 ? anti-parallel 
AR 2 3 ? anti-parallel 
AR 3 4 ? parallel      
AR 4 5 ? anti-parallel 
AR 5 6 ? anti-parallel 
AS 1 2 ? anti-parallel 
AT 1 2 ? anti-parallel 
AT 2 3 ? anti-parallel 
AT 3 4 ? anti-parallel 
AU 1 2 ? anti-parallel 
AU 2 3 ? anti-parallel 
AU 3 4 ? parallel      
AU 4 5 ? anti-parallel 
AU 5 6 ? anti-parallel 
AV 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A  1 GLU A 35  ? ARG A 37  ? GLU A 35  ARG A 37  
A  2 THR A 45  ? PHE A 49  ? THR A 45  PHE A 49  
A  3 GLU A 245 ? TYR A 259 ? GLU A 245 TYR A 259 
A  4 PHE A 54  ? SER A 57  ? PHE A 54  SER A 57  
B  1 GLU A 35  ? ARG A 37  ? GLU A 35  ARG A 37  
B  2 THR A 45  ? PHE A 49  ? THR A 45  PHE A 49  
B  3 GLU A 245 ? TYR A 259 ? GLU A 245 TYR A 259 
B  4 LYS A 208 ? ASP A 219 ? LYS A 208 ASP A 219 
B  5 HIS A 188 ? SER A 196 ? HIS A 188 SER A 196 
B  6 ILE A 170 ? SER A 172 ? ILE A 170 SER A 172 
C  1 LYS A 279 ? TRP A 282 ? LYS A 279 TRP A 282 
C  2 PHE A 300 ? GLU A 303 ? PHE A 300 GLU A 303 
D  1 GLU B 35  ? ARG B 37  ? GLU B 35  ARG B 37  
D  2 THR B 45  ? PHE B 49  ? THR B 45  PHE B 49  
D  3 GLU B 245 ? TYR B 259 ? GLU B 245 TYR B 259 
D  4 PHE B 54  ? SER B 57  ? PHE B 54  SER B 57  
E  1 GLU B 35  ? ARG B 37  ? GLU B 35  ARG B 37  
E  2 THR B 45  ? PHE B 49  ? THR B 45  PHE B 49  
E  3 GLU B 245 ? TYR B 259 ? GLU B 245 TYR B 259 
E  4 LYS B 208 ? ASP B 219 ? LYS B 208 ASP B 219 
E  5 HIS B 188 ? SER B 196 ? HIS B 188 SER B 196 
E  6 ILE B 170 ? SER B 172 ? ILE B 170 SER B 172 
F  1 LYS B 279 ? TRP B 282 ? LYS B 279 TRP B 282 
F  2 PHE B 300 ? GLU B 303 ? PHE B 300 GLU B 303 
G  1 GLU C 35  ? ARG C 37  ? GLU C 35  ARG C 37  
G  2 THR C 45  ? PHE C 49  ? THR C 45  PHE C 49  
G  3 GLU C 245 ? TYR C 259 ? GLU C 245 TYR C 259 
G  4 PHE C 54  ? SER C 57  ? PHE C 54  SER C 57  
H  1 GLU C 35  ? ARG C 37  ? GLU C 35  ARG C 37  
H  2 THR C 45  ? PHE C 49  ? THR C 45  PHE C 49  
H  3 GLU C 245 ? TYR C 259 ? GLU C 245 TYR C 259 
H  4 LYS C 208 ? ASP C 219 ? LYS C 208 ASP C 219 
H  5 HIS C 188 ? SER C 196 ? HIS C 188 SER C 196 
H  6 ILE C 170 ? SER C 172 ? ILE C 170 SER C 172 
I  1 LYS C 279 ? TRP C 282 ? LYS C 279 TRP C 282 
I  2 PHE C 300 ? GLU C 303 ? PHE C 300 GLU C 303 
J  1 GLU D 35  ? ARG D 37  ? GLU D 35  ARG D 37  
J  2 THR D 45  ? PHE D 49  ? THR D 45  PHE D 49  
J  3 GLU D 245 ? TYR D 259 ? GLU D 245 TYR D 259 
J  4 PHE D 54  ? SER D 57  ? PHE D 54  SER D 57  
K  1 GLU D 35  ? ARG D 37  ? GLU D 35  ARG D 37  
K  2 THR D 45  ? PHE D 49  ? THR D 45  PHE D 49  
K  3 GLU D 245 ? TYR D 259 ? GLU D 245 TYR D 259 
K  4 LYS D 208 ? ASP D 219 ? LYS D 208 ASP D 219 
K  5 HIS D 188 ? SER D 196 ? HIS D 188 SER D 196 
K  6 ILE D 170 ? SER D 172 ? ILE D 170 SER D 172 
L  1 LYS D 279 ? TRP D 282 ? LYS D 279 TRP D 282 
L  2 PHE D 300 ? GLU D 303 ? PHE D 300 GLU D 303 
M  1 GLU E 35  ? ARG E 37  ? GLU E 35  ARG E 37  
M  2 THR E 45  ? PHE E 49  ? THR E 45  PHE E 49  
M  3 GLU E 245 ? TYR E 259 ? GLU E 245 TYR E 259 
M  4 PHE E 54  ? SER E 57  ? PHE E 54  SER E 57  
N  1 GLU E 35  ? ARG E 37  ? GLU E 35  ARG E 37  
N  2 THR E 45  ? PHE E 49  ? THR E 45  PHE E 49  
N  3 GLU E 245 ? TYR E 259 ? GLU E 245 TYR E 259 
N  4 LYS E 208 ? ASP E 219 ? LYS E 208 ASP E 219 
N  5 HIS E 188 ? SER E 196 ? HIS E 188 SER E 196 
N  6 ILE E 170 ? SER E 172 ? ILE E 170 SER E 172 
O  1 LYS E 279 ? TRP E 282 ? LYS E 279 TRP E 282 
O  2 PHE E 300 ? GLU E 303 ? PHE E 300 GLU E 303 
P  1 GLU F 35  ? ARG F 37  ? GLU F 35  ARG F 37  
P  2 THR F 45  ? PHE F 49  ? THR F 45  PHE F 49  
P  3 GLU F 245 ? TYR F 259 ? GLU F 245 TYR F 259 
P  4 PHE F 54  ? SER F 57  ? PHE F 54  SER F 57  
Q  1 GLU F 35  ? ARG F 37  ? GLU F 35  ARG F 37  
Q  2 THR F 45  ? PHE F 49  ? THR F 45  PHE F 49  
Q  3 GLU F 245 ? TYR F 259 ? GLU F 245 TYR F 259 
Q  4 LYS F 208 ? ASP F 219 ? LYS F 208 ASP F 219 
Q  5 HIS F 188 ? SER F 196 ? HIS F 188 SER F 196 
Q  6 ILE F 170 ? SER F 172 ? ILE F 170 SER F 172 
R  1 LYS F 279 ? TRP F 282 ? LYS F 279 TRP F 282 
R  2 PHE F 300 ? GLU F 303 ? PHE F 300 GLU F 303 
S  1 GLU G 35  ? ARG G 37  ? GLU G 35  ARG G 37  
S  2 THR G 45  ? PHE G 49  ? THR G 45  PHE G 49  
S  3 GLU G 245 ? TYR G 259 ? GLU G 245 TYR G 259 
S  4 PHE G 54  ? SER G 57  ? PHE G 54  SER G 57  
T  1 GLU G 35  ? ARG G 37  ? GLU G 35  ARG G 37  
T  2 THR G 45  ? PHE G 49  ? THR G 45  PHE G 49  
T  3 GLU G 245 ? TYR G 259 ? GLU G 245 TYR G 259 
T  4 LYS G 208 ? ASP G 219 ? LYS G 208 ASP G 219 
T  5 HIS G 188 ? SER G 196 ? HIS G 188 SER G 196 
T  6 ILE G 170 ? SER G 172 ? ILE G 170 SER G 172 
U  1 LYS G 279 ? TRP G 282 ? LYS G 279 TRP G 282 
U  2 PHE G 300 ? GLU G 303 ? PHE G 300 GLU G 303 
V  1 GLU H 35  ? ARG H 37  ? GLU H 35  ARG H 37  
V  2 THR H 45  ? PHE H 49  ? THR H 45  PHE H 49  
V  3 GLU H 245 ? TYR H 259 ? GLU H 245 TYR H 259 
V  4 PHE H 54  ? SER H 57  ? PHE H 54  SER H 57  
W  1 GLU H 35  ? ARG H 37  ? GLU H 35  ARG H 37  
W  2 THR H 45  ? PHE H 49  ? THR H 45  PHE H 49  
W  3 GLU H 245 ? TYR H 259 ? GLU H 245 TYR H 259 
W  4 LYS H 208 ? ASP H 219 ? LYS H 208 ASP H 219 
W  5 HIS H 188 ? SER H 196 ? HIS H 188 SER H 196 
W  6 ILE H 170 ? SER H 172 ? ILE H 170 SER H 172 
X  1 LYS H 279 ? TRP H 282 ? LYS H 279 TRP H 282 
X  2 PHE H 300 ? GLU H 303 ? PHE H 300 GLU H 303 
Y  1 GLU I 35  ? ARG I 37  ? GLU I 35  ARG I 37  
Y  2 THR I 45  ? PHE I 49  ? THR I 45  PHE I 49  
Y  3 GLU I 245 ? TYR I 259 ? GLU I 245 TYR I 259 
Y  4 PHE I 54  ? SER I 57  ? PHE I 54  SER I 57  
Z  1 GLU I 35  ? ARG I 37  ? GLU I 35  ARG I 37  
Z  2 THR I 45  ? PHE I 49  ? THR I 45  PHE I 49  
Z  3 GLU I 245 ? TYR I 259 ? GLU I 245 TYR I 259 
Z  4 LYS I 208 ? ASP I 219 ? LYS I 208 ASP I 219 
Z  5 HIS I 188 ? SER I 196 ? HIS I 188 SER I 196 
Z  6 ILE I 170 ? SER I 172 ? ILE I 170 SER I 172 
AA 1 LYS I 279 ? TRP I 282 ? LYS I 279 TRP I 282 
AA 2 PHE I 300 ? GLU I 303 ? PHE I 300 GLU I 303 
AB 1 GLU J 35  ? ARG J 37  ? GLU J 35  ARG J 37  
AB 2 THR J 45  ? PHE J 49  ? THR J 45  PHE J 49  
AB 3 GLU J 245 ? TYR J 259 ? GLU J 245 TYR J 259 
AB 4 PHE J 54  ? SER J 57  ? PHE J 54  SER J 57  
AC 1 GLU J 35  ? ARG J 37  ? GLU J 35  ARG J 37  
AC 2 THR J 45  ? PHE J 49  ? THR J 45  PHE J 49  
AC 3 GLU J 245 ? TYR J 259 ? GLU J 245 TYR J 259 
AC 4 LYS J 208 ? ASP J 219 ? LYS J 208 ASP J 219 
AC 5 HIS J 188 ? SER J 196 ? HIS J 188 SER J 196 
AC 6 ILE J 170 ? SER J 172 ? ILE J 170 SER J 172 
AD 1 LYS J 279 ? TRP J 282 ? LYS J 279 TRP J 282 
AD 2 PHE J 300 ? GLU J 303 ? PHE J 300 GLU J 303 
AE 1 GLU K 35  ? ARG K 37  ? GLU K 35  ARG K 37  
AE 2 THR K 45  ? PHE K 49  ? THR K 45  PHE K 49  
AE 3 GLU K 245 ? TYR K 259 ? GLU K 245 TYR K 259 
AE 4 PHE K 54  ? SER K 57  ? PHE K 54  SER K 57  
AF 1 GLU K 35  ? ARG K 37  ? GLU K 35  ARG K 37  
AF 2 THR K 45  ? PHE K 49  ? THR K 45  PHE K 49  
AF 3 GLU K 245 ? TYR K 259 ? GLU K 245 TYR K 259 
AF 4 LYS K 208 ? ASP K 219 ? LYS K 208 ASP K 219 
AF 5 HIS K 188 ? SER K 196 ? HIS K 188 SER K 196 
AF 6 ILE K 170 ? SER K 172 ? ILE K 170 SER K 172 
AG 1 LYS K 279 ? TRP K 282 ? LYS K 279 TRP K 282 
AG 2 PHE K 300 ? GLU K 303 ? PHE K 300 GLU K 303 
AH 1 GLU L 35  ? ARG L 37  ? GLU L 35  ARG L 37  
AH 2 THR L 45  ? PHE L 49  ? THR L 45  PHE L 49  
AH 3 GLU L 245 ? TYR L 259 ? GLU L 245 TYR L 259 
AH 4 PHE L 54  ? SER L 57  ? PHE L 54  SER L 57  
AI 1 GLU L 35  ? ARG L 37  ? GLU L 35  ARG L 37  
AI 2 THR L 45  ? PHE L 49  ? THR L 45  PHE L 49  
AI 3 GLU L 245 ? TYR L 259 ? GLU L 245 TYR L 259 
AI 4 LYS L 208 ? ASP L 219 ? LYS L 208 ASP L 219 
AI 5 HIS L 188 ? SER L 196 ? HIS L 188 SER L 196 
AI 6 ILE L 170 ? SER L 172 ? ILE L 170 SER L 172 
AJ 1 LYS L 279 ? TRP L 282 ? LYS L 279 TRP L 282 
AJ 2 PHE L 300 ? GLU L 303 ? PHE L 300 GLU L 303 
AK 1 GLU M 35  ? ARG M 37  ? GLU M 35  ARG M 37  
AK 2 THR M 45  ? PHE M 49  ? THR M 45  PHE M 49  
AK 3 GLU M 245 ? TYR M 259 ? GLU M 245 TYR M 259 
AK 4 PHE M 54  ? SER M 57  ? PHE M 54  SER M 57  
AL 1 GLU M 35  ? ARG M 37  ? GLU M 35  ARG M 37  
AL 2 THR M 45  ? PHE M 49  ? THR M 45  PHE M 49  
AL 3 GLU M 245 ? TYR M 259 ? GLU M 245 TYR M 259 
AL 4 LYS M 208 ? ASP M 219 ? LYS M 208 ASP M 219 
AL 5 HIS M 188 ? SER M 196 ? HIS M 188 SER M 196 
AL 6 ILE M 170 ? SER M 172 ? ILE M 170 SER M 172 
AM 1 LYS M 279 ? TRP M 282 ? LYS M 279 TRP M 282 
AM 2 PHE M 300 ? GLU M 303 ? PHE M 300 GLU M 303 
AN 1 GLU N 35  ? ARG N 37  ? GLU N 35  ARG N 37  
AN 2 THR N 45  ? PHE N 49  ? THR N 45  PHE N 49  
AN 3 GLU N 245 ? TYR N 259 ? GLU N 245 TYR N 259 
AN 4 PHE N 54  ? SER N 57  ? PHE N 54  SER N 57  
AO 1 GLU N 35  ? ARG N 37  ? GLU N 35  ARG N 37  
AO 2 THR N 45  ? PHE N 49  ? THR N 45  PHE N 49  
AO 3 GLU N 245 ? TYR N 259 ? GLU N 245 TYR N 259 
AO 4 LYS N 208 ? ASP N 219 ? LYS N 208 ASP N 219 
AO 5 HIS N 188 ? SER N 196 ? HIS N 188 SER N 196 
AO 6 ILE N 170 ? SER N 172 ? ILE N 170 SER N 172 
AP 1 LYS N 279 ? TRP N 282 ? LYS N 279 TRP N 282 
AP 2 PHE N 300 ? GLU N 303 ? PHE N 300 GLU N 303 
AQ 1 GLU O 35  ? ARG O 37  ? GLU O 35  ARG O 37  
AQ 2 THR O 45  ? PHE O 49  ? THR O 45  PHE O 49  
AQ 3 GLU O 245 ? TYR O 259 ? GLU O 245 TYR O 259 
AQ 4 PHE O 54  ? SER O 57  ? PHE O 54  SER O 57  
AR 1 GLU O 35  ? ARG O 37  ? GLU O 35  ARG O 37  
AR 2 THR O 45  ? PHE O 49  ? THR O 45  PHE O 49  
AR 3 GLU O 245 ? TYR O 259 ? GLU O 245 TYR O 259 
AR 4 LYS O 208 ? ASP O 219 ? LYS O 208 ASP O 219 
AR 5 HIS O 188 ? SER O 196 ? HIS O 188 SER O 196 
AR 6 ILE O 170 ? SER O 172 ? ILE O 170 SER O 172 
AS 1 LYS O 279 ? TRP O 282 ? LYS O 279 TRP O 282 
AS 2 PHE O 300 ? GLU O 303 ? PHE O 300 GLU O 303 
AT 1 GLU P 35  ? ARG P 37  ? GLU P 35  ARG P 37  
AT 2 THR P 45  ? PHE P 49  ? THR P 45  PHE P 49  
AT 3 GLU P 245 ? TYR P 259 ? GLU P 245 TYR P 259 
AT 4 PHE P 54  ? SER P 57  ? PHE P 54  SER P 57  
AU 1 GLU P 35  ? ARG P 37  ? GLU P 35  ARG P 37  
AU 2 THR P 45  ? PHE P 49  ? THR P 45  PHE P 49  
AU 3 GLU P 245 ? TYR P 259 ? GLU P 245 TYR P 259 
AU 4 LYS P 208 ? ASP P 219 ? LYS P 208 ASP P 219 
AU 5 HIS P 188 ? SER P 196 ? HIS P 188 SER P 196 
AU 6 ILE P 170 ? SER P 172 ? ILE P 170 SER P 172 
AV 1 LYS P 279 ? TRP P 282 ? LYS P 279 TRP P 282 
AV 2 PHE P 300 ? GLU P 303 ? PHE P 300 GLU P 303 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A  1 2 N ARG A 37  ? N ARG A 37  O THR A 45  ? O THR A 45  
A  2 3 N VAL A 46  ? N VAL A 46  O VAL A 258 ? O VAL A 258 
A  3 4 O PHE A 249 ? O PHE A 249 N PHE A 56  ? N PHE A 56  
B  1 2 N ARG A 37  ? N ARG A 37  O THR A 45  ? O THR A 45  
B  2 3 N VAL A 46  ? N VAL A 46  O VAL A 258 ? O VAL A 258 
B  3 4 O ILE A 250 ? O ILE A 250 N CYS A 211 ? N CYS A 211 
B  4 5 O SER A 210 ? O SER A 210 N PHE A 194 ? N PHE A 194 
B  5 6 O CYS A 191 ? O CYS A 191 N LEU A 171 ? N LEU A 171 
C  1 2 N LYS A 281 ? N LYS A 281 O VAL A 301 ? O VAL A 301 
D  1 2 N ARG B 37  ? N ARG B 37  O THR B 45  ? O THR B 45  
D  2 3 N VAL B 46  ? N VAL B 46  O VAL B 258 ? O VAL B 258 
D  3 4 O PHE B 249 ? O PHE B 249 N PHE B 56  ? N PHE B 56  
E  1 2 N ARG B 37  ? N ARG B 37  O THR B 45  ? O THR B 45  
E  2 3 N VAL B 46  ? N VAL B 46  O VAL B 258 ? O VAL B 258 
E  3 4 O HIS B 247 ? O HIS B 247 N LEU B 209 ? N LEU B 209 
E  4 5 O SER B 210 ? O SER B 210 N PHE B 194 ? N PHE B 194 
E  5 6 O CYS B 191 ? O CYS B 191 N LEU B 171 ? N LEU B 171 
F  1 2 N LYS B 281 ? N LYS B 281 O VAL B 301 ? O VAL B 301 
G  1 2 N ARG C 37  ? N ARG C 37  O THR C 45  ? O THR C 45  
G  2 3 N VAL C 46  ? N VAL C 46  O VAL C 258 ? O VAL C 258 
G  3 4 O PHE C 249 ? O PHE C 249 N PHE C 56  ? N PHE C 56  
H  1 2 N ARG C 37  ? N ARG C 37  O THR C 45  ? O THR C 45  
H  2 3 N VAL C 46  ? N VAL C 46  O VAL C 258 ? O VAL C 258 
H  3 4 O ILE C 250 ? O ILE C 250 N CYS C 211 ? N CYS C 211 
H  4 5 O SER C 210 ? O SER C 210 N PHE C 194 ? N PHE C 194 
H  5 6 O CYS C 191 ? O CYS C 191 N LEU C 171 ? N LEU C 171 
I  1 2 N LYS C 281 ? N LYS C 281 O VAL C 301 ? O VAL C 301 
J  1 2 N ARG D 37  ? N ARG D 37  O THR D 45  ? O THR D 45  
J  2 3 N LEU D 48  ? N LEU D 48  O ALA D 256 ? O ALA D 256 
J  3 4 O PHE D 249 ? O PHE D 249 N PHE D 56  ? N PHE D 56  
K  1 2 N ARG D 37  ? N ARG D 37  O THR D 45  ? O THR D 45  
K  2 3 N LEU D 48  ? N LEU D 48  O ALA D 256 ? O ALA D 256 
K  3 4 O ILE D 250 ? O ILE D 250 N CYS D 211 ? N CYS D 211 
K  4 5 O LEU D 212 ? O LEU D 212 N GLN D 192 ? N GLN D 192 
K  5 6 O CYS D 191 ? O CYS D 191 N LEU D 171 ? N LEU D 171 
L  1 2 N LYS D 281 ? N LYS D 281 O VAL D 301 ? O VAL D 301 
M  1 2 N ARG E 37  ? N ARG E 37  O THR E 45  ? O THR E 45  
M  2 3 N VAL E 46  ? N VAL E 46  O VAL E 258 ? O VAL E 258 
M  3 4 O PHE E 249 ? O PHE E 249 N PHE E 56  ? N PHE E 56  
N  1 2 N ARG E 37  ? N ARG E 37  O THR E 45  ? O THR E 45  
N  2 3 N VAL E 46  ? N VAL E 46  O VAL E 258 ? O VAL E 258 
N  3 4 O HIS E 247 ? O HIS E 247 N LEU E 209 ? N LEU E 209 
N  4 5 O SER E 210 ? O SER E 210 N PHE E 194 ? N PHE E 194 
N  5 6 O CYS E 191 ? O CYS E 191 N LEU E 171 ? N LEU E 171 
O  1 2 N LYS E 281 ? N LYS E 281 O VAL E 301 ? O VAL E 301 
P  1 2 N ARG F 37  ? N ARG F 37  O THR F 45  ? O THR F 45  
P  2 3 N LEU F 48  ? N LEU F 48  O ALA F 256 ? O ALA F 256 
P  3 4 O PHE F 249 ? O PHE F 249 N PHE F 56  ? N PHE F 56  
Q  1 2 N ARG F 37  ? N ARG F 37  O THR F 45  ? O THR F 45  
Q  2 3 N LEU F 48  ? N LEU F 48  O ALA F 256 ? O ALA F 256 
Q  3 4 O ILE F 250 ? O ILE F 250 N CYS F 211 ? N CYS F 211 
Q  4 5 O LEU F 212 ? O LEU F 212 N GLN F 192 ? N GLN F 192 
Q  5 6 O CYS F 191 ? O CYS F 191 N LEU F 171 ? N LEU F 171 
R  1 2 N LYS F 281 ? N LYS F 281 O VAL F 301 ? O VAL F 301 
S  1 2 N ARG G 37  ? N ARG G 37  O THR G 45  ? O THR G 45  
S  2 3 N VAL G 46  ? N VAL G 46  O VAL G 258 ? O VAL G 258 
S  3 4 O PHE G 249 ? O PHE G 249 N PHE G 56  ? N PHE G 56  
T  1 2 N ARG G 37  ? N ARG G 37  O THR G 45  ? O THR G 45  
T  2 3 N VAL G 46  ? N VAL G 46  O VAL G 258 ? O VAL G 258 
T  3 4 O ILE G 250 ? O ILE G 250 N CYS G 211 ? N CYS G 211 
T  4 5 O SER G 210 ? O SER G 210 N PHE G 194 ? N PHE G 194 
T  5 6 O CYS G 191 ? O CYS G 191 N LEU G 171 ? N LEU G 171 
U  1 2 N LYS G 281 ? N LYS G 281 O VAL G 301 ? O VAL G 301 
V  1 2 N ARG H 37  ? N ARG H 37  O THR H 45  ? O THR H 45  
V  2 3 N LEU H 48  ? N LEU H 48  O ALA H 256 ? O ALA H 256 
V  3 4 O PHE H 249 ? O PHE H 249 N PHE H 56  ? N PHE H 56  
W  1 2 N ARG H 37  ? N ARG H 37  O THR H 45  ? O THR H 45  
W  2 3 N LEU H 48  ? N LEU H 48  O ALA H 256 ? O ALA H 256 
W  3 4 O ILE H 250 ? O ILE H 250 N CYS H 211 ? N CYS H 211 
W  4 5 O LEU H 212 ? O LEU H 212 N GLN H 192 ? N GLN H 192 
W  5 6 O CYS H 191 ? O CYS H 191 N LEU H 171 ? N LEU H 171 
X  1 2 N LYS H 281 ? N LYS H 281 O VAL H 301 ? O VAL H 301 
Y  1 2 N ARG I 37  ? N ARG I 37  O THR I 45  ? O THR I 45  
Y  2 3 N LEU I 48  ? N LEU I 48  O ALA I 256 ? O ALA I 256 
Y  3 4 O PHE I 249 ? O PHE I 249 N PHE I 56  ? N PHE I 56  
Z  1 2 N ARG I 37  ? N ARG I 37  O THR I 45  ? O THR I 45  
Z  2 3 N LEU I 48  ? N LEU I 48  O ALA I 256 ? O ALA I 256 
Z  3 4 O ILE I 250 ? O ILE I 250 N CYS I 211 ? N CYS I 211 
Z  4 5 O LYS I 208 ? O LYS I 208 N SER I 196 ? N SER I 196 
Z  5 6 O CYS I 191 ? O CYS I 191 N LEU I 171 ? N LEU I 171 
AA 1 2 N LYS I 281 ? N LYS I 281 O VAL I 301 ? O VAL I 301 
AB 1 2 N ARG J 37  ? N ARG J 37  O THR J 45  ? O THR J 45  
AB 2 3 N LEU J 48  ? N LEU J 48  O ALA J 256 ? O ALA J 256 
AB 3 4 O PHE J 249 ? O PHE J 249 N PHE J 56  ? N PHE J 56  
AC 1 2 N ARG J 37  ? N ARG J 37  O THR J 45  ? O THR J 45  
AC 2 3 N LEU J 48  ? N LEU J 48  O ALA J 256 ? O ALA J 256 
AC 3 4 O ILE J 250 ? O ILE J 250 N CYS J 211 ? N CYS J 211 
AC 4 5 O LEU J 212 ? O LEU J 212 N GLN J 192 ? N GLN J 192 
AC 5 6 O CYS J 191 ? O CYS J 191 N LEU J 171 ? N LEU J 171 
AD 1 2 N LYS J 281 ? N LYS J 281 O VAL J 301 ? O VAL J 301 
AE 1 2 N ARG K 37  ? N ARG K 37  O THR K 45  ? O THR K 45  
AE 2 3 N LEU K 48  ? N LEU K 48  O ALA K 256 ? O ALA K 256 
AE 3 4 O PHE K 249 ? O PHE K 249 N PHE K 56  ? N PHE K 56  
AF 1 2 N ARG K 37  ? N ARG K 37  O THR K 45  ? O THR K 45  
AF 2 3 N LEU K 48  ? N LEU K 48  O ALA K 256 ? O ALA K 256 
AF 3 4 O ILE K 250 ? O ILE K 250 N CYS K 211 ? N CYS K 211 
AF 4 5 O LEU K 212 ? O LEU K 212 N GLN K 192 ? N GLN K 192 
AF 5 6 O CYS K 191 ? O CYS K 191 N LEU K 171 ? N LEU K 171 
AG 1 2 N LYS K 281 ? N LYS K 281 O VAL K 301 ? O VAL K 301 
AH 1 2 N ARG L 37  ? N ARG L 37  O THR L 45  ? O THR L 45  
AH 2 3 N LEU L 48  ? N LEU L 48  O ALA L 256 ? O ALA L 256 
AH 3 4 O PHE L 249 ? O PHE L 249 N PHE L 56  ? N PHE L 56  
AI 1 2 N ARG L 37  ? N ARG L 37  O THR L 45  ? O THR L 45  
AI 2 3 N LEU L 48  ? N LEU L 48  O ALA L 256 ? O ALA L 256 
AI 3 4 O ILE L 250 ? O ILE L 250 N CYS L 211 ? N CYS L 211 
AI 4 5 O LEU L 212 ? O LEU L 212 N GLN L 192 ? N GLN L 192 
AI 5 6 O CYS L 191 ? O CYS L 191 N LEU L 171 ? N LEU L 171 
AJ 1 2 N LYS L 281 ? N LYS L 281 O VAL L 301 ? O VAL L 301 
AK 1 2 N ARG M 37  ? N ARG M 37  O THR M 45  ? O THR M 45  
AK 2 3 N LEU M 48  ? N LEU M 48  O ALA M 256 ? O ALA M 256 
AK 3 4 O PHE M 249 ? O PHE M 249 N PHE M 56  ? N PHE M 56  
AL 1 2 N ARG M 37  ? N ARG M 37  O THR M 45  ? O THR M 45  
AL 2 3 N LEU M 48  ? N LEU M 48  O ALA M 256 ? O ALA M 256 
AL 3 4 O ILE M 250 ? O ILE M 250 N CYS M 211 ? N CYS M 211 
AL 4 5 O LEU M 212 ? O LEU M 212 N GLN M 192 ? N GLN M 192 
AL 5 6 O CYS M 191 ? O CYS M 191 N LEU M 171 ? N LEU M 171 
AM 1 2 N LYS M 281 ? N LYS M 281 O VAL M 301 ? O VAL M 301 
AN 1 2 N ARG N 37  ? N ARG N 37  O THR N 45  ? O THR N 45  
AN 2 3 N LEU N 48  ? N LEU N 48  O ALA N 256 ? O ALA N 256 
AN 3 4 O PHE N 249 ? O PHE N 249 N PHE N 56  ? N PHE N 56  
AO 1 2 N ARG N 37  ? N ARG N 37  O THR N 45  ? O THR N 45  
AO 2 3 N LEU N 48  ? N LEU N 48  O ALA N 256 ? O ALA N 256 
AO 3 4 O ILE N 250 ? O ILE N 250 N CYS N 211 ? N CYS N 211 
AO 4 5 O LEU N 212 ? O LEU N 212 N GLN N 192 ? N GLN N 192 
AO 5 6 O CYS N 191 ? O CYS N 191 N LEU N 171 ? N LEU N 171 
AP 1 2 N LYS N 281 ? N LYS N 281 O VAL N 301 ? O VAL N 301 
AQ 1 2 N ARG O 37  ? N ARG O 37  O THR O 45  ? O THR O 45  
AQ 2 3 N LEU O 48  ? N LEU O 48  O ALA O 256 ? O ALA O 256 
AQ 3 4 O PHE O 249 ? O PHE O 249 N PHE O 56  ? N PHE O 56  
AR 1 2 N ARG O 37  ? N ARG O 37  O THR O 45  ? O THR O 45  
AR 2 3 N LEU O 48  ? N LEU O 48  O ALA O 256 ? O ALA O 256 
AR 3 4 O ILE O 250 ? O ILE O 250 N CYS O 211 ? N CYS O 211 
AR 4 5 O LYS O 208 ? O LYS O 208 N SER O 196 ? N SER O 196 
AR 5 6 O CYS O 191 ? O CYS O 191 N LEU O 171 ? N LEU O 171 
AS 1 2 N LYS O 281 ? N LYS O 281 O VAL O 301 ? O VAL O 301 
AT 1 2 N ARG P 37  ? N ARG P 37  O THR P 45  ? O THR P 45  
AT 2 3 N LEU P 48  ? N LEU P 48  O ALA P 256 ? O ALA P 256 
AT 3 4 O PHE P 249 ? O PHE P 249 N PHE P 56  ? N PHE P 56  
AU 1 2 N ARG P 37  ? N ARG P 37  O THR P 45  ? O THR P 45  
AU 2 3 N LEU P 48  ? N LEU P 48  O ALA P 256 ? O ALA P 256 
AU 3 4 O ILE P 250 ? O ILE P 250 N CYS P 211 ? N CYS P 211 
AU 4 5 O LEU P 212 ? O LEU P 212 N GLN P 192 ? N GLN P 192 
AU 5 6 O CYS P 191 ? O CYS P 191 N LEU P 171 ? N LEU P 171 
AV 1 2 N LYS P 281 ? N LYS P 281 O VAL P 301 ? O VAL P 301 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE UMP A 350'  
AC2 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE CB3 A 2351' 
AC3 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE UMP B 400'  
AC4 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CB3 B 2401' 
AC5 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE UMP C 450'  
AC6 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE CB3 C 2451' 
AC7 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE UMP D 500'  
AC8 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE CB3 D 2501' 
AC9 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE UMP E 550'  
BC1 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE CB3 E 2551' 
BC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE UMP F 600'  
BC3 Software ? ? ? ? 24 'BINDING SITE FOR RESIDUE CB3 F 2601' 
BC4 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE UMP G 650'  
BC5 Software ? ? ? ? 23 'BINDING SITE FOR RESIDUE CB3 G 2651' 
BC6 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE UMP H 700'  
BC7 Software ? ? ? ? 25 'BINDING SITE FOR RESIDUE CB3 H 2701' 
BC8 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UMP I 350'  
BC9 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UMP J 400'  
CC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UMP K 450'  
CC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UMP L 500'  
CC3 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UMP M 550'  
CC4 Software ? ? ? ? 21 'BINDING SITE FOR RESIDUE UMP N 600'  
CC5 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE UMP O 650'  
CC6 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE UMP P 700'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 16 ARG A  40  ? ARG A 40   . ? 1_555 ? 
2   AC1 16 CYS A  187 ? CYS A 187  . ? 1_555 ? 
3   AC1 16 HIS A  188 ? HIS A 188  . ? 1_555 ? 
4   AC1 16 GLN A  215 ? GLN A 215  . ? 1_555 ? 
5   AC1 16 ARG A  216 ? ARG A 216  . ? 1_555 ? 
6   AC1 16 SER A  217 ? SER A 217  . ? 1_555 ? 
7   AC1 16 ASP A  219 ? ASP A 219  . ? 1_555 ? 
8   AC1 16 GLY A  223 ? GLY A 223  . ? 1_555 ? 
9   AC1 16 ASN A  227 ? ASN A 227  . ? 1_555 ? 
10  AC1 16 HIS A  257 ? HIS A 257  . ? 1_555 ? 
11  AC1 16 TYR A  259 ? TYR A 259  . ? 1_555 ? 
12  AC1 16 HOH OA .   ? HOH A 523  . ? 1_555 ? 
13  AC1 16 HOH OA .   ? HOH A 555  . ? 1_555 ? 
14  AC1 16 CB3 R  .   ? CB3 A 2351 . ? 1_555 ? 
15  AC1 16 ARG B  167 ? ARG B 167  . ? 1_555 ? 
16  AC1 16 ARG B  168 ? ARG B 168  . ? 1_555 ? 
17  AC2 24 PHE A  72  ? PHE A 72   . ? 1_555 ? 
18  AC2 24 GLU A  79  ? GLU A 79   . ? 1_555 ? 
19  AC2 24 ILE A  100 ? ILE A 100  . ? 1_555 ? 
20  AC2 24 TRP A  101 ? TRP A 101  . ? 1_555 ? 
21  AC2 24 ASN A  104 ? ASN A 104  . ? 1_555 ? 
22  AC2 24 ASP A  219 ? ASP A 219  . ? 1_555 ? 
23  AC2 24 LEU A  222 ? LEU A 222  . ? 1_555 ? 
24  AC2 24 GLY A  223 ? GLY A 223  . ? 1_555 ? 
25  AC2 24 PHE A  226 ? PHE A 226  . ? 1_555 ? 
26  AC2 24 ASN A  227 ? ASN A 227  . ? 1_555 ? 
27  AC2 24 TYR A  259 ? TYR A 259  . ? 1_555 ? 
28  AC2 24 MET A  315 ? MET A 315  . ? 1_555 ? 
29  AC2 24 SER A  316 ? SER A 316  . ? 1_555 ? 
30  AC2 24 UMP Q  .   ? UMP A 350  . ? 1_555 ? 
31  AC2 24 HOH OA .   ? HOH A 571  . ? 1_555 ? 
32  AC2 24 HOH OA .   ? HOH A 574  . ? 1_555 ? 
33  AC2 24 HOH OA .   ? HOH A 657  . ? 1_555 ? 
34  AC2 24 HOH OA .   ? HOH A 776  . ? 1_555 ? 
35  AC2 24 HOH OA .   ? HOH A 876  . ? 1_555 ? 
36  AC2 24 HOH OA .   ? HOH A 979  . ? 1_555 ? 
37  AC2 24 HOH OA .   ? HOH A 1400 . ? 1_555 ? 
38  AC2 24 HOH OA .   ? HOH A 1598 . ? 1_555 ? 
39  AC2 24 ARG H  70  ? ARG H 70   . ? 3_445 ? 
40  AC2 24 LYS H  310 ? LYS H 310  . ? 3_445 ? 
41  AC3 16 ARG A  167 ? ARG A 167  . ? 1_555 ? 
42  AC3 16 ARG A  168 ? ARG A 168  . ? 1_555 ? 
43  AC3 16 ARG B  40  ? ARG B 40   . ? 1_555 ? 
44  AC3 16 TYR B  127 ? TYR B 127  . ? 1_555 ? 
45  AC3 16 CYS B  187 ? CYS B 187  . ? 1_555 ? 
46  AC3 16 HIS B  188 ? HIS B 188  . ? 1_555 ? 
47  AC3 16 GLN B  215 ? GLN B 215  . ? 1_555 ? 
48  AC3 16 ARG B  216 ? ARG B 216  . ? 1_555 ? 
49  AC3 16 SER B  217 ? SER B 217  . ? 1_555 ? 
50  AC3 16 ASP B  219 ? ASP B 219  . ? 1_555 ? 
51  AC3 16 ASN B  227 ? ASN B 227  . ? 1_555 ? 
52  AC3 16 HIS B  257 ? HIS B 257  . ? 1_555 ? 
53  AC3 16 TYR B  259 ? TYR B 259  . ? 1_555 ? 
54  AC3 16 HOH PA .   ? HOH B 603  . ? 1_555 ? 
55  AC3 16 HOH PA .   ? HOH B 729  . ? 1_555 ? 
56  AC3 16 CB3 T  .   ? CB3 B 2401 . ? 1_555 ? 
57  AC4 23 PHE B  72  ? PHE B 72   . ? 1_555 ? 
58  AC4 23 GLU B  79  ? GLU B 79   . ? 1_555 ? 
59  AC4 23 ILE B  100 ? ILE B 100  . ? 1_555 ? 
60  AC4 23 TRP B  101 ? TRP B 101  . ? 1_555 ? 
61  AC4 23 ASN B  104 ? ASN B 104  . ? 1_555 ? 
62  AC4 23 ASP B  219 ? ASP B 219  . ? 1_555 ? 
63  AC4 23 LEU B  222 ? LEU B 222  . ? 1_555 ? 
64  AC4 23 GLY B  223 ? GLY B 223  . ? 1_555 ? 
65  AC4 23 PHE B  226 ? PHE B 226  . ? 1_555 ? 
66  AC4 23 ASN B  227 ? ASN B 227  . ? 1_555 ? 
67  AC4 23 TYR B  259 ? TYR B 259  . ? 1_555 ? 
68  AC4 23 MET B  315 ? MET B 315  . ? 1_555 ? 
69  AC4 23 SER B  316 ? SER B 316  . ? 1_555 ? 
70  AC4 23 UMP S  .   ? UMP B 400  . ? 1_555 ? 
71  AC4 23 HOH PA .   ? HOH B 545  . ? 1_555 ? 
72  AC4 23 HOH PA .   ? HOH B 632  . ? 1_555 ? 
73  AC4 23 HOH PA .   ? HOH B 681  . ? 1_555 ? 
74  AC4 23 HOH PA .   ? HOH B 993  . ? 1_555 ? 
75  AC4 23 HOH PA .   ? HOH B 994  . ? 1_555 ? 
76  AC4 23 HOH PA .   ? HOH B 1079 . ? 1_555 ? 
77  AC4 23 HOH PA .   ? HOH B 1381 . ? 1_555 ? 
78  AC4 23 ARG G  70  ? ARG G 70   . ? 1_455 ? 
79  AC4 23 LYS G  310 ? LYS G 310  . ? 1_455 ? 
80  AC5 16 ARG C  40  ? ARG C 40   . ? 1_555 ? 
81  AC5 16 CYS C  187 ? CYS C 187  . ? 1_555 ? 
82  AC5 16 HIS C  188 ? HIS C 188  . ? 1_555 ? 
83  AC5 16 GLN C  215 ? GLN C 215  . ? 1_555 ? 
84  AC5 16 ARG C  216 ? ARG C 216  . ? 1_555 ? 
85  AC5 16 SER C  217 ? SER C 217  . ? 1_555 ? 
86  AC5 16 ASP C  219 ? ASP C 219  . ? 1_555 ? 
87  AC5 16 GLY C  223 ? GLY C 223  . ? 1_555 ? 
88  AC5 16 ASN C  227 ? ASN C 227  . ? 1_555 ? 
89  AC5 16 HIS C  257 ? HIS C 257  . ? 1_555 ? 
90  AC5 16 TYR C  259 ? TYR C 259  . ? 1_555 ? 
91  AC5 16 HOH QA .   ? HOH C 525  . ? 1_555 ? 
92  AC5 16 HOH QA .   ? HOH C 783  . ? 1_555 ? 
93  AC5 16 CB3 V  .   ? CB3 C 2451 . ? 1_555 ? 
94  AC5 16 ARG D  167 ? ARG D 167  . ? 1_555 ? 
95  AC5 16 ARG D  168 ? ARG D 168  . ? 1_555 ? 
96  AC6 24 PHE C  72  ? PHE C 72   . ? 1_555 ? 
97  AC6 24 GLU C  79  ? GLU C 79   . ? 1_555 ? 
98  AC6 24 ILE C  100 ? ILE C 100  . ? 1_555 ? 
99  AC6 24 TRP C  101 ? TRP C 101  . ? 1_555 ? 
100 AC6 24 ASN C  104 ? ASN C 104  . ? 1_555 ? 
101 AC6 24 ASP C  219 ? ASP C 219  . ? 1_555 ? 
102 AC6 24 LEU C  222 ? LEU C 222  . ? 1_555 ? 
103 AC6 24 GLY C  223 ? GLY C 223  . ? 1_555 ? 
104 AC6 24 PHE C  226 ? PHE C 226  . ? 1_555 ? 
105 AC6 24 ASN C  227 ? ASN C 227  . ? 1_555 ? 
106 AC6 24 TYR C  259 ? TYR C 259  . ? 1_555 ? 
107 AC6 24 MET C  315 ? MET C 315  . ? 1_555 ? 
108 AC6 24 SER C  316 ? SER C 316  . ? 1_555 ? 
109 AC6 24 UMP U  .   ? UMP C 450  . ? 1_555 ? 
110 AC6 24 HOH QA .   ? HOH C 538  . ? 1_555 ? 
111 AC6 24 HOH QA .   ? HOH C 824  . ? 1_555 ? 
112 AC6 24 HOH QA .   ? HOH C 967  . ? 1_555 ? 
113 AC6 24 HOH QA .   ? HOH C 968  . ? 1_555 ? 
114 AC6 24 HOH QA .   ? HOH C 1001 . ? 1_555 ? 
115 AC6 24 HOH QA .   ? HOH C 1374 . ? 1_555 ? 
116 AC6 24 HOH QA .   ? HOH C 1435 . ? 1_555 ? 
117 AC6 24 HOH QA .   ? HOH C 1437 . ? 1_555 ? 
118 AC6 24 ARG F  70  ? ARG F 70   . ? 1_555 ? 
119 AC6 24 LYS F  310 ? LYS F 310  . ? 1_555 ? 
120 AC7 16 ARG C  167 ? ARG C 167  . ? 1_555 ? 
121 AC7 16 ARG C  168 ? ARG C 168  . ? 1_555 ? 
122 AC7 16 ARG D  40  ? ARG D 40   . ? 1_555 ? 
123 AC7 16 TYR D  127 ? TYR D 127  . ? 1_555 ? 
124 AC7 16 CYS D  187 ? CYS D 187  . ? 1_555 ? 
125 AC7 16 HIS D  188 ? HIS D 188  . ? 1_555 ? 
126 AC7 16 GLN D  215 ? GLN D 215  . ? 1_555 ? 
127 AC7 16 ARG D  216 ? ARG D 216  . ? 1_555 ? 
128 AC7 16 SER D  217 ? SER D 217  . ? 1_555 ? 
129 AC7 16 ASP D  219 ? ASP D 219  . ? 1_555 ? 
130 AC7 16 ASN D  227 ? ASN D 227  . ? 1_555 ? 
131 AC7 16 HIS D  257 ? HIS D 257  . ? 1_555 ? 
132 AC7 16 TYR D  259 ? TYR D 259  . ? 1_555 ? 
133 AC7 16 HOH RA .   ? HOH D 521  . ? 1_555 ? 
134 AC7 16 HOH RA .   ? HOH D 915  . ? 1_555 ? 
135 AC7 16 CB3 X  .   ? CB3 D 2501 . ? 1_555 ? 
136 AC8 24 PHE D  72  ? PHE D 72   . ? 1_555 ? 
137 AC8 24 GLU D  79  ? GLU D 79   . ? 1_555 ? 
138 AC8 24 ILE D  100 ? ILE D 100  . ? 1_555 ? 
139 AC8 24 TRP D  101 ? TRP D 101  . ? 1_555 ? 
140 AC8 24 ASN D  104 ? ASN D 104  . ? 1_555 ? 
141 AC8 24 ASP D  219 ? ASP D 219  . ? 1_555 ? 
142 AC8 24 LEU D  222 ? LEU D 222  . ? 1_555 ? 
143 AC8 24 GLY D  223 ? GLY D 223  . ? 1_555 ? 
144 AC8 24 PHE D  226 ? PHE D 226  . ? 1_555 ? 
145 AC8 24 ASN D  227 ? ASN D 227  . ? 1_555 ? 
146 AC8 24 TYR D  259 ? TYR D 259  . ? 1_555 ? 
147 AC8 24 MET D  315 ? MET D 315  . ? 1_555 ? 
148 AC8 24 SER D  316 ? SER D 316  . ? 1_555 ? 
149 AC8 24 UMP W  .   ? UMP D 500  . ? 1_555 ? 
150 AC8 24 HOH RA .   ? HOH D 520  . ? 1_555 ? 
151 AC8 24 HOH RA .   ? HOH D 695  . ? 1_555 ? 
152 AC8 24 HOH RA .   ? HOH D 752  . ? 1_555 ? 
153 AC8 24 HOH RA .   ? HOH D 771  . ? 1_555 ? 
154 AC8 24 HOH RA .   ? HOH D 965  . ? 1_555 ? 
155 AC8 24 HOH RA .   ? HOH D 992  . ? 1_555 ? 
156 AC8 24 HOH RA .   ? HOH D 1088 . ? 1_555 ? 
157 AC8 24 HOH RA .   ? HOH D 1375 . ? 1_555 ? 
158 AC8 24 ARG E  70  ? ARG E 70   . ? 3_445 ? 
159 AC8 24 LYS E  310 ? LYS E 310  . ? 3_445 ? 
160 AC9 17 ARG E  40  ? ARG E 40   . ? 1_555 ? 
161 AC9 17 TYR E  127 ? TYR E 127  . ? 1_555 ? 
162 AC9 17 CYS E  187 ? CYS E 187  . ? 1_555 ? 
163 AC9 17 HIS E  188 ? HIS E 188  . ? 1_555 ? 
164 AC9 17 GLN E  215 ? GLN E 215  . ? 1_555 ? 
165 AC9 17 ARG E  216 ? ARG E 216  . ? 1_555 ? 
166 AC9 17 SER E  217 ? SER E 217  . ? 1_555 ? 
167 AC9 17 ASP E  219 ? ASP E 219  . ? 1_555 ? 
168 AC9 17 GLY E  223 ? GLY E 223  . ? 1_555 ? 
169 AC9 17 ASN E  227 ? ASN E 227  . ? 1_555 ? 
170 AC9 17 HIS E  257 ? HIS E 257  . ? 1_555 ? 
171 AC9 17 TYR E  259 ? TYR E 259  . ? 1_555 ? 
172 AC9 17 HOH SA .   ? HOH E 514  . ? 1_555 ? 
173 AC9 17 HOH SA .   ? HOH E 610  . ? 1_555 ? 
174 AC9 17 CB3 Z  .   ? CB3 E 2551 . ? 1_555 ? 
175 AC9 17 ARG F  167 ? ARG F 167  . ? 1_555 ? 
176 AC9 17 ARG F  168 ? ARG F 168  . ? 1_555 ? 
177 BC1 24 ARG D  70  ? ARG D 70   . ? 3_555 ? 
178 BC1 24 LYS D  310 ? LYS D 310  . ? 3_555 ? 
179 BC1 24 HOH RA .   ? HOH D 1502 . ? 3_555 ? 
180 BC1 24 PHE E  72  ? PHE E 72   . ? 1_555 ? 
181 BC1 24 GLU E  79  ? GLU E 79   . ? 1_555 ? 
182 BC1 24 ILE E  100 ? ILE E 100  . ? 1_555 ? 
183 BC1 24 TRP E  101 ? TRP E 101  . ? 1_555 ? 
184 BC1 24 ASN E  104 ? ASN E 104  . ? 1_555 ? 
185 BC1 24 ASP E  219 ? ASP E 219  . ? 1_555 ? 
186 BC1 24 LEU E  222 ? LEU E 222  . ? 1_555 ? 
187 BC1 24 GLY E  223 ? GLY E 223  . ? 1_555 ? 
188 BC1 24 PHE E  226 ? PHE E 226  . ? 1_555 ? 
189 BC1 24 ASN E  227 ? ASN E 227  . ? 1_555 ? 
190 BC1 24 TYR E  259 ? TYR E 259  . ? 1_555 ? 
191 BC1 24 MET E  315 ? MET E 315  . ? 1_555 ? 
192 BC1 24 SER E  316 ? SER E 316  . ? 1_555 ? 
193 BC1 24 UMP Y  .   ? UMP E 550  . ? 1_555 ? 
194 BC1 24 HOH SA .   ? HOH E 565  . ? 1_555 ? 
195 BC1 24 HOH SA .   ? HOH E 677  . ? 1_555 ? 
196 BC1 24 HOH SA .   ? HOH E 802  . ? 1_555 ? 
197 BC1 24 HOH SA .   ? HOH E 1095 . ? 1_555 ? 
198 BC1 24 HOH SA .   ? HOH E 1233 . ? 1_555 ? 
199 BC1 24 HOH SA .   ? HOH E 1294 . ? 1_555 ? 
200 BC1 24 HOH SA .   ? HOH E 1296 . ? 1_555 ? 
201 BC2 16 ARG E  167 ? ARG E 167  . ? 1_555 ? 
202 BC2 16 ARG E  168 ? ARG E 168  . ? 1_555 ? 
203 BC2 16 ARG F  40  ? ARG F 40   . ? 1_555 ? 
204 BC2 16 TYR F  127 ? TYR F 127  . ? 1_555 ? 
205 BC2 16 CYS F  187 ? CYS F 187  . ? 1_555 ? 
206 BC2 16 HIS F  188 ? HIS F 188  . ? 1_555 ? 
207 BC2 16 GLN F  215 ? GLN F 215  . ? 1_555 ? 
208 BC2 16 ARG F  216 ? ARG F 216  . ? 1_555 ? 
209 BC2 16 SER F  217 ? SER F 217  . ? 1_555 ? 
210 BC2 16 ASP F  219 ? ASP F 219  . ? 1_555 ? 
211 BC2 16 ASN F  227 ? ASN F 227  . ? 1_555 ? 
212 BC2 16 HIS F  257 ? HIS F 257  . ? 1_555 ? 
213 BC2 16 TYR F  259 ? TYR F 259  . ? 1_555 ? 
214 BC2 16 HOH TA .   ? HOH F 622  . ? 1_555 ? 
215 BC2 16 HOH TA .   ? HOH F 1055 . ? 1_555 ? 
216 BC2 16 CB3 BA .   ? CB3 F 2601 . ? 1_555 ? 
217 BC3 24 ARG C  70  ? ARG C 70   . ? 1_555 ? 
218 BC3 24 LYS C  310 ? LYS C 310  . ? 1_555 ? 
219 BC3 24 PHE F  72  ? PHE F 72   . ? 1_555 ? 
220 BC3 24 GLU F  79  ? GLU F 79   . ? 1_555 ? 
221 BC3 24 ILE F  100 ? ILE F 100  . ? 1_555 ? 
222 BC3 24 TRP F  101 ? TRP F 101  . ? 1_555 ? 
223 BC3 24 ASN F  104 ? ASN F 104  . ? 1_555 ? 
224 BC3 24 ASP F  219 ? ASP F 219  . ? 1_555 ? 
225 BC3 24 LEU F  222 ? LEU F 222  . ? 1_555 ? 
226 BC3 24 GLY F  223 ? GLY F 223  . ? 1_555 ? 
227 BC3 24 PHE F  226 ? PHE F 226  . ? 1_555 ? 
228 BC3 24 ASN F  227 ? ASN F 227  . ? 1_555 ? 
229 BC3 24 TYR F  259 ? TYR F 259  . ? 1_555 ? 
230 BC3 24 MET F  315 ? MET F 315  . ? 1_555 ? 
231 BC3 24 SER F  316 ? SER F 316  . ? 1_555 ? 
232 BC3 24 UMP AA .   ? UMP F 600  . ? 1_555 ? 
233 BC3 24 HOH TA .   ? HOH F 759  . ? 1_555 ? 
234 BC3 24 HOH TA .   ? HOH F 792  . ? 1_555 ? 
235 BC3 24 HOH TA .   ? HOH F 1041 . ? 1_555 ? 
236 BC3 24 HOH TA .   ? HOH F 1043 . ? 1_555 ? 
237 BC3 24 HOH TA .   ? HOH F 1317 . ? 1_555 ? 
238 BC3 24 HOH TA .   ? HOH F 1377 . ? 1_555 ? 
239 BC3 24 HOH TA .   ? HOH F 1498 . ? 1_555 ? 
240 BC3 24 HOH TA .   ? HOH F 1516 . ? 1_555 ? 
241 BC4 15 ARG G  40  ? ARG G 40   . ? 1_555 ? 
242 BC4 15 CYS G  187 ? CYS G 187  . ? 1_555 ? 
243 BC4 15 HIS G  188 ? HIS G 188  . ? 1_555 ? 
244 BC4 15 GLN G  215 ? GLN G 215  . ? 1_555 ? 
245 BC4 15 ARG G  216 ? ARG G 216  . ? 1_555 ? 
246 BC4 15 SER G  217 ? SER G 217  . ? 1_555 ? 
247 BC4 15 ASP G  219 ? ASP G 219  . ? 1_555 ? 
248 BC4 15 ASN G  227 ? ASN G 227  . ? 1_555 ? 
249 BC4 15 HIS G  257 ? HIS G 257  . ? 1_555 ? 
250 BC4 15 TYR G  259 ? TYR G 259  . ? 1_555 ? 
251 BC4 15 HOH UA .   ? HOH G 423  . ? 1_555 ? 
252 BC4 15 HOH UA .   ? HOH G 1150 . ? 1_555 ? 
253 BC4 15 CB3 DA .   ? CB3 G 2651 . ? 1_555 ? 
254 BC4 15 ARG H  167 ? ARG H 167  . ? 1_555 ? 
255 BC4 15 ARG H  168 ? ARG H 168  . ? 1_555 ? 
256 BC5 23 ARG B  70  ? ARG B 70   . ? 1_655 ? 
257 BC5 23 LYS B  310 ? LYS B 310  . ? 1_655 ? 
258 BC5 23 PHE G  72  ? PHE G 72   . ? 1_555 ? 
259 BC5 23 GLU G  79  ? GLU G 79   . ? 1_555 ? 
260 BC5 23 ILE G  100 ? ILE G 100  . ? 1_555 ? 
261 BC5 23 TRP G  101 ? TRP G 101  . ? 1_555 ? 
262 BC5 23 ASN G  104 ? ASN G 104  . ? 1_555 ? 
263 BC5 23 ASP G  219 ? ASP G 219  . ? 1_555 ? 
264 BC5 23 LEU G  222 ? LEU G 222  . ? 1_555 ? 
265 BC5 23 GLY G  223 ? GLY G 223  . ? 1_555 ? 
266 BC5 23 PHE G  226 ? PHE G 226  . ? 1_555 ? 
267 BC5 23 ASN G  227 ? ASN G 227  . ? 1_555 ? 
268 BC5 23 TYR G  259 ? TYR G 259  . ? 1_555 ? 
269 BC5 23 MET G  315 ? MET G 315  . ? 1_555 ? 
270 BC5 23 SER G  316 ? SER G 316  . ? 1_555 ? 
271 BC5 23 HOH UA .   ? HOH G 451  . ? 1_555 ? 
272 BC5 23 HOH UA .   ? HOH G 452  . ? 1_555 ? 
273 BC5 23 HOH UA .   ? HOH G 499  . ? 1_555 ? 
274 BC5 23 HOH UA .   ? HOH G 502  . ? 1_555 ? 
275 BC5 23 UMP CA .   ? UMP G 650  . ? 1_555 ? 
276 BC5 23 HOH UA .   ? HOH G 1151 . ? 1_555 ? 
277 BC5 23 HOH UA .   ? HOH G 1342 . ? 1_555 ? 
278 BC5 23 HOH UA .   ? HOH G 1343 . ? 1_555 ? 
279 BC6 15 ARG G  167 ? ARG G 167  . ? 1_555 ? 
280 BC6 15 ARG G  168 ? ARG G 168  . ? 1_555 ? 
281 BC6 15 ARG H  40  ? ARG H 40   . ? 1_555 ? 
282 BC6 15 CYS H  187 ? CYS H 187  . ? 1_555 ? 
283 BC6 15 HIS H  188 ? HIS H 188  . ? 1_555 ? 
284 BC6 15 GLN H  215 ? GLN H 215  . ? 1_555 ? 
285 BC6 15 ARG H  216 ? ARG H 216  . ? 1_555 ? 
286 BC6 15 SER H  217 ? SER H 217  . ? 1_555 ? 
287 BC6 15 ASP H  219 ? ASP H 219  . ? 1_555 ? 
288 BC6 15 ASN H  227 ? ASN H 227  . ? 1_555 ? 
289 BC6 15 HIS H  257 ? HIS H 257  . ? 1_555 ? 
290 BC6 15 TYR H  259 ? TYR H 259  . ? 1_555 ? 
291 BC6 15 HOH VA .   ? HOH H 477  . ? 1_555 ? 
292 BC6 15 HOH VA .   ? HOH H 1044 . ? 1_555 ? 
293 BC6 15 CB3 FA .   ? CB3 H 2701 . ? 1_555 ? 
294 BC7 25 ARG A  70  ? ARG A 70   . ? 3_555 ? 
295 BC7 25 LYS A  310 ? LYS A 310  . ? 3_555 ? 
296 BC7 25 PHE H  72  ? PHE H 72   . ? 1_555 ? 
297 BC7 25 GLU H  79  ? GLU H 79   . ? 1_555 ? 
298 BC7 25 ILE H  100 ? ILE H 100  . ? 1_555 ? 
299 BC7 25 TRP H  101 ? TRP H 101  . ? 1_555 ? 
300 BC7 25 ASN H  104 ? ASN H 104  . ? 1_555 ? 
301 BC7 25 LEU H  184 ? LEU H 184  . ? 1_555 ? 
302 BC7 25 ASP H  219 ? ASP H 219  . ? 1_555 ? 
303 BC7 25 LEU H  222 ? LEU H 222  . ? 1_555 ? 
304 BC7 25 GLY H  223 ? GLY H 223  . ? 1_555 ? 
305 BC7 25 PHE H  226 ? PHE H 226  . ? 1_555 ? 
306 BC7 25 ASN H  227 ? ASN H 227  . ? 1_555 ? 
307 BC7 25 TYR H  259 ? TYR H 259  . ? 1_555 ? 
308 BC7 25 MET H  315 ? MET H 315  . ? 1_555 ? 
309 BC7 25 SER H  316 ? SER H 316  . ? 1_555 ? 
310 BC7 25 HOH VA .   ? HOH H 409  . ? 1_555 ? 
311 BC7 25 HOH VA .   ? HOH H 479  . ? 1_555 ? 
312 BC7 25 UMP EA .   ? UMP H 700  . ? 1_555 ? 
313 BC7 25 HOH VA .   ? HOH H 1236 . ? 1_555 ? 
314 BC7 25 HOH VA .   ? HOH H 1367 . ? 1_555 ? 
315 BC7 25 HOH VA .   ? HOH H 1371 . ? 1_555 ? 
316 BC7 25 HOH VA .   ? HOH H 1372 . ? 1_555 ? 
317 BC7 25 HOH VA .   ? HOH H 1376 . ? 1_555 ? 
318 BC7 25 HOH VA .   ? HOH H 1439 . ? 1_555 ? 
319 BC8 14 ARG I  40  ? ARG I 40   . ? 1_555 ? 
320 BC8 14 TYR I  127 ? TYR I 127  . ? 1_555 ? 
321 BC8 14 LEU I  184 ? LEU I 184  . ? 1_555 ? 
322 BC8 14 CYS I  187 ? CYS I 187  . ? 1_555 ? 
323 BC8 14 HIS I  188 ? HIS I 188  . ? 1_555 ? 
324 BC8 14 GLN I  215 ? GLN I 215  . ? 1_555 ? 
325 BC8 14 ARG I  216 ? ARG I 216  . ? 1_555 ? 
326 BC8 14 SER I  217 ? SER I 217  . ? 1_555 ? 
327 BC8 14 ASP I  219 ? ASP I 219  . ? 1_555 ? 
328 BC8 14 ASN I  227 ? ASN I 227  . ? 1_555 ? 
329 BC8 14 HIS I  257 ? HIS I 257  . ? 1_555 ? 
330 BC8 14 TYR I  259 ? TYR I 259  . ? 1_555 ? 
331 BC8 14 ARG J  167 ? ARG J 167  . ? 1_555 ? 
332 BC8 14 ARG J  168 ? ARG J 168  . ? 1_555 ? 
333 BC9 14 ARG I  167 ? ARG I 167  . ? 1_555 ? 
334 BC9 14 ARG I  168 ? ARG I 168  . ? 1_555 ? 
335 BC9 14 ARG J  40  ? ARG J 40   . ? 1_555 ? 
336 BC9 14 TYR J  127 ? TYR J 127  . ? 1_555 ? 
337 BC9 14 CYS J  187 ? CYS J 187  . ? 1_555 ? 
338 BC9 14 HIS J  188 ? HIS J 188  . ? 1_555 ? 
339 BC9 14 GLN J  215 ? GLN J 215  . ? 1_555 ? 
340 BC9 14 ARG J  216 ? ARG J 216  . ? 1_555 ? 
341 BC9 14 SER J  217 ? SER J 217  . ? 1_555 ? 
342 BC9 14 ASP J  219 ? ASP J 219  . ? 1_555 ? 
343 BC9 14 GLY J  223 ? GLY J 223  . ? 1_555 ? 
344 BC9 14 ASN J  227 ? ASN J 227  . ? 1_555 ? 
345 BC9 14 HIS J  257 ? HIS J 257  . ? 1_555 ? 
346 BC9 14 TYR J  259 ? TYR J 259  . ? 1_555 ? 
347 CC1 14 ARG K  40  ? ARG K 40   . ? 1_555 ? 
348 CC1 14 TYR K  127 ? TYR K 127  . ? 1_555 ? 
349 CC1 14 CYS K  187 ? CYS K 187  . ? 1_555 ? 
350 CC1 14 HIS K  188 ? HIS K 188  . ? 1_555 ? 
351 CC1 14 GLN K  215 ? GLN K 215  . ? 1_555 ? 
352 CC1 14 ARG K  216 ? ARG K 216  . ? 1_555 ? 
353 CC1 14 SER K  217 ? SER K 217  . ? 1_555 ? 
354 CC1 14 CYS K  218 ? CYS K 218  . ? 1_555 ? 
355 CC1 14 ASP K  219 ? ASP K 219  . ? 1_555 ? 
356 CC1 14 ASN K  227 ? ASN K 227  . ? 1_555 ? 
357 CC1 14 HIS K  257 ? HIS K 257  . ? 1_555 ? 
358 CC1 14 TYR K  259 ? TYR K 259  . ? 1_555 ? 
359 CC1 14 ARG L  167 ? ARG L 167  . ? 1_555 ? 
360 CC1 14 ARG L  168 ? ARG L 168  . ? 1_555 ? 
361 CC2 14 ARG K  167 ? ARG K 167  . ? 1_555 ? 
362 CC2 14 ARG K  168 ? ARG K 168  . ? 1_555 ? 
363 CC2 14 ARG L  40  ? ARG L 40   . ? 1_555 ? 
364 CC2 14 TYR L  127 ? TYR L 127  . ? 1_555 ? 
365 CC2 14 CYS L  187 ? CYS L 187  . ? 1_555 ? 
366 CC2 14 HIS L  188 ? HIS L 188  . ? 1_555 ? 
367 CC2 14 GLN L  215 ? GLN L 215  . ? 1_555 ? 
368 CC2 14 ARG L  216 ? ARG L 216  . ? 1_555 ? 
369 CC2 14 SER L  217 ? SER L 217  . ? 1_555 ? 
370 CC2 14 CYS L  218 ? CYS L 218  . ? 1_555 ? 
371 CC2 14 ASP L  219 ? ASP L 219  . ? 1_555 ? 
372 CC2 14 ASN L  227 ? ASN L 227  . ? 1_555 ? 
373 CC2 14 HIS L  257 ? HIS L 257  . ? 1_555 ? 
374 CC2 14 TYR L  259 ? TYR L 259  . ? 1_555 ? 
375 CC3 14 ARG M  40  ? ARG M 40   . ? 1_555 ? 
376 CC3 14 TYR M  127 ? TYR M 127  . ? 1_555 ? 
377 CC3 14 CYS M  187 ? CYS M 187  . ? 1_555 ? 
378 CC3 14 HIS M  188 ? HIS M 188  . ? 1_555 ? 
379 CC3 14 GLN M  215 ? GLN M 215  . ? 1_555 ? 
380 CC3 14 ARG M  216 ? ARG M 216  . ? 1_555 ? 
381 CC3 14 SER M  217 ? SER M 217  . ? 1_555 ? 
382 CC3 14 CYS M  218 ? CYS M 218  . ? 1_555 ? 
383 CC3 14 ASP M  219 ? ASP M 219  . ? 1_555 ? 
384 CC3 14 ASN M  227 ? ASN M 227  . ? 1_555 ? 
385 CC3 14 HIS M  257 ? HIS M 257  . ? 1_555 ? 
386 CC3 14 TYR M  259 ? TYR M 259  . ? 1_555 ? 
387 CC3 14 ARG N  167 ? ARG N 167  . ? 1_555 ? 
388 CC3 14 ARG N  168 ? ARG N 168  . ? 1_555 ? 
389 CC4 21 ARG M  167 ? ARG M 167  . ? 1_555 ? 
390 CC4 21 ARG M  168 ? ARG M 168  . ? 1_555 ? 
391 CC4 21 ARG N  40  ? ARG N 40   . ? 1_555 ? 
392 CC4 21 PHE N  109 ? PHE N 109  . ? 2_756 ? 
393 CC4 21 LEU N  110 ? LEU N 110  . ? 2_756 ? 
394 CC4 21 GLU N  111 ? GLU N 111  . ? 2_756 ? 
395 CC4 21 LYS N  112 ? LYS N 112  . ? 2_756 ? 
396 CC4 21 VAL N  113 ? VAL N 113  . ? 2_756 ? 
397 CC4 21 GLY N  114 ? GLY N 114  . ? 2_756 ? 
398 CC4 21 LEU N  115 ? LEU N 115  . ? 2_756 ? 
399 CC4 21 TYR N  127 ? TYR N 127  . ? 1_555 ? 
400 CC4 21 CYS N  187 ? CYS N 187  . ? 1_555 ? 
401 CC4 21 HIS N  188 ? HIS N 188  . ? 1_555 ? 
402 CC4 21 GLN N  215 ? GLN N 215  . ? 1_555 ? 
403 CC4 21 ARG N  216 ? ARG N 216  . ? 1_555 ? 
404 CC4 21 SER N  217 ? SER N 217  . ? 1_555 ? 
405 CC4 21 CYS N  218 ? CYS N 218  . ? 1_555 ? 
406 CC4 21 ASP N  219 ? ASP N 219  . ? 1_555 ? 
407 CC4 21 ASN N  227 ? ASN N 227  . ? 1_555 ? 
408 CC4 21 HIS N  257 ? HIS N 257  . ? 1_555 ? 
409 CC4 21 TYR N  259 ? TYR N 259  . ? 1_555 ? 
410 CC5 13 ARG O  40  ? ARG O 40   . ? 1_555 ? 
411 CC5 13 TYR O  127 ? TYR O 127  . ? 1_555 ? 
412 CC5 13 CYS O  187 ? CYS O 187  . ? 1_555 ? 
413 CC5 13 HIS O  188 ? HIS O 188  . ? 1_555 ? 
414 CC5 13 GLN O  215 ? GLN O 215  . ? 1_555 ? 
415 CC5 13 ARG O  216 ? ARG O 216  . ? 1_555 ? 
416 CC5 13 SER O  217 ? SER O 217  . ? 1_555 ? 
417 CC5 13 ASP O  219 ? ASP O 219  . ? 1_555 ? 
418 CC5 13 ASN O  227 ? ASN O 227  . ? 1_555 ? 
419 CC5 13 HIS O  257 ? HIS O 257  . ? 1_555 ? 
420 CC5 13 TYR O  259 ? TYR O 259  . ? 1_555 ? 
421 CC5 13 ARG P  167 ? ARG P 167  . ? 1_555 ? 
422 CC5 13 ARG P  168 ? ARG P 168  . ? 1_555 ? 
423 CC6 14 ARG O  167 ? ARG O 167  . ? 1_555 ? 
424 CC6 14 ARG O  168 ? ARG O 168  . ? 1_555 ? 
425 CC6 14 ARG P  40  ? ARG P 40   . ? 1_555 ? 
426 CC6 14 TYR P  127 ? TYR P 127  . ? 1_555 ? 
427 CC6 14 CYS P  187 ? CYS P 187  . ? 1_555 ? 
428 CC6 14 HIS P  188 ? HIS P 188  . ? 1_555 ? 
429 CC6 14 GLN P  215 ? GLN P 215  . ? 1_555 ? 
430 CC6 14 ARG P  216 ? ARG P 216  . ? 1_555 ? 
431 CC6 14 SER P  217 ? SER P 217  . ? 1_555 ? 
432 CC6 14 CYS P  218 ? CYS P 218  . ? 1_555 ? 
433 CC6 14 ASP P  219 ? ASP P 219  . ? 1_555 ? 
434 CC6 14 ASN P  227 ? ASN P 227  . ? 1_555 ? 
435 CC6 14 HIS P  257 ? HIS P 257  . ? 1_555 ? 
436 CC6 14 TYR P  259 ? TYR P 259  . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2AAZ 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AAZ 
_atom_sites.fract_transf_matrix[1][1]   0.005574 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000019 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.005571 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004782 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1      N N     A ARG A  1 13  ? 53.970  -34.816 8.098   0.25 48.68  ? 13   ARG A N     1 
ATOM   2      C CA    A ARG A  1 13  ? 54.262  -34.915 9.558   0.25 48.77  ? 13   ARG A CA    1 
ATOM   3      C C     A ARG A  1 13  ? 53.412  -35.997 10.222  0.25 50.11  ? 13   ARG A C     1 
ATOM   4      O O     A ARG A  1 13  ? 52.184  -35.998 10.114  0.25 51.26  ? 13   ARG A O     1 
ATOM   5      C CB    A ARG A  1 13  ? 54.023  -33.555 10.239  0.25 47.59  ? 13   ARG A CB    1 
ATOM   6      C CG    A ARG A  1 13  ? 55.031  -32.493 9.834   0.25 44.57  ? 13   ARG A CG    1 
ATOM   7      C CD    A ARG A  1 13  ? 54.673  -31.088 10.298  0.25 42.17  ? 13   ARG A CD    1 
ATOM   8      N NE    A ARG A  1 13  ? 55.708  -30.153 9.858   0.25 39.98  ? 13   ARG A NE    1 
ATOM   9      C CZ    A ARG A  1 13  ? 55.708  -28.842 10.084  0.25 38.41  ? 13   ARG A CZ    1 
ATOM   10     N NH1   A ARG A  1 13  ? 54.713  -28.272 10.759  0.25 34.71  ? 13   ARG A NH1   1 
ATOM   11     N NH2   A ARG A  1 13  ? 56.709  -28.099 9.623   0.25 33.43  ? 13   ARG A NH2   1 
ATOM   12     N N     A SER A  1 14  ? 54.074  -36.918 10.911  0.25 50.23  ? 14   SER A N     1 
ATOM   13     C CA    A SER A  1 14  ? 53.386  -38.007 11.591  0.25 51.20  ? 14   SER A CA    1 
ATOM   14     C C     A SER A  1 14  ? 52.505  -37.513 12.727  0.25 51.92  ? 14   SER A C     1 
ATOM   15     O O     A SER A  1 14  ? 51.482  -38.127 13.043  0.25 52.32  ? 14   SER A O     1 
ATOM   16     C CB    A SER A  1 14  ? 54.405  -38.997 12.145  0.25 51.85  ? 14   SER A CB    1 
ATOM   17     O OG    A SER A  1 14  ? 53.798  -39.878 13.073  0.25 56.38  ? 14   SER A OG    1 
ATOM   18     N N     A ASN A  1 15  ? 52.924  -36.416 13.354  0.25 50.46  ? 15   ASN A N     1 
ATOM   19     C CA    A ASN A  1 15  ? 52.188  -35.814 14.462  0.25 50.58  ? 15   ASN A CA    1 
ATOM   20     C C     A ASN A  1 15  ? 52.264  -34.304 14.267  0.25 48.04  ? 15   ASN A C     1 
ATOM   21     O O     A ASN A  1 15  ? 53.049  -33.620 14.920  0.25 47.56  ? 15   ASN A O     1 
ATOM   22     C CB    A ASN A  1 15  ? 52.817  -36.206 15.804  0.25 51.36  ? 15   ASN A CB    1 
ATOM   23     C CG    A ASN A  1 15  ? 51.979  -35.765 16.980  0.25 53.62  ? 15   ASN A CG    1 
ATOM   24     O OD1   A ASN A  1 15  ? 50.930  -35.144 16.806  0.25 53.55  ? 15   ASN A OD1   1 
ATOM   25     N ND2   A ASN A  1 15  ? 52.432  -36.083 18.188  0.25 54.43  ? 15   ASN A ND2   1 
ATOM   26     N N     A PRO A  1 16  ? 51.427  -33.770 13.365  0.25 47.08  ? 16   PRO A N     1 
ATOM   27     C CA    A PRO A  1 16  ? 51.363  -32.345 13.029  0.25 44.28  ? 16   PRO A CA    1 
ATOM   28     C C     A PRO A  1 16  ? 51.111  -31.424 14.212  0.25 41.33  ? 16   PRO A C     1 
ATOM   29     O O     A PRO A  1 16  ? 51.520  -30.260 14.196  0.25 40.41  ? 16   PRO A O     1 
ATOM   30     C CB    A PRO A  1 16  ? 50.217  -32.278 12.011  0.25 46.21  ? 16   PRO A CB    1 
ATOM   31     C CG    A PRO A  1 16  ? 50.135  -33.667 11.461  0.25 46.74  ? 16   PRO A CG    1 
ATOM   32     C CD    A PRO A  1 16  ? 50.336  -34.501 12.694  0.25 46.92  ? 16   PRO A CD    1 
ATOM   33     N N     A ASP A  1 17  ? 50.457  -31.950 15.239  0.25 36.70  ? 17   ASP A N     1 
ATOM   34     C CA    A ASP A  1 17  ? 50.120  -31.137 16.389  0.25 36.12  ? 17   ASP A CA    1 
ATOM   35     C C     A ASP A  1 17  ? 51.206  -31.080 17.454  0.25 35.21  ? 17   ASP A C     1 
ATOM   36     O O     A ASP A  1 17  ? 51.027  -30.436 18.487  0.25 32.34  ? 17   ASP A O     1 
ATOM   37     C CB    A ASP A  1 17  ? 48.811  -31.628 17.017  0.25 39.10  ? 17   ASP A CB    1 
ATOM   38     C CG    A ASP A  1 17  ? 47.651  -31.653 16.017  0.25 43.34  ? 17   ASP A CG    1 
ATOM   39     O OD1   A ASP A  1 17  ? 47.510  -30.690 15.225  0.25 43.51  ? 17   ASP A OD1   1 
ATOM   40     O OD2   A ASP A  1 17  ? 46.877  -32.636 16.028  0.25 46.02  ? 17   ASP A OD2   1 
ATOM   41     N N     A HIS A  1 18  ? 52.336  -31.747 17.212  0.25 30.76  ? 18   HIS A N     1 
ATOM   42     C CA    A HIS A  1 18  ? 53.400  -31.726 18.205  0.25 26.72  ? 18   HIS A CA    1 
ATOM   43     C C     A HIS A  1 18  ? 53.807  -30.293 18.439  0.25 23.14  ? 18   HIS A C     1 
ATOM   44     O O     A HIS A  1 18  ? 54.145  -29.579 17.511  0.25 25.58  ? 18   HIS A O     1 
ATOM   45     C CB    A HIS A  1 18  ? 54.615  -32.541 17.745  0.25 25.15  ? 18   HIS A CB    1 
ATOM   46     C CG    A HIS A  1 18  ? 55.587  -32.831 18.844  0.25 25.04  ? 18   HIS A CG    1 
ATOM   47     N ND1   A HIS A  1 18  ? 56.280  -31.838 19.505  0.25 24.24  ? 18   HIS A ND1   1 
ATOM   48     C CD2   A HIS A  1 18  ? 55.972  -34.002 19.410  0.25 26.94  ? 18   HIS A CD2   1 
ATOM   49     C CE1   A HIS A  1 18  ? 57.051  -32.384 20.431  0.25 27.08  ? 18   HIS A CE1   1 
ATOM   50     N NE2   A HIS A  1 18  ? 56.882  -33.696 20.394  0.25 28.39  ? 18   HIS A NE2   1 
ATOM   51     N N     A GLU A  1 19  ? 53.798  -29.881 19.699  0.25 24.17  ? 19   GLU A N     1 
ATOM   52     C CA    A GLU A  1 19  ? 54.155  -28.512 20.061  0.25 24.46  ? 19   GLU A CA    1 
ATOM   53     C C     A GLU A  1 19  ? 55.524  -28.038 19.597  0.25 22.75  ? 19   GLU A C     1 
ATOM   54     O O     A GLU A  1 19  ? 55.722  -26.848 19.402  0.25 23.66  ? 19   GLU A O     1 
ATOM   55     C CB    A GLU A  1 19  ? 54.038  -28.334 21.585  0.25 25.81  ? 19   GLU A CB    1 
ATOM   56     C CG    A GLU A  1 19  ? 52.599  -28.388 22.085  0.25 28.68  ? 19   GLU A CG    1 
ATOM   57     C CD    A GLU A  1 19  ? 52.519  -28.459 23.594  0.25 29.14  ? 19   GLU A CD    1 
ATOM   58     O OE1   A GLU A  1 19  ? 51.412  -28.398 24.135  0.25 30.49  ? 19   GLU A OE1   1 
ATOM   59     O OE2   A GLU A  1 19  ? 53.574  -28.592 24.242  0.25 36.49  ? 19   GLU A OE2   1 
ATOM   60     N N     A GLU A  1 20  ? 56.473  -28.954 19.416  0.25 23.53  ? 20   GLU A N     1 
ATOM   61     C CA    A GLU A  1 20  ? 57.817  -28.554 18.985  0.25 21.67  ? 20   GLU A CA    1 
ATOM   62     C C     A GLU A  1 20  ? 57.821  -27.942 17.587  0.25 22.46  ? 20   GLU A C     1 
ATOM   63     O O     A GLU A  1 20  ? 58.731  -27.191 17.211  0.25 23.36  ? 20   GLU A O     1 
ATOM   64     C CB    A GLU A  1 20  ? 58.784  -29.765 19.071  0.25 23.36  ? 20   GLU A CB    1 
ATOM   65     C CG    A GLU A  1 20  ? 60.225  -29.427 18.768  0.25 21.59  ? 20   GLU A CG    1 
ATOM   66     C CD    A GLU A  1 20  ? 61.229  -30.438 19.351  0.25 26.19  ? 20   GLU A CD    1 
ATOM   67     O OE1   A GLU A  1 20  ? 62.435  -30.311 19.027  0.25 24.57  ? 20   GLU A OE1   1 
ATOM   68     O OE2   A GLU A  1 20  ? 60.835  -31.344 20.129  0.25 22.67  ? 20   GLU A OE2   1 
ATOM   69     N N     A TYR A  1 21  ? 56.798  -28.236 16.793  0.25 24.62  ? 21   TYR A N     1 
ATOM   70     C CA    A TYR A  1 21  ? 56.732  -27.637 15.463  0.25 24.59  ? 21   TYR A CA    1 
ATOM   71     C C     A TYR A  1 21  ? 56.625  -26.123 15.514  0.25 23.25  ? 21   TYR A C     1 
ATOM   72     O O     A TYR A  1 21  ? 56.976  -25.436 14.552  0.25 25.32  ? 21   TYR A O     1 
ATOM   73     C CB    A TYR A  1 21  ? 55.569  -28.238 14.645  0.25 27.36  ? 21   TYR A CB    1 
ATOM   74     C CG    A TYR A  1 21  ? 55.900  -29.608 14.079  0.25 27.74  ? 21   TYR A CG    1 
ATOM   75     C CD1   A TYR A  1 21  ? 55.165  -30.726 14.440  0.25 27.59  ? 21   TYR A CD1   1 
ATOM   76     C CD2   A TYR A  1 21  ? 56.992  -29.785 13.206  0.25 27.72  ? 21   TYR A CD2   1 
ATOM   77     C CE1   A TYR A  1 21  ? 55.506  -32.000 13.952  0.25 29.57  ? 21   TYR A CE1   1 
ATOM   78     C CE2   A TYR A  1 21  ? 57.336  -31.040 12.719  0.25 25.38  ? 21   TYR A CE2   1 
ATOM   79     C CZ    A TYR A  1 21  ? 56.592  -32.142 13.096  0.25 28.07  ? 21   TYR A CZ    1 
ATOM   80     O OH    A TYR A  1 21  ? 56.933  -33.393 12.632  0.25 30.74  ? 21   TYR A OH    1 
ATOM   81     N N     A GLN A  1 22  ? 56.142  -25.583 16.634  0.25 23.92  ? 22   GLN A N     1 
ATOM   82     C CA    A GLN A  1 22  ? 56.053  -24.127 16.778  0.25 21.38  ? 22   GLN A CA    1 
ATOM   83     C C     A GLN A  1 22  ? 57.478  -23.579 16.676  0.25 22.27  ? 22   GLN A C     1 
ATOM   84     O O     A GLN A  1 22  ? 57.748  -22.609 15.976  0.25 20.90  ? 22   GLN A O     1 
ATOM   85     C CB    A GLN A  1 22  ? 55.500  -23.748 18.154  0.25 23.72  ? 22   GLN A CB    1 
ATOM   86     C CG    A GLN A  1 22  ? 54.057  -24.139 18.427  0.25 23.54  ? 22   GLN A CG    1 
ATOM   87     C CD    A GLN A  1 22  ? 53.689  -23.903 19.881  0.25 23.49  ? 22   GLN A CD    1 
ATOM   88     O OE1   A GLN A  1 22  ? 54.094  -24.660 20.784  0.25 27.47  ? 22   GLN A OE1   1 
ATOM   89     N NE2   A GLN A  1 22  ? 52.940  -22.848 20.124  0.25 20.33  ? 22   GLN A NE2   1 
ATOM   90     N N     A TYR A  1 23  ? 58.391  -24.210 17.409  0.25 22.73  ? 23   TYR A N     1 
ATOM   91     C CA    A TYR A  1 23  ? 59.798  -23.784 17.408  0.25 23.72  ? 23   TYR A CA    1 
ATOM   92     C C     A TYR A  1 23  ? 60.440  -23.969 16.019  0.25 21.37  ? 23   TYR A C     1 
ATOM   93     O O     A TYR A  1 23  ? 61.059  -23.058 15.477  0.25 22.06  ? 23   TYR A O     1 
ATOM   94     C CB    A TYR A  1 23  ? 60.556  -24.573 18.482  0.25 22.10  ? 23   TYR A CB    1 
ATOM   95     C CG    A TYR A  1 23  ? 62.049  -24.376 18.455  0.25 22.70  ? 23   TYR A CG    1 
ATOM   96     C CD1   A TYR A  1 23  ? 62.871  -25.265 17.751  0.25 24.28  ? 23   TYR A CD1   1 
ATOM   97     C CD2   A TYR A  1 23  ? 62.648  -23.331 19.146  0.25 20.88  ? 23   TYR A CD2   1 
ATOM   98     C CE1   A TYR A  1 23  ? 64.248  -25.119 17.749  0.25 20.65  ? 23   TYR A CE1   1 
ATOM   99     C CE2   A TYR A  1 23  ? 64.042  -23.160 19.142  0.25 22.18  ? 23   TYR A CE2   1 
ATOM   100    C CZ    A TYR A  1 23  ? 64.832  -24.074 18.434  0.25 22.54  ? 23   TYR A CZ    1 
ATOM   101    O OH    A TYR A  1 23  ? 66.204  -23.931 18.399  0.25 24.57  ? 23   TYR A OH    1 
ATOM   102    N N     A LEU A  1 24  ? 60.263  -25.147 15.434  0.25 25.01  ? 24   LEU A N     1 
ATOM   103    C CA    A LEU A  1 24  ? 60.833  -25.443 14.111  0.25 25.63  ? 24   LEU A CA    1 
ATOM   104    C C     A LEU A  1 24  ? 60.260  -24.532 13.022  0.25 25.74  ? 24   LEU A C     1 
ATOM   105    O O     A LEU A  1 24  ? 60.985  -24.000 12.173  0.25 23.55  ? 24   LEU A O     1 
ATOM   106    C CB    A LEU A  1 24  ? 60.569  -26.906 13.762  0.25 24.88  ? 24   LEU A CB    1 
ATOM   107    C CG    A LEU A  1 24  ? 61.212  -27.920 14.721  0.25 27.31  ? 24   LEU A CG    1 
ATOM   108    C CD1   A LEU A  1 24  ? 60.777  -29.317 14.336  0.25 27.05  ? 24   LEU A CD1   1 
ATOM   109    C CD2   A LEU A  1 24  ? 62.728  -27.798 14.676  0.25 25.04  ? 24   LEU A CD2   1 
ATOM   110    N N     A ASP A  1 25  ? 58.948  -24.337 13.049  0.25 26.56  ? 25   ASP A N     1 
ATOM   111    C CA    A ASP A  1 25  ? 58.315  -23.470 12.053  0.25 26.81  ? 25   ASP A CA    1 
ATOM   112    C C     A ASP A  1 25  ? 58.798  -22.023 12.137  0.25 25.13  ? 25   ASP A C     1 
ATOM   113    O O     A ASP A  1 25  ? 59.038  -21.383 11.114  0.25 26.65  ? 25   ASP A O     1 
ATOM   114    C CB    A ASP A  1 25  ? 56.790  -23.530 12.204  0.25 28.35  ? 25   ASP A CB    1 
ATOM   115    C CG    A ASP A  1 25  ? 56.203  -24.825 11.659  0.25 32.09  ? 25   ASP A CG    1 
ATOM   116    O OD1   A ASP A  1 25  ? 55.013  -25.109 11.924  0.25 36.07  ? 25   ASP A OD1   1 
ATOM   117    O OD2   A ASP A  1 25  ? 56.929  -25.559 10.961  0.25 31.15  ? 25   ASP A OD2   1 
ATOM   118    N N     A LEU A  1 26  ? 58.957  -21.498 13.353  0.25 23.37  ? 26   LEU A N     1 
ATOM   119    C CA    A LEU A  1 26  ? 59.399  -20.126 13.494  0.25 23.61  ? 26   LEU A CA    1 
ATOM   120    C C     A LEU A  1 26  ? 60.799  -19.945 12.935  0.25 23.29  ? 26   LEU A C     1 
ATOM   121    O O     A LEU A  1 26  ? 61.075  -18.957 12.275  0.25 25.54  ? 26   LEU A O     1 
ATOM   122    C CB    A LEU A  1 26  ? 59.349  -19.678 14.968  0.25 24.03  ? 26   LEU A CB    1 
ATOM   123    C CG    A LEU A  1 26  ? 59.861  -18.261 15.243  0.25 24.37  ? 26   LEU A CG    1 
ATOM   124    C CD1   A LEU A  1 26  ? 59.104  -17.253 14.367  0.25 27.23  ? 26   LEU A CD1   1 
ATOM   125    C CD2   A LEU A  1 26  ? 59.701  -17.919 16.732  0.25 25.11  ? 26   LEU A CD2   1 
ATOM   126    N N     A ILE A  1 27  ? 61.685  -20.892 13.216  0.25 24.90  ? 27   ILE A N     1 
ATOM   127    C CA    A ILE A  1 27  ? 63.055  -20.820 12.708  0.25 26.13  ? 27   ILE A CA    1 
ATOM   128    C C     A ILE A  1 27  ? 63.028  -20.831 11.183  0.25 27.64  ? 27   ILE A C     1 
ATOM   129    O O     A ILE A  1 27  ? 63.734  -20.059 10.543  0.25 28.84  ? 27   ILE A O     1 
ATOM   130    C CB    A ILE A  1 27  ? 63.904  -22.019 13.204  0.25 26.69  ? 27   ILE A CB    1 
ATOM   131    C CG1   A ILE A  1 27  ? 64.212  -21.841 14.695  0.25 26.14  ? 27   ILE A CG1   1 
ATOM   132    C CG2   A ILE A  1 27  ? 65.166  -22.141 12.362  0.25 25.96  ? 27   ILE A CG2   1 
ATOM   133    C CD1   A ILE A  1 27  ? 64.894  -22.997 15.320  0.25 28.01  ? 27   ILE A CD1   1 
ATOM   134    N N     A ARG A  1 28  ? 62.201  -21.701 10.612  0.25 26.81  ? 28   ARG A N     1 
ATOM   135    C CA    A ARG A  1 28  ? 62.080  -21.784 9.155   0.25 30.03  ? 28   ARG A CA    1 
ATOM   136    C C     A ARG A  1 28  ? 61.593  -20.455 8.587   0.25 29.95  ? 28   ARG A C     1 
ATOM   137    O O     A ARG A  1 28  ? 62.113  -19.952 7.578   0.25 28.69  ? 28   ARG A O     1 
ATOM   138    C CB    A ARG A  1 28  ? 61.119  -22.925 8.775   0.25 32.51  ? 28   ARG A CB    1 
ATOM   139    C CG    A ARG A  1 28  ? 60.927  -23.123 7.285   0.25 39.00  ? 28   ARG A CG    1 
ATOM   140    C CD    A ARG A  1 28  ? 59.978  -24.284 6.988   0.25 40.98  ? 28   ARG A CD    1 
ATOM   141    N NE    A ARG A  1 28  ? 60.602  -25.594 7.164   0.25 43.41  ? 28   ARG A NE    1 
ATOM   142    C CZ    A ARG A  1 28  ? 60.512  -26.370 8.241   0.25 43.90  ? 28   ARG A CZ    1 
ATOM   143    N NH1   A ARG A  1 28  ? 59.808  -25.999 9.305   0.25 46.40  ? 28   ARG A NH1   1 
ATOM   144    N NH2   A ARG A  1 28  ? 61.133  -27.544 8.247   0.25 43.18  ? 28   ARG A NH2   1 
ATOM   145    N N     A ARG A  1 29  ? 60.605  -19.861 9.253   0.25 31.89  ? 29   ARG A N     1 
ATOM   146    C CA    A ARG A  1 29  ? 60.068  -18.580 8.811   0.25 28.19  ? 29   ARG A CA    1 
ATOM   147    C C     A ARG A  1 29  ? 61.118  -17.469 8.897   0.25 29.55  ? 29   ARG A C     1 
ATOM   148    O O     A ARG A  1 29  ? 61.280  -16.678 7.965   0.25 29.77  ? 29   ARG A O     1 
ATOM   149    C CB    A ARG A  1 29  ? 58.851  -18.209 9.654   0.25 30.93  ? 29   ARG A CB    1 
ATOM   150    C CG    A ARG A  1 29  ? 58.179  -16.919 9.207   0.25 30.64  ? 29   ARG A CG    1 
ATOM   151    C CD    A ARG A  1 29  ? 57.065  -16.529 10.163  0.25 33.94  ? 29   ARG A CD    1 
ATOM   152    N NE    A ARG A  1 29  ? 56.538  -15.206 9.854   0.25 35.20  ? 29   ARG A NE    1 
ATOM   153    C CZ    A ARG A  1 29  ? 55.838  -14.462 10.702  0.25 36.83  ? 29   ARG A CZ    1 
ATOM   154    N NH1   A ARG A  1 29  ? 55.576  -14.918 11.924  0.25 38.18  ? 29   ARG A NH1   1 
ATOM   155    N NH2   A ARG A  1 29  ? 55.423  -13.255 10.333  0.25 36.39  ? 29   ARG A NH2   1 
ATOM   156    N N     A ILE A  1 30  ? 61.841  -17.409 10.008  0.25 29.06  ? 30   ILE A N     1 
ATOM   157    C CA    A ILE A  1 30  ? 62.865  -16.376 10.173  0.25 28.96  ? 30   ILE A CA    1 
ATOM   158    C C     A ILE A  1 30  ? 63.934  -16.504 9.081   0.25 27.35  ? 30   ILE A C     1 
ATOM   159    O O     A ILE A  1 30  ? 64.363  -15.521 8.495   0.25 26.64  ? 30   ILE A O     1 
ATOM   160    C CB    A ILE A  1 30  ? 63.552  -16.482 11.567  0.25 27.49  ? 30   ILE A CB    1 
ATOM   161    C CG1   A ILE A  1 30  ? 62.532  -16.197 12.681  0.25 28.59  ? 30   ILE A CG1   1 
ATOM   162    C CG2   A ILE A  1 30  ? 64.724  -15.522 11.644  0.25 24.54  ? 30   ILE A CG2   1 
ATOM   163    C CD1   A ILE A  1 30  ? 63.046  -16.479 14.104  0.25 27.97  ? 30   ILE A CD1   1 
ATOM   164    N N     A ILE A  1 31  ? 64.368  -17.722 8.812   0.25 29.58  ? 31   ILE A N     1 
ATOM   165    C CA    A ILE A  1 31  ? 65.387  -17.917 7.782   0.25 30.76  ? 31   ILE A CA    1 
ATOM   166    C C     A ILE A  1 31  ? 64.824  -17.490 6.421   0.25 33.05  ? 31   ILE A C     1 
ATOM   167    O O     A ILE A  1 31  ? 65.516  -16.845 5.627   0.25 34.07  ? 31   ILE A O     1 
ATOM   168    C CB    A ILE A  1 31  ? 65.823  -19.393 7.725   0.25 31.61  ? 31   ILE A CB    1 
ATOM   169    C CG1   A ILE A  1 31  ? 66.505  -19.775 9.037   0.25 30.61  ? 31   ILE A CG1   1 
ATOM   170    C CG2   A ILE A  1 31  ? 66.769  -19.639 6.544   0.25 31.93  ? 31   ILE A CG2   1 
ATOM   171    C CD1   A ILE A  1 31  ? 66.871  -21.230 9.119   0.25 31.35  ? 31   ILE A CD1   1 
ATOM   172    N N     A ASN A  1 32  ? 63.564  -17.827 6.166   0.25 33.07  ? 32   ASN A N     1 
ATOM   173    C CA    A ASN A  1 32  ? 62.924  -17.502 4.889   0.25 36.27  ? 32   ASN A CA    1 
ATOM   174    C C     A ASN A  1 32  ? 62.613  -16.026 4.649   0.25 36.86  ? 32   ASN A C     1 
ATOM   175    O O     A ASN A  1 32  ? 63.056  -15.449 3.656   0.25 37.63  ? 32   ASN A O     1 
ATOM   176    C CB    A ASN A  1 32  ? 61.619  -18.309 4.716   0.25 36.91  ? 32   ASN A CB    1 
ATOM   177    C CG    A ASN A  1 32  ? 61.865  -19.771 4.385   0.25 40.70  ? 32   ASN A CG    1 
ATOM   178    O OD1   A ASN A  1 32  ? 60.946  -20.597 4.460   0.25 43.78  ? 32   ASN A OD1   1 
ATOM   179    N ND2   A ASN A  1 32  ? 63.099  -20.100 4.006   0.25 40.12  ? 32   ASN A ND2   1 
ATOM   180    N N     A VAL A  1 33  ? 61.851  -15.413 5.551   0.25 36.66  ? 33   VAL A N     1 
ATOM   181    C CA    A VAL A  1 33  ? 61.465  -14.016 5.381   0.25 35.76  ? 33   VAL A CA    1 
ATOM   182    C C     A VAL A  1 33  ? 62.015  -13.044 6.426   0.25 37.30  ? 33   VAL A C     1 
ATOM   183    O O     A VAL A  1 33  ? 61.652  -11.866 6.440   0.25 36.69  ? 33   VAL A O     1 
ATOM   184    C CB    A VAL A  1 33  ? 59.917  -13.879 5.359   0.25 35.06  ? 33   VAL A CB    1 
ATOM   185    C CG1   A VAL A  1 33  ? 59.337  -14.684 4.188   0.25 34.78  ? 33   VAL A CG1   1 
ATOM   186    C CG2   A VAL A  1 33  ? 59.332  -14.372 6.665   0.25 33.47  ? 33   VAL A CG2   1 
ATOM   187    N N     A GLY A  1 34  ? 62.884  -13.529 7.306   0.25 36.92  ? 34   GLY A N     1 
ATOM   188    C CA    A GLY A  1 34  ? 63.443  -12.653 8.317   0.25 33.65  ? 34   GLY A CA    1 
ATOM   189    C C     A GLY A  1 34  ? 64.302  -11.562 7.706   0.25 33.87  ? 34   GLY A C     1 
ATOM   190    O O     A GLY A  1 34  ? 64.766  -11.684 6.579   0.25 33.20  ? 34   GLY A O     1 
ATOM   191    N N     A GLU A  1 35  ? 64.507  -10.487 8.456   0.25 32.32  ? 35   GLU A N     1 
ATOM   192    C CA    A GLU A  1 35  ? 65.313  -9.370  7.992   0.25 34.04  ? 35   GLU A CA    1 
ATOM   193    C C     A GLU A  1 35  ? 66.777  -9.497  8.452   0.25 32.60  ? 35   GLU A C     1 
ATOM   194    O O     A GLU A  1 35  ? 67.046  -9.730  9.625   0.25 32.76  ? 35   GLU A O     1 
ATOM   195    C CB    A GLU A  1 35  ? 64.691  -8.074  8.512   0.25 34.11  ? 35   GLU A CB    1 
ATOM   196    C CG    A GLU A  1 35  ? 65.503  -6.808  8.296   0.25 40.23  ? 35   GLU A CG    1 
ATOM   197    C CD    A GLU A  1 35  ? 64.832  -5.581  8.925   0.25 43.96  ? 35   GLU A CD    1 
ATOM   198    O OE1   A GLU A  1 35  ? 65.498  -4.528  9.064   0.25 43.10  ? 35   GLU A OE1   1 
ATOM   199    O OE2   A GLU A  1 35  ? 63.628  -5.673  9.279   0.25 46.79  ? 35   GLU A OE2   1 
ATOM   200    N N     A VAL A  1 36  ? 67.716  -9.355  7.521   0.25 31.73  ? 36   VAL A N     1 
ATOM   201    C CA    A VAL A  1 36  ? 69.138  -9.449  7.842   0.25 32.35  ? 36   VAL A CA    1 
ATOM   202    C C     A VAL A  1 36  ? 69.541  -8.183  8.582   0.25 32.36  ? 36   VAL A C     1 
ATOM   203    O O     A VAL A  1 36  ? 69.359  -7.088  8.085   0.25 34.01  ? 36   VAL A O     1 
ATOM   204    C CB    A VAL A  1 36  ? 70.000  -9.580  6.571   0.25 32.03  ? 36   VAL A CB    1 
ATOM   205    C CG1   A VAL A  1 36  ? 71.473  -9.611  6.949   0.25 33.06  ? 36   VAL A CG1   1 
ATOM   206    C CG2   A VAL A  1 36  ? 69.616  -10.839 5.815   0.25 33.74  ? 36   VAL A CG2   1 
ATOM   207    N N     A ARG A  1 37  ? 70.095  -8.330  9.777   0.25 33.25  ? 37   ARG A N     1 
ATOM   208    C CA    A ARG A  1 37  ? 70.467  -7.157  10.559  0.25 31.93  ? 37   ARG A CA    1 
ATOM   209    C C     A ARG A  1 37  ? 71.800  -7.256  11.268  0.25 32.00  ? 37   ARG A C     1 
ATOM   210    O O     A ARG A  1 37  ? 72.296  -8.349  11.530  0.25 30.87  ? 37   ARG A O     1 
ATOM   211    C CB    A ARG A  1 37  ? 69.403  -6.896  11.627  0.25 32.12  ? 37   ARG A CB    1 
ATOM   212    C CG    A ARG A  1 37  ? 67.994  -6.785  11.070  0.25 33.05  ? 37   ARG A CG    1 
ATOM   213    C CD    A ARG A  1 37  ? 66.962  -7.068  12.122  0.25 30.83  ? 37   ARG A CD    1 
ATOM   214    N NE    A ARG A  1 37  ? 66.954  -6.135  13.234  0.25 27.78  ? 37   ARG A NE    1 
ATOM   215    C CZ    A ARG A  1 37  ? 66.534  -4.875  13.244  0.25 28.09  ? 37   ARG A CZ    1 
ATOM   216    N NH1   A ARG A  1 37  ? 66.052  -4.273  12.161  0.25 26.40  ? 37   ARG A NH1   1 
ATOM   217    N NH2   A ARG A  1 37  ? 66.566  -4.225  14.399  0.25 25.66  ? 37   ARG A NH2   1 
ATOM   218    N N     A PRO A  1 38  ? 72.401  -6.098  11.581  0.25 32.13  ? 38   PRO A N     1 
ATOM   219    C CA    A PRO A  1 38  ? 73.685  -6.025  12.290  0.25 33.30  ? 38   PRO A CA    1 
ATOM   220    C C     A PRO A  1 38  ? 73.268  -6.165  13.751  0.25 34.09  ? 38   PRO A C     1 
ATOM   221    O O     A PRO A  1 38  ? 72.091  -5.981  14.076  0.25 34.25  ? 38   PRO A O     1 
ATOM   222    C CB    A PRO A  1 38  ? 74.177  -4.606  12.014  0.25 32.65  ? 38   PRO A CB    1 
ATOM   223    C CG    A PRO A  1 38  ? 73.377  -4.156  10.806  0.25 36.59  ? 38   PRO A CG    1 
ATOM   224    C CD    A PRO A  1 38  ? 72.023  -4.779  11.057  0.25 34.10  ? 38   PRO A CD    1 
ATOM   225    N N     A ASP A  1 39  ? 74.205  -6.481  14.631  0.25 34.56  ? 39   ASP A N     1 
ATOM   226    C CA    A ASP A  1 39  ? 73.859  -6.614  16.039  0.25 32.93  ? 39   ASP A CA    1 
ATOM   227    C C     A ASP A  1 39  ? 75.051  -6.325  16.939  0.25 33.20  ? 39   ASP A C     1 
ATOM   228    O O     A ASP A  1 39  ? 76.188  -6.174  16.473  0.25 32.48  ? 39   ASP A O     1 
ATOM   229    C CB    A ASP A  1 39  ? 73.307  -8.015  16.333  0.25 30.51  ? 39   ASP A CB    1 
ATOM   230    C CG    A ASP A  1 39  ? 74.397  -9.076  16.419  0.25 35.19  ? 39   ASP A CG    1 
ATOM   231    O OD1   A ASP A  1 39  ? 75.165  -9.243  15.443  0.25 33.92  ? 39   ASP A OD1   1 
ATOM   232    O OD2   A ASP A  1 39  ? 74.478  -9.762  17.464  0.25 29.33  ? 39   ASP A OD2   1 
ATOM   233    N N     A ARG A  1 40  ? 74.774  -6.257  18.236  0.25 30.56  ? 40   ARG A N     1 
ATOM   234    C CA    A ARG A  1 40  ? 75.786  -5.998  19.237  0.25 28.60  ? 40   ARG A CA    1 
ATOM   235    C C     A ARG A  1 40  ? 77.005  -6.927  19.147  0.25 29.46  ? 40   ARG A C     1 
ATOM   236    O O     A ARG A  1 40  ? 78.137  -6.467  19.292  0.25 28.40  ? 40   ARG A O     1 
ATOM   237    C CB    A ARG A  1 40  ? 75.164  -6.138  20.628  0.25 27.51  ? 40   ARG A CB    1 
ATOM   238    C CG    A ARG A  1 40  ? 76.127  -5.979  21.790  0.25 28.29  ? 40   ARG A CG    1 
ATOM   239    C CD    A ARG A  1 40  ? 75.427  -6.273  23.133  0.25 26.59  ? 40   ARG A CD    1 
ATOM   240    N NE    A ARG A  1 40  ? 74.898  -7.640  23.206  0.25 28.09  ? 40   ARG A NE    1 
ATOM   241    C CZ    A ARG A  1 40  ? 75.647  -8.725  23.399  0.25 28.60  ? 40   ARG A CZ    1 
ATOM   242    N NH1   A ARG A  1 40  ? 76.963  -8.623  23.538  0.25 25.15  ? 40   ARG A NH1   1 
ATOM   243    N NH2   A ARG A  1 40  ? 75.078  -9.916  23.472  0.25 25.42  ? 40   ARG A NH2   1 
ATOM   244    N N     A THR A  1 41  ? 76.773  -8.219  18.913  0.25 29.64  ? 41   THR A N     1 
ATOM   245    C CA    A THR A  1 41  ? 77.867  -9.199  18.876  0.25 30.90  ? 41   THR A CA    1 
ATOM   246    C C     A THR A  1 41  ? 78.766  -9.075  17.650  0.25 31.70  ? 41   THR A C     1 
ATOM   247    O O     A THR A  1 41  ? 79.925  -9.472  17.684  0.25 31.85  ? 41   THR A O     1 
ATOM   248    C CB    A THR A  1 41  ? 77.345  -10.641 18.899  0.25 28.53  ? 41   THR A CB    1 
ATOM   249    O OG1   A THR A  1 41  ? 76.720  -10.921 17.635  0.25 30.28  ? 41   THR A OG1   1 
ATOM   250    C CG2   A THR A  1 41  ? 76.332  -10.834 20.036  0.25 28.04  ? 41   THR A CG2   1 
ATOM   251    N N     A GLY A  1 42  ? 78.219  -8.542  16.564  0.25 33.44  ? 42   GLY A N     1 
ATOM   252    C CA    A GLY A  1 42  ? 79.003  -8.396  15.357  0.25 33.47  ? 42   GLY A CA    1 
ATOM   253    C C     A GLY A  1 42  ? 78.915  -9.575  14.404  0.25 33.55  ? 42   GLY A C     1 
ATOM   254    O O     A GLY A  1 42  ? 79.471  -9.521  13.309  0.25 34.36  ? 42   GLY A O     1 
ATOM   255    N N     A THR A  1 43  ? 78.225  -10.642 14.785  0.25 32.99  ? 43   THR A N     1 
ATOM   256    C CA    A THR A  1 43  ? 78.110  -11.783 13.881  0.25 32.52  ? 43   THR A CA    1 
ATOM   257    C C     A THR A  1 43  ? 76.942  -11.583 12.907  0.25 30.12  ? 43   THR A C     1 
ATOM   258    O O     A THR A  1 43  ? 76.936  -12.120 11.803  0.25 30.65  ? 43   THR A O     1 
ATOM   259    C CB    A THR A  1 43  ? 77.905  -13.105 14.660  0.25 33.67  ? 43   THR A CB    1 
ATOM   260    O OG1   A THR A  1 43  ? 76.537  -13.235 15.037  0.25 40.42  ? 43   THR A OG1   1 
ATOM   261    C CG2   A THR A  1 43  ? 78.733  -13.112 15.908  0.25 30.75  ? 43   THR A CG2   1 
ATOM   262    N N     A GLY A  1 44  ? 75.951  -10.800 13.311  0.25 29.50  ? 44   GLY A N     1 
ATOM   263    C CA    A GLY A  1 44  ? 74.809  -10.566 12.441  0.25 26.81  ? 44   GLY A CA    1 
ATOM   264    C C     A GLY A  1 44  ? 73.716  -11.609 12.655  0.25 26.36  ? 44   GLY A C     1 
ATOM   265    O O     A GLY A  1 44  ? 74.005  -12.710 13.117  0.25 24.39  ? 44   GLY A O     1 
ATOM   266    N N     A THR A  1 45  ? 72.469  -11.256 12.338  0.25 23.94  ? 45   THR A N     1 
ATOM   267    C CA    A THR A  1 45  ? 71.353  -12.173 12.498  0.25 25.04  ? 45   THR A CA    1 
ATOM   268    C C     A THR A  1 45  ? 70.292  -11.927 11.424  0.25 25.10  ? 45   THR A C     1 
ATOM   269    O O     A THR A  1 45  ? 70.399  -11.011 10.609  0.25 27.96  ? 45   THR A O     1 
ATOM   270    C CB    A THR A  1 45  ? 70.621  -11.960 13.837  0.25 24.12  ? 45   THR A CB    1 
ATOM   271    O OG1   A THR A  1 45  ? 69.884  -10.730 13.762  0.25 21.89  ? 45   THR A OG1   1 
ATOM   272    C CG2   A THR A  1 45  ? 71.609  -11.890 15.029  0.25 22.49  ? 45   THR A CG2   1 
ATOM   273    N N     A VAL A  1 46  ? 69.273  -12.773 11.435  0.25 24.92  ? 46   VAL A N     1 
ATOM   274    C CA    A VAL A  1 46  ? 68.121  -12.618 10.560  0.25 27.17  ? 46   VAL A CA    1 
ATOM   275    C C     A VAL A  1 46  ? 67.000  -12.610 11.618  0.25 26.09  ? 46   VAL A C     1 
ATOM   276    O O     A VAL A  1 46  ? 66.965  -13.472 12.477  0.25 25.50  ? 46   VAL A O     1 
ATOM   277    C CB    A VAL A  1 46  ? 67.988  -13.806 9.586   0.25 30.24  ? 46   VAL A CB    1 
ATOM   278    C CG1   A VAL A  1 46  ? 67.914  -15.112 10.352  0.25 32.96  ? 46   VAL A CG1   1 
ATOM   279    C CG2   A VAL A  1 46  ? 66.764  -13.617 8.717   0.25 29.69  ? 46   VAL A CG2   1 
ATOM   280    N N     A ALA A  1 47  ? 66.095  -11.645 11.570  0.25 26.15  ? 47   ALA A N     1 
ATOM   281    C CA    A ALA A  1 47  ? 65.071  -11.555 12.607  0.25 25.07  ? 47   ALA A CA    1 
ATOM   282    C C     A ALA A  1 47  ? 63.689  -11.099 12.190  0.25 26.15  ? 47   ALA A C     1 
ATOM   283    O O     A ALA A  1 47  ? 63.494  -10.520 11.121  0.25 24.70  ? 47   ALA A O     1 
ATOM   284    C CB    A ALA A  1 47  ? 65.555  -10.613 13.718  0.25 22.84  ? 47   ALA A CB    1 
ATOM   285    N N     A LEU A  1 48  ? 62.746  -11.360 13.095  0.25 26.39  ? 48   LEU A N     1 
ATOM   286    C CA    A LEU A  1 48  ? 61.348  -10.967 12.971  0.25 25.58  ? 48   LEU A CA    1 
ATOM   287    C C     A LEU A  1 48  ? 60.978  -10.417 14.345  0.25 27.28  ? 48   LEU A C     1 
ATOM   288    O O     A LEU A  1 48  ? 61.471  -10.918 15.364  0.25 25.96  ? 48   LEU A O     1 
ATOM   289    C CB    A LEU A  1 48  ? 60.472  -12.175 12.660  0.25 25.56  ? 48   LEU A CB    1 
ATOM   290    C CG    A LEU A  1 48  ? 60.595  -12.798 11.267  0.25 24.81  ? 48   LEU A CG    1 
ATOM   291    C CD1   A LEU A  1 48  ? 59.675  -14.024 11.189  0.25 25.55  ? 48   LEU A CD1   1 
ATOM   292    C CD2   A LEU A  1 48  ? 60.211  -11.766 10.220  0.25 23.53  ? 48   LEU A CD2   1 
ATOM   293    N N     A PHE A  1 49  ? 60.123  -9.398  14.381  0.25 25.80  ? 49   PHE A N     1 
ATOM   294    C CA    A PHE A  1 49  ? 59.700  -8.816  15.650  0.25 26.03  ? 49   PHE A CA    1 
ATOM   295    C C     A PHE A  1 49  ? 58.307  -9.254  16.068  0.25 26.66  ? 49   PHE A C     1 
ATOM   296    O O     A PHE A  1 49  ? 57.381  -9.260  15.259  0.25 26.62  ? 49   PHE A O     1 
ATOM   297    C CB    A PHE A  1 49  ? 59.720  -7.295  15.583  0.25 24.40  ? 49   PHE A CB    1 
ATOM   298    C CG    A PHE A  1 49  ? 59.330  -6.620  16.870  0.25 22.93  ? 49   PHE A CG    1 
ATOM   299    C CD1   A PHE A  1 49  ? 60.101  -6.779  18.014  0.25 21.81  ? 49   PHE A CD1   1 
ATOM   300    C CD2   A PHE A  1 49  ? 58.207  -5.786  16.924  0.25 21.38  ? 49   PHE A CD2   1 
ATOM   301    C CE1   A PHE A  1 49  ? 59.779  -6.120  19.199  0.25 20.10  ? 49   PHE A CE1   1 
ATOM   302    C CE2   A PHE A  1 49  ? 57.869  -5.118  18.107  0.25 23.29  ? 49   PHE A CE2   1 
ATOM   303    C CZ    A PHE A  1 49  ? 58.662  -5.285  19.250  0.25 21.37  ? 49   PHE A CZ    1 
ATOM   304    N N     A ALA A  1 50  ? 58.173  -9.618  17.345  0.25 25.99  ? 50   ALA A N     1 
ATOM   305    C CA    A ALA A  1 50  ? 56.881  -9.999  17.908  0.25 25.71  ? 50   ALA A CA    1 
ATOM   306    C C     A ALA A  1 50  ? 56.095  -11.038 17.129  0.25 25.49  ? 50   ALA A C     1 
ATOM   307    O O     A ALA A  1 50  ? 54.964  -10.786 16.737  0.25 27.17  ? 50   ALA A O     1 
ATOM   308    C CB    A ALA A  1 50  ? 56.023  -8.747  18.079  0.25 23.44  ? 50   ALA A CB    1 
ATOM   309    N N     A PRO A  1 51  ? 56.680  -12.218 16.886  0.25 26.09  ? 51   PRO A N     1 
ATOM   310    C CA    A PRO A  1 51  ? 55.933  -13.239 16.149  0.25 25.35  ? 51   PRO A CA    1 
ATOM   311    C C     A PRO A  1 51  ? 54.918  -13.851 17.109  0.25 25.04  ? 51   PRO A C     1 
ATOM   312    O O     A PRO A  1 51  ? 54.994  -13.624 18.318  0.25 25.59  ? 51   PRO A O     1 
ATOM   313    C CB    A PRO A  1 51  ? 57.013  -14.246 15.768  0.25 26.98  ? 51   PRO A CB    1 
ATOM   314    C CG    A PRO A  1 51  ? 57.944  -14.160 16.960  0.25 25.99  ? 51   PRO A CG    1 
ATOM   315    C CD    A PRO A  1 51  ? 58.048  -12.681 17.187  0.25 24.81  ? 51   PRO A CD    1 
ATOM   316    N N     A PRO A  1 52  ? 53.960  -14.633 16.586  0.25 24.22  ? 52   PRO A N     1 
ATOM   317    C CA    A PRO A  1 52  ? 52.963  -15.253 17.465  0.25 24.63  ? 52   PRO A CA    1 
ATOM   318    C C     A PRO A  1 52  ? 53.660  -15.988 18.619  0.25 27.11  ? 52   PRO A C     1 
ATOM   319    O O     A PRO A  1 52  ? 54.708  -16.623 18.438  0.25 24.59  ? 52   PRO A O     1 
ATOM   320    C CB    A PRO A  1 52  ? 52.224  -16.224 16.527  0.25 25.13  ? 52   PRO A CB    1 
ATOM   321    C CG    A PRO A  1 52  ? 52.270  -15.509 15.190  0.25 27.12  ? 52   PRO A CG    1 
ATOM   322    C CD    A PRO A  1 52  ? 53.710  -14.957 15.162  0.25 25.38  ? 52   PRO A CD    1 
ATOM   323    N N     A SER A  1 53  ? 53.053  -15.940 19.797  0.25 26.44  ? 53   SER A N     1 
ATOM   324    C CA    A SER A  1 53  ? 53.631  -16.588 20.971  0.25 27.52  ? 53   SER A CA    1 
ATOM   325    C C     A SER A  1 53  ? 53.564  -18.101 20.917  0.25 26.71  ? 53   SER A C     1 
ATOM   326    O O     A SER A  1 53  ? 52.732  -18.657 20.197  0.25 24.38  ? 53   SER A O     1 
ATOM   327    C CB    A SER A  1 53  ? 52.903  -16.104 22.232  0.25 28.80  ? 53   SER A CB    1 
ATOM   328    O OG    A SER A  1 53  ? 51.555  -16.512 22.198  0.25 31.38  ? 53   SER A OG    1 
ATOM   329    N N     A PHE A  1 54  ? 54.435  -18.763 21.691  0.25 23.84  ? 54   PHE A N     1 
ATOM   330    C CA    A PHE A  1 54  ? 54.446  -20.218 21.767  0.25 22.90  ? 54   PHE A CA    1 
ATOM   331    C C     A PHE A  1 54  ? 53.610  -20.644 22.962  0.25 24.62  ? 54   PHE A C     1 
ATOM   332    O O     A PHE A  1 54  ? 53.619  -19.978 24.002  0.25 25.84  ? 54   PHE A O     1 
ATOM   333    C CB    A PHE A  1 54  ? 55.874  -20.769 22.000  0.25 24.17  ? 54   PHE A CB    1 
ATOM   334    C CG    A PHE A  1 54  ? 56.783  -20.668 20.814  0.25 24.71  ? 54   PHE A CG    1 
ATOM   335    C CD1   A PHE A  1 54  ? 56.300  -20.244 19.578  0.25 23.68  ? 54   PHE A CD1   1 
ATOM   336    C CD2   A PHE A  1 54  ? 58.138  -21.007 20.936  0.25 26.11  ? 54   PHE A CD2   1 
ATOM   337    C CE1   A PHE A  1 54  ? 57.146  -20.156 18.479  0.25 27.19  ? 54   PHE A CE1   1 
ATOM   338    C CE2   A PHE A  1 54  ? 58.999  -20.921 19.827  0.25 25.43  ? 54   PHE A CE2   1 
ATOM   339    C CZ    A PHE A  1 54  ? 58.500  -20.497 18.601  0.25 26.22  ? 54   PHE A CZ    1 
ATOM   340    N N     A ARG A  1 55  ? 52.934  -21.782 22.843  0.25 24.28  ? 55   ARG A N     1 
ATOM   341    C CA    A ARG A  1 55  ? 52.138  -22.304 23.946  0.25 25.94  ? 55   ARG A CA    1 
ATOM   342    C C     A ARG A  1 55  ? 52.511  -23.760 24.159  0.25 24.37  ? 55   ARG A C     1 
ATOM   343    O O     A ARG A  1 55  ? 52.526  -24.550 23.224  0.25 25.92  ? 55   ARG A O     1 
ATOM   344    C CB    A ARG A  1 55  ? 50.636  -22.191 23.651  0.25 28.50  ? 55   ARG A CB    1 
ATOM   345    C CG    A ARG A  1 55  ? 50.180  -20.793 23.241  0.25 31.71  ? 55   ARG A CG    1 
ATOM   346    C CD    A ARG A  1 55  ? 48.652  -20.748 23.071  0.25 32.88  ? 55   ARG A CD    1 
ATOM   347    N NE    A ARG A  1 55  ? 47.987  -20.599 24.364  0.25 36.39  ? 55   ARG A NE    1 
ATOM   348    C CZ    A ARG A  1 55  ? 47.761  -19.426 24.952  0.25 34.50  ? 55   ARG A CZ    1 
ATOM   349    N NH1   A ARG A  1 55  ? 48.137  -18.303 24.359  0.25 33.46  ? 55   ARG A NH1   1 
ATOM   350    N NH2   A ARG A  1 55  ? 47.167  -19.380 26.134  0.25 34.95  ? 55   ARG A NH2   1 
ATOM   351    N N     A PHE A  1 56  ? 52.820  -24.112 25.393  0.25 21.69  ? 56   PHE A N     1 
ATOM   352    C CA    A PHE A  1 56  ? 53.193  -25.482 25.711  0.25 21.88  ? 56   PHE A CA    1 
ATOM   353    C C     A PHE A  1 56  ? 52.371  -26.015 26.873  0.25 21.98  ? 56   PHE A C     1 
ATOM   354    O O     A PHE A  1 56  ? 52.251  -25.367 27.913  0.25 20.40  ? 56   PHE A O     1 
ATOM   355    C CB    A PHE A  1 56  ? 54.678  -25.557 26.090  0.25 19.94  ? 56   PHE A CB    1 
ATOM   356    C CG    A PHE A  1 56  ? 55.609  -25.176 24.976  0.25 22.74  ? 56   PHE A CG    1 
ATOM   357    C CD1   A PHE A  1 56  ? 55.907  -26.091 23.960  0.25 22.53  ? 56   PHE A CD1   1 
ATOM   358    C CD2   A PHE A  1 56  ? 56.195  -23.921 24.941  0.25 19.20  ? 56   PHE A CD2   1 
ATOM   359    C CE1   A PHE A  1 56  ? 56.780  -25.749 22.927  0.25 21.15  ? 56   PHE A CE1   1 
ATOM   360    C CE2   A PHE A  1 56  ? 57.073  -23.573 23.907  0.25 22.06  ? 56   PHE A CE2   1 
ATOM   361    C CZ    A PHE A  1 56  ? 57.361  -24.487 22.905  0.25 21.19  ? 56   PHE A CZ    1 
ATOM   362    N N     A SER A  1 57  ? 51.804  -27.201 26.703  0.25 22.62  ? 57   SER A N     1 
ATOM   363    C CA    A SER A  1 57  ? 51.028  -27.789 27.788  0.25 24.04  ? 57   SER A CA    1 
ATOM   364    C C     A SER A  1 57  ? 51.959  -28.398 28.827  0.25 26.80  ? 57   SER A C     1 
ATOM   365    O O     A SER A  1 57  ? 52.930  -29.079 28.474  0.25 24.14  ? 57   SER A O     1 
ATOM   366    C CB    A SER A  1 57  ? 50.103  -28.884 27.258  0.25 24.34  ? 57   SER A CB    1 
ATOM   367    O OG    A SER A  1 57  ? 49.565  -29.609 28.354  0.25 21.70  ? 57   SER A OG    1 
ATOM   368    N N     A LEU A  1 58  ? 51.662  -28.150 30.106  0.25 25.91  ? 58   LEU A N     1 
ATOM   369    C CA    A LEU A  1 58  ? 52.449  -28.686 31.203  0.25 25.09  ? 58   LEU A CA    1 
ATOM   370    C C     A LEU A  1 58  ? 51.633  -29.727 31.970  0.25 26.61  ? 58   LEU A C     1 
ATOM   371    O O     A LEU A  1 58  ? 52.041  -30.185 33.036  0.25 26.60  ? 58   LEU A O     1 
ATOM   372    C CB    A LEU A  1 58  ? 52.881  -27.565 32.154  0.25 25.84  ? 58   LEU A CB    1 
ATOM   373    C CG    A LEU A  1 58  ? 53.686  -26.409 31.548  0.25 24.99  ? 58   LEU A CG    1 
ATOM   374    C CD1   A LEU A  1 58  ? 54.066  -25.418 32.657  0.25 18.50  ? 58   LEU A CD1   1 
ATOM   375    C CD2   A LEU A  1 58  ? 54.944  -26.955 30.854  0.25 20.23  ? 58   LEU A CD2   1 
ATOM   376    N N     A ALA A  1 59  ? 50.492  -30.119 31.406  0.25 25.67  ? 59   ALA A N     1 
ATOM   377    C CA    A ALA A  1 59  ? 49.636  -31.106 32.045  0.25 27.39  ? 59   ALA A CA    1 
ATOM   378    C C     A ALA A  1 59  ? 50.264  -32.502 31.969  0.25 30.41  ? 59   ALA A C     1 
ATOM   379    O O     A ALA A  1 59  ? 51.136  -32.754 31.138  0.25 28.58  ? 59   ALA A O     1 
ATOM   380    C CB    A ALA A  1 59  ? 48.261  -31.117 31.375  0.25 29.36  ? 59   ALA A CB    1 
ATOM   381    N N     A ASP A  1 60  ? 49.808  -33.402 32.838  0.25 30.09  ? 60   ASP A N     1 
ATOM   382    C CA    A ASP A  1 60  ? 50.317  -34.766 32.881  0.25 31.93  ? 60   ASP A CA    1 
ATOM   383    C C     A ASP A  1 60  ? 51.837  -34.812 33.047  0.25 29.61  ? 60   ASP A C     1 
ATOM   384    O O     A ASP A  1 60  ? 52.506  -35.619 32.422  0.25 28.02  ? 60   ASP A O     1 
ATOM   385    C CB    A ASP A  1 60  ? 49.913  -35.518 31.607  0.25 34.72  ? 60   ASP A CB    1 
ATOM   386    C CG    A ASP A  1 60  ? 48.406  -35.503 31.377  0.25 39.96  ? 60   ASP A CG    1 
ATOM   387    O OD1   A ASP A  1 60  ? 47.665  -35.973 32.269  0.25 40.60  ? 60   ASP A OD1   1 
ATOM   388    O OD2   A ASP A  1 60  ? 47.960  -35.019 30.308  0.25 39.08  ? 60   ASP A OD2   1 
ATOM   389    N N     A ASN A  1 61  ? 52.365  -33.932 33.884  0.25 28.31  ? 61   ASN A N     1 
ATOM   390    C CA    A ASN A  1 61  ? 53.798  -33.876 34.170  0.25 29.79  ? 61   ASN A CA    1 
ATOM   391    C C     A ASN A  1 61  ? 54.676  -33.670 32.951  0.25 27.46  ? 61   ASN A C     1 
ATOM   392    O O     A ASN A  1 61  ? 55.847  -34.028 32.979  0.25 29.71  ? 61   ASN A O     1 
ATOM   393    C CB    A ASN A  1 61  ? 54.252  -35.156 34.870  0.25 31.38  ? 61   ASN A CB    1 
ATOM   394    C CG    A ASN A  1 61  ? 53.281  -35.619 35.932  0.25 31.77  ? 61   ASN A CG    1 
ATOM   395    O OD1   A ASN A  1 61  ? 52.440  -36.467 35.683  0.25 32.35  ? 61   ASN A OD1   1 
ATOM   396    N ND2   A ASN A  1 61  ? 53.395  -35.060 37.120  0.25 33.70  ? 61   ASN A ND2   1 
ATOM   397    N N     A THR A  1 62  ? 54.129  -33.084 31.893  0.25 25.42  ? 62   THR A N     1 
ATOM   398    C CA    A THR A  1 62  ? 54.895  -32.862 30.678  0.25 26.76  ? 62   THR A CA    1 
ATOM   399    C C     A THR A  1 62  ? 55.943  -31.732 30.781  0.25 27.32  ? 62   THR A C     1 
ATOM   400    O O     A THR A  1 62  ? 55.686  -30.658 31.338  0.25 25.39  ? 62   THR A O     1 
ATOM   401    C CB    A THR A  1 62  ? 53.966  -32.560 29.503  0.25 27.40  ? 62   THR A CB    1 
ATOM   402    O OG1   A THR A  1 62  ? 53.027  -33.633 29.345  0.25 28.13  ? 62   THR A OG1   1 
ATOM   403    C CG2   A THR A  1 62  ? 54.773  -32.405 28.197  0.25 27.46  ? 62   THR A CG2   1 
ATOM   404    N N     A LEU A  1 63  ? 57.125  -31.994 30.236  0.25 26.25  ? 63   LEU A N     1 
ATOM   405    C CA    A LEU A  1 63  ? 58.213  -31.019 30.229  0.25 25.41  ? 63   LEU A CA    1 
ATOM   406    C C     A LEU A  1 63  ? 58.599  -30.772 28.767  0.25 25.26  ? 63   LEU A C     1 
ATOM   407    O O     A LEU A  1 63  ? 59.099  -31.674 28.084  0.25 26.49  ? 63   LEU A O     1 
ATOM   408    C CB    A LEU A  1 63  ? 59.427  -31.558 30.995  0.25 25.56  ? 63   LEU A CB    1 
ATOM   409    C CG    A LEU A  1 63  ? 60.727  -30.726 30.884  0.25 26.89  ? 63   LEU A CG    1 
ATOM   410    C CD1   A LEU A  1 63  ? 60.492  -29.303 31.382  0.25 23.05  ? 63   LEU A CD1   1 
ATOM   411    C CD2   A LEU A  1 63  ? 61.840  -31.380 31.716  0.25 24.87  ? 63   LEU A CD2   1 
ATOM   412    N N     A PRO A  1 64  ? 58.358  -29.552 28.265  0.25 24.02  ? 64   PRO A N     1 
ATOM   413    C CA    A PRO A  1 64  ? 58.699  -29.242 26.877  0.25 22.16  ? 64   PRO A CA    1 
ATOM   414    C C     A PRO A  1 64  ? 60.204  -29.071 26.657  0.25 21.77  ? 64   PRO A C     1 
ATOM   415    O O     A PRO A  1 64  ? 60.694  -27.970 26.440  0.25 21.36  ? 64   PRO A O     1 
ATOM   416    C CB    A PRO A  1 64  ? 57.907  -27.959 26.605  0.25 20.60  ? 64   PRO A CB    1 
ATOM   417    C CG    A PRO A  1 64  ? 57.868  -27.305 27.949  0.25 21.38  ? 64   PRO A CG    1 
ATOM   418    C CD    A PRO A  1 64  ? 57.615  -28.442 28.895  0.25 20.12  ? 64   PRO A CD    1 
ATOM   419    N N     A LEU A  1 65  ? 60.927  -30.179 26.759  0.25 23.91  ? 65   LEU A N     1 
ATOM   420    C CA    A LEU A  1 65  ? 62.369  -30.202 26.519  0.25 22.79  ? 65   LEU A CA    1 
ATOM   421    C C     A LEU A  1 65  ? 62.507  -30.643 25.045  0.25 21.41  ? 65   LEU A C     1 
ATOM   422    O O     A LEU A  1 65  ? 62.144  -31.757 24.702  0.25 21.46  ? 65   LEU A O     1 
ATOM   423    C CB    A LEU A  1 65  ? 63.027  -31.224 27.448  0.25 22.68  ? 65   LEU A CB    1 
ATOM   424    C CG    A LEU A  1 65  ? 64.563  -31.271 27.411  0.25 22.19  ? 65   LEU A CG    1 
ATOM   425    C CD1   A LEU A  1 65  ? 65.151  -29.932 27.871  0.25 18.87  ? 65   LEU A CD1   1 
ATOM   426    C CD2   A LEU A  1 65  ? 65.038  -32.415 28.300  0.25 23.43  ? 65   LEU A CD2   1 
ATOM   427    N N     A LEU A  1 66  ? 63.005  -29.760 24.186  0.25 21.25  ? 66   LEU A N     1 
ATOM   428    C CA    A LEU A  1 66  ? 63.129  -30.047 22.766  0.25 22.43  ? 66   LEU A CA    1 
ATOM   429    C C     A LEU A  1 66  ? 63.809  -31.375 22.462  0.25 28.17  ? 66   LEU A C     1 
ATOM   430    O O     A LEU A  1 66  ? 64.788  -31.773 23.120  0.25 25.96  ? 66   LEU A O     1 
ATOM   431    C CB    A LEU A  1 66  ? 63.858  -28.900 22.057  0.25 24.20  ? 66   LEU A CB    1 
ATOM   432    C CG    A LEU A  1 66  ? 63.284  -27.480 22.193  0.25 23.93  ? 66   LEU A CG    1 
ATOM   433    C CD1   A LEU A  1 66  ? 63.967  -26.584 21.182  0.25 20.72  ? 66   LEU A CD1   1 
ATOM   434    C CD2   A LEU A  1 66  ? 61.768  -27.467 21.970  0.25 23.04  ? 66   LEU A CD2   1 
ATOM   435    N N     A THR A  1 67  ? 63.283  -32.062 21.448  0.25 26.41  ? 67   THR A N     1 
ATOM   436    C CA    A THR A  1 67  ? 63.789  -33.356 21.072  0.25 25.32  ? 67   THR A CA    1 
ATOM   437    C C     A THR A  1 67  ? 64.500  -33.404 19.736  0.25 26.80  ? 67   THR A C     1 
ATOM   438    O O     A THR A  1 67  ? 65.157  -34.397 19.445  0.25 26.96  ? 67   THR A O     1 
ATOM   439    C CB    A THR A  1 67  ? 62.664  -34.396 21.044  0.25 26.09  ? 67   THR A CB    1 
ATOM   440    O OG1   A THR A  1 67  ? 61.712  -34.043 20.038  0.25 24.65  ? 67   THR A OG1   1 
ATOM   441    C CG2   A THR A  1 67  ? 61.979  -34.469 22.404  0.25 24.67  ? 67   THR A CG2   1 
ATOM   442    N N     A THR A  1 68  ? 64.400  -32.345 18.936  0.25 25.21  ? 68   THR A N     1 
ATOM   443    C CA    A THR A  1 68  ? 65.057  -32.366 17.646  0.25 26.26  ? 68   THR A CA    1 
ATOM   444    C C     A THR A  1 68  ? 66.561  -32.171 17.758  0.25 26.10  ? 68   THR A C     1 
ATOM   445    O O     A THR A  1 68  ? 67.267  -32.123 16.750  0.25 22.54  ? 68   THR A O     1 
ATOM   446    C CB    A THR A  1 68  ? 64.443  -31.335 16.670  0.25 25.33  ? 68   THR A CB    1 
ATOM   447    O OG1   A THR A  1 68  ? 64.337  -30.056 17.298  0.25 28.36  ? 68   THR A OG1   1 
ATOM   448    C CG2   A THR A  1 68  ? 63.063  -31.791 16.232  0.25 26.36  ? 68   THR A CG2   1 
ATOM   449    N N     A LYS A  1 69  ? 67.036  -32.018 18.992  0.25 26.43  ? 69   LYS A N     1 
ATOM   450    C CA    A LYS A  1 69  ? 68.470  -31.900 19.265  0.25 25.68  ? 69   LYS A CA    1 
ATOM   451    C C     A LYS A  1 69  ? 68.623  -32.211 20.746  0.25 26.59  ? 69   LYS A C     1 
ATOM   452    O O     A LYS A  1 69  ? 67.663  -32.036 21.504  0.25 24.83  ? 69   LYS A O     1 
ATOM   453    C CB    A LYS A  1 69  ? 69.000  -30.500 18.959  0.25 25.43  ? 69   LYS A CB    1 
ATOM   454    C CG    A LYS A  1 69  ? 68.896  -29.510 20.125  0.25 26.54  ? 69   LYS A CG    1 
ATOM   455    C CD    A LYS A  1 69  ? 69.637  -28.226 19.827  0.25 25.42  ? 69   LYS A CD    1 
ATOM   456    C CE    A LYS A  1 69  ? 69.498  -27.221 20.972  0.25 23.82  ? 69   LYS A CE    1 
ATOM   457    N NZ    A LYS A  1 69  ? 70.211  -25.950 20.643  0.25 22.95  ? 69   LYS A NZ    1 
ATOM   458    N N     A ARG A  1 70  ? 69.804  -32.688 21.158  0.25 24.56  ? 70   ARG A N     1 
ATOM   459    C CA    A ARG A  1 70  ? 70.027  -33.002 22.569  0.25 25.64  ? 70   ARG A CA    1 
ATOM   460    C C     A ARG A  1 70  ? 70.224  -31.697 23.326  0.25 25.20  ? 70   ARG A C     1 
ATOM   461    O O     A ARG A  1 70  ? 71.128  -30.924 23.010  0.25 28.37  ? 70   ARG A O     1 
ATOM   462    C CB    A ARG A  1 70  ? 71.277  -33.889 22.778  0.25 29.05  ? 70   ARG A CB    1 
ATOM   463    C CG    A ARG A  1 70  ? 71.398  -34.392 24.238  0.25 32.79  ? 70   ARG A CG    1 
ATOM   464    C CD    A ARG A  1 70  ? 72.756  -35.008 24.660  0.25 36.51  ? 70   ARG A CD    1 
ATOM   465    N NE    A ARG A  1 70  ? 73.412  -35.466 23.515  0.25 40.42  ? 70   ARG A NE    1 
ATOM   466    C CZ    A ARG A  1 70  ? 74.615  -35.414 22.964  0.25 40.50  ? 70   ARG A CZ    1 
ATOM   467    N NH1   A ARG A  1 70  ? 75.751  -34.838 23.377  0.25 31.93  ? 70   ARG A NH1   1 
ATOM   468    N NH2   A ARG A  1 70  ? 74.564  -36.046 21.811  0.25 36.80  ? 70   ARG A NH2   1 
ATOM   469    N N     A VAL A  1 71  ? 69.377  -31.445 24.311  0.25 23.99  ? 71   VAL A N     1 
ATOM   470    C CA    A VAL A  1 71  ? 69.476  -30.214 25.106  0.25 22.82  ? 71   VAL A CA    1 
ATOM   471    C C     A VAL A  1 71  ? 70.163  -30.518 26.425  0.25 22.80  ? 71   VAL A C     1 
ATOM   472    O O     A VAL A  1 71  ? 69.845  -31.508 27.068  0.25 23.43  ? 71   VAL A O     1 
ATOM   473    C CB    A VAL A  1 71  ? 68.068  -29.621 25.401  0.25 24.73  ? 71   VAL A CB    1 
ATOM   474    C CG1   A VAL A  1 71  ? 68.201  -28.365 26.273  0.25 22.03  ? 71   VAL A CG1   1 
ATOM   475    C CG2   A VAL A  1 71  ? 67.366  -29.285 24.073  0.25 20.90  ? 71   VAL A CG2   1 
ATOM   476    N N     A PHE A  1 72  ? 71.109  -29.668 26.820  0.25 24.46  ? 72   PHE A N     1 
ATOM   477    C CA    A PHE A  1 72  ? 71.855  -29.861 28.067  0.25 24.23  ? 72   PHE A CA    1 
ATOM   478    C C     A PHE A  1 72  ? 70.916  -29.649 29.279  0.25 23.93  ? 72   PHE A C     1 
ATOM   479    O O     A PHE A  1 72  ? 70.953  -28.616 29.931  0.25 24.77  ? 72   PHE A O     1 
ATOM   480    C CB    A PHE A  1 72  ? 73.029  -28.862 28.103  0.25 24.92  ? 72   PHE A CB    1 
ATOM   481    C CG    A PHE A  1 72  ? 73.962  -29.035 29.286  0.25 23.81  ? 72   PHE A CG    1 
ATOM   482    C CD1   A PHE A  1 72  ? 74.852  -28.024 29.634  0.25 24.48  ? 72   PHE A CD1   1 
ATOM   483    C CD2   A PHE A  1 72  ? 73.993  -30.222 30.000  0.25 25.74  ? 72   PHE A CD2   1 
ATOM   484    C CE1   A PHE A  1 72  ? 75.779  -28.200 30.687  0.25 24.36  ? 72   PHE A CE1   1 
ATOM   485    C CE2   A PHE A  1 72  ? 74.912  -30.411 31.049  0.25 27.30  ? 72   PHE A CE2   1 
ATOM   486    C CZ    A PHE A  1 72  ? 75.806  -29.392 31.387  0.25 24.22  ? 72   PHE A CZ    1 
ATOM   487    N N     A LEU A  1 73  ? 70.092  -30.642 29.575  0.25 23.05  ? 73   LEU A N     1 
ATOM   488    C CA    A LEU A  1 73  ? 69.137  -30.560 30.668  0.25 22.70  ? 73   LEU A CA    1 
ATOM   489    C C     A LEU A  1 73  ? 69.750  -30.137 31.998  0.25 25.68  ? 73   LEU A C     1 
ATOM   490    O O     A LEU A  1 73  ? 69.244  -29.220 32.671  0.25 23.59  ? 73   LEU A O     1 
ATOM   491    C CB    A LEU A  1 73  ? 68.433  -31.906 30.842  0.25 22.80  ? 73   LEU A CB    1 
ATOM   492    C CG    A LEU A  1 73  ? 67.479  -32.079 32.034  0.25 23.66  ? 73   LEU A CG    1 
ATOM   493    C CD1   A LEU A  1 73  ? 66.296  -31.060 31.955  0.25 23.05  ? 73   LEU A CD1   1 
ATOM   494    C CD2   A LEU A  1 73  ? 66.954  -33.484 32.031  0.25 19.49  ? 73   LEU A CD2   1 
ATOM   495    N N     A ARG A  1 74  ? 70.829  -30.811 32.394  0.25 25.38  ? 74   ARG A N     1 
ATOM   496    C CA    A ARG A  1 74  ? 71.484  -30.494 33.652  0.25 24.59  ? 74   ARG A CA    1 
ATOM   497    C C     A ARG A  1 74  ? 71.873  -29.028 33.707  0.25 22.72  ? 74   ARG A C     1 
ATOM   498    O O     A ARG A  1 74  ? 71.809  -28.403 34.782  0.25 23.78  ? 74   ARG A O     1 
ATOM   499    C CB    A ARG A  1 74  ? 72.738  -31.383 33.868  0.25 26.58  ? 74   ARG A CB    1 
ATOM   500    C CG    A ARG A  1 74  ? 73.459  -31.127 35.193  0.25 28.91  ? 74   ARG A CG    1 
ATOM   501    C CD    A ARG A  1 74  ? 74.357  -32.300 35.574  0.25 38.33  ? 74   ARG A CD    1 
ATOM   502    N NE    A ARG A  1 74  ? 75.452  -32.512 34.625  0.25 40.50  ? 74   ARG A NE    1 
ATOM   503    C CZ    A ARG A  1 74  ? 76.542  -31.745 34.541  0.25 45.11  ? 74   ARG A CZ    1 
ATOM   504    N NH1   A ARG A  1 74  ? 76.694  -30.704 35.354  0.25 43.53  ? 74   ARG A NH1   1 
ATOM   505    N NH2   A ARG A  1 74  ? 77.486  -32.022 33.644  0.25 40.88  ? 74   ARG A NH2   1 
ATOM   506    N N     A GLY A  1 75  ? 72.303  -28.484 32.572  0.25 20.54  ? 75   GLY A N     1 
ATOM   507    C CA    A GLY A  1 75  ? 72.678  -27.075 32.532  0.25 19.08  ? 75   GLY A CA    1 
ATOM   508    C C     A GLY A  1 75  ? 71.458  -26.171 32.763  0.25 22.03  ? 75   GLY A C     1 
ATOM   509    O O     A GLY A  1 75  ? 71.552  -25.135 33.411  0.25 18.35  ? 75   GLY A O     1 
ATOM   510    N N     A VAL A  1 76  ? 70.306  -26.556 32.218  0.25 22.03  ? 76   VAL A N     1 
ATOM   511    C CA    A VAL A  1 76  ? 69.081  -25.761 32.393  0.25 21.12  ? 76   VAL A CA    1 
ATOM   512    C C     A VAL A  1 76  ? 68.724  -25.758 33.882  0.25 19.93  ? 76   VAL A C     1 
ATOM   513    O O     A VAL A  1 76  ? 68.537  -24.706 34.478  0.25 23.67  ? 76   VAL A O     1 
ATOM   514    C CB    A VAL A  1 76  ? 67.899  -26.376 31.579  0.25 20.84  ? 76   VAL A CB    1 
ATOM   515    C CG1   A VAL A  1 76  ? 66.618  -25.599 31.814  0.25 21.50  ? 76   VAL A CG1   1 
ATOM   516    C CG2   A VAL A  1 76  ? 68.238  -26.381 30.103  0.25 22.33  ? 76   VAL A CG2   1 
ATOM   517    N N     A ILE A  1 77  ? 68.641  -26.941 34.481  0.25 24.40  ? 77   ILE A N     1 
ATOM   518    C CA    A ILE A  1 77  ? 68.316  -27.063 35.898  0.25 24.40  ? 77   ILE A CA    1 
ATOM   519    C C     A ILE A  1 77  ? 69.309  -26.282 36.771  0.25 24.56  ? 77   ILE A C     1 
ATOM   520    O O     A ILE A  1 77  ? 68.920  -25.495 37.642  0.25 24.75  ? 77   ILE A O     1 
ATOM   521    C CB    A ILE A  1 77  ? 68.317  -28.531 36.325  0.25 24.86  ? 77   ILE A CB    1 
ATOM   522    C CG1   A ILE A  1 77  ? 67.285  -29.311 35.489  0.25 27.50  ? 77   ILE A CG1   1 
ATOM   523    C CG2   A ILE A  1 77  ? 67.983  -28.666 37.840  0.25 24.39  ? 77   ILE A CG2   1 
ATOM   524    C CD1   A ILE A  1 77  ? 67.352  -30.851 35.706  0.25 25.52  ? 77   ILE A CD1   1 
ATOM   525    N N     A ALA A  1 78  ? 70.596  -26.480 36.537  0.25 20.70  ? 78   ALA A N     1 
ATOM   526    C CA    A ALA A  1 78  ? 71.595  -25.778 37.330  0.25 24.09  ? 78   ALA A CA    1 
ATOM   527    C C     A ALA A  1 78  ? 71.419  -24.260 37.269  0.25 21.45  ? 78   ALA A C     1 
ATOM   528    O O     A ALA A  1 78  ? 71.441  -23.579 38.294  0.25 18.71  ? 78   ALA A O     1 
ATOM   529    C CB    A ALA A  1 78  ? 73.019  -26.181 36.873  0.25 24.90  ? 78   ALA A CB    1 
ATOM   530    N N     A GLU A  1 79  ? 71.247  -23.727 36.065  0.25 23.17  ? 79   GLU A N     1 
ATOM   531    C CA    A GLU A  1 79  ? 71.060  -22.293 35.909  0.25 22.14  ? 79   GLU A CA    1 
ATOM   532    C C     A GLU A  1 79  ? 69.802  -21.808 36.645  0.25 23.27  ? 79   GLU A C     1 
ATOM   533    O O     A GLU A  1 79  ? 69.818  -20.758 37.291  0.25 22.22  ? 79   GLU A O     1 
ATOM   534    C CB    A GLU A  1 79  ? 70.952  -21.913 34.440  0.25 22.40  ? 79   GLU A CB    1 
ATOM   535    C CG    A GLU A  1 79  ? 70.684  -20.429 34.243  0.25 22.30  ? 79   GLU A CG    1 
ATOM   536    C CD    A GLU A  1 79  ? 70.347  -20.051 32.806  0.25 21.33  ? 79   GLU A CD    1 
ATOM   537    O OE1   A GLU A  1 79  ? 69.537  -20.762 32.165  0.25 21.53  ? 79   GLU A OE1   1 
ATOM   538    O OE2   A GLU A  1 79  ? 70.889  -19.035 32.333  0.25 18.48  ? 79   GLU A OE2   1 
ATOM   539    N N     A LEU A  1 80  ? 68.724  -22.587 36.557  0.25 23.45  ? 80   LEU A N     1 
ATOM   540    C CA    A LEU A  1 80  ? 67.472  -22.223 37.214  0.25 20.68  ? 80   LEU A CA    1 
ATOM   541    C C     A LEU A  1 80  ? 67.595  -22.185 38.742  0.25 21.79  ? 80   LEU A C     1 
ATOM   542    O O     A LEU A  1 80  ? 67.134  -21.241 39.386  0.25 20.56  ? 80   LEU A O     1 
ATOM   543    C CB    A LEU A  1 80  ? 66.367  -23.196 36.809  0.25 20.64  ? 80   LEU A CB    1 
ATOM   544    C CG    A LEU A  1 80  ? 65.010  -22.949 37.496  0.25 20.50  ? 80   LEU A CG    1 
ATOM   545    C CD1   A LEU A  1 80  ? 64.565  -21.527 37.218  0.25 22.42  ? 80   LEU A CD1   1 
ATOM   546    C CD2   A LEU A  1 80  ? 63.962  -23.927 36.965  0.25 21.70  ? 80   LEU A CD2   1 
ATOM   547    N N     A LEU A  1 81  ? 68.219  -23.205 39.329  0.25 21.74  ? 81   LEU A N     1 
ATOM   548    C CA    A LEU A  1 81  ? 68.393  -23.257 40.779  0.25 22.06  ? 81   LEU A CA    1 
ATOM   549    C C     A LEU A  1 81  ? 69.321  -22.140 41.222  0.25 21.98  ? 81   LEU A C     1 
ATOM   550    O O     A LEU A  1 81  ? 69.238  -21.634 42.351  0.25 23.26  ? 81   LEU A O     1 
ATOM   551    C CB    A LEU A  1 81  ? 68.957  -24.619 41.208  0.25 23.90  ? 81   LEU A CB    1 
ATOM   552    C CG    A LEU A  1 81  ? 68.050  -25.820 40.920  0.25 22.06  ? 81   LEU A CG    1 
ATOM   553    C CD1   A LEU A  1 81  ? 68.646  -27.074 41.540  0.25 19.73  ? 81   LEU A CD1   1 
ATOM   554    C CD2   A LEU A  1 81  ? 66.663  -25.572 41.499  0.25 25.17  ? 81   LEU A CD2   1 
ATOM   555    N N     A TRP A  1 82  ? 70.173  -21.723 40.295  0.25 23.56  ? 82   TRP A N     1 
ATOM   556    C CA    A TRP A  1 82  ? 71.137  -20.645 40.513  0.25 22.11  ? 82   TRP A CA    1 
ATOM   557    C C     A TRP A  1 82  ? 70.341  -19.322 40.560  0.25 23.04  ? 82   TRP A C     1 
ATOM   558    O O     A TRP A  1 82  ? 70.567  -18.478 41.433  0.25 22.53  ? 82   TRP A O     1 
ATOM   559    C CB    A TRP A  1 82  ? 72.133  -20.675 39.356  0.25 23.48  ? 82   TRP A CB    1 
ATOM   560    C CG    A TRP A  1 82  ? 73.168  -19.616 39.337  0.25 22.12  ? 82   TRP A CG    1 
ATOM   561    C CD1   A TRP A  1 82  ? 74.193  -19.445 40.231  0.25 21.25  ? 82   TRP A CD1   1 
ATOM   562    C CD2   A TRP A  1 82  ? 73.347  -18.627 38.320  0.25 21.58  ? 82   TRP A CD2   1 
ATOM   563    N NE1   A TRP A  1 82  ? 75.004  -18.403 39.825  0.25 20.26  ? 82   TRP A NE1   1 
ATOM   564    C CE2   A TRP A  1 82  ? 74.507  -17.889 38.655  0.25 19.42  ? 82   TRP A CE2   1 
ATOM   565    C CE3   A TRP A  1 82  ? 72.638  -18.293 37.152  0.25 19.25  ? 82   TRP A CE3   1 
ATOM   566    C CZ2   A TRP A  1 82  ? 74.976  -16.842 37.868  0.25 22.05  ? 82   TRP A CZ2   1 
ATOM   567    C CZ3   A TRP A  1 82  ? 73.107  -17.248 36.367  0.25 22.96  ? 82   TRP A CZ3   1 
ATOM   568    C CH2   A TRP A  1 82  ? 74.267  -16.535 36.729  0.25 24.62  ? 82   TRP A CH2   1 
ATOM   569    N N     A PHE A  1 83  ? 69.396  -19.154 39.639  0.25 22.44  ? 83   PHE A N     1 
ATOM   570    C CA    A PHE A  1 83  ? 68.561  -17.942 39.631  0.25 22.48  ? 83   PHE A CA    1 
ATOM   571    C C     A PHE A  1 83  ? 67.815  -17.881 40.961  0.25 20.28  ? 83   PHE A C     1 
ATOM   572    O O     A PHE A  1 83  ? 67.856  -16.880 41.682  0.25 24.33  ? 83   PHE A O     1 
ATOM   573    C CB    A PHE A  1 83  ? 67.478  -17.966 38.519  0.25 21.21  ? 83   PHE A CB    1 
ATOM   574    C CG    A PHE A  1 83  ? 68.013  -17.885 37.105  0.25 20.83  ? 83   PHE A CG    1 
ATOM   575    C CD1   A PHE A  1 83  ? 69.167  -17.146 36.817  0.25 19.73  ? 83   PHE A CD1   1 
ATOM   576    C CD2   A PHE A  1 83  ? 67.316  -18.489 36.050  0.25 20.95  ? 83   PHE A CD2   1 
ATOM   577    C CE1   A PHE A  1 83  ? 69.617  -17.004 35.521  0.25 16.49  ? 83   PHE A CE1   1 
ATOM   578    C CE2   A PHE A  1 83  ? 67.760  -18.353 34.723  0.25 18.22  ? 83   PHE A CE2   1 
ATOM   579    C CZ    A PHE A  1 83  ? 68.922  -17.598 34.468  0.25 19.33  ? 83   PHE A CZ    1 
ATOM   580    N N     A VAL A  1 84  ? 67.116  -18.958 41.274  0.25 22.62  ? 84   VAL A N     1 
ATOM   581    C CA    A VAL A  1 84  ? 66.324  -19.028 42.493  0.25 21.61  ? 84   VAL A CA    1 
ATOM   582    C C     A VAL A  1 84  ? 67.119  -18.655 43.738  0.25 25.35  ? 84   VAL A C     1 
ATOM   583    O O     A VAL A  1 84  ? 66.619  -17.951 44.625  0.25 25.43  ? 84   VAL A O     1 
ATOM   584    C CB    A VAL A  1 84  ? 65.722  -20.445 42.660  0.25 23.95  ? 84   VAL A CB    1 
ATOM   585    C CG1   A VAL A  1 84  ? 64.996  -20.568 43.993  0.25 21.73  ? 84   VAL A CG1   1 
ATOM   586    C CG2   A VAL A  1 84  ? 64.755  -20.731 41.507  0.25 20.67  ? 84   VAL A CG2   1 
ATOM   587    N N     A SER A  1 85  ? 68.367  -19.101 43.798  0.25 23.04  ? 85   SER A N     1 
ATOM   588    C CA    A SER A  1 85  ? 69.210  -18.830 44.951  0.25 25.53  ? 85   SER A CA    1 
ATOM   589    C C     A SER A  1 85  ? 69.581  -17.362 45.050  0.25 23.62  ? 85   SER A C     1 
ATOM   590    O O     A SER A  1 85  ? 70.077  -16.930 46.081  0.25 27.25  ? 85   SER A O     1 
ATOM   591    C CB    A SER A  1 85  ? 70.499  -19.671 44.883  0.25 24.85  ? 85   SER A CB    1 
ATOM   592    O OG    A SER A  1 85  ? 71.315  -19.210 43.822  0.25 22.81  ? 85   SER A OG    1 
ATOM   593    N N     A GLY A  1 86  ? 69.346  -16.598 43.985  0.25 24.23  ? 86   GLY A N     1 
ATOM   594    C CA    A GLY A  1 86  ? 69.696  -15.183 43.998  0.25 21.03  ? 86   GLY A CA    1 
ATOM   595    C C     A GLY A  1 86  ? 71.177  -14.929 43.703  0.25 23.77  ? 86   GLY A C     1 
ATOM   596    O O     A GLY A  1 86  ? 71.635  -13.782 43.689  0.25 23.15  ? 86   GLY A O     1 
ATOM   597    N N     A CYS A  1 87  ? 71.926  -16.000 43.444  0.25 24.66  ? 87   CYS A N     1 
ATOM   598    C CA    A CYS A  1 87  ? 73.357  -15.919 43.168  0.25 23.88  ? 87   CYS A CA    1 
ATOM   599    C C     A CYS A  1 87  ? 73.653  -15.336 41.796  0.25 25.41  ? 87   CYS A C     1 
ATOM   600    O O     A CYS A  1 87  ? 72.937  -15.614 40.828  0.25 26.06  ? 87   CYS A O     1 
ATOM   601    C CB    A CYS A  1 87  ? 73.965  -17.320 43.283  0.25 25.93  ? 87   CYS A CB    1 
ATOM   602    S SG    A CYS A  1 87  ? 75.790  -17.437 42.996  0.25 33.95  ? 87   CYS A SG    1 
ATOM   603    N N     A THR A  1 88  ? 74.710  -14.532 41.704  0.25 22.27  ? 88   THR A N     1 
ATOM   604    C CA    A THR A  1 88  ? 75.096  -13.908 40.452  0.25 22.62  ? 88   THR A CA    1 
ATOM   605    C C     A THR A  1 88  ? 76.553  -14.229 40.064  0.25 25.37  ? 88   THR A C     1 
ATOM   606    O O     A THR A  1 88  ? 77.129  -13.570 39.185  0.25 22.27  ? 88   THR A O     1 
ATOM   607    C CB    A THR A  1 88  ? 74.956  -12.381 40.524  0.25 25.04  ? 88   THR A CB    1 
ATOM   608    O OG1   A THR A  1 88  ? 75.802  -11.878 41.565  0.25 27.95  ? 88   THR A OG1   1 
ATOM   609    C CG2   A THR A  1 88  ? 73.513  -11.986 40.807  0.25 27.03  ? 88   THR A CG2   1 
ATOM   610    N N     A ASP A  1 89  ? 77.126  -15.235 40.718  0.25 22.95  ? 89   ASP A N     1 
ATOM   611    C CA    A ASP A  1 89  ? 78.497  -15.662 40.452  0.25 24.51  ? 89   ASP A CA    1 
ATOM   612    C C     A ASP A  1 89  ? 78.494  -16.847 39.486  0.25 21.79  ? 89   ASP A C     1 
ATOM   613    O O     A ASP A  1 89  ? 78.085  -17.938 39.834  0.25 22.83  ? 89   ASP A O     1 
ATOM   614    C CB    A ASP A  1 89  ? 79.178  -16.070 41.757  0.25 25.80  ? 89   ASP A CB    1 
ATOM   615    C CG    A ASP A  1 89  ? 80.676  -16.309 41.578  0.25 30.76  ? 89   ASP A CG    1 
ATOM   616    O OD1   A ASP A  1 89  ? 81.383  -16.424 42.603  0.25 28.39  ? 89   ASP A OD1   1 
ATOM   617    O OD2   A ASP A  1 89  ? 81.142  -16.376 40.410  0.25 29.98  ? 89   ASP A OD2   1 
ATOM   618    N N     A ALA A  1 90  ? 78.933  -16.616 38.258  0.25 22.74  ? 90   ALA A N     1 
ATOM   619    C CA    A ALA A  1 90  ? 78.964  -17.672 37.254  0.25 24.03  ? 90   ALA A CA    1 
ATOM   620    C C     A ALA A  1 90  ? 79.884  -18.836 37.643  0.25 25.59  ? 90   ALA A C     1 
ATOM   621    O O     A ALA A  1 90  ? 79.745  -19.946 37.114  0.25 27.61  ? 90   ALA A O     1 
ATOM   622    C CB    A ALA A  1 90  ? 79.380  -17.086 35.899  0.25 22.06  ? 90   ALA A CB    1 
ATOM   623    N N     A LYS A  1 91  ? 80.814  -18.609 38.568  0.25 25.59  ? 91   LYS A N     1 
ATOM   624    C CA    A LYS A  1 91  ? 81.694  -19.705 38.986  0.25 26.35  ? 91   LYS A CA    1 
ATOM   625    C C     A LYS A  1 91  ? 80.874  -20.782 39.679  0.25 25.34  ? 91   LYS A C     1 
ATOM   626    O O     A LYS A  1 91  ? 81.289  -21.931 39.744  0.25 23.72  ? 91   LYS A O     1 
ATOM   627    C CB    A LYS A  1 91  ? 82.777  -19.210 39.948  0.25 28.34  ? 91   LYS A CB    1 
ATOM   628    C CG    A LYS A  1 91  ? 83.740  -18.214 39.335  0.25 31.76  ? 91   LYS A CG    1 
ATOM   629    C CD    A LYS A  1 91  ? 84.565  -18.834 38.218  0.25 34.64  ? 91   LYS A CD    1 
ATOM   630    C CE    A LYS A  1 91  ? 85.570  -17.817 37.665  0.25 39.73  ? 91   LYS A CE    1 
ATOM   631    N NZ    A LYS A  1 91  ? 86.372  -18.346 36.515  0.25 42.50  ? 91   LYS A NZ    1 
ATOM   632    N N     A MET A  1 92  ? 79.708  -20.417 40.216  0.25 24.08  ? 92   MET A N     1 
ATOM   633    C CA    A MET A  1 92  ? 78.863  -21.415 40.882  0.25 25.37  ? 92   MET A CA    1 
ATOM   634    C C     A MET A  1 92  ? 78.290  -22.384 39.855  0.25 24.01  ? 92   MET A C     1 
ATOM   635    O O     A MET A  1 92  ? 77.849  -23.494 40.200  0.25 26.16  ? 92   MET A O     1 
ATOM   636    C CB    A MET A  1 92  ? 77.724  -20.735 41.643  0.25 33.53  ? 92   MET A CB    1 
ATOM   637    C CG    A MET A  1 92  ? 78.214  -19.754 42.700  0.25 42.25  ? 92   MET A CG    1 
ATOM   638    S SD    A MET A  1 92  ? 79.416  -20.543 43.836  0.25 53.91  ? 92   MET A SD    1 
ATOM   639    C CE    A MET A  1 92  ? 78.301  -21.657 44.726  0.25 48.98  ? 92   MET A CE    1 
ATOM   640    N N     A LEU A  1 93  ? 78.273  -21.962 38.595  0.25 20.96  ? 93   LEU A N     1 
ATOM   641    C CA    A LEU A  1 93  ? 77.802  -22.844 37.506  0.25 23.53  ? 93   LEU A CA    1 
ATOM   642    C C     A LEU A  1 93  ? 78.983  -23.609 36.888  0.25 20.78  ? 93   LEU A C     1 
ATOM   643    O O     A LEU A  1 93  ? 78.898  -24.798 36.690  0.25 23.08  ? 93   LEU A O     1 
ATOM   644    C CB    A LEU A  1 93  ? 77.101  -22.044 36.399  0.25 19.72  ? 93   LEU A CB    1 
ATOM   645    C CG    A LEU A  1 93  ? 75.776  -21.386 36.845  0.25 22.75  ? 93   LEU A CG    1 
ATOM   646    C CD1   A LEU A  1 93  ? 75.170  -20.593 35.666  0.25 21.30  ? 93   LEU A CD1   1 
ATOM   647    C CD2   A LEU A  1 93  ? 74.810  -22.446 37.337  0.25 21.42  ? 93   LEU A CD2   1 
ATOM   648    N N     A SER A  1 94  ? 80.075  -22.922 36.580  0.25 23.33  ? 94   SER A N     1 
ATOM   649    C CA    A SER A  1 94  ? 81.231  -23.604 35.989  0.25 26.21  ? 94   SER A CA    1 
ATOM   650    C C     A SER A  1 94  ? 81.857  -24.635 36.941  0.25 27.13  ? 94   SER A C     1 
ATOM   651    O O     A SER A  1 94  ? 82.440  -25.624 36.499  0.25 27.27  ? 94   SER A O     1 
ATOM   652    C CB    A SER A  1 94  ? 82.292  -22.579 35.552  0.25 27.63  ? 94   SER A CB    1 
ATOM   653    O OG    A SER A  1 94  ? 82.732  -21.787 36.639  0.25 33.39  ? 94   SER A OG    1 
ATOM   654    N N     A SER A  1 95  ? 81.726  -24.424 38.248  0.25 29.47  ? 95   SER A N     1 
ATOM   655    C CA    A SER A  1 95  ? 82.296  -25.357 39.212  0.25 29.59  ? 95   SER A CA    1 
ATOM   656    C C     A SER A  1 95  ? 81.531  -26.667 39.185  0.25 30.15  ? 95   SER A C     1 
ATOM   657    O O     A SER A  1 95  ? 82.048  -27.715 39.605  0.25 27.25  ? 95   SER A O     1 
ATOM   658    C CB    A SER A  1 95  ? 82.276  -24.771 40.632  0.25 32.08  ? 95   SER A CB    1 
ATOM   659    O OG    A SER A  1 95  ? 80.939  -24.587 41.083  0.25 41.07  ? 95   SER A OG    1 
ATOM   660    N N     A GLN A  1 96  ? 80.293  -26.622 38.707  0.25 25.79  ? 96   GLN A N     1 
ATOM   661    C CA    A GLN A  1 96  ? 79.521  -27.843 38.617  0.25 26.48  ? 96   GLN A CA    1 
ATOM   662    C C     A GLN A  1 96  ? 79.413  -28.326 37.168  0.25 26.28  ? 96   GLN A C     1 
ATOM   663    O O     A GLN A  1 96  ? 78.536  -29.111 36.818  0.25 28.41  ? 96   GLN A O     1 
ATOM   664    C CB    A GLN A  1 96  ? 78.129  -27.674 39.260  0.25 29.56  ? 96   GLN A CB    1 
ATOM   665    C CG    A GLN A  1 96  ? 77.352  -26.466 38.780  0.25 27.63  ? 96   GLN A CG    1 
ATOM   666    C CD    A GLN A  1 96  ? 75.997  -26.321 39.478  0.25 29.44  ? 96   GLN A CD    1 
ATOM   667    O OE1   A GLN A  1 96  ? 75.642  -25.234 39.947  0.25 30.48  ? 96   GLN A OE1   1 
ATOM   668    N NE2   A GLN A  1 96  ? 75.240  -27.405 39.540  0.25 24.07  ? 96   GLN A NE2   1 
ATOM   669    N N     A GLY A  1 97  ? 80.329  -27.856 36.338  0.25 25.71  ? 97   GLY A N     1 
ATOM   670    C CA    A GLY A  1 97  ? 80.371  -28.282 34.951  0.25 27.81  ? 97   GLY A CA    1 
ATOM   671    C C     A GLY A  1 97  ? 79.428  -27.609 33.980  0.25 27.05  ? 97   GLY A C     1 
ATOM   672    O O     A GLY A  1 97  ? 79.173  -28.161 32.915  0.25 27.36  ? 97   GLY A O     1 
ATOM   673    N N     A VAL A  1 98  ? 78.924  -26.427 34.332  0.25 27.05  ? 98   VAL A N     1 
ATOM   674    C CA    A VAL A  1 98  ? 77.989  -25.691 33.459  0.25 25.05  ? 98   VAL A CA    1 
ATOM   675    C C     A VAL A  1 98  ? 78.641  -24.362 33.076  0.25 24.83  ? 98   VAL A C     1 
ATOM   676    O O     A VAL A  1 98  ? 78.772  -23.474 33.912  0.25 25.78  ? 98   VAL A O     1 
ATOM   677    C CB    A VAL A  1 98  ? 76.657  -25.445 34.205  0.25 24.86  ? 98   VAL A CB    1 
ATOM   678    C CG1   A VAL A  1 98  ? 75.678  -24.628 33.335  0.25 22.31  ? 98   VAL A CG1   1 
ATOM   679    C CG2   A VAL A  1 98  ? 76.052  -26.792 34.593  0.25 21.48  ? 98   VAL A CG2   1 
ATOM   680    N N     A GLY A  1 99  ? 79.050  -24.224 31.816  0.25 23.22  ? 99   GLY A N     1 
ATOM   681    C CA    A GLY A  1 99  ? 79.728  -23.009 31.393  0.25 22.48  ? 99   GLY A CA    1 
ATOM   682    C C     A GLY A  1 99  ? 78.958  -22.054 30.502  0.25 24.60  ? 99   GLY A C     1 
ATOM   683    O O     A GLY A  1 99  ? 79.557  -21.210 29.808  0.25 22.46  ? 99   GLY A O     1 
ATOM   684    N N     A ILE A  1 100 ? 77.632  -22.148 30.527  0.25 23.07  ? 100  ILE A N     1 
ATOM   685    C CA    A ILE A  1 100 ? 76.823  -21.260 29.677  0.25 23.48  ? 100  ILE A CA    1 
ATOM   686    C C     A ILE A  1 100 ? 77.053  -19.779 29.945  0.25 21.37  ? 100  ILE A C     1 
ATOM   687    O O     A ILE A  1 100 ? 76.859  -18.946 29.055  0.25 25.77  ? 100  ILE A O     1 
ATOM   688    C CB    A ILE A  1 100 ? 75.316  -21.580 29.811  0.25 23.44  ? 100  ILE A CB    1 
ATOM   689    C CG1   A ILE A  1 100 ? 74.850  -21.340 31.249  0.25 26.49  ? 100  ILE A CG1   1 
ATOM   690    C CG2   A ILE A  1 100 ? 75.071  -23.031 29.387  0.25 20.49  ? 100  ILE A CG2   1 
ATOM   691    C CD1   A ILE A  1 100 ? 73.343  -21.515 31.454  0.25 26.33  ? 100  ILE A CD1   1 
ATOM   692    N N     A TRP A  1 101 ? 77.451  -19.429 31.166  0.25 21.80  ? 101  TRP A N     1 
ATOM   693    C CA    A TRP A  1 101 ? 77.703  -18.026 31.482  0.25 22.65  ? 101  TRP A CA    1 
ATOM   694    C C     A TRP A  1 101 ? 79.190  -17.635 31.526  0.25 25.98  ? 101  TRP A C     1 
ATOM   695    O O     A TRP A  1 101 ? 79.522  -16.506 31.879  0.25 24.47  ? 101  TRP A O     1 
ATOM   696    C CB    A TRP A  1 101 ? 77.035  -17.625 32.806  0.25 22.87  ? 101  TRP A CB    1 
ATOM   697    C CG    A TRP A  1 101 ? 75.549  -17.326 32.644  0.25 21.30  ? 101  TRP A CG    1 
ATOM   698    C CD1   A TRP A  1 101 ? 74.504  -18.132 33.002  0.25 19.14  ? 101  TRP A CD1   1 
ATOM   699    C CD2   A TRP A  1 101 ? 74.971  -16.186 31.995  0.25 17.58  ? 101  TRP A CD2   1 
ATOM   700    N NE1   A TRP A  1 101 ? 73.307  -17.565 32.612  0.25 19.11  ? 101  TRP A NE1   1 
ATOM   701    C CE2   A TRP A  1 101 ? 73.566  -16.372 31.989  0.25 19.49  ? 101  TRP A CE2   1 
ATOM   702    C CE3   A TRP A  1 101 ? 75.501  -15.027 31.416  0.25 18.40  ? 101  TRP A CE3   1 
ATOM   703    C CZ2   A TRP A  1 101 ? 72.690  -15.441 31.423  0.25 19.05  ? 101  TRP A CZ2   1 
ATOM   704    C CZ3   A TRP A  1 101 ? 74.631  -14.100 30.852  0.25 20.70  ? 101  TRP A CZ3   1 
ATOM   705    C CH2   A TRP A  1 101 ? 73.230  -14.318 30.863  0.25 17.24  ? 101  TRP A CH2   1 
ATOM   706    N N     A ASP A  1 102 ? 80.070  -18.557 31.137  0.25 27.21  ? 102  ASP A N     1 
ATOM   707    C CA    A ASP A  1 102 ? 81.508  -18.290 31.141  0.25 29.10  ? 102  ASP A CA    1 
ATOM   708    C C     A ASP A  1 102 ? 81.839  -17.196 30.143  0.25 29.81  ? 102  ASP A C     1 
ATOM   709    O O     A ASP A  1 102 ? 82.671  -16.329 30.400  0.25 32.39  ? 102  ASP A O     1 
ATOM   710    C CB    A ASP A  1 102 ? 82.282  -19.567 30.791  0.25 29.67  ? 102  ASP A CB    1 
ATOM   711    C CG    A ASP A  1 102 ? 82.174  -20.631 31.868  0.25 32.04  ? 102  ASP A CG    1 
ATOM   712    O OD1   A ASP A  1 102 ? 82.723  -21.732 31.668  0.25 35.22  ? 102  ASP A OD1   1 
ATOM   713    O OD2   A ASP A  1 102 ? 81.546  -20.372 32.922  0.25 34.01  ? 102  ASP A OD2   1 
ATOM   714    N N     A GLY A  1 103 ? 81.167  -17.224 29.001  0.25 31.58  ? 103  GLY A N     1 
ATOM   715    C CA    A GLY A  1 103 ? 81.404  -16.226 27.971  0.25 31.06  ? 103  GLY A CA    1 
ATOM   716    C C     A GLY A  1 103 ? 81.199  -14.784 28.396  0.25 34.19  ? 103  GLY A C     1 
ATOM   717    O O     A GLY A  1 103 ? 82.061  -13.924 28.132  0.25 36.08  ? 103  GLY A O     1 
ATOM   718    N N     A ASN A  1 104 ? 80.073  -14.492 29.048  0.25 30.22  ? 104  ASN A N     1 
ATOM   719    C CA    A ASN A  1 104 ? 79.815  -13.127 29.473  0.25 30.77  ? 104  ASN A CA    1 
ATOM   720    C C     A ASN A  1 104 ? 80.371  -12.811 30.859  0.25 31.00  ? 104  ASN A C     1 
ATOM   721    O O     A ASN A  1 104 ? 80.322  -11.677 31.301  0.25 33.76  ? 104  ASN A O     1 
ATOM   722    C CB    A ASN A  1 104 ? 78.314  -12.828 29.423  0.25 31.29  ? 104  ASN A CB    1 
ATOM   723    C CG    A ASN A  1 104 ? 77.745  -12.972 28.033  0.25 32.72  ? 104  ASN A CG    1 
ATOM   724    O OD1   A ASN A  1 104 ? 77.217  -14.023 27.675  0.25 38.05  ? 104  ASN A OD1   1 
ATOM   725    N ND2   A ASN A  1 104 ? 77.867  -11.929 27.233  0.25 33.14  ? 104  ASN A ND2   1 
ATOM   726    N N     A GLY A  1 105 ? 80.900  -13.818 31.541  0.25 31.46  ? 105  GLY A N     1 
ATOM   727    C CA    A GLY A  1 105 ? 81.480  -13.591 32.849  0.25 30.76  ? 105  GLY A CA    1 
ATOM   728    C C     A GLY A  1 105 ? 83.009  -13.543 32.800  0.25 32.55  ? 105  GLY A C     1 
ATOM   729    O O     A GLY A  1 105 ? 83.658  -13.309 33.817  0.25 32.61  ? 105  GLY A O     1 
ATOM   730    N N     A SER A  1 106 ? 83.587  -13.762 31.624  0.25 32.69  ? 106  SER A N     1 
ATOM   731    C CA    A SER A  1 106 ? 85.052  -13.755 31.475  0.25 35.09  ? 106  SER A CA    1 
ATOM   732    C C     A SER A  1 106 ? 85.616  -12.361 31.707  0.25 35.17  ? 106  SER A C     1 
ATOM   733    O O     A SER A  1 106 ? 84.936  -11.360 31.482  0.25 36.09  ? 106  SER A O     1 
ATOM   734    C CB    A SER A  1 106 ? 85.449  -14.216 30.069  0.25 30.54  ? 106  SER A CB    1 
ATOM   735    O OG    A SER A  1 106 ? 85.118  -13.214 29.124  0.25 35.74  ? 106  SER A OG    1 
ATOM   736    N N     A LYS A  1 107 ? 86.866  -12.265 32.126  0.25 36.42  ? 107  LYS A N     1 
ATOM   737    C CA    A LYS A  1 107 ? 87.452  -10.951 32.356  0.25 38.39  ? 107  LYS A CA    1 
ATOM   738    C C     A LYS A  1 107 ? 87.453  -10.057 31.099  0.25 38.54  ? 107  LYS A C     1 
ATOM   739    O O     A LYS A  1 107 ? 87.188  -8.852  31.176  0.25 39.65  ? 107  LYS A O     1 
ATOM   740    C CB    A LYS A  1 107 ? 88.879  -11.105 32.879  0.25 41.39  ? 107  LYS A CB    1 
ATOM   741    C CG    A LYS A  1 107 ? 89.467  -9.814  33.408  0.25 47.00  ? 107  LYS A CG    1 
ATOM   742    C CD    A LYS A  1 107 ? 88.764  -9.315  34.687  0.25 49.89  ? 107  LYS A CD    1 
ATOM   743    C CE    A LYS A  1 107 ? 89.478  -8.060  35.241  0.25 53.19  ? 107  LYS A CE    1 
ATOM   744    N NZ    A LYS A  1 107 ? 89.042  -7.637  36.617  0.25 52.21  ? 107  LYS A NZ    1 
ATOM   745    N N     A GLU A  1 108 ? 87.756  -10.646 29.947  0.25 36.85  ? 108  GLU A N     1 
ATOM   746    C CA    A GLU A  1 108 ? 87.787  -9.906  28.685  0.25 35.95  ? 108  GLU A CA    1 
ATOM   747    C C     A GLU A  1 108 ? 86.437  -9.273  28.383  0.25 35.90  ? 108  GLU A C     1 
ATOM   748    O O     A GLU A  1 108 ? 86.355  -8.118  27.960  0.25 36.14  ? 108  GLU A O     1 
ATOM   749    C CB    A GLU A  1 108 ? 88.165  -10.832 27.547  0.25 33.14  ? 108  GLU A CB    1 
ATOM   750    N N     A PHE A  1 109 ? 85.367  -10.031 28.585  0.25 34.10  ? 109  PHE A N     1 
ATOM   751    C CA    A PHE A  1 109 ? 84.073  -9.450  28.289  0.25 32.76  ? 109  PHE A CA    1 
ATOM   752    C C     A PHE A  1 109 ? 83.722  -8.383  29.309  0.25 33.04  ? 109  PHE A C     1 
ATOM   753    O O     A PHE A  1 109 ? 83.300  -7.290  28.938  0.25 33.65  ? 109  PHE A O     1 
ATOM   754    C CB    A PHE A  1 109 ? 82.973  -10.493 28.264  0.25 31.37  ? 109  PHE A CB    1 
ATOM   755    C CG    A PHE A  1 109 ? 81.655  -9.935  27.838  0.25 31.76  ? 109  PHE A CG    1 
ATOM   756    C CD1   A PHE A  1 109 ? 81.391  -9.707  26.495  0.25 33.54  ? 109  PHE A CD1   1 
ATOM   757    C CD2   A PHE A  1 109 ? 80.701  -9.564  28.786  0.25 32.59  ? 109  PHE A CD2   1 
ATOM   758    C CE1   A PHE A  1 109 ? 80.190  -9.111  26.089  0.25 33.19  ? 109  PHE A CE1   1 
ATOM   759    C CE2   A PHE A  1 109 ? 79.486  -8.962  28.400  0.25 30.84  ? 109  PHE A CE2   1 
ATOM   760    C CZ    A PHE A  1 109 ? 79.234  -8.737  27.051  0.25 32.26  ? 109  PHE A CZ    1 
ATOM   761    N N     A LEU A  1 110 ? 83.893  -8.697  30.592  0.25 34.39  ? 110  LEU A N     1 
ATOM   762    C CA    A LEU A  1 110 ? 83.599  -7.723  31.650  0.25 35.01  ? 110  LEU A CA    1 
ATOM   763    C C     A LEU A  1 110 ? 84.374  -6.415  31.428  0.25 38.66  ? 110  LEU A C     1 
ATOM   764    O O     A LEU A  1 110 ? 83.795  -5.323  31.467  0.25 37.00  ? 110  LEU A O     1 
ATOM   765    C CB    A LEU A  1 110 ? 83.948  -8.308  33.023  0.25 31.75  ? 110  LEU A CB    1 
ATOM   766    C CG    A LEU A  1 110 ? 83.070  -9.485  33.469  0.25 29.78  ? 110  LEU A CG    1 
ATOM   767    C CD1   A LEU A  1 110 ? 83.549  -10.028 34.805  0.25 28.65  ? 110  LEU A CD1   1 
ATOM   768    C CD2   A LEU A  1 110 ? 81.628  -9.027  33.574  0.25 30.76  ? 110  LEU A CD2   1 
ATOM   769    N N     A GLU A  1 111 ? 85.680  -6.522  31.193  0.25 40.57  ? 111  GLU A N     1 
ATOM   770    C CA    A GLU A  1 111 ? 86.487  -5.324  30.963  0.25 43.47  ? 111  GLU A CA    1 
ATOM   771    C C     A GLU A  1 111 ? 85.989  -4.612  29.706  0.25 43.51  ? 111  GLU A C     1 
ATOM   772    O O     A GLU A  1 111 ? 85.979  -3.382  29.617  0.25 44.10  ? 111  GLU A O     1 
ATOM   773    C CB    A GLU A  1 111 ? 87.967  -5.700  30.815  0.25 46.58  ? 111  GLU A CB    1 
ATOM   774    C CG    A GLU A  1 111 ? 88.599  -6.228  32.113  0.25 52.44  ? 111  GLU A CG    1 
ATOM   775    C CD    A GLU A  1 111 ? 90.086  -6.504  31.967  0.25 54.95  ? 111  GLU A CD    1 
ATOM   776    O OE1   A GLU A  1 111 ? 90.816  -5.588  31.536  0.25 57.31  ? 111  GLU A OE1   1 
ATOM   777    O OE2   A GLU A  1 111 ? 90.524  -7.630  32.283  0.25 57.79  ? 111  GLU A OE2   1 
ATOM   778    N N     A LYS A  1 112 ? 85.539  -5.402  28.746  0.25 43.99  ? 112  LYS A N     1 
ATOM   779    C CA    A LYS A  1 112 ? 85.045  -4.882  27.480  0.25 44.28  ? 112  LYS A CA    1 
ATOM   780    C C     A LYS A  1 112 ? 83.804  -4.004  27.654  0.25 44.76  ? 112  LYS A C     1 
ATOM   781    O O     A LYS A  1 112 ? 83.621  -3.026  26.935  0.25 45.21  ? 112  LYS A O     1 
ATOM   782    C CB    A LYS A  1 112 ? 84.746  -6.058  26.557  0.25 46.50  ? 112  LYS A CB    1 
ATOM   783    C CG    A LYS A  1 112 ? 84.194  -5.706  25.195  0.25 50.33  ? 112  LYS A CG    1 
ATOM   784    C CD    A LYS A  1 112 ? 83.880  -6.993  24.435  0.25 52.96  ? 112  LYS A CD    1 
ATOM   785    C CE    A LYS A  1 112 ? 83.187  -6.717  23.112  0.25 55.81  ? 112  LYS A CE    1 
ATOM   786    N NZ    A LYS A  1 112 ? 82.880  -7.988  22.382  0.25 57.92  ? 112  LYS A NZ    1 
ATOM   787    N N     A VAL A  1 113 ? 82.946  -4.348  28.610  0.25 43.25  ? 113  VAL A N     1 
ATOM   788    C CA    A VAL A  1 113 ? 81.736  -3.562  28.845  0.25 40.51  ? 113  VAL A CA    1 
ATOM   789    C C     A VAL A  1 113 ? 81.871  -2.574  30.003  0.25 40.00  ? 113  VAL A C     1 
ATOM   790    O O     A VAL A  1 113 ? 80.867  -2.126  30.566  0.25 40.92  ? 113  VAL A O     1 
ATOM   791    C CB    A VAL A  1 113 ? 80.497  -4.465  29.132  0.25 40.54  ? 113  VAL A CB    1 
ATOM   792    C CG1   A VAL A  1 113 ? 80.100  -5.225  27.875  0.25 40.36  ? 113  VAL A CG1   1 
ATOM   793    C CG2   A VAL A  1 113 ? 80.802  -5.441  30.272  0.25 40.13  ? 113  VAL A CG2   1 
ATOM   794    N N     A GLY A  1 114 ? 83.100  -2.240  30.370  0.25 38.40  ? 114  GLY A N     1 
ATOM   795    C CA    A GLY A  1 114 ? 83.304  -1.290  31.451  0.25 35.62  ? 114  GLY A CA    1 
ATOM   796    C C     A GLY A  1 114 ? 83.173  -1.834  32.863  0.25 35.15  ? 114  GLY A C     1 
ATOM   797    O O     A GLY A  1 114 ? 82.976  -1.066  33.805  0.25 37.15  ? 114  GLY A O     1 
ATOM   798    N N     A LEU A  1 115 ? 83.289  -3.143  33.037  0.25 32.62  ? 115  LEU A N     1 
ATOM   799    C CA    A LEU A  1 115 ? 83.178  -3.718  34.369  0.25 30.30  ? 115  LEU A CA    1 
ATOM   800    C C     A LEU A  1 115 ? 84.476  -4.430  34.750  0.25 29.33  ? 115  LEU A C     1 
ATOM   801    O O     A LEU A  1 115 ? 84.433  -5.520  35.329  0.25 26.80  ? 115  LEU A O     1 
ATOM   802    C CB    A LEU A  1 115 ? 82.016  -4.707  34.396  0.25 29.48  ? 115  LEU A CB    1 
ATOM   803    C CG    A LEU A  1 115 ? 80.642  -4.150  33.990  0.25 31.64  ? 115  LEU A CG    1 
ATOM   804    C CD1   A LEU A  1 115 ? 79.638  -5.296  33.819  0.25 28.66  ? 115  LEU A CD1   1 
ATOM   805    C CD2   A LEU A  1 115 ? 80.149  -3.167  35.042  0.25 25.99  ? 115  LEU A CD2   1 
ATOM   806    N N     A GLY A  1 116 ? 85.616  -3.800  34.430  0.25 30.30  ? 116  GLY A N     1 
ATOM   807    C CA    A GLY A  1 116 ? 86.921  -4.392  34.723  0.25 29.87  ? 116  GLY A CA    1 
ATOM   808    C C     A GLY A  1 116 ? 87.286  -4.505  36.189  0.25 31.09  ? 116  GLY A C     1 
ATOM   809    O O     A GLY A  1 116 ? 88.203  -5.246  36.538  0.25 35.80  ? 116  GLY A O     1 
ATOM   810    N N     A HIS A  1 117 ? 86.561  -3.799  37.051  0.25 31.79  ? 117  HIS A N     1 
ATOM   811    C CA    A HIS A  1 117 ? 86.825  -3.827  38.487  0.25 30.97  ? 117  HIS A CA    1 
ATOM   812    C C     A HIS A  1 117 ? 86.279  -5.071  39.150  0.25 31.21  ? 117  HIS A C     1 
ATOM   813    O O     A HIS A  1 117 ? 86.479  -5.288  40.345  0.25 33.65  ? 117  HIS A O     1 
ATOM   814    C CB    A HIS A  1 117 ? 86.196  -2.592  39.132  0.25 33.27  ? 117  HIS A CB    1 
ATOM   815    C CG    A HIS A  1 117 ? 84.710  -2.510  38.951  0.25 34.31  ? 117  HIS A CG    1 
ATOM   816    N ND1   A HIS A  1 117 ? 83.816  -3.083  39.834  0.25 36.38  ? 117  HIS A ND1   1 
ATOM   817    C CD2   A HIS A  1 117 ? 83.964  -1.949  37.972  0.25 33.04  ? 117  HIS A CD2   1 
ATOM   818    C CE1   A HIS A  1 117 ? 82.583  -2.874  39.407  0.25 31.63  ? 117  HIS A CE1   1 
ATOM   819    N NE2   A HIS A  1 117 ? 82.646  -2.189  38.279  0.25 33.53  ? 117  HIS A NE2   1 
ATOM   820    N N     A ARG A  1 118 ? 85.573  -5.894  38.382  0.25 32.15  ? 118  ARG A N     1 
ATOM   821    C CA    A ARG A  1 118 ? 84.990  -7.106  38.936  0.25 30.68  ? 118  ARG A CA    1 
ATOM   822    C C     A ARG A  1 118 ? 85.838  -8.336  38.673  0.25 30.80  ? 118  ARG A C     1 
ATOM   823    O O     A ARG A  1 118 ? 86.544  -8.396  37.668  0.25 32.58  ? 118  ARG A O     1 
ATOM   824    C CB    A ARG A  1 118 ? 83.623  -7.323  38.327  0.25 33.79  ? 118  ARG A CB    1 
ATOM   825    C CG    A ARG A  1 118 ? 82.623  -6.314  38.733  0.25 32.73  ? 118  ARG A CG    1 
ATOM   826    C CD    A ARG A  1 118 ? 81.438  -7.109  39.183  0.25 31.26  ? 118  ARG A CD    1 
ATOM   827    N NE    A ARG A  1 118 ? 80.337  -6.292  38.954  0.25 31.26  ? 118  ARG A NE    1 
ATOM   828    C CZ    A ARG A  1 118 ? 79.354  -6.238  38.084  0.25 30.70  ? 118  ARG A CZ    1 
ATOM   829    N NH1   A ARG A  1 118 ? 79.063  -7.058  37.069  0.25 28.49  ? 118  ARG A NH1   1 
ATOM   830    N NH2   A ARG A  1 118 ? 78.692  -5.120  38.269  0.25 29.72  ? 118  ARG A NH2   1 
ATOM   831    N N     A ARG A  1 119 ? 85.783  -9.308  39.576  0.25 29.59  ? 119  ARG A N     1 
ATOM   832    C CA    A ARG A  1 119 ? 86.528  -10.537 39.369  0.25 30.92  ? 119  ARG A CA    1 
ATOM   833    C C     A ARG A  1 119 ? 85.768  -11.346 38.319  0.25 32.50  ? 119  ARG A C     1 
ATOM   834    O O     A ARG A  1 119 ? 84.545  -11.183 38.142  0.25 32.35  ? 119  ARG A O     1 
ATOM   835    C CB    A ARG A  1 119 ? 86.643  -11.344 40.666  0.25 30.23  ? 119  ARG A CB    1 
ATOM   836    C CG    A ARG A  1 119 ? 85.341  -11.890 41.212  0.25 33.40  ? 119  ARG A CG    1 
ATOM   837    C CD    A ARG A  1 119 ? 85.624  -13.023 42.198  0.25 35.00  ? 119  ARG A CD    1 
ATOM   838    N NE    A ARG A  1 119 ? 84.416  -13.715 42.621  0.25 34.17  ? 119  ARG A NE    1 
ATOM   839    C CZ    A ARG A  1 119 ? 83.807  -13.510 43.782  0.25 37.85  ? 119  ARG A CZ    1 
ATOM   840    N NH1   A ARG A  1 119 ? 82.706  -14.188 44.086  0.25 35.79  ? 119  ARG A NH1   1 
ATOM   841    N NH2   A ARG A  1 119 ? 84.306  -12.631 44.646  0.25 40.09  ? 119  ARG A NH2   1 
ATOM   842    N N     A GLU A  1 120 ? 86.487  -12.215 37.623  0.25 31.04  ? 120  GLU A N     1 
ATOM   843    C CA    A GLU A  1 120 ? 85.881  -13.030 36.585  0.25 31.46  ? 120  GLU A CA    1 
ATOM   844    C C     A GLU A  1 120 ? 84.694  -13.815 37.134  0.25 28.16  ? 120  GLU A C     1 
ATOM   845    O O     A GLU A  1 120 ? 84.782  -14.415 38.203  0.25 28.88  ? 120  GLU A O     1 
ATOM   846    C CB    A GLU A  1 120 ? 86.923  -14.001 36.022  0.25 31.28  ? 120  GLU A CB    1 
ATOM   847    C CG    A GLU A  1 120 ? 86.420  -14.787 34.844  0.25 35.00  ? 120  GLU A CG    1 
ATOM   848    C CD    A GLU A  1 120 ? 87.518  -15.617 34.214  0.25 38.08  ? 120  GLU A CD    1 
ATOM   849    O OE1   A GLU A  1 120 ? 87.898  -16.655 34.806  0.25 42.44  ? 120  GLU A OE1   1 
ATOM   850    O OE2   A GLU A  1 120 ? 88.005  -15.219 33.138  0.25 39.96  ? 120  GLU A OE2   1 
ATOM   851    N N     A GLY A  1 121 ? 83.595  -13.829 36.387  0.25 27.55  ? 121  GLY A N     1 
ATOM   852    C CA    A GLY A  1 121 ? 82.418  -14.563 36.831  0.25 26.67  ? 121  GLY A CA    1 
ATOM   853    C C     A GLY A  1 121 ? 81.386  -13.728 37.576  0.25 25.90  ? 121  GLY A C     1 
ATOM   854    O O     A GLY A  1 121 ? 80.248  -14.174 37.762  0.25 26.59  ? 121  GLY A O     1 
ATOM   855    N N     A ASP A  1 122 ? 81.777  -12.541 38.033  0.25 23.37  ? 122  ASP A N     1 
ATOM   856    C CA    A ASP A  1 122 ? 80.833  -11.678 38.760  0.25 24.87  ? 122  ASP A CA    1 
ATOM   857    C C     A ASP A  1 122 ? 80.015  -10.889 37.747  0.25 22.77  ? 122  ASP A C     1 
ATOM   858    O O     A ASP A  1 122 ? 80.428  -9.816  37.311  0.25 23.81  ? 122  ASP A O     1 
ATOM   859    C CB    A ASP A  1 122 ? 81.585  -10.725 39.661  0.25 24.75  ? 122  ASP A CB    1 
ATOM   860    C CG    A ASP A  1 122 ? 80.654  -9.850  40.499  0.25 29.64  ? 122  ASP A CG    1 
ATOM   861    O OD1   A ASP A  1 122 ? 79.420  -9.877  40.305  0.25 25.62  ? 122  ASP A OD1   1 
ATOM   862    O OD2   A ASP A  1 122 ? 81.174  -9.113  41.352  0.25 28.20  ? 122  ASP A OD2   1 
ATOM   863    N N     A LEU A  1 123 ? 78.859  -11.435 37.379  0.25 21.08  ? 123  LEU A N     1 
ATOM   864    C CA    A LEU A  1 123 ? 77.995  -10.834 36.355  0.25 22.30  ? 123  LEU A CA    1 
ATOM   865    C C     A LEU A  1 123 ? 77.267  -9.569  36.783  0.25 21.29  ? 123  LEU A C     1 
ATOM   866    O O     A LEU A  1 123 ? 76.744  -8.831  35.952  0.25 23.71  ? 123  LEU A O     1 
ATOM   867    C CB    A LEU A  1 123 ? 76.971  -11.875 35.884  0.25 23.84  ? 123  LEU A CB    1 
ATOM   868    C CG    A LEU A  1 123 ? 77.526  -13.196 35.347  0.25 24.53  ? 123  LEU A CG    1 
ATOM   869    C CD1   A LEU A  1 123 ? 76.390  -14.194 35.101  0.25 20.26  ? 123  LEU A CD1   1 
ATOM   870    C CD2   A LEU A  1 123 ? 78.308  -12.917 34.069  0.25 25.67  ? 123  LEU A CD2   1 
ATOM   871    N N     A GLY A  1 124 ? 77.225  -9.304  38.079  0.25 22.38  ? 124  GLY A N     1 
ATOM   872    C CA    A GLY A  1 124 ? 76.523  -8.103  38.519  0.25 20.83  ? 124  GLY A CA    1 
ATOM   873    C C     A GLY A  1 124 ? 75.130  -8.493  39.003  0.25 21.43  ? 124  GLY A C     1 
ATOM   874    O O     A GLY A  1 124 ? 74.876  -9.689  39.160  0.25 20.58  ? 124  GLY A O     1 
ATOM   875    N N     A PRO A  1 125 ? 74.221  -7.525  39.236  0.25 21.29  ? 125  PRO A N     1 
ATOM   876    C CA    A PRO A  1 125 ? 72.852  -7.774  39.713  0.25 22.04  ? 125  PRO A CA    1 
ATOM   877    C C     A PRO A  1 125 ? 71.915  -8.284  38.636  0.25 22.62  ? 125  PRO A C     1 
ATOM   878    O O     A PRO A  1 125 ? 70.931  -7.607  38.296  0.25 22.48  ? 125  PRO A O     1 
ATOM   879    C CB    A PRO A  1 125 ? 72.419  -6.406  40.247  0.25 21.93  ? 125  PRO A CB    1 
ATOM   880    C CG    A PRO A  1 125 ? 73.083  -5.460  39.294  0.25 21.40  ? 125  PRO A CG    1 
ATOM   881    C CD    A PRO A  1 125 ? 74.484  -6.078  39.128  0.25 20.01  ? 125  PRO A CD    1 
ATOM   882    N N     A VAL A  1 126 ? 72.226  -9.464  38.097  0.25 20.90  ? 126  VAL A N     1 
ATOM   883    C CA    A VAL A  1 126 ? 71.411  -10.064 37.049  0.25 21.97  ? 126  VAL A CA    1 
ATOM   884    C C     A VAL A  1 126 ? 70.252  -10.918 37.618  0.25 21.53  ? 126  VAL A C     1 
ATOM   885    O O     A VAL A  1 126 ? 70.037  -10.971 38.830  0.25 22.55  ? 126  VAL A O     1 
ATOM   886    C CB    A VAL A  1 126 ? 72.275  -10.939 36.097  0.25 17.11  ? 126  VAL A CB    1 
ATOM   887    C CG1   A VAL A  1 126 ? 73.283  -10.081 35.369  0.25 18.22  ? 126  VAL A CG1   1 
ATOM   888    C CG2   A VAL A  1 126 ? 72.972  -11.987 36.872  0.25 18.27  ? 126  VAL A CG2   1 
ATOM   889    N N     A TYR A  1 127 ? 69.537  -11.583 36.719  0.25 21.81  ? 127  TYR A N     1 
ATOM   890    C CA    A TYR A  1 127 ? 68.377  -12.412 37.046  0.25 22.65  ? 127  TYR A CA    1 
ATOM   891    C C     A TYR A  1 127 ? 68.098  -12.724 38.505  0.25 22.11  ? 127  TYR A C     1 
ATOM   892    O O     A TYR A  1 127 ? 67.256  -12.090 39.138  0.25 21.89  ? 127  TYR A O     1 
ATOM   893    C CB    A TYR A  1 127 ? 68.444  -13.736 36.265  0.25 25.75  ? 127  TYR A CB    1 
ATOM   894    C CG    A TYR A  1 127 ? 68.474  -13.568 34.762  0.25 26.12  ? 127  TYR A CG    1 
ATOM   895    C CD1   A TYR A  1 127 ? 67.385  -13.053 34.082  0.25 26.65  ? 127  TYR A CD1   1 
ATOM   896    C CD2   A TYR A  1 127 ? 69.617  -13.911 34.019  0.25 26.79  ? 127  TYR A CD2   1 
ATOM   897    C CE1   A TYR A  1 127 ? 67.419  -12.881 32.692  0.25 28.06  ? 127  TYR A CE1   1 
ATOM   898    C CE2   A TYR A  1 127 ? 69.661  -13.741 32.641  0.25 24.55  ? 127  TYR A CE2   1 
ATOM   899    C CZ    A TYR A  1 127 ? 68.561  -13.229 31.979  0.25 25.37  ? 127  TYR A CZ    1 
ATOM   900    O OH    A TYR A  1 127 ? 68.600  -13.083 30.595  0.25 23.15  ? 127  TYR A OH    1 
ATOM   901    N N     A GLY A  1 128 ? 68.803  -13.721 39.032  0.25 22.43  ? 128  GLY A N     1 
ATOM   902    C CA    A GLY A  1 128 ? 68.611  -14.140 40.408  0.25 21.51  ? 128  GLY A CA    1 
ATOM   903    C C     A GLY A  1 128 ? 68.588  -13.055 41.474  0.25 22.03  ? 128  GLY A C     1 
ATOM   904    O O     A GLY A  1 128 ? 67.771  -13.116 42.420  0.25 20.40  ? 128  GLY A O     1 
ATOM   905    N N     A PHE A  1 129 ? 69.481  -12.085 41.346  0.25 20.11  ? 129  PHE A N     1 
ATOM   906    C CA    A PHE A  1 129 ? 69.553  -11.009 42.314  0.25 20.76  ? 129  PHE A CA    1 
ATOM   907    C C     A PHE A  1 129 ? 68.271  -10.152 42.268  0.25 23.03  ? 129  PHE A C     1 
ATOM   908    O O     A PHE A  1 129 ? 67.717  -9.800  43.317  0.25 22.75  ? 129  PHE A O     1 
ATOM   909    C CB    A PHE A  1 129 ? 70.785  -10.144 42.033  0.25 18.50  ? 129  PHE A CB    1 
ATOM   910    C CG    A PHE A  1 129 ? 70.910  -8.969  42.946  0.25 21.21  ? 129  PHE A CG    1 
ATOM   911    C CD1   A PHE A  1 129 ? 70.331  -7.745  42.616  0.25 19.10  ? 129  PHE A CD1   1 
ATOM   912    C CD2   A PHE A  1 129 ? 71.598  -9.085  44.154  0.25 20.81  ? 129  PHE A CD2   1 
ATOM   913    C CE1   A PHE A  1 129 ? 70.439  -6.649  43.482  0.25 18.49  ? 129  PHE A CE1   1 
ATOM   914    C CE2   A PHE A  1 129 ? 71.708  -7.985  45.027  0.25 22.27  ? 129  PHE A CE2   1 
ATOM   915    C CZ    A PHE A  1 129 ? 71.126  -6.774  44.682  0.25 19.93  ? 129  PHE A CZ    1 
ATOM   916    N N     A GLN A  1 130 ? 67.809  -9.820  41.063  0.25 21.13  ? 130  GLN A N     1 
ATOM   917    C CA    A GLN A  1 130 ? 66.587  -9.022  40.922  0.25 22.28  ? 130  GLN A CA    1 
ATOM   918    C C     A GLN A  1 130 ? 65.382  -9.809  41.437  0.25 20.78  ? 130  GLN A C     1 
ATOM   919    O O     A GLN A  1 130 ? 64.529  -9.256  42.106  0.25 24.53  ? 130  GLN A O     1 
ATOM   920    C CB    A GLN A  1 130 ? 66.356  -8.647  39.451  0.25 22.21  ? 130  GLN A CB    1 
ATOM   921    C CG    A GLN A  1 130 ? 67.457  -7.764  38.836  0.25 21.10  ? 130  GLN A CG    1 
ATOM   922    C CD    A GLN A  1 130 ? 67.674  -6.484  39.623  0.25 22.56  ? 130  GLN A CD    1 
ATOM   923    O OE1   A GLN A  1 130 ? 66.736  -5.942  40.239  0.25 22.84  ? 130  GLN A OE1   1 
ATOM   924    N NE2   A GLN A  1 130 ? 68.903  -5.972  39.592  0.25 17.47  ? 130  GLN A NE2   1 
ATOM   925    N N     A TRP A  1 131 ? 65.332  -11.101 41.126  0.25 21.43  ? 131  TRP A N     1 
ATOM   926    C CA    A TRP A  1 131 ? 64.235  -11.982 41.547  0.25 22.55  ? 131  TRP A CA    1 
ATOM   927    C C     A TRP A  1 131 ? 64.033  -12.039 43.061  0.25 26.19  ? 131  TRP A C     1 
ATOM   928    O O     A TRP A  1 131 ? 62.885  -12.020 43.547  0.25 23.08  ? 131  TRP A O     1 
ATOM   929    C CB    A TRP A  1 131 ? 64.466  -13.418 41.059  0.25 21.82  ? 131  TRP A CB    1 
ATOM   930    C CG    A TRP A  1 131 ? 64.188  -13.664 39.607  0.25 21.85  ? 131  TRP A CG    1 
ATOM   931    C CD1   A TRP A  1 131 ? 64.008  -12.732 38.634  0.25 21.04  ? 131  TRP A CD1   1 
ATOM   932    C CD2   A TRP A  1 131 ? 64.085  -14.939 38.963  0.25 23.62  ? 131  TRP A CD2   1 
ATOM   933    N NE1   A TRP A  1 131 ? 63.795  -13.340 37.423  0.25 18.29  ? 131  TRP A NE1   1 
ATOM   934    C CE2   A TRP A  1 131 ? 63.838  -14.696 37.593  0.25 22.81  ? 131  TRP A CE2   1 
ATOM   935    C CE3   A TRP A  1 131 ? 64.183  -16.270 39.410  0.25 24.06  ? 131  TRP A CE3   1 
ATOM   936    C CZ2   A TRP A  1 131 ? 63.686  -15.734 36.657  0.25 20.08  ? 131  TRP A CZ2   1 
ATOM   937    C CZ3   A TRP A  1 131 ? 64.030  -17.301 38.475  0.25 22.45  ? 131  TRP A CZ3   1 
ATOM   938    C CH2   A TRP A  1 131 ? 63.784  -17.022 37.121  0.25 21.95  ? 131  TRP A CH2   1 
ATOM   939    N N     A ARG A  1 132 ? 65.140  -12.113 43.803  0.25 24.21  ? 132  ARG A N     1 
ATOM   940    C CA    A ARG A  1 132 ? 65.069  -12.229 45.257  0.25 22.54  ? 132  ARG A CA    1 
ATOM   941    C C     A ARG A  1 132 ? 65.423  -10.973 46.045  0.25 23.52  ? 132  ARG A C     1 
ATOM   942    O O     A ARG A  1 132 ? 65.096  -10.887 47.221  0.25 23.24  ? 132  ARG A O     1 
ATOM   943    C CB    A ARG A  1 132 ? 65.988  -13.388 45.740  0.25 25.22  ? 132  ARG A CB    1 
ATOM   944    C CG    A ARG A  1 132 ? 65.852  -14.716 44.968  0.25 27.00  ? 132  ARG A CG    1 
ATOM   945    C CD    A ARG A  1 132 ? 64.400  -15.229 44.898  0.25 25.03  ? 132  ARG A CD    1 
ATOM   946    N NE    A ARG A  1 132 ? 63.821  -15.523 46.206  0.25 23.66  ? 132  ARG A NE    1 
ATOM   947    C CZ    A ARG A  1 132 ? 63.987  -16.648 46.890  0.25 23.53  ? 132  ARG A CZ    1 
ATOM   948    N NH1   A ARG A  1 132 ? 64.734  -17.643 46.423  0.25 25.30  ? 132  ARG A NH1   1 
ATOM   949    N NH2   A ARG A  1 132 ? 63.369  -16.787 48.046  0.25 22.72  ? 132  ARG A NH2   1 
ATOM   950    N N     A HIS A  1 133 ? 66.079  -9.997  45.410  0.25 22.96  ? 133  HIS A N     1 
ATOM   951    C CA    A HIS A  1 133 ? 66.507  -8.805  46.129  0.25 21.61  ? 133  HIS A CA    1 
ATOM   952    C C     A HIS A  1 133 ? 66.319  -7.514  45.349  0.25 22.19  ? 133  HIS A C     1 
ATOM   953    O O     A HIS A  1 133 ? 67.124  -6.588  45.487  0.25 20.74  ? 133  HIS A O     1 
ATOM   954    C CB    A HIS A  1 133 ? 68.001  -8.933  46.480  0.25 24.23  ? 133  HIS A CB    1 
ATOM   955    C CG    A HIS A  1 133 ? 68.357  -10.219 47.155  0.25 23.18  ? 133  HIS A CG    1 
ATOM   956    N ND1   A HIS A  1 133 ? 67.972  -10.510 48.445  0.25 23.96  ? 133  HIS A ND1   1 
ATOM   957    C CD2   A HIS A  1 133 ? 69.069  -11.287 46.724  0.25 24.02  ? 133  HIS A CD2   1 
ATOM   958    C CE1   A HIS A  1 133 ? 68.429  -11.701 48.783  0.25 21.34  ? 133  HIS A CE1   1 
ATOM   959    N NE2   A HIS A  1 133 ? 69.097  -12.195 47.754  0.25 22.42  ? 133  HIS A NE2   1 
ATOM   960    N N     A PHE A  1 134 ? 65.273  -7.437  44.531  0.25 22.78  ? 134  PHE A N     1 
ATOM   961    C CA    A PHE A  1 134 ? 65.047  -6.247  43.732  0.25 19.44  ? 134  PHE A CA    1 
ATOM   962    C C     A PHE A  1 134 ? 65.109  -4.967  44.548  0.25 22.33  ? 134  PHE A C     1 
ATOM   963    O O     A PHE A  1 134 ? 64.429  -4.830  45.575  0.25 21.29  ? 134  PHE A O     1 
ATOM   964    C CB    A PHE A  1 134 ? 63.693  -6.328  43.015  0.25 20.32  ? 134  PHE A CB    1 
ATOM   965    C CG    A PHE A  1 134 ? 63.495  -5.250  42.002  0.25 21.94  ? 134  PHE A CG    1 
ATOM   966    C CD1   A PHE A  1 134 ? 63.249  -3.938  42.402  0.25 22.17  ? 134  PHE A CD1   1 
ATOM   967    C CD2   A PHE A  1 134 ? 63.586  -5.531  40.631  0.25 24.27  ? 134  PHE A CD2   1 
ATOM   968    C CE1   A PHE A  1 134 ? 63.107  -2.931  41.456  0.25 22.03  ? 134  PHE A CE1   1 
ATOM   969    C CE2   A PHE A  1 134 ? 63.439  -4.512  39.679  0.25 23.26  ? 134  PHE A CE2   1 
ATOM   970    C CZ    A PHE A  1 134 ? 63.207  -3.229  40.089  0.25 23.13  ? 134  PHE A CZ    1 
ATOM   971    N N     A GLY A  1 135 ? 65.906  -4.012  44.066  0.25 20.51  ? 135  GLY A N     1 
ATOM   972    C CA    A GLY A  1 135 ? 66.021  -2.746  44.759  0.25 24.40  ? 135  GLY A CA    1 
ATOM   973    C C     A GLY A  1 135 ? 67.188  -2.653  45.729  0.25 23.71  ? 135  GLY A C     1 
ATOM   974    O O     A GLY A  1 135 ? 67.601  -1.562  46.087  0.25 25.13  ? 135  GLY A O     1 
ATOM   975    N N     A ALA A  1 136 ? 67.720  -3.781  46.165  0.25 23.14  ? 136  ALA A N     1 
ATOM   976    C CA    A ALA A  1 136 ? 68.852  -3.753  47.075  0.25 22.77  ? 136  ALA A CA    1 
ATOM   977    C C     A ALA A  1 136 ? 70.091  -3.196  46.370  0.25 26.02  ? 136  ALA A C     1 
ATOM   978    O O     A ALA A  1 136 ? 70.207  -3.234  45.144  0.25 24.34  ? 136  ALA A O     1 
ATOM   979    C CB    A ALA A  1 136 ? 69.146  -5.153  47.613  0.25 16.84  ? 136  ALA A CB    1 
ATOM   980    N N     A GLU A  1 137 ? 71.016  -2.680  47.166  0.25 27.75  ? 137  GLU A N     1 
ATOM   981    C CA    A GLU A  1 137 ? 72.256  -2.113  46.653  0.25 31.42  ? 137  GLU A CA    1 
ATOM   982    C C     A GLU A  1 137 ? 73.230  -3.256  46.364  0.25 28.24  ? 137  GLU A C     1 
ATOM   983    O O     A GLU A  1 137 ? 73.476  -4.099  47.219  0.25 28.48  ? 137  GLU A O     1 
ATOM   984    C CB    A GLU A  1 137 ? 72.860  -1.175  47.703  0.25 35.59  ? 137  GLU A CB    1 
ATOM   985    C CG    A GLU A  1 137 ? 74.134  -0.474  47.258  0.25 43.29  ? 137  GLU A CG    1 
ATOM   986    C CD    A GLU A  1 137 ? 74.870  0.177   48.421  0.25 50.16  ? 137  GLU A CD    1 
ATOM   987    O OE1   A GLU A  1 137 ? 74.207  0.878   49.225  0.25 52.66  ? 137  GLU A OE1   1 
ATOM   988    O OE2   A GLU A  1 137 ? 76.111  -0.010  48.529  0.25 53.61  ? 137  GLU A OE2   1 
ATOM   989    N N     A TYR A  1 138 ? 73.783  -3.284  45.165  0.25 26.49  ? 138  TYR A N     1 
ATOM   990    C CA    A TYR A  1 138 ? 74.702  -4.347  44.798  0.25 26.49  ? 138  TYR A CA    1 
ATOM   991    C C     A TYR A  1 138 ? 76.148  -3.913  45.000  0.25 27.64  ? 138  TYR A C     1 
ATOM   992    O O     A TYR A  1 138 ? 76.548  -2.838  44.568  0.25 27.14  ? 138  TYR A O     1 
ATOM   993    C CB    A TYR A  1 138 ? 74.515  -4.717  43.328  0.25 27.37  ? 138  TYR A CB    1 
ATOM   994    C CG    A TYR A  1 138 ? 75.234  -5.981  42.892  0.25 24.36  ? 138  TYR A CG    1 
ATOM   995    C CD1   A TYR A  1 138 ? 74.689  -7.230  43.145  0.25 22.50  ? 138  TYR A CD1   1 
ATOM   996    C CD2   A TYR A  1 138 ? 76.473  -5.913  42.255  0.25 26.24  ? 138  TYR A CD2   1 
ATOM   997    C CE1   A TYR A  1 138 ? 75.363  -8.407  42.779  0.25 28.26  ? 138  TYR A CE1   1 
ATOM   998    C CE2   A TYR A  1 138 ? 77.169  -7.078  41.881  0.25 26.02  ? 138  TYR A CE2   1 
ATOM   999    C CZ    A TYR A  1 138 ? 76.610  -8.320  42.145  0.25 28.70  ? 138  TYR A CZ    1 
ATOM   1000   O OH    A TYR A  1 138 ? 77.275  -9.476  41.777  0.25 27.98  ? 138  TYR A OH    1 
ATOM   1001   N N     A THR A  1 139 ? 76.934  -4.750  45.660  0.25 28.19  ? 139  THR A N     1 
ATOM   1002   C CA    A THR A  1 139 ? 78.352  -4.436  45.840  0.25 31.14  ? 139  THR A CA    1 
ATOM   1003   C C     A THR A  1 139 ? 79.103  -5.372  44.896  0.25 28.68  ? 139  THR A C     1 
ATOM   1004   O O     A THR A  1 139 ? 79.589  -4.945  43.863  0.25 30.89  ? 139  THR A O     1 
ATOM   1005   C CB    A THR A  1 139 ? 78.808  -4.656  47.298  0.25 30.31  ? 139  THR A CB    1 
ATOM   1006   O OG1   A THR A  1 139 ? 78.436  -5.964  47.731  0.25 33.48  ? 139  THR A OG1   1 
ATOM   1007   C CG2   A THR A  1 139 ? 78.164  -3.635  48.207  0.25 29.12  ? 139  THR A CG2   1 
ATOM   1008   N N     A ASP A  1 140 ? 79.181  -6.646  45.254  0.25 30.70  ? 140  ASP A N     1 
ATOM   1009   C CA    A ASP A  1 140 ? 79.812  -7.659  44.393  0.25 32.58  ? 140  ASP A CA    1 
ATOM   1010   C C     A ASP A  1 140 ? 79.026  -8.964  44.595  0.25 31.52  ? 140  ASP A C     1 
ATOM   1011   O O     A ASP A  1 140 ? 78.036  -8.965  45.334  0.25 32.62  ? 140  ASP A O     1 
ATOM   1012   C CB    A ASP A  1 140 ? 81.313  -7.797  44.705  0.25 31.32  ? 140  ASP A CB    1 
ATOM   1013   C CG    A ASP A  1 140 ? 81.583  -8.372  46.077  0.25 33.34  ? 140  ASP A CG    1 
ATOM   1014   O OD1   A ASP A  1 140 ? 82.747  -8.302  46.502  0.25 37.99  ? 140  ASP A OD1   1 
ATOM   1015   O OD2   A ASP A  1 140 ? 80.665  -8.894  46.731  0.25 37.20  ? 140  ASP A OD2   1 
ATOM   1016   N N     A ALA A  1 141 ? 79.444  -10.086 43.975  0.25 32.42  ? 141  ALA A N     1 
ATOM   1017   C CA    A ALA A  1 141 ? 78.688  -11.332 44.143  0.25 33.77  ? 141  ALA A CA    1 
ATOM   1018   C C     A ALA A  1 141 ? 78.776  -11.977 45.507  0.25 33.69  ? 141  ALA A C     1 
ATOM   1019   O O     A ALA A  1 141 ? 78.009  -12.900 45.798  0.25 33.82  ? 141  ALA A O     1 
ATOM   1020   C CB    A ALA A  1 141 ? 79.275  -12.231 43.073  0.25 33.10  ? 141  ALA A CB    1 
ATOM   1021   N N     A ASP A  1 142 ? 79.711  -11.512 46.335  0.25 32.46  ? 142  ASP A N     1 
ATOM   1022   C CA    A ASP A  1 142 ? 79.876  -12.050 47.683  0.25 33.34  ? 142  ASP A CA    1 
ATOM   1023   C C     A ASP A  1 142 ? 79.093  -11.256 48.729  0.25 32.88  ? 142  ASP A C     1 
ATOM   1024   O O     A ASP A  1 142 ? 79.047  -11.634 49.905  0.25 32.98  ? 142  ASP A O     1 
ATOM   1025   C CB    A ASP A  1 142 ? 81.361  -12.059 48.062  0.25 36.02  ? 142  ASP A CB    1 
ATOM   1026   C CG    A ASP A  1 142 ? 82.178  -12.997 47.184  0.25 39.56  ? 142  ASP A CG    1 
ATOM   1027   O OD1   A ASP A  1 142 ? 83.415  -12.848 47.149  0.25 44.42  ? 142  ASP A OD1   1 
ATOM   1028   O OD2   A ASP A  1 142 ? 81.585  -13.885 46.534  0.25 37.89  ? 142  ASP A OD2   1 
ATOM   1029   N N     A GLY A  1 143 ? 78.474  -10.166 48.300  0.25 31.94  ? 143  GLY A N     1 
ATOM   1030   C CA    A GLY A  1 143 ? 77.718  -9.339  49.223  0.25 32.56  ? 143  GLY A CA    1 
ATOM   1031   C C     A GLY A  1 143 ? 76.641  -10.081 49.987  0.25 33.92  ? 143  GLY A C     1 
ATOM   1032   O O     A GLY A  1 143 ? 76.120  -11.101 49.532  0.25 33.31  ? 143  GLY A O     1 
ATOM   1033   N N     A ASP A  1 144 ? 76.307  -9.567  51.164  0.25 34.93  ? 144  ASP A N     1 
ATOM   1034   C CA    A ASP A  1 144 ? 75.277  -10.168 52.004  0.25 35.47  ? 144  ASP A CA    1 
ATOM   1035   C C     A ASP A  1 144 ? 73.949  -9.474  51.710  0.25 33.17  ? 144  ASP A C     1 
ATOM   1036   O O     A ASP A  1 144 ? 73.711  -8.356  52.159  0.25 34.48  ? 144  ASP A O     1 
ATOM   1037   C CB    A ASP A  1 144 ? 75.646  -9.999  53.477  0.25 38.14  ? 144  ASP A CB    1 
ATOM   1038   C CG    A ASP A  1 144 ? 74.555  -10.489 54.406  0.25 42.67  ? 144  ASP A CG    1 
ATOM   1039   O OD1   A ASP A  1 144 ? 73.972  -11.568 54.134  0.25 43.90  ? 144  ASP A OD1   1 
ATOM   1040   O OD2   A ASP A  1 144 ? 74.288  -9.797  55.411  0.25 46.20  ? 144  ASP A OD2   1 
ATOM   1041   N N     A TYR A  1 145 ? 73.086  -10.143 50.961  0.25 32.56  ? 145  TYR A N     1 
ATOM   1042   C CA    A TYR A  1 145 ? 71.796  -9.554  50.571  0.25 31.18  ? 145  TYR A CA    1 
ATOM   1043   C C     A TYR A  1 145 ? 70.601  -10.186 51.269  0.25 29.94  ? 145  TYR A C     1 
ATOM   1044   O O     A TYR A  1 145 ? 69.451  -9.832  50.993  0.25 28.78  ? 145  TYR A O     1 
ATOM   1045   C CB    A TYR A  1 145 ? 71.637  -9.683  49.056  0.25 27.84  ? 145  TYR A CB    1 
ATOM   1046   C CG    A TYR A  1 145 ? 72.815  -9.100  48.300  0.25 29.62  ? 145  TYR A CG    1 
ATOM   1047   C CD1   A TYR A  1 145 ? 73.117  -7.751  48.391  0.25 27.49  ? 145  TYR A CD1   1 
ATOM   1048   C CD2   A TYR A  1 145 ? 73.640  -9.910  47.509  0.25 28.66  ? 145  TYR A CD2   1 
ATOM   1049   C CE1   A TYR A  1 145 ? 74.216  -7.202  47.717  0.25 28.39  ? 145  TYR A CE1   1 
ATOM   1050   C CE2   A TYR A  1 145 ? 74.736  -9.375  46.827  0.25 29.04  ? 145  TYR A CE2   1 
ATOM   1051   C CZ    A TYR A  1 145 ? 75.016  -8.013  46.939  0.25 29.62  ? 145  TYR A CZ    1 
ATOM   1052   O OH    A TYR A  1 145 ? 76.083  -7.456  46.262  0.25 30.38  ? 145  TYR A OH    1 
ATOM   1053   N N     A LYS A  1 146 ? 70.869  -11.117 52.177  0.25 29.77  ? 146  LYS A N     1 
ATOM   1054   C CA    A LYS A  1 146 ? 69.788  -11.789 52.871  0.25 33.94  ? 146  LYS A CA    1 
ATOM   1055   C C     A LYS A  1 146 ? 68.863  -10.786 53.552  0.25 32.49  ? 146  LYS A C     1 
ATOM   1056   O O     A LYS A  1 146 ? 69.307  -9.941  54.302  0.25 31.06  ? 146  LYS A O     1 
ATOM   1057   C CB    A LYS A  1 146 ? 70.347  -12.768 53.895  0.25 38.64  ? 146  LYS A CB    1 
ATOM   1058   C CG    A LYS A  1 146 ? 69.277  -13.630 54.562  0.25 44.61  ? 146  LYS A CG    1 
ATOM   1059   C CD    A LYS A  1 146 ? 69.908  -14.653 55.503  0.25 50.59  ? 146  LYS A CD    1 
ATOM   1060   C CE    A LYS A  1 146 ? 68.861  -15.602 56.086  0.25 52.63  ? 146  LYS A CE    1 
ATOM   1061   N NZ    A LYS A  1 146 ? 69.486  -16.640 56.962  0.25 55.04  ? 146  LYS A NZ    1 
ATOM   1062   N N     A GLY A  1 147 ? 67.569  -10.882 53.267  0.25 35.19  ? 147  GLY A N     1 
ATOM   1063   C CA    A GLY A  1 147 ? 66.607  -9.967  53.867  0.25 32.28  ? 147  GLY A CA    1 
ATOM   1064   C C     A GLY A  1 147 ? 66.603  -8.578  53.267  0.25 32.41  ? 147  GLY A C     1 
ATOM   1065   O O     A GLY A  1 147 ? 65.907  -7.699  53.762  0.25 31.87  ? 147  GLY A O     1 
ATOM   1066   N N     A LYS A  1 148 ? 67.372  -8.366  52.200  0.25 31.89  ? 148  LYS A N     1 
ATOM   1067   C CA    A LYS A  1 148 ? 67.425  -7.057  51.556  0.25 31.04  ? 148  LYS A CA    1 
ATOM   1068   C C     A LYS A  1 148 ? 66.749  -7.071  50.182  0.25 29.67  ? 148  LYS A C     1 
ATOM   1069   O O     A LYS A  1 148 ? 66.850  -8.061  49.447  0.25 27.29  ? 148  LYS A O     1 
ATOM   1070   C CB    A LYS A  1 148 ? 68.882  -6.615  51.392  0.25 32.69  ? 148  LYS A CB    1 
ATOM   1071   C CG    A LYS A  1 148 ? 69.624  -6.506  52.713  0.25 37.20  ? 148  LYS A CG    1 
ATOM   1072   C CD    A LYS A  1 148 ? 71.067  -6.081  52.520  0.25 37.69  ? 148  LYS A CD    1 
ATOM   1073   C CE    A LYS A  1 148 ? 71.809  -6.095  53.851  0.25 40.64  ? 148  LYS A CE    1 
ATOM   1074   N NZ    A LYS A  1 148 ? 73.236  -5.701  53.690  0.25 44.27  ? 148  LYS A NZ    1 
ATOM   1075   N N     A GLY A  1 149 ? 66.094  -5.965  49.841  0.25 26.28  ? 149  GLY A N     1 
ATOM   1076   C CA    A GLY A  1 149 ? 65.409  -5.862  48.563  0.25 25.71  ? 149  GLY A CA    1 
ATOM   1077   C C     A GLY A  1 149 ? 64.081  -6.601  48.582  0.25 24.35  ? 149  GLY A C     1 
ATOM   1078   O O     A GLY A  1 149 ? 63.703  -7.171  49.598  0.25 23.05  ? 149  GLY A O     1 
ATOM   1079   N N     A VAL A  1 150 ? 63.372  -6.592  47.458  0.25 24.47  ? 150  VAL A N     1 
ATOM   1080   C CA    A VAL A  1 150 ? 62.082  -7.280  47.379  0.25 24.12  ? 150  VAL A CA    1 
ATOM   1081   C C     A VAL A  1 150 ? 62.234  -8.710  46.868  0.25 26.80  ? 150  VAL A C     1 
ATOM   1082   O O     A VAL A  1 150 ? 62.817  -8.947  45.792  0.25 22.60  ? 150  VAL A O     1 
ATOM   1083   C CB    A VAL A  1 150 ? 61.099  -6.531  46.440  0.25 25.18  ? 150  VAL A CB    1 
ATOM   1084   C CG1   A VAL A  1 150 ? 59.761  -7.269  46.374  0.25 23.73  ? 150  VAL A CG1   1 
ATOM   1085   C CG2   A VAL A  1 150 ? 60.914  -5.096  46.930  0.25 23.84  ? 150  VAL A CG2   1 
ATOM   1086   N N     A ASP A  1 151 ? 61.724  -9.665  47.650  0.25 23.48  ? 151  ASP A N     1 
ATOM   1087   C CA    A ASP A  1 151 ? 61.775  -11.046 47.258  0.25 25.44  ? 151  ASP A CA    1 
ATOM   1088   C C     A ASP A  1 151 ? 60.516  -11.344 46.434  0.25 24.43  ? 151  ASP A C     1 
ATOM   1089   O O     A ASP A  1 151 ? 59.504  -11.792 46.958  0.25 24.49  ? 151  ASP A O     1 
ATOM   1090   C CB    A ASP A  1 151 ? 61.848  -11.952 48.490  0.25 23.73  ? 151  ASP A CB    1 
ATOM   1091   C CG    A ASP A  1 151 ? 61.958  -13.407 48.116  0.25 22.24  ? 151  ASP A CG    1 
ATOM   1092   O OD1   A ASP A  1 151 ? 62.218  -14.254 49.014  0.25 22.29  ? 151  ASP A OD1   1 
ATOM   1093   O OD2   A ASP A  1 151 ? 61.773  -13.691 46.912  0.25 19.69  ? 151  ASP A OD2   1 
ATOM   1094   N N     A GLN A  1 152 ? 60.598  -11.077 45.139  0.25 23.35  ? 152  GLN A N     1 
ATOM   1095   C CA    A GLN A  1 152 ? 59.495  -11.302 44.229  0.25 23.51  ? 152  GLN A CA    1 
ATOM   1096   C C     A GLN A  1 152 ? 59.059  -12.748 44.158  0.25 25.93  ? 152  GLN A C     1 
ATOM   1097   O O     A GLN A  1 152 ? 57.860  -13.030 44.135  0.25 25.10  ? 152  GLN A O     1 
ATOM   1098   C CB    A GLN A  1 152 ? 59.858  -10.843 42.820  0.25 22.98  ? 152  GLN A CB    1 
ATOM   1099   C CG    A GLN A  1 152 ? 60.278  -9.392  42.701  0.25 20.96  ? 152  GLN A CG    1 
ATOM   1100   C CD    A GLN A  1 152 ? 60.635  -9.066  41.273  0.25 22.10  ? 152  GLN A CD    1 
ATOM   1101   O OE1   A GLN A  1 152 ? 59.756  -9.045  40.409  0.25 21.36  ? 152  GLN A OE1   1 
ATOM   1102   N NE2   A GLN A  1 152 ? 61.928  -8.834  41.002  0.25 17.03  ? 152  GLN A NE2   1 
ATOM   1103   N N     A LEU A  1 153 ? 60.032  -13.663 44.116  0.25 23.98  ? 153  LEU A N     1 
ATOM   1104   C CA    A LEU A  1 153 ? 59.719  -15.080 44.016  0.25 23.60  ? 153  LEU A CA    1 
ATOM   1105   C C     A LEU A  1 153 ? 58.868  -15.605 45.171  0.25 22.44  ? 153  LEU A C     1 
ATOM   1106   O O     A LEU A  1 153 ? 57.845  -16.247 44.945  0.25 19.00  ? 153  LEU A O     1 
ATOM   1107   C CB    A LEU A  1 153 ? 61.008  -15.908 43.897  0.25 24.75  ? 153  LEU A CB    1 
ATOM   1108   C CG    A LEU A  1 153 ? 60.809  -17.404 43.632  0.25 25.04  ? 153  LEU A CG    1 
ATOM   1109   C CD1   A LEU A  1 153 ? 59.969  -17.600 42.373  0.25 22.60  ? 153  LEU A CD1   1 
ATOM   1110   C CD2   A LEU A  1 153 ? 62.172  -18.088 43.483  0.25 25.17  ? 153  LEU A CD2   1 
ATOM   1111   N N     A GLN A  1 154 ? 59.283  -15.339 46.407  0.25 24.34  ? 154  GLN A N     1 
ATOM   1112   C CA    A GLN A  1 154 ? 58.514  -15.821 47.556  0.25 24.63  ? 154  GLN A CA    1 
ATOM   1113   C C     A GLN A  1 154 ? 57.128  -15.151 47.597  0.25 23.92  ? 154  GLN A C     1 
ATOM   1114   O O     A GLN A  1 154 ? 56.146  -15.781 48.002  0.25 24.54  ? 154  GLN A O     1 
ATOM   1115   C CB    A GLN A  1 154 ? 59.263  -15.564 48.866  0.25 25.22  ? 154  GLN A CB    1 
ATOM   1116   C CG    A GLN A  1 154 ? 58.559  -16.174 50.076  0.25 27.25  ? 154  GLN A CG    1 
ATOM   1117   C CD    A GLN A  1 154 ? 58.316  -17.669 49.923  0.25 28.47  ? 154  GLN A CD    1 
ATOM   1118   O OE1   A GLN A  1 154 ? 57.252  -18.182 50.288  0.25 30.17  ? 154  GLN A OE1   1 
ATOM   1119   N NE2   A GLN A  1 154 ? 59.304  -18.380 49.401  0.25 25.68  ? 154  GLN A NE2   1 
ATOM   1120   N N     A ARG A  1 155 ? 57.054  -13.890 47.177  0.25 22.72  ? 155  ARG A N     1 
ATOM   1121   C CA    A ARG A  1 155 ? 55.773  -13.182 47.139  0.25 25.26  ? 155  ARG A CA    1 
ATOM   1122   C C     A ARG A  1 155 ? 54.846  -13.880 46.141  0.25 27.41  ? 155  ARG A C     1 
ATOM   1123   O O     A ARG A  1 155 ? 53.647  -14.021 46.398  0.25 27.37  ? 155  ARG A O     1 
ATOM   1124   C CB    A ARG A  1 155 ? 55.965  -11.726 46.747  0.25 25.32  ? 155  ARG A CB    1 
ATOM   1125   C CG    A ARG A  1 155 ? 54.651  -10.898 46.690  0.25 29.94  ? 155  ARG A CG    1 
ATOM   1126   C CD    A ARG A  1 155 ? 53.760  -11.134 47.933  0.25 32.86  ? 155  ARG A CD    1 
ATOM   1127   N NE    A ARG A  1 155 ? 54.412  -10.725 49.181  0.25 36.09  ? 155  ARG A NE    1 
ATOM   1128   C CZ    A ARG A  1 155 ? 54.513  -9.468  49.599  0.25 35.14  ? 155  ARG A CZ    1 
ATOM   1129   N NH1   A ARG A  1 155 ? 55.132  -9.198  50.741  0.25 37.35  ? 155  ARG A NH1   1 
ATOM   1130   N NH2   A ARG A  1 155 ? 53.989  -8.484  48.885  0.25 33.76  ? 155  ARG A NH2   1 
ATOM   1131   N N     A VAL A  1 156 ? 55.402  -14.325 45.010  0.25 25.59  ? 156  VAL A N     1 
ATOM   1132   C CA    A VAL A  1 156 ? 54.619  -15.063 44.024  0.25 23.33  ? 156  VAL A CA    1 
ATOM   1133   C C     A VAL A  1 156 ? 54.037  -16.333 44.665  0.25 23.29  ? 156  VAL A C     1 
ATOM   1134   O O     A VAL A  1 156 ? 52.841  -16.641 44.519  0.25 20.76  ? 156  VAL A O     1 
ATOM   1135   C CB    A VAL A  1 156 ? 55.499  -15.475 42.804  0.25 22.48  ? 156  VAL A CB    1 
ATOM   1136   C CG1   A VAL A  1 156 ? 54.800  -16.526 41.975  0.25 21.70  ? 156  VAL A CG1   1 
ATOM   1137   C CG2   A VAL A  1 156 ? 55.792  -14.252 41.941  0.25 21.09  ? 156  VAL A CG2   1 
ATOM   1138   N N     A ILE A  1 157 ? 54.889  -17.068 45.370  0.25 22.61  ? 157  ILE A N     1 
ATOM   1139   C CA    A ILE A  1 157 ? 54.484  -18.302 46.042  0.25 23.74  ? 157  ILE A CA    1 
ATOM   1140   C C     A ILE A  1 157 ? 53.344  -18.046 47.033  0.25 23.77  ? 157  ILE A C     1 
ATOM   1141   O O     A ILE A  1 157 ? 52.316  -18.726 46.996  0.25 22.89  ? 157  ILE A O     1 
ATOM   1142   C CB    A ILE A  1 157 ? 55.661  -18.921 46.832  0.25 25.20  ? 157  ILE A CB    1 
ATOM   1143   C CG1   A ILE A  1 157 ? 56.809  -19.290 45.873  0.25 28.65  ? 157  ILE A CG1   1 
ATOM   1144   C CG2   A ILE A  1 157 ? 55.179  -20.116 47.621  0.25 23.09  ? 157  ILE A CG2   1 
ATOM   1145   C CD1   A ILE A  1 157 ? 56.448  -20.336 44.855  0.25 30.63  ? 157  ILE A CD1   1 
ATOM   1146   N N     A ASP A  1 158 ? 53.553  -17.074 47.916  0.25 21.40  ? 158  ASP A N     1 
ATOM   1147   C CA    A ASP A  1 158 ? 52.575  -16.706 48.928  0.25 24.27  ? 158  ASP A CA    1 
ATOM   1148   C C     A ASP A  1 158 ? 51.252  -16.276 48.313  0.25 23.26  ? 158  ASP A C     1 
ATOM   1149   O O     A ASP A  1 158 ? 50.189  -16.629 48.810  0.25 22.11  ? 158  ASP A O     1 
ATOM   1150   C CB    A ASP A  1 158 ? 53.126  -15.568 49.812  0.25 22.23  ? 158  ASP A CB    1 
ATOM   1151   C CG    A ASP A  1 158 ? 54.292  -16.009 50.665  0.25 28.69  ? 158  ASP A CG    1 
ATOM   1152   O OD1   A ASP A  1 158 ? 54.974  -15.138 51.252  0.25 29.35  ? 158  ASP A OD1   1 
ATOM   1153   O OD2   A ASP A  1 158 ? 54.514  -17.238 50.755  0.25 28.58  ? 158  ASP A OD2   1 
ATOM   1154   N N     A THR A  1 159 ? 51.327  -15.507 47.231  0.25 25.24  ? 159  THR A N     1 
ATOM   1155   C CA    A THR A  1 159 ? 50.132  -15.009 46.550  0.25 23.57  ? 159  THR A CA    1 
ATOM   1156   C C     A THR A  1 159 ? 49.316  -16.112 45.880  0.25 25.92  ? 159  THR A C     1 
ATOM   1157   O O     A THR A  1 159 ? 48.069  -16.107 45.933  0.25 22.76  ? 159  THR A O     1 
ATOM   1158   C CB    A THR A  1 159 ? 50.509  -13.947 45.505  0.25 21.16  ? 159  THR A CB    1 
ATOM   1159   O OG1   A THR A  1 159 ? 51.245  -12.898 46.155  0.25 19.38  ? 159  THR A OG1   1 
ATOM   1160   C CG2   A THR A  1 159 ? 49.224  -13.351 44.850  0.25 22.44  ? 159  THR A CG2   1 
ATOM   1161   N N     A ILE A  1 160 ? 50.010  -17.045 45.230  0.25 23.70  ? 160  ILE A N     1 
ATOM   1162   C CA    A ILE A  1 160 ? 49.345  -18.171 44.589  0.25 23.52  ? 160  ILE A CA    1 
ATOM   1163   C C     A ILE A  1 160 ? 48.594  -19.012 45.633  0.25 25.23  ? 160  ILE A C     1 
ATOM   1164   O O     A ILE A  1 160 ? 47.483  -19.510 45.383  0.25 24.25  ? 160  ILE A O     1 
ATOM   1165   C CB    A ILE A  1 160 ? 50.377  -19.086 43.851  0.25 21.68  ? 160  ILE A CB    1 
ATOM   1166   C CG1   A ILE A  1 160 ? 50.909  -18.366 42.608  0.25 21.79  ? 160  ILE A CG1   1 
ATOM   1167   C CG2   A ILE A  1 160 ? 49.729  -20.404 43.432  0.25 19.87  ? 160  ILE A CG2   1 
ATOM   1168   C CD1   A ILE A  1 160 ? 52.128  -19.026 42.000  0.25 17.19  ? 160  ILE A CD1   1 
ATOM   1169   N N     A LYS A  1 161 ? 49.205  -19.179 46.800  0.25 24.40  ? 161  LYS A N     1 
ATOM   1170   C CA    A LYS A  1 161 ? 48.587  -19.969 47.857  0.25 25.97  ? 161  LYS A CA    1 
ATOM   1171   C C     A LYS A  1 161 ? 47.446  -19.264 48.609  0.25 25.63  ? 161  LYS A C     1 
ATOM   1172   O O     A LYS A  1 161 ? 46.440  -19.896 48.917  0.25 25.59  ? 161  LYS A O     1 
ATOM   1173   C CB    A LYS A  1 161 ? 49.645  -20.391 48.880  0.25 25.34  ? 161  LYS A CB    1 
ATOM   1174   C CG    A LYS A  1 161 ? 50.674  -21.393 48.336  0.25 30.83  ? 161  LYS A CG    1 
ATOM   1175   C CD    A LYS A  1 161 ? 51.865  -21.521 49.267  0.25 30.10  ? 161  LYS A CD    1 
ATOM   1176   C CE    A LYS A  1 161 ? 51.470  -22.083 50.617  0.25 32.92  ? 161  LYS A CE    1 
ATOM   1177   N NZ    A LYS A  1 161 ? 52.617  -22.118 51.550  0.25 33.05  ? 161  LYS A NZ    1 
ATOM   1178   N N     A ASN A  1 162 ? 47.602  -17.971 48.885  0.25 22.81  ? 162  ASN A N     1 
ATOM   1179   C CA    A ASN A  1 162 ? 46.614  -17.253 49.682  0.25 24.93  ? 162  ASN A CA    1 
ATOM   1180   C C     A ASN A  1 162 ? 45.693  -16.294 48.959  0.25 23.26  ? 162  ASN A C     1 
ATOM   1181   O O     A ASN A  1 162 ? 44.673  -15.893 49.503  0.25 25.56  ? 162  ASN A O     1 
ATOM   1182   C CB    A ASN A  1 162 ? 47.339  -16.539 50.829  0.25 24.63  ? 162  ASN A CB    1 
ATOM   1183   C CG    A ASN A  1 162 ? 48.159  -17.499 51.660  0.25 29.27  ? 162  ASN A CG    1 
ATOM   1184   O OD1   A ASN A  1 162 ? 47.622  -18.460 52.214  0.25 26.75  ? 162  ASN A OD1   1 
ATOM   1185   N ND2   A ASN A  1 162 ? 49.465  -17.261 51.741  0.25 30.82  ? 162  ASN A ND2   1 
ATOM   1186   N N     A ASN A  1 163 ? 46.055  -15.897 47.748  0.25 21.30  ? 163  ASN A N     1 
ATOM   1187   C CA    A ASN A  1 163 ? 45.206  -14.984 46.986  0.25 22.04  ? 163  ASN A CA    1 
ATOM   1188   C C     A ASN A  1 163 ? 45.442  -15.200 45.494  0.25 21.45  ? 163  ASN A C     1 
ATOM   1189   O O     A ASN A  1 163 ? 45.875  -14.291 44.782  0.25 21.82  ? 163  ASN A O     1 
ATOM   1190   C CB    A ASN A  1 163 ? 45.491  -13.534 47.372  0.25 21.96  ? 163  ASN A CB    1 
ATOM   1191   C CG    A ASN A  1 163 ? 44.435  -12.576 46.843  0.25 25.50  ? 163  ASN A CG    1 
ATOM   1192   O OD1   A ASN A  1 163 ? 43.267  -12.937 46.750  0.25 28.42  ? 163  ASN A OD1   1 
ATOM   1193   N ND2   A ASN A  1 163 ? 44.836  -11.360 46.495  0.25 24.34  ? 163  ASN A ND2   1 
ATOM   1194   N N     A PRO A  1 164 ? 45.121  -16.407 45.006  0.25 23.56  ? 164  PRO A N     1 
ATOM   1195   C CA    A PRO A  1 164 ? 45.281  -16.838 43.610  0.25 26.08  ? 164  PRO A CA    1 
ATOM   1196   C C     A PRO A  1 164 ? 44.693  -15.956 42.514  0.25 26.74  ? 164  PRO A C     1 
ATOM   1197   O O     A PRO A  1 164 ? 45.241  -15.906 41.411  0.25 26.35  ? 164  PRO A O     1 
ATOM   1198   C CB    A PRO A  1 164 ? 44.689  -18.252 43.610  0.25 26.30  ? 164  PRO A CB    1 
ATOM   1199   C CG    A PRO A  1 164 ? 43.659  -18.182 44.700  0.25 26.94  ? 164  PRO A CG    1 
ATOM   1200   C CD    A PRO A  1 164 ? 44.396  -17.431 45.781  0.25 23.41  ? 164  PRO A CD    1 
ATOM   1201   N N     A THR A  1 165 ? 43.598  -15.254 42.798  0.25 23.25  ? 165  THR A N     1 
ATOM   1202   C CA    A THR A  1 165 ? 43.004  -14.411 41.769  0.25 25.41  ? 165  THR A CA    1 
ATOM   1203   C C     A THR A  1 165 ? 43.675  -13.040 41.656  0.25 24.09  ? 165  THR A C     1 
ATOM   1204   O O     A THR A  1 165 ? 43.278  -12.188 40.863  0.25 25.33  ? 165  THR A O     1 
ATOM   1205   C CB    A THR A  1 165 ? 41.472  -14.244 41.989  0.25 24.31  ? 165  THR A CB    1 
ATOM   1206   O OG1   A THR A  1 165 ? 41.220  -13.592 43.238  0.25 27.67  ? 165  THR A OG1   1 
ATOM   1207   C CG2   A THR A  1 165 ? 40.804  -15.624 41.982  0.25 24.19  ? 165  THR A CG2   1 
ATOM   1208   N N     A ASP A  1 166 ? 44.699  -12.815 42.463  0.25 25.70  ? 166  ASP A N     1 
ATOM   1209   C CA    A ASP A  1 166 ? 45.442  -11.562 42.397  0.25 21.59  ? 166  ASP A CA    1 
ATOM   1210   C C     A ASP A  1 166 ? 45.941  -11.415 40.949  0.25 21.17  ? 166  ASP A C     1 
ATOM   1211   O O     A ASP A  1 166 ? 46.231  -12.396 40.266  0.25 21.50  ? 166  ASP A O     1 
ATOM   1212   C CB    A ASP A  1 166 ? 46.598  -11.613 43.385  0.25 24.43  ? 166  ASP A CB    1 
ATOM   1213   C CG    A ASP A  1 166 ? 47.463  -10.359 43.363  0.25 24.94  ? 166  ASP A CG    1 
ATOM   1214   O OD1   A ASP A  1 166 ? 48.371  -10.270 42.497  0.25 24.70  ? 166  ASP A OD1   1 
ATOM   1215   O OD2   A ASP A  1 166 ? 47.236  -9.465  44.207  0.25 23.73  ? 166  ASP A OD2   1 
ATOM   1216   N N     A ARG A  1 167 ? 46.028  -10.185 40.474  0.25 21.25  ? 167  ARG A N     1 
ATOM   1217   C CA    A ARG A  1 167 ? 46.449  -9.952  39.103  0.25 22.40  ? 167  ARG A CA    1 
ATOM   1218   C C     A ARG A  1 167 ? 47.847  -9.367  39.003  0.25 20.97  ? 167  ARG A C     1 
ATOM   1219   O O     A ARG A  1 167 ? 48.212  -8.850  37.947  0.25 19.67  ? 167  ARG A O     1 
ATOM   1220   C CB    A ARG A  1 167 ? 45.481  -8.989  38.420  0.25 18.60  ? 167  ARG A CB    1 
ATOM   1221   C CG    A ARG A  1 167 ? 44.033  -9.467  38.242  0.25 24.29  ? 167  ARG A CG    1 
ATOM   1222   C CD    A ARG A  1 167 ? 43.162  -8.181  38.188  0.25 24.46  ? 167  ARG A CD    1 
ATOM   1223   N NE    A ARG A  1 167 ? 41.786  -8.445  37.920  0.25 33.93  ? 167  ARG A NE    1 
ATOM   1224   C CZ    A ARG A  1 167 ? 40.791  -7.644  38.269  0.25 30.81  ? 167  ARG A CZ    1 
ATOM   1225   N NH1   A ARG A  1 167 ? 41.029  -6.505  38.922  0.25 27.06  ? 167  ARG A NH1   1 
ATOM   1226   N NH2   A ARG A  1 167 ? 39.561  -8.002  37.955  0.25 28.76  ? 167  ARG A NH2   1 
ATOM   1227   N N     A ARG A  1 168 ? 48.608  -9.433  40.091  0.25 20.47  ? 168  ARG A N     1 
ATOM   1228   C CA    A ARG A  1 168 ? 49.959  -8.859  40.103  0.25 22.98  ? 168  ARG A CA    1 
ATOM   1229   C C     A ARG A  1 168 ? 51.014  -9.933  40.399  0.25 21.98  ? 168  ARG A C     1 
ATOM   1230   O O     A ARG A  1 168 ? 52.046  -9.629  40.966  0.25 24.77  ? 168  ARG A O     1 
ATOM   1231   C CB    A ARG A  1 168 ? 50.076  -7.763  41.180  0.25 18.87  ? 168  ARG A CB    1 
ATOM   1232   C CG    A ARG A  1 168 ? 49.198  -6.528  41.012  0.25 19.55  ? 168  ARG A CG    1 
ATOM   1233   C CD    A ARG A  1 168 ? 47.749  -6.777  41.491  0.25 21.49  ? 168  ARG A CD    1 
ATOM   1234   N NE    A ARG A  1 168 ? 46.945  -5.548  41.502  0.25 21.64  ? 168  ARG A NE    1 
ATOM   1235   C CZ    A ARG A  1 168 ? 46.789  -4.770  42.571  0.25 25.35  ? 168  ARG A CZ    1 
ATOM   1236   N NH1   A ARG A  1 168 ? 46.039  -3.682  42.498  0.25 25.08  ? 168  ARG A NH1   1 
ATOM   1237   N NH2   A ARG A  1 168 ? 47.368  -5.080  43.721  0.25 20.97  ? 168  ARG A NH2   1 
ATOM   1238   N N     A ILE A  1 169 ? 50.741  -11.175 40.036  0.25 18.91  ? 169  ILE A N     1 
ATOM   1239   C CA    A ILE A  1 169 ? 51.675  -12.264 40.314  0.25 21.06  ? 169  ILE A CA    1 
ATOM   1240   C C     A ILE A  1 169 ? 52.774  -12.179 39.273  0.25 18.51  ? 169  ILE A C     1 
ATOM   1241   O O     A ILE A  1 169 ? 52.794  -12.933 38.321  0.25 16.93  ? 169  ILE A O     1 
ATOM   1242   C CB    A ILE A  1 169 ? 50.961  -13.614 40.251  0.25 19.81  ? 169  ILE A CB    1 
ATOM   1243   C CG1   A ILE A  1 169 ? 49.663  -13.525 41.076  0.25 20.70  ? 169  ILE A CG1   1 
ATOM   1244   C CG2   A ILE A  1 169 ? 51.867  -14.740 40.824  0.25 17.29  ? 169  ILE A CG2   1 
ATOM   1245   C CD1   A ILE A  1 169 ? 48.867  -14.852 41.139  0.25 17.99  ? 169  ILE A CD1   1 
ATOM   1246   N N     A ILE A  1 170 ? 53.680  -11.231 39.486  0.25 17.76  ? 170  ILE A N     1 
ATOM   1247   C CA    A ILE A  1 170 ? 54.754  -10.961 38.538  0.25 19.72  ? 170  ILE A CA    1 
ATOM   1248   C C     A ILE A  1 170 ? 56.156  -11.256 39.091  0.25 19.55  ? 170  ILE A C     1 
ATOM   1249   O O     A ILE A  1 170 ? 56.444  -10.988 40.247  0.25 19.30  ? 170  ILE A O     1 
ATOM   1250   C CB    A ILE A  1 170 ? 54.719  -9.477  38.118  0.25 22.05  ? 170  ILE A CB    1 
ATOM   1251   C CG1   A ILE A  1 170 ? 53.336  -9.104  37.555  0.25 22.86  ? 170  ILE A CG1   1 
ATOM   1252   C CG2   A ILE A  1 170 ? 55.810  -9.176  37.066  0.25 24.31  ? 170  ILE A CG2   1 
ATOM   1253   C CD1   A ILE A  1 170 ? 52.971  -9.847  36.295  0.25 21.73  ? 170  ILE A CD1   1 
ATOM   1254   N N     A LEU A  1 171 ? 57.015  -11.798 38.238  0.25 21.01  ? 171  LEU A N     1 
ATOM   1255   C CA    A LEU A  1 171 ? 58.398  -12.094 38.591  0.25 20.64  ? 171  LEU A CA    1 
ATOM   1256   C C     A LEU A  1 171 ? 59.211  -11.389 37.492  0.25 21.71  ? 171  LEU A C     1 
ATOM   1257   O O     A LEU A  1 171 ? 59.145  -11.789 36.320  0.25 21.41  ? 171  LEU A O     1 
ATOM   1258   C CB    A LEU A  1 171 ? 58.643  -13.598 38.546  0.25 22.15  ? 171  LEU A CB    1 
ATOM   1259   C CG    A LEU A  1 171 ? 60.094  -14.026 38.847  0.25 23.35  ? 171  LEU A CG    1 
ATOM   1260   C CD1   A LEU A  1 171 ? 60.508  -13.542 40.234  0.25 19.66  ? 171  LEU A CD1   1 
ATOM   1261   C CD2   A LEU A  1 171 ? 60.205  -15.529 38.756  0.25 26.09  ? 171  LEU A CD2   1 
ATOM   1262   N N     A SER A  1 172 ? 59.960  -10.351 37.859  0.25 17.61  ? 172  SER A N     1 
ATOM   1263   C CA    A SER A  1 172 ? 60.711  -9.592  36.868  0.25 22.24  ? 172  SER A CA    1 
ATOM   1264   C C     A SER A  1 172 ? 62.153  -9.311  37.244  0.25 22.68  ? 172  SER A C     1 
ATOM   1265   O O     A SER A  1 172 ? 62.452  -9.007  38.392  0.25 23.22  ? 172  SER A O     1 
ATOM   1266   C CB    A SER A  1 172 ? 60.025  -8.245  36.603  0.25 21.54  ? 172  SER A CB    1 
ATOM   1267   O OG    A SER A  1 172 ? 60.700  -7.506  35.588  0.25 25.16  ? 172  SER A OG    1 
ATOM   1268   N N     A ALA A  1 173 ? 63.031  -9.367  36.252  0.25 23.19  ? 173  ALA A N     1 
ATOM   1269   C CA    A ALA A  1 173 ? 64.450  -9.091  36.466  0.25 22.07  ? 173  ALA A CA    1 
ATOM   1270   C C     A ALA A  1 173 ? 64.842  -7.768  35.827  0.25 25.17  ? 173  ALA A C     1 
ATOM   1271   O O     A ALA A  1 173 ? 65.987  -7.308  35.972  0.25 25.83  ? 173  ALA A O     1 
ATOM   1272   C CB    A ALA A  1 173 ? 65.299  -10.223 35.890  0.25 22.23  ? 173  ALA A CB    1 
ATOM   1273   N N     A TRP A  1 174 ? 63.909  -7.138  35.114  0.25 23.87  ? 174  TRP A N     1 
ATOM   1274   C CA    A TRP A  1 174 ? 64.225  -5.866  34.472  0.25 24.39  ? 174  TRP A CA    1 
ATOM   1275   C C     A TRP A  1 174 ? 64.368  -4.753  35.504  0.25 26.00  ? 174  TRP A C     1 
ATOM   1276   O O     A TRP A  1 174 ? 63.445  -4.511  36.288  0.25 27.03  ? 174  TRP A O     1 
ATOM   1277   C CB    A TRP A  1 174 ? 63.140  -5.497  33.459  0.25 23.60  ? 174  TRP A CB    1 
ATOM   1278   C CG    A TRP A  1 174 ? 63.580  -4.441  32.494  0.25 24.47  ? 174  TRP A CG    1 
ATOM   1279   C CD1   A TRP A  1 174 ? 63.179  -3.137  32.458  0.25 25.74  ? 174  TRP A CD1   1 
ATOM   1280   C CD2   A TRP A  1 174 ? 64.549  -4.592  31.453  0.25 22.73  ? 174  TRP A CD2   1 
ATOM   1281   N NE1   A TRP A  1 174 ? 63.839  -2.465  31.461  0.25 25.36  ? 174  TRP A NE1   1 
ATOM   1282   C CE2   A TRP A  1 174 ? 64.688  -3.338  30.828  0.25 22.43  ? 174  TRP A CE2   1 
ATOM   1283   C CE3   A TRP A  1 174 ? 65.313  -5.670  30.990  0.25 22.62  ? 174  TRP A CE3   1 
ATOM   1284   C CZ2   A TRP A  1 174 ? 65.562  -3.124  29.760  0.25 21.69  ? 174  TRP A CZ2   1 
ATOM   1285   C CZ3   A TRP A  1 174 ? 66.191  -5.455  29.913  0.25 23.73  ? 174  TRP A CZ3   1 
ATOM   1286   C CH2   A TRP A  1 174 ? 66.304  -4.190  29.315  0.25 21.35  ? 174  TRP A CH2   1 
ATOM   1287   N N     A ASN A  1 175 ? 65.525  -4.083  35.507  0.25 21.85  ? 175  ASN A N     1 
ATOM   1288   C CA    A ASN A  1 175 ? 65.774  -2.993  36.447  0.25 21.98  ? 175  ASN A CA    1 
ATOM   1289   C C     A ASN A  1 175 ? 66.601  -1.946  35.726  0.25 24.69  ? 175  ASN A C     1 
ATOM   1290   O O     A ASN A  1 175 ? 67.838  -2.050  35.655  0.25 24.30  ? 175  ASN A O     1 
ATOM   1291   C CB    A ASN A  1 175 ? 66.529  -3.504  37.671  0.25 22.36  ? 175  ASN A CB    1 
ATOM   1292   C CG    A ASN A  1 175 ? 66.676  -2.444  38.753  0.25 20.18  ? 175  ASN A CG    1 
ATOM   1293   O OD1   A ASN A  1 175 ? 66.807  -1.272  38.451  0.25 23.27  ? 175  ASN A OD1   1 
ATOM   1294   N ND2   A ASN A  1 175 ? 66.660  -2.864  40.017  0.25 20.11  ? 175  ASN A ND2   1 
ATOM   1295   N N     A PRO A  1 176 ? 65.931  -0.925  35.161  0.25 23.82  ? 176  PRO A N     1 
ATOM   1296   C CA    A PRO A  1 176 ? 66.603  0.147   34.425  0.25 23.56  ? 176  PRO A CA    1 
ATOM   1297   C C     A PRO A  1 176 ? 67.775  0.786   35.180  0.25 25.77  ? 176  PRO A C     1 
ATOM   1298   O O     A PRO A  1 176 ? 68.753  1.211   34.558  0.25 24.96  ? 176  PRO A O     1 
ATOM   1299   C CB    A PRO A  1 176 ? 65.472  1.153   34.158  0.25 22.84  ? 176  PRO A CB    1 
ATOM   1300   C CG    A PRO A  1 176 ? 64.259  0.258   34.026  0.25 24.46  ? 176  PRO A CG    1 
ATOM   1301   C CD    A PRO A  1 176 ? 64.465  -0.726  35.175  0.25 22.88  ? 176  PRO A CD    1 
ATOM   1302   N N     A LYS A  1 177 ? 67.666  0.882   36.501  0.25 25.06  ? 177  LYS A N     1 
ATOM   1303   C CA    A LYS A  1 177 ? 68.727  1.492   37.280  0.25 24.91  ? 177  LYS A CA    1 
ATOM   1304   C C     A LYS A  1 177 ? 69.974  0.608   37.347  0.25 24.68  ? 177  LYS A C     1 
ATOM   1305   O O     A LYS A  1 177 ? 71.103  1.117   37.249  0.25 23.33  ? 177  LYS A O     1 
ATOM   1306   C CB    A LYS A  1 177 ? 68.263  1.801   38.709  0.25 23.43  ? 177  LYS A CB    1 
ATOM   1307   C CG    A LYS A  1 177 ? 69.329  2.492   39.547  0.25 24.12  ? 177  LYS A CG    1 
ATOM   1308   C CD    A LYS A  1 177 ? 68.857  2.719   40.971  0.25 31.90  ? 177  LYS A CD    1 
ATOM   1309   C CE    A LYS A  1 177 ? 69.950  3.395   41.808  0.25 33.34  ? 177  LYS A CE    1 
ATOM   1310   N NZ    A LYS A  1 177 ? 69.578  3.441   43.262  0.25 41.37  ? 177  LYS A NZ    1 
ATOM   1311   N N     A ASP A  1 178 ? 69.774  -0.697  37.522  0.25 23.26  ? 178  ASP A N     1 
ATOM   1312   C CA    A ASP A  1 178 ? 70.903  -1.634  37.641  0.25 25.31  ? 178  ASP A CA    1 
ATOM   1313   C C     A ASP A  1 178 ? 71.512  -2.126  36.315  0.25 25.00  ? 178  ASP A C     1 
ATOM   1314   O O     A ASP A  1 178 ? 72.615  -2.710  36.317  0.25 26.84  ? 178  ASP A O     1 
ATOM   1315   C CB    A ASP A  1 178 ? 70.485  -2.856  38.467  0.25 22.25  ? 178  ASP A CB    1 
ATOM   1316   C CG    A ASP A  1 178 ? 70.370  -2.567  39.951  0.25 21.45  ? 178  ASP A CG    1 
ATOM   1317   O OD1   A ASP A  1 178 ? 70.611  -1.427  40.385  0.25 22.06  ? 178  ASP A OD1   1 
ATOM   1318   O OD2   A ASP A  1 178 ? 70.030  -3.496  40.706  0.25 24.05  ? 178  ASP A OD2   1 
ATOM   1319   N N     A LEU A  1 179 ? 70.813  -1.903  35.203  0.25 24.17  ? 179  LEU A N     1 
ATOM   1320   C CA    A LEU A  1 179 ? 71.286  -2.362  33.893  0.25 27.86  ? 179  LEU A CA    1 
ATOM   1321   C C     A LEU A  1 179 ? 72.783  -2.160  33.621  0.25 27.69  ? 179  LEU A C     1 
ATOM   1322   O O     A LEU A  1 179 ? 73.469  -3.083  33.254  0.25 30.00  ? 179  LEU A O     1 
ATOM   1323   C CB    A LEU A  1 179 ? 70.504  -1.692  32.758  0.25 29.35  ? 179  LEU A CB    1 
ATOM   1324   C CG    A LEU A  1 179 ? 69.022  -2.033  32.580  0.25 32.52  ? 179  LEU A CG    1 
ATOM   1325   C CD1   A LEU A  1 179 ? 68.543  -1.368  31.295  0.25 30.90  ? 179  LEU A CD1   1 
ATOM   1326   C CD2   A LEU A  1 179 ? 68.811  -3.547  32.517  0.25 28.65  ? 179  LEU A CD2   1 
ATOM   1327   N N     A PRO A  1 180 ? 73.293  -0.938  33.774  0.25 30.05  ? 180  PRO A N     1 
ATOM   1328   C CA    A PRO A  1 180 ? 74.733  -0.749  33.508  0.25 30.20  ? 180  PRO A CA    1 
ATOM   1329   C C     A PRO A  1 180 ? 75.670  -1.599  34.367  0.25 30.27  ? 180  PRO A C     1 
ATOM   1330   O O     A PRO A  1 180 ? 76.836  -1.781  34.011  0.25 31.30  ? 180  PRO A O     1 
ATOM   1331   C CB    A PRO A  1 180 ? 74.942  0.751   33.730  0.25 30.79  ? 180  PRO A CB    1 
ATOM   1332   C CG    A PRO A  1 180 ? 73.772  1.149   34.635  0.25 32.41  ? 180  PRO A CG    1 
ATOM   1333   C CD    A PRO A  1 180 ? 72.629  0.329   34.128  0.25 27.23  ? 180  PRO A CD    1 
ATOM   1334   N N     A LEU A  1 181 ? 75.168  -2.121  35.491  0.25 26.26  ? 181  LEU A N     1 
ATOM   1335   C CA    A LEU A  1 181 ? 75.989  -2.943  36.362  0.25 24.96  ? 181  LEU A CA    1 
ATOM   1336   C C     A LEU A  1 181 ? 75.977  -4.410  35.946  0.25 24.48  ? 181  LEU A C     1 
ATOM   1337   O O     A LEU A  1 181 ? 76.730  -5.229  36.487  0.25 22.50  ? 181  LEU A O     1 
ATOM   1338   C CB    A LEU A  1 181 ? 75.496  -2.828  37.804  0.25 27.89  ? 181  LEU A CB    1 
ATOM   1339   C CG    A LEU A  1 181 ? 75.485  -1.451  38.482  0.25 27.96  ? 181  LEU A CG    1 
ATOM   1340   C CD1   A LEU A  1 181 ? 74.960  -1.597  39.909  0.25 28.89  ? 181  LEU A CD1   1 
ATOM   1341   C CD2   A LEU A  1 181 ? 76.897  -0.879  38.502  0.25 29.84  ? 181  LEU A CD2   1 
ATOM   1342   N N     A MET A  1 182 ? 75.106  -4.731  34.994  0.25 22.75  ? 182  MET A N     1 
ATOM   1343   C CA    A MET A  1 182 ? 74.931  -6.073  34.500  0.25 24.44  ? 182  MET A CA    1 
ATOM   1344   C C     A MET A  1 182 ? 75.819  -6.392  33.305  0.25 23.92  ? 182  MET A C     1 
ATOM   1345   O O     A MET A  1 182 ? 75.925  -5.607  32.381  0.25 25.57  ? 182  MET A O     1 
ATOM   1346   C CB    A MET A  1 182 ? 73.465  -6.287  34.093  0.25 24.61  ? 182  MET A CB    1 
ATOM   1347   C CG    A MET A  1 182 ? 72.482  -6.273  35.257  0.25 24.22  ? 182  MET A CG    1 
ATOM   1348   S SD    A MET A  1 182 ? 70.808  -6.556  34.679  0.25 26.14  ? 182  MET A SD    1 
ATOM   1349   C CE    A MET A  1 182 ? 69.884  -5.404  35.675  0.25 23.94  ? 182  MET A CE    1 
ATOM   1350   N N     A ALA A  1 183 ? 76.443  -7.558  33.330  0.25 27.08  ? 183  ALA A N     1 
ATOM   1351   C CA    A ALA A  1 183 ? 77.305  -7.978  32.207  0.25 26.82  ? 183  ALA A CA    1 
ATOM   1352   C C     A ALA A  1 183 ? 76.430  -8.036  30.957  0.25 27.01  ? 183  ALA A C     1 
ATOM   1353   O O     A ALA A  1 183 ? 76.885  -7.750  29.847  0.25 26.89  ? 183  ALA A O     1 
ATOM   1354   C CB    A ALA A  1 183 ? 77.902  -9.351  32.488  0.25 24.16  ? 183  ALA A CB    1 
ATOM   1355   N N     A LEU A  1 184 ? 75.160  -8.385  31.154  0.25 27.06  ? 184  LEU A N     1 
ATOM   1356   C CA    A LEU A  1 184 ? 74.213  -8.461  30.052  0.25 27.26  ? 184  LEU A CA    1 
ATOM   1357   C C     A LEU A  1 184 ? 72.813  -8.182  30.599  0.25 26.25  ? 184  LEU A C     1 
ATOM   1358   O O     A LEU A  1 184 ? 72.461  -8.680  31.662  0.25 24.91  ? 184  LEU A O     1 
ATOM   1359   C CB    A LEU A  1 184 ? 74.272  -9.870  29.451  0.25 29.36  ? 184  LEU A CB    1 
ATOM   1360   C CG    A LEU A  1 184 ? 73.896  -10.119 27.998  0.25 31.71  ? 184  LEU A CG    1 
ATOM   1361   C CD1   A LEU A  1 184 ? 74.848  -9.361  27.099  0.25 27.71  ? 184  LEU A CD1   1 
ATOM   1362   C CD2   A LEU A  1 184 ? 73.973  -11.603 27.697  0.25 28.25  ? 184  LEU A CD2   1 
ATOM   1363   N N     A PRO A  1 185 ? 72.004  -7.374  29.894  0.25 24.80  ? 185  PRO A N     1 
ATOM   1364   C CA    A PRO A  1 185 ? 70.651  -7.088  30.385  0.25 24.10  ? 185  PRO A CA    1 
ATOM   1365   C C     A PRO A  1 185 ? 69.778  -8.351  30.273  0.25 22.24  ? 185  PRO A C     1 
ATOM   1366   O O     A PRO A  1 185 ? 69.981  -9.198  29.402  0.25 21.53  ? 185  PRO A O     1 
ATOM   1367   C CB    A PRO A  1 185 ? 70.159  -5.978  29.436  0.25 26.34  ? 185  PRO A CB    1 
ATOM   1368   C CG    A PRO A  1 185 ? 71.429  -5.322  28.981  0.25 25.00  ? 185  PRO A CG    1 
ATOM   1369   C CD    A PRO A  1 185 ? 72.332  -6.508  28.748  0.25 25.29  ? 185  PRO A CD    1 
ATOM   1370   N N     A PRO A  1 186 ? 68.792  -8.495  31.156  0.25 22.49  ? 186  PRO A N     1 
ATOM   1371   C CA    A PRO A  1 186 ? 67.897  -9.665  31.136  0.25 21.58  ? 186  PRO A CA    1 
ATOM   1372   C C     A PRO A  1 186 ? 67.232  -9.901  29.772  0.25 21.89  ? 186  PRO A C     1 
ATOM   1373   O O     A PRO A  1 186 ? 66.723  -8.966  29.166  0.25 23.46  ? 186  PRO A O     1 
ATOM   1374   C CB    A PRO A  1 186 ? 66.864  -9.315  32.213  0.25 19.04  ? 186  PRO A CB    1 
ATOM   1375   C CG    A PRO A  1 186 ? 67.634  -8.442  33.160  0.25 21.91  ? 186  PRO A CG    1 
ATOM   1376   C CD    A PRO A  1 186 ? 68.418  -7.560  32.233  0.25 21.75  ? 186  PRO A CD    1 
ATOM   1377   N N     A CYS A  1 187 ? 67.260  -11.135 29.279  0.25 22.64  ? 187  CYS A N     1 
ATOM   1378   C CA    A CYS A  1 187 ? 66.605  -11.459 28.009  0.25 23.66  ? 187  CYS A CA    1 
ATOM   1379   C C     A CYS A  1 187 ? 65.158  -11.827 28.376  0.25 23.66  ? 187  CYS A C     1 
ATOM   1380   O O     A CYS A  1 187 ? 64.212  -11.293 27.806  0.25 22.44  ? 187  CYS A O     1 
ATOM   1381   C CB    A CYS A  1 187 ? 67.296  -12.638 27.308  0.25 25.01  ? 187  CYS A CB    1 
ATOM   1382   S SG    A CYS A  1 187 ? 68.995  -12.228 26.732  0.25 28.17  ? 187  CYS A SG    1 
ATOM   1383   N N     A HIS A  1 188 ? 64.998  -12.758 29.308  0.25 21.03  ? 188  HIS A N     1 
ATOM   1384   C CA    A HIS A  1 188 ? 63.662  -13.098 29.766  0.25 23.49  ? 188  HIS A CA    1 
ATOM   1385   C C     A HIS A  1 188 ? 63.470  -12.076 30.876  0.25 26.11  ? 188  HIS A C     1 
ATOM   1386   O O     A HIS A  1 188 ? 63.905  -12.269 32.005  0.25 27.25  ? 188  HIS A O     1 
ATOM   1387   C CB    A HIS A  1 188 ? 63.570  -14.554 30.255  0.25 20.93  ? 188  HIS A CB    1 
ATOM   1388   C CG    A HIS A  1 188 ? 64.752  -15.042 31.047  0.25 22.15  ? 188  HIS A CG    1 
ATOM   1389   N ND1   A HIS A  1 188 ? 64.692  -15.292 32.409  0.25 17.35  ? 188  HIS A ND1   1 
ATOM   1390   C CD2   A HIS A  1 188 ? 66.003  -15.391 30.656  0.25 18.30  ? 188  HIS A CD2   1 
ATOM   1391   C CE1   A HIS A  1 188 ? 65.856  -15.775 32.814  0.25 21.41  ? 188  HIS A CE1   1 
ATOM   1392   N NE2   A HIS A  1 188 ? 66.665  -15.848 31.770  0.25 17.65  ? 188  HIS A NE2   1 
ATOM   1393   N N     A MET A  1 189 ? 62.838  -10.960 30.528  0.25 25.93  ? 189  MET A N     1 
ATOM   1394   C CA    A MET A  1 189 ? 62.693  -9.876  31.473  0.25 26.37  ? 189  MET A CA    1 
ATOM   1395   C C     A MET A  1 189 ? 61.620  -9.973  32.509  0.25 26.70  ? 189  MET A C     1 
ATOM   1396   O O     A MET A  1 189 ? 61.682  -9.267  33.497  0.25 26.27  ? 189  MET A O     1 
ATOM   1397   C CB    A MET A  1 189 ? 62.625  -8.541  30.739  0.25 27.73  ? 189  MET A CB    1 
ATOM   1398   C CG    A MET A  1 189 ? 61.793  -8.509  29.481  0.25 31.12  ? 189  MET A CG    1 
ATOM   1399   S SD    A MET A  1 189 ? 62.101  -6.970  28.567  0.25 32.04  ? 189  MET A SD    1 
ATOM   1400   C CE    A MET A  1 189 ? 61.028  -5.830  29.484  0.25 35.85  ? 189  MET A CE    1 
ATOM   1401   N N     A PHE A  1 190 ? 60.641  -10.846 32.301  0.25 27.72  ? 190  PHE A N     1 
ATOM   1402   C CA    A PHE A  1 190 ? 59.615  -11.031 33.313  0.25 27.97  ? 190  PHE A CA    1 
ATOM   1403   C C     A PHE A  1 190 ? 58.591  -12.070 32.896  0.25 26.72  ? 190  PHE A C     1 
ATOM   1404   O O     A PHE A  1 190 ? 58.490  -12.435 31.720  0.25 23.68  ? 190  PHE A O     1 
ATOM   1405   C CB    A PHE A  1 190 ? 58.903  -9.721  33.581  0.25 34.09  ? 190  PHE A CB    1 
ATOM   1406   C CG    A PHE A  1 190 ? 57.691  -9.535  32.748  0.25 36.66  ? 190  PHE A CG    1 
ATOM   1407   C CD1   A PHE A  1 190 ? 56.455  -10.023 33.177  0.25 37.64  ? 190  PHE A CD1   1 
ATOM   1408   C CD2   A PHE A  1 190 ? 57.790  -8.965  31.498  0.25 39.66  ? 190  PHE A CD2   1 
ATOM   1409   C CE1   A PHE A  1 190 ? 55.347  -9.950  32.370  0.25 39.66  ? 190  PHE A CE1   1 
ATOM   1410   C CE2   A PHE A  1 190 ? 56.668  -8.890  30.674  0.25 40.75  ? 190  PHE A CE2   1 
ATOM   1411   C CZ    A PHE A  1 190 ? 55.453  -9.382  31.110  0.25 39.84  ? 190  PHE A CZ    1 
ATOM   1412   N N     A CYS A  1 191 ? 57.832  -12.540 33.872  0.25 21.94  ? 191  CYS A N     1 
ATOM   1413   C CA    A CYS A  1 191 ? 56.794  -13.511 33.611  0.25 22.81  ? 191  CYS A CA    1 
ATOM   1414   C C     A CYS A  1 191 ? 55.634  -13.229 34.558  0.25 21.17  ? 191  CYS A C     1 
ATOM   1415   O O     A CYS A  1 191 ? 55.793  -12.545 35.588  0.25 17.91  ? 191  CYS A O     1 
ATOM   1416   C CB    A CYS A  1 191 ? 57.310  -14.940 33.803  0.25 20.43  ? 191  CYS A CB    1 
ATOM   1417   S SG    A CYS A  1 191 ? 57.665  -15.453 35.483  0.25 24.82  ? 191  CYS A SG    1 
ATOM   1418   N N     A GLN A  1 192 ? 54.468  -13.736 34.192  0.25 19.40  ? 192  GLN A N     1 
ATOM   1419   C CA    A GLN A  1 192 ? 53.275  -13.567 34.999  0.25 16.74  ? 192  GLN A CA    1 
ATOM   1420   C C     A GLN A  1 192 ? 52.631  -14.940 35.195  0.25 17.21  ? 192  GLN A C     1 
ATOM   1421   O O     A GLN A  1 192 ? 52.532  -15.737 34.253  0.25 18.10  ? 192  GLN A O     1 
ATOM   1422   C CB    A GLN A  1 192 ? 52.290  -12.621 34.293  0.25 19.08  ? 192  GLN A CB    1 
ATOM   1423   C CG    A GLN A  1 192 ? 50.901  -12.570 34.951  0.25 18.63  ? 192  GLN A CG    1 
ATOM   1424   C CD    A GLN A  1 192 ? 50.024  -11.458 34.396  0.25 17.19  ? 192  GLN A CD    1 
ATOM   1425   O OE1   A GLN A  1 192 ? 50.263  -10.953 33.300  0.25 17.04  ? 192  GLN A OE1   1 
ATOM   1426   N NE2   A GLN A  1 192 ? 49.001  -11.073 35.162  0.25 18.48  ? 192  GLN A NE2   1 
ATOM   1427   N N     A PHE A  1 193 ? 52.205  -15.226 36.422  0.25 15.12  ? 193  PHE A N     1 
ATOM   1428   C CA    A PHE A  1 193 ? 51.547  -16.478 36.721  0.25 16.75  ? 193  PHE A CA    1 
ATOM   1429   C C     A PHE A  1 193 ? 50.054  -16.239 36.856  0.25 17.77  ? 193  PHE A C     1 
ATOM   1430   O O     A PHE A  1 193 ? 49.638  -15.167 37.234  0.25 17.37  ? 193  PHE A O     1 
ATOM   1431   C CB    A PHE A  1 193 ? 52.099  -17.079 38.011  0.25 18.73  ? 193  PHE A CB    1 
ATOM   1432   C CG    A PHE A  1 193 ? 53.554  -17.466 37.903  0.25 20.07  ? 193  PHE A CG    1 
ATOM   1433   C CD1   A PHE A  1 193 ? 54.556  -16.546 38.219  0.25 20.54  ? 193  PHE A CD1   1 
ATOM   1434   C CD2   A PHE A  1 193 ? 53.912  -18.721 37.431  0.25 18.66  ? 193  PHE A CD2   1 
ATOM   1435   C CE1   A PHE A  1 193 ? 55.922  -16.873 38.068  0.25 22.60  ? 193  PHE A CE1   1 
ATOM   1436   C CE2   A PHE A  1 193 ? 55.273  -19.073 37.270  0.25 23.24  ? 193  PHE A CE2   1 
ATOM   1437   C CZ    A PHE A  1 193 ? 56.279  -18.137 37.592  0.25 19.50  ? 193  PHE A CZ    1 
ATOM   1438   N N     A PHE A  1 194 ? 49.272  -17.261 36.533  0.25 21.36  ? 194  PHE A N     1 
ATOM   1439   C CA    A PHE A  1 194 ? 47.823  -17.200 36.591  0.25 21.47  ? 194  PHE A CA    1 
ATOM   1440   C C     A PHE A  1 194 ? 47.327  -18.497 37.191  0.25 20.41  ? 194  PHE A C     1 
ATOM   1441   O O     A PHE A  1 194 ? 47.828  -19.575 36.865  0.25 21.20  ? 194  PHE A O     1 
ATOM   1442   C CB    A PHE A  1 194 ? 47.242  -17.006 35.177  0.25 21.21  ? 194  PHE A CB    1 
ATOM   1443   C CG    A PHE A  1 194 ? 45.720  -16.915 35.142  0.25 21.21  ? 194  PHE A CG    1 
ATOM   1444   C CD1   A PHE A  1 194 ? 44.949  -18.066 35.003  0.25 23.65  ? 194  PHE A CD1   1 
ATOM   1445   C CD2   A PHE A  1 194 ? 45.078  -15.682 35.228  0.25 19.88  ? 194  PHE A CD2   1 
ATOM   1446   C CE1   A PHE A  1 194 ? 43.537  -17.996 34.943  0.25 24.07  ? 194  PHE A CE1   1 
ATOM   1447   C CE2   A PHE A  1 194 ? 43.684  -15.589 35.172  0.25 24.87  ? 194  PHE A CE2   1 
ATOM   1448   C CZ    A PHE A  1 194 ? 42.911  -16.747 35.030  0.25 23.44  ? 194  PHE A CZ    1 
ATOM   1449   N N     A VAL A  1 195 ? 46.338  -18.392 38.072  0.25 20.60  ? 195  VAL A N     1 
ATOM   1450   C CA    A VAL A  1 195 ? 45.783  -19.566 38.726  0.25 21.34  ? 195  VAL A CA    1 
ATOM   1451   C C     A VAL A  1 195 ? 44.299  -19.703 38.430  0.25 24.90  ? 195  VAL A C     1 
ATOM   1452   O O     A VAL A  1 195 ? 43.526  -18.789 38.715  0.25 22.67  ? 195  VAL A O     1 
ATOM   1453   C CB    A VAL A  1 195 ? 45.965  -19.482 40.247  0.25 22.44  ? 195  VAL A CB    1 
ATOM   1454   C CG1   A VAL A  1 195 ? 45.508  -20.760 40.906  0.25 21.59  ? 195  VAL A CG1   1 
ATOM   1455   C CG2   A VAL A  1 195 ? 47.419  -19.204 40.572  0.25 21.04  ? 195  VAL A CG2   1 
ATOM   1456   N N     A SER A  1 196 ? 43.913  -20.831 37.835  0.25 28.23  ? 196  SER A N     1 
ATOM   1457   C CA    A SER A  1 196 ? 42.502  -21.098 37.552  0.25 29.86  ? 196  SER A CA    1 
ATOM   1458   C C     A SER A  1 196 ? 41.946  -21.831 38.761  0.25 30.02  ? 196  SER A C     1 
ATOM   1459   O O     A SER A  1 196 ? 42.528  -22.820 39.223  0.25 30.71  ? 196  SER A O     1 
ATOM   1460   C CB    A SER A  1 196 ? 42.333  -21.984 36.319  0.25 31.06  ? 196  SER A CB    1 
ATOM   1461   O OG    A SER A  1 196 ? 42.808  -21.335 35.155  0.25 38.93  ? 196  SER A OG    1 
ATOM   1462   N N     A LEU A  1 197 ? 40.821  -21.349 39.271  0.25 30.15  ? 197  LEU A N     1 
ATOM   1463   C CA    A LEU A  1 197 ? 40.188  -21.959 40.430  0.25 32.55  ? 197  LEU A CA    1 
ATOM   1464   C C     A LEU A  1 197 ? 39.540  -23.280 40.042  0.25 31.55  ? 197  LEU A C     1 
ATOM   1465   O O     A LEU A  1 197 ? 39.206  -23.489 38.885  0.25 26.11  ? 197  LEU A O     1 
ATOM   1466   C CB    A LEU A  1 197 ? 39.125  -21.010 41.002  0.25 34.78  ? 197  LEU A CB    1 
ATOM   1467   C CG    A LEU A  1 197 ? 39.651  -19.641 41.441  0.25 36.42  ? 197  LEU A CG    1 
ATOM   1468   C CD1   A LEU A  1 197 ? 38.504  -18.799 41.984  0.25 37.10  ? 197  LEU A CD1   1 
ATOM   1469   C CD2   A LEU A  1 197 ? 40.722  -19.819 42.499  0.25 35.50  ? 197  LEU A CD2   1 
ATOM   1470   N N     A PRO A  1 198 ? 39.383  -24.198 41.011  0.25 35.55  ? 198  PRO A N     1 
ATOM   1471   C CA    A PRO A  1 198 ? 38.766  -25.509 40.770  0.25 37.98  ? 198  PRO A CA    1 
ATOM   1472   C C     A PRO A  1 198 ? 37.345  -25.344 40.237  0.25 41.38  ? 198  PRO A C     1 
ATOM   1473   O O     A PRO A  1 198 ? 36.575  -24.556 40.772  0.25 42.01  ? 198  PRO A O     1 
ATOM   1474   C CB    A PRO A  1 198 ? 38.767  -26.152 42.155  0.25 37.52  ? 198  PRO A CB    1 
ATOM   1475   C CG    A PRO A  1 198 ? 39.967  -25.513 42.826  0.25 37.69  ? 198  PRO A CG    1 
ATOM   1476   C CD    A PRO A  1 198 ? 39.844  -24.080 42.409  0.25 33.39  ? 198  PRO A CD    1 
ATOM   1477   N N     A PRO A  1 199 ? 36.985  -26.078 39.170  0.25 44.75  ? 199  PRO A N     1 
ATOM   1478   C CA    A PRO A  1 199 ? 35.636  -25.996 38.586  0.25 47.52  ? 199  PRO A CA    1 
ATOM   1479   C C     A PRO A  1 199 ? 34.571  -26.399 39.614  0.25 49.24  ? 199  PRO A C     1 
ATOM   1480   O O     A PRO A  1 199 ? 34.879  -27.047 40.612  0.25 48.66  ? 199  PRO A O     1 
ATOM   1481   C CB    A PRO A  1 199 ? 35.697  -26.994 37.431  0.25 46.61  ? 199  PRO A CB    1 
ATOM   1482   C CG    A PRO A  1 199 ? 37.138  -26.974 37.041  0.25 48.00  ? 199  PRO A CG    1 
ATOM   1483   C CD    A PRO A  1 199 ? 37.844  -26.969 38.374  0.25 45.67  ? 199  PRO A CD    1 
ATOM   1484   N N     A ALA A  1 200 ? 33.318  -26.037 39.356  0.25 52.27  ? 200  ALA A N     1 
ATOM   1485   C CA    A ALA A  1 200 ? 32.223  -26.377 40.264  0.25 54.66  ? 200  ALA A CA    1 
ATOM   1486   C C     A ALA A  1 200 ? 32.041  -27.897 40.391  0.25 57.06  ? 200  ALA A C     1 
ATOM   1487   O O     A ALA A  1 200 ? 31.916  -28.428 41.500  0.25 57.90  ? 200  ALA A O     1 
ATOM   1488   C CB    A ALA A  1 200 ? 30.928  -25.735 39.782  0.25 53.77  ? 200  ALA A CB    1 
ATOM   1489   N N     A ASP A  1 201 ? 32.048  -28.591 39.256  0.25 58.29  ? 201  ASP A N     1 
ATOM   1490   C CA    A ASP A  1 201 ? 31.875  -30.043 39.219  0.25 60.12  ? 201  ASP A CA    1 
ATOM   1491   C C     A ASP A  1 201 ? 32.989  -30.845 39.918  0.25 60.71  ? 201  ASP A C     1 
ATOM   1492   O O     A ASP A  1 201 ? 33.172  -32.032 39.628  0.25 61.07  ? 201  ASP A O     1 
ATOM   1493   C CB    A ASP A  1 201 ? 31.750  -30.506 37.760  0.25 61.11  ? 201  ASP A CB    1 
ATOM   1494   C CG    A ASP A  1 201 ? 33.050  -30.355 36.984  0.25 62.85  ? 201  ASP A CG    1 
ATOM   1495   O OD1   A ASP A  1 201 ? 33.653  -29.258 37.035  0.25 62.68  ? 201  ASP A OD1   1 
ATOM   1496   O OD2   A ASP A  1 201 ? 33.470  -31.329 36.315  0.25 64.22  ? 201  ASP A OD2   1 
ATOM   1497   N N     A SER A  1 202 ? 33.726  -30.199 40.824  0.25 60.79  ? 202  SER A N     1 
ATOM   1498   C CA    A SER A  1 202 ? 34.808  -30.844 41.577  0.25 59.88  ? 202  SER A CA    1 
ATOM   1499   C C     A SER A  1 202 ? 35.709  -29.831 42.269  0.25 59.50  ? 202  SER A C     1 
ATOM   1500   O O     A SER A  1 202 ? 36.832  -29.586 41.828  0.25 59.93  ? 202  SER A O     1 
ATOM   1501   C CB    A SER A  1 202 ? 35.671  -31.733 40.667  0.25 59.90  ? 202  SER A CB    1 
ATOM   1502   O OG    A SER A  1 202 ? 36.165  -31.023 39.551  0.25 60.41  ? 202  SER A OG    1 
ATOM   1503   N N     A PRO A  1 203 ? 35.236  -29.241 43.374  0.25 59.62  ? 203  PRO A N     1 
ATOM   1504   C CA    A PRO A  1 203 ? 36.022  -28.250 44.114  0.25 58.53  ? 203  PRO A CA    1 
ATOM   1505   C C     A PRO A  1 203 ? 37.221  -28.838 44.843  0.25 57.33  ? 203  PRO A C     1 
ATOM   1506   O O     A PRO A  1 203 ? 37.994  -28.113 45.468  0.25 57.87  ? 203  PRO A O     1 
ATOM   1507   C CB    A PRO A  1 203 ? 34.997  -27.659 45.071  0.25 58.66  ? 203  PRO A CB    1 
ATOM   1508   C CG    A PRO A  1 203 ? 34.142  -28.846 45.389  0.25 58.49  ? 203  PRO A CG    1 
ATOM   1509   C CD    A PRO A  1 203 ? 33.918  -29.438 44.007  0.25 58.82  ? 203  PRO A CD    1 
ATOM   1510   N N     A GLY A  1 204 ? 37.366  -30.156 44.772  0.25 56.45  ? 204  GLY A N     1 
ATOM   1511   C CA    A GLY A  1 204 ? 38.477  -30.801 45.446  0.25 53.55  ? 204  GLY A CA    1 
ATOM   1512   C C     A GLY A  1 204 ? 39.741  -30.771 44.606  0.25 51.24  ? 204  GLY A C     1 
ATOM   1513   O O     A GLY A  1 204 ? 40.844  -30.912 45.131  0.25 49.77  ? 204  GLY A O     1 
ATOM   1514   N N     A SER A  1 205 ? 39.581  -30.573 43.300  0.25 47.74  ? 205  SER A N     1 
ATOM   1515   C CA    A SER A  1 205 ? 40.715  -30.546 42.387  0.25 45.34  ? 205  SER A CA    1 
ATOM   1516   C C     A SER A  1 205 ? 41.710  -29.442 42.725  0.25 41.86  ? 205  SER A C     1 
ATOM   1517   O O     A SER A  1 205 ? 41.379  -28.465 43.384  0.25 41.77  ? 205  SER A O     1 
ATOM   1518   C CB    A SER A  1 205 ? 40.225  -30.366 40.949  0.25 46.29  ? 205  SER A CB    1 
ATOM   1519   O OG    A SER A  1 205 ? 39.305  -31.379 40.584  0.25 51.32  ? 205  SER A OG    1 
ATOM   1520   N N     A LYS A  1 206 ? 42.941  -29.610 42.272  0.25 39.12  ? 206  LYS A N     1 
ATOM   1521   C CA    A LYS A  1 206 ? 43.973  -28.608 42.506  0.25 35.29  ? 206  LYS A CA    1 
ATOM   1522   C C     A LYS A  1 206 ? 43.826  -27.463 41.499  0.25 32.67  ? 206  LYS A C     1 
ATOM   1523   O O     A LYS A  1 206 ? 43.509  -27.699 40.333  0.25 30.49  ? 206  LYS A O     1 
ATOM   1524   C CB    A LYS A  1 206 ? 45.363  -29.215 42.320  0.25 34.65  ? 206  LYS A CB    1 
ATOM   1525   C CG    A LYS A  1 206 ? 45.779  -30.260 43.332  0.25 36.54  ? 206  LYS A CG    1 
ATOM   1526   C CD    A LYS A  1 206 ? 47.199  -30.719 43.023  0.25 37.39  ? 206  LYS A CD    1 
ATOM   1527   C CE    A LYS A  1 206 ? 47.683  -31.773 44.002  0.25 41.28  ? 206  LYS A CE    1 
ATOM   1528   N NZ    A LYS A  1 206 ? 49.068  -32.194 43.664  0.25 40.01  ? 206  LYS A NZ    1 
ATOM   1529   N N     A PRO A  1 207 ? 44.049  -26.212 41.941  0.25 28.09  ? 207  PRO A N     1 
ATOM   1530   C CA    A PRO A  1 207 ? 43.942  -25.081 41.019  0.25 27.38  ? 207  PRO A CA    1 
ATOM   1531   C C     A PRO A  1 207 ? 44.991  -25.282 39.919  0.25 23.77  ? 207  PRO A C     1 
ATOM   1532   O O     A PRO A  1 207 ? 46.006  -25.945 40.129  0.25 21.24  ? 207  PRO A O     1 
ATOM   1533   C CB    A PRO A  1 207 ? 44.267  -23.882 41.907  0.25 27.15  ? 207  PRO A CB    1 
ATOM   1534   C CG    A PRO A  1 207 ? 43.786  -24.318 43.271  0.25 27.15  ? 207  PRO A CG    1 
ATOM   1535   C CD    A PRO A  1 207 ? 44.270  -25.750 43.325  0.25 29.32  ? 207  PRO A CD    1 
ATOM   1536   N N     A LYS A  1 208 ? 44.743  -24.727 38.745  0.25 22.94  ? 208  LYS A N     1 
ATOM   1537   C CA    A LYS A  1 208 ? 45.686  -24.885 37.654  0.25 25.08  ? 208  LYS A CA    1 
ATOM   1538   C C     A LYS A  1 208 ? 46.596  -23.663 37.532  0.25 24.10  ? 208  LYS A C     1 
ATOM   1539   O O     A LYS A  1 208 ? 46.120  -22.529 37.545  0.25 24.60  ? 208  LYS A O     1 
ATOM   1540   C CB    A LYS A  1 208 ? 44.950  -25.144 36.340  0.25 27.21  ? 208  LYS A CB    1 
ATOM   1541   C CG    A LYS A  1 208 ? 44.250  -26.502 36.277  0.25 29.98  ? 208  LYS A CG    1 
ATOM   1542   C CD    A LYS A  1 208 ? 43.691  -26.730 34.870  0.25 36.50  ? 208  LYS A CD    1 
ATOM   1543   C CE    A LYS A  1 208 ? 42.923  -28.034 34.772  0.25 38.95  ? 208  LYS A CE    1 
ATOM   1544   N NZ    A LYS A  1 208 ? 43.784  -29.184 35.125  0.25 41.01  ? 208  LYS A NZ    1 
ATOM   1545   N N     A LEU A  1 209 ? 47.898  -23.911 37.403  0.25 21.80  ? 209  LEU A N     1 
ATOM   1546   C CA    A LEU A  1 209 ? 48.891  -22.838 37.313  0.25 20.59  ? 209  LEU A CA    1 
ATOM   1547   C C     A LEU A  1 209 ? 49.452  -22.658 35.918  0.25 19.61  ? 209  LEU A C     1 
ATOM   1548   O O     A LEU A  1 209 ? 49.933  -23.603 35.322  0.25 24.33  ? 209  LEU A O     1 
ATOM   1549   C CB    A LEU A  1 209 ? 50.051  -23.118 38.273  0.25 19.14  ? 209  LEU A CB    1 
ATOM   1550   C CG    A LEU A  1 209 ? 51.208  -22.097 38.313  0.25 17.86  ? 209  LEU A CG    1 
ATOM   1551   C CD1   A LEU A  1 209 ? 50.718  -20.773 38.919  0.25 15.78  ? 209  LEU A CD1   1 
ATOM   1552   C CD2   A LEU A  1 209 ? 52.349  -22.662 39.158  0.25 16.19  ? 209  LEU A CD2   1 
ATOM   1553   N N     A SER A  1 210 ? 49.396  -21.435 35.409  0.25 20.77  ? 210  SER A N     1 
ATOM   1554   C CA    A SER A  1 210 ? 49.938  -21.109 34.097  0.25 21.04  ? 210  SER A CA    1 
ATOM   1555   C C     A SER A  1 210 ? 50.986  -20.005 34.236  0.25 19.99  ? 210  SER A C     1 
ATOM   1556   O O     A SER A  1 210 ? 50.999  -19.256 35.213  0.25 18.98  ? 210  SER A O     1 
ATOM   1557   C CB    A SER A  1 210 ? 48.832  -20.646 33.157  0.25 19.85  ? 210  SER A CB    1 
ATOM   1558   O OG    A SER A  1 210 ? 47.958  -21.723 32.852  0.25 25.23  ? 210  SER A OG    1 
ATOM   1559   N N     A CYS A  1 211 ? 51.841  -19.892 33.236  0.25 21.20  ? 211  CYS A N     1 
ATOM   1560   C CA    A CYS A  1 211 ? 52.908  -18.904 33.257  0.25 20.10  ? 211  CYS A CA    1 
ATOM   1561   C C     A CYS A  1 211 ? 53.137  -18.318 31.865  0.25 18.75  ? 211  CYS A C     1 
ATOM   1562   O O     A CYS A  1 211 ? 53.251  -19.053 30.882  0.25 22.06  ? 211  CYS A O     1 
ATOM   1563   C CB    A CYS A  1 211 ? 54.211  -19.578 33.755  0.25 19.03  ? 211  CYS A CB    1 
ATOM   1564   S SG    A CYS A  1 211 ? 55.751  -18.570 33.552  0.25 26.63  ? 211  CYS A SG    1 
ATOM   1565   N N     A LEU A  1 212 ? 53.199  -16.996 31.785  0.25 20.79  ? 212  LEU A N     1 
ATOM   1566   C CA    A LEU A  1 212 ? 53.478  -16.317 30.523  0.25 21.43  ? 212  LEU A CA    1 
ATOM   1567   C C     A LEU A  1 212 ? 54.792  -15.574 30.745  0.25 21.82  ? 212  LEU A C     1 
ATOM   1568   O O     A LEU A  1 212 ? 54.910  -14.794 31.693  0.25 20.00  ? 212  LEU A O     1 
ATOM   1569   C CB    A LEU A  1 212 ? 52.384  -15.306 30.166  0.25 21.12  ? 212  LEU A CB    1 
ATOM   1570   C CG    A LEU A  1 212 ? 52.518  -14.674 28.771  0.25 26.92  ? 212  LEU A CG    1 
ATOM   1571   C CD1   A LEU A  1 212 ? 51.219  -13.996 28.417  0.25 30.31  ? 212  LEU A CD1   1 
ATOM   1572   C CD2   A LEU A  1 212 ? 53.650  -13.672 28.734  0.25 27.56  ? 212  LEU A CD2   1 
ATOM   1573   N N     A MET A  1 213 ? 55.770  -15.815 29.876  0.25 21.08  ? 213  MET A N     1 
ATOM   1574   C CA    A MET A  1 213 ? 57.065  -15.135 29.993  0.25 20.43  ? 213  MET A CA    1 
ATOM   1575   C C     A MET A  1 213 ? 57.296  -14.319 28.738  0.25 20.70  ? 213  MET A C     1 
ATOM   1576   O O     A MET A  1 213 ? 56.950  -14.750 27.627  0.25 22.82  ? 213  MET A O     1 
ATOM   1577   C CB    A MET A  1 213 ? 58.198  -16.176 30.158  0.25 18.73  ? 213  MET A CB    1 
ATOM   1578   C CG    A MET A  1 213 ? 59.590  -15.591 30.386  0.25 16.26  ? 213  MET A CG    1 
ATOM   1579   S SD    A MET A  1 213 ? 60.452  -15.198 28.868  0.25 23.14  ? 213  MET A SD    1 
ATOM   1580   C CE    A MET A  1 213 ? 61.267  -16.781 28.517  0.25 20.68  ? 213  MET A CE    1 
ATOM   1581   N N     A TYR A  1 214 ? 57.872  -13.137 28.901  0.25 20.83  ? 214  TYR A N     1 
ATOM   1582   C CA    A TYR A  1 214 ? 58.162  -12.275 27.766  0.25 20.19  ? 214  TYR A CA    1 
ATOM   1583   C C     A TYR A  1 214 ? 59.680  -12.134 27.646  0.25 20.73  ? 214  TYR A C     1 
ATOM   1584   O O     A TYR A  1 214 ? 60.331  -11.712 28.598  0.25 18.75  ? 214  TYR A O     1 
ATOM   1585   C CB    A TYR A  1 214 ? 57.562  -10.883 27.957  0.25 20.05  ? 214  TYR A CB    1 
ATOM   1586   C CG    A TYR A  1 214 ? 57.826  -9.986  26.771  0.25 24.34  ? 214  TYR A CG    1 
ATOM   1587   C CD1   A TYR A  1 214 ? 56.968  -9.986  25.676  0.25 28.23  ? 214  TYR A CD1   1 
ATOM   1588   C CD2   A TYR A  1 214 ? 58.973  -9.194  26.706  0.25 26.57  ? 214  TYR A CD2   1 
ATOM   1589   C CE1   A TYR A  1 214 ? 57.244  -9.223  24.543  0.25 28.85  ? 214  TYR A CE1   1 
ATOM   1590   C CE2   A TYR A  1 214 ? 59.261  -8.434  25.585  0.25 27.98  ? 214  TYR A CE2   1 
ATOM   1591   C CZ    A TYR A  1 214 ? 58.400  -8.449  24.511  0.25 27.92  ? 214  TYR A CZ    1 
ATOM   1592   O OH    A TYR A  1 214 ? 58.693  -7.699  23.399  0.25 26.58  ? 214  TYR A OH    1 
ATOM   1593   N N     A GLN A  1 215 ? 60.209  -12.453 26.466  0.25 19.53  ? 215  GLN A N     1 
ATOM   1594   C CA    A GLN A  1 215 ? 61.642  -12.405 26.190  0.25 19.77  ? 215  GLN A CA    1 
ATOM   1595   C C     A GLN A  1 215 ? 61.911  -11.326 25.135  0.25 20.64  ? 215  GLN A C     1 
ATOM   1596   O O     A GLN A  1 215 ? 61.468  -11.435 24.000  0.25 21.96  ? 215  GLN A O     1 
ATOM   1597   C CB    A GLN A  1 215 ? 62.095  -13.781 25.688  0.25 23.41  ? 215  GLN A CB    1 
ATOM   1598   C CG    A GLN A  1 215 ? 63.597  -14.064 25.815  0.25 23.41  ? 215  GLN A CG    1 
ATOM   1599   C CD    A GLN A  1 215 ? 63.977  -15.490 25.427  0.25 21.37  ? 215  GLN A CD    1 
ATOM   1600   O OE1   A GLN A  1 215 ? 63.245  -16.449 25.701  0.25 19.40  ? 215  GLN A OE1   1 
ATOM   1601   N NE2   A GLN A  1 215 ? 65.144  -15.640 24.791  0.25 18.82  ? 215  GLN A NE2   1 
ATOM   1602   N N     A ARG A  1 216 ? 62.612  -10.268 25.527  0.25 20.02  ? 216  ARG A N     1 
ATOM   1603   C CA    A ARG A  1 216 ? 62.931  -9.163  24.618  0.25 20.34  ? 216  ARG A CA    1 
ATOM   1604   C C     A ARG A  1 216 ? 63.840  -9.540  23.443  0.25 20.77  ? 216  ARG A C     1 
ATOM   1605   O O     A ARG A  1 216 ? 63.733  -8.976  22.357  0.25 22.31  ? 216  ARG A O     1 
ATOM   1606   C CB    A ARG A  1 216 ? 63.607  -8.025  25.396  0.25 18.40  ? 216  ARG A CB    1 
ATOM   1607   C CG    A ARG A  1 216 ? 65.046  -8.384  25.863  0.25 20.68  ? 216  ARG A CG    1 
ATOM   1608   C CD    A ARG A  1 216 ? 65.796  -7.196  26.445  0.25 19.76  ? 216  ARG A CD    1 
ATOM   1609   N NE    A ARG A  1 216 ? 67.104  -7.638  26.918  0.25 19.82  ? 216  ARG A NE    1 
ATOM   1610   C CZ    A ARG A  1 216 ? 68.157  -7.882  26.139  0.25 21.74  ? 216  ARG A CZ    1 
ATOM   1611   N NH1   A ARG A  1 216 ? 68.089  -7.710  24.828  0.25 17.36  ? 216  ARG A NH1   1 
ATOM   1612   N NH2   A ARG A  1 216 ? 69.283  -8.346  26.676  0.25 22.47  ? 216  ARG A NH2   1 
ATOM   1613   N N     A SER A  1 217 ? 64.732  -10.496 23.665  0.25 22.47  ? 217  SER A N     1 
ATOM   1614   C CA    A SER A  1 217 ? 65.722  -10.868 22.648  0.25 24.52  ? 217  SER A CA    1 
ATOM   1615   C C     A SER A  1 217 ? 65.853  -12.362 22.729  0.25 22.77  ? 217  SER A C     1 
ATOM   1616   O O     A SER A  1 217 ? 66.146  -12.905 23.788  0.25 27.20  ? 217  SER A O     1 
ATOM   1617   C CB    A SER A  1 217 ? 67.076  -10.178 22.965  0.25 22.47  ? 217  SER A CB    1 
ATOM   1618   O OG    A SER A  1 217 ? 68.041  -10.396 21.953  0.25 23.39  ? 217  SER A OG    1 
ATOM   1619   N N     A CYS A  1 218 ? 65.651  -13.031 21.601  0.25 22.90  ? 218  CYS A N     1 
ATOM   1620   C CA    A CYS A  1 218 ? 65.658  -14.469 21.568  0.25 20.39  ? 218  CYS A CA    1 
ATOM   1621   C C     A CYS A  1 218 ? 66.582  -15.122 20.540  0.25 20.88  ? 218  CYS A C     1 
ATOM   1622   O O     A CYS A  1 218 ? 66.347  -15.046 19.348  0.25 17.98  ? 218  CYS A O     1 
ATOM   1623   C CB    A CYS A  1 218 ? 64.224  -14.943 21.319  0.25 22.03  ? 218  CYS A CB    1 
ATOM   1624   S SG    A CYS A  1 218 ? 63.003  -13.925 22.256  0.25 21.96  ? 218  CYS A SG    1 
ATOM   1625   N N     A ASP A  1 219 ? 67.620  -15.790 21.031  0.25 23.09  ? 219  ASP A N     1 
ATOM   1626   C CA    A ASP A  1 219 ? 68.563  -16.524 20.173  0.25 21.12  ? 219  ASP A CA    1 
ATOM   1627   C C     A ASP A  1 219 ? 67.875  -17.868 20.013  0.25 21.11  ? 219  ASP A C     1 
ATOM   1628   O O     A ASP A  1 219 ? 67.929  -18.715 20.914  0.25 20.77  ? 219  ASP A O     1 
ATOM   1629   C CB    A ASP A  1 219 ? 69.898  -16.661 20.921  0.25 23.04  ? 219  ASP A CB    1 
ATOM   1630   C CG    A ASP A  1 219 ? 70.925  -17.452 20.146  0.25 23.83  ? 219  ASP A CG    1 
ATOM   1631   O OD1   A ASP A  1 219 ? 72.131  -17.349 20.474  0.25 24.01  ? 219  ASP A OD1   1 
ATOM   1632   O OD2   A ASP A  1 219 ? 70.523  -18.182 19.221  0.25 20.52  ? 219  ASP A OD2   1 
ATOM   1633   N N     A LEU A  1 220 ? 67.196  -18.068 18.881  0.25 23.63  ? 220  LEU A N     1 
ATOM   1634   C CA    A LEU A  1 220 ? 66.438  -19.306 18.696  0.25 23.89  ? 220  LEU A CA    1 
ATOM   1635   C C     A LEU A  1 220 ? 67.273  -20.568 18.692  0.25 24.47  ? 220  LEU A C     1 
ATOM   1636   O O     A LEU A  1 220 ? 66.839  -21.617 19.194  0.25 21.04  ? 220  LEU A O     1 
ATOM   1637   C CB    A LEU A  1 220 ? 65.581  -19.233 17.429  0.25 26.64  ? 220  LEU A CB    1 
ATOM   1638   C CG    A LEU A  1 220 ? 64.224  -18.609 17.815  0.25 28.82  ? 220  LEU A CG    1 
ATOM   1639   C CD1   A LEU A  1 220 ? 64.211  -17.152 17.479  0.25 28.44  ? 220  LEU A CD1   1 
ATOM   1640   C CD2   A LEU A  1 220 ? 63.108  -19.353 17.144  0.25 28.40  ? 220  LEU A CD2   1 
ATOM   1641   N N     A GLY A  1 221 ? 68.465  -20.478 18.119  0.25 20.47  ? 221  GLY A N     1 
ATOM   1642   C CA    A GLY A  1 221 ? 69.312  -21.653 18.104  0.25 19.01  ? 221  GLY A CA    1 
ATOM   1643   C C     A GLY A  1 221 ? 69.738  -22.108 19.487  0.25 16.17  ? 221  GLY A C     1 
ATOM   1644   O O     A GLY A  1 221 ? 69.483  -23.244 19.865  0.25 20.24  ? 221  GLY A O     1 
ATOM   1645   N N     A LEU A  1 222 ? 70.353  -21.214 20.257  0.25 19.03  ? 222  LEU A N     1 
ATOM   1646   C CA    A LEU A  1 222 ? 70.880  -21.564 21.574  0.25 21.91  ? 222  LEU A CA    1 
ATOM   1647   C C     A LEU A  1 222 ? 70.068  -21.210 22.818  0.25 21.92  ? 222  LEU A C     1 
ATOM   1648   O O     A LEU A  1 222 ? 69.944  -22.022 23.744  0.25 24.13  ? 222  LEU A O     1 
ATOM   1649   C CB    A LEU A  1 222 ? 72.283  -20.946 21.732  0.25 21.64  ? 222  LEU A CB    1 
ATOM   1650   C CG    A LEU A  1 222 ? 73.385  -21.554 20.850  0.25 26.41  ? 222  LEU A CG    1 
ATOM   1651   C CD1   A LEU A  1 222 ? 74.702  -20.790 21.085  0.25 25.54  ? 222  LEU A CD1   1 
ATOM   1652   C CD2   A LEU A  1 222 ? 73.562  -23.039 21.195  0.25 26.32  ? 222  LEU A CD2   1 
ATOM   1653   N N     A GLY A  1 223 ? 69.537  -20.001 22.852  0.25 20.84  ? 223  GLY A N     1 
ATOM   1654   C CA    A GLY A  1 223 ? 68.804  -19.563 24.028  0.25 23.04  ? 223  GLY A CA    1 
ATOM   1655   C C     A GLY A  1 223 ? 67.405  -20.126 24.224  0.25 22.35  ? 223  GLY A C     1 
ATOM   1656   O O     A GLY A  1 223 ? 67.120  -20.758 25.238  0.25 23.94  ? 223  GLY A O     1 
ATOM   1657   N N     A VAL A  1 224 ? 66.538  -19.928 23.237  0.25 24.66  ? 224  VAL A N     1 
ATOM   1658   C CA    A VAL A  1 224 ? 65.144  -20.387 23.345  0.25 23.26  ? 224  VAL A CA    1 
ATOM   1659   C C     A VAL A  1 224 ? 64.953  -21.797 23.870  0.25 22.89  ? 224  VAL A C     1 
ATOM   1660   O O     A VAL A  1 224 ? 64.063  -22.036 24.683  0.25 24.51  ? 224  VAL A O     1 
ATOM   1661   C CB    A VAL A  1 224 ? 64.418  -20.176 22.006  0.25 24.52  ? 224  VAL A CB    1 
ATOM   1662   C CG1   A VAL A  1 224 ? 62.971  -20.708 22.056  0.25 20.40  ? 224  VAL A CG1   1 
ATOM   1663   C CG2   A VAL A  1 224 ? 64.427  -18.711 21.709  0.25 19.53  ? 224  VAL A CG2   1 
ATOM   1664   N N     A PRO A  1 225 ? 65.767  -22.769 23.407  0.25 23.32  ? 225  PRO A N     1 
ATOM   1665   C CA    A PRO A  1 225 ? 65.581  -24.118 23.937  0.25 18.91  ? 225  PRO A CA    1 
ATOM   1666   C C     A PRO A  1 225 ? 65.751  -24.149 25.460  0.25 17.75  ? 225  PRO A C     1 
ATOM   1667   O O     A PRO A  1 225 ? 65.068  -24.894 26.144  0.25 16.48  ? 225  PRO A O     1 
ATOM   1668   C CB    A PRO A  1 225 ? 66.671  -24.931 23.232  0.25 22.95  ? 225  PRO A CB    1 
ATOM   1669   C CG    A PRO A  1 225 ? 66.784  -24.242 21.885  0.25 24.58  ? 225  PRO A CG    1 
ATOM   1670   C CD    A PRO A  1 225 ? 66.730  -22.760 22.285  0.25 25.54  ? 225  PRO A CD    1 
ATOM   1671   N N     A PHE A  1 226 ? 66.671  -23.350 25.986  0.25 19.82  ? 226  PHE A N     1 
ATOM   1672   C CA    A PHE A  1 226 ? 66.905  -23.311 27.429  0.25 20.92  ? 226  PHE A CA    1 
ATOM   1673   C C     A PHE A  1 226 ? 65.755  -22.538 28.098  0.25 21.82  ? 226  PHE A C     1 
ATOM   1674   O O     A PHE A  1 226 ? 65.212  -22.973 29.109  0.25 20.31  ? 226  PHE A O     1 
ATOM   1675   C CB    A PHE A  1 226 ? 68.232  -22.587 27.748  0.25 19.06  ? 226  PHE A CB    1 
ATOM   1676   C CG    A PHE A  1 226 ? 69.427  -23.516 27.899  0.25 24.50  ? 226  PHE A CG    1 
ATOM   1677   C CD1   A PHE A  1 226 ? 69.839  -24.328 26.839  0.25 23.00  ? 226  PHE A CD1   1 
ATOM   1678   C CD2   A PHE A  1 226 ? 70.118  -23.583 29.108  0.25 22.98  ? 226  PHE A CD2   1 
ATOM   1679   C CE1   A PHE A  1 226 ? 70.930  -25.207 26.979  0.25 24.54  ? 226  PHE A CE1   1 
ATOM   1680   C CE2   A PHE A  1 226 ? 71.209  -24.450 29.272  0.25 23.76  ? 226  PHE A CE2   1 
ATOM   1681   C CZ    A PHE A  1 226 ? 71.615  -25.269 28.199  0.25 24.29  ? 226  PHE A CZ    1 
ATOM   1682   N N     A ASN A  1 227 ? 65.408  -21.395 27.524  0.25 17.32  ? 227  ASN A N     1 
ATOM   1683   C CA    A ASN A  1 227 ? 64.350  -20.562 28.100  0.25 23.37  ? 227  ASN A CA    1 
ATOM   1684   C C     A ASN A  1 227 ? 63.051  -21.319 28.249  0.25 21.51  ? 227  ASN A C     1 
ATOM   1685   O O     A ASN A  1 227 ? 62.398  -21.213 29.273  0.25 26.21  ? 227  ASN A O     1 
ATOM   1686   C CB    A ASN A  1 227 ? 64.116  -19.308 27.252  0.25 18.42  ? 227  ASN A CB    1 
ATOM   1687   C CG    A ASN A  1 227 ? 65.297  -18.338 27.286  0.25 23.18  ? 227  ASN A CG    1 
ATOM   1688   O OD1   A ASN A  1 227 ? 65.847  -17.957 26.237  0.25 23.52  ? 227  ASN A OD1   1 
ATOM   1689   N ND2   A ASN A  1 227 ? 65.681  -17.916 28.491  0.25 19.51  ? 227  ASN A ND2   1 
ATOM   1690   N N     A ILE A  1 228 ? 62.683  -22.088 27.231  0.25 22.40  ? 228  ILE A N     1 
ATOM   1691   C CA    A ILE A  1 228 ? 61.445  -22.851 27.270  0.25 21.67  ? 228  ILE A CA    1 
ATOM   1692   C C     A ILE A  1 228 ? 61.444  -23.868 28.408  0.25 24.26  ? 228  ILE A C     1 
ATOM   1693   O O     A ILE A  1 228 ? 60.514  -23.911 29.215  0.25 22.52  ? 228  ILE A O     1 
ATOM   1694   C CB    A ILE A  1 228 ? 61.200  -23.572 25.943  0.25 19.79  ? 228  ILE A CB    1 
ATOM   1695   C CG1   A ILE A  1 228 ? 60.973  -22.537 24.833  0.25 18.86  ? 228  ILE A CG1   1 
ATOM   1696   C CG2   A ILE A  1 228 ? 59.977  -24.504 26.063  0.25 18.37  ? 228  ILE A CG2   1 
ATOM   1697   C CD1   A ILE A  1 228 ? 60.779  -23.163 23.421  0.25 19.91  ? 228  ILE A CD1   1 
ATOM   1698   N N     A ALA A  1 229 ? 62.504  -24.678 28.487  0.25 21.65  ? 229  ALA A N     1 
ATOM   1699   C CA    A ALA A  1 229 ? 62.585  -25.688 29.523  0.25 21.44  ? 229  ALA A CA    1 
ATOM   1700   C C     A ALA A  1 229 ? 62.709  -25.059 30.914  0.25 20.66  ? 229  ALA A C     1 
ATOM   1701   O O     A ALA A  1 229 ? 62.127  -25.551 31.860  0.25 18.96  ? 229  ALA A O     1 
ATOM   1702   C CB    A ALA A  1 229 ? 63.783  -26.624 29.250  0.25 23.64  ? 229  ALA A CB    1 
ATOM   1703   N N     A SER A  1 230 ? 63.473  -23.973 31.019  0.25 17.08  ? 230  SER A N     1 
ATOM   1704   C CA    A SER A  1 230 ? 63.679  -23.293 32.280  0.25 18.04  ? 230  SER A CA    1 
ATOM   1705   C C     A SER A  1 230 ? 62.360  -22.800 32.925  0.25 19.78  ? 230  SER A C     1 
ATOM   1706   O O     A SER A  1 230 ? 62.063  -23.127 34.075  0.25 18.95  ? 230  SER A O     1 
ATOM   1707   C CB    A SER A  1 230 ? 64.591  -22.105 32.068  0.25 15.64  ? 230  SER A CB    1 
ATOM   1708   O OG    A SER A  1 230 ? 64.940  -21.521 33.307  0.25 19.59  ? 230  SER A OG    1 
ATOM   1709   N N     A TYR A  1 231 ? 61.590  -22.005 32.193  0.25 17.07  ? 231  TYR A N     1 
ATOM   1710   C CA    A TYR A  1 231 ? 60.326  -21.503 32.735  0.25 20.06  ? 231  TYR A CA    1 
ATOM   1711   C C     A TYR A  1 231 ? 59.304  -22.619 32.922  0.25 19.46  ? 231  TYR A C     1 
ATOM   1712   O O     A TYR A  1 231 ? 58.463  -22.541 33.817  0.25 24.89  ? 231  TYR A O     1 
ATOM   1713   C CB    A TYR A  1 231 ? 59.793  -20.367 31.856  0.25 18.97  ? 231  TYR A CB    1 
ATOM   1714   C CG    A TYR A  1 231 ? 60.429  -19.060 32.246  0.25 21.24  ? 231  TYR A CG    1 
ATOM   1715   C CD1   A TYR A  1 231 ? 59.879  -18.266 33.256  0.25 21.08  ? 231  TYR A CD1   1 
ATOM   1716   C CD2   A TYR A  1 231 ? 61.645  -18.672 31.691  0.25 21.08  ? 231  TYR A CD2   1 
ATOM   1717   C CE1   A TYR A  1 231 ? 60.526  -17.128 33.707  0.25 21.70  ? 231  TYR A CE1   1 
ATOM   1718   C CE2   A TYR A  1 231 ? 62.304  -17.539 32.134  0.25 21.86  ? 231  TYR A CE2   1 
ATOM   1719   C CZ    A TYR A  1 231 ? 61.747  -16.768 33.137  0.25 20.04  ? 231  TYR A CZ    1 
ATOM   1720   O OH    A TYR A  1 231 ? 62.391  -15.634 33.555  0.25 17.95  ? 231  TYR A OH    1 
ATOM   1721   N N     A ALA A  1 232 ? 59.384  -23.671 32.107  0.25 19.58  ? 232  ALA A N     1 
ATOM   1722   C CA    A ALA A  1 232 ? 58.472  -24.796 32.288  0.25 21.08  ? 232  ALA A CA    1 
ATOM   1723   C C     A ALA A  1 232 ? 58.825  -25.449 33.623  0.25 23.27  ? 232  ALA A C     1 
ATOM   1724   O O     A ALA A  1 232 ? 57.941  -25.780 34.423  0.25 23.59  ? 232  ALA A O     1 
ATOM   1725   C CB    A ALA A  1 232 ? 58.615  -25.795 31.143  0.25 22.48  ? 232  ALA A CB    1 
ATOM   1726   N N     A LEU A  1 233 ? 60.128  -25.628 33.875  0.25 20.10  ? 233  LEU A N     1 
ATOM   1727   C CA    A LEU A  1 233 ? 60.565  -26.225 35.122  0.25 21.12  ? 233  LEU A CA    1 
ATOM   1728   C C     A LEU A  1 233 ? 60.211  -25.328 36.327  0.25 21.22  ? 233  LEU A C     1 
ATOM   1729   O O     A LEU A  1 233 ? 59.796  -25.828 37.379  0.25 22.52  ? 233  LEU A O     1 
ATOM   1730   C CB    A LEU A  1 233 ? 62.081  -26.476 35.087  0.25 22.90  ? 233  LEU A CB    1 
ATOM   1731   C CG    A LEU A  1 233 ? 62.544  -27.578 34.133  0.25 23.76  ? 233  LEU A CG    1 
ATOM   1732   C CD1   A LEU A  1 233 ? 64.055  -27.555 33.983  0.25 22.65  ? 233  LEU A CD1   1 
ATOM   1733   C CD2   A LEU A  1 233 ? 62.062  -28.918 34.671  0.25 17.24  ? 233  LEU A CD2   1 
ATOM   1734   N N     A LEU A  1 234 ? 60.380  -24.020 36.173  0.25 22.37  ? 234  LEU A N     1 
ATOM   1735   C CA    A LEU A  1 234 ? 60.059  -23.089 37.252  0.25 23.78  ? 234  LEU A CA    1 
ATOM   1736   C C     A LEU A  1 234 ? 58.584  -23.224 37.635  0.25 23.17  ? 234  LEU A C     1 
ATOM   1737   O O     A LEU A  1 234 ? 58.232  -23.227 38.813  0.25 23.29  ? 234  LEU A O     1 
ATOM   1738   C CB    A LEU A  1 234 ? 60.332  -21.643 36.823  0.25 21.94  ? 234  LEU A CB    1 
ATOM   1739   C CG    A LEU A  1 234 ? 60.026  -20.556 37.861  0.25 22.78  ? 234  LEU A CG    1 
ATOM   1740   C CD1   A LEU A  1 234 ? 60.787  -20.848 39.160  0.25 23.10  ? 234  LEU A CD1   1 
ATOM   1741   C CD2   A LEU A  1 234 ? 60.390  -19.182 37.301  0.25 21.85  ? 234  LEU A CD2   1 
ATOM   1742   N N     A THR A  1 235 ? 57.728  -23.336 36.629  0.25 22.28  ? 235  THR A N     1 
ATOM   1743   C CA    A THR A  1 235 ? 56.296  -23.488 36.885  0.25 23.79  ? 235  THR A CA    1 
ATOM   1744   C C     A THR A  1 235 ? 56.011  -24.807 37.612  0.25 22.40  ? 235  THR A C     1 
ATOM   1745   O O     A THR A  1 235 ? 55.172  -24.851 38.502  0.25 23.47  ? 235  THR A O     1 
ATOM   1746   C CB    A THR A  1 235 ? 55.511  -23.419 35.582  0.25 20.79  ? 235  THR A CB    1 
ATOM   1747   O OG1   A THR A  1 235 ? 55.833  -22.195 34.921  0.25 19.54  ? 235  THR A OG1   1 
ATOM   1748   C CG2   A THR A  1 235 ? 54.023  -23.455 35.843  0.25 23.49  ? 235  THR A CG2   1 
ATOM   1749   N N     A HIS A  1 236 ? 56.702  -25.883 37.230  0.25 23.50  ? 236  HIS A N     1 
ATOM   1750   C CA    A HIS A  1 236 ? 56.520  -27.175 37.891  0.25 22.61  ? 236  HIS A CA    1 
ATOM   1751   C C     A HIS A  1 236 ? 56.960  -27.050 39.350  0.25 23.93  ? 236  HIS A C     1 
ATOM   1752   O O     A HIS A  1 236 ? 56.297  -27.570 40.244  0.25 23.82  ? 236  HIS A O     1 
ATOM   1753   C CB    A HIS A  1 236 ? 57.361  -28.272 37.208  0.25 25.76  ? 236  HIS A CB    1 
ATOM   1754   C CG    A HIS A  1 236 ? 56.729  -28.845 35.974  0.25 25.16  ? 236  HIS A CG    1 
ATOM   1755   N ND1   A HIS A  1 236 ? 55.669  -29.726 36.023  0.25 23.09  ? 236  HIS A ND1   1 
ATOM   1756   C CD2   A HIS A  1 236 ? 56.989  -28.641 34.661  0.25 22.94  ? 236  HIS A CD2   1 
ATOM   1757   C CE1   A HIS A  1 236 ? 55.303  -30.039 34.793  0.25 24.85  ? 236  HIS A CE1   1 
ATOM   1758   N NE2   A HIS A  1 236 ? 56.089  -29.397 33.948  0.25 26.31  ? 236  HIS A NE2   1 
ATOM   1759   N N     A MET A  1 237 ? 58.073  -26.362 39.584  0.25 21.81  ? 237  MET A N     1 
ATOM   1760   C CA    A MET A  1 237 ? 58.589  -26.171 40.947  0.25 22.13  ? 237  MET A CA    1 
ATOM   1761   C C     A MET A  1 237 ? 57.583  -25.405 41.795  0.25 21.02  ? 237  MET A C     1 
ATOM   1762   O O     A MET A  1 237 ? 57.238  -25.819 42.898  0.25 21.14  ? 237  MET A O     1 
ATOM   1763   C CB    A MET A  1 237 ? 59.906  -25.369 40.939  0.25 19.06  ? 237  MET A CB    1 
ATOM   1764   C CG    A MET A  1 237 ? 61.125  -26.117 40.372  0.25 19.89  ? 237  MET A CG    1 
ATOM   1765   S SD    A MET A  1 237 ? 62.504  -24.988 40.071  0.25 20.20  ? 237  MET A SD    1 
ATOM   1766   C CE    A MET A  1 237 ? 63.021  -24.674 41.780  0.25 20.47  ? 237  MET A CE    1 
ATOM   1767   N N     A ILE A  1 238 ? 57.136  -24.270 41.285  0.25 20.89  ? 238  ILE A N     1 
ATOM   1768   C CA    A ILE A  1 238 ? 56.194  -23.439 42.021  0.25 21.54  ? 238  ILE A CA    1 
ATOM   1769   C C     A ILE A  1 238 ? 54.906  -24.219 42.280  0.25 22.23  ? 238  ILE A C     1 
ATOM   1770   O O     A ILE A  1 238 ? 54.320  -24.125 43.355  0.25 23.27  ? 238  ILE A O     1 
ATOM   1771   C CB    A ILE A  1 238 ? 55.905  -22.123 41.227  0.25 24.01  ? 238  ILE A CB    1 
ATOM   1772   C CG1   A ILE A  1 238 ? 57.169  -21.227 41.245  0.25 22.54  ? 238  ILE A CG1   1 
ATOM   1773   C CG2   A ILE A  1 238 ? 54.726  -21.362 41.867  0.25 21.77  ? 238  ILE A CG2   1 
ATOM   1774   C CD1   A ILE A  1 238 ? 57.113  -20.015 40.336  0.25 19.94  ? 238  ILE A CD1   1 
ATOM   1775   N N     A ALA A  1 239 ? 54.483  -25.016 41.301  0.25 22.48  ? 239  ALA A N     1 
ATOM   1776   C CA    A ALA A  1 239 ? 53.254  -25.796 41.439  0.25 23.37  ? 239  ALA A CA    1 
ATOM   1777   C C     A ALA A  1 239 ? 53.356  -26.758 42.613  0.25 23.05  ? 239  ALA A C     1 
ATOM   1778   O O     A ALA A  1 239 ? 52.392  -26.957 43.355  0.25 23.01  ? 239  ALA A O     1 
ATOM   1779   C CB    A ALA A  1 239 ? 52.974  -26.572 40.145  0.25 22.37  ? 239  ALA A CB    1 
ATOM   1780   N N     A LEU A  1 240 ? 54.533  -27.352 42.795  0.25 21.43  ? 240  LEU A N     1 
ATOM   1781   C CA    A LEU A  1 240 ? 54.738  -28.285 43.889  0.25 23.94  ? 240  LEU A CA    1 
ATOM   1782   C C     A LEU A  1 240 ? 54.621  -27.608 45.247  0.25 23.85  ? 240  LEU A C     1 
ATOM   1783   O O     A LEU A  1 240 ? 53.976  -28.124 46.151  0.25 24.65  ? 240  LEU A O     1 
ATOM   1784   C CB    A LEU A  1 240 ? 56.125  -28.958 43.783  0.25 21.98  ? 240  LEU A CB    1 
ATOM   1785   C CG    A LEU A  1 240 ? 56.464  -29.968 44.878  0.25 22.41  ? 240  LEU A CG    1 
ATOM   1786   C CD1   A LEU A  1 240 ? 55.464  -31.125 44.847  0.25 23.14  ? 240  LEU A CD1   1 
ATOM   1787   C CD2   A LEU A  1 240 ? 57.902  -30.520 44.666  0.25 27.58  ? 240  LEU A CD2   1 
ATOM   1788   N N     A ILE A  1 241 ? 55.273  -26.462 45.387  0.25 25.76  ? 241  ILE A N     1 
ATOM   1789   C CA    A ILE A  1 241 ? 55.267  -25.717 46.641  0.25 25.05  ? 241  ILE A CA    1 
ATOM   1790   C C     A ILE A  1 241 ? 53.916  -25.083 46.974  0.25 24.61  ? 241  ILE A C     1 
ATOM   1791   O O     A ILE A  1 241 ? 53.591  -24.895 48.137  0.25 23.93  ? 241  ILE A O     1 
ATOM   1792   C CB    A ILE A  1 241 ? 56.337  -24.599 46.617  0.25 24.08  ? 241  ILE A CB    1 
ATOM   1793   C CG1   A ILE A  1 241 ? 57.716  -25.192 46.284  0.25 24.36  ? 241  ILE A CG1   1 
ATOM   1794   C CG2   A ILE A  1 241 ? 56.378  -23.885 47.969  0.25 21.70  ? 241  ILE A CG2   1 
ATOM   1795   C CD1   A ILE A  1 241 ? 58.170  -26.284 47.255  0.25 22.17  ? 241  ILE A CD1   1 
ATOM   1796   N N     A THR A  1 242 ? 53.121  -24.784 45.955  0.25 25.53  ? 242  THR A N     1 
ATOM   1797   C CA    A THR A  1 242 ? 51.836  -24.123 46.166  0.25 23.20  ? 242  THR A CA    1 
ATOM   1798   C C     A THR A  1 242 ? 50.627  -25.034 46.069  0.25 25.91  ? 242  THR A C     1 
ATOM   1799   O O     A THR A  1 242 ? 49.482  -24.565 46.128  0.25 25.87  ? 242  THR A O     1 
ATOM   1800   C CB    A THR A  1 242 ? 51.639  -22.972 45.159  0.25 21.83  ? 242  THR A CB    1 
ATOM   1801   O OG1   A THR A  1 242 ? 51.623  -23.503 43.828  0.25 20.77  ? 242  THR A OG1   1 
ATOM   1802   C CG2   A THR A  1 242 ? 52.757  -21.943 45.293  0.25 20.00  ? 242  THR A CG2   1 
ATOM   1803   N N     A ASP A  1 243 ? 50.870  -26.328 45.911  0.25 27.37  ? 243  ASP A N     1 
ATOM   1804   C CA    A ASP A  1 243 ? 49.780  -27.289 45.808  0.25 30.31  ? 243  ASP A CA    1 
ATOM   1805   C C     A ASP A  1 243 ? 48.880  -27.005 44.614  0.25 29.35  ? 243  ASP A C     1 
ATOM   1806   O O     A ASP A  1 243 ? 47.650  -27.151 44.699  0.25 29.09  ? 243  ASP A O     1 
ATOM   1807   C CB    A ASP A  1 243 ? 48.952  -27.291 47.106  0.25 31.51  ? 243  ASP A CB    1 
ATOM   1808   C CG    A ASP A  1 243 ? 49.683  -27.956 48.248  0.25 34.16  ? 243  ASP A CG    1 
ATOM   1809   O OD1   A ASP A  1 243 ? 49.386  -27.647 49.414  0.25 38.54  ? 243  ASP A OD1   1 
ATOM   1810   O OD2   A ASP A  1 243 ? 50.558  -28.808 47.978  0.25 38.36  ? 243  ASP A OD2   1 
ATOM   1811   N N     A THR A  1 244 ? 49.483  -26.568 43.512  0.25 24.80  ? 244  THR A N     1 
ATOM   1812   C CA    A THR A  1 244 ? 48.719  -26.318 42.295  0.25 24.90  ? 244  THR A CA    1 
ATOM   1813   C C     A THR A  1 244 ? 49.178  -27.298 41.210  0.25 26.30  ? 244  THR A C     1 
ATOM   1814   O O     A THR A  1 244 ? 50.182  -27.991 41.381  0.25 27.79  ? 244  THR A O     1 
ATOM   1815   C CB    A THR A  1 244 ? 48.864  -24.862 41.798  0.25 26.34  ? 244  THR A CB    1 
ATOM   1816   O OG1   A THR A  1 244 ? 50.254  -24.514 41.668  0.25 24.45  ? 244  THR A OG1   1 
ATOM   1817   C CG2   A THR A  1 244 ? 48.178  -23.902 42.780  0.25 23.24  ? 244  THR A CG2   1 
ATOM   1818   N N     A GLU A  1 245 ? 48.432  -27.373 40.116  0.25 25.23  ? 245  GLU A N     1 
ATOM   1819   C CA    A GLU A  1 245 ? 48.740  -28.292 39.029  0.25 26.85  ? 245  GLU A CA    1 
ATOM   1820   C C     A GLU A  1 245 ? 49.216  -27.510 37.814  0.25 26.39  ? 245  GLU A C     1 
ATOM   1821   O O     A GLU A  1 245 ? 48.496  -26.670 37.278  0.25 25.23  ? 245  GLU A O     1 
ATOM   1822   C CB    A GLU A  1 245 ? 47.480  -29.108 38.676  0.25 28.00  ? 245  GLU A CB    1 
ATOM   1823   C CG    A GLU A  1 245 ? 47.616  -30.074 37.527  0.25 32.72  ? 245  GLU A CG    1 
ATOM   1824   C CD    A GLU A  1 245 ? 48.623  -31.179 37.811  0.25 38.85  ? 245  GLU A CD    1 
ATOM   1825   O OE1   A GLU A  1 245 ? 48.722  -31.606 38.983  0.25 41.09  ? 245  GLU A OE1   1 
ATOM   1826   O OE2   A GLU A  1 245 ? 49.305  -31.637 36.863  0.25 41.70  ? 245  GLU A OE2   1 
ATOM   1827   N N     A PRO A  1 246 ? 50.443  -27.777 37.358  0.25 27.63  ? 246  PRO A N     1 
ATOM   1828   C CA    A PRO A  1 246 ? 50.947  -27.051 36.188  0.25 28.43  ? 246  PRO A CA    1 
ATOM   1829   C C     A PRO A  1 246 ? 49.994  -27.232 35.024  0.25 28.09  ? 246  PRO A C     1 
ATOM   1830   O O     A PRO A  1 246 ? 49.498  -28.332 34.774  0.25 30.18  ? 246  PRO A O     1 
ATOM   1831   C CB    A PRO A  1 246 ? 52.330  -27.664 35.955  0.25 28.96  ? 246  PRO A CB    1 
ATOM   1832   C CG    A PRO A  1 246 ? 52.234  -29.001 36.583  0.25 33.91  ? 246  PRO A CG    1 
ATOM   1833   C CD    A PRO A  1 246 ? 51.401  -28.792 37.815  0.25 29.91  ? 246  PRO A CD    1 
ATOM   1834   N N     A HIS A  1 247 ? 49.717  -26.148 34.308  0.25 29.44  ? 247  HIS A N     1 
ATOM   1835   C CA    A HIS A  1 247 ? 48.777  -26.222 33.198  0.25 26.56  ? 247  HIS A CA    1 
ATOM   1836   C C     A HIS A  1 247 ? 49.343  -25.793 31.853  0.25 26.07  ? 247  HIS A C     1 
ATOM   1837   O O     A HIS A  1 247 ? 49.387  -26.580 30.925  0.25 25.93  ? 247  HIS A O     1 
ATOM   1838   C CB    A HIS A  1 247 ? 47.525  -25.379 33.531  0.25 24.47  ? 247  HIS A CB    1 
ATOM   1839   C CG    A HIS A  1 247 ? 46.504  -25.359 32.440  0.25 25.62  ? 247  HIS A CG    1 
ATOM   1840   N ND1   A HIS A  1 247 ? 45.949  -26.510 31.923  0.25 28.67  ? 247  HIS A ND1   1 
ATOM   1841   C CD2   A HIS A  1 247 ? 45.948  -24.333 31.752  0.25 26.41  ? 247  HIS A CD2   1 
ATOM   1842   C CE1   A HIS A  1 247 ? 45.098  -26.194 30.961  0.25 26.21  ? 247  HIS A CE1   1 
ATOM   1843   N NE2   A HIS A  1 247 ? 45.079  -24.878 30.839  0.25 26.19  ? 247  HIS A NE2   1 
ATOM   1844   N N     A GLU A  1 248 ? 49.783  -24.545 31.741  0.25 25.48  ? 248  GLU A N     1 
ATOM   1845   C CA    A GLU A  1 248 ? 50.284  -24.067 30.453  0.25 26.55  ? 248  GLU A CA    1 
ATOM   1846   C C     A GLU A  1 248 ? 51.417  -23.063 30.598  0.25 25.62  ? 248  GLU A C     1 
ATOM   1847   O O     A GLU A  1 248 ? 51.483  -22.318 31.577  0.25 26.38  ? 248  GLU A O     1 
ATOM   1848   C CB    A GLU A  1 248 ? 49.128  -23.409 29.692  0.25 27.22  ? 248  GLU A CB    1 
ATOM   1849   C CG    A GLU A  1 248 ? 49.403  -23.041 28.252  0.25 34.76  ? 248  GLU A CG    1 
ATOM   1850   C CD    A GLU A  1 248 ? 48.178  -22.411 27.583  0.25 37.70  ? 248  GLU A CD    1 
ATOM   1851   O OE1   A GLU A  1 248 ? 48.168  -22.277 26.337  0.25 40.38  ? 248  GLU A OE1   1 
ATOM   1852   O OE2   A GLU A  1 248 ? 47.235  -22.035 28.315  0.25 38.52  ? 248  GLU A OE2   1 
ATOM   1853   N N     A PHE A  1 249 ? 52.304  -23.047 29.615  0.25 23.46  ? 249  PHE A N     1 
ATOM   1854   C CA    A PHE A  1 249 ? 53.406  -22.092 29.602  0.25 22.67  ? 249  PHE A CA    1 
ATOM   1855   C C     A PHE A  1 249 ? 53.337  -21.371 28.269  0.25 23.16  ? 249  PHE A C     1 
ATOM   1856   O O     A PHE A  1 249 ? 53.304  -22.009 27.213  0.25 24.82  ? 249  PHE A O     1 
ATOM   1857   C CB    A PHE A  1 249 ? 54.771  -22.793 29.739  0.25 24.57  ? 249  PHE A CB    1 
ATOM   1858   C CG    A PHE A  1 249 ? 55.931  -21.898 29.409  0.25 24.16  ? 249  PHE A CG    1 
ATOM   1859   C CD1   A PHE A  1 249 ? 56.087  -20.673 30.068  0.25 21.92  ? 249  PHE A CD1   1 
ATOM   1860   C CD2   A PHE A  1 249 ? 56.823  -22.239 28.401  0.25 23.50  ? 249  PHE A CD2   1 
ATOM   1861   C CE1   A PHE A  1 249 ? 57.111  -19.791 29.720  0.25 21.31  ? 249  PHE A CE1   1 
ATOM   1862   C CE2   A PHE A  1 249 ? 57.857  -21.367 28.036  0.25 25.60  ? 249  PHE A CE2   1 
ATOM   1863   C CZ    A PHE A  1 249 ? 58.000  -20.135 28.699  0.25 24.64  ? 249  PHE A CZ    1 
ATOM   1864   N N     A ILE A  1 250 ? 53.315  -20.043 28.316  0.25 22.82  ? 250  ILE A N     1 
ATOM   1865   C CA    A ILE A  1 250 ? 53.239  -19.226 27.117  0.25 20.73  ? 250  ILE A CA    1 
ATOM   1866   C C     A ILE A  1 250 ? 54.509  -18.372 27.024  0.25 21.24  ? 250  ILE A C     1 
ATOM   1867   O O     A ILE A  1 250 ? 54.960  -17.753 28.015  0.25 20.44  ? 250  ILE A O     1 
ATOM   1868   C CB    A ILE A  1 250 ? 52.015  -18.258 27.140  0.25 20.48  ? 250  ILE A CB    1 
ATOM   1869   C CG1   A ILE A  1 250 ? 50.702  -19.049 27.344  0.25 24.46  ? 250  ILE A CG1   1 
ATOM   1870   C CG2   A ILE A  1 250 ? 51.957  -17.467 25.856  0.25 18.82  ? 250  ILE A CG2   1 
ATOM   1871   C CD1   A ILE A  1 250 ? 50.432  -19.437 28.788  0.25 24.05  ? 250  ILE A CD1   1 
ATOM   1872   N N     A LEU A  1 251 ? 55.067  -18.316 25.828  0.25 19.97  ? 251  LEU A N     1 
ATOM   1873   C CA    A LEU A  1 251 ? 56.279  -17.543 25.614  0.25 21.74  ? 251  LEU A CA    1 
ATOM   1874   C C     A LEU A  1 251 ? 56.115  -16.538 24.484  0.25 21.63  ? 251  LEU A C     1 
ATOM   1875   O O     A LEU A  1 251 ? 55.947  -16.926 23.332  0.25 22.00  ? 251  LEU A O     1 
ATOM   1876   C CB    A LEU A  1 251 ? 57.436  -18.492 25.317  0.25 22.40  ? 251  LEU A CB    1 
ATOM   1877   C CG    A LEU A  1 251 ? 58.773  -17.887 24.869  0.25 28.50  ? 251  LEU A CG    1 
ATOM   1878   C CD1   A LEU A  1 251 ? 59.194  -16.807 25.782  0.25 27.52  ? 251  LEU A CD1   1 
ATOM   1879   C CD2   A LEU A  1 251 ? 59.835  -19.002 24.836  0.25 30.29  ? 251  LEU A CD2   1 
ATOM   1880   N N     A GLN A  1 252 ? 56.154  -15.252 24.822  0.25 19.89  ? 252  GLN A N     1 
ATOM   1881   C CA    A GLN A  1 252 ? 56.029  -14.192 23.846  0.25 23.15  ? 252  GLN A CA    1 
ATOM   1882   C C     A GLN A  1 252 ? 57.409  -13.599 23.609  0.25 23.42  ? 252  GLN A C     1 
ATOM   1883   O O     A GLN A  1 252 ? 58.117  -13.227 24.542  0.25 20.36  ? 252  GLN A O     1 
ATOM   1884   C CB    A GLN A  1 252 ? 55.074  -13.096 24.353  0.25 26.48  ? 252  GLN A CB    1 
ATOM   1885   C CG    A GLN A  1 252 ? 55.024  -11.872 23.444  0.25 28.35  ? 252  GLN A CG    1 
ATOM   1886   C CD    A GLN A  1 252 ? 54.569  -12.210 22.049  0.25 31.20  ? 252  GLN A CD    1 
ATOM   1887   O OE1   A GLN A  1 252 ? 55.185  -11.793 21.060  0.25 32.26  ? 252  GLN A OE1   1 
ATOM   1888   N NE2   A GLN A  1 252 ? 53.476  -12.960 21.952  0.25 29.51  ? 252  GLN A NE2   1 
ATOM   1889   N N     A MET A  1 253 ? 57.771  -13.485 22.346  0.25 24.04  ? 253  MET A N     1 
ATOM   1890   C CA    A MET A  1 253 ? 59.085  -12.974 21.983  0.25 25.52  ? 253  MET A CA    1 
ATOM   1891   C C     A MET A  1 253 ? 59.045  -11.580 21.399  0.25 23.40  ? 253  MET A C     1 
ATOM   1892   O O     A MET A  1 253 ? 58.066  -11.192 20.756  0.25 23.74  ? 253  MET A O     1 
ATOM   1893   C CB    A MET A  1 253 ? 59.724  -13.901 20.940  0.25 21.95  ? 253  MET A CB    1 
ATOM   1894   C CG    A MET A  1 253 ? 59.922  -15.316 21.371  0.25 24.40  ? 253  MET A CG    1 
ATOM   1895   S SD    A MET A  1 253 ? 60.710  -16.317 20.031  0.25 26.63  ? 253  MET A SD    1 
ATOM   1896   C CE    A MET A  1 253 ? 60.295  -17.893 20.562  0.25 25.48  ? 253  MET A CE    1 
ATOM   1897   N N     A GLY A  1 254 ? 60.137  -10.846 21.599  0.25 22.83  ? 254  GLY A N     1 
ATOM   1898   C CA    A GLY A  1 254 ? 60.255  -9.513  21.042  0.25 21.11  ? 254  GLY A CA    1 
ATOM   1899   C C     A GLY A  1 254 ? 61.123  -9.671  19.809  0.25 21.35  ? 254  GLY A C     1 
ATOM   1900   O O     A GLY A  1 254 ? 60.630  -10.041 18.738  0.25 19.59  ? 254  GLY A O     1 
ATOM   1901   N N     A ASP A  1 255 ? 62.422  -9.419  19.950  0.25 20.67  ? 255  ASP A N     1 
ATOM   1902   C CA    A ASP A  1 255 ? 63.347  -9.566  18.819  0.25 21.63  ? 255  ASP A CA    1 
ATOM   1903   C C     A ASP A  1 255 ? 63.697  -11.049 18.716  0.25 24.54  ? 255  ASP A C     1 
ATOM   1904   O O     A ASP A  1 255 ? 64.525  -11.575 19.490  0.25 25.69  ? 255  ASP A O     1 
ATOM   1905   C CB    A ASP A  1 255 ? 64.607  -8.730  19.078  0.25 24.86  ? 255  ASP A CB    1 
ATOM   1906   C CG    A ASP A  1 255 ? 65.542  -8.683  17.886  0.25 22.83  ? 255  ASP A CG    1 
ATOM   1907   O OD1   A ASP A  1 255 ? 65.935  -7.566  17.518  0.25 25.82  ? 255  ASP A OD1   1 
ATOM   1908   O OD2   A ASP A  1 255 ? 65.882  -9.741  17.329  0.25 23.42  ? 255  ASP A OD2   1 
ATOM   1909   N N     A ALA A  1 256 ? 63.038  -11.738 17.787  0.25 24.88  ? 256  ALA A N     1 
ATOM   1910   C CA    A ALA A  1 256 ? 63.249  -13.170 17.584  0.25 24.06  ? 256  ALA A CA    1 
ATOM   1911   C C     A ALA A  1 256 ? 64.234  -13.316 16.440  0.25 24.46  ? 256  ALA A C     1 
ATOM   1912   O O     A ALA A  1 256 ? 63.920  -12.957 15.304  0.25 25.09  ? 256  ALA A O     1 
ATOM   1913   C CB    A ALA A  1 256 ? 61.913  -13.869 17.239  0.25 23.44  ? 256  ALA A CB    1 
ATOM   1914   N N     A HIS A  1 257 ? 65.412  -13.867 16.720  0.25 22.99  ? 257  HIS A N     1 
ATOM   1915   C CA    A HIS A  1 257 ? 66.432  -13.956 15.676  0.25 21.64  ? 257  HIS A CA    1 
ATOM   1916   C C     A HIS A  1 257 ? 67.226  -15.264 15.603  0.25 25.06  ? 257  HIS A C     1 
ATOM   1917   O O     A HIS A  1 257 ? 67.287  -16.065 16.554  0.25 23.78  ? 257  HIS A O     1 
ATOM   1918   C CB    A HIS A  1 257 ? 67.410  -12.785 15.844  0.25 22.81  ? 257  HIS A CB    1 
ATOM   1919   C CG    A HIS A  1 257 ? 68.005  -12.688 17.219  0.25 24.58  ? 257  HIS A CG    1 
ATOM   1920   N ND1   A HIS A  1 257 ? 67.421  -11.954 18.234  0.25 24.77  ? 257  HIS A ND1   1 
ATOM   1921   C CD2   A HIS A  1 257 ? 69.084  -13.298 17.772  0.25 23.20  ? 257  HIS A CD2   1 
ATOM   1922   C CE1   A HIS A  1 257 ? 68.110  -12.120 19.352  0.25 23.70  ? 257  HIS A CE1   1 
ATOM   1923   N NE2   A HIS A  1 257 ? 69.125  -12.932 19.098  0.25 24.73  ? 257  HIS A NE2   1 
ATOM   1924   N N     A VAL A  1 258 ? 67.839  -15.478 14.445  0.25 25.34  ? 258  VAL A N     1 
ATOM   1925   C CA    A VAL A  1 258 ? 68.669  -16.658 14.208  0.25 23.98  ? 258  VAL A CA    1 
ATOM   1926   C C     A VAL A  1 258 ? 70.020  -16.090 13.809  0.25 24.06  ? 258  VAL A C     1 
ATOM   1927   O O     A VAL A  1 258 ? 70.097  -15.348 12.833  0.25 26.97  ? 258  VAL A O     1 
ATOM   1928   C CB    A VAL A  1 258 ? 68.118  -17.503 13.027  0.25 24.47  ? 258  VAL A CB    1 
ATOM   1929   C CG1   A VAL A  1 258 ? 69.131  -18.569 12.620  0.25 20.22  ? 258  VAL A CG1   1 
ATOM   1930   C CG2   A VAL A  1 258 ? 66.798  -18.165 13.425  0.25 22.18  ? 258  VAL A CG2   1 
ATOM   1931   N N     A TYR A  1 259 ? 71.076  -16.398 14.560  0.25 22.82  ? 259  TYR A N     1 
ATOM   1932   C CA    A TYR A  1 259 ? 72.403  -15.896 14.188  0.25 24.80  ? 259  TYR A CA    1 
ATOM   1933   C C     A TYR A  1 259 ? 72.854  -16.453 12.853  0.25 22.83  ? 259  TYR A C     1 
ATOM   1934   O O     A TYR A  1 259 ? 72.508  -17.571 12.499  0.25 23.52  ? 259  TYR A O     1 
ATOM   1935   C CB    A TYR A  1 259 ? 73.441  -16.213 15.269  0.25 24.33  ? 259  TYR A CB    1 
ATOM   1936   C CG    A TYR A  1 259 ? 73.338  -15.257 16.440  0.25 24.48  ? 259  TYR A CG    1 
ATOM   1937   C CD1   A TYR A  1 259 ? 72.463  -15.507 17.504  0.25 25.39  ? 259  TYR A CD1   1 
ATOM   1938   C CD2   A TYR A  1 259 ? 74.076  -14.080 16.460  0.25 24.67  ? 259  TYR A CD2   1 
ATOM   1939   C CE1   A TYR A  1 259 ? 72.329  -14.597 18.564  0.25 22.25  ? 259  TYR A CE1   1 
ATOM   1940   C CE2   A TYR A  1 259 ? 73.955  -13.174 17.517  0.25 25.27  ? 259  TYR A CE2   1 
ATOM   1941   C CZ    A TYR A  1 259 ? 73.074  -13.448 18.566  0.25 22.53  ? 259  TYR A CZ    1 
ATOM   1942   O OH    A TYR A  1 259 ? 72.955  -12.563 19.611  0.25 23.71  ? 259  TYR A OH    1 
ATOM   1943   N N     A ARG A  1 260 ? 73.621  -15.654 12.119  0.25 28.42  ? 260  ARG A N     1 
ATOM   1944   C CA    A ARG A  1 260 ? 74.126  -16.032 10.802  0.25 31.66  ? 260  ARG A CA    1 
ATOM   1945   C C     A ARG A  1 260 ? 74.838  -17.375 10.815  0.25 30.90  ? 260  ARG A C     1 
ATOM   1946   O O     A ARG A  1 260 ? 74.631  -18.191 9.921   0.25 32.73  ? 260  ARG A O     1 
ATOM   1947   C CB    A ARG A  1 260 ? 75.082  -14.954 10.277  0.25 38.53  ? 260  ARG A CB    1 
ATOM   1948   C CG    A ARG A  1 260 ? 74.535  -13.532 10.373  0.25 46.34  ? 260  ARG A CG    1 
ATOM   1949   C CD    A ARG A  1 260 ? 73.353  -13.279 9.432   0.25 52.52  ? 260  ARG A CD    1 
ATOM   1950   N NE    A ARG A  1 260 ? 73.788  -12.752 8.140   0.25 58.36  ? 260  ARG A NE    1 
ATOM   1951   C CZ    A ARG A  1 260 ? 74.339  -11.552 7.970   0.25 60.13  ? 260  ARG A CZ    1 
ATOM   1952   N NH1   A ARG A  1 260 ? 74.519  -10.745 9.011   0.25 61.73  ? 260  ARG A NH1   1 
ATOM   1953   N NH2   A ARG A  1 260 ? 74.720  -11.159 6.759   0.25 60.77  ? 260  ARG A NH2   1 
ATOM   1954   N N     A ASP A  1 261 ? 75.666  -17.615 11.828  0.25 30.10  ? 261  ASP A N     1 
ATOM   1955   C CA    A ASP A  1 261 ? 76.396  -18.879 11.899  0.25 30.13  ? 261  ASP A CA    1 
ATOM   1956   C C     A ASP A  1 261 ? 75.566  -20.037 12.455  0.25 29.50  ? 261  ASP A C     1 
ATOM   1957   O O     A ASP A  1 261 ? 76.102  -21.113 12.727  0.25 29.32  ? 261  ASP A O     1 
ATOM   1958   C CB    A ASP A  1 261 ? 77.698  -18.704 12.706  0.25 29.46  ? 261  ASP A CB    1 
ATOM   1959   C CG    A ASP A  1 261 ? 77.461  -18.173 14.116  0.25 33.29  ? 261  ASP A CG    1 
ATOM   1960   O OD1   A ASP A  1 261 ? 76.395  -17.559 14.376  0.25 33.75  ? 261  ASP A OD1   1 
ATOM   1961   O OD2   A ASP A  1 261 ? 78.358  -18.351 14.968  0.25 31.37  ? 261  ASP A OD2   1 
ATOM   1962   N N     A HIS A  1 262 ? 74.259  -19.826 12.623  0.25 26.99  ? 262  HIS A N     1 
ATOM   1963   C CA    A HIS A  1 262 ? 73.387  -20.900 13.122  0.25 26.67  ? 262  HIS A CA    1 
ATOM   1964   C C     A HIS A  1 262 ? 72.479  -21.425 12.019  0.25 27.28  ? 262  HIS A C     1 
ATOM   1965   O O     A HIS A  1 262 ? 71.881  -22.491 12.160  0.25 27.23  ? 262  HIS A O     1 
ATOM   1966   C CB    A HIS A  1 262 ? 72.494  -20.402 14.280  0.25 26.04  ? 262  HIS A CB    1 
ATOM   1967   C CG    A HIS A  1 262 ? 73.231  -20.151 15.559  0.25 24.60  ? 262  HIS A CG    1 
ATOM   1968   N ND1   A HIS A  1 262 ? 72.598  -19.719 16.708  0.25 26.02  ? 262  HIS A ND1   1 
ATOM   1969   C CD2   A HIS A  1 262 ? 74.542  -20.292 15.879  0.25 23.98  ? 262  HIS A CD2   1 
ATOM   1970   C CE1   A HIS A  1 262 ? 73.488  -19.606 17.679  0.25 25.08  ? 262  HIS A CE1   1 
ATOM   1971   N NE2   A HIS A  1 262 ? 74.673  -19.949 17.202  0.25 24.14  ? 262  HIS A NE2   1 
ATOM   1972   N N     A VAL A  1 263 ? 72.367  -20.668 10.928  0.25 29.77  ? 263  VAL A N     1 
ATOM   1973   C CA    A VAL A  1 263 ? 71.484  -21.033 9.816   0.25 31.36  ? 263  VAL A CA    1 
ATOM   1974   C C     A VAL A  1 263 ? 71.698  -22.446 9.298   0.25 31.83  ? 263  VAL A C     1 
ATOM   1975   O O     A VAL A  1 263 ? 70.762  -23.250 9.249   0.25 31.50  ? 263  VAL A O     1 
ATOM   1976   C CB    A VAL A  1 263 ? 71.628  -20.031 8.636   0.25 32.68  ? 263  VAL A CB    1 
ATOM   1977   C CG1   A VAL A  1 263 ? 70.800  -20.506 7.434   0.25 32.22  ? 263  VAL A CG1   1 
ATOM   1978   C CG2   A VAL A  1 263 ? 71.153  -18.643 9.074   0.25 32.66  ? 263  VAL A CG2   1 
ATOM   1979   N N     A GLU A  1 264 ? 72.927  -22.763 8.905   0.25 32.54  ? 264  GLU A N     1 
ATOM   1980   C CA    A GLU A  1 264 ? 73.203  -24.108 8.396   0.25 31.85  ? 264  GLU A CA    1 
ATOM   1981   C C     A GLU A  1 264 ? 72.980  -25.202 9.435   0.25 29.87  ? 264  GLU A C     1 
ATOM   1982   O O     A GLU A  1 264 ? 72.368  -26.231 9.133   0.25 32.19  ? 264  GLU A O     1 
ATOM   1983   C CB    A GLU A  1 264 ? 74.627  -24.190 7.832   0.25 33.32  ? 264  GLU A CB    1 
ATOM   1984   C CG    A GLU A  1 264 ? 74.801  -23.365 6.565   0.25 40.34  ? 264  GLU A CG    1 
ATOM   1985   C CD    A GLU A  1 264 ? 73.724  -23.667 5.529   0.25 45.22  ? 264  GLU A CD    1 
ATOM   1986   O OE1   A GLU A  1 264 ? 73.564  -24.857 5.168   0.25 46.57  ? 264  GLU A OE1   1 
ATOM   1987   O OE2   A GLU A  1 264 ? 73.034  -22.719 5.080   0.25 47.13  ? 264  GLU A OE2   1 
ATOM   1988   N N     A PRO A  1 265 ? 73.483  -25.018 10.667  0.25 27.25  ? 265  PRO A N     1 
ATOM   1989   C CA    A PRO A  1 265 ? 73.259  -26.069 11.667  0.25 25.47  ? 265  PRO A CA    1 
ATOM   1990   C C     A PRO A  1 265 ? 71.760  -26.321 11.923  0.25 26.15  ? 265  PRO A C     1 
ATOM   1991   O O     A PRO A  1 265 ? 71.336  -27.444 12.148  0.25 29.24  ? 265  PRO A O     1 
ATOM   1992   C CB    A PRO A  1 265 ? 73.966  -25.521 12.905  0.25 24.50  ? 265  PRO A CB    1 
ATOM   1993   C CG    A PRO A  1 265 ? 75.120  -24.735 12.311  0.25 26.64  ? 265  PRO A CG    1 
ATOM   1994   C CD    A PRO A  1 265 ? 74.460  -24.021 11.148  0.25 27.11  ? 265  PRO A CD    1 
ATOM   1995   N N     A LEU A  1 266 ? 70.966  -25.261 11.902  0.25 26.88  ? 266  LEU A N     1 
ATOM   1996   C CA    A LEU A  1 266 ? 69.540  -25.368 12.159  0.25 27.17  ? 266  LEU A CA    1 
ATOM   1997   C C     A LEU A  1 266 ? 68.808  -26.076 11.020  0.25 30.06  ? 266  LEU A C     1 
ATOM   1998   O O     A LEU A  1 266 ? 67.815  -26.782 11.246  0.25 29.30  ? 266  LEU A O     1 
ATOM   1999   C CB    A LEU A  1 266 ? 68.956  -23.968 12.409  0.25 25.52  ? 266  LEU A CB    1 
ATOM   2000   C CG    A LEU A  1 266 ? 69.319  -23.323 13.771  0.25 27.78  ? 266  LEU A CG    1 
ATOM   2001   C CD1   A LEU A  1 266 ? 68.722  -21.911 13.895  0.25 26.10  ? 266  LEU A CD1   1 
ATOM   2002   C CD2   A LEU A  1 266 ? 68.794  -24.199 14.915  0.25 25.99  ? 266  LEU A CD2   1 
ATOM   2003   N N     A LYS A  1 267 ? 69.293  -25.903 9.796   0.25 30.68  ? 267  LYS A N     1 
ATOM   2004   C CA    A LYS A  1 267 ? 68.660  -26.566 8.659   0.25 33.55  ? 267  LYS A CA    1 
ATOM   2005   C C     A LYS A  1 267 ? 68.694  -28.067 8.874   0.25 33.28  ? 267  LYS A C     1 
ATOM   2006   O O     A LYS A  1 267 ? 67.757  -28.774 8.507   0.25 35.05  ? 267  LYS A O     1 
ATOM   2007   C CB    A LYS A  1 267 ? 69.370  -26.205 7.354   0.25 35.31  ? 267  LYS A CB    1 
ATOM   2008   C CG    A LYS A  1 267 ? 69.121  -24.779 6.903   0.25 38.68  ? 267  LYS A CG    1 
ATOM   2009   C CD    A LYS A  1 267 ? 69.838  -24.491 5.603   0.25 41.89  ? 267  LYS A CD    1 
ATOM   2010   C CE    A LYS A  1 267 ? 69.560  -23.076 5.134   0.25 45.47  ? 267  LYS A CE    1 
ATOM   2011   N NZ    A LYS A  1 267 ? 70.356  -22.760 3.913   0.25 47.66  ? 267  LYS A NZ    1 
ATOM   2012   N N     A THR A  1 268 ? 69.773  -28.555 9.486   0.25 33.00  ? 268  THR A N     1 
ATOM   2013   C CA    A THR A  1 268 ? 69.902  -29.977 9.776   0.25 30.79  ? 268  THR A CA    1 
ATOM   2014   C C     A THR A  1 268 ? 68.828  -30.388 10.792  0.25 30.81  ? 268  THR A C     1 
ATOM   2015   O O     A THR A  1 268 ? 68.200  -31.440 10.672  0.25 29.24  ? 268  THR A O     1 
ATOM   2016   C CB    A THR A  1 268 ? 71.289  -30.297 10.375  0.25 30.57  ? 268  THR A CB    1 
ATOM   2017   O OG1   A THR A  1 268 ? 72.299  -30.051 9.397   0.25 35.08  ? 268  THR A OG1   1 
ATOM   2018   C CG2   A THR A  1 268 ? 71.359  -31.738 10.805  0.25 31.77  ? 268  THR A CG2   1 
ATOM   2019   N N     A GLN A  1 269 ? 68.637  -29.554 11.808  0.25 30.33  ? 269  GLN A N     1 
ATOM   2020   C CA    A GLN A  1 269 ? 67.636  -29.838 12.836  0.25 29.80  ? 269  GLN A CA    1 
ATOM   2021   C C     A GLN A  1 269 ? 66.208  -29.800 12.263  0.25 26.88  ? 269  GLN A C     1 
ATOM   2022   O O     A GLN A  1 269 ? 65.358  -30.580 12.662  0.25 26.86  ? 269  GLN A O     1 
ATOM   2023   C CB    A GLN A  1 269 ? 67.763  -28.824 13.986  0.25 27.47  ? 269  GLN A CB    1 
ATOM   2024   C CG    A GLN A  1 269 ? 66.860  -29.138 15.180  0.25 27.29  ? 269  GLN A CG    1 
ATOM   2025   C CD    A GLN A  1 269 ? 67.147  -28.255 16.390  0.25 28.25  ? 269  GLN A CD    1 
ATOM   2026   O OE1   A GLN A  1 269 ? 66.415  -28.293 17.399  0.25 27.98  ? 269  GLN A OE1   1 
ATOM   2027   N NE2   A GLN A  1 269 ? 68.213  -27.470 16.307  0.25 22.38  ? 269  GLN A NE2   1 
ATOM   2028   N N     A LEU A  1 270 ? 65.953  -28.889 11.333  0.25 29.83  ? 270  LEU A N     1 
ATOM   2029   C CA    A LEU A  1 270 ? 64.617  -28.759 10.731  0.25 32.35  ? 270  LEU A CA    1 
ATOM   2030   C C     A LEU A  1 270 ? 64.139  -30.020 10.015  0.25 35.65  ? 270  LEU A C     1 
ATOM   2031   O O     A LEU A  1 270 ? 62.936  -30.213 9.817   0.25 34.84  ? 270  LEU A O     1 
ATOM   2032   C CB    A LEU A  1 270 ? 64.607  -27.591 9.752   0.25 34.27  ? 270  LEU A CB    1 
ATOM   2033   C CG    A LEU A  1 270 ? 64.790  -26.197 10.353  0.25 35.44  ? 270  LEU A CG    1 
ATOM   2034   C CD1   A LEU A  1 270 ? 64.866  -25.170 9.243   0.25 36.57  ? 270  LEU A CD1   1 
ATOM   2035   C CD2   A LEU A  1 270 ? 63.631  -25.891 11.271  0.25 35.74  ? 270  LEU A CD2   1 
ATOM   2036   N N     A GLU A  1 271 ? 65.078  -30.890 9.648   0.25 36.63  ? 271  GLU A N     1 
ATOM   2037   C CA    A GLU A  1 271 ? 64.744  -32.131 8.938   0.25 38.43  ? 271  GLU A CA    1 
ATOM   2038   C C     A GLU A  1 271 ? 64.267  -33.229 9.881   0.25 35.58  ? 271  GLU A C     1 
ATOM   2039   O O     A GLU A  1 271 ? 63.754  -34.247 9.443   0.25 34.04  ? 271  GLU A O     1 
ATOM   2040   C CB    A GLU A  1 271 ? 65.976  -32.657 8.182   0.25 41.83  ? 271  GLU A CB    1 
ATOM   2041   C CG    A GLU A  1 271 ? 66.555  -31.707 7.146   0.25 48.91  ? 271  GLU A CG    1 
ATOM   2042   C CD    A GLU A  1 271 ? 67.883  -32.213 6.591   0.25 53.76  ? 271  GLU A CD    1 
ATOM   2043   O OE1   A GLU A  1 271 ? 67.939  -33.382 6.156   0.25 57.61  ? 271  GLU A OE1   1 
ATOM   2044   O OE2   A GLU A  1 271 ? 68.872  -31.447 6.586   0.25 56.63  ? 271  GLU A OE2   1 
ATOM   2045   N N     A ARG A  1 272 ? 64.429  -33.016 11.178  0.25 33.20  ? 272  ARG A N     1 
ATOM   2046   C CA    A ARG A  1 272 ? 64.062  -34.028 12.158  0.25 30.34  ? 272  ARG A CA    1 
ATOM   2047   C C     A ARG A  1 272 ? 62.648  -33.946 12.698  0.25 30.43  ? 272  ARG A C     1 
ATOM   2048   O O     A ARG A  1 272 ? 62.130  -32.867 12.961  0.25 29.23  ? 272  ARG A O     1 
ATOM   2049   C CB    A ARG A  1 272 ? 65.048  -33.975 13.326  0.25 29.91  ? 272  ARG A CB    1 
ATOM   2050   C CG    A ARG A  1 272 ? 66.484  -34.252 12.920  0.25 31.74  ? 272  ARG A CG    1 
ATOM   2051   C CD    A ARG A  1 272 ? 67.439  -33.874 14.040  0.25 33.10  ? 272  ARG A CD    1 
ATOM   2052   N NE    A ARG A  1 272 ? 68.805  -34.252 13.725  0.25 30.74  ? 272  ARG A NE    1 
ATOM   2053   C CZ    A ARG A  1 272 ? 69.830  -34.109 14.557  0.25 33.76  ? 272  ARG A CZ    1 
ATOM   2054   N NH1   A ARG A  1 272 ? 71.036  -34.500 14.164  0.25 30.92  ? 272  ARG A NH1   1 
ATOM   2055   N NH2   A ARG A  1 272 ? 69.653  -33.574 15.773  0.25 27.46  ? 272  ARG A NH2   1 
ATOM   2056   N N     A GLU A  1 273 ? 62.052  -35.114 12.889  0.25 30.25  ? 273  GLU A N     1 
ATOM   2057   C CA    A GLU A  1 273 ? 60.707  -35.222 13.420  0.25 33.83  ? 273  GLU A CA    1 
ATOM   2058   C C     A GLU A  1 273 ? 60.774  -35.338 14.944  0.25 31.31  ? 273  GLU A C     1 
ATOM   2059   O O     A GLU A  1 273 ? 61.466  -36.194 15.482  0.25 31.62  ? 273  GLU A O     1 
ATOM   2060   C CB    A GLU A  1 273 ? 60.012  -36.448 12.825  0.25 35.42  ? 273  GLU A CB    1 
ATOM   2061   C CG    A GLU A  1 273 ? 58.640  -36.725 13.423  0.25 45.15  ? 273  GLU A CG    1 
ATOM   2062   C CD    A GLU A  1 273 ? 57.936  -37.909 12.759  0.25 48.55  ? 273  GLU A CD    1 
ATOM   2063   O OE1   A GLU A  1 273 ? 56.897  -38.360 13.285  0.25 53.07  ? 273  GLU A OE1   1 
ATOM   2064   O OE2   A GLU A  1 273 ? 58.418  -38.379 11.712  0.25 49.47  ? 273  GLU A OE2   1 
ATOM   2065   N N     A PRO A  1 274 ? 60.046  -34.471 15.655  0.25 31.36  ? 274  PRO A N     1 
ATOM   2066   C CA    A PRO A  1 274 ? 60.025  -34.474 17.121  0.25 29.44  ? 274  PRO A CA    1 
ATOM   2067   C C     A PRO A  1 274 ? 59.545  -35.780 17.738  0.25 29.32  ? 274  PRO A C     1 
ATOM   2068   O O     A PRO A  1 274 ? 58.731  -36.501 17.152  0.25 28.70  ? 274  PRO A O     1 
ATOM   2069   C CB    A PRO A  1 274 ? 59.073  -33.320 17.464  0.25 31.78  ? 274  PRO A CB    1 
ATOM   2070   C CG    A PRO A  1 274 ? 59.145  -32.429 16.264  0.25 33.54  ? 274  PRO A CG    1 
ATOM   2071   C CD    A PRO A  1 274 ? 59.183  -33.403 15.116  0.25 29.36  ? 274  PRO A CD    1 
ATOM   2072   N N     A ARG A  1 275 ? 60.067  -36.084 18.925  0.25 29.72  ? 275  ARG A N     1 
ATOM   2073   C CA    A ARG A  1 275 ? 59.669  -37.269 19.665  0.25 29.02  ? 275  ARG A CA    1 
ATOM   2074   C C     A ARG A  1 275 ? 58.762  -36.711 20.761  0.25 29.61  ? 275  ARG A C     1 
ATOM   2075   O O     A ARG A  1 275 ? 58.872  -35.525 21.102  0.25 29.32  ? 275  ARG A O     1 
ATOM   2076   C CB    A ARG A  1 275 ? 60.886  -37.951 20.320  0.25 30.65  ? 275  ARG A CB    1 
ATOM   2077   C CG    A ARG A  1 275 ? 61.650  -38.952 19.427  0.25 30.66  ? 275  ARG A CG    1 
ATOM   2078   C CD    A ARG A  1 275 ? 62.479  -38.267 18.364  0.25 30.76  ? 275  ARG A CD    1 
ATOM   2079   N NE    A ARG A  1 275 ? 63.165  -39.236 17.497  0.25 31.80  ? 275  ARG A NE    1 
ATOM   2080   C CZ    A ARG A  1 275 ? 64.251  -39.937 17.832  0.25 31.15  ? 275  ARG A CZ    1 
ATOM   2081   N NH1   A ARG A  1 275 ? 64.814  -39.796 19.030  0.25 30.07  ? 275  ARG A NH1   1 
ATOM   2082   N NH2   A ARG A  1 275 ? 64.777  -40.792 16.969  0.25 28.96  ? 275  ARG A NH2   1 
ATOM   2083   N N     A ASP A  1 276 ? 57.892  -37.544 21.325  0.25 28.15  ? 276  ASP A N     1 
ATOM   2084   C CA    A ASP A  1 276 ? 57.014  -37.065 22.389  0.25 28.78  ? 276  ASP A CA    1 
ATOM   2085   C C     A ASP A  1 276 ? 57.853  -36.469 23.514  0.25 28.89  ? 276  ASP A C     1 
ATOM   2086   O O     A ASP A  1 276 ? 58.899  -37.003 23.861  0.25 25.50  ? 276  ASP A O     1 
ATOM   2087   C CB    A ASP A  1 276 ? 56.163  -38.207 22.956  0.25 29.40  ? 276  ASP A CB    1 
ATOM   2088   C CG    A ASP A  1 276 ? 55.204  -38.789 21.930  0.25 32.72  ? 276  ASP A CG    1 
ATOM   2089   O OD1   A ASP A  1 276 ? 54.721  -38.044 21.054  0.25 35.24  ? 276  ASP A OD1   1 
ATOM   2090   O OD2   A ASP A  1 276 ? 54.919  -39.999 22.005  0.25 39.41  ? 276  ASP A OD2   1 
ATOM   2091   N N     A PHE A  1 277 ? 57.379  -35.365 24.089  0.25 28.55  ? 277  PHE A N     1 
ATOM   2092   C CA    A PHE A  1 277 ? 58.081  -34.712 25.192  0.25 24.55  ? 277  PHE A CA    1 
ATOM   2093   C C     A PHE A  1 277 ? 58.191  -35.633 26.403  0.25 24.70  ? 277  PHE A C     1 
ATOM   2094   O O     A PHE A  1 277 ? 57.336  -36.474 26.641  0.25 23.19  ? 277  PHE A O     1 
ATOM   2095   C CB    A PHE A  1 277 ? 57.357  -33.426 25.636  0.25 22.13  ? 277  PHE A CB    1 
ATOM   2096   C CG    A PHE A  1 277 ? 57.552  -32.241 24.709  0.25 23.63  ? 277  PHE A CG    1 
ATOM   2097   C CD1   A PHE A  1 277 ? 58.798  -31.978 24.121  0.25 19.61  ? 277  PHE A CD1   1 
ATOM   2098   C CD2   A PHE A  1 277 ? 56.503  -31.348 24.479  0.25 18.98  ? 277  PHE A CD2   1 
ATOM   2099   C CE1   A PHE A  1 277 ? 58.997  -30.852 23.322  0.25 21.20  ? 277  PHE A CE1   1 
ATOM   2100   C CE2   A PHE A  1 277 ? 56.692  -30.205 23.678  0.25 20.40  ? 277  PHE A CE2   1 
ATOM   2101   C CZ    A PHE A  1 277 ? 57.933  -29.955 23.098  0.25 21.99  ? 277  PHE A CZ    1 
ATOM   2102   N N     A PRO A  1 278 ? 59.271  -35.488 27.179  0.25 23.74  ? 278  PRO A N     1 
ATOM   2103   C CA    A PRO A  1 278 ? 59.491  -36.298 28.374  0.25 23.79  ? 278  PRO A CA    1 
ATOM   2104   C C     A PRO A  1 278 ? 58.584  -35.819 29.509  0.25 26.14  ? 278  PRO A C     1 
ATOM   2105   O O     A PRO A  1 278 ? 57.883  -34.811 29.379  0.25 23.86  ? 278  PRO A O     1 
ATOM   2106   C CB    A PRO A  1 278 ? 60.954  -36.045 28.691  0.25 23.75  ? 278  PRO A CB    1 
ATOM   2107   C CG    A PRO A  1 278 ? 61.136  -34.621 28.276  0.25 22.37  ? 278  PRO A CG    1 
ATOM   2108   C CD    A PRO A  1 278 ? 60.425  -34.603 26.928  0.25 24.05  ? 278  PRO A CD    1 
ATOM   2109   N N     A LYS A  1 279 ? 58.602  -36.546 30.618  0.25 27.50  ? 279  LYS A N     1 
ATOM   2110   C CA    A LYS A  1 279 ? 57.797  -36.167 31.766  0.25 30.23  ? 279  LYS A CA    1 
ATOM   2111   C C     A LYS A  1 279 ? 58.683  -35.873 32.958  0.25 30.05  ? 279  LYS A C     1 
ATOM   2112   O O     A LYS A  1 279 ? 59.787  -36.402 33.056  0.25 28.50  ? 279  LYS A O     1 
ATOM   2113   C CB    A LYS A  1 279 ? 56.797  -37.271 32.089  0.25 33.99  ? 279  LYS A CB    1 
ATOM   2114   C CG    A LYS A  1 279 ? 55.709  -37.379 31.019  0.25 39.23  ? 279  LYS A CG    1 
ATOM   2115   C CD    A LYS A  1 279 ? 54.576  -38.283 31.440  0.25 43.48  ? 279  LYS A CD    1 
ATOM   2116   C CE    A LYS A  1 279 ? 53.441  -38.224 30.410  0.25 46.37  ? 279  LYS A CE    1 
ATOM   2117   N NZ    A LYS A  1 279 ? 52.268  -39.057 30.795  0.25 49.36  ? 279  LYS A NZ    1 
ATOM   2118   N N     A LEU A  1 280 ? 58.207  -35.006 33.849  0.25 27.75  ? 280  LEU A N     1 
ATOM   2119   C CA    A LEU A  1 280 ? 58.976  -34.646 35.032  0.25 29.19  ? 280  LEU A CA    1 
ATOM   2120   C C     A LEU A  1 280 ? 58.384  -35.270 36.278  0.25 29.52  ? 280  LEU A C     1 
ATOM   2121   O O     A LEU A  1 280 ? 57.169  -35.235 36.467  0.25 30.28  ? 280  LEU A O     1 
ATOM   2122   C CB    A LEU A  1 280 ? 59.017  -33.126 35.202  0.25 26.83  ? 280  LEU A CB    1 
ATOM   2123   C CG    A LEU A  1 280 ? 59.653  -32.596 36.499  0.25 28.64  ? 280  LEU A CG    1 
ATOM   2124   C CD1   A LEU A  1 280 ? 61.184  -32.840 36.467  0.25 25.83  ? 280  LEU A CD1   1 
ATOM   2125   C CD2   A LEU A  1 280 ? 59.366  -31.109 36.653  0.25 24.82  ? 280  LEU A CD2   1 
ATOM   2126   N N     A LYS A  1 281 ? 59.245  -35.859 37.104  0.25 28.49  ? 281  LYS A N     1 
ATOM   2127   C CA    A LYS A  1 281 ? 58.831  -36.462 38.368  0.25 31.15  ? 281  LYS A CA    1 
ATOM   2128   C C     A LYS A  1 281 ? 59.789  -35.933 39.437  0.25 30.09  ? 281  LYS A C     1 
ATOM   2129   O O     A LYS A  1 281 ? 60.907  -35.542 39.111  0.25 29.76  ? 281  LYS A O     1 
ATOM   2130   C CB    A LYS A  1 281 ? 58.948  -37.977 38.295  0.25 34.68  ? 281  LYS A CB    1 
ATOM   2131   C CG    A LYS A  1 281 ? 58.192  -38.584 37.140  0.25 40.19  ? 281  LYS A CG    1 
ATOM   2132   C CD    A LYS A  1 281 ? 56.696  -38.348 37.281  0.25 45.88  ? 281  LYS A CD    1 
ATOM   2133   C CE    A LYS A  1 281 ? 55.928  -39.131 36.219  0.25 46.27  ? 281  LYS A CE    1 
ATOM   2134   N NZ    A LYS A  1 281 ? 54.469  -38.952 36.379  0.25 51.10  ? 281  LYS A NZ    1 
ATOM   2135   N N     A TRP A  1 282 ? 59.361  -35.929 40.696  0.25 28.47  ? 282  TRP A N     1 
ATOM   2136   C CA    A TRP A  1 282 ? 60.201  -35.430 41.785  0.25 29.23  ? 282  TRP A CA    1 
ATOM   2137   C C     A TRP A  1 282 ? 60.792  -36.589 42.576  0.25 30.76  ? 282  TRP A C     1 
ATOM   2138   O O     A TRP A  1 282 ? 60.092  -37.559 42.890  0.25 31.31  ? 282  TRP A O     1 
ATOM   2139   C CB    A TRP A  1 282 ? 59.390  -34.520 42.730  0.25 26.02  ? 282  TRP A CB    1 
ATOM   2140   C CG    A TRP A  1 282 ? 58.838  -33.282 42.082  0.25 26.80  ? 282  TRP A CG    1 
ATOM   2141   C CD1   A TRP A  1 282 ? 57.511  -32.957 41.919  0.25 25.66  ? 282  TRP A CD1   1 
ATOM   2142   C CD2   A TRP A  1 282 ? 59.587  -32.203 41.500  0.25 24.99  ? 282  TRP A CD2   1 
ATOM   2143   N NE1   A TRP A  1 282 ? 57.399  -31.749 41.276  0.25 25.57  ? 282  TRP A NE1   1 
ATOM   2144   C CE2   A TRP A  1 282 ? 58.652  -31.266 41.005  0.25 26.12  ? 282  TRP A CE2   1 
ATOM   2145   C CE3   A TRP A  1 282 ? 60.957  -31.941 41.347  0.25 25.23  ? 282  TRP A CE3   1 
ATOM   2146   C CZ2   A TRP A  1 282 ? 59.046  -30.081 40.361  0.25 26.76  ? 282  TRP A CZ2   1 
ATOM   2147   C CZ3   A TRP A  1 282 ? 61.353  -30.775 40.713  0.25 25.38  ? 282  TRP A CZ3   1 
ATOM   2148   C CH2   A TRP A  1 282 ? 60.400  -29.850 40.221  0.25 26.33  ? 282  TRP A CH2   1 
ATOM   2149   N N     A ALA A  1 283 ? 62.079  -36.486 42.898  0.25 30.01  ? 283  ALA A N     1 
ATOM   2150   C CA    A ALA A  1 283 ? 62.759  -37.538 43.649  0.25 30.79  ? 283  ALA A CA    1 
ATOM   2151   C C     A ALA A  1 283 ? 62.396  -37.471 45.122  0.25 30.92  ? 283  ALA A C     1 
ATOM   2152   O O     A ALA A  1 283 ? 62.630  -38.419 45.863  0.25 33.36  ? 283  ALA A O     1 
ATOM   2153   C CB    A ALA A  1 283 ? 64.282  -37.423 43.479  0.25 27.40  ? 283  ALA A CB    1 
ATOM   2154   N N     A ARG A  1 284 ? 61.839  -36.344 45.547  0.25 31.16  ? 284  ARG A N     1 
ATOM   2155   C CA    A ARG A  1 284 ? 61.442  -36.153 46.938  0.25 31.05  ? 284  ARG A CA    1 
ATOM   2156   C C     A ARG A  1 284 ? 60.050  -35.559 47.027  0.25 30.57  ? 284  ARG A C     1 
ATOM   2157   O O     A ARG A  1 284 ? 59.488  -35.116 46.031  0.25 30.18  ? 284  ARG A O     1 
ATOM   2158   C CB    A ARG A  1 284 ? 62.431  -35.236 47.657  0.25 32.26  ? 284  ARG A CB    1 
ATOM   2159   C CG    A ARG A  1 284 ? 63.778  -35.869 47.933  0.25 32.02  ? 284  ARG A CG    1 
ATOM   2160   C CD    A ARG A  1 284 ? 64.861  -34.850 47.841  0.25 34.38  ? 284  ARG A CD    1 
ATOM   2161   N NE    A ARG A  1 284 ? 65.001  -33.879 48.824  0.25 34.51  ? 284  ARG A NE    1 
ATOM   2162   C CZ    A ARG A  1 284 ? 65.288  -32.588 48.908  0.25 32.89  ? 284  ARG A CZ    1 
ATOM   2163   N NH1   A ARG A  1 284 ? 65.534  -31.657 47.986  0.25 30.31  ? 284  ARG A NH1   1 
ATOM   2164   N NH2   A ARG A  1 284 ? 65.443  -32.293 50.163  0.25 31.57  ? 284  ARG A NH2   1 
ATOM   2165   N N     A SER A  1 285 ? 59.494  -35.549 48.227  0.25 31.21  ? 285  SER A N     1 
ATOM   2166   C CA    A SER A  1 285 ? 58.151  -35.010 48.423  0.25 33.36  ? 285  SER A CA    1 
ATOM   2167   C C     A SER A  1 285 ? 58.174  -33.512 48.677  0.25 31.94  ? 285  SER A C     1 
ATOM   2168   O O     A SER A  1 285 ? 59.239  -32.917 48.914  0.25 31.52  ? 285  SER A O     1 
ATOM   2169   C CB    A SER A  1 285 ? 57.475  -35.703 49.614  0.25 34.40  ? 285  SER A CB    1 
ATOM   2170   O OG    A SER A  1 285 ? 58.162  -35.396 50.820  0.25 34.04  ? 285  SER A OG    1 
ATOM   2171   N N     A LYS A  1 286 ? 56.995  -32.903 48.621  0.25 32.50  ? 286  LYS A N     1 
ATOM   2172   C CA    A LYS A  1 286 ? 56.862  -31.475 48.883  0.25 33.91  ? 286  LYS A CA    1 
ATOM   2173   C C     A LYS A  1 286 ? 57.416  -31.135 50.269  0.25 34.67  ? 286  LYS A C     1 
ATOM   2174   O O     A LYS A  1 286 ? 58.137  -30.141 50.429  0.25 33.52  ? 286  LYS A O     1 
ATOM   2175   C CB    A LYS A  1 286 ? 55.388  -31.060 48.823  0.25 36.66  ? 286  LYS A CB    1 
ATOM   2176   C CG    A LYS A  1 286 ? 55.131  -29.627 49.299  0.25 37.53  ? 286  LYS A CG    1 
ATOM   2177   C CD    A LYS A  1 286 ? 53.650  -29.364 49.453  0.25 40.52  ? 286  LYS A CD    1 
ATOM   2178   C CE    A LYS A  1 286 ? 53.401  -28.011 50.055  0.25 39.12  ? 286  LYS A CE    1 
ATOM   2179   N NZ    A LYS A  1 286 ? 51.939  -27.784 50.243  0.25 44.73  ? 286  LYS A NZ    1 
ATOM   2180   N N     A GLU A  1 287 ? 57.061  -31.959 51.259  0.25 31.51  ? 287  GLU A N     1 
ATOM   2181   C CA    A GLU A  1 287 ? 57.507  -31.771 52.628  0.25 33.17  ? 287  GLU A CA    1 
ATOM   2182   C C     A GLU A  1 287 ? 59.021  -31.838 52.753  0.25 33.38  ? 287  GLU A C     1 
ATOM   2183   O O     A GLU A  1 287 ? 59.629  -31.043 53.471  0.25 34.27  ? 287  GLU A O     1 
ATOM   2184   C CB    A GLU A  1 287 ? 56.888  -32.827 53.548  0.25 35.44  ? 287  GLU A CB    1 
ATOM   2185   C CG    A GLU A  1 287 ? 55.372  -32.764 53.685  0.25 40.77  ? 287  GLU A CG    1 
ATOM   2186   C CD    A GLU A  1 287 ? 54.643  -33.009 52.372  0.25 44.52  ? 287  GLU A CD    1 
ATOM   2187   O OE1   A GLU A  1 287 ? 55.015  -33.946 51.627  0.25 43.91  ? 287  GLU A OE1   1 
ATOM   2188   O OE2   A GLU A  1 287 ? 53.682  -32.266 52.090  0.25 47.42  ? 287  GLU A OE2   1 
ATOM   2189   N N     A GLU A  1 288 ? 59.637  -32.792 52.067  0.25 31.08  ? 288  GLU A N     1 
ATOM   2190   C CA    A GLU A  1 288 ? 61.083  -32.922 52.135  0.25 31.52  ? 288  GLU A CA    1 
ATOM   2191   C C     A GLU A  1 288 ? 61.762  -31.727 51.492  0.25 29.17  ? 288  GLU A C     1 
ATOM   2192   O O     A GLU A  1 288 ? 62.720  -31.182 52.041  0.25 27.89  ? 288  GLU A O     1 
ATOM   2193   C CB    A GLU A  1 288 ? 61.536  -34.218 51.452  0.25 36.70  ? 288  GLU A CB    1 
ATOM   2194   C CG    A GLU A  1 288 ? 60.981  -35.481 52.089  0.25 42.25  ? 288  GLU A CG    1 
ATOM   2195   C CD    A GLU A  1 288 ? 61.379  -36.741 51.335  0.25 46.45  ? 288  GLU A CD    1 
ATOM   2196   O OE1   A GLU A  1 288 ? 61.031  -36.868 50.140  0.25 47.34  ? 288  GLU A OE1   1 
ATOM   2197   O OE2   A GLU A  1 288 ? 62.039  -37.607 51.946  0.25 51.34  ? 288  GLU A OE2   1 
ATOM   2198   N N     A ILE A  1 289 ? 61.282  -31.323 50.314  0.25 29.76  ? 289  ILE A N     1 
ATOM   2199   C CA    A ILE A  1 289 ? 61.855  -30.163 49.624  0.25 28.29  ? 289  ILE A CA    1 
ATOM   2200   C C     A ILE A  1 289 ? 61.608  -28.909 50.466  0.25 27.11  ? 289  ILE A C     1 
ATOM   2201   O O     A ILE A  1 289 ? 62.474  -28.037 50.582  0.25 24.08  ? 289  ILE A O     1 
ATOM   2202   C CB    A ILE A  1 289 ? 61.255  -30.027 48.214  0.25 28.39  ? 289  ILE A CB    1 
ATOM   2203   C CG1   A ILE A  1 289 ? 61.740  -31.209 47.366  0.25 28.41  ? 289  ILE A CG1   1 
ATOM   2204   C CG2   A ILE A  1 289 ? 61.691  -28.722 47.568  0.25 29.09  ? 289  ILE A CG2   1 
ATOM   2205   C CD1   A ILE A  1 289 ? 61.137  -31.284 45.981  0.25 30.40  ? 289  ILE A CD1   1 
ATOM   2206   N N     A GLY A  1 290 ? 60.427  -28.836 51.073  0.25 27.98  ? 290  GLY A N     1 
ATOM   2207   C CA    A GLY A  1 290 ? 60.105  -27.710 51.945  0.25 30.04  ? 290  GLY A CA    1 
ATOM   2208   C C     A GLY A  1 290 ? 59.565  -26.467 51.272  0.25 31.06  ? 290  GLY A C     1 
ATOM   2209   O O     A GLY A  1 290 ? 58.363  -26.197 51.340  0.25 31.07  ? 290  GLY A O     1 
ATOM   2210   N N     A ASP A  1 291 ? 60.448  -25.700 50.631  0.25 30.85  ? 291  ASP A N     1 
ATOM   2211   C CA    A ASP A  1 291 ? 60.044  -24.476 49.944  0.25 27.92  ? 291  ASP A CA    1 
ATOM   2212   C C     A ASP A  1 291 ? 60.821  -24.310 48.642  0.25 26.37  ? 291  ASP A C     1 
ATOM   2213   O O     A ASP A  1 291 ? 61.611  -25.183 48.268  0.25 25.17  ? 291  ASP A O     1 
ATOM   2214   C CB    A ASP A  1 291 ? 60.273  -23.263 50.846  0.25 31.13  ? 291  ASP A CB    1 
ATOM   2215   C CG    A ASP A  1 291 ? 61.695  -23.187 51.364  0.25 30.56  ? 291  ASP A CG    1 
ATOM   2216   O OD1   A ASP A  1 291 ? 62.633  -23.464 50.597  0.25 30.30  ? 291  ASP A OD1   1 
ATOM   2217   O OD2   A ASP A  1 291 ? 61.869  -22.841 52.546  0.25 35.97  ? 291  ASP A OD2   1 
ATOM   2218   N N     A ILE A  1 292 ? 60.610  -23.186 47.971  0.25 22.40  ? 292  ILE A N     1 
ATOM   2219   C CA    A ILE A  1 292 ? 61.249  -22.915 46.685  0.25 26.08  ? 292  ILE A CA    1 
ATOM   2220   C C     A ILE A  1 292 ? 62.785  -22.929 46.731  0.25 26.59  ? 292  ILE A C     1 
ATOM   2221   O O     A ILE A  1 292 ? 63.442  -23.070 45.704  0.25 25.85  ? 292  ILE A O     1 
ATOM   2222   C CB    A ILE A  1 292 ? 60.778  -21.549 46.119  0.25 24.26  ? 292  ILE A CB    1 
ATOM   2223   C CG1   A ILE A  1 292 ? 61.055  -21.473 44.621  0.25 24.50  ? 292  ILE A CG1   1 
ATOM   2224   C CG2   A ILE A  1 292 ? 61.488  -20.406 46.837  0.25 27.06  ? 292  ILE A CG2   1 
ATOM   2225   C CD1   A ILE A  1 292 ? 60.221  -22.441 43.791  0.25 22.01  ? 292  ILE A CD1   1 
ATOM   2226   N N     A ASP A  1 293 ? 63.347  -22.786 47.923  0.25 27.87  ? 293  ASP A N     1 
ATOM   2227   C CA    A ASP A  1 293 ? 64.793  -22.764 48.079  0.25 28.00  ? 293  ASP A CA    1 
ATOM   2228   C C     A ASP A  1 293 ? 65.360  -24.122 48.462  0.25 28.17  ? 293  ASP A C     1 
ATOM   2229   O O     A ASP A  1 293 ? 66.562  -24.251 48.669  0.25 26.04  ? 293  ASP A O     1 
ATOM   2230   C CB    A ASP A  1 293 ? 65.204  -21.744 49.152  0.25 29.34  ? 293  ASP A CB    1 
ATOM   2231   C CG    A ASP A  1 293 ? 64.958  -20.314 48.731  0.25 29.16  ? 293  ASP A CG    1 
ATOM   2232   O OD1   A ASP A  1 293 ? 65.547  -19.872 47.720  0.25 29.52  ? 293  ASP A OD1   1 
ATOM   2233   O OD2   A ASP A  1 293 ? 64.176  -19.629 49.431  0.25 29.42  ? 293  ASP A OD2   1 
ATOM   2234   N N     A GLY A  1 294 ? 64.497  -25.127 48.568  0.25 26.57  ? 294  GLY A N     1 
ATOM   2235   C CA    A GLY A  1 294 ? 64.963  -26.443 48.945  0.25 27.72  ? 294  GLY A CA    1 
ATOM   2236   C C     A GLY A  1 294 ? 65.217  -27.439 47.817  0.25 28.53  ? 294  GLY A C     1 
ATOM   2237   O O     A GLY A  1 294 ? 65.564  -28.578 48.100  0.25 32.18  ? 294  GLY A O     1 
ATOM   2238   N N     A PHE A  1 295 ? 65.054  -27.038 46.559  0.25 26.07  ? 295  PHE A N     1 
ATOM   2239   C CA    A PHE A  1 295 ? 65.279  -27.959 45.438  0.25 25.69  ? 295  PHE A CA    1 
ATOM   2240   C C     A PHE A  1 295 ? 66.763  -28.227 45.170  0.25 26.62  ? 295  PHE A C     1 
ATOM   2241   O O     A PHE A  1 295 ? 67.626  -27.366 45.400  0.25 23.29  ? 295  PHE A O     1 
ATOM   2242   C CB    A PHE A  1 295 ? 64.653  -27.419 44.147  0.25 24.55  ? 295  PHE A CB    1 
ATOM   2243   C CG    A PHE A  1 295 ? 63.156  -27.443 44.134  0.25 22.89  ? 295  PHE A CG    1 
ATOM   2244   C CD1   A PHE A  1 295 ? 62.418  -26.484 44.825  0.25 25.64  ? 295  PHE A CD1   1 
ATOM   2245   C CD2   A PHE A  1 295 ? 62.477  -28.423 43.428  0.25 23.30  ? 295  PHE A CD2   1 
ATOM   2246   C CE1   A PHE A  1 295 ? 61.016  -26.506 44.808  0.25 24.22  ? 295  PHE A CE1   1 
ATOM   2247   C CE2   A PHE A  1 295 ? 61.079  -28.461 43.404  0.25 22.03  ? 295  PHE A CE2   1 
ATOM   2248   C CZ    A PHE A  1 295 ? 60.346  -27.495 44.098  0.25 23.35  ? 295  PHE A CZ    1 
ATOM   2249   N N     A LYS A  1 296 ? 67.038  -29.426 44.660  0.25 29.09  ? 296  LYS A N     1 
ATOM   2250   C CA    A LYS A  1 296 ? 68.393  -29.865 44.313  0.25 29.80  ? 296  LYS A CA    1 
ATOM   2251   C C     A LYS A  1 296 ? 68.341  -30.471 42.918  0.25 28.68  ? 296  LYS A C     1 
ATOM   2252   O O     A LYS A  1 296 ? 67.312  -31.006 42.507  0.25 24.89  ? 296  LYS A O     1 
ATOM   2253   C CB    A LYS A  1 296 ? 68.892  -30.923 45.305  0.25 31.53  ? 296  LYS A CB    1 
ATOM   2254   C CG    A LYS A  1 296 ? 69.031  -30.425 46.737  0.25 38.01  ? 296  LYS A CG    1 
ATOM   2255   C CD    A LYS A  1 296 ? 69.311  -31.569 47.699  0.25 44.88  ? 296  LYS A CD    1 
ATOM   2256   C CE    A LYS A  1 296 ? 69.309  -31.084 49.147  0.25 49.02  ? 296  LYS A CE    1 
ATOM   2257   N NZ    A LYS A  1 296 ? 69.474  -32.205 50.122  0.25 53.13  ? 296  LYS A NZ    1 
ATOM   2258   N N     A VAL A  1 297 ? 69.460  -30.416 42.200  0.25 26.61  ? 297  VAL A N     1 
ATOM   2259   C CA    A VAL A  1 297 ? 69.491  -30.954 40.847  0.25 28.36  ? 297  VAL A CA    1 
ATOM   2260   C C     A VAL A  1 297 ? 68.930  -32.362 40.772  0.25 28.99  ? 297  VAL A C     1 
ATOM   2261   O O     A VAL A  1 297 ? 68.126  -32.666 39.891  0.25 28.51  ? 297  VAL A O     1 
ATOM   2262   C CB    A VAL A  1 297 ? 70.925  -30.966 40.264  0.25 30.34  ? 297  VAL A CB    1 
ATOM   2263   C CG1   A VAL A  1 297 ? 70.900  -31.579 38.865  0.25 32.01  ? 297  VAL A CG1   1 
ATOM   2264   C CG2   A VAL A  1 297 ? 71.470  -29.574 40.191  0.25 30.83  ? 297  VAL A CG2   1 
ATOM   2265   N N     A GLU A  1 298 ? 69.340  -33.216 41.710  0.25 28.83  ? 298  GLU A N     1 
ATOM   2266   C CA    A GLU A  1 298 ? 68.890  -34.599 41.747  0.25 29.40  ? 298  GLU A CA    1 
ATOM   2267   C C     A GLU A  1 298 ? 67.406  -34.784 42.019  0.25 30.50  ? 298  GLU A C     1 
ATOM   2268   O O     A GLU A  1 298 ? 66.880  -35.895 41.902  0.25 28.21  ? 298  GLU A O     1 
ATOM   2269   C CB    A GLU A  1 298 ? 69.704  -35.398 42.779  0.25 34.51  ? 298  GLU A CB    1 
ATOM   2270   C CG    A GLU A  1 298 ? 70.154  -34.580 43.974  0.25 40.34  ? 298  GLU A CG    1 
ATOM   2271   C CD    A GLU A  1 298 ? 71.392  -33.748 43.675  0.25 41.26  ? 298  GLU A CD    1 
ATOM   2272   O OE1   A GLU A  1 298 ? 71.621  -32.746 44.385  0.25 45.40  ? 298  GLU A OE1   1 
ATOM   2273   O OE2   A GLU A  1 298 ? 72.142  -34.113 42.745  0.25 44.39  ? 298  GLU A OE2   1 
ATOM   2274   N N     A ASP A  1 299 ? 66.709  -33.709 42.378  0.25 31.48  ? 299  ASP A N     1 
ATOM   2275   C CA    A ASP A  1 299 ? 65.282  -33.835 42.638  0.25 29.79  ? 299  ASP A CA    1 
ATOM   2276   C C     A ASP A  1 299 ? 64.518  -33.974 41.330  0.25 29.65  ? 299  ASP A C     1 
ATOM   2277   O O     A ASP A  1 299 ? 63.428  -34.561 41.288  0.25 29.85  ? 299  ASP A O     1 
ATOM   2278   C CB    A ASP A  1 299 ? 64.755  -32.608 43.387  0.25 30.73  ? 299  ASP A CB    1 
ATOM   2279   C CG    A ASP A  1 299 ? 65.192  -32.570 44.835  0.25 31.29  ? 299  ASP A CG    1 
ATOM   2280   O OD1   A ASP A  1 299 ? 65.188  -33.642 45.472  0.25 33.33  ? 299  ASP A OD1   1 
ATOM   2281   O OD2   A ASP A  1 299 ? 65.510  -31.464 45.345  0.25 28.85  ? 299  ASP A OD2   1 
ATOM   2282   N N     A PHE A  1 300 ? 65.095  -33.429 40.263  0.25 29.87  ? 300  PHE A N     1 
ATOM   2283   C CA    A PHE A  1 300 ? 64.464  -33.449 38.947  0.25 28.89  ? 300  PHE A CA    1 
ATOM   2284   C C     A PHE A  1 300 ? 64.652  -34.768 38.201  0.25 31.22  ? 300  PHE A C     1 
ATOM   2285   O O     A PHE A  1 300 ? 65.724  -35.022 37.631  0.25 33.12  ? 300  PHE A O     1 
ATOM   2286   C CB    A PHE A  1 300 ? 65.009  -32.305 38.079  0.25 27.01  ? 300  PHE A CB    1 
ATOM   2287   C CG    A PHE A  1 300 ? 64.745  -30.927 38.633  0.25 26.60  ? 300  PHE A CG    1 
ATOM   2288   C CD1   A PHE A  1 300 ? 65.429  -30.473 39.752  0.25 27.02  ? 300  PHE A CD1   1 
ATOM   2289   C CD2   A PHE A  1 300 ? 63.797  -30.080 38.036  0.25 21.91  ? 300  PHE A CD2   1 
ATOM   2290   C CE1   A PHE A  1 300 ? 65.179  -29.208 40.274  0.25 25.58  ? 300  PHE A CE1   1 
ATOM   2291   C CE2   A PHE A  1 300 ? 63.545  -28.820 38.554  0.25 20.70  ? 300  PHE A CE2   1 
ATOM   2292   C CZ    A PHE A  1 300 ? 64.232  -28.381 39.673  0.25 22.69  ? 300  PHE A CZ    1 
ATOM   2293   N N     A VAL A  1 301 ? 63.613  -35.598 38.199  0.25 29.62  ? 301  VAL A N     1 
ATOM   2294   C CA    A VAL A  1 301 ? 63.666  -36.873 37.498  0.25 31.46  ? 301  VAL A CA    1 
ATOM   2295   C C     A VAL A  1 301 ? 62.919  -36.798 36.168  0.25 30.45  ? 301  VAL A C     1 
ATOM   2296   O O     A VAL A  1 301 ? 61.697  -36.918 36.127  0.25 30.78  ? 301  VAL A O     1 
ATOM   2297   C CB    A VAL A  1 301 ? 63.056  -38.007 38.348  0.25 32.43  ? 301  VAL A CB    1 
ATOM   2298   C CG1   A VAL A  1 301 ? 63.177  -39.338 37.594  0.25 35.58  ? 301  VAL A CG1   1 
ATOM   2299   C CG2   A VAL A  1 301 ? 63.786  -38.103 39.680  0.25 29.67  ? 301  VAL A CG2   1 
ATOM   2300   N N     A VAL A  1 302 ? 63.665  -36.608 35.083  0.25 29.17  ? 302  VAL A N     1 
ATOM   2301   C CA    A VAL A  1 302 ? 63.075  -36.508 33.751  0.25 28.68  ? 302  VAL A CA    1 
ATOM   2302   C C     A VAL A  1 302 ? 63.101  -37.858 33.057  0.25 30.80  ? 302  VAL A C     1 
ATOM   2303   O O     A VAL A  1 302 ? 64.171  -38.412 32.768  0.25 30.32  ? 302  VAL A O     1 
ATOM   2304   C CB    A VAL A  1 302 ? 63.830  -35.463 32.898  0.25 29.54  ? 302  VAL A CB    1 
ATOM   2305   C CG1   A VAL A  1 302 ? 63.215  -35.357 31.515  0.25 28.51  ? 302  VAL A CG1   1 
ATOM   2306   C CG2   A VAL A  1 302 ? 63.785  -34.100 33.601  0.25 29.39  ? 302  VAL A CG2   1 
ATOM   2307   N N     A GLU A  1 303 ? 61.924  -38.402 32.788  0.25 30.87  ? 303  GLU A N     1 
ATOM   2308   C CA    A GLU A  1 303 ? 61.860  -39.706 32.146  0.25 32.33  ? 303  GLU A CA    1 
ATOM   2309   C C     A GLU A  1 303 ? 61.271  -39.658 30.746  0.25 28.94  ? 303  GLU A C     1 
ATOM   2310   O O     A GLU A  1 303 ? 60.428  -38.821 30.453  0.25 27.80  ? 303  GLU A O     1 
ATOM   2311   C CB    A GLU A  1 303 ? 61.067  -40.674 33.036  0.25 35.78  ? 303  GLU A CB    1 
ATOM   2312   C CG    A GLU A  1 303 ? 59.655  -40.253 33.321  0.25 39.62  ? 303  GLU A CG    1 
ATOM   2313   C CD    A GLU A  1 303 ? 59.109  -40.884 34.595  0.25 42.78  ? 303  GLU A CD    1 
ATOM   2314   O OE1   A GLU A  1 303 ? 57.891  -40.766 34.843  0.25 44.28  ? 303  GLU A OE1   1 
ATOM   2315   O OE2   A GLU A  1 303 ? 59.900  -41.486 35.354  0.25 44.34  ? 303  GLU A OE2   1 
ATOM   2316   N N     A GLY A  1 304 ? 61.749  -40.552 29.882  0.25 28.61  ? 304  GLY A N     1 
ATOM   2317   C CA    A GLY A  1 304 ? 61.250  -40.626 28.523  0.25 26.61  ? 304  GLY A CA    1 
ATOM   2318   C C     A GLY A  1 304 ? 61.848  -39.609 27.577  0.25 26.54  ? 304  GLY A C     1 
ATOM   2319   O O     A GLY A  1 304 ? 61.285  -39.346 26.517  0.25 27.28  ? 304  GLY A O     1 
ATOM   2320   N N     A TYR A  1 305 ? 62.976  -39.014 27.945  0.25 25.28  ? 305  TYR A N     1 
ATOM   2321   C CA    A TYR A  1 305 ? 63.588  -38.026 27.053  0.25 27.29  ? 305  TYR A CA    1 
ATOM   2322   C C     A TYR A  1 305 ? 64.325  -38.801 25.950  0.25 27.61  ? 305  TYR A C     1 
ATOM   2323   O O     A TYR A  1 305 ? 65.286  -39.516 26.232  0.25 27.58  ? 305  TYR A O     1 
ATOM   2324   C CB    A TYR A  1 305 ? 64.580  -37.131 27.824  0.25 21.79  ? 305  TYR A CB    1 
ATOM   2325   C CG    A TYR A  1 305 ? 65.161  -36.013 26.993  0.25 20.78  ? 305  TYR A CG    1 
ATOM   2326   C CD1   A TYR A  1 305 ? 66.504  -35.652 27.114  0.25 22.89  ? 305  TYR A CD1   1 
ATOM   2327   C CD2   A TYR A  1 305 ? 64.370  -35.312 26.071  0.25 17.97  ? 305  TYR A CD2   1 
ATOM   2328   C CE1   A TYR A  1 305 ? 67.048  -34.620 26.334  0.25 21.33  ? 305  TYR A CE1   1 
ATOM   2329   C CE2   A TYR A  1 305 ? 64.900  -34.298 25.302  0.25 22.71  ? 305  TYR A CE2   1 
ATOM   2330   C CZ    A TYR A  1 305 ? 66.240  -33.956 25.438  0.25 19.98  ? 305  TYR A CZ    1 
ATOM   2331   O OH    A TYR A  1 305 ? 66.758  -32.952 24.676  0.25 20.11  ? 305  TYR A OH    1 
ATOM   2332   N N     A LYS A  1 306 ? 63.885  -38.631 24.704  0.25 30.10  ? 306  LYS A N     1 
ATOM   2333   C CA    A LYS A  1 306 ? 64.475  -39.337 23.571  0.25 29.29  ? 306  LYS A CA    1 
ATOM   2334   C C     A LYS A  1 306 ? 64.783  -38.395 22.424  0.25 28.86  ? 306  LYS A C     1 
ATOM   2335   O O     A LYS A  1 306 ? 64.110  -38.394 21.397  0.25 31.95  ? 306  LYS A O     1 
ATOM   2336   C CB    A LYS A  1 306 ? 63.517  -40.432 23.113  0.25 31.49  ? 306  LYS A CB    1 
ATOM   2337   C CG    A LYS A  1 306 ? 63.244  -41.465 24.187  0.25 32.33  ? 306  LYS A CG    1 
ATOM   2338   C CD    A LYS A  1 306 ? 62.217  -42.498 23.742  0.25 37.68  ? 306  LYS A CD    1 
ATOM   2339   C CE    A LYS A  1 306 ? 61.996  -43.547 24.840  0.25 37.70  ? 306  LYS A CE    1 
ATOM   2340   N NZ    A LYS A  1 306 ? 60.957  -44.535 24.467  0.25 42.72  ? 306  LYS A NZ    1 
ATOM   2341   N N     A PRO A  1 307 ? 65.821  -37.575 22.585  0.25 27.18  ? 307  PRO A N     1 
ATOM   2342   C CA    A PRO A  1 307 ? 66.219  -36.617 21.561  0.25 26.53  ? 307  PRO A CA    1 
ATOM   2343   C C     A PRO A  1 307 ? 67.087  -37.179 20.435  0.25 28.76  ? 307  PRO A C     1 
ATOM   2344   O O     A PRO A  1 307 ? 67.635  -38.289 20.539  0.25 29.13  ? 307  PRO A O     1 
ATOM   2345   C CB    A PRO A  1 307 ? 66.986  -35.581 22.370  0.25 26.94  ? 307  PRO A CB    1 
ATOM   2346   C CG    A PRO A  1 307 ? 67.759  -36.476 23.339  0.25 25.65  ? 307  PRO A CG    1 
ATOM   2347   C CD    A PRO A  1 307 ? 66.668  -37.453 23.793  0.25 25.65  ? 307  PRO A CD    1 
ATOM   2348   N N     A TRP A  1 308 ? 67.197  -36.401 19.359  0.25 28.47  ? 308  TRP A N     1 
ATOM   2349   C CA    A TRP A  1 308 ? 68.071  -36.759 18.259  0.25 29.58  ? 308  TRP A CA    1 
ATOM   2350   C C     A TRP A  1 308 ? 69.460  -36.302 18.714  0.25 28.42  ? 308  TRP A C     1 
ATOM   2351   O O     A TRP A  1 308 ? 69.622  -35.860 19.858  0.25 27.26  ? 308  TRP A O     1 
ATOM   2352   C CB    A TRP A  1 308 ? 67.682  -36.025 16.987  0.25 28.54  ? 308  TRP A CB    1 
ATOM   2353   C CG    A TRP A  1 308 ? 66.416  -36.520 16.364  0.25 32.47  ? 308  TRP A CG    1 
ATOM   2354   C CD1   A TRP A  1 308 ? 65.143  -36.078 16.618  0.25 34.11  ? 308  TRP A CD1   1 
ATOM   2355   C CD2   A TRP A  1 308 ? 66.292  -37.570 15.397  0.25 32.44  ? 308  TRP A CD2   1 
ATOM   2356   N NE1   A TRP A  1 308 ? 64.235  -36.789 15.862  0.25 34.12  ? 308  TRP A NE1   1 
ATOM   2357   C CE2   A TRP A  1 308 ? 64.912  -37.711 15.108  0.25 33.22  ? 308  TRP A CE2   1 
ATOM   2358   C CE3   A TRP A  1 308 ? 67.212  -38.410 14.750  0.25 33.17  ? 308  TRP A CE3   1 
ATOM   2359   C CZ2   A TRP A  1 308 ? 64.428  -38.663 14.195  0.25 33.48  ? 308  TRP A CZ2   1 
ATOM   2360   C CZ3   A TRP A  1 308 ? 66.729  -39.364 13.838  0.25 35.12  ? 308  TRP A CZ3   1 
ATOM   2361   C CH2   A TRP A  1 308 ? 65.346  -39.477 13.573  0.25 36.67  ? 308  TRP A CH2   1 
ATOM   2362   N N     A GLY A  1 309 ? 70.441  -36.391 17.822  0.25 28.15  ? 309  GLY A N     1 
ATOM   2363   C CA    A GLY A  1 309 ? 71.800  -35.986 18.152  0.25 26.51  ? 309  GLY A CA    1 
ATOM   2364   C C     A GLY A  1 309 ? 71.982  -34.508 18.438  0.25 28.58  ? 309  GLY A C     1 
ATOM   2365   O O     A GLY A  1 309 ? 71.150  -33.676 18.088  0.25 26.25  ? 309  GLY A O     1 
ATOM   2366   N N     A LYS A  1 310 ? 73.093  -34.173 19.084  0.25 29.76  ? 310  LYS A N     1 
ATOM   2367   C CA    A LYS A  1 310 ? 73.387  -32.791 19.408  0.25 31.17  ? 310  LYS A CA    1 
ATOM   2368   C C     A LYS A  1 310 ? 73.716  -32.043 18.129  0.25 32.37  ? 310  LYS A C     1 
ATOM   2369   O O     A LYS A  1 310 ? 74.139  -32.639 17.128  0.25 33.09  ? 310  LYS A O     1 
ATOM   2370   C CB    A LYS A  1 310 ? 74.584  -32.699 20.361  0.25 31.59  ? 310  LYS A CB    1 
ATOM   2371   C CG    A LYS A  1 310 ? 75.921  -33.071 19.717  0.25 35.81  ? 310  LYS A CG    1 
ATOM   2372   C CD    A LYS A  1 310 ? 77.073  -32.911 20.706  0.25 37.57  ? 310  LYS A CD    1 
ATOM   2373   C CE    A LYS A  1 310 ? 78.386  -33.392 20.113  0.25 37.95  ? 310  LYS A CE    1 
ATOM   2374   N NZ    A LYS A  1 310 ? 78.807  -32.613 18.937  0.25 39.18  ? 310  LYS A NZ    1 
ATOM   2375   N N     A ILE A  1 311 ? 73.511  -30.735 18.168  0.25 31.23  ? 311  ILE A N     1 
ATOM   2376   C CA    A ILE A  1 311 ? 73.799  -29.877 17.039  0.25 32.93  ? 311  ILE A CA    1 
ATOM   2377   C C     A ILE A  1 311 ? 74.685  -28.753 17.561  0.25 32.66  ? 311  ILE A C     1 
ATOM   2378   O O     A ILE A  1 311 ? 74.260  -27.950 18.398  0.25 29.83  ? 311  ILE A O     1 
ATOM   2379   C CB    A ILE A  1 311 ? 72.502  -29.283 16.449  0.25 35.30  ? 311  ILE A CB    1 
ATOM   2380   C CG1   A ILE A  1 311 ? 71.656  -30.418 15.872  0.25 37.27  ? 311  ILE A CG1   1 
ATOM   2381   C CG2   A ILE A  1 311 ? 72.837  -28.230 15.388  0.25 33.14  ? 311  ILE A CG2   1 
ATOM   2382   C CD1   A ILE A  1 311 ? 70.379  -29.954 15.278  0.25 41.58  ? 311  ILE A CD1   1 
ATOM   2383   N N     A ASP A  1 312 ? 75.913  -28.706 17.064  0.25 31.96  ? 312  ASP A N     1 
ATOM   2384   C CA    A ASP A  1 312 ? 76.867  -27.694 17.493  0.25 32.49  ? 312  ASP A CA    1 
ATOM   2385   C C     A ASP A  1 312 ? 76.561  -26.304 16.968  0.25 29.50  ? 312  ASP A C     1 
ATOM   2386   O O     A ASP A  1 312 ? 76.380  -26.104 15.774  0.25 29.60  ? 312  ASP A O     1 
ATOM   2387   C CB    A ASP A  1 312 ? 78.284  -28.095 17.061  0.25 35.58  ? 312  ASP A CB    1 
ATOM   2388   C CG    A ASP A  1 312 ? 78.691  -29.460 17.590  0.25 39.43  ? 312  ASP A CG    1 
ATOM   2389   O OD1   A ASP A  1 312 ? 78.405  -29.758 18.771  0.25 39.31  ? 312  ASP A OD1   1 
ATOM   2390   O OD2   A ASP A  1 312 ? 79.317  -30.232 16.826  0.25 43.43  ? 312  ASP A OD2   1 
ATOM   2391   N N     A MET A  1 313 ? 76.507  -25.339 17.879  0.25 29.37  ? 313  MET A N     1 
ATOM   2392   C CA    A MET A  1 313 ? 76.267  -23.952 17.519  0.25 27.50  ? 313  MET A CA    1 
ATOM   2393   C C     A MET A  1 313 ? 77.100  -23.079 18.437  0.25 27.42  ? 313  MET A C     1 
ATOM   2394   O O     A MET A  1 313 ? 77.101  -23.256 19.658  0.25 27.14  ? 313  MET A O     1 
ATOM   2395   C CB    A MET A  1 313 ? 74.780  -23.607 17.641  0.25 26.98  ? 313  MET A CB    1 
ATOM   2396   C CG    A MET A  1 313 ? 73.923  -24.209 16.518  0.25 27.66  ? 313  MET A CG    1 
ATOM   2397   S SD    A MET A  1 313 ? 72.162  -23.680 16.551  0.25 27.66  ? 313  MET A SD    1 
ATOM   2398   C CE    A MET A  1 313 ? 71.477  -24.977 17.519  0.25 21.70  ? 313  MET A CE    1 
ATOM   2399   N N     A LYS A  1 314 ? 77.829  -22.141 17.842  0.25 29.58  ? 314  LYS A N     1 
ATOM   2400   C CA    A LYS A  1 314 ? 78.670  -21.242 18.610  0.25 29.76  ? 314  LYS A CA    1 
ATOM   2401   C C     A LYS A  1 314 ? 77.865  -20.073 19.159  0.25 32.20  ? 314  LYS A C     1 
ATOM   2402   O O     A LYS A  1 314 ? 77.015  -19.516 18.457  0.25 30.34  ? 314  LYS A O     1 
ATOM   2403   C CB    A LYS A  1 314 ? 79.799  -20.707 17.735  0.25 32.17  ? 314  LYS A CB    1 
ATOM   2404   C CG    A LYS A  1 314 ? 80.698  -19.710 18.449  0.25 36.96  ? 314  LYS A CG    1 
ATOM   2405   C CD    A LYS A  1 314 ? 81.724  -19.111 17.492  0.25 41.71  ? 314  LYS A CD    1 
ATOM   2406   C CE    A LYS A  1 314 ? 82.538  -18.023 18.187  0.25 45.04  ? 314  LYS A CE    1 
ATOM   2407   N NZ    A LYS A  1 314 ? 83.510  -17.370 17.262  0.25 50.26  ? 314  LYS A NZ    1 
ATOM   2408   N N     A MET A  1 315 ? 78.136  -19.700 20.416  0.25 31.74  ? 315  MET A N     1 
ATOM   2409   C CA    A MET A  1 315 ? 77.447  -18.578 21.036  0.25 30.61  ? 315  MET A CA    1 
ATOM   2410   C C     A MET A  1 315 ? 78.218  -17.301 20.757  0.25 32.05  ? 315  MET A C     1 
ATOM   2411   O O     A MET A  1 315 ? 79.443  -17.272 20.870  0.25 31.69  ? 315  MET A O     1 
ATOM   2412   C CB    A MET A  1 315 ? 77.341  -18.753 22.542  0.25 32.00  ? 315  MET A CB    1 
ATOM   2413   C CG    A MET A  1 315 ? 76.415  -17.712 23.185  0.25 31.58  ? 315  MET A CG    1 
ATOM   2414   S SD    A MET A  1 315 ? 76.649  -17.537 24.963  0.25 37.29  ? 315  MET A SD    1 
ATOM   2415   C CE    A MET A  1 315 ? 77.819  -16.201 25.014  0.25 31.59  ? 315  MET A CE    1 
ATOM   2416   N N     A SER A  1 316 ? 77.505  -16.244 20.375  0.25 30.22  ? 316  SER A N     1 
ATOM   2417   C CA    A SER A  1 316 ? 78.146  -14.968 20.106  0.25 28.28  ? 316  SER A CA    1 
ATOM   2418   C C     A SER A  1 316 ? 78.095  -14.142 21.380  0.25 31.02  ? 316  SER A C     1 
ATOM   2419   O O     A SER A  1 316 ? 77.003  -13.820 21.882  0.25 30.08  ? 316  SER A O     1 
ATOM   2420   C CB    A SER A  1 316 ? 77.427  -14.249 18.967  0.25 28.59  ? 316  SER A CB    1 
ATOM   2421   O OG    A SER A  1 316 ? 77.516  -14.982 17.750  0.25 28.19  ? 316  SER A OG    1 
ATOM   2422   N N     A ALA A  1 317 ? 79.275  -13.803 21.901  0.25 31.73  ? 317  ALA A N     1 
ATOM   2423   C CA    A ALA A  1 317 ? 79.401  -13.029 23.138  0.25 33.80  ? 317  ALA A CA    1 
ATOM   2424   C C     A ALA A  1 317 ? 78.978  -11.581 22.971  0.25 35.38  ? 317  ALA A C     1 
ATOM   2425   O O     A ALA A  1 317 ? 78.263  -11.059 23.862  0.25 37.96  ? 317  ALA A O     1 
ATOM   2426   C CB    A ALA A  1 317 ? 80.847  -13.088 23.653  0.25 33.92  ? 317  ALA A CB    1 
ATOM   2427   O OXT   A ALA A  1 317 ? 79.388  -10.969 21.967  0.25 36.95  ? 317  ALA A OXT   1 
ATOM   2428   N N     A ARG B  1 13  ? 29.910  -10.227 8.054   0.25 54.46  ? 13   ARG B N     1 
ATOM   2429   C CA    A ARG B  1 13  ? 30.809  -9.055  8.231   0.25 54.45  ? 13   ARG B CA    1 
ATOM   2430   C C     A ARG B  1 13  ? 31.202  -8.430  6.907   0.25 55.95  ? 13   ARG B C     1 
ATOM   2431   O O     A ARG B  1 13  ? 31.960  -9.021  6.130   0.25 57.45  ? 13   ARG B O     1 
ATOM   2432   C CB    A ARG B  1 13  ? 32.075  -9.467  8.988   0.25 52.57  ? 13   ARG B CB    1 
ATOM   2433   C CG    A ARG B  1 13  ? 31.795  -9.848  10.412  0.25 48.51  ? 13   ARG B CG    1 
ATOM   2434   C CD    A ARG B  1 13  ? 33.006  -10.378 11.150  0.25 44.06  ? 13   ARG B CD    1 
ATOM   2435   N NE    A ARG B  1 13  ? 32.589  -10.693 12.513  0.25 41.64  ? 13   ARG B NE    1 
ATOM   2436   C CZ    A ARG B  1 13  ? 33.362  -11.221 13.451  0.25 37.15  ? 13   ARG B CZ    1 
ATOM   2437   N NH1   A ARG B  1 13  ? 34.629  -11.512 13.185  0.25 29.97  ? 13   ARG B NH1   1 
ATOM   2438   N NH2   A ARG B  1 13  ? 32.848  -11.456 14.655  0.25 33.02  ? 13   ARG B NH2   1 
ATOM   2439   N N     A SER B  1 14  ? 30.674  -7.237  6.653   0.25 54.89  ? 14   SER B N     1 
ATOM   2440   C CA    A SER B  1 14  ? 30.995  -6.517  5.434   0.25 55.45  ? 14   SER B CA    1 
ATOM   2441   C C     A SER B  1 14  ? 32.516  -6.539  5.223   0.25 54.10  ? 14   SER B C     1 
ATOM   2442   O O     A SER B  1 14  ? 32.996  -6.790  4.119   0.25 55.77  ? 14   SER B O     1 
ATOM   2443   C CB    A SER B  1 14  ? 30.485  -5.074  5.532   0.25 55.40  ? 14   SER B CB    1 
ATOM   2444   O OG    A SER B  1 14  ? 31.048  -4.258  4.517   0.25 60.34  ? 14   SER B OG    1 
ATOM   2445   N N     A ASN B  1 15  ? 33.274  -6.281  6.284   0.25 51.67  ? 15   ASN B N     1 
ATOM   2446   C CA    A ASN B  1 15  ? 34.727  -6.300  6.184   0.25 48.54  ? 15   ASN B CA    1 
ATOM   2447   C C     A ASN B  1 15  ? 35.300  -7.118  7.345   0.25 46.57  ? 15   ASN B C     1 
ATOM   2448   O O     A ASN B  1 15  ? 35.666  -6.587  8.396   0.25 45.69  ? 15   ASN B O     1 
ATOM   2449   C CB    A ASN B  1 15  ? 35.282  -4.874  6.187   0.25 49.10  ? 15   ASN B CB    1 
ATOM   2450   C CG    A ASN B  1 15  ? 36.803  -4.842  6.165   0.25 51.83  ? 15   ASN B CG    1 
ATOM   2451   O OD1   A ASN B  1 15  ? 37.460  -5.876  5.958   0.25 51.42  ? 15   ASN B OD1   1 
ATOM   2452   N ND2   A ASN B  1 15  ? 37.375  -3.653  6.377   0.25 49.78  ? 15   ASN B ND2   1 
ATOM   2453   N N     A PRO B  1 16  ? 35.378  -8.439  7.156   0.25 45.30  ? 16   PRO B N     1 
ATOM   2454   C CA    A PRO B  1 16  ? 35.885  -9.410  8.132   0.25 43.13  ? 16   PRO B CA    1 
ATOM   2455   C C     A PRO B  1 16  ? 37.332  -9.183  8.561   0.25 41.12  ? 16   PRO B C     1 
ATOM   2456   O O     A PRO B  1 16  ? 37.747  -9.672  9.611   0.25 42.29  ? 16   PRO B O     1 
ATOM   2457   C CB    A PRO B  1 16  ? 35.713  -10.748 7.407   0.25 43.16  ? 16   PRO B CB    1 
ATOM   2458   C CG    A PRO B  1 16  ? 34.619  -10.468 6.396   0.25 43.33  ? 16   PRO B CG    1 
ATOM   2459   C CD    A PRO B  1 16  ? 35.003  -9.114  5.901   0.25 43.87  ? 16   PRO B CD    1 
ATOM   2460   N N     A ASP B  1 17  ? 38.100  -8.445  7.762   0.25 39.54  ? 17   ASP B N     1 
ATOM   2461   C CA    A ASP B  1 17  ? 39.492  -8.211  8.115   0.25 38.32  ? 17   ASP B CA    1 
ATOM   2462   C C     A ASP B  1 17  ? 39.714  -6.951  8.954   0.25 35.33  ? 17   ASP B C     1 
ATOM   2463   O O     A ASP B  1 17  ? 40.855  -6.616  9.273   0.25 32.48  ? 17   ASP B O     1 
ATOM   2464   C CB    A ASP B  1 17  ? 40.367  -8.129  6.858   0.25 40.80  ? 17   ASP B CB    1 
ATOM   2465   C CG    A ASP B  1 17  ? 40.267  -9.374  5.987   0.25 43.30  ? 17   ASP B CG    1 
ATOM   2466   O OD1   A ASP B  1 17  ? 40.239  -10.502 6.530   0.25 44.95  ? 17   ASP B OD1   1 
ATOM   2467   O OD2   A ASP B  1 17  ? 40.227  -9.217  4.751   0.25 45.11  ? 17   ASP B OD2   1 
ATOM   2468   N N     A HIS B  1 18  ? 38.641  -6.245  9.301   0.25 31.98  ? 18   HIS B N     1 
ATOM   2469   C CA    A HIS B  1 18  ? 38.800  -5.037  10.107  0.25 29.66  ? 18   HIS B CA    1 
ATOM   2470   C C     A HIS B  1 18  ? 39.445  -5.421  11.447  0.25 28.86  ? 18   HIS B C     1 
ATOM   2471   O O     A HIS B  1 18  ? 38.939  -6.281  12.170  0.25 28.59  ? 18   HIS B O     1 
ATOM   2472   C CB    A HIS B  1 18  ? 37.447  -4.362  10.360  0.25 29.22  ? 18   HIS B CB    1 
ATOM   2473   C CG    A HIS B  1 18  ? 37.563  -2.972  10.908  0.25 28.32  ? 18   HIS B CG    1 
ATOM   2474   N ND1   A HIS B  1 18  ? 38.121  -2.697  12.138  0.25 26.72  ? 18   HIS B ND1   1 
ATOM   2475   C CD2   A HIS B  1 18  ? 37.217  -1.775  10.378  0.25 29.74  ? 18   HIS B CD2   1 
ATOM   2476   C CE1   A HIS B  1 18  ? 38.121  -1.394  12.340  0.25 26.84  ? 18   HIS B CE1   1 
ATOM   2477   N NE2   A HIS B  1 18  ? 37.579  -0.809  11.287  0.25 29.80  ? 18   HIS B NE2   1 
ATOM   2478   N N     A GLU B  1 19  ? 40.553  -4.764  11.775  0.25 27.88  ? 19   GLU B N     1 
ATOM   2479   C CA    A GLU B  1 19  ? 41.282  -5.053  13.007  0.25 27.16  ? 19   GLU B CA    1 
ATOM   2480   C C     A GLU B  1 19  ? 40.472  -4.980  14.285  0.25 26.92  ? 19   GLU B C     1 
ATOM   2481   O O     A GLU B  1 19  ? 40.799  -5.660  15.256  0.25 26.25  ? 19   GLU B O     1 
ATOM   2482   C CB    A GLU B  1 19  ? 42.496  -4.136  13.114  0.25 26.16  ? 19   GLU B CB    1 
ATOM   2483   C CG    A GLU B  1 19  ? 43.571  -4.445  12.069  0.25 26.99  ? 19   GLU B CG    1 
ATOM   2484   C CD    A GLU B  1 19  ? 44.650  -3.389  12.013  0.25 31.72  ? 19   GLU B CD    1 
ATOM   2485   O OE1   A GLU B  1 19  ? 45.638  -3.590  11.290  0.25 33.03  ? 19   GLU B OE1   1 
ATOM   2486   O OE2   A GLU B  1 19  ? 44.508  -2.347  12.688  0.25 37.39  ? 19   GLU B OE2   1 
ATOM   2487   N N     A GLU B  1 20  ? 39.402  -4.183  14.291  0.25 25.51  ? 20   GLU B N     1 
ATOM   2488   C CA    A GLU B  1 20  ? 38.588  -4.034  15.492  0.25 22.10  ? 20   GLU B CA    1 
ATOM   2489   C C     A GLU B  1 20  ? 37.882  -5.334  15.872  0.25 22.80  ? 20   GLU B C     1 
ATOM   2490   O O     A GLU B  1 20  ? 37.490  -5.526  17.025  0.25 23.64  ? 20   GLU B O     1 
ATOM   2491   C CB    A GLU B  1 20  ? 37.577  -2.875  15.316  0.25 23.31  ? 20   GLU B CB    1 
ATOM   2492   C CG    A GLU B  1 20  ? 36.751  -2.581  16.581  0.25 23.65  ? 20   GLU B CG    1 
ATOM   2493   C CD    A GLU B  1 20  ? 36.147  -1.168  16.628  0.25 23.58  ? 20   GLU B CD    1 
ATOM   2494   O OE1   A GLU B  1 20  ? 35.316  -0.932  17.539  0.25 24.11  ? 20   GLU B OE1   1 
ATOM   2495   O OE2   A GLU B  1 20  ? 36.493  -0.299  15.787  0.25 22.59  ? 20   GLU B OE2   1 
ATOM   2496   N N     A TYR B  1 21  ? 37.716  -6.243  14.914  0.25 23.38  ? 21   TYR B N     1 
ATOM   2497   C CA    A TYR B  1 21  ? 37.082  -7.526  15.231  0.25 23.18  ? 21   TYR B CA    1 
ATOM   2498   C C     A TYR B  1 21  ? 37.911  -8.327  16.232  0.25 22.93  ? 21   TYR B C     1 
ATOM   2499   O O     A TYR B  1 21  ? 37.372  -9.167  16.946  0.25 23.01  ? 21   TYR B O     1 
ATOM   2500   C CB    A TYR B  1 21  ? 36.820  -8.341  13.951  0.25 23.59  ? 21   TYR B CB    1 
ATOM   2501   C CG    A TYR B  1 21  ? 35.593  -7.867  13.206  0.25 23.20  ? 21   TYR B CG    1 
ATOM   2502   C CD1   A TYR B  1 21  ? 35.694  -7.358  11.925  0.25 26.07  ? 21   TYR B CD1   1 
ATOM   2503   C CD2   A TYR B  1 21  ? 34.325  -7.900  13.810  0.25 25.24  ? 21   TYR B CD2   1 
ATOM   2504   C CE1   A TYR B  1 21  ? 34.574  -6.879  11.247  0.25 30.01  ? 21   TYR B CE1   1 
ATOM   2505   C CE2   A TYR B  1 21  ? 33.190  -7.429  13.140  0.25 24.01  ? 21   TYR B CE2   1 
ATOM   2506   C CZ    A TYR B  1 21  ? 33.324  -6.918  11.862  0.25 28.43  ? 21   TYR B CZ    1 
ATOM   2507   O OH    A TYR B  1 21  ? 32.223  -6.429  11.175  0.25 33.58  ? 21   TYR B OH    1 
ATOM   2508   N N     A GLN B  1 22  ? 39.213  -8.045  16.314  0.25 23.14  ? 22   GLN B N     1 
ATOM   2509   C CA    A GLN B  1 22  ? 40.076  -8.736  17.287  0.25 24.39  ? 22   GLN B CA    1 
ATOM   2510   C C     A GLN B  1 22  ? 39.548  -8.446  18.679  0.25 23.59  ? 22   GLN B C     1 
ATOM   2511   O O     A GLN B  1 22  ? 39.420  -9.338  19.519  0.25 23.48  ? 22   GLN B O     1 
ATOM   2512   C CB    A GLN B  1 22  ? 41.522  -8.217  17.224  0.25 22.86  ? 22   GLN B CB    1 
ATOM   2513   C CG    A GLN B  1 22  ? 42.267  -8.550  15.951  0.25 25.09  ? 22   GLN B CG    1 
ATOM   2514   C CD    A GLN B  1 22  ? 43.587  -7.806  15.870  0.25 26.97  ? 22   GLN B CD    1 
ATOM   2515   O OE1   A GLN B  1 22  ? 43.620  -6.591  15.599  0.25 27.06  ? 22   GLN B OE1   1 
ATOM   2516   N NE2   A GLN B  1 22  ? 44.681  -8.515  16.121  0.25 20.90  ? 22   GLN B NE2   1 
ATOM   2517   N N     A TYR B  1 23  ? 39.258  -7.174  18.912  0.25 24.79  ? 23   TYR B N     1 
ATOM   2518   C CA    A TYR B  1 23  ? 38.745  -6.711  20.191  0.25 24.98  ? 23   TYR B CA    1 
ATOM   2519   C C     A TYR B  1 23  ? 37.350  -7.268  20.457  0.25 24.94  ? 23   TYR B C     1 
ATOM   2520   O O     A TYR B  1 23  ? 37.085  -7.791  21.535  0.25 23.94  ? 23   TYR B O     1 
ATOM   2521   C CB    A TYR B  1 23  ? 38.741  -5.164  20.206  0.25 24.64  ? 23   TYR B CB    1 
ATOM   2522   C CG    A TYR B  1 23  ? 38.046  -4.541  21.395  0.25 22.21  ? 23   TYR B CG    1 
ATOM   2523   C CD1   A TYR B  1 23  ? 36.696  -4.182  21.324  0.25 24.19  ? 23   TYR B CD1   1 
ATOM   2524   C CD2   A TYR B  1 23  ? 38.728  -4.318  22.597  0.25 23.48  ? 23   TYR B CD2   1 
ATOM   2525   C CE1   A TYR B  1 23  ? 36.036  -3.609  22.422  0.25 22.39  ? 23   TYR B CE1   1 
ATOM   2526   C CE2   A TYR B  1 23  ? 38.075  -3.749  23.710  0.25 22.90  ? 23   TYR B CE2   1 
ATOM   2527   C CZ    A TYR B  1 23  ? 36.729  -3.400  23.611  0.25 24.95  ? 23   TYR B CZ    1 
ATOM   2528   O OH    A TYR B  1 23  ? 36.071  -2.868  24.706  0.25 23.78  ? 23   TYR B OH    1 
ATOM   2529   N N     A LEU B  1 24  ? 36.460  -7.156  19.474  0.25 26.34  ? 24   LEU B N     1 
ATOM   2530   C CA    A LEU B  1 24  ? 35.081  -7.648  19.642  0.25 26.25  ? 24   LEU B CA    1 
ATOM   2531   C C     A LEU B  1 24  ? 35.036  -9.165  19.825  0.25 27.14  ? 24   LEU B C     1 
ATOM   2532   O O     A LEU B  1 24  ? 34.296  -9.672  20.678  0.25 25.59  ? 24   LEU B O     1 
ATOM   2533   C CB    A LEU B  1 24  ? 34.230  -7.258  18.432  0.25 26.53  ? 24   LEU B CB    1 
ATOM   2534   C CG    A LEU B  1 24  ? 34.076  -5.757  18.169  0.25 26.23  ? 24   LEU B CG    1 
ATOM   2535   C CD1   A LEU B  1 24  ? 33.355  -5.550  16.854  0.25 30.07  ? 24   LEU B CD1   1 
ATOM   2536   C CD2   A LEU B  1 24  ? 33.325  -5.105  19.303  0.25 26.23  ? 24   LEU B CD2   1 
ATOM   2537   N N     A ASP B  1 25  ? 35.825  -9.889  19.027  0.25 26.56  ? 25   ASP B N     1 
ATOM   2538   C CA    A ASP B  1 25  ? 35.868  -11.346 19.142  0.25 27.24  ? 25   ASP B CA    1 
ATOM   2539   C C     A ASP B  1 25  ? 36.384  -11.823 20.507  0.25 25.21  ? 25   ASP B C     1 
ATOM   2540   O O     A ASP B  1 25  ? 35.859  -12.778 21.084  0.25 24.88  ? 25   ASP B O     1 
ATOM   2541   C CB    A ASP B  1 25  ? 36.732  -11.936 18.017  0.25 29.88  ? 25   ASP B CB    1 
ATOM   2542   C CG    A ASP B  1 25  ? 36.017  -11.933 16.675  0.25 33.19  ? 25   ASP B CG    1 
ATOM   2543   O OD1   A ASP B  1 25  ? 36.666  -12.205 15.645  0.25 34.34  ? 25   ASP B OD1   1 
ATOM   2544   O OD2   A ASP B  1 25  ? 34.796  -11.654 16.662  0.25 35.26  ? 25   ASP B OD2   1 
ATOM   2545   N N     A LEU B  1 26  ? 37.398  -11.152 21.042  0.25 24.64  ? 26   LEU B N     1 
ATOM   2546   C CA    A LEU B  1 26  ? 37.943  -11.562 22.353  0.25 23.97  ? 26   LEU B CA    1 
ATOM   2547   C C     A LEU B  1 26  ? 36.906  -11.376 23.450  0.25 22.44  ? 26   LEU B C     1 
ATOM   2548   O O     A LEU B  1 26  ? 36.768  -12.218 24.328  0.25 23.04  ? 26   LEU B O     1 
ATOM   2549   C CB    A LEU B  1 26  ? 39.207  -10.766 22.692  0.25 23.56  ? 26   LEU B CB    1 
ATOM   2550   C CG    A LEU B  1 26  ? 39.812  -11.085 24.068  0.25 26.35  ? 26   LEU B CG    1 
ATOM   2551   C CD1   A LEU B  1 26  ? 40.094  -12.578 24.188  0.25 30.15  ? 26   LEU B CD1   1 
ATOM   2552   C CD2   A LEU B  1 26  ? 41.109  -10.304 24.258  0.25 27.66  ? 26   LEU B CD2   1 
ATOM   2553   N N     A ILE B  1 27  ? 36.171  -10.272 23.398  0.25 23.45  ? 27   ILE B N     1 
ATOM   2554   C CA    A ILE B  1 27  ? 35.135  -10.014 24.390  0.25 24.88  ? 27   ILE B CA    1 
ATOM   2555   C C     A ILE B  1 27  ? 34.067  -11.109 24.306  0.25 25.10  ? 27   ILE B C     1 
ATOM   2556   O O     A ILE B  1 27  ? 33.626  -11.649 25.320  0.25 24.03  ? 27   ILE B O     1 
ATOM   2557   C CB    A ILE B  1 27  ? 34.473  -8.634  24.161  0.25 27.21  ? 27   ILE B CB    1 
ATOM   2558   C CG1   A ILE B  1 27  ? 35.426  -7.519  24.601  0.25 29.14  ? 27   ILE B CG1   1 
ATOM   2559   C CG2   A ILE B  1 27  ? 33.167  -8.529  24.945  0.25 28.35  ? 27   ILE B CG2   1 
ATOM   2560   C CD1   A ILE B  1 27  ? 34.908  -6.142  24.265  0.25 31.59  ? 27   ILE B CD1   1 
ATOM   2561   N N     A ARG B  1 28  ? 33.673  -11.447 23.087  0.25 26.50  ? 28   ARG B N     1 
ATOM   2562   C CA    A ARG B  1 28  ? 32.655  -12.481 22.885  0.25 28.70  ? 28   ARG B CA    1 
ATOM   2563   C C     A ARG B  1 28  ? 33.162  -13.806 23.463  0.25 28.62  ? 28   ARG B C     1 
ATOM   2564   O O     A ARG B  1 28  ? 32.429  -14.532 24.145  0.25 26.42  ? 28   ARG B O     1 
ATOM   2565   C CB    A ARG B  1 28  ? 32.357  -12.616 21.383  0.25 28.74  ? 28   ARG B CB    1 
ATOM   2566   C CG    A ARG B  1 28  ? 31.296  -13.643 21.054  0.25 35.91  ? 28   ARG B CG    1 
ATOM   2567   C CD    A ARG B  1 28  ? 31.026  -13.712 19.548  0.25 38.73  ? 28   ARG B CD    1 
ATOM   2568   N NE    A ARG B  1 28  ? 30.195  -12.618 19.064  0.25 42.92  ? 28   ARG B NE    1 
ATOM   2569   C CZ    A ARG B  1 28  ? 30.626  -11.494 18.504  0.25 45.29  ? 28   ARG B CZ    1 
ATOM   2570   N NH1   A ARG B  1 28  ? 31.929  -11.264 18.327  0.25 46.99  ? 28   ARG B NH1   1 
ATOM   2571   N NH2   A ARG B  1 28  ? 29.730  -10.589 18.115  0.25 43.54  ? 28   ARG B NH2   1 
ATOM   2572   N N     A ARG B  1 29  ? 34.435  -14.115 23.203  0.25 27.69  ? 29   ARG B N     1 
ATOM   2573   C CA    A ARG B  1 29  ? 35.022  -15.344 23.715  0.25 25.70  ? 29   ARG B CA    1 
ATOM   2574   C C     A ARG B  1 29  ? 35.072  -15.362 25.241  0.25 26.43  ? 29   ARG B C     1 
ATOM   2575   O O     A ARG B  1 29  ? 34.730  -16.363 25.864  0.25 27.21  ? 29   ARG B O     1 
ATOM   2576   C CB    A ARG B  1 29  ? 36.433  -15.518 23.147  0.25 28.94  ? 29   ARG B CB    1 
ATOM   2577   C CG    A ARG B  1 29  ? 37.092  -16.832 23.538  0.25 30.22  ? 29   ARG B CG    1 
ATOM   2578   C CD    A ARG B  1 29  ? 38.536  -16.896 23.059  0.25 29.93  ? 29   ARG B CD    1 
ATOM   2579   N NE    A ARG B  1 29  ? 39.214  -18.051 23.627  0.25 32.25  ? 29   ARG B NE    1 
ATOM   2580   C CZ    A ARG B  1 29  ? 40.529  -18.177 23.706  0.25 34.46  ? 29   ARG B CZ    1 
ATOM   2581   N NH1   A ARG B  1 29  ? 41.318  -17.208 23.245  0.25 35.98  ? 29   ARG B NH1   1 
ATOM   2582   N NH2   A ARG B  1 29  ? 41.054  -19.260 24.262  0.25 34.53  ? 29   ARG B NH2   1 
ATOM   2583   N N     A ILE B  1 30  ? 35.496  -14.258 25.849  0.25 24.74  ? 30   ILE B N     1 
ATOM   2584   C CA    A ILE B  1 30  ? 35.573  -14.190 27.301  0.25 25.45  ? 30   ILE B CA    1 
ATOM   2585   C C     A ILE B  1 30  ? 34.194  -14.393 27.933  0.25 27.54  ? 30   ILE B C     1 
ATOM   2586   O O     A ILE B  1 30  ? 34.039  -15.122 28.926  0.25 26.54  ? 30   ILE B O     1 
ATOM   2587   C CB    A ILE B  1 30  ? 36.140  -12.824 27.766  0.25 24.15  ? 30   ILE B CB    1 
ATOM   2588   C CG1   A ILE B  1 30  ? 37.596  -12.677 27.297  0.25 24.22  ? 30   ILE B CG1   1 
ATOM   2589   C CG2   A ILE B  1 30  ? 36.043  -12.711 29.261  0.25 22.34  ? 30   ILE B CG2   1 
ATOM   2590   C CD1   A ILE B  1 30  ? 38.198  -11.299 27.533  0.25 25.71  ? 30   ILE B CD1   1 
ATOM   2591   N N     A ILE B  1 31  ? 33.190  -13.744 27.362  0.25 28.55  ? 31   ILE B N     1 
ATOM   2592   C CA    A ILE B  1 31  ? 31.840  -13.877 27.880  0.25 30.56  ? 31   ILE B CA    1 
ATOM   2593   C C     A ILE B  1 31  ? 31.380  -15.319 27.734  0.25 32.46  ? 31   ILE B C     1 
ATOM   2594   O O     A ILE B  1 31  ? 30.794  -15.873 28.660  0.25 31.26  ? 31   ILE B O     1 
ATOM   2595   C CB    A ILE B  1 31  ? 30.857  -12.931 27.126  0.25 31.84  ? 31   ILE B CB    1 
ATOM   2596   C CG1   A ILE B  1 31  ? 31.223  -11.481 27.417  0.25 29.17  ? 31   ILE B CG1   1 
ATOM   2597   C CG2   A ILE B  1 31  ? 29.402  -13.194 27.566  0.25 32.99  ? 31   ILE B CG2   1 
ATOM   2598   C CD1   A ILE B  1 31  ? 30.413  -10.480 26.640  0.25 29.96  ? 31   ILE B CD1   1 
ATOM   2599   N N     A ASN B  1 32  ? 31.666  -15.926 26.576  0.25 34.34  ? 32   ASN B N     1 
ATOM   2600   C CA    A ASN B  1 32  ? 31.269  -17.313 26.299  0.25 36.04  ? 32   ASN B CA    1 
ATOM   2601   C C     A ASN B  1 32  ? 31.977  -18.409 27.101  0.25 38.18  ? 32   ASN B C     1 
ATOM   2602   O O     A ASN B  1 32  ? 31.314  -19.223 27.760  0.25 39.21  ? 32   ASN B O     1 
ATOM   2603   C CB    A ASN B  1 32  ? 31.443  -17.623 24.816  0.25 36.99  ? 32   ASN B CB    1 
ATOM   2604   C CG    A ASN B  1 32  ? 30.368  -16.988 23.955  0.25 39.80  ? 32   ASN B CG    1 
ATOM   2605   O OD1   A ASN B  1 32  ? 30.477  -16.962 22.722  0.25 39.72  ? 32   ASN B OD1   1 
ATOM   2606   N ND2   A ASN B  1 32  ? 29.317  -16.479 24.597  0.25 39.44  ? 32   ASN B ND2   1 
ATOM   2607   N N     A VAL B  1 33  ? 33.311  -18.439 27.044  0.25 35.25  ? 33   VAL B N     1 
ATOM   2608   C CA    A VAL B  1 33  ? 34.061  -19.468 27.748  0.25 35.32  ? 33   VAL B CA    1 
ATOM   2609   C C     A VAL B  1 33  ? 34.986  -18.983 28.862  0.25 35.95  ? 33   VAL B C     1 
ATOM   2610   O O     A VAL B  1 33  ? 35.747  -19.768 29.420  0.25 35.49  ? 33   VAL B O     1 
ATOM   2611   C CB    A VAL B  1 33  ? 34.901  -20.315 26.758  0.25 35.57  ? 33   VAL B CB    1 
ATOM   2612   C CG1   A VAL B  1 33  ? 33.967  -20.999 25.736  0.25 32.20  ? 33   VAL B CG1   1 
ATOM   2613   C CG2   A VAL B  1 33  ? 35.927  -19.438 26.052  0.25 32.11  ? 33   VAL B CG2   1 
ATOM   2614   N N     A GLY B  1 34  ? 34.926  -17.697 29.183  0.25 35.35  ? 34   GLY B N     1 
ATOM   2615   C CA    A GLY B  1 34  ? 35.761  -17.169 30.246  0.25 33.22  ? 34   GLY B CA    1 
ATOM   2616   C C     A GLY B  1 34  ? 35.395  -17.765 31.599  0.25 33.45  ? 34   GLY B C     1 
ATOM   2617   O O     A GLY B  1 34  ? 34.287  -18.274 31.800  0.25 31.90  ? 34   GLY B O     1 
ATOM   2618   N N     A GLU B  1 35  ? 36.336  -17.713 32.533  0.25 30.63  ? 35   GLU B N     1 
ATOM   2619   C CA    A GLU B  1 35  ? 36.117  -18.234 33.881  0.25 30.71  ? 35   GLU B CA    1 
ATOM   2620   C C     A GLU B  1 35  ? 35.634  -17.130 34.854  0.25 29.20  ? 35   GLU B C     1 
ATOM   2621   O O     A GLU B  1 35  ? 36.236  -16.056 34.949  0.25 26.04  ? 35   GLU B O     1 
ATOM   2622   C CB    A GLU B  1 35  ? 37.424  -18.858 34.377  0.25 31.55  ? 35   GLU B CB    1 
ATOM   2623   C CG    A GLU B  1 35  ? 37.459  -19.276 35.825  0.25 35.66  ? 35   GLU B CG    1 
ATOM   2624   C CD    A GLU B  1 35  ? 38.855  -19.769 36.253  0.25 40.25  ? 35   GLU B CD    1 
ATOM   2625   O OE1   A GLU B  1 35  ? 39.119  -19.845 37.477  0.25 38.12  ? 35   GLU B OE1   1 
ATOM   2626   O OE2   A GLU B  1 35  ? 39.687  -20.081 35.359  0.25 43.28  ? 35   GLU B OE2   1 
ATOM   2627   N N     A VAL B  1 36  ? 34.541  -17.400 35.565  0.25 28.82  ? 36   VAL B N     1 
ATOM   2628   C CA    A VAL B  1 36  ? 33.985  -16.453 36.525  0.25 30.70  ? 36   VAL B CA    1 
ATOM   2629   C C     A VAL B  1 36  ? 34.897  -16.397 37.738  0.25 30.96  ? 36   VAL B C     1 
ATOM   2630   O O     A VAL B  1 36  ? 35.145  -17.408 38.373  0.25 32.09  ? 36   VAL B O     1 
ATOM   2631   C CB    A VAL B  1 36  ? 32.575  -16.882 36.989  0.25 31.43  ? 36   VAL B CB    1 
ATOM   2632   C CG1   A VAL B  1 36  ? 32.051  -15.905 38.038  0.25 29.94  ? 36   VAL B CG1   1 
ATOM   2633   C CG2   A VAL B  1 36  ? 31.638  -16.934 35.791  0.25 29.21  ? 36   VAL B CG2   1 
ATOM   2634   N N     A ARG B  1 37  ? 35.379  -15.209 38.079  0.25 29.95  ? 37   ARG B N     1 
ATOM   2635   C CA    A ARG B  1 37  ? 36.307  -15.094 39.199  0.25 29.65  ? 37   ARG B CA    1 
ATOM   2636   C C     A ARG B  1 37  ? 36.081  -13.895 40.097  0.25 28.11  ? 37   ARG B C     1 
ATOM   2637   O O     A ARG B  1 37  ? 35.517  -12.897 39.676  0.25 28.95  ? 37   ARG B O     1 
ATOM   2638   C CB    A ARG B  1 37  ? 37.741  -14.994 38.659  0.25 31.26  ? 37   ARG B CB    1 
ATOM   2639   C CG    A ARG B  1 37  ? 38.133  -16.130 37.713  0.25 29.18  ? 37   ARG B CG    1 
ATOM   2640   C CD    A ARG B  1 37  ? 39.291  -15.744 36.819  0.25 27.81  ? 37   ARG B CD    1 
ATOM   2641   N NE    A ARG B  1 37  ? 40.524  -15.432 37.532  0.25 24.91  ? 37   ARG B NE    1 
ATOM   2642   C CZ    A ARG B  1 37  ? 41.367  -16.269 38.141  0.25 25.72  ? 37   ARG B CZ    1 
ATOM   2643   N NH1   A ARG B  1 37  ? 41.164  -17.576 38.195  0.25 26.73  ? 37   ARG B NH1   1 
ATOM   2644   N NH2   A ARG B  1 37  ? 42.480  -15.760 38.666  0.25 18.87  ? 37   ARG B NH2   1 
ATOM   2645   N N     A PRO B  1 38  ? 36.503  -14.000 41.362  0.25 27.37  ? 38   PRO B N     1 
ATOM   2646   C CA    A PRO B  1 38  ? 36.387  -12.920 42.338  0.25 26.42  ? 38   PRO B CA    1 
ATOM   2647   C C     A PRO B  1 38  ? 37.591  -12.030 41.979  0.25 27.24  ? 38   PRO B C     1 
ATOM   2648   O O     A PRO B  1 38  ? 38.500  -12.473 41.253  0.25 25.78  ? 38   PRO B O     1 
ATOM   2649   C CB    A PRO B  1 38  ? 36.625  -13.616 43.671  0.25 28.72  ? 38   PRO B CB    1 
ATOM   2650   C CG    A PRO B  1 38  ? 36.444  -15.088 43.368  0.25 34.25  ? 38   PRO B CG    1 
ATOM   2651   C CD    A PRO B  1 38  ? 36.995  -15.234 42.003  0.25 28.74  ? 38   PRO B CD    1 
ATOM   2652   N N     A ASP B  1 39  ? 37.622  -10.805 42.483  0.25 26.58  ? 39   ASP B N     1 
ATOM   2653   C CA    A ASP B  1 39  ? 38.736  -9.907  42.188  0.25 26.81  ? 39   ASP B CA    1 
ATOM   2654   C C     A ASP B  1 39  ? 38.869  -8.860  43.256  0.25 27.69  ? 39   ASP B C     1 
ATOM   2655   O O     A ASP B  1 39  ? 38.003  -8.737  44.136  0.25 28.36  ? 39   ASP B O     1 
ATOM   2656   C CB    A ASP B  1 39  ? 38.557  -9.237  40.816  0.25 25.61  ? 39   ASP B CB    1 
ATOM   2657   C CG    A ASP B  1 39  ? 37.534  -8.094  40.831  0.25 29.61  ? 39   ASP B CG    1 
ATOM   2658   O OD1   A ASP B  1 39  ? 36.355  -8.329  41.208  0.25 29.51  ? 39   ASP B OD1   1 
ATOM   2659   O OD2   A ASP B  1 39  ? 37.917  -6.962  40.448  0.25 25.03  ? 39   ASP B OD2   1 
ATOM   2660   N N     A ARG B  1 40  ? 39.965  -8.109  43.174  0.25 26.71  ? 40   ARG B N     1 
ATOM   2661   C CA    A ARG B  1 40  ? 40.272  -7.050  44.123  0.25 24.58  ? 40   ARG B CA    1 
ATOM   2662   C C     A ARG B  1 40  ? 39.126  -6.048  44.333  0.25 23.93  ? 40   ARG B C     1 
ATOM   2663   O O     A ARG B  1 40  ? 38.872  -5.639  45.460  0.25 25.89  ? 40   ARG B O     1 
ATOM   2664   C CB    A ARG B  1 40  ? 41.517  -6.283  43.636  0.25 23.76  ? 40   ARG B CB    1 
ATOM   2665   C CG    A ARG B  1 40  ? 41.941  -5.112  44.501  0.25 21.90  ? 40   ARG B CG    1 
ATOM   2666   C CD    A ARG B  1 40  ? 43.102  -4.333  43.845  0.25 20.32  ? 40   ARG B CD    1 
ATOM   2667   N NE    A ARG B  1 40  ? 42.748  -3.800  42.524  0.25 22.22  ? 40   ARG B NE    1 
ATOM   2668   C CZ    A ARG B  1 40  ? 41.981  -2.725  42.320  0.25 19.53  ? 40   ARG B CZ    1 
ATOM   2669   N NH1   A ARG B  1 40  ? 41.476  -2.054  43.347  0.25 20.19  ? 40   ARG B NH1   1 
ATOM   2670   N NH2   A ARG B  1 40  ? 41.733  -2.305  41.084  0.25 20.25  ? 40   ARG B NH2   1 
ATOM   2671   N N     A THR B  1 41  ? 38.469  -5.636  43.251  0.25 23.43  ? 41   THR B N     1 
ATOM   2672   C CA    A THR B  1 41  ? 37.406  -4.626  43.340  0.25 25.31  ? 41   THR B CA    1 
ATOM   2673   C C     A THR B  1 41  ? 36.139  -5.104  44.027  0.25 27.77  ? 41   THR B C     1 
ATOM   2674   O O     A THR B  1 41  ? 35.403  -4.296  44.601  0.25 27.42  ? 41   THR B O     1 
ATOM   2675   C CB    A THR B  1 41  ? 36.991  -4.102  41.958  0.25 23.73  ? 41   THR B CB    1 
ATOM   2676   O OG1   A THR B  1 41  ? 36.251  -5.121  41.273  0.25 24.04  ? 41   THR B OG1   1 
ATOM   2677   C CG2   A THR B  1 41  ? 38.235  -3.702  41.147  0.25 25.65  ? 41   THR B CG2   1 
ATOM   2678   N N     A GLY B  1 42  ? 35.886  -6.407  43.972  0.25 28.51  ? 42   GLY B N     1 
ATOM   2679   C CA    A GLY B  1 42  ? 34.683  -6.938  44.592  0.25 28.84  ? 42   GLY B CA    1 
ATOM   2680   C C     A GLY B  1 42  ? 33.510  -7.067  43.631  0.25 28.78  ? 42   GLY B C     1 
ATOM   2681   O O     A GLY B  1 42  ? 32.487  -7.655  43.978  0.25 29.89  ? 42   GLY B O     1 
ATOM   2682   N N     A THR B  1 43  ? 33.627  -6.543  42.413  0.25 28.55  ? 43   THR B N     1 
ATOM   2683   C CA    A THR B  1 43  ? 32.509  -6.672  41.479  0.25 29.09  ? 43   THR B CA    1 
ATOM   2684   C C     A THR B  1 43  ? 32.507  -8.023  40.761  0.25 29.12  ? 43   THR B C     1 
ATOM   2685   O O     A THR B  1 43  ? 31.447  -8.530  40.366  0.25 29.30  ? 43   THR B O     1 
ATOM   2686   C CB    A THR B  1 43  ? 32.507  -5.548  40.419  0.25 30.42  ? 43   THR B CB    1 
ATOM   2687   O OG1   A THR B  1 43  ? 33.381  -5.902  39.351  0.25 39.17  ? 43   THR B OG1   1 
ATOM   2688   C CG2   A THR B  1 43  ? 32.985  -4.262  41.007  0.25 24.84  ? 43   THR B CG2   1 
ATOM   2689   N N     A GLY B  1 44  ? 33.686  -8.619  40.595  0.25 26.60  ? 44   GLY B N     1 
ATOM   2690   C CA    A GLY B  1 44  ? 33.760  -9.902  39.912  0.25 24.49  ? 44   GLY B CA    1 
ATOM   2691   C C     A GLY B  1 44  ? 33.999  -9.757  38.419  0.25 24.76  ? 44   GLY B C     1 
ATOM   2692   O O     A GLY B  1 44  ? 33.638  -8.752  37.814  0.25 23.55  ? 44   GLY B O     1 
ATOM   2693   N N     A THR B  1 45  ? 34.612  -10.763 37.807  0.25 23.23  ? 45   THR B N     1 
ATOM   2694   C CA    A THR B  1 45  ? 34.860  -10.705 36.371  0.25 23.35  ? 45   THR B CA    1 
ATOM   2695   C C     A THR B  1 45  ? 34.757  -12.080 35.743  0.25 21.92  ? 45   THR B C     1 
ATOM   2696   O O     A THR B  1 45  ? 34.572  -13.071 36.416  0.25 24.65  ? 45   THR B O     1 
ATOM   2697   C CB    A THR B  1 45  ? 36.292  -10.216 36.059  0.25 23.68  ? 45   THR B CB    1 
ATOM   2698   O OG1   A THR B  1 45  ? 37.215  -11.261 36.395  0.25 21.22  ? 45   THR B OG1   1 
ATOM   2699   C CG2   A THR B  1 45  ? 36.651  -8.960  36.887  0.25 23.52  ? 45   THR B CG2   1 
ATOM   2700   N N     A VAL B  1 46  ? 34.860  -12.117 34.428  0.25 24.48  ? 46   VAL B N     1 
ATOM   2701   C CA    A VAL B  1 46  ? 34.905  -13.372 33.684  0.25 26.49  ? 46   VAL B CA    1 
ATOM   2702   C C     A VAL B  1 46  ? 36.246  -13.173 32.958  0.25 25.04  ? 46   VAL B C     1 
ATOM   2703   O O     A VAL B  1 46  ? 36.478  -12.110 32.389  0.25 23.05  ? 46   VAL B O     1 
ATOM   2704   C CB    A VAL B  1 46  ? 33.719  -13.501 32.698  0.25 27.39  ? 46   VAL B CB    1 
ATOM   2705   C CG1   A VAL B  1 46  ? 33.689  -12.333 31.751  0.25 30.02  ? 46   VAL B CG1   1 
ATOM   2706   C CG2   A VAL B  1 46  ? 33.814  -14.801 31.953  0.25 29.06  ? 46   VAL B CG2   1 
ATOM   2707   N N     A ALA B  1 47  ? 37.132  -14.169 32.989  0.25 27.01  ? 47   ALA B N     1 
ATOM   2708   C CA    A ALA B  1 47  ? 38.454  -13.963 32.378  0.25 27.10  ? 47   ALA B CA    1 
ATOM   2709   C C     A ALA B  1 47  ? 39.111  -15.144 31.689  0.25 25.85  ? 47   ALA B C     1 
ATOM   2710   O O     A ALA B  1 47  ? 38.735  -16.291 31.917  0.25 22.52  ? 47   ALA B O     1 
ATOM   2711   C CB    A ALA B  1 47  ? 39.422  -13.418 33.460  0.25 22.86  ? 47   ALA B CB    1 
ATOM   2712   N N     A LEU B  1 48  ? 40.121  -14.812 30.870  0.25 25.35  ? 48   LEU B N     1 
ATOM   2713   C CA    A LEU B  1 48  ? 40.951  -15.764 30.140  0.25 25.17  ? 48   LEU B CA    1 
ATOM   2714   C C     A LEU B  1 48  ? 42.398  -15.274 30.305  0.25 26.34  ? 48   LEU B C     1 
ATOM   2715   O O     A LEU B  1 48  ? 42.652  -14.076 30.330  0.25 23.95  ? 48   LEU B O     1 
ATOM   2716   C CB    A LEU B  1 48  ? 40.601  -15.788 28.655  0.25 26.03  ? 48   LEU B CB    1 
ATOM   2717   C CG    A LEU B  1 48  ? 39.237  -16.374 28.261  0.25 26.01  ? 48   LEU B CG    1 
ATOM   2718   C CD1   A LEU B  1 48  ? 39.058  -16.260 26.749  0.25 26.59  ? 48   LEU B CD1   1 
ATOM   2719   C CD2   A LEU B  1 48  ? 39.146  -17.813 28.694  0.25 23.82  ? 48   LEU B CD2   1 
ATOM   2720   N N     A PHE B  1 49  ? 43.346  -16.196 30.417  0.25 24.93  ? 49   PHE B N     1 
ATOM   2721   C CA    A PHE B  1 49  ? 44.737  -15.800 30.588  0.25 23.46  ? 49   PHE B CA    1 
ATOM   2722   C C     A PHE B  1 49  ? 45.527  -15.942 29.300  0.25 22.51  ? 49   PHE B C     1 
ATOM   2723   O O     A PHE B  1 49  ? 45.395  -16.920 28.589  0.25 24.78  ? 49   PHE B O     1 
ATOM   2724   C CB    A PHE B  1 49  ? 45.412  -16.648 31.675  0.25 21.98  ? 49   PHE B CB    1 
ATOM   2725   C CG    A PHE B  1 49  ? 46.844  -16.267 31.938  0.25 18.36  ? 49   PHE B CG    1 
ATOM   2726   C CD1   A PHE B  1 49  ? 47.165  -15.016 32.437  0.25 19.46  ? 49   PHE B CD1   1 
ATOM   2727   C CD2   A PHE B  1 49  ? 47.873  -17.172 31.693  0.25 20.09  ? 49   PHE B CD2   1 
ATOM   2728   C CE1   A PHE B  1 49  ? 48.515  -14.649 32.697  0.25 21.43  ? 49   PHE B CE1   1 
ATOM   2729   C CE2   A PHE B  1 49  ? 49.214  -16.834 31.947  0.25 21.09  ? 49   PHE B CE2   1 
ATOM   2730   C CZ    A PHE B  1 49  ? 49.542  -15.570 32.448  0.25 18.09  ? 49   PHE B CZ    1 
ATOM   2731   N N     A ALA B  1 50  ? 46.346  -14.942 29.011  0.25 24.89  ? 50   ALA B N     1 
ATOM   2732   C CA    A ALA B  1 50  ? 47.226  -14.947 27.851  0.25 26.27  ? 50   ALA B CA    1 
ATOM   2733   C C     A ALA B  1 50  ? 46.593  -15.317 26.516  0.25 29.53  ? 50   ALA B C     1 
ATOM   2734   O O     A ALA B  1 50  ? 47.048  -16.245 25.841  0.25 30.04  ? 50   ALA B O     1 
ATOM   2735   C CB    A ALA B  1 50  ? 48.418  -15.863 28.123  0.25 24.44  ? 50   ALA B CB    1 
ATOM   2736   N N     A PRO B  1 51  ? 45.535  -14.600 26.110  0.25 27.78  ? 51   PRO B N     1 
ATOM   2737   C CA    A PRO B  1 51  ? 44.922  -14.938 24.828  0.25 27.37  ? 51   PRO B CA    1 
ATOM   2738   C C     A PRO B  1 51  ? 45.825  -14.433 23.715  0.25 26.27  ? 51   PRO B C     1 
ATOM   2739   O O     A PRO B  1 51  ? 46.764  -13.679 23.965  0.25 26.81  ? 51   PRO B O     1 
ATOM   2740   C CB    A PRO B  1 51  ? 43.587  -14.179 24.876  0.25 28.61  ? 51   PRO B CB    1 
ATOM   2741   C CG    A PRO B  1 51  ? 43.954  -12.943 25.647  0.25 29.97  ? 51   PRO B CG    1 
ATOM   2742   C CD    A PRO B  1 51  ? 44.785  -13.528 26.791  0.25 28.85  ? 51   PRO B CD    1 
ATOM   2743   N N     A PRO B  1 52  ? 45.569  -14.854 22.469  0.25 24.86  ? 52   PRO B N     1 
ATOM   2744   C CA    A PRO B  1 52  ? 46.411  -14.381 21.361  0.25 25.98  ? 52   PRO B CA    1 
ATOM   2745   C C     A PRO B  1 52  ? 46.508  -12.850 21.372  0.25 24.87  ? 52   PRO B C     1 
ATOM   2746   O O     A PRO B  1 52  ? 45.530  -12.149 21.651  0.25 21.98  ? 52   PRO B O     1 
ATOM   2747   C CB    A PRO B  1 52  ? 45.688  -14.905 20.116  0.25 24.94  ? 52   PRO B CB    1 
ATOM   2748   C CG    A PRO B  1 52  ? 45.064  -16.201 20.622  0.25 25.94  ? 52   PRO B CG    1 
ATOM   2749   C CD    A PRO B  1 52  ? 44.555  -15.826 22.006  0.25 24.87  ? 52   PRO B CD    1 
ATOM   2750   N N     A SER B  1 53  ? 47.684  -12.334 21.038  0.25 23.22  ? 53   SER B N     1 
ATOM   2751   C CA    A SER B  1 53  ? 47.901  -10.897 21.049  0.25 24.22  ? 53   SER B CA    1 
ATOM   2752   C C     A SER B  1 53  ? 47.158  -10.166 19.936  0.25 26.09  ? 53   SER B C     1 
ATOM   2753   O O     A SER B  1 53  ? 46.775  -10.777 18.928  0.25 23.87  ? 53   SER B O     1 
ATOM   2754   C CB    A SER B  1 53  ? 49.397  -10.612 20.926  0.25 28.82  ? 53   SER B CB    1 
ATOM   2755   O OG    A SER B  1 53  ? 49.903  -11.111 19.692  0.25 28.81  ? 53   SER B OG    1 
ATOM   2756   N N     A PHE B  1 54  ? 46.950  -8.860  20.123  0.25 23.68  ? 54   PHE B N     1 
ATOM   2757   C CA    A PHE B  1 54  ? 46.294  -8.033  19.114  0.25 23.69  ? 54   PHE B CA    1 
ATOM   2758   C C     A PHE B  1 54  ? 47.379  -7.367  18.258  0.25 24.59  ? 54   PHE B C     1 
ATOM   2759   O O     A PHE B  1 54  ? 48.452  -7.024  18.760  0.25 21.34  ? 54   PHE B O     1 
ATOM   2760   C CB    A PHE B  1 54  ? 45.466  -6.908  19.764  0.25 23.69  ? 54   PHE B CB    1 
ATOM   2761   C CG    A PHE B  1 54  ? 44.197  -7.366  20.406  0.25 23.70  ? 54   PHE B CG    1 
ATOM   2762   C CD1   A PHE B  1 54  ? 43.776  -8.689  20.296  0.25 23.14  ? 54   PHE B CD1   1 
ATOM   2763   C CD2   A PHE B  1 54  ? 43.413  -6.461  21.119  0.25 24.27  ? 54   PHE B CD2   1 
ATOM   2764   C CE1   A PHE B  1 54  ? 42.583  -9.106  20.898  0.25 27.04  ? 54   PHE B CE1   1 
ATOM   2765   C CE2   A PHE B  1 54  ? 42.213  -6.868  21.723  0.25 24.80  ? 54   PHE B CE2   1 
ATOM   2766   C CZ    A PHE B  1 54  ? 41.803  -8.189  21.612  0.25 24.76  ? 54   PHE B CZ    1 
ATOM   2767   N N     A ARG B  1 55  ? 47.089  -7.164  16.978  0.25 26.20  ? 55   ARG B N     1 
ATOM   2768   C CA    A ARG B  1 55  ? 48.047  -6.508  16.092  0.25 28.48  ? 55   ARG B CA    1 
ATOM   2769   C C     A ARG B  1 55  ? 47.288  -5.430  15.349  0.25 27.40  ? 55   ARG B C     1 
ATOM   2770   O O     A ARG B  1 55  ? 46.218  -5.692  14.801  0.25 27.43  ? 55   ARG B O     1 
ATOM   2771   C CB    A ARG B  1 55  ? 48.655  -7.506  15.092  0.25 28.09  ? 55   ARG B CB    1 
ATOM   2772   C CG    A ARG B  1 55  ? 49.273  -8.749  15.736  0.25 34.02  ? 55   ARG B CG    1 
ATOM   2773   C CD    A ARG B  1 55  ? 49.975  -9.619  14.686  0.25 35.17  ? 55   ARG B CD    1 
ATOM   2774   N NE    A ARG B  1 55  ? 51.309  -9.103  14.386  0.25 38.49  ? 55   ARG B NE    1 
ATOM   2775   C CZ    A ARG B  1 55  ? 52.397  -9.431  15.085  0.25 38.41  ? 55   ARG B CZ    1 
ATOM   2776   N NH1   A ARG B  1 55  ? 52.287  -10.274 16.102  0.25 33.95  ? 55   ARG B NH1   1 
ATOM   2777   N NH2   A ARG B  1 55  ? 53.586  -8.915  14.779  0.25 36.84  ? 55   ARG B NH2   1 
ATOM   2778   N N     A PHE B  1 56  ? 47.835  -4.218  15.347  0.25 25.44  ? 56   PHE B N     1 
ATOM   2779   C CA    A PHE B  1 56  ? 47.213  -3.101  14.665  0.25 25.24  ? 56   PHE B CA    1 
ATOM   2780   C C     A PHE B  1 56  ? 48.208  -2.396  13.772  0.25 25.22  ? 56   PHE B C     1 
ATOM   2781   O O     A PHE B  1 56  ? 49.303  -2.048  14.207  0.25 24.77  ? 56   PHE B O     1 
ATOM   2782   C CB    A PHE B  1 56  ? 46.659  -2.089  15.688  0.25 22.42  ? 56   PHE B CB    1 
ATOM   2783   C CG    A PHE B  1 56  ? 45.569  -2.641  16.559  0.25 22.55  ? 56   PHE B CG    1 
ATOM   2784   C CD1   A PHE B  1 56  ? 44.268  -2.736  16.087  0.25 21.38  ? 56   PHE B CD1   1 
ATOM   2785   C CD2   A PHE B  1 56  ? 45.846  -3.062  17.861  0.25 22.59  ? 56   PHE B CD2   1 
ATOM   2786   C CE1   A PHE B  1 56  ? 43.252  -3.240  16.897  0.25 20.35  ? 56   PHE B CE1   1 
ATOM   2787   C CE2   A PHE B  1 56  ? 44.840  -3.570  18.677  0.25 23.15  ? 56   PHE B CE2   1 
ATOM   2788   C CZ    A PHE B  1 56  ? 43.530  -3.657  18.187  0.25 21.73  ? 56   PHE B CZ    1 
ATOM   2789   N N     A SER B  1 57  ? 47.831  -2.188  12.520  0.25 24.92  ? 57   SER B N     1 
ATOM   2790   C CA    A SER B  1 57  ? 48.701  -1.483  11.591  0.25 27.17  ? 57   SER B CA    1 
ATOM   2791   C C     A SER B  1 57  ? 48.670  0.021   11.863  0.25 27.97  ? 57   SER B C     1 
ATOM   2792   O O     A SER B  1 57  ? 47.600  0.607   12.037  0.25 31.76  ? 57   SER B O     1 
ATOM   2793   C CB    A SER B  1 57  ? 48.258  -1.735  10.141  0.25 27.69  ? 57   SER B CB    1 
ATOM   2794   O OG    A SER B  1 57  ? 48.940  -0.850  9.269   0.25 24.83  ? 57   SER B OG    1 
ATOM   2795   N N     A LEU B  1 58  ? 49.840  0.649   11.898  0.25 27.06  ? 58   LEU B N     1 
ATOM   2796   C CA    A LEU B  1 58  ? 49.930  2.093   12.118  0.25 28.50  ? 58   LEU B CA    1 
ATOM   2797   C C     A LEU B  1 58  ? 50.388  2.795   10.830  0.25 28.47  ? 58   LEU B C     1 
ATOM   2798   O O     A LEU B  1 58  ? 50.735  3.976   10.841  0.25 30.18  ? 58   LEU B O     1 
ATOM   2799   C CB    A LEU B  1 58  ? 50.923  2.401   13.246  0.25 28.21  ? 58   LEU B CB    1 
ATOM   2800   C CG    A LEU B  1 58  ? 50.630  1.721   14.592  0.25 25.43  ? 58   LEU B CG    1 
ATOM   2801   C CD1   A LEU B  1 58  ? 51.688  2.150   15.606  0.25 22.47  ? 58   LEU B CD1   1 
ATOM   2802   C CD2   A LEU B  1 58  ? 49.239  2.112   15.074  0.25 27.27  ? 58   LEU B CD2   1 
ATOM   2803   N N     A ALA B  1 59  ? 50.402  2.052   9.728   0.25 30.00  ? 59   ALA B N     1 
ATOM   2804   C CA    A ALA B  1 59  ? 50.823  2.605   8.442   0.25 30.43  ? 59   ALA B CA    1 
ATOM   2805   C C     A ALA B  1 59  ? 49.773  3.583   7.915   0.25 32.06  ? 59   ALA B C     1 
ATOM   2806   O O     A ALA B  1 59  ? 48.607  3.560   8.350   0.25 29.47  ? 59   ALA B O     1 
ATOM   2807   C CB    A ALA B  1 59  ? 51.039  1.471   7.432   0.25 31.26  ? 59   ALA B CB    1 
ATOM   2808   N N     A ASP B  1 60  ? 50.192  4.439   6.985   0.25 33.01  ? 60   ASP B N     1 
ATOM   2809   C CA    A ASP B  1 60  ? 49.307  5.429   6.386   0.25 34.71  ? 60   ASP B CA    1 
ATOM   2810   C C     A ASP B  1 60  ? 48.619  6.305   7.440   0.25 34.81  ? 60   ASP B C     1 
ATOM   2811   O O     A ASP B  1 60  ? 47.432  6.606   7.327   0.25 33.86  ? 60   ASP B O     1 
ATOM   2812   C CB    A ASP B  1 60  ? 48.257  4.724   5.526   0.25 38.65  ? 60   ASP B CB    1 
ATOM   2813   C CG    A ASP B  1 60  ? 48.881  3.839   4.468   0.25 42.96  ? 60   ASP B CG    1 
ATOM   2814   O OD1   A ASP B  1 60  ? 49.677  4.363   3.657   0.25 45.20  ? 60   ASP B OD1   1 
ATOM   2815   O OD2   A ASP B  1 60  ? 48.581  2.621   4.449   0.25 46.20  ? 60   ASP B OD2   1 
ATOM   2816   N N     A ASN B  1 61  ? 49.373  6.702   8.466   0.25 34.52  ? 61   ASN B N     1 
ATOM   2817   C CA    A ASN B  1 61  ? 48.855  7.552   9.537   0.25 33.34  ? 61   ASN B CA    1 
ATOM   2818   C C     A ASN B  1 61  ? 47.625  6.987   10.253  0.25 32.57  ? 61   ASN B C     1 
ATOM   2819   O O     A ASN B  1 61  ? 46.841  7.738   10.830  0.25 32.77  ? 61   ASN B O     1 
ATOM   2820   C CB    A ASN B  1 61  ? 48.494  8.935   8.988   0.25 34.04  ? 61   ASN B CB    1 
ATOM   2821   C CG    A ASN B  1 61  ? 49.520  9.465   8.009   0.25 36.51  ? 61   ASN B CG    1 
ATOM   2822   O OD1   A ASN B  1 61  ? 49.356  9.337   6.795   0.25 39.39  ? 61   ASN B OD1   1 
ATOM   2823   N ND2   A ASN B  1 61  ? 50.584  10.064  8.530   0.25 36.29  ? 61   ASN B ND2   1 
ATOM   2824   N N     A THR B  1 62  ? 47.459  5.671   10.240  0.25 31.48  ? 62   THR B N     1 
ATOM   2825   C CA    A THR B  1 62  ? 46.298  5.065   10.881  0.25 29.52  ? 62   THR B CA    1 
ATOM   2826   C C     A THR B  1 62  ? 46.358  5.048   12.411  0.25 30.32  ? 62   THR B C     1 
ATOM   2827   O O     A THR B  1 62  ? 47.403  4.763   13.010  0.25 28.20  ? 62   THR B O     1 
ATOM   2828   C CB    A THR B  1 62  ? 46.094  3.638   10.370  0.25 27.88  ? 62   THR B CB    1 
ATOM   2829   O OG1   A THR B  1 62  ? 45.979  3.673   8.947   0.25 27.80  ? 62   THR B OG1   1 
ATOM   2830   C CG2   A THR B  1 62  ? 44.835  3.018   10.963  0.25 27.34  ? 62   THR B CG2   1 
ATOM   2831   N N     A LEU B  1 63  ? 45.225  5.368   13.036  0.25 29.29  ? 63   LEU B N     1 
ATOM   2832   C CA    A LEU B  1 63  ? 45.119  5.373   14.492  0.25 27.89  ? 63   LEU B CA    1 
ATOM   2833   C C     A LEU B  1 63  ? 44.009  4.398   14.893  0.25 28.30  ? 63   LEU B C     1 
ATOM   2834   O O     A LEU B  1 63  ? 42.827  4.626   14.607  0.25 26.85  ? 63   LEU B O     1 
ATOM   2835   C CB    A LEU B  1 63  ? 44.794  6.769   15.011  0.25 25.90  ? 63   LEU B CB    1 
ATOM   2836   C CG    A LEU B  1 63  ? 44.445  6.872   16.506  0.25 29.10  ? 63   LEU B CG    1 
ATOM   2837   C CD1   A LEU B  1 63  ? 45.609  6.358   17.359  0.25 28.86  ? 63   LEU B CD1   1 
ATOM   2838   C CD2   A LEU B  1 63  ? 44.125  8.314   16.870  0.25 30.47  ? 63   LEU B CD2   1 
ATOM   2839   N N     A PRO B  1 64  ? 44.379  3.289   15.560  0.25 26.99  ? 64   PRO B N     1 
ATOM   2840   C CA    A PRO B  1 64  ? 43.376  2.303   15.974  0.25 25.94  ? 64   PRO B CA    1 
ATOM   2841   C C     A PRO B  1 64  ? 42.511  2.760   17.134  0.25 25.47  ? 64   PRO B C     1 
ATOM   2842   O O     A PRO B  1 64  ? 42.617  2.234   18.243  0.25 24.21  ? 64   PRO B O     1 
ATOM   2843   C CB    A PRO B  1 64  ? 44.220  1.075   16.304  0.25 26.28  ? 64   PRO B CB    1 
ATOM   2844   C CG    A PRO B  1 64  ? 45.500  1.666   16.796  0.25 25.19  ? 64   PRO B CG    1 
ATOM   2845   C CD    A PRO B  1 64  ? 45.746  2.800   15.831  0.25 26.97  ? 64   PRO B CD    1 
ATOM   2846   N N     A LEU B  1 65  ? 41.675  3.764   16.873  0.25 24.83  ? 65   LEU B N     1 
ATOM   2847   C CA    A LEU B  1 65  ? 40.759  4.304   17.881  0.25 22.31  ? 65   LEU B CA    1 
ATOM   2848   C C     A LEU B  1 65  ? 39.430  3.585   17.619  0.25 22.83  ? 65   LEU B C     1 
ATOM   2849   O O     A LEU B  1 65  ? 38.801  3.807   16.598  0.25 22.87  ? 65   LEU B O     1 
ATOM   2850   C CB    A LEU B  1 65  ? 40.602  5.818   17.672  0.25 23.20  ? 65   LEU B CB    1 
ATOM   2851   C CG    A LEU B  1 65  ? 39.761  6.585   18.711  0.25 25.41  ? 65   LEU B CG    1 
ATOM   2852   C CD1   A LEU B  1 65  ? 40.448  6.516   20.054  0.25 23.09  ? 65   LEU B CD1   1 
ATOM   2853   C CD2   A LEU B  1 65  ? 39.590  8.033   18.289  0.25 24.57  ? 65   LEU B CD2   1 
ATOM   2854   N N     A LEU B  1 66  ? 39.013  2.722   18.537  0.25 23.26  ? 66   LEU B N     1 
ATOM   2855   C CA    A LEU B  1 66  ? 37.799  1.931   18.359  0.25 23.79  ? 66   LEU B CA    1 
ATOM   2856   C C     A LEU B  1 66  ? 36.589  2.749   17.906  0.25 25.84  ? 66   LEU B C     1 
ATOM   2857   O O     A LEU B  1 66  ? 36.358  3.857   18.389  0.25 24.61  ? 66   LEU B O     1 
ATOM   2858   C CB    A LEU B  1 66  ? 37.463  1.184   19.644  0.25 22.17  ? 66   LEU B CB    1 
ATOM   2859   C CG    A LEU B  1 66  ? 38.551  0.297   20.268  0.25 25.93  ? 66   LEU B CG    1 
ATOM   2860   C CD1   A LEU B  1 66  ? 37.889  -0.581  21.332  0.25 21.96  ? 66   LEU B CD1   1 
ATOM   2861   C CD2   A LEU B  1 66  ? 39.236  -0.563  19.218  0.25 21.86  ? 66   LEU B CD2   1 
ATOM   2862   N N     A THR B  1 67  ? 35.809  2.165   16.999  0.25 27.90  ? 67   THR B N     1 
ATOM   2863   C CA    A THR B  1 67  ? 34.638  2.823   16.437  0.25 26.22  ? 67   THR B CA    1 
ATOM   2864   C C     A THR B  1 67  ? 33.301  2.222   16.851  0.25 27.93  ? 67   THR B C     1 
ATOM   2865   O O     A THR B  1 67  ? 32.247  2.825   16.605  0.25 26.96  ? 67   THR B O     1 
ATOM   2866   C CB    A THR B  1 67  ? 34.704  2.807   14.917  0.25 26.49  ? 67   THR B CB    1 
ATOM   2867   O OG1   A THR B  1 67  ? 34.615  1.455   14.458  0.25 24.29  ? 67   THR B OG1   1 
ATOM   2868   C CG2   A THR B  1 67  ? 36.018  3.434   14.439  0.25 21.96  ? 67   THR B CG2   1 
ATOM   2869   N N     A THR B  1 68  ? 33.317  1.051   17.480  0.25 26.55  ? 68   THR B N     1 
ATOM   2870   C CA    A THR B  1 68  ? 32.049  0.445   17.890  0.25 27.42  ? 68   THR B CA    1 
ATOM   2871   C C     A THR B  1 68  ? 31.442  1.135   19.109  0.25 28.20  ? 68   THR B C     1 
ATOM   2872   O O     A THR B  1 68  ? 30.381  0.742   19.593  0.25 25.63  ? 68   THR B O     1 
ATOM   2873   C CB    A THR B  1 68  ? 32.176  -1.069  18.147  0.25 27.99  ? 68   THR B CB    1 
ATOM   2874   O OG1   A THR B  1 68  ? 33.278  -1.340  19.015  0.25 29.40  ? 68   THR B OG1   1 
ATOM   2875   C CG2   A THR B  1 68  ? 32.372  -1.802  16.827  0.25 29.62  ? 68   THR B CG2   1 
ATOM   2876   N N     A LYS B  1 69  ? 32.143  2.154   19.605  0.25 27.75  ? 69   LYS B N     1 
ATOM   2877   C CA    A LYS B  1 69  ? 31.653  2.988   20.703  0.25 28.04  ? 69   LYS B CA    1 
ATOM   2878   C C     A LYS B  1 69  ? 32.468  4.276   20.651  0.25 27.52  ? 69   LYS B C     1 
ATOM   2879   O O     A LYS B  1 69  ? 33.585  4.282   20.130  0.25 25.83  ? 69   LYS B O     1 
ATOM   2880   C CB    A LYS B  1 69  ? 31.823  2.309   22.067  0.25 26.92  ? 69   LYS B CB    1 
ATOM   2881   C CG    A LYS B  1 69  ? 33.167  2.593   22.735  0.25 27.38  ? 69   LYS B CG    1 
ATOM   2882   C CD    A LYS B  1 69  ? 33.178  2.061   24.157  0.25 26.81  ? 69   LYS B CD    1 
ATOM   2883   C CE    A LYS B  1 69  ? 34.526  2.320   24.827  0.25 27.78  ? 69   LYS B CE    1 
ATOM   2884   N NZ    A LYS B  1 69  ? 34.577  1.688   26.176  0.25 27.34  ? 69   LYS B NZ    1 
ATOM   2885   N N     A ARG B  1 70  ? 31.902  5.371   21.152  0.25 28.13  ? 70   ARG B N     1 
ATOM   2886   C CA    A ARG B  1 70  ? 32.639  6.624   21.155  0.25 27.75  ? 70   ARG B CA    1 
ATOM   2887   C C     A ARG B  1 70  ? 33.707  6.567   22.253  0.25 26.99  ? 70   ARG B C     1 
ATOM   2888   O O     A ARG B  1 70  ? 33.394  6.347   23.425  0.25 24.90  ? 70   ARG B O     1 
ATOM   2889   C CB    A ARG B  1 70  ? 31.704  7.811   21.413  0.25 31.96  ? 70   ARG B CB    1 
ATOM   2890   C CG    A ARG B  1 70  ? 32.399  9.162   21.336  0.25 34.76  ? 70   ARG B CG    1 
ATOM   2891   C CD    A ARG B  1 70  ? 31.396  10.293  21.217  0.25 38.87  ? 70   ARG B CD    1 
ATOM   2892   N NE    A ARG B  1 70  ? 30.743  10.648  22.463  0.25 39.74  ? 70   ARG B NE    1 
ATOM   2893   C CZ    A ARG B  1 70  ? 29.463  10.466  22.785  0.25 40.60  ? 70   ARG B CZ    1 
ATOM   2894   N NH1   A ARG B  1 70  ? 29.064  10.892  23.977  0.25 34.99  ? 70   ARG B NH1   1 
ATOM   2895   N NH2   A ARG B  1 70  ? 28.604  9.855   21.964  0.25 33.95  ? 70   ARG B NH2   1 
ATOM   2896   N N     A VAL B  1 71  ? 34.963  6.748   21.863  0.25 25.76  ? 71   VAL B N     1 
ATOM   2897   C CA    A VAL B  1 71  ? 36.065  6.729   22.817  0.25 24.91  ? 71   VAL B CA    1 
ATOM   2898   C C     A VAL B  1 71  ? 36.476  8.147   23.154  0.25 22.72  ? 71   VAL B C     1 
ATOM   2899   O O     A VAL B  1 71  ? 36.616  8.968   22.263  0.25 24.22  ? 71   VAL B O     1 
ATOM   2900   C CB    A VAL B  1 71  ? 37.301  5.966   22.233  0.25 25.81  ? 71   VAL B CB    1 
ATOM   2901   C CG1   A VAL B  1 71  ? 38.441  5.944   23.251  0.25 25.06  ? 71   VAL B CG1   1 
ATOM   2902   C CG2   A VAL B  1 71  ? 36.902  4.541   21.881  0.25 26.13  ? 71   VAL B CG2   1 
ATOM   2903   N N     A PHE B  1 72  ? 36.686  8.428   24.436  0.25 24.49  ? 72   PHE B N     1 
ATOM   2904   C CA    A PHE B  1 72  ? 37.082  9.759   24.894  0.25 25.49  ? 72   PHE B CA    1 
ATOM   2905   C C     A PHE B  1 72  ? 38.524  10.063  24.441  0.25 25.51  ? 72   PHE B C     1 
ATOM   2906   O O     A PHE B  1 72  ? 39.462  10.020  25.244  0.25 24.83  ? 72   PHE B O     1 
ATOM   2907   C CB    A PHE B  1 72  ? 36.972  9.829   26.428  0.25 25.36  ? 72   PHE B CB    1 
ATOM   2908   C CG    A PHE B  1 72  ? 37.219  11.209  27.014  0.25 26.37  ? 72   PHE B CG    1 
ATOM   2909   C CD1   A PHE B  1 72  ? 37.499  11.359  28.375  0.25 25.00  ? 72   PHE B CD1   1 
ATOM   2910   C CD2   A PHE B  1 72  ? 37.134  12.354  26.226  0.25 27.34  ? 72   PHE B CD2   1 
ATOM   2911   C CE1   A PHE B  1 72  ? 37.689  12.635  28.936  0.25 25.41  ? 72   PHE B CE1   1 
ATOM   2912   C CE2   A PHE B  1 72  ? 37.321  13.625  26.781  0.25 26.43  ? 72   PHE B CE2   1 
ATOM   2913   C CZ    A PHE B  1 72  ? 37.598  13.759  28.138  0.25 27.03  ? 72   PHE B CZ    1 
ATOM   2914   N N     A LEU B  1 73  ? 38.683  10.379  23.159  0.25 24.03  ? 73   LEU B N     1 
ATOM   2915   C CA    A LEU B  1 73  ? 39.991  10.669  22.578  0.25 26.43  ? 73   LEU B CA    1 
ATOM   2916   C C     A LEU B  1 73  ? 40.821  11.679  23.372  0.25 27.16  ? 73   LEU B C     1 
ATOM   2917   O O     A LEU B  1 73  ? 41.986  11.421  23.692  0.25 27.69  ? 73   LEU B O     1 
ATOM   2918   C CB    A LEU B  1 73  ? 39.821  11.155  21.135  0.25 24.48  ? 73   LEU B CB    1 
ATOM   2919   C CG    A LEU B  1 73  ? 41.083  11.643  20.401  0.25 28.26  ? 73   LEU B CG    1 
ATOM   2920   C CD1   A LEU B  1 73  ? 42.144  10.517  20.290  0.25 24.63  ? 73   LEU B CD1   1 
ATOM   2921   C CD2   A LEU B  1 73  ? 40.680  12.144  19.010  0.25 25.10  ? 73   LEU B CD2   1 
ATOM   2922   N N     A ARG B  1 74  ? 40.228  12.825  23.690  0.25 26.87  ? 74   ARG B N     1 
ATOM   2923   C CA    A ARG B  1 74  ? 40.938  13.852  24.435  0.25 27.64  ? 74   ARG B CA    1 
ATOM   2924   C C     A ARG B  1 74  ? 41.481  13.304  25.769  0.25 24.77  ? 74   ARG B C     1 
ATOM   2925   O O     A ARG B  1 74  ? 42.551  13.694  26.227  0.25 23.34  ? 74   ARG B O     1 
ATOM   2926   C CB    A ARG B  1 74  ? 40.018  15.073  24.683  0.25 30.16  ? 74   ARG B CB    1 
ATOM   2927   C CG    A ARG B  1 74  ? 40.701  16.232  25.407  0.25 28.95  ? 74   ARG B CG    1 
ATOM   2928   C CD    A ARG B  1 74  ? 39.928  17.539  25.241  0.25 36.84  ? 74   ARG B CD    1 
ATOM   2929   N NE    A ARG B  1 74  ? 38.587  17.493  25.833  0.25 41.38  ? 74   ARG B NE    1 
ATOM   2930   C CZ    A ARG B  1 74  ? 38.324  17.571  27.139  0.25 44.64  ? 74   ARG B CZ    1 
ATOM   2931   N NH1   A ARG B  1 74  ? 39.319  17.699  28.009  0.25 46.17  ? 74   ARG B NH1   1 
ATOM   2932   N NH2   A ARG B  1 74  ? 37.063  17.528  27.575  0.25 40.98  ? 74   ARG B NH2   1 
ATOM   2933   N N     A GLY B  1 75  ? 40.728  12.410  26.384  0.25 22.87  ? 75   GLY B N     1 
ATOM   2934   C CA    A GLY B  1 75  ? 41.152  11.826  27.633  0.25 21.85  ? 75   GLY B CA    1 
ATOM   2935   C C     A GLY B  1 75  ? 42.383  10.946  27.430  0.25 23.70  ? 75   GLY B C     1 
ATOM   2936   O O     A GLY B  1 75  ? 43.279  10.921  28.274  0.25 22.88  ? 75   GLY B O     1 
ATOM   2937   N N     A VAL B  1 76  ? 42.421  10.212  26.321  0.25 21.32  ? 76   VAL B N     1 
ATOM   2938   C CA    A VAL B  1 76  ? 43.562  9.363   26.006  0.25 21.26  ? 76   VAL B CA    1 
ATOM   2939   C C     A VAL B  1 76  ? 44.801  10.242  25.796  0.25 23.64  ? 76   VAL B C     1 
ATOM   2940   O O     A VAL B  1 76  ? 45.848  9.998   26.385  0.25 25.27  ? 76   VAL B O     1 
ATOM   2941   C CB    A VAL B  1 76  ? 43.301  8.552   24.709  0.25 21.14  ? 76   VAL B CB    1 
ATOM   2942   C CG1   A VAL B  1 76  ? 44.517  7.693   24.374  0.25 17.59  ? 76   VAL B CG1   1 
ATOM   2943   C CG2   A VAL B  1 76  ? 42.053  7.660   24.894  0.25 19.78  ? 76   VAL B CG2   1 
ATOM   2944   N N     A ILE B  1 77  ? 44.675  11.266  24.951  0.25 22.84  ? 77   ILE B N     1 
ATOM   2945   C CA    A ILE B  1 77  ? 45.786  12.159  24.667  0.25 24.30  ? 77   ILE B CA    1 
ATOM   2946   C C     A ILE B  1 77  ? 46.279  12.860  25.930  0.25 26.20  ? 77   ILE B C     1 
ATOM   2947   O O     A ILE B  1 77  ? 47.481  12.923  26.180  0.25 25.83  ? 77   ILE B O     1 
ATOM   2948   C CB    A ILE B  1 77  ? 45.397  13.233  23.646  0.25 25.25  ? 77   ILE B CB    1 
ATOM   2949   C CG1   A ILE B  1 77  ? 44.951  12.576  22.340  0.25 23.41  ? 77   ILE B CG1   1 
ATOM   2950   C CG2   A ILE B  1 77  ? 46.590  14.171  23.397  0.25 24.02  ? 77   ILE B CG2   1 
ATOM   2951   C CD1   A ILE B  1 77  ? 44.360  13.567  21.331  0.25 22.81  ? 77   ILE B CD1   1 
ATOM   2952   N N     A ALA B  1 78  ? 45.353  13.401  26.717  0.25 24.30  ? 78   ALA B N     1 
ATOM   2953   C CA    A ALA B  1 78  ? 45.732  14.078  27.944  0.25 25.13  ? 78   ALA B CA    1 
ATOM   2954   C C     A ALA B  1 78  ? 46.510  13.148  28.886  0.25 24.95  ? 78   ALA B C     1 
ATOM   2955   O O     A ALA B  1 78  ? 47.534  13.547  29.445  0.25 25.01  ? 78   ALA B O     1 
ATOM   2956   C CB    A ALA B  1 78  ? 44.505  14.616  28.657  0.25 22.68  ? 78   ALA B CB    1 
ATOM   2957   N N     A GLU B  1 79  ? 46.005  11.932  29.084  0.25 25.97  ? 79   GLU B N     1 
ATOM   2958   C CA    A GLU B  1 79  ? 46.665  10.991  29.975  0.25 25.12  ? 79   GLU B CA    1 
ATOM   2959   C C     A GLU B  1 79  ? 48.075  10.657  29.460  0.25 25.73  ? 79   GLU B C     1 
ATOM   2960   O O     A GLU B  1 79  ? 49.026  10.559  30.247  0.25 22.25  ? 79   GLU B O     1 
ATOM   2961   C CB    A GLU B  1 79  ? 45.847  9.700   30.120  0.25 22.63  ? 79   GLU B CB    1 
ATOM   2962   C CG    A GLU B  1 79  ? 46.548  8.652   31.013  0.25 23.85  ? 79   GLU B CG    1 
ATOM   2963   C CD    A GLU B  1 79  ? 45.917  7.282   30.929  0.25 21.96  ? 79   GLU B CD    1 
ATOM   2964   O OE1   A GLU B  1 79  ? 45.601  6.861   29.800  0.25 24.24  ? 79   GLU B OE1   1 
ATOM   2965   O OE2   A GLU B  1 79  ? 45.748  6.624   31.981  0.25 20.22  ? 79   GLU B OE2   1 
ATOM   2966   N N     A LEU B  1 80  ? 48.200  10.510  28.142  0.25 24.25  ? 80   LEU B N     1 
ATOM   2967   C CA    A LEU B  1 80  ? 49.483  10.166  27.537  0.25 25.72  ? 80   LEU B CA    1 
ATOM   2968   C C     A LEU B  1 80  ? 50.524  11.264  27.726  0.25 26.35  ? 80   LEU B C     1 
ATOM   2969   O O     A LEU B  1 80  ? 51.672  10.983  28.091  0.25 26.22  ? 80   LEU B O     1 
ATOM   2970   C CB    A LEU B  1 80  ? 49.314  9.878   26.043  0.25 23.52  ? 80   LEU B CB    1 
ATOM   2971   C CG    A LEU B  1 80  ? 50.621  9.577   25.280  0.25 26.78  ? 80   LEU B CG    1 
ATOM   2972   C CD1   A LEU B  1 80  ? 51.379  8.396   25.937  0.25 22.15  ? 80   LEU B CD1   1 
ATOM   2973   C CD2   A LEU B  1 80  ? 50.295  9.250   23.825  0.25 23.23  ? 80   LEU B CD2   1 
ATOM   2974   N N     A LEU B  1 81  ? 50.130  12.511  27.488  0.25 22.37  ? 81   LEU B N     1 
ATOM   2975   C CA    A LEU B  1 81  ? 51.077  13.624  27.621  0.25 25.26  ? 81   LEU B CA    1 
ATOM   2976   C C     A LEU B  1 81  ? 51.440  13.771  29.091  0.25 24.24  ? 81   LEU B C     1 
ATOM   2977   O O     A LEU B  1 81  ? 52.516  14.243  29.442  0.25 24.04  ? 81   LEU B O     1 
ATOM   2978   C CB    A LEU B  1 81  ? 50.455  14.933  27.090  0.25 24.95  ? 81   LEU B CB    1 
ATOM   2979   C CG    A LEU B  1 81  ? 50.108  14.922  25.592  0.25 26.09  ? 81   LEU B CG    1 
ATOM   2980   C CD1   A LEU B  1 81  ? 49.574  16.285  25.164  0.25 23.14  ? 81   LEU B CD1   1 
ATOM   2981   C CD2   A LEU B  1 81  ? 51.375  14.562  24.783  0.25 22.55  ? 81   LEU B CD2   1 
ATOM   2982   N N     A TRP B  1 82  ? 50.516  13.347  29.942  0.25 22.90  ? 82   TRP B N     1 
ATOM   2983   C CA    A TRP B  1 82  ? 50.685  13.415  31.374  0.25 21.02  ? 82   TRP B CA    1 
ATOM   2984   C C     A TRP B  1 82  ? 51.787  12.387  31.729  0.25 23.48  ? 82   TRP B C     1 
ATOM   2985   O O     A TRP B  1 82  ? 52.713  12.716  32.465  0.25 22.02  ? 82   TRP B O     1 
ATOM   2986   C CB    A TRP B  1 82  ? 49.342  13.082  32.017  0.25 22.21  ? 82   TRP B CB    1 
ATOM   2987   C CG    A TRP B  1 82  ? 49.307  13.007  33.502  0.25 20.02  ? 82   TRP B CG    1 
ATOM   2988   C CD1   A TRP B  1 82  ? 49.499  14.036  34.385  0.25 19.88  ? 82   TRP B CD1   1 
ATOM   2989   C CD2   A TRP B  1 82  ? 48.958  11.861  34.289  0.25 20.65  ? 82   TRP B CD2   1 
ATOM   2990   N NE1   A TRP B  1 82  ? 49.287  13.595  35.680  0.25 18.83  ? 82   TRP B NE1   1 
ATOM   2991   C CE2   A TRP B  1 82  ? 48.954  12.267  35.642  0.25 18.87  ? 82   TRP B CE2   1 
ATOM   2992   C CE3   A TRP B  1 82  ? 48.646  10.527  33.981  0.25 20.01  ? 82   TRP B CE3   1 
ATOM   2993   C CZ2   A TRP B  1 82  ? 48.652  11.389  36.675  0.25 18.88  ? 82   TRP B CZ2   1 
ATOM   2994   C CZ3   A TRP B  1 82  ? 48.346  9.664   35.005  0.25 18.61  ? 82   TRP B CZ3   1 
ATOM   2995   C CH2   A TRP B  1 82  ? 48.349  10.097  36.341  0.25 19.19  ? 82   TRP B CH2   1 
ATOM   2996   N N     A PHE B  1 83  ? 51.687  11.169  31.184  0.25 22.93  ? 83   PHE B N     1 
ATOM   2997   C CA    A PHE B  1 83  ? 52.687  10.119  31.423  0.25 23.71  ? 83   PHE B CA    1 
ATOM   2998   C C     A PHE B  1 83  ? 54.051  10.653  31.000  0.25 22.87  ? 83   PHE B C     1 
ATOM   2999   O O     A PHE B  1 83  ? 55.007  10.625  31.762  0.25 22.67  ? 83   PHE B O     1 
ATOM   3000   C CB    A PHE B  1 83  ? 52.429  8.868   30.580  0.25 20.37  ? 83   PHE B CB    1 
ATOM   3001   C CG    A PHE B  1 83  ? 51.213  8.061   30.984  0.25 20.94  ? 83   PHE B CG    1 
ATOM   3002   C CD1   A PHE B  1 83  ? 50.751  8.058   32.285  0.25 20.40  ? 83   PHE B CD1   1 
ATOM   3003   C CD2   A PHE B  1 83  ? 50.566  7.258   30.043  0.25 20.95  ? 83   PHE B CD2   1 
ATOM   3004   C CE1   A PHE B  1 83  ? 49.668  7.273   32.654  0.25 20.16  ? 83   PHE B CE1   1 
ATOM   3005   C CE2   A PHE B  1 83  ? 49.478  6.468   30.408  0.25 22.60  ? 83   PHE B CE2   1 
ATOM   3006   C CZ    A PHE B  1 83  ? 49.032  6.482   31.729  0.25 20.10  ? 83   PHE B CZ    1 
ATOM   3007   N N     A VAL B  1 84  ? 54.121  11.121  29.754  0.25 25.33  ? 84   VAL B N     1 
ATOM   3008   C CA    A VAL B  1 84  ? 55.359  11.653  29.195  0.25 23.33  ? 84   VAL B CA    1 
ATOM   3009   C C     A VAL B  1 84  ? 56.001  12.704  30.084  0.25 23.41  ? 84   VAL B C     1 
ATOM   3010   O O     A VAL B  1 84  ? 57.225  12.680  30.293  0.25 22.33  ? 84   VAL B O     1 
ATOM   3011   C CB    A VAL B  1 84  ? 55.113  12.216  27.789  0.25 24.72  ? 84   VAL B CB    1 
ATOM   3012   C CG1   A VAL B  1 84  ? 56.375  12.885  27.243  0.25 23.47  ? 84   VAL B CG1   1 
ATOM   3013   C CG2   A VAL B  1 84  ? 54.689  11.078  26.865  0.25 25.25  ? 84   VAL B CG2   1 
ATOM   3014   N N     A SER B  1 85  ? 55.189  13.612  30.622  0.25 21.64  ? 85   SER B N     1 
ATOM   3015   C CA    A SER B  1 85  ? 55.701  14.675  31.488  0.25 22.12  ? 85   SER B CA    1 
ATOM   3016   C C     A SER B  1 85  ? 56.285  14.138  32.792  0.25 22.71  ? 85   SER B C     1 
ATOM   3017   O O     A SER B  1 85  ? 56.974  14.856  33.493  0.25 24.49  ? 85   SER B O     1 
ATOM   3018   C CB    A SER B  1 85  ? 54.591  15.688  31.843  0.25 22.87  ? 85   SER B CB    1 
ATOM   3019   O OG    A SER B  1 85  ? 53.649  15.102  32.728  0.25 23.59  ? 85   SER B OG    1 
ATOM   3020   N N     A GLY B  1 86  ? 56.001  12.885  33.116  0.25 23.72  ? 86   GLY B N     1 
ATOM   3021   C CA    A GLY B  1 86  ? 56.516  12.310  34.348  0.25 24.28  ? 86   GLY B CA    1 
ATOM   3022   C C     A GLY B  1 86  ? 55.702  12.704  35.569  0.25 24.48  ? 86   GLY B C     1 
ATOM   3023   O O     A GLY B  1 86  ? 56.043  12.347  36.694  0.25 23.63  ? 86   GLY B O     1 
ATOM   3024   N N     A CYS B  1 87  ? 54.613  13.426  35.337  0.25 25.34  ? 87   CYS B N     1 
ATOM   3025   C CA    A CYS B  1 87  ? 53.734  13.888  36.409  0.25 25.80  ? 87   CYS B CA    1 
ATOM   3026   C C     A CYS B  1 87  ? 52.896  12.737  36.984  0.25 25.23  ? 87   CYS B C     1 
ATOM   3027   O O     A CYS B  1 87  ? 52.482  11.852  36.254  0.25 26.45  ? 87   CYS B O     1 
ATOM   3028   C CB    A CYS B  1 87  ? 52.796  14.975  35.851  0.25 26.78  ? 87   CYS B CB    1 
ATOM   3029   S SG    A CYS B  1 87  ? 51.623  15.670  37.053  0.25 32.91  ? 87   CYS B SG    1 
ATOM   3030   N N     A THR B  1 88  ? 52.635  12.768  38.286  0.25 23.49  ? 88   THR B N     1 
ATOM   3031   C CA    A THR B  1 88  ? 51.831  11.730  38.932  0.25 22.68  ? 88   THR B CA    1 
ATOM   3032   C C     A THR B  1 88  ? 50.659  12.333  39.718  0.25 23.97  ? 88   THR B C     1 
ATOM   3033   O O     A THR B  1 88  ? 50.059  11.665  40.569  0.25 23.04  ? 88   THR B O     1 
ATOM   3034   C CB    A THR B  1 88  ? 52.681  10.907  39.903  0.25 21.77  ? 88   THR B CB    1 
ATOM   3035   O OG1   A THR B  1 88  ? 53.207  11.772  40.907  0.25 22.32  ? 88   THR B OG1   1 
ATOM   3036   C CG2   A THR B  1 88  ? 53.830  10.240  39.158  0.25 22.83  ? 88   THR B CG2   1 
ATOM   3037   N N     A ASP B  1 89  ? 50.358  13.602  39.455  0.25 22.75  ? 89   ASP B N     1 
ATOM   3038   C CA    A ASP B  1 89  ? 49.254  14.265  40.137  0.25 23.22  ? 89   ASP B CA    1 
ATOM   3039   C C     A ASP B  1 89  ? 48.010  14.225  39.242  0.25 21.95  ? 89   ASP B C     1 
ATOM   3040   O O     A ASP B  1 89  ? 47.968  14.884  38.201  0.25 20.85  ? 89   ASP B O     1 
ATOM   3041   C CB    A ASP B  1 89  ? 49.646  15.704  40.440  0.25 24.67  ? 89   ASP B CB    1 
ATOM   3042   C CG    A ASP B  1 89  ? 48.607  16.440  41.264  0.25 26.49  ? 89   ASP B CG    1 
ATOM   3043   O OD1   A ASP B  1 89  ? 48.913  17.572  41.683  0.25 27.12  ? 89   ASP B OD1   1 
ATOM   3044   O OD2   A ASP B  1 89  ? 47.500  15.903  41.490  0.25 24.01  ? 89   ASP B OD2   1 
ATOM   3045   N N     A ALA B  1 90  ? 47.014  13.444  39.655  0.25 21.90  ? 90   ALA B N     1 
ATOM   3046   C CA    A ALA B  1 90  ? 45.770  13.301  38.905  0.25 22.44  ? 90   ALA B CA    1 
ATOM   3047   C C     A ALA B  1 90  ? 45.010  14.626  38.719  0.25 24.57  ? 90   ALA B C     1 
ATOM   3048   O O     A ALA B  1 90  ? 44.208  14.770  37.777  0.25 26.44  ? 90   ALA B O     1 
ATOM   3049   C CB    A ALA B  1 90  ? 44.870  12.262  39.581  0.25 19.13  ? 90   ALA B CB    1 
ATOM   3050   N N     A LYS B  1 91  ? 45.257  15.596  39.593  0.25 24.28  ? 91   LYS B N     1 
ATOM   3051   C CA    A LYS B  1 91  ? 44.593  16.891  39.468  0.25 25.74  ? 91   LYS B CA    1 
ATOM   3052   C C     A LYS B  1 91  ? 44.981  17.565  38.146  0.25 26.39  ? 91   LYS B C     1 
ATOM   3053   O O     A LYS B  1 91  ? 44.260  18.424  37.657  0.25 24.57  ? 91   LYS B O     1 
ATOM   3054   C CB    A LYS B  1 91  ? 44.971  17.815  40.637  0.25 28.11  ? 91   LYS B CB    1 
ATOM   3055   C CG    A LYS B  1 91  ? 44.510  17.331  42.002  0.25 29.87  ? 91   LYS B CG    1 
ATOM   3056   C CD    A LYS B  1 91  ? 42.991  17.287  42.100  0.25 31.45  ? 91   LYS B CD    1 
ATOM   3057   C CE    A LYS B  1 91  ? 42.551  16.835  43.485  0.25 34.30  ? 91   LYS B CE    1 
ATOM   3058   N NZ    A LYS B  1 91  ? 41.071  16.679  43.614  0.25 36.54  ? 91   LYS B NZ    1 
ATOM   3059   N N     A MET B  1 92  ? 46.135  17.197  37.585  0.25 23.88  ? 92   MET B N     1 
ATOM   3060   C CA    A MET B  1 92  ? 46.568  17.788  36.329  0.25 27.17  ? 92   MET B CA    1 
ATOM   3061   C C     A MET B  1 92  ? 45.678  17.292  35.186  0.25 26.21  ? 92   MET B C     1 
ATOM   3062   O O     A MET B  1 92  ? 45.662  17.889  34.107  0.25 27.13  ? 92   MET B O     1 
ATOM   3063   C CB    A MET B  1 92  ? 48.025  17.430  36.025  0.25 32.06  ? 92   MET B CB    1 
ATOM   3064   C CG    A MET B  1 92  ? 49.003  17.864  37.108  0.25 40.57  ? 92   MET B CG    1 
ATOM   3065   S SD    A MET B  1 92  ? 48.858  19.608  37.488  0.25 51.86  ? 92   MET B SD    1 
ATOM   3066   C CE    A MET B  1 92  ? 49.446  20.316  35.920  0.25 47.57  ? 92   MET B CE    1 
ATOM   3067   N N     A LEU B  1 93  ? 44.958  16.197  35.421  0.25 24.41  ? 93   LEU B N     1 
ATOM   3068   C CA    A LEU B  1 93  ? 44.048  15.658  34.414  0.25 25.99  ? 93   LEU B CA    1 
ATOM   3069   C C     A LEU B  1 93  ? 42.634  16.183  34.692  0.25 25.28  ? 93   LEU B C     1 
ATOM   3070   O O     A LEU B  1 93  ? 41.959  16.639  33.774  0.25 26.83  ? 93   LEU B O     1 
ATOM   3071   C CB    A LEU B  1 93  ? 44.045  14.120  34.421  0.25 24.70  ? 93   LEU B CB    1 
ATOM   3072   C CG    A LEU B  1 93  ? 45.348  13.427  33.982  0.25 26.90  ? 93   LEU B CG    1 
ATOM   3073   C CD1   A LEU B  1 93  ? 45.190  11.905  34.126  0.25 25.99  ? 93   LEU B CD1   1 
ATOM   3074   C CD2   A LEU B  1 93  ? 45.677  13.806  32.519  0.25 20.79  ? 93   LEU B CD2   1 
ATOM   3075   N N     A SER B  1 94  ? 42.194  16.139  35.944  0.25 24.93  ? 94   SER B N     1 
ATOM   3076   C CA    A SER B  1 94  ? 40.849  16.614  36.275  0.25 28.25  ? 94   SER B CA    1 
ATOM   3077   C C     A SER B  1 94  ? 40.694  18.119  36.029  0.25 27.80  ? 94   SER B C     1 
ATOM   3078   O O     A SER B  1 94  ? 39.613  18.600  35.710  0.25 26.57  ? 94   SER B O     1 
ATOM   3079   C CB    A SER B  1 94  ? 40.489  16.271  37.729  0.25 28.24  ? 94   SER B CB    1 
ATOM   3080   O OG    A SER B  1 94  ? 41.433  16.810  38.646  0.25 34.00  ? 94   SER B OG    1 
ATOM   3081   N N     A SER B  1 95  ? 41.782  18.868  36.153  0.25 29.13  ? 95   SER B N     1 
ATOM   3082   C CA    A SER B  1 95  ? 41.721  20.302  35.929  0.25 28.62  ? 95   SER B CA    1 
ATOM   3083   C C     A SER B  1 95  ? 41.445  20.598  34.457  0.25 29.00  ? 95   SER B C     1 
ATOM   3084   O O     A SER B  1 95  ? 40.936  21.673  34.117  0.25 28.18  ? 95   SER B O     1 
ATOM   3085   C CB    A SER B  1 95  ? 43.021  20.991  36.364  0.25 30.34  ? 95   SER B CB    1 
ATOM   3086   O OG    A SER B  1 95  ? 44.117  20.582  35.555  0.25 35.79  ? 95   SER B OG    1 
ATOM   3087   N N     A GLN B  1 96  ? 41.781  19.659  33.579  0.25 28.86  ? 96   GLN B N     1 
ATOM   3088   C CA    A GLN B  1 96  ? 41.515  19.844  32.149  0.25 28.29  ? 96   GLN B CA    1 
ATOM   3089   C C     A GLN B  1 96  ? 40.330  18.994  31.691  0.25 26.44  ? 96   GLN B C     1 
ATOM   3090   O O     A GLN B  1 96  ? 40.208  18.655  30.525  0.25 27.19  ? 96   GLN B O     1 
ATOM   3091   C CB    A GLN B  1 96  ? 42.763  19.527  31.305  0.25 28.40  ? 96   GLN B CB    1 
ATOM   3092   C CG    A GLN B  1 96  ? 43.452  18.229  31.623  0.25 30.48  ? 96   GLN B CG    1 
ATOM   3093   C CD    A GLN B  1 96  ? 44.707  18.007  30.781  0.25 29.87  ? 96   GLN B CD    1 
ATOM   3094   O OE1   A GLN B  1 96  ? 45.744  17.601  31.293  0.25 31.08  ? 96   GLN B OE1   1 
ATOM   3095   N NE2   A GLN B  1 96  ? 44.606  18.250  29.489  0.25 24.17  ? 96   GLN B NE2   1 
ATOM   3096   N N     A GLY B  1 97  ? 39.465  18.639  32.631  0.25 26.40  ? 97   GLY B N     1 
ATOM   3097   C CA    A GLY B  1 97  ? 38.283  17.861  32.303  0.25 26.79  ? 97   GLY B CA    1 
ATOM   3098   C C     A GLY B  1 97  ? 38.424  16.369  32.043  0.25 28.25  ? 97   GLY B C     1 
ATOM   3099   O O     A GLY B  1 97  ? 37.577  15.774  31.364  0.25 26.50  ? 97   GLY B O     1 
ATOM   3100   N N     A VAL B  1 98  ? 39.475  15.748  32.585  0.25 27.12  ? 98   VAL B N     1 
ATOM   3101   C CA    A VAL B  1 98  ? 39.704  14.323  32.388  0.25 23.68  ? 98   VAL B CA    1 
ATOM   3102   C C     A VAL B  1 98  ? 39.741  13.681  33.764  0.25 25.64  ? 98   VAL B C     1 
ATOM   3103   O O     A VAL B  1 98  ? 40.698  13.898  34.521  0.25 23.31  ? 98   VAL B O     1 
ATOM   3104   C CB    A VAL B  1 98  ? 41.038  14.109  31.658  0.25 25.78  ? 98   VAL B CB    1 
ATOM   3105   C CG1   A VAL B  1 98  ? 41.332  12.604  31.499  0.25 24.00  ? 98   VAL B CG1   1 
ATOM   3106   C CG2   A VAL B  1 98  ? 40.974  14.792  30.282  0.25 25.40  ? 98   VAL B CG2   1 
ATOM   3107   N N     A GLY B  1 99  ? 38.712  12.890  34.100  0.25 21.00  ? 99   GLY B N     1 
ATOM   3108   C CA    A GLY B  1 99  ? 38.668  12.306  35.428  0.25 20.36  ? 99   GLY B CA    1 
ATOM   3109   C C     A GLY B  1 99  ? 38.914  10.826  35.542  0.25 21.01  ? 99   GLY B C     1 
ATOM   3110   O O     A GLY B  1 99  ? 38.527  10.233  36.536  0.25 21.92  ? 99   GLY B O     1 
ATOM   3111   N N     A ILE B  1 100 ? 39.552  10.223  34.533  0.25 18.99  ? 100  ILE B N     1 
ATOM   3112   C CA    A ILE B  1 100 ? 39.798  8.788   34.536  0.25 19.31  ? 100  ILE B CA    1 
ATOM   3113   C C     A ILE B  1 100 ? 40.578  8.292   35.741  0.25 19.16  ? 100  ILE B C     1 
ATOM   3114   O O     A ILE B  1 100 ? 40.423  7.146   36.156  0.25 19.82  ? 100  ILE B O     1 
ATOM   3115   C CB    A ILE B  1 100 ? 40.534  8.342   33.244  0.25 22.31  ? 100  ILE B CB    1 
ATOM   3116   C CG1   A ILE B  1 100 ? 41.900  9.023   33.150  0.25 20.26  ? 100  ILE B CG1   1 
ATOM   3117   C CG2   A ILE B  1 100 ? 39.659  8.644   32.017  0.25 22.62  ? 100  ILE B CG2   1 
ATOM   3118   C CD1   A ILE B  1 100 ? 42.736  8.538   31.950  0.25 21.48  ? 100  ILE B CD1   1 
ATOM   3119   N N     A TRP B  1 101 ? 41.391  9.161   36.336  0.25 22.08  ? 101  TRP B N     1 
ATOM   3120   C CA    A TRP B  1 101 ? 42.168  8.775   37.521  0.25 23.98  ? 101  TRP B CA    1 
ATOM   3121   C C     A TRP B  1 101 ? 41.600  9.338   38.834  0.25 24.57  ? 101  TRP B C     1 
ATOM   3122   O O     A TRP B  1 101 ? 42.214  9.209   39.898  0.25 21.66  ? 101  TRP B O     1 
ATOM   3123   C CB    A TRP B  1 101 ? 43.640  9.211   37.351  0.25 22.29  ? 101  TRP B CB    1 
ATOM   3124   C CG    A TRP B  1 101 ? 44.434  8.229   36.507  0.25 19.19  ? 101  TRP B CG    1 
ATOM   3125   C CD1   A TRP B  1 101 ? 44.837  8.395   35.216  0.25 16.90  ? 101  TRP B CD1   1 
ATOM   3126   C CD2   A TRP B  1 101 ? 44.834  6.899   36.887  0.25 17.67  ? 101  TRP B CD2   1 
ATOM   3127   N NE1   A TRP B  1 101 ? 45.459  7.250   34.758  0.25 19.24  ? 101  TRP B NE1   1 
ATOM   3128   C CE2   A TRP B  1 101 ? 45.463  6.316   35.764  0.25 16.12  ? 101  TRP B CE2   1 
ATOM   3129   C CE3   A TRP B  1 101 ? 44.712  6.147   38.065  0.25 13.13  ? 101  TRP B CE3   1 
ATOM   3130   C CZ2   A TRP B  1 101 ? 45.965  5.012   35.780  0.25 20.39  ? 101  TRP B CZ2   1 
ATOM   3131   C CZ3   A TRP B  1 101 ? 45.213  4.846   38.087  0.25 17.64  ? 101  TRP B CZ3   1 
ATOM   3132   C CH2   A TRP B  1 101 ? 45.835  4.289   36.948  0.25 19.87  ? 101  TRP B CH2   1 
ATOM   3133   N N     A ASP B  1 102 ? 40.432  9.975   38.763  0.25 23.79  ? 102  ASP B N     1 
ATOM   3134   C CA    A ASP B  1 102 ? 39.821  10.538  39.973  0.25 26.93  ? 102  ASP B CA    1 
ATOM   3135   C C     A ASP B  1 102 ? 39.452  9.439   40.953  0.25 25.35  ? 102  ASP B C     1 
ATOM   3136   O O     A ASP B  1 102 ? 39.559  9.626   42.144  0.25 29.28  ? 102  ASP B O     1 
ATOM   3137   C CB    A ASP B  1 102 ? 38.546  11.332  39.621  0.25 29.15  ? 102  ASP B CB    1 
ATOM   3138   C CG    A ASP B  1 102 ? 38.844  12.593  38.855  0.25 32.05  ? 102  ASP B CG    1 
ATOM   3139   O OD1   A ASP B  1 102 ? 37.889  13.284  38.458  0.25 34.49  ? 102  ASP B OD1   1 
ATOM   3140   O OD2   A ASP B  1 102 ? 40.035  12.907  38.648  0.25 36.09  ? 102  ASP B OD2   1 
ATOM   3141   N N     A GLY B  1 103 ? 39.020  8.294   40.438  0.25 27.77  ? 103  GLY B N     1 
ATOM   3142   C CA    A GLY B  1 103 ? 38.617  7.193   41.300  0.25 28.50  ? 103  GLY B CA    1 
ATOM   3143   C C     A GLY B  1 103 ? 39.730  6.619   42.174  0.25 32.67  ? 103  GLY B C     1 
ATOM   3144   O O     A GLY B  1 103 ? 39.516  6.370   43.367  0.25 32.70  ? 103  GLY B O     1 
ATOM   3145   N N     A ASN B  1 104 ? 40.913  6.396   41.602  0.25 30.25  ? 104  ASN B N     1 
ATOM   3146   C CA    A ASN B  1 104 ? 42.016  5.844   42.386  0.25 30.48  ? 104  ASN B CA    1 
ATOM   3147   C C     A ASN B  1 104 ? 42.854  6.936   43.056  0.25 30.25  ? 104  ASN B C     1 
ATOM   3148   O O     A ASN B  1 104 ? 43.764  6.648   43.839  0.25 31.62  ? 104  ASN B O     1 
ATOM   3149   C CB    A ASN B  1 104 ? 42.905  4.942   41.510  0.25 31.21  ? 104  ASN B CB    1 
ATOM   3150   C CG    A ASN B  1 104 ? 42.145  3.736   40.957  0.25 33.03  ? 104  ASN B CG    1 
ATOM   3151   O OD1   A ASN B  1 104 ? 41.671  3.755   39.826  0.25 37.89  ? 104  ASN B OD1   1 
ATOM   3152   N ND2   A ASN B  1 104 ? 42.003  2.697   41.769  0.25 36.48  ? 104  ASN B ND2   1 
ATOM   3153   N N     A GLY B  1 105 ? 42.530  8.194   42.768  0.25 27.94  ? 105  GLY B N     1 
ATOM   3154   C CA    A GLY B  1 105 ? 43.261  9.295   43.369  0.25 24.82  ? 105  GLY B CA    1 
ATOM   3155   C C     A GLY B  1 105 ? 42.454  9.983   44.453  0.25 25.16  ? 105  GLY B C     1 
ATOM   3156   O O     A GLY B  1 105 ? 42.925  10.911  45.109  0.25 22.31  ? 105  GLY B O     1 
ATOM   3157   N N     A SER B  1 106 ? 41.230  9.516   44.666  0.25 25.25  ? 106  SER B N     1 
ATOM   3158   C CA    A SER B  1 106 ? 40.377  10.122  45.677  0.25 24.48  ? 106  SER B CA    1 
ATOM   3159   C C     A SER B  1 106 ? 40.935  9.908   47.082  0.25 24.72  ? 106  SER B C     1 
ATOM   3160   O O     A SER B  1 106 ? 41.609  8.904   47.377  0.25 23.75  ? 106  SER B O     1 
ATOM   3161   C CB    A SER B  1 106 ? 38.945  9.547   45.603  0.25 21.14  ? 106  SER B CB    1 
ATOM   3162   O OG    A SER B  1 106 ? 38.924  8.201   46.028  0.25 25.48  ? 106  SER B OG    1 
ATOM   3163   N N     A LYS B  1 107 ? 40.636  10.880  47.943  0.25 25.32  ? 107  LYS B N     1 
ATOM   3164   C CA    A LYS B  1 107 ? 41.059  10.833  49.330  0.25 26.07  ? 107  LYS B CA    1 
ATOM   3165   C C     A LYS B  1 107 ? 40.560  9.532   49.929  0.25 25.80  ? 107  LYS B C     1 
ATOM   3166   O O     A LYS B  1 107 ? 41.295  8.847   50.659  0.25 23.05  ? 107  LYS B O     1 
ATOM   3167   C CB    A LYS B  1 107 ? 40.484  12.030  50.109  0.25 25.46  ? 107  LYS B CB    1 
ATOM   3168   C CG    A LYS B  1 107 ? 41.324  12.431  51.339  0.25 25.80  ? 107  LYS B CG    1 
ATOM   3169   C CD    A LYS B  1 107 ? 42.796  12.662  50.897  0.25 24.48  ? 107  LYS B CD    1 
ATOM   3170   C CE    A LYS B  1 107 ? 43.669  13.178  52.027  0.25 21.19  ? 107  LYS B CE    1 
ATOM   3171   N NZ    A LYS B  1 107 ? 43.961  12.144  53.045  0.25 24.25  ? 107  LYS B NZ    1 
ATOM   3172   N N     A GLU B  1 108 ? 39.320  9.162   49.606  0.25 25.65  ? 108  GLU B N     1 
ATOM   3173   C CA    A GLU B  1 108 ? 38.775  7.919   50.153  0.25 27.52  ? 108  GLU B CA    1 
ATOM   3174   C C     A GLU B  1 108 ? 39.541  6.651   49.741  0.25 27.58  ? 108  GLU B C     1 
ATOM   3175   O O     A GLU B  1 108 ? 39.764  5.783   50.582  0.25 27.97  ? 108  GLU B O     1 
ATOM   3176   C CB    A GLU B  1 108 ? 37.272  7.770   49.815  0.25 29.95  ? 108  GLU B CB    1 
ATOM   3177   C CG    A GLU B  1 108 ? 36.615  6.582   50.539  0.25 38.79  ? 108  GLU B CG    1 
ATOM   3178   C CD    A GLU B  1 108 ? 35.131  6.380   50.211  0.25 44.59  ? 108  GLU B CD    1 
ATOM   3179   O OE1   A GLU B  1 108 ? 34.294  7.193   50.668  0.25 48.90  ? 108  GLU B OE1   1 
ATOM   3180   O OE2   A GLU B  1 108 ? 34.800  5.406   49.497  0.25 48.25  ? 108  GLU B OE2   1 
ATOM   3181   N N     A PHE B  1 109 ? 39.955  6.531   48.476  0.25 26.14  ? 109  PHE B N     1 
ATOM   3182   C CA    A PHE B  1 109 ? 40.684  5.342   48.016  0.25 26.82  ? 109  PHE B CA    1 
ATOM   3183   C C     A PHE B  1 109 ? 42.110  5.305   48.590  0.25 25.98  ? 109  PHE B C     1 
ATOM   3184   O O     A PHE B  1 109 ? 42.575  4.273   49.063  0.25 28.42  ? 109  PHE B O     1 
ATOM   3185   C CB    A PHE B  1 109 ? 40.749  5.313   46.469  0.25 25.56  ? 109  PHE B CB    1 
ATOM   3186   C CG    A PHE B  1 109 ? 41.405  4.073   45.918  0.25 28.27  ? 109  PHE B CG    1 
ATOM   3187   C CD1   A PHE B  1 109 ? 40.680  2.888   45.794  0.25 25.79  ? 109  PHE B CD1   1 
ATOM   3188   C CD2   A PHE B  1 109 ? 42.766  4.070   45.578  0.25 26.97  ? 109  PHE B CD2   1 
ATOM   3189   C CE1   A PHE B  1 109 ? 41.298  1.721   45.341  0.25 24.93  ? 109  PHE B CE1   1 
ATOM   3190   C CE2   A PHE B  1 109 ? 43.395  2.904   45.123  0.25 24.18  ? 109  PHE B CE2   1 
ATOM   3191   C CZ    A PHE B  1 109 ? 42.658  1.732   45.005  0.25 25.58  ? 109  PHE B CZ    1 
ATOM   3192   N N     A LEU B  1 110 ? 42.808  6.433   48.524  0.25 26.41  ? 110  LEU B N     1 
ATOM   3193   C CA    A LEU B  1 110 ? 44.181  6.517   49.043  0.25 26.15  ? 110  LEU B CA    1 
ATOM   3194   C C     A LEU B  1 110 ? 44.257  6.052   50.505  0.25 27.77  ? 110  LEU B C     1 
ATOM   3195   O O     A LEU B  1 110 ? 45.107  5.252   50.882  0.25 26.73  ? 110  LEU B O     1 
ATOM   3196   C CB    A LEU B  1 110 ? 44.682  7.950   48.922  0.25 21.51  ? 110  LEU B CB    1 
ATOM   3197   C CG    A LEU B  1 110 ? 44.902  8.437   47.488  0.25 21.97  ? 110  LEU B CG    1 
ATOM   3198   C CD1   A LEU B  1 110 ? 45.304  9.896   47.505  0.25 21.00  ? 110  LEU B CD1   1 
ATOM   3199   C CD2   A LEU B  1 110 ? 45.977  7.559   46.782  0.25 23.46  ? 110  LEU B CD2   1 
ATOM   3200   N N     A GLU B  1 111 ? 43.354  6.562   51.331  0.25 29.70  ? 111  GLU B N     1 
ATOM   3201   C CA    A GLU B  1 111 ? 43.332  6.160   52.731  0.25 35.49  ? 111  GLU B CA    1 
ATOM   3202   C C     A GLU B  1 111 ? 43.019  4.669   52.854  0.25 36.84  ? 111  GLU B C     1 
ATOM   3203   O O     A GLU B  1 111 ? 43.514  3.984   53.759  0.25 36.20  ? 111  GLU B O     1 
ATOM   3204   C CB    A GLU B  1 111 ? 42.287  6.970   53.491  0.25 36.72  ? 111  GLU B CB    1 
ATOM   3205   C CG    A GLU B  1 111 ? 42.650  8.438   53.618  0.25 44.84  ? 111  GLU B CG    1 
ATOM   3206   C CD    A GLU B  1 111 ? 41.673  9.224   54.482  0.25 48.23  ? 111  GLU B CD    1 
ATOM   3207   O OE1   A GLU B  1 111 ? 41.403  8.802   55.627  0.25 51.74  ? 111  GLU B OE1   1 
ATOM   3208   O OE2   A GLU B  1 111 ? 41.180  10.268  54.022  0.25 48.55  ? 111  GLU B OE2   1 
ATOM   3209   N N     A LYS B  1 112 ? 42.195  4.183   51.927  0.25 38.26  ? 112  LYS B N     1 
ATOM   3210   C CA    A LYS B  1 112 ? 41.799  2.785   51.884  0.25 39.36  ? 112  LYS B CA    1 
ATOM   3211   C C     A LYS B  1 112 ? 42.990  1.854   51.646  0.25 36.89  ? 112  LYS B C     1 
ATOM   3212   O O     A LYS B  1 112 ? 43.050  0.777   52.216  0.25 38.12  ? 112  LYS B O     1 
ATOM   3213   C CB    A LYS B  1 112 ? 40.741  2.605   50.787  0.25 42.86  ? 112  LYS B CB    1 
ATOM   3214   C CG    A LYS B  1 112 ? 40.233  1.200   50.569  0.25 46.53  ? 112  LYS B CG    1 
ATOM   3215   C CD    A LYS B  1 112 ? 39.246  1.196   49.397  0.25 50.62  ? 112  LYS B CD    1 
ATOM   3216   C CE    A LYS B  1 112 ? 38.777  -0.196  49.045  0.25 53.36  ? 112  LYS B CE    1 
ATOM   3217   N NZ    A LYS B  1 112 ? 37.830  -0.147  47.900  0.25 55.37  ? 112  LYS B NZ    1 
ATOM   3218   N N     A VAL B  1 113 ? 43.934  2.264   50.808  0.25 35.53  ? 113  VAL B N     1 
ATOM   3219   C CA    A VAL B  1 113 ? 45.106  1.434   50.522  0.25 35.11  ? 113  VAL B CA    1 
ATOM   3220   C C     A VAL B  1 113 ? 46.330  1.802   51.372  0.25 32.51  ? 113  VAL B C     1 
ATOM   3221   O O     A VAL B  1 113 ? 47.453  1.512   50.991  0.25 31.68  ? 113  VAL B O     1 
ATOM   3222   C CB    A VAL B  1 113 ? 45.505  1.528   49.021  0.25 38.11  ? 113  VAL B CB    1 
ATOM   3223   C CG1   A VAL B  1 113 ? 44.429  0.879   48.156  0.25 39.65  ? 113  VAL B CG1   1 
ATOM   3224   C CG2   A VAL B  1 113 ? 45.714  2.987   48.626  0.25 34.65  ? 113  VAL B CG2   1 
ATOM   3225   N N     A GLY B  1 114 ? 46.096  2.457   52.508  0.25 30.57  ? 114  GLY B N     1 
ATOM   3226   C CA    A GLY B  1 114 ? 47.181  2.851   53.396  0.25 30.68  ? 114  GLY B CA    1 
ATOM   3227   C C     A GLY B  1 114 ? 48.020  4.050   52.969  0.25 28.41  ? 114  GLY B C     1 
ATOM   3228   O O     A GLY B  1 114 ? 49.151  4.195   53.399  0.25 30.54  ? 114  GLY B O     1 
ATOM   3229   N N     A LEU B  1 115 ? 47.475  4.910   52.114  0.25 26.62  ? 115  LEU B N     1 
ATOM   3230   C CA    A LEU B  1 115 ? 48.209  6.085   51.649  0.25 24.19  ? 115  LEU B CA    1 
ATOM   3231   C C     A LEU B  1 115 ? 47.493  7.368   52.105  0.25 23.40  ? 115  LEU B C     1 
ATOM   3232   O O     A LEU B  1 115 ? 47.373  8.337   51.355  0.25 20.92  ? 115  LEU B O     1 
ATOM   3233   C CB    A LEU B  1 115 ? 48.326  6.045   50.127  0.25 22.54  ? 115  LEU B CB    1 
ATOM   3234   C CG    A LEU B  1 115 ? 49.044  4.827   49.538  0.25 24.99  ? 115  LEU B CG    1 
ATOM   3235   C CD1   A LEU B  1 115 ? 48.883  4.818   48.020  0.25 20.55  ? 115  LEU B CD1   1 
ATOM   3236   C CD2   A LEU B  1 115 ? 50.538  4.863   49.931  0.25 25.08  ? 115  LEU B CD2   1 
ATOM   3237   N N     A GLY B  1 116 ? 47.029  7.360   53.352  0.25 22.24  ? 116  GLY B N     1 
ATOM   3238   C CA    A GLY B  1 116 ? 46.293  8.488   53.911  0.25 20.98  ? 116  GLY B CA    1 
ATOM   3239   C C     A GLY B  1 116 ? 47.120  9.751   54.111  0.25 24.59  ? 116  GLY B C     1 
ATOM   3240   O O     A GLY B  1 116 ? 46.573  10.857  54.231  0.25 23.36  ? 116  GLY B O     1 
ATOM   3241   N N     A HIS B  1 117 ? 48.444  9.608   54.129  0.25 20.43  ? 117  HIS B N     1 
ATOM   3242   C CA    A HIS B  1 117 ? 49.329  10.760  54.317  0.25 21.02  ? 117  HIS B CA    1 
ATOM   3243   C C     A HIS B  1 117 ? 49.488  11.584  53.024  0.25 22.05  ? 117  HIS B C     1 
ATOM   3244   O O     A HIS B  1 117 ? 50.161  12.624  52.984  0.25 23.47  ? 117  HIS B O     1 
ATOM   3245   C CB    A HIS B  1 117 ? 50.701  10.266  54.798  0.25 22.09  ? 117  HIS B CB    1 
ATOM   3246   C CG    A HIS B  1 117 ? 51.381  9.358   53.822  0.25 21.60  ? 117  HIS B CG    1 
ATOM   3247   N ND1   A HIS B  1 117 ? 52.206  9.829   52.827  0.25 26.53  ? 117  HIS B ND1   1 
ATOM   3248   C CD2   A HIS B  1 117 ? 51.301  8.018   53.639  0.25 23.69  ? 117  HIS B CD2   1 
ATOM   3249   C CE1   A HIS B  1 117 ? 52.600  8.821   52.066  0.25 25.65  ? 117  HIS B CE1   1 
ATOM   3250   N NE2   A HIS B  1 117 ? 52.066  7.710   52.540  0.25 25.65  ? 117  HIS B NE2   1 
ATOM   3251   N N     A ARG B  1 118 ? 48.876  11.139  51.944  0.25 21.16  ? 118  ARG B N     1 
ATOM   3252   C CA    A ARG B  1 118 ? 48.999  11.887  50.712  0.25 22.46  ? 118  ARG B CA    1 
ATOM   3253   C C     A ARG B  1 118 ? 47.803  12.787  50.458  0.25 23.89  ? 118  ARG B C     1 
ATOM   3254   O O     A ARG B  1 118 ? 46.698  12.510  50.930  0.25 22.01  ? 118  ARG B O     1 
ATOM   3255   C CB    A ARG B  1 118 ? 49.211  10.909  49.553  0.25 26.19  ? 118  ARG B CB    1 
ATOM   3256   C CG    A ARG B  1 118 ? 50.540  10.153  49.723  0.25 32.19  ? 118  ARG B CG    1 
ATOM   3257   C CD    A ARG B  1 118 ? 51.482  10.261  48.551  0.25 27.27  ? 118  ARG B CD    1 
ATOM   3258   N NE    A ARG B  1 118 ? 51.047  9.312   47.589  0.25 35.54  ? 118  ARG B NE    1 
ATOM   3259   C CZ    A ARG B  1 118 ? 51.563  8.140   47.276  0.25 31.20  ? 118  ARG B CZ    1 
ATOM   3260   N NH1   A ARG B  1 118 ? 50.903  7.473   46.356  0.25 29.80  ? 118  ARG B NH1   1 
ATOM   3261   N NH2   A ARG B  1 118 ? 52.684  7.649   47.810  0.25 32.26  ? 118  ARG B NH2   1 
ATOM   3262   N N     A ARG B  1 119 ? 48.025  13.892  49.753  0.25 23.72  ? 119  ARG B N     1 
ATOM   3263   C CA    A ARG B  1 119 ? 46.905  14.766  49.424  0.25 27.57  ? 119  ARG B CA    1 
ATOM   3264   C C     A ARG B  1 119 ? 46.154  14.096  48.267  0.25 25.23  ? 119  ARG B C     1 
ATOM   3265   O O     A ARG B  1 119 ? 46.722  13.286  47.519  0.25 19.93  ? 119  ARG B O     1 
ATOM   3266   C CB    A ARG B  1 119 ? 47.378  16.160  49.006  0.25 30.28  ? 119  ARG B CB    1 
ATOM   3267   C CG    A ARG B  1 119 ? 48.176  16.202  47.724  0.25 33.97  ? 119  ARG B CG    1 
ATOM   3268   C CD    A ARG B  1 119 ? 48.170  17.628  47.156  0.25 35.48  ? 119  ARG B CD    1 
ATOM   3269   N NE    A ARG B  1 119 ? 48.782  17.713  45.831  0.25 32.51  ? 119  ARG B NE    1 
ATOM   3270   C CZ    A ARG B  1 119 ? 50.032  18.103  45.598  0.25 34.63  ? 119  ARG B CZ    1 
ATOM   3271   N NH1   A ARG B  1 119 ? 50.486  18.142  44.354  0.25 31.67  ? 119  ARG B NH1   1 
ATOM   3272   N NH2   A ARG B  1 119 ? 50.824  18.470  46.600  0.25 34.77  ? 119  ARG B NH2   1 
ATOM   3273   N N     A GLU B  1 120 ? 44.880  14.435  48.119  0.25 24.94  ? 120  GLU B N     1 
ATOM   3274   C CA    A GLU B  1 120 ? 44.060  13.842  47.072  0.25 23.52  ? 120  GLU B CA    1 
ATOM   3275   C C     A GLU B  1 120 ? 44.689  14.054  45.696  0.25 22.62  ? 120  GLU B C     1 
ATOM   3276   O O     A GLU B  1 120 ? 45.153  15.138  45.380  0.25 22.43  ? 120  GLU B O     1 
ATOM   3277   C CB    A GLU B  1 120 ? 42.654  14.455  47.100  0.25 25.37  ? 120  GLU B CB    1 
ATOM   3278   C CG    A GLU B  1 120 ? 41.696  13.776  46.152  0.25 27.06  ? 120  GLU B CG    1 
ATOM   3279   C CD    A GLU B  1 120 ? 40.275  14.301  46.295  0.25 30.77  ? 120  GLU B CD    1 
ATOM   3280   O OE1   A GLU B  1 120 ? 40.022  15.449  45.863  0.25 30.21  ? 120  GLU B OE1   1 
ATOM   3281   O OE2   A GLU B  1 120 ? 39.428  13.566  46.856  0.25 28.81  ? 120  GLU B OE2   1 
ATOM   3282   N N     A GLY B  1 121 ? 44.695  13.010  44.870  0.25 22.72  ? 121  GLY B N     1 
ATOM   3283   C CA    A GLY B  1 121 ? 45.277  13.127  43.543  0.25 18.64  ? 121  GLY B CA    1 
ATOM   3284   C C     A GLY B  1 121 ? 46.742  12.693  43.441  0.25 20.80  ? 121  GLY B C     1 
ATOM   3285   O O     A GLY B  1 121 ? 47.253  12.453  42.338  0.25 19.48  ? 121  GLY B O     1 
ATOM   3286   N N     A ASP B  1 122 ? 47.425  12.592  44.575  0.25 20.31  ? 122  ASP B N     1 
ATOM   3287   C CA    A ASP B  1 122 ? 48.840  12.176  44.558  0.25 21.24  ? 122  ASP B CA    1 
ATOM   3288   C C     A ASP B  1 122 ? 48.901  10.666  44.496  0.25 18.29  ? 122  ASP B C     1 
ATOM   3289   O O     A ASP B  1 122 ? 48.912  9.998   45.529  0.25 19.66  ? 122  ASP B O     1 
ATOM   3290   C CB    A ASP B  1 122 ? 49.549  12.664  45.821  0.25 21.38  ? 122  ASP B CB    1 
ATOM   3291   C CG    A ASP B  1 122 ? 51.044  12.364  45.801  0.25 25.06  ? 122  ASP B CG    1 
ATOM   3292   O OD1   A ASP B  1 122 ? 51.521  11.597  44.932  0.25 21.66  ? 122  ASP B OD1   1 
ATOM   3293   O OD2   A ASP B  1 122 ? 51.735  12.900  46.677  0.25 22.35  ? 122  ASP B OD2   1 
ATOM   3294   N N     A LEU B  1 123 ? 48.943  10.133  43.278  0.25 18.20  ? 123  LEU B N     1 
ATOM   3295   C CA    A LEU B  1 123 ? 48.968  8.698   43.032  0.25 17.58  ? 123  LEU B CA    1 
ATOM   3296   C C     A LEU B  1 123 ? 50.257  7.973   43.448  0.25 19.03  ? 123  LEU B C     1 
ATOM   3297   O O     A LEU B  1 123 ? 50.256  6.768   43.634  0.25 19.51  ? 123  LEU B O     1 
ATOM   3298   C CB    A LEU B  1 123 ? 48.708  8.445   41.553  0.25 16.86  ? 123  LEU B CB    1 
ATOM   3299   C CG    A LEU B  1 123 ? 47.382  9.026   41.002  0.25 24.48  ? 123  LEU B CG    1 
ATOM   3300   C CD1   A LEU B  1 123 ? 47.311  8.854   39.482  0.25 20.02  ? 123  LEU B CD1   1 
ATOM   3301   C CD2   A LEU B  1 123 ? 46.183  8.327   41.682  0.25 21.24  ? 123  LEU B CD2   1 
ATOM   3302   N N     A GLY B  1 124 ? 51.355  8.703   43.593  0.25 23.11  ? 124  GLY B N     1 
ATOM   3303   C CA    A GLY B  1 124 ? 52.593  8.034   43.976  0.25 19.71  ? 124  GLY B CA    1 
ATOM   3304   C C     A GLY B  1 124 ? 53.477  7.898   42.763  0.25 18.80  ? 124  GLY B C     1 
ATOM   3305   O O     A GLY B  1 124 ? 53.178  8.481   41.744  0.25 17.98  ? 124  GLY B O     1 
ATOM   3306   N N     A PRO B  1 125 ? 54.570  7.119   42.839  0.25 19.47  ? 125  PRO B N     1 
ATOM   3307   C CA    A PRO B  1 125 ? 55.490  6.930   41.720  0.25 20.25  ? 125  PRO B CA    1 
ATOM   3308   C C     A PRO B  1 125 ? 54.953  5.990   40.626  0.25 22.19  ? 125  PRO B C     1 
ATOM   3309   O O     A PRO B  1 125 ? 55.550  4.941   40.338  0.25 19.03  ? 125  PRO B O     1 
ATOM   3310   C CB    A PRO B  1 125 ? 56.742  6.383   42.402  0.25 21.57  ? 125  PRO B CB    1 
ATOM   3311   C CG    A PRO B  1 125 ? 56.155  5.510   43.497  0.25 22.32  ? 125  PRO B CG    1 
ATOM   3312   C CD    A PRO B  1 125 ? 55.032  6.392   44.040  0.25 20.32  ? 125  PRO B CD    1 
ATOM   3313   N N     A VAL B  1 126 ? 53.850  6.391   39.990  0.25 19.47  ? 126  VAL B N     1 
ATOM   3314   C CA    A VAL B  1 126 ? 53.250  5.580   38.954  0.25 21.58  ? 126  VAL B CA    1 
ATOM   3315   C C     A VAL B  1 126 ? 53.853  5.862   37.575  0.25 21.88  ? 126  VAL B C     1 
ATOM   3316   O O     A VAL B  1 126 ? 54.857  6.565   37.457  0.25 23.77  ? 126  VAL B O     1 
ATOM   3317   C CB    A VAL B  1 126 ? 51.690  5.779   38.910  0.25 22.04  ? 126  VAL B CB    1 
ATOM   3318   C CG1   A VAL B  1 126 ? 51.071  5.336   40.232  0.25 17.92  ? 126  VAL B CG1   1 
ATOM   3319   C CG2   A VAL B  1 126 ? 51.353  7.217   38.652  0.25 22.25  ? 126  VAL B CG2   1 
ATOM   3320   N N     A TYR B  1 127 ? 53.242  5.274   36.551  0.25 20.95  ? 127  TYR B N     1 
ATOM   3321   C CA    A TYR B  1 127 ? 53.677  5.377   35.166  0.25 22.56  ? 127  TYR B CA    1 
ATOM   3322   C C     A TYR B  1 127 ? 54.715  6.441   34.804  0.25 24.45  ? 127  TYR B C     1 
ATOM   3323   O O     A TYR B  1 127 ? 55.898  6.132   34.635  0.25 22.31  ? 127  TYR B O     1 
ATOM   3324   C CB    A TYR B  1 127 ? 52.463  5.549   34.254  0.25 23.46  ? 127  TYR B CB    1 
ATOM   3325   C CG    A TYR B  1 127 ? 51.464  4.413   34.340  0.25 22.85  ? 127  TYR B CG    1 
ATOM   3326   C CD1   A TYR B  1 127 ? 51.785  3.141   33.886  0.25 21.92  ? 127  TYR B CD1   1 
ATOM   3327   C CD2   A TYR B  1 127 ? 50.192  4.627   34.872  0.25 25.57  ? 127  TYR B CD2   1 
ATOM   3328   C CE1   A TYR B  1 127 ? 50.860  2.091   33.943  0.25 23.08  ? 127  TYR B CE1   1 
ATOM   3329   C CE2   A TYR B  1 127 ? 49.256  3.596   34.943  0.25 24.74  ? 127  TYR B CE2   1 
ATOM   3330   C CZ    A TYR B  1 127 ? 49.587  2.330   34.475  0.25 27.27  ? 127  TYR B CZ    1 
ATOM   3331   O OH    A TYR B  1 127 ? 48.642  1.315   34.540  0.25 24.72  ? 127  TYR B OH    1 
ATOM   3332   N N     A GLY B  1 128 ? 54.255  7.678   34.649  0.25 22.77  ? 128  GLY B N     1 
ATOM   3333   C CA    A GLY B  1 128 ? 55.138  8.770   34.271  0.25 24.41  ? 128  GLY B CA    1 
ATOM   3334   C C     A GLY B  1 128 ? 56.433  8.914   35.066  0.25 22.81  ? 128  GLY B C     1 
ATOM   3335   O O     A GLY B  1 128 ? 57.492  9.231   34.516  0.25 21.20  ? 128  GLY B O     1 
ATOM   3336   N N     A PHE B  1 129 ? 56.349  8.697   36.365  0.25 21.81  ? 129  PHE B N     1 
ATOM   3337   C CA    A PHE B  1 129 ? 57.518  8.844   37.210  0.25 23.92  ? 129  PHE B CA    1 
ATOM   3338   C C     A PHE B  1 129 ? 58.547  7.746   36.895  0.25 24.63  ? 129  PHE B C     1 
ATOM   3339   O O     A PHE B  1 129 ? 59.742  8.022   36.773  0.25 24.80  ? 129  PHE B O     1 
ATOM   3340   C CB    A PHE B  1 129 ? 57.098  8.816   38.678  0.25 22.40  ? 129  PHE B CB    1 
ATOM   3341   C CG    A PHE B  1 129 ? 58.250  8.879   39.636  0.25 22.82  ? 129  PHE B CG    1 
ATOM   3342   C CD1   A PHE B  1 129 ? 58.876  7.712   40.078  0.25 21.46  ? 129  PHE B CD1   1 
ATOM   3343   C CD2   A PHE B  1 129 ? 58.711  10.106  40.093  0.25 21.45  ? 129  PHE B CD2   1 
ATOM   3344   C CE1   A PHE B  1 129 ? 59.954  7.773   40.979  0.25 20.30  ? 129  PHE B CE1   1 
ATOM   3345   C CE2   A PHE B  1 129 ? 59.783  10.183  40.990  0.25 23.76  ? 129  PHE B CE2   1 
ATOM   3346   C CZ    A PHE B  1 129 ? 60.406  9.015   41.438  0.25 18.96  ? 129  PHE B CZ    1 
ATOM   3347   N N     A GLN B  1 130 ? 58.079  6.514   36.735  0.25 21.97  ? 130  GLN B N     1 
ATOM   3348   C CA    A GLN B  1 130 ? 58.970  5.415   36.418  0.25 25.04  ? 130  GLN B CA    1 
ATOM   3349   C C     A GLN B  1 130 ? 59.592  5.614   35.027  0.25 25.20  ? 130  GLN B C     1 
ATOM   3350   O O     A GLN B  1 130 ? 60.782  5.346   34.805  0.25 22.07  ? 130  GLN B O     1 
ATOM   3351   C CB    A GLN B  1 130 ? 58.208  4.093   36.453  0.25 24.10  ? 130  GLN B CB    1 
ATOM   3352   C CG    A GLN B  1 130 ? 57.636  3.725   37.829  0.25 26.40  ? 130  GLN B CG    1 
ATOM   3353   C CD    A GLN B  1 130 ? 58.697  3.696   38.922  0.25 25.12  ? 130  GLN B CD    1 
ATOM   3354   O OE1   A GLN B  1 130 ? 59.852  3.342   38.669  0.25 23.11  ? 130  GLN B OE1   1 
ATOM   3355   N NE2   A GLN B  1 130 ? 58.298  4.044   40.148  0.25 21.19  ? 130  GLN B NE2   1 
ATOM   3356   N N     A TRP B  1 131 ? 58.770  6.078   34.092  0.25 24.29  ? 131  TRP B N     1 
ATOM   3357   C CA    A TRP B  1 131 ? 59.206  6.319   32.719  0.25 24.27  ? 131  TRP B CA    1 
ATOM   3358   C C     A TRP B  1 131 ? 60.361  7.306   32.588  0.25 23.98  ? 131  TRP B C     1 
ATOM   3359   O O     A TRP B  1 131 ? 61.285  7.099   31.801  0.25 21.24  ? 131  TRP B O     1 
ATOM   3360   C CB    A TRP B  1 131 ? 58.045  6.851   31.886  0.25 23.30  ? 131  TRP B CB    1 
ATOM   3361   C CG    A TRP B  1 131 ? 57.070  5.823   31.423  0.25 24.03  ? 131  TRP B CG    1 
ATOM   3362   C CD1   A TRP B  1 131 ? 56.910  4.547   31.910  0.25 22.02  ? 131  TRP B CD1   1 
ATOM   3363   C CD2   A TRP B  1 131 ? 56.068  5.996   30.412  0.25 24.47  ? 131  TRP B CD2   1 
ATOM   3364   N NE1   A TRP B  1 131 ? 55.871  3.926   31.265  0.25 21.71  ? 131  TRP B NE1   1 
ATOM   3365   C CE2   A TRP B  1 131 ? 55.335  4.790   30.341  0.25 23.50  ? 131  TRP B CE2   1 
ATOM   3366   C CE3   A TRP B  1 131 ? 55.716  7.060   29.555  0.25 22.59  ? 131  TRP B CE3   1 
ATOM   3367   C CZ2   A TRP B  1 131 ? 54.267  4.611   29.449  0.25 22.75  ? 131  TRP B CZ2   1 
ATOM   3368   C CZ3   A TRP B  1 131 ? 54.651  6.874   28.663  0.25 22.93  ? 131  TRP B CZ3   1 
ATOM   3369   C CH2   A TRP B  1 131 ? 53.940  5.654   28.623  0.25 17.29  ? 131  TRP B CH2   1 
ATOM   3370   N N     A ARG B  1 132 ? 60.287  8.391   33.347  0.25 24.65  ? 132  ARG B N     1 
ATOM   3371   C CA    A ARG B  1 132 ? 61.315  9.428   33.278  0.25 25.17  ? 132  ARG B CA    1 
ATOM   3372   C C     A ARG B  1 132 ? 62.297  9.504   34.454  0.25 24.25  ? 132  ARG B C     1 
ATOM   3373   O O     A ARG B  1 132 ? 63.304  10.203  34.339  0.25 24.55  ? 132  ARG B O     1 
ATOM   3374   C CB    A ARG B  1 132 ? 60.647  10.805  33.147  0.25 23.24  ? 132  ARG B CB    1 
ATOM   3375   C CG    A ARG B  1 132 ? 59.537  10.906  32.091  0.25 25.47  ? 132  ARG B CG    1 
ATOM   3376   C CD    A ARG B  1 132 ? 59.981  10.444  30.703  0.25 23.20  ? 132  ARG B CD    1 
ATOM   3377   N NE    A ARG B  1 132 ? 61.084  11.222  30.134  0.25 24.57  ? 132  ARG B NE    1 
ATOM   3378   C CZ    A ARG B  1 132 ? 60.951  12.386  29.503  0.25 25.30  ? 132  ARG B CZ    1 
ATOM   3379   N NH1   A ARG B  1 132 ? 59.756  12.942  29.357  0.25 26.23  ? 132  ARG B NH1   1 
ATOM   3380   N NH2   A ARG B  1 132 ? 62.017  12.972  28.970  0.25 23.55  ? 132  ARG B NH2   1 
ATOM   3381   N N     A HIS B  1 133 ? 62.004  8.826   35.564  0.25 21.61  ? 133  HIS B N     1 
ATOM   3382   C CA    A HIS B  1 133 ? 62.848  8.901   36.767  0.25 21.80  ? 133  HIS B CA    1 
ATOM   3383   C C     A HIS B  1 133 ? 63.001  7.567   37.506  0.25 22.79  ? 133  HIS B C     1 
ATOM   3384   O O     A HIS B  1 133 ? 63.138  7.547   38.733  0.25 24.32  ? 133  HIS B O     1 
ATOM   3385   C CB    A HIS B  1 133 ? 62.250  9.919   37.760  0.25 24.82  ? 133  HIS B CB    1 
ATOM   3386   C CG    A HIS B  1 133 ? 61.952  11.257  37.164  0.25 26.82  ? 133  HIS B CG    1 
ATOM   3387   N ND1   A HIS B  1 133 ? 62.940  12.118  36.730  0.25 28.37  ? 133  HIS B ND1   1 
ATOM   3388   C CD2   A HIS B  1 133 ? 60.772  11.874  36.899  0.25 26.73  ? 133  HIS B CD2   1 
ATOM   3389   C CE1   A HIS B  1 133 ? 62.382  13.206  36.221  0.25 26.17  ? 133  HIS B CE1   1 
ATOM   3390   N NE2   A HIS B  1 133 ? 61.070  13.082  36.311  0.25 26.51  ? 133  HIS B NE2   1 
ATOM   3391   N N     A PHE B  1 134 ? 62.976  6.454   36.781  0.25 23.89  ? 134  PHE B N     1 
ATOM   3392   C CA    A PHE B  1 134 ? 63.083  5.146   37.417  0.25 24.85  ? 134  PHE B CA    1 
ATOM   3393   C C     A PHE B  1 134 ? 64.255  5.055   38.391  0.25 25.73  ? 134  PHE B C     1 
ATOM   3394   O O     A PHE B  1 134 ? 65.381  5.384   38.039  0.25 25.91  ? 134  PHE B O     1 
ATOM   3395   C CB    A PHE B  1 134 ? 63.216  4.053   36.364  0.25 25.17  ? 134  PHE B CB    1 
ATOM   3396   C CG    A PHE B  1 134 ? 63.120  2.662   36.931  0.25 28.84  ? 134  PHE B CG    1 
ATOM   3397   C CD1   A PHE B  1 134 ? 64.153  2.140   37.722  0.25 26.02  ? 134  PHE B CD1   1 
ATOM   3398   C CD2   A PHE B  1 134 ? 61.973  1.893   36.725  0.25 26.75  ? 134  PHE B CD2   1 
ATOM   3399   C CE1   A PHE B  1 134 ? 64.034  0.893   38.296  0.25 26.99  ? 134  PHE B CE1   1 
ATOM   3400   C CE2   A PHE B  1 134 ? 61.853  0.633   37.304  0.25 25.82  ? 134  PHE B CE2   1 
ATOM   3401   C CZ    A PHE B  1 134 ? 62.875  0.138   38.086  0.25 29.46  ? 134  PHE B CZ    1 
ATOM   3402   N N     A GLY B  1 135 ? 63.985  4.599   39.612  0.25 25.75  ? 135  GLY B N     1 
ATOM   3403   C CA    A GLY B  1 135 ? 65.044  4.478   40.601  0.25 24.48  ? 135  GLY B CA    1 
ATOM   3404   C C     A GLY B  1 135 ? 65.149  5.661   41.554  0.25 26.43  ? 135  GLY B C     1 
ATOM   3405   O O     A GLY B  1 135 ? 65.676  5.530   42.658  0.25 27.07  ? 135  GLY B O     1 
ATOM   3406   N N     A ALA B  1 136 ? 64.659  6.825   41.142  0.25 26.78  ? 136  ALA B N     1 
ATOM   3407   C CA    A ALA B  1 136 ? 64.717  8.000   42.000  0.25 27.44  ? 136  ALA B CA    1 
ATOM   3408   C C     A ALA B  1 136 ? 63.849  7.785   43.233  0.25 28.14  ? 136  ALA B C     1 
ATOM   3409   O O     A ALA B  1 136 ? 62.914  6.973   43.194  0.25 25.55  ? 136  ALA B O     1 
ATOM   3410   C CB    A ALA B  1 136 ? 64.240  9.227   41.235  0.25 28.82  ? 136  ALA B CB    1 
ATOM   3411   N N     A GLU B  1 137 ? 64.174  8.512   44.306  0.25 26.07  ? 137  GLU B N     1 
ATOM   3412   C CA    A GLU B  1 137 ? 63.449  8.454   45.568  0.25 29.29  ? 137  GLU B CA    1 
ATOM   3413   C C     A GLU B  1 137 ? 62.198  9.322   45.454  0.25 26.29  ? 137  GLU B C     1 
ATOM   3414   O O     A GLU B  1 137 ? 62.294  10.494  45.124  0.25 26.93  ? 137  GLU B O     1 
ATOM   3415   C CB    A GLU B  1 137 ? 64.323  9.008   46.697  0.25 35.12  ? 137  GLU B CB    1 
ATOM   3416   C CG    A GLU B  1 137 ? 63.676  8.984   48.074  0.25 42.62  ? 137  GLU B CG    1 
ATOM   3417   C CD    A GLU B  1 137 ? 64.436  9.837   49.080  0.25 49.29  ? 137  GLU B CD    1 
ATOM   3418   O OE1   A GLU B  1 137 ? 65.688  9.752   49.105  0.25 52.31  ? 137  GLU B OE1   1 
ATOM   3419   O OE2   A GLU B  1 137 ? 63.787  10.586  49.848  0.25 49.87  ? 137  GLU B OE2   1 
ATOM   3420   N N     A TYR B  1 138 ? 61.036  8.757   45.752  0.25 25.88  ? 138  TYR B N     1 
ATOM   3421   C CA    A TYR B  1 138 ? 59.791  9.521   45.649  0.25 26.04  ? 138  TYR B CA    1 
ATOM   3422   C C     A TYR B  1 138 ? 59.384  10.121  46.989  0.25 27.15  ? 138  TYR B C     1 
ATOM   3423   O O     A TYR B  1 138 ? 59.357  9.423   47.993  0.25 31.12  ? 138  TYR B O     1 
ATOM   3424   C CB    A TYR B  1 138 ? 58.664  8.609   45.163  0.25 25.57  ? 138  TYR B CB    1 
ATOM   3425   C CG    A TYR B  1 138 ? 57.395  9.348   44.789  0.25 25.75  ? 138  TYR B CG    1 
ATOM   3426   C CD1   A TYR B  1 138 ? 57.257  9.921   43.527  0.25 24.24  ? 138  TYR B CD1   1 
ATOM   3427   C CD2   A TYR B  1 138 ? 56.333  9.461   45.692  0.25 26.84  ? 138  TYR B CD2   1 
ATOM   3428   C CE1   A TYR B  1 138 ? 56.096  10.588  43.158  0.25 25.67  ? 138  TYR B CE1   1 
ATOM   3429   C CE2   A TYR B  1 138 ? 55.146  10.134  45.336  0.25 26.48  ? 138  TYR B CE2   1 
ATOM   3430   C CZ    A TYR B  1 138 ? 55.044  10.689  44.060  0.25 27.32  ? 138  TYR B CZ    1 
ATOM   3431   O OH    A TYR B  1 138 ? 53.900  11.329  43.662  0.25 24.22  ? 138  TYR B OH    1 
ATOM   3432   N N     A THR B  1 139 ? 59.066  11.408  47.008  0.25 28.92  ? 139  THR B N     1 
ATOM   3433   C CA    A THR B  1 139 ? 58.608  12.046  48.235  0.25 29.22  ? 139  THR B CA    1 
ATOM   3434   C C     A THR B  1 139 ? 57.108  12.227  48.053  0.25 28.07  ? 139  THR B C     1 
ATOM   3435   O O     A THR B  1 139 ? 56.325  11.482  48.638  0.25 28.43  ? 139  THR B O     1 
ATOM   3436   C CB    A THR B  1 139 ? 59.318  13.402  48.464  0.25 30.16  ? 139  THR B CB    1 
ATOM   3437   O OG1   A THR B  1 139 ? 59.245  14.204  47.277  0.25 33.15  ? 139  THR B OG1   1 
ATOM   3438   C CG2   A THR B  1 139 ? 60.795  13.158  48.804  0.25 33.00  ? 139  THR B CG2   1 
ATOM   3439   N N     A ASP B  1 140 ? 56.715  13.194  47.232  0.25 30.10  ? 140  ASP B N     1 
ATOM   3440   C CA    A ASP B  1 140 ? 55.294  13.441  46.929  0.25 32.05  ? 140  ASP B CA    1 
ATOM   3441   C C     A ASP B  1 140 ? 55.231  13.883  45.461  0.25 32.38  ? 140  ASP B C     1 
ATOM   3442   O O     A ASP B  1 140 ? 56.268  13.888  44.788  0.25 27.40  ? 140  ASP B O     1 
ATOM   3443   C CB    A ASP B  1 140 ? 54.693  14.469  47.914  0.25 32.05  ? 140  ASP B CB    1 
ATOM   3444   C CG    A ASP B  1 140 ? 55.278  15.842  47.775  0.25 30.95  ? 140  ASP B CG    1 
ATOM   3445   O OD1   A ASP B  1 140 ? 55.009  16.660  48.683  0.25 34.86  ? 140  ASP B OD1   1 
ATOM   3446   O OD2   A ASP B  1 140 ? 55.983  16.101  46.782  0.25 33.58  ? 140  ASP B OD2   1 
ATOM   3447   N N     A ALA B  1 141 ? 54.047  14.266  44.943  0.25 33.20  ? 141  ALA B N     1 
ATOM   3448   C CA    A ALA B  1 141 ? 53.979  14.675  43.537  0.25 34.15  ? 141  ALA B CA    1 
ATOM   3449   C C     A ALA B  1 141 ? 54.617  16.007  43.209  0.25 33.48  ? 141  ALA B C     1 
ATOM   3450   O O     A ALA B  1 141 ? 54.783  16.317  42.033  0.25 33.09  ? 141  ALA B O     1 
ATOM   3451   C CB    A ALA B  1 141 ? 52.484  14.700  43.266  0.25 34.50  ? 141  ALA B CB    1 
ATOM   3452   N N     A ASP B  1 142 ? 54.936  16.796  44.237  0.25 32.84  ? 142  ASP B N     1 
ATOM   3453   C CA    A ASP B  1 142 ? 55.549  18.114  44.047  0.25 34.40  ? 142  ASP B CA    1 
ATOM   3454   C C     A ASP B  1 142 ? 57.075  18.064  44.097  0.25 33.01  ? 142  ASP B C     1 
ATOM   3455   O O     A ASP B  1 142 ? 57.746  19.064  43.849  0.25 32.73  ? 142  ASP B O     1 
ATOM   3456   C CB    A ASP B  1 142 ? 55.043  19.092  45.111  0.25 35.67  ? 142  ASP B CB    1 
ATOM   3457   C CG    A ASP B  1 142 ? 53.561  19.390  44.975  0.25 40.18  ? 142  ASP B CG    1 
ATOM   3458   O OD1   A ASP B  1 142 ? 52.986  19.944  45.936  0.25 44.61  ? 142  ASP B OD1   1 
ATOM   3459   O OD2   A ASP B  1 142 ? 52.972  19.080  43.914  0.25 40.74  ? 142  ASP B OD2   1 
ATOM   3460   N N     A GLY B  1 143 ? 57.612  16.895  44.415  0.25 32.63  ? 143  GLY B N     1 
ATOM   3461   C CA    A GLY B  1 143 ? 59.054  16.724  44.499  0.25 33.76  ? 143  GLY B CA    1 
ATOM   3462   C C     A GLY B  1 143 ? 59.801  17.123  43.240  0.25 32.55  ? 143  GLY B C     1 
ATOM   3463   O O     A GLY B  1 143 ? 59.263  17.105  42.137  0.25 33.91  ? 143  GLY B O     1 
ATOM   3464   N N     A ASP B  1 144 ? 61.057  17.500  43.414  0.25 35.64  ? 144  ASP B N     1 
ATOM   3465   C CA    A ASP B  1 144 ? 61.904  17.918  42.304  0.25 35.84  ? 144  ASP B CA    1 
ATOM   3466   C C     A ASP B  1 144 ? 62.708  16.713  41.838  0.25 34.86  ? 144  ASP B C     1 
ATOM   3467   O O     A ASP B  1 144 ? 63.672  16.306  42.483  0.25 36.23  ? 144  ASP B O     1 
ATOM   3468   C CB    A ASP B  1 144 ? 62.845  19.032  42.753  0.25 39.51  ? 144  ASP B CB    1 
ATOM   3469   C CG    A ASP B  1 144 ? 63.820  19.433  41.664  0.25 42.93  ? 144  ASP B CG    1 
ATOM   3470   O OD1   A ASP B  1 144 ? 63.391  19.547  40.486  0.25 43.78  ? 144  ASP B OD1   1 
ATOM   3471   O OD2   A ASP B  1 144 ? 65.007  19.630  41.997  0.25 47.32  ? 144  ASP B OD2   1 
ATOM   3472   N N     A TYR B  1 145 ? 62.310  16.143  40.710  0.25 32.25  ? 145  TYR B N     1 
ATOM   3473   C CA    A TYR B  1 145 ? 62.957  14.948  40.191  0.25 31.77  ? 145  TYR B CA    1 
ATOM   3474   C C     A TYR B  1 145 ? 63.775  15.195  38.934  0.25 31.14  ? 145  TYR B C     1 
ATOM   3475   O O     A TYR B  1 145 ? 64.354  14.270  38.373  0.25 27.72  ? 145  TYR B O     1 
ATOM   3476   C CB    A TYR B  1 145 ? 61.887  13.881  39.920  0.25 28.02  ? 145  TYR B CB    1 
ATOM   3477   C CG    A TYR B  1 145 ? 61.019  13.603  41.132  0.25 29.96  ? 145  TYR B CG    1 
ATOM   3478   C CD1   A TYR B  1 145 ? 61.576  13.098  42.306  0.25 28.11  ? 145  TYR B CD1   1 
ATOM   3479   C CD2   A TYR B  1 145 ? 59.639  13.848  41.107  0.25 29.14  ? 145  TYR B CD2   1 
ATOM   3480   C CE1   A TYR B  1 145 ? 60.790  12.837  43.431  0.25 28.50  ? 145  TYR B CE1   1 
ATOM   3481   C CE2   A TYR B  1 145 ? 58.834  13.588  42.237  0.25 26.41  ? 145  TYR B CE2   1 
ATOM   3482   C CZ    A TYR B  1 145 ? 59.421  13.086  43.383  0.25 28.45  ? 145  TYR B CZ    1 
ATOM   3483   O OH    A TYR B  1 145 ? 58.670  12.822  44.495  0.25 30.45  ? 145  TYR B OH    1 
ATOM   3484   N N     A LYS B  1 146 ? 63.821  16.444  38.495  0.25 31.77  ? 146  LYS B N     1 
ATOM   3485   C CA    A LYS B  1 146 ? 64.561  16.778  37.287  0.25 35.99  ? 146  LYS B CA    1 
ATOM   3486   C C     A LYS B  1 146 ? 65.997  16.271  37.368  0.25 34.65  ? 146  LYS B C     1 
ATOM   3487   O O     A LYS B  1 146 ? 66.704  16.555  38.331  0.25 32.16  ? 146  LYS B O     1 
ATOM   3488   C CB    A LYS B  1 146 ? 64.544  18.286  37.051  0.25 37.91  ? 146  LYS B CB    1 
ATOM   3489   C CG    A LYS B  1 146 ? 65.170  18.691  35.721  0.25 46.74  ? 146  LYS B CG    1 
ATOM   3490   C CD    A LYS B  1 146 ? 65.019  20.180  35.471  0.25 51.27  ? 146  LYS B CD    1 
ATOM   3491   C CE    A LYS B  1 146 ? 65.539  20.571  34.097  0.25 54.46  ? 146  LYS B CE    1 
ATOM   3492   N NZ    A LYS B  1 146 ? 65.322  22.030  33.833  0.25 56.44  ? 146  LYS B NZ    1 
ATOM   3493   N N     A GLY B  1 147 ? 66.402  15.495  36.362  0.25 35.12  ? 147  GLY B N     1 
ATOM   3494   C CA    A GLY B  1 147 ? 67.750  14.945  36.328  0.25 34.14  ? 147  GLY B CA    1 
ATOM   3495   C C     A GLY B  1 147 ? 67.983  13.790  37.285  0.25 35.05  ? 147  GLY B C     1 
ATOM   3496   O O     A GLY B  1 147 ? 69.112  13.334  37.439  0.25 36.37  ? 147  GLY B O     1 
ATOM   3497   N N     A LYS B  1 148 ? 66.925  13.304  37.931  0.25 33.18  ? 148  LYS B N     1 
ATOM   3498   C CA    A LYS B  1 148 ? 67.067  12.196  38.868  0.25 31.93  ? 148  LYS B CA    1 
ATOM   3499   C C     A LYS B  1 148 ? 66.446  10.910  38.321  0.25 32.34  ? 148  LYS B C     1 
ATOM   3500   O O     A LYS B  1 148 ? 65.394  10.943  37.656  0.25 29.30  ? 148  LYS B O     1 
ATOM   3501   C CB    A LYS B  1 148 ? 66.425  12.546  40.219  0.25 34.25  ? 148  LYS B CB    1 
ATOM   3502   C CG    A LYS B  1 148 ? 67.071  13.740  40.904  0.25 37.34  ? 148  LYS B CG    1 
ATOM   3503   C CD    A LYS B  1 148 ? 66.379  14.094  42.206  0.25 41.09  ? 148  LYS B CD    1 
ATOM   3504   C CE    A LYS B  1 148 ? 66.955  15.383  42.784  0.25 40.19  ? 148  LYS B CE    1 
ATOM   3505   N NZ    A LYS B  1 148 ? 66.292  15.758  44.064  0.25 45.07  ? 148  LYS B NZ    1 
ATOM   3506   N N     A GLY B  1 149 ? 67.101  9.782   38.608  0.25 29.04  ? 149  GLY B N     1 
ATOM   3507   C CA    A GLY B  1 149 ? 66.608  8.492   38.149  0.25 28.31  ? 149  GLY B CA    1 
ATOM   3508   C C     A GLY B  1 149 ? 66.916  8.268   36.686  0.25 26.71  ? 149  GLY B C     1 
ATOM   3509   O O     A GLY B  1 149 ? 67.535  9.114   36.042  0.25 25.95  ? 149  GLY B O     1 
ATOM   3510   N N     A VAL B  1 150 ? 66.477  7.138   36.149  0.25 24.41  ? 150  VAL B N     1 
ATOM   3511   C CA    A VAL B  1 150 ? 66.734  6.823   34.746  0.25 25.94  ? 150  VAL B CA    1 
ATOM   3512   C C     A VAL B  1 150 ? 65.620  7.317   33.814  0.25 25.56  ? 150  VAL B C     1 
ATOM   3513   O O     A VAL B  1 150 ? 64.450  6.982   33.985  0.25 23.97  ? 150  VAL B O     1 
ATOM   3514   C CB    A VAL B  1 150 ? 66.910  5.286   34.549  0.25 25.65  ? 150  VAL B CB    1 
ATOM   3515   C CG1   A VAL B  1 150 ? 67.183  4.970   33.074  0.25 25.20  ? 150  VAL B CG1   1 
ATOM   3516   C CG2   A VAL B  1 150 ? 68.072  4.776   35.419  0.25 23.73  ? 150  VAL B CG2   1 
ATOM   3517   N N     A ASP B  1 151 ? 65.984  8.132   32.833  0.25 26.62  ? 151  ASP B N     1 
ATOM   3518   C CA    A ASP B  1 151 ? 64.998  8.618   31.871  0.25 25.55  ? 151  ASP B CA    1 
ATOM   3519   C C     A ASP B  1 151 ? 64.895  7.599   30.738  0.25 27.28  ? 151  ASP B C     1 
ATOM   3520   O O     A ASP B  1 151 ? 65.558  7.735   29.697  0.25 27.55  ? 151  ASP B O     1 
ATOM   3521   C CB    A ASP B  1 151 ? 65.411  9.977   31.310  0.25 24.59  ? 151  ASP B CB    1 
ATOM   3522   C CG    A ASP B  1 151 ? 64.346  10.582  30.400  0.25 25.01  ? 151  ASP B CG    1 
ATOM   3523   O OD1   A ASP B  1 151 ? 64.449  11.768  30.067  0.25 23.62  ? 151  ASP B OD1   1 
ATOM   3524   O OD2   A ASP B  1 151 ? 63.403  9.870   30.000  0.25 22.87  ? 151  ASP B OD2   1 
ATOM   3525   N N     A GLN B  1 152 ? 64.050  6.586   30.934  0.25 25.01  ? 152  GLN B N     1 
ATOM   3526   C CA    A GLN B  1 152 ? 63.878  5.529   29.940  0.25 25.48  ? 152  GLN B CA    1 
ATOM   3527   C C     A GLN B  1 152 ? 63.359  6.016   28.603  0.25 26.12  ? 152  GLN B C     1 
ATOM   3528   O O     A GLN B  1 152 ? 63.781  5.534   27.543  0.25 25.34  ? 152  GLN B O     1 
ATOM   3529   C CB    A GLN B  1 152 ? 62.925  4.455   30.450  0.25 23.07  ? 152  GLN B CB    1 
ATOM   3530   C CG    A GLN B  1 152 ? 63.319  3.820   31.775  0.25 22.10  ? 152  GLN B CG    1 
ATOM   3531   C CD    A GLN B  1 152 ? 62.287  2.821   32.209  0.25 20.29  ? 152  GLN B CD    1 
ATOM   3532   O OE1   A GLN B  1 152 ? 62.121  1.775   31.577  0.25 22.09  ? 152  GLN B OE1   1 
ATOM   3533   N NE2   A GLN B  1 152 ? 61.558  3.145   33.271  0.25 20.39  ? 152  GLN B NE2   1 
ATOM   3534   N N     A LEU B  1 153 ? 62.437  6.969   28.648  0.25 24.59  ? 153  LEU B N     1 
ATOM   3535   C CA    A LEU B  1 153 ? 61.832  7.480   27.432  0.25 25.29  ? 153  LEU B CA    1 
ATOM   3536   C C     A LEU B  1 153 ? 62.842  8.179   26.521  0.25 25.43  ? 153  LEU B C     1 
ATOM   3537   O O     A LEU B  1 153 ? 62.896  7.909   25.329  0.25 24.98  ? 153  LEU B O     1 
ATOM   3538   C CB    A LEU B  1 153 ? 60.662  8.426   27.776  0.25 22.47  ? 153  LEU B CB    1 
ATOM   3539   C CG    A LEU B  1 153 ? 59.916  8.972   26.555  0.25 22.99  ? 153  LEU B CG    1 
ATOM   3540   C CD1   A LEU B  1 153 ? 59.385  7.798   25.725  0.25 21.31  ? 153  LEU B CD1   1 
ATOM   3541   C CD2   A LEU B  1 153 ? 58.762  9.894   26.985  0.25 22.72  ? 153  LEU B CD2   1 
ATOM   3542   N N     A GLN B  1 154 ? 63.645  9.080   27.073  0.25 27.76  ? 154  GLN B N     1 
ATOM   3543   C CA    A GLN B  1 154 ? 64.638  9.750   26.247  0.25 27.45  ? 154  GLN B CA    1 
ATOM   3544   C C     A GLN B  1 154 ? 65.672  8.751   25.738  0.25 26.10  ? 154  GLN B C     1 
ATOM   3545   O O     A GLN B  1 154 ? 66.161  8.877   24.620  0.25 28.01  ? 154  GLN B O     1 
ATOM   3546   C CB    A GLN B  1 154 ? 65.339  10.867  27.024  0.25 29.48  ? 154  GLN B CB    1 
ATOM   3547   C CG    A GLN B  1 154 ? 66.289  11.708  26.126  0.25 30.70  ? 154  GLN B CG    1 
ATOM   3548   C CD    A GLN B  1 154 ? 65.590  12.295  24.888  0.25 32.16  ? 154  GLN B CD    1 
ATOM   3549   O OE1   A GLN B  1 154 ? 66.176  12.348  23.794  0.25 34.74  ? 154  GLN B OE1   1 
ATOM   3550   N NE2   A GLN B  1 154 ? 64.348  12.741  25.055  0.25 29.07  ? 154  GLN B NE2   1 
ATOM   3551   N N     A ARG B  1 155 ? 66.005  7.753   26.548  0.25 25.82  ? 155  ARG B N     1 
ATOM   3552   C CA    A ARG B  1 155 ? 66.983  6.753   26.129  0.25 27.11  ? 155  ARG B CA    1 
ATOM   3553   C C     A ARG B  1 155 ? 66.439  5.988   24.924  0.25 28.49  ? 155  ARG B C     1 
ATOM   3554   O O     A ARG B  1 155 ? 67.187  5.652   23.998  0.25 26.54  ? 155  ARG B O     1 
ATOM   3555   C CB    A ARG B  1 155 ? 67.299  5.785   27.280  0.25 29.81  ? 155  ARG B CB    1 
ATOM   3556   C CG    A ARG B  1 155 ? 68.332  4.676   26.930  0.25 36.18  ? 155  ARG B CG    1 
ATOM   3557   C CD    A ARG B  1 155 ? 69.550  5.255   26.186  0.25 42.90  ? 155  ARG B CD    1 
ATOM   3558   N NE    A ARG B  1 155 ? 70.301  6.220   27.002  0.25 47.90  ? 155  ARG B NE    1 
ATOM   3559   C CZ    A ARG B  1 155 ? 71.138  5.882   27.984  0.25 49.13  ? 155  ARG B CZ    1 
ATOM   3560   N NH1   A ARG B  1 155 ? 71.771  6.827   28.673  0.25 50.81  ? 155  ARG B NH1   1 
ATOM   3561   N NH2   A ARG B  1 155 ? 71.355  4.599   28.268  0.25 50.99  ? 155  ARG B NH2   1 
ATOM   3562   N N     A VAL B  1 156 ? 65.132  5.710   24.946  0.25 27.45  ? 156  VAL B N     1 
ATOM   3563   C CA    A VAL B  1 156 ? 64.487  5.016   23.841  0.25 25.19  ? 156  VAL B CA    1 
ATOM   3564   C C     A VAL B  1 156 ? 64.635  5.847   22.570  0.25 26.37  ? 156  VAL B C     1 
ATOM   3565   O O     A VAL B  1 156 ? 64.979  5.318   21.507  0.25 28.02  ? 156  VAL B O     1 
ATOM   3566   C CB    A VAL B  1 156 ? 62.969  4.787   24.119  0.25 25.23  ? 156  VAL B CB    1 
ATOM   3567   C CG1   A VAL B  1 156 ? 62.247  4.427   22.824  0.25 25.17  ? 156  VAL B CG1   1 
ATOM   3568   C CG2   A VAL B  1 156 ? 62.794  3.654   25.132  0.25 19.56  ? 156  VAL B CG2   1 
ATOM   3569   N N     A ILE B  1 157 ? 64.374  7.145   22.683  0.25 29.02  ? 157  ILE B N     1 
ATOM   3570   C CA    A ILE B  1 157 ? 64.472  8.073   21.544  0.25 29.98  ? 157  ILE B CA    1 
ATOM   3571   C C     A ILE B  1 157 ? 65.908  8.085   20.990  0.25 31.54  ? 157  ILE B C     1 
ATOM   3572   O O     A ILE B  1 157 ? 66.137  7.921   19.787  0.25 31.56  ? 157  ILE B O     1 
ATOM   3573   C CB    A ILE B  1 157 ? 64.121  9.510   21.972  0.25 30.61  ? 157  ILE B CB    1 
ATOM   3574   C CG1   A ILE B  1 157 ? 62.675  9.580   22.482  0.25 31.82  ? 157  ILE B CG1   1 
ATOM   3575   C CG2   A ILE B  1 157 ? 64.343  10.466  20.808  0.25 30.31  ? 157  ILE B CG2   1 
ATOM   3576   C CD1   A ILE B  1 157 ? 61.651  9.267   21.449  0.25 35.96  ? 157  ILE B CD1   1 
ATOM   3577   N N     A ASP B  1 158 ? 66.871  8.261   21.887  0.25 30.15  ? 158  ASP B N     1 
ATOM   3578   C CA    A ASP B  1 158 ? 68.278  8.301   21.499  0.25 31.88  ? 158  ASP B CA    1 
ATOM   3579   C C     A ASP B  1 158 ? 68.734  7.023   20.824  0.25 30.79  ? 158  ASP B C     1 
ATOM   3580   O O     A ASP B  1 158 ? 69.484  7.065   19.856  0.25 33.11  ? 158  ASP B O     1 
ATOM   3581   C CB    A ASP B  1 158 ? 69.154  8.583   22.730  0.25 30.39  ? 158  ASP B CB    1 
ATOM   3582   C CG    A ASP B  1 158 ? 68.957  9.990   23.281  0.25 31.98  ? 158  ASP B CG    1 
ATOM   3583   O OD1   A ASP B  1 158 ? 69.422  10.267  24.397  0.25 39.05  ? 158  ASP B OD1   1 
ATOM   3584   O OD2   A ASP B  1 158 ? 68.346  10.838  22.607  0.25 35.53  ? 158  ASP B OD2   1 
ATOM   3585   N N     A THR B  1 159 ? 68.274  5.886   21.336  0.25 30.70  ? 159  THR B N     1 
ATOM   3586   C CA    A THR B  1 159 ? 68.648  4.586   20.795  0.25 30.00  ? 159  THR B CA    1 
ATOM   3587   C C     A THR B  1 159 ? 68.053  4.324   19.412  0.25 30.84  ? 159  THR B C     1 
ATOM   3588   O O     A THR B  1 159 ? 68.718  3.769   18.530  0.25 30.89  ? 159  THR B O     1 
ATOM   3589   C CB    A THR B  1 159 ? 68.229  3.462   21.765  0.25 29.56  ? 159  THR B CB    1 
ATOM   3590   O OG1   A THR B  1 159 ? 68.822  3.710   23.046  0.25 27.66  ? 159  THR B OG1   1 
ATOM   3591   C CG2   A THR B  1 159 ? 68.697  2.104   21.261  0.25 29.62  ? 159  THR B CG2   1 
ATOM   3592   N N     A ILE B  1 160 ? 66.802  4.716   19.219  0.25 29.81  ? 160  ILE B N     1 
ATOM   3593   C CA    A ILE B  1 160 ? 66.145  4.521   17.940  0.25 27.32  ? 160  ILE B CA    1 
ATOM   3594   C C     A ILE B  1 160 ? 66.890  5.322   16.861  0.25 29.42  ? 160  ILE B C     1 
ATOM   3595   O O     A ILE B  1 160 ? 67.061  4.865   15.732  0.25 29.82  ? 160  ILE B O     1 
ATOM   3596   C CB    A ILE B  1 160 ? 64.680  4.993   18.007  0.25 24.56  ? 160  ILE B CB    1 
ATOM   3597   C CG1   A ILE B  1 160 ? 63.856  4.001   18.835  0.25 24.88  ? 160  ILE B CG1   1 
ATOM   3598   C CG2   A ILE B  1 160 ? 64.107  5.098   16.601  0.25 26.17  ? 160  ILE B CG2   1 
ATOM   3599   C CD1   A ILE B  1 160 ? 62.460  4.489   19.161  0.25 24.19  ? 160  ILE B CD1   1 
ATOM   3600   N N     A LYS B  1 161 ? 67.340  6.513   17.225  0.25 29.34  ? 161  LYS B N     1 
ATOM   3601   C CA    A LYS B  1 161 ? 68.054  7.387   16.298  0.25 33.17  ? 161  LYS B CA    1 
ATOM   3602   C C     A LYS B  1 161 ? 69.514  7.003   16.037  0.25 33.03  ? 161  LYS B C     1 
ATOM   3603   O O     A LYS B  1 161 ? 69.982  7.070   14.910  0.25 34.52  ? 161  LYS B O     1 
ATOM   3604   C CB    A LYS B  1 161 ? 68.021  8.828   16.815  0.25 31.97  ? 161  LYS B CB    1 
ATOM   3605   C CG    A LYS B  1 161 ? 66.634  9.468   16.772  0.25 37.05  ? 161  LYS B CG    1 
ATOM   3606   C CD    A LYS B  1 161 ? 66.602  10.768  17.569  0.25 36.88  ? 161  LYS B CD    1 
ATOM   3607   C CE    A LYS B  1 161 ? 67.498  11.823  16.953  0.25 40.05  ? 161  LYS B CE    1 
ATOM   3608   N NZ    A LYS B  1 161 ? 67.560  13.033  17.818  0.25 40.75  ? 161  LYS B NZ    1 
ATOM   3609   N N     A ASN B  1 162 ? 70.229  6.601   17.077  0.25 33.29  ? 162  ASN B N     1 
ATOM   3610   C CA    A ASN B  1 162 ? 71.646  6.277   16.915  0.25 33.99  ? 162  ASN B CA    1 
ATOM   3611   C C     A ASN B  1 162 ? 72.065  4.814   16.897  0.25 33.05  ? 162  ASN B C     1 
ATOM   3612   O O     A ASN B  1 162 ? 73.185  4.498   16.485  0.25 34.54  ? 162  ASN B O     1 
ATOM   3613   C CB    A ASN B  1 162 ? 72.442  7.027   17.976  0.25 33.92  ? 162  ASN B CB    1 
ATOM   3614   C CG    A ASN B  1 162 ? 72.170  8.511   17.940  0.25 35.53  ? 162  ASN B CG    1 
ATOM   3615   O OD1   A ASN B  1 162 ? 72.342  9.157   16.905  0.25 41.07  ? 162  ASN B OD1   1 
ATOM   3616   N ND2   A ASN B  1 162 ? 71.732  9.062   19.061  0.25 35.91  ? 162  ASN B ND2   1 
ATOM   3617   N N     A ASN B  1 163 ? 71.194  3.924   17.350  0.25 30.56  ? 163  ASN B N     1 
ATOM   3618   C CA    A ASN B  1 163 ? 71.512  2.508   17.345  0.25 30.63  ? 163  ASN B CA    1 
ATOM   3619   C C     A ASN B  1 163 ? 70.229  1.694   17.311  0.25 29.64  ? 163  ASN B C     1 
ATOM   3620   O O     A ASN B  1 163 ? 69.951  0.932   18.243  0.25 29.20  ? 163  ASN B O     1 
ATOM   3621   C CB    A ASN B  1 163 ? 72.339  2.148   18.585  0.25 30.53  ? 163  ASN B CB    1 
ATOM   3622   C CG    A ASN B  1 163 ? 72.928  0.765   18.486  0.25 29.82  ? 163  ASN B CG    1 
ATOM   3623   O OD1   A ASN B  1 163 ? 73.282  0.329   17.396  0.25 28.77  ? 163  ASN B OD1   1 
ATOM   3624   N ND2   A ASN B  1 163 ? 73.041  0.067   19.613  0.25 30.99  ? 163  ASN B ND2   1 
ATOM   3625   N N     A PRO B  1 164 ? 69.454  1.828   16.213  0.25 30.73  ? 164  PRO B N     1 
ATOM   3626   C CA    A PRO B  1 164 ? 68.164  1.155   15.960  0.25 30.44  ? 164  PRO B CA    1 
ATOM   3627   C C     A PRO B  1 164 ? 68.091  -0.344  16.121  0.25 30.74  ? 164  PRO B C     1 
ATOM   3628   O O     A PRO B  1 164 ? 67.055  -0.860  16.524  0.25 32.47  ? 164  PRO B O     1 
ATOM   3629   C CB    A PRO B  1 164 ? 67.795  1.602   14.534  0.25 32.48  ? 164  PRO B CB    1 
ATOM   3630   C CG    A PRO B  1 164 ? 69.152  1.863   13.886  0.25 32.00  ? 164  PRO B CG    1 
ATOM   3631   C CD    A PRO B  1 164 ? 69.889  2.581   15.016  0.25 30.07  ? 164  PRO B CD    1 
ATOM   3632   N N     A THR B  1 165 ? 69.170  -1.055  15.814  0.25 29.22  ? 165  THR B N     1 
ATOM   3633   C CA    A THR B  1 165 ? 69.152  -2.502  15.938  0.25 30.76  ? 165  THR B CA    1 
ATOM   3634   C C     A THR B  1 165 ? 69.371  -2.981  17.375  0.25 29.20  ? 165  THR B C     1 
ATOM   3635   O O     A THR B  1 165 ? 69.392  -4.177  17.644  0.25 31.96  ? 165  THR B O     1 
ATOM   3636   C CB    A THR B  1 165 ? 70.202  -3.157  14.993  0.25 30.83  ? 165  THR B CB    1 
ATOM   3637   O OG1   A THR B  1 165 ? 71.513  -2.680  15.314  0.25 35.48  ? 165  THR B OG1   1 
ATOM   3638   C CG2   A THR B  1 165 ? 69.888  -2.797  13.552  0.25 30.00  ? 165  THR B CG2   1 
ATOM   3639   N N     A ASP B  1 166 ? 69.538  -2.048  18.300  0.25 30.36  ? 166  ASP B N     1 
ATOM   3640   C CA    A ASP B  1 166 ? 69.716  -2.405  19.705  0.25 28.86  ? 166  ASP B CA    1 
ATOM   3641   C C     A ASP B  1 166 ? 68.501  -3.265  20.091  0.25 27.61  ? 166  ASP B C     1 
ATOM   3642   O O     A ASP B  1 166 ? 67.411  -3.077  19.556  0.25 24.29  ? 166  ASP B O     1 
ATOM   3643   C CB    A ASP B  1 166 ? 69.781  -1.133  20.558  0.25 29.21  ? 166  ASP B CB    1 
ATOM   3644   C CG    A ASP B  1 166 ? 69.941  -1.429  22.042  0.25 30.91  ? 166  ASP B CG    1 
ATOM   3645   O OD1   A ASP B  1 166 ? 68.923  -1.673  22.739  0.25 33.86  ? 166  ASP B OD1   1 
ATOM   3646   O OD2   A ASP B  1 166 ? 71.096  -1.434  22.513  0.25 33.61  ? 166  ASP B OD2   1 
ATOM   3647   N N     A ARG B  1 167 ? 68.690  -4.199  21.024  0.25 24.78  ? 167  ARG B N     1 
ATOM   3648   C CA    A ARG B  1 167 ? 67.607  -5.079  21.428  0.25 22.09  ? 167  ARG B CA    1 
ATOM   3649   C C     A ARG B  1 167 ? 67.078  -4.788  22.824  0.25 20.84  ? 167  ARG B C     1 
ATOM   3650   O O     A ARG B  1 167 ? 66.370  -5.641  23.394  0.25 21.27  ? 167  ARG B O     1 
ATOM   3651   C CB    A ARG B  1 167 ? 68.080  -6.526  21.387  0.25 17.13  ? 167  ARG B CB    1 
ATOM   3652   C CG    A ARG B  1 167 ? 68.486  -7.067  20.031  0.25 25.52  ? 167  ARG B CG    1 
ATOM   3653   C CD    A ARG B  1 167 ? 69.507  -8.186  20.298  0.25 30.55  ? 167  ARG B CD    1 
ATOM   3654   N NE    A ARG B  1 167 ? 69.891  -8.881  19.103  0.25 35.26  ? 167  ARG B NE    1 
ATOM   3655   C CZ    A ARG B  1 167 ? 71.024  -9.551  18.962  0.25 32.13  ? 167  ARG B CZ    1 
ATOM   3656   N NH1   A ARG B  1 167 ? 71.906  -9.619  19.955  0.25 29.81  ? 167  ARG B NH1   1 
ATOM   3657   N NH2   A ARG B  1 167 ? 71.265  -10.145 17.815  0.25 29.18  ? 167  ARG B NH2   1 
ATOM   3658   N N     A ARG B  1 168 ? 67.427  -3.626  23.373  0.25 20.43  ? 168  ARG B N     1 
ATOM   3659   C CA    A ARG B  1 168 ? 67.015  -3.259  24.732  0.25 21.97  ? 168  ARG B CA    1 
ATOM   3660   C C     A ARG B  1 168 ? 66.188  -1.964  24.728  0.25 20.49  ? 168  ARG B C     1 
ATOM   3661   O O     A ARG B  1 168 ? 66.197  -1.219  25.694  0.25 22.78  ? 168  ARG B O     1 
ATOM   3662   C CB    A ARG B  1 168 ? 68.239  -3.033  25.640  0.25 22.00  ? 168  ARG B CB    1 
ATOM   3663   C CG    A ARG B  1 168 ? 69.180  -4.220  25.877  0.25 21.30  ? 168  ARG B CG    1 
ATOM   3664   C CD    A ARG B  1 168 ? 70.151  -4.426  24.723  0.25 28.11  ? 168  ARG B CD    1 
ATOM   3665   N NE    A ARG B  1 168 ? 71.150  -5.457  25.012  0.25 30.91  ? 168  ARG B NE    1 
ATOM   3666   C CZ    A ARG B  1 168 ? 72.368  -5.224  25.495  0.25 32.00  ? 168  ARG B CZ    1 
ATOM   3667   N NH1   A ARG B  1 168 ? 73.197  -6.237  25.723  0.25 31.58  ? 168  ARG B NH1   1 
ATOM   3668   N NH2   A ARG B  1 168 ? 72.768  -3.988  25.747  0.25 31.51  ? 168  ARG B NH2   1 
ATOM   3669   N N     A ILE B  1 169 ? 65.475  -1.694  23.651  0.25 20.36  ? 169  ILE B N     1 
ATOM   3670   C CA    A ILE B  1 169 ? 64.692  -0.467  23.570  0.25 21.45  ? 169  ILE B CA    1 
ATOM   3671   C C     A ILE B  1 169 ? 63.404  -0.703  24.350  0.25 22.67  ? 169  ILE B C     1 
ATOM   3672   O O     A ILE B  1 169 ? 62.336  -0.948  23.776  0.25 24.78  ? 169  ILE B O     1 
ATOM   3673   C CB    A ILE B  1 169 ? 64.392  -0.135  22.107  0.25 21.25  ? 169  ILE B CB    1 
ATOM   3674   C CG1   A ILE B  1 169 ? 65.696  -0.189  21.298  0.25 22.69  ? 169  ILE B CG1   1 
ATOM   3675   C CG2   A ILE B  1 169 ? 63.787  1.260   21.994  0.25 19.72  ? 169  ILE B CG2   1 
ATOM   3676   C CD1   A ILE B  1 169 ? 65.499  0.107   19.813  0.25 22.21  ? 169  ILE B CD1   1 
ATOM   3677   N N     A ILE B  1 170 ? 63.526  -0.611  25.668  0.25 23.72  ? 170  ILE B N     1 
ATOM   3678   C CA    A ILE B  1 170 ? 62.427  -0.895  26.581  0.25 23.75  ? 170  ILE B CA    1 
ATOM   3679   C C     A ILE B  1 170 ? 61.967  0.319   27.390  0.25 22.45  ? 170  ILE B C     1 
ATOM   3680   O O     A ILE B  1 170 ? 62.762  1.161   27.799  0.25 19.99  ? 170  ILE B O     1 
ATOM   3681   C CB    A ILE B  1 170 ? 62.847  -2.021  27.584  0.25 25.75  ? 170  ILE B CB    1 
ATOM   3682   C CG1   A ILE B  1 170 ? 63.360  -3.251  26.825  0.25 27.59  ? 170  ILE B CG1   1 
ATOM   3683   C CG2   A ILE B  1 170 ? 61.683  -2.376  28.504  0.25 26.19  ? 170  ILE B CG2   1 
ATOM   3684   C CD1   A ILE B  1 170 ? 62.303  -3.963  25.975  0.25 25.23  ? 170  ILE B CD1   1 
ATOM   3685   N N     A LEU B  1 171 ? 60.660  0.400   27.609  0.25 23.23  ? 171  LEU B N     1 
ATOM   3686   C CA    A LEU B  1 171 ? 60.062  1.472   28.391  0.25 21.35  ? 171  LEU B CA    1 
ATOM   3687   C C     A LEU B  1 171 ? 59.205  0.731   29.412  0.25 22.07  ? 171  LEU B C     1 
ATOM   3688   O O     A LEU B  1 171 ? 58.211  0.111   29.046  0.25 23.19  ? 171  LEU B O     1 
ATOM   3689   C CB    A LEU B  1 171 ? 59.179  2.356   27.502  0.25 23.50  ? 171  LEU B CB    1 
ATOM   3690   C CG    A LEU B  1 171 ? 58.436  3.476   28.226  0.25 23.85  ? 171  LEU B CG    1 
ATOM   3691   C CD1   A LEU B  1 171 ? 59.468  4.414   28.891  0.25 23.99  ? 171  LEU B CD1   1 
ATOM   3692   C CD2   A LEU B  1 171 ? 57.552  4.250   27.249  0.25 24.06  ? 171  LEU B CD2   1 
ATOM   3693   N N     A SER B  1 172 ? 59.588  0.780   30.684  0.25 20.13  ? 172  SER B N     1 
ATOM   3694   C CA    A SER B  1 172 ? 58.855  0.046   31.705  0.25 22.55  ? 172  SER B CA    1 
ATOM   3695   C C     A SER B  1 172 ? 58.491  0.858   32.941  0.25 24.71  ? 172  SER B C     1 
ATOM   3696   O O     A SER B  1 172 ? 59.295  1.679   33.440  0.25 22.17  ? 172  SER B O     1 
ATOM   3697   C CB    A SER B  1 172 ? 59.670  -1.164  32.158  0.25 22.71  ? 172  SER B CB    1 
ATOM   3698   O OG    A SER B  1 172 ? 58.962  -1.912  33.128  0.25 24.45  ? 172  SER B OG    1 
ATOM   3699   N N     A ALA B  1 173 ? 57.289  0.599   33.451  0.25 20.97  ? 173  ALA B N     1 
ATOM   3700   C CA    A ALA B  1 173 ? 56.828  1.275   34.644  0.25 22.90  ? 173  ALA B CA    1 
ATOM   3701   C C     A ALA B  1 173 ? 56.810  0.334   35.837  0.25 20.25  ? 173  ALA B C     1 
ATOM   3702   O O     A ALA B  1 173 ? 56.531  0.752   36.955  0.25 22.42  ? 173  ALA B O     1 
ATOM   3703   C CB    A ALA B  1 173 ? 55.443  1.857   34.415  0.25 23.19  ? 173  ALA B CB    1 
ATOM   3704   N N     A TRP B  1 174 ? 57.134  -0.936  35.615  0.25 21.34  ? 174  TRP B N     1 
ATOM   3705   C CA    A TRP B  1 174 ? 57.114  -1.912  36.696  0.25 21.38  ? 174  TRP B CA    1 
ATOM   3706   C C     A TRP B  1 174 ? 58.306  -1.742  37.625  0.25 24.59  ? 174  TRP B C     1 
ATOM   3707   O O     A TRP B  1 174 ? 59.457  -1.810  37.182  0.25 23.65  ? 174  TRP B O     1 
ATOM   3708   C CB    A TRP B  1 174 ? 57.091  -3.330  36.147  0.25 22.53  ? 174  TRP B CB    1 
ATOM   3709   C CG    A TRP B  1 174 ? 56.680  -4.337  37.173  0.25 24.44  ? 174  TRP B CG    1 
ATOM   3710   C CD1   A TRP B  1 174 ? 57.484  -5.237  37.816  0.25 22.31  ? 174  TRP B CD1   1 
ATOM   3711   C CD2   A TRP B  1 174 ? 55.364  -4.518  37.705  0.25 23.60  ? 174  TRP B CD2   1 
ATOM   3712   N NE1   A TRP B  1 174 ? 56.747  -5.962  38.719  0.25 26.68  ? 174  TRP B NE1   1 
ATOM   3713   C CE2   A TRP B  1 174 ? 55.443  -5.547  38.670  0.25 22.92  ? 174  TRP B CE2   1 
ATOM   3714   C CE3   A TRP B  1 174 ? 54.127  -3.908  37.458  0.25 23.86  ? 174  TRP B CE3   1 
ATOM   3715   C CZ2   A TRP B  1 174 ? 54.328  -5.994  39.395  0.25 23.88  ? 174  TRP B CZ2   1 
ATOM   3716   C CZ3   A TRP B  1 174 ? 53.005  -4.348  38.176  0.25 24.98  ? 174  TRP B CZ3   1 
ATOM   3717   C CH2   A TRP B  1 174 ? 53.121  -5.389  39.138  0.25 25.87  ? 174  TRP B CH2   1 
ATOM   3718   N N     A ASN B  1 175 ? 58.024  -1.518  38.906  0.25 22.76  ? 175  ASN B N     1 
ATOM   3719   C CA    A ASN B  1 175 ? 59.066  -1.308  39.911  0.25 21.66  ? 175  ASN B CA    1 
ATOM   3720   C C     A ASN B  1 175 ? 58.618  -1.967  41.215  0.25 20.95  ? 175  ASN B C     1 
ATOM   3721   O O     A ASN B  1 175 ? 57.891  -1.373  42.006  0.25 19.74  ? 175  ASN B O     1 
ATOM   3722   C CB    A ASN B  1 175 ? 59.280  0.186   40.139  0.25 20.65  ? 175  ASN B CB    1 
ATOM   3723   C CG    A ASN B  1 175 ? 60.476  0.473   41.010  0.25 19.45  ? 175  ASN B CG    1 
ATOM   3724   O OD1   A ASN B  1 175 ? 60.747  -0.257  41.950  0.25 20.68  ? 175  ASN B OD1   1 
ATOM   3725   N ND2   A ASN B  1 175 ? 61.188  1.551   40.707  0.25 21.89  ? 175  ASN B ND2   1 
ATOM   3726   N N     A PRO B  1 176 ? 59.072  -3.203  41.456  0.25 19.97  ? 176  PRO B N     1 
ATOM   3727   C CA    A PRO B  1 176 ? 58.718  -3.963  42.656  0.25 19.14  ? 176  PRO B CA    1 
ATOM   3728   C C     A PRO B  1 176 ? 58.953  -3.220  43.961  0.25 21.37  ? 176  PRO B C     1 
ATOM   3729   O O     A PRO B  1 176 ? 58.211  -3.411  44.944  0.25 19.15  ? 176  PRO B O     1 
ATOM   3730   C CB    A PRO B  1 176 ? 59.575  -5.227  42.534  0.25 20.47  ? 176  PRO B CB    1 
ATOM   3731   C CG    A PRO B  1 176 ? 59.644  -5.419  41.019  0.25 21.35  ? 176  PRO B CG    1 
ATOM   3732   C CD    A PRO B  1 176 ? 59.914  -4.002  40.541  0.25 20.23  ? 176  PRO B CD    1 
ATOM   3733   N N     A LYS B  1 177 ? 59.991  -2.386  43.992  0.25 20.55  ? 177  LYS B N     1 
ATOM   3734   C CA    A LYS B  1 177 ? 60.285  -1.629  45.206  0.25 20.59  ? 177  LYS B CA    1 
ATOM   3735   C C     A LYS B  1 177 ? 59.280  -0.506  45.474  0.25 20.78  ? 177  LYS B C     1 
ATOM   3736   O O     A LYS B  1 177 ? 58.917  -0.277  46.623  0.25 19.02  ? 177  LYS B O     1 
ATOM   3737   C CB    A LYS B  1 177 ? 61.679  -1.013  45.136  0.25 20.26  ? 177  LYS B CB    1 
ATOM   3738   C CG    A LYS B  1 177 ? 62.046  -0.255  46.417  0.25 23.30  ? 177  LYS B CG    1 
ATOM   3739   C CD    A LYS B  1 177 ? 63.404  0.401   46.306  0.25 25.39  ? 177  LYS B CD    1 
ATOM   3740   C CE    A LYS B  1 177 ? 63.762  1.110   47.612  0.25 29.36  ? 177  LYS B CE    1 
ATOM   3741   N NZ    A LYS B  1 177 ? 65.011  1.900   47.451  0.25 33.01  ? 177  LYS B NZ    1 
ATOM   3742   N N     A ASP B  1 178 ? 58.847  0.186   44.414  0.25 19.55  ? 178  ASP B N     1 
ATOM   3743   C CA    A ASP B  1 178 ? 57.904  1.295   44.543  0.25 20.13  ? 178  ASP B CA    1 
ATOM   3744   C C     A ASP B  1 178 ? 56.420  0.920   44.579  0.25 20.71  ? 178  ASP B C     1 
ATOM   3745   O O     A ASP B  1 178 ? 55.580  1.751   44.945  0.25 23.27  ? 178  ASP B O     1 
ATOM   3746   C CB    A ASP B  1 178 ? 58.121  2.301   43.405  0.25 17.85  ? 178  ASP B CB    1 
ATOM   3747   C CG    A ASP B  1 178 ? 59.395  3.141   43.584  0.25 22.30  ? 178  ASP B CG    1 
ATOM   3748   O OD1   A ASP B  1 178 ? 60.095  2.987   44.610  0.25 20.98  ? 178  ASP B OD1   1 
ATOM   3749   O OD2   A ASP B  1 178 ? 59.686  3.961   42.684  0.25 19.47  ? 178  ASP B OD2   1 
ATOM   3750   N N     A LEU B  1 179 ? 56.094  -0.304  44.195  0.25 21.80  ? 179  LEU B N     1 
ATOM   3751   C CA    A LEU B  1 179 ? 54.692  -0.752  44.166  0.25 24.97  ? 179  LEU B CA    1 
ATOM   3752   C C     A LEU B  1 179 ? 53.813  -0.337  45.330  0.25 25.10  ? 179  LEU B C     1 
ATOM   3753   O O     A LEU B  1 179 ? 52.729  0.185   45.131  0.25 28.27  ? 179  LEU B O     1 
ATOM   3754   C CB    A LEU B  1 179 ? 54.611  -2.275  44.034  0.25 28.16  ? 179  LEU B CB    1 
ATOM   3755   C CG    A LEU B  1 179 ? 55.082  -2.930  42.729  0.25 31.14  ? 179  LEU B CG    1 
ATOM   3756   C CD1   A LEU B  1 179 ? 54.720  -4.414  42.776  0.25 31.54  ? 179  LEU B CD1   1 
ATOM   3757   C CD2   A LEU B  1 179 ? 54.412  -2.279  41.526  0.25 29.91  ? 179  LEU B CD2   1 
ATOM   3758   N N     A PRO B  1 180 ? 54.258  -0.576  46.573  0.25 28.28  ? 180  PRO B N     1 
ATOM   3759   C CA    A PRO B  1 180 ? 53.417  -0.190  47.718  0.25 27.02  ? 180  PRO B CA    1 
ATOM   3760   C C     A PRO B  1 180 ? 53.145  1.305   47.843  0.25 26.42  ? 180  PRO B C     1 
ATOM   3761   O O     A PRO B  1 180 ? 52.221  1.713   48.542  0.25 27.52  ? 180  PRO B O     1 
ATOM   3762   C CB    A PRO B  1 180 ? 54.179  -0.764  48.930  0.25 29.13  ? 180  PRO B CB    1 
ATOM   3763   C CG    A PRO B  1 180 ? 55.597  -0.884  48.440  0.25 32.32  ? 180  PRO B CG    1 
ATOM   3764   C CD    A PRO B  1 180 ? 55.451  -1.325  47.010  0.25 27.13  ? 180  PRO B CD    1 
ATOM   3765   N N     A LEU B  1 181 ? 53.933  2.122   47.150  0.25 24.01  ? 181  LEU B N     1 
ATOM   3766   C CA    A LEU B  1 181 ? 53.747  3.562   47.213  0.25 23.99  ? 181  LEU B CA    1 
ATOM   3767   C C     A LEU B  1 181 ? 52.749  4.010   46.152  0.25 23.37  ? 181  LEU B C     1 
ATOM   3768   O O     A LEU B  1 181 ? 52.317  5.162   46.153  0.25 22.48  ? 181  LEU B O     1 
ATOM   3769   C CB    A LEU B  1 181 ? 55.082  4.289   46.999  0.25 23.61  ? 181  LEU B CB    1 
ATOM   3770   C CG    A LEU B  1 181 ? 56.239  4.011   47.967  0.25 27.90  ? 181  LEU B CG    1 
ATOM   3771   C CD1   A LEU B  1 181 ? 57.449  4.830   47.529  0.25 29.21  ? 181  LEU B CD1   1 
ATOM   3772   C CD2   A LEU B  1 181 ? 55.852  4.365   49.388  0.25 31.52  ? 181  LEU B CD2   1 
ATOM   3773   N N     A MET B  1 182 ? 52.386  3.088   45.258  0.25 22.29  ? 182  MET B N     1 
ATOM   3774   C CA    A MET B  1 182 ? 51.474  3.379   44.163  0.25 23.23  ? 182  MET B CA    1 
ATOM   3775   C C     A MET B  1 182 ? 50.007  3.145   44.510  0.25 23.46  ? 182  MET B C     1 
ATOM   3776   O O     A MET B  1 182 ? 49.659  2.139   45.094  0.25 23.35  ? 182  MET B O     1 
ATOM   3777   C CB    A MET B  1 182 ? 51.819  2.522   42.953  0.25 23.35  ? 182  MET B CB    1 
ATOM   3778   C CG    A MET B  1 182 ? 53.170  2.846   42.293  0.25 23.25  ? 182  MET B CG    1 
ATOM   3779   S SD    A MET B  1 182 ? 53.430  1.681   40.969  0.25 27.06  ? 182  MET B SD    1 
ATOM   3780   C CE    A MET B  1 182 ? 55.271  1.401   41.096  0.25 28.70  ? 182  MET B CE    1 
ATOM   3781   N N     A ALA B  1 183 ? 49.150  4.080   44.121  0.25 23.48  ? 183  ALA B N     1 
ATOM   3782   C CA    A ALA B  1 183 ? 47.732  3.946   44.387  0.25 22.94  ? 183  ALA B CA    1 
ATOM   3783   C C     A ALA B  1 183 ? 47.248  2.698   43.664  0.25 23.99  ? 183  ALA B C     1 
ATOM   3784   O O     A ALA B  1 183 ? 46.332  2.015   44.128  0.25 27.14  ? 183  ALA B O     1 
ATOM   3785   C CB    A ALA B  1 183 ? 46.995  5.180   43.885  0.25 21.09  ? 183  ALA B CB    1 
ATOM   3786   N N     A LEU B  1 184 ? 47.883  2.392   42.537  0.25 22.56  ? 184  LEU B N     1 
ATOM   3787   C CA    A LEU B  1 184 ? 47.525  1.212   41.754  0.25 23.92  ? 184  LEU B CA    1 
ATOM   3788   C C     A LEU B  1 184 ? 48.782  0.778   40.994  0.25 21.22  ? 184  LEU B C     1 
ATOM   3789   O O     A LEU B  1 184 ? 49.508  1.620   40.488  0.25 20.98  ? 184  LEU B O     1 
ATOM   3790   C CB    A LEU B  1 184 ? 46.416  1.582   40.761  0.25 28.71  ? 184  LEU B CB    1 
ATOM   3791   C CG    A LEU B  1 184 ? 45.456  0.497   40.259  0.25 31.85  ? 184  LEU B CG    1 
ATOM   3792   C CD1   A LEU B  1 184 ? 44.681  -0.075  41.429  0.25 30.96  ? 184  LEU B CD1   1 
ATOM   3793   C CD2   A LEU B  1 184 ? 44.489  1.093   39.236  0.25 28.56  ? 184  LEU B CD2   1 
ATOM   3794   N N     A PRO B  1 185 ? 49.079  -0.530  40.952  0.25 21.88  ? 185  PRO B N     1 
ATOM   3795   C CA    A PRO B  1 185 ? 50.279  -0.992  40.224  0.25 24.44  ? 185  PRO B CA    1 
ATOM   3796   C C     A PRO B  1 185 ? 50.040  -0.835  38.718  0.25 22.03  ? 185  PRO B C     1 
ATOM   3797   O O     A PRO B  1 185 ? 48.925  -0.893  38.245  0.25 21.66  ? 185  PRO B O     1 
ATOM   3798   C CB    A PRO B  1 185 ? 50.406  -2.464  40.632  0.25 22.77  ? 185  PRO B CB    1 
ATOM   3799   C CG    A PRO B  1 185 ? 49.694  -2.514  41.971  0.25 25.43  ? 185  PRO B CG    1 
ATOM   3800   C CD    A PRO B  1 185 ? 48.494  -1.628  41.736  0.25 22.85  ? 185  PRO B CD    1 
ATOM   3801   N N     A PRO B  1 186 ? 51.105  -0.641  37.952  0.25 24.67  ? 186  PRO B N     1 
ATOM   3802   C CA    A PRO B  1 186 ? 50.992  -0.471  36.498  0.25 21.63  ? 186  PRO B CA    1 
ATOM   3803   C C     A PRO B  1 186 ? 50.243  -1.618  35.826  0.25 20.65  ? 186  PRO B C     1 
ATOM   3804   O O     A PRO B  1 186 ? 50.476  -2.780  36.156  0.25 21.48  ? 186  PRO B O     1 
ATOM   3805   C CB    A PRO B  1 186 ? 52.449  -0.404  36.059  0.25 21.27  ? 186  PRO B CB    1 
ATOM   3806   C CG    A PRO B  1 186 ? 53.146  0.186   37.279  0.25 21.00  ? 186  PRO B CG    1 
ATOM   3807   C CD    A PRO B  1 186 ? 52.515  -0.609  38.387  0.25 18.96  ? 186  PRO B CD    1 
ATOM   3808   N N     A CYS B  1 187 ? 49.316  -1.292  34.924  0.25 19.40  ? 187  CYS B N     1 
ATOM   3809   C CA    A CYS B  1 187 ? 48.572  -2.300  34.180  0.25 21.71  ? 187  CYS B CA    1 
ATOM   3810   C C     A CYS B  1 187 ? 49.418  -2.550  32.919  0.25 18.89  ? 187  CYS B C     1 
ATOM   3811   O O     A CYS B  1 187 ? 49.781  -3.668  32.628  0.25 20.75  ? 187  CYS B O     1 
ATOM   3812   C CB    A CYS B  1 187 ? 47.168  -1.794  33.793  0.25 22.61  ? 187  CYS B CB    1 
ATOM   3813   S SG    A CYS B  1 187 ? 46.013  -1.684  35.195  0.25 29.78  ? 187  CYS B SG    1 
ATOM   3814   N N     A HIS B  1 188 ? 49.711  -1.504  32.168  0.25 19.40  ? 188  HIS B N     1 
ATOM   3815   C CA    A HIS B  1 188 ? 50.563  -1.655  31.000  0.25 22.17  ? 188  HIS B CA    1 
ATOM   3816   C C     A HIS B  1 188 ? 51.943  -1.503  31.662  0.25 23.74  ? 188  HIS B C     1 
ATOM   3817   O O     A HIS B  1 188 ? 52.419  -0.395  31.904  0.25 23.37  ? 188  HIS B O     1 
ATOM   3818   C CB    A HIS B  1 188 ? 50.292  -0.560  29.945  0.25 17.54  ? 188  HIS B CB    1 
ATOM   3819   C CG    A HIS B  1 188 ? 50.023  0.801   30.507  0.25 18.77  ? 188  HIS B CG    1 
ATOM   3820   N ND1   A HIS B  1 188 ? 50.895  1.859   30.346  0.25 18.39  ? 188  HIS B ND1   1 
ATOM   3821   C CD2   A HIS B  1 188 ? 48.937  1.303   31.147  0.25 17.33  ? 188  HIS B CD2   1 
ATOM   3822   C CE1   A HIS B  1 188 ? 50.358  2.951   30.853  0.25 17.50  ? 188  HIS B CE1   1 
ATOM   3823   N NE2   A HIS B  1 188 ? 49.168  2.641   31.346  0.25 18.90  ? 188  HIS B NE2   1 
ATOM   3824   N N     A MET B  1 189 ? 52.556  -2.633  31.979  0.25 22.16  ? 189  MET B N     1 
ATOM   3825   C CA    A MET B  1 189 ? 53.827  -2.602  32.672  0.25 26.07  ? 189  MET B CA    1 
ATOM   3826   C C     A MET B  1 189 ? 55.080  -2.307  31.873  0.25 26.44  ? 189  MET B C     1 
ATOM   3827   O O     A MET B  1 189 ? 56.097  -1.899  32.443  0.25 26.60  ? 189  MET B O     1 
ATOM   3828   C CB    A MET B  1 189 ? 53.997  -3.862  33.519  0.25 27.17  ? 189  MET B CB    1 
ATOM   3829   C CG    A MET B  1 189 ? 53.533  -5.156  32.941  0.25 30.81  ? 189  MET B CG    1 
ATOM   3830   S SD    A MET B  1 189 ? 53.523  -6.440  34.273  0.25 34.04  ? 189  MET B SD    1 
ATOM   3831   C CE    A MET B  1 189 ? 55.208  -6.942  34.265  0.25 38.39  ? 189  MET B CE    1 
ATOM   3832   N N     A PHE B  1 190 ? 55.021  -2.499  30.566  0.25 26.79  ? 190  PHE B N     1 
ATOM   3833   C CA    A PHE B  1 190 ? 56.174  -2.178  29.740  0.25 29.39  ? 190  PHE B CA    1 
ATOM   3834   C C     A PHE B  1 190 ? 55.905  -2.413  28.258  0.25 27.93  ? 190  PHE B C     1 
ATOM   3835   O O     A PHE B  1 190 ? 54.957  -3.093  27.867  0.25 25.39  ? 190  PHE B O     1 
ATOM   3836   C CB    A PHE B  1 190 ? 57.380  -3.021  30.158  0.25 32.68  ? 190  PHE B CB    1 
ATOM   3837   C CG    A PHE B  1 190 ? 57.484  -4.306  29.408  0.25 34.63  ? 190  PHE B CG    1 
ATOM   3838   C CD1   A PHE B  1 190 ? 58.158  -4.350  28.198  0.25 37.87  ? 190  PHE B CD1   1 
ATOM   3839   C CD2   A PHE B  1 190 ? 56.821  -5.439  29.844  0.25 37.81  ? 190  PHE B CD2   1 
ATOM   3840   C CE1   A PHE B  1 190 ? 58.167  -5.496  27.422  0.25 38.46  ? 190  PHE B CE1   1 
ATOM   3841   C CE2   A PHE B  1 190 ? 56.822  -6.597  29.066  0.25 38.98  ? 190  PHE B CE2   1 
ATOM   3842   C CZ    A PHE B  1 190 ? 57.495  -6.622  27.855  0.25 39.24  ? 190  PHE B CZ    1 
ATOM   3843   N N     A CYS B  1 191 ? 56.774  -1.853  27.436  0.25 25.95  ? 191  CYS B N     1 
ATOM   3844   C CA    A CYS B  1 191 ? 56.666  -2.046  26.015  0.25 25.37  ? 191  CYS B CA    1 
ATOM   3845   C C     A CYS B  1 191 ? 58.068  -2.065  25.412  0.25 22.49  ? 191  CYS B C     1 
ATOM   3846   O O     A CYS B  1 191 ? 59.017  -1.526  25.993  0.25 20.31  ? 191  CYS B O     1 
ATOM   3847   C CB    A CYS B  1 191 ? 55.825  -0.923  25.389  0.25 25.10  ? 191  CYS B CB    1 
ATOM   3848   S SG    A CYS B  1 191 ? 56.576  0.664   25.356  0.25 28.56  ? 191  CYS B SG    1 
ATOM   3849   N N     A GLN B  1 192 ? 58.183  -2.693  24.250  0.25 20.13  ? 192  GLN B N     1 
ATOM   3850   C CA    A GLN B  1 192 ? 59.443  -2.778  23.536  0.25 21.69  ? 192  GLN B CA    1 
ATOM   3851   C C     A GLN B  1 192 ? 59.303  -2.241  22.108  0.25 23.30  ? 192  GLN B C     1 
ATOM   3852   O O     A GLN B  1 192 ? 58.359  -2.592  21.395  0.25 25.47  ? 192  GLN B O     1 
ATOM   3853   C CB    A GLN B  1 192 ? 59.912  -4.225  23.491  0.25 22.20  ? 192  GLN B CB    1 
ATOM   3854   C CG    A GLN B  1 192 ? 61.090  -4.467  22.549  0.25 21.39  ? 192  GLN B CG    1 
ATOM   3855   C CD    A GLN B  1 192 ? 61.697  -5.852  22.702  0.25 22.60  ? 192  GLN B CD    1 
ATOM   3856   O OE1   A GLN B  1 192 ? 61.044  -6.796  23.170  0.25 20.18  ? 192  GLN B OE1   1 
ATOM   3857   N NE2   A GLN B  1 192 ? 62.961  -5.988  22.284  0.25 21.47  ? 192  GLN B NE2   1 
ATOM   3858   N N     A PHE B  1 193 ? 60.223  -1.365  21.703  0.25 22.31  ? 193  PHE B N     1 
ATOM   3859   C CA    A PHE B  1 193 ? 60.204  -0.826  20.354  0.25 21.83  ? 193  PHE B CA    1 
ATOM   3860   C C     A PHE B  1 193 ? 61.184  -1.581  19.467  0.25 23.55  ? 193  PHE B C     1 
ATOM   3861   O O     A PHE B  1 193 ? 62.188  -2.119  19.944  0.25 24.30  ? 193  PHE B O     1 
ATOM   3862   C CB    A PHE B  1 193 ? 60.529  0.664   20.371  0.25 22.70  ? 193  PHE B CB    1 
ATOM   3863   C CG    A PHE B  1 193 ? 59.520  1.484   21.136  0.25 25.42  ? 193  PHE B CG    1 
ATOM   3864   C CD1   A PHE B  1 193 ? 59.657  1.687   22.514  0.25 22.89  ? 193  PHE B CD1   1 
ATOM   3865   C CD2   A PHE B  1 193 ? 58.412  2.015   20.488  0.25 24.82  ? 193  PHE B CD2   1 
ATOM   3866   C CE1   A PHE B  1 193 ? 58.706  2.405   23.224  0.25 24.70  ? 193  PHE B CE1   1 
ATOM   3867   C CE2   A PHE B  1 193 ? 57.450  2.739   21.196  0.25 26.35  ? 193  PHE B CE2   1 
ATOM   3868   C CZ    A PHE B  1 193 ? 57.597  2.936   22.566  0.25 24.75  ? 193  PHE B CZ    1 
ATOM   3869   N N     A PHE B  1 194 ? 60.869  -1.639  18.178  0.25 24.28  ? 194  PHE B N     1 
ATOM   3870   C CA    A PHE B  1 194 ? 61.687  -2.328  17.198  0.25 22.04  ? 194  PHE B CA    1 
ATOM   3871   C C     A PHE B  1 194 ? 61.731  -1.448  15.950  0.25 25.94  ? 194  PHE B C     1 
ATOM   3872   O O     A PHE B  1 194 ? 60.695  -0.874  15.530  0.25 21.87  ? 194  PHE B O     1 
ATOM   3873   C CB    A PHE B  1 194 ? 61.064  -3.694  16.874  0.25 20.67  ? 194  PHE B CB    1 
ATOM   3874   C CG    A PHE B  1 194 ? 61.841  -4.503  15.859  0.25 23.70  ? 194  PHE B CG    1 
ATOM   3875   C CD1   A PHE B  1 194 ? 61.606  -4.349  14.485  0.25 20.99  ? 194  PHE B CD1   1 
ATOM   3876   C CD2   A PHE B  1 194 ? 62.816  -5.416  16.278  0.25 24.44  ? 194  PHE B CD2   1 
ATOM   3877   C CE1   A PHE B  1 194 ? 62.324  -5.085  13.542  0.25 23.33  ? 194  PHE B CE1   1 
ATOM   3878   C CE2   A PHE B  1 194 ? 63.544  -6.169  15.331  0.25 26.60  ? 194  PHE B CE2   1 
ATOM   3879   C CZ    A PHE B  1 194 ? 63.298  -6.000  13.967  0.25 24.32  ? 194  PHE B CZ    1 
ATOM   3880   N N     A VAL B  1 195 ? 62.923  -1.338  15.365  0.25 23.82  ? 195  VAL B N     1 
ATOM   3881   C CA    A VAL B  1 195 ? 63.127  -0.542  14.174  0.25 26.46  ? 195  VAL B CA    1 
ATOM   3882   C C     A VAL B  1 195 ? 63.606  -1.392  12.985  0.25 30.37  ? 195  VAL B C     1 
ATOM   3883   O O     A VAL B  1 195 ? 64.657  -2.046  13.048  0.25 29.00  ? 195  VAL B O     1 
ATOM   3884   C CB    A VAL B  1 195 ? 64.179  0.549   14.431  0.25 27.87  ? 195  VAL B CB    1 
ATOM   3885   C CG1   A VAL B  1 195 ? 64.281  1.472   13.211  0.25 27.87  ? 195  VAL B CG1   1 
ATOM   3886   C CG2   A VAL B  1 195 ? 63.821  1.345   15.679  0.25 27.03  ? 195  VAL B CG2   1 
ATOM   3887   N N     A SER B  1 196 ? 62.831  -1.404  11.908  0.25 30.00  ? 196  SER B N     1 
ATOM   3888   C CA    A SER B  1 196 ? 63.236  -2.143  10.721  0.25 34.45  ? 196  SER B CA    1 
ATOM   3889   C C     A SER B  1 196 ? 64.059  -1.196  9.868   0.25 35.07  ? 196  SER B C     1 
ATOM   3890   O O     A SER B  1 196 ? 63.644  -0.066  9.621   0.25 37.31  ? 196  SER B O     1 
ATOM   3891   C CB    A SER B  1 196 ? 62.024  -2.621  9.918   0.25 33.57  ? 196  SER B CB    1 
ATOM   3892   O OG    A SER B  1 196 ? 61.279  -3.577  10.658  0.25 40.69  ? 196  SER B OG    1 
ATOM   3893   N N     A LEU B  1 197 ? 65.226  -1.650  9.430   0.25 36.07  ? 197  LEU B N     1 
ATOM   3894   C CA    A LEU B  1 197 ? 66.090  -0.821  8.602   0.25 38.91  ? 197  LEU B CA    1 
ATOM   3895   C C     A LEU B  1 197 ? 65.514  -0.704  7.189   0.25 39.04  ? 197  LEU B C     1 
ATOM   3896   O O     A LEU B  1 197 ? 64.760  -1.574  6.744   0.25 36.78  ? 197  LEU B O     1 
ATOM   3897   C CB    A LEU B  1 197 ? 67.497  -1.431  8.545   0.25 39.59  ? 197  LEU B CB    1 
ATOM   3898   C CG    A LEU B  1 197 ? 68.186  -1.601  9.903   0.25 38.50  ? 197  LEU B CG    1 
ATOM   3899   C CD1   A LEU B  1 197 ? 69.561  -2.223  9.707   0.25 40.16  ? 197  LEU B CD1   1 
ATOM   3900   C CD2   A LEU B  1 197 ? 68.309  -0.256  10.585  0.25 40.42  ? 197  LEU B CD2   1 
ATOM   3901   N N     A PRO B  1 198 ? 65.853  0.387   6.474   0.25 41.59  ? 198  PRO B N     1 
ATOM   3902   C CA    A PRO B  1 198 ? 65.375  0.623   5.105   0.25 42.90  ? 198  PRO B CA    1 
ATOM   3903   C C     A PRO B  1 198 ? 65.807  -0.523  4.186   0.25 45.37  ? 198  PRO B C     1 
ATOM   3904   O O     A PRO B  1 198 ? 66.964  -0.939  4.211   0.25 45.89  ? 198  PRO B O     1 
ATOM   3905   C CB    A PRO B  1 198 ? 66.056  1.935   4.727   0.25 41.70  ? 198  PRO B CB    1 
ATOM   3906   C CG    A PRO B  1 198 ? 66.225  2.637   6.035   0.25 39.83  ? 198  PRO B CG    1 
ATOM   3907   C CD    A PRO B  1 198 ? 66.672  1.521   6.947   0.25 41.33  ? 198  PRO B CD    1 
ATOM   3908   N N     A PRO B  1 199 ? 64.878  -1.058  3.379   0.25 47.31  ? 199  PRO B N     1 
ATOM   3909   C CA    A PRO B  1 199 ? 65.195  -2.158  2.459   0.25 49.53  ? 199  PRO B CA    1 
ATOM   3910   C C     A PRO B  1 199 ? 66.326  -1.744  1.518   0.25 49.94  ? 199  PRO B C     1 
ATOM   3911   O O     A PRO B  1 199 ? 66.517  -0.560  1.258   0.25 50.02  ? 199  PRO B O     1 
ATOM   3912   C CB    A PRO B  1 199 ? 63.875  -2.389  1.720   0.25 49.64  ? 199  PRO B CB    1 
ATOM   3913   C CG    A PRO B  1 199 ? 62.849  -1.990  2.736   0.25 49.74  ? 199  PRO B CG    1 
ATOM   3914   C CD    A PRO B  1 199 ? 63.446  -0.723  3.319   0.25 49.46  ? 199  PRO B CD    1 
ATOM   3915   N N     A ALA B  1 200 ? 67.087  -2.723  1.045   0.25 52.74  ? 200  ALA B N     1 
ATOM   3916   C CA    A ALA B  1 200 ? 68.216  -2.480  0.151   0.25 55.76  ? 200  ALA B CA    1 
ATOM   3917   C C     A ALA B  1 200 ? 67.849  -1.740  -1.137  0.25 57.40  ? 200  ALA B C     1 
ATOM   3918   O O     A ALA B  1 200 ? 68.573  -0.836  -1.569  0.25 58.61  ? 200  ALA B O     1 
ATOM   3919   C CB    A ALA B  1 200 ? 68.897  -3.806  -0.191  0.25 55.60  ? 200  ALA B CB    1 
ATOM   3920   N N     A ASP B  1 201 ? 66.725  -2.118  -1.741  0.25 59.22  ? 201  ASP B N     1 
ATOM   3921   C CA    A ASP B  1 201 ? 66.283  -1.505  -2.993  0.25 61.56  ? 201  ASP B CA    1 
ATOM   3922   C C     A ASP B  1 201 ? 66.027  -0.002  -2.923  0.25 61.77  ? 201  ASP B C     1 
ATOM   3923   O O     A ASP B  1 201 ? 66.030  0.671   -3.952  0.25 62.96  ? 201  ASP B O     1 
ATOM   3924   C CB    A ASP B  1 201 ? 65.024  -2.209  -3.517  0.25 63.16  ? 201  ASP B CB    1 
ATOM   3925   C CG    A ASP B  1 201 ? 63.812  -1.964  -2.644  0.25 63.95  ? 201  ASP B CG    1 
ATOM   3926   O OD1   A ASP B  1 201 ? 63.465  -0.779  -2.428  0.25 64.34  ? 201  ASP B OD1   1 
ATOM   3927   O OD2   A ASP B  1 201 ? 63.206  -2.959  -2.185  0.25 64.82  ? 201  ASP B OD2   1 
ATOM   3928   N N     A SER B  1 202 ? 65.795  0.523   -1.722  0.25 62.25  ? 202  SER B N     1 
ATOM   3929   C CA    A SER B  1 202 ? 65.554  1.954   -1.554  0.25 61.66  ? 202  SER B CA    1 
ATOM   3930   C C     A SER B  1 202 ? 65.943  2.367   -0.142  0.25 61.41  ? 202  SER B C     1 
ATOM   3931   O O     A SER B  1 202 ? 65.100  2.385   0.757   0.25 62.55  ? 202  SER B O     1 
ATOM   3932   C CB    A SER B  1 202 ? 64.077  2.285   -1.809  0.25 62.26  ? 202  SER B CB    1 
ATOM   3933   O OG    A SER B  1 202 ? 63.231  1.640   -0.873  0.25 61.93  ? 202  SER B OG    1 
ATOM   3934   N N     A PRO B  1 203 ? 67.228  2.715   0.067   0.25 60.79  ? 203  PRO B N     1 
ATOM   3935   C CA    A PRO B  1 203 ? 67.814  3.134   1.347   0.25 59.54  ? 203  PRO B CA    1 
ATOM   3936   C C     A PRO B  1 203 ? 67.435  4.530   1.813   0.25 58.33  ? 203  PRO B C     1 
ATOM   3937   O O     A PRO B  1 203 ? 67.836  4.962   2.893   0.25 58.86  ? 203  PRO B O     1 
ATOM   3938   C CB    A PRO B  1 203 ? 69.311  3.007   1.088   0.25 60.22  ? 203  PRO B CB    1 
ATOM   3939   C CG    A PRO B  1 203 ? 69.412  3.435   -0.338  0.25 59.82  ? 203  PRO B CG    1 
ATOM   3940   C CD    A PRO B  1 203 ? 68.270  2.656   -0.973  0.25 60.05  ? 203  PRO B CD    1 
ATOM   3941   N N     A GLY B  1 204 ? 66.670  5.236   0.991   0.25 57.13  ? 204  GLY B N     1 
ATOM   3942   C CA    A GLY B  1 204 ? 66.265  6.579   1.356   0.25 55.63  ? 204  GLY B CA    1 
ATOM   3943   C C     A GLY B  1 204 ? 65.025  6.585   2.231   0.25 53.85  ? 204  GLY B C     1 
ATOM   3944   O O     A GLY B  1 204 ? 64.760  7.561   2.935   0.25 54.56  ? 204  GLY B O     1 
ATOM   3945   N N     A SER B  1 205 ? 64.266  5.494   2.186   0.25 50.90  ? 205  SER B N     1 
ATOM   3946   C CA    A SER B  1 205 ? 63.048  5.370   2.975   0.25 48.78  ? 205  SER B CA    1 
ATOM   3947   C C     A SER B  1 205 ? 63.301  5.505   4.475   0.25 45.64  ? 205  SER B C     1 
ATOM   3948   O O     A SER B  1 205 ? 64.423  5.323   4.948   0.25 45.04  ? 205  SER B O     1 
ATOM   3949   C CB    A SER B  1 205 ? 62.391  4.020   2.699   0.25 49.57  ? 205  SER B CB    1 
ATOM   3950   O OG    A SER B  1 205 ? 62.136  3.855   1.321   0.25 53.48  ? 205  SER B OG    1 
ATOM   3951   N N     A LYS B  1 206 ? 62.249  5.829   5.217   0.25 42.03  ? 206  LYS B N     1 
ATOM   3952   C CA    A LYS B  1 206 ? 62.368  5.967   6.666   0.25 40.29  ? 206  LYS B CA    1 
ATOM   3953   C C     A LYS B  1 206 ? 62.297  4.595   7.337   0.25 36.64  ? 206  LYS B C     1 
ATOM   3954   O O     A LYS B  1 206 ? 61.546  3.724   6.905   0.25 36.57  ? 206  LYS B O     1 
ATOM   3955   C CB    A LYS B  1 206 ? 61.235  6.828   7.234   0.25 39.60  ? 206  LYS B CB    1 
ATOM   3956   C CG    A LYS B  1 206 ? 61.254  8.290   6.838   0.25 42.61  ? 206  LYS B CG    1 
ATOM   3957   C CD    A LYS B  1 206 ? 60.085  9.007   7.510   0.25 44.42  ? 206  LYS B CD    1 
ATOM   3958   C CE    A LYS B  1 206 ? 60.006  10.480  7.125   0.25 45.75  ? 206  LYS B CE    1 
ATOM   3959   N NZ    A LYS B  1 206 ? 58.827  11.142  7.775   0.25 45.52  ? 206  LYS B NZ    1 
ATOM   3960   N N     A PRO B  1 207 ? 63.099  4.378   8.386   0.25 34.11  ? 207  PRO B N     1 
ATOM   3961   C CA    A PRO B  1 207 ? 63.046  3.085   9.065   0.25 32.69  ? 207  PRO B CA    1 
ATOM   3962   C C     A PRO B  1 207 ? 61.622  2.915   9.616   0.25 31.81  ? 207  PRO B C     1 
ATOM   3963   O O     A PRO B  1 207 ? 60.941  3.909   9.892   0.25 31.18  ? 207  PRO B O     1 
ATOM   3964   C CB    A PRO B  1 207 ? 64.073  3.251   10.179  0.25 32.64  ? 207  PRO B CB    1 
ATOM   3965   C CG    A PRO B  1 207 ? 65.079  4.193   9.580   0.25 32.30  ? 207  PRO B CG    1 
ATOM   3966   C CD    A PRO B  1 207 ? 64.182  5.217   8.923   0.25 33.62  ? 207  PRO B CD    1 
ATOM   3967   N N     A LYS B  1 208 ? 61.168  1.676   9.765   0.25 31.48  ? 208  LYS B N     1 
ATOM   3968   C CA    A LYS B  1 208 ? 59.828  1.441   10.296  0.25 31.68  ? 208  LYS B CA    1 
ATOM   3969   C C     A LYS B  1 208 ? 59.865  1.162   11.803  0.25 29.36  ? 208  LYS B C     1 
ATOM   3970   O O     A LYS B  1 208 ? 60.687  0.384   12.276  0.25 28.83  ? 208  LYS B O     1 
ATOM   3971   C CB    A LYS B  1 208 ? 59.160  0.284   9.557   0.25 31.84  ? 208  LYS B CB    1 
ATOM   3972   C CG    A LYS B  1 208 ? 58.827  0.616   8.106   0.25 35.50  ? 208  LYS B CG    1 
ATOM   3973   C CD    A LYS B  1 208 ? 58.056  -0.533  7.471   0.25 40.07  ? 208  LYS B CD    1 
ATOM   3974   C CE    A LYS B  1 208 ? 57.749  -0.267  5.992   0.25 43.42  ? 208  LYS B CE    1 
ATOM   3975   N NZ    A LYS B  1 208 ? 56.988  0.997   5.815   0.25 46.13  ? 208  LYS B NZ    1 
ATOM   3976   N N     A LEU B  1 209 ? 58.976  1.812   12.546  0.25 26.69  ? 209  LEU B N     1 
ATOM   3977   C CA    A LEU B  1 209 ? 58.918  1.663   13.997  0.25 24.45  ? 209  LEU B CA    1 
ATOM   3978   C C     A LEU B  1 209 ? 57.721  0.844   14.464  0.25 25.64  ? 209  LEU B C     1 
ATOM   3979   O O     A LEU B  1 209 ? 56.571  1.149   14.117  0.25 24.75  ? 209  LEU B O     1 
ATOM   3980   C CB    A LEU B  1 209 ? 58.859  3.046   14.659  0.25 22.69  ? 209  LEU B CB    1 
ATOM   3981   C CG    A LEU B  1 209 ? 58.813  3.103   16.192  0.25 23.18  ? 209  LEU B CG    1 
ATOM   3982   C CD1   A LEU B  1 209 ? 60.131  2.558   16.761  0.25 21.73  ? 209  LEU B CD1   1 
ATOM   3983   C CD2   A LEU B  1 209 ? 58.574  4.522   16.660  0.25 21.91  ? 209  LEU B CD2   1 
ATOM   3984   N N     A SER B  1 210 ? 57.993  -0.178  15.275  0.25 24.92  ? 210  SER B N     1 
ATOM   3985   C CA    A SER B  1 210 ? 56.942  -1.026  15.824  0.25 23.45  ? 210  SER B CA    1 
ATOM   3986   C C     A SER B  1 210 ? 57.017  -0.999  17.355  0.25 25.32  ? 210  SER B C     1 
ATOM   3987   O O     A SER B  1 210 ? 58.059  -0.660  17.947  0.25 25.69  ? 210  SER B O     1 
ATOM   3988   C CB    A SER B  1 210 ? 57.081  -2.464  15.328  0.25 21.52  ? 210  SER B CB    1 
ATOM   3989   O OG    A SER B  1 210 ? 56.788  -2.577  13.953  0.25 23.24  ? 210  SER B OG    1 
ATOM   3990   N N     A CYS B  1 211 ? 55.913  -1.372  17.991  0.25 23.55  ? 211  CYS B N     1 
ATOM   3991   C CA    A CYS B  1 211 ? 55.838  -1.380  19.441  0.25 24.09  ? 211  CYS B CA    1 
ATOM   3992   C C     A CYS B  1 211 ? 55.032  -2.561  19.946  0.25 24.52  ? 211  CYS B C     1 
ATOM   3993   O O     A CYS B  1 211 ? 53.937  -2.835  19.453  0.25 23.78  ? 211  CYS B O     1 
ATOM   3994   C CB    A CYS B  1 211 ? 55.199  -0.069  19.936  0.25 23.97  ? 211  CYS B CB    1 
ATOM   3995   S SG    A CYS B  1 211 ? 54.813  0.034   21.722  0.25 23.69  ? 211  CYS B SG    1 
ATOM   3996   N N     A LEU B  1 212 ? 55.587  -3.272  20.924  0.25 23.85  ? 212  LEU B N     1 
ATOM   3997   C CA    A LEU B  1 212 ? 54.874  -4.369  21.552  0.25 23.98  ? 212  LEU B CA    1 
ATOM   3998   C C     A LEU B  1 212 ? 54.712  -3.975  23.023  0.25 24.64  ? 212  LEU B C     1 
ATOM   3999   O O     A LEU B  1 212 ? 55.690  -3.620  23.679  0.25 24.31  ? 212  LEU B O     1 
ATOM   4000   C CB    A LEU B  1 212 ? 55.660  -5.677  21.444  0.25 28.16  ? 212  LEU B CB    1 
ATOM   4001   C CG    A LEU B  1 212 ? 54.914  -6.926  21.955  0.25 29.96  ? 212  LEU B CG    1 
ATOM   4002   C CD1   A LEU B  1 212 ? 55.634  -8.169  21.483  0.25 32.92  ? 212  LEU B CD1   1 
ATOM   4003   C CD2   A LEU B  1 212 ? 54.817  -6.915  23.463  0.25 32.01  ? 212  LEU B CD2   1 
ATOM   4004   N N     A MET B  1 213 ? 53.474  -4.012  23.524  0.25 22.74  ? 213  MET B N     1 
ATOM   4005   C CA    A MET B  1 213 ? 53.205  -3.651  24.909  0.25 21.22  ? 213  MET B CA    1 
ATOM   4006   C C     A MET B  1 213 ? 52.584  -4.838  25.601  0.25 21.47  ? 213  MET B C     1 
ATOM   4007   O O     A MET B  1 213 ? 51.767  -5.556  25.020  0.25 22.40  ? 213  MET B O     1 
ATOM   4008   C CB    A MET B  1 213 ? 52.261  -2.431  24.984  0.25 20.60  ? 213  MET B CB    1 
ATOM   4009   C CG    A MET B  1 213 ? 51.967  -1.923  26.400  0.25 17.42  ? 213  MET B CG    1 
ATOM   4010   S SD    A MET B  1 213 ? 50.602  -2.782  27.252  0.25 21.60  ? 213  MET B SD    1 
ATOM   4011   C CE    A MET B  1 213 ? 49.220  -1.771  26.650  0.25 19.15  ? 213  MET B CE    1 
ATOM   4012   N N     A TYR B  1 214 ? 52.982  -5.060  26.847  0.25 21.73  ? 214  TYR B N     1 
ATOM   4013   C CA    A TYR B  1 214 ? 52.438  -6.173  27.617  0.25 21.30  ? 214  TYR B CA    1 
ATOM   4014   C C     A TYR B  1 214 ? 51.617  -5.593  28.765  0.25 20.04  ? 214  TYR B C     1 
ATOM   4015   O O     A TYR B  1 214 ? 52.116  -4.764  29.537  0.25 17.91  ? 214  TYR B O     1 
ATOM   4016   C CB    A TYR B  1 214 ? 53.563  -7.047  28.200  0.25 20.75  ? 214  TYR B CB    1 
ATOM   4017   C CG    A TYR B  1 214 ? 53.012  -8.232  28.957  0.25 24.04  ? 214  TYR B CG    1 
ATOM   4018   C CD1   A TYR B  1 214 ? 52.674  -9.410  28.296  0.25 29.72  ? 214  TYR B CD1   1 
ATOM   4019   C CD2   A TYR B  1 214 ? 52.760  -8.154  30.322  0.25 25.40  ? 214  TYR B CD2   1 
ATOM   4020   C CE1   A TYR B  1 214 ? 52.091  -10.487 28.976  0.25 29.97  ? 214  TYR B CE1   1 
ATOM   4021   C CE2   A TYR B  1 214 ? 52.184  -9.217  31.010  0.25 27.47  ? 214  TYR B CE2   1 
ATOM   4022   C CZ    A TYR B  1 214 ? 51.849  -10.377 30.339  0.25 28.88  ? 214  TYR B CZ    1 
ATOM   4023   O OH    A TYR B  1 214 ? 51.254  -11.422 31.012  0.25 26.49  ? 214  TYR B OH    1 
ATOM   4024   N N     A GLN B  1 215 ? 50.380  -6.062  28.890  0.25 20.12  ? 215  GLN B N     1 
ATOM   4025   C CA    A GLN B  1 215 ? 49.467  -5.559  29.911  0.25 19.77  ? 215  GLN B CA    1 
ATOM   4026   C C     A GLN B  1 215 ? 49.077  -6.738  30.791  0.25 18.17  ? 215  GLN B C     1 
ATOM   4027   O O     A GLN B  1 215 ? 48.439  -7.667  30.325  0.25 20.00  ? 215  GLN B O     1 
ATOM   4028   C CB    A GLN B  1 215 ? 48.235  -4.954  29.223  0.25 20.25  ? 215  GLN B CB    1 
ATOM   4029   C CG    A GLN B  1 215 ? 47.384  -4.044  30.123  0.25 21.78  ? 215  GLN B CG    1 
ATOM   4030   C CD    A GLN B  1 215 ? 46.250  -3.374  29.354  0.25 19.93  ? 215  GLN B CD    1 
ATOM   4031   O OE1   A GLN B  1 215 ? 46.406  -3.063  28.175  0.25 16.14  ? 215  GLN B OE1   1 
ATOM   4032   N NE2   A GLN B  1 215 ? 45.108  -3.144  30.028  0.25 15.65  ? 215  GLN B NE2   1 
ATOM   4033   N N     A ARG B  1 216 ? 49.466  -6.683  32.063  0.25 19.60  ? 216  ARG B N     1 
ATOM   4034   C CA    A ARG B  1 216 ? 49.215  -7.740  33.038  0.25 18.02  ? 216  ARG B CA    1 
ATOM   4035   C C     A ARG B  1 216 ? 47.750  -7.970  33.389  0.25 20.07  ? 216  ARG B C     1 
ATOM   4036   O O     A ARG B  1 216 ? 47.348  -9.110  33.678  0.25 19.45  ? 216  ARG B O     1 
ATOM   4037   C CB    A ARG B  1 216 ? 49.974  -7.430  34.353  0.25 15.97  ? 216  ARG B CB    1 
ATOM   4038   C CG    A ARG B  1 216 ? 49.383  -6.274  35.152  0.25 18.16  ? 216  ARG B CG    1 
ATOM   4039   C CD    A ARG B  1 216 ? 49.958  -6.147  36.565  0.25 15.47  ? 216  ARG B CD    1 
ATOM   4040   N NE    A ARG B  1 216 ? 49.421  -4.943  37.202  0.25 18.44  ? 216  ARG B NE    1 
ATOM   4041   C CZ    A ARG B  1 216 ? 48.194  -4.836  37.727  0.25 22.86  ? 216  ARG B CZ    1 
ATOM   4042   N NH1   A ARG B  1 216 ? 47.344  -5.865  37.736  0.25 19.45  ? 216  ARG B NH1   1 
ATOM   4043   N NH2   A ARG B  1 216 ? 47.789  -3.668  38.193  0.25 17.65  ? 216  ARG B NH2   1 
ATOM   4044   N N     A SER B  1 217 ? 46.971  -6.888  33.391  0.25 21.24  ? 217  SER B N     1 
ATOM   4045   C CA    A SER B  1 217 ? 45.552  -6.919  33.764  0.25 21.58  ? 217  SER B CA    1 
ATOM   4046   C C     A SER B  1 217 ? 44.822  -6.020  32.762  0.25 22.02  ? 217  SER B C     1 
ATOM   4047   O O     A SER B  1 217 ? 45.183  -4.863  32.576  0.25 23.20  ? 217  SER B O     1 
ATOM   4048   C CB    A SER B  1 217 ? 45.384  -6.367  35.180  0.25 24.12  ? 217  SER B CB    1 
ATOM   4049   O OG    A SER B  1 217 ? 44.061  -6.528  35.653  0.25 26.23  ? 217  SER B OG    1 
ATOM   4050   N N     A CYS B  1 218 ? 43.774  -6.546  32.142  0.25 20.34  ? 218  CYS B N     1 
ATOM   4051   C CA    A CYS B  1 218 ? 43.094  -5.809  31.099  0.25 19.85  ? 218  CYS B CA    1 
ATOM   4052   C C     A CYS B  1 218 ? 41.572  -5.743  31.227  0.25 20.23  ? 218  CYS B C     1 
ATOM   4053   O O     A CYS B  1 218 ? 40.867  -6.739  31.049  0.25 18.72  ? 218  CYS B O     1 
ATOM   4054   C CB    A CYS B  1 218 ? 43.456  -6.426  29.762  0.25 20.81  ? 218  CYS B CB    1 
ATOM   4055   S SG    A CYS B  1 218 ? 45.233  -6.822  29.607  0.25 22.36  ? 218  CYS B SG    1 
ATOM   4056   N N     A ASP B  1 219 ? 41.084  -4.560  31.554  0.25 22.03  ? 219  ASP B N     1 
ATOM   4057   C CA    A ASP B  1 219 ? 39.641  -4.326  31.663  0.25 21.83  ? 219  ASP B CA    1 
ATOM   4058   C C     A ASP B  1 219 ? 39.225  -4.088  30.216  0.25 18.78  ? 219  ASP B C     1 
ATOM   4059   O O     A ASP B  1 219 ? 39.400  -3.007  29.692  0.25 20.63  ? 219  ASP B O     1 
ATOM   4060   C CB    A ASP B  1 219 ? 39.411  -3.099  32.528  0.25 18.48  ? 219  ASP B CB    1 
ATOM   4061   C CG    A ASP B  1 219 ? 37.936  -2.707  32.639  0.25 22.75  ? 219  ASP B CG    1 
ATOM   4062   O OD1   A ASP B  1 219 ? 37.614  -1.931  33.570  0.25 21.32  ? 219  ASP B OD1   1 
ATOM   4063   O OD2   A ASP B  1 219 ? 37.120  -3.145  31.798  0.25 18.00  ? 219  ASP B OD2   1 
ATOM   4064   N N     A LEU B  1 220 ? 38.697  -5.108  29.557  0.25 20.87  ? 220  LEU B N     1 
ATOM   4065   C CA    A LEU B  1 220 ? 38.353  -4.947  28.154  0.25 20.38  ? 220  LEU B CA    1 
ATOM   4066   C C     A LEU B  1 220 ? 37.316  -3.886  27.853  0.25 20.64  ? 220  LEU B C     1 
ATOM   4067   O O     A LEU B  1 220 ? 37.433  -3.185  26.856  0.25 22.03  ? 220  LEU B O     1 
ATOM   4068   C CB    A LEU B  1 220 ? 37.941  -6.281  27.533  0.25 25.36  ? 220  LEU B CB    1 
ATOM   4069   C CG    A LEU B  1 220 ? 39.209  -6.974  27.018  0.25 29.62  ? 220  LEU B CG    1 
ATOM   4070   C CD1   A LEU B  1 220 ? 39.683  -7.998  28.023  0.25 30.11  ? 220  LEU B CD1   1 
ATOM   4071   C CD2   A LEU B  1 220 ? 38.937  -7.604  25.673  0.25 31.60  ? 220  LEU B CD2   1 
ATOM   4072   N N     A GLY B  1 221 ? 36.327  -3.747  28.731  0.25 21.14  ? 221  GLY B N     1 
ATOM   4073   C CA    A GLY B  1 221 ? 35.303  -2.738  28.513  0.25 20.03  ? 221  GLY B CA    1 
ATOM   4074   C C     A GLY B  1 221 ? 35.822  -1.319  28.560  0.25 18.97  ? 221  GLY B C     1 
ATOM   4075   O O     A GLY B  1 221 ? 35.666  -0.572  27.614  0.25 21.18  ? 221  GLY B O     1 
ATOM   4076   N N     A LEU B  1 222 ? 36.474  -0.948  29.660  0.25 19.38  ? 222  LEU B N     1 
ATOM   4077   C CA    A LEU B  1 222 ? 36.968  0.392   29.835  0.25 15.76  ? 222  LEU B CA    1 
ATOM   4078   C C     A LEU B  1 222 ? 38.437  0.692   29.549  0.25 18.79  ? 222  LEU B C     1 
ATOM   4079   O O     A LEU B  1 222 ? 38.748  1.680   28.913  0.25 16.36  ? 222  LEU B O     1 
ATOM   4080   C CB    A LEU B  1 222 ? 36.648  0.857   31.253  0.25 20.13  ? 222  LEU B CB    1 
ATOM   4081   C CG    A LEU B  1 222 ? 35.158  1.093   31.553  0.25 22.12  ? 222  LEU B CG    1 
ATOM   4082   C CD1   A LEU B  1 222 ? 34.999  1.498   33.015  0.25 21.33  ? 222  LEU B CD1   1 
ATOM   4083   C CD2   A LEU B  1 222 ? 34.610  2.194   30.622  0.25 13.18  ? 222  LEU B CD2   1 
ATOM   4084   N N     A GLY B  1 223 ? 39.331  -0.162  30.010  0.25 21.72  ? 223  GLY B N     1 
ATOM   4085   C CA    A GLY B  1 223 ? 40.740  0.101   29.825  0.25 21.06  ? 223  GLY B CA    1 
ATOM   4086   C C     A GLY B  1 223 ? 41.364  -0.148  28.477  0.25 19.36  ? 223  GLY B C     1 
ATOM   4087   O O     A GLY B  1 223 ? 42.033  0.727   27.934  0.25 21.22  ? 223  GLY B O     1 
ATOM   4088   N N     A VAL B  1 224 ? 41.151  -1.335  27.928  0.25 20.46  ? 224  VAL B N     1 
ATOM   4089   C CA    A VAL B  1 224 ? 41.767  -1.710  26.653  0.25 19.03  ? 224  VAL B CA    1 
ATOM   4090   C C     A VAL B  1 224 ? 41.587  -0.699  25.541  0.25 22.66  ? 224  VAL B C     1 
ATOM   4091   O O     A VAL B  1 224 ? 42.544  -0.442  24.767  0.25 18.83  ? 224  VAL B O     1 
ATOM   4092   C CB    A VAL B  1 224 ? 41.283  -3.114  26.236  0.25 21.16  ? 224  VAL B CB    1 
ATOM   4093   C CG1   A VAL B  1 224 ? 41.778  -3.496  24.860  0.25 18.33  ? 224  VAL B CG1   1 
ATOM   4094   C CG2   A VAL B  1 224 ? 41.802  -4.128  27.266  0.25 23.93  ? 224  VAL B CG2   1 
ATOM   4095   N N     A PRO B  1 225 ? 40.371  -0.098  25.425  0.25 20.06  ? 225  PRO B N     1 
ATOM   4096   C CA    A PRO B  1 225 ? 40.206  0.885   24.354  0.25 16.56  ? 225  PRO B CA    1 
ATOM   4097   C C     A PRO B  1 225 ? 41.204  2.040   24.522  0.25 19.83  ? 225  PRO B C     1 
ATOM   4098   O O     A PRO B  1 225 ? 41.756  2.564   23.546  0.25 16.74  ? 225  PRO B O     1 
ATOM   4099   C CB    A PRO B  1 225 ? 38.746  1.332   24.512  0.25 21.47  ? 225  PRO B CB    1 
ATOM   4100   C CG    A PRO B  1 225 ? 38.052  0.073   25.032  0.25 17.85  ? 225  PRO B CG    1 
ATOM   4101   C CD    A PRO B  1 225 ? 39.076  -0.458  26.041  0.25 18.55  ? 225  PRO B CD    1 
ATOM   4102   N N     A PHE B  1 226 ? 41.424  2.460   25.763  0.25 19.58  ? 226  PHE B N     1 
ATOM   4103   C CA    A PHE B  1 226 ? 42.357  3.542   26.022  0.25 20.90  ? 226  PHE B CA    1 
ATOM   4104   C C     A PHE B  1 226 ? 43.802  3.056   25.787  0.25 20.58  ? 226  PHE B C     1 
ATOM   4105   O O     A PHE B  1 226 ? 44.579  3.739   25.142  0.25 24.36  ? 226  PHE B O     1 
ATOM   4106   C CB    A PHE B  1 226 ? 42.248  4.050   27.467  0.25 18.48  ? 226  PHE B CB    1 
ATOM   4107   C CG    A PHE B  1 226 ? 41.288  5.204   27.654  0.25 23.57  ? 226  PHE B CG    1 
ATOM   4108   C CD1   A PHE B  1 226 ? 39.931  5.066   27.355  0.25 25.22  ? 226  PHE B CD1   1 
ATOM   4109   C CD2   A PHE B  1 226 ? 41.747  6.427   28.149  0.25 22.49  ? 226  PHE B CD2   1 
ATOM   4110   C CE1   A PHE B  1 226 ? 39.034  6.133   27.551  0.25 24.44  ? 226  PHE B CE1   1 
ATOM   4111   C CE2   A PHE B  1 226 ? 40.875  7.496   28.347  0.25 25.48  ? 226  PHE B CE2   1 
ATOM   4112   C CZ    A PHE B  1 226 ? 39.501  7.348   28.045  0.25 24.76  ? 226  PHE B CZ    1 
ATOM   4113   N N     A ASN B  1 227 ? 44.140  1.890   26.315  0.25 19.85  ? 227  ASN B N     1 
ATOM   4114   C CA    A ASN B  1 227 ? 45.496  1.349   26.174  0.25 21.14  ? 227  ASN B CA    1 
ATOM   4115   C C     A ASN B  1 227 ? 45.912  1.207   24.732  0.25 22.83  ? 227  ASN B C     1 
ATOM   4116   O O     A ASN B  1 227 ? 47.033  1.545   24.381  0.25 23.89  ? 227  ASN B O     1 
ATOM   4117   C CB    A ASN B  1 227 ? 45.617  -0.008  26.862  0.25 19.28  ? 227  ASN B CB    1 
ATOM   4118   C CG    A ASN B  1 227 ? 45.446  0.082   28.356  0.25 18.77  ? 227  ASN B CG    1 
ATOM   4119   O OD1   A ASN B  1 227 ? 44.561  -0.566  28.926  0.25 22.62  ? 227  ASN B OD1   1 
ATOM   4120   N ND2   A ASN B  1 227 ? 46.296  0.875   29.011  0.25 17.19  ? 227  ASN B ND2   1 
ATOM   4121   N N     A ILE B  1 228 ? 45.003  0.714   23.888  0.25 24.14  ? 228  ILE B N     1 
ATOM   4122   C CA    A ILE B  1 228 ? 45.316  0.551   22.472  0.25 23.75  ? 228  ILE B CA    1 
ATOM   4123   C C     A ILE B  1 228 ? 45.626  1.881   21.804  0.25 25.11  ? 228  ILE B C     1 
ATOM   4124   O O     A ILE B  1 228 ? 46.662  2.029   21.124  0.25 22.76  ? 228  ILE B O     1 
ATOM   4125   C CB    A ILE B  1 228 ? 44.139  -0.142  21.717  0.25 24.09  ? 228  ILE B CB    1 
ATOM   4126   C CG1   A ILE B  1 228 ? 43.989  -1.575  22.212  0.25 24.22  ? 228  ILE B CG1   1 
ATOM   4127   C CG2   A ILE B  1 228 ? 44.392  -0.142  20.202  0.25 21.09  ? 228  ILE B CG2   1 
ATOM   4128   C CD1   A ILE B  1 228 ? 42.777  -2.314  21.615  0.25 27.07  ? 228  ILE B CD1   1 
ATOM   4129   N N     A ALA B  1 229 ? 44.743  2.867   21.998  0.25 22.89  ? 229  ALA B N     1 
ATOM   4130   C CA    A ALA B  1 229 ? 44.949  4.171   21.369  0.25 22.32  ? 229  ALA B CA    1 
ATOM   4131   C C     A ALA B  1 229 ? 46.162  4.885   21.973  0.25 22.35  ? 229  ALA B C     1 
ATOM   4132   O O     A ALA B  1 229 ? 46.917  5.547   21.266  0.25 22.14  ? 229  ALA B O     1 
ATOM   4133   C CB    A ALA B  1 229 ? 43.674  5.046   21.514  0.25 22.08  ? 229  ALA B CB    1 
ATOM   4134   N N     A SER B  1 230 ? 46.336  4.752   23.284  0.25 19.87  ? 230  SER B N     1 
ATOM   4135   C CA    A SER B  1 230 ? 47.461  5.375   23.962  0.25 22.44  ? 230  SER B CA    1 
ATOM   4136   C C     A SER B  1 230 ? 48.828  4.940   23.387  0.25 19.90  ? 230  SER B C     1 
ATOM   4137   O O     A SER B  1 230 ? 49.648  5.768   22.991  0.25 23.45  ? 230  SER B O     1 
ATOM   4138   C CB    A SER B  1 230 ? 47.420  5.027   25.462  0.25 21.50  ? 230  SER B CB    1 
ATOM   4139   O OG    A SER B  1 230 ? 48.362  5.813   26.194  0.25 25.30  ? 230  SER B OG    1 
ATOM   4140   N N     A TYR B  1 231 ? 49.080  3.644   23.350  0.25 20.05  ? 231  TYR B N     1 
ATOM   4141   C CA    A TYR B  1 231 ? 50.375  3.190   22.827  0.25 23.26  ? 231  TYR B CA    1 
ATOM   4142   C C     A TYR B  1 231 ? 50.521  3.410   21.324  0.25 23.34  ? 231  TYR B C     1 
ATOM   4143   O O     A TYR B  1 231 ? 51.636  3.590   20.813  0.25 24.68  ? 231  TYR B O     1 
ATOM   4144   C CB    A TYR B  1 231 ? 50.629  1.728   23.213  0.25 23.15  ? 231  TYR B CB    1 
ATOM   4145   C CG    A TYR B  1 231 ? 51.185  1.617   24.605  0.25 20.57  ? 231  TYR B CG    1 
ATOM   4146   C CD1   A TYR B  1 231 ? 52.573  1.627   24.824  0.25 20.82  ? 231  TYR B CD1   1 
ATOM   4147   C CD2   A TYR B  1 231 ? 50.331  1.608   25.716  0.25 20.99  ? 231  TYR B CD2   1 
ATOM   4148   C CE1   A TYR B  1 231 ? 53.101  1.636   26.128  0.25 22.08  ? 231  TYR B CE1   1 
ATOM   4149   C CE2   A TYR B  1 231 ? 50.832  1.624   27.018  0.25 21.41  ? 231  TYR B CE2   1 
ATOM   4150   C CZ    A TYR B  1 231 ? 52.223  1.640   27.224  0.25 24.07  ? 231  TYR B CZ    1 
ATOM   4151   O OH    A TYR B  1 231 ? 52.704  1.678   28.518  0.25 21.28  ? 231  TYR B OH    1 
ATOM   4152   N N     A ALA B  1 232 ? 49.404  3.416   20.607  0.25 23.85  ? 232  ALA B N     1 
ATOM   4153   C CA    A ALA B  1 232 ? 49.463  3.701   19.171  0.25 23.80  ? 232  ALA B CA    1 
ATOM   4154   C C     A ALA B  1 232 ? 49.926  5.162   19.040  0.25 24.07  ? 232  ALA B C     1 
ATOM   4155   O O     A ALA B  1 232 ? 50.798  5.489   18.219  0.25 24.09  ? 232  ALA B O     1 
ATOM   4156   C CB    A ALA B  1 232 ? 48.090  3.524   18.533  0.25 22.37  ? 232  ALA B CB    1 
ATOM   4157   N N     A LEU B  1 233 ? 49.347  6.042   19.861  0.25 22.66  ? 233  LEU B N     1 
ATOM   4158   C CA    A LEU B  1 233 ? 49.711  7.449   19.829  0.25 22.51  ? 233  LEU B CA    1 
ATOM   4159   C C     A LEU B  1 233 ? 51.163  7.665   20.260  0.25 22.26  ? 233  LEU B C     1 
ATOM   4160   O O     A LEU B  1 233 ? 51.883  8.470   19.678  0.25 21.59  ? 233  LEU B O     1 
ATOM   4161   C CB    A LEU B  1 233 ? 48.771  8.271   20.719  0.25 21.70  ? 233  LEU B CB    1 
ATOM   4162   C CG    A LEU B  1 233 ? 47.335  8.429   20.190  0.25 23.42  ? 233  LEU B CG    1 
ATOM   4163   C CD1   A LEU B  1 233 ? 46.436  9.001   21.275  0.25 25.62  ? 233  LEU B CD1   1 
ATOM   4164   C CD2   A LEU B  1 233 ? 47.365  9.342   18.966  0.25 22.11  ? 233  LEU B CD2   1 
ATOM   4165   N N     A LEU B  1 234 ? 51.591  6.949   21.294  0.25 24.15  ? 234  LEU B N     1 
ATOM   4166   C CA    A LEU B  1 234 ? 52.968  7.080   21.751  0.25 23.07  ? 234  LEU B CA    1 
ATOM   4167   C C     A LEU B  1 234 ? 53.923  6.733   20.611  0.25 23.75  ? 234  LEU B C     1 
ATOM   4168   O O     A LEU B  1 234 ? 54.928  7.413   20.390  0.25 27.86  ? 234  LEU B O     1 
ATOM   4169   C CB    A LEU B  1 234 ? 53.215  6.149   22.949  0.25 22.91  ? 234  LEU B CB    1 
ATOM   4170   C CG    A LEU B  1 234 ? 54.642  6.149   23.538  0.25 25.18  ? 234  LEU B CG    1 
ATOM   4171   C CD1   A LEU B  1 234 ? 55.060  7.559   23.948  0.25 24.46  ? 234  LEU B CD1   1 
ATOM   4172   C CD2   A LEU B  1 234 ? 54.696  5.224   24.727  0.25 20.95  ? 234  LEU B CD2   1 
ATOM   4173   N N     A THR B  1 235 ? 53.608  5.675   19.879  0.25 25.24  ? 235  THR B N     1 
ATOM   4174   C CA    A THR B  1 235 ? 54.466  5.233   18.774  0.25 24.70  ? 235  THR B CA    1 
ATOM   4175   C C     A THR B  1 235 ? 54.495  6.279   17.666  0.25 26.17  ? 235  THR B C     1 
ATOM   4176   O O     A THR B  1 235 ? 55.552  6.542   17.078  0.25 24.65  ? 235  THR B O     1 
ATOM   4177   C CB    A THR B  1 235 ? 53.980  3.884   18.248  0.25 26.17  ? 235  THR B CB    1 
ATOM   4178   O OG1   A THR B  1 235 ? 53.958  2.958   19.338  0.25 23.03  ? 235  THR B OG1   1 
ATOM   4179   C CG2   A THR B  1 235 ? 54.915  3.334   17.156  0.25 24.56  ? 235  THR B CG2   1 
ATOM   4180   N N     A HIS B  1 236 ? 53.345  6.900   17.398  0.25 25.64  ? 236  HIS B N     1 
ATOM   4181   C CA    A HIS B  1 236 ? 53.298  7.964   16.391  0.25 25.64  ? 236  HIS B CA    1 
ATOM   4182   C C     A HIS B  1 236 ? 54.177  9.129   16.856  0.25 24.39  ? 236  HIS B C     1 
ATOM   4183   O O     A HIS B  1 236 ? 54.922  9.695   16.063  0.25 24.68  ? 236  HIS B O     1 
ATOM   4184   C CB    A HIS B  1 236 ? 51.859  8.460   16.190  0.25 24.58  ? 236  HIS B CB    1 
ATOM   4185   C CG    A HIS B  1 236 ? 51.040  7.591   15.283  0.25 24.44  ? 236  HIS B CG    1 
ATOM   4186   N ND1   A HIS B  1 236 ? 51.208  7.578   13.916  0.25 25.95  ? 236  HIS B ND1   1 
ATOM   4187   C CD2   A HIS B  1 236 ? 50.069  6.682   15.552  0.25 23.39  ? 236  HIS B CD2   1 
ATOM   4188   C CE1   A HIS B  1 236 ? 50.379  6.692   13.380  0.25 26.82  ? 236  HIS B CE1   1 
ATOM   4189   N NE2   A HIS B  1 236 ? 49.678  6.136   14.354  0.25 22.82  ? 236  HIS B NE2   1 
ATOM   4190   N N     A MET B  1 237 ? 54.081  9.483   18.139  0.25 24.41  ? 237  MET B N     1 
ATOM   4191   C CA    A MET B  1 237 ? 54.862  10.585  18.704  0.25 24.04  ? 237  MET B CA    1 
ATOM   4192   C C     A MET B  1 237 ? 56.360  10.302  18.568  0.25 26.59  ? 237  MET B C     1 
ATOM   4193   O O     A MET B  1 237 ? 57.128  11.127  18.069  0.25 26.74  ? 237  MET B O     1 
ATOM   4194   C CB    A MET B  1 237 ? 54.544  10.775  20.189  0.25 25.19  ? 237  MET B CB    1 
ATOM   4195   C CG    A MET B  1 237 ? 53.165  11.357  20.507  0.25 22.90  ? 237  MET B CG    1 
ATOM   4196   S SD    A MET B  1 237 ? 52.803  11.264  22.265  0.25 26.08  ? 237  MET B SD    1 
ATOM   4197   C CE    A MET B  1 237 ? 53.856  12.505  22.916  0.25 18.63  ? 237  MET B CE    1 
ATOM   4198   N N     A ILE B  1 238 ? 56.772  9.130   19.030  0.25 26.33  ? 238  ILE B N     1 
ATOM   4199   C CA    A ILE B  1 238 ? 58.176  8.762   18.965  0.25 27.91  ? 238  ILE B CA    1 
ATOM   4200   C C     A ILE B  1 238 ? 58.675  8.722   17.520  0.25 27.19  ? 238  ILE B C     1 
ATOM   4201   O O     A ILE B  1 238 ? 59.815  9.093   17.239  0.25 26.05  ? 238  ILE B O     1 
ATOM   4202   C CB    A ILE B  1 238 ? 58.408  7.407   19.657  0.25 25.27  ? 238  ILE B CB    1 
ATOM   4203   C CG1   A ILE B  1 238 ? 58.167  7.566   21.162  0.25 25.31  ? 238  ILE B CG1   1 
ATOM   4204   C CG2   A ILE B  1 238 ? 59.836  6.906   19.382  0.25 25.57  ? 238  ILE B CG2   1 
ATOM   4205   C CD1   A ILE B  1 238 ? 58.132  6.238   21.934  0.25 25.21  ? 238  ILE B CD1   1 
ATOM   4206   N N     A ALA B  1 239 ? 57.812  8.283   16.612  0.25 28.41  ? 239  ALA B N     1 
ATOM   4207   C CA    A ALA B  1 239 ? 58.174  8.207   15.197  0.25 29.78  ? 239  ALA B CA    1 
ATOM   4208   C C     A ALA B  1 239 ? 58.511  9.593   14.657  0.25 32.14  ? 239  ALA B C     1 
ATOM   4209   O O     A ALA B  1 239 ? 59.479  9.773   13.901  0.25 31.73  ? 239  ALA B O     1 
ATOM   4210   C CB    A ALA B  1 239 ? 57.034  7.601   14.392  0.25 27.90  ? 239  ALA B CB    1 
ATOM   4211   N N     A LEU B  1 240 ? 57.716  10.580  15.048  0.25 32.15  ? 240  LEU B N     1 
ATOM   4212   C CA    A LEU B  1 240 ? 57.933  11.934  14.579  0.25 32.57  ? 240  LEU B CA    1 
ATOM   4213   C C     A LEU B  1 240 ? 59.283  12.467  15.054  0.25 33.22  ? 240  LEU B C     1 
ATOM   4214   O O     A LEU B  1 240 ? 60.048  13.036  14.276  0.25 32.61  ? 240  LEU B O     1 
ATOM   4215   C CB    A LEU B  1 240 ? 56.806  12.859  15.072  0.25 31.67  ? 240  LEU B CB    1 
ATOM   4216   C CG    A LEU B  1 240 ? 56.920  14.333  14.680  0.25 31.01  ? 240  LEU B CG    1 
ATOM   4217   C CD1   A LEU B  1 240 ? 56.875  14.470  13.145  0.25 31.60  ? 240  LEU B CD1   1 
ATOM   4218   C CD2   A LEU B  1 240 ? 55.776  15.115  15.305  0.25 31.49  ? 240  LEU B CD2   1 
ATOM   4219   N N     A ILE B  1 241 ? 59.572  12.285  16.339  0.25 31.18  ? 241  ILE B N     1 
ATOM   4220   C CA    A ILE B  1 241 ? 60.821  12.780  16.900  0.25 30.84  ? 241  ILE B CA    1 
ATOM   4221   C C     A ILE B  1 241 ? 62.071  12.037  16.398  0.25 30.21  ? 241  ILE B C     1 
ATOM   4222   O O     A ILE B  1 241 ? 63.166  12.603  16.364  0.25 32.44  ? 241  ILE B O     1 
ATOM   4223   C CB    A ILE B  1 241 ? 60.788  12.695  18.458  0.25 30.86  ? 241  ILE B CB    1 
ATOM   4224   C CG1   A ILE B  1 241 ? 59.559  13.439  18.992  0.25 30.81  ? 241  ILE B CG1   1 
ATOM   4225   C CG2   A ILE B  1 241 ? 62.070  13.286  19.058  0.25 30.69  ? 241  ILE B CG2   1 
ATOM   4226   C CD1   A ILE B  1 241 ? 59.486  14.888  18.584  0.25 29.83  ? 241  ILE B CD1   1 
ATOM   4227   N N     A THR B  1 242 ? 61.909  10.781  15.999  0.25 30.26  ? 242  THR B N     1 
ATOM   4228   C CA    A THR B  1 242 ? 63.047  9.974   15.565  0.25 30.34  ? 242  THR B CA    1 
ATOM   4229   C C     A THR B  1 242 ? 63.171  9.806   14.060  0.25 30.72  ? 242  THR B C     1 
ATOM   4230   O O     A THR B  1 242 ? 64.019  9.040   13.582  0.25 28.89  ? 242  THR B O     1 
ATOM   4231   C CB    A THR B  1 242 ? 62.983  8.561   16.188  0.25 30.90  ? 242  THR B CB    1 
ATOM   4232   O OG1   A THR B  1 242 ? 61.760  7.927   15.792  0.25 32.38  ? 242  THR B OG1   1 
ATOM   4233   C CG2   A THR B  1 242 ? 63.039  8.636   17.720  0.25 25.91  ? 242  THR B CG2   1 
ATOM   4234   N N     A ASP B  1 243 ? 62.324  10.506  13.319  0.25 30.55  ? 243  ASP B N     1 
ATOM   4235   C CA    A ASP B  1 243 ? 62.345  10.414  11.865  0.25 33.05  ? 243  ASP B CA    1 
ATOM   4236   C C     A ASP B  1 243 ? 62.109  8.995   11.362  0.25 32.61  ? 243  ASP B C     1 
ATOM   4237   O O     A ASP B  1 243 ? 62.743  8.565   10.404  0.25 33.36  ? 243  ASP B O     1 
ATOM   4238   C CB    A ASP B  1 243 ? 63.687  10.937  11.323  0.25 36.29  ? 243  ASP B CB    1 
ATOM   4239   C CG    A ASP B  1 243 ? 63.804  12.448  11.417  0.25 36.84  ? 243  ASP B CG    1 
ATOM   4240   O OD1   A ASP B  1 243 ? 64.936  12.960  11.455  0.25 42.05  ? 243  ASP B OD1   1 
ATOM   4241   O OD2   A ASP B  1 243 ? 62.763  13.133  11.442  0.25 40.61  ? 243  ASP B OD2   1 
ATOM   4242   N N     A THR B  1 244 ? 61.215  8.261   12.026  0.25 31.03  ? 244  THR B N     1 
ATOM   4243   C CA    A THR B  1 244 ? 60.883  6.910   11.602  0.25 28.37  ? 244  THR B CA    1 
ATOM   4244   C C     A THR B  1 244 ? 59.408  6.872   11.200  0.25 29.75  ? 244  THR B C     1 
ATOM   4245   O O     A THR B  1 244 ? 58.653  7.808   11.473  0.25 29.47  ? 244  THR B O     1 
ATOM   4246   C CB    A THR B  1 244 ? 61.138  5.869   12.728  0.25 28.92  ? 244  THR B CB    1 
ATOM   4247   O OG1   A THR B  1 244 ? 60.482  6.283   13.932  0.25 27.94  ? 244  THR B OG1   1 
ATOM   4248   C CG2   A THR B  1 244 ? 62.647  5.729   12.997  0.25 28.11  ? 244  THR B CG2   1 
ATOM   4249   N N     A GLU B  1 245 ? 59.003  5.789   10.548  0.25 30.08  ? 245  GLU B N     1 
ATOM   4250   C CA    A GLU B  1 245 ? 57.626  5.634   10.105  0.25 31.87  ? 245  GLU B CA    1 
ATOM   4251   C C     A GLU B  1 245 ? 56.881  4.604   10.956  0.25 31.02  ? 245  GLU B C     1 
ATOM   4252   O O     A GLU B  1 245 ? 57.267  3.447   11.016  0.25 31.05  ? 245  GLU B O     1 
ATOM   4253   C CB    A GLU B  1 245 ? 57.621  5.193   8.647   0.25 33.37  ? 245  GLU B CB    1 
ATOM   4254   C CG    A GLU B  1 245 ? 56.247  4.963   8.026   0.25 36.77  ? 245  GLU B CG    1 
ATOM   4255   C CD    A GLU B  1 245 ? 55.422  6.232   7.924   0.25 39.98  ? 245  GLU B CD    1 
ATOM   4256   O OE1   A GLU B  1 245 ? 56.022  7.309   7.706   0.25 42.03  ? 245  GLU B OE1   1 
ATOM   4257   O OE2   A GLU B  1 245 ? 54.174  6.154   8.047   0.25 41.37  ? 245  GLU B OE2   1 
ATOM   4258   N N     A PRO B  1 246 ? 55.806  5.021   11.634  0.25 32.18  ? 246  PRO B N     1 
ATOM   4259   C CA    A PRO B  1 246 ? 55.059  4.063   12.456  0.25 30.76  ? 246  PRO B CA    1 
ATOM   4260   C C     A PRO B  1 246 ? 54.624  2.864   11.610  0.25 30.43  ? 246  PRO B C     1 
ATOM   4261   O O     A PRO B  1 246 ? 54.123  3.015   10.484  0.25 31.76  ? 246  PRO B O     1 
ATOM   4262   C CB    A PRO B  1 246 ? 53.888  4.895   12.987  0.25 31.79  ? 246  PRO B CB    1 
ATOM   4263   C CG    A PRO B  1 246 ? 53.705  5.951   11.960  0.25 36.20  ? 246  PRO B CG    1 
ATOM   4264   C CD    A PRO B  1 246 ? 55.126  6.328   11.583  0.25 33.00  ? 246  PRO B CD    1 
ATOM   4265   N N     A HIS B  1 247 ? 54.824  1.667   12.139  0.25 28.13  ? 247  HIS B N     1 
ATOM   4266   C CA    A HIS B  1 247 ? 54.475  0.475   11.383  0.25 30.19  ? 247  HIS B CA    1 
ATOM   4267   C C     A HIS B  1 247 ? 53.403  -0.409  12.008  0.25 29.97  ? 247  HIS B C     1 
ATOM   4268   O O     A HIS B  1 247 ? 52.323  -0.573  11.437  0.25 30.45  ? 247  HIS B O     1 
ATOM   4269   C CB    A HIS B  1 247 ? 55.746  -0.348  11.112  0.25 27.38  ? 247  HIS B CB    1 
ATOM   4270   C CG    A HIS B  1 247 ? 55.504  -1.602  10.332  0.25 32.36  ? 247  HIS B CG    1 
ATOM   4271   N ND1   A HIS B  1 247 ? 54.879  -1.615  9.102   0.25 31.21  ? 247  HIS B ND1   1 
ATOM   4272   C CD2   A HIS B  1 247 ? 55.800  -2.893  10.615  0.25 31.32  ? 247  HIS B CD2   1 
ATOM   4273   C CE1   A HIS B  1 247 ? 54.797  -2.858  8.665   0.25 31.52  ? 247  HIS B CE1   1 
ATOM   4274   N NE2   A HIS B  1 247 ? 55.348  -3.652  9.566   0.25 33.00  ? 247  HIS B NE2   1 
ATOM   4275   N N     A GLU B  1 248 ? 53.692  -0.956  13.187  0.25 31.78  ? 248  GLU B N     1 
ATOM   4276   C CA    A GLU B  1 248 ? 52.760  -1.882  13.846  0.25 30.55  ? 248  GLU B CA    1 
ATOM   4277   C C     A GLU B  1 248 ? 52.781  -1.778  15.370  0.25 30.24  ? 248  GLU B C     1 
ATOM   4278   O O     A GLU B  1 248 ? 53.818  -1.502  15.984  0.25 29.81  ? 248  GLU B O     1 
ATOM   4279   C CB    A GLU B  1 248 ? 53.134  -3.318  13.446  0.25 31.66  ? 248  GLU B CB    1 
ATOM   4280   C CG    A GLU B  1 248 ? 52.150  -4.403  13.837  0.25 36.14  ? 248  GLU B CG    1 
ATOM   4281   C CD    A GLU B  1 248 ? 52.598  -5.795  13.348  0.25 42.02  ? 248  GLU B CD    1 
ATOM   4282   O OE1   A GLU B  1 248 ? 51.805  -6.767  13.431  0.25 41.42  ? 248  GLU B OE1   1 
ATOM   4283   O OE2   A GLU B  1 248 ? 53.755  -5.926  12.888  0.25 43.83  ? 248  GLU B OE2   1 
ATOM   4284   N N     A PHE B  1 249 ? 51.623  -2.008  15.971  0.25 27.32  ? 249  PHE B N     1 
ATOM   4285   C CA    A PHE B  1 249 ? 51.487  -2.002  17.415  0.25 27.10  ? 249  PHE B CA    1 
ATOM   4286   C C     A PHE B  1 249 ? 50.930  -3.359  17.803  0.25 27.11  ? 249  PHE B C     1 
ATOM   4287   O O     A PHE B  1 249 ? 49.901  -3.786  17.266  0.25 27.96  ? 249  PHE B O     1 
ATOM   4288   C CB    A PHE B  1 249 ? 50.532  -0.901  17.890  0.25 26.89  ? 249  PHE B CB    1 
ATOM   4289   C CG    A PHE B  1 249 ? 50.137  -1.043  19.331  0.25 28.31  ? 249  PHE B CG    1 
ATOM   4290   C CD1   A PHE B  1 249 ? 51.112  -1.162  20.322  0.25 26.43  ? 249  PHE B CD1   1 
ATOM   4291   C CD2   A PHE B  1 249 ? 48.793  -1.138  19.693  0.25 27.68  ? 249  PHE B CD2   1 
ATOM   4292   C CE1   A PHE B  1 249 ? 50.754  -1.386  21.662  0.25 28.79  ? 249  PHE B CE1   1 
ATOM   4293   C CE2   A PHE B  1 249 ? 48.417  -1.361  21.024  0.25 27.25  ? 249  PHE B CE2   1 
ATOM   4294   C CZ    A PHE B  1 249 ? 49.396  -1.488  22.016  0.25 28.43  ? 249  PHE B CZ    1 
ATOM   4295   N N     A ILE B  1 250 ? 51.608  -4.038  18.726  0.25 24.60  ? 250  ILE B N     1 
ATOM   4296   C CA    A ILE B  1 250 ? 51.193  -5.355  19.181  0.25 23.84  ? 250  ILE B CA    1 
ATOM   4297   C C     A ILE B  1 250 ? 50.890  -5.265  20.673  0.25 24.24  ? 250  ILE B C     1 
ATOM   4298   O O     A ILE B  1 250 ? 51.664  -4.681  21.443  0.25 24.22  ? 250  ILE B O     1 
ATOM   4299   C CB    A ILE B  1 250 ? 52.307  -6.416  18.987  0.25 22.38  ? 250  ILE B CB    1 
ATOM   4300   C CG1   A ILE B  1 250 ? 52.764  -6.457  17.526  0.25 26.19  ? 250  ILE B CG1   1 
ATOM   4301   C CG2   A ILE B  1 250 ? 51.798  -7.795  19.425  0.25 25.33  ? 250  ILE B CG2   1 
ATOM   4302   C CD1   A ILE B  1 250 ? 53.782  -5.378  17.174  0.25 22.54  ? 250  ILE B CD1   1 
ATOM   4303   N N     A LEU B  1 251 ? 49.784  -5.873  21.076  0.25 24.00  ? 251  LEU B N     1 
ATOM   4304   C CA    A LEU B  1 251 ? 49.377  -5.845  22.477  0.25 24.44  ? 251  LEU B CA    1 
ATOM   4305   C C     A LEU B  1 251 ? 49.165  -7.248  23.032  0.25 24.40  ? 251  LEU B C     1 
ATOM   4306   O O     A LEU B  1 251 ? 48.274  -7.999  22.590  0.25 22.02  ? 251  LEU B O     1 
ATOM   4307   C CB    A LEU B  1 251 ? 48.098  -5.006  22.619  0.25 25.74  ? 251  LEU B CB    1 
ATOM   4308   C CG    A LEU B  1 251 ? 47.351  -4.979  23.955  0.25 29.84  ? 251  LEU B CG    1 
ATOM   4309   C CD1   A LEU B  1 251 ? 48.303  -4.698  25.093  0.25 29.28  ? 251  LEU B CD1   1 
ATOM   4310   C CD2   A LEU B  1 251 ? 46.264  -3.921  23.894  0.25 26.76  ? 251  LEU B CD2   1 
ATOM   4311   N N     A GLN B  1 252 ? 50.016  -7.624  23.990  0.25 24.21  ? 252  GLN B N     1 
ATOM   4312   C CA    A GLN B  1 252 ? 49.888  -8.935  24.628  0.25 23.06  ? 252  GLN B CA    1 
ATOM   4313   C C     A GLN B  1 252 ? 49.246  -8.771  25.995  0.25 21.33  ? 252  GLN B C     1 
ATOM   4314   O O     A GLN B  1 252 ? 49.669  -7.954  26.801  0.25 19.97  ? 252  GLN B O     1 
ATOM   4315   C CB    A GLN B  1 252 ? 51.245  -9.616  24.776  0.25 24.93  ? 252  GLN B CB    1 
ATOM   4316   C CG    A GLN B  1 252 ? 51.181  -10.940 25.526  0.25 27.26  ? 252  GLN B CG    1 
ATOM   4317   C CD    A GLN B  1 252 ? 50.282  -11.978 24.871  0.25 31.20  ? 252  GLN B CD    1 
ATOM   4318   O OE1   A GLN B  1 252 ? 49.453  -12.612 25.545  0.25 31.07  ? 252  GLN B OE1   1 
ATOM   4319   N NE2   A GLN B  1 252 ? 50.445  -12.176 23.559  0.25 30.84  ? 252  GLN B NE2   1 
ATOM   4320   N N     A MET B  1 253 ? 48.229  -9.574  26.265  0.25 19.95  ? 253  MET B N     1 
ATOM   4321   C CA    A MET B  1 253 ? 47.518  -9.473  27.527  0.25 22.67  ? 253  MET B CA    1 
ATOM   4322   C C     A MET B  1 253 ? 47.793  -10.628 28.454  0.25 18.58  ? 253  MET B C     1 
ATOM   4323   O O     A MET B  1 253 ? 48.078  -11.718 28.010  0.25 21.53  ? 253  MET B O     1 
ATOM   4324   C CB    A MET B  1 253 ? 46.005  -9.424  27.280  0.25 21.35  ? 253  MET B CB    1 
ATOM   4325   C CG    A MET B  1 253 ? 45.539  -8.293  26.420  0.25 23.18  ? 253  MET B CG    1 
ATOM   4326   S SD    A MET B  1 253 ? 43.720  -8.351  26.293  0.25 24.37  ? 253  MET B SD    1 
ATOM   4327   C CE    A MET B  1 253 ? 43.527  -7.293  24.847  0.25 23.33  ? 253  MET B CE    1 
ATOM   4328   N N     A GLY B  1 254 ? 47.708  -10.360 29.746  0.25 19.85  ? 254  GLY B N     1 
ATOM   4329   C CA    A GLY B  1 254 ? 47.901  -11.391 30.752  0.25 17.92  ? 254  GLY B CA    1 
ATOM   4330   C C     A GLY B  1 254 ? 46.497  -11.749 31.212  0.25 20.32  ? 254  GLY B C     1 
ATOM   4331   O O     A GLY B  1 254 ? 45.798  -12.522 30.574  0.25 17.22  ? 254  GLY B O     1 
ATOM   4332   N N     A ASP B  1 255 ? 46.056  -11.164 32.312  0.25 21.22  ? 255  ASP B N     1 
ATOM   4333   C CA    A ASP B  1 255 ? 44.714  -11.462 32.821  0.25 22.42  ? 255  ASP B CA    1 
ATOM   4334   C C     A ASP B  1 255 ? 43.727  -10.585 32.018  0.25 22.88  ? 255  ASP B C     1 
ATOM   4335   O O     A ASP B  1 255 ? 43.558  -9.407  32.316  0.25 23.87  ? 255  ASP B O     1 
ATOM   4336   C CB    A ASP B  1 255 ? 44.658  -11.124 34.320  0.25 21.97  ? 255  ASP B CB    1 
ATOM   4337   C CG    A ASP B  1 255 ? 43.331  -11.515 34.975  0.25 22.49  ? 255  ASP B CG    1 
ATOM   4338   O OD1   A ASP B  1 255 ? 43.377  -12.157 36.043  0.25 21.35  ? 255  ASP B OD1   1 
ATOM   4339   O OD2   A ASP B  1 255 ? 42.253  -11.188 34.449  0.25 22.74  ? 255  ASP B OD2   1 
ATOM   4340   N N     A ALA B  1 256 ? 43.108  -11.163 30.995  0.25 21.66  ? 256  ALA B N     1 
ATOM   4341   C CA    A ALA B  1 256 ? 42.161  -10.445 30.154  0.25 24.31  ? 256  ALA B CA    1 
ATOM   4342   C C     A ALA B  1 256 ? 40.760  -10.729 30.700  0.25 25.08  ? 256  ALA B C     1 
ATOM   4343   O O     A ALA B  1 256 ? 40.313  -11.863 30.699  0.25 24.13  ? 256  ALA B O     1 
ATOM   4344   C CB    A ALA B  1 256 ? 42.281  -10.934 28.702  0.25 23.35  ? 256  ALA B CB    1 
ATOM   4345   N N     A HIS B  1 257 ? 40.065  -9.693  31.147  0.25 25.41  ? 257  HIS B N     1 
ATOM   4346   C CA    A HIS B  1 257 ? 38.763  -9.894  31.746  0.25 23.52  ? 257  HIS B CA    1 
ATOM   4347   C C     A HIS B  1 257 ? 37.675  -8.868  31.367  0.25 23.75  ? 257  HIS B C     1 
ATOM   4348   O O     A HIS B  1 257 ? 37.942  -7.762  30.888  0.25 20.87  ? 257  HIS B O     1 
ATOM   4349   C CB    A HIS B  1 257 ? 38.925  -9.894  33.270  0.25 23.12  ? 257  HIS B CB    1 
ATOM   4350   C CG    A HIS B  1 257 ? 39.651  -8.684  33.792  0.25 25.60  ? 257  HIS B CG    1 
ATOM   4351   N ND1   A HIS B  1 257 ? 41.023  -8.630  33.898  0.25 25.68  ? 257  HIS B ND1   1 
ATOM   4352   C CD2   A HIS B  1 257 ? 39.197  -7.473  34.196  0.25 26.07  ? 257  HIS B CD2   1 
ATOM   4353   C CE1   A HIS B  1 257 ? 41.384  -7.442  34.351  0.25 26.02  ? 257  HIS B CE1   1 
ATOM   4354   N NE2   A HIS B  1 257 ? 40.294  -6.720  34.539  0.25 27.13  ? 257  HIS B NE2   1 
ATOM   4355   N N     A VAL B  1 258 ? 36.438  -9.268  31.621  0.25 23.26  ? 258  VAL B N     1 
ATOM   4356   C CA    A VAL B  1 258 ? 35.267  -8.435  31.385  0.25 22.76  ? 258  VAL B CA    1 
ATOM   4357   C C     A VAL B  1 258 ? 34.547  -8.368  32.734  0.25 22.41  ? 258  VAL B C     1 
ATOM   4358   O O     A VAL B  1 258 ? 34.153  -9.402  33.268  0.25 26.38  ? 258  VAL B O     1 
ATOM   4359   C CB    A VAL B  1 258 ? 34.323  -9.067  30.349  0.25 21.78  ? 258  VAL B CB    1 
ATOM   4360   C CG1   A VAL B  1 258 ? 33.015  -8.288  30.298  0.25 24.69  ? 258  VAL B CG1   1 
ATOM   4361   C CG2   A VAL B  1 258 ? 34.979  -9.072  28.974  0.25 21.32  ? 258  VAL B CG2   1 
ATOM   4362   N N     A TYR B  1 259 ? 34.414  -7.177  33.307  0.25 21.85  ? 259  TYR B N     1 
ATOM   4363   C CA    A TYR B  1 259 ? 33.713  -7.056  34.586  0.25 23.90  ? 259  TYR B CA    1 
ATOM   4364   C C     A TYR B  1 259 ? 32.246  -7.489  34.457  0.25 22.80  ? 259  TYR B C     1 
ATOM   4365   O O     A TYR B  1 259 ? 31.634  -7.346  33.391  0.25 20.17  ? 259  TYR B O     1 
ATOM   4366   C CB    A TYR B  1 259 ? 33.795  -5.631  35.120  0.25 22.86  ? 259  TYR B CB    1 
ATOM   4367   C CG    A TYR B  1 259 ? 35.122  -5.346  35.779  0.25 24.71  ? 259  TYR B CG    1 
ATOM   4368   C CD1   A TYR B  1 259 ? 36.209  -4.881  35.040  0.25 23.71  ? 259  TYR B CD1   1 
ATOM   4369   C CD2   A TYR B  1 259 ? 35.309  -5.605  37.138  0.25 26.38  ? 259  TYR B CD2   1 
ATOM   4370   C CE1   A TYR B  1 259 ? 37.466  -4.682  35.636  0.25 21.65  ? 259  TYR B CE1   1 
ATOM   4371   C CE2   A TYR B  1 259 ? 36.552  -5.415  37.740  0.25 27.91  ? 259  TYR B CE2   1 
ATOM   4372   C CZ    A TYR B  1 259 ? 37.624  -4.954  36.978  0.25 24.24  ? 259  TYR B CZ    1 
ATOM   4373   O OH    A TYR B  1 259 ? 38.839  -4.769  37.588  0.25 24.47  ? 259  TYR B OH    1 
ATOM   4374   N N     A ARG B  1 260 ? 31.713  -8.038  35.542  0.25 24.88  ? 260  ARG B N     1 
ATOM   4375   C CA    A ARG B  1 260 ? 30.339  -8.537  35.571  0.25 29.52  ? 260  ARG B CA    1 
ATOM   4376   C C     A ARG B  1 260 ? 29.334  -7.491  35.112  0.25 27.09  ? 260  ARG B C     1 
ATOM   4377   O O     A ARG B  1 260 ? 28.436  -7.803  34.349  0.25 27.41  ? 260  ARG B O     1 
ATOM   4378   C CB    A ARG B  1 260 ? 29.977  -9.013  36.985  0.25 35.42  ? 260  ARG B CB    1 
ATOM   4379   C CG    A ARG B  1 260 ? 31.018  -9.963  37.603  0.25 44.31  ? 260  ARG B CG    1 
ATOM   4380   C CD    A ARG B  1 260 ? 31.090  -11.320 36.894  0.25 50.40  ? 260  ARG B CD    1 
ATOM   4381   N NE    A ARG B  1 260 ? 30.202  -12.298 37.516  0.25 54.96  ? 260  ARG B NE    1 
ATOM   4382   C CZ    A ARG B  1 260 ? 30.373  -12.785 38.743  0.25 58.01  ? 260  ARG B CZ    1 
ATOM   4383   N NH1   A ARG B  1 260 ? 31.401  -12.389 39.481  0.25 59.81  ? 260  ARG B NH1   1 
ATOM   4384   N NH2   A ARG B  1 260 ? 29.513  -13.666 39.235  0.25 59.09  ? 260  ARG B NH2   1 
ATOM   4385   N N     A ASP B  1 261 ? 29.510  -6.248  35.552  0.25 27.22  ? 261  ASP B N     1 
ATOM   4386   C CA    A ASP B  1 261 ? 28.574  -5.180  35.195  0.25 27.47  ? 261  ASP B CA    1 
ATOM   4387   C C     A ASP B  1 261 ? 28.836  -4.580  33.834  0.25 27.16  ? 261  ASP B C     1 
ATOM   4388   O O     A ASP B  1 261 ? 28.223  -3.582  33.473  0.25 26.46  ? 261  ASP B O     1 
ATOM   4389   C CB    A ASP B  1 261 ? 28.566  -4.086  36.273  0.25 24.97  ? 261  ASP B CB    1 
ATOM   4390   C CG    A ASP B  1 261 ? 29.951  -3.492  36.529  0.25 31.00  ? 261  ASP B CG    1 
ATOM   4391   O OD1   A ASP B  1 261 ? 30.980  -4.131  36.183  0.25 27.58  ? 261  ASP B OD1   1 
ATOM   4392   O OD2   A ASP B  1 261 ? 30.012  -2.380  37.093  0.25 30.09  ? 261  ASP B OD2   1 
ATOM   4393   N N     A HIS B  1 262 ? 29.742  -5.194  33.070  0.25 25.67  ? 262  HIS B N     1 
ATOM   4394   C CA    A HIS B  1 262 ? 30.042  -4.719  31.723  0.25 26.25  ? 262  HIS B CA    1 
ATOM   4395   C C     A HIS B  1 262 ? 29.470  -5.666  30.661  0.25 26.93  ? 262  HIS B C     1 
ATOM   4396   O O     A HIS B  1 262 ? 29.354  -5.303  29.485  0.25 29.10  ? 262  HIS B O     1 
ATOM   4397   C CB    A HIS B  1 262 ? 31.566  -4.609  31.500  0.25 24.35  ? 262  HIS B CB    1 
ATOM   4398   C CG    A HIS B  1 262 ? 32.208  -3.476  32.236  0.25 24.63  ? 262  HIS B CG    1 
ATOM   4399   N ND1   A HIS B  1 262 ? 33.555  -3.192  32.135  0.25 20.75  ? 262  HIS B ND1   1 
ATOM   4400   C CD2   A HIS B  1 262 ? 31.678  -2.523  33.042  0.25 22.23  ? 262  HIS B CD2   1 
ATOM   4401   C CE1   A HIS B  1 262 ? 33.824  -2.108  32.838  0.25 23.00  ? 262  HIS B CE1   1 
ATOM   4402   N NE2   A HIS B  1 262 ? 32.702  -1.680  33.396  0.25 23.51  ? 262  HIS B NE2   1 
ATOM   4403   N N     A VAL B  1 263 ? 29.132  -6.879  31.069  0.25 27.58  ? 263  VAL B N     1 
ATOM   4404   C CA    A VAL B  1 263 ? 28.618  -7.882  30.132  0.25 29.37  ? 263  VAL B CA    1 
ATOM   4405   C C     A VAL B  1 263 ? 27.460  -7.388  29.260  0.25 30.31  ? 263  VAL B C     1 
ATOM   4406   O O     A VAL B  1 263 ? 27.539  -7.427  28.034  0.25 29.14  ? 263  VAL B O     1 
ATOM   4407   C CB    A VAL B  1 263 ? 28.193  -9.174  30.886  0.25 29.98  ? 263  VAL B CB    1 
ATOM   4408   C CG1   A VAL B  1 263 ? 27.561  -10.179 29.922  0.25 27.13  ? 263  VAL B CG1   1 
ATOM   4409   C CG2   A VAL B  1 263 ? 29.443  -9.813  31.545  0.25 31.89  ? 263  VAL B CG2   1 
ATOM   4410   N N     A GLU B  1 264 ? 26.387  -6.915  29.887  0.25 31.84  ? 264  GLU B N     1 
ATOM   4411   C CA    A GLU B  1 264 ? 25.241  -6.444  29.119  0.25 31.13  ? 264  GLU B CA    1 
ATOM   4412   C C     A GLU B  1 264 ? 25.565  -5.246  28.244  0.25 29.33  ? 264  GLU B C     1 
ATOM   4413   O O     A GLU B  1 264 ? 25.174  -5.200  27.075  0.25 32.39  ? 264  GLU B O     1 
ATOM   4414   C CB    A GLU B  1 264 ? 24.078  -6.134  30.057  0.25 36.33  ? 264  GLU B CB    1 
ATOM   4415   C CG    A GLU B  1 264 ? 23.482  -7.380  30.696  0.25 39.12  ? 264  GLU B CG    1 
ATOM   4416   C CD    A GLU B  1 264 ? 23.160  -8.451  29.663  0.25 44.38  ? 264  GLU B CD    1 
ATOM   4417   O OE1   A GLU B  1 264 ? 22.445  -8.130  28.676  0.25 44.29  ? 264  GLU B OE1   1 
ATOM   4418   O OE2   A GLU B  1 264 ? 23.625  -9.611  29.834  0.25 43.77  ? 264  GLU B OE2   1 
ATOM   4419   N N     A PRO B  1 265 ? 26.278  -4.246  28.783  0.25 27.69  ? 265  PRO B N     1 
ATOM   4420   C CA    A PRO B  1 265 ? 26.598  -3.096  27.931  0.25 26.86  ? 265  PRO B CA    1 
ATOM   4421   C C     A PRO B  1 265 ? 27.429  -3.496  26.705  0.25 28.26  ? 265  PRO B C     1 
ATOM   4422   O O     A PRO B  1 265 ? 27.224  -2.972  25.609  0.25 30.17  ? 265  PRO B O     1 
ATOM   4423   C CB    A PRO B  1 265 ? 27.355  -2.178  28.878  0.25 25.77  ? 265  PRO B CB    1 
ATOM   4424   C CG    A PRO B  1 265 ? 26.679  -2.445  30.193  0.25 24.77  ? 265  PRO B CG    1 
ATOM   4425   C CD    A PRO B  1 265 ? 26.566  -3.946  30.198  0.25 28.66  ? 265  PRO B CD    1 
ATOM   4426   N N     A LEU B  1 266 ? 28.362  -4.429  26.886  0.25 26.79  ? 266  LEU B N     1 
ATOM   4427   C CA    A LEU B  1 266 ? 29.218  -4.879  25.785  0.25 28.15  ? 266  LEU B CA    1 
ATOM   4428   C C     A LEU B  1 266 ? 28.449  -5.668  24.716  0.25 29.88  ? 266  LEU B C     1 
ATOM   4429   O O     A LEU B  1 266 ? 28.794  -5.633  23.536  0.25 29.97  ? 266  LEU B O     1 
ATOM   4430   C CB    A LEU B  1 266 ? 30.380  -5.727  26.338  0.25 26.77  ? 266  LEU B CB    1 
ATOM   4431   C CG    A LEU B  1 266 ? 31.458  -4.941  27.112  0.25 25.89  ? 266  LEU B CG    1 
ATOM   4432   C CD1   A LEU B  1 266 ? 32.531  -5.886  27.701  0.25 26.22  ? 266  LEU B CD1   1 
ATOM   4433   C CD2   A LEU B  1 266 ? 32.116  -3.956  26.152  0.25 22.88  ? 266  LEU B CD2   1 
ATOM   4434   N N     A LYS B  1 267 ? 27.412  -6.389  25.129  0.25 31.03  ? 267  LYS B N     1 
ATOM   4435   C CA    A LYS B  1 267 ? 26.601  -7.151  24.174  0.25 32.81  ? 267  LYS B CA    1 
ATOM   4436   C C     A LYS B  1 267 ? 25.999  -6.207  23.152  0.25 30.73  ? 267  LYS B C     1 
ATOM   4437   O O     A LYS B  1 267 ? 25.847  -6.548  21.987  0.25 33.86  ? 267  LYS B O     1 
ATOM   4438   C CB    A LYS B  1 267 ? 25.488  -7.914  24.896  0.25 34.06  ? 267  LYS B CB    1 
ATOM   4439   C CG    A LYS B  1 267 ? 25.989  -9.103  25.697  0.25 39.07  ? 267  LYS B CG    1 
ATOM   4440   C CD    A LYS B  1 267 ? 24.835  -9.831  26.359  0.25 42.70  ? 267  LYS B CD    1 
ATOM   4441   C CE    A LYS B  1 267 ? 25.333  -11.023 27.161  0.25 45.16  ? 267  LYS B CE    1 
ATOM   4442   N NZ    A LYS B  1 267 ? 24.208  -11.694 27.878  0.25 48.44  ? 267  LYS B NZ    1 
ATOM   4443   N N     A THR B  1 268 ? 25.666  -5.004  23.590  0.25 31.84  ? 268  THR B N     1 
ATOM   4444   C CA    A THR B  1 268 ? 25.119  -3.996  22.688  0.25 31.96  ? 268  THR B CA    1 
ATOM   4445   C C     A THR B  1 268 ? 26.202  -3.577  21.706  0.25 30.86  ? 268  THR B C     1 
ATOM   4446   O O     A THR B  1 268 ? 25.946  -3.412  20.513  0.25 31.39  ? 268  THR B O     1 
ATOM   4447   C CB    A THR B  1 268 ? 24.656  -2.750  23.469  0.25 33.92  ? 268  THR B CB    1 
ATOM   4448   O OG1   A THR B  1 268 ? 23.560  -3.109  24.318  0.25 36.47  ? 268  THR B OG1   1 
ATOM   4449   C CG2   A THR B  1 268 ? 24.218  -1.644  22.514  0.25 36.28  ? 268  THR B CG2   1 
ATOM   4450   N N     A GLN B  1 269 ? 27.427  -3.424  22.202  0.25 29.22  ? 269  GLN B N     1 
ATOM   4451   C CA    A GLN B  1 269 ? 28.535  -3.018  21.338  0.25 28.38  ? 269  GLN B CA    1 
ATOM   4452   C C     A GLN B  1 269 ? 28.884  -4.097  20.322  0.25 28.48  ? 269  GLN B C     1 
ATOM   4453   O O     A GLN B  1 269 ? 29.241  -3.798  19.176  0.25 28.27  ? 269  GLN B O     1 
ATOM   4454   C CB    A GLN B  1 269 ? 29.784  -2.684  22.181  0.25 26.87  ? 269  GLN B CB    1 
ATOM   4455   C CG    A GLN B  1 269 ? 30.925  -2.092  21.368  0.25 22.55  ? 269  GLN B CG    1 
ATOM   4456   C CD    A GLN B  1 269 ? 32.056  -1.540  22.238  0.25 24.35  ? 269  GLN B CD    1 
ATOM   4457   O OE1   A GLN B  1 269 ? 33.116  -1.150  21.730  0.25 22.70  ? 269  GLN B OE1   1 
ATOM   4458   N NE2   A GLN B  1 269 ? 31.838  -1.510  23.546  0.25 22.37  ? 269  GLN B NE2   1 
ATOM   4459   N N     A LEU B  1 270 ? 28.774  -5.353  20.737  0.25 30.96  ? 270  LEU B N     1 
ATOM   4460   C CA    A LEU B  1 270 ? 29.105  -6.485  19.857  0.25 34.46  ? 270  LEU B CA    1 
ATOM   4461   C C     A LEU B  1 270 ? 28.243  -6.568  18.601  0.25 35.20  ? 270  LEU B C     1 
ATOM   4462   O O     A LEU B  1 270 ? 28.631  -7.208  17.627  0.25 35.27  ? 270  LEU B O     1 
ATOM   4463   C CB    A LEU B  1 270 ? 28.990  -7.803  20.630  0.25 34.98  ? 270  LEU B CB    1 
ATOM   4464   C CG    A LEU B  1 270 ? 29.995  -8.001  21.765  0.25 36.51  ? 270  LEU B CG    1 
ATOM   4465   C CD1   A LEU B  1 270 ? 29.677  -9.276  22.527  0.25 34.58  ? 270  LEU B CD1   1 
ATOM   4466   C CD2   A LEU B  1 270 ? 31.394  -8.060  21.178  0.25 33.98  ? 270  LEU B CD2   1 
ATOM   4467   N N     A GLU B  1 271 ? 27.085  -5.915  18.628  0.25 35.46  ? 271  GLU B N     1 
ATOM   4468   C CA    A GLU B  1 271 ? 26.162  -5.918  17.496  0.25 37.29  ? 271  GLU B CA    1 
ATOM   4469   C C     A GLU B  1 271 ? 26.556  -4.912  16.434  0.25 35.64  ? 271  GLU B C     1 
ATOM   4470   O O     A GLU B  1 271 ? 26.022  -4.933  15.332  0.25 37.55  ? 271  GLU B O     1 
ATOM   4471   C CB    A GLU B  1 271 ? 24.742  -5.578  17.967  0.25 40.31  ? 271  GLU B CB    1 
ATOM   4472   C CG    A GLU B  1 271 ? 24.153  -6.530  18.991  0.25 46.38  ? 271  GLU B CG    1 
ATOM   4473   C CD    A GLU B  1 271 ? 22.829  -6.020  19.548  0.25 52.80  ? 271  GLU B CD    1 
ATOM   4474   O OE1   A GLU B  1 271 ? 21.935  -5.677  18.743  0.25 54.60  ? 271  GLU B OE1   1 
ATOM   4475   O OE2   A GLU B  1 271 ? 22.674  -5.963  20.788  0.25 55.36  ? 271  GLU B OE2   1 
ATOM   4476   N N     A ARG B  1 272 ? 27.501  -4.037  16.751  0.25 33.64  ? 272  ARG B N     1 
ATOM   4477   C CA    A ARG B  1 272 ? 27.893  -2.989  15.816  0.25 30.65  ? 272  ARG B CA    1 
ATOM   4478   C C     A ARG B  1 272 ? 29.043  -3.326  14.890  0.25 31.75  ? 272  ARG B C     1 
ATOM   4479   O O     A ARG B  1 272 ? 30.015  -3.967  15.292  0.25 30.92  ? 272  ARG B O     1 
ATOM   4480   C CB    A ARG B  1 272 ? 28.235  -1.717  16.592  0.25 31.12  ? 272  ARG B CB    1 
ATOM   4481   C CG    A ARG B  1 272 ? 27.095  -1.190  17.450  0.25 31.93  ? 272  ARG B CG    1 
ATOM   4482   C CD    A ARG B  1 272 ? 27.567  -0.107  18.399  0.25 32.25  ? 272  ARG B CD    1 
ATOM   4483   N NE    A ARG B  1 272 ? 26.442  0.510   19.086  0.25 30.87  ? 272  ARG B NE    1 
ATOM   4484   C CZ    A ARG B  1 272 ? 26.547  1.511   19.942  0.25 29.68  ? 272  ARG B CZ    1 
ATOM   4485   N NH1   A ARG B  1 272 ? 25.450  2.006   20.506  0.25 28.25  ? 272  ARG B NH1   1 
ATOM   4486   N NH2   A ARG B  1 272 ? 27.745  1.999   20.237  0.25 25.25  ? 272  ARG B NH2   1 
ATOM   4487   N N     A GLU B  1 273 ? 28.932  -2.857  13.651  0.25 30.60  ? 273  GLU B N     1 
ATOM   4488   C CA    A GLU B  1 273 ? 29.951  -3.065  12.645  0.25 33.25  ? 273  GLU B CA    1 
ATOM   4489   C C     A GLU B  1 273 ? 30.940  -1.897  12.685  0.25 32.67  ? 273  GLU B C     1 
ATOM   4490   O O     A GLU B  1 273 ? 30.554  -0.732  12.610  0.25 32.30  ? 273  GLU B O     1 
ATOM   4491   C CB    A GLU B  1 273 ? 29.309  -3.161  11.262  0.25 36.01  ? 273  GLU B CB    1 
ATOM   4492   C CG    A GLU B  1 273 ? 30.310  -3.238  10.118  0.25 43.64  ? 273  GLU B CG    1 
ATOM   4493   C CD    A GLU B  1 273 ? 29.647  -3.434  8.761   0.25 46.79  ? 273  GLU B CD    1 
ATOM   4494   O OE1   A GLU B  1 273 ? 30.350  -3.304  7.735   0.25 51.47  ? 273  GLU B OE1   1 
ATOM   4495   O OE2   A GLU B  1 273 ? 28.434  -3.721  8.718   0.25 49.23  ? 273  GLU B OE2   1 
ATOM   4496   N N     A PRO B  1 274 ? 32.238  -2.203  12.788  0.25 31.03  ? 274  PRO B N     1 
ATOM   4497   C CA    A PRO B  1 274 ? 33.284  -1.176  12.839  0.25 30.44  ? 274  PRO B CA    1 
ATOM   4498   C C     A PRO B  1 274 ? 33.323  -0.265  11.606  0.25 30.21  ? 274  PRO B C     1 
ATOM   4499   O O     A PRO B  1 274 ? 32.957  -0.674  10.506  0.25 30.25  ? 274  PRO B O     1 
ATOM   4500   C CB    A PRO B  1 274 ? 34.576  -1.996  12.958  0.25 27.98  ? 274  PRO B CB    1 
ATOM   4501   C CG    A PRO B  1 274 ? 34.114  -3.271  13.625  0.25 32.37  ? 274  PRO B CG    1 
ATOM   4502   C CD    A PRO B  1 274 ? 32.810  -3.554  12.927  0.25 30.42  ? 274  PRO B CD    1 
ATOM   4503   N N     A ARG B  1 275 ? 33.764  0.972   11.810  0.25 28.07  ? 275  ARG B N     1 
ATOM   4504   C CA    A ARG B  1 275 ? 33.936  1.934   10.731  0.25 29.19  ? 275  ARG B CA    1 
ATOM   4505   C C     A ARG B  1 275 ? 35.444  1.980   10.530  0.25 28.40  ? 275  ARG B C     1 
ATOM   4506   O O     A ARG B  1 275 ? 36.193  1.631   11.441  0.25 28.56  ? 275  ARG B O     1 
ATOM   4507   C CB    A ARG B  1 275 ? 33.451  3.332   11.139  0.25 29.51  ? 275  ARG B CB    1 
ATOM   4508   C CG    A ARG B  1 275 ? 31.941  3.609   10.963  0.25 30.76  ? 275  ARG B CG    1 
ATOM   4509   C CD    A ARG B  1 275 ? 31.088  2.877   11.956  0.25 29.85  ? 275  ARG B CD    1 
ATOM   4510   N NE    A ARG B  1 275 ? 29.656  3.095   11.698  0.25 32.75  ? 275  ARG B NE    1 
ATOM   4511   C CZ    A ARG B  1 275 ? 28.982  4.202   12.006  0.25 31.17  ? 275  ARG B CZ    1 
ATOM   4512   N NH1   A ARG B  1 275 ? 29.588  5.230   12.594  0.25 30.72  ? 275  ARG B NH1   1 
ATOM   4513   N NH2   A ARG B  1 275 ? 27.685  4.276   11.734  0.25 29.52  ? 275  ARG B NH2   1 
ATOM   4514   N N     A ASP B  1 276 ? 35.897  2.399   9.358   0.25 27.49  ? 276  ASP B N     1 
ATOM   4515   C CA    A ASP B  1 276 ? 37.328  2.468   9.112   0.25 29.13  ? 276  ASP B CA    1 
ATOM   4516   C C     A ASP B  1 276 ? 37.988  3.355   10.176  0.25 30.38  ? 276  ASP B C     1 
ATOM   4517   O O     A ASP B  1 276 ? 37.453  4.397   10.561  0.25 27.70  ? 276  ASP B O     1 
ATOM   4518   C CB    A ASP B  1 276 ? 37.628  3.048   7.731   0.25 31.23  ? 276  ASP B CB    1 
ATOM   4519   C CG    A ASP B  1 276 ? 37.093  2.189   6.603   0.25 35.87  ? 276  ASP B CG    1 
ATOM   4520   O OD1   A ASP B  1 276 ? 37.035  0.954   6.761   0.25 40.14  ? 276  ASP B OD1   1 
ATOM   4521   O OD2   A ASP B  1 276 ? 36.742  2.748   5.551   0.25 38.28  ? 276  ASP B OD2   1 
ATOM   4522   N N     A PHE B  1 277 ? 39.158  2.939   10.649  0.25 28.24  ? 277  PHE B N     1 
ATOM   4523   C CA    A PHE B  1 277 ? 39.868  3.711   11.654  0.25 28.33  ? 277  PHE B CA    1 
ATOM   4524   C C     A PHE B  1 277 ? 40.219  5.093   11.131  0.25 29.66  ? 277  PHE B C     1 
ATOM   4525   O O     A PHE B  1 277 ? 40.407  5.289   9.922   0.25 28.06  ? 277  PHE B O     1 
ATOM   4526   C CB    A PHE B  1 277 ? 41.175  3.003   12.068  0.25 26.85  ? 277  PHE B CB    1 
ATOM   4527   C CG    A PHE B  1 277 ? 40.978  1.830   12.990  0.25 24.79  ? 277  PHE B CG    1 
ATOM   4528   C CD1   A PHE B  1 277 ? 40.044  1.880   14.028  0.25 22.47  ? 277  PHE B CD1   1 
ATOM   4529   C CD2   A PHE B  1 277 ? 41.784  0.703   12.870  0.25 24.53  ? 277  PHE B CD2   1 
ATOM   4530   C CE1   A PHE B  1 277 ? 39.924  0.822   14.937  0.25 22.20  ? 277  PHE B CE1   1 
ATOM   4531   C CE2   A PHE B  1 277 ? 41.671  -0.354  13.764  0.25 21.56  ? 277  PHE B CE2   1 
ATOM   4532   C CZ    A PHE B  1 277 ? 40.742  -0.295  14.800  0.25 24.38  ? 277  PHE B CZ    1 
ATOM   4533   N N     A PRO B  1 278 ? 40.310  6.075   12.040  0.25 28.93  ? 278  PRO B N     1 
ATOM   4534   C CA    A PRO B  1 278 ? 40.653  7.443   11.670  0.25 29.59  ? 278  PRO B CA    1 
ATOM   4535   C C     A PRO B  1 278 ? 42.149  7.574   11.401  0.25 29.89  ? 278  PRO B C     1 
ATOM   4536   O O     A PRO B  1 278 ? 42.909  6.626   11.599  0.25 30.63  ? 278  PRO B O     1 
ATOM   4537   C CB    A PRO B  1 278 ? 40.227  8.246   12.893  0.25 29.21  ? 278  PRO B CB    1 
ATOM   4538   C CG    A PRO B  1 278 ? 40.506  7.295   14.018  0.25 28.20  ? 278  PRO B CG    1 
ATOM   4539   C CD    A PRO B  1 278 ? 39.950  5.992   13.468  0.25 29.10  ? 278  PRO B CD    1 
ATOM   4540   N N     A LYS B  1 279 ? 42.568  8.746   10.943  0.25 31.57  ? 279  LYS B N     1 
ATOM   4541   C CA    A LYS B  1 279 ? 43.982  8.979   10.691  0.25 33.62  ? 279  LYS B CA    1 
ATOM   4542   C C     A LYS B  1 279 ? 44.498  10.104  11.576  0.25 32.48  ? 279  LYS B C     1 
ATOM   4543   O O     A LYS B  1 279 ? 43.733  10.992  11.980  0.25 32.32  ? 279  LYS B O     1 
ATOM   4544   C CB    A LYS B  1 279 ? 44.218  9.296   9.212   0.25 36.38  ? 279  LYS B CB    1 
ATOM   4545   C CG    A LYS B  1 279 ? 43.956  8.091   8.333   0.25 40.94  ? 279  LYS B CG    1 
ATOM   4546   C CD    A LYS B  1 279 ? 44.423  8.312   6.908   0.25 47.26  ? 279  LYS B CD    1 
ATOM   4547   C CE    A LYS B  1 279 ? 44.308  7.019   6.095   0.25 47.60  ? 279  LYS B CE    1 
ATOM   4548   N NZ    A LYS B  1 279 ? 44.800  7.197   4.692   0.25 51.88  ? 279  LYS B NZ    1 
ATOM   4549   N N     A LEU B  1 280 ? 45.789  10.053  11.889  0.25 31.20  ? 280  LEU B N     1 
ATOM   4550   C CA    A LEU B  1 280 ? 46.406  11.064  12.736  0.25 31.40  ? 280  LEU B CA    1 
ATOM   4551   C C     A LEU B  1 280 ? 47.294  11.986  11.934  0.25 32.29  ? 280  LEU B C     1 
ATOM   4552   O O     A LEU B  1 280 ? 48.062  11.534  11.106  0.25 32.75  ? 280  LEU B O     1 
ATOM   4553   C CB    A LEU B  1 280 ? 47.243  10.403  13.837  0.25 28.41  ? 280  LEU B CB    1 
ATOM   4554   C CG    A LEU B  1 280 ? 48.095  11.333  14.704  0.25 27.60  ? 280  LEU B CG    1 
ATOM   4555   C CD1   A LEU B  1 280 ? 47.193  12.168  15.606  0.25 23.59  ? 280  LEU B CD1   1 
ATOM   4556   C CD2   A LEU B  1 280 ? 49.050  10.488  15.553  0.25 25.18  ? 280  LEU B CD2   1 
ATOM   4557   N N     A LYS B  1 281 ? 47.180  13.287  12.196  0.25 33.54  ? 281  LYS B N     1 
ATOM   4558   C CA    A LYS B  1 281 ? 47.998  14.292  11.525  0.25 33.83  ? 281  LYS B CA    1 
ATOM   4559   C C     A LYS B  1 281 ? 48.506  15.226  12.610  0.25 31.20  ? 281  LYS B C     1 
ATOM   4560   O O     A LYS B  1 281 ? 47.871  15.362  13.662  0.25 31.78  ? 281  LYS B O     1 
ATOM   4561   C CB    A LYS B  1 281 ? 47.146  15.086  10.524  0.25 38.05  ? 281  LYS B CB    1 
ATOM   4562   C CG    A LYS B  1 281 ? 46.427  14.221  9.505   0.25 40.54  ? 281  LYS B CG    1 
ATOM   4563   C CD    A LYS B  1 281 ? 47.429  13.483  8.620   0.25 44.58  ? 281  LYS B CD    1 
ATOM   4564   C CE    A LYS B  1 281 ? 46.712  12.761  7.486   0.25 47.96  ? 281  LYS B CE    1 
ATOM   4565   N NZ    A LYS B  1 281 ? 47.673  12.096  6.571   0.25 51.41  ? 281  LYS B NZ    1 
ATOM   4566   N N     A TRP B  1 282 ? 49.639  15.869  12.368  0.25 30.55  ? 282  TRP B N     1 
ATOM   4567   C CA    A TRP B  1 282 ? 50.198  16.797  13.347  0.25 32.37  ? 282  TRP B CA    1 
ATOM   4568   C C     A TRP B  1 282 ? 49.884  18.252  12.969  0.25 33.76  ? 282  TRP B C     1 
ATOM   4569   O O     A TRP B  1 282 ? 50.004  18.635  11.806  0.25 34.59  ? 282  TRP B O     1 
ATOM   4570   C CB    A TRP B  1 282 ? 51.711  16.612  13.453  0.25 30.26  ? 282  TRP B CB    1 
ATOM   4571   C CG    A TRP B  1 282 ? 52.119  15.245  13.901  0.25 31.92  ? 282  TRP B CG    1 
ATOM   4572   C CD1   A TRP B  1 282 ? 52.834  14.323  13.186  0.25 31.20  ? 282  TRP B CD1   1 
ATOM   4573   C CD2   A TRP B  1 282 ? 51.841  14.643  15.169  0.25 30.38  ? 282  TRP B CD2   1 
ATOM   4574   N NE1   A TRP B  1 282 ? 53.020  13.186  13.934  0.25 31.77  ? 282  TRP B NE1   1 
ATOM   4575   C CE2   A TRP B  1 282 ? 52.422  13.356  15.155  0.25 30.21  ? 282  TRP B CE2   1 
ATOM   4576   C CE3   A TRP B  1 282 ? 51.156  15.066  16.316  0.25 29.99  ? 282  TRP B CE3   1 
ATOM   4577   C CZ2   A TRP B  1 282 ? 52.341  12.485  16.245  0.25 29.21  ? 282  TRP B CZ2   1 
ATOM   4578   C CZ3   A TRP B  1 282 ? 51.075  14.191  17.408  0.25 31.27  ? 282  TRP B CZ3   1 
ATOM   4579   C CH2   A TRP B  1 282 ? 51.666  12.915  17.359  0.25 29.52  ? 282  TRP B CH2   1 
ATOM   4580   N N     A ALA B  1 283 ? 49.476  19.048  13.956  0.25 34.11  ? 283  ALA B N     1 
ATOM   4581   C CA    A ALA B  1 283 ? 49.151  20.448  13.735  0.25 34.50  ? 283  ALA B CA    1 
ATOM   4582   C C     A ALA B  1 283 ? 50.420  21.279  13.611  0.25 34.77  ? 283  ALA B C     1 
ATOM   4583   O O     A ALA B  1 283 ? 50.367  22.418  13.163  0.25 35.23  ? 283  ALA B O     1 
ATOM   4584   C CB    A ALA B  1 283 ? 48.287  20.978  14.875  0.25 33.44  ? 283  ALA B CB    1 
ATOM   4585   N N     A ARG B  1 284 ? 51.557  20.709  14.008  0.25 34.26  ? 284  ARG B N     1 
ATOM   4586   C CA    A ARG B  1 284 ? 52.833  21.418  13.926  0.25 33.71  ? 284  ARG B CA    1 
ATOM   4587   C C     A ARG B  1 284 ? 53.913  20.505  13.368  0.25 33.55  ? 284  ARG B C     1 
ATOM   4588   O O     A ARG B  1 284 ? 53.711  19.309  13.235  0.25 33.85  ? 284  ARG B O     1 
ATOM   4589   C CB    A ARG B  1 284 ? 53.264  21.942  15.296  0.25 32.06  ? 284  ARG B CB    1 
ATOM   4590   C CG    A ARG B  1 284 ? 52.359  23.037  15.866  0.25 32.20  ? 284  ARG B CG    1 
ATOM   4591   C CD    A ARG B  1 284 ? 52.940  23.619  17.151  0.25 31.14  ? 284  ARG B CD    1 
ATOM   4592   N NE    A ARG B  1 284 ? 53.005  22.639  18.234  0.25 35.14  ? 284  ARG B NE    1 
ATOM   4593   C CZ    A ARG B  1 284 ? 53.837  22.689  19.272  0.25 32.23  ? 284  ARG B CZ    1 
ATOM   4594   N NH1   A ARG B  1 284 ? 53.796  21.734  20.192  0.25 29.59  ? 284  ARG B NH1   1 
ATOM   4595   N NH2   A ARG B  1 284 ? 54.724  23.665  19.377  0.25 34.05  ? 284  ARG B NH2   1 
ATOM   4596   N N     A SER B  1 285 ? 55.064  21.077  13.040  0.25 33.30  ? 285  SER B N     1 
ATOM   4597   C CA    A SER B  1 285 ? 56.159  20.298  12.478  0.25 34.11  ? 285  SER B CA    1 
ATOM   4598   C C     A SER B  1 285 ? 57.062  19.703  13.557  0.25 34.83  ? 285  SER B C     1 
ATOM   4599   O O     A SER B  1 285 ? 56.985  20.068  14.731  0.25 35.71  ? 285  SER B O     1 
ATOM   4600   C CB    A SER B  1 285 ? 57.007  21.179  11.564  0.25 32.18  ? 285  SER B CB    1 
ATOM   4601   O OG    A SER B  1 285 ? 57.607  22.217  12.325  0.25 35.61  ? 285  SER B OG    1 
ATOM   4602   N N     A LYS B  1 286 ? 57.923  18.785  13.144  0.25 35.28  ? 286  LYS B N     1 
ATOM   4603   C CA    A LYS B  1 286 ? 58.852  18.155  14.059  0.25 37.39  ? 286  LYS B CA    1 
ATOM   4604   C C     A LYS B  1 286 ? 59.693  19.213  14.748  0.25 38.31  ? 286  LYS B C     1 
ATOM   4605   O O     A LYS B  1 286 ? 59.907  19.161  15.969  0.25 40.34  ? 286  LYS B O     1 
ATOM   4606   C CB    A LYS B  1 286 ? 59.772  17.200  13.294  0.25 39.88  ? 286  LYS B CB    1 
ATOM   4607   C CG    A LYS B  1 286 ? 60.929  16.656  14.132  0.25 42.13  ? 286  LYS B CG    1 
ATOM   4608   C CD    A LYS B  1 286 ? 61.919  15.900  13.279  0.25 43.82  ? 286  LYS B CD    1 
ATOM   4609   C CE    A LYS B  1 286 ? 63.135  15.493  14.098  0.25 45.11  ? 286  LYS B CE    1 
ATOM   4610   N NZ    A LYS B  1 286 ? 64.163  14.833  13.235  0.25 48.95  ? 286  LYS B NZ    1 
ATOM   4611   N N     A GLU B  1 287 ? 60.178  20.168  13.958  0.25 38.43  ? 287  GLU B N     1 
ATOM   4612   C CA    A GLU B  1 287 ? 61.013  21.252  14.471  0.25 38.34  ? 287  GLU B CA    1 
ATOM   4613   C C     A GLU B  1 287 ? 60.285  22.102  15.504  0.25 36.11  ? 287  GLU B C     1 
ATOM   4614   O O     A GLU B  1 287 ? 60.856  22.493  16.519  0.25 35.55  ? 287  GLU B O     1 
ATOM   4615   C CB    A GLU B  1 287 ? 61.478  22.156  13.320  0.25 40.88  ? 287  GLU B CB    1 
ATOM   4616   C CG    A GLU B  1 287 ? 62.392  21.493  12.301  0.25 44.39  ? 287  GLU B CG    1 
ATOM   4617   C CD    A GLU B  1 287 ? 61.713  20.366  11.546  0.25 48.01  ? 287  GLU B CD    1 
ATOM   4618   O OE1   A GLU B  1 287 ? 60.550  20.549  11.095  0.25 48.91  ? 287  GLU B OE1   1 
ATOM   4619   O OE2   A GLU B  1 287 ? 62.350  19.301  11.393  0.25 48.97  ? 287  GLU B OE2   1 
ATOM   4620   N N     A GLU B  1 288 ? 59.021  22.403  15.238  0.25 34.68  ? 288  GLU B N     1 
ATOM   4621   C CA    A GLU B  1 288 ? 58.243  23.216  16.161  0.25 35.77  ? 288  GLU B CA    1 
ATOM   4622   C C     A GLU B  1 288 ? 58.013  22.461  17.462  0.25 34.97  ? 288  GLU B C     1 
ATOM   4623   O O     A GLU B  1 288 ? 58.169  23.021  18.546  0.25 33.68  ? 288  GLU B O     1 
ATOM   4624   C CB    A GLU B  1 288 ? 56.905  23.602  15.530  0.25 38.59  ? 288  GLU B CB    1 
ATOM   4625   C CG    A GLU B  1 288 ? 57.049  24.476  14.281  0.25 43.17  ? 288  GLU B CG    1 
ATOM   4626   C CD    A GLU B  1 288 ? 55.707  24.814  13.632  0.25 47.62  ? 288  GLU B CD    1 
ATOM   4627   O OE1   A GLU B  1 288 ? 54.983  23.879  13.213  0.25 50.61  ? 288  GLU B OE1   1 
ATOM   4628   O OE2   A GLU B  1 288 ? 55.376  26.018  13.538  0.25 49.11  ? 288  GLU B OE2   1 
ATOM   4629   N N     A ILE B  1 289 ? 57.644  21.189  17.353  0.25 34.23  ? 289  ILE B N     1 
ATOM   4630   C CA    A ILE B  1 289 ? 57.403  20.376  18.544  0.25 32.86  ? 289  ILE B CA    1 
ATOM   4631   C C     A ILE B  1 289 ? 58.722  20.197  19.296  0.25 32.13  ? 289  ILE B C     1 
ATOM   4632   O O     A ILE B  1 289 ? 58.753  20.253  20.520  0.25 29.62  ? 289  ILE B O     1 
ATOM   4633   C CB    A ILE B  1 289 ? 56.782  19.019  18.160  0.25 31.05  ? 289  ILE B CB    1 
ATOM   4634   C CG1   A ILE B  1 289 ? 55.368  19.266  17.632  0.25 29.76  ? 289  ILE B CG1   1 
ATOM   4635   C CG2   A ILE B  1 289 ? 56.756  18.074  19.378  0.25 29.81  ? 289  ILE B CG2   1 
ATOM   4636   C CD1   A ILE B  1 289 ? 54.679  18.053  17.073  0.25 30.37  ? 289  ILE B CD1   1 
ATOM   4637   N N     A GLY B  1 290 ? 59.802  19.993  18.548  0.25 32.36  ? 290  GLY B N     1 
ATOM   4638   C CA    A GLY B  1 290 ? 61.116  19.875  19.160  0.25 33.59  ? 290  GLY B CA    1 
ATOM   4639   C C     A GLY B  1 290 ? 61.509  18.491  19.620  0.25 34.82  ? 290  GLY B C     1 
ATOM   4640   O O     A GLY B  1 290 ? 62.287  17.811  18.948  0.25 37.88  ? 290  GLY B O     1 
ATOM   4641   N N     A ASP B  1 291 ? 60.982  18.067  20.762  0.25 31.20  ? 291  ASP B N     1 
ATOM   4642   C CA    A ASP B  1 291 ? 61.301  16.756  21.288  0.25 30.16  ? 291  ASP B CA    1 
ATOM   4643   C C     A ASP B  1 291 ? 60.057  16.106  21.898  0.25 29.96  ? 291  ASP B C     1 
ATOM   4644   O O     A ASP B  1 291 ? 58.956  16.654  21.809  0.25 29.16  ? 291  ASP B O     1 
ATOM   4645   C CB    A ASP B  1 291 ? 62.406  16.866  22.342  0.25 32.94  ? 291  ASP B CB    1 
ATOM   4646   C CG    A ASP B  1 291 ? 62.080  17.874  23.423  0.25 34.16  ? 291  ASP B CG    1 
ATOM   4647   O OD1   A ASP B  1 291 ? 60.920  17.912  23.887  0.25 38.78  ? 291  ASP B OD1   1 
ATOM   4648   O OD2   A ASP B  1 291 ? 62.985  18.629  23.826  0.25 39.23  ? 291  ASP B OD2   1 
ATOM   4649   N N     A ILE B  1 292 ? 60.244  14.952  22.529  0.25 26.24  ? 292  ILE B N     1 
ATOM   4650   C CA    A ILE B  1 292 ? 59.133  14.210  23.120  0.25 28.05  ? 292  ILE B CA    1 
ATOM   4651   C C     A ILE B  1 292 ? 58.367  14.993  24.185  0.25 29.66  ? 292  ILE B C     1 
ATOM   4652   O O     A ILE B  1 292 ? 57.196  14.701  24.476  0.25 30.97  ? 292  ILE B O     1 
ATOM   4653   C CB    A ILE B  1 292 ? 59.632  12.874  23.703  0.25 28.21  ? 292  ILE B CB    1 
ATOM   4654   C CG1   A ILE B  1 292 ? 58.458  11.911  23.867  0.25 30.30  ? 292  ILE B CG1   1 
ATOM   4655   C CG2   A ILE B  1 292 ? 60.359  13.109  25.035  0.25 22.90  ? 292  ILE B CG2   1 
ATOM   4656   C CD1   A ILE B  1 292 ? 57.823  11.493  22.556  0.25 29.43  ? 292  ILE B CD1   1 
ATOM   4657   N N     A ASP B  1 293 ? 59.012  16.006  24.755  0.25 28.87  ? 293  ASP B N     1 
ATOM   4658   C CA    A ASP B  1 293 ? 58.368  16.814  25.783  0.25 30.41  ? 293  ASP B CA    1 
ATOM   4659   C C     A ASP B  1 293 ? 57.680  18.059  25.242  0.25 30.22  ? 293  ASP B C     1 
ATOM   4660   O O     A ASP B  1 293 ? 57.128  18.843  26.012  0.25 30.90  ? 293  ASP B O     1 
ATOM   4661   C CB    A ASP B  1 293 ? 59.397  17.230  26.837  0.25 32.51  ? 293  ASP B CB    1 
ATOM   4662   C CG    A ASP B  1 293 ? 59.887  16.055  27.660  0.25 34.28  ? 293  ASP B CG    1 
ATOM   4663   O OD1   A ASP B  1 293 ? 59.031  15.423  28.320  0.25 31.37  ? 293  ASP B OD1   1 
ATOM   4664   O OD2   A ASP B  1 293 ? 61.113  15.763  27.632  0.25 31.94  ? 293  ASP B OD2   1 
ATOM   4665   N N     A GLY B  1 294 ? 57.696  18.237  23.926  0.25 30.71  ? 294  GLY B N     1 
ATOM   4666   C CA    A GLY B  1 294 ? 57.083  19.421  23.355  0.25 31.85  ? 294  GLY B CA    1 
ATOM   4667   C C     A GLY B  1 294 ? 55.693  19.264  22.760  0.25 32.06  ? 294  GLY B C     1 
ATOM   4668   O O     A GLY B  1 294 ? 55.198  20.193  22.132  0.25 33.83  ? 294  GLY B O     1 
ATOM   4669   N N     A PHE B  1 295 ? 55.052  18.116  22.951  0.25 30.90  ? 295  PHE B N     1 
ATOM   4670   C CA    A PHE B  1 295 ? 53.722  17.905  22.381  0.25 30.01  ? 295  PHE B CA    1 
ATOM   4671   C C     A PHE B  1 295 ? 52.629  18.562  23.206  0.25 30.48  ? 295  PHE B C     1 
ATOM   4672   O O     A PHE B  1 295 ? 52.758  18.692  24.423  0.25 30.93  ? 295  PHE B O     1 
ATOM   4673   C CB    A PHE B  1 295 ? 53.414  16.412  22.251  0.25 26.88  ? 295  PHE B CB    1 
ATOM   4674   C CG    A PHE B  1 295 ? 54.171  15.721  21.165  0.25 26.49  ? 295  PHE B CG    1 
ATOM   4675   C CD1   A PHE B  1 295 ? 55.500  15.351  21.345  0.25 26.49  ? 295  PHE B CD1   1 
ATOM   4676   C CD2   A PHE B  1 295 ? 53.548  15.412  19.953  0.25 25.71  ? 295  PHE B CD2   1 
ATOM   4677   C CE1   A PHE B  1 295 ? 56.200  14.676  20.328  0.25 25.27  ? 295  PHE B CE1   1 
ATOM   4678   C CE2   A PHE B  1 295 ? 54.238  14.747  18.941  0.25 23.13  ? 295  PHE B CE2   1 
ATOM   4679   C CZ    A PHE B  1 295 ? 55.563  14.379  19.128  0.25 23.48  ? 295  PHE B CZ    1 
ATOM   4680   N N     A LYS B  1 296 ? 51.553  18.968  22.529  0.25 30.42  ? 296  LYS B N     1 
ATOM   4681   C CA    A LYS B  1 296 ? 50.404  19.600  23.173  0.25 29.03  ? 296  LYS B CA    1 
ATOM   4682   C C     A LYS B  1 296 ? 49.158  18.896  22.662  0.25 28.85  ? 296  LYS B C     1 
ATOM   4683   O O     A LYS B  1 296 ? 49.158  18.372  21.550  0.25 26.42  ? 296  LYS B O     1 
ATOM   4684   C CB    A LYS B  1 296 ? 50.329  21.083  22.813  0.25 34.34  ? 296  LYS B CB    1 
ATOM   4685   C CG    A LYS B  1 296 ? 51.506  21.912  23.312  0.25 39.51  ? 296  LYS B CG    1 
ATOM   4686   C CD    A LYS B  1 296 ? 51.495  23.314  22.741  0.25 41.90  ? 296  LYS B CD    1 
ATOM   4687   C CE    A LYS B  1 296 ? 52.746  24.082  23.147  0.25 45.24  ? 296  LYS B CE    1 
ATOM   4688   N NZ    A LYS B  1 296 ? 52.800  25.422  22.492  0.25 46.76  ? 296  LYS B NZ    1 
ATOM   4689   N N     A VAL B  1 297 ? 48.093  18.898  23.457  0.25 28.29  ? 297  VAL B N     1 
ATOM   4690   C CA    A VAL B  1 297 ? 46.866  18.234  23.047  0.25 31.22  ? 297  VAL B CA    1 
ATOM   4691   C C     A VAL B  1 297 ? 46.432  18.660  21.649  0.25 31.78  ? 297  VAL B C     1 
ATOM   4692   O O     A VAL B  1 297 ? 46.105  17.817  20.812  0.25 34.05  ? 297  VAL B O     1 
ATOM   4693   C CB    A VAL B  1 297 ? 45.714  18.523  24.024  0.25 31.33  ? 297  VAL B CB    1 
ATOM   4694   C CG1   A VAL B  1 297 ? 44.425  17.875  23.514  0.25 31.83  ? 297  VAL B CG1   1 
ATOM   4695   C CG2   A VAL B  1 297 ? 46.065  17.987  25.387  0.25 34.44  ? 297  VAL B CG2   1 
ATOM   4696   N N     A GLU B  1 298 ? 46.445  19.964  21.395  0.25 33.13  ? 298  GLU B N     1 
ATOM   4697   C CA    A GLU B  1 298 ? 46.033  20.510  20.099  0.25 33.98  ? 298  GLU B CA    1 
ATOM   4698   C C     A GLU B  1 298 ? 46.906  20.100  18.921  0.25 33.25  ? 298  GLU B C     1 
ATOM   4699   O O     A GLU B  1 298 ? 46.540  20.359  17.781  0.25 32.30  ? 298  GLU B O     1 
ATOM   4700   C CB    A GLU B  1 298 ? 45.945  22.036  20.166  0.25 35.98  ? 298  GLU B CB    1 
ATOM   4701   C CG    A GLU B  1 298 ? 46.966  22.670  21.098  0.25 44.67  ? 298  GLU B CG    1 
ATOM   4702   C CD    A GLU B  1 298 ? 46.531  22.601  22.555  0.25 45.35  ? 298  GLU B CD    1 
ATOM   4703   O OE1   A GLU B  1 298 ? 47.394  22.703  23.444  0.25 48.11  ? 298  GLU B OE1   1 
ATOM   4704   O OE2   A GLU B  1 298 ? 45.315  22.462  22.807  0.25 49.16  ? 298  GLU B OE2   1 
ATOM   4705   N N     A ASP B  1 299 ? 48.047  19.451  19.181  0.25 31.70  ? 299  ASP B N     1 
ATOM   4706   C CA    A ASP B  1 299 ? 48.917  19.006  18.090  0.25 28.95  ? 299  ASP B CA    1 
ATOM   4707   C C     A ASP B  1 299 ? 48.342  17.770  17.405  0.25 29.26  ? 299  ASP B C     1 
ATOM   4708   O O     A ASP B  1 299 ? 48.656  17.486  16.248  0.25 29.08  ? 299  ASP B O     1 
ATOM   4709   C CB    A ASP B  1 299 ? 50.322  18.656  18.604  0.25 31.94  ? 299  ASP B CB    1 
ATOM   4710   C CG    A ASP B  1 299 ? 51.123  19.874  19.009  0.25 32.20  ? 299  ASP B CG    1 
ATOM   4711   O OD1   A ASP B  1 299 ? 51.068  20.887  18.283  0.25 35.40  ? 299  ASP B OD1   1 
ATOM   4712   O OD2   A ASP B  1 299 ? 51.822  19.825  20.046  0.25 35.53  ? 299  ASP B OD2   1 
ATOM   4713   N N     A PHE B  1 300 ? 47.504  17.032  18.129  0.25 30.13  ? 300  PHE B N     1 
ATOM   4714   C CA    A PHE B  1 300 ? 46.901  15.800  17.625  0.25 29.78  ? 300  PHE B CA    1 
ATOM   4715   C C     A PHE B  1 300 ? 45.637  16.052  16.808  0.25 32.09  ? 300  PHE B C     1 
ATOM   4716   O O     A PHE B  1 300 ? 44.553  16.282  17.367  0.25 32.58  ? 300  PHE B O     1 
ATOM   4717   C CB    A PHE B  1 300 ? 46.554  14.863  18.795  0.25 28.64  ? 300  PHE B CB    1 
ATOM   4718   C CG    A PHE B  1 300 ? 47.761  14.405  19.601  0.25 29.19  ? 300  PHE B CG    1 
ATOM   4719   C CD1   A PHE B  1 300 ? 48.423  15.287  20.443  0.25 27.91  ? 300  PHE B CD1   1 
ATOM   4720   C CD2   A PHE B  1 300 ? 48.226  13.093  19.507  0.25 27.27  ? 300  PHE B CD2   1 
ATOM   4721   C CE1   A PHE B  1 300 ? 49.531  14.878  21.182  0.25 29.53  ? 300  PHE B CE1   1 
ATOM   4722   C CE2   A PHE B  1 300 ? 49.329  12.669  20.237  0.25 27.18  ? 300  PHE B CE2   1 
ATOM   4723   C CZ    A PHE B  1 300 ? 49.986  13.565  21.079  0.25 29.19  ? 300  PHE B CZ    1 
ATOM   4724   N N     A VAL B  1 301 ? 45.771  15.992  15.488  0.25 32.37  ? 301  VAL B N     1 
ATOM   4725   C CA    A VAL B  1 301 ? 44.632  16.202  14.596  0.25 31.61  ? 301  VAL B CA    1 
ATOM   4726   C C     A VAL B  1 301 ? 44.138  14.869  14.061  0.25 31.13  ? 301  VAL B C     1 
ATOM   4727   O O     A VAL B  1 301 ? 44.716  14.312  13.123  0.25 32.61  ? 301  VAL B O     1 
ATOM   4728   C CB    A VAL B  1 301 ? 45.019  17.104  13.402  0.25 32.96  ? 301  VAL B CB    1 
ATOM   4729   C CG1   A VAL B  1 301 ? 43.806  17.305  12.490  0.25 33.93  ? 301  VAL B CG1   1 
ATOM   4730   C CG2   A VAL B  1 301 ? 45.537  18.447  13.909  0.25 30.93  ? 301  VAL B CG2   1 
ATOM   4731   N N     A VAL B  1 302 ? 43.069  14.360  14.664  0.25 29.97  ? 302  VAL B N     1 
ATOM   4732   C CA    A VAL B  1 302 ? 42.490  13.091  14.273  0.25 28.18  ? 302  VAL B CA    1 
ATOM   4733   C C     A VAL B  1 302 ? 41.339  13.327  13.306  0.25 30.78  ? 302  VAL B C     1 
ATOM   4734   O O     A VAL B  1 302 ? 40.321  13.942  13.656  0.25 30.83  ? 302  VAL B O     1 
ATOM   4735   C CB    A VAL B  1 302 ? 41.984  12.311  15.513  0.25 26.73  ? 302  VAL B CB    1 
ATOM   4736   C CG1   A VAL B  1 302 ? 41.378  10.993  15.088  0.25 24.45  ? 302  VAL B CG1   1 
ATOM   4737   C CG2   A VAL B  1 302 ? 43.149  12.067  16.480  0.25 28.37  ? 302  VAL B CG2   1 
ATOM   4738   N N     A GLU B  1 303 ? 41.487  12.825  12.091  0.25 31.06  ? 303  GLU B N     1 
ATOM   4739   C CA    A GLU B  1 303 ? 40.449  13.019  11.093  0.25 32.93  ? 303  GLU B CA    1 
ATOM   4740   C C     A GLU B  1 303 ? 39.786  11.726  10.643  0.25 30.62  ? 303  GLU B C     1 
ATOM   4741   O O     A GLU B  1 303 ? 40.403  10.659  10.620  0.25 30.15  ? 303  GLU B O     1 
ATOM   4742   C CB    A GLU B  1 303 ? 41.026  13.787  9.890   0.25 36.43  ? 303  GLU B CB    1 
ATOM   4743   C CG    A GLU B  1 303 ? 42.183  13.100  9.212   0.25 41.70  ? 303  GLU B CG    1 
ATOM   4744   C CD    A GLU B  1 303 ? 43.054  14.061  8.417   0.25 43.33  ? 303  GLU B CD    1 
ATOM   4745   O OE1   A GLU B  1 303 ? 43.909  13.577  7.641   0.25 45.32  ? 303  GLU B OE1   1 
ATOM   4746   O OE2   A GLU B  1 303 ? 42.895  15.288  8.576   0.25 43.77  ? 303  GLU B OE2   1 
ATOM   4747   N N     A GLY B  1 304 ? 38.508  11.819  10.308  0.25 28.86  ? 304  GLY B N     1 
ATOM   4748   C CA    A GLY B  1 304 ? 37.784  10.646  9.871   0.25 28.54  ? 304  GLY B CA    1 
ATOM   4749   C C     A GLY B  1 304 ? 37.272  9.749   10.985  0.25 27.99  ? 304  GLY B C     1 
ATOM   4750   O O     A GLY B  1 304 ? 36.899  8.603   10.734  0.25 30.53  ? 304  GLY B O     1 
ATOM   4751   N N     A TYR B  1 305 ? 37.233  10.239  12.218  0.25 26.24  ? 305  TYR B N     1 
ATOM   4752   C CA    A TYR B  1 305 ? 36.737  9.400   13.295  0.25 26.22  ? 305  TYR B CA    1 
ATOM   4753   C C     A TYR B  1 305 ? 35.206  9.376   13.221  0.25 28.43  ? 305  TYR B C     1 
ATOM   4754   O O     A TYR B  1 305 ? 34.558  10.396  13.406  0.25 29.22  ? 305  TYR B O     1 
ATOM   4755   C CB    A TYR B  1 305 ? 37.191  9.932   14.651  0.25 27.07  ? 305  TYR B CB    1 
ATOM   4756   C CG    A TYR B  1 305 ? 36.838  9.030   15.814  0.25 25.79  ? 305  TYR B CG    1 
ATOM   4757   C CD1   A TYR B  1 305 ? 36.426  9.567   17.035  0.25 26.76  ? 305  TYR B CD1   1 
ATOM   4758   C CD2   A TYR B  1 305 ? 36.913  7.641   15.697  0.25 27.42  ? 305  TYR B CD2   1 
ATOM   4759   C CE1   A TYR B  1 305 ? 36.091  8.745   18.112  0.25 24.85  ? 305  TYR B CE1   1 
ATOM   4760   C CE2   A TYR B  1 305 ? 36.588  6.805   16.763  0.25 25.09  ? 305  TYR B CE2   1 
ATOM   4761   C CZ    A TYR B  1 305 ? 36.173  7.370   17.970  0.25 26.52  ? 305  TYR B CZ    1 
ATOM   4762   O OH    A TYR B  1 305 ? 35.816  6.582   19.037  0.25 24.65  ? 305  TYR B OH    1 
ATOM   4763   N N     A LYS B  1 306 ? 34.637  8.201   12.974  0.25 29.37  ? 306  LYS B N     1 
ATOM   4764   C CA    A LYS B  1 306 ? 33.187  8.050   12.850  0.25 30.16  ? 306  LYS B CA    1 
ATOM   4765   C C     A LYS B  1 306 ? 32.668  6.896   13.691  0.25 28.47  ? 306  LYS B C     1 
ATOM   4766   O O     A LYS B  1 306 ? 32.293  5.853   13.178  0.25 29.79  ? 306  LYS B O     1 
ATOM   4767   C CB    A LYS B  1 306 ? 32.827  7.827   11.379  0.25 33.42  ? 306  LYS B CB    1 
ATOM   4768   C CG    A LYS B  1 306 ? 33.225  9.006   10.494  0.25 38.32  ? 306  LYS B CG    1 
ATOM   4769   C CD    A LYS B  1 306 ? 32.951  8.736   9.023   0.25 41.11  ? 306  LYS B CD    1 
ATOM   4770   C CE    A LYS B  1 306 ? 33.359  9.945   8.172   0.25 43.01  ? 306  LYS B CE    1 
ATOM   4771   N NZ    A LYS B  1 306 ? 33.140  9.697   6.719   0.25 47.34  ? 306  LYS B NZ    1 
ATOM   4772   N N     A PRO B  1 307 ? 32.618  7.086   15.006  0.25 27.32  ? 307  PRO B N     1 
ATOM   4773   C CA    A PRO B  1 307 ? 32.148  6.051   15.919  0.25 27.60  ? 307  PRO B CA    1 
ATOM   4774   C C     A PRO B  1 307 ? 30.637  5.962   16.112  0.25 28.19  ? 307  PRO B C     1 
ATOM   4775   O O     A PRO B  1 307 ? 29.880  6.880   15.775  0.25 28.00  ? 307  PRO B O     1 
ATOM   4776   C CB    A PRO B  1 307 ? 32.845  6.427   17.215  0.25 28.35  ? 307  PRO B CB    1 
ATOM   4777   C CG    A PRO B  1 307 ? 32.702  7.944   17.191  0.25 28.00  ? 307  PRO B CG    1 
ATOM   4778   C CD    A PRO B  1 307 ? 33.118  8.257   15.755  0.25 29.67  ? 307  PRO B CD    1 
ATOM   4779   N N     A TRP B  1 308 ? 30.207  4.839   16.666  0.25 27.65  ? 308  TRP B N     1 
ATOM   4780   C CA    A TRP B  1 308 ? 28.815  4.662   16.999  0.25 28.30  ? 308  TRP B CA    1 
ATOM   4781   C C     A TRP B  1 308 ? 28.640  5.395   18.336  0.25 29.10  ? 308  TRP B C     1 
ATOM   4782   O O     A TRP B  1 308 ? 29.576  6.032   18.828  0.25 29.21  ? 308  TRP B O     1 
ATOM   4783   C CB    A TRP B  1 308 ? 28.476  3.190   17.177  0.25 28.59  ? 308  TRP B CB    1 
ATOM   4784   C CG    A TRP B  1 308 ? 28.458  2.416   15.892  0.25 32.29  ? 308  TRP B CG    1 
ATOM   4785   C CD1   A TRP B  1 308 ? 29.508  1.763   15.309  0.25 33.12  ? 308  TRP B CD1   1 
ATOM   4786   C CD2   A TRP B  1 308 ? 27.334  2.224   15.025  0.25 31.82  ? 308  TRP B CD2   1 
ATOM   4787   N NE1   A TRP B  1 308 ? 29.105  1.172   14.137  0.25 33.91  ? 308  TRP B NE1   1 
ATOM   4788   C CE2   A TRP B  1 308 ? 27.775  1.442   13.936  0.25 35.47  ? 308  TRP B CE2   1 
ATOM   4789   C CE3   A TRP B  1 308 ? 25.996  2.640   15.061  0.25 35.32  ? 308  TRP B CE3   1 
ATOM   4790   C CZ2   A TRP B  1 308 ? 26.921  1.062   12.883  0.25 37.32  ? 308  TRP B CZ2   1 
ATOM   4791   C CZ3   A TRP B  1 308 ? 25.140  2.265   14.012  0.25 34.62  ? 308  TRP B CZ3   1 
ATOM   4792   C CH2   A TRP B  1 308 ? 25.611  1.484   12.940  0.25 34.54  ? 308  TRP B CH2   1 
ATOM   4793   N N     A GLY B  1 309 ? 27.456  5.287   18.923  0.25 28.31  ? 309  GLY B N     1 
ATOM   4794   C CA    A GLY B  1 309 ? 27.186  5.956   20.182  0.25 27.74  ? 309  GLY B CA    1 
ATOM   4795   C C     A GLY B  1 309 ? 28.017  5.479   21.362  0.25 29.39  ? 309  GLY B C     1 
ATOM   4796   O O     A GLY B  1 309 ? 28.629  4.406   21.328  0.25 26.69  ? 309  GLY B O     1 
ATOM   4797   N N     A LYS B  1 310 ? 28.038  6.285   22.416  0.25 27.87  ? 310  LYS B N     1 
ATOM   4798   C CA    A LYS B  1 310 ? 28.782  5.948   23.603  0.25 30.74  ? 310  LYS B CA    1 
ATOM   4799   C C     A LYS B  1 310 ? 28.063  4.817   24.315  0.25 33.28  ? 310  LYS B C     1 
ATOM   4800   O O     A LYS B  1 310 ? 26.846  4.638   24.147  0.25 32.96  ? 310  LYS B O     1 
ATOM   4801   C CB    A LYS B  1 310 ? 28.885  7.152   24.543  0.25 33.89  ? 310  LYS B CB    1 
ATOM   4802   C CG    A LYS B  1 310 ? 27.548  7.546   25.190  0.25 36.84  ? 310  LYS B CG    1 
ATOM   4803   C CD    A LYS B  1 310 ? 27.723  8.691   26.171  0.25 35.09  ? 310  LYS B CD    1 
ATOM   4804   C CE    A LYS B  1 310 ? 26.384  9.132   26.740  0.25 37.37  ? 310  LYS B CE    1 
ATOM   4805   N NZ    A LYS B  1 310 ? 25.710  8.069   27.520  0.25 37.90  ? 310  LYS B NZ    1 
ATOM   4806   N N     A ILE B  1 311 ? 28.823  4.049   25.095  0.25 30.78  ? 311  ILE B N     1 
ATOM   4807   C CA    A ILE B  1 311 ? 28.277  2.943   25.857  0.25 32.02  ? 311  ILE B CA    1 
ATOM   4808   C C     A ILE B  1 311 ? 28.705  3.137   27.301  0.25 31.94  ? 311  ILE B C     1 
ATOM   4809   O O     A ILE B  1 311 ? 29.893  3.093   27.618  0.25 31.90  ? 311  ILE B O     1 
ATOM   4810   C CB    A ILE B  1 311 ? 28.815  1.596   25.331  0.25 34.87  ? 311  ILE B CB    1 
ATOM   4811   C CG1   A ILE B  1 311 ? 28.309  1.376   23.902  0.25 36.10  ? 311  ILE B CG1   1 
ATOM   4812   C CG2   A ILE B  1 311 ? 28.364  0.448   26.253  0.25 32.79  ? 311  ILE B CG2   1 
ATOM   4813   C CD1   A ILE B  1 311 ? 28.789  0.114   23.276  0.25 37.67  ? 311  ILE B CD1   1 
ATOM   4814   N N     A ASP B  1 312 ? 27.740  3.372   28.176  0.25 30.86  ? 312  ASP B N     1 
ATOM   4815   C CA    A ASP B  1 312 ? 28.048  3.601   29.577  0.25 31.89  ? 312  ASP B CA    1 
ATOM   4816   C C     A ASP B  1 312 ? 28.515  2.348   30.316  0.25 29.78  ? 312  ASP B C     1 
ATOM   4817   O O     A ASP B  1 312 ? 27.872  1.301   30.264  0.25 28.29  ? 312  ASP B O     1 
ATOM   4818   C CB    A ASP B  1 312 ? 26.832  4.196   30.301  0.25 33.03  ? 312  ASP B CB    1 
ATOM   4819   C CG    A ASP B  1 312 ? 26.325  5.476   29.647  0.25 34.83  ? 312  ASP B CG    1 
ATOM   4820   O OD1   A ASP B  1 312 ? 27.149  6.325   29.263  0.25 35.37  ? 312  ASP B OD1   1 
ATOM   4821   O OD2   A ASP B  1 312 ? 25.094  5.644   29.531  0.25 36.97  ? 312  ASP B OD2   1 
ATOM   4822   N N     A MET B  1 313 ? 29.644  2.470   31.006  0.25 26.71  ? 313  MET B N     1 
ATOM   4823   C CA    A MET B  1 313 ? 30.197  1.366   31.786  0.25 26.72  ? 313  MET B CA    1 
ATOM   4824   C C     A MET B  1 313 ? 30.841  1.939   33.034  0.25 25.72  ? 313  MET B C     1 
ATOM   4825   O O     A MET B  1 313 ? 31.642  2.880   32.959  0.25 28.06  ? 313  MET B O     1 
ATOM   4826   C CB    A MET B  1 313 ? 31.219  0.579   30.962  0.25 24.82  ? 313  MET B CB    1 
ATOM   4827   C CG    A MET B  1 313 ? 30.586  -0.344  29.930  0.25 25.50  ? 313  MET B CG    1 
ATOM   4828   S SD    A MET B  1 313 ? 31.814  -1.405  29.059  0.25 26.60  ? 313  MET B SD    1 
ATOM   4829   C CE    A MET B  1 313 ? 32.159  -0.397  27.667  0.25 22.68  ? 313  MET B CE    1 
ATOM   4830   N N     A LYS B  1 314 ? 30.477  1.393   34.188  0.25 23.80  ? 314  LYS B N     1 
ATOM   4831   C CA    A LYS B  1 314 ? 31.011  1.876   35.446  0.25 26.38  ? 314  LYS B CA    1 
ATOM   4832   C C     A LYS B  1 314 ? 32.395  1.266   35.716  0.25 26.96  ? 314  LYS B C     1 
ATOM   4833   O O     A LYS B  1 314 ? 32.634  0.085   35.443  0.25 26.96  ? 314  LYS B O     1 
ATOM   4834   C CB    A LYS B  1 314 ? 30.055  1.512   36.586  0.25 30.03  ? 314  LYS B CB    1 
ATOM   4835   C CG    A LYS B  1 314 ? 30.579  1.898   37.959  0.25 34.93  ? 314  LYS B CG    1 
ATOM   4836   C CD    A LYS B  1 314 ? 29.664  1.406   39.065  0.25 41.59  ? 314  LYS B CD    1 
ATOM   4837   C CE    A LYS B  1 314 ? 30.235  1.735   40.436  0.25 45.76  ? 314  LYS B CE    1 
ATOM   4838   N NZ    A LYS B  1 314 ? 29.369  1.208   41.535  0.25 49.54  ? 314  LYS B NZ    1 
ATOM   4839   N N     A MET B  1 315 ? 33.303  2.073   36.248  0.25 25.47  ? 315  MET B N     1 
ATOM   4840   C CA    A MET B  1 315 ? 34.634  1.591   36.550  0.25 26.84  ? 315  MET B CA    1 
ATOM   4841   C C     A MET B  1 315 ? 34.651  1.084   37.976  0.25 26.58  ? 315  MET B C     1 
ATOM   4842   O O     A MET B  1 315 ? 34.081  1.714   38.868  0.25 26.09  ? 315  MET B O     1 
ATOM   4843   C CB    A MET B  1 315 ? 35.669  2.705   36.407  0.25 27.56  ? 315  MET B CB    1 
ATOM   4844   C CG    A MET B  1 315 ? 37.104  2.182   36.537  0.25 29.05  ? 315  MET B CG    1 
ATOM   4845   S SD    A MET B  1 315 ? 38.318  3.454   36.874  0.25 34.12  ? 315  MET B SD    1 
ATOM   4846   C CE    A MET B  1 315 ? 38.412  3.348   38.645  0.25 32.19  ? 315  MET B CE    1 
ATOM   4847   N N     A SER B  1 316 ? 35.286  -0.062  38.198  0.25 26.40  ? 316  SER B N     1 
ATOM   4848   C CA    A SER B  1 316 ? 35.365  -0.612  39.545  0.25 27.02  ? 316  SER B CA    1 
ATOM   4849   C C     A SER B  1 316 ? 36.693  -0.184  40.158  0.25 29.64  ? 316  SER B C     1 
ATOM   4850   O O     A SER B  1 316 ? 37.772  -0.542  39.650  0.25 26.29  ? 316  SER B O     1 
ATOM   4851   C CB    A SER B  1 316 ? 35.253  -2.123  39.516  0.25 26.72  ? 316  SER B CB    1 
ATOM   4852   O OG    A SER B  1 316 ? 33.997  -2.527  38.994  0.25 27.10  ? 316  SER B OG    1 
ATOM   4853   N N     A ALA B  1 317 ? 36.601  0.573   41.250  0.25 27.84  ? 317  ALA B N     1 
ATOM   4854   C CA    A ALA B  1 317 ? 37.771  1.105   41.942  0.25 30.86  ? 317  ALA B CA    1 
ATOM   4855   C C     A ALA B  1 317 ? 38.582  0.036   42.661  0.25 31.99  ? 317  ALA B C     1 
ATOM   4856   O O     A ALA B  1 317 ? 39.830  0.086   42.569  0.25 33.18  ? 317  ALA B O     1 
ATOM   4857   C CB    A ALA B  1 317 ? 37.343  2.199   42.933  0.25 27.02  ? 317  ALA B CB    1 
ATOM   4858   O OXT   A ALA B  1 317 ? 37.963  -0.820  43.315  0.25 33.27  ? 317  ALA B OXT   1 
ATOM   4859   N N     A ARG C  1 13  ? 54.049  32.527  96.637  0.25 53.87  ? 13   ARG C N     1 
ATOM   4860   C CA    A ARG C  1 13  ? 54.418  32.714  95.206  0.25 52.58  ? 13   ARG C CA    1 
ATOM   4861   C C     A ARG C  1 13  ? 53.533  33.759  94.548  0.25 53.88  ? 13   ARG C C     1 
ATOM   4862   O O     A ARG C  1 13  ? 52.305  33.715  94.657  0.25 55.58  ? 13   ARG C O     1 
ATOM   4863   C CB    A ARG C  1 13  ? 54.305  31.388  94.454  0.25 50.99  ? 13   ARG C CB    1 
ATOM   4864   C CG    A ARG C  1 13  ? 55.280  30.344  94.935  0.25 47.96  ? 13   ARG C CG    1 
ATOM   4865   C CD    A ARG C  1 13  ? 55.071  29.023  94.244  0.25 46.26  ? 13   ARG C CD    1 
ATOM   4866   N NE    A ARG C  1 13  ? 55.970  28.011  94.776  0.25 42.44  ? 13   ARG C NE    1 
ATOM   4867   C CZ    A ARG C  1 13  ? 55.884  26.719  94.494  0.25 42.14  ? 13   ARG C CZ    1 
ATOM   4868   N NH1   A ARG C  1 13  ? 54.936  26.279  93.675  0.25 41.41  ? 13   ARG C NH1   1 
ATOM   4869   N NH2   A ARG C  1 13  ? 56.730  25.865  95.050  0.25 41.75  ? 13   ARG C NH2   1 
ATOM   4870   N N     A SER C  1 14  ? 54.174  34.692  93.856  0.25 53.56  ? 14   SER C N     1 
ATOM   4871   C CA    A SER C  1 14  ? 53.493  35.782  93.174  0.25 53.09  ? 14   SER C CA    1 
ATOM   4872   C C     A SER C  1 14  ? 52.610  35.332  92.010  0.25 52.24  ? 14   SER C C     1 
ATOM   4873   O O     A SER C  1 14  ? 51.589  35.962  91.711  0.25 51.45  ? 14   SER C O     1 
ATOM   4874   C CB    A SER C  1 14  ? 54.537  36.778  92.667  0.25 52.91  ? 14   SER C CB    1 
ATOM   4875   O OG    A SER C  1 14  ? 53.949  37.738  91.812  0.25 57.30  ? 14   SER C OG    1 
ATOM   4876   N N     A ASN C  1 15  ? 53.024  34.256  91.346  0.25 50.76  ? 15   ASN C N     1 
ATOM   4877   C CA    A ASN C  1 15  ? 52.301  33.709  90.204  0.25 49.32  ? 15   ASN C CA    1 
ATOM   4878   C C     A ASN C  1 15  ? 52.387  32.195  90.356  0.25 47.06  ? 15   ASN C C     1 
ATOM   4879   O O     A ASN C  1 15  ? 53.164  31.521  89.673  0.25 47.00  ? 15   ASN C O     1 
ATOM   4880   C CB    A ASN C  1 15  ? 52.958  34.190  88.900  0.25 51.68  ? 15   ASN C CB    1 
ATOM   4881   C CG    A ASN C  1 15  ? 52.208  33.741  87.653  0.25 53.62  ? 15   ASN C CG    1 
ATOM   4882   O OD1   A ASN C  1 15  ? 51.018  33.422  87.697  0.25 53.04  ? 15   ASN C OD1   1 
ATOM   4883   N ND2   A ASN C  1 15  ? 52.906  33.736  86.524  0.25 54.93  ? 15   ASN C ND2   1 
ATOM   4884   N N     A PRO C  1 16  ? 51.573  31.646  91.271  0.25 44.24  ? 16   PRO C N     1 
ATOM   4885   C CA    A PRO C  1 16  ? 51.483  30.224  91.608  0.25 41.78  ? 16   PRO C CA    1 
ATOM   4886   C C     A PRO C  1 16  ? 51.228  29.300  90.417  0.25 38.22  ? 16   PRO C C     1 
ATOM   4887   O O     A PRO C  1 16  ? 51.626  28.133  90.435  0.25 37.07  ? 16   PRO C O     1 
ATOM   4888   C CB    A PRO C  1 16  ? 50.318  30.175  92.614  0.25 42.91  ? 16   PRO C CB    1 
ATOM   4889   C CG    A PRO C  1 16  ? 50.214  31.580  93.135  0.25 42.98  ? 16   PRO C CG    1 
ATOM   4890   C CD    A PRO C  1 16  ? 50.456  32.386  91.891  0.25 44.27  ? 16   PRO C CD    1 
ATOM   4891   N N     A ASP C  1 17  ? 50.584  29.824  89.381  0.25 34.98  ? 17   ASP C N     1 
ATOM   4892   C CA    A ASP C  1 17  ? 50.244  28.998  88.230  0.25 34.05  ? 17   ASP C CA    1 
ATOM   4893   C C     A ASP C  1 17  ? 51.322  28.936  87.161  0.25 32.41  ? 17   ASP C C     1 
ATOM   4894   O O     A ASP C  1 17  ? 51.135  28.305  86.120  0.25 30.41  ? 17   ASP C O     1 
ATOM   4895   C CB    A ASP C  1 17  ? 48.929  29.474  87.601  0.25 36.20  ? 17   ASP C CB    1 
ATOM   4896   C CG    A ASP C  1 17  ? 47.762  29.483  88.598  0.25 39.98  ? 17   ASP C CG    1 
ATOM   4897   O OD1   A ASP C  1 17  ? 47.628  28.522  89.384  0.25 41.19  ? 17   ASP C OD1   1 
ATOM   4898   O OD2   A ASP C  1 17  ? 46.974  30.452  88.577  0.25 44.27  ? 17   ASP C OD2   1 
ATOM   4899   N N     A HIS C  1 18  ? 52.455  29.590  87.405  0.25 29.80  ? 18   HIS C N     1 
ATOM   4900   C CA    A HIS C  1 18  ? 53.524  29.572  86.416  0.25 26.23  ? 18   HIS C CA    1 
ATOM   4901   C C     A HIS C  1 18  ? 53.940  28.144  86.186  0.25 22.94  ? 18   HIS C C     1 
ATOM   4902   O O     A HIS C  1 18  ? 54.305  27.437  87.122  0.25 25.25  ? 18   HIS C O     1 
ATOM   4903   C CB    A HIS C  1 18  ? 54.728  30.387  86.888  0.25 28.77  ? 18   HIS C CB    1 
ATOM   4904   C CG    A HIS C  1 18  ? 55.712  30.678  85.800  0.25 26.81  ? 18   HIS C CG    1 
ATOM   4905   N ND1   A HIS C  1 18  ? 56.413  29.686  85.148  0.25 26.83  ? 18   HIS C ND1   1 
ATOM   4906   C CD2   A HIS C  1 18  ? 56.084  31.846  85.224  0.25 26.86  ? 18   HIS C CD2   1 
ATOM   4907   C CE1   A HIS C  1 18  ? 57.175  30.232  84.215  0.25 26.40  ? 18   HIS C CE1   1 
ATOM   4908   N NE2   A HIS C  1 18  ? 56.994  31.541  84.242  0.25 25.37  ? 18   HIS C NE2   1 
ATOM   4909   N N     A GLU C  1 19  ? 53.894  27.718  84.930  0.25 24.06  ? 19   GLU C N     1 
ATOM   4910   C CA    A GLU C  1 19  ? 54.255  26.353  84.556  0.25 22.74  ? 19   GLU C CA    1 
ATOM   4911   C C     A GLU C  1 19  ? 55.626  25.877  84.999  0.25 22.08  ? 19   GLU C C     1 
ATOM   4912   O O     A GLU C  1 19  ? 55.836  24.681  85.156  0.25 22.55  ? 19   GLU C O     1 
ATOM   4913   C CB    A GLU C  1 19  ? 54.127  26.172  83.043  0.25 26.95  ? 19   GLU C CB    1 
ATOM   4914   C CG    A GLU C  1 19  ? 52.694  26.217  82.537  0.25 27.47  ? 19   GLU C CG    1 
ATOM   4915   C CD    A GLU C  1 19  ? 52.613  26.321  81.027  0.25 29.46  ? 19   GLU C CD    1 
ATOM   4916   O OE1   A GLU C  1 19  ? 51.508  26.252  80.479  0.25 27.64  ? 19   GLU C OE1   1 
ATOM   4917   O OE2   A GLU C  1 19  ? 53.667  26.480  80.379  0.25 37.30  ? 19   GLU C OE2   1 
ATOM   4918   N N     A GLU C  1 20  ? 56.562  26.797  85.214  0.25 24.84  ? 20   GLU C N     1 
ATOM   4919   C CA    A GLU C  1 20  ? 57.908  26.401  85.624  0.25 22.31  ? 20   GLU C CA    1 
ATOM   4920   C C     A GLU C  1 20  ? 57.918  25.778  87.024  0.25 23.59  ? 20   GLU C C     1 
ATOM   4921   O O     A GLU C  1 20  ? 58.825  25.008  87.388  0.25 22.09  ? 20   GLU C O     1 
ATOM   4922   C CB    A GLU C  1 20  ? 58.861  27.614  85.540  0.25 23.80  ? 20   GLU C CB    1 
ATOM   4923   C CG    A GLU C  1 20  ? 60.322  27.273  85.845  0.25 21.83  ? 20   GLU C CG    1 
ATOM   4924   C CD    A GLU C  1 20  ? 61.334  28.266  85.238  0.25 23.04  ? 20   GLU C CD    1 
ATOM   4925   O OE1   A GLU C  1 20  ? 62.544  28.120  85.536  0.25 23.63  ? 20   GLU C OE1   1 
ATOM   4926   O OE2   A GLU C  1 20  ? 60.941  29.170  84.466  0.25 21.13  ? 20   GLU C OE2   1 
ATOM   4927   N N     A TYR C  1 21  ? 56.904  26.078  87.826  0.25 23.91  ? 21   TYR C N     1 
ATOM   4928   C CA    A TYR C  1 21  ? 56.852  25.475  89.164  0.25 24.58  ? 21   TYR C CA    1 
ATOM   4929   C C     A TYR C  1 21  ? 56.739  23.954  89.111  0.25 25.22  ? 21   TYR C C     1 
ATOM   4930   O O     A TYR C  1 21  ? 57.097  23.267  90.069  0.25 28.29  ? 21   TYR C O     1 
ATOM   4931   C CB    A TYR C  1 21  ? 55.693  26.073  89.981  0.25 27.21  ? 21   TYR C CB    1 
ATOM   4932   C CG    A TYR C  1 21  ? 56.021  27.434  90.545  0.25 27.51  ? 21   TYR C CG    1 
ATOM   4933   C CD1   A TYR C  1 21  ? 55.288  28.553  90.183  0.25 28.93  ? 21   TYR C CD1   1 
ATOM   4934   C CD2   A TYR C  1 21  ? 57.109  27.605  91.414  0.25 30.75  ? 21   TYR C CD2   1 
ATOM   4935   C CE1   A TYR C  1 21  ? 55.622  29.821  90.663  0.25 31.95  ? 21   TYR C CE1   1 
ATOM   4936   C CE2   A TYR C  1 21  ? 57.458  28.875  91.903  0.25 28.71  ? 21   TYR C CE2   1 
ATOM   4937   C CZ    A TYR C  1 21  ? 56.709  29.970  91.519  0.25 30.59  ? 21   TYR C CZ    1 
ATOM   4938   O OH    A TYR C  1 21  ? 57.033  31.226  91.974  0.25 34.43  ? 21   TYR C OH    1 
ATOM   4939   N N     A GLN C  1 22  ? 56.248  23.417  87.991  0.25 25.33  ? 22   GLN C N     1 
ATOM   4940   C CA    A GLN C  1 22  ? 56.168  21.970  87.826  0.25 21.63  ? 22   GLN C CA    1 
ATOM   4941   C C     A GLN C  1 22  ? 57.583  21.422  87.915  0.25 21.31  ? 22   GLN C C     1 
ATOM   4942   O O     A GLN C  1 22  ? 57.838  20.437  88.598  0.25 21.51  ? 22   GLN C O     1 
ATOM   4943   C CB    A GLN C  1 22  ? 55.619  21.598  86.444  0.25 23.26  ? 22   GLN C CB    1 
ATOM   4944   C CG    A GLN C  1 22  ? 54.158  21.964  86.188  0.25 23.28  ? 22   GLN C CG    1 
ATOM   4945   C CD    A GLN C  1 22  ? 53.789  21.753  84.725  0.25 24.18  ? 22   GLN C CD    1 
ATOM   4946   O OE1   A GLN C  1 22  ? 54.206  22.524  83.831  0.25 25.93  ? 22   GLN C OE1   1 
ATOM   4947   N NE2   A GLN C  1 22  ? 53.035  20.691  84.459  0.25 23.78  ? 22   GLN C NE2   1 
ATOM   4948   N N     A TYR C  1 23  ? 58.505  22.052  87.186  0.25 21.09  ? 23   TYR C N     1 
ATOM   4949   C CA    A TYR C  1 23  ? 59.905  21.617  87.171  0.25 19.78  ? 23   TYR C CA    1 
ATOM   4950   C C     A TYR C  1 23  ? 60.553  21.798  88.551  0.25 21.49  ? 23   TYR C C     1 
ATOM   4951   O O     A TYR C  1 23  ? 61.192  20.889  89.075  0.25 23.54  ? 23   TYR C O     1 
ATOM   4952   C CB    A TYR C  1 23  ? 60.661  22.417  86.096  0.25 19.80  ? 23   TYR C CB    1 
ATOM   4953   C CG    A TYR C  1 23  ? 62.153  22.226  86.118  0.25 21.75  ? 23   TYR C CG    1 
ATOM   4954   C CD1   A TYR C  1 23  ? 62.972  23.114  86.817  0.25 24.88  ? 23   TYR C CD1   1 
ATOM   4955   C CD2   A TYR C  1 23  ? 62.755  21.187  85.419  0.25 23.60  ? 23   TYR C CD2   1 
ATOM   4956   C CE1   A TYR C  1 23  ? 64.352  22.980  86.815  0.25 23.63  ? 23   TYR C CE1   1 
ATOM   4957   C CE2   A TYR C  1 23  ? 64.152  21.033  85.412  0.25 24.22  ? 23   TYR C CE2   1 
ATOM   4958   C CZ    A TYR C  1 23  ? 64.937  21.945  86.123  0.25 23.08  ? 23   TYR C CZ    1 
ATOM   4959   O OH    A TYR C  1 23  ? 66.296  21.791  86.202  0.25 23.47  ? 23   TYR C OH    1 
ATOM   4960   N N     A LEU C  1 24  ? 60.376  22.975  89.146  0.25 25.75  ? 24   LEU C N     1 
ATOM   4961   C CA    A LEU C  1 24  ? 60.947  23.260  90.465  0.25 24.42  ? 24   LEU C CA    1 
ATOM   4962   C C     A LEU C  1 24  ? 60.378  22.346  91.553  0.25 25.09  ? 24   LEU C C     1 
ATOM   4963   O O     A LEU C  1 24  ? 61.117  21.802  92.389  0.25 25.19  ? 24   LEU C O     1 
ATOM   4964   C CB    A LEU C  1 24  ? 60.698  24.723  90.818  0.25 24.86  ? 24   LEU C CB    1 
ATOM   4965   C CG    A LEU C  1 24  ? 61.331  25.751  89.863  0.25 27.36  ? 24   LEU C CG    1 
ATOM   4966   C CD1   A LEU C  1 24  ? 60.899  27.158  90.268  0.25 28.71  ? 24   LEU C CD1   1 
ATOM   4967   C CD2   A LEU C  1 24  ? 62.854  25.626  89.904  0.25 25.36  ? 24   LEU C CD2   1 
ATOM   4968   N N     A ASP C  1 25  ? 59.062  22.159  91.544  0.25 26.89  ? 25   ASP C N     1 
ATOM   4969   C CA    A ASP C  1 25  ? 58.429  21.296  92.551  0.25 26.88  ? 25   ASP C CA    1 
ATOM   4970   C C     A ASP C  1 25  ? 58.905  19.846  92.461  0.25 24.43  ? 25   ASP C C     1 
ATOM   4971   O O     A ASP C  1 25  ? 59.139  19.204  93.481  0.25 25.23  ? 25   ASP C O     1 
ATOM   4972   C CB    A ASP C  1 25  ? 56.908  21.353  92.409  0.25 28.19  ? 25   ASP C CB    1 
ATOM   4973   C CG    A ASP C  1 25  ? 56.323  22.641  92.941  0.25 30.04  ? 25   ASP C CG    1 
ATOM   4974   O OD1   A ASP C  1 25  ? 55.133  22.898  92.690  0.25 33.91  ? 25   ASP C OD1   1 
ATOM   4975   O OD2   A ASP C  1 25  ? 57.045  23.398  93.617  0.25 33.12  ? 25   ASP C OD2   1 
ATOM   4976   N N     A LEU C  1 26  ? 59.065  19.325  91.244  0.25 23.18  ? 26   LEU C N     1 
ATOM   4977   C CA    A LEU C  1 26  ? 59.512  17.949  91.092  0.25 22.27  ? 26   LEU C CA    1 
ATOM   4978   C C     A LEU C  1 26  ? 60.916  17.782  91.654  0.25 24.53  ? 26   LEU C C     1 
ATOM   4979   O O     A LEU C  1 26  ? 61.207  16.805  92.340  0.25 25.69  ? 26   LEU C O     1 
ATOM   4980   C CB    A LEU C  1 26  ? 59.475  17.512  89.619  0.25 23.88  ? 26   LEU C CB    1 
ATOM   4981   C CG    A LEU C  1 26  ? 59.971  16.090  89.337  0.25 24.76  ? 26   LEU C CG    1 
ATOM   4982   C CD1   A LEU C  1 26  ? 59.212  15.072  90.196  0.25 25.94  ? 26   LEU C CD1   1 
ATOM   4983   C CD2   A LEU C  1 26  ? 59.787  15.774  87.865  0.25 26.41  ? 26   LEU C CD2   1 
ATOM   4984   N N     A ILE C  1 27  ? 61.791  18.732  91.362  0.25 25.34  ? 27   ILE C N     1 
ATOM   4985   C CA    A ILE C  1 27  ? 63.160  18.655  91.882  0.25 27.78  ? 27   ILE C CA    1 
ATOM   4986   C C     A ILE C  1 27  ? 63.140  18.657  93.410  0.25 24.51  ? 27   ILE C C     1 
ATOM   4987   O O     A ILE C  1 27  ? 63.844  17.887  94.050  0.25 22.01  ? 27   ILE C O     1 
ATOM   4988   C CB    A ILE C  1 27  ? 64.013  19.842  91.392  0.25 26.20  ? 27   ILE C CB    1 
ATOM   4989   C CG1   A ILE C  1 27  ? 64.305  19.672  89.896  0.25 26.86  ? 27   ILE C CG1   1 
ATOM   4990   C CG2   A ILE C  1 27  ? 65.283  19.929  92.208  0.25 25.71  ? 27   ILE C CG2   1 
ATOM   4991   C CD1   A ILE C  1 27  ? 65.019  20.829  89.271  0.25 24.40  ? 27   ILE C CD1   1 
ATOM   4992   N N     A ARG C  1 28  ? 62.314  19.518  93.982  0.25 24.91  ? 28   ARG C N     1 
ATOM   4993   C CA    A ARG C  1 28  ? 62.207  19.598  95.435  0.25 27.00  ? 28   ARG C CA    1 
ATOM   4994   C C     A ARG C  1 28  ? 61.737  18.261  95.988  0.25 27.97  ? 28   ARG C C     1 
ATOM   4995   O O     A ARG C  1 28  ? 62.276  17.746  96.977  0.25 27.69  ? 28   ARG C O     1 
ATOM   4996   C CB    A ARG C  1 28  ? 61.230  20.726  95.813  0.25 31.50  ? 28   ARG C CB    1 
ATOM   4997   C CG    A ARG C  1 28  ? 61.048  20.934  97.304  0.25 37.31  ? 28   ARG C CG    1 
ATOM   4998   C CD    A ARG C  1 28  ? 60.100  22.098  97.607  0.25 41.59  ? 28   ARG C CD    1 
ATOM   4999   N NE    A ARG C  1 28  ? 60.726  23.410  97.443  0.25 43.52  ? 28   ARG C NE    1 
ATOM   5000   C CZ    A ARG C  1 28  ? 60.636  24.195  96.372  0.25 46.50  ? 28   ARG C CZ    1 
ATOM   5001   N NH1   A ARG C  1 28  ? 59.929  23.833  95.301  0.25 48.73  ? 28   ARG C NH1   1 
ATOM   5002   N NH2   A ARG C  1 28  ? 61.269  25.362  96.374  0.25 45.79  ? 28   ARG C NH2   1 
ATOM   5003   N N     A ARG C  1 29  ? 60.738  17.674  95.332  0.25 29.72  ? 29   ARG C N     1 
ATOM   5004   C CA    A ARG C  1 29  ? 60.207  16.387  95.767  0.25 28.18  ? 29   ARG C CA    1 
ATOM   5005   C C     A ARG C  1 29  ? 61.259  15.286  95.671  0.25 29.77  ? 29   ARG C C     1 
ATOM   5006   O O     A ARG C  1 29  ? 61.420  14.484  96.597  0.25 29.64  ? 29   ARG C O     1 
ATOM   5007   C CB    A ARG C  1 29  ? 58.993  16.007  94.923  0.25 29.78  ? 29   ARG C CB    1 
ATOM   5008   C CG    A ARG C  1 29  ? 58.325  14.726  95.362  0.25 30.10  ? 29   ARG C CG    1 
ATOM   5009   C CD    A ARG C  1 29  ? 57.207  14.342  94.400  0.25 30.96  ? 29   ARG C CD    1 
ATOM   5010   N NE    A ARG C  1 29  ? 56.697  13.020  94.710  0.25 33.35  ? 29   ARG C NE    1 
ATOM   5011   C CZ    A ARG C  1 29  ? 55.987  12.281  93.873  0.25 33.54  ? 29   ARG C CZ    1 
ATOM   5012   N NH1   A ARG C  1 29  ? 55.704  12.740  92.665  0.25 37.66  ? 29   ARG C NH1   1 
ATOM   5013   N NH2   A ARG C  1 29  ? 55.566  11.084  94.249  0.25 35.98  ? 29   ARG C NH2   1 
ATOM   5014   N N     A ILE C  1 30  ? 61.972  15.226  94.551  0.25 27.36  ? 30   ILE C N     1 
ATOM   5015   C CA    A ILE C  1 30  ? 63.002  14.194  94.386  0.25 27.56  ? 30   ILE C CA    1 
ATOM   5016   C C     A ILE C  1 30  ? 64.074  14.319  95.479  0.25 27.33  ? 30   ILE C C     1 
ATOM   5017   O O     A ILE C  1 30  ? 64.516  13.335  96.067  0.25 27.95  ? 30   ILE C O     1 
ATOM   5018   C CB    A ILE C  1 30  ? 63.687  14.306  92.993  0.25 27.97  ? 30   ILE C CB    1 
ATOM   5019   C CG1   A ILE C  1 30  ? 62.664  14.009  91.883  0.25 27.34  ? 30   ILE C CG1   1 
ATOM   5020   C CG2   A ILE C  1 30  ? 64.892  13.355  92.925  0.25 23.72  ? 30   ILE C CG2   1 
ATOM   5021   C CD1   A ILE C  1 30  ? 63.162  14.269  90.458  0.25 27.07  ? 30   ILE C CD1   1 
ATOM   5022   N N     A ILE C  1 31  ? 64.505  15.539  95.748  0.25 29.91  ? 31   ILE C N     1 
ATOM   5023   C CA    A ILE C  1 31  ? 65.516  15.743  96.785  0.25 32.34  ? 31   ILE C CA    1 
ATOM   5024   C C     A ILE C  1 31  ? 64.968  15.311  98.147  0.25 33.27  ? 31   ILE C C     1 
ATOM   5025   O O     A ILE C  1 31  ? 65.663  14.659  98.921  0.25 33.58  ? 31   ILE C O     1 
ATOM   5026   C CB    A ILE C  1 31  ? 65.948  17.223  96.847  0.25 31.43  ? 31   ILE C CB    1 
ATOM   5027   C CG1   A ILE C  1 31  ? 66.643  17.603  95.542  0.25 31.93  ? 31   ILE C CG1   1 
ATOM   5028   C CG2   A ILE C  1 31  ? 66.888  17.453  98.031  0.25 32.43  ? 31   ILE C CG2   1 
ATOM   5029   C CD1   A ILE C  1 31  ? 66.998  19.069  95.436  0.25 33.24  ? 31   ILE C CD1   1 
ATOM   5030   N N     A ASN C  1 32  ? 63.711  15.650  98.411  0.25 33.93  ? 32   ASN C N     1 
ATOM   5031   C CA    A ASN C  1 32  ? 63.060  15.323  99.681  0.25 36.03  ? 32   ASN C CA    1 
ATOM   5032   C C     A ASN C  1 32  ? 62.746  13.851  99.917  0.25 37.75  ? 32   ASN C C     1 
ATOM   5033   O O     A ASN C  1 32  ? 63.191  13.274  100.914 0.25 39.25  ? 32   ASN C O     1 
ATOM   5034   C CB    A ASN C  1 32  ? 61.753  16.123  99.826  0.25 36.52  ? 32   ASN C CB    1 
ATOM   5035   C CG    A ASN C  1 32  ? 61.988  17.575  100.176 0.25 39.55  ? 32   ASN C CG    1 
ATOM   5036   O OD1   A ASN C  1 32  ? 61.063  18.394  100.114 0.25 41.36  ? 32   ASN C OD1   1 
ATOM   5037   N ND2   A ASN C  1 32  ? 63.219  17.906  100.563 0.25 40.30  ? 32   ASN C ND2   1 
ATOM   5038   N N     A VAL C  1 33  ? 61.983  13.237  99.012  0.25 37.43  ? 33   VAL C N     1 
ATOM   5039   C CA    A VAL C  1 33  ? 61.597  11.836  99.179  0.25 36.22  ? 33   VAL C CA    1 
ATOM   5040   C C     A VAL C  1 33  ? 62.141  10.872  98.123  0.25 37.39  ? 33   VAL C C     1 
ATOM   5041   O O     A VAL C  1 33  ? 61.760  9.700   98.088  0.25 36.80  ? 33   VAL C O     1 
ATOM   5042   C CB    A VAL C  1 33  ? 60.055  11.697  99.209  0.25 35.79  ? 33   VAL C CB    1 
ATOM   5043   C CG1   A VAL C  1 33  ? 59.482  12.509  100.381 0.25 35.15  ? 33   VAL C CG1   1 
ATOM   5044   C CG2   A VAL C  1 33  ? 59.466  12.185  97.898  0.25 32.52  ? 33   VAL C CG2   1 
ATOM   5045   N N     A GLY C  1 34  ? 63.022  11.353  97.254  0.25 35.66  ? 34   GLY C N     1 
ATOM   5046   C CA    A GLY C  1 34  ? 63.569  10.470  96.239  0.25 33.71  ? 34   GLY C CA    1 
ATOM   5047   C C     A GLY C  1 34  ? 64.427  9.375   96.846  0.25 32.83  ? 34   GLY C C     1 
ATOM   5048   O O     A GLY C  1 34  ? 64.889  9.491   97.968  0.25 33.58  ? 34   GLY C O     1 
ATOM   5049   N N     A GLU C  1 35  ? 64.644  8.306   96.095  0.25 33.01  ? 35   GLU C N     1 
ATOM   5050   C CA    A GLU C  1 35  ? 65.450  7.190   96.556  0.25 33.06  ? 35   GLU C CA    1 
ATOM   5051   C C     A GLU C  1 35  ? 66.911  7.309   96.086  0.25 32.62  ? 35   GLU C C     1 
ATOM   5052   O O     A GLU C  1 35  ? 67.171  7.515   94.908  0.25 31.53  ? 35   GLU C O     1 
ATOM   5053   C CB    A GLU C  1 35  ? 64.827  5.900   96.037  0.25 34.39  ? 35   GLU C CB    1 
ATOM   5054   C CG    A GLU C  1 35  ? 65.642  4.630   96.237  0.25 38.89  ? 35   GLU C CG    1 
ATOM   5055   C CD    A GLU C  1 35  ? 64.975  3.412   95.584  0.25 42.87  ? 35   GLU C CD    1 
ATOM   5056   O OE1   A GLU C  1 35  ? 65.657  2.381   95.410  0.25 43.96  ? 35   GLU C OE1   1 
ATOM   5057   O OE2   A GLU C  1 35  ? 63.764  3.482   95.243  0.25 46.41  ? 35   GLU C OE2   1 
ATOM   5058   N N     A VAL C  1 36  ? 67.855  7.176   97.017  0.25 32.34  ? 36   VAL C N     1 
ATOM   5059   C CA    A VAL C  1 36  ? 69.274  7.268   96.695  0.25 31.19  ? 36   VAL C CA    1 
ATOM   5060   C C     A VAL C  1 36  ? 69.668  6.009   95.959  0.25 31.74  ? 36   VAL C C     1 
ATOM   5061   O O     A VAL C  1 36  ? 69.468  4.912   96.459  0.25 34.71  ? 36   VAL C O     1 
ATOM   5062   C CB    A VAL C  1 36  ? 70.136  7.403   97.964  0.25 32.08  ? 36   VAL C CB    1 
ATOM   5063   C CG1   A VAL C  1 36  ? 71.619  7.425   97.584  0.25 30.50  ? 36   VAL C CG1   1 
ATOM   5064   C CG2   A VAL C  1 36  ? 69.755  8.676   98.715  0.25 27.98  ? 36   VAL C CG2   1 
ATOM   5065   N N     A ARG C  1 37  ? 70.237  6.156   94.769  0.25 31.24  ? 37   ARG C N     1 
ATOM   5066   C CA    A ARG C  1 37  ? 70.598  4.985   93.983  0.25 31.59  ? 37   ARG C CA    1 
ATOM   5067   C C     A ARG C  1 37  ? 71.923  5.092   93.269  0.25 32.33  ? 37   ARG C C     1 
ATOM   5068   O O     A ARG C  1 37  ? 72.406  6.189   93.007  0.25 31.96  ? 37   ARG C O     1 
ATOM   5069   C CB    A ARG C  1 37  ? 69.528  4.730   92.916  0.25 32.15  ? 37   ARG C CB    1 
ATOM   5070   C CG    A ARG C  1 37  ? 68.117  4.614   93.471  0.25 31.74  ? 37   ARG C CG    1 
ATOM   5071   C CD    A ARG C  1 37  ? 67.078  4.887   92.419  0.25 31.54  ? 37   ARG C CD    1 
ATOM   5072   N NE    A ARG C  1 37  ? 67.078  3.954   91.302  0.25 30.98  ? 37   ARG C NE    1 
ATOM   5073   C CZ    A ARG C  1 37  ? 66.661  2.691   91.282  0.25 30.88  ? 37   ARG C CZ    1 
ATOM   5074   N NH1   A ARG C  1 37  ? 66.172  2.077   92.355  0.25 31.90  ? 37   ARG C NH1   1 
ATOM   5075   N NH2   A ARG C  1 37  ? 66.698  2.046   90.124  0.25 27.34  ? 37   ARG C NH2   1 
ATOM   5076   N N     A PRO C  1 38  ? 72.535  3.939   92.963  0.25 31.86  ? 38   PRO C N     1 
ATOM   5077   C CA    A PRO C  1 38  ? 73.811  3.866   92.246  0.25 32.17  ? 38   PRO C CA    1 
ATOM   5078   C C     A PRO C  1 38  ? 73.382  4.012   90.772  0.25 32.82  ? 38   PRO C C     1 
ATOM   5079   O O     A PRO C  1 38  ? 72.204  3.839   90.452  0.25 31.44  ? 38   PRO C O     1 
ATOM   5080   C CB    A PRO C  1 38  ? 74.296  2.445   92.515  0.25 30.95  ? 38   PRO C CB    1 
ATOM   5081   C CG    A PRO C  1 38  ? 73.494  1.990   93.701  0.25 36.00  ? 38   PRO C CG    1 
ATOM   5082   C CD    A PRO C  1 38  ? 72.152  2.618   93.474  0.25 31.84  ? 38   PRO C CD    1 
ATOM   5083   N N     A ASP C  1 39  ? 74.313  4.309   89.879  0.25 33.03  ? 39   ASP C N     1 
ATOM   5084   C CA    A ASP C  1 39  ? 73.955  4.446   88.473  0.25 31.52  ? 39   ASP C CA    1 
ATOM   5085   C C     A ASP C  1 39  ? 75.147  4.159   87.575  0.25 33.41  ? 39   ASP C C     1 
ATOM   5086   O O     A ASP C  1 39  ? 76.279  3.985   88.048  0.25 32.57  ? 39   ASP C O     1 
ATOM   5087   C CB    A ASP C  1 39  ? 73.409  5.849   88.184  0.25 29.55  ? 39   ASP C CB    1 
ATOM   5088   C CG    A ASP C  1 39  ? 74.509  6.910   88.091  0.25 33.56  ? 39   ASP C CG    1 
ATOM   5089   O OD1   A ASP C  1 39  ? 75.263  7.091   89.076  0.25 32.10  ? 39   ASP C OD1   1 
ATOM   5090   O OD2   A ASP C  1 39  ? 74.611  7.574   87.028  0.25 28.67  ? 39   ASP C OD2   1 
ATOM   5091   N N     A ARG C  1 40  ? 74.874  4.108   86.275  0.25 31.39  ? 40   ARG C N     1 
ATOM   5092   C CA    A ARG C  1 40  ? 75.890  3.846   85.272  0.25 31.16  ? 40   ARG C CA    1 
ATOM   5093   C C     A ARG C  1 40  ? 77.114  4.777   85.371  0.25 30.91  ? 40   ARG C C     1 
ATOM   5094   O O     A ARG C  1 40  ? 78.251  4.320   85.240  0.25 30.76  ? 40   ARG C O     1 
ATOM   5095   C CB    A ARG C  1 40  ? 75.264  3.977   83.879  0.25 29.91  ? 40   ARG C CB    1 
ATOM   5096   C CG    A ARG C  1 40  ? 76.235  3.820   82.715  0.25 30.41  ? 40   ARG C CG    1 
ATOM   5097   C CD    A ARG C  1 40  ? 75.547  4.129   81.378  0.25 30.57  ? 40   ARG C CD    1 
ATOM   5098   N NE    A ARG C  1 40  ? 75.014  5.496   81.318  0.25 30.03  ? 40   ARG C NE    1 
ATOM   5099   C CZ    A ARG C  1 40  ? 75.750  6.584   81.109  0.25 28.61  ? 40   ARG C CZ    1 
ATOM   5100   N NH1   A ARG C  1 40  ? 77.064  6.492   80.938  0.25 28.43  ? 40   ARG C NH1   1 
ATOM   5101   N NH2   A ARG C  1 40  ? 75.171  7.770   81.040  0.25 23.49  ? 40   ARG C NH2   1 
ATOM   5102   N N     A THR C  1 41  ? 76.876  6.064   85.605  0.25 30.78  ? 41   THR C N     1 
ATOM   5103   C CA    A THR C  1 41  ? 77.960  7.051   85.653  0.25 31.13  ? 41   THR C CA    1 
ATOM   5104   C C     A THR C  1 41  ? 78.869  6.934   86.860  0.25 31.30  ? 41   THR C C     1 
ATOM   5105   O O     A THR C  1 41  ? 80.031  7.334   86.808  0.25 31.48  ? 41   THR C O     1 
ATOM   5106   C CB    A THR C  1 41  ? 77.431  8.489   85.628  0.25 28.02  ? 41   THR C CB    1 
ATOM   5107   O OG1   A THR C  1 41  ? 76.793  8.776   86.882  0.25 27.88  ? 41   THR C OG1   1 
ATOM   5108   C CG2   A THR C  1 41  ? 76.442  8.675   84.491  0.25 29.67  ? 41   THR C CG2   1 
ATOM   5109   N N     A GLY C  1 42  ? 78.337  6.401   87.951  0.25 32.21  ? 42   GLY C N     1 
ATOM   5110   C CA    A GLY C  1 42  ? 79.142  6.256   89.148  0.25 29.55  ? 42   GLY C CA    1 
ATOM   5111   C C     A GLY C  1 42  ? 79.029  7.429   90.105  0.25 30.64  ? 42   GLY C C     1 
ATOM   5112   O O     A GLY C  1 42  ? 79.571  7.384   91.208  0.25 31.71  ? 42   GLY C O     1 
ATOM   5113   N N     A THR C  1 43  ? 78.324  8.488   89.724  0.25 30.89  ? 43   THR C N     1 
ATOM   5114   C CA    A THR C  1 43  ? 78.208  9.622   90.636  0.25 31.48  ? 43   THR C CA    1 
ATOM   5115   C C     A THR C  1 43  ? 77.047  9.425   91.599  0.25 30.56  ? 43   THR C C     1 
ATOM   5116   O O     A THR C  1 43  ? 77.037  9.977   92.699  0.25 31.24  ? 43   THR C O     1 
ATOM   5117   C CB    A THR C  1 43  ? 78.013  10.948  89.881  0.25 32.50  ? 43   THR C CB    1 
ATOM   5118   O OG1   A THR C  1 43  ? 76.635  11.106  89.537  0.25 38.92  ? 43   THR C OG1   1 
ATOM   5119   C CG2   A THR C  1 43  ? 78.829  10.952  88.605  0.25 29.29  ? 43   THR C CG2   1 
ATOM   5120   N N     A GLY C  1 44  ? 76.057  8.640   91.184  0.25 28.69  ? 44   GLY C N     1 
ATOM   5121   C CA    A GLY C  1 44  ? 74.918  8.397   92.050  0.25 25.93  ? 44   GLY C CA    1 
ATOM   5122   C C     A GLY C  1 44  ? 73.829  9.433   91.854  0.25 26.08  ? 44   GLY C C     1 
ATOM   5123   O O     A GLY C  1 44  ? 74.091  10.538  91.387  0.25 22.19  ? 44   GLY C O     1 
ATOM   5124   N N     A THR C  1 45  ? 72.597  9.069   92.197  0.25 24.84  ? 45   THR C N     1 
ATOM   5125   C CA    A THR C  1 45  ? 71.475  9.989   92.048  0.25 24.79  ? 45   THR C CA    1 
ATOM   5126   C C     A THR C  1 45  ? 70.414  9.731   93.110  0.25 23.69  ? 45   THR C C     1 
ATOM   5127   O O     A THR C  1 45  ? 70.510  8.785   93.895  0.25 24.74  ? 45   THR C O     1 
ATOM   5128   C CB    A THR C  1 45  ? 70.750  9.793   90.696  0.25 24.63  ? 45   THR C CB    1 
ATOM   5129   O OG1   A THR C  1 45  ? 70.013  8.566   90.746  0.25 25.44  ? 45   THR C OG1   1 
ATOM   5130   C CG2   A THR C  1 45  ? 71.738  9.726   89.525  0.25 24.14  ? 45   THR C CG2   1 
ATOM   5131   N N     A VAL C  1 46  ? 69.410  10.600  93.124  0.25 25.34  ? 46   VAL C N     1 
ATOM   5132   C CA    A VAL C  1 46  ? 68.249  10.449  93.997  0.25 27.33  ? 46   VAL C CA    1 
ATOM   5133   C C     A VAL C  1 46  ? 67.129  10.441  92.942  0.25 26.01  ? 46   VAL C C     1 
ATOM   5134   O O     A VAL C  1 46  ? 67.108  11.305  92.073  0.25 24.37  ? 46   VAL C O     1 
ATOM   5135   C CB    A VAL C  1 46  ? 68.119  11.638  94.981  0.25 28.79  ? 46   VAL C CB    1 
ATOM   5136   C CG1   A VAL C  1 46  ? 68.079  12.957  94.233  0.25 32.06  ? 46   VAL C CG1   1 
ATOM   5137   C CG2   A VAL C  1 46  ? 66.873  11.458  95.833  0.25 29.06  ? 46   VAL C CG2   1 
ATOM   5138   N N     A ALA C  1 47  ? 66.215  9.475   92.998  0.25 26.69  ? 47   ALA C N     1 
ATOM   5139   C CA    A ALA C  1 47  ? 65.187  9.382   91.954  0.25 26.24  ? 47   ALA C CA    1 
ATOM   5140   C C     A ALA C  1 47  ? 63.813  8.923   92.362  0.25 25.39  ? 47   ALA C C     1 
ATOM   5141   O O     A ALA C  1 47  ? 63.628  8.343   93.425  0.25 24.39  ? 47   ALA C O     1 
ATOM   5142   C CB    A ALA C  1 47  ? 65.679  8.448   90.826  0.25 23.33  ? 47   ALA C CB    1 
ATOM   5143   N N     A LEU C  1 48  ? 62.863  9.201   91.468  0.25 26.70  ? 48   LEU C N     1 
ATOM   5144   C CA    A LEU C  1 48  ? 61.459  8.802   91.582  0.25 25.23  ? 48   LEU C CA    1 
ATOM   5145   C C     A LEU C  1 48  ? 61.078  8.245   90.209  0.25 26.33  ? 48   LEU C C     1 
ATOM   5146   O O     A LEU C  1 48  ? 61.575  8.729   89.175  0.25 25.68  ? 48   LEU C O     1 
ATOM   5147   C CB    A LEU C  1 48  ? 60.572  10.000  91.896  0.25 26.21  ? 48   LEU C CB    1 
ATOM   5148   C CG    A LEU C  1 48  ? 60.705  10.627  93.285  0.25 25.14  ? 48   LEU C CG    1 
ATOM   5149   C CD1   A LEU C  1 48  ? 59.807  11.853  93.361  0.25 23.92  ? 48   LEU C CD1   1 
ATOM   5150   C CD2   A LEU C  1 48  ? 60.341  9.607   94.339  0.25 25.04  ? 48   LEU C CD2   1 
ATOM   5151   N N     A PHE C  1 49  ? 60.213  7.233   90.181  0.25 24.00  ? 49   PHE C N     1 
ATOM   5152   C CA    A PHE C  1 49  ? 59.793  6.647   88.906  0.25 24.05  ? 49   PHE C CA    1 
ATOM   5153   C C     A PHE C  1 49  ? 58.409  7.094   88.506  0.25 25.80  ? 49   PHE C C     1 
ATOM   5154   O O     A PHE C  1 49  ? 57.499  7.121   89.340  0.25 23.34  ? 49   PHE C O     1 
ATOM   5155   C CB    A PHE C  1 49  ? 59.810  5.126   88.973  0.25 22.10  ? 49   PHE C CB    1 
ATOM   5156   C CG    A PHE C  1 49  ? 59.433  4.446   87.681  0.25 23.30  ? 49   PHE C CG    1 
ATOM   5157   C CD1   A PHE C  1 49  ? 60.196  4.624   86.526  0.25 22.33  ? 49   PHE C CD1   1 
ATOM   5158   C CD2   A PHE C  1 49  ? 58.325  3.593   87.627  0.25 21.08  ? 49   PHE C CD2   1 
ATOM   5159   C CE1   A PHE C  1 49  ? 59.875  3.970   85.329  0.25 20.45  ? 49   PHE C CE1   1 
ATOM   5160   C CE2   A PHE C  1 49  ? 57.983  2.924   86.440  0.25 22.99  ? 49   PHE C CE2   1 
ATOM   5161   C CZ    A PHE C  1 49  ? 58.765  3.111   85.274  0.25 18.93  ? 49   PHE C CZ    1 
ATOM   5162   N N     A ALA C  1 50  ? 58.265  7.455   87.227  0.25 24.21  ? 50   ALA C N     1 
ATOM   5163   C CA    A ALA C  1 50  ? 56.987  7.850   86.650  0.25 25.55  ? 50   ALA C CA    1 
ATOM   5164   C C     A ALA C  1 50  ? 56.191  8.881   87.429  0.25 27.57  ? 50   ALA C C     1 
ATOM   5165   O O     A ALA C  1 50  ? 55.051  8.630   87.806  0.25 28.98  ? 50   ALA C O     1 
ATOM   5166   C CB    A ALA C  1 50  ? 56.131  6.613   86.420  0.25 23.05  ? 50   ALA C CB    1 
ATOM   5167   N N     A PRO C  1 51  ? 56.771  10.071  87.663  0.25 26.95  ? 51   PRO C N     1 
ATOM   5168   C CA    A PRO C  1 51  ? 56.030  11.083  88.405  0.25 24.96  ? 51   PRO C CA    1 
ATOM   5169   C C     A PRO C  1 51  ? 55.018  11.702  87.461  0.25 26.02  ? 51   PRO C C     1 
ATOM   5170   O O     A PRO C  1 51  ? 55.091  11.499  86.248  0.25 26.18  ? 51   PRO C O     1 
ATOM   5171   C CB    A PRO C  1 51  ? 57.129  12.071  88.816  0.25 25.97  ? 51   PRO C CB    1 
ATOM   5172   C CG    A PRO C  1 51  ? 58.057  12.007  87.634  0.25 23.15  ? 51   PRO C CG    1 
ATOM   5173   C CD    A PRO C  1 51  ? 58.153  10.530  87.391  0.25 26.83  ? 51   PRO C CD    1 
ATOM   5174   N N     A PRO C  1 52  ? 54.052  12.465  87.998  0.25 24.85  ? 52   PRO C N     1 
ATOM   5175   C CA    A PRO C  1 52  ? 53.057  13.088  87.125  0.25 25.16  ? 52   PRO C CA    1 
ATOM   5176   C C     A PRO C  1 52  ? 53.760  13.823  85.981  0.25 27.57  ? 52   PRO C C     1 
ATOM   5177   O O     A PRO C  1 52  ? 54.820  14.423  86.172  0.25 28.11  ? 52   PRO C O     1 
ATOM   5178   C CB    A PRO C  1 52  ? 52.322  14.054  88.066  0.25 26.61  ? 52   PRO C CB    1 
ATOM   5179   C CG    A PRO C  1 52  ? 52.372  13.317  89.400  0.25 27.75  ? 52   PRO C CG    1 
ATOM   5180   C CD    A PRO C  1 52  ? 53.812  12.787  89.417  0.25 25.53  ? 52   PRO C CD    1 
ATOM   5181   N N     A SER C  1 53  ? 53.157  13.791  84.803  0.25 26.29  ? 53   SER C N     1 
ATOM   5182   C CA    A SER C  1 53  ? 53.732  14.436  83.631  0.25 26.98  ? 53   SER C CA    1 
ATOM   5183   C C     A SER C  1 53  ? 53.665  15.955  83.675  0.25 25.66  ? 53   SER C C     1 
ATOM   5184   O O     A SER C  1 53  ? 52.845  16.527  84.380  0.25 24.44  ? 53   SER C O     1 
ATOM   5185   C CB    A SER C  1 53  ? 53.006  13.931  82.385  0.25 27.24  ? 53   SER C CB    1 
ATOM   5186   O OG    A SER C  1 53  ? 51.654  14.339  82.414  0.25 31.36  ? 53   SER C OG    1 
ATOM   5187   N N     A PHE C  1 54  ? 54.526  16.610  82.897  0.25 24.67  ? 54   PHE C N     1 
ATOM   5188   C CA    A PHE C  1 54  ? 54.547  18.066  82.826  0.25 22.83  ? 54   PHE C CA    1 
ATOM   5189   C C     A PHE C  1 54  ? 53.713  18.487  81.632  0.25 22.21  ? 54   PHE C C     1 
ATOM   5190   O O     A PHE C  1 54  ? 53.704  17.805  80.616  0.25 25.29  ? 54   PHE C O     1 
ATOM   5191   C CB    A PHE C  1 54  ? 55.972  18.613  82.593  0.25 21.48  ? 54   PHE C CB    1 
ATOM   5192   C CG    A PHE C  1 54  ? 56.881  18.525  83.784  0.25 24.69  ? 54   PHE C CG    1 
ATOM   5193   C CD1   A PHE C  1 54  ? 56.415  18.064  85.007  0.25 23.30  ? 54   PHE C CD1   1 
ATOM   5194   C CD2   A PHE C  1 54  ? 58.232  18.898  83.668  0.25 25.87  ? 54   PHE C CD2   1 
ATOM   5195   C CE1   A PHE C  1 54  ? 57.268  17.967  86.098  0.25 26.21  ? 54   PHE C CE1   1 
ATOM   5196   C CE2   A PHE C  1 54  ? 59.096  18.805  84.767  0.25 27.29  ? 54   PHE C CE2   1 
ATOM   5197   C CZ    A PHE C  1 54  ? 58.602  18.335  85.981  0.25 25.21  ? 54   PHE C CZ    1 
ATOM   5198   N N     A ARG C  1 55  ? 53.045  19.629  81.742  0.25 24.88  ? 55   ARG C N     1 
ATOM   5199   C CA    A ARG C  1 55  ? 52.243  20.151  80.648  0.25 26.42  ? 55   ARG C CA    1 
ATOM   5200   C C     A ARG C  1 55  ? 52.627  21.607  80.453  0.25 23.27  ? 55   ARG C C     1 
ATOM   5201   O O     A ARG C  1 55  ? 52.658  22.376  81.398  0.25 26.54  ? 55   ARG C O     1 
ATOM   5202   C CB    A ARG C  1 55  ? 50.737  20.046  80.960  0.25 28.09  ? 55   ARG C CB    1 
ATOM   5203   C CG    A ARG C  1 55  ? 50.279  18.645  81.390  0.25 32.59  ? 55   ARG C CG    1 
ATOM   5204   C CD    A ARG C  1 55  ? 48.747  18.598  81.537  0.25 32.94  ? 55   ARG C CD    1 
ATOM   5205   N NE    A ARG C  1 55  ? 48.096  18.451  80.234  0.25 34.16  ? 55   ARG C NE    1 
ATOM   5206   C CZ    A ARG C  1 55  ? 47.874  17.276  79.643  0.25 32.79  ? 55   ARG C CZ    1 
ATOM   5207   N NH1   A ARG C  1 55  ? 48.240  16.148  80.239  0.25 31.45  ? 55   ARG C NH1   1 
ATOM   5208   N NH2   A ARG C  1 55  ? 47.291  17.232  78.459  0.25 31.58  ? 55   ARG C NH2   1 
ATOM   5209   N N     A PHE C  1 56  ? 52.911  21.984  79.219  0.25 23.21  ? 56   PHE C N     1 
ATOM   5210   C CA    A PHE C  1 56  ? 53.296  23.354  78.912  0.25 21.02  ? 56   PHE C CA    1 
ATOM   5211   C C     A PHE C  1 56  ? 52.467  23.874  77.758  0.25 20.68  ? 56   PHE C C     1 
ATOM   5212   O O     A PHE C  1 56  ? 52.356  23.218  76.732  0.25 22.17  ? 56   PHE C O     1 
ATOM   5213   C CB    A PHE C  1 56  ? 54.780  23.410  78.522  0.25 19.31  ? 56   PHE C CB    1 
ATOM   5214   C CG    A PHE C  1 56  ? 55.713  23.033  79.640  0.25 21.21  ? 56   PHE C CG    1 
ATOM   5215   C CD1   A PHE C  1 56  ? 56.015  23.945  80.649  0.25 20.99  ? 56   PHE C CD1   1 
ATOM   5216   C CD2   A PHE C  1 56  ? 56.288  21.777  79.686  0.25 18.80  ? 56   PHE C CD2   1 
ATOM   5217   C CE1   A PHE C  1 56  ? 56.880  23.598  81.681  0.25 20.30  ? 56   PHE C CE1   1 
ATOM   5218   C CE2   A PHE C  1 56  ? 57.148  21.422  80.711  0.25 22.25  ? 56   PHE C CE2   1 
ATOM   5219   C CZ    A PHE C  1 56  ? 57.448  22.336  81.715  0.25 18.83  ? 56   PHE C CZ    1 
ATOM   5220   N N     A SER C  1 57  ? 51.886  25.053  77.920  0.25 21.02  ? 57   SER C N     1 
ATOM   5221   C CA    A SER C  1 57  ? 51.102  25.641  76.842  0.25 23.44  ? 57   SER C CA    1 
ATOM   5222   C C     A SER C  1 57  ? 52.034  26.258  75.796  0.25 25.60  ? 57   SER C C     1 
ATOM   5223   O O     A SER C  1 57  ? 52.999  26.941  76.153  0.25 23.80  ? 57   SER C O     1 
ATOM   5224   C CB    A SER C  1 57  ? 50.184  26.738  77.377  0.25 21.37  ? 57   SER C CB    1 
ATOM   5225   O OG    A SER C  1 57  ? 49.635  27.447  76.269  0.25 22.00  ? 57   SER C OG    1 
ATOM   5226   N N     A LEU C  1 58  ? 51.743  26.020  74.516  0.25 24.62  ? 58   LEU C N     1 
ATOM   5227   C CA    A LEU C  1 58  ? 52.547  26.569  73.423  0.25 24.50  ? 58   LEU C CA    1 
ATOM   5228   C C     A LEU C  1 58  ? 51.738  27.620  72.654  0.25 27.43  ? 58   LEU C C     1 
ATOM   5229   O O     A LEU C  1 58  ? 52.148  28.079  71.578  0.25 26.63  ? 58   LEU C O     1 
ATOM   5230   C CB    A LEU C  1 58  ? 52.985  25.454  72.467  0.25 23.52  ? 58   LEU C CB    1 
ATOM   5231   C CG    A LEU C  1 58  ? 53.768  24.291  73.084  0.25 22.23  ? 58   LEU C CG    1 
ATOM   5232   C CD1   A LEU C  1 58  ? 54.149  23.295  71.999  0.25 17.45  ? 58   LEU C CD1   1 
ATOM   5233   C CD2   A LEU C  1 58  ? 55.020  24.820  73.763  0.25 20.88  ? 58   LEU C CD2   1 
ATOM   5234   N N     A ALA C  1 59  ? 50.588  27.997  73.211  0.25 26.29  ? 59   ALA C N     1 
ATOM   5235   C CA    A ALA C  1 59  ? 49.718  28.983  72.589  0.25 27.71  ? 59   ALA C CA    1 
ATOM   5236   C C     A ALA C  1 59  ? 50.341  30.377  72.672  0.25 29.45  ? 59   ALA C C     1 
ATOM   5237   O O     A ALA C  1 59  ? 51.214  30.632  73.514  0.25 28.25  ? 59   ALA C O     1 
ATOM   5238   C CB    A ALA C  1 59  ? 48.352  28.979  73.277  0.25 28.41  ? 59   ALA C CB    1 
ATOM   5239   N N     A ASP C  1 60  ? 49.882  31.274  71.802  0.25 29.84  ? 60   ASP C N     1 
ATOM   5240   C CA    A ASP C  1 60  ? 50.387  32.644  71.759  0.25 31.96  ? 60   ASP C CA    1 
ATOM   5241   C C     A ASP C  1 60  ? 51.899  32.701  71.586  0.25 30.14  ? 60   ASP C C     1 
ATOM   5242   O O     A ASP C  1 60  ? 52.559  33.523  72.202  0.25 30.96  ? 60   ASP C O     1 
ATOM   5243   C CB    A ASP C  1 60  ? 49.982  33.393  73.033  0.25 33.20  ? 60   ASP C CB    1 
ATOM   5244   C CG    A ASP C  1 60  ? 48.483  33.360  73.261  0.25 36.96  ? 60   ASP C CG    1 
ATOM   5245   O OD1   A ASP C  1 60  ? 47.748  33.818  72.367  0.25 38.52  ? 60   ASP C OD1   1 
ATOM   5246   O OD2   A ASP C  1 60  ? 48.034  32.871  74.316  0.25 37.60  ? 60   ASP C OD2   1 
ATOM   5247   N N     A ASN C  1 61  ? 52.433  31.815  70.754  0.25 30.42  ? 61   ASN C N     1 
ATOM   5248   C CA    A ASN C  1 61  ? 53.866  31.768  70.461  0.25 30.18  ? 61   ASN C CA    1 
ATOM   5249   C C     A ASN C  1 61  ? 54.753  31.558  71.670  0.25 27.81  ? 61   ASN C C     1 
ATOM   5250   O O     A ASN C  1 61  ? 55.927  31.916  71.632  0.25 28.90  ? 61   ASN C O     1 
ATOM   5251   C CB    A ASN C  1 61  ? 54.312  33.055  69.766  0.25 31.94  ? 61   ASN C CB    1 
ATOM   5252   C CG    A ASN C  1 61  ? 53.345  33.505  68.685  0.25 33.26  ? 61   ASN C CG    1 
ATOM   5253   O OD1   A ASN C  1 61  ? 52.488  34.350  68.924  0.25 34.71  ? 61   ASN C OD1   1 
ATOM   5254   N ND2   A ASN C  1 61  ? 53.478  32.940  67.492  0.25 36.76  ? 61   ASN C ND2   1 
ATOM   5255   N N     A THR C  1 62  ? 54.214  30.954  72.722  0.25 25.25  ? 62   THR C N     1 
ATOM   5256   C CA    A THR C  1 62  ? 54.978  30.729  73.941  0.25 25.73  ? 62   THR C CA    1 
ATOM   5257   C C     A THR C  1 62  ? 56.023  29.611  73.830  0.25 24.85  ? 62   THR C C     1 
ATOM   5258   O O     A THR C  1 62  ? 55.785  28.561  73.229  0.25 22.61  ? 62   THR C O     1 
ATOM   5259   C CB    A THR C  1 62  ? 54.040  30.429  75.120  0.25 26.67  ? 62   THR C CB    1 
ATOM   5260   O OG1   A THR C  1 62  ? 53.111  31.514  75.272  0.25 28.30  ? 62   THR C OG1   1 
ATOM   5261   C CG2   A THR C  1 62  ? 54.835  30.269  76.413  0.25 24.92  ? 62   THR C CG2   1 
ATOM   5262   N N     A LEU C  1 63  ? 57.197  29.870  74.389  0.25 25.26  ? 63   LEU C N     1 
ATOM   5263   C CA    A LEU C  1 63  ? 58.293  28.900  74.386  0.25 24.67  ? 63   LEU C CA    1 
ATOM   5264   C C     A LEU C  1 63  ? 58.679  28.651  75.837  0.25 23.42  ? 63   LEU C C     1 
ATOM   5265   O O     A LEU C  1 63  ? 59.163  29.559  76.528  0.25 25.40  ? 63   LEU C O     1 
ATOM   5266   C CB    A LEU C  1 63  ? 59.492  29.446  73.608  0.25 23.39  ? 63   LEU C CB    1 
ATOM   5267   C CG    A LEU C  1 63  ? 60.787  28.609  73.698  0.25 27.90  ? 63   LEU C CG    1 
ATOM   5268   C CD1   A LEU C  1 63  ? 60.536  27.190  73.169  0.25 25.57  ? 63   LEU C CD1   1 
ATOM   5269   C CD2   A LEU C  1 63  ? 61.907  29.280  72.864  0.25 24.62  ? 63   LEU C CD2   1 
ATOM   5270   N N     A PRO C  1 64  ? 58.447  27.425  76.330  0.25 22.92  ? 64   PRO C N     1 
ATOM   5271   C CA    A PRO C  1 64  ? 58.788  27.110  77.718  0.25 22.43  ? 64   PRO C CA    1 
ATOM   5272   C C     A PRO C  1 64  ? 60.300  26.936  77.959  0.25 23.42  ? 64   PRO C C     1 
ATOM   5273   O O     A PRO C  1 64  ? 60.788  25.837  78.243  0.25 22.54  ? 64   PRO C O     1 
ATOM   5274   C CB    A PRO C  1 64  ? 57.984  25.839  77.995  0.25 20.89  ? 64   PRO C CB    1 
ATOM   5275   C CG    A PRO C  1 64  ? 57.960  25.164  76.639  0.25 21.95  ? 64   PRO C CG    1 
ATOM   5276   C CD    A PRO C  1 64  ? 57.688  26.322  75.704  0.25 20.29  ? 64   PRO C CD    1 
ATOM   5277   N N     A LEU C  1 65  ? 61.023  28.041  77.830  0.25 23.46  ? 65   LEU C N     1 
ATOM   5278   C CA    A LEU C  1 65  ? 62.464  28.067  78.077  0.25 22.79  ? 65   LEU C CA    1 
ATOM   5279   C C     A LEU C  1 65  ? 62.616  28.516  79.541  0.25 19.97  ? 65   LEU C C     1 
ATOM   5280   O O     A LEU C  1 65  ? 62.286  29.645  79.876  0.25 19.29  ? 65   LEU C O     1 
ATOM   5281   C CB    A LEU C  1 65  ? 63.119  29.081  77.135  0.25 22.83  ? 65   LEU C CB    1 
ATOM   5282   C CG    A LEU C  1 65  ? 64.653  29.140  77.178  0.25 24.86  ? 65   LEU C CG    1 
ATOM   5283   C CD1   A LEU C  1 65  ? 65.264  27.821  76.712  0.25 22.34  ? 65   LEU C CD1   1 
ATOM   5284   C CD2   A LEU C  1 65  ? 65.118  30.291  76.283  0.25 25.05  ? 65   LEU C CD2   1 
ATOM   5285   N N     A LEU C  1 66  ? 63.099  27.628  80.401  0.25 22.12  ? 66   LEU C N     1 
ATOM   5286   C CA    A LEU C  1 66  ? 63.227  27.904  81.826  0.25 23.31  ? 66   LEU C CA    1 
ATOM   5287   C C     A LEU C  1 66  ? 63.904  29.237  82.131  0.25 28.54  ? 66   LEU C C     1 
ATOM   5288   O O     A LEU C  1 66  ? 64.884  29.640  81.478  0.25 25.30  ? 66   LEU C O     1 
ATOM   5289   C CB    A LEU C  1 66  ? 63.967  26.752  82.523  0.25 24.94  ? 66   LEU C CB    1 
ATOM   5290   C CG    A LEU C  1 66  ? 63.388  25.338  82.391  0.25 26.72  ? 66   LEU C CG    1 
ATOM   5291   C CD1   A LEU C  1 66  ? 64.073  24.440  83.399  0.25 25.39  ? 66   LEU C CD1   1 
ATOM   5292   C CD2   A LEU C  1 66  ? 61.889  25.332  82.623  0.25 23.75  ? 66   LEU C CD2   1 
ATOM   5293   N N     A THR C  1 67  ? 63.365  29.930  83.130  0.25 26.96  ? 67   THR C N     1 
ATOM   5294   C CA    A THR C  1 67  ? 63.887  31.223  83.518  0.25 25.42  ? 67   THR C CA    1 
ATOM   5295   C C     A THR C  1 67  ? 64.600  31.248  84.866  0.25 26.03  ? 67   THR C C     1 
ATOM   5296   O O     A THR C  1 67  ? 65.261  32.227  85.177  0.25 25.96  ? 67   THR C O     1 
ATOM   5297   C CB    A THR C  1 67  ? 62.769  32.259  83.561  0.25 28.34  ? 67   THR C CB    1 
ATOM   5298   O OG1   A THR C  1 67  ? 61.836  31.910  84.595  0.25 27.56  ? 67   THR C OG1   1 
ATOM   5299   C CG2   A THR C  1 67  ? 62.060  32.323  82.214  0.25 23.74  ? 67   THR C CG2   1 
ATOM   5300   N N     A THR C  1 68  ? 64.484  30.189  85.666  0.25 24.38  ? 68   THR C N     1 
ATOM   5301   C CA    A THR C  1 68  ? 65.156  30.198  86.957  0.25 25.70  ? 68   THR C CA    1 
ATOM   5302   C C     A THR C  1 68  ? 66.662  29.987  86.840  0.25 26.46  ? 68   THR C C     1 
ATOM   5303   O O     A THR C  1 68  ? 67.371  29.914  87.849  0.25 24.32  ? 68   THR C O     1 
ATOM   5304   C CB    A THR C  1 68  ? 64.554  29.179  87.924  0.25 21.65  ? 68   THR C CB    1 
ATOM   5305   O OG1   A THR C  1 68  ? 64.465  27.901  87.295  0.25 29.58  ? 68   THR C OG1   1 
ATOM   5306   C CG2   A THR C  1 68  ? 63.169  29.636  88.359  0.25 24.66  ? 68   THR C CG2   1 
ATOM   5307   N N     A LYS C  1 69  ? 67.133  29.851  85.603  0.25 26.76  ? 69   LYS C N     1 
ATOM   5308   C CA    A LYS C  1 69  ? 68.569  29.740  85.320  0.25 26.98  ? 69   LYS C CA    1 
ATOM   5309   C C     A LYS C  1 69  ? 68.727  30.057  83.843  0.25 28.20  ? 69   LYS C C     1 
ATOM   5310   O O     A LYS C  1 69  ? 67.775  29.875  83.069  0.25 26.84  ? 69   LYS C O     1 
ATOM   5311   C CB    A LYS C  1 69  ? 69.113  28.339  85.627  0.25 25.77  ? 69   LYS C CB    1 
ATOM   5312   C CG    A LYS C  1 69  ? 69.051  27.366  84.464  0.25 26.75  ? 69   LYS C CG    1 
ATOM   5313   C CD    A LYS C  1 69  ? 69.787  26.079  84.765  0.25 24.16  ? 69   LYS C CD    1 
ATOM   5314   C CE    A LYS C  1 69  ? 69.602  25.065  83.640  0.25 24.36  ? 69   LYS C CE    1 
ATOM   5315   N NZ    A LYS C  1 69  ? 70.332  23.793  83.949  0.25 22.83  ? 69   LYS C NZ    1 
ATOM   5316   N N     A ARG C  1 70  ? 69.905  30.546  83.442  0.25 26.52  ? 70   ARG C N     1 
ATOM   5317   C CA    A ARG C  1 70  ? 70.119  30.859  82.030  0.25 26.06  ? 70   ARG C CA    1 
ATOM   5318   C C     A ARG C  1 70  ? 70.315  29.550  81.270  0.25 23.99  ? 70   ARG C C     1 
ATOM   5319   O O     A ARG C  1 70  ? 71.216  28.766  81.580  0.25 25.59  ? 70   ARG C O     1 
ATOM   5320   C CB    A ARG C  1 70  ? 71.364  31.750  81.823  0.25 29.99  ? 70   ARG C CB    1 
ATOM   5321   C CG    A ARG C  1 70  ? 71.492  32.230  80.352  0.25 31.25  ? 70   ARG C CG    1 
ATOM   5322   C CD    A ARG C  1 70  ? 72.857  32.825  79.936  0.25 35.90  ? 70   ARG C CD    1 
ATOM   5323   N NE    A ARG C  1 70  ? 73.503  33.297  81.085  0.25 40.82  ? 70   ARG C NE    1 
ATOM   5324   C CZ    A ARG C  1 70  ? 74.701  33.252  81.647  0.25 40.78  ? 70   ARG C CZ    1 
ATOM   5325   N NH1   A ARG C  1 70  ? 75.837  32.672  81.249  0.25 35.89  ? 70   ARG C NH1   1 
ATOM   5326   N NH2   A ARG C  1 70  ? 74.650  33.896  82.789  0.25 36.38  ? 70   ARG C NH2   1 
ATOM   5327   N N     A VAL C  1 71  ? 69.453  29.294  80.300  0.25 23.57  ? 71   VAL C N     1 
ATOM   5328   C CA    A VAL C  1 71  ? 69.554  28.075  79.497  0.25 22.72  ? 71   VAL C CA    1 
ATOM   5329   C C     A VAL C  1 71  ? 70.248  28.394  78.185  0.25 21.39  ? 71   VAL C C     1 
ATOM   5330   O O     A VAL C  1 71  ? 69.930  29.393  77.565  0.25 21.84  ? 71   VAL C O     1 
ATOM   5331   C CB    A VAL C  1 71  ? 68.149  27.493  79.178  0.25 23.92  ? 71   VAL C CB    1 
ATOM   5332   C CG1   A VAL C  1 71  ? 68.283  26.245  78.302  0.25 21.34  ? 71   VAL C CG1   1 
ATOM   5333   C CG2   A VAL C  1 71  ? 67.432  27.154  80.478  0.25 20.89  ? 71   VAL C CG2   1 
ATOM   5334   N N     A PHE C  1 72  ? 71.188  27.541  77.776  0.25 24.06  ? 72   PHE C N     1 
ATOM   5335   C CA    A PHE C  1 72  ? 71.927  27.731  76.519  0.25 24.26  ? 72   PHE C CA    1 
ATOM   5336   C C     A PHE C  1 72  ? 70.985  27.508  75.316  0.25 24.37  ? 72   PHE C C     1 
ATOM   5337   O O     A PHE C  1 72  ? 71.026  26.473  74.672  0.25 25.91  ? 72   PHE C O     1 
ATOM   5338   C CB    A PHE C  1 72  ? 73.101  26.734  76.472  0.25 25.39  ? 72   PHE C CB    1 
ATOM   5339   C CG    A PHE C  1 72  ? 74.051  26.931  75.302  0.25 24.14  ? 72   PHE C CG    1 
ATOM   5340   C CD1   A PHE C  1 72  ? 74.943  25.917  74.946  0.25 23.21  ? 72   PHE C CD1   1 
ATOM   5341   C CD2   A PHE C  1 72  ? 74.079  28.120  74.599  0.25 23.12  ? 72   PHE C CD2   1 
ATOM   5342   C CE1   A PHE C  1 72  ? 75.870  26.091  73.890  0.25 24.35  ? 72   PHE C CE1   1 
ATOM   5343   C CE2   A PHE C  1 72  ? 74.998  28.313  73.542  0.25 28.98  ? 72   PHE C CE2   1 
ATOM   5344   C CZ    A PHE C  1 72  ? 75.897  27.288  73.190  0.25 24.53  ? 72   PHE C CZ    1 
ATOM   5345   N N     A LEU C  1 73  ? 70.139  28.489  75.031  0.25 23.72  ? 73   LEU C N     1 
ATOM   5346   C CA    A LEU C  1 73  ? 69.192  28.428  73.927  0.25 24.89  ? 73   LEU C CA    1 
ATOM   5347   C C     A LEU C  1 73  ? 69.819  28.023  72.587  0.25 27.49  ? 73   LEU C C     1 
ATOM   5348   O O     A LEU C  1 73  ? 69.326  27.109  71.918  0.25 25.02  ? 73   LEU C O     1 
ATOM   5349   C CB    A LEU C  1 73  ? 68.497  29.781  73.768  0.25 24.85  ? 73   LEU C CB    1 
ATOM   5350   C CG    A LEU C  1 73  ? 67.550  29.951  72.564  0.25 27.36  ? 73   LEU C CG    1 
ATOM   5351   C CD1   A LEU C  1 73  ? 66.366  28.949  72.631  0.25 22.93  ? 73   LEU C CD1   1 
ATOM   5352   C CD2   A LEU C  1 73  ? 67.041  31.366  72.555  0.25 25.58  ? 73   LEU C CD2   1 
ATOM   5353   N N     A ARG C  1 74  ? 70.894  28.705  72.185  0.25 27.70  ? 74   ARG C N     1 
ATOM   5354   C CA    A ARG C  1 74  ? 71.550  28.380  70.920  0.25 26.07  ? 74   ARG C CA    1 
ATOM   5355   C C     A ARG C  1 74  ? 71.939  26.906  70.870  0.25 22.09  ? 74   ARG C C     1 
ATOM   5356   O O     A ARG C  1 74  ? 71.854  26.262  69.814  0.25 21.80  ? 74   ARG C O     1 
ATOM   5357   C CB    A ARG C  1 74  ? 72.803  29.266  70.712  0.25 29.70  ? 74   ARG C CB    1 
ATOM   5358   C CG    A ARG C  1 74  ? 73.512  29.016  69.376  0.25 31.02  ? 74   ARG C CG    1 
ATOM   5359   C CD    A ARG C  1 74  ? 74.420  30.178  68.996  0.25 37.34  ? 74   ARG C CD    1 
ATOM   5360   N NE    A ARG C  1 74  ? 75.516  30.376  69.943  0.25 40.02  ? 74   ARG C NE    1 
ATOM   5361   C CZ    A ARG C  1 74  ? 76.610  29.618  70.014  0.25 43.07  ? 74   ARG C CZ    1 
ATOM   5362   N NH1   A ARG C  1 74  ? 76.762  28.597  69.188  0.25 43.32  ? 74   ARG C NH1   1 
ATOM   5363   N NH2   A ARG C  1 74  ? 77.565  29.890  70.901  0.25 41.83  ? 74   ARG C NH2   1 
ATOM   5364   N N     A GLY C  1 75  ? 72.369  26.376  72.008  0.25 18.80  ? 75   GLY C N     1 
ATOM   5365   C CA    A GLY C  1 75  ? 72.752  24.975  72.065  0.25 20.40  ? 75   GLY C CA    1 
ATOM   5366   C C     A GLY C  1 75  ? 71.542  24.064  71.817  0.25 20.99  ? 75   GLY C C     1 
ATOM   5367   O O     A GLY C  1 75  ? 71.657  23.028  71.164  0.25 18.35  ? 75   GLY C O     1 
ATOM   5368   N N     A VAL C  1 76  ? 70.389  24.446  72.353  0.25 20.56  ? 76   VAL C N     1 
ATOM   5369   C CA    A VAL C  1 76  ? 69.167  23.658  72.174  0.25 20.52  ? 76   VAL C CA    1 
ATOM   5370   C C     A VAL C  1 76  ? 68.790  23.642  70.690  0.25 21.76  ? 76   VAL C C     1 
ATOM   5371   O O     A VAL C  1 76  ? 68.564  22.577  70.112  0.25 24.86  ? 76   VAL C O     1 
ATOM   5372   C CB    A VAL C  1 76  ? 67.989  24.279  72.985  0.25 19.87  ? 76   VAL C CB    1 
ATOM   5373   C CG1   A VAL C  1 76  ? 66.683  23.503  72.716  0.25 18.85  ? 76   VAL C CG1   1 
ATOM   5374   C CG2   A VAL C  1 76  ? 68.330  24.261  74.482  0.25 17.87  ? 76   VAL C CG2   1 
ATOM   5375   N N     A ILE C  1 77  ? 68.719  24.828  70.086  0.25 21.57  ? 77   ILE C N     1 
ATOM   5376   C CA    A ILE C  1 77  ? 68.377  24.959  68.678  0.25 22.20  ? 77   ILE C CA    1 
ATOM   5377   C C     A ILE C  1 77  ? 69.367  24.185  67.799  0.25 23.52  ? 77   ILE C C     1 
ATOM   5378   O O     A ILE C  1 77  ? 68.971  23.412  66.926  0.25 21.34  ? 77   ILE C O     1 
ATOM   5379   C CB    A ILE C  1 77  ? 68.371  26.437  68.262  0.25 23.08  ? 77   ILE C CB    1 
ATOM   5380   C CG1   A ILE C  1 77  ? 67.332  27.211  69.086  0.25 24.85  ? 77   ILE C CG1   1 
ATOM   5381   C CG2   A ILE C  1 77  ? 68.048  26.586  66.759  0.25 23.41  ? 77   ILE C CG2   1 
ATOM   5382   C CD1   A ILE C  1 77  ? 67.425  28.735  68.876  0.25 23.45  ? 77   ILE C CD1   1 
ATOM   5383   N N     A ALA C  1 78  ? 70.661  24.377  68.031  0.25 22.62  ? 78   ALA C N     1 
ATOM   5384   C CA    A ALA C  1 78  ? 71.661  23.669  67.227  0.25 23.12  ? 78   ALA C CA    1 
ATOM   5385   C C     A ALA C  1 78  ? 71.472  22.169  67.295  0.25 21.89  ? 78   ALA C C     1 
ATOM   5386   O O     A ALA C  1 78  ? 71.458  21.500  66.253  0.25 20.32  ? 78   ALA C O     1 
ATOM   5387   C CB    A ALA C  1 78  ? 73.095  24.047  67.672  0.25 23.60  ? 78   ALA C CB    1 
ATOM   5388   N N     A GLU C  1 79  ? 71.338  21.629  68.511  0.25 22.75  ? 79   GLU C N     1 
ATOM   5389   C CA    A GLU C  1 79  ? 71.141  20.196  68.673  0.25 21.46  ? 79   GLU C CA    1 
ATOM   5390   C C     A GLU C  1 79  ? 69.876  19.720  67.927  0.25 21.01  ? 79   GLU C C     1 
ATOM   5391   O O     A GLU C  1 79  ? 69.884  18.682  67.275  0.25 21.72  ? 79   GLU C O     1 
ATOM   5392   C CB    A GLU C  1 79  ? 71.014  19.823  70.148  0.25 21.54  ? 79   GLU C CB    1 
ATOM   5393   C CG    A GLU C  1 79  ? 70.775  18.320  70.341  0.25 21.83  ? 79   GLU C CG    1 
ATOM   5394   C CD    A GLU C  1 79  ? 70.416  17.928  71.762  0.25 21.64  ? 79   GLU C CD    1 
ATOM   5395   O OE1   A GLU C  1 79  ? 69.598  18.643  72.393  0.25 19.57  ? 79   GLU C OE1   1 
ATOM   5396   O OE2   A GLU C  1 79  ? 70.945  16.902  72.241  0.25 17.06  ? 79   GLU C OE2   1 
ATOM   5397   N N     A LEU C  1 80  ? 68.798  20.488  68.028  0.25 21.73  ? 80   LEU C N     1 
ATOM   5398   C CA    A LEU C  1 80  ? 67.533  20.127  67.372  0.25 20.33  ? 80   LEU C CA    1 
ATOM   5399   C C     A LEU C  1 80  ? 67.639  20.088  65.833  0.25 22.24  ? 80   LEU C C     1 
ATOM   5400   O O     A LEU C  1 80  ? 67.162  19.146  65.197  0.25 18.37  ? 80   LEU C O     1 
ATOM   5401   C CB    A LEU C  1 80  ? 66.438  21.113  67.768  0.25 19.30  ? 80   LEU C CB    1 
ATOM   5402   C CG    A LEU C  1 80  ? 65.084  20.859  67.075  0.25 16.91  ? 80   LEU C CG    1 
ATOM   5403   C CD1   A LEU C  1 80  ? 64.613  19.419  67.348  0.25 18.55  ? 80   LEU C CD1   1 
ATOM   5404   C CD2   A LEU C  1 80  ? 64.046  21.878  67.604  0.25 18.77  ? 80   LEU C CD2   1 
ATOM   5405   N N     A LEU C  1 81  ? 68.252  21.118  65.238  0.25 22.72  ? 81   LEU C N     1 
ATOM   5406   C CA    A LEU C  1 81  ? 68.424  21.156  63.784  0.25 22.66  ? 81   LEU C CA    1 
ATOM   5407   C C     A LEU C  1 81  ? 69.364  20.033  63.349  0.25 23.40  ? 81   LEU C C     1 
ATOM   5408   O O     A LEU C  1 81  ? 69.280  19.530  62.221  0.25 24.65  ? 81   LEU C O     1 
ATOM   5409   C CB    A LEU C  1 81  ? 68.988  22.506  63.338  0.25 23.38  ? 81   LEU C CB    1 
ATOM   5410   C CG    A LEU C  1 81  ? 68.101  23.711  63.659  0.25 25.54  ? 81   LEU C CG    1 
ATOM   5411   C CD1   A LEU C  1 81  ? 68.712  24.968  63.047  0.25 23.51  ? 81   LEU C CD1   1 
ATOM   5412   C CD2   A LEU C  1 81  ? 66.675  23.490  63.086  0.25 25.13  ? 81   LEU C CD2   1 
ATOM   5413   N N     A TRP C  1 82  ? 70.229  19.626  64.273  0.25 22.30  ? 82   TRP C N     1 
ATOM   5414   C CA    A TRP C  1 82  ? 71.186  18.552  64.047  0.25 22.13  ? 82   TRP C CA    1 
ATOM   5415   C C     A TRP C  1 82  ? 70.387  17.230  63.992  0.25 23.04  ? 82   TRP C C     1 
ATOM   5416   O O     A TRP C  1 82  ? 70.608  16.395  63.101  0.25 20.32  ? 82   TRP C O     1 
ATOM   5417   C CB    A TRP C  1 82  ? 72.193  18.563  65.199  0.25 21.60  ? 82   TRP C CB    1 
ATOM   5418   C CG    A TRP C  1 82  ? 73.235  17.513  65.216  0.25 20.41  ? 82   TRP C CG    1 
ATOM   5419   C CD1   A TRP C  1 82  ? 74.271  17.346  64.315  0.25 22.38  ? 82   TRP C CD1   1 
ATOM   5420   C CD2   A TRP C  1 82  ? 73.419  16.515  66.228  0.25 20.82  ? 82   TRP C CD2   1 
ATOM   5421   N NE1   A TRP C  1 82  ? 75.079  16.302  64.718  0.25 21.13  ? 82   TRP C NE1   1 
ATOM   5422   C CE2   A TRP C  1 82  ? 74.581  15.781  65.887  0.25 18.91  ? 82   TRP C CE2   1 
ATOM   5423   C CE3   A TRP C  1 82  ? 72.716  16.171  67.398  0.25 20.36  ? 82   TRP C CE3   1 
ATOM   5424   C CZ2   A TRP C  1 82  ? 75.051  14.729  66.672  0.25 23.54  ? 82   TRP C CZ2   1 
ATOM   5425   C CZ3   A TRP C  1 82  ? 73.183  15.129  68.176  0.25 20.75  ? 82   TRP C CZ3   1 
ATOM   5426   C CH2   A TRP C  1 82  ? 74.337  14.419  67.815  0.25 23.19  ? 82   TRP C CH2   1 
ATOM   5427   N N     A PHE C  1 83  ? 69.453  17.047  64.928  0.25 21.95  ? 83   PHE C N     1 
ATOM   5428   C CA    A PHE C  1 83  ? 68.630  15.831  64.927  0.25 21.40  ? 83   PHE C CA    1 
ATOM   5429   C C     A PHE C  1 83  ? 67.892  15.779  63.601  0.25 20.20  ? 83   PHE C C     1 
ATOM   5430   O O     A PHE C  1 83  ? 67.962  14.783  62.864  0.25 22.20  ? 83   PHE C O     1 
ATOM   5431   C CB    A PHE C  1 83  ? 67.544  15.829  66.037  0.25 20.46  ? 83   PHE C CB    1 
ATOM   5432   C CG    A PHE C  1 83  ? 68.073  15.754  67.446  0.25 20.07  ? 83   PHE C CG    1 
ATOM   5433   C CD1   A PHE C  1 83  ? 69.234  15.044  67.730  0.25 21.68  ? 83   PHE C CD1   1 
ATOM   5434   C CD2   A PHE C  1 83  ? 67.361  16.340  68.507  0.25 20.43  ? 83   PHE C CD2   1 
ATOM   5435   C CE1   A PHE C  1 83  ? 69.688  14.908  69.033  0.25 17.27  ? 83   PHE C CE1   1 
ATOM   5436   C CE2   A PHE C  1 83  ? 67.806  16.205  69.824  0.25 19.16  ? 83   PHE C CE2   1 
ATOM   5437   C CZ    A PHE C  1 83  ? 68.980  15.478  70.081  0.25 21.03  ? 83   PHE C CZ    1 
ATOM   5438   N N     A VAL C  1 84  ? 67.171  16.855  63.303  0.25 21.87  ? 84   VAL C N     1 
ATOM   5439   C CA    A VAL C  1 84  ? 66.372  16.932  62.082  0.25 23.16  ? 84   VAL C CA    1 
ATOM   5440   C C     A VAL C  1 84  ? 67.167  16.563  60.833  0.25 24.12  ? 84   VAL C C     1 
ATOM   5441   O O     A VAL C  1 84  ? 66.654  15.868  59.941  0.25 22.02  ? 84   VAL C O     1 
ATOM   5442   C CB    A VAL C  1 84  ? 65.756  18.349  61.917  0.25 23.51  ? 84   VAL C CB    1 
ATOM   5443   C CG1   A VAL C  1 84  ? 65.022  18.483  60.580  0.25 25.29  ? 84   VAL C CG1   1 
ATOM   5444   C CG2   A VAL C  1 84  ? 64.776  18.622  63.052  0.25 23.91  ? 84   VAL C CG2   1 
ATOM   5445   N N     A SER C  1 85  ? 68.427  16.993  60.783  0.25 22.24  ? 85   SER C N     1 
ATOM   5446   C CA    A SER C  1 85  ? 69.265  16.731  59.613  0.25 24.35  ? 85   SER C CA    1 
ATOM   5447   C C     A SER C  1 85  ? 69.619  15.273  59.508  0.25 22.86  ? 85   SER C C     1 
ATOM   5448   O O     A SER C  1 85  ? 70.094  14.839  58.484  0.25 27.34  ? 85   SER C O     1 
ATOM   5449   C CB    A SER C  1 85  ? 70.565  17.556  59.674  0.25 23.35  ? 85   SER C CB    1 
ATOM   5450   O OG    A SER C  1 85  ? 71.401  17.060  60.698  0.25 21.63  ? 85   SER C OG    1 
ATOM   5451   N N     A GLY C  1 86  ? 69.412  14.519  60.584  0.25 26.15  ? 86   GLY C N     1 
ATOM   5452   C CA    A GLY C  1 86  ? 69.736  13.104  60.570  0.25 24.70  ? 86   GLY C CA    1 
ATOM   5453   C C     A GLY C  1 86  ? 71.209  12.832  60.839  0.25 27.76  ? 86   GLY C C     1 
ATOM   5454   O O     A GLY C  1 86  ? 71.646  11.672  60.820  0.25 27.85  ? 86   GLY C O     1 
ATOM   5455   N N     A CYS C  1 87  ? 71.964  13.891  61.111  0.25 28.25  ? 87   CYS C N     1 
ATOM   5456   C CA    A CYS C  1 87  ? 73.401  13.811  61.366  0.25 26.66  ? 87   CYS C CA    1 
ATOM   5457   C C     A CYS C  1 87  ? 73.695  13.231  62.742  0.25 27.92  ? 87   CYS C C     1 
ATOM   5458   O O     A CYS C  1 87  ? 72.961  13.488  63.705  0.25 27.74  ? 87   CYS C O     1 
ATOM   5459   C CB    A CYS C  1 87  ? 74.008  15.212  61.247  0.25 29.46  ? 87   CYS C CB    1 
ATOM   5460   S SG    A CYS C  1 87  ? 75.824  15.333  61.535  0.25 33.99  ? 87   CYS C SG    1 
ATOM   5461   N N     A THR C  1 88  ? 74.769  12.450  62.834  0.25 24.46  ? 88   THR C N     1 
ATOM   5462   C CA    A THR C  1 88  ? 75.157  11.818  64.080  0.25 24.41  ? 88   THR C CA    1 
ATOM   5463   C C     A THR C  1 88  ? 76.608  12.129  64.464  0.25 24.86  ? 88   THR C C     1 
ATOM   5464   O O     A THR C  1 88  ? 77.185  11.459  65.334  0.25 23.30  ? 88   THR C O     1 
ATOM   5465   C CB    A THR C  1 88  ? 75.011  10.294  63.989  0.25 26.43  ? 88   THR C CB    1 
ATOM   5466   O OG1   A THR C  1 88  ? 75.856  9.800   62.935  0.25 28.69  ? 88   THR C OG1   1 
ATOM   5467   C CG2   A THR C  1 88  ? 73.556  9.924   63.699  0.25 25.95  ? 88   THR C CG2   1 
ATOM   5468   N N     A ASP C  1 89  ? 77.184  13.130  63.809  0.25 22.32  ? 89   ASP C N     1 
ATOM   5469   C CA    A ASP C  1 89  ? 78.557  13.548  64.077  0.25 22.50  ? 89   ASP C CA    1 
ATOM   5470   C C     A ASP C  1 89  ? 78.548  14.740  65.042  0.25 19.30  ? 89   ASP C C     1 
ATOM   5471   O O     A ASP C  1 89  ? 78.111  15.826  64.701  0.25 21.07  ? 89   ASP C O     1 
ATOM   5472   C CB    A ASP C  1 89  ? 79.239  13.945  62.765  0.25 25.02  ? 89   ASP C CB    1 
ATOM   5473   C CG    A ASP C  1 89  ? 80.721  14.214  62.940  0.25 28.58  ? 89   ASP C CG    1 
ATOM   5474   O OD1   A ASP C  1 89  ? 81.410  14.359  61.912  0.25 31.08  ? 89   ASP C OD1   1 
ATOM   5475   O OD2   A ASP C  1 89  ? 81.192  14.285  64.098  0.25 25.64  ? 89   ASP C OD2   1 
ATOM   5476   N N     A ALA C  1 90  ? 79.005  14.517  66.261  0.25 19.96  ? 90   ALA C N     1 
ATOM   5477   C CA    A ALA C  1 90  ? 79.032  15.573  67.268  0.25 23.34  ? 90   ALA C CA    1 
ATOM   5478   C C     A ALA C  1 90  ? 79.947  16.744  66.870  0.25 25.65  ? 90   ALA C C     1 
ATOM   5479   O O     A ALA C  1 90  ? 79.786  17.866  67.368  0.25 25.86  ? 90   ALA C O     1 
ATOM   5480   C CB    A ALA C  1 90  ? 79.476  14.996  68.608  0.25 22.76  ? 90   ALA C CB    1 
ATOM   5481   N N     A LYS C  1 91  ? 80.897  16.507  65.968  0.25 25.02  ? 91   LYS C N     1 
ATOM   5482   C CA    A LYS C  1 91  ? 81.770  17.611  65.554  0.25 26.78  ? 91   LYS C CA    1 
ATOM   5483   C C     A LYS C  1 91  ? 80.941  18.692  64.858  0.25 26.96  ? 91   LYS C C     1 
ATOM   5484   O O     A LYS C  1 91  ? 81.357  19.843  64.775  0.25 27.08  ? 91   LYS C O     1 
ATOM   5485   C CB    A LYS C  1 91  ? 82.856  17.122  64.592  0.25 29.42  ? 91   LYS C CB    1 
ATOM   5486   C CG    A LYS C  1 91  ? 83.806  16.115  65.187  0.25 32.00  ? 91   LYS C CG    1 
ATOM   5487   C CD    A LYS C  1 91  ? 84.617  16.717  66.302  0.25 37.00  ? 91   LYS C CD    1 
ATOM   5488   C CE    A LYS C  1 91  ? 85.634  15.705  66.846  0.25 38.40  ? 91   LYS C CE    1 
ATOM   5489   N NZ    A LYS C  1 91  ? 86.428  16.244  67.981  0.25 41.71  ? 91   LYS C NZ    1 
ATOM   5490   N N     A MET C  1 92  ? 79.774  18.329  64.331  0.25 26.00  ? 92   MET C N     1 
ATOM   5491   C CA    A MET C  1 92  ? 78.934  19.330  63.667  0.25 27.60  ? 92   MET C CA    1 
ATOM   5492   C C     A MET C  1 92  ? 78.369  20.298  64.706  0.25 25.47  ? 92   MET C C     1 
ATOM   5493   O O     A MET C  1 92  ? 77.947  21.423  64.372  0.25 23.48  ? 92   MET C O     1 
ATOM   5494   C CB    A MET C  1 92  ? 77.789  18.649  62.909  0.25 34.72  ? 92   MET C CB    1 
ATOM   5495   C CG    A MET C  1 92  ? 78.270  17.661  61.852  0.25 43.48  ? 92   MET C CG    1 
ATOM   5496   S SD    A MET C  1 92  ? 79.466  18.429  60.713  0.25 54.03  ? 92   MET C SD    1 
ATOM   5497   C CE    A MET C  1 92  ? 78.350  19.560  59.830  0.25 49.60  ? 92   MET C CE    1 
ATOM   5498   N N     A LEU C  1 93  ? 78.342  19.865  65.966  0.25 22.97  ? 93   LEU C N     1 
ATOM   5499   C CA    A LEU C  1 93  ? 77.863  20.756  67.039  0.25 23.42  ? 93   LEU C CA    1 
ATOM   5500   C C     A LEU C  1 93  ? 79.057  21.515  67.649  0.25 22.27  ? 93   LEU C C     1 
ATOM   5501   O O     A LEU C  1 93  ? 78.991  22.713  67.843  0.25 22.57  ? 93   LEU C O     1 
ATOM   5502   C CB    A LEU C  1 93  ? 77.140  19.960  68.146  0.25 23.28  ? 93   LEU C CB    1 
ATOM   5503   C CG    A LEU C  1 93  ? 75.819  19.287  67.728  0.25 21.81  ? 93   LEU C CG    1 
ATOM   5504   C CD1   A LEU C  1 93  ? 75.242  18.484  68.897  0.25 22.11  ? 93   LEU C CD1   1 
ATOM   5505   C CD2   A LEU C  1 93  ? 74.838  20.344  67.264  0.25 25.85  ? 93   LEU C CD2   1 
ATOM   5506   N N     A SER C  1 94  ? 80.144  20.812  67.950  0.25 23.56  ? 94   SER C N     1 
ATOM   5507   C CA    A SER C  1 94  ? 81.307  21.482  68.542  0.25 28.31  ? 94   SER C CA    1 
ATOM   5508   C C     A SER C  1 94  ? 81.920  22.515  67.602  0.25 28.14  ? 94   SER C C     1 
ATOM   5509   O O     A SER C  1 94  ? 82.469  23.508  68.055  0.25 28.11  ? 94   SER C O     1 
ATOM   5510   C CB    A SER C  1 94  ? 82.375  20.471  68.966  0.25 27.20  ? 94   SER C CB    1 
ATOM   5511   O OG    A SER C  1 94  ? 82.809  19.695  67.876  0.25 32.76  ? 94   SER C OG    1 
ATOM   5512   N N     A SER C  1 95  ? 81.798  22.302  66.297  0.25 29.24  ? 95   SER C N     1 
ATOM   5513   C CA    A SER C  1 95  ? 82.359  23.244  65.330  0.25 30.04  ? 95   SER C CA    1 
ATOM   5514   C C     A SER C  1 95  ? 81.587  24.545  65.362  0.25 29.14  ? 95   SER C C     1 
ATOM   5515   O O     A SER C  1 95  ? 82.103  25.581  64.949  0.25 25.10  ? 95   SER C O     1 
ATOM   5516   C CB    A SER C  1 95  ? 82.334  22.664  63.905  0.25 34.20  ? 95   SER C CB    1 
ATOM   5517   O OG    A SER C  1 95  ? 81.006  22.503  63.438  0.25 42.24  ? 95   SER C OG    1 
ATOM   5518   N N     A GLN C  1 96  ? 80.338  24.501  65.835  0.25 27.20  ? 96   GLN C N     1 
ATOM   5519   C CA    A GLN C  1 96  ? 79.572  25.731  65.942  0.25 25.10  ? 96   GLN C CA    1 
ATOM   5520   C C     A GLN C  1 96  ? 79.458  26.212  67.392  0.25 27.01  ? 96   GLN C C     1 
ATOM   5521   O O     A GLN C  1 96  ? 78.551  26.980  67.745  0.25 29.05  ? 96   GLN C O     1 
ATOM   5522   C CB    A GLN C  1 96  ? 78.190  25.570  65.302  0.25 28.08  ? 96   GLN C CB    1 
ATOM   5523   C CG    A GLN C  1 96  ? 77.407  24.372  65.792  0.25 25.94  ? 96   GLN C CG    1 
ATOM   5524   C CD    A GLN C  1 96  ? 76.061  24.225  65.086  0.25 28.40  ? 96   GLN C CD    1 
ATOM   5525   O OE1   A GLN C  1 96  ? 75.728  23.150  64.587  0.25 28.57  ? 96   GLN C OE1   1 
ATOM   5526   N NE2   A GLN C  1 96  ? 75.288  25.300  65.046  0.25 23.08  ? 96   GLN C NE2   1 
ATOM   5527   N N     A GLY C  1 97  ? 80.380  25.749  68.231  0.25 25.12  ? 97   GLY C N     1 
ATOM   5528   C CA    A GLY C  1 97  ? 80.408  26.180  69.616  0.25 26.62  ? 97   GLY C CA    1 
ATOM   5529   C C     A GLY C  1 97  ? 79.463  25.503  70.594  0.25 27.34  ? 97   GLY C C     1 
ATOM   5530   O O     A GLY C  1 97  ? 79.191  26.053  71.660  0.25 27.14  ? 97   GLY C O     1 
ATOM   5531   N N     A VAL C  1 98  ? 78.983  24.309  70.255  0.25 26.99  ? 98   VAL C N     1 
ATOM   5532   C CA    A VAL C  1 98  ? 78.064  23.572  71.123  0.25 25.07  ? 98   VAL C CA    1 
ATOM   5533   C C     A VAL C  1 98  ? 78.716  22.247  71.485  0.25 23.90  ? 98   VAL C C     1 
ATOM   5534   O O     A VAL C  1 98  ? 78.840  21.370  70.644  0.25 28.65  ? 98   VAL C O     1 
ATOM   5535   C CB    A VAL C  1 98  ? 76.732  23.341  70.389  0.25 25.09  ? 98   VAL C CB    1 
ATOM   5536   C CG1   A VAL C  1 98  ? 75.773  22.529  71.256  0.25 23.23  ? 98   VAL C CG1   1 
ATOM   5537   C CG2   A VAL C  1 98  ? 76.137  24.693  70.014  0.25 22.13  ? 98   VAL C CG2   1 
ATOM   5538   N N     A GLY C  1 99  ? 79.121  22.095  72.744  0.25 21.78  ? 99   GLY C N     1 
ATOM   5539   C CA    A GLY C  1 99  ? 79.806  20.884  73.149  0.25 21.84  ? 99   GLY C CA    1 
ATOM   5540   C C     A GLY C  1 99  ? 79.037  19.920  74.023  0.25 24.42  ? 99   GLY C C     1 
ATOM   5541   O O     A GLY C  1 99  ? 79.654  19.070  74.677  0.25 22.33  ? 99   GLY C O     1 
ATOM   5542   N N     A ILE C  1 100 ? 77.701  20.005  74.007  0.25 22.79  ? 100  ILE C N     1 
ATOM   5543   C CA    A ILE C  1 100 ? 76.898  19.126  74.862  0.25 23.16  ? 100  ILE C CA    1 
ATOM   5544   C C     A ILE C  1 100 ? 77.122  17.655  74.612  0.25 22.11  ? 100  ILE C C     1 
ATOM   5545   O O     A ILE C  1 100 ? 76.940  16.836  75.518  0.25 27.63  ? 100  ILE C O     1 
ATOM   5546   C CB    A ILE C  1 100 ? 75.386  19.449  74.746  0.25 23.00  ? 100  ILE C CB    1 
ATOM   5547   C CG1   A ILE C  1 100 ? 74.912  19.227  73.307  0.25 25.64  ? 100  ILE C CG1   1 
ATOM   5548   C CG2   A ILE C  1 100 ? 75.134  20.877  75.169  0.25 21.24  ? 100  ILE C CG2   1 
ATOM   5549   C CD1   A ILE C  1 100 ? 73.407  19.421  73.122  0.25 25.76  ? 100  ILE C CD1   1 
ATOM   5550   N N     A TRP C  1 101 ? 77.510  17.292  73.391  0.25 23.53  ? 101  TRP C N     1 
ATOM   5551   C CA    A TRP C  1 101 ? 77.772  15.891  73.081  0.25 22.33  ? 101  TRP C CA    1 
ATOM   5552   C C     A TRP C  1 101 ? 79.256  15.514  73.031  0.25 25.94  ? 101  TRP C C     1 
ATOM   5553   O O     A TRP C  1 101 ? 79.595  14.393  72.647  0.25 25.36  ? 101  TRP C O     1 
ATOM   5554   C CB    A TRP C  1 101 ? 77.101  15.481  71.753  0.25 23.54  ? 101  TRP C CB    1 
ATOM   5555   C CG    A TRP C  1 101 ? 75.617  15.194  71.906  0.25 22.25  ? 101  TRP C CG    1 
ATOM   5556   C CD1   A TRP C  1 101 ? 74.566  16.016  71.561  0.25 22.54  ? 101  TRP C CD1   1 
ATOM   5557   C CD2   A TRP C  1 101 ? 75.040  14.060  72.549  0.25 19.27  ? 101  TRP C CD2   1 
ATOM   5558   N NE1   A TRP C  1 101 ? 73.371  15.456  71.969  0.25 21.83  ? 101  TRP C NE1   1 
ATOM   5559   C CE2   A TRP C  1 101 ? 73.637  14.258  72.580  0.25 20.56  ? 101  TRP C CE2   1 
ATOM   5560   C CE3   A TRP C  1 101 ? 75.571  12.893  73.111  0.25 19.40  ? 101  TRP C CE3   1 
ATOM   5561   C CZ2   A TRP C  1 101 ? 72.767  13.336  73.155  0.25 19.65  ? 101  TRP C CZ2   1 
ATOM   5562   C CZ3   A TRP C  1 101 ? 74.703  11.976  73.686  0.25 23.03  ? 101  TRP C CZ3   1 
ATOM   5563   C CH2   A TRP C  1 101 ? 73.306  12.209  73.704  0.25 16.60  ? 101  TRP C CH2   1 
ATOM   5564   N N     A ASP C  1 102 ? 80.132  16.436  73.414  0.25 27.28  ? 102  ASP C N     1 
ATOM   5565   C CA    A ASP C  1 102 ? 81.576  16.165  73.400  0.25 29.14  ? 102  ASP C CA    1 
ATOM   5566   C C     A ASP C  1 102 ? 81.919  15.074  74.396  0.25 29.19  ? 102  ASP C C     1 
ATOM   5567   O O     A ASP C  1 102 ? 82.772  14.228  74.150  0.25 32.11  ? 102  ASP C O     1 
ATOM   5568   C CB    A ASP C  1 102 ? 82.367  17.441  73.742  0.25 29.74  ? 102  ASP C CB    1 
ATOM   5569   C CG    A ASP C  1 102 ? 82.262  18.502  72.669  0.25 30.11  ? 102  ASP C CG    1 
ATOM   5570   O OD1   A ASP C  1 102 ? 82.829  19.588  72.865  0.25 32.74  ? 102  ASP C OD1   1 
ATOM   5571   O OD2   A ASP C  1 102 ? 81.620  18.259  71.624  0.25 34.17  ? 102  ASP C OD2   1 
ATOM   5572   N N     A GLY C  1 103 ? 81.236  15.083  75.531  0.25 31.99  ? 103  GLY C N     1 
ATOM   5573   C CA    A GLY C  1 103 ? 81.488  14.087  76.553  0.25 29.14  ? 103  GLY C CA    1 
ATOM   5574   C C     A GLY C  1 103 ? 81.271  12.645  76.125  0.25 34.36  ? 103  GLY C C     1 
ATOM   5575   O O     A GLY C  1 103 ? 82.124  11.772  76.380  0.25 36.45  ? 103  GLY C O     1 
ATOM   5576   N N     A ASN C  1 104 ? 80.140  12.360  75.485  0.25 30.19  ? 104  ASN C N     1 
ATOM   5577   C CA    A ASN C  1 104 ? 79.892  10.994  75.054  0.25 30.29  ? 104  ASN C CA    1 
ATOM   5578   C C     A ASN C  1 104 ? 80.447  10.685  73.672  0.25 29.88  ? 104  ASN C C     1 
ATOM   5579   O O     A ASN C  1 104 ? 80.381  9.548   73.224  0.25 34.19  ? 104  ASN C O     1 
ATOM   5580   C CB    A ASN C  1 104 ? 78.391  10.682  75.101  0.25 32.10  ? 104  ASN C CB    1 
ATOM   5581   C CG    A ASN C  1 104 ? 77.818  10.828  76.506  0.25 33.36  ? 104  ASN C CG    1 
ATOM   5582   O OD1   A ASN C  1 104 ? 77.297  11.880  76.875  0.25 37.32  ? 104  ASN C OD1   1 
ATOM   5583   N ND2   A ASN C  1 104 ? 77.949  9.781   77.306  0.25 33.72  ? 104  ASN C ND2   1 
ATOM   5584   N N     A GLY C  1 105 ? 80.987  11.690  72.994  0.25 29.57  ? 105  GLY C N     1 
ATOM   5585   C CA    A GLY C  1 105 ? 81.559  11.464  71.683  0.25 29.87  ? 105  GLY C CA    1 
ATOM   5586   C C     A GLY C  1 105 ? 83.081  11.431  71.716  0.25 32.56  ? 105  GLY C C     1 
ATOM   5587   O O     A GLY C  1 105 ? 83.727  11.235  70.688  0.25 34.25  ? 105  GLY C O     1 
ATOM   5588   N N     A SER C  1 106 ? 83.663  11.626  72.897  0.25 33.64  ? 106  SER C N     1 
ATOM   5589   C CA    A SER C  1 106 ? 85.124  11.637  73.037  0.25 34.54  ? 106  SER C CA    1 
ATOM   5590   C C     A SER C  1 106 ? 85.674  10.242  72.799  0.25 34.55  ? 106  SER C C     1 
ATOM   5591   O O     A SER C  1 106 ? 84.990  9.250   73.024  0.25 36.16  ? 106  SER C O     1 
ATOM   5592   C CB    A SER C  1 106 ? 85.530  12.095  74.445  0.25 28.91  ? 106  SER C CB    1 
ATOM   5593   O OG    A SER C  1 106 ? 85.171  11.104  75.394  0.25 34.00  ? 106  SER C OG    1 
ATOM   5594   N N     A LYS C  1 107 ? 86.920  10.144  72.376  0.25 35.70  ? 107  LYS C N     1 
ATOM   5595   C CA    A LYS C  1 107 ? 87.514  8.849   72.142  0.25 35.74  ? 107  LYS C CA    1 
ATOM   5596   C C     A LYS C  1 107 ? 87.474  7.975   73.400  0.25 36.67  ? 107  LYS C C     1 
ATOM   5597   O O     A LYS C  1 107 ? 87.115  6.799   73.343  0.25 39.09  ? 107  LYS C O     1 
ATOM   5598   C CB    A LYS C  1 107 ? 88.959  9.035   71.679  0.25 40.79  ? 107  LYS C CB    1 
ATOM   5599   C CG    A LYS C  1 107 ? 89.584  7.806   71.028  0.25 45.37  ? 107  LYS C CG    1 
ATOM   5600   C CD    A LYS C  1 107 ? 88.987  7.487   69.648  0.25 48.01  ? 107  LYS C CD    1 
ATOM   5601   C CE    A LYS C  1 107 ? 89.701  6.280   69.033  0.25 49.48  ? 107  LYS C CE    1 
ATOM   5602   N NZ    A LYS C  1 107 ? 89.177  5.869   67.690  0.25 50.91  ? 107  LYS C NZ    1 
ATOM   5603   N N     A GLU C  1 108 ? 87.824  8.545   74.544  0.25 36.32  ? 108  GLU C N     1 
ATOM   5604   C CA    A GLU C  1 108 ? 87.851  7.771   75.783  0.25 36.60  ? 108  GLU C CA    1 
ATOM   5605   C C     A GLU C  1 108 ? 86.512  7.143   76.093  0.25 36.32  ? 108  GLU C C     1 
ATOM   5606   O O     A GLU C  1 108 ? 86.434  5.989   76.512  0.25 37.45  ? 108  GLU C O     1 
ATOM   5607   C CB    A GLU C  1 108 ? 88.291  8.653   76.968  0.25 36.52  ? 108  GLU C CB    1 
ATOM   5608   N N     A PHE C  1 109 ? 85.442  7.897   75.896  0.25 35.12  ? 109  PHE C N     1 
ATOM   5609   C CA    A PHE C  1 109 ? 84.155  7.316   76.198  0.25 33.20  ? 109  PHE C CA    1 
ATOM   5610   C C     A PHE C  1 109 ? 83.797  6.259   75.179  0.25 33.16  ? 109  PHE C C     1 
ATOM   5611   O O     A PHE C  1 109 ? 83.360  5.175   75.550  0.25 36.92  ? 109  PHE C O     1 
ATOM   5612   C CB    A PHE C  1 109 ? 83.055  8.361   76.242  0.25 31.08  ? 109  PHE C CB    1 
ATOM   5613   C CG    A PHE C  1 109 ? 81.741  7.793   76.659  0.25 32.42  ? 109  PHE C CG    1 
ATOM   5614   C CD1   A PHE C  1 109 ? 81.467  7.578   78.008  0.25 33.35  ? 109  PHE C CD1   1 
ATOM   5615   C CD2   A PHE C  1 109 ? 80.791  7.418   75.706  0.25 30.47  ? 109  PHE C CD2   1 
ATOM   5616   C CE1   A PHE C  1 109 ? 80.266  7.000   78.414  0.25 33.13  ? 109  PHE C CE1   1 
ATOM   5617   C CE2   A PHE C  1 109 ? 79.581  6.838   76.095  0.25 32.93  ? 109  PHE C CE2   1 
ATOM   5618   C CZ    A PHE C  1 109 ? 79.315  6.628   77.454  0.25 31.74  ? 109  PHE C CZ    1 
ATOM   5619   N N     A LEU C  1 110 ? 83.987  6.561   73.897  0.25 34.51  ? 110  LEU C N     1 
ATOM   5620   C CA    A LEU C  1 110 ? 83.676  5.588   72.843  0.25 33.69  ? 110  LEU C CA    1 
ATOM   5621   C C     A LEU C  1 110 ? 84.440  4.281   73.051  0.25 36.31  ? 110  LEU C C     1 
ATOM   5622   O O     A LEU C  1 110 ? 83.853  3.196   72.988  0.25 34.88  ? 110  LEU C O     1 
ATOM   5623   C CB    A LEU C  1 110 ? 84.010  6.170   71.461  0.25 31.60  ? 110  LEU C CB    1 
ATOM   5624   C CG    A LEU C  1 110 ? 83.142  7.352   71.025  0.25 31.24  ? 110  LEU C CG    1 
ATOM   5625   C CD1   A LEU C  1 110 ? 83.623  7.907   69.689  0.25 30.63  ? 110  LEU C CD1   1 
ATOM   5626   C CD2   A LEU C  1 110 ? 81.685  6.884   70.928  0.25 31.35  ? 110  LEU C CD2   1 
ATOM   5627   N N     A GLU C  1 111 ? 85.747  4.378   73.293  0.25 39.17  ? 111  GLU C N     1 
ATOM   5628   C CA    A GLU C  1 111 ? 86.555  3.183   73.506  0.25 41.83  ? 111  GLU C CA    1 
ATOM   5629   C C     A GLU C  1 111 ? 86.060  2.478   74.759  0.25 42.39  ? 111  GLU C C     1 
ATOM   5630   O O     A GLU C  1 111 ? 86.063  1.253   74.853  0.25 44.05  ? 111  GLU C O     1 
ATOM   5631   C CB    A GLU C  1 111 ? 88.040  3.562   73.647  0.25 46.64  ? 111  GLU C CB    1 
ATOM   5632   C CG    A GLU C  1 111 ? 88.664  4.101   72.345  0.25 51.92  ? 111  GLU C CG    1 
ATOM   5633   C CD    A GLU C  1 111 ? 90.149  4.381   72.481  0.25 54.75  ? 111  GLU C CD    1 
ATOM   5634   O OE1   A GLU C  1 111 ? 90.885  3.462   72.903  0.25 57.66  ? 111  GLU C OE1   1 
ATOM   5635   O OE2   A GLU C  1 111 ? 90.578  5.515   72.164  0.25 56.34  ? 111  GLU C OE2   1 
ATOM   5636   N N     A LYS C  1 112 ? 85.602  3.266   75.717  0.25 42.35  ? 112  LYS C N     1 
ATOM   5637   C CA    A LYS C  1 112 ? 85.111  2.741   76.983  0.25 43.04  ? 112  LYS C CA    1 
ATOM   5638   C C     A LYS C  1 112 ? 83.871  1.862   76.814  0.25 43.83  ? 112  LYS C C     1 
ATOM   5639   O O     A LYS C  1 112 ? 83.684  0.881   77.533  0.25 43.76  ? 112  LYS C O     1 
ATOM   5640   C CB    A LYS C  1 112 ? 84.812  3.914   77.917  0.25 45.85  ? 112  LYS C CB    1 
ATOM   5641   C CG    A LYS C  1 112 ? 84.253  3.552   79.273  0.25 48.66  ? 112  LYS C CG    1 
ATOM   5642   C CD    A LYS C  1 112 ? 83.963  4.828   80.052  0.25 52.53  ? 112  LYS C CD    1 
ATOM   5643   C CE    A LYS C  1 112 ? 83.261  4.555   81.372  0.25 54.21  ? 112  LYS C CE    1 
ATOM   5644   N NZ    A LYS C  1 112 ? 82.983  5.826   82.105  0.25 56.22  ? 112  LYS C NZ    1 
ATOM   5645   N N     A VAL C  1 113 ? 83.012  2.209   75.862  0.25 42.05  ? 113  VAL C N     1 
ATOM   5646   C CA    A VAL C  1 113 ? 81.804  1.421   75.629  0.25 39.55  ? 113  VAL C CA    1 
ATOM   5647   C C     A VAL C  1 113 ? 81.934  0.433   74.471  0.25 39.02  ? 113  VAL C C     1 
ATOM   5648   O O     A VAL C  1 113 ? 80.929  -0.010  73.914  0.25 38.72  ? 113  VAL C O     1 
ATOM   5649   C CB    A VAL C  1 113 ? 80.569  2.328   75.352  0.25 40.06  ? 113  VAL C CB    1 
ATOM   5650   C CG1   A VAL C  1 113 ? 80.191  3.093   76.612  0.25 39.76  ? 113  VAL C CG1   1 
ATOM   5651   C CG2   A VAL C  1 113 ? 80.875  3.308   74.213  0.25 39.97  ? 113  VAL C CG2   1 
ATOM   5652   N N     A GLY C  1 114 ? 83.164  0.088   74.105  0.25 39.05  ? 114  GLY C N     1 
ATOM   5653   C CA    A GLY C  1 114 ? 83.363  -0.860  73.020  0.25 34.91  ? 114  GLY C CA    1 
ATOM   5654   C C     A GLY C  1 114 ? 83.224  -0.308  71.611  0.25 34.72  ? 114  GLY C C     1 
ATOM   5655   O O     A GLY C  1 114 ? 83.015  -1.084  70.676  0.25 36.35  ? 114  GLY C O     1 
ATOM   5656   N N     A LEU C  1 115 ? 83.347  1.007   71.434  0.25 32.09  ? 115  LEU C N     1 
ATOM   5657   C CA    A LEU C  1 115 ? 83.236  1.597   70.106  0.25 29.82  ? 115  LEU C CA    1 
ATOM   5658   C C     A LEU C  1 115 ? 84.547  2.307   69.728  0.25 29.98  ? 115  LEU C C     1 
ATOM   5659   O O     A LEU C  1 115 ? 84.518  3.393   69.150  0.25 27.90  ? 115  LEU C O     1 
ATOM   5660   C CB    A LEU C  1 115 ? 82.078  2.600   70.081  0.25 30.66  ? 115  LEU C CB    1 
ATOM   5661   C CG    A LEU C  1 115 ? 80.704  2.041   70.487  0.25 32.05  ? 115  LEU C CG    1 
ATOM   5662   C CD1   A LEU C  1 115 ? 79.683  3.175   70.678  0.25 30.23  ? 115  LEU C CD1   1 
ATOM   5663   C CD2   A LEU C  1 115 ? 80.221  1.075   69.413  0.25 29.86  ? 115  LEU C CD2   1 
ATOM   5664   N N     A GLY C  1 116 ? 85.679  1.672   70.042  0.25 29.62  ? 116  GLY C N     1 
ATOM   5665   C CA    A GLY C  1 116 ? 86.984  2.263   69.746  0.25 30.98  ? 116  GLY C CA    1 
ATOM   5666   C C     A GLY C  1 116 ? 87.334  2.399   68.279  0.25 30.21  ? 116  GLY C C     1 
ATOM   5667   O O     A GLY C  1 116 ? 88.225  3.176   67.928  0.25 34.71  ? 116  GLY C O     1 
ATOM   5668   N N     A HIS C  1 117 ? 86.629  1.669   67.421  0.25 30.46  ? 117  HIS C N     1 
ATOM   5669   C CA    A HIS C  1 117 ? 86.880  1.713   65.983  0.25 30.06  ? 117  HIS C CA    1 
ATOM   5670   C C     A HIS C  1 117 ? 86.332  2.977   65.328  0.25 30.93  ? 117  HIS C C     1 
ATOM   5671   O O     A HIS C  1 117 ? 86.544  3.225   64.146  0.25 32.14  ? 117  HIS C O     1 
ATOM   5672   C CB    A HIS C  1 117 ? 86.243  0.487   65.334  0.25 33.39  ? 117  HIS C CB    1 
ATOM   5673   C CG    A HIS C  1 117 ? 84.757  0.411   65.522  0.25 32.95  ? 117  HIS C CG    1 
ATOM   5674   N ND1   A HIS C  1 117 ? 83.863  0.991   64.644  0.25 36.58  ? 117  HIS C ND1   1 
ATOM   5675   C CD2   A HIS C  1 117 ? 84.009  -0.171  66.490  0.25 32.51  ? 117  HIS C CD2   1 
ATOM   5676   C CE1   A HIS C  1 117 ? 82.628  0.763   65.060  0.25 32.73  ? 117  HIS C CE1   1 
ATOM   5677   N NE2   A HIS C  1 117 ? 82.689  0.061   66.179  0.25 32.72  ? 117  HIS C NE2   1 
ATOM   5678   N N     A ARG C  1 118 ? 85.612  3.786   66.099  0.25 31.04  ? 118  ARG C N     1 
ATOM   5679   C CA    A ARG C  1 118 ? 85.033  4.997   65.539  0.25 31.01  ? 118  ARG C CA    1 
ATOM   5680   C C     A ARG C  1 118 ? 85.888  6.221   65.800  0.25 31.16  ? 118  ARG C C     1 
ATOM   5681   O O     A ARG C  1 118 ? 86.593  6.272   66.809  0.25 30.75  ? 118  ARG C O     1 
ATOM   5682   C CB    A ARG C  1 118 ? 83.663  5.222   66.148  0.25 33.01  ? 118  ARG C CB    1 
ATOM   5683   C CG    A ARG C  1 118 ? 82.665  4.209   65.756  0.25 32.87  ? 118  ARG C CG    1 
ATOM   5684   C CD    A ARG C  1 118 ? 81.480  4.996   65.283  0.25 29.89  ? 118  ARG C CD    1 
ATOM   5685   N NE    A ARG C  1 118 ? 80.371  4.181   65.509  0.25 30.42  ? 118  ARG C NE    1 
ATOM   5686   C CZ    A ARG C  1 118 ? 79.385  4.129   66.379  0.25 27.09  ? 118  ARG C CZ    1 
ATOM   5687   N NH1   A ARG C  1 118 ? 79.094  4.938   67.388  0.25 26.74  ? 118  ARG C NH1   1 
ATOM   5688   N NH2   A ARG C  1 118 ? 78.719  3.018   66.202  0.25 28.81  ? 118  ARG C NH2   1 
ATOM   5689   N N     A ARG C  1 119 ? 85.831  7.198   64.895  0.25 31.36  ? 119  ARG C N     1 
ATOM   5690   C CA    A ARG C  1 119 ? 86.580  8.420   65.096  0.25 32.65  ? 119  ARG C CA    1 
ATOM   5691   C C     A ARG C  1 119 ? 85.819  9.225   66.150  0.25 34.97  ? 119  ARG C C     1 
ATOM   5692   O O     A ARG C  1 119 ? 84.594  9.049   66.329  0.25 34.19  ? 119  ARG C O     1 
ATOM   5693   C CB    A ARG C  1 119 ? 86.693  9.220   63.798  0.25 32.41  ? 119  ARG C CB    1 
ATOM   5694   C CG    A ARG C  1 119 ? 85.388  9.784   63.269  0.25 36.90  ? 119  ARG C CG    1 
ATOM   5695   C CD    A ARG C  1 119 ? 85.667  10.918  62.296  0.25 35.55  ? 119  ARG C CD    1 
ATOM   5696   N NE    A ARG C  1 119 ? 84.453  11.612  61.886  0.25 37.48  ? 119  ARG C NE    1 
ATOM   5697   C CZ    A ARG C  1 119 ? 83.828  11.403  60.734  0.25 38.31  ? 119  ARG C CZ    1 
ATOM   5698   N NH1   A ARG C  1 119 ? 82.723  12.084  60.441  0.25 37.19  ? 119  ARG C NH1   1 
ATOM   5699   N NH2   A ARG C  1 119 ? 84.319  10.519  59.870  0.25 40.11  ? 119  ARG C NH2   1 
ATOM   5700   N N     A GLU C  1 120 ? 86.536  10.100  66.848  0.25 32.31  ? 120  GLU C N     1 
ATOM   5701   C CA    A GLU C  1 120 ? 85.936  10.905  67.893  0.25 31.00  ? 120  GLU C CA    1 
ATOM   5702   C C     A GLU C  1 120 ? 84.750  11.687  67.361  0.25 27.50  ? 120  GLU C C     1 
ATOM   5703   O O     A GLU C  1 120 ? 84.832  12.281  66.299  0.25 26.20  ? 120  GLU C O     1 
ATOM   5704   C CB    A GLU C  1 120 ? 86.984  11.872  68.461  0.25 31.51  ? 120  GLU C CB    1 
ATOM   5705   C CG    A GLU C  1 120 ? 86.477  12.671  69.656  0.25 35.09  ? 120  GLU C CG    1 
ATOM   5706   C CD    A GLU C  1 120 ? 87.580  13.487  70.287  0.25 36.65  ? 120  GLU C CD    1 
ATOM   5707   O OE1   A GLU C  1 120 ? 87.967  14.515  69.690  0.25 39.90  ? 120  GLU C OE1   1 
ATOM   5708   O OE2   A GLU C  1 120 ? 88.063  13.085  71.368  0.25 38.05  ? 120  GLU C OE2   1 
ATOM   5709   N N     A GLY C  1 121 ? 83.647  11.687  68.108  0.25 27.97  ? 121  GLY C N     1 
ATOM   5710   C CA    A GLY C  1 121 ? 82.473  12.435  67.675  0.25 26.10  ? 121  GLY C CA    1 
ATOM   5711   C C     A GLY C  1 121 ? 81.433  11.622  66.930  0.25 24.76  ? 121  GLY C C     1 
ATOM   5712   O O     A GLY C  1 121 ? 80.285  12.069  66.764  0.25 25.29  ? 121  GLY C O     1 
ATOM   5713   N N     A ASP C  1 122 ? 81.822  10.447  66.456  0.25 23.28  ? 122  ASP C N     1 
ATOM   5714   C CA    A ASP C  1 122 ? 80.877  9.586   65.734  0.25 25.15  ? 122  ASP C CA    1 
ATOM   5715   C C     A ASP C  1 122 ? 80.074  8.785   66.761  0.25 23.73  ? 122  ASP C C     1 
ATOM   5716   O O     A ASP C  1 122 ? 80.505  7.719   67.204  0.25 22.50  ? 122  ASP C O     1 
ATOM   5717   C CB    A ASP C  1 122 ? 81.634  8.640   64.820  0.25 26.94  ? 122  ASP C CB    1 
ATOM   5718   C CG    A ASP C  1 122 ? 80.709  7.762   63.989  0.25 30.84  ? 122  ASP C CG    1 
ATOM   5719   O OD1   A ASP C  1 122 ? 79.470  7.760   64.211  0.25 25.77  ? 122  ASP C OD1   1 
ATOM   5720   O OD2   A ASP C  1 122 ? 81.247  7.053   63.122  0.25 28.68  ? 122  ASP C OD2   1 
ATOM   5721   N N     A LEU C  1 123 ? 78.912  9.316   67.127  0.25 22.51  ? 123  LEU C N     1 
ATOM   5722   C CA    A LEU C  1 123 ? 78.049  8.709   68.145  0.25 22.23  ? 123  LEU C CA    1 
ATOM   5723   C C     A LEU C  1 123 ? 77.332  7.440   67.717  0.25 21.64  ? 123  LEU C C     1 
ATOM   5724   O O     A LEU C  1 123 ? 76.836  6.684   68.541  0.25 22.18  ? 123  LEU C O     1 
ATOM   5725   C CB    A LEU C  1 123 ? 77.018  9.747   68.612  0.25 23.79  ? 123  LEU C CB    1 
ATOM   5726   C CG    A LEU C  1 123 ? 77.582  11.065  69.176  0.25 23.43  ? 123  LEU C CG    1 
ATOM   5727   C CD1   A LEU C  1 123 ? 76.442  12.055  69.427  0.25 22.21  ? 123  LEU C CD1   1 
ATOM   5728   C CD2   A LEU C  1 123 ? 78.341  10.792  70.477  0.25 23.16  ? 123  LEU C CD2   1 
ATOM   5729   N N     A GLY C  1 124 ? 77.255  7.200   66.418  0.25 22.18  ? 124  GLY C N     1 
ATOM   5730   C CA    A GLY C  1 124 ? 76.558  6.010   65.976  0.25 21.46  ? 124  GLY C CA    1 
ATOM   5731   C C     A GLY C  1 124 ? 75.169  6.390   65.490  0.25 20.71  ? 124  GLY C C     1 
ATOM   5732   O O     A GLY C  1 124 ? 74.902  7.575   65.328  0.25 19.21  ? 124  GLY C O     1 
ATOM   5733   N N     A PRO C  1 125 ? 74.273  5.414   65.248  0.25 20.96  ? 125  PRO C N     1 
ATOM   5734   C CA    A PRO C  1 125 ? 72.907  5.662   64.765  0.25 20.57  ? 125  PRO C CA    1 
ATOM   5735   C C     A PRO C  1 125 ? 71.959  6.173   65.829  0.25 21.30  ? 125  PRO C C     1 
ATOM   5736   O O     A PRO C  1 125 ? 70.949  5.500   66.130  0.25 21.30  ? 125  PRO C O     1 
ATOM   5737   C CB    A PRO C  1 125 ? 72.487  4.298   64.238  0.25 19.26  ? 125  PRO C CB    1 
ATOM   5738   C CG    A PRO C  1 125 ? 73.146  3.369   65.223  0.25 21.51  ? 125  PRO C CG    1 
ATOM   5739   C CD    A PRO C  1 125 ? 74.536  3.969   65.359  0.25 20.22  ? 125  PRO C CD    1 
ATOM   5740   N N     A VAL C  1 126 ? 72.279  7.342   66.390  0.25 19.35  ? 126  VAL C N     1 
ATOM   5741   C CA    A VAL C  1 126 ? 71.466  7.939   67.448  0.25 22.82  ? 126  VAL C CA    1 
ATOM   5742   C C     A VAL C  1 126 ? 70.307  8.792   66.897  0.25 22.81  ? 126  VAL C C     1 
ATOM   5743   O O     A VAL C  1 126 ? 70.070  8.831   65.684  0.25 24.60  ? 126  VAL C O     1 
ATOM   5744   C CB    A VAL C  1 126 ? 72.340  8.811   68.419  0.25 19.93  ? 126  VAL C CB    1 
ATOM   5745   C CG1   A VAL C  1 126 ? 73.353  7.945   69.145  0.25 18.48  ? 126  VAL C CG1   1 
ATOM   5746   C CG2   A VAL C  1 126 ? 73.041  9.886   67.662  0.25 19.16  ? 126  VAL C CG2   1 
ATOM   5747   N N     A TYR C  1 127 ? 69.607  9.469   67.801  0.25 22.80  ? 127  TYR C N     1 
ATOM   5748   C CA    A TYR C  1 127 ? 68.446  10.298  67.483  0.25 23.41  ? 127  TYR C CA    1 
ATOM   5749   C C     A TYR C  1 127 ? 68.152  10.621  66.026  0.25 23.95  ? 127  TYR C C     1 
ATOM   5750   O O     A TYR C  1 127 ? 67.289  10.008  65.410  0.25 22.73  ? 127  TYR C O     1 
ATOM   5751   C CB    A TYR C  1 127 ? 68.513  11.618  68.268  0.25 25.24  ? 127  TYR C CB    1 
ATOM   5752   C CG    A TYR C  1 127 ? 68.548  11.429  69.765  0.25 26.47  ? 127  TYR C CG    1 
ATOM   5753   C CD1   A TYR C  1 127 ? 67.458  10.904  70.445  0.25 25.37  ? 127  TYR C CD1   1 
ATOM   5754   C CD2   A TYR C  1 127 ? 69.684  11.782  70.506  0.25 28.54  ? 127  TYR C CD2   1 
ATOM   5755   C CE1   A TYR C  1 127 ? 67.490  10.736  71.828  0.25 27.72  ? 127  TYR C CE1   1 
ATOM   5756   C CE2   A TYR C  1 127 ? 69.727  11.615  71.892  0.25 27.60  ? 127  TYR C CE2   1 
ATOM   5757   C CZ    A TYR C  1 127 ? 68.628  11.092  72.547  0.25 27.53  ? 127  TYR C CZ    1 
ATOM   5758   O OH    A TYR C  1 127 ? 68.672  10.911  73.920  0.25 27.54  ? 127  TYR C OH    1 
ATOM   5759   N N     A GLY C  1 128 ? 68.855  11.616  65.498  0.25 24.18  ? 128  GLY C N     1 
ATOM   5760   C CA    A GLY C  1 128 ? 68.667  12.045  64.127  0.25 22.19  ? 128  GLY C CA    1 
ATOM   5761   C C     A GLY C  1 128 ? 68.636  10.955  63.067  0.25 22.79  ? 128  GLY C C     1 
ATOM   5762   O O     A GLY C  1 128 ? 67.813  10.999  62.142  0.25 22.99  ? 128  GLY C O     1 
ATOM   5763   N N     A PHE C  1 129 ? 69.528  9.983   63.184  0.25 21.58  ? 129  PHE C N     1 
ATOM   5764   C CA    A PHE C  1 129 ? 69.584  8.913   62.211  0.25 21.79  ? 129  PHE C CA    1 
ATOM   5765   C C     A PHE C  1 129 ? 68.295  8.062   62.258  0.25 22.91  ? 129  PHE C C     1 
ATOM   5766   O O     A PHE C  1 129 ? 67.742  7.706   61.217  0.25 20.42  ? 129  PHE C O     1 
ATOM   5767   C CB    A PHE C  1 129 ? 70.814  8.028   62.484  0.25 17.83  ? 129  PHE C CB    1 
ATOM   5768   C CG    A PHE C  1 129 ? 70.930  6.872   61.562  0.25 21.44  ? 129  PHE C CG    1 
ATOM   5769   C CD1   A PHE C  1 129 ? 70.341  5.648   61.882  0.25 20.40  ? 129  PHE C CD1   1 
ATOM   5770   C CD2   A PHE C  1 129 ? 71.623  6.996   60.355  0.25 21.00  ? 129  PHE C CD2   1 
ATOM   5771   C CE1   A PHE C  1 129 ? 70.437  4.559   61.015  0.25 19.34  ? 129  PHE C CE1   1 
ATOM   5772   C CE2   A PHE C  1 129 ? 71.730  5.907   59.477  0.25 22.17  ? 129  PHE C CE2   1 
ATOM   5773   C CZ    A PHE C  1 129 ? 71.132  4.684   59.811  0.25 19.81  ? 129  PHE C CZ    1 
ATOM   5774   N N     A GLN C  1 130 ? 67.837  7.735   63.463  0.25 20.62  ? 130  GLN C N     1 
ATOM   5775   C CA    A GLN C  1 130 ? 66.627  6.926   63.606  0.25 22.34  ? 130  GLN C CA    1 
ATOM   5776   C C     A GLN C  1 130 ? 65.421  7.698   63.100  0.25 20.53  ? 130  GLN C C     1 
ATOM   5777   O O     A GLN C  1 130 ? 64.566  7.132   62.424  0.25 23.67  ? 130  GLN C O     1 
ATOM   5778   C CB    A GLN C  1 130 ? 66.403  6.539   65.071  0.25 20.70  ? 130  GLN C CB    1 
ATOM   5779   C CG    A GLN C  1 130 ? 67.490  5.655   65.682  0.25 21.85  ? 130  GLN C CG    1 
ATOM   5780   C CD    A GLN C  1 130 ? 67.711  4.366   64.896  0.25 23.47  ? 130  GLN C CD    1 
ATOM   5781   O OE1   A GLN C  1 130 ? 66.771  3.798   64.306  0.25 21.26  ? 130  GLN C OE1   1 
ATOM   5782   N NE2   A GLN C  1 130 ? 68.956  3.882   64.895  0.25 19.87  ? 130  GLN C NE2   1 
ATOM   5783   N N     A TRP C  1 131 ? 65.373  8.992   63.416  0.25 22.89  ? 131  TRP C N     1 
ATOM   5784   C CA    A TRP C  1 131 ? 64.274  9.876   63.002  0.25 23.50  ? 131  TRP C CA    1 
ATOM   5785   C C     A TRP C  1 131 ? 64.067  9.924   61.485  0.25 26.38  ? 131  TRP C C     1 
ATOM   5786   O O     A TRP C  1 131 ? 62.920  9.874   61.009  0.25 22.46  ? 131  TRP C O     1 
ATOM   5787   C CB    A TRP C  1 131 ? 64.524  11.307  63.489  0.25 23.68  ? 131  TRP C CB    1 
ATOM   5788   C CG    A TRP C  1 131 ? 64.258  11.556  64.953  0.25 22.03  ? 131  TRP C CG    1 
ATOM   5789   C CD1   A TRP C  1 131 ? 64.087  10.625  65.921  0.25 20.20  ? 131  TRP C CD1   1 
ATOM   5790   C CD2   A TRP C  1 131 ? 64.152  12.832  65.598  0.25 24.28  ? 131  TRP C CD2   1 
ATOM   5791   N NE1   A TRP C  1 131 ? 63.875  11.227  67.129  0.25 20.21  ? 131  TRP C NE1   1 
ATOM   5792   C CE2   A TRP C  1 131 ? 63.909  12.586  66.963  0.25 24.17  ? 131  TRP C CE2   1 
ATOM   5793   C CE3   A TRP C  1 131 ? 64.241  14.163  65.154  0.25 24.26  ? 131  TRP C CE3   1 
ATOM   5794   C CZ2   A TRP C  1 131 ? 63.750  13.622  67.898  0.25 23.03  ? 131  TRP C CZ2   1 
ATOM   5795   C CZ3   A TRP C  1 131 ? 64.085  15.190  66.082  0.25 21.62  ? 131  TRP C CZ3   1 
ATOM   5796   C CH2   A TRP C  1 131 ? 63.841  14.913  67.433  0.25 23.65  ? 131  TRP C CH2   1 
ATOM   5797   N N     A ARG C  1 132 ? 65.168  10.006  60.733  0.25 23.12  ? 132  ARG C N     1 
ATOM   5798   C CA    A ARG C  1 132 ? 65.090  10.122  59.275  0.25 22.55  ? 132  ARG C CA    1 
ATOM   5799   C C     A ARG C  1 132 ? 65.448  8.864   58.469  0.25 23.94  ? 132  ARG C C     1 
ATOM   5800   O O     A ARG C  1 132 ? 65.104  8.779   57.289  0.25 23.74  ? 132  ARG C O     1 
ATOM   5801   C CB    A ARG C  1 132 ? 66.000  11.284  58.781  0.25 24.20  ? 132  ARG C CB    1 
ATOM   5802   C CG    A ARG C  1 132 ? 65.884  12.607  59.556  0.25 25.11  ? 132  ARG C CG    1 
ATOM   5803   C CD    A ARG C  1 132 ? 64.455  13.140  59.640  0.25 22.70  ? 132  ARG C CD    1 
ATOM   5804   N NE    A ARG C  1 132 ? 63.862  13.448  58.346  0.25 23.54  ? 132  ARG C NE    1 
ATOM   5805   C CZ    A ARG C  1 132 ? 64.026  14.582  57.670  0.25 22.46  ? 132  ARG C CZ    1 
ATOM   5806   N NH1   A ARG C  1 132 ? 64.782  15.562  58.139  0.25 24.18  ? 132  ARG C NH1   1 
ATOM   5807   N NH2   A ARG C  1 132 ? 63.392  14.751  56.525  0.25 21.87  ? 132  ARG C NH2   1 
ATOM   5808   N N     A HIS C  1 133 ? 66.107  7.889   59.096  0.25 21.25  ? 133  HIS C N     1 
ATOM   5809   C CA    A HIS C  1 133 ? 66.549  6.689   58.390  0.25 22.15  ? 133  HIS C CA    1 
ATOM   5810   C C     A HIS C  1 133 ? 66.363  5.401   59.191  0.25 22.56  ? 133  HIS C C     1 
ATOM   5811   O O     A HIS C  1 133 ? 67.174  4.465   59.081  0.25 20.92  ? 133  HIS C O     1 
ATOM   5812   C CB    A HIS C  1 133 ? 68.038  6.829   58.048  0.25 21.81  ? 133  HIS C CB    1 
ATOM   5813   C CG    A HIS C  1 133 ? 68.385  8.119   57.371  0.25 22.72  ? 133  HIS C CG    1 
ATOM   5814   N ND1   A HIS C  1 133 ? 68.012  8.405   56.075  0.25 22.69  ? 133  HIS C ND1   1 
ATOM   5815   C CD2   A HIS C  1 133 ? 69.081  9.198   57.808  0.25 22.85  ? 133  HIS C CD2   1 
ATOM   5816   C CE1   A HIS C  1 133 ? 68.464  9.601   55.740  0.25 19.50  ? 133  HIS C CE1   1 
ATOM   5817   N NE2   A HIS C  1 133 ? 69.113  10.103  56.776  0.25 19.92  ? 133  HIS C NE2   1 
ATOM   5818   N N     A PHE C  1 134 ? 65.294  5.321   59.981  0.25 22.07  ? 134  PHE C N     1 
ATOM   5819   C CA    A PHE C  1 134 ? 65.079  4.140   60.792  0.25 19.10  ? 134  PHE C CA    1 
ATOM   5820   C C     A PHE C  1 134 ? 65.141  2.853   59.982  0.25 22.04  ? 134  PHE C C     1 
ATOM   5821   O O     A PHE C  1 134 ? 64.471  2.716   58.959  0.25 22.66  ? 134  PHE C O     1 
ATOM   5822   C CB    A PHE C  1 134 ? 63.729  4.221   61.526  0.25 18.43  ? 134  PHE C CB    1 
ATOM   5823   C CG    A PHE C  1 134 ? 63.551  3.152   62.541  0.25 18.22  ? 134  PHE C CG    1 
ATOM   5824   C CD1   A PHE C  1 134 ? 63.297  1.843   62.143  0.25 22.01  ? 134  PHE C CD1   1 
ATOM   5825   C CD2   A PHE C  1 134 ? 63.651  3.441   63.908  0.25 22.54  ? 134  PHE C CD2   1 
ATOM   5826   C CE1   A PHE C  1 134 ? 63.145  0.829   63.080  0.25 21.88  ? 134  PHE C CE1   1 
ATOM   5827   C CE2   A PHE C  1 134 ? 63.502  2.425   64.871  0.25 23.82  ? 134  PHE C CE2   1 
ATOM   5828   C CZ    A PHE C  1 134 ? 63.251  1.123   64.456  0.25 25.40  ? 134  PHE C CZ    1 
ATOM   5829   N N     A GLY C  1 135 ? 65.932  1.894   60.459  0.25 20.88  ? 135  GLY C N     1 
ATOM   5830   C CA    A GLY C  1 135 ? 66.055  0.646   59.741  0.25 24.61  ? 135  GLY C CA    1 
ATOM   5831   C C     A GLY C  1 135 ? 67.232  0.564   58.785  0.25 24.93  ? 135  GLY C C     1 
ATOM   5832   O O     A GLY C  1 135 ? 67.684  -0.518  58.439  0.25 28.66  ? 135  GLY C O     1 
ATOM   5833   N N     A ALA C  1 136 ? 67.743  1.698   58.346  0.25 25.49  ? 136  ALA C N     1 
ATOM   5834   C CA    A ALA C  1 136 ? 68.883  1.681   57.449  0.25 24.36  ? 136  ALA C CA    1 
ATOM   5835   C C     A ALA C  1 136 ? 70.125  1.114   58.143  0.25 25.89  ? 136  ALA C C     1 
ATOM   5836   O O     A ALA C  1 136 ? 70.243  1.131   59.364  0.25 25.11  ? 136  ALA C O     1 
ATOM   5837   C CB    A ALA C  1 136 ? 69.172  3.079   56.943  0.25 19.58  ? 136  ALA C CB    1 
ATOM   5838   N N     A GLU C  1 137 ? 71.039  0.591   57.340  0.25 26.65  ? 137  GLU C N     1 
ATOM   5839   C CA    A GLU C  1 137 ? 72.280  0.017   57.840  0.25 31.10  ? 137  GLU C CA    1 
ATOM   5840   C C     A GLU C  1 137 ? 73.271  1.160   58.146  0.25 26.93  ? 137  GLU C C     1 
ATOM   5841   O O     A GLU C  1 137 ? 73.536  2.007   57.313  0.25 28.12  ? 137  GLU C O     1 
ATOM   5842   C CB    A GLU C  1 137 ? 72.877  -0.918  56.778  0.25 34.34  ? 137  GLU C CB    1 
ATOM   5843   C CG    A GLU C  1 137 ? 74.150  -1.621  57.214  0.25 43.87  ? 137  GLU C CG    1 
ATOM   5844   C CD    A GLU C  1 137 ? 74.890  -2.256  56.047  0.25 49.72  ? 137  GLU C CD    1 
ATOM   5845   O OE1   A GLU C  1 137 ? 74.235  -2.961  55.243  0.25 51.75  ? 137  GLU C OE1   1 
ATOM   5846   O OE2   A GLU C  1 137 ? 76.125  -2.055  55.938  0.25 53.99  ? 137  GLU C OE2   1 
ATOM   5847   N N     A TYR C  1 138 ? 73.815  1.181   59.346  0.25 25.56  ? 138  TYR C N     1 
ATOM   5848   C CA    A TYR C  1 138 ? 74.738  2.250   59.708  0.25 26.95  ? 138  TYR C CA    1 
ATOM   5849   C C     A TYR C  1 138 ? 76.189  1.822   59.503  0.25 26.40  ? 138  TYR C C     1 
ATOM   5850   O O     A TYR C  1 138 ? 76.583  0.748   59.920  0.25 28.31  ? 138  TYR C O     1 
ATOM   5851   C CB    A TYR C  1 138 ? 74.550  2.627   61.174  0.25 26.21  ? 138  TYR C CB    1 
ATOM   5852   C CG    A TYR C  1 138 ? 75.286  3.885   61.589  0.25 24.35  ? 138  TYR C CG    1 
ATOM   5853   C CD1   A TYR C  1 138 ? 74.743  5.136   61.355  0.25 22.50  ? 138  TYR C CD1   1 
ATOM   5854   C CD2   A TYR C  1 138 ? 76.535  3.812   62.213  0.25 27.62  ? 138  TYR C CD2   1 
ATOM   5855   C CE1   A TYR C  1 138 ? 75.406  6.298   61.723  0.25 26.57  ? 138  TYR C CE1   1 
ATOM   5856   C CE2   A TYR C  1 138 ? 77.227  4.973   62.592  0.25 27.53  ? 138  TYR C CE2   1 
ATOM   5857   C CZ    A TYR C  1 138 ? 76.655  6.217   62.343  0.25 28.11  ? 138  TYR C CZ    1 
ATOM   5858   O OH    A TYR C  1 138 ? 77.318  7.380   62.703  0.25 27.59  ? 138  TYR C OH    1 
ATOM   5859   N N     A THR C  1 139 ? 76.977  2.656   58.847  0.25 26.45  ? 139  THR C N     1 
ATOM   5860   C CA    A THR C  1 139 ? 78.392  2.341   58.662  0.25 29.06  ? 139  THR C CA    1 
ATOM   5861   C C     A THR C  1 139 ? 79.141  3.284   59.609  0.25 27.50  ? 139  THR C C     1 
ATOM   5862   O O     A THR C  1 139 ? 79.608  2.870   60.662  0.25 29.69  ? 139  THR C O     1 
ATOM   5863   C CB    A THR C  1 139 ? 78.842  2.568   57.208  0.25 28.83  ? 139  THR C CB    1 
ATOM   5864   O OG1   A THR C  1 139 ? 78.460  3.877   56.784  0.25 34.03  ? 139  THR C OG1   1 
ATOM   5865   C CG2   A THR C  1 139 ? 78.195  1.542   56.286  0.25 30.32  ? 139  THR C CG2   1 
ATOM   5866   N N     A ASP C  1 140 ? 79.243  4.550   59.233  0.25 28.61  ? 140  ASP C N     1 
ATOM   5867   C CA    A ASP C  1 140 ? 79.862  5.558   60.094  0.25 31.24  ? 140  ASP C CA    1 
ATOM   5868   C C     A ASP C  1 140 ? 79.066  6.847   59.901  0.25 31.15  ? 140  ASP C C     1 
ATOM   5869   O O     A ASP C  1 140 ? 78.074  6.835   59.167  0.25 31.64  ? 140  ASP C O     1 
ATOM   5870   C CB    A ASP C  1 140 ? 81.361  5.710   59.777  0.25 30.71  ? 140  ASP C CB    1 
ATOM   5871   C CG    A ASP C  1 140 ? 81.622  6.280   58.407  0.25 30.56  ? 140  ASP C CG    1 
ATOM   5872   O OD1   A ASP C  1 140 ? 82.789  6.217   57.989  0.25 34.66  ? 140  ASP C OD1   1 
ATOM   5873   O OD2   A ASP C  1 140 ? 80.701  6.797   57.750  0.25 34.86  ? 140  ASP C OD2   1 
ATOM   5874   N N     A ALA C  1 141 ? 79.486  7.974   60.513  0.25 33.26  ? 141  ALA C N     1 
ATOM   5875   C CA    A ALA C  1 141 ? 78.723  9.216   60.359  0.25 34.39  ? 141  ALA C CA    1 
ATOM   5876   C C     A ALA C  1 141 ? 78.808  9.867   59.000  0.25 34.53  ? 141  ALA C C     1 
ATOM   5877   O O     A ALA C  1 141 ? 78.045  10.788  58.720  0.25 33.95  ? 141  ALA C O     1 
ATOM   5878   C CB    A ALA C  1 141 ? 79.311  10.111  61.435  0.25 34.07  ? 141  ALA C CB    1 
ATOM   5879   N N     A ASP C  1 142 ? 79.735  9.404   58.164  0.25 33.27  ? 142  ASP C N     1 
ATOM   5880   C CA    A ASP C  1 142 ? 79.893  9.971   56.829  0.25 33.42  ? 142  ASP C CA    1 
ATOM   5881   C C     A ASP C  1 142 ? 79.110  9.179   55.784  0.25 32.73  ? 142  ASP C C     1 
ATOM   5882   O O     A ASP C  1 142 ? 79.081  9.551   54.613  0.25 31.68  ? 142  ASP C O     1 
ATOM   5883   C CB    A ASP C  1 142 ? 81.377  9.988   56.437  0.25 36.53  ? 142  ASP C CB    1 
ATOM   5884   C CG    A ASP C  1 142 ? 82.200  10.919  57.311  0.25 39.21  ? 142  ASP C CG    1 
ATOM   5885   O OD1   A ASP C  1 142 ? 83.436  10.787  57.315  0.25 43.47  ? 142  ASP C OD1   1 
ATOM   5886   O OD2   A ASP C  1 142 ? 81.616  11.791  57.988  0.25 38.31  ? 142  ASP C OD2   1 
ATOM   5887   N N     A GLY C  1 143 ? 78.475  8.093   56.212  0.25 31.95  ? 143  GLY C N     1 
ATOM   5888   C CA    A GLY C  1 143 ? 77.724  7.267   55.286  0.25 31.97  ? 143  GLY C CA    1 
ATOM   5889   C C     A GLY C  1 143 ? 76.647  8.009   54.524  0.25 32.85  ? 143  GLY C C     1 
ATOM   5890   O O     A GLY C  1 143 ? 76.132  9.032   54.976  0.25 31.23  ? 143  GLY C O     1 
ATOM   5891   N N     A ASP C  1 144 ? 76.310  7.493   53.348  0.25 33.79  ? 144  ASP C N     1 
ATOM   5892   C CA    A ASP C  1 144 ? 75.286  8.094   52.503  0.25 35.50  ? 144  ASP C CA    1 
ATOM   5893   C C     A ASP C  1 144 ? 73.954  7.393   52.794  0.25 33.58  ? 144  ASP C C     1 
ATOM   5894   O O     A ASP C  1 144 ? 73.706  6.289   52.336  0.25 33.70  ? 144  ASP C O     1 
ATOM   5895   C CB    A ASP C  1 144 ? 75.659  7.924   51.034  0.25 38.27  ? 144  ASP C CB    1 
ATOM   5896   C CG    A ASP C  1 144 ? 74.577  8.430   50.103  0.25 42.47  ? 144  ASP C CG    1 
ATOM   5897   O OD1   A ASP C  1 144 ? 74.002  9.512   50.385  0.25 42.16  ? 144  ASP C OD1   1 
ATOM   5898   O OD2   A ASP C  1 144 ? 74.304  7.747   49.086  0.25 47.22  ? 144  ASP C OD2   1 
ATOM   5899   N N     A TYR C  1 145 ? 73.095  8.056   53.552  0.25 33.32  ? 145  TYR C N     1 
ATOM   5900   C CA    A TYR C  1 145 ? 71.815  7.469   53.949  0.25 31.59  ? 145  TYR C CA    1 
ATOM   5901   C C     A TYR C  1 145 ? 70.617  8.101   53.262  0.25 31.77  ? 145  TYR C C     1 
ATOM   5902   O O     A TYR C  1 145 ? 69.469  7.728   53.532  0.25 30.85  ? 145  TYR C O     1 
ATOM   5903   C CB    A TYR C  1 145 ? 71.668  7.602   55.464  0.25 30.07  ? 145  TYR C CB    1 
ATOM   5904   C CG    A TYR C  1 145 ? 72.841  7.014   56.222  0.25 27.97  ? 145  TYR C CG    1 
ATOM   5905   C CD1   A TYR C  1 145 ? 73.138  5.667   56.128  0.25 25.95  ? 145  TYR C CD1   1 
ATOM   5906   C CD2   A TYR C  1 145 ? 73.663  7.823   57.018  0.25 27.36  ? 145  TYR C CD2   1 
ATOM   5907   C CE1   A TYR C  1 145 ? 74.233  5.116   56.803  0.25 28.28  ? 145  TYR C CE1   1 
ATOM   5908   C CE2   A TYR C  1 145 ? 74.762  7.285   57.700  0.25 28.38  ? 145  TYR C CE2   1 
ATOM   5909   C CZ    A TYR C  1 145 ? 75.040  5.928   57.585  0.25 27.24  ? 145  TYR C CZ    1 
ATOM   5910   O OH    A TYR C  1 145 ? 76.119  5.381   58.247  0.25 27.03  ? 145  TYR C OH    1 
ATOM   5911   N N     A LYS C  1 146 ? 70.878  9.054   52.373  0.25 31.69  ? 146  LYS C N     1 
ATOM   5912   C CA    A LYS C  1 146 ? 69.793  9.721   51.676  0.25 34.05  ? 146  LYS C CA    1 
ATOM   5913   C C     A LYS C  1 146 ? 68.862  8.707   50.991  0.25 32.14  ? 146  LYS C C     1 
ATOM   5914   O O     A LYS C  1 146 ? 69.296  7.849   50.232  0.25 29.08  ? 146  LYS C O     1 
ATOM   5915   C CB    A LYS C  1 146 ? 70.353  10.711  50.651  0.25 37.37  ? 146  LYS C CB    1 
ATOM   5916   C CG    A LYS C  1 146 ? 69.291  11.570  49.992  0.25 44.54  ? 146  LYS C CG    1 
ATOM   5917   C CD    A LYS C  1 146 ? 69.917  12.599  49.056  0.25 51.49  ? 146  LYS C CD    1 
ATOM   5918   C CE    A LYS C  1 146 ? 68.871  13.543  48.466  0.25 52.55  ? 146  LYS C CE    1 
ATOM   5919   N NZ    A LYS C  1 146 ? 69.502  14.575  47.583  0.25 54.54  ? 146  LYS C NZ    1 
ATOM   5920   N N     A GLY C  1 147 ? 67.572  8.809   51.283  0.25 33.43  ? 147  GLY C N     1 
ATOM   5921   C CA    A GLY C  1 147 ? 66.603  7.903   50.688  0.25 31.72  ? 147  GLY C CA    1 
ATOM   5922   C C     A GLY C  1 147 ? 66.606  6.514   51.287  0.25 32.57  ? 147  GLY C C     1 
ATOM   5923   O O     A GLY C  1 147 ? 65.915  5.633   50.796  0.25 31.24  ? 147  GLY C O     1 
ATOM   5924   N N     A LYS C  1 148 ? 67.381  6.308   52.349  0.25 31.59  ? 148  LYS C N     1 
ATOM   5925   C CA    A LYS C  1 148 ? 67.441  5.003   52.984  0.25 31.26  ? 148  LYS C CA    1 
ATOM   5926   C C     A LYS C  1 148 ? 66.743  4.995   54.352  0.25 30.66  ? 148  LYS C C     1 
ATOM   5927   O O     A LYS C  1 148 ? 66.807  5.978   55.100  0.25 27.71  ? 148  LYS C O     1 
ATOM   5928   C CB    A LYS C  1 148 ? 68.902  4.563   53.141  0.25 32.29  ? 148  LYS C CB    1 
ATOM   5929   C CG    A LYS C  1 148 ? 69.641  4.451   51.805  0.25 34.53  ? 148  LYS C CG    1 
ATOM   5930   C CD    A LYS C  1 148 ? 71.083  3.990   51.986  0.25 36.33  ? 148  LYS C CD    1 
ATOM   5931   C CE    A LYS C  1 148 ? 71.812  4.016   50.646  0.25 39.21  ? 148  LYS C CE    1 
ATOM   5932   N NZ    A LYS C  1 148 ? 73.238  3.624   50.772  0.25 42.64  ? 148  LYS C NZ    1 
ATOM   5933   N N     A GLY C  1 149 ? 66.082  3.881   54.661  0.25 27.08  ? 149  GLY C N     1 
ATOM   5934   C CA    A GLY C  1 149 ? 65.397  3.748   55.933  0.25 27.62  ? 149  GLY C CA    1 
ATOM   5935   C C     A GLY C  1 149 ? 64.086  4.496   55.923  0.25 25.90  ? 149  GLY C C     1 
ATOM   5936   O O     A GLY C  1 149 ? 63.707  5.078   54.904  0.25 23.35  ? 149  GLY C O     1 
ATOM   5937   N N     A VAL C  1 150 ? 63.391  4.488   57.057  0.25 25.89  ? 150  VAL C N     1 
ATOM   5938   C CA    A VAL C  1 150 ? 62.111  5.182   57.149  0.25 24.71  ? 150  VAL C CA    1 
ATOM   5939   C C     A VAL C  1 150 ? 62.269  6.617   57.661  0.25 26.13  ? 150  VAL C C     1 
ATOM   5940   O O     A VAL C  1 150 ? 62.850  6.851   58.740  0.25 23.21  ? 150  VAL C O     1 
ATOM   5941   C CB    A VAL C  1 150 ? 61.126  4.426   58.093  0.25 25.45  ? 150  VAL C CB    1 
ATOM   5942   C CG1   A VAL C  1 150 ? 59.788  5.162   58.181  0.25 21.34  ? 150  VAL C CG1   1 
ATOM   5943   C CG2   A VAL C  1 150 ? 60.929  3.014   57.593  0.25 26.47  ? 150  VAL C CG2   1 
ATOM   5944   N N     A ASP C  1 151 ? 61.743  7.574   56.894  0.25 22.98  ? 151  ASP C N     1 
ATOM   5945   C CA    A ASP C  1 151 ? 61.794  8.958   57.293  0.25 24.07  ? 151  ASP C CA    1 
ATOM   5946   C C     A ASP C  1 151 ? 60.550  9.252   58.119  0.25 23.41  ? 151  ASP C C     1 
ATOM   5947   O O     A ASP C  1 151 ? 59.542  9.701   57.596  0.25 24.64  ? 151  ASP C O     1 
ATOM   5948   C CB    A ASP C  1 151 ? 61.852  9.883   56.068  0.25 23.93  ? 151  ASP C CB    1 
ATOM   5949   C CG    A ASP C  1 151 ? 61.987  11.353  56.456  0.25 21.90  ? 151  ASP C CG    1 
ATOM   5950   O OD1   A ASP C  1 151 ? 62.217  12.209  55.567  0.25 21.47  ? 151  ASP C OD1   1 
ATOM   5951   O OD2   A ASP C  1 151 ? 61.847  11.655  57.660  0.25 22.01  ? 151  ASP C OD2   1 
ATOM   5952   N N     A GLN C  1 152 ? 60.630  8.980   59.415  0.25 24.73  ? 152  GLN C N     1 
ATOM   5953   C CA    A GLN C  1 152 ? 59.516  9.210   60.327  0.25 24.93  ? 152  GLN C CA    1 
ATOM   5954   C C     A GLN C  1 152 ? 59.084  10.655  60.408  0.25 26.56  ? 152  GLN C C     1 
ATOM   5955   O O     A GLN C  1 152 ? 57.880  10.941  60.456  0.25 26.90  ? 152  GLN C O     1 
ATOM   5956   C CB    A GLN C  1 152 ? 59.866  8.743   61.736  0.25 23.16  ? 152  GLN C CB    1 
ATOM   5957   C CG    A GLN C  1 152 ? 60.306  7.305   61.830  0.25 20.83  ? 152  GLN C CG    1 
ATOM   5958   C CD    A GLN C  1 152 ? 60.680  6.959   63.249  0.25 22.65  ? 152  GLN C CD    1 
ATOM   5959   O OE1   A GLN C  1 152 ? 59.814  6.937   64.123  0.25 18.98  ? 152  GLN C OE1   1 
ATOM   5960   N NE2   A GLN C  1 152 ? 61.982  6.716   63.498  0.25 18.02  ? 152  GLN C NE2   1 
ATOM   5961   N N     A LEU C  1 153 ? 60.058  11.566  60.428  0.25 24.84  ? 153  LEU C N     1 
ATOM   5962   C CA    A LEU C  1 153 ? 59.754  12.985  60.533  0.25 23.55  ? 153  LEU C CA    1 
ATOM   5963   C C     A LEU C  1 153 ? 58.914  13.513  59.376  0.25 23.66  ? 153  LEU C C     1 
ATOM   5964   O O     A LEU C  1 153 ? 57.901  14.184  59.585  0.25 21.28  ? 153  LEU C O     1 
ATOM   5965   C CB    A LEU C  1 153 ? 61.052  13.808  60.670  0.25 24.21  ? 153  LEU C CB    1 
ATOM   5966   C CG    A LEU C  1 153 ? 60.844  15.315  60.928  0.25 23.61  ? 153  LEU C CG    1 
ATOM   5967   C CD1   A LEU C  1 153 ? 59.990  15.491  62.178  0.25 18.82  ? 153  LEU C CD1   1 
ATOM   5968   C CD2   A LEU C  1 153 ? 62.208  16.018  61.105  0.25 21.95  ? 153  LEU C CD2   1 
ATOM   5969   N N     A GLN C  1 154 ? 59.316  13.216  58.147  0.25 23.01  ? 154  GLN C N     1 
ATOM   5970   C CA    A GLN C  1 154 ? 58.548  13.714  57.014  0.25 22.23  ? 154  GLN C CA    1 
ATOM   5971   C C     A GLN C  1 154 ? 57.155  13.054  56.977  0.25 20.59  ? 154  GLN C C     1 
ATOM   5972   O O     A GLN C  1 154 ? 56.177  13.677  56.568  0.25 22.59  ? 154  GLN C O     1 
ATOM   5973   C CB    A GLN C  1 154 ? 59.288  13.460  55.691  0.25 21.44  ? 154  GLN C CB    1 
ATOM   5974   C CG    A GLN C  1 154 ? 58.580  14.088  54.490  0.25 22.61  ? 154  GLN C CG    1 
ATOM   5975   C CD    A GLN C  1 154 ? 58.341  15.578  54.649  0.25 22.70  ? 154  GLN C CD    1 
ATOM   5976   O OE1   A GLN C  1 154 ? 57.281  16.096  54.291  0.25 25.50  ? 154  GLN C OE1   1 
ATOM   5977   N NE2   A GLN C  1 154 ? 59.333  16.285  55.173  0.25 24.83  ? 154  GLN C NE2   1 
ATOM   5978   N N     A ARG C  1 155 ? 57.076  11.806  57.411  0.25 21.07  ? 155  ARG C N     1 
ATOM   5979   C CA    A ARG C  1 155 ? 55.800  11.104  57.443  0.25 22.81  ? 155  ARG C CA    1 
ATOM   5980   C C     A ARG C  1 155 ? 54.877  11.805  58.431  0.25 24.19  ? 155  ARG C C     1 
ATOM   5981   O O     A ARG C  1 155 ? 53.681  11.941  58.166  0.25 24.07  ? 155  ARG C O     1 
ATOM   5982   C CB    A ARG C  1 155 ? 55.990  9.645   57.836  0.25 24.94  ? 155  ARG C CB    1 
ATOM   5983   C CG    A ARG C  1 155 ? 54.687  8.812   57.877  0.25 26.24  ? 155  ARG C CG    1 
ATOM   5984   C CD    A ARG C  1 155 ? 53.810  9.050   56.641  0.25 30.25  ? 155  ARG C CD    1 
ATOM   5985   N NE    A ARG C  1 155 ? 54.464  8.643   55.396  0.25 30.39  ? 155  ARG C NE    1 
ATOM   5986   C CZ    A ARG C  1 155 ? 54.532  7.387   54.964  0.25 33.57  ? 155  ARG C CZ    1 
ATOM   5987   N NH1   A ARG C  1 155 ? 55.151  7.116   53.820  0.25 33.67  ? 155  ARG C NH1   1 
ATOM   5988   N NH2   A ARG C  1 155 ? 53.974  6.398   55.664  0.25 29.42  ? 155  ARG C NH2   1 
ATOM   5989   N N     A VAL C  1 156 ? 55.440  12.263  59.557  0.25 22.59  ? 156  VAL C N     1 
ATOM   5990   C CA    A VAL C  1 156 ? 54.667  12.988  60.563  0.25 21.61  ? 156  VAL C CA    1 
ATOM   5991   C C     A VAL C  1 156 ? 54.086  14.252  59.922  0.25 23.96  ? 156  VAL C C     1 
ATOM   5992   O O     A VAL C  1 156 ? 52.888  14.547  60.059  0.25 20.47  ? 156  VAL C O     1 
ATOM   5993   C CB    A VAL C  1 156 ? 55.543  13.387  61.772  0.25 21.41  ? 156  VAL C CB    1 
ATOM   5994   C CG1   A VAL C  1 156 ? 54.837  14.439  62.620  0.25 20.09  ? 156  VAL C CG1   1 
ATOM   5995   C CG2   A VAL C  1 156 ? 55.838  12.160  62.618  0.25 20.06  ? 156  VAL C CG2   1 
ATOM   5996   N N     A ILE C  1 157 ? 54.938  14.997  59.222  0.25 21.14  ? 157  ILE C N     1 
ATOM   5997   C CA    A ILE C  1 157 ? 54.515  16.226  58.547  0.25 22.55  ? 157  ILE C CA    1 
ATOM   5998   C C     A ILE C  1 157 ? 53.371  15.955  57.559  0.25 20.79  ? 157  ILE C C     1 
ATOM   5999   O O     A ILE C  1 157 ? 52.326  16.619  57.604  0.25 21.19  ? 157  ILE C O     1 
ATOM   6000   C CB    A ILE C  1 157 ? 55.697  16.856  57.756  0.25 23.32  ? 157  ILE C CB    1 
ATOM   6001   C CG1   A ILE C  1 157 ? 56.833  17.229  58.718  0.25 26.91  ? 157  ILE C CG1   1 
ATOM   6002   C CG2   A ILE C  1 157 ? 55.225  18.052  56.975  0.25 21.95  ? 157  ILE C CG2   1 
ATOM   6003   C CD1   A ILE C  1 157 ? 56.461  18.288  59.708  0.25 29.07  ? 157  ILE C CD1   1 
ATOM   6004   N N     A ASP C  1 158 ? 53.594  15.005  56.656  0.25 18.60  ? 158  ASP C N     1 
ATOM   6005   C CA    A ASP C  1 158 ? 52.607  14.618  55.645  0.25 22.21  ? 158  ASP C CA    1 
ATOM   6006   C C     A ASP C  1 158 ? 51.282  14.172  56.265  0.25 22.45  ? 158  ASP C C     1 
ATOM   6007   O O     A ASP C  1 158 ? 50.211  14.505  55.760  0.25 24.07  ? 158  ASP C O     1 
ATOM   6008   C CB    A ASP C  1 158 ? 53.159  13.474  54.768  0.25 20.08  ? 158  ASP C CB    1 
ATOM   6009   C CG    A ASP C  1 158 ? 54.321  13.919  53.887  0.25 24.95  ? 158  ASP C CG    1 
ATOM   6010   O OD1   A ASP C  1 158 ? 55.030  13.060  53.325  0.25 25.56  ? 158  ASP C OD1   1 
ATOM   6011   O OD2   A ASP C  1 158 ? 54.525  15.135  53.752  0.25 27.10  ? 158  ASP C OD2   1 
ATOM   6012   N N     A THR C  1 159 ? 51.358  13.400  57.344  0.25 23.43  ? 159  THR C N     1 
ATOM   6013   C CA    A THR C  1 159 ? 50.162  12.916  58.028  0.25 23.16  ? 159  THR C CA    1 
ATOM   6014   C C     A THR C  1 159 ? 49.350  14.027  58.713  0.25 23.85  ? 159  THR C C     1 
ATOM   6015   O O     A THR C  1 159 ? 48.104  14.014  58.683  0.25 20.75  ? 159  THR C O     1 
ATOM   6016   C CB    A THR C  1 159 ? 50.529  11.852  59.073  0.25 23.18  ? 159  THR C CB    1 
ATOM   6017   O OG1   A THR C  1 159 ? 51.265  10.798  58.435  0.25 20.07  ? 159  THR C OG1   1 
ATOM   6018   C CG2   A THR C  1 159 ? 49.247  11.267  59.712  0.25 22.07  ? 159  THR C CG2   1 
ATOM   6019   N N     A ILE C  1 160 ? 50.043  14.967  59.354  0.25 21.34  ? 160  ILE C N     1 
ATOM   6020   C CA    A ILE C  1 160 ? 49.375  16.084  60.012  0.25 22.67  ? 160  ILE C CA    1 
ATOM   6021   C C     A ILE C  1 160 ? 48.624  16.930  58.978  0.25 24.95  ? 160  ILE C C     1 
ATOM   6022   O O     A ILE C  1 160 ? 47.518  17.415  59.237  0.25 24.39  ? 160  ILE C O     1 
ATOM   6023   C CB    A ILE C  1 160 ? 50.396  16.994  60.752  0.25 22.49  ? 160  ILE C CB    1 
ATOM   6024   C CG1   A ILE C  1 160 ? 50.954  16.258  61.977  0.25 21.23  ? 160  ILE C CG1   1 
ATOM   6025   C CG2   A ILE C  1 160 ? 49.739  18.304  61.181  0.25 20.80  ? 160  ILE C CG2   1 
ATOM   6026   C CD1   A ILE C  1 160 ? 52.175  16.931  62.585  0.25 17.14  ? 160  ILE C CD1   1 
ATOM   6027   N N     A LYS C  1 161 ? 49.232  17.107  57.808  0.25 25.40  ? 161  LYS C N     1 
ATOM   6028   C CA    A LYS C  1 161 ? 48.613  17.895  56.746  0.25 26.84  ? 161  LYS C CA    1 
ATOM   6029   C C     A LYS C  1 161 ? 47.482  17.186  55.987  0.25 26.30  ? 161  LYS C C     1 
ATOM   6030   O O     A LYS C  1 161 ? 46.473  17.814  55.665  0.25 28.19  ? 161  LYS C O     1 
ATOM   6031   C CB    A LYS C  1 161 ? 49.674  18.319  55.726  0.25 26.35  ? 161  LYS C CB    1 
ATOM   6032   C CG    A LYS C  1 161 ? 50.699  19.314  56.266  0.25 29.52  ? 161  LYS C CG    1 
ATOM   6033   C CD    A LYS C  1 161 ? 51.892  19.432  55.324  0.25 29.87  ? 161  LYS C CD    1 
ATOM   6034   C CE    A LYS C  1 161 ? 51.506  20.012  53.984  0.25 30.91  ? 161  LYS C CE    1 
ATOM   6035   N NZ    A LYS C  1 161 ? 52.660  20.041  53.058  0.25 30.31  ? 161  LYS C NZ    1 
ATOM   6036   N N     A ASN C  1 162 ? 47.644  15.892  55.707  0.25 23.51  ? 162  ASN C N     1 
ATOM   6037   C CA    A ASN C  1 162 ? 46.654  15.168  54.913  0.25 22.80  ? 162  ASN C CA    1 
ATOM   6038   C C     A ASN C  1 162 ? 45.732  14.195  55.643  0.25 23.56  ? 162  ASN C C     1 
ATOM   6039   O O     A ASN C  1 162 ? 44.709  13.784  55.105  0.25 22.88  ? 162  ASN C O     1 
ATOM   6040   C CB    A ASN C  1 162 ? 47.380  14.463  53.780  0.25 23.91  ? 162  ASN C CB    1 
ATOM   6041   C CG    A ASN C  1 162 ? 48.187  15.426  52.935  0.25 27.17  ? 162  ASN C CG    1 
ATOM   6042   O OD1   A ASN C  1 162 ? 47.641  16.371  52.374  0.25 28.99  ? 162  ASN C OD1   1 
ATOM   6043   N ND2   A ASN C  1 162 ? 49.490  15.194  52.838  0.25 27.13  ? 162  ASN C ND2   1 
ATOM   6044   N N     A ASN C  1 163 ? 46.094  13.805  56.860  0.25 21.19  ? 163  ASN C N     1 
ATOM   6045   C CA    A ASN C  1 163 ? 45.249  12.898  57.624  0.25 21.19  ? 163  ASN C CA    1 
ATOM   6046   C C     A ASN C  1 163 ? 45.477  13.114  59.122  0.25 20.11  ? 163  ASN C C     1 
ATOM   6047   O O     A ASN C  1 163 ? 45.889  12.205  59.854  0.25 18.15  ? 163  ASN C O     1 
ATOM   6048   C CB    A ASN C  1 163 ? 45.523  11.446  57.224  0.25 23.59  ? 163  ASN C CB    1 
ATOM   6049   C CG    A ASN C  1 163 ? 44.467  10.497  57.766  0.25 24.84  ? 163  ASN C CG    1 
ATOM   6050   O OD1   A ASN C  1 163 ? 43.315  10.882  57.888  0.25 25.74  ? 163  ASN C OD1   1 
ATOM   6051   N ND2   A ASN C  1 163 ? 44.855  9.269   58.096  0.25 18.04  ? 163  ASN C ND2   1 
ATOM   6052   N N     A PRO C  1 164 ? 45.167  14.326  59.598  0.25 22.76  ? 164  PRO C N     1 
ATOM   6053   C CA    A PRO C  1 164 ? 45.325  14.751  60.997  0.25 25.93  ? 164  PRO C CA    1 
ATOM   6054   C C     A PRO C  1 164 ? 44.735  13.867  62.083  0.25 26.59  ? 164  PRO C C     1 
ATOM   6055   O O     A PRO C  1 164 ? 45.292  13.808  63.187  0.25 28.25  ? 164  PRO C O     1 
ATOM   6056   C CB    A PRO C  1 164 ? 44.746  16.170  61.006  0.25 25.36  ? 164  PRO C CB    1 
ATOM   6057   C CG    A PRO C  1 164 ? 43.720  16.126  59.900  0.25 25.94  ? 164  PRO C CG    1 
ATOM   6058   C CD    A PRO C  1 164 ? 44.419  15.335  58.823  0.25 23.38  ? 164  PRO C CD    1 
ATOM   6059   N N     A THR C  1 165 ? 43.638  13.163  61.792  0.25 23.86  ? 165  THR C N     1 
ATOM   6060   C CA    A THR C  1 165 ? 43.039  12.319  62.822  0.25 24.36  ? 165  THR C CA    1 
ATOM   6061   C C     A THR C  1 165 ? 43.710  10.945  62.939  0.25 25.69  ? 165  THR C C     1 
ATOM   6062   O O     A THR C  1 165 ? 43.315  10.092  63.744  0.25 21.56  ? 165  THR C O     1 
ATOM   6063   C CB    A THR C  1 165 ? 41.511  12.163  62.612  0.25 25.60  ? 165  THR C CB    1 
ATOM   6064   O OG1   A THR C  1 165 ? 41.242  11.549  61.347  0.25 28.41  ? 165  THR C OG1   1 
ATOM   6065   C CG2   A THR C  1 165 ? 40.845  13.531  62.648  0.25 23.49  ? 165  THR C CG2   1 
ATOM   6066   N N     A ASP C  1 166 ? 44.742  10.721  62.131  0.25 25.17  ? 166  ASP C N     1 
ATOM   6067   C CA    A ASP C  1 166 ? 45.493  9.468   62.192  0.25 20.08  ? 166  ASP C CA    1 
ATOM   6068   C C     A ASP C  1 166 ? 45.975  9.331   63.638  0.25 19.24  ? 166  ASP C C     1 
ATOM   6069   O O     A ASP C  1 166 ? 46.229  10.320  64.318  0.25 19.15  ? 166  ASP C O     1 
ATOM   6070   C CB    A ASP C  1 166 ? 46.674  9.533   61.225  0.25 24.01  ? 166  ASP C CB    1 
ATOM   6071   C CG    A ASP C  1 166 ? 47.509  8.277   61.224  0.25 24.72  ? 166  ASP C CG    1 
ATOM   6072   O OD1   A ASP C  1 166 ? 48.420  8.172   62.070  0.25 26.68  ? 166  ASP C OD1   1 
ATOM   6073   O OD2   A ASP C  1 166 ? 47.261  7.390   60.376  0.25 27.79  ? 166  ASP C OD2   1 
ATOM   6074   N N     A ARG C  1 167 ? 46.077  8.099   64.119  0.25 21.15  ? 167  ARG C N     1 
ATOM   6075   C CA    A ARG C  1 167 ? 46.500  7.859   65.494  0.25 21.88  ? 167  ARG C CA    1 
ATOM   6076   C C     A ARG C  1 167 ? 47.892  7.253   65.571  0.25 21.45  ? 167  ARG C C     1 
ATOM   6077   O O     A ARG C  1 167 ? 48.268  6.730   66.628  0.25 19.37  ? 167  ARG C O     1 
ATOM   6078   C CB    A ARG C  1 167 ? 45.538  6.907   66.199  0.25 17.51  ? 167  ARG C CB    1 
ATOM   6079   C CG    A ARG C  1 167 ? 44.075  7.398   66.340  0.25 23.97  ? 167  ARG C CG    1 
ATOM   6080   C CD    A ARG C  1 167 ? 43.211  6.113   66.398  0.25 27.62  ? 167  ARG C CD    1 
ATOM   6081   N NE    A ARG C  1 167 ? 41.835  6.377   66.672  0.25 34.95  ? 167  ARG C NE    1 
ATOM   6082   C CZ    A ARG C  1 167 ? 40.847  5.563   66.339  0.25 30.50  ? 167  ARG C CZ    1 
ATOM   6083   N NH1   A ARG C  1 167 ? 41.097  4.411   65.701  0.25 29.24  ? 167  ARG C NH1   1 
ATOM   6084   N NH2   A ARG C  1 167 ? 39.619  5.925   66.642  0.25 29.93  ? 167  ARG C NH2   1 
ATOM   6085   N N     A ARG C  1 168 ? 48.650  7.335   64.478  0.25 21.72  ? 168  ARG C N     1 
ATOM   6086   C CA    A ARG C  1 168 ? 50.004  6.765   64.461  0.25 22.87  ? 168  ARG C CA    1 
ATOM   6087   C C     A ARG C  1 168 ? 51.074  7.823   64.186  0.25 22.27  ? 168  ARG C C     1 
ATOM   6088   O O     A ARG C  1 168 ? 52.125  7.498   63.652  0.25 22.83  ? 168  ARG C O     1 
ATOM   6089   C CB    A ARG C  1 168 ? 50.124  5.675   63.377  0.25 19.27  ? 168  ARG C CB    1 
ATOM   6090   C CG    A ARG C  1 168 ? 49.216  4.452   63.547  0.25 21.85  ? 168  ARG C CG    1 
ATOM   6091   C CD    A ARG C  1 168 ? 47.778  4.700   63.058  0.25 20.79  ? 168  ARG C CD    1 
ATOM   6092   N NE    A ARG C  1 168 ? 46.981  3.476   63.037  0.25 22.88  ? 168  ARG C NE    1 
ATOM   6093   C CZ    A ARG C  1 168 ? 46.832  2.676   61.981  0.25 26.76  ? 168  ARG C CZ    1 
ATOM   6094   N NH1   A ARG C  1 168 ? 46.085  1.585   62.072  0.25 21.84  ? 168  ARG C NH1   1 
ATOM   6095   N NH2   A ARG C  1 168 ? 47.396  2.974   60.820  0.25 22.16  ? 168  ARG C NH2   1 
ATOM   6096   N N     A ILE C  1 169 ? 50.808  9.067   64.551  0.25 20.44  ? 169  ILE C N     1 
ATOM   6097   C CA    A ILE C  1 169 ? 51.729  10.149  64.273  0.25 22.97  ? 169  ILE C CA    1 
ATOM   6098   C C     A ILE C  1 169 ? 52.832  10.083  65.304  0.25 22.27  ? 169  ILE C C     1 
ATOM   6099   O O     A ILE C  1 169 ? 52.871  10.864  66.246  0.25 20.87  ? 169  ILE C O     1 
ATOM   6100   C CB    A ILE C  1 169 ? 51.016  11.511  64.320  0.25 22.24  ? 169  ILE C CB    1 
ATOM   6101   C CG1   A ILE C  1 169 ? 49.718  11.435  63.507  0.25 22.06  ? 169  ILE C CG1   1 
ATOM   6102   C CG2   A ILE C  1 169 ? 51.926  12.608  63.727  0.25 16.64  ? 169  ILE C CG2   1 
ATOM   6103   C CD1   A ILE C  1 169 ? 48.923  12.748  63.482  0.25 22.49  ? 169  ILE C CD1   1 
ATOM   6104   N N     A ILE C  1 170 ? 53.728  9.128   65.091  0.25 18.62  ? 170  ILE C N     1 
ATOM   6105   C CA    A ILE C  1 170 ? 54.813  8.860   66.018  0.25 22.11  ? 170  ILE C CA    1 
ATOM   6106   C C     A ILE C  1 170 ? 56.209  9.161   65.454  0.25 21.59  ? 170  ILE C C     1 
ATOM   6107   O O     A ILE C  1 170 ? 56.481  8.909   64.285  0.25 20.78  ? 170  ILE C O     1 
ATOM   6108   C CB    A ILE C  1 170 ? 54.789  7.377   66.445  0.25 21.97  ? 170  ILE C CB    1 
ATOM   6109   C CG1   A ILE C  1 170 ? 53.402  6.993   67.025  0.25 23.89  ? 170  ILE C CG1   1 
ATOM   6110   C CG2   A ILE C  1 170 ? 55.886  7.104   67.481  0.25 25.71  ? 170  ILE C CG2   1 
ATOM   6111   C CD1   A ILE C  1 170 ? 53.023  7.747   68.274  0.25 21.46  ? 170  ILE C CD1   1 
ATOM   6112   N N     A LEU C  1 171 ? 57.077  9.687   66.313  0.25 21.45  ? 171  LEU C N     1 
ATOM   6113   C CA    A LEU C  1 171 ? 58.454  9.978   65.960  0.25 21.02  ? 171  LEU C CA    1 
ATOM   6114   C C     A LEU C  1 171 ? 59.277  9.298   67.060  0.25 21.90  ? 171  LEU C C     1 
ATOM   6115   O O     A LEU C  1 171 ? 59.252  9.736   68.221  0.25 21.06  ? 171  LEU C O     1 
ATOM   6116   C CB    A LEU C  1 171 ? 58.686  11.480  65.971  0.25 22.14  ? 171  LEU C CB    1 
ATOM   6117   C CG    A LEU C  1 171 ? 60.131  11.910  65.678  0.25 25.81  ? 171  LEU C CG    1 
ATOM   6118   C CD1   A LEU C  1 171 ? 60.520  11.435  64.283  0.25 24.38  ? 171  LEU C CD1   1 
ATOM   6119   C CD2   A LEU C  1 171 ? 60.257  13.428  65.795  0.25 27.00  ? 171  LEU C CD2   1 
ATOM   6120   N N     A SER C  1 172 ? 60.008  8.244   66.707  0.25 20.43  ? 172  SER C N     1 
ATOM   6121   C CA    A SER C  1 172 ? 60.768  7.491   67.704  0.25 21.01  ? 172  SER C CA    1 
ATOM   6122   C C     A SER C  1 172 ? 62.208  7.211   67.305  0.25 24.19  ? 172  SER C C     1 
ATOM   6123   O O     A SER C  1 172 ? 62.503  6.933   66.144  0.25 24.84  ? 172  SER C O     1 
ATOM   6124   C CB    A SER C  1 172 ? 60.088  6.143   67.968  0.25 21.84  ? 172  SER C CB    1 
ATOM   6125   O OG    A SER C  1 172 ? 60.785  5.362   68.934  0.25 20.95  ? 172  SER C OG    1 
ATOM   6126   N N     A ALA C  1 173 ? 63.086  7.234   68.298  0.25 24.47  ? 173  ALA C N     1 
ATOM   6127   C CA    A ALA C  1 173 ? 64.505  6.982   68.090  0.25 23.66  ? 173  ALA C CA    1 
ATOM   6128   C C     A ALA C  1 173 ? 64.900  5.643   68.698  0.25 24.61  ? 173  ALA C C     1 
ATOM   6129   O O     A ALA C  1 173 ? 66.028  5.172   68.509  0.25 23.50  ? 173  ALA C O     1 
ATOM   6130   C CB    A ALA C  1 173 ? 65.333  8.104   68.715  0.25 22.24  ? 173  ALA C CB    1 
ATOM   6131   N N     A TRP C  1 174 ? 63.977  5.019   69.424  0.25 21.27  ? 174  TRP C N     1 
ATOM   6132   C CA    A TRP C  1 174 ? 64.286  3.746   70.042  0.25 22.43  ? 174  TRP C CA    1 
ATOM   6133   C C     A TRP C  1 174 ? 64.425  2.637   69.002  0.25 24.42  ? 174  TRP C C     1 
ATOM   6134   O O     A TRP C  1 174 ? 63.516  2.392   68.211  0.25 23.89  ? 174  TRP C O     1 
ATOM   6135   C CB    A TRP C  1 174 ? 63.202  3.364   71.055  0.25 21.90  ? 174  TRP C CB    1 
ATOM   6136   C CG    A TRP C  1 174 ? 63.661  2.304   72.021  0.25 21.30  ? 174  TRP C CG    1 
ATOM   6137   C CD1   A TRP C  1 174 ? 63.250  1.014   72.071  0.25 23.15  ? 174  TRP C CD1   1 
ATOM   6138   C CD2   A TRP C  1 174 ? 64.635  2.459   73.063  0.25 18.63  ? 174  TRP C CD2   1 
ATOM   6139   N NE1   A TRP C  1 174 ? 63.905  0.341   73.078  0.25 24.33  ? 174  TRP C NE1   1 
ATOM   6140   C CE2   A TRP C  1 174 ? 64.761  1.213   73.701  0.25 21.98  ? 174  TRP C CE2   1 
ATOM   6141   C CE3   A TRP C  1 174 ? 65.405  3.536   73.519  0.25 21.29  ? 174  TRP C CE3   1 
ATOM   6142   C CZ2   A TRP C  1 174 ? 65.629  1.002   74.777  0.25 21.34  ? 174  TRP C CZ2   1 
ATOM   6143   C CZ3   A TRP C  1 174 ? 66.272  3.326   74.598  0.25 22.83  ? 174  TRP C CZ3   1 
ATOM   6144   C CH2   A TRP C  1 174 ? 66.373  2.067   75.211  0.25 22.02  ? 174  TRP C CH2   1 
ATOM   6145   N N     A ASN C  1 175 ? 65.567  1.954   69.017  0.25 20.93  ? 175  ASN C N     1 
ATOM   6146   C CA    A ASN C  1 175 ? 65.808  0.874   68.068  0.25 21.00  ? 175  ASN C CA    1 
ATOM   6147   C C     A ASN C  1 175 ? 66.641  -0.171  68.792  0.25 23.15  ? 175  ASN C C     1 
ATOM   6148   O O     A ASN C  1 175 ? 67.863  -0.050  68.878  0.25 23.58  ? 175  ASN C O     1 
ATOM   6149   C CB    A ASN C  1 175 ? 66.562  1.405   66.842  0.25 20.60  ? 175  ASN C CB    1 
ATOM   6150   C CG    A ASN C  1 175 ? 66.745  0.355   65.769  0.25 20.39  ? 175  ASN C CG    1 
ATOM   6151   O OD1   A ASN C  1 175 ? 66.918  -0.812  66.075  0.25 23.19  ? 175  ASN C OD1   1 
ATOM   6152   N ND2   A ASN C  1 175 ? 66.712  0.770   64.501  0.25 19.55  ? 175  ASN C ND2   1 
ATOM   6153   N N     A PRO C  1 176 ? 65.984  -1.207  69.341  0.25 21.78  ? 176  PRO C N     1 
ATOM   6154   C CA    A PRO C  1 176 ? 66.664  -2.281  70.072  0.25 22.16  ? 176  PRO C CA    1 
ATOM   6155   C C     A PRO C  1 176 ? 67.828  -2.919  69.317  0.25 23.55  ? 176  PRO C C     1 
ATOM   6156   O O     A PRO C  1 176 ? 68.811  -3.342  69.932  0.25 22.05  ? 176  PRO C O     1 
ATOM   6157   C CB    A PRO C  1 176 ? 65.543  -3.285  70.348  0.25 22.47  ? 176  PRO C CB    1 
ATOM   6158   C CG    A PRO C  1 176 ? 64.315  -2.376  70.503  0.25 22.18  ? 176  PRO C CG    1 
ATOM   6159   C CD    A PRO C  1 176 ? 64.517  -1.384  69.365  0.25 24.05  ? 176  PRO C CD    1 
ATOM   6160   N N     A LYS C  1 177 ? 67.718  -3.008  67.998  0.25 22.35  ? 177  LYS C N     1 
ATOM   6161   C CA    A LYS C  1 177 ? 68.785  -3.612  67.219  0.25 24.15  ? 177  LYS C CA    1 
ATOM   6162   C C     A LYS C  1 177 ? 70.027  -2.708  67.152  0.25 23.79  ? 177  LYS C C     1 
ATOM   6163   O O     A LYS C  1 177 ? 71.154  -3.198  67.247  0.25 22.73  ? 177  LYS C O     1 
ATOM   6164   C CB    A LYS C  1 177 ? 68.317  -3.917  65.793  0.25 23.33  ? 177  LYS C CB    1 
ATOM   6165   C CG    A LYS C  1 177 ? 69.392  -4.584  64.935  0.25 26.35  ? 177  LYS C CG    1 
ATOM   6166   C CD    A LYS C  1 177 ? 68.909  -4.799  63.506  0.25 29.80  ? 177  LYS C CD    1 
ATOM   6167   C CE    A LYS C  1 177 ? 69.981  -5.502  62.682  0.25 33.67  ? 177  LYS C CE    1 
ATOM   6168   N NZ    A LYS C  1 177 ? 69.636  -5.559  61.234  0.25 38.02  ? 177  LYS C NZ    1 
ATOM   6169   N N     A ASP C  1 178 ? 69.817  -1.403  66.984  0.25 23.22  ? 178  ASP C N     1 
ATOM   6170   C CA    A ASP C  1 178 ? 70.934  -0.453  66.874  0.25 24.47  ? 178  ASP C CA    1 
ATOM   6171   C C     A ASP C  1 178 ? 71.550  0.043   68.200  0.25 25.02  ? 178  ASP C C     1 
ATOM   6172   O O     A ASP C  1 178 ? 72.656  0.615   68.197  0.25 24.83  ? 178  ASP C O     1 
ATOM   6173   C CB    A ASP C  1 178 ? 70.508  0.756   66.049  0.25 22.34  ? 178  ASP C CB    1 
ATOM   6174   C CG    A ASP C  1 178 ? 70.425  0.460   64.573  0.25 21.64  ? 178  ASP C CG    1 
ATOM   6175   O OD1   A ASP C  1 178 ? 70.695  -0.677  64.174  0.25 22.99  ? 178  ASP C OD1   1 
ATOM   6176   O OD2   A ASP C  1 178 ? 70.078  1.366   63.793  0.25 26.41  ? 178  ASP C OD2   1 
ATOM   6177   N N     A LEU C  1 179 ? 70.857  -0.175  69.318  0.25 24.20  ? 179  LEU C N     1 
ATOM   6178   C CA    A LEU C  1 179 ? 71.350  0.262   70.629  0.25 26.68  ? 179  LEU C CA    1 
ATOM   6179   C C     A LEU C  1 179 ? 72.851  0.046   70.897  0.25 28.16  ? 179  LEU C C     1 
ATOM   6180   O O     A LEU C  1 179 ? 73.550  0.967   71.277  0.25 29.60  ? 179  LEU C O     1 
ATOM   6181   C CB    A LEU C  1 179 ? 70.574  -0.414  71.756  0.25 28.52  ? 179  LEU C CB    1 
ATOM   6182   C CG    A LEU C  1 179 ? 69.096  -0.075  71.929  0.25 30.62  ? 179  LEU C CG    1 
ATOM   6183   C CD1   A LEU C  1 179 ? 68.594  -0.744  73.207  0.25 33.13  ? 179  LEU C CD1   1 
ATOM   6184   C CD2   A LEU C  1 179 ? 68.899  1.404   71.986  0.25 27.09  ? 179  LEU C CD2   1 
ATOM   6185   N N     A PRO C  1 180 ? 73.360  -1.174  70.716  0.25 29.69  ? 180  PRO C N     1 
ATOM   6186   C CA    A PRO C  1 180 ? 74.795  -1.369  70.978  0.25 29.01  ? 180  PRO C CA    1 
ATOM   6187   C C     A PRO C  1 180 ? 75.738  -0.526  70.117  0.25 29.58  ? 180  PRO C C     1 
ATOM   6188   O O     A PRO C  1 180 ? 76.906  -0.348  70.474  0.25 30.71  ? 180  PRO C O     1 
ATOM   6189   C CB    A PRO C  1 180 ? 74.991  -2.878  70.776  0.25 31.07  ? 180  PRO C CB    1 
ATOM   6190   C CG    A PRO C  1 180 ? 73.840  -3.279  69.851  0.25 31.86  ? 180  PRO C CG    1 
ATOM   6191   C CD    A PRO C  1 180 ? 72.691  -2.438  70.348  0.25 29.41  ? 180  PRO C CD    1 
ATOM   6192   N N     A LEU C  1 181 ? 75.238  0.007   68.999  0.25 27.16  ? 181  LEU C N     1 
ATOM   6193   C CA    A LEU C  1 181 ? 76.055  0.834   68.118  0.25 25.17  ? 181  LEU C CA    1 
ATOM   6194   C C     A LEU C  1 181 ? 76.031  2.305   68.526  0.25 25.49  ? 181  LEU C C     1 
ATOM   6195   O O     A LEU C  1 181 ? 76.772  3.140   67.974  0.25 22.60  ? 181  LEU C O     1 
ATOM   6196   C CB    A LEU C  1 181 ? 75.572  0.723   66.675  0.25 25.22  ? 181  LEU C CB    1 
ATOM   6197   C CG    A LEU C  1 181 ? 75.532  -0.644  65.993  0.25 28.49  ? 181  LEU C CG    1 
ATOM   6198   C CD1   A LEU C  1 181 ? 75.025  -0.465  64.572  0.25 26.79  ? 181  LEU C CD1   1 
ATOM   6199   C CD2   A LEU C  1 181 ? 76.918  -1.265  65.978  0.25 31.42  ? 181  LEU C CD2   1 
ATOM   6200   N N     A MET C  1 182 ? 75.170  2.616   69.489  0.25 22.77  ? 182  MET C N     1 
ATOM   6201   C CA    A MET C  1 182 ? 74.997  3.955   69.990  0.25 23.00  ? 182  MET C CA    1 
ATOM   6202   C C     A MET C  1 182 ? 75.887  4.267   71.179  0.25 22.56  ? 182  MET C C     1 
ATOM   6203   O O     A MET C  1 182 ? 75.999  3.466   72.093  0.25 24.19  ? 182  MET C O     1 
ATOM   6204   C CB    A MET C  1 182 ? 73.537  4.151   70.414  0.25 26.19  ? 182  MET C CB    1 
ATOM   6205   C CG    A MET C  1 182 ? 72.546  4.164   69.258  0.25 26.16  ? 182  MET C CG    1 
ATOM   6206   S SD    A MET C  1 182 ? 70.870  4.421   69.886  0.25 28.55  ? 182  MET C SD    1 
ATOM   6207   C CE    A MET C  1 182 ? 69.927  3.282   68.833  0.25 26.04  ? 182  MET C CE    1 
ATOM   6208   N N     A ALA C  1 183 ? 76.499  5.444   71.174  0.25 24.16  ? 183  ALA C N     1 
ATOM   6209   C CA    A ALA C  1 183 ? 77.362  5.845   72.296  0.25 27.08  ? 183  ALA C CA    1 
ATOM   6210   C C     A ALA C  1 183 ? 76.486  5.898   73.545  0.25 26.83  ? 183  ALA C C     1 
ATOM   6211   O O     A ALA C  1 183 ? 76.936  5.615   74.643  0.25 28.13  ? 183  ALA C O     1 
ATOM   6212   C CB    A ALA C  1 183 ? 77.972  7.210   72.034  0.25 22.15  ? 183  ALA C CB    1 
ATOM   6213   N N     A LEU C  1 184 ? 75.222  6.256   73.354  0.25 27.37  ? 184  LEU C N     1 
ATOM   6214   C CA    A LEU C  1 184 ? 74.271  6.332   74.458  0.25 26.76  ? 184  LEU C CA    1 
ATOM   6215   C C     A LEU C  1 184 ? 72.874  6.049   73.906  0.25 26.29  ? 184  LEU C C     1 
ATOM   6216   O O     A LEU C  1 184 ? 72.514  6.531   72.829  0.25 22.94  ? 184  LEU C O     1 
ATOM   6217   C CB    A LEU C  1 184 ? 74.321  7.742   75.060  0.25 29.86  ? 184  LEU C CB    1 
ATOM   6218   C CG    A LEU C  1 184 ? 73.968  7.984   76.519  0.25 30.89  ? 184  LEU C CG    1 
ATOM   6219   C CD1   A LEU C  1 184 ? 74.925  7.220   77.419  0.25 29.08  ? 184  LEU C CD1   1 
ATOM   6220   C CD2   A LEU C  1 184 ? 74.044  9.458   76.810  0.25 30.28  ? 184  LEU C CD2   1 
ATOM   6221   N N     A PRO C  1 185 ? 72.068  5.249   74.622  0.25 24.97  ? 185  PRO C N     1 
ATOM   6222   C CA    A PRO C  1 185 ? 70.721  4.962   74.121  0.25 23.66  ? 185  PRO C CA    1 
ATOM   6223   C C     A PRO C  1 185 ? 69.846  6.211   74.235  0.25 20.88  ? 185  PRO C C     1 
ATOM   6224   O O     A PRO C  1 185 ? 70.031  7.040   75.109  0.25 20.44  ? 185  PRO C O     1 
ATOM   6225   C CB    A PRO C  1 185 ? 70.237  3.844   75.054  0.25 28.25  ? 185  PRO C CB    1 
ATOM   6226   C CG    A PRO C  1 185 ? 71.506  3.202   75.527  0.25 27.10  ? 185  PRO C CG    1 
ATOM   6227   C CD    A PRO C  1 185 ? 72.383  4.393   75.776  0.25 26.36  ? 185  PRO C CD    1 
ATOM   6228   N N     A PRO C  1 186 ? 68.866  6.354   73.355  0.25 21.12  ? 186  PRO C N     1 
ATOM   6229   C CA    A PRO C  1 186 ? 67.972  7.521   73.390  0.25 20.63  ? 186  PRO C CA    1 
ATOM   6230   C C     A PRO C  1 186 ? 67.318  7.755   74.764  0.25 20.34  ? 186  PRO C C     1 
ATOM   6231   O O     A PRO C  1 186 ? 66.819  6.813   75.361  0.25 22.82  ? 186  PRO C O     1 
ATOM   6232   C CB    A PRO C  1 186 ? 66.931  7.181   72.315  0.25 17.62  ? 186  PRO C CB    1 
ATOM   6233   C CG    A PRO C  1 186 ? 67.697  6.327   71.355  0.25 23.31  ? 186  PRO C CG    1 
ATOM   6234   C CD    A PRO C  1 186 ? 68.493  5.431   72.271  0.25 21.31  ? 186  PRO C CD    1 
ATOM   6235   N N     A CYS C  1 187 ? 67.348  8.990   75.266  0.25 19.59  ? 187  CYS C N     1 
ATOM   6236   C CA    A CYS C  1 187 ? 66.680  9.320   76.535  0.25 22.50  ? 187  CYS C CA    1 
ATOM   6237   C C     A CYS C  1 187 ? 65.234  9.686   76.178  0.25 22.41  ? 187  CYS C C     1 
ATOM   6238   O O     A CYS C  1 187 ? 64.290  9.136   76.746  0.25 22.29  ? 187  CYS C O     1 
ATOM   6239   C CB    A CYS C  1 187 ? 67.352  10.506  77.255  0.25 22.87  ? 187  CYS C CB    1 
ATOM   6240   S SG    A CYS C  1 187 ? 69.039  10.092  77.829  0.25 28.56  ? 187  CYS C SG    1 
ATOM   6241   N N     A HIS C  1 188 ? 65.067  10.630  75.257  0.25 18.49  ? 188  HIS C N     1 
ATOM   6242   C CA    A HIS C  1 188 ? 63.733  10.971  74.797  0.25 23.12  ? 188  HIS C CA    1 
ATOM   6243   C C     A HIS C  1 188 ? 63.544  9.949   73.686  0.25 25.65  ? 188  HIS C C     1 
ATOM   6244   O O     A HIS C  1 188 ? 63.985  10.146  72.541  0.25 27.04  ? 188  HIS C O     1 
ATOM   6245   C CB    A HIS C  1 188 ? 63.647  12.429  74.297  0.25 22.52  ? 188  HIS C CB    1 
ATOM   6246   C CG    A HIS C  1 188 ? 64.835  12.899  73.504  0.25 22.95  ? 188  HIS C CG    1 
ATOM   6247   N ND1   A HIS C  1 188 ? 64.764  13.179  72.153  0.25 20.68  ? 188  HIS C ND1   1 
ATOM   6248   C CD2   A HIS C  1 188 ? 66.095  13.226  73.890  0.25 22.83  ? 188  HIS C CD2   1 
ATOM   6249   C CE1   A HIS C  1 188 ? 65.925  13.669  71.745  0.25 22.05  ? 188  HIS C CE1   1 
ATOM   6250   N NE2   A HIS C  1 188 ? 66.749  13.710  72.781  0.25 20.21  ? 188  HIS C NE2   1 
ATOM   6251   N N     A MET C  1 189 ? 62.903  8.832   74.034  0.25 24.10  ? 189  MET C N     1 
ATOM   6252   C CA    A MET C  1 189 ? 62.763  7.757   73.079  0.25 25.23  ? 189  MET C CA    1 
ATOM   6253   C C     A MET C  1 189 ? 61.694  7.855   72.031  0.25 26.70  ? 189  MET C C     1 
ATOM   6254   O O     A MET C  1 189 ? 61.771  7.165   71.024  0.25 27.37  ? 189  MET C O     1 
ATOM   6255   C CB    A MET C  1 189 ? 62.712  6.414   73.808  0.25 29.81  ? 189  MET C CB    1 
ATOM   6256   C CG    A MET C  1 189 ? 61.892  6.374   75.077  0.25 32.11  ? 189  MET C CG    1 
ATOM   6257   S SD    A MET C  1 189 ? 62.149  4.804   75.969  0.25 32.26  ? 189  MET C SD    1 
ATOM   6258   C CE    A MET C  1 189 ? 61.093  3.693   75.053  0.25 36.06  ? 189  MET C CE    1 
ATOM   6259   N N     A PHE C  1 190 ? 60.702  8.709   72.244  0.25 27.25  ? 190  PHE C N     1 
ATOM   6260   C CA    A PHE C  1 190 ? 59.681  8.891   71.222  0.25 27.40  ? 190  PHE C CA    1 
ATOM   6261   C C     A PHE C  1 190 ? 58.675  9.944   71.640  0.25 23.69  ? 190  PHE C C     1 
ATOM   6262   O O     A PHE C  1 190 ? 58.625  10.345  72.798  0.25 23.51  ? 190  PHE C O     1 
ATOM   6263   C CB    A PHE C  1 190 ? 58.961  7.581   70.963  0.25 34.42  ? 190  PHE C CB    1 
ATOM   6264   C CG    A PHE C  1 190 ? 57.749  7.400   71.806  0.25 36.88  ? 190  PHE C CG    1 
ATOM   6265   C CD1   A PHE C  1 190 ? 56.519  7.908   71.390  0.25 39.23  ? 190  PHE C CD1   1 
ATOM   6266   C CD2   A PHE C  1 190 ? 57.850  6.823   73.053  0.25 40.13  ? 190  PHE C CD2   1 
ATOM   6267   C CE1   A PHE C  1 190 ? 55.417  7.850   72.205  0.25 42.20  ? 190  PHE C CE1   1 
ATOM   6268   C CE2   A PHE C  1 190 ? 56.741  6.760   73.885  0.25 42.32  ? 190  PHE C CE2   1 
ATOM   6269   C CZ    A PHE C  1 190 ? 55.527  7.275   73.461  0.25 43.40  ? 190  PHE C CZ    1 
ATOM   6270   N N     A CYS C  1 191 ? 57.901  10.413  70.679  0.25 22.18  ? 191  CYS C N     1 
ATOM   6271   C CA    A CYS C  1 191 ? 56.868  11.395  70.974  0.25 22.17  ? 191  CYS C CA    1 
ATOM   6272   C C     A CYS C  1 191 ? 55.702  11.135  70.027  0.25 20.72  ? 191  CYS C C     1 
ATOM   6273   O O     A CYS C  1 191 ? 55.867  10.481  68.990  0.25 20.44  ? 191  CYS C O     1 
ATOM   6274   C CB    A CYS C  1 191 ? 57.403  12.813  70.816  0.25 21.07  ? 191  CYS C CB    1 
ATOM   6275   S SG    A CYS C  1 191 ? 57.707  13.361  69.146  0.25 26.03  ? 191  CYS C SG    1 
ATOM   6276   N N     A GLN C  1 192 ? 54.526  11.628  70.402  0.25 20.06  ? 192  GLN C N     1 
ATOM   6277   C CA    A GLN C  1 192 ? 53.336  11.464  69.595  0.25 16.94  ? 192  GLN C CA    1 
ATOM   6278   C C     A GLN C  1 192 ? 52.692  12.822  69.391  0.25 19.27  ? 192  GLN C C     1 
ATOM   6279   O O     A GLN C  1 192 ? 52.585  13.619  70.329  0.25 19.34  ? 192  GLN C O     1 
ATOM   6280   C CB    A GLN C  1 192 ? 52.342  10.512  70.295  0.25 19.57  ? 192  GLN C CB    1 
ATOM   6281   C CG    A GLN C  1 192 ? 50.955  10.451  69.631  0.25 17.22  ? 192  GLN C CG    1 
ATOM   6282   C CD    A GLN C  1 192 ? 50.078  9.343   70.184  0.25 19.30  ? 192  GLN C CD    1 
ATOM   6283   O OE1   A GLN C  1 192 ? 50.315  8.827   71.286  0.25 18.73  ? 192  GLN C OE1   1 
ATOM   6284   N NE2   A GLN C  1 192 ? 49.050  8.966   69.415  0.25 18.87  ? 192  GLN C NE2   1 
ATOM   6285   N N     A PHE C  1 193 ? 52.286  13.107  68.159  0.25 16.12  ? 193  PHE C N     1 
ATOM   6286   C CA    A PHE C  1 193 ? 51.609  14.357  67.874  0.25 18.32  ? 193  PHE C CA    1 
ATOM   6287   C C     A PHE C  1 193 ? 50.103  14.123  67.751  0.25 17.39  ? 193  PHE C C     1 
ATOM   6288   O O     A PHE C  1 193 ? 49.670  13.051  67.352  0.25 19.10  ? 193  PHE C O     1 
ATOM   6289   C CB    A PHE C  1 193 ? 52.152  14.971  66.587  0.25 19.95  ? 193  PHE C CB    1 
ATOM   6290   C CG    A PHE C  1 193 ? 53.607  15.364  66.691  0.25 21.11  ? 193  PHE C CG    1 
ATOM   6291   C CD1   A PHE C  1 193 ? 54.613  14.453  66.353  0.25 22.17  ? 193  PHE C CD1   1 
ATOM   6292   C CD2   A PHE C  1 193 ? 53.965  16.609  67.186  0.25 21.08  ? 193  PHE C CD2   1 
ATOM   6293   C CE1   A PHE C  1 193 ? 55.978  14.780  66.503  0.25 20.47  ? 193  PHE C CE1   1 
ATOM   6294   C CE2   A PHE C  1 193 ? 55.334  16.957  67.349  0.25 22.10  ? 193  PHE C CE2   1 
ATOM   6295   C CZ    A PHE C  1 193 ? 56.333  16.031  67.003  0.25 18.11  ? 193  PHE C CZ    1 
ATOM   6296   N N     A PHE C  1 194 ? 49.329  15.138  68.091  0.25 19.29  ? 194  PHE C N     1 
ATOM   6297   C CA    A PHE C  1 194 ? 47.874  15.076  68.019  0.25 21.16  ? 194  PHE C CA    1 
ATOM   6298   C C     A PHE C  1 194 ? 47.374  16.384  67.427  0.25 20.28  ? 194  PHE C C     1 
ATOM   6299   O O     A PHE C  1 194 ? 47.873  17.460  67.767  0.25 23.43  ? 194  PHE C O     1 
ATOM   6300   C CB    A PHE C  1 194 ? 47.288  14.868  69.418  0.25 18.95  ? 194  PHE C CB    1 
ATOM   6301   C CG    A PHE C  1 194 ? 45.781  14.791  69.446  0.25 22.44  ? 194  PHE C CG    1 
ATOM   6302   C CD1   A PHE C  1 194 ? 45.011  15.946  69.577  0.25 25.16  ? 194  PHE C CD1   1 
ATOM   6303   C CD2   A PHE C  1 194 ? 45.136  13.563  69.386  0.25 22.54  ? 194  PHE C CD2   1 
ATOM   6304   C CE1   A PHE C  1 194 ? 43.605  15.879  69.664  0.25 22.98  ? 194  PHE C CE1   1 
ATOM   6305   C CE2   A PHE C  1 194 ? 43.730  13.486  69.466  0.25 24.18  ? 194  PHE C CE2   1 
ATOM   6306   C CZ    A PHE C  1 194 ? 42.976  14.650  69.609  0.25 22.11  ? 194  PHE C CZ    1 
ATOM   6307   N N     A VAL C  1 195 ? 46.397  16.296  66.536  0.25 19.23  ? 195  VAL C N     1 
ATOM   6308   C CA    A VAL C  1 195 ? 45.847  17.472  65.891  0.25 20.96  ? 195  VAL C CA    1 
ATOM   6309   C C     A VAL C  1 195 ? 44.360  17.619  66.179  0.25 24.62  ? 195  VAL C C     1 
ATOM   6310   O O     A VAL C  1 195 ? 43.587  16.730  65.844  0.25 21.78  ? 195  VAL C O     1 
ATOM   6311   C CB    A VAL C  1 195 ? 46.016  17.390  64.361  0.25 22.84  ? 195  VAL C CB    1 
ATOM   6312   C CG1   A VAL C  1 195 ? 45.562  18.667  63.720  0.25 19.80  ? 195  VAL C CG1   1 
ATOM   6313   C CG2   A VAL C  1 195 ? 47.453  17.107  64.015  0.25 22.56  ? 195  VAL C CG2   1 
ATOM   6314   N N     A SER C  1 196 ? 43.970  18.738  66.789  0.25 25.49  ? 196  SER C N     1 
ATOM   6315   C CA    A SER C  1 196 ? 42.559  19.015  67.071  0.25 30.13  ? 196  SER C CA    1 
ATOM   6316   C C     A SER C  1 196 ? 41.989  19.752  65.867  0.25 31.35  ? 196  SER C C     1 
ATOM   6317   O O     A SER C  1 196 ? 42.553  20.762  65.413  0.25 30.41  ? 196  SER C O     1 
ATOM   6318   C CB    A SER C  1 196 ? 42.397  19.907  68.302  0.25 29.73  ? 196  SER C CB    1 
ATOM   6319   O OG    A SER C  1 196 ? 42.843  19.249  69.466  0.25 40.10  ? 196  SER C OG    1 
ATOM   6320   N N     A LEU C  1 197 ? 40.874  19.253  65.353  0.25 30.79  ? 197  LEU C N     1 
ATOM   6321   C CA    A LEU C  1 197 ? 40.240  19.872  64.197  0.25 34.61  ? 197  LEU C CA    1 
ATOM   6322   C C     A LEU C  1 197 ? 39.591  21.195  64.593  0.25 31.91  ? 197  LEU C C     1 
ATOM   6323   O O     A LEU C  1 197 ? 39.240  21.389  65.738  0.25 29.06  ? 197  LEU C O     1 
ATOM   6324   C CB    A LEU C  1 197 ? 39.176  18.925  63.607  0.25 33.66  ? 197  LEU C CB    1 
ATOM   6325   C CG    A LEU C  1 197 ? 39.694  17.553  63.166  0.25 36.60  ? 197  LEU C CG    1 
ATOM   6326   C CD1   A LEU C  1 197 ? 38.541  16.716  62.641  0.25 36.74  ? 197  LEU C CD1   1 
ATOM   6327   C CD2   A LEU C  1 197 ? 40.761  17.717  62.107  0.25 37.83  ? 197  LEU C CD2   1 
ATOM   6328   N N     A PRO C  1 198 ? 39.449  22.123  63.640  0.25 35.41  ? 198  PRO C N     1 
ATOM   6329   C CA    A PRO C  1 198 ? 38.833  23.432  63.882  0.25 37.97  ? 198  PRO C CA    1 
ATOM   6330   C C     A PRO C  1 198 ? 37.405  23.259  64.409  0.25 41.07  ? 198  PRO C C     1 
ATOM   6331   O O     A PRO C  1 198 ? 36.636  22.484  63.863  0.25 40.21  ? 198  PRO C O     1 
ATOM   6332   C CB    A PRO C  1 198 ? 38.829  24.071  62.502  0.25 37.41  ? 198  PRO C CB    1 
ATOM   6333   C CG    A PRO C  1 198 ? 40.013  23.436  61.823  0.25 38.71  ? 198  PRO C CG    1 
ATOM   6334   C CD    A PRO C  1 198 ? 39.904  22.006  62.241  0.25 35.58  ? 198  PRO C CD    1 
ATOM   6335   N N     A PRO C  1 199 ? 37.046  23.977  65.484  0.25 44.48  ? 199  PRO C N     1 
ATOM   6336   C CA    A PRO C  1 199 ? 35.704  23.897  66.074  0.25 47.41  ? 199  PRO C CA    1 
ATOM   6337   C C     A PRO C  1 199 ? 34.622  24.283  65.073  0.25 49.52  ? 199  PRO C C     1 
ATOM   6338   O O     A PRO C  1 199 ? 34.900  24.934  64.060  0.25 50.06  ? 199  PRO C O     1 
ATOM   6339   C CB    A PRO C  1 199 ? 35.767  24.891  67.228  0.25 47.02  ? 199  PRO C CB    1 
ATOM   6340   C CG    A PRO C  1 199 ? 37.209  24.860  67.618  0.25 47.03  ? 199  PRO C CG    1 
ATOM   6341   C CD    A PRO C  1 199 ? 37.910  24.863  66.280  0.25 45.58  ? 199  PRO C CD    1 
ATOM   6342   N N     A ALA C  1 200 ? 33.389  23.893  65.391  0.25 52.38  ? 200  ALA C N     1 
ATOM   6343   C CA    A ALA C  1 200 ? 32.220  24.172  64.562  0.25 55.36  ? 200  ALA C CA    1 
ATOM   6344   C C     A ALA C  1 200 ? 32.040  25.662  64.284  0.25 57.39  ? 200  ALA C C     1 
ATOM   6345   O O     A ALA C  1 200 ? 31.904  26.070  63.126  0.25 58.69  ? 200  ALA C O     1 
ATOM   6346   C CB    A ALA C  1 200 ? 30.960  23.614  65.237  0.25 54.27  ? 200  ALA C CB    1 
ATOM   6347   N N     A ASP C  1 201 ? 32.056  26.469  65.342  0.25 58.52  ? 201  ASP C N     1 
ATOM   6348   C CA    A ASP C  1 201 ? 31.866  27.911  65.209  0.25 59.88  ? 201  ASP C CA    1 
ATOM   6349   C C     A ASP C  1 201 ? 33.100  28.686  64.723  0.25 60.52  ? 201  ASP C C     1 
ATOM   6350   O O     A ASP C  1 201 ? 33.424  29.744  65.271  0.25 59.63  ? 201  ASP C O     1 
ATOM   6351   C CB    A ASP C  1 201 ? 31.365  28.488  66.546  0.25 60.70  ? 201  ASP C CB    1 
ATOM   6352   C CG    A ASP C  1 201 ? 32.443  28.533  67.617  0.25 62.08  ? 201  ASP C CG    1 
ATOM   6353   O OD1   A ASP C  1 201 ? 33.323  27.641  67.634  0.25 62.53  ? 201  ASP C OD1   1 
ATOM   6354   O OD2   A ASP C  1 201 ? 32.399  29.457  68.462  0.25 64.58  ? 201  ASP C OD2   1 
ATOM   6355   N N     A SER C  1 202 ? 33.771  28.154  63.697  0.25 60.04  ? 202  SER C N     1 
ATOM   6356   C CA    A SER C  1 202 ? 34.959  28.777  63.101  0.25 59.74  ? 202  SER C CA    1 
ATOM   6357   C C     A SER C  1 202 ? 35.826  27.762  62.374  0.25 59.06  ? 202  SER C C     1 
ATOM   6358   O O     A SER C  1 202 ? 36.977  27.534  62.752  0.25 58.62  ? 202  SER C O     1 
ATOM   6359   C CB    A SER C  1 202 ? 35.825  29.481  64.154  0.25 59.48  ? 202  SER C CB    1 
ATOM   6360   O OG    A SER C  1 202 ? 36.396  28.557  65.052  0.25 62.47  ? 202  SER C OG    1 
ATOM   6361   N N     A PRO C  1 203 ? 35.294  27.152  61.309  0.25 58.94  ? 203  PRO C N     1 
ATOM   6362   C CA    A PRO C  1 203 ? 36.069  26.160  60.560  0.25 58.37  ? 203  PRO C CA    1 
ATOM   6363   C C     A PRO C  1 203 ? 37.264  26.757  59.822  0.25 57.26  ? 203  PRO C C     1 
ATOM   6364   O O     A PRO C  1 203 ? 38.037  26.037  59.182  0.25 57.06  ? 203  PRO C O     1 
ATOM   6365   C CB    A PRO C  1 203 ? 35.033  25.575  59.606  0.25 58.79  ? 203  PRO C CB    1 
ATOM   6366   C CG    A PRO C  1 203 ? 34.173  26.768  59.296  0.25 58.67  ? 203  PRO C CG    1 
ATOM   6367   C CD    A PRO C  1 203 ? 33.971  27.360  60.689  0.25 59.26  ? 203  PRO C CD    1 
ATOM   6368   N N     A GLY C  1 204 ? 37.406  28.076  59.900  0.25 55.28  ? 204  GLY C N     1 
ATOM   6369   C CA    A GLY C  1 204 ? 38.515  28.720  59.223  0.25 52.58  ? 204  GLY C CA    1 
ATOM   6370   C C     A GLY C  1 204 ? 39.779  28.684  60.060  0.25 50.23  ? 204  GLY C C     1 
ATOM   6371   O O     A GLY C  1 204 ? 40.884  28.822  59.535  0.25 48.83  ? 204  GLY C O     1 
ATOM   6372   N N     A SER C  1 205 ? 39.617  28.487  61.365  0.25 46.74  ? 205  SER C N     1 
ATOM   6373   C CA    A SER C  1 205 ? 40.755  28.453  62.276  0.25 43.74  ? 205  SER C CA    1 
ATOM   6374   C C     A SER C  1 205 ? 41.741  27.346  61.935  0.25 39.17  ? 205  SER C C     1 
ATOM   6375   O O     A SER C  1 205 ? 41.397  26.367  61.278  0.25 36.48  ? 205  SER C O     1 
ATOM   6376   C CB    A SER C  1 205 ? 40.269  28.273  63.712  0.25 45.17  ? 205  SER C CB    1 
ATOM   6377   O OG    A SER C  1 205 ? 39.345  29.282  64.066  0.25 48.78  ? 205  SER C OG    1 
ATOM   6378   N N     A LYS C  1 206 ? 42.978  27.517  62.378  0.25 35.97  ? 206  LYS C N     1 
ATOM   6379   C CA    A LYS C  1 206 ? 44.009  26.516  62.142  0.25 32.46  ? 206  LYS C CA    1 
ATOM   6380   C C     A LYS C  1 206 ? 43.866  25.367  63.141  0.25 29.97  ? 206  LYS C C     1 
ATOM   6381   O O     A LYS C  1 206 ? 43.542  25.591  64.306  0.25 27.16  ? 206  LYS C O     1 
ATOM   6382   C CB    A LYS C  1 206 ? 45.406  27.121  62.321  0.25 33.78  ? 206  LYS C CB    1 
ATOM   6383   C CG    A LYS C  1 206 ? 45.816  28.172  61.322  0.25 36.04  ? 206  LYS C CG    1 
ATOM   6384   C CD    A LYS C  1 206 ? 47.233  28.626  61.619  0.25 37.41  ? 206  LYS C CD    1 
ATOM   6385   C CE    A LYS C  1 206 ? 47.708  29.694  60.647  0.25 40.90  ? 206  LYS C CE    1 
ATOM   6386   N NZ    A LYS C  1 206 ? 49.098  30.126  60.978  0.25 42.00  ? 206  LYS C NZ    1 
ATOM   6387   N N     A PRO C  1 207 ? 44.101  24.123  62.694  0.25 26.50  ? 207  PRO C N     1 
ATOM   6388   C CA    A PRO C  1 207 ? 43.997  22.990  63.617  0.25 27.85  ? 207  PRO C CA    1 
ATOM   6389   C C     A PRO C  1 207 ? 45.042  23.194  64.711  0.25 24.82  ? 207  PRO C C     1 
ATOM   6390   O O     A PRO C  1 207 ? 46.047  23.861  64.483  0.25 21.20  ? 207  PRO C O     1 
ATOM   6391   C CB    A PRO C  1 207 ? 44.316  21.793  62.733  0.25 25.82  ? 207  PRO C CB    1 
ATOM   6392   C CG    A PRO C  1 207 ? 43.827  22.232  61.379  0.25 26.48  ? 207  PRO C CG    1 
ATOM   6393   C CD    A PRO C  1 207 ? 44.313  23.662  61.313  0.25 27.08  ? 207  PRO C CD    1 
ATOM   6394   N N     A LYS C  1 208 ? 44.803  22.639  65.893  0.25 24.70  ? 208  LYS C N     1 
ATOM   6395   C CA    A LYS C  1 208 ? 45.757  22.799  66.984  0.25 26.11  ? 208  LYS C CA    1 
ATOM   6396   C C     A LYS C  1 208 ? 46.672  21.579  67.100  0.25 24.95  ? 208  LYS C C     1 
ATOM   6397   O O     A LYS C  1 208 ? 46.211  20.454  67.084  0.25 24.74  ? 208  LYS C O     1 
ATOM   6398   C CB    A LYS C  1 208 ? 45.029  23.051  68.295  0.25 28.32  ? 208  LYS C CB    1 
ATOM   6399   C CG    A LYS C  1 208 ? 44.324  24.400  68.363  0.25 29.99  ? 208  LYS C CG    1 
ATOM   6400   C CD    A LYS C  1 208 ? 43.748  24.622  69.771  0.25 37.33  ? 208  LYS C CD    1 
ATOM   6401   C CE    A LYS C  1 208 ? 42.987  25.931  69.877  0.25 39.12  ? 208  LYS C CE    1 
ATOM   6402   N NZ    A LYS C  1 208 ? 43.856  27.082  69.525  0.25 42.05  ? 208  LYS C NZ    1 
ATOM   6403   N N     A LEU C  1 209 ? 47.973  21.822  67.217  0.25 24.11  ? 209  LEU C N     1 
ATOM   6404   C CA    A LEU C  1 209 ? 48.963  20.749  67.304  0.25 21.67  ? 209  LEU C CA    1 
ATOM   6405   C C     A LEU C  1 209 ? 49.532  20.547  68.700  0.25 20.76  ? 209  LEU C C     1 
ATOM   6406   O O     A LEU C  1 209 ? 50.014  21.480  69.308  0.25 21.07  ? 209  LEU C O     1 
ATOM   6407   C CB    A LEU C  1 209 ? 50.120  21.043  66.348  0.25 22.43  ? 209  LEU C CB    1 
ATOM   6408   C CG    A LEU C  1 209 ? 51.252  20.002  66.290  0.25 20.66  ? 209  LEU C CG    1 
ATOM   6409   C CD1   A LEU C  1 209 ? 50.718  18.698  65.663  0.25 16.59  ? 209  LEU C CD1   1 
ATOM   6410   C CD2   A LEU C  1 209 ? 52.400  20.546  65.439  0.25 18.63  ? 209  LEU C CD2   1 
ATOM   6411   N N     A SER C  1 210 ? 49.482  19.313  69.197  0.25 19.58  ? 210  SER C N     1 
ATOM   6412   C CA    A SER C  1 210 ? 50.013  18.986  70.509  0.25 20.93  ? 210  SER C CA    1 
ATOM   6413   C C     A SER C  1 210 ? 51.069  17.887  70.377  0.25 18.72  ? 210  SER C C     1 
ATOM   6414   O O     A SER C  1 210 ? 51.119  17.153  69.391  0.25 17.72  ? 210  SER C O     1 
ATOM   6415   C CB    A SER C  1 210 ? 48.901  18.521  71.449  0.25 20.44  ? 210  SER C CB    1 
ATOM   6416   O OG    A SER C  1 210 ? 48.031  19.588  71.788  0.25 24.10  ? 210  SER C OG    1 
ATOM   6417   N N     A CYS C  1 211 ? 51.904  17.779  71.388  0.25 20.39  ? 211  CYS C N     1 
ATOM   6418   C CA    A CYS C  1 211 ? 52.976  16.809  71.380  0.25 18.78  ? 211  CYS C CA    1 
ATOM   6419   C C     A CYS C  1 211 ? 53.204  16.217  72.751  0.25 16.97  ? 211  CYS C C     1 
ATOM   6420   O O     A CYS C  1 211 ? 53.323  16.951  73.735  0.25 21.44  ? 211  CYS C O     1 
ATOM   6421   C CB    A CYS C  1 211 ? 54.275  17.494  70.906  0.25 20.44  ? 211  CYS C CB    1 
ATOM   6422   S SG    A CYS C  1 211 ? 55.775  16.445  71.085  0.25 21.44  ? 211  CYS C SG    1 
ATOM   6423   N N     A LEU C  1 212 ? 53.254  14.890  72.820  0.25 18.58  ? 212  LEU C N     1 
ATOM   6424   C CA    A LEU C  1 212 ? 53.552  14.198  74.076  0.25 20.10  ? 212  LEU C CA    1 
ATOM   6425   C C     A LEU C  1 212 ? 54.872  13.447  73.839  0.25 19.49  ? 212  LEU C C     1 
ATOM   6426   O O     A LEU C  1 212 ? 54.989  12.684  72.893  0.25 15.01  ? 212  LEU C O     1 
ATOM   6427   C CB    A LEU C  1 212 ? 52.462  13.192  74.444  0.25 18.93  ? 212  LEU C CB    1 
ATOM   6428   C CG    A LEU C  1 212 ? 52.612  12.558  75.837  0.25 24.69  ? 212  LEU C CG    1 
ATOM   6429   C CD1   A LEU C  1 212 ? 51.304  11.911  76.219  0.25 27.98  ? 212  LEU C CD1   1 
ATOM   6430   C CD2   A LEU C  1 212 ? 53.750  11.536  75.853  0.25 24.07  ? 212  LEU C CD2   1 
ATOM   6431   N N     A MET C  1 213 ? 55.854  13.687  74.696  0.25 20.42  ? 213  MET C N     1 
ATOM   6432   C CA    A MET C  1 213 ? 57.153  13.019  74.587  0.25 20.85  ? 213  MET C CA    1 
ATOM   6433   C C     A MET C  1 213 ? 57.390  12.196  75.852  0.25 19.59  ? 213  MET C C     1 
ATOM   6434   O O     A MET C  1 213 ? 57.019  12.605  76.961  0.25 20.71  ? 213  MET C O     1 
ATOM   6435   C CB    A MET C  1 213 ? 58.275  14.060  74.418  0.25 20.48  ? 213  MET C CB    1 
ATOM   6436   C CG    A MET C  1 213 ? 59.671  13.476  74.163  0.25 18.83  ? 213  MET C CG    1 
ATOM   6437   S SD    A MET C  1 213 ? 60.537  13.073  75.675  0.25 23.71  ? 213  MET C SD    1 
ATOM   6438   C CE    A MET C  1 213 ? 61.336  14.662  76.051  0.25 21.12  ? 213  MET C CE    1 
ATOM   6439   N N     A TYR C  1 214 ? 57.992  11.029  75.685  0.25 18.80  ? 214  TYR C N     1 
ATOM   6440   C CA    A TYR C  1 214 ? 58.271  10.157  76.809  0.25 18.53  ? 214  TYR C CA    1 
ATOM   6441   C C     A TYR C  1 214 ? 59.770  10.010  76.921  0.25 18.04  ? 214  TYR C C     1 
ATOM   6442   O O     A TYR C  1 214 ? 60.415  9.575   75.967  0.25 17.71  ? 214  TYR C O     1 
ATOM   6443   C CB    A TYR C  1 214 ? 57.676  8.762   76.599  0.25 18.62  ? 214  TYR C CB    1 
ATOM   6444   C CG    A TYR C  1 214 ? 57.934  7.863   77.780  0.25 23.61  ? 214  TYR C CG    1 
ATOM   6445   C CD1   A TYR C  1 214 ? 57.072  7.859   78.876  0.25 27.70  ? 214  TYR C CD1   1 
ATOM   6446   C CD2   A TYR C  1 214 ? 59.087  7.071   77.846  0.25 25.60  ? 214  TYR C CD2   1 
ATOM   6447   C CE1   A TYR C  1 214 ? 57.348  7.091   80.017  0.25 28.17  ? 214  TYR C CE1   1 
ATOM   6448   C CE2   A TYR C  1 214 ? 59.374  6.305   78.979  0.25 27.85  ? 214  TYR C CE2   1 
ATOM   6449   C CZ    A TYR C  1 214 ? 58.502  6.319   80.061  0.25 28.15  ? 214  TYR C CZ    1 
ATOM   6450   O OH    A TYR C  1 214 ? 58.784  5.576   81.192  0.25 25.19  ? 214  TYR C OH    1 
ATOM   6451   N N     A GLN C  1 215 ? 60.301  10.337  78.093  0.25 18.97  ? 215  GLN C N     1 
ATOM   6452   C CA    A GLN C  1 215 ? 61.739  10.287  78.370  0.25 19.35  ? 215  GLN C CA    1 
ATOM   6453   C C     A GLN C  1 215 ? 62.008  9.209   79.423  0.25 17.92  ? 215  GLN C C     1 
ATOM   6454   O O     A GLN C  1 215 ? 61.589  9.333   80.574  0.25 18.72  ? 215  GLN C O     1 
ATOM   6455   C CB    A GLN C  1 215 ? 62.189  11.654  78.882  0.25 20.69  ? 215  GLN C CB    1 
ATOM   6456   C CG    A GLN C  1 215 ? 63.697  11.933  78.711  0.25 22.51  ? 215  GLN C CG    1 
ATOM   6457   C CD    A GLN C  1 215 ? 64.075  13.340  79.096  0.25 17.11  ? 215  GLN C CD    1 
ATOM   6458   O OE1   A GLN C  1 215 ? 63.354  14.294  78.806  0.25 19.85  ? 215  GLN C OE1   1 
ATOM   6459   N NE2   A GLN C  1 215 ? 65.215  13.483  79.767  0.25 17.43  ? 215  GLN C NE2   1 
ATOM   6460   N N     A ARG C  1 216 ? 62.707  8.152   79.022  0.25 16.41  ? 216  ARG C N     1 
ATOM   6461   C CA    A ARG C  1 216 ? 63.014  7.036   79.919  0.25 19.03  ? 216  ARG C CA    1 
ATOM   6462   C C     A ARG C  1 216 ? 63.912  7.391   81.099  0.25 20.16  ? 216  ARG C C     1 
ATOM   6463   O O     A ARG C  1 216 ? 63.783  6.809   82.172  0.25 22.91  ? 216  ARG C O     1 
ATOM   6464   C CB    A ARG C  1 216 ? 63.682  5.899   79.124  0.25 17.22  ? 216  ARG C CB    1 
ATOM   6465   C CG    A ARG C  1 216 ? 65.126  6.252   78.686  0.25 20.55  ? 216  ARG C CG    1 
ATOM   6466   C CD    A ARG C  1 216 ? 65.890  5.054   78.112  0.25 19.23  ? 216  ARG C CD    1 
ATOM   6467   N NE    A ARG C  1 216 ? 67.195  5.509   77.627  0.25 22.01  ? 216  ARG C NE    1 
ATOM   6468   C CZ    A ARG C  1 216 ? 68.252  5.742   78.396  0.25 21.20  ? 216  ARG C CZ    1 
ATOM   6469   N NH1   A ARG C  1 216 ? 68.196  5.547   79.712  0.25 16.30  ? 216  ARG C NH1   1 
ATOM   6470   N NH2   A ARG C  1 216 ? 69.369  6.223   77.847  0.25 21.72  ? 216  ARG C NH2   1 
ATOM   6471   N N     A SER C  1 217 ? 64.831  8.329   80.885  0.25 21.20  ? 217  SER C N     1 
ATOM   6472   C CA    A SER C  1 217 ? 65.827  8.713   81.896  0.25 25.28  ? 217  SER C CA    1 
ATOM   6473   C C     A SER C  1 217 ? 65.951  10.229  81.823  0.25 23.72  ? 217  SER C C     1 
ATOM   6474   O O     A SER C  1 217 ? 66.211  10.778  80.765  0.25 26.88  ? 217  SER C O     1 
ATOM   6475   C CB    A SER C  1 217 ? 67.177  8.035   81.576  0.25 23.44  ? 217  SER C CB    1 
ATOM   6476   O OG    A SER C  1 217 ? 68.138  8.277   82.585  0.25 24.84  ? 217  SER C OG    1 
ATOM   6477   N N     A CYS C  1 218 ? 65.786  10.899  82.957  0.25 21.43  ? 218  CYS C N     1 
ATOM   6478   C CA    A CYS C  1 218 ? 65.774  12.347  82.970  0.25 21.64  ? 218  CYS C CA    1 
ATOM   6479   C C     A CYS C  1 218 ? 66.682  13.004  84.000  0.25 20.84  ? 218  CYS C C     1 
ATOM   6480   O O     A CYS C  1 218 ? 66.437  12.918  85.204  0.25 18.73  ? 218  CYS C O     1 
ATOM   6481   C CB    A CYS C  1 218 ? 64.329  12.813  83.221  0.25 22.47  ? 218  CYS C CB    1 
ATOM   6482   S SG    A CYS C  1 218 ? 63.129  11.791  82.288  0.25 21.02  ? 218  CYS C SG    1 
ATOM   6483   N N     A ASP C  1 219 ? 67.718  13.674  83.504  0.25 22.02  ? 219  ASP C N     1 
ATOM   6484   C CA    A ASP C  1 219 ? 68.671  14.392  84.356  0.25 19.59  ? 219  ASP C CA    1 
ATOM   6485   C C     A ASP C  1 219 ? 67.986  15.728  84.540  0.25 19.90  ? 219  ASP C C     1 
ATOM   6486   O O     A ASP C  1 219 ? 68.041  16.594  83.661  0.25 17.02  ? 219  ASP C O     1 
ATOM   6487   C CB    A ASP C  1 219 ? 69.999  14.534  83.601  0.25 21.45  ? 219  ASP C CB    1 
ATOM   6488   C CG    A ASP C  1 219 ? 71.036  15.335  84.378  0.25 24.62  ? 219  ASP C CG    1 
ATOM   6489   O OD1   A ASP C  1 219 ? 72.251  15.195  84.083  0.25 23.71  ? 219  ASP C OD1   1 
ATOM   6490   O OD2   A ASP C  1 219 ? 70.640  16.111  85.265  0.25 19.86  ? 219  ASP C OD2   1 
ATOM   6491   N N     A LEU C  1 220 ? 67.305  15.908  85.670  0.25 22.89  ? 220  LEU C N     1 
ATOM   6492   C CA    A LEU C  1 220 ? 66.555  17.154  85.853  0.25 23.43  ? 220  LEU C CA    1 
ATOM   6493   C C     A LEU C  1 220 ? 67.383  18.423  85.852  0.25 23.69  ? 220  LEU C C     1 
ATOM   6494   O O     A LEU C  1 220 ? 66.952  19.461  85.327  0.25 24.27  ? 220  LEU C O     1 
ATOM   6495   C CB    A LEU C  1 220 ? 65.697  17.091  87.121  0.25 26.86  ? 220  LEU C CB    1 
ATOM   6496   C CG    A LEU C  1 220 ? 64.341  16.471  86.752  0.25 28.61  ? 220  LEU C CG    1 
ATOM   6497   C CD1   A LEU C  1 220 ? 64.330  15.016  87.098  0.25 29.67  ? 220  LEU C CD1   1 
ATOM   6498   C CD2   A LEU C  1 220 ? 63.230  17.208  87.440  0.25 29.86  ? 220  LEU C CD2   1 
ATOM   6499   N N     A GLY C  1 221 ? 68.568  18.357  86.438  0.25 20.96  ? 221  GLY C N     1 
ATOM   6500   C CA    A GLY C  1 221 ? 69.404  19.547  86.461  0.25 17.76  ? 221  GLY C CA    1 
ATOM   6501   C C     A GLY C  1 221 ? 69.850  19.987  85.081  0.25 14.84  ? 221  GLY C C     1 
ATOM   6502   O O     A GLY C  1 221 ? 69.608  21.122  84.716  0.25 19.00  ? 221  GLY C O     1 
ATOM   6503   N N     A LEU C  1 222 ? 70.472  19.095  84.310  0.25 18.95  ? 222  LEU C N     1 
ATOM   6504   C CA    A LEU C  1 222 ? 71.007  19.434  82.989  0.25 20.92  ? 222  LEU C CA    1 
ATOM   6505   C C     A LEU C  1 222 ? 70.197  19.064  81.741  0.25 20.12  ? 222  LEU C C     1 
ATOM   6506   O O     A LEU C  1 222 ? 70.087  19.852  80.808  0.25 18.47  ? 222  LEU C O     1 
ATOM   6507   C CB    A LEU C  1 222 ? 72.402  18.812  82.841  0.25 20.81  ? 222  LEU C CB    1 
ATOM   6508   C CG    A LEU C  1 222 ? 73.520  19.426  83.694  0.25 26.46  ? 222  LEU C CG    1 
ATOM   6509   C CD1   A LEU C  1 222 ? 74.838  18.646  83.471  0.25 22.93  ? 222  LEU C CD1   1 
ATOM   6510   C CD2   A LEU C  1 222 ? 73.701  20.892  83.318  0.25 26.68  ? 222  LEU C CD2   1 
ATOM   6511   N N     A GLY C  1 223 ? 69.663  17.854  81.710  0.25 22.07  ? 223  GLY C N     1 
ATOM   6512   C CA    A GLY C  1 223 ? 68.910  17.425  80.537  0.25 23.27  ? 223  GLY C CA    1 
ATOM   6513   C C     A GLY C  1 223 ? 67.519  18.000  80.340  0.25 21.21  ? 223  GLY C C     1 
ATOM   6514   O O     A GLY C  1 223 ? 67.236  18.623  79.319  0.25 22.21  ? 223  GLY C O     1 
ATOM   6515   N N     A VAL C  1 224 ? 66.647  17.802  81.324  0.25 22.73  ? 224  VAL C N     1 
ATOM   6516   C CA    A VAL C  1 224 ? 65.261  18.257  81.226  0.25 21.13  ? 224  VAL C CA    1 
ATOM   6517   C C     A VAL C  1 224 ? 65.059  19.667  80.707  0.25 20.79  ? 224  VAL C C     1 
ATOM   6518   O O     A VAL C  1 224 ? 64.160  19.906  79.903  0.25 22.08  ? 224  VAL C O     1 
ATOM   6519   C CB    A VAL C  1 224 ? 64.540  18.040  82.573  0.25 21.07  ? 224  VAL C CB    1 
ATOM   6520   C CG1   A VAL C  1 224 ? 63.106  18.552  82.530  0.25 18.49  ? 224  VAL C CG1   1 
ATOM   6521   C CG2   A VAL C  1 224 ? 64.543  16.574  82.857  0.25 15.70  ? 224  VAL C CG2   1 
ATOM   6522   N N     A PRO C  1 225 ? 65.880  20.637  81.160  0.25 23.15  ? 225  PRO C N     1 
ATOM   6523   C CA    A PRO C  1 225 ? 65.693  21.991  80.640  0.25 20.17  ? 225  PRO C CA    1 
ATOM   6524   C C     A PRO C  1 225 ? 65.858  22.017  79.129  0.25 18.71  ? 225  PRO C C     1 
ATOM   6525   O O     A PRO C  1 225 ? 65.162  22.757  78.445  0.25 20.08  ? 225  PRO C O     1 
ATOM   6526   C CB    A PRO C  1 225 ? 66.785  22.789  81.347  0.25 22.80  ? 225  PRO C CB    1 
ATOM   6527   C CG    A PRO C  1 225 ? 66.871  22.100  82.675  0.25 22.75  ? 225  PRO C CG    1 
ATOM   6528   C CD    A PRO C  1 225 ? 66.849  20.635  82.274  0.25 22.53  ? 225  PRO C CD    1 
ATOM   6529   N N     A PHE C  1 226 ? 66.788  21.221  78.606  0.25 20.54  ? 226  PHE C N     1 
ATOM   6530   C CA    A PHE C  1 226 ? 66.999  21.181  77.148  0.25 22.01  ? 226  PHE C CA    1 
ATOM   6531   C C     A PHE C  1 226 ? 65.851  20.418  76.478  0.25 17.97  ? 226  PHE C C     1 
ATOM   6532   O O     A PHE C  1 226 ? 65.295  20.874  75.486  0.25 19.44  ? 226  PHE C O     1 
ATOM   6533   C CB    A PHE C  1 226 ? 68.317  20.471  76.799  0.25 18.34  ? 226  PHE C CB    1 
ATOM   6534   C CG    A PHE C  1 226 ? 69.499  21.403  76.659  0.25 23.78  ? 226  PHE C CG    1 
ATOM   6535   C CD1   A PHE C  1 226 ? 69.914  22.198  77.725  0.25 21.85  ? 226  PHE C CD1   1 
ATOM   6536   C CD2   A PHE C  1 226 ? 70.195  21.476  75.454  0.25 21.40  ? 226  PHE C CD2   1 
ATOM   6537   C CE1   A PHE C  1 226 ? 71.025  23.072  77.586  0.25 25.42  ? 226  PHE C CE1   1 
ATOM   6538   C CE2   A PHE C  1 226 ? 71.292  22.333  75.304  0.25 22.42  ? 226  PHE C CE2   1 
ATOM   6539   C CZ    A PHE C  1 226 ? 71.705  23.132  76.373  0.25 23.08  ? 226  PHE C CZ    1 
ATOM   6540   N N     A ASN C  1 227 ? 65.513  19.259  77.035  0.25 17.12  ? 227  ASN C N     1 
ATOM   6541   C CA    A ASN C  1 227 ? 64.438  18.418  76.480  0.25 19.73  ? 227  ASN C CA    1 
ATOM   6542   C C     A ASN C  1 227 ? 63.134  19.180  76.332  0.25 18.85  ? 227  ASN C C     1 
ATOM   6543   O O     A ASN C  1 227 ? 62.460  19.065  75.309  0.25 22.07  ? 227  ASN C O     1 
ATOM   6544   C CB    A ASN C  1 227 ? 64.223  17.179  77.356  0.25 15.66  ? 227  ASN C CB    1 
ATOM   6545   C CG    A ASN C  1 227 ? 65.396  16.184  77.281  0.25 22.57  ? 227  ASN C CG    1 
ATOM   6546   O OD1   A ASN C  1 227 ? 65.956  15.758  78.298  0.25 21.50  ? 227  ASN C OD1   1 
ATOM   6547   N ND2   A ASN C  1 227 ? 65.757  15.803  76.071  0.25 23.72  ? 227  ASN C ND2   1 
ATOM   6548   N N     A ILE C  1 228 ? 62.793  19.978  77.338  0.25 20.27  ? 228  ILE C N     1 
ATOM   6549   C CA    A ILE C  1 228 ? 61.543  20.740  77.314  0.25 21.52  ? 228  ILE C CA    1 
ATOM   6550   C C     A ILE C  1 228 ? 61.526  21.762  76.193  0.25 23.16  ? 228  ILE C C     1 
ATOM   6551   O O     A ILE C  1 228 ? 60.597  21.807  75.401  0.25 22.15  ? 228  ILE C O     1 
ATOM   6552   C CB    A ILE C  1 228 ? 61.289  21.452  78.653  0.25 20.29  ? 228  ILE C CB    1 
ATOM   6553   C CG1   A ILE C  1 228 ? 61.078  20.407  79.757  0.25 19.67  ? 228  ILE C CG1   1 
ATOM   6554   C CG2   A ILE C  1 228 ? 60.030  22.332  78.553  0.25 19.56  ? 228  ILE C CG2   1 
ATOM   6555   C CD1   A ILE C  1 228 ? 60.896  21.020  81.146  0.25 23.98  ? 228  ILE C CD1   1 
ATOM   6556   N N     A ALA C  1 229 ? 62.570  22.579  76.114  0.25 22.24  ? 229  ALA C N     1 
ATOM   6557   C CA    A ALA C  1 229 ? 62.643  23.586  75.075  0.25 19.42  ? 229  ALA C CA    1 
ATOM   6558   C C     A ALA C  1 229 ? 62.776  22.948  73.687  0.25 20.66  ? 229  ALA C C     1 
ATOM   6559   O O     A ALA C  1 229 ? 62.189  23.435  72.733  0.25 21.44  ? 229  ALA C O     1 
ATOM   6560   C CB    A ALA C  1 229 ? 63.829  24.524  75.343  0.25 20.61  ? 229  ALA C CB    1 
ATOM   6561   N N     A SER C  1 230 ? 63.550  21.869  73.586  0.25 16.91  ? 230  SER C N     1 
ATOM   6562   C CA    A SER C  1 230 ? 63.750  21.186  72.318  0.25 18.08  ? 230  SER C CA    1 
ATOM   6563   C C     A SER C  1 230 ? 62.422  20.679  71.690  0.25 18.62  ? 230  SER C C     1 
ATOM   6564   O O     A SER C  1 230 ? 62.106  20.978  70.539  0.25 16.22  ? 230  SER C O     1 
ATOM   6565   C CB    A SER C  1 230 ? 64.686  20.002  72.520  0.25 13.44  ? 230  SER C CB    1 
ATOM   6566   O OG    A SER C  1 230 ? 64.999  19.395  71.273  0.25 20.50  ? 230  SER C OG    1 
ATOM   6567   N N     A TYR C  1 231 ? 61.655  19.888  72.437  0.25 20.05  ? 231  TYR C N     1 
ATOM   6568   C CA    A TYR C  1 231 ? 60.394  19.386  71.879  0.25 18.52  ? 231  TYR C CA    1 
ATOM   6569   C C     A TYR C  1 231 ? 59.377  20.504  71.695  0.25 19.38  ? 231  TYR C C     1 
ATOM   6570   O O     A TYR C  1 231 ? 58.543  20.434  70.781  0.25 24.75  ? 231  TYR C O     1 
ATOM   6571   C CB    A TYR C  1 231 ? 59.858  18.242  72.743  0.25 20.09  ? 231  TYR C CB    1 
ATOM   6572   C CG    A TYR C  1 231 ? 60.511  16.946  72.335  0.25 21.68  ? 231  TYR C CG    1 
ATOM   6573   C CD1   A TYR C  1 231 ? 59.964  16.154  71.320  0.25 19.19  ? 231  TYR C CD1   1 
ATOM   6574   C CD2   A TYR C  1 231 ? 61.739  16.561  72.887  0.25 19.54  ? 231  TYR C CD2   1 
ATOM   6575   C CE1   A TYR C  1 231 ? 60.618  15.023  70.860  0.25 17.35  ? 231  TYR C CE1   1 
ATOM   6576   C CE2   A TYR C  1 231 ? 62.402  15.426  72.429  0.25 20.37  ? 231  TYR C CE2   1 
ATOM   6577   C CZ    A TYR C  1 231 ? 61.843  14.664  71.423  0.25 17.87  ? 231  TYR C CZ    1 
ATOM   6578   O OH    A TYR C  1 231 ? 62.502  13.533  70.986  0.25 18.32  ? 231  TYR C OH    1 
ATOM   6579   N N     A ALA C  1 232 ? 59.461  21.554  72.511  0.25 16.61  ? 232  ALA C N     1 
ATOM   6580   C CA    A ALA C  1 232 ? 58.541  22.687  72.325  0.25 19.59  ? 232  ALA C CA    1 
ATOM   6581   C C     A ALA C  1 232 ? 58.902  23.345  70.988  0.25 21.16  ? 232  ALA C C     1 
ATOM   6582   O O     A ALA C  1 232 ? 58.028  23.686  70.181  0.25 19.98  ? 232  ALA C O     1 
ATOM   6583   C CB    A ALA C  1 232 ? 58.678  23.680  73.459  0.25 17.56  ? 232  ALA C CB    1 
ATOM   6584   N N     A LEU C  1 233 ? 60.205  23.514  70.739  0.25 20.52  ? 233  LEU C N     1 
ATOM   6585   C CA    A LEU C  1 233 ? 60.649  24.105  69.474  0.25 20.58  ? 233  LEU C CA    1 
ATOM   6586   C C     A LEU C  1 233 ? 60.297  23.206  68.275  0.25 19.87  ? 233  LEU C C     1 
ATOM   6587   O O     A LEU C  1 233 ? 59.874  23.692  67.218  0.25 22.00  ? 233  LEU C O     1 
ATOM   6588   C CB    A LEU C  1 233 ? 62.152  24.351  69.511  0.25 23.34  ? 233  LEU C CB    1 
ATOM   6589   C CG    A LEU C  1 233 ? 62.607  25.468  70.461  0.25 24.94  ? 233  LEU C CG    1 
ATOM   6590   C CD1   A LEU C  1 233 ? 64.113  25.441  70.596  0.25 25.00  ? 233  LEU C CD1   1 
ATOM   6591   C CD2   A LEU C  1 233 ? 62.133  26.810  69.933  0.25 22.73  ? 233  LEU C CD2   1 
ATOM   6592   N N     A LEU C  1 234 ? 60.469  21.896  68.429  0.25 20.26  ? 234  LEU C N     1 
ATOM   6593   C CA    A LEU C  1 234 ? 60.122  20.978  67.339  0.25 21.06  ? 234  LEU C CA    1 
ATOM   6594   C C     A LEU C  1 234 ? 58.643  21.135  66.954  0.25 22.30  ? 234  LEU C C     1 
ATOM   6595   O O     A LEU C  1 234 ? 58.285  21.157  65.765  0.25 20.78  ? 234  LEU C O     1 
ATOM   6596   C CB    A LEU C  1 234 ? 60.382  19.535  67.750  0.25 20.58  ? 234  LEU C CB    1 
ATOM   6597   C CG    A LEU C  1 234 ? 60.093  18.439  66.721  0.25 19.90  ? 234  LEU C CG    1 
ATOM   6598   C CD1   A LEU C  1 234 ? 60.855  18.719  65.412  0.25 22.30  ? 234  LEU C CD1   1 
ATOM   6599   C CD2   A LEU C  1 234 ? 60.476  17.094  67.298  0.25 21.61  ? 234  LEU C CD2   1 
ATOM   6600   N N     A THR C  1 235 ? 57.792  21.256  67.966  0.25 20.17  ? 235  THR C N     1 
ATOM   6601   C CA    A THR C  1 235 ? 56.364  21.405  67.723  0.25 21.93  ? 235  THR C CA    1 
ATOM   6602   C C     A THR C  1 235 ? 56.070  22.706  66.993  0.25 22.50  ? 235  THR C C     1 
ATOM   6603   O O     A THR C  1 235 ? 55.240  22.740  66.079  0.25 21.59  ? 235  THR C O     1 
ATOM   6604   C CB    A THR C  1 235 ? 55.576  21.336  69.046  0.25 20.78  ? 235  THR C CB    1 
ATOM   6605   O OG1   A THR C  1 235 ? 55.882  20.107  69.696  0.25 18.40  ? 235  THR C OG1   1 
ATOM   6606   C CG2   A THR C  1 235 ? 54.073  21.383  68.796  0.25 21.65  ? 235  THR C CG2   1 
ATOM   6607   N N     A HIS C  1 236 ? 56.753  23.785  67.383  0.25 24.45  ? 236  HIS C N     1 
ATOM   6608   C CA    A HIS C  1 236 ? 56.575  25.071  66.715  0.25 22.30  ? 236  HIS C CA    1 
ATOM   6609   C C     A HIS C  1 236 ? 57.013  24.937  65.258  0.25 23.30  ? 236  HIS C C     1 
ATOM   6610   O O     A HIS C  1 236 ? 56.365  25.456  64.366  0.25 22.03  ? 236  HIS C O     1 
ATOM   6611   C CB    A HIS C  1 236 ? 57.415  26.161  67.402  0.25 25.60  ? 236  HIS C CB    1 
ATOM   6612   C CG    A HIS C  1 236 ? 56.786  26.725  68.640  0.25 25.62  ? 236  HIS C CG    1 
ATOM   6613   N ND1   A HIS C  1 236 ? 55.715  27.593  68.596  0.25 25.95  ? 236  HIS C ND1   1 
ATOM   6614   C CD2   A HIS C  1 236 ? 57.060  26.529  69.956  0.25 22.51  ? 236  HIS C CD2   1 
ATOM   6615   C CE1   A HIS C  1 236 ? 55.355  27.908  69.830  0.25 24.71  ? 236  HIS C CE1   1 
ATOM   6616   N NE2   A HIS C  1 236 ? 56.156  27.278  70.673  0.25 27.16  ? 236  HIS C NE2   1 
ATOM   6617   N N     A MET C  1 237 ? 58.127  24.247  65.024  0.25 21.79  ? 237  MET C N     1 
ATOM   6618   C CA    A MET C  1 237 ? 58.643  24.060  63.666  0.25 21.06  ? 237  MET C CA    1 
ATOM   6619   C C     A MET C  1 237 ? 57.644  23.292  62.808  0.25 19.64  ? 237  MET C C     1 
ATOM   6620   O O     A MET C  1 237 ? 57.311  23.698  61.695  0.25 22.62  ? 237  MET C O     1 
ATOM   6621   C CB    A MET C  1 237 ? 59.967  23.271  63.692  0.25 17.93  ? 237  MET C CB    1 
ATOM   6622   C CG    A MET C  1 237 ? 61.182  24.050  64.260  0.25 19.86  ? 237  MET C CG    1 
ATOM   6623   S SD    A MET C  1 237 ? 62.572  22.940  64.553  0.25 22.64  ? 237  MET C SD    1 
ATOM   6624   C CE    A MET C  1 237 ? 63.042  22.560  62.838  0.25 18.32  ? 237  MET C CE    1 
ATOM   6625   N N     A ILE C  1 238 ? 57.180  22.168  63.328  0.25 19.80  ? 238  ILE C N     1 
ATOM   6626   C CA    A ILE C  1 238 ? 56.236  21.340  62.600  0.25 21.80  ? 238  ILE C CA    1 
ATOM   6627   C C     A ILE C  1 238 ? 54.947  22.110  62.343  0.25 21.73  ? 238  ILE C C     1 
ATOM   6628   O O     A ILE C  1 238 ? 54.354  22.013  61.261  0.25 22.26  ? 238  ILE C O     1 
ATOM   6629   C CB    A ILE C  1 238 ? 55.952  20.023  63.376  0.25 22.53  ? 238  ILE C CB    1 
ATOM   6630   C CG1   A ILE C  1 238 ? 57.205  19.128  63.331  0.25 20.57  ? 238  ILE C CG1   1 
ATOM   6631   C CG2   A ILE C  1 238 ? 54.772  19.275  62.747  0.25 20.63  ? 238  ILE C CG2   1 
ATOM   6632   C CD1   A ILE C  1 238 ? 57.172  17.958  64.285  0.25 21.81  ? 238  ILE C CD1   1 
ATOM   6633   N N     A ALA C  1 239 ? 54.536  22.905  63.322  0.25 20.65  ? 239  ALA C N     1 
ATOM   6634   C CA    A ALA C  1 239 ? 53.314  23.693  63.185  0.25 22.49  ? 239  ALA C CA    1 
ATOM   6635   C C     A ALA C  1 239 ? 53.412  24.649  62.007  0.25 22.50  ? 239  ALA C C     1 
ATOM   6636   O O     A ALA C  1 239 ? 52.452  24.834  61.265  0.25 22.66  ? 239  ALA C O     1 
ATOM   6637   C CB    A ALA C  1 239 ? 53.054  24.472  64.472  0.25 20.73  ? 239  ALA C CB    1 
ATOM   6638   N N     A LEU C  1 240 ? 54.584  25.261  61.836  0.25 23.00  ? 240  LEU C N     1 
ATOM   6639   C CA    A LEU C  1 240 ? 54.787  26.200  60.743  0.25 24.01  ? 240  LEU C CA    1 
ATOM   6640   C C     A LEU C  1 240 ? 54.670  25.526  59.387  0.25 23.99  ? 240  LEU C C     1 
ATOM   6641   O O     A LEU C  1 240 ? 54.005  26.044  58.491  0.25 24.77  ? 240  LEU C O     1 
ATOM   6642   C CB    A LEU C  1 240 ? 56.172  26.883  60.854  0.25 23.09  ? 240  LEU C CB    1 
ATOM   6643   C CG    A LEU C  1 240 ? 56.512  27.883  59.735  0.25 23.15  ? 240  LEU C CG    1 
ATOM   6644   C CD1   A LEU C  1 240 ? 55.527  29.054  59.756  0.25 23.75  ? 240  LEU C CD1   1 
ATOM   6645   C CD2   A LEU C  1 240 ? 57.933  28.413  59.935  0.25 28.37  ? 240  LEU C CD2   1 
ATOM   6646   N N     A ILE C  1 241 ? 55.325  24.374  59.241  0.25 24.73  ? 241  ILE C N     1 
ATOM   6647   C CA    A ILE C  1 241 ? 55.312  23.629  57.983  0.25 25.25  ? 241  ILE C CA    1 
ATOM   6648   C C     A ILE C  1 241 ? 53.952  22.983  57.649  0.25 24.39  ? 241  ILE C C     1 
ATOM   6649   O O     A ILE C  1 241 ? 53.627  22.783  56.489  0.25 25.27  ? 241  ILE C O     1 
ATOM   6650   C CB    A ILE C  1 241 ? 56.380  22.510  57.990  0.25 26.25  ? 241  ILE C CB    1 
ATOM   6651   C CG1   A ILE C  1 241 ? 57.760  23.090  58.323  0.25 27.08  ? 241  ILE C CG1   1 
ATOM   6652   C CG2   A ILE C  1 241 ? 56.418  21.824  56.632  0.25 24.50  ? 241  ILE C CG2   1 
ATOM   6653   C CD1   A ILE C  1 241 ? 58.216  24.195  57.365  0.25 27.65  ? 241  ILE C CD1   1 
ATOM   6654   N N     A THR C  1 242 ? 53.152  22.679  58.657  0.25 24.83  ? 242  THR C N     1 
ATOM   6655   C CA    A THR C  1 242 ? 51.868  22.028  58.427  0.25 23.90  ? 242  THR C CA    1 
ATOM   6656   C C     A THR C  1 242 ? 50.660  22.953  58.521  0.25 27.39  ? 242  THR C C     1 
ATOM   6657   O O     A THR C  1 242 ? 49.512  22.493  58.460  0.25 26.30  ? 242  THR C O     1 
ATOM   6658   C CB    A THR C  1 242 ? 51.667  20.902  59.435  0.25 24.26  ? 242  THR C CB    1 
ATOM   6659   O OG1   A THR C  1 242 ? 51.680  21.452  60.755  0.25 24.36  ? 242  THR C OG1   1 
ATOM   6660   C CG2   A THR C  1 242 ? 52.785  19.864  59.308  0.25 24.64  ? 242  THR C CG2   1 
ATOM   6661   N N     A ASP C  1 243 ? 50.908  24.245  58.697  0.25 28.65  ? 243  ASP C N     1 
ATOM   6662   C CA    A ASP C  1 243 ? 49.825  25.214  58.823  0.25 29.78  ? 243  ASP C CA    1 
ATOM   6663   C C     A ASP C  1 243 ? 48.933  24.922  60.022  0.25 29.41  ? 243  ASP C C     1 
ATOM   6664   O O     A ASP C  1 243 ? 47.702  25.058  59.944  0.25 29.91  ? 243  ASP C O     1 
ATOM   6665   C CB    A ASP C  1 243 ? 48.983  25.237  57.533  0.25 33.01  ? 243  ASP C CB    1 
ATOM   6666   C CG    A ASP C  1 243 ? 49.703  25.909  56.389  0.25 34.15  ? 243  ASP C CG    1 
ATOM   6667   O OD1   A ASP C  1 243 ? 49.393  25.606  55.223  0.25 39.60  ? 243  ASP C OD1   1 
ATOM   6668   O OD2   A ASP C  1 243 ? 50.584  26.752  56.658  0.25 37.19  ? 243  ASP C OD2   1 
ATOM   6669   N N     A THR C  1 244 ? 49.538  24.497  61.128  0.25 23.68  ? 244  THR C N     1 
ATOM   6670   C CA    A THR C  1 244 ? 48.754  24.248  62.330  0.25 25.40  ? 244  THR C CA    1 
ATOM   6671   C C     A THR C  1 244 ? 49.203  25.232  63.408  0.25 26.13  ? 244  THR C C     1 
ATOM   6672   O O     A THR C  1 244 ? 50.200  25.934  63.240  0.25 27.84  ? 244  THR C O     1 
ATOM   6673   C CB    A THR C  1 244 ? 48.901  22.776  62.836  0.25 26.10  ? 244  THR C CB    1 
ATOM   6674   O OG1   A THR C  1 244 ? 50.296  22.425  62.979  0.25 24.01  ? 244  THR C OG1   1 
ATOM   6675   C CG2   A THR C  1 244 ? 48.223  21.820  61.842  0.25 24.44  ? 244  THR C CG2   1 
ATOM   6676   N N     A GLU C  1 245 ? 48.462  25.294  64.501  0.25 26.28  ? 245  GLU C N     1 
ATOM   6677   C CA    A GLU C  1 245 ? 48.773  26.197  65.606  0.25 26.49  ? 245  GLU C CA    1 
ATOM   6678   C C     A GLU C  1 245 ? 49.266  25.418  66.821  0.25 25.25  ? 245  GLU C C     1 
ATOM   6679   O O     A GLU C  1 245 ? 48.546  24.597  67.378  0.25 24.15  ? 245  GLU C O     1 
ATOM   6680   C CB    A GLU C  1 245 ? 47.511  26.996  65.976  0.25 28.41  ? 245  GLU C CB    1 
ATOM   6681   C CG    A GLU C  1 245 ? 47.653  27.978  67.127  0.25 32.18  ? 245  GLU C CG    1 
ATOM   6682   C CD    A GLU C  1 245 ? 48.651  29.079  66.831  0.25 36.56  ? 245  GLU C CD    1 
ATOM   6683   O OE1   A GLU C  1 245 ? 48.698  29.519  65.667  0.25 39.82  ? 245  GLU C OE1   1 
ATOM   6684   O OE2   A GLU C  1 245 ? 49.373  29.519  67.759  0.25 40.89  ? 245  GLU C OE2   1 
ATOM   6685   N N     A PRO C  1 246 ? 50.507  25.665  67.254  0.25 27.26  ? 246  PRO C N     1 
ATOM   6686   C CA    A PRO C  1 246 ? 51.014  24.936  68.425  0.25 26.96  ? 246  PRO C CA    1 
ATOM   6687   C C     A PRO C  1 246 ? 50.068  25.123  69.597  0.25 26.12  ? 246  PRO C C     1 
ATOM   6688   O O     A PRO C  1 246 ? 49.581  26.219  69.841  0.25 26.49  ? 246  PRO C O     1 
ATOM   6689   C CB    A PRO C  1 246 ? 52.388  25.556  68.664  0.25 26.40  ? 246  PRO C CB    1 
ATOM   6690   C CG    A PRO C  1 246 ? 52.272  26.910  68.067  0.25 32.59  ? 246  PRO C CG    1 
ATOM   6691   C CD    A PRO C  1 246 ? 51.460  26.694  66.813  0.25 28.79  ? 246  PRO C CD    1 
ATOM   6692   N N     A HIS C  1 247 ? 49.802  24.044  70.324  0.25 28.59  ? 247  HIS C N     1 
ATOM   6693   C CA    A HIS C  1 247 ? 48.867  24.114  71.438  0.25 27.52  ? 247  HIS C CA    1 
ATOM   6694   C C     A HIS C  1 247 ? 49.435  23.685  72.783  0.25 25.39  ? 247  HIS C C     1 
ATOM   6695   O O     A HIS C  1 247 ? 49.491  24.473  73.714  0.25 25.22  ? 247  HIS C O     1 
ATOM   6696   C CB    A HIS C  1 247 ? 47.618  23.271  71.115  0.25 26.46  ? 247  HIS C CB    1 
ATOM   6697   C CG    A HIS C  1 247 ? 46.600  23.260  72.214  0.25 28.49  ? 247  HIS C CG    1 
ATOM   6698   N ND1   A HIS C  1 247 ? 46.049  24.412  72.730  0.25 28.73  ? 247  HIS C ND1   1 
ATOM   6699   C CD2   A HIS C  1 247 ? 46.028  22.238  72.891  0.25 31.27  ? 247  HIS C CD2   1 
ATOM   6700   C CE1   A HIS C  1 247 ? 45.184  24.102  73.680  0.25 27.79  ? 247  HIS C CE1   1 
ATOM   6701   N NE2   A HIS C  1 247 ? 45.150  22.789  73.797  0.25 31.15  ? 247  HIS C NE2   1 
ATOM   6702   N N     A GLU C  1 248 ? 49.881  22.442  72.883  0.25 24.59  ? 248  GLU C N     1 
ATOM   6703   C CA    A GLU C  1 248 ? 50.380  21.944  74.165  0.25 25.46  ? 248  GLU C CA    1 
ATOM   6704   C C     A GLU C  1 248 ? 51.511  20.940  74.007  0.25 23.95  ? 248  GLU C C     1 
ATOM   6705   O O     A GLU C  1 248 ? 51.564  20.193  73.034  0.25 23.70  ? 248  GLU C O     1 
ATOM   6706   C CB    A GLU C  1 248 ? 49.226  21.266  74.926  0.25 25.19  ? 248  GLU C CB    1 
ATOM   6707   C CG    A GLU C  1 248 ? 49.493  20.904  76.362  0.25 34.37  ? 248  GLU C CG    1 
ATOM   6708   C CD    A GLU C  1 248 ? 48.252  20.297  77.039  0.25 37.00  ? 248  GLU C CD    1 
ATOM   6709   O OE1   A GLU C  1 248 ? 48.257  20.140  78.278  0.25 39.84  ? 248  GLU C OE1   1 
ATOM   6710   O OE2   A GLU C  1 248 ? 47.277  19.965  76.320  0.25 38.46  ? 248  GLU C OE2   1 
ATOM   6711   N N     A PHE C  1 249 ? 52.406  20.930  74.984  0.25 20.73  ? 249  PHE C N     1 
ATOM   6712   C CA    A PHE C  1 249 ? 53.502  19.972  75.005  0.25 19.06  ? 249  PHE C CA    1 
ATOM   6713   C C     A PHE C  1 249 ? 53.427  19.244  76.320  0.25 18.36  ? 249  PHE C C     1 
ATOM   6714   O O     A PHE C  1 249 ? 53.385  19.873  77.377  0.25 21.07  ? 249  PHE C O     1 
ATOM   6715   C CB    A PHE C  1 249 ? 54.866  20.663  74.893  0.25 18.48  ? 249  PHE C CB    1 
ATOM   6716   C CG    A PHE C  1 249 ? 56.014  19.753  75.220  0.25 18.32  ? 249  PHE C CG    1 
ATOM   6717   C CD1   A PHE C  1 249 ? 56.167  18.546  74.552  0.25 17.10  ? 249  PHE C CD1   1 
ATOM   6718   C CD2   A PHE C  1 249 ? 56.902  20.075  76.234  0.25 21.46  ? 249  PHE C CD2   1 
ATOM   6719   C CE1   A PHE C  1 249 ? 57.182  17.662  74.889  0.25 15.97  ? 249  PHE C CE1   1 
ATOM   6720   C CE2   A PHE C  1 249 ? 57.936  19.198  76.591  0.25 19.73  ? 249  PHE C CE2   1 
ATOM   6721   C CZ    A PHE C  1 249 ? 58.074  17.995  75.921  0.25 18.64  ? 249  PHE C CZ    1 
ATOM   6722   N N     A ILE C  1 250 ? 53.393  17.918  76.267  0.25 20.63  ? 250  ILE C N     1 
ATOM   6723   C CA    A ILE C  1 250 ? 53.327  17.092  77.484  0.25 19.92  ? 250  ILE C CA    1 
ATOM   6724   C C     A ILE C  1 250 ? 54.590  16.235  77.579  0.25 18.53  ? 250  ILE C C     1 
ATOM   6725   O O     A ILE C  1 250 ? 55.036  15.630  76.593  0.25 21.15  ? 250  ILE C O     1 
ATOM   6726   C CB    A ILE C  1 250 ? 52.101  16.140  77.478  0.25 20.07  ? 250  ILE C CB    1 
ATOM   6727   C CG1   A ILE C  1 250 ? 50.804  16.944  77.277  0.25 22.36  ? 250  ILE C CG1   1 
ATOM   6728   C CG2   A ILE C  1 250 ? 52.049  15.345  78.759  0.25 20.94  ? 250  ILE C CG2   1 
ATOM   6729   C CD1   A ILE C  1 250 ? 50.513  17.262  75.812  0.25 22.37  ? 250  ILE C CD1   1 
ATOM   6730   N N     A LEU C  1 251 ? 55.152  16.166  78.774  0.25 18.90  ? 251  LEU C N     1 
ATOM   6731   C CA    A LEU C  1 251 ? 56.365  15.395  78.982  0.25 21.01  ? 251  LEU C CA    1 
ATOM   6732   C C     A LEU C  1 251 ? 56.208  14.388  80.107  0.25 21.64  ? 251  LEU C C     1 
ATOM   6733   O O     A LEU C  1 251 ? 56.053  14.757  81.280  0.25 24.27  ? 251  LEU C O     1 
ATOM   6734   C CB    A LEU C  1 251 ? 57.526  16.341  79.275  0.25 22.94  ? 251  LEU C CB    1 
ATOM   6735   C CG    A LEU C  1 251 ? 58.880  15.756  79.705  0.25 25.22  ? 251  LEU C CG    1 
ATOM   6736   C CD1   A LEU C  1 251 ? 59.287  14.673  78.783  0.25 27.15  ? 251  LEU C CD1   1 
ATOM   6737   C CD2   A LEU C  1 251 ? 59.937  16.875  79.692  0.25 26.30  ? 251  LEU C CD2   1 
ATOM   6738   N N     A GLN C  1 252 ? 56.246  13.113  79.749  0.25 21.09  ? 252  GLN C N     1 
ATOM   6739   C CA    A GLN C  1 252 ? 56.127  12.038  80.732  0.25 23.56  ? 252  GLN C CA    1 
ATOM   6740   C C     A GLN C  1 252 ? 57.503  11.456  80.961  0.25 21.57  ? 252  GLN C C     1 
ATOM   6741   O O     A GLN C  1 252 ? 58.202  11.093  80.011  0.25 21.55  ? 252  GLN C O     1 
ATOM   6742   C CB    A GLN C  1 252 ? 55.192  10.935  80.222  0.25 25.56  ? 252  GLN C CB    1 
ATOM   6743   C CG    A GLN C  1 252 ? 55.147  9.722   81.135  0.25 28.49  ? 252  GLN C CG    1 
ATOM   6744   C CD    A GLN C  1 252 ? 54.687  10.077  82.540  0.25 29.99  ? 252  GLN C CD    1 
ATOM   6745   O OE1   A GLN C  1 252 ? 55.305  9.677   83.532  0.25 32.44  ? 252  GLN C OE1   1 
ATOM   6746   N NE2   A GLN C  1 252 ? 53.595  10.819  82.631  0.25 28.45  ? 252  GLN C NE2   1 
ATOM   6747   N N     A MET C  1 253 ? 57.871  11.330  82.222  0.25 21.09  ? 253  MET C N     1 
ATOM   6748   C CA    A MET C  1 253 ? 59.179  10.823  82.582  0.25 22.42  ? 253  MET C CA    1 
ATOM   6749   C C     A MET C  1 253 ? 59.152  9.436   83.163  0.25 22.57  ? 253  MET C C     1 
ATOM   6750   O O     A MET C  1 253 ? 58.186  9.052   83.823  0.25 21.95  ? 253  MET C O     1 
ATOM   6751   C CB    A MET C  1 253 ? 59.823  11.742  83.625  0.25 23.08  ? 253  MET C CB    1 
ATOM   6752   C CG    A MET C  1 253 ? 60.046  13.173  83.189  0.25 23.29  ? 253  MET C CG    1 
ATOM   6753   S SD    A MET C  1 253 ? 60.855  14.124  84.556  0.25 26.28  ? 253  MET C SD    1 
ATOM   6754   C CE    A MET C  1 253 ? 60.430  15.739  84.068  0.25 22.60  ? 253  MET C CE    1 
ATOM   6755   N N     A GLY C  1 254 ? 60.229  8.689   82.930  0.25 20.79  ? 254  GLY C N     1 
ATOM   6756   C CA    A GLY C  1 254 ? 60.351  7.371   83.526  0.25 21.59  ? 254  GLY C CA    1 
ATOM   6757   C C     A GLY C  1 254 ? 61.245  7.539   84.761  0.25 23.48  ? 254  GLY C C     1 
ATOM   6758   O O     A GLY C  1 254 ? 60.783  7.946   85.832  0.25 18.78  ? 254  GLY C O     1 
ATOM   6759   N N     A ASP C  1 255 ? 62.538  7.251   84.617  0.25 20.93  ? 255  ASP C N     1 
ATOM   6760   C CA    A ASP C  1 255 ? 63.465  7.410   85.736  0.25 22.06  ? 255  ASP C CA    1 
ATOM   6761   C C     A ASP C  1 255 ? 63.818  8.906   85.839  0.25 23.56  ? 255  ASP C C     1 
ATOM   6762   O O     A ASP C  1 255 ? 64.634  9.425   85.065  0.25 20.70  ? 255  ASP C O     1 
ATOM   6763   C CB    A ASP C  1 255 ? 64.726  6.564   85.478  0.25 25.12  ? 255  ASP C CB    1 
ATOM   6764   C CG    A ASP C  1 255 ? 65.665  6.528   86.665  0.25 23.98  ? 255  ASP C CG    1 
ATOM   6765   O OD1   A ASP C  1 255 ? 66.099  5.419   87.027  0.25 26.58  ? 255  ASP C OD1   1 
ATOM   6766   O OD2   A ASP C  1 255 ? 65.975  7.594   87.230  0.25 24.20  ? 255  ASP C OD2   1 
ATOM   6767   N N     A ALA C  1 256 ? 63.171  9.599   86.773  0.25 22.88  ? 256  ALA C N     1 
ATOM   6768   C CA    A ALA C  1 256 ? 63.382  11.028  86.973  0.25 23.64  ? 256  ALA C CA    1 
ATOM   6769   C C     A ALA C  1 256 ? 64.354  11.166  88.131  0.25 25.29  ? 256  ALA C C     1 
ATOM   6770   O O     A ALA C  1 256 ? 64.034  10.794  89.266  0.25 24.32  ? 256  ALA C O     1 
ATOM   6771   C CB    A ALA C  1 256 ? 62.054  11.728  87.298  0.25 21.50  ? 256  ALA C CB    1 
ATOM   6772   N N     A HIS C  1 257 ? 65.534  11.713  87.851  0.25 22.75  ? 257  HIS C N     1 
ATOM   6773   C CA    A HIS C  1 257 ? 66.559  11.816  88.881  0.25 21.96  ? 257  HIS C CA    1 
ATOM   6774   C C     A HIS C  1 257 ? 67.355  13.126  88.960  0.25 24.49  ? 257  HIS C C     1 
ATOM   6775   O O     A HIS C  1 257 ? 67.422  13.919  88.011  0.25 23.42  ? 257  HIS C O     1 
ATOM   6776   C CB    A HIS C  1 257 ? 67.549  10.666  88.702  0.25 21.98  ? 257  HIS C CB    1 
ATOM   6777   C CG    A HIS C  1 257 ? 68.120  10.578  87.319  0.25 25.74  ? 257  HIS C CG    1 
ATOM   6778   N ND1   A HIS C  1 257 ? 67.521  9.849   86.311  0.25 23.44  ? 257  HIS C ND1   1 
ATOM   6779   C CD2   A HIS C  1 257 ? 69.194  11.185  86.758  0.25 24.46  ? 257  HIS C CD2   1 
ATOM   6780   C CE1   A HIS C  1 257 ? 68.202  10.011  85.190  0.25 23.93  ? 257  HIS C CE1   1 
ATOM   6781   N NE2   A HIS C  1 257 ? 69.221  10.817  85.433  0.25 25.98  ? 257  HIS C NE2   1 
ATOM   6782   N N     A VAL C  1 258 ? 67.969  13.331  90.119  0.25 23.92  ? 258  VAL C N     1 
ATOM   6783   C CA    A VAL C  1 258 ? 68.803  14.497  90.367  0.25 23.29  ? 258  VAL C CA    1 
ATOM   6784   C C     A VAL C  1 258 ? 70.159  13.931  90.761  0.25 22.36  ? 258  VAL C C     1 
ATOM   6785   O O     A VAL C  1 258 ? 70.251  13.192  91.733  0.25 25.18  ? 258  VAL C O     1 
ATOM   6786   C CB    A VAL C  1 258 ? 68.247  15.343  91.531  0.25 24.11  ? 258  VAL C CB    1 
ATOM   6787   C CG1   A VAL C  1 258 ? 69.245  16.431  91.906  0.25 24.99  ? 258  VAL C CG1   1 
ATOM   6788   C CG2   A VAL C  1 258 ? 66.924  15.981  91.138  0.25 21.73  ? 258  VAL C CG2   1 
ATOM   6789   N N     A TYR C  1 259 ? 71.206  14.234  89.996  0.25 22.62  ? 259  TYR C N     1 
ATOM   6790   C CA    A TYR C  1 259 ? 72.534  13.730  90.345  0.25 23.88  ? 259  TYR C CA    1 
ATOM   6791   C C     A TYR C  1 259 ? 73.002  14.298  91.680  0.25 23.83  ? 259  TYR C C     1 
ATOM   6792   O O     A TYR C  1 259 ? 72.655  15.423  92.032  0.25 23.64  ? 259  TYR C O     1 
ATOM   6793   C CB    A TYR C  1 259 ? 73.551  14.062  89.254  0.25 23.29  ? 259  TYR C CB    1 
ATOM   6794   C CG    A TYR C  1 259 ? 73.449  13.109  88.091  0.25 24.83  ? 259  TYR C CG    1 
ATOM   6795   C CD1   A TYR C  1 259 ? 72.573  13.356  87.035  0.25 23.85  ? 259  TYR C CD1   1 
ATOM   6796   C CD2   A TYR C  1 259 ? 74.200  11.938  88.064  0.25 23.59  ? 259  TYR C CD2   1 
ATOM   6797   C CE1   A TYR C  1 259 ? 72.444  12.449  85.969  0.25 23.43  ? 259  TYR C CE1   1 
ATOM   6798   C CE2   A TYR C  1 259 ? 74.086  11.036  87.006  0.25 25.33  ? 259  TYR C CE2   1 
ATOM   6799   C CZ    A TYR C  1 259 ? 73.199  11.304  85.959  0.25 23.67  ? 259  TYR C CZ    1 
ATOM   6800   O OH    A TYR C  1 259 ? 73.079  10.414  84.918  0.25 23.71  ? 259  TYR C OH    1 
ATOM   6801   N N     A ARG C  1 260 ? 73.766  13.497  92.412  0.25 26.31  ? 260  ARG C N     1 
ATOM   6802   C CA    A ARG C  1 260 ? 74.269  13.876  93.728  0.25 31.90  ? 260  ARG C CA    1 
ATOM   6803   C C     A ARG C  1 260 ? 74.979  15.223  93.715  0.25 30.91  ? 260  ARG C C     1 
ATOM   6804   O O     A ARG C  1 260 ? 74.764  16.039  94.602  0.25 30.94  ? 260  ARG C O     1 
ATOM   6805   C CB    A ARG C  1 260 ? 75.224  12.795  94.254  0.25 37.84  ? 260  ARG C CB    1 
ATOM   6806   C CG    A ARG C  1 260 ? 74.676  11.376  94.144  0.25 46.52  ? 260  ARG C CG    1 
ATOM   6807   C CD    A ARG C  1 260 ? 73.497  11.119  95.095  0.25 51.94  ? 260  ARG C CD    1 
ATOM   6808   N NE    A ARG C  1 260 ? 73.942  10.586  96.381  0.25 57.71  ? 260  ARG C NE    1 
ATOM   6809   C CZ    A ARG C  1 260 ? 74.487  9.382   96.543  0.25 59.04  ? 260  ARG C CZ    1 
ATOM   6810   N NH1   A ARG C  1 260 ? 74.649  8.581   95.498  0.25 60.24  ? 260  ARG C NH1   1 
ATOM   6811   N NH2   A ARG C  1 260 ? 74.877  8.980   97.750  0.25 59.74  ? 260  ARG C NH2   1 
ATOM   6812   N N     A ASP C  1 261 ? 75.811  15.467  92.702  0.25 30.04  ? 261  ASP C N     1 
ATOM   6813   C CA    A ASP C  1 261 ? 76.538  16.733  92.626  0.25 29.12  ? 261  ASP C CA    1 
ATOM   6814   C C     A ASP C  1 261 ? 75.704  17.884  92.067  0.25 30.30  ? 261  ASP C C     1 
ATOM   6815   O O     A ASP C  1 261 ? 76.241  18.965  91.778  0.25 28.08  ? 261  ASP C O     1 
ATOM   6816   C CB    A ASP C  1 261 ? 77.831  16.561  91.818  0.25 29.00  ? 261  ASP C CB    1 
ATOM   6817   C CG    A ASP C  1 261 ? 77.588  16.037  90.402  0.25 32.42  ? 261  ASP C CG    1 
ATOM   6818   O OD1   A ASP C  1 261 ? 76.523  15.417  90.123  0.25 27.93  ? 261  ASP C OD1   1 
ATOM   6819   O OD2   A ASP C  1 261 ? 78.498  16.234  89.565  0.25 32.24  ? 261  ASP C OD2   1 
ATOM   6820   N N     A HIS C  1 262 ? 74.392  17.666  91.909  0.25 26.89  ? 262  HIS C N     1 
ATOM   6821   C CA    A HIS C  1 262 ? 73.515  18.736  91.419  0.25 26.86  ? 262  HIS C CA    1 
ATOM   6822   C C     A HIS C  1 262 ? 72.605  19.264  92.527  0.25 28.26  ? 262  HIS C C     1 
ATOM   6823   O O     A HIS C  1 262 ? 71.995  20.326  92.382  0.25 28.05  ? 262  HIS C O     1 
ATOM   6824   C CB    A HIS C  1 262 ? 72.619  18.242  90.262  0.25 25.12  ? 262  HIS C CB    1 
ATOM   6825   C CG    A HIS C  1 262 ? 73.356  17.985  88.985  0.25 24.12  ? 262  HIS C CG    1 
ATOM   6826   N ND1   A HIS C  1 262 ? 72.727  17.526  87.848  0.25 21.89  ? 262  HIS C ND1   1 
ATOM   6827   C CD2   A HIS C  1 262 ? 74.661  18.160  88.653  0.25 22.98  ? 262  HIS C CD2   1 
ATOM   6828   C CE1   A HIS C  1 262 ? 73.611  17.433  86.867  0.25 24.12  ? 262  HIS C CE1   1 
ATOM   6829   N NE2   A HIS C  1 262 ? 74.791  17.813  87.329  0.25 25.41  ? 262  HIS C NE2   1 
ATOM   6830   N N     A VAL C  1 263 ? 72.487  18.507  93.612  0.25 29.03  ? 263  VAL C N     1 
ATOM   6831   C CA    A VAL C  1 263 ? 71.617  18.876  94.724  0.25 30.42  ? 263  VAL C CA    1 
ATOM   6832   C C     A VAL C  1 263 ? 71.850  20.289  95.258  0.25 30.66  ? 263  VAL C C     1 
ATOM   6833   O O     A VAL C  1 263 ? 70.919  21.101  95.348  0.25 30.51  ? 263  VAL C O     1 
ATOM   6834   C CB    A VAL C  1 263 ? 71.755  17.863  95.895  0.25 31.22  ? 263  VAL C CB    1 
ATOM   6835   C CG1   A VAL C  1 263 ? 70.924  18.323  97.098  0.25 30.95  ? 263  VAL C CG1   1 
ATOM   6836   C CG2   A VAL C  1 263 ? 71.300  16.490  95.446  0.25 31.83  ? 263  VAL C CG2   1 
ATOM   6837   N N     A GLU C  1 264 ? 73.089  20.603  95.617  0.25 32.09  ? 264  GLU C N     1 
ATOM   6838   C CA    A GLU C  1 264 ? 73.367  21.942  96.142  0.25 31.98  ? 264  GLU C CA    1 
ATOM   6839   C C     A GLU C  1 264 ? 73.155  23.037  95.110  0.25 30.51  ? 264  GLU C C     1 
ATOM   6840   O O     A GLU C  1 264 ? 72.567  24.076  95.412  0.25 33.94  ? 264  GLU C O     1 
ATOM   6841   C CB    A GLU C  1 264 ? 74.782  22.011  96.718  0.25 35.39  ? 264  GLU C CB    1 
ATOM   6842   C CG    A GLU C  1 264 ? 74.946  21.182  97.982  0.25 39.55  ? 264  GLU C CG    1 
ATOM   6843   C CD    A GLU C  1 264 ? 73.882  21.508  99.023  0.25 45.42  ? 264  GLU C CD    1 
ATOM   6844   O OE1   A GLU C  1 264 ? 73.731  22.701  99.371  0.25 46.18  ? 264  GLU C OE1   1 
ATOM   6845   O OE2   A GLU C  1 264 ? 73.189  20.574  99.493  0.25 48.17  ? 264  GLU C OE2   1 
ATOM   6846   N N     A PRO C  1 265 ? 73.627  22.836  93.872  0.25 28.01  ? 265  PRO C N     1 
ATOM   6847   C CA    A PRO C  1 265 ? 73.406  23.901  92.883  0.25 26.97  ? 265  PRO C CA    1 
ATOM   6848   C C     A PRO C  1 265 ? 71.910  24.151  92.637  0.25 28.19  ? 265  PRO C C     1 
ATOM   6849   O O     A PRO C  1 265 ? 71.485  25.279  92.451  0.25 31.85  ? 265  PRO C O     1 
ATOM   6850   C CB    A PRO C  1 265 ? 74.120  23.371  91.644  0.25 27.28  ? 265  PRO C CB    1 
ATOM   6851   C CG    A PRO C  1 265 ? 75.274  22.575  92.234  0.25 26.27  ? 265  PRO C CG    1 
ATOM   6852   C CD    A PRO C  1 265 ? 74.619  21.857  93.395  0.25 27.51  ? 265  PRO C CD    1 
ATOM   6853   N N     A LEU C  1 266 ? 71.111  23.090  92.638  0.25 29.77  ? 266  LEU C N     1 
ATOM   6854   C CA    A LEU C  1 266 ? 69.678  23.221  92.390  0.25 28.53  ? 266  LEU C CA    1 
ATOM   6855   C C     A LEU C  1 266 ? 68.950  23.919  93.544  0.25 30.23  ? 266  LEU C C     1 
ATOM   6856   O O     A LEU C  1 266 ? 67.949  24.612  93.338  0.25 30.18  ? 266  LEU C O     1 
ATOM   6857   C CB    A LEU C  1 266 ? 69.067  21.835  92.115  0.25 28.23  ? 266  LEU C CB    1 
ATOM   6858   C CG    A LEU C  1 266 ? 69.436  21.179  90.770  0.25 28.18  ? 266  LEU C CG    1 
ATOM   6859   C CD1   A LEU C  1 266 ? 68.872  19.775  90.677  0.25 30.17  ? 266  LEU C CD1   1 
ATOM   6860   C CD2   A LEU C  1 266 ? 68.922  22.028  89.635  0.25 25.77  ? 266  LEU C CD2   1 
ATOM   6861   N N     A LYS C  1 267 ? 69.451  23.753  94.761  0.25 31.85  ? 267  LYS C N     1 
ATOM   6862   C CA    A LYS C  1 267 ? 68.818  24.412  95.907  0.25 34.51  ? 267  LYS C CA    1 
ATOM   6863   C C     A LYS C  1 267 ? 68.848  25.920  95.704  0.25 33.50  ? 267  LYS C C     1 
ATOM   6864   O O     A LYS C  1 267 ? 67.921  26.632  96.090  0.25 34.52  ? 267  LYS C O     1 
ATOM   6865   C CB    A LYS C  1 267 ? 69.530  24.045  97.208  0.25 35.10  ? 267  LYS C CB    1 
ATOM   6866   C CG    A LYS C  1 267 ? 69.275  22.611  97.657  0.25 38.14  ? 267  LYS C CG    1 
ATOM   6867   C CD    A LYS C  1 267 ? 69.993  22.316  98.961  0.25 38.80  ? 267  LYS C CD    1 
ATOM   6868   C CE    A LYS C  1 267 ? 69.730  20.905  99.422  0.25 41.79  ? 267  LYS C CE    1 
ATOM   6869   N NZ    A LYS C  1 267 ? 70.528  20.596  100.642 0.25 46.39  ? 267  LYS C NZ    1 
ATOM   6870   N N     A THR C  1 268 ? 69.911  26.405  95.069  0.25 33.65  ? 268  THR C N     1 
ATOM   6871   C CA    A THR C  1 268 ? 70.039  27.825  94.791  0.25 30.77  ? 268  THR C CA    1 
ATOM   6872   C C     A THR C  1 268 ? 68.972  28.237  93.775  0.25 32.43  ? 268  THR C C     1 
ATOM   6873   O O     A THR C  1 268 ? 68.331  29.295  93.895  0.25 31.71  ? 268  THR C O     1 
ATOM   6874   C CB    A THR C  1 268 ? 71.431  28.154  94.207  0.25 33.55  ? 268  THR C CB    1 
ATOM   6875   O OG1   A THR C  1 268 ? 72.436  27.898  95.193  0.25 34.36  ? 268  THR C OG1   1 
ATOM   6876   C CG2   A THR C  1 268 ? 71.500  29.611  93.779  0.25 29.86  ? 268  THR C CG2   1 
ATOM   6877   N N     A GLN C  1 269 ? 68.778  27.395  92.767  0.25 30.23  ? 269  GLN C N     1 
ATOM   6878   C CA    A GLN C  1 269 ? 67.777  27.679  91.744  0.25 29.24  ? 269  GLN C CA    1 
ATOM   6879   C C     A GLN C  1 269 ? 66.354  27.635  92.328  0.25 27.76  ? 269  GLN C C     1 
ATOM   6880   O O     A GLN C  1 269 ? 65.488  28.389  91.910  0.25 29.17  ? 269  GLN C O     1 
ATOM   6881   C CB    A GLN C  1 269 ? 67.898  26.654  90.593  0.25 27.44  ? 269  GLN C CB    1 
ATOM   6882   C CG    A GLN C  1 269 ? 66.980  26.955  89.396  0.25 26.07  ? 269  GLN C CG    1 
ATOM   6883   C CD    A GLN C  1 269 ? 67.265  26.078  88.175  0.25 27.25  ? 269  GLN C CD    1 
ATOM   6884   O OE1   A GLN C  1 269 ? 66.566  26.174  87.154  0.25 26.81  ? 269  GLN C OE1   1 
ATOM   6885   N NE2   A GLN C  1 269 ? 68.287  25.231  88.263  0.25 23.02  ? 269  GLN C NE2   1 
ATOM   6886   N N     A LEU C  1 270 ? 66.118  26.745  93.283  0.25 28.90  ? 270  LEU C N     1 
ATOM   6887   C CA    A LEU C  1 270 ? 64.781  26.603  93.875  0.25 33.65  ? 270  LEU C CA    1 
ATOM   6888   C C     A LEU C  1 270 ? 64.293  27.849  94.597  0.25 35.50  ? 270  LEU C C     1 
ATOM   6889   O O     A LEU C  1 270 ? 63.094  28.012  94.815  0.25 35.50  ? 270  LEU C O     1 
ATOM   6890   C CB    A LEU C  1 270 ? 64.759  25.422  94.845  0.25 35.65  ? 270  LEU C CB    1 
ATOM   6891   C CG    A LEU C  1 270 ? 64.933  24.032  94.229  0.25 35.09  ? 270  LEU C CG    1 
ATOM   6892   C CD1   A LEU C  1 270 ? 65.019  22.996  95.324  0.25 36.28  ? 270  LEU C CD1   1 
ATOM   6893   C CD2   A LEU C  1 270 ? 63.769  23.744  93.305  0.25 35.56  ? 270  LEU C CD2   1 
ATOM   6894   N N     A GLU C  1 271 ? 65.225  28.733  94.943  0.25 36.19  ? 271  GLU C N     1 
ATOM   6895   C CA    A GLU C  1 271 ? 64.898  29.962  95.651  0.25 38.81  ? 271  GLU C CA    1 
ATOM   6896   C C     A GLU C  1 271 ? 64.416  31.054  94.711  0.25 36.66  ? 271  GLU C C     1 
ATOM   6897   O O     A GLU C  1 271 ? 63.890  32.067  95.158  0.25 35.69  ? 271  GLU C O     1 
ATOM   6898   C CB    A GLU C  1 271 ? 66.131  30.484  96.399  0.25 43.56  ? 271  GLU C CB    1 
ATOM   6899   C CG    A GLU C  1 271 ? 66.712  29.538  97.440  0.25 50.73  ? 271  GLU C CG    1 
ATOM   6900   C CD    A GLU C  1 271 ? 68.039  30.043  97.994  0.25 56.10  ? 271  GLU C CD    1 
ATOM   6901   O OE1   A GLU C  1 271 ? 68.092  31.211  98.439  0.25 59.13  ? 271  GLU C OE1   1 
ATOM   6902   O OE2   A GLU C  1 271 ? 69.032  29.278  97.986  0.25 59.85  ? 271  GLU C OE2   1 
ATOM   6903   N N     A ARG C  1 272 ? 64.575  30.840  93.410  0.25 32.98  ? 272  ARG C N     1 
ATOM   6904   C CA    A ARG C  1 272 ? 64.209  31.855  92.434  0.25 31.12  ? 272  ARG C CA    1 
ATOM   6905   C C     A ARG C  1 272 ? 62.789  31.778  91.900  0.25 31.14  ? 272  ARG C C     1 
ATOM   6906   O O     A ARG C  1 272 ? 62.268  30.696  91.657  0.25 29.01  ? 272  ARG C O     1 
ATOM   6907   C CB    A ARG C  1 272 ? 65.186  31.806  91.267  0.25 28.73  ? 272  ARG C CB    1 
ATOM   6908   C CG    A ARG C  1 272 ? 66.623  32.056  91.677  0.25 29.57  ? 272  ARG C CG    1 
ATOM   6909   C CD    A ARG C  1 272 ? 67.584  31.689  90.547  0.25 30.41  ? 272  ARG C CD    1 
ATOM   6910   N NE    A ARG C  1 272 ? 68.953  32.079  90.860  0.25 29.44  ? 272  ARG C NE    1 
ATOM   6911   C CZ    A ARG C  1 272 ? 69.973  31.970  90.014  0.25 32.95  ? 272  ARG C CZ    1 
ATOM   6912   N NH1   A ARG C  1 272 ? 71.179  32.362  90.397  0.25 29.27  ? 272  ARG C NH1   1 
ATOM   6913   N NH2   A ARG C  1 272 ? 69.793  31.457  88.788  0.25 27.25  ? 272  ARG C NH2   1 
ATOM   6914   N N     A GLU C  1 273 ? 62.190  32.948  91.711  0.25 30.82  ? 273  GLU C N     1 
ATOM   6915   C CA    A GLU C  1 273 ? 60.840  33.070  91.193  0.25 32.35  ? 273  GLU C CA    1 
ATOM   6916   C C     A GLU C  1 273 ? 60.913  33.190  89.670  0.25 31.46  ? 273  GLU C C     1 
ATOM   6917   O O     A GLU C  1 273 ? 61.628  34.034  89.133  0.25 29.35  ? 273  GLU C O     1 
ATOM   6918   C CB    A GLU C  1 273 ? 60.160  34.303  91.780  0.25 35.05  ? 273  GLU C CB    1 
ATOM   6919   C CG    A GLU C  1 273 ? 58.783  34.570  91.195  0.25 44.20  ? 273  GLU C CG    1 
ATOM   6920   C CD    A GLU C  1 273 ? 58.086  35.757  91.850  0.25 48.95  ? 273  GLU C CD    1 
ATOM   6921   O OE1   A GLU C  1 273 ? 57.056  36.220  91.312  0.25 52.06  ? 273  GLU C OE1   1 
ATOM   6922   O OE2   A GLU C  1 273 ? 58.564  36.222  92.905  0.25 51.67  ? 273  GLU C OE2   1 
ATOM   6923   N N     A PRO C  1 274 ? 60.161  32.341  88.957  0.25 31.79  ? 274  PRO C N     1 
ATOM   6924   C CA    A PRO C  1 274 ? 60.142  32.340  87.494  0.25 30.05  ? 274  PRO C CA    1 
ATOM   6925   C C     A PRO C  1 274 ? 59.669  33.641  86.880  0.25 29.59  ? 274  PRO C C     1 
ATOM   6926   O O     A PRO C  1 274 ? 58.845  34.347  87.452  0.25 29.18  ? 274  PRO C O     1 
ATOM   6927   C CB    A PRO C  1 274 ? 59.190  31.182  87.158  0.25 32.18  ? 274  PRO C CB    1 
ATOM   6928   C CG    A PRO C  1 274 ? 59.303  30.274  88.342  0.25 32.22  ? 274  PRO C CG    1 
ATOM   6929   C CD    A PRO C  1 274 ? 59.324  31.251  89.494  0.25 30.50  ? 274  PRO C CD    1 
ATOM   6930   N N     A ARG C  1 275 ? 60.208  33.960  85.706  0.25 29.29  ? 275  ARG C N     1 
ATOM   6931   C CA    A ARG C  1 275 ? 59.794  35.140  84.959  0.25 27.48  ? 275  ARG C CA    1 
ATOM   6932   C C     A ARG C  1 275 ? 58.877  34.569  83.871  0.25 26.01  ? 275  ARG C C     1 
ATOM   6933   O O     A ARG C  1 275 ? 58.979  33.383  83.554  0.25 24.34  ? 275  ARG C O     1 
ATOM   6934   C CB    A ARG C  1 275 ? 61.005  35.819  84.290  0.25 27.28  ? 275  ARG C CB    1 
ATOM   6935   C CG    A ARG C  1 275 ? 61.783  36.800  85.173  0.25 28.59  ? 275  ARG C CG    1 
ATOM   6936   C CD    A ARG C  1 275 ? 62.602  36.117  86.235  0.25 29.73  ? 275  ARG C CD    1 
ATOM   6937   N NE    A ARG C  1 275 ? 63.280  37.090  87.101  0.25 31.66  ? 275  ARG C NE    1 
ATOM   6938   C CZ    A ARG C  1 275 ? 64.366  37.791  86.761  0.25 33.14  ? 275  ARG C CZ    1 
ATOM   6939   N NH1   A ARG C  1 275 ? 64.923  37.639  85.564  0.25 29.66  ? 275  ARG C NH1   1 
ATOM   6940   N NH2   A ARG C  1 275 ? 64.907  38.654  87.620  0.25 31.78  ? 275  ARG C NH2   1 
ATOM   6941   N N     A ASP C  1 276 ? 57.996  35.391  83.302  0.25 27.64  ? 276  ASP C N     1 
ATOM   6942   C CA    A ASP C  1 276 ? 57.115  34.922  82.234  0.25 26.65  ? 276  ASP C CA    1 
ATOM   6943   C C     A ASP C  1 276 ? 57.943  34.335  81.089  0.25 28.29  ? 276  ASP C C     1 
ATOM   6944   O O     A ASP C  1 276 ? 58.986  34.889  80.706  0.25 24.18  ? 276  ASP C O     1 
ATOM   6945   C CB    A ASP C  1 276 ? 56.271  36.059  81.676  0.25 29.13  ? 276  ASP C CB    1 
ATOM   6946   C CG    A ASP C  1 276 ? 55.336  36.650  82.710  0.25 32.88  ? 276  ASP C CG    1 
ATOM   6947   O OD1   A ASP C  1 276 ? 54.898  35.910  83.611  0.25 34.01  ? 276  ASP C OD1   1 
ATOM   6948   O OD2   A ASP C  1 276 ? 55.041  37.857  82.613  0.25 37.24  ? 276  ASP C OD2   1 
ATOM   6949   N N     A PHE C  1 277 ? 57.469  33.224  80.532  0.25 26.92  ? 277  PHE C N     1 
ATOM   6950   C CA    A PHE C  1 277 ? 58.178  32.580  79.424  0.25 26.10  ? 277  PHE C CA    1 
ATOM   6951   C C     A PHE C  1 277 ? 58.286  33.514  78.226  0.25 24.87  ? 277  PHE C C     1 
ATOM   6952   O O     A PHE C  1 277 ? 57.422  34.364  78.000  0.25 25.51  ? 277  PHE C O     1 
ATOM   6953   C CB    A PHE C  1 277 ? 57.464  31.285  78.970  0.25 21.81  ? 277  PHE C CB    1 
ATOM   6954   C CG    A PHE C  1 277 ? 57.659  30.105  79.890  0.25 23.90  ? 277  PHE C CG    1 
ATOM   6955   C CD1   A PHE C  1 277 ? 58.914  29.829  80.454  0.25 19.82  ? 277  PHE C CD1   1 
ATOM   6956   C CD2   A PHE C  1 277 ? 56.598  29.241  80.157  0.25 18.50  ? 277  PHE C CD2   1 
ATOM   6957   C CE1   A PHE C  1 277 ? 59.105  28.717  81.264  0.25 21.59  ? 277  PHE C CE1   1 
ATOM   6958   C CE2   A PHE C  1 277 ? 56.782  28.121  80.969  0.25 20.99  ? 277  PHE C CE2   1 
ATOM   6959   C CZ    A PHE C  1 277 ? 58.036  27.856  81.527  0.25 21.52  ? 277  PHE C CZ    1 
ATOM   6960   N N     A PRO C  1 278 ? 59.367  33.376  77.446  0.25 25.02  ? 278  PRO C N     1 
ATOM   6961   C CA    A PRO C  1 278 ? 59.590  34.199  76.251  0.25 23.95  ? 278  PRO C CA    1 
ATOM   6962   C C     A PRO C  1 278 ? 58.679  33.720  75.117  0.25 26.09  ? 278  PRO C C     1 
ATOM   6963   O O     A PRO C  1 278 ? 57.972  32.721  75.251  0.25 24.62  ? 278  PRO C O     1 
ATOM   6964   C CB    A PRO C  1 278 ? 61.052  33.941  75.927  0.25 25.58  ? 278  PRO C CB    1 
ATOM   6965   C CG    A PRO C  1 278 ? 61.245  32.528  76.347  0.25 25.21  ? 278  PRO C CG    1 
ATOM   6966   C CD    A PRO C  1 278 ? 60.522  32.490  77.697  0.25 25.03  ? 278  PRO C CD    1 
ATOM   6967   N N     A LYS C  1 279 ? 58.682  34.449  74.011  0.25 26.37  ? 279  LYS C N     1 
ATOM   6968   C CA    A LYS C  1 279 ? 57.884  34.064  72.862  0.25 28.96  ? 279  LYS C CA    1 
ATOM   6969   C C     A LYS C  1 279 ? 58.773  33.774  71.660  0.25 29.32  ? 279  LYS C C     1 
ATOM   6970   O O     A LYS C  1 279 ? 59.872  34.318  71.552  0.25 28.59  ? 279  LYS C O     1 
ATOM   6971   C CB    A LYS C  1 279 ? 56.872  35.154  72.540  0.25 33.35  ? 279  LYS C CB    1 
ATOM   6972   C CG    A LYS C  1 279 ? 55.799  35.270  73.622  0.25 38.45  ? 279  LYS C CG    1 
ATOM   6973   C CD    A LYS C  1 279 ? 54.659  36.172  73.207  0.25 44.07  ? 279  LYS C CD    1 
ATOM   6974   C CE    A LYS C  1 279 ? 53.526  36.098  74.237  0.25 46.21  ? 279  LYS C CE    1 
ATOM   6975   N NZ    A LYS C  1 279 ? 52.350  36.942  73.848  0.25 51.23  ? 279  LYS C NZ    1 
ATOM   6976   N N     A LEU C  1 280 ? 58.298  32.903  70.772  0.25 28.13  ? 280  LEU C N     1 
ATOM   6977   C CA    A LEU C  1 280 ? 59.049  32.536  69.579  0.25 29.60  ? 280  LEU C CA    1 
ATOM   6978   C C     A LEU C  1 280 ? 58.445  33.168  68.336  0.25 30.51  ? 280  LEU C C     1 
ATOM   6979   O O     A LEU C  1 280 ? 57.220  33.150  68.149  0.25 30.18  ? 280  LEU C O     1 
ATOM   6980   C CB    A LEU C  1 280 ? 59.077  31.005  69.405  0.25 27.14  ? 280  LEU C CB    1 
ATOM   6981   C CG    A LEU C  1 280 ? 59.713  30.486  68.100  0.25 26.86  ? 280  LEU C CG    1 
ATOM   6982   C CD1   A LEU C  1 280 ? 61.240  30.729  68.132  0.25 23.85  ? 280  LEU C CD1   1 
ATOM   6983   C CD2   A LEU C  1 280 ? 59.412  29.020  67.909  0.25 25.10  ? 280  LEU C CD2   1 
ATOM   6984   N N     A LYS C  1 281 ? 59.310  33.733  67.501  0.25 29.16  ? 281  LYS C N     1 
ATOM   6985   C CA    A LYS C  1 281 ? 58.902  34.349  66.242  0.25 31.31  ? 281  LYS C CA    1 
ATOM   6986   C C     A LYS C  1 281 ? 59.861  33.831  65.162  0.25 29.99  ? 281  LYS C C     1 
ATOM   6987   O O     A LYS C  1 281 ? 60.988  33.474  65.474  0.25 24.83  ? 281  LYS C O     1 
ATOM   6988   C CB    A LYS C  1 281 ? 59.016  35.865  66.326  0.25 33.84  ? 281  LYS C CB    1 
ATOM   6989   C CG    A LYS C  1 281 ? 58.252  36.476  67.482  0.25 40.43  ? 281  LYS C CG    1 
ATOM   6990   C CD    A LYS C  1 281 ? 56.754  36.240  67.343  0.25 43.53  ? 281  LYS C CD    1 
ATOM   6991   C CE    A LYS C  1 281 ? 55.990  37.019  68.408  0.25 44.31  ? 281  LYS C CE    1 
ATOM   6992   N NZ    A LYS C  1 281 ? 54.530  36.849  68.245  0.25 50.46  ? 281  LYS C NZ    1 
ATOM   6993   N N     A TRP C  1 282 ? 59.411  33.807  63.905  0.25 27.08  ? 282  TRP C N     1 
ATOM   6994   C CA    A TRP C  1 282 ? 60.244  33.324  62.813  0.25 28.47  ? 282  TRP C CA    1 
ATOM   6995   C C     A TRP C  1 282 ? 60.829  34.495  62.037  0.25 29.87  ? 282  TRP C C     1 
ATOM   6996   O O     A TRP C  1 282 ? 60.129  35.471  61.759  0.25 31.16  ? 282  TRP C O     1 
ATOM   6997   C CB    A TRP C  1 282 ? 59.427  32.429  61.867  0.25 25.83  ? 282  TRP C CB    1 
ATOM   6998   C CG    A TRP C  1 282 ? 58.878  31.191  62.520  0.25 26.08  ? 282  TRP C CG    1 
ATOM   6999   C CD1   A TRP C  1 282 ? 57.554  30.868  62.695  0.25 23.87  ? 282  TRP C CD1   1 
ATOM   7000   C CD2   A TRP C  1 282 ? 59.634  30.112  63.099  0.25 23.77  ? 282  TRP C CD2   1 
ATOM   7001   N NE1   A TRP C  1 282 ? 57.447  29.661  63.345  0.25 21.15  ? 282  TRP C NE1   1 
ATOM   7002   C CE2   A TRP C  1 282 ? 58.703  29.174  63.604  0.25 23.41  ? 282  TRP C CE2   1 
ATOM   7003   C CE3   A TRP C  1 282 ? 61.007  29.851  63.242  0.25 25.69  ? 282  TRP C CE3   1 
ATOM   7004   C CZ2   A TRP C  1 282 ? 59.098  27.997  64.239  0.25 22.37  ? 282  TRP C CZ2   1 
ATOM   7005   C CZ3   A TRP C  1 282 ? 61.407  28.687  63.874  0.25 24.08  ? 282  TRP C CZ3   1 
ATOM   7006   C CH2   A TRP C  1 282 ? 60.449  27.764  64.371  0.25 24.13  ? 282  TRP C CH2   1 
ATOM   7007   N N     A ALA C  1 283 ? 62.108  34.394  61.696  0.25 29.35  ? 283  ALA C N     1 
ATOM   7008   C CA    A ALA C  1 283 ? 62.786  35.452  60.960  0.25 31.41  ? 283  ALA C CA    1 
ATOM   7009   C C     A ALA C  1 283 ? 62.430  35.379  59.492  0.25 33.32  ? 283  ALA C C     1 
ATOM   7010   O O     A ALA C  1 283 ? 62.684  36.320  58.745  0.25 35.49  ? 283  ALA C O     1 
ATOM   7011   C CB    A ALA C  1 283 ? 64.313  35.337  61.138  0.25 30.85  ? 283  ALA C CB    1 
ATOM   7012   N N     A ARG C  1 284 ? 61.852  34.256  59.072  0.25 32.84  ? 284  ARG C N     1 
ATOM   7013   C CA    A ARG C  1 284 ? 61.471  34.078  57.676  0.25 31.98  ? 284  ARG C CA    1 
ATOM   7014   C C     A ARG C  1 284 ? 60.089  33.477  57.587  0.25 30.90  ? 284  ARG C C     1 
ATOM   7015   O O     A ARG C  1 284 ? 59.545  33.019  58.579  0.25 29.78  ? 284  ARG C O     1 
ATOM   7016   C CB    A ARG C  1 284 ? 62.472  33.173  56.946  0.25 32.43  ? 284  ARG C CB    1 
ATOM   7017   C CG    A ARG C  1 284 ? 63.865  33.774  56.787  0.25 31.87  ? 284  ARG C CG    1 
ATOM   7018   C CD    A ARG C  1 284 ? 64.772  32.902  55.899  0.25 30.13  ? 284  ARG C CD    1 
ATOM   7019   N NE    A ARG C  1 284 ? 65.042  31.598  56.482  0.25 31.70  ? 284  ARG C NE    1 
ATOM   7020   C CZ    A ARG C  1 284 ? 65.375  30.500  55.804  0.25 30.50  ? 284  ARG C CZ    1 
ATOM   7021   N NH1   A ARG C  1 284 ? 65.597  29.373  56.460  0.25 30.95  ? 284  ARG C NH1   1 
ATOM   7022   N NH2   A ARG C  1 284 ? 65.469  30.511  54.487  0.25 29.34  ? 284  ARG C NH2   1 
ATOM   7023   N N     A SER C  1 285 ? 59.520  33.480  56.392  0.25 31.81  ? 285  SER C N     1 
ATOM   7024   C CA    A SER C  1 285 ? 58.175  32.928  56.194  0.25 33.79  ? 285  SER C CA    1 
ATOM   7025   C C     A SER C  1 285 ? 58.193  31.424  55.931  0.25 33.10  ? 285  SER C C     1 
ATOM   7026   O O     A SER C  1 285 ? 59.250  30.818  55.676  0.25 33.09  ? 285  SER C O     1 
ATOM   7027   C CB    A SER C  1 285 ? 57.499  33.621  55.010  0.25 33.64  ? 285  SER C CB    1 
ATOM   7028   O OG    A SER C  1 285 ? 58.210  33.315  53.822  0.25 35.72  ? 285  SER C OG    1 
ATOM   7029   N N     A LYS C  1 286 ? 57.014  30.822  55.987  0.25 34.48  ? 286  LYS C N     1 
ATOM   7030   C CA    A LYS C  1 286 ? 56.882  29.396  55.730  0.25 34.97  ? 286  LYS C CA    1 
ATOM   7031   C C     A LYS C  1 286 ? 57.436  29.063  54.344  0.25 35.29  ? 286  LYS C C     1 
ATOM   7032   O O     A LYS C  1 286 ? 58.171  28.080  54.178  0.25 34.85  ? 286  LYS C O     1 
ATOM   7033   C CB    A LYS C  1 286 ? 55.408  28.989  55.791  0.25 37.89  ? 286  LYS C CB    1 
ATOM   7034   C CG    A LYS C  1 286 ? 55.142  27.566  55.309  0.25 40.30  ? 286  LYS C CG    1 
ATOM   7035   C CD    A LYS C  1 286 ? 53.650  27.301  55.174  0.25 41.94  ? 286  LYS C CD    1 
ATOM   7036   C CE    A LYS C  1 286 ? 53.404  25.936  54.580  0.25 42.02  ? 286  LYS C CE    1 
ATOM   7037   N NZ    A LYS C  1 286 ? 51.951  25.692  54.371  0.25 45.49  ? 286  LYS C NZ    1 
ATOM   7038   N N     A GLU C  1 287 ? 57.076  29.887  53.357  0.25 33.81  ? 287  GLU C N     1 
ATOM   7039   C CA    A GLU C  1 287 ? 57.516  29.699  51.982  0.25 34.48  ? 287  GLU C CA    1 
ATOM   7040   C C     A GLU C  1 287 ? 59.033  29.761  51.853  0.25 33.72  ? 287  GLU C C     1 
ATOM   7041   O O     A GLU C  1 287 ? 59.637  28.964  51.137  0.25 32.98  ? 287  GLU C O     1 
ATOM   7042   C CB    A GLU C  1 287 ? 56.894  30.761  51.070  0.25 37.75  ? 287  GLU C CB    1 
ATOM   7043   C CG    A GLU C  1 287 ? 55.378  30.700  50.938  0.25 42.73  ? 287  GLU C CG    1 
ATOM   7044   C CD    A GLU C  1 287 ? 54.649  30.943  52.253  0.25 46.04  ? 287  GLU C CD    1 
ATOM   7045   O OE1   A GLU C  1 287 ? 55.016  31.886  52.995  0.25 46.70  ? 287  GLU C OE1   1 
ATOM   7046   O OE2   A GLU C  1 287 ? 53.691  30.194  52.536  0.25 47.48  ? 287  GLU C OE2   1 
ATOM   7047   N N     A GLU C  1 288 ? 59.650  30.719  52.535  0.25 32.39  ? 288  GLU C N     1 
ATOM   7048   C CA    A GLU C  1 288 ? 61.097  30.859  52.473  0.25 32.92  ? 288  GLU C CA    1 
ATOM   7049   C C     A GLU C  1 288 ? 61.780  29.664  53.126  0.25 30.01  ? 288  GLU C C     1 
ATOM   7050   O O     A GLU C  1 288 ? 62.739  29.126  52.589  0.25 29.45  ? 288  GLU C O     1 
ATOM   7051   C CB    A GLU C  1 288 ? 61.541  32.156  53.163  0.25 37.59  ? 288  GLU C CB    1 
ATOM   7052   C CG    A GLU C  1 288 ? 60.983  33.418  52.532  0.25 43.31  ? 288  GLU C CG    1 
ATOM   7053   C CD    A GLU C  1 288 ? 61.395  34.681  53.274  0.25 46.27  ? 288  GLU C CD    1 
ATOM   7054   O OE1   A GLU C  1 288 ? 61.055  34.811  54.469  0.25 49.36  ? 288  GLU C OE1   1 
ATOM   7055   O OE2   A GLU C  1 288 ? 62.054  35.546  52.656  0.25 48.53  ? 288  GLU C OE2   1 
ATOM   7056   N N     A ILE C  1 289 ? 61.288  29.249  54.293  0.25 29.84  ? 289  ILE C N     1 
ATOM   7057   C CA    A ILE C  1 289 ? 61.869  28.099  54.975  0.25 28.66  ? 289  ILE C CA    1 
ATOM   7058   C C     A ILE C  1 289 ? 61.630  26.849  54.133  0.25 28.63  ? 289  ILE C C     1 
ATOM   7059   O O     A ILE C  1 289 ? 62.502  25.988  54.025  0.25 24.51  ? 289  ILE C O     1 
ATOM   7060   C CB    A ILE C  1 289 ? 61.276  27.958  56.390  0.25 30.23  ? 289  ILE C CB    1 
ATOM   7061   C CG1   A ILE C  1 289 ? 61.750  29.150  57.234  0.25 31.07  ? 289  ILE C CG1   1 
ATOM   7062   C CG2   A ILE C  1 289 ? 61.724  26.647  57.033  0.25 27.22  ? 289  ILE C CG2   1 
ATOM   7063   C CD1   A ILE C  1 289 ? 61.163  29.216  58.645  0.25 29.92  ? 289  ILE C CD1   1 
ATOM   7064   N N     A GLY C  1 290 ? 60.444  26.766  53.525  0.25 29.91  ? 290  GLY C N     1 
ATOM   7065   C CA    A GLY C  1 290 ? 60.131  25.639  52.656  0.25 30.82  ? 290  GLY C CA    1 
ATOM   7066   C C     A GLY C  1 290 ? 59.586  24.391  53.327  0.25 31.66  ? 290  GLY C C     1 
ATOM   7067   O O     A GLY C  1 290 ? 58.386  24.113  53.243  0.25 28.23  ? 290  GLY C O     1 
ATOM   7068   N N     A ASP C  1 291 ? 60.470  23.622  53.962  0.25 29.22  ? 291  ASP C N     1 
ATOM   7069   C CA    A ASP C  1 291 ? 60.066  22.397  54.647  0.25 28.26  ? 291  ASP C CA    1 
ATOM   7070   C C     A ASP C  1 291 ? 60.825  22.228  55.953  0.25 26.66  ? 291  ASP C C     1 
ATOM   7071   O O     A ASP C  1 291 ? 61.597  23.108  56.343  0.25 27.99  ? 291  ASP C O     1 
ATOM   7072   C CB    A ASP C  1 291 ? 60.297  21.174  53.745  0.25 30.49  ? 291  ASP C CB    1 
ATOM   7073   C CG    A ASP C  1 291 ? 61.714  21.105  53.210  0.25 31.37  ? 291  ASP C CG    1 
ATOM   7074   O OD1   A ASP C  1 291 ? 62.666  21.406  53.952  0.25 33.45  ? 291  ASP C OD1   1 
ATOM   7075   O OD2   A ASP C  1 291 ? 61.877  20.749  52.038  0.25 35.80  ? 291  ASP C OD2   1 
ATOM   7076   N N     A ILE C  1 292 ? 60.611  21.098  56.621  0.25 24.56  ? 292  ILE C N     1 
ATOM   7077   C CA    A ILE C  1 292 ? 61.258  20.822  57.899  0.25 24.89  ? 292  ILE C CA    1 
ATOM   7078   C C     A ILE C  1 292 ? 62.797  20.839  57.831  0.25 25.86  ? 292  ILE C C     1 
ATOM   7079   O O     A ILE C  1 292 ? 63.465  20.994  58.851  0.25 24.69  ? 292  ILE C O     1 
ATOM   7080   C CB    A ILE C  1 292 ? 60.804  19.460  58.460  0.25 23.72  ? 292  ILE C CB    1 
ATOM   7081   C CG1   A ILE C  1 292 ? 61.076  19.383  59.960  0.25 22.55  ? 292  ILE C CG1   1 
ATOM   7082   C CG2   A ILE C  1 292 ? 61.541  18.319  57.755  0.25 24.19  ? 292  ILE C CG2   1 
ATOM   7083   C CD1   A ILE C  1 292 ? 60.273  20.372  60.790  0.25 21.98  ? 292  ILE C CD1   1 
ATOM   7084   N N     A ASP C  1 293 ? 63.349  20.684  56.635  0.25 26.49  ? 293  ASP C N     1 
ATOM   7085   C CA    A ASP C  1 293 ? 64.801  20.677  56.473  0.25 28.41  ? 293  ASP C CA    1 
ATOM   7086   C C     A ASP C  1 293 ? 65.370  22.045  56.102  0.25 28.89  ? 293  ASP C C     1 
ATOM   7087   O O     A ASP C  1 293 ? 66.579  22.183  55.892  0.25 26.16  ? 293  ASP C O     1 
ATOM   7088   C CB    A ASP C  1 293 ? 65.218  19.655  55.400  0.25 28.43  ? 293  ASP C CB    1 
ATOM   7089   C CG    A ASP C  1 293 ? 64.968  18.223  55.827  0.25 31.06  ? 293  ASP C CG    1 
ATOM   7090   O OD1   A ASP C  1 293 ? 65.549  17.778  56.841  0.25 32.00  ? 293  ASP C OD1   1 
ATOM   7091   O OD2   A ASP C  1 293 ? 64.185  17.530  55.137  0.25 31.93  ? 293  ASP C OD2   1 
ATOM   7092   N N     A GLY C  1 294 ? 64.506  23.052  56.023  0.25 26.28  ? 294  GLY C N     1 
ATOM   7093   C CA    A GLY C  1 294 ? 64.973  24.366  55.649  0.25 28.83  ? 294  GLY C CA    1 
ATOM   7094   C C     A GLY C  1 294 ? 65.232  25.367  56.775  0.25 31.59  ? 294  GLY C C     1 
ATOM   7095   O O     A GLY C  1 294 ? 65.549  26.520  56.486  0.25 30.20  ? 294  GLY C O     1 
ATOM   7096   N N     A PHE C  1 295 ? 65.094  24.956  58.038  0.25 27.83  ? 295  PHE C N     1 
ATOM   7097   C CA    A PHE C  1 295 ? 65.324  25.875  59.147  0.25 26.17  ? 295  PHE C CA    1 
ATOM   7098   C C     A PHE C  1 295 ? 66.800  26.143  59.415  0.25 26.37  ? 295  PHE C C     1 
ATOM   7099   O O     A PHE C  1 295 ? 67.661  25.274  59.210  0.25 24.54  ? 295  PHE C O     1 
ATOM   7100   C CB    A PHE C  1 295 ? 64.700  25.348  60.442  0.25 24.94  ? 295  PHE C CB    1 
ATOM   7101   C CG    A PHE C  1 295 ? 63.193  25.374  60.451  0.25 24.37  ? 295  PHE C CG    1 
ATOM   7102   C CD1   A PHE C  1 295 ? 62.455  24.414  59.762  0.25 25.15  ? 295  PHE C CD1   1 
ATOM   7103   C CD2   A PHE C  1 295 ? 62.518  26.348  61.156  0.25 23.30  ? 295  PHE C CD2   1 
ATOM   7104   C CE1   A PHE C  1 295 ? 61.062  24.431  59.786  0.25 24.88  ? 295  PHE C CE1   1 
ATOM   7105   C CE2   A PHE C  1 295 ? 61.118  26.375  61.181  0.25 21.81  ? 295  PHE C CE2   1 
ATOM   7106   C CZ    A PHE C  1 295 ? 60.397  25.413  60.495  0.25 21.74  ? 295  PHE C CZ    1 
ATOM   7107   N N     A LYS C  1 296 ? 67.069  27.349  59.890  0.25 28.09  ? 296  LYS C N     1 
ATOM   7108   C CA    A LYS C  1 296 ? 68.425  27.784  60.246  0.25 31.96  ? 296  LYS C CA    1 
ATOM   7109   C C     A LYS C  1 296 ? 68.370  28.366  61.652  0.25 30.12  ? 296  LYS C C     1 
ATOM   7110   O O     A LYS C  1 296 ? 67.330  28.881  62.056  0.25 27.39  ? 296  LYS C O     1 
ATOM   7111   C CB    A LYS C  1 296 ? 68.914  28.862  59.269  0.25 30.89  ? 296  LYS C CB    1 
ATOM   7112   C CG    A LYS C  1 296 ? 69.064  28.356  57.836  0.25 38.23  ? 296  LYS C CG    1 
ATOM   7113   C CD    A LYS C  1 296 ? 69.353  29.499  56.877  0.25 44.27  ? 296  LYS C CD    1 
ATOM   7114   C CE    A LYS C  1 296 ? 69.307  29.025  55.424  0.25 47.69  ? 296  LYS C CE    1 
ATOM   7115   N NZ    A LYS C  1 296 ? 69.484  30.138  54.448  0.25 50.45  ? 296  LYS C NZ    1 
ATOM   7116   N N     A VAL C  1 297 ? 69.489  28.307  62.381  0.25 29.85  ? 297  VAL C N     1 
ATOM   7117   C CA    A VAL C  1 297 ? 69.534  28.846  63.739  0.25 28.67  ? 297  VAL C CA    1 
ATOM   7118   C C     A VAL C  1 297 ? 68.976  30.259  63.805  0.25 29.85  ? 297  VAL C C     1 
ATOM   7119   O O     A VAL C  1 297 ? 68.154  30.559  64.677  0.25 28.71  ? 297  VAL C O     1 
ATOM   7120   C CB    A VAL C  1 297 ? 70.975  28.861  64.304  0.25 31.50  ? 297  VAL C CB    1 
ATOM   7121   C CG1   A VAL C  1 297 ? 70.975  29.502  65.697  0.25 32.74  ? 297  VAL C CG1   1 
ATOM   7122   C CG2   A VAL C  1 297 ? 71.514  27.448  64.388  0.25 31.65  ? 297  VAL C CG2   1 
ATOM   7123   N N     A GLU C  1 298 ? 69.398  31.116  62.869  0.25 27.60  ? 298  GLU C N     1 
ATOM   7124   C CA    A GLU C  1 298 ? 68.948  32.502  62.837  0.25 30.23  ? 298  GLU C CA    1 
ATOM   7125   C C     A GLU C  1 298 ? 67.457  32.696  62.562  0.25 31.02  ? 298  GLU C C     1 
ATOM   7126   O O     A GLU C  1 298 ? 66.947  33.809  62.665  0.25 30.27  ? 298  GLU C O     1 
ATOM   7127   C CB    A GLU C  1 298 ? 69.761  33.304  61.811  0.25 34.47  ? 298  GLU C CB    1 
ATOM   7128   C CG    A GLU C  1 298 ? 70.216  32.490  60.616  0.25 39.63  ? 298  GLU C CG    1 
ATOM   7129   C CD    A GLU C  1 298 ? 71.440  31.641  60.923  0.25 41.07  ? 298  GLU C CD    1 
ATOM   7130   O OE1   A GLU C  1 298 ? 71.672  30.647  60.213  0.25 43.74  ? 298  GLU C OE1   1 
ATOM   7131   O OE2   A GLU C  1 298 ? 72.185  31.976  61.865  0.25 44.61  ? 298  GLU C OE2   1 
ATOM   7132   N N     A ASP C  1 299 ? 66.753  31.625  62.211  0.25 29.92  ? 299  ASP C N     1 
ATOM   7133   C CA    A ASP C  1 299 ? 65.328  31.741  61.957  0.25 29.65  ? 299  ASP C CA    1 
ATOM   7134   C C     A ASP C  1 299 ? 64.563  31.873  63.272  0.25 28.92  ? 299  ASP C C     1 
ATOM   7135   O O     A ASP C  1 299 ? 63.460  32.441  63.314  0.25 31.14  ? 299  ASP C O     1 
ATOM   7136   C CB    A ASP C  1 299 ? 64.810  30.507  61.206  0.25 30.97  ? 299  ASP C CB    1 
ATOM   7137   C CG    A ASP C  1 299 ? 65.229  30.483  59.745  0.25 32.56  ? 299  ASP C CG    1 
ATOM   7138   O OD1   A ASP C  1 299 ? 65.241  31.559  59.119  0.25 31.35  ? 299  ASP C OD1   1 
ATOM   7139   O OD2   A ASP C  1 299 ? 65.516  29.374  59.218  0.25 31.02  ? 299  ASP C OD2   1 
ATOM   7140   N N     A PHE C  1 300 ? 65.150  31.344  64.337  0.25 28.05  ? 300  PHE C N     1 
ATOM   7141   C CA    A PHE C  1 300 ? 64.525  31.358  65.657  0.25 30.66  ? 300  PHE C CA    1 
ATOM   7142   C C     A PHE C  1 300 ? 64.718  32.666  66.414  0.25 30.78  ? 300  PHE C C     1 
ATOM   7143   O O     A PHE C  1 300 ? 65.774  32.901  67.000  0.25 33.75  ? 300  PHE C O     1 
ATOM   7144   C CB    A PHE C  1 300 ? 65.062  30.198  66.521  0.25 28.64  ? 300  PHE C CB    1 
ATOM   7145   C CG    A PHE C  1 300 ? 64.788  28.830  65.951  0.25 28.01  ? 300  PHE C CG    1 
ATOM   7146   C CD1   A PHE C  1 300 ? 65.461  28.390  64.814  0.25 28.95  ? 300  PHE C CD1   1 
ATOM   7147   C CD2   A PHE C  1 300 ? 63.843  27.982  66.546  0.25 24.12  ? 300  PHE C CD2   1 
ATOM   7148   C CE1   A PHE C  1 300 ? 65.199  27.136  64.274  0.25 28.00  ? 300  PHE C CE1   1 
ATOM   7149   C CE2   A PHE C  1 300 ? 63.577  26.729  66.016  0.25 23.21  ? 300  PHE C CE2   1 
ATOM   7150   C CZ    A PHE C  1 300 ? 64.248  26.302  64.884  0.25 24.61  ? 300  PHE C CZ    1 
ATOM   7151   N N     A VAL C  1 301 ? 63.689  33.503  66.417  0.25 29.84  ? 301  VAL C N     1 
ATOM   7152   C CA    A VAL C  1 301 ? 63.749  34.778  67.119  0.25 31.03  ? 301  VAL C CA    1 
ATOM   7153   C C     A VAL C  1 301 ? 62.996  34.685  68.438  0.25 30.26  ? 301  VAL C C     1 
ATOM   7154   O O     A VAL C  1 301 ? 61.771  34.775  68.468  0.25 29.65  ? 301  VAL C O     1 
ATOM   7155   C CB    A VAL C  1 301 ? 63.136  35.915  66.269  0.25 32.66  ? 301  VAL C CB    1 
ATOM   7156   C CG1   A VAL C  1 301 ? 63.241  37.247  67.028  0.25 34.14  ? 301  VAL C CG1   1 
ATOM   7157   C CG2   A VAL C  1 301 ? 63.866  36.007  64.936  0.25 31.28  ? 301  VAL C CG2   1 
ATOM   7158   N N     A VAL C  1 302 ? 63.737  34.502  69.526  0.25 29.09  ? 302  VAL C N     1 
ATOM   7159   C CA    A VAL C  1 302 ? 63.148  34.393  70.853  0.25 29.61  ? 302  VAL C CA    1 
ATOM   7160   C C     A VAL C  1 302 ? 63.173  35.747  71.547  0.25 30.86  ? 302  VAL C C     1 
ATOM   7161   O O     A VAL C  1 302 ? 64.241  36.293  71.834  0.25 31.47  ? 302  VAL C O     1 
ATOM   7162   C CB    A VAL C  1 302 ? 63.913  33.352  71.713  0.25 28.99  ? 302  VAL C CB    1 
ATOM   7163   C CG1   A VAL C  1 302 ? 63.295  33.248  73.103  0.25 27.10  ? 302  VAL C CG1   1 
ATOM   7164   C CG2   A VAL C  1 302 ? 63.895  31.982  71.012  0.25 28.76  ? 302  VAL C CG2   1 
ATOM   7165   N N     A GLU C  1 303 ? 61.996  36.291  71.828  0.25 30.75  ? 303  GLU C N     1 
ATOM   7166   C CA    A GLU C  1 303 ? 61.928  37.593  72.472  0.25 32.57  ? 303  GLU C CA    1 
ATOM   7167   C C     A GLU C  1 303 ? 61.346  37.553  73.878  0.25 30.76  ? 303  GLU C C     1 
ATOM   7168   O O     A GLU C  1 303 ? 60.500  36.721  74.179  0.25 31.53  ? 303  GLU C O     1 
ATOM   7169   C CB    A GLU C  1 303 ? 61.135  38.558  71.579  0.25 35.84  ? 303  GLU C CB    1 
ATOM   7170   C CG    A GLU C  1 303 ? 59.727  38.127  71.285  0.25 39.84  ? 303  GLU C CG    1 
ATOM   7171   C CD    A GLU C  1 303 ? 59.168  38.780  70.022  0.25 44.29  ? 303  GLU C CD    1 
ATOM   7172   O OE1   A GLU C  1 303 ? 57.943  38.681  69.780  0.25 42.50  ? 303  GLU C OE1   1 
ATOM   7173   O OE2   A GLU C  1 303 ? 59.960  39.384  69.266  0.25 46.41  ? 303  GLU C OE2   1 
ATOM   7174   N N     A GLY C  1 304 ? 61.822  38.452  74.739  0.25 29.92  ? 304  GLY C N     1 
ATOM   7175   C CA    A GLY C  1 304 ? 61.339  38.511  76.108  0.25 27.08  ? 304  GLY C CA    1 
ATOM   7176   C C     A GLY C  1 304 ? 61.945  37.487  77.047  0.25 26.61  ? 304  GLY C C     1 
ATOM   7177   O O     A GLY C  1 304 ? 61.382  37.206  78.110  0.25 27.93  ? 304  GLY C O     1 
ATOM   7178   N N     A TYR C  1 305 ? 63.082  36.906  76.679  0.25 23.62  ? 305  TYR C N     1 
ATOM   7179   C CA    A TYR C  1 305 ? 63.691  35.916  77.560  0.25 24.22  ? 305  TYR C CA    1 
ATOM   7180   C C     A TYR C  1 305 ? 64.425  36.684  78.661  0.25 27.20  ? 305  TYR C C     1 
ATOM   7181   O O     A TYR C  1 305 ? 65.389  37.402  78.384  0.25 26.30  ? 305  TYR C O     1 
ATOM   7182   C CB    A TYR C  1 305 ? 64.678  35.025  76.793  0.25 19.56  ? 305  TYR C CB    1 
ATOM   7183   C CG    A TYR C  1 305 ? 65.251  33.895  77.615  0.25 20.65  ? 305  TYR C CG    1 
ATOM   7184   C CD1   A TYR C  1 305 ? 66.588  33.516  77.480  0.25 18.61  ? 305  TYR C CD1   1 
ATOM   7185   C CD2   A TYR C  1 305 ? 64.458  33.206  78.546  0.25 18.56  ? 305  TYR C CD2   1 
ATOM   7186   C CE1   A TYR C  1 305 ? 67.125  32.481  78.250  0.25 18.96  ? 305  TYR C CE1   1 
ATOM   7187   C CE2   A TYR C  1 305 ? 64.986  32.174  79.317  0.25 21.44  ? 305  TYR C CE2   1 
ATOM   7188   C CZ    A TYR C  1 305 ? 66.319  31.817  79.163  0.25 20.45  ? 305  TYR C CZ    1 
ATOM   7189   O OH    A TYR C  1 305 ? 66.831  30.807  79.926  0.25 20.30  ? 305  TYR C OH    1 
ATOM   7190   N N     A LYS C  1 306 ? 63.981  36.512  79.908  0.25 28.31  ? 306  LYS C N     1 
ATOM   7191   C CA    A LYS C  1 306 ? 64.578  37.208  81.050  0.25 29.14  ? 306  LYS C CA    1 
ATOM   7192   C C     A LYS C  1 306 ? 64.890  36.260  82.188  0.25 28.35  ? 306  LYS C C     1 
ATOM   7193   O O     A LYS C  1 306 ? 64.206  36.244  83.214  0.25 29.42  ? 306  LYS C O     1 
ATOM   7194   C CB    A LYS C  1 306 ? 63.624  38.305  81.525  0.25 32.63  ? 306  LYS C CB    1 
ATOM   7195   C CG    A LYS C  1 306 ? 63.353  39.348  80.450  0.25 33.28  ? 306  LYS C CG    1 
ATOM   7196   C CD    A LYS C  1 306 ? 62.333  40.375  80.900  0.25 37.28  ? 306  LYS C CD    1 
ATOM   7197   C CE    A LYS C  1 306 ? 62.107  41.427  79.813  0.25 39.97  ? 306  LYS C CE    1 
ATOM   7198   N NZ    A LYS C  1 306 ? 61.051  42.416  80.198  0.25 42.98  ? 306  LYS C NZ    1 
ATOM   7199   N N     A PRO C  1 307 ? 65.936  35.449  82.025  0.25 26.03  ? 307  PRO C N     1 
ATOM   7200   C CA    A PRO C  1 307 ? 66.331  34.487  83.049  0.25 24.90  ? 307  PRO C CA    1 
ATOM   7201   C C     A PRO C  1 307 ? 67.196  35.048  84.174  0.25 27.69  ? 307  PRO C C     1 
ATOM   7202   O O     A PRO C  1 307 ? 67.742  36.159  84.081  0.25 26.61  ? 307  PRO C O     1 
ATOM   7203   C CB    A PRO C  1 307 ? 67.096  33.450  82.240  0.25 25.44  ? 307  PRO C CB    1 
ATOM   7204   C CG    A PRO C  1 307 ? 67.857  34.339  81.259  0.25 24.95  ? 307  PRO C CG    1 
ATOM   7205   C CD    A PRO C  1 307 ? 66.765  35.308  80.806  0.25 25.43  ? 307  PRO C CD    1 
ATOM   7206   N N     A TRP C  1 308 ? 67.316  34.259  85.240  0.25 27.33  ? 308  TRP C N     1 
ATOM   7207   C CA    A TRP C  1 308 ? 68.185  34.607  86.345  0.25 28.25  ? 308  TRP C CA    1 
ATOM   7208   C C     A TRP C  1 308 ? 69.563  34.142  85.882  0.25 28.13  ? 308  TRP C C     1 
ATOM   7209   O O     A TRP C  1 308 ? 69.709  33.704  84.739  0.25 23.85  ? 308  TRP C O     1 
ATOM   7210   C CB    A TRP C  1 308 ? 67.799  33.868  87.606  0.25 26.83  ? 308  TRP C CB    1 
ATOM   7211   C CG    A TRP C  1 308 ? 66.541  34.372  88.229  0.25 30.98  ? 308  TRP C CG    1 
ATOM   7212   C CD1   A TRP C  1 308 ? 65.272  33.928  87.989  0.25 30.43  ? 308  TRP C CD1   1 
ATOM   7213   C CD2   A TRP C  1 308 ? 66.426  35.422  89.193  0.25 31.44  ? 308  TRP C CD2   1 
ATOM   7214   N NE1   A TRP C  1 308 ? 64.370  34.636  88.743  0.25 32.35  ? 308  TRP C NE1   1 
ATOM   7215   C CE2   A TRP C  1 308 ? 65.045  35.558  89.494  0.25 33.64  ? 308  TRP C CE2   1 
ATOM   7216   C CE3   A TRP C  1 308 ? 67.348  36.263  89.829  0.25 31.45  ? 308  TRP C CE3   1 
ATOM   7217   C CZ2   A TRP C  1 308 ? 64.563  36.504  90.412  0.25 32.04  ? 308  TRP C CZ2   1 
ATOM   7218   C CZ3   A TRP C  1 308 ? 66.868  37.217  90.745  0.25 35.30  ? 308  TRP C CZ3   1 
ATOM   7219   C CH2   A TRP C  1 308 ? 65.480  37.323  91.024  0.25 36.78  ? 308  TRP C CH2   1 
ATOM   7220   N N     A GLY C  1 309 ? 70.551  34.226  86.766  0.25 27.34  ? 309  GLY C N     1 
ATOM   7221   C CA    A GLY C  1 309 ? 71.906  33.836  86.404  0.25 28.27  ? 309  GLY C CA    1 
ATOM   7222   C C     A GLY C  1 309 ? 72.111  32.365  86.121  0.25 30.26  ? 309  GLY C C     1 
ATOM   7223   O O     A GLY C  1 309 ? 71.297  31.521  86.481  0.25 31.58  ? 309  GLY C O     1 
ATOM   7224   N N     A LYS C  1 310 ? 73.223  32.038  85.471  0.25 31.69  ? 310  LYS C N     1 
ATOM   7225   C CA    A LYS C  1 310 ? 73.518  30.651  85.162  0.25 30.06  ? 310  LYS C CA    1 
ATOM   7226   C C     A LYS C  1 310 ? 73.843  29.907  86.444  0.25 31.05  ? 310  LYS C C     1 
ATOM   7227   O O     A LYS C  1 310 ? 74.262  30.509  87.436  0.25 30.93  ? 310  LYS C O     1 
ATOM   7228   C CB    A LYS C  1 310 ? 74.711  30.549  84.210  0.25 31.92  ? 310  LYS C CB    1 
ATOM   7229   C CG    A LYS C  1 310 ? 76.034  30.975  84.832  0.25 35.09  ? 310  LYS C CG    1 
ATOM   7230   C CD    A LYS C  1 310 ? 77.183  30.790  83.857  0.25 36.35  ? 310  LYS C CD    1 
ATOM   7231   C CE    A LYS C  1 310 ? 78.502  31.260  84.450  0.25 35.87  ? 310  LYS C CE    1 
ATOM   7232   N NZ    A LYS C  1 310 ? 78.926  30.484  85.622  0.25 36.20  ? 310  LYS C NZ    1 
ATOM   7233   N N     A ILE C  1 311 ? 73.638  28.596  86.414  0.25 29.89  ? 311  ILE C N     1 
ATOM   7234   C CA    A ILE C  1 311 ? 73.929  27.729  87.535  0.25 31.19  ? 311  ILE C CA    1 
ATOM   7235   C C     A ILE C  1 311 ? 74.810  26.601  87.000  0.25 31.81  ? 311  ILE C C     1 
ATOM   7236   O O     A ILE C  1 311 ? 74.380  25.805  86.153  0.25 28.08  ? 311  ILE C O     1 
ATOM   7237   C CB    A ILE C  1 311 ? 72.639  27.131  88.121  0.25 33.25  ? 311  ILE C CB    1 
ATOM   7238   C CG1   A ILE C  1 311 ? 71.785  28.257  88.697  0.25 34.81  ? 311  ILE C CG1   1 
ATOM   7239   C CG2   A ILE C  1 311 ? 72.974  26.091  89.161  0.25 30.38  ? 311  ILE C CG2   1 
ATOM   7240   C CD1   A ILE C  1 311 ? 70.507  27.794  89.282  0.25 38.81  ? 311  ILE C CD1   1 
ATOM   7241   N N     A ASP C  1 312 ? 76.043  26.548  87.489  0.25 29.93  ? 312  ASP C N     1 
ATOM   7242   C CA    A ASP C  1 312 ? 76.992  25.542  87.056  0.25 30.53  ? 312  ASP C CA    1 
ATOM   7243   C C     A ASP C  1 312 ? 76.683  24.152  87.579  0.25 28.83  ? 312  ASP C C     1 
ATOM   7244   O O     A ASP C  1 312 ? 76.486  23.950  88.780  0.25 27.39  ? 312  ASP C O     1 
ATOM   7245   C CB    A ASP C  1 312 ? 78.417  25.940  87.489  0.25 34.49  ? 312  ASP C CB    1 
ATOM   7246   C CG    A ASP C  1 312 ? 78.825  27.298  86.964  0.25 36.39  ? 312  ASP C CG    1 
ATOM   7247   O OD1   A ASP C  1 312 ? 78.523  27.605  85.796  0.25 38.17  ? 312  ASP C OD1   1 
ATOM   7248   O OD2   A ASP C  1 312 ? 79.467  28.058  87.719  0.25 45.37  ? 312  ASP C OD2   1 
ATOM   7249   N N     A MET C  1 313 ? 76.637  23.188  86.665  0.25 27.04  ? 313  MET C N     1 
ATOM   7250   C CA    A MET C  1 313 ? 76.396  21.808  87.021  0.25 25.70  ? 313  MET C CA    1 
ATOM   7251   C C     A MET C  1 313 ? 77.219  20.940  86.096  0.25 25.52  ? 313  MET C C     1 
ATOM   7252   O O     A MET C  1 313 ? 77.194  21.126  84.870  0.25 25.82  ? 313  MET C O     1 
ATOM   7253   C CB    A MET C  1 313 ? 74.904  21.465  86.903  0.25 23.84  ? 313  MET C CB    1 
ATOM   7254   C CG    A MET C  1 313 ? 74.055  22.047  88.024  0.25 24.21  ? 313  MET C CG    1 
ATOM   7255   S SD    A MET C  1 313 ? 72.269  21.515  87.977  0.25 27.03  ? 313  MET C SD    1 
ATOM   7256   C CE    A MET C  1 313 ? 71.625  22.834  87.014  0.25 21.03  ? 313  MET C CE    1 
ATOM   7257   N N     A LYS C  1 314 ? 77.954  20.000  86.681  0.25 26.46  ? 314  LYS C N     1 
ATOM   7258   C CA    A LYS C  1 314 ? 78.789  19.100  85.906  0.25 28.22  ? 314  LYS C CA    1 
ATOM   7259   C C     A LYS C  1 314 ? 77.982  17.934  85.357  0.25 30.97  ? 314  LYS C C     1 
ATOM   7260   O O     A LYS C  1 314 ? 77.128  17.370  86.060  0.25 30.84  ? 314  LYS C O     1 
ATOM   7261   C CB    A LYS C  1 314 ? 79.925  18.558  86.774  0.25 30.69  ? 314  LYS C CB    1 
ATOM   7262   C CG    A LYS C  1 314 ? 80.815  17.559  86.056  0.25 35.93  ? 314  LYS C CG    1 
ATOM   7263   C CD    A LYS C  1 314 ? 81.851  16.961  87.004  0.25 41.05  ? 314  LYS C CD    1 
ATOM   7264   C CE    A LYS C  1 314 ? 82.656  15.872  86.314  0.25 43.30  ? 314  LYS C CE    1 
ATOM   7265   N NZ    A LYS C  1 314 ? 83.616  15.211  87.245  0.25 47.92  ? 314  LYS C NZ    1 
ATOM   7266   N N     A MET C  1 315 ? 78.256  17.565  84.104  0.25 30.93  ? 315  MET C N     1 
ATOM   7267   C CA    A MET C  1 315 ? 77.567  16.441  83.484  0.25 29.58  ? 315  MET C CA    1 
ATOM   7268   C C     A MET C  1 315 ? 78.325  15.159  83.750  0.25 30.37  ? 315  MET C C     1 
ATOM   7269   O O     A MET C  1 315 ? 79.545  15.119  83.618  0.25 28.73  ? 315  MET C O     1 
ATOM   7270   C CB    A MET C  1 315 ? 77.445  16.630  81.978  0.25 31.73  ? 315  MET C CB    1 
ATOM   7271   C CG    A MET C  1 315 ? 76.521  15.599  81.337  0.25 31.59  ? 315  MET C CG    1 
ATOM   7272   S SD    A MET C  1 315 ? 76.751  15.420  79.573  0.25 36.76  ? 315  MET C SD    1 
ATOM   7273   C CE    A MET C  1 315 ? 77.911  14.082  79.521  0.25 31.12  ? 315  MET C CE    1 
ATOM   7274   N N     A SER C  1 316 ? 77.609  14.106  84.141  0.25 29.12  ? 316  SER C N     1 
ATOM   7275   C CA    A SER C  1 316 ? 78.255  12.825  84.402  0.25 29.55  ? 316  SER C CA    1 
ATOM   7276   C C     A SER C  1 316 ? 78.202  11.990  83.124  0.25 31.23  ? 316  SER C C     1 
ATOM   7277   O O     A SER C  1 316 ? 77.110  11.654  82.636  0.25 30.20  ? 316  SER C O     1 
ATOM   7278   C CB    A SER C  1 316 ? 77.547  12.107  85.554  0.25 31.06  ? 316  SER C CB    1 
ATOM   7279   O OG    A SER C  1 316 ? 77.647  12.851  86.772  0.25 31.80  ? 316  SER C OG    1 
ATOM   7280   N N     A ALA C  1 317 ? 79.379  11.657  82.592  0.25 32.02  ? 317  ALA C N     1 
ATOM   7281   C CA    A ALA C  1 317 ? 79.505  10.887  81.354  0.25 32.68  ? 317  ALA C CA    1 
ATOM   7282   C C     A ALA C  1 317 ? 79.077  9.447   81.527  0.25 34.38  ? 317  ALA C C     1 
ATOM   7283   O O     A ALA C  1 317 ? 78.379  8.921   80.629  0.25 34.65  ? 317  ALA C O     1 
ATOM   7284   C CB    A ALA C  1 317 ? 80.944  10.936  80.846  0.25 35.72  ? 317  ALA C CB    1 
ATOM   7285   O OXT   A ALA C  1 317 ? 79.472  8.848   82.546  0.25 36.13  ? 317  ALA C OXT   1 
ATOM   7286   N N     A ARG D  1 13  ? 29.973  7.974   96.528  0.25 52.80  ? 13   ARG D N     1 
ATOM   7287   C CA    A ARG D  1 13  ? 30.919  6.832   96.363  0.25 52.04  ? 13   ARG D CA    1 
ATOM   7288   C C     A ARG D  1 13  ? 31.329  6.250   97.714  0.25 52.64  ? 13   ARG D C     1 
ATOM   7289   O O     A ARG D  1 13  ? 32.006  6.905   98.509  0.25 52.94  ? 13   ARG D O     1 
ATOM   7290   C CB    A ARG D  1 13  ? 32.170  7.282   95.583  0.25 50.22  ? 13   ARG D CB    1 
ATOM   7291   C CG    A ARG D  1 13  ? 31.872  7.687   94.153  0.25 45.37  ? 13   ARG D CG    1 
ATOM   7292   C CD    A ARG D  1 13  ? 33.091  8.221   93.390  0.25 45.57  ? 13   ARG D CD    1 
ATOM   7293   N NE    A ARG D  1 13  ? 32.684  8.602   92.036  0.25 43.28  ? 13   ARG D NE    1 
ATOM   7294   C CZ    A ARG D  1 13  ? 33.483  9.105   91.102  0.25 41.58  ? 13   ARG D CZ    1 
ATOM   7295   N NH1   A ARG D  1 13  ? 34.764  9.303   91.354  0.25 40.39  ? 13   ARG D NH1   1 
ATOM   7296   N NH2   A ARG D  1 13  ? 32.991  9.399   89.905  0.25 39.93  ? 13   ARG D NH2   1 
ATOM   7297   N N     A SER D  1 14  ? 30.902  5.017   97.969  0.25 52.54  ? 14   SER D N     1 
ATOM   7298   C CA    A SER D  1 14  ? 31.235  4.337   99.214  0.25 54.03  ? 14   SER D CA    1 
ATOM   7299   C C     A SER D  1 14  ? 32.751  4.325   99.447  0.25 52.83  ? 14   SER D C     1 
ATOM   7300   O O     A SER D  1 14  ? 33.213  4.601   100.553 0.25 54.20  ? 14   SER D O     1 
ATOM   7301   C CB    A SER D  1 14  ? 30.700  2.906   99.190  0.25 54.09  ? 14   SER D CB    1 
ATOM   7302   O OG    A SER D  1 14  ? 31.118  2.193   100.343 0.25 59.79  ? 14   SER D OG    1 
ATOM   7303   N N     A ASN D  1 15  ? 33.518  3.992   98.413  0.25 51.17  ? 15   ASN D N     1 
ATOM   7304   C CA    A ASN D  1 15  ? 34.978  3.982   98.511  0.25 49.90  ? 15   ASN D CA    1 
ATOM   7305   C C     A ASN D  1 15  ? 35.534  4.761   97.319  0.25 48.27  ? 15   ASN D C     1 
ATOM   7306   O O     A ASN D  1 15  ? 35.934  4.185   96.301  0.25 47.35  ? 15   ASN D O     1 
ATOM   7307   C CB    A ASN D  1 15  ? 35.526  2.548   98.527  0.25 50.62  ? 15   ASN D CB    1 
ATOM   7308   C CG    A ASN D  1 15  ? 37.058  2.501   98.552  0.25 53.09  ? 15   ASN D CG    1 
ATOM   7309   O OD1   A ASN D  1 15  ? 37.720  3.437   99.025  0.25 53.80  ? 15   ASN D OD1   1 
ATOM   7310   N ND2   A ASN D  1 15  ? 37.625  1.406   98.050  0.25 51.83  ? 15   ASN D ND2   1 
ATOM   7311   N N     A PRO D  1 16  ? 35.550  6.097   97.442  0.25 46.30  ? 16   PRO D N     1 
ATOM   7312   C CA    A PRO D  1 16  ? 36.023  7.065   96.451  0.25 43.52  ? 16   PRO D CA    1 
ATOM   7313   C C     A PRO D  1 16  ? 37.500  6.934   96.081  0.25 41.46  ? 16   PRO D C     1 
ATOM   7314   O O     A PRO D  1 16  ? 37.949  7.541   95.109  0.25 41.60  ? 16   PRO D O     1 
ATOM   7315   C CB    A PRO D  1 16  ? 35.713  8.396   97.116  0.25 44.69  ? 16   PRO D CB    1 
ATOM   7316   C CG    A PRO D  1 16  ? 35.952  8.079   98.562  0.25 45.21  ? 16   PRO D CG    1 
ATOM   7317   C CD    A PRO D  1 16  ? 35.204  6.784   98.699  0.25 45.95  ? 16   PRO D CD    1 
ATOM   7318   N N     A ASP D  1 17  ? 38.264  6.174   96.858  0.25 38.08  ? 17   ASP D N     1 
ATOM   7319   C CA    A ASP D  1 17  ? 39.673  6.005   96.522  0.25 37.63  ? 17   ASP D CA    1 
ATOM   7320   C C     A ASP D  1 17  ? 39.903  4.755   95.667  0.25 34.82  ? 17   ASP D C     1 
ATOM   7321   O O     A ASP D  1 17  ? 41.046  4.432   95.322  0.25 33.89  ? 17   ASP D O     1 
ATOM   7322   C CB    A ASP D  1 17  ? 40.543  5.918   97.778  0.25 39.16  ? 17   ASP D CB    1 
ATOM   7323   C CG    A ASP D  1 17  ? 40.447  7.162   98.649  0.25 41.57  ? 17   ASP D CG    1 
ATOM   7324   O OD1   A ASP D  1 17  ? 40.432  8.286   98.108  0.25 43.49  ? 17   ASP D OD1   1 
ATOM   7325   O OD2   A ASP D  1 17  ? 40.396  7.009   99.884  0.25 44.29  ? 17   ASP D OD2   1 
ATOM   7326   N N     A HIS D  1 18  ? 38.828  4.051   95.322  0.25 31.12  ? 18   HIS D N     1 
ATOM   7327   C CA    A HIS D  1 18  ? 38.973  2.841   94.513  0.25 28.71  ? 18   HIS D CA    1 
ATOM   7328   C C     A HIS D  1 18  ? 39.610  3.236   93.182  0.25 27.78  ? 18   HIS D C     1 
ATOM   7329   O O     A HIS D  1 18  ? 39.101  4.110   92.469  0.25 24.89  ? 18   HIS D O     1 
ATOM   7330   C CB    A HIS D  1 18  ? 37.614  2.174   94.257  0.25 27.95  ? 18   HIS D CB    1 
ATOM   7331   C CG    A HIS D  1 18  ? 37.721  0.782   93.714  0.25 28.62  ? 18   HIS D CG    1 
ATOM   7332   N ND1   A HIS D  1 18  ? 38.280  0.501   92.483  0.25 26.20  ? 18   HIS D ND1   1 
ATOM   7333   C CD2   A HIS D  1 18  ? 37.365  -0.414  94.246  0.25 29.46  ? 18   HIS D CD2   1 
ATOM   7334   C CE1   A HIS D  1 18  ? 38.269  -0.805  92.285  0.25 29.38  ? 18   HIS D CE1   1 
ATOM   7335   N NE2   A HIS D  1 18  ? 37.719  -1.384  93.339  0.25 29.11  ? 18   HIS D NE2   1 
ATOM   7336   N N     A GLU D  1 19  ? 40.715  2.571   92.849  0.25 25.19  ? 19   GLU D N     1 
ATOM   7337   C CA    A GLU D  1 19  ? 41.441  2.866   91.622  0.25 26.59  ? 19   GLU D CA    1 
ATOM   7338   C C     A GLU D  1 19  ? 40.624  2.796   90.347  0.25 25.06  ? 19   GLU D C     1 
ATOM   7339   O O     A GLU D  1 19  ? 40.942  3.483   89.383  0.25 23.89  ? 19   GLU D O     1 
ATOM   7340   C CB    A GLU D  1 19  ? 42.660  1.943   91.511  0.25 25.71  ? 19   GLU D CB    1 
ATOM   7341   C CG    A GLU D  1 19  ? 43.738  2.260   92.536  0.25 28.97  ? 19   GLU D CG    1 
ATOM   7342   C CD    A GLU D  1 19  ? 44.808  1.195   92.594  0.25 30.52  ? 19   GLU D CD    1 
ATOM   7343   O OE1   A GLU D  1 19  ? 45.785  1.371   93.333  0.25 32.13  ? 19   GLU D OE1   1 
ATOM   7344   O OE2   A GLU D  1 19  ? 44.669  0.173   91.902  0.25 38.73  ? 19   GLU D OE2   1 
ATOM   7345   N N     A GLU D  1 20  ? 39.555  2.004   90.342  0.25 24.86  ? 20   GLU D N     1 
ATOM   7346   C CA    A GLU D  1 20  ? 38.736  1.858   89.137  0.25 23.11  ? 20   GLU D CA    1 
ATOM   7347   C C     A GLU D  1 20  ? 38.038  3.165   88.756  0.25 23.65  ? 20   GLU D C     1 
ATOM   7348   O O     A GLU D  1 20  ? 37.656  3.369   87.595  0.25 23.01  ? 20   GLU D O     1 
ATOM   7349   C CB    A GLU D  1 20  ? 37.712  0.704   89.319  0.25 23.92  ? 20   GLU D CB    1 
ATOM   7350   C CG    A GLU D  1 20  ? 36.873  0.406   88.054  0.25 24.14  ? 20   GLU D CG    1 
ATOM   7351   C CD    A GLU D  1 20  ? 36.297  -1.009  88.018  0.25 23.67  ? 20   GLU D CD    1 
ATOM   7352   O OE1   A GLU D  1 20  ? 35.489  -1.277  87.104  0.25 26.51  ? 20   GLU D OE1   1 
ATOM   7353   O OE2   A GLU D  1 20  ? 36.641  -1.857  88.882  0.25 23.07  ? 20   GLU D OE2   1 
ATOM   7354   N N     A TYR D  1 21  ? 37.869  4.070   89.717  0.25 24.16  ? 21   TYR D N     1 
ATOM   7355   C CA    A TYR D  1 21  ? 37.233  5.350   89.400  0.25 24.02  ? 21   TYR D CA    1 
ATOM   7356   C C     A TYR D  1 21  ? 38.075  6.158   88.404  0.25 24.14  ? 21   TYR D C     1 
ATOM   7357   O O     A TYR D  1 21  ? 37.559  7.025   87.694  0.25 24.61  ? 21   TYR D O     1 
ATOM   7358   C CB    A TYR D  1 21  ? 36.965  6.166   90.683  0.25 27.16  ? 21   TYR D CB    1 
ATOM   7359   C CG    A TYR D  1 21  ? 35.740  5.680   91.440  0.25 26.33  ? 21   TYR D CG    1 
ATOM   7360   C CD1   A TYR D  1 21  ? 35.847  5.174   92.725  0.25 29.77  ? 21   TYR D CD1   1 
ATOM   7361   C CD2   A TYR D  1 21  ? 34.476  5.696   90.841  0.25 27.07  ? 21   TYR D CD2   1 
ATOM   7362   C CE1   A TYR D  1 21  ? 34.724  4.684   93.407  0.25 31.04  ? 21   TYR D CE1   1 
ATOM   7363   C CE2   A TYR D  1 21  ? 33.351  5.215   91.504  0.25 25.48  ? 21   TYR D CE2   1 
ATOM   7364   C CZ    A TYR D  1 21  ? 33.481  4.710   92.786  0.25 29.08  ? 21   TYR D CZ    1 
ATOM   7365   O OH    A TYR D  1 21  ? 32.368  4.230   93.455  0.25 32.61  ? 21   TYR D OH    1 
ATOM   7366   N N     A GLN D  1 22  ? 39.366  5.869   88.328  0.25 23.40  ? 22   GLN D N     1 
ATOM   7367   C CA    A GLN D  1 22  ? 40.224  6.567   87.352  0.25 26.21  ? 22   GLN D CA    1 
ATOM   7368   C C     A GLN D  1 22  ? 39.691  6.263   85.948  0.25 25.27  ? 22   GLN D C     1 
ATOM   7369   O O     A GLN D  1 22  ? 39.555  7.147   85.092  0.25 25.11  ? 22   GLN D O     1 
ATOM   7370   C CB    A GLN D  1 22  ? 41.670  6.047   87.424  0.25 26.07  ? 22   GLN D CB    1 
ATOM   7371   C CG    A GLN D  1 22  ? 42.415  6.360   88.718  0.25 23.98  ? 22   GLN D CG    1 
ATOM   7372   C CD    A GLN D  1 22  ? 43.743  5.617   88.782  0.25 26.21  ? 22   GLN D CD    1 
ATOM   7373   O OE1   A GLN D  1 22  ? 43.779  4.405   89.041  0.25 25.27  ? 22   GLN D OE1   1 
ATOM   7374   N NE2   A GLN D  1 22  ? 44.837  6.328   88.529  0.25 20.54  ? 22   GLN D NE2   1 
ATOM   7375   N N     A TYR D  1 23  ? 39.403  4.990   85.718  0.25 24.88  ? 23   TYR D N     1 
ATOM   7376   C CA    A TYR D  1 23  ? 38.890  4.537   84.435  0.25 24.81  ? 23   TYR D CA    1 
ATOM   7377   C C     A TYR D  1 23  ? 37.489  5.105   84.169  0.25 25.10  ? 23   TYR D C     1 
ATOM   7378   O O     A TYR D  1 23  ? 37.230  5.651   83.092  0.25 22.89  ? 23   TYR D O     1 
ATOM   7379   C CB    A TYR D  1 23  ? 38.888  2.997   84.416  0.25 24.17  ? 23   TYR D CB    1 
ATOM   7380   C CG    A TYR D  1 23  ? 38.176  2.373   83.235  0.25 22.12  ? 23   TYR D CG    1 
ATOM   7381   C CD1   A TYR D  1 23  ? 36.820  2.015   83.320  0.25 22.03  ? 23   TYR D CD1   1 
ATOM   7382   C CD2   A TYR D  1 23  ? 38.843  2.160   82.030  0.25 22.09  ? 23   TYR D CD2   1 
ATOM   7383   C CE1   A TYR D  1 23  ? 36.148  1.456   82.230  0.25 19.30  ? 23   TYR D CE1   1 
ATOM   7384   C CE2   A TYR D  1 23  ? 38.185  1.603   80.924  0.25 22.92  ? 23   TYR D CE2   1 
ATOM   7385   C CZ    A TYR D  1 23  ? 36.834  1.250   81.037  0.25 24.87  ? 23   TYR D CZ    1 
ATOM   7386   O OH    A TYR D  1 23  ? 36.194  0.667   79.970  0.25 24.72  ? 23   TYR D OH    1 
ATOM   7387   N N     A LEU D  1 24  ? 36.597  4.995   85.156  0.25 24.85  ? 24   LEU D N     1 
ATOM   7388   C CA    A LEU D  1 24  ? 35.211  5.488   85.000  0.25 24.76  ? 24   LEU D CA    1 
ATOM   7389   C C     A LEU D  1 24  ? 35.177  7.001   84.818  0.25 23.89  ? 24   LEU D C     1 
ATOM   7390   O O     A LEU D  1 24  ? 34.463  7.516   83.956  0.25 22.97  ? 24   LEU D O     1 
ATOM   7391   C CB    A LEU D  1 24  ? 34.359  5.096   86.225  0.25 25.23  ? 24   LEU D CB    1 
ATOM   7392   C CG    A LEU D  1 24  ? 34.229  3.582   86.487  0.25 27.15  ? 24   LEU D CG    1 
ATOM   7393   C CD1   A LEU D  1 24  ? 33.521  3.330   87.807  0.25 26.80  ? 24   LEU D CD1   1 
ATOM   7394   C CD2   A LEU D  1 24  ? 33.477  2.931   85.330  0.25 25.79  ? 24   LEU D CD2   1 
ATOM   7395   N N     A ASP D  1 25  ? 35.956  7.718   85.629  0.25 24.37  ? 25   ASP D N     1 
ATOM   7396   C CA    A ASP D  1 25  ? 36.013  9.172   85.516  0.25 24.86  ? 25   ASP D CA    1 
ATOM   7397   C C     A ASP D  1 25  ? 36.521  9.643   84.161  0.25 22.60  ? 25   ASP D C     1 
ATOM   7398   O O     A ASP D  1 25  ? 35.990  10.595  83.584  0.25 22.35  ? 25   ASP D O     1 
ATOM   7399   C CB    A ASP D  1 25  ? 36.886  9.753   86.637  0.25 28.66  ? 25   ASP D CB    1 
ATOM   7400   C CG    A ASP D  1 25  ? 36.171  9.751   87.991  0.25 32.91  ? 25   ASP D CG    1 
ATOM   7401   O OD1   A ASP D  1 25  ? 36.833  10.019  89.010  0.25 35.80  ? 25   ASP D OD1   1 
ATOM   7402   O OD2   A ASP D  1 25  ? 34.943  9.486   88.029  0.25 34.73  ? 25   ASP D OD2   1 
ATOM   7403   N N     A LEU D  1 26  ? 37.530  8.961   83.624  0.25 22.75  ? 26   LEU D N     1 
ATOM   7404   C CA    A LEU D  1 26  ? 38.063  9.380   82.319  0.25 23.70  ? 26   LEU D CA    1 
ATOM   7405   C C     A LEU D  1 26  ? 37.016  9.211   81.233  0.25 21.89  ? 26   LEU D C     1 
ATOM   7406   O O     A LEU D  1 26  ? 36.883  10.057  80.360  0.25 24.32  ? 26   LEU D O     1 
ATOM   7407   C CB    A LEU D  1 26  ? 39.329  8.579   81.952  0.25 21.92  ? 26   LEU D CB    1 
ATOM   7408   C CG    A LEU D  1 26  ? 39.936  8.921   80.574  0.25 26.68  ? 26   LEU D CG    1 
ATOM   7409   C CD1   A LEU D  1 26  ? 40.207  10.425  80.464  0.25 23.78  ? 26   LEU D CD1   1 
ATOM   7410   C CD2   A LEU D  1 26  ? 41.247  8.133   80.363  0.25 24.08  ? 26   LEU D CD2   1 
ATOM   7411   N N     A ILE D  1 27  ? 36.277  8.109   81.280  0.25 23.76  ? 27   ILE D N     1 
ATOM   7412   C CA    A ILE D  1 27  ? 35.242  7.857   80.280  0.25 24.72  ? 27   ILE D CA    1 
ATOM   7413   C C     A ILE D  1 27  ? 34.186  8.946   80.370  0.25 26.25  ? 27   ILE D C     1 
ATOM   7414   O O     A ILE D  1 27  ? 33.742  9.484   79.352  0.25 25.02  ? 27   ILE D O     1 
ATOM   7415   C CB    A ILE D  1 27  ? 34.584  6.474   80.486  0.25 27.37  ? 27   ILE D CB    1 
ATOM   7416   C CG1   A ILE D  1 27  ? 35.555  5.365   80.055  0.25 27.56  ? 27   ILE D CG1   1 
ATOM   7417   C CG2   A ILE D  1 27  ? 33.271  6.381   79.712  0.25 27.16  ? 27   ILE D CG2   1 
ATOM   7418   C CD1   A ILE D  1 27  ? 35.039  3.990   80.371  0.25 32.23  ? 27   ILE D CD1   1 
ATOM   7419   N N     A ARG D  1 28  ? 33.790  9.280   81.598  0.25 28.80  ? 28   ARG D N     1 
ATOM   7420   C CA    A ARG D  1 28  ? 32.777  10.324  81.802  0.25 29.81  ? 28   ARG D CA    1 
ATOM   7421   C C     A ARG D  1 28  ? 33.290  11.644  81.219  0.25 30.49  ? 28   ARG D C     1 
ATOM   7422   O O     A ARG D  1 28  ? 32.560  12.365  80.513  0.25 27.72  ? 28   ARG D O     1 
ATOM   7423   C CB    A ARG D  1 28  ? 32.441  10.484  83.305  0.25 31.01  ? 28   ARG D CB    1 
ATOM   7424   C CG    A ARG D  1 28  ? 31.357  11.576  83.578  0.25 37.30  ? 28   ARG D CG    1 
ATOM   7425   C CD    A ARG D  1 28  ? 30.587  11.499  84.943  0.25 42.12  ? 28   ARG D CD    1 
ATOM   7426   N NE    A ARG D  1 28  ? 31.165  10.431  85.615  0.25 43.27  ? 28   ARG D NE    1 
ATOM   7427   C CZ    A ARG D  1 28  ? 30.872  9.287   86.187  0.25 46.60  ? 28   ARG D CZ    1 
ATOM   7428   N NH1   A ARG D  1 28  ? 32.012  8.779   86.591  0.25 47.92  ? 28   ARG D NH1   1 
ATOM   7429   N NH2   A ARG D  1 28  ? 29.724  8.640   86.402  0.25 45.16  ? 28   ARG D NH2   1 
ATOM   7430   N N     A ARG D  1 29  ? 34.557  11.957  81.493  0.25 28.60  ? 29   ARG D N     1 
ATOM   7431   C CA    A ARG D  1 29  ? 35.146  13.187  80.970  0.25 27.19  ? 29   ARG D CA    1 
ATOM   7432   C C     A ARG D  1 29  ? 35.202  13.212  79.434  0.25 27.90  ? 29   ARG D C     1 
ATOM   7433   O O     A ARG D  1 29  ? 34.869  14.216  78.806  0.25 27.95  ? 29   ARG D O     1 
ATOM   7434   C CB    A ARG D  1 29  ? 36.548  13.364  81.534  0.25 30.29  ? 29   ARG D CB    1 
ATOM   7435   C CG    A ARG D  1 29  ? 37.207  14.665  81.110  0.25 34.82  ? 29   ARG D CG    1 
ATOM   7436   C CD    A ARG D  1 29  ? 38.654  14.735  81.585  0.25 33.56  ? 29   ARG D CD    1 
ATOM   7437   N NE    A ARG D  1 29  ? 39.326  15.891  81.015  0.25 35.68  ? 29   ARG D NE    1 
ATOM   7438   C CZ    A ARG D  1 29  ? 40.645  16.018  80.942  0.25 38.10  ? 29   ARG D CZ    1 
ATOM   7439   N NH1   A ARG D  1 29  ? 41.431  15.049  81.408  0.25 36.25  ? 29   ARG D NH1   1 
ATOM   7440   N NH2   A ARG D  1 29  ? 41.172  17.107  80.396  0.25 37.44  ? 29   ARG D NH2   1 
ATOM   7441   N N     A ILE D  1 30  ? 35.620  12.109  78.825  0.25 26.79  ? 30   ILE D N     1 
ATOM   7442   C CA    A ILE D  1 30  ? 35.683  12.036  77.364  0.25 26.58  ? 30   ILE D CA    1 
ATOM   7443   C C     A ILE D  1 30  ? 34.300  12.239  76.740  0.25 28.20  ? 30   ILE D C     1 
ATOM   7444   O O     A ILE D  1 30  ? 34.134  12.970  75.746  0.25 27.48  ? 30   ILE D O     1 
ATOM   7445   C CB    A ILE D  1 30  ? 36.247  10.669  76.900  0.25 24.51  ? 30   ILE D CB    1 
ATOM   7446   C CG1   A ILE D  1 30  ? 37.710  10.529  77.350  0.25 23.65  ? 30   ILE D CG1   1 
ATOM   7447   C CG2   A ILE D  1 30  ? 36.169  10.566  75.398  0.25 21.93  ? 30   ILE D CG2   1 
ATOM   7448   C CD1   A ILE D  1 30  ? 38.311  9.150   77.075  0.25 24.13  ? 30   ILE D CD1   1 
ATOM   7449   N N     A ILE D  1 31  ? 33.301  11.573  77.303  0.25 29.23  ? 31   ILE D N     1 
ATOM   7450   C CA    A ILE D  1 31  ? 31.945  11.719  76.787  0.25 30.72  ? 31   ILE D CA    1 
ATOM   7451   C C     A ILE D  1 31  ? 31.489  13.165  76.940  0.25 32.01  ? 31   ILE D C     1 
ATOM   7452   O O     A ILE D  1 31  ? 30.907  13.723  76.019  0.25 33.75  ? 31   ILE D O     1 
ATOM   7453   C CB    A ILE D  1 31  ? 30.959  10.775  77.535  0.25 33.32  ? 31   ILE D CB    1 
ATOM   7454   C CG1   A ILE D  1 31  ? 31.321  9.319   77.234  0.25 30.81  ? 31   ILE D CG1   1 
ATOM   7455   C CG2   A ILE D  1 31  ? 29.514  11.047  77.106  0.25 34.02  ? 31   ILE D CG2   1 
ATOM   7456   C CD1   A ILE D  1 31  ? 30.538  8.303   78.008  0.25 29.91  ? 31   ILE D CD1   1 
ATOM   7457   N N     A ASN D  1 32  ? 31.783  13.773  78.093  0.25 33.70  ? 32   ASN D N     1 
ATOM   7458   C CA    A ASN D  1 32  ? 31.384  15.154  78.378  0.25 35.39  ? 32   ASN D CA    1 
ATOM   7459   C C     A ASN D  1 32  ? 32.092  16.251  77.576  0.25 37.29  ? 32   ASN D C     1 
ATOM   7460   O O     A ASN D  1 32  ? 31.436  17.062  76.921  0.25 37.79  ? 32   ASN D O     1 
ATOM   7461   C CB    A ASN D  1 32  ? 31.567  15.456  79.864  0.25 37.29  ? 32   ASN D CB    1 
ATOM   7462   C CG    A ASN D  1 32  ? 30.489  14.819  80.735  0.25 39.13  ? 32   ASN D CG    1 
ATOM   7463   O OD1   A ASN D  1 32  ? 30.613  14.781  81.968  0.25 38.97  ? 32   ASN D OD1   1 
ATOM   7464   N ND2   A ASN D  1 32  ? 29.427  14.322  80.103  0.25 36.03  ? 32   ASN D ND2   1 
ATOM   7465   N N     A VAL D  1 33  ? 33.423  16.281  77.624  0.25 36.69  ? 33   VAL D N     1 
ATOM   7466   C CA    A VAL D  1 33  ? 34.171  17.316  76.922  0.25 36.08  ? 33   VAL D CA    1 
ATOM   7467   C C     A VAL D  1 33  ? 35.092  16.827  75.811  0.25 36.60  ? 33   VAL D C     1 
ATOM   7468   O O     A VAL D  1 33  ? 35.856  17.606  75.253  0.25 37.94  ? 33   VAL D O     1 
ATOM   7469   C CB    A VAL D  1 33  ? 35.009  18.158  77.907  0.25 34.40  ? 33   VAL D CB    1 
ATOM   7470   C CG1   A VAL D  1 33  ? 34.086  18.824  78.928  0.25 33.69  ? 33   VAL D CG1   1 
ATOM   7471   C CG2   A VAL D  1 33  ? 36.042  17.281  78.603  0.25 34.09  ? 33   VAL D CG2   1 
ATOM   7472   N N     A GLY D  1 34  ? 35.024  15.547  75.488  0.25 35.49  ? 34   GLY D N     1 
ATOM   7473   C CA    A GLY D  1 34  ? 35.857  15.026  74.424  0.25 34.22  ? 34   GLY D CA    1 
ATOM   7474   C C     A GLY D  1 34  ? 35.488  15.621  73.069  0.25 33.73  ? 34   GLY D C     1 
ATOM   7475   O O     A GLY D  1 34  ? 34.387  16.123  72.873  0.25 32.47  ? 34   GLY D O     1 
ATOM   7476   N N     A GLU D  1 35  ? 36.423  15.571  72.129  0.25 28.69  ? 35   GLU D N     1 
ATOM   7477   C CA    A GLU D  1 35  ? 36.201  16.099  70.788  0.25 30.41  ? 35   GLU D CA    1 
ATOM   7478   C C     A GLU D  1 35  ? 35.715  15.007  69.822  0.25 29.05  ? 35   GLU D C     1 
ATOM   7479   O O     A GLU D  1 35  ? 36.305  13.930  69.734  0.25 26.95  ? 35   GLU D O     1 
ATOM   7480   C CB    A GLU D  1 35  ? 37.511  16.721  70.284  0.25 32.38  ? 35   GLU D CB    1 
ATOM   7481   C CG    A GLU D  1 35  ? 37.543  17.139  68.843  0.25 35.43  ? 35   GLU D CG    1 
ATOM   7482   C CD    A GLU D  1 35  ? 38.942  17.628  68.418  0.25 38.58  ? 35   GLU D CD    1 
ATOM   7483   O OE1   A GLU D  1 35  ? 39.208  17.703  67.196  0.25 32.56  ? 35   GLU D OE1   1 
ATOM   7484   O OE2   A GLU D  1 35  ? 39.767  17.940  69.318  0.25 41.96  ? 35   GLU D OE2   1 
ATOM   7485   N N     A VAL D  1 36  ? 34.625  15.285  69.115  0.25 29.17  ? 36   VAL D N     1 
ATOM   7486   C CA    A VAL D  1 36  ? 34.070  14.339  68.152  0.25 30.20  ? 36   VAL D CA    1 
ATOM   7487   C C     A VAL D  1 36  ? 34.979  14.275  66.935  0.25 30.20  ? 36   VAL D C     1 
ATOM   7488   O O     A VAL D  1 36  ? 35.227  15.286  66.291  0.25 29.07  ? 36   VAL D O     1 
ATOM   7489   C CB    A VAL D  1 36  ? 32.656  14.771  67.690  0.25 32.10  ? 36   VAL D CB    1 
ATOM   7490   C CG1   A VAL D  1 36  ? 32.129  13.788  66.634  0.25 30.50  ? 36   VAL D CG1   1 
ATOM   7491   C CG2   A VAL D  1 36  ? 31.716  14.827  68.905  0.25 29.42  ? 36   VAL D CG2   1 
ATOM   7492   N N     A ARG D  1 37  ? 35.469  13.085  66.609  0.25 30.37  ? 37   ARG D N     1 
ATOM   7493   C CA    A ARG D  1 37  ? 36.380  12.973  65.480  0.25 30.16  ? 37   ARG D CA    1 
ATOM   7494   C C     A ARG D  1 37  ? 36.154  11.787  64.574  0.25 28.67  ? 37   ARG D C     1 
ATOM   7495   O O     A ARG D  1 37  ? 35.602  10.780  64.990  0.25 27.43  ? 37   ARG D O     1 
ATOM   7496   C CB    A ARG D  1 37  ? 37.817  12.862  65.978  0.25 32.56  ? 37   ARG D CB    1 
ATOM   7497   C CG    A ARG D  1 37  ? 38.201  13.736  67.140  0.25 31.23  ? 37   ARG D CG    1 
ATOM   7498   C CD    A ARG D  1 37  ? 39.508  13.119  67.694  0.25 30.93  ? 37   ARG D CD    1 
ATOM   7499   N NE    A ARG D  1 37  ? 40.338  14.079  67.148  0.25 29.94  ? 37   ARG D NE    1 
ATOM   7500   C CZ    A ARG D  1 37  ? 41.469  14.272  66.524  0.25 28.97  ? 37   ARG D CZ    1 
ATOM   7501   N NH1   A ARG D  1 37  ? 41.524  15.563  66.327  0.25 26.12  ? 37   ARG D NH1   1 
ATOM   7502   N NH2   A ARG D  1 37  ? 42.452  13.473  66.114  0.25 22.48  ? 37   ARG D NH2   1 
ATOM   7503   N N     A PRO D  1 38  ? 36.586  11.901  63.308  0.25 27.89  ? 38   PRO D N     1 
ATOM   7504   C CA    A PRO D  1 38  ? 36.464  10.826  62.326  0.25 29.20  ? 38   PRO D CA    1 
ATOM   7505   C C     A PRO D  1 38  ? 37.669  9.920   62.668  0.25 28.58  ? 38   PRO D C     1 
ATOM   7506   O O     A PRO D  1 38  ? 38.579  10.351  63.369  0.25 25.98  ? 38   PRO D O     1 
ATOM   7507   C CB    A PRO D  1 38  ? 36.697  11.531  60.988  0.25 30.67  ? 38   PRO D CB    1 
ATOM   7508   C CG    A PRO D  1 38  ? 36.502  12.977  61.290  0.25 34.56  ? 38   PRO D CG    1 
ATOM   7509   C CD    A PRO D  1 38  ? 37.064  13.135  62.663  0.25 30.96  ? 38   PRO D CD    1 
ATOM   7510   N N     A ASP D  1 39  ? 37.683  8.693   62.174  0.25 28.34  ? 39   ASP D N     1 
ATOM   7511   C CA    A ASP D  1 39  ? 38.800  7.800   62.462  0.25 29.66  ? 39   ASP D CA    1 
ATOM   7512   C C     A ASP D  1 39  ? 38.943  6.750   61.378  0.25 28.73  ? 39   ASP D C     1 
ATOM   7513   O O     A ASP D  1 39  ? 38.090  6.637   60.490  0.25 32.21  ? 39   ASP D O     1 
ATOM   7514   C CB    A ASP D  1 39  ? 38.615  7.128   63.838  0.25 27.17  ? 39   ASP D CB    1 
ATOM   7515   C CG    A ASP D  1 39  ? 37.597  5.988   63.811  0.25 30.05  ? 39   ASP D CG    1 
ATOM   7516   O OD1   A ASP D  1 39  ? 36.424  6.228   63.430  0.25 25.77  ? 39   ASP D OD1   1 
ATOM   7517   O OD2   A ASP D  1 39  ? 37.979  4.860   64.189  0.25 23.37  ? 39   ASP D OD2   1 
ATOM   7518   N N     A ARG D  1 40  ? 40.032  5.998   61.451  0.25 26.60  ? 40   ARG D N     1 
ATOM   7519   C CA    A ARG D  1 40  ? 40.326  4.929   60.500  0.25 25.23  ? 40   ARG D CA    1 
ATOM   7520   C C     A ARG D  1 40  ? 39.167  3.931   60.293  0.25 23.62  ? 40   ARG D C     1 
ATOM   7521   O O     A ARG D  1 40  ? 38.887  3.520   59.168  0.25 24.31  ? 40   ARG D O     1 
ATOM   7522   C CB    A ARG D  1 40  ? 41.558  4.145   61.002  0.25 22.43  ? 40   ARG D CB    1 
ATOM   7523   C CG    A ARG D  1 40  ? 42.010  3.010   60.112  0.25 24.23  ? 40   ARG D CG    1 
ATOM   7524   C CD    A ARG D  1 40  ? 43.164  2.211   60.765  0.25 22.19  ? 40   ARG D CD    1 
ATOM   7525   N NE    A ARG D  1 40  ? 42.813  1.676   62.092  0.25 20.56  ? 40   ARG D NE    1 
ATOM   7526   C CZ    A ARG D  1 40  ? 42.039  0.610   62.313  0.25 21.53  ? 40   ARG D CZ    1 
ATOM   7527   N NH1   A ARG D  1 40  ? 41.508  -0.072  61.304  0.25 19.71  ? 40   ARG D NH1   1 
ATOM   7528   N NH2   A ARG D  1 40  ? 41.803  0.211   63.552  0.25 21.48  ? 40   ARG D NH2   1 
ATOM   7529   N N     A THR D  1 41  ? 38.529  3.511   61.386  0.25 24.37  ? 41   THR D N     1 
ATOM   7530   C CA    A THR D  1 41  ? 37.465  2.510   61.305  0.25 24.48  ? 41   THR D CA    1 
ATOM   7531   C C     A THR D  1 41  ? 36.197  2.996   60.611  0.25 27.71  ? 41   THR D C     1 
ATOM   7532   O O     A THR D  1 41  ? 35.442  2.191   60.038  0.25 26.61  ? 41   THR D O     1 
ATOM   7533   C CB    A THR D  1 41  ? 37.059  2.001   62.692  0.25 25.00  ? 41   THR D CB    1 
ATOM   7534   O OG1   A THR D  1 41  ? 36.318  3.029   63.367  0.25 23.58  ? 41   THR D OG1   1 
ATOM   7535   C CG2   A THR D  1 41  ? 38.310  1.610   63.525  0.25 23.30  ? 41   THR D CG2   1 
ATOM   7536   N N     A GLY D  1 42  ? 35.954  4.300   60.666  0.25 26.65  ? 42   GLY D N     1 
ATOM   7537   C CA    A GLY D  1 42  ? 34.745  4.824   60.052  0.25 27.34  ? 42   GLY D CA    1 
ATOM   7538   C C     A GLY D  1 42  ? 33.572  4.943   61.015  0.25 27.24  ? 42   GLY D C     1 
ATOM   7539   O O     A GLY D  1 42  ? 32.543  5.504   60.664  0.25 26.76  ? 42   GLY D O     1 
ATOM   7540   N N     A THR D  1 43  ? 33.701  4.441   62.239  0.25 27.84  ? 43   THR D N     1 
ATOM   7541   C CA    A THR D  1 43  ? 32.581  4.557   63.172  0.25 28.66  ? 43   THR D CA    1 
ATOM   7542   C C     A THR D  1 43  ? 32.586  5.901   63.904  0.25 27.67  ? 43   THR D C     1 
ATOM   7543   O O     A THR D  1 43  ? 31.529  6.402   64.318  0.25 28.74  ? 43   THR D O     1 
ATOM   7544   C CB    A THR D  1 43  ? 32.573  3.405   64.215  0.25 30.34  ? 43   THR D CB    1 
ATOM   7545   O OG1   A THR D  1 43  ? 33.417  3.734   65.311  0.25 37.17  ? 43   THR D OG1   1 
ATOM   7546   C CG2   A THR D  1 43  ? 33.072  2.142   63.605  0.25 25.21  ? 43   THR D CG2   1 
ATOM   7547   N N     A GLY D  1 44  ? 33.769  6.492   64.065  0.25 26.00  ? 44   GLY D N     1 
ATOM   7548   C CA    A GLY D  1 44  ? 33.858  7.776   64.745  0.25 21.31  ? 44   GLY D CA    1 
ATOM   7549   C C     A GLY D  1 44  ? 34.070  7.627   66.237  0.25 24.87  ? 44   GLY D C     1 
ATOM   7550   O O     A GLY D  1 44  ? 33.693  6.611   66.841  0.25 24.79  ? 44   GLY D O     1 
ATOM   7551   N N     A THR D  1 45  ? 34.676  8.638   66.858  0.25 23.96  ? 45   THR D N     1 
ATOM   7552   C CA    A THR D  1 45  ? 34.932  8.584   68.290  0.25 22.44  ? 45   THR D CA    1 
ATOM   7553   C C     A THR D  1 45  ? 34.838  9.959   68.923  0.25 21.43  ? 45   THR D C     1 
ATOM   7554   O O     A THR D  1 45  ? 34.662  10.964  68.255  0.25 23.78  ? 45   THR D O     1 
ATOM   7555   C CB    A THR D  1 45  ? 36.368  8.087   68.588  0.25 24.96  ? 45   THR D CB    1 
ATOM   7556   O OG1   A THR D  1 45  ? 37.288  9.136   68.248  0.25 22.56  ? 45   THR D OG1   1 
ATOM   7557   C CG2   A THR D  1 45  ? 36.714  6.835   67.759  0.25 23.33  ? 45   THR D CG2   1 
ATOM   7558   N N     A VAL D  1 46  ? 34.941  9.985   70.240  0.25 23.60  ? 46   VAL D N     1 
ATOM   7559   C CA    A VAL D  1 46  ? 34.989  11.231  70.988  0.25 25.97  ? 46   VAL D CA    1 
ATOM   7560   C C     A VAL D  1 46  ? 36.337  11.041  71.711  0.25 23.91  ? 46   VAL D C     1 
ATOM   7561   O O     A VAL D  1 46  ? 36.576  9.995   72.289  0.25 22.75  ? 46   VAL D O     1 
ATOM   7562   C CB    A VAL D  1 46  ? 33.805  11.358  71.972  0.25 27.47  ? 46   VAL D CB    1 
ATOM   7563   C CG1   A VAL D  1 46  ? 33.773  10.199  72.923  0.25 26.94  ? 46   VAL D CG1   1 
ATOM   7564   C CG2   A VAL D  1 46  ? 33.926  12.648  72.740  0.25 29.70  ? 46   VAL D CG2   1 
ATOM   7565   N N     A ALA D  1 47  ? 37.220  12.035  71.673  0.25 27.05  ? 47   ALA D N     1 
ATOM   7566   C CA    A ALA D  1 47  ? 38.542  11.836  72.273  0.25 28.04  ? 47   ALA D CA    1 
ATOM   7567   C C     A ALA D  1 47  ? 39.220  13.015  72.965  0.25 27.78  ? 47   ALA D C     1 
ATOM   7568   O O     A ALA D  1 47  ? 38.856  14.164  72.757  0.25 26.70  ? 47   ALA D O     1 
ATOM   7569   C CB    A ALA D  1 47  ? 39.494  11.273  71.189  0.25 24.91  ? 47   ALA D CB    1 
ATOM   7570   N N     A LEU D  1 48  ? 40.226  12.677  73.777  0.25 27.07  ? 48   LEU D N     1 
ATOM   7571   C CA    A LEU D  1 48  ? 41.054  13.628  74.513  0.25 27.01  ? 48   LEU D CA    1 
ATOM   7572   C C     A LEU D  1 48  ? 42.491  13.133  74.341  0.25 26.64  ? 48   LEU D C     1 
ATOM   7573   O O     A LEU D  1 48  ? 42.733  11.936  74.335  0.25 26.74  ? 48   LEU D O     1 
ATOM   7574   C CB    A LEU D  1 48  ? 40.713  13.626  76.006  0.25 25.09  ? 48   LEU D CB    1 
ATOM   7575   C CG    A LEU D  1 48  ? 39.351  14.218  76.407  0.25 26.18  ? 48   LEU D CG    1 
ATOM   7576   C CD1   A LEU D  1 48  ? 39.169  14.074  77.918  0.25 25.05  ? 48   LEU D CD1   1 
ATOM   7577   C CD2   A LEU D  1 48  ? 39.266  15.674  75.978  0.25 23.51  ? 48   LEU D CD2   1 
ATOM   7578   N N     A PHE D  1 49  ? 43.441  14.051  74.214  0.25 26.25  ? 49   PHE D N     1 
ATOM   7579   C CA    A PHE D  1 49  ? 44.832  13.662  74.046  0.25 23.92  ? 49   PHE D CA    1 
ATOM   7580   C C     A PHE D  1 49  ? 45.632  13.798  75.325  0.25 23.62  ? 49   PHE D C     1 
ATOM   7581   O O     A PHE D  1 49  ? 45.515  14.790  76.036  0.25 25.08  ? 49   PHE D O     1 
ATOM   7582   C CB    A PHE D  1 49  ? 45.509  14.517  72.968  0.25 23.13  ? 49   PHE D CB    1 
ATOM   7583   C CG    A PHE D  1 49  ? 46.949  14.130  72.706  0.25 19.43  ? 49   PHE D CG    1 
ATOM   7584   C CD1   A PHE D  1 49  ? 47.266  12.875  72.217  0.25 18.75  ? 49   PHE D CD1   1 
ATOM   7585   C CD2   A PHE D  1 49  ? 47.974  15.040  72.918  0.25 16.89  ? 49   PHE D CD2   1 
ATOM   7586   C CE1   A PHE D  1 49  ? 48.605  12.523  71.939  0.25 21.41  ? 49   PHE D CE1   1 
ATOM   7587   C CE2   A PHE D  1 49  ? 49.307  14.707  72.646  0.25 19.91  ? 49   PHE D CE2   1 
ATOM   7588   C CZ    A PHE D  1 49  ? 49.627  13.455  72.160  0.25 17.68  ? 49   PHE D CZ    1 
ATOM   7589   N N     A ALA D  1 50  ? 46.448  12.791  75.610  0.25 24.00  ? 50   ALA D N     1 
ATOM   7590   C CA    A ALA D  1 50  ? 47.330  12.807  76.763  0.25 25.81  ? 50   ALA D CA    1 
ATOM   7591   C C     A ALA D  1 50  ? 46.697  13.164  78.108  0.25 27.94  ? 50   ALA D C     1 
ATOM   7592   O O     A ALA D  1 50  ? 47.151  14.075  78.790  0.25 29.29  ? 50   ALA D O     1 
ATOM   7593   C CB    A ALA D  1 50  ? 48.505  13.757  76.480  0.25 23.86  ? 50   ALA D CB    1 
ATOM   7594   N N     A PRO D  1 51  ? 45.634  12.458  78.508  0.25 27.61  ? 51   PRO D N     1 
ATOM   7595   C CA    A PRO D  1 51  ? 45.034  12.789  79.800  0.25 26.23  ? 51   PRO D CA    1 
ATOM   7596   C C     A PRO D  1 51  ? 45.946  12.276  80.901  0.25 25.58  ? 51   PRO D C     1 
ATOM   7597   O O     A PRO D  1 51  ? 46.878  11.508  80.632  0.25 24.21  ? 51   PRO D O     1 
ATOM   7598   C CB    A PRO D  1 51  ? 43.711  12.026  79.768  0.25 26.80  ? 51   PRO D CB    1 
ATOM   7599   C CG    A PRO D  1 51  ? 44.086  10.772  79.002  0.25 27.94  ? 51   PRO D CG    1 
ATOM   7600   C CD    A PRO D  1 51  ? 44.890  11.380  77.836  0.25 29.21  ? 51   PRO D CD    1 
ATOM   7601   N N     A PRO D  1 52  ? 45.702  12.695  82.159  0.25 25.68  ? 52   PRO D N     1 
ATOM   7602   C CA    A PRO D  1 52  ? 46.546  12.216  83.266  0.25 24.39  ? 52   PRO D CA    1 
ATOM   7603   C C     A PRO D  1 52  ? 46.637  10.692  83.234  0.25 24.00  ? 52   PRO D C     1 
ATOM   7604   O O     A PRO D  1 52  ? 45.660  10.001  82.918  0.25 22.64  ? 52   PRO D O     1 
ATOM   7605   C CB    A PRO D  1 52  ? 45.815  12.725  84.517  0.25 25.89  ? 52   PRO D CB    1 
ATOM   7606   C CG    A PRO D  1 52  ? 45.197  14.031  84.027  0.25 26.34  ? 52   PRO D CG    1 
ATOM   7607   C CD    A PRO D  1 52  ? 44.693  13.670  82.626  0.25 23.87  ? 52   PRO D CD    1 
ATOM   7608   N N     A SER D  1 53  ? 47.810  10.167  83.570  0.25 23.45  ? 53   SER D N     1 
ATOM   7609   C CA    A SER D  1 53  ? 48.034  8.737   83.557  0.25 25.35  ? 53   SER D CA    1 
ATOM   7610   C C     A SER D  1 53  ? 47.298  8.004   84.686  0.25 25.21  ? 53   SER D C     1 
ATOM   7611   O O     A SER D  1 53  ? 46.922  8.618   85.677  0.25 23.10  ? 53   SER D O     1 
ATOM   7612   C CB    A SER D  1 53  ? 49.522  8.465   83.676  0.25 27.27  ? 53   SER D CB    1 
ATOM   7613   O OG    A SER D  1 53  ? 49.988  8.911   84.932  0.25 29.53  ? 53   SER D OG    1 
ATOM   7614   N N     A PHE D  1 54  ? 47.098  6.694   84.517  0.25 24.19  ? 54   PHE D N     1 
ATOM   7615   C CA    A PHE D  1 54  ? 46.436  5.861   85.527  0.25 23.86  ? 54   PHE D CA    1 
ATOM   7616   C C     A PHE D  1 54  ? 47.522  5.186   86.348  0.25 25.26  ? 54   PHE D C     1 
ATOM   7617   O O     A PHE D  1 54  ? 48.585  4.829   85.810  0.25 20.75  ? 54   PHE D O     1 
ATOM   7618   C CB    A PHE D  1 54  ? 45.589  4.730   84.890  0.25 23.03  ? 54   PHE D CB    1 
ATOM   7619   C CG    A PHE D  1 54  ? 44.336  5.189   84.222  0.25 21.07  ? 54   PHE D CG    1 
ATOM   7620   C CD1   A PHE D  1 54  ? 43.898  6.499   84.342  0.25 22.95  ? 54   PHE D CD1   1 
ATOM   7621   C CD2   A PHE D  1 54  ? 43.552  4.281   83.493  0.25 24.04  ? 54   PHE D CD2   1 
ATOM   7622   C CE1   A PHE D  1 54  ? 42.699  6.908   83.749  0.25 20.10  ? 54   PHE D CE1   1 
ATOM   7623   C CE2   A PHE D  1 54  ? 42.350  4.694   82.906  0.25 23.27  ? 54   PHE D CE2   1 
ATOM   7624   C CZ    A PHE D  1 54  ? 41.936  6.005   83.039  0.25 21.19  ? 54   PHE D CZ    1 
ATOM   7625   N N     A ARG D  1 55  ? 47.243  4.982   87.635  0.25 25.88  ? 55   ARG D N     1 
ATOM   7626   C CA    A ARG D  1 55  ? 48.192  4.321   88.509  0.25 28.77  ? 55   ARG D CA    1 
ATOM   7627   C C     A ARG D  1 55  ? 47.442  3.234   89.264  0.25 29.23  ? 55   ARG D C     1 
ATOM   7628   O O     A ARG D  1 55  ? 46.385  3.479   89.847  0.25 29.07  ? 55   ARG D O     1 
ATOM   7629   C CB    A ARG D  1 55  ? 48.812  5.319   89.508  0.25 29.97  ? 55   ARG D CB    1 
ATOM   7630   C CG    A ARG D  1 55  ? 49.441  6.557   88.864  0.25 34.06  ? 55   ARG D CG    1 
ATOM   7631   C CD    A ARG D  1 55  ? 50.131  7.420   89.926  0.25 35.55  ? 55   ARG D CD    1 
ATOM   7632   N NE    A ARG D  1 55  ? 51.465  6.902   90.229  0.25 37.70  ? 55   ARG D NE    1 
ATOM   7633   C CZ    A ARG D  1 55  ? 52.553  7.224   89.526  0.25 35.85  ? 55   ARG D CZ    1 
ATOM   7634   N NH1   A ARG D  1 55  ? 52.441  8.059   88.504  0.25 32.42  ? 55   ARG D NH1   1 
ATOM   7635   N NH2   A ARG D  1 55  ? 53.743  6.714   89.842  0.25 36.77  ? 55   ARG D NH2   1 
ATOM   7636   N N     A PHE D  1 56  ? 47.993  2.028   89.256  0.25 28.02  ? 56   PHE D N     1 
ATOM   7637   C CA    A PHE D  1 56  ? 47.369  0.907   89.939  0.25 27.23  ? 56   PHE D CA    1 
ATOM   7638   C C     A PHE D  1 56  ? 48.375  0.202   90.819  0.25 27.48  ? 56   PHE D C     1 
ATOM   7639   O O     A PHE D  1 56  ? 49.484  -0.138  90.376  0.25 26.83  ? 56   PHE D O     1 
ATOM   7640   C CB    A PHE D  1 56  ? 46.802  -0.092  88.917  0.25 23.80  ? 56   PHE D CB    1 
ATOM   7641   C CG    A PHE D  1 56  ? 45.712  0.472   88.051  0.25 22.76  ? 56   PHE D CG    1 
ATOM   7642   C CD1   A PHE D  1 56  ? 44.409  0.570   88.528  0.25 22.12  ? 56   PHE D CD1   1 
ATOM   7643   C CD2   A PHE D  1 56  ? 45.982  0.883   86.748  0.25 25.34  ? 56   PHE D CD2   1 
ATOM   7644   C CE1   A PHE D  1 56  ? 43.381  1.062   87.727  0.25 20.03  ? 56   PHE D CE1   1 
ATOM   7645   C CE2   A PHE D  1 56  ? 44.971  1.379   85.927  0.25 24.30  ? 56   PHE D CE2   1 
ATOM   7646   C CZ    A PHE D  1 56  ? 43.657  1.468   86.424  0.25 24.19  ? 56   PHE D CZ    1 
ATOM   7647   N N     A SER D  1 57  ? 47.993  -0.025  92.066  0.25 25.51  ? 57   SER D N     1 
ATOM   7648   C CA    A SER D  1 57  ? 48.864  -0.724  92.995  0.25 27.06  ? 57   SER D CA    1 
ATOM   7649   C C     A SER D  1 57  ? 48.827  -2.217  92.721  0.25 26.69  ? 57   SER D C     1 
ATOM   7650   O O     A SER D  1 57  ? 47.754  -2.797  92.531  0.25 30.77  ? 57   SER D O     1 
ATOM   7651   C CB    A SER D  1 57  ? 48.434  -0.463  94.447  0.25 26.44  ? 57   SER D CB    1 
ATOM   7652   O OG    A SER D  1 57  ? 49.096  -1.361  95.324  0.25 27.07  ? 57   SER D OG    1 
ATOM   7653   N N     A LEU D  1 58  ? 49.997  -2.847  92.713  0.25 25.58  ? 58   LEU D N     1 
ATOM   7654   C CA    A LEU D  1 58  ? 50.090  -4.281  92.476  0.25 24.63  ? 58   LEU D CA    1 
ATOM   7655   C C     A LEU D  1 58  ? 50.554  -4.977  93.745  0.25 25.25  ? 58   LEU D C     1 
ATOM   7656   O O     A LEU D  1 58  ? 50.899  -6.151  93.721  0.25 27.68  ? 58   LEU D O     1 
ATOM   7657   C CB    A LEU D  1 58  ? 51.085  -4.569  91.343  0.25 25.65  ? 58   LEU D CB    1 
ATOM   7658   C CG    A LEU D  1 58  ? 50.788  -3.895  89.997  0.25 22.71  ? 58   LEU D CG    1 
ATOM   7659   C CD1   A LEU D  1 58  ? 51.844  -4.352  88.983  0.25 21.94  ? 58   LEU D CD1   1 
ATOM   7660   C CD2   A LEU D  1 58  ? 49.384  -4.282  89.521  0.25 22.35  ? 58   LEU D CD2   1 
ATOM   7661   N N     A ALA D  1 59  ? 50.579  -4.236  94.856  0.25 27.78  ? 59   ALA D N     1 
ATOM   7662   C CA    A ALA D  1 59  ? 50.998  -4.792  96.144  0.25 26.10  ? 59   ALA D CA    1 
ATOM   7663   C C     A ALA D  1 59  ? 49.943  -5.758  96.681  0.25 29.63  ? 59   ALA D C     1 
ATOM   7664   O O     A ALA D  1 59  ? 48.777  -5.701  96.283  0.25 27.67  ? 59   ALA D O     1 
ATOM   7665   C CB    A ALA D  1 59  ? 51.232  -3.680  97.141  0.25 27.11  ? 59   ALA D CB    1 
ATOM   7666   N N     A ASP D  1 60  ? 50.368  -6.651  97.570  0.25 31.39  ? 60   ASP D N     1 
ATOM   7667   C CA    A ASP D  1 60  ? 49.478  -7.635  98.178  0.25 34.07  ? 60   ASP D CA    1 
ATOM   7668   C C     A ASP D  1 60  ? 48.795  -8.518  97.132  0.25 33.64  ? 60   ASP D C     1 
ATOM   7669   O O     A ASP D  1 60  ? 47.621  -8.844  97.255  0.25 31.01  ? 60   ASP D O     1 
ATOM   7670   C CB    A ASP D  1 60  ? 48.428  -6.922  99.033  0.25 36.49  ? 60   ASP D CB    1 
ATOM   7671   C CG    A ASP D  1 60  ? 49.055  -6.061  100.112 0.25 40.32  ? 60   ASP D CG    1 
ATOM   7672   O OD1   A ASP D  1 60  ? 49.834  -6.615  100.915 0.25 42.80  ? 60   ASP D OD1   1 
ATOM   7673   O OD2   A ASP D  1 60  ? 48.776  -4.840  100.154 0.25 42.99  ? 60   ASP D OD2   1 
ATOM   7674   N N     A ASN D  1 61  ? 49.547  -8.892  96.100  0.25 34.59  ? 61   ASN D N     1 
ATOM   7675   C CA    A ASN D  1 61  ? 49.037  -9.744  95.027  0.25 33.62  ? 61   ASN D CA    1 
ATOM   7676   C C     A ASN D  1 61  ? 47.805  -9.188  94.315  0.25 30.72  ? 61   ASN D C     1 
ATOM   7677   O O     A ASN D  1 61  ? 47.026  -9.946  93.746  0.25 30.86  ? 61   ASN D O     1 
ATOM   7678   C CB    A ASN D  1 61  ? 48.681  -11.127 95.578  0.25 36.93  ? 61   ASN D CB    1 
ATOM   7679   C CG    A ASN D  1 61  ? 49.709  -11.658 96.556  0.25 36.64  ? 61   ASN D CG    1 
ATOM   7680   O OD1   A ASN D  1 61  ? 49.552  -11.519 97.765  0.25 40.98  ? 61   ASN D OD1   1 
ATOM   7681   N ND2   A ASN D  1 61  ? 50.759  -12.277 96.039  0.25 38.71  ? 61   ASN D ND2   1 
ATOM   7682   N N     A THR D  1 62  ? 47.634  -7.876  94.329  0.25 29.91  ? 62   THR D N     1 
ATOM   7683   C CA    A THR D  1 62  ? 46.467  -7.263  93.696  0.25 30.14  ? 62   THR D CA    1 
ATOM   7684   C C     A THR D  1 62  ? 46.511  -7.233  92.168  0.25 30.31  ? 62   THR D C     1 
ATOM   7685   O O     A THR D  1 62  ? 47.545  -6.919  91.559  0.25 30.40  ? 62   THR D O     1 
ATOM   7686   C CB    A THR D  1 62  ? 46.260  -5.829  94.208  0.25 27.06  ? 62   THR D CB    1 
ATOM   7687   O OG1   A THR D  1 62  ? 46.138  -5.850  95.628  0.25 29.82  ? 62   THR D OG1   1 
ATOM   7688   C CG2   A THR D  1 62  ? 44.992  -5.224  93.623  0.25 26.34  ? 62   THR D CG2   1 
ATOM   7689   N N     A LEU D  1 63  ? 45.383  -7.580  91.554  0.25 28.89  ? 63   LEU D N     1 
ATOM   7690   C CA    A LEU D  1 63  ? 45.263  -7.566  90.100  0.25 27.67  ? 63   LEU D CA    1 
ATOM   7691   C C     A LEU D  1 63  ? 44.160  -6.587  89.710  0.25 28.09  ? 63   LEU D C     1 
ATOM   7692   O O     A LEU D  1 63  ? 42.974  -6.817  90.007  0.25 28.03  ? 63   LEU D O     1 
ATOM   7693   C CB    A LEU D  1 63  ? 44.925  -8.960  89.567  0.25 26.25  ? 63   LEU D CB    1 
ATOM   7694   C CG    A LEU D  1 63  ? 44.585  -9.065  88.065  0.25 29.22  ? 63   LEU D CG    1 
ATOM   7695   C CD1   A LEU D  1 63  ? 45.752  -8.550  87.214  0.25 28.31  ? 63   LEU D CD1   1 
ATOM   7696   C CD2   A LEU D  1 63  ? 44.285  -10.506 87.696  0.25 29.96  ? 63   LEU D CD2   1 
ATOM   7697   N N     A PRO D  1 64  ? 44.530  -5.472  89.045  0.25 27.57  ? 64   PRO D N     1 
ATOM   7698   C CA    A PRO D  1 64  ? 43.527  -4.484  88.635  0.25 26.11  ? 64   PRO D CA    1 
ATOM   7699   C C     A PRO D  1 64  ? 42.649  -4.946  87.470  0.25 26.42  ? 64   PRO D C     1 
ATOM   7700   O O     A PRO D  1 64  ? 42.718  -4.400  86.357  0.25 25.39  ? 64   PRO D O     1 
ATOM   7701   C CB    A PRO D  1 64  ? 44.377  -3.254  88.294  0.25 25.78  ? 64   PRO D CB    1 
ATOM   7702   C CG    A PRO D  1 64  ? 45.649  -3.862  87.775  0.25 23.28  ? 64   PRO D CG    1 
ATOM   7703   C CD    A PRO D  1 64  ? 45.898  -4.993  88.743  0.25 25.18  ? 64   PRO D CD    1 
ATOM   7704   N N     A LEU D  1 65  ? 41.827  -5.962  87.729  0.25 25.13  ? 65   LEU D N     1 
ATOM   7705   C CA    A LEU D  1 65  ? 40.906  -6.485  86.724  0.25 22.07  ? 65   LEU D CA    1 
ATOM   7706   C C     A LEU D  1 65  ? 39.573  -5.754  86.999  0.25 24.28  ? 65   LEU D C     1 
ATOM   7707   O O     A LEU D  1 65  ? 38.937  -5.971  88.034  0.25 23.15  ? 65   LEU D O     1 
ATOM   7708   C CB    A LEU D  1 65  ? 40.767  -8.002  86.906  0.25 21.06  ? 65   LEU D CB    1 
ATOM   7709   C CG    A LEU D  1 65  ? 39.901  -8.742  85.874  0.25 23.74  ? 65   LEU D CG    1 
ATOM   7710   C CD1   A LEU D  1 65  ? 40.580  -8.668  84.532  0.25 19.41  ? 65   LEU D CD1   1 
ATOM   7711   C CD2   A LEU D  1 65  ? 39.687  -10.194 86.293  0.25 25.51  ? 65   LEU D CD2   1 
ATOM   7712   N N     A LEU D  1 66  ? 39.150  -4.896  86.077  0.25 23.15  ? 66   LEU D N     1 
ATOM   7713   C CA    A LEU D  1 66  ? 37.945  -4.101  86.271  0.25 24.29  ? 66   LEU D CA    1 
ATOM   7714   C C     A LEU D  1 66  ? 36.744  -4.932  86.728  0.25 26.84  ? 66   LEU D C     1 
ATOM   7715   O O     A LEU D  1 66  ? 36.512  -6.031  86.246  0.25 27.41  ? 66   LEU D O     1 
ATOM   7716   C CB    A LEU D  1 66  ? 37.596  -3.350  84.990  0.25 23.40  ? 66   LEU D CB    1 
ATOM   7717   C CG    A LEU D  1 66  ? 38.677  -2.465  84.351  0.25 27.47  ? 66   LEU D CG    1 
ATOM   7718   C CD1   A LEU D  1 66  ? 38.021  -1.587  83.267  0.25 25.41  ? 66   LEU D CD1   1 
ATOM   7719   C CD2   A LEU D  1 66  ? 39.345  -1.582  85.391  0.25 26.02  ? 66   LEU D CD2   1 
ATOM   7720   N N     A THR D  1 67  ? 35.965  -4.363  87.639  0.25 30.92  ? 67   THR D N     1 
ATOM   7721   C CA    A THR D  1 67  ? 34.795  -5.021  88.201  0.25 27.01  ? 67   THR D CA    1 
ATOM   7722   C C     A THR D  1 67  ? 33.454  -4.417  87.790  0.25 28.65  ? 67   THR D C     1 
ATOM   7723   O O     A THR D  1 67  ? 32.401  -5.020  88.057  0.25 27.34  ? 67   THR D O     1 
ATOM   7724   C CB    A THR D  1 67  ? 34.861  -4.990  89.715  0.25 26.79  ? 67   THR D CB    1 
ATOM   7725   O OG1   A THR D  1 67  ? 34.798  -3.627  90.160  0.25 26.33  ? 67   THR D OG1   1 
ATOM   7726   C CG2   A THR D  1 67  ? 36.151  -5.638  90.198  0.25 20.11  ? 67   THR D CG2   1 
ATOM   7727   N N     A THR D  1 68  ? 33.464  -3.242  87.161  0.25 24.64  ? 68   THR D N     1 
ATOM   7728   C CA    A THR D  1 68  ? 32.197  -2.640  86.746  0.25 26.38  ? 68   THR D CA    1 
ATOM   7729   C C     A THR D  1 68  ? 31.595  -3.322  85.524  0.25 26.90  ? 68   THR D C     1 
ATOM   7730   O O     A THR D  1 68  ? 30.541  -2.922  85.039  0.25 26.64  ? 68   THR D O     1 
ATOM   7731   C CB    A THR D  1 68  ? 32.314  -1.113  86.498  0.25 28.22  ? 68   THR D CB    1 
ATOM   7732   O OG1   A THR D  1 68  ? 33.434  -0.831  85.652  0.25 31.26  ? 68   THR D OG1   1 
ATOM   7733   C CG2   A THR D  1 68  ? 32.487  -0.392  87.823  0.25 29.32  ? 68   THR D CG2   1 
ATOM   7734   N N     A LYS D  1 69  ? 32.288  -4.340  85.017  0.25 25.50  ? 69   LYS D N     1 
ATOM   7735   C CA    A LYS D  1 69  ? 31.781  -5.157  83.919  0.25 26.14  ? 69   LYS D CA    1 
ATOM   7736   C C     A LYS D  1 69  ? 32.595  -6.438  83.961  0.25 26.94  ? 69   LYS D C     1 
ATOM   7737   O O     A LYS D  1 69  ? 33.710  -6.427  84.476  0.25 26.15  ? 69   LYS D O     1 
ATOM   7738   C CB    A LYS D  1 69  ? 31.950  -4.474  82.571  0.25 26.81  ? 69   LYS D CB    1 
ATOM   7739   C CG    A LYS D  1 69  ? 33.308  -4.732  81.914  0.25 24.76  ? 69   LYS D CG    1 
ATOM   7740   C CD    A LYS D  1 69  ? 33.314  -4.207  80.482  0.25 23.19  ? 69   LYS D CD    1 
ATOM   7741   C CE    A LYS D  1 69  ? 34.676  -4.438  79.817  0.25 21.79  ? 69   LYS D CE    1 
ATOM   7742   N NZ    A LYS D  1 69  ? 34.691  -3.843  78.445  0.25 25.13  ? 69   LYS D NZ    1 
ATOM   7743   N N     A ARG D  1 70  ? 32.036  -7.543  83.460  0.25 28.46  ? 70   ARG D N     1 
ATOM   7744   C CA    A ARG D  1 70  ? 32.771  -8.806  83.456  0.25 28.48  ? 70   ARG D CA    1 
ATOM   7745   C C     A ARG D  1 70  ? 33.825  -8.726  82.360  0.25 26.75  ? 70   ARG D C     1 
ATOM   7746   O O     A ARG D  1 70  ? 33.500  -8.490  81.194  0.25 27.49  ? 70   ARG D O     1 
ATOM   7747   C CB    A ARG D  1 70  ? 31.858  -10.021 83.168  0.25 31.51  ? 70   ARG D CB    1 
ATOM   7748   C CG    A ARG D  1 70  ? 32.581  -11.383 83.387  0.25 34.12  ? 70   ARG D CG    1 
ATOM   7749   C CD    A ARG D  1 70  ? 31.876  -12.656 82.833  0.25 39.41  ? 70   ARG D CD    1 
ATOM   7750   N NE    A ARG D  1 70  ? 30.502  -12.420 82.778  0.25 39.91  ? 70   ARG D NE    1 
ATOM   7751   C CZ    A ARG D  1 70  ? 29.502  -12.578 81.929  0.25 41.68  ? 70   ARG D CZ    1 
ATOM   7752   N NH1   A ARG D  1 70  ? 29.459  -13.091 80.692  0.25 34.93  ? 70   ARG D NH1   1 
ATOM   7753   N NH2   A ARG D  1 70  ? 28.428  -12.051 82.469  0.25 38.77  ? 70   ARG D NH2   1 
ATOM   7754   N N     A VAL D  1 71  ? 35.078  -8.928  82.735  0.25 24.85  ? 71   VAL D N     1 
ATOM   7755   C CA    A VAL D  1 71  ? 36.185  -8.885  81.784  0.25 24.99  ? 71   VAL D CA    1 
ATOM   7756   C C     A VAL D  1 71  ? 36.618  -10.298 81.465  0.25 24.19  ? 71   VAL D C     1 
ATOM   7757   O O     A VAL D  1 71  ? 36.783  -11.105 82.381  0.25 23.05  ? 71   VAL D O     1 
ATOM   7758   C CB    A VAL D  1 71  ? 37.414  -8.128  82.368  0.25 27.06  ? 71   VAL D CB    1 
ATOM   7759   C CG1   A VAL D  1 71  ? 38.574  -8.143  81.348  0.25 27.10  ? 71   VAL D CG1   1 
ATOM   7760   C CG2   A VAL D  1 71  ? 37.020  -6.704  82.719  0.25 25.12  ? 71   VAL D CG2   1 
ATOM   7761   N N     A PHE D  1 72  ? 36.819  -10.589 80.176  0.25 24.46  ? 72   PHE D N     1 
ATOM   7762   C CA    A PHE D  1 72  ? 37.223  -11.923 79.718  0.25 23.33  ? 72   PHE D CA    1 
ATOM   7763   C C     A PHE D  1 72  ? 38.658  -12.217 80.162  0.25 24.45  ? 72   PHE D C     1 
ATOM   7764   O O     A PHE D  1 72  ? 39.611  -12.143 79.366  0.25 26.83  ? 72   PHE D O     1 
ATOM   7765   C CB    A PHE D  1 72  ? 37.094  -11.994 78.179  0.25 25.09  ? 72   PHE D CB    1 
ATOM   7766   C CG    A PHE D  1 72  ? 37.328  -13.370 77.587  0.25 25.56  ? 72   PHE D CG    1 
ATOM   7767   C CD1   A PHE D  1 72  ? 37.594  -13.514 76.221  0.25 25.82  ? 72   PHE D CD1   1 
ATOM   7768   C CD2   A PHE D  1 72  ? 37.251  -14.516 78.376  0.25 28.22  ? 72   PHE D CD2   1 
ATOM   7769   C CE1   A PHE D  1 72  ? 37.782  -14.792 75.644  0.25 27.26  ? 72   PHE D CE1   1 
ATOM   7770   C CE2   A PHE D  1 72  ? 37.435  -15.801 77.814  0.25 29.60  ? 72   PHE D CE2   1 
ATOM   7771   C CZ    A PHE D  1 72  ? 37.702  -15.932 76.440  0.25 27.07  ? 72   PHE D CZ    1 
ATOM   7772   N N     A LEU D  1 73  ? 38.812  -12.563 81.433  0.25 22.93  ? 73   LEU D N     1 
ATOM   7773   C CA    A LEU D  1 73  ? 40.117  -12.846 82.007  0.25 25.26  ? 73   LEU D CA    1 
ATOM   7774   C C     A LEU D  1 73  ? 40.955  -13.863 81.224  0.25 25.91  ? 73   LEU D C     1 
ATOM   7775   O O     A LEU D  1 73  ? 42.136  -13.626 80.935  0.25 24.46  ? 73   LEU D O     1 
ATOM   7776   C CB    A LEU D  1 73  ? 39.956  -13.317 83.461  0.25 25.42  ? 73   LEU D CB    1 
ATOM   7777   C CG    A LEU D  1 73  ? 41.223  -13.802 84.181  0.25 24.69  ? 73   LEU D CG    1 
ATOM   7778   C CD1   A LEU D  1 73  ? 42.280  -12.691 84.263  0.25 21.15  ? 73   LEU D CD1   1 
ATOM   7779   C CD2   A LEU D  1 73  ? 40.841  -14.287 85.572  0.25 24.24  ? 73   LEU D CD2   1 
ATOM   7780   N N     A ARG D  1 74  ? 40.355  -14.997 80.893  0.25 26.17  ? 74   ARG D N     1 
ATOM   7781   C CA    A ARG D  1 74  ? 41.066  -16.027 80.154  0.25 26.64  ? 74   ARG D CA    1 
ATOM   7782   C C     A ARG D  1 74  ? 41.608  -15.486 78.826  0.25 24.43  ? 74   ARG D C     1 
ATOM   7783   O O     A ARG D  1 74  ? 42.686  -15.879 78.386  0.25 23.56  ? 74   ARG D O     1 
ATOM   7784   C CB    A ARG D  1 74  ? 40.150  -17.242 79.913  0.25 30.14  ? 74   ARG D CB    1 
ATOM   7785   C CG    A ARG D  1 74  ? 40.830  -18.394 79.166  0.25 31.02  ? 74   ARG D CG    1 
ATOM   7786   C CD    A ARG D  1 74  ? 40.050  -19.708 79.319  0.25 36.60  ? 74   ARG D CD    1 
ATOM   7787   N NE    A ARG D  1 74  ? 38.711  -19.665 78.737  0.25 38.10  ? 74   ARG D NE    1 
ATOM   7788   C CZ    A ARG D  1 74  ? 38.448  -19.748 77.429  0.25 44.84  ? 74   ARG D CZ    1 
ATOM   7789   N NH1   A ARG D  1 74  ? 39.442  -19.878 76.557  0.25 44.55  ? 74   ARG D NH1   1 
ATOM   7790   N NH2   A ARG D  1 74  ? 37.188  -19.719 76.987  0.25 41.46  ? 74   ARG D NH2   1 
ATOM   7791   N N     A GLY D  1 75  ? 40.858  -14.585 78.202  0.25 22.77  ? 75   GLY D N     1 
ATOM   7792   C CA    A GLY D  1 75  ? 41.286  -14.008 76.949  0.25 20.85  ? 75   GLY D CA    1 
ATOM   7793   C C     A GLY D  1 75  ? 42.515  -13.131 77.152  0.25 24.87  ? 75   GLY D C     1 
ATOM   7794   O O     A GLY D  1 75  ? 43.426  -13.112 76.304  0.25 23.73  ? 75   GLY D O     1 
ATOM   7795   N N     A VAL D  1 76  ? 42.544  -12.400 78.264  0.25 21.60  ? 76   VAL D N     1 
ATOM   7796   C CA    A VAL D  1 76  ? 43.671  -11.539 78.572  0.25 21.05  ? 76   VAL D CA    1 
ATOM   7797   C C     A VAL D  1 76  ? 44.916  -12.396 78.772  0.25 23.25  ? 76   VAL D C     1 
ATOM   7798   O O     A VAL D  1 76  ? 45.956  -12.139 78.175  0.25 23.65  ? 76   VAL D O     1 
ATOM   7799   C CB    A VAL D  1 76  ? 43.401  -10.706 79.870  0.25 19.77  ? 76   VAL D CB    1 
ATOM   7800   C CG1   A VAL D  1 76  ? 44.607  -9.831  80.207  0.25 20.34  ? 76   VAL D CG1   1 
ATOM   7801   C CG2   A VAL D  1 76  ? 42.184  -9.821  79.680  0.25 19.40  ? 76   VAL D CG2   1 
ATOM   7802   N N     A ILE D  1 77  ? 44.810  -13.414 79.629  0.25 23.00  ? 77   ILE D N     1 
ATOM   7803   C CA    A ILE D  1 77  ? 45.923  -14.305 79.905  0.25 23.11  ? 77   ILE D CA    1 
ATOM   7804   C C     A ILE D  1 77  ? 46.405  -15.011 78.620  0.25 26.60  ? 77   ILE D C     1 
ATOM   7805   O O     A ILE D  1 77  ? 47.609  -15.078 78.344  0.25 25.34  ? 77   ILE D O     1 
ATOM   7806   C CB    A ILE D  1 77  ? 45.526  -15.386 80.928  0.25 24.65  ? 77   ILE D CB    1 
ATOM   7807   C CG1   A ILE D  1 77  ? 45.087  -14.733 82.238  0.25 22.16  ? 77   ILE D CG1   1 
ATOM   7808   C CG2   A ILE D  1 77  ? 46.684  -16.357 81.139  0.25 21.71  ? 77   ILE D CG2   1 
ATOM   7809   C CD1   A ILE D  1 77  ? 44.472  -15.717 83.226  0.25 19.59  ? 77   ILE D CD1   1 
ATOM   7810   N N     A ALA D  1 78  ? 45.472  -15.559 77.846  0.25 23.11  ? 78   ALA D N     1 
ATOM   7811   C CA    A ALA D  1 78  ? 45.853  -16.241 76.611  0.25 23.53  ? 78   ALA D CA    1 
ATOM   7812   C C     A ALA D  1 78  ? 46.621  -15.304 75.670  0.25 23.02  ? 78   ALA D C     1 
ATOM   7813   O O     A ALA D  1 78  ? 47.652  -15.694 75.124  0.25 23.84  ? 78   ALA D O     1 
ATOM   7814   C CB    A ALA D  1 78  ? 44.627  -16.789 75.891  0.25 21.84  ? 78   ALA D CB    1 
ATOM   7815   N N     A GLU D  1 79  ? 46.115  -14.087 75.476  0.25 22.68  ? 79   GLU D N     1 
ATOM   7816   C CA    A GLU D  1 79  ? 46.776  -13.135 74.606  0.25 22.18  ? 79   GLU D CA    1 
ATOM   7817   C C     A GLU D  1 79  ? 48.173  -12.810 75.108  0.25 24.09  ? 79   GLU D C     1 
ATOM   7818   O O     A GLU D  1 79  ? 49.122  -12.724 74.313  0.25 23.55  ? 79   GLU D O     1 
ATOM   7819   C CB    A GLU D  1 79  ? 45.967  -11.841 74.468  0.25 23.52  ? 79   GLU D CB    1 
ATOM   7820   C CG    A GLU D  1 79  ? 46.688  -10.776 73.595  0.25 22.91  ? 79   GLU D CG    1 
ATOM   7821   C CD    A GLU D  1 79  ? 46.029  -9.432  73.658  0.25 21.09  ? 79   GLU D CD    1 
ATOM   7822   O OE1   A GLU D  1 79  ? 45.685  -9.014  74.784  0.25 26.26  ? 79   GLU D OE1   1 
ATOM   7823   O OE2   A GLU D  1 79  ? 45.848  -8.790  72.595  0.25 19.94  ? 79   GLU D OE2   1 
ATOM   7824   N N     A LEU D  1 80  ? 48.305  -12.656 76.426  0.25 24.61  ? 80   LEU D N     1 
ATOM   7825   C CA    A LEU D  1 80  ? 49.590  -12.324 77.029  0.25 24.36  ? 80   LEU D CA    1 
ATOM   7826   C C     A LEU D  1 80  ? 50.638  -13.417 76.837  0.25 25.21  ? 80   LEU D C     1 
ATOM   7827   O O     A LEU D  1 80  ? 51.781  -13.129 76.466  0.25 25.91  ? 80   LEU D O     1 
ATOM   7828   C CB    A LEU D  1 80  ? 49.421  -12.033 78.521  0.25 24.19  ? 80   LEU D CB    1 
ATOM   7829   C CG    A LEU D  1 80  ? 50.735  -11.731 79.266  0.25 25.47  ? 80   LEU D CG    1 
ATOM   7830   C CD1   A LEU D  1 80  ? 51.453  -10.540 78.602  0.25 20.18  ? 80   LEU D CD1   1 
ATOM   7831   C CD2   A LEU D  1 80  ? 50.427  -11.436 80.755  0.25 22.53  ? 80   LEU D CD2   1 
ATOM   7832   N N     A LEU D  1 81  ? 50.254  -14.665 77.080  0.25 21.36  ? 81   LEU D N     1 
ATOM   7833   C CA    A LEU D  1 81  ? 51.186  -15.783 76.933  0.25 23.73  ? 81   LEU D CA    1 
ATOM   7834   C C     A LEU D  1 81  ? 51.544  -15.945 75.463  0.25 22.60  ? 81   LEU D C     1 
ATOM   7835   O O     A LEU D  1 81  ? 52.619  -16.451 75.108  0.25 22.68  ? 81   LEU D O     1 
ATOM   7836   C CB    A LEU D  1 81  ? 50.564  -17.091 77.471  0.25 24.16  ? 81   LEU D CB    1 
ATOM   7837   C CG    A LEU D  1 81  ? 50.222  -17.085 78.969  0.25 25.22  ? 81   LEU D CG    1 
ATOM   7838   C CD1   A LEU D  1 81  ? 49.706  -18.451 79.417  0.25 22.18  ? 81   LEU D CD1   1 
ATOM   7839   C CD2   A LEU D  1 81  ? 51.480  -16.716 79.758  0.25 24.37  ? 81   LEU D CD2   1 
ATOM   7840   N N     A TRP D  1 82  ? 50.619  -15.519 74.617  0.25 20.71  ? 82   TRP D N     1 
ATOM   7841   C CA    A TRP D  1 82  ? 50.778  -15.566 73.170  0.25 21.75  ? 82   TRP D CA    1 
ATOM   7842   C C     A TRP D  1 82  ? 51.872  -14.526 72.812  0.25 23.45  ? 82   TRP D C     1 
ATOM   7843   O O     A TRP D  1 82  ? 52.787  -14.847 72.059  0.25 24.54  ? 82   TRP D O     1 
ATOM   7844   C CB    A TRP D  1 82  ? 49.436  -15.216 72.530  0.25 21.50  ? 82   TRP D CB    1 
ATOM   7845   C CG    A TRP D  1 82  ? 49.419  -15.125 71.056  0.25 19.90  ? 82   TRP D CG    1 
ATOM   7846   C CD1   A TRP D  1 82  ? 49.617  -16.146 70.164  0.25 19.94  ? 82   TRP D CD1   1 
ATOM   7847   C CD2   A TRP D  1 82  ? 49.077  -13.979 70.280  0.25 21.02  ? 82   TRP D CD2   1 
ATOM   7848   N NE1   A TRP D  1 82  ? 49.414  -15.706 68.888  0.25 21.47  ? 82   TRP D NE1   1 
ATOM   7849   C CE2   A TRP D  1 82  ? 49.080  -14.377 68.926  0.25 20.31  ? 82   TRP D CE2   1 
ATOM   7850   C CE3   A TRP D  1 82  ? 48.760  -12.648 70.597  0.25 21.24  ? 82   TRP D CE3   1 
ATOM   7851   C CZ2   A TRP D  1 82  ? 48.777  -13.494 67.883  0.25 20.04  ? 82   TRP D CZ2   1 
ATOM   7852   C CZ3   A TRP D  1 82  ? 48.459  -11.767 69.553  0.25 21.63  ? 82   TRP D CZ3   1 
ATOM   7853   C CH2   A TRP D  1 82  ? 48.471  -12.205 68.209  0.25 18.09  ? 82   TRP D CH2   1 
ATOM   7854   N N     A PHE D  1 83  ? 51.789  -13.319 73.386  0.25 20.74  ? 83   PHE D N     1 
ATOM   7855   C CA    A PHE D  1 83  ? 52.786  -12.271 73.133  0.25 22.29  ? 83   PHE D CA    1 
ATOM   7856   C C     A PHE D  1 83  ? 54.149  -12.804 73.547  0.25 23.13  ? 83   PHE D C     1 
ATOM   7857   O O     A PHE D  1 83  ? 55.100  -12.779 72.766  0.25 24.31  ? 83   PHE D O     1 
ATOM   7858   C CB    A PHE D  1 83  ? 52.541  -11.004 73.965  0.25 20.54  ? 83   PHE D CB    1 
ATOM   7859   C CG    A PHE D  1 83  ? 51.316  -10.209 73.576  0.25 15.78  ? 83   PHE D CG    1 
ATOM   7860   C CD1   A PHE D  1 83  ? 50.856  -10.197 72.284  0.25 16.95  ? 83   PHE D CD1   1 
ATOM   7861   C CD2   A PHE D  1 83  ? 50.672  -9.424  74.527  0.25 20.06  ? 83   PHE D CD2   1 
ATOM   7862   C CE1   A PHE D  1 83  ? 49.775  -9.412  71.924  0.25 17.58  ? 83   PHE D CE1   1 
ATOM   7863   C CE2   A PHE D  1 83  ? 49.570  -8.629  74.171  0.25 16.91  ? 83   PHE D CE2   1 
ATOM   7864   C CZ    A PHE D  1 83  ? 49.135  -8.634  72.862  0.25 16.45  ? 83   PHE D CZ    1 
ATOM   7865   N N     A VAL D  1 84  ? 54.226  -13.270 74.795  0.25 23.79  ? 84   VAL D N     1 
ATOM   7866   C CA    A VAL D  1 84  ? 55.459  -13.800 75.360  0.25 23.73  ? 84   VAL D CA    1 
ATOM   7867   C C     A VAL D  1 84  ? 56.097  -14.869 74.485  0.25 23.70  ? 84   VAL D C     1 
ATOM   7868   O O     A VAL D  1 84  ? 57.315  -14.872 74.309  0.25 25.35  ? 84   VAL D O     1 
ATOM   7869   C CB    A VAL D  1 84  ? 55.218  -14.367 76.770  0.25 24.48  ? 84   VAL D CB    1 
ATOM   7870   C CG1   A VAL D  1 84  ? 56.486  -15.015 77.305  0.25 20.92  ? 84   VAL D CG1   1 
ATOM   7871   C CG2   A VAL D  1 84  ? 54.773  -13.254 77.691  0.25 23.16  ? 84   VAL D CG2   1 
ATOM   7872   N N     A SER D  1 85  ? 55.285  -15.765 73.933  0.25 22.20  ? 85   SER D N     1 
ATOM   7873   C CA    A SER D  1 85  ? 55.801  -16.825 73.060  0.25 22.51  ? 85   SER D CA    1 
ATOM   7874   C C     A SER D  1 85  ? 56.388  -16.293 71.755  0.25 23.70  ? 85   SER D C     1 
ATOM   7875   O O     A SER D  1 85  ? 57.080  -17.024 71.067  0.25 25.05  ? 85   SER D O     1 
ATOM   7876   C CB    A SER D  1 85  ? 54.702  -17.822 72.684  0.25 21.92  ? 85   SER D CB    1 
ATOM   7877   O OG    A SER D  1 85  ? 53.764  -17.191 71.838  0.25 24.45  ? 85   SER D OG    1 
ATOM   7878   N N     A GLY D  1 86  ? 56.104  -15.035 71.419  0.25 24.07  ? 86   GLY D N     1 
ATOM   7879   C CA    A GLY D  1 86  ? 56.615  -14.462 70.186  0.25 24.48  ? 86   GLY D CA    1 
ATOM   7880   C C     A GLY D  1 86  ? 55.781  -14.847 68.976  0.25 24.65  ? 86   GLY D C     1 
ATOM   7881   O O     A GLY D  1 86  ? 56.108  -14.490 67.851  0.25 23.56  ? 86   GLY D O     1 
ATOM   7882   N N     A CYS D  1 87  ? 54.695  -15.580 69.211  0.25 24.66  ? 87   CYS D N     1 
ATOM   7883   C CA    A CYS D  1 87  ? 53.801  -16.016 68.136  0.25 23.20  ? 87   CYS D CA    1 
ATOM   7884   C C     A CYS D  1 87  ? 52.973  -14.867 67.562  0.25 22.53  ? 87   CYS D C     1 
ATOM   7885   O O     A CYS D  1 87  ? 52.564  -13.969 68.290  0.25 23.84  ? 87   CYS D O     1 
ATOM   7886   C CB    A CYS D  1 87  ? 52.854  -17.096 68.687  0.25 26.60  ? 87   CYS D CB    1 
ATOM   7887   S SG    A CYS D  1 87  ? 51.669  -17.804 67.484  0.25 32.70  ? 87   CYS D SG    1 
ATOM   7888   N N     A THR D  1 88  ? 52.713  -14.899 66.258  0.25 20.43  ? 88   THR D N     1 
ATOM   7889   C CA    A THR D  1 88  ? 51.916  -13.858 65.618  0.25 21.55  ? 88   THR D CA    1 
ATOM   7890   C C     A THR D  1 88  ? 50.733  -14.447 64.837  0.25 22.74  ? 88   THR D C     1 
ATOM   7891   O O     A THR D  1 88  ? 50.122  -13.764 64.014  0.25 22.83  ? 88   THR D O     1 
ATOM   7892   C CB    A THR D  1 88  ? 52.764  -13.046 64.649  0.25 21.90  ? 88   THR D CB    1 
ATOM   7893   O OG1   A THR D  1 88  ? 53.298  -13.917 63.640  0.25 24.57  ? 88   THR D OG1   1 
ATOM   7894   C CG2   A THR D  1 88  ? 53.903  -12.375 65.405  0.25 22.76  ? 88   THR D CG2   1 
ATOM   7895   N N     A ASP D  1 89  ? 50.425  -15.713 65.098  0.25 22.22  ? 89   ASP D N     1 
ATOM   7896   C CA    A ASP D  1 89  ? 49.314  -16.389 64.427  0.25 23.00  ? 89   ASP D CA    1 
ATOM   7897   C C     A ASP D  1 89  ? 48.073  -16.352 65.325  0.25 22.48  ? 89   ASP D C     1 
ATOM   7898   O O     A ASP D  1 89  ? 48.024  -17.002 66.383  0.25 23.42  ? 89   ASP D O     1 
ATOM   7899   C CB    A ASP D  1 89  ? 49.709  -17.827 64.118  0.25 22.04  ? 89   ASP D CB    1 
ATOM   7900   C CG    A ASP D  1 89  ? 48.667  -18.557 63.295  0.25 25.79  ? 89   ASP D CG    1 
ATOM   7901   O OD1   A ASP D  1 89  ? 48.986  -19.675 62.823  0.25 21.73  ? 89   ASP D OD1   1 
ATOM   7902   O OD2   A ASP D  1 89  ? 47.538  -18.022 63.124  0.25 22.77  ? 89   ASP D OD2   1 
ATOM   7903   N N     A ALA D  1 90  ? 47.087  -15.571 64.911  0.25 22.54  ? 90   ALA D N     1 
ATOM   7904   C CA    A ALA D  1 90  ? 45.858  -15.431 65.678  0.25 24.58  ? 90   ALA D CA    1 
ATOM   7905   C C     A ALA D  1 90  ? 45.102  -16.744 65.857  0.25 23.99  ? 90   ALA D C     1 
ATOM   7906   O O     A ALA D  1 90  ? 44.278  -16.863 66.770  0.25 26.09  ? 90   ALA D O     1 
ATOM   7907   C CB    A ALA D  1 90  ? 44.945  -14.378 65.017  0.25 21.29  ? 90   ALA D CB    1 
ATOM   7908   N N     A LYS D  1 91  ? 45.366  -17.725 64.999  0.25 25.37  ? 91   LYS D N     1 
ATOM   7909   C CA    A LYS D  1 91  ? 44.678  -19.008 65.106  0.25 26.22  ? 91   LYS D CA    1 
ATOM   7910   C C     A LYS D  1 91  ? 45.049  -19.679 66.426  0.25 26.85  ? 91   LYS D C     1 
ATOM   7911   O O     A LYS D  1 91  ? 44.299  -20.515 66.935  0.25 25.18  ? 91   LYS D O     1 
ATOM   7912   C CB    A LYS D  1 91  ? 45.040  -19.941 63.928  0.25 29.81  ? 91   LYS D CB    1 
ATOM   7913   C CG    A LYS D  1 91  ? 44.578  -19.456 62.563  0.25 31.22  ? 91   LYS D CG    1 
ATOM   7914   C CD    A LYS D  1 91  ? 43.053  -19.383 62.473  0.25 33.52  ? 91   LYS D CD    1 
ATOM   7915   C CE    A LYS D  1 91  ? 42.605  -18.953 61.081  0.25 35.10  ? 91   LYS D CE    1 
ATOM   7916   N NZ    A LYS D  1 91  ? 41.115  -18.805 60.968  0.25 35.86  ? 91   LYS D NZ    1 
ATOM   7917   N N     A MET D  1 92  ? 46.204  -19.317 66.983  0.25 24.24  ? 92   MET D N     1 
ATOM   7918   C CA    A MET D  1 92  ? 46.640  -19.910 68.240  0.25 24.78  ? 92   MET D CA    1 
ATOM   7919   C C     A MET D  1 92  ? 45.754  -19.411 69.378  0.25 24.01  ? 92   MET D C     1 
ATOM   7920   O O     A MET D  1 92  ? 45.740  -19.986 70.476  0.25 25.11  ? 92   MET D O     1 
ATOM   7921   C CB    A MET D  1 92  ? 48.100  -19.553 68.542  0.25 28.48  ? 92   MET D CB    1 
ATOM   7922   C CG    A MET D  1 92  ? 49.084  -19.986 67.456  0.25 39.75  ? 92   MET D CG    1 
ATOM   7923   S SD    A MET D  1 92  ? 48.946  -21.718 67.080  0.25 48.99  ? 92   MET D SD    1 
ATOM   7924   C CE    A MET D  1 92  ? 49.513  -22.422 68.641  0.25 47.48  ? 92   MET D CE    1 
ATOM   7925   N N     A LEU D  1 93  ? 45.036  -18.325 69.131  0.25 22.61  ? 93   LEU D N     1 
ATOM   7926   C CA    A LEU D  1 93  ? 44.127  -17.790 70.143  0.25 25.55  ? 93   LEU D CA    1 
ATOM   7927   C C     A LEU D  1 93  ? 42.721  -18.323 69.872  0.25 25.74  ? 93   LEU D C     1 
ATOM   7928   O O     A LEU D  1 93  ? 42.062  -18.806 70.782  0.25 27.16  ? 93   LEU D O     1 
ATOM   7929   C CB    A LEU D  1 93  ? 44.122  -16.254 70.138  0.25 22.96  ? 93   LEU D CB    1 
ATOM   7930   C CG    A LEU D  1 93  ? 45.433  -15.568 70.578  0.25 26.94  ? 93   LEU D CG    1 
ATOM   7931   C CD1   A LEU D  1 93  ? 45.306  -14.039 70.464  0.25 26.60  ? 93   LEU D CD1   1 
ATOM   7932   C CD2   A LEU D  1 93  ? 45.750  -15.975 72.014  0.25 20.52  ? 93   LEU D CD2   1 
ATOM   7933   N N     A SER D  1 94  ? 42.267  -18.257 68.624  0.25 26.51  ? 94   SER D N     1 
ATOM   7934   C CA    A SER D  1 94  ? 40.922  -18.741 68.292  0.25 28.05  ? 94   SER D CA    1 
ATOM   7935   C C     A SER D  1 94  ? 40.768  -20.250 68.531  0.25 28.08  ? 94   SER D C     1 
ATOM   7936   O O     A SER D  1 94  ? 39.684  -20.737 68.842  0.25 25.74  ? 94   SER D O     1 
ATOM   7937   C CB    A SER D  1 94  ? 40.573  -18.390 66.841  0.25 27.84  ? 94   SER D CB    1 
ATOM   7938   O OG    A SER D  1 94  ? 41.497  -18.971 65.941  0.25 32.90  ? 94   SER D OG    1 
ATOM   7939   N N     A SER D  1 95  ? 41.859  -20.999 68.407  0.25 28.74  ? 95   SER D N     1 
ATOM   7940   C CA    A SER D  1 95  ? 41.801  -22.432 68.637  0.25 28.29  ? 95   SER D CA    1 
ATOM   7941   C C     A SER D  1 95  ? 41.541  -22.734 70.123  0.25 28.17  ? 95   SER D C     1 
ATOM   7942   O O     A SER D  1 95  ? 41.059  -23.816 70.481  0.25 28.04  ? 95   SER D O     1 
ATOM   7943   C CB    A SER D  1 95  ? 43.104  -23.111 68.185  0.25 30.87  ? 95   SER D CB    1 
ATOM   7944   O OG    A SER D  1 95  ? 44.189  -22.727 69.008  0.25 37.73  ? 95   SER D OG    1 
ATOM   7945   N N     A GLN D  1 96  ? 41.871  -21.795 70.993  0.25 28.19  ? 96   GLN D N     1 
ATOM   7946   C CA    A GLN D  1 96  ? 41.615  -21.987 72.414  0.25 28.04  ? 96   GLN D CA    1 
ATOM   7947   C C     A GLN D  1 96  ? 40.425  -21.141 72.874  0.25 26.25  ? 96   GLN D C     1 
ATOM   7948   O O     A GLN D  1 96  ? 40.294  -20.810 74.042  0.25 26.74  ? 96   GLN D O     1 
ATOM   7949   C CB    A GLN D  1 96  ? 42.873  -21.673 73.252  0.25 28.39  ? 96   GLN D CB    1 
ATOM   7950   C CG    A GLN D  1 96  ? 43.533  -20.355 72.951  0.25 32.57  ? 96   GLN D CG    1 
ATOM   7951   C CD    A GLN D  1 96  ? 44.805  -20.132 73.772  0.25 32.49  ? 96   GLN D CD    1 
ATOM   7952   O OE1   A GLN D  1 96  ? 45.836  -19.710 73.239  0.25 33.05  ? 96   GLN D OE1   1 
ATOM   7953   N NE2   A GLN D  1 96  ? 44.733  -20.405 75.066  0.25 26.39  ? 96   GLN D NE2   1 
ATOM   7954   N N     A GLY D  1 97  ? 39.567  -20.772 71.934  0.25 26.52  ? 97   GLY D N     1 
ATOM   7955   C CA    A GLY D  1 97  ? 38.378  -20.003 72.270  0.25 28.27  ? 97   GLY D CA    1 
ATOM   7956   C C     A GLY D  1 97  ? 38.514  -18.510 72.521  0.25 29.51  ? 97   GLY D C     1 
ATOM   7957   O O     A GLY D  1 97  ? 37.654  -17.912 73.183  0.25 25.82  ? 97   GLY D O     1 
ATOM   7958   N N     A VAL D  1 98  ? 39.584  -17.900 72.005  0.25 28.10  ? 98   VAL D N     1 
ATOM   7959   C CA    A VAL D  1 98  ? 39.812  -16.469 72.191  0.25 23.99  ? 98   VAL D CA    1 
ATOM   7960   C C     A VAL D  1 98  ? 39.838  -15.829 70.807  0.25 26.02  ? 98   VAL D C     1 
ATOM   7961   O O     A VAL D  1 98  ? 40.779  -16.047 70.026  0.25 22.04  ? 98   VAL D O     1 
ATOM   7962   C CB    A VAL D  1 98  ? 41.144  -16.246 72.923  0.25 24.94  ? 98   VAL D CB    1 
ATOM   7963   C CG1   A VAL D  1 98  ? 41.435  -14.752 73.067  0.25 22.27  ? 98   VAL D CG1   1 
ATOM   7964   C CG2   A VAL D  1 98  ? 41.081  -16.918 74.300  0.25 23.56  ? 98   VAL D CG2   1 
ATOM   7965   N N     A GLY D  1 99  ? 38.813  -15.032 70.495  0.25 23.14  ? 99   GLY D N     1 
ATOM   7966   C CA    A GLY D  1 99  ? 38.750  -14.443 69.164  0.25 22.17  ? 99   GLY D CA    1 
ATOM   7967   C C     A GLY D  1 99  ? 38.984  -12.960 69.043  0.25 19.91  ? 99   GLY D C     1 
ATOM   7968   O O     A GLY D  1 99  ? 38.590  -12.369 68.053  0.25 21.54  ? 99   GLY D O     1 
ATOM   7969   N N     A ILE D  1 100 ? 39.639  -12.359 70.037  0.25 19.49  ? 100  ILE D N     1 
ATOM   7970   C CA    A ILE D  1 100 ? 39.880  -10.923 70.041  0.25 20.77  ? 100  ILE D CA    1 
ATOM   7971   C C     A ILE D  1 100 ? 40.654  -10.415 68.833  0.25 21.60  ? 100  ILE D C     1 
ATOM   7972   O O     A ILE D  1 100 ? 40.493  -9.249  68.419  0.25 19.07  ? 100  ILE D O     1 
ATOM   7973   C CB    A ILE D  1 100 ? 40.614  -10.487 71.335  0.25 23.17  ? 100  ILE D CB    1 
ATOM   7974   C CG1   A ILE D  1 100 ? 41.987  -11.170 71.434  0.25 20.25  ? 100  ILE D CG1   1 
ATOM   7975   C CG2   A ILE D  1 100 ? 39.717  -10.813 72.568  0.25 24.15  ? 100  ILE D CG2   1 
ATOM   7976   C CD1   A ILE D  1 100 ? 42.856  -10.660 72.594  0.25 21.29  ? 100  ILE D CD1   1 
ATOM   7977   N N     A TRP D  1 101 ? 41.477  -11.288 68.247  0.25 21.88  ? 101  TRP D N     1 
ATOM   7978   C CA    A TRP D  1 101 ? 42.252  -10.907 67.068  0.25 21.86  ? 101  TRP D CA    1 
ATOM   7979   C C     A TRP D  1 101 ? 41.688  -11.463 65.756  0.25 23.17  ? 101  TRP D C     1 
ATOM   7980   O O     A TRP D  1 101 ? 42.301  -11.308 64.694  0.25 22.64  ? 101  TRP D O     1 
ATOM   7981   C CB    A TRP D  1 101 ? 43.716  -11.337 67.240  0.25 20.12  ? 101  TRP D CB    1 
ATOM   7982   C CG    A TRP D  1 101 ? 44.518  -10.360 68.076  0.25 17.13  ? 101  TRP D CG    1 
ATOM   7983   C CD1   A TRP D  1 101 ? 44.928  -10.529 69.372  0.25 16.35  ? 101  TRP D CD1   1 
ATOM   7984   C CD2   A TRP D  1 101 ? 44.910  -9.031  67.702  0.25 15.25  ? 101  TRP D CD2   1 
ATOM   7985   N NE1   A TRP D  1 101 ? 45.542  -9.381  69.834  0.25 17.31  ? 101  TRP D NE1   1 
ATOM   7986   C CE2   A TRP D  1 101 ? 45.539  -8.447  68.830  0.25 16.18  ? 101  TRP D CE2   1 
ATOM   7987   C CE3   A TRP D  1 101 ? 44.787  -8.275  66.527  0.25 15.93  ? 101  TRP D CE3   1 
ATOM   7988   C CZ2   A TRP D  1 101 ? 46.037  -7.143  68.816  0.25 18.15  ? 101  TRP D CZ2   1 
ATOM   7989   C CZ3   A TRP D  1 101 ? 45.288  -6.971  66.510  0.25 17.75  ? 101  TRP D CZ3   1 
ATOM   7990   C CH2   A TRP D  1 101 ? 45.905  -6.419  67.652  0.25 19.04  ? 101  TRP D CH2   1 
ATOM   7991   N N     A ASP D  1 102 ? 40.514  -12.096 65.822  0.25 21.85  ? 102  ASP D N     1 
ATOM   7992   C CA    A ASP D  1 102 ? 39.887  -12.653 64.620  0.25 24.67  ? 102  ASP D CA    1 
ATOM   7993   C C     A ASP D  1 102 ? 39.512  -11.546 63.644  0.25 24.36  ? 102  ASP D C     1 
ATOM   7994   O O     A ASP D  1 102 ? 39.617  -11.716 62.449  0.25 28.11  ? 102  ASP D O     1 
ATOM   7995   C CB    A ASP D  1 102 ? 38.612  -13.450 64.984  0.25 28.10  ? 102  ASP D CB    1 
ATOM   7996   C CG    A ASP D  1 102 ? 38.913  -14.715 65.752  0.25 31.59  ? 102  ASP D CG    1 
ATOM   7997   O OD1   A ASP D  1 102 ? 37.966  -15.431 66.143  0.25 35.11  ? 102  ASP D OD1   1 
ATOM   7998   O OD2   A ASP D  1 102 ? 40.100  -15.019 65.962  0.25 36.77  ? 102  ASP D OD2   1 
ATOM   7999   N N     A GLY D  1 103 ? 39.077  -10.409 64.160  0.25 25.98  ? 103  GLY D N     1 
ATOM   8000   C CA    A GLY D  1 103 ? 38.682  -9.311  63.295  0.25 27.67  ? 103  GLY D CA    1 
ATOM   8001   C C     A GLY D  1 103 ? 39.794  -8.720  62.427  0.25 30.18  ? 103  GLY D C     1 
ATOM   8002   O O     A GLY D  1 103 ? 39.583  -8.439  61.250  0.25 31.96  ? 103  GLY D O     1 
ATOM   8003   N N     A ASN D  1 104 ? 40.977  -8.514  62.991  0.25 28.49  ? 104  ASN D N     1 
ATOM   8004   C CA    A ASN D  1 104 ? 42.069  -7.962  62.211  0.25 29.13  ? 104  ASN D CA    1 
ATOM   8005   C C     A ASN D  1 104 ? 42.897  -9.043  61.533  0.25 27.44  ? 104  ASN D C     1 
ATOM   8006   O O     A ASN D  1 104 ? 43.776  -8.754  60.730  0.25 28.75  ? 104  ASN D O     1 
ATOM   8007   C CB    A ASN D  1 104 ? 42.956  -7.067  63.095  0.25 29.36  ? 104  ASN D CB    1 
ATOM   8008   C CG    A ASN D  1 104 ? 42.194  -5.870  63.648  0.25 32.22  ? 104  ASN D CG    1 
ATOM   8009   O OD1   A ASN D  1 104 ? 41.713  -5.899  64.784  0.25 35.73  ? 104  ASN D OD1   1 
ATOM   8010   N ND2   A ASN D  1 104 ? 42.050  -4.821  62.836  0.25 34.13  ? 104  ASN D ND2   1 
ATOM   8011   N N     A GLY D  1 105 ? 42.607  -10.295 61.846  0.25 27.71  ? 105  GLY D N     1 
ATOM   8012   C CA    A GLY D  1 105 ? 43.339  -11.392 61.230  0.25 26.34  ? 105  GLY D CA    1 
ATOM   8013   C C     A GLY D  1 105 ? 42.531  -12.080 60.141  0.25 26.39  ? 105  GLY D C     1 
ATOM   8014   O O     A GLY D  1 105 ? 43.019  -13.003 59.484  0.25 24.75  ? 105  GLY D O     1 
ATOM   8015   N N     A SER D  1 106 ? 41.294  -11.629 59.943  0.25 24.48  ? 106  SER D N     1 
ATOM   8016   C CA    A SER D  1 106 ? 40.423  -12.224 58.941  0.25 24.34  ? 106  SER D CA    1 
ATOM   8017   C C     A SER D  1 106 ? 40.969  -12.000 57.542  0.25 23.84  ? 106  SER D C     1 
ATOM   8018   O O     A SER D  1 106 ? 41.637  -10.993 57.259  0.25 24.59  ? 106  SER D O     1 
ATOM   8019   C CB    A SER D  1 106 ? 38.994  -11.646 59.038  0.25 18.72  ? 106  SER D CB    1 
ATOM   8020   O OG    A SER D  1 106 ? 38.955  -10.305 58.606  0.25 24.82  ? 106  SER D OG    1 
ATOM   8021   N N     A LYS D  1 107 ? 40.667  -12.964 56.677  0.25 27.07  ? 107  LYS D N     1 
ATOM   8022   C CA    A LYS D  1 107 ? 41.105  -12.918 55.290  0.25 28.23  ? 107  LYS D CA    1 
ATOM   8023   C C     A LYS D  1 107 ? 40.630  -11.617 54.671  0.25 28.49  ? 107  LYS D C     1 
ATOM   8024   O O     A LYS D  1 107 ? 41.372  -10.964 53.936  0.25 27.07  ? 107  LYS D O     1 
ATOM   8025   C CB    A LYS D  1 107 ? 40.540  -14.121 54.512  0.25 28.22  ? 107  LYS D CB    1 
ATOM   8026   C CG    A LYS D  1 107 ? 41.309  -14.455 53.232  0.25 26.93  ? 107  LYS D CG    1 
ATOM   8027   C CD    A LYS D  1 107 ? 42.742  -14.875 53.582  0.25 26.04  ? 107  LYS D CD    1 
ATOM   8028   C CE    A LYS D  1 107 ? 43.522  -15.316 52.366  0.25 21.84  ? 107  LYS D CE    1 
ATOM   8029   N NZ    A LYS D  1 107 ? 44.031  -14.179 51.550  0.25 23.76  ? 107  LYS D NZ    1 
ATOM   8030   N N     A GLU D  1 108 ? 39.397  -11.224 54.998  0.25 28.48  ? 108  GLU D N     1 
ATOM   8031   C CA    A GLU D  1 108 ? 38.830  -9.986  54.466  0.25 27.65  ? 108  GLU D CA    1 
ATOM   8032   C C     A GLU D  1 108 ? 39.598  -8.722  54.870  0.25 26.93  ? 108  GLU D C     1 
ATOM   8033   O O     A GLU D  1 108 ? 39.785  -7.832  54.052  0.25 24.25  ? 108  GLU D O     1 
ATOM   8034   C CB    A GLU D  1 108 ? 37.385  -9.795  54.927  0.25 31.60  ? 108  GLU D CB    1 
ATOM   8035   C CG    A GLU D  1 108 ? 36.411  -10.899 54.610  0.25 40.74  ? 108  GLU D CG    1 
ATOM   8036   C CD    A GLU D  1 108 ? 35.089  -10.684 55.342  0.25 48.48  ? 108  GLU D CD    1 
ATOM   8037   O OE1   A GLU D  1 108 ? 35.050  -10.885 56.580  0.25 51.33  ? 108  GLU D OE1   1 
ATOM   8038   O OE2   A GLU D  1 108 ? 34.096  -10.284 54.686  0.25 52.37  ? 108  GLU D OE2   1 
ATOM   8039   N N     A PHE D  1 109 ? 39.997  -8.618  56.136  0.25 26.02  ? 109  PHE D N     1 
ATOM   8040   C CA    A PHE D  1 109 ? 40.705  -7.431  56.593  0.25 26.98  ? 109  PHE D CA    1 
ATOM   8041   C C     A PHE D  1 109 ? 42.118  -7.395  56.017  0.25 25.73  ? 109  PHE D C     1 
ATOM   8042   O O     A PHE D  1 109 ? 42.577  -6.365  55.560  0.25 26.32  ? 109  PHE D O     1 
ATOM   8043   C CB    A PHE D  1 109 ? 40.775  -7.408  58.129  0.25 25.43  ? 109  PHE D CB    1 
ATOM   8044   C CG    A PHE D  1 109 ? 41.417  -6.173  58.679  0.25 29.36  ? 109  PHE D CG    1 
ATOM   8045   C CD1   A PHE D  1 109 ? 40.691  -4.993  58.797  0.25 27.65  ? 109  PHE D CD1   1 
ATOM   8046   C CD2   A PHE D  1 109 ? 42.772  -6.169  59.031  0.25 27.98  ? 109  PHE D CD2   1 
ATOM   8047   C CE1   A PHE D  1 109 ? 41.309  -3.823  59.259  0.25 30.22  ? 109  PHE D CE1   1 
ATOM   8048   C CE2   A PHE D  1 109 ? 43.395  -5.007  59.492  0.25 29.38  ? 109  PHE D CE2   1 
ATOM   8049   C CZ    A PHE D  1 109 ? 42.659  -3.832  59.605  0.25 29.75  ? 109  PHE D CZ    1 
ATOM   8050   N N     A LEU D  1 110 ? 42.804  -8.532  56.057  0.25 27.23  ? 110  LEU D N     1 
ATOM   8051   C CA    A LEU D  1 110 ? 44.176  -8.613  55.546  0.25 27.17  ? 110  LEU D CA    1 
ATOM   8052   C C     A LEU D  1 110 ? 44.250  -8.148  54.092  0.25 28.35  ? 110  LEU D C     1 
ATOM   8053   O O     A LEU D  1 110 ? 45.097  -7.347  53.728  0.25 25.86  ? 110  LEU D O     1 
ATOM   8054   C CB    A LEU D  1 110 ? 44.700  -10.037 55.679  0.25 24.95  ? 110  LEU D CB    1 
ATOM   8055   C CG    A LEU D  1 110 ? 44.918  -10.525 57.113  0.25 24.70  ? 110  LEU D CG    1 
ATOM   8056   C CD1   A LEU D  1 110 ? 45.351  -11.977 57.107  0.25 23.65  ? 110  LEU D CD1   1 
ATOM   8057   C CD2   A LEU D  1 110 ? 45.970  -9.645  57.825  0.25 27.06  ? 110  LEU D CD2   1 
ATOM   8058   N N     A GLU D  1 111 ? 43.345  -8.650  53.263  0.25 29.39  ? 111  GLU D N     1 
ATOM   8059   C CA    A GLU D  1 111 ? 43.308  -8.240  51.867  0.25 36.02  ? 111  GLU D CA    1 
ATOM   8060   C C     A GLU D  1 111 ? 42.980  -6.756  51.742  0.25 36.85  ? 111  GLU D C     1 
ATOM   8061   O O     A GLU D  1 111 ? 43.444  -6.082  50.817  0.25 36.84  ? 111  GLU D O     1 
ATOM   8062   C CB    A GLU D  1 111 ? 42.265  -9.053  51.101  0.25 38.83  ? 111  GLU D CB    1 
ATOM   8063   C CG    A GLU D  1 111 ? 42.627  -10.513 50.978  0.25 45.37  ? 111  GLU D CG    1 
ATOM   8064   C CD    A GLU D  1 111 ? 41.654  -11.289 50.120  0.25 49.25  ? 111  GLU D CD    1 
ATOM   8065   O OE1   A GLU D  1 111 ? 41.392  -10.855 48.974  0.25 52.51  ? 111  GLU D OE1   1 
ATOM   8066   O OE2   A GLU D  1 111 ? 41.162  -12.340 50.581  0.25 49.72  ? 111  GLU D OE2   1 
ATOM   8067   N N     A LYS D  1 112 ? 42.169  -6.267  52.677  0.25 37.25  ? 112  LYS D N     1 
ATOM   8068   C CA    A LYS D  1 112 ? 41.771  -4.870  52.728  0.25 37.99  ? 112  LYS D CA    1 
ATOM   8069   C C     A LYS D  1 112 ? 42.963  -3.941  52.960  0.25 36.20  ? 112  LYS D C     1 
ATOM   8070   O O     A LYS D  1 112 ? 43.017  -2.864  52.382  0.25 36.80  ? 112  LYS D O     1 
ATOM   8071   C CB    A LYS D  1 112 ? 40.729  -4.693  53.840  0.25 41.74  ? 112  LYS D CB    1 
ATOM   8072   C CG    A LYS D  1 112 ? 40.214  -3.293  54.066  0.25 46.00  ? 112  LYS D CG    1 
ATOM   8073   C CD    A LYS D  1 112 ? 39.222  -3.294  55.236  0.25 48.69  ? 112  LYS D CD    1 
ATOM   8074   C CE    A LYS D  1 112 ? 38.757  -1.902  55.588  0.25 52.56  ? 112  LYS D CE    1 
ATOM   8075   N NZ    A LYS D  1 112 ? 37.798  -1.939  56.727  0.25 54.59  ? 112  LYS D NZ    1 
ATOM   8076   N N     A VAL D  1 113 ? 43.911  -4.353  53.797  0.25 35.44  ? 113  VAL D N     1 
ATOM   8077   C CA    A VAL D  1 113 ? 45.087  -3.520  54.089  0.25 34.92  ? 113  VAL D CA    1 
ATOM   8078   C C     A VAL D  1 113 ? 46.308  -3.883  53.234  0.25 30.67  ? 113  VAL D C     1 
ATOM   8079   O O     A VAL D  1 113 ? 47.428  -3.584  53.603  0.25 31.06  ? 113  VAL D O     1 
ATOM   8080   C CB    A VAL D  1 113 ? 45.488  -3.620  55.590  0.25 36.21  ? 113  VAL D CB    1 
ATOM   8081   C CG1   A VAL D  1 113 ? 44.410  -2.995  56.463  0.25 39.10  ? 113  VAL D CG1   1 
ATOM   8082   C CG2   A VAL D  1 113 ? 45.696  -5.072  55.979  0.25 36.91  ? 113  VAL D CG2   1 
ATOM   8083   N N     A GLY D  1 114 ? 46.076  -4.560  52.113  0.25 30.44  ? 114  GLY D N     1 
ATOM   8084   C CA    A GLY D  1 114 ? 47.168  -4.935  51.221  0.25 30.12  ? 114  GLY D CA    1 
ATOM   8085   C C     A GLY D  1 114 ? 48.011  -6.129  51.628  0.25 29.34  ? 114  GLY D C     1 
ATOM   8086   O O     A GLY D  1 114 ? 49.142  -6.265  51.182  0.25 30.76  ? 114  GLY D O     1 
ATOM   8087   N N     A LEU D  1 115 ? 47.467  -7.002  52.471  0.25 26.27  ? 115  LEU D N     1 
ATOM   8088   C CA    A LEU D  1 115 ? 48.189  -8.179  52.935  0.25 24.13  ? 115  LEU D CA    1 
ATOM   8089   C C     A LEU D  1 115 ? 47.447  -9.447  52.482  0.25 24.83  ? 115  LEU D C     1 
ATOM   8090   O O     A LEU D  1 115 ? 47.297  -10.421 53.238  0.25 22.78  ? 115  LEU D O     1 
ATOM   8091   C CB    A LEU D  1 115 ? 48.325  -8.147  54.465  0.25 26.04  ? 115  LEU D CB    1 
ATOM   8092   C CG    A LEU D  1 115 ? 49.035  -6.920  55.060  0.25 27.69  ? 115  LEU D CG    1 
ATOM   8093   C CD1   A LEU D  1 115 ? 48.892  -6.919  56.573  0.25 24.20  ? 115  LEU D CD1   1 
ATOM   8094   C CD2   A LEU D  1 115 ? 50.524  -6.922  54.649  0.25 26.90  ? 115  LEU D CD2   1 
ATOM   8095   N N     A GLY D  1 116 ? 46.992  -9.438  51.229  0.25 21.64  ? 116  GLY D N     1 
ATOM   8096   C CA    A GLY D  1 116 ? 46.262  -10.574 50.694  0.25 22.39  ? 116  GLY D CA    1 
ATOM   8097   C C     A GLY D  1 116 ? 47.098  -11.834 50.481  0.25 23.94  ? 116  GLY D C     1 
ATOM   8098   O O     A GLY D  1 116 ? 46.563  -12.949 50.340  0.25 21.61  ? 116  GLY D O     1 
ATOM   8099   N N     A HIS D  1 117 ? 48.420  -11.681 50.486  0.25 20.24  ? 117  HIS D N     1 
ATOM   8100   C CA    A HIS D  1 117 ? 49.307  -12.825 50.272  0.25 21.28  ? 117  HIS D CA    1 
ATOM   8101   C C     A HIS D  1 117 ? 49.491  -13.657 51.534  0.25 22.31  ? 117  HIS D C     1 
ATOM   8102   O O     A HIS D  1 117 ? 50.189  -14.678 51.547  0.25 24.08  ? 117  HIS D O     1 
ATOM   8103   C CB    A HIS D  1 117 ? 50.676  -12.333 49.768  0.25 21.84  ? 117  HIS D CB    1 
ATOM   8104   C CG    A HIS D  1 117 ? 51.375  -11.429 50.733  0.25 23.10  ? 117  HIS D CG    1 
ATOM   8105   N ND1   A HIS D  1 117 ? 52.208  -11.902 51.722  0.25 25.95  ? 117  HIS D ND1   1 
ATOM   8106   C CD2   A HIS D  1 117 ? 51.301  -10.092 50.913  0.25 22.39  ? 117  HIS D CD2   1 
ATOM   8107   C CE1   A HIS D  1 117 ? 52.613  -10.898 52.473  0.25 23.17  ? 117  HIS D CE1   1 
ATOM   8108   N NE2   A HIS D  1 117 ? 52.078  -9.788  52.001  0.25 24.20  ? 117  HIS D NE2   1 
ATOM   8109   N N     A ARG D  1 118 ? 48.860  -13.246 52.617  0.25 22.84  ? 118  ARG D N     1 
ATOM   8110   C CA    A ARG D  1 118 ? 48.997  -13.989 53.850  0.25 22.12  ? 118  ARG D CA    1 
ATOM   8111   C C     A ARG D  1 118 ? 47.802  -14.880 54.126  0.25 23.46  ? 118  ARG D C     1 
ATOM   8112   O O     A ARG D  1 118 ? 46.694  -14.593 53.696  0.25 21.42  ? 118  ARG D O     1 
ATOM   8113   C CB    A ARG D  1 118 ? 49.217  -13.008 55.007  0.25 28.24  ? 118  ARG D CB    1 
ATOM   8114   C CG    A ARG D  1 118 ? 50.546  -12.257 54.846  0.25 31.40  ? 118  ARG D CG    1 
ATOM   8115   C CD    A ARG D  1 118 ? 51.472  -12.370 56.025  0.25 28.27  ? 118  ARG D CD    1 
ATOM   8116   N NE    A ARG D  1 118 ? 51.049  -11.413 56.995  0.25 36.62  ? 118  ARG D NE    1 
ATOM   8117   C CZ    A ARG D  1 118 ? 51.552  -10.226 57.286  0.25 30.34  ? 118  ARG D CZ    1 
ATOM   8118   N NH1   A ARG D  1 118 ? 50.908  -9.563  58.221  0.25 30.75  ? 118  ARG D NH1   1 
ATOM   8119   N NH2   A ARG D  1 118 ? 52.650  -9.723  56.731  0.25 30.64  ? 118  ARG D NH2   1 
ATOM   8120   N N     A ARG D  1 119 ? 48.029  -15.986 54.824  0.25 24.05  ? 119  ARG D N     1 
ATOM   8121   C CA    A ARG D  1 119 ? 46.904  -16.849 55.158  0.25 26.35  ? 119  ARG D CA    1 
ATOM   8122   C C     A ARG D  1 119 ? 46.160  -16.192 56.322  0.25 23.83  ? 119  ARG D C     1 
ATOM   8123   O O     A ARG D  1 119 ? 46.736  -15.418 57.096  0.25 18.60  ? 119  ARG D O     1 
ATOM   8124   C CB    A ARG D  1 119 ? 47.369  -18.243 55.565  0.25 29.74  ? 119  ARG D CB    1 
ATOM   8125   C CG    A ARG D  1 119 ? 48.188  -18.297 56.838  0.25 32.88  ? 119  ARG D CG    1 
ATOM   8126   C CD    A ARG D  1 119 ? 48.171  -19.726 57.396  0.25 32.54  ? 119  ARG D CD    1 
ATOM   8127   N NE    A ARG D  1 119 ? 48.794  -19.810 58.712  0.25 30.36  ? 119  ARG D NE    1 
ATOM   8128   C CZ    A ARG D  1 119 ? 50.041  -20.203 58.943  0.25 33.63  ? 119  ARG D CZ    1 
ATOM   8129   N NH1   A ARG D  1 119 ? 50.497  -20.227 60.191  0.25 30.49  ? 119  ARG D NH1   1 
ATOM   8130   N NH2   A ARG D  1 119 ? 50.828  -20.588 57.941  0.25 33.32  ? 119  ARG D NH2   1 
ATOM   8131   N N     A GLU D  1 120 ? 44.881  -16.509 56.449  0.25 23.41  ? 120  GLU D N     1 
ATOM   8132   C CA    A GLU D  1 120 ? 44.072  -15.935 57.503  0.25 22.93  ? 120  GLU D CA    1 
ATOM   8133   C C     A GLU D  1 120 ? 44.709  -16.141 58.880  0.25 22.32  ? 120  GLU D C     1 
ATOM   8134   O O     A GLU D  1 120 ? 45.154  -17.223 59.207  0.25 22.20  ? 120  GLU D O     1 
ATOM   8135   C CB    A GLU D  1 120 ? 42.661  -16.564 57.476  0.25 24.97  ? 120  GLU D CB    1 
ATOM   8136   C CG    A GLU D  1 120 ? 41.708  -15.906 58.449  0.25 26.34  ? 120  GLU D CG    1 
ATOM   8137   C CD    A GLU D  1 120 ? 40.299  -16.408 58.294  0.25 28.66  ? 120  GLU D CD    1 
ATOM   8138   O OE1   A GLU D  1 120 ? 40.034  -17.548 58.725  0.25 31.02  ? 120  GLU D OE1   1 
ATOM   8139   O OE2   A GLU D  1 120 ? 39.469  -15.670 57.721  0.25 30.32  ? 120  GLU D OE2   1 
ATOM   8140   N N     A GLY D  1 121 ? 44.734  -15.089 59.695  0.25 21.18  ? 121  GLY D N     1 
ATOM   8141   C CA    A GLY D  1 121 ? 45.300  -15.209 61.026  0.25 18.18  ? 121  GLY D CA    1 
ATOM   8142   C C     A GLY D  1 121 ? 46.759  -14.781 61.123  0.25 22.03  ? 121  GLY D C     1 
ATOM   8143   O O     A GLY D  1 121 ? 47.256  -14.556 62.223  0.25 21.92  ? 121  GLY D O     1 
ATOM   8144   N N     A ASP D  1 122 ? 47.452  -14.689 59.988  0.25 20.83  ? 122  ASP D N     1 
ATOM   8145   C CA    A ASP D  1 122 ? 48.869  -14.277 60.009  0.25 21.66  ? 122  ASP D CA    1 
ATOM   8146   C C     A ASP D  1 122 ? 48.930  -12.770 60.075  0.25 17.86  ? 122  ASP D C     1 
ATOM   8147   O O     A ASP D  1 122 ? 48.945  -12.099 59.039  0.25 18.70  ? 122  ASP D O     1 
ATOM   8148   C CB    A ASP D  1 122 ? 49.585  -14.769 58.750  0.25 22.44  ? 122  ASP D CB    1 
ATOM   8149   C CG    A ASP D  1 122 ? 51.063  -14.402 58.731  0.25 26.88  ? 122  ASP D CG    1 
ATOM   8150   O OD1   A ASP D  1 122 ? 51.517  -13.586 59.558  0.25 20.89  ? 122  ASP D OD1   1 
ATOM   8151   O OD2   A ASP D  1 122 ? 51.777  -14.926 57.858  0.25 27.16  ? 122  ASP D OD2   1 
ATOM   8152   N N     A LEU D  1 123 ? 48.967  -12.239 61.300  0.25 18.08  ? 123  LEU D N     1 
ATOM   8153   C CA    A LEU D  1 123 ? 48.978  -10.796 61.545  0.25 18.08  ? 123  LEU D CA    1 
ATOM   8154   C C     A LEU D  1 123 ? 50.266  -10.065 61.134  0.25 19.31  ? 123  LEU D C     1 
ATOM   8155   O O     A LEU D  1 123 ? 50.258  -8.857  60.957  0.25 20.41  ? 123  LEU D O     1 
ATOM   8156   C CB    A LEU D  1 123 ? 48.718  -10.530 63.018  0.25 16.38  ? 123  LEU D CB    1 
ATOM   8157   C CG    A LEU D  1 123 ? 47.410  -11.119 63.581  0.25 21.31  ? 123  LEU D CG    1 
ATOM   8158   C CD1   A LEU D  1 123 ? 47.358  -10.945 65.108  0.25 19.26  ? 123  LEU D CD1   1 
ATOM   8159   C CD2   A LEU D  1 123 ? 46.224  -10.409 62.930  0.25 19.68  ? 123  LEU D CD2   1 
ATOM   8160   N N     A GLY D  1 124 ? 51.366  -10.792 60.969  0.25 22.73  ? 124  GLY D N     1 
ATOM   8161   C CA    A GLY D  1 124 ? 52.596  -10.116 60.595  0.25 20.87  ? 124  GLY D CA    1 
ATOM   8162   C C     A GLY D  1 124 ? 53.483  -9.990  61.815  0.25 22.39  ? 124  GLY D C     1 
ATOM   8163   O O     A GLY D  1 124 ? 53.189  -10.596 62.846  0.25 19.58  ? 124  GLY D O     1 
ATOM   8164   N N     A PRO D  1 125 ? 54.576  -9.216  61.729  0.25 20.46  ? 125  PRO D N     1 
ATOM   8165   C CA    A PRO D  1 125 ? 55.513  -9.024  62.837  0.25 21.53  ? 125  PRO D CA    1 
ATOM   8166   C C     A PRO D  1 125 ? 54.992  -8.092  63.940  0.25 23.53  ? 125  PRO D C     1 
ATOM   8167   O O     A PRO D  1 125 ? 55.619  -7.072  64.246  0.25 18.83  ? 125  PRO D O     1 
ATOM   8168   C CB    A PRO D  1 125 ? 56.762  -8.467  62.143  0.25 22.34  ? 125  PRO D CB    1 
ATOM   8169   C CG    A PRO D  1 125 ? 56.161  -7.606  61.055  0.25 22.06  ? 125  PRO D CG    1 
ATOM   8170   C CD    A PRO D  1 125 ? 55.025  -8.498  60.518  0.25 21.47  ? 125  PRO D CD    1 
ATOM   8171   N N     A VAL D  1 126 ? 53.876  -8.480  64.567  0.25 19.52  ? 126  VAL D N     1 
ATOM   8172   C CA    A VAL D  1 126 ? 53.278  -7.680  65.618  0.25 20.57  ? 126  VAL D CA    1 
ATOM   8173   C C     A VAL D  1 126 ? 53.884  -7.981  66.989  0.25 22.54  ? 126  VAL D C     1 
ATOM   8174   O O     A VAL D  1 126 ? 54.888  -8.704  67.105  0.25 22.56  ? 126  VAL D O     1 
ATOM   8175   C CB    A VAL D  1 126 ? 51.709  -7.887  65.667  0.25 21.17  ? 126  VAL D CB    1 
ATOM   8176   C CG1   A VAL D  1 126 ? 51.092  -7.447  64.354  0.25 16.56  ? 126  VAL D CG1   1 
ATOM   8177   C CG2   A VAL D  1 126 ? 51.386  -9.324  65.918  0.25 18.26  ? 126  VAL D CG2   1 
ATOM   8178   N N     A TYR D  1 127 ? 53.270  -7.403  68.021  0.25 22.30  ? 127  TYR D N     1 
ATOM   8179   C CA    A TYR D  1 127 ? 53.716  -7.510  69.406  0.25 22.39  ? 127  TYR D CA    1 
ATOM   8180   C C     A TYR D  1 127 ? 54.753  -8.559  69.760  0.25 23.92  ? 127  TYR D C     1 
ATOM   8181   O O     A TYR D  1 127 ? 55.925  -8.236  69.921  0.25 24.83  ? 127  TYR D O     1 
ATOM   8182   C CB    A TYR D  1 127 ? 52.505  -7.681  70.332  0.25 23.65  ? 127  TYR D CB    1 
ATOM   8183   C CG    A TYR D  1 127 ? 51.516  -6.548  70.245  0.25 23.65  ? 127  TYR D CG    1 
ATOM   8184   C CD1   A TYR D  1 127 ? 51.839  -5.272  70.711  0.25 21.39  ? 127  TYR D CD1   1 
ATOM   8185   C CD2   A TYR D  1 127 ? 50.252  -6.753  69.702  0.25 24.48  ? 127  TYR D CD2   1 
ATOM   8186   C CE1   A TYR D  1 127 ? 50.916  -4.224  70.643  0.25 23.00  ? 127  TYR D CE1   1 
ATOM   8187   C CE2   A TYR D  1 127 ? 49.323  -5.721  69.628  0.25 23.08  ? 127  TYR D CE2   1 
ATOM   8188   C CZ    A TYR D  1 127 ? 49.648  -4.464  70.098  0.25 25.93  ? 127  TYR D CZ    1 
ATOM   8189   O OH    A TYR D  1 127 ? 48.690  -3.455  70.067  0.25 26.47  ? 127  TYR D OH    1 
ATOM   8190   N N     A GLY D  1 128 ? 54.305  -9.801  69.920  0.25 23.86  ? 128  GLY D N     1 
ATOM   8191   C CA    A GLY D  1 128 ? 55.184  -10.897 70.289  0.25 23.31  ? 128  GLY D CA    1 
ATOM   8192   C C     A GLY D  1 128 ? 56.473  -11.036 69.472  0.25 23.91  ? 128  GLY D C     1 
ATOM   8193   O O     A GLY D  1 128 ? 57.531  -11.330 70.020  0.25 23.58  ? 128  GLY D O     1 
ATOM   8194   N N     A PHE D  1 129 ? 56.378  -10.844 68.163  0.25 21.68  ? 129  PHE D N     1 
ATOM   8195   C CA    A PHE D  1 129 ? 57.546  -10.970 67.315  0.25 24.14  ? 129  PHE D CA    1 
ATOM   8196   C C     A PHE D  1 129 ? 58.574  -9.870  67.624  0.25 22.33  ? 129  PHE D C     1 
ATOM   8197   O O     A PHE D  1 129 ? 59.762  -10.150 67.726  0.25 22.95  ? 129  PHE D O     1 
ATOM   8198   C CB    A PHE D  1 129 ? 57.132  -10.938 65.852  0.25 21.47  ? 129  PHE D CB    1 
ATOM   8199   C CG    A PHE D  1 129 ? 58.296  -10.993 64.902  0.25 22.55  ? 129  PHE D CG    1 
ATOM   8200   C CD1   A PHE D  1 129 ? 58.920  -9.820  64.465  0.25 20.77  ? 129  PHE D CD1   1 
ATOM   8201   C CD2   A PHE D  1 129 ? 58.762  -12.215 64.446  0.25 22.22  ? 129  PHE D CD2   1 
ATOM   8202   C CE1   A PHE D  1 129 ? 60.004  -9.879  63.570  0.25 22.81  ? 129  PHE D CE1   1 
ATOM   8203   C CE2   A PHE D  1 129 ? 59.830  -12.289 63.561  0.25 25.03  ? 129  PHE D CE2   1 
ATOM   8204   C CZ    A PHE D  1 129 ? 60.457  -11.118 63.117  0.25 20.58  ? 129  PHE D CZ    1 
ATOM   8205   N N     A GLN D  1 130 ? 58.112  -8.637  67.783  0.25 21.06  ? 130  GLN D N     1 
ATOM   8206   C CA    A GLN D  1 130 ? 59.007  -7.533  68.117  0.25 23.43  ? 130  GLN D CA    1 
ATOM   8207   C C     A GLN D  1 130 ? 59.630  -7.734  69.503  0.25 23.97  ? 130  GLN D C     1 
ATOM   8208   O O     A GLN D  1 130 ? 60.818  -7.487  69.711  0.25 23.19  ? 130  GLN D O     1 
ATOM   8209   C CB    A GLN D  1 130 ? 58.256  -6.204  68.086  0.25 22.04  ? 130  GLN D CB    1 
ATOM   8210   C CG    A GLN D  1 130 ? 57.675  -5.821  66.717  0.25 21.60  ? 130  GLN D CG    1 
ATOM   8211   C CD    A GLN D  1 130 ? 58.721  -5.800  65.630  0.25 21.19  ? 130  GLN D CD    1 
ATOM   8212   O OE1   A GLN D  1 130 ? 59.883  -5.481  65.886  0.25 22.80  ? 130  GLN D OE1   1 
ATOM   8213   N NE2   A GLN D  1 130 ? 58.314  -6.128  64.401  0.25 14.95  ? 130  GLN D NE2   1 
ATOM   8214   N N     A TRP D  1 131 ? 58.818  -8.194  70.451  0.25 22.04  ? 131  TRP D N     1 
ATOM   8215   C CA    A TRP D  1 131 ? 59.269  -8.442  71.823  0.25 23.13  ? 131  TRP D CA    1 
ATOM   8216   C C     A TRP D  1 131 ? 60.424  -9.430  71.948  0.25 22.78  ? 131  TRP D C     1 
ATOM   8217   O O     A TRP D  1 131 ? 61.333  -9.223  72.745  0.25 21.10  ? 131  TRP D O     1 
ATOM   8218   C CB    A TRP D  1 131 ? 58.114  -8.984  72.675  0.25 22.88  ? 131  TRP D CB    1 
ATOM   8219   C CG    A TRP D  1 131 ? 57.128  -7.947  73.141  0.25 23.23  ? 131  TRP D CG    1 
ATOM   8220   C CD1   A TRP D  1 131 ? 56.972  -6.675  72.661  0.25 23.17  ? 131  TRP D CD1   1 
ATOM   8221   C CD2   A TRP D  1 131 ? 56.128  -8.121  74.156  0.25 24.18  ? 131  TRP D CD2   1 
ATOM   8222   N NE1   A TRP D  1 131 ? 55.939  -6.050  73.312  0.25 23.41  ? 131  TRP D NE1   1 
ATOM   8223   C CE2   A TRP D  1 131 ? 55.400  -6.912  74.233  0.25 22.65  ? 131  TRP D CE2   1 
ATOM   8224   C CE3   A TRP D  1 131 ? 55.775  -9.188  75.005  0.25 21.52  ? 131  TRP D CE3   1 
ATOM   8225   C CZ2   A TRP D  1 131 ? 54.334  -6.732  75.128  0.25 23.19  ? 131  TRP D CZ2   1 
ATOM   8226   C CZ3   A TRP D  1 131 ? 54.718  -9.008  75.896  0.25 21.69  ? 131  TRP D CZ3   1 
ATOM   8227   C CH2   A TRP D  1 131 ? 54.005  -7.779  75.948  0.25 18.32  ? 131  TRP D CH2   1 
ATOM   8228   N N     A ARG D  1 132 ? 60.354  -10.521 71.188  0.25 23.86  ? 132  ARG D N     1 
ATOM   8229   C CA    A ARG D  1 132 ? 61.380  -11.556 71.243  0.25 23.92  ? 132  ARG D CA    1 
ATOM   8230   C C     A ARG D  1 132 ? 62.349  -11.622 70.056  0.25 23.08  ? 132  ARG D C     1 
ATOM   8231   O O     A ARG D  1 132 ? 63.370  -12.310 70.145  0.25 24.96  ? 132  ARG D O     1 
ATOM   8232   C CB    A ARG D  1 132 ? 60.714  -12.935 71.382  0.25 23.18  ? 132  ARG D CB    1 
ATOM   8233   C CG    A ARG D  1 132 ? 59.593  -13.037 72.446  0.25 23.69  ? 132  ARG D CG    1 
ATOM   8234   C CD    A ARG D  1 132 ? 60.033  -12.590 73.834  0.25 22.30  ? 132  ARG D CD    1 
ATOM   8235   N NE    A ARG D  1 132 ? 61.138  -13.375 74.383  0.25 22.39  ? 132  ARG D NE    1 
ATOM   8236   C CZ    A ARG D  1 132 ? 61.015  -14.518 75.044  0.25 25.43  ? 132  ARG D CZ    1 
ATOM   8237   N NH1   A ARG D  1 132 ? 59.825  -15.054 75.258  0.25 25.45  ? 132  ARG D NH1   1 
ATOM   8238   N NH2   A ARG D  1 132 ? 62.095  -15.115 75.525  0.25 24.35  ? 132  ARG D NH2   1 
ATOM   8239   N N     A HIS D  1 133 ? 62.039  -10.943 68.956  0.25 21.57  ? 133  HIS D N     1 
ATOM   8240   C CA    A HIS D  1 133 ? 62.886  -11.015 67.751  0.25 21.66  ? 133  HIS D CA    1 
ATOM   8241   C C     A HIS D  1 133 ? 63.036  -9.678  67.028  0.25 21.31  ? 133  HIS D C     1 
ATOM   8242   O O     A HIS D  1 133 ? 63.139  -9.652  65.798  0.25 23.86  ? 133  HIS D O     1 
ATOM   8243   C CB    A HIS D  1 133 ? 62.276  -12.027 66.759  0.25 23.08  ? 133  HIS D CB    1 
ATOM   8244   C CG    A HIS D  1 133 ? 61.984  -13.370 67.354  0.25 24.71  ? 133  HIS D CG    1 
ATOM   8245   N ND1   A HIS D  1 133 ? 62.977  -14.246 67.754  0.25 27.15  ? 133  HIS D ND1   1 
ATOM   8246   C CD2   A HIS D  1 133 ? 60.806  -13.976 67.650  0.25 22.78  ? 133  HIS D CD2   1 
ATOM   8247   C CE1   A HIS D  1 133 ? 62.421  -15.328 68.276  0.25 25.83  ? 133  HIS D CE1   1 
ATOM   8248   N NE2   A HIS D  1 133 ? 61.105  -15.187 68.226  0.25 24.62  ? 133  HIS D NE2   1 
ATOM   8249   N N     A PHE D  1 134 ? 63.050  -8.569  67.765  0.25 21.19  ? 134  PHE D N     1 
ATOM   8250   C CA    A PHE D  1 134 ? 63.142  -7.254  67.132  0.25 23.02  ? 134  PHE D CA    1 
ATOM   8251   C C     A PHE D  1 134 ? 64.302  -7.150  66.148  0.25 24.15  ? 134  PHE D C     1 
ATOM   8252   O O     A PHE D  1 134 ? 65.430  -7.479  66.484  0.25 23.59  ? 134  PHE D O     1 
ATOM   8253   C CB    A PHE D  1 134 ? 63.273  -6.157  68.182  0.25 22.65  ? 134  PHE D CB    1 
ATOM   8254   C CG    A PHE D  1 134 ? 63.151  -4.769  67.612  0.25 26.22  ? 134  PHE D CG    1 
ATOM   8255   C CD1   A PHE D  1 134 ? 64.176  -4.228  66.823  0.25 25.70  ? 134  PHE D CD1   1 
ATOM   8256   C CD2   A PHE D  1 134 ? 61.998  -4.015  67.818  0.25 25.39  ? 134  PHE D CD2   1 
ATOM   8257   C CE1   A PHE D  1 134 ? 64.060  -2.992  66.252  0.25 22.67  ? 134  PHE D CE1   1 
ATOM   8258   C CE2   A PHE D  1 134 ? 61.873  -2.750  67.242  0.25 23.96  ? 134  PHE D CE2   1 
ATOM   8259   C CZ    A PHE D  1 134 ? 62.902  -2.242  66.457  0.25 27.36  ? 134  PHE D CZ    1 
ATOM   8260   N N     A GLY D  1 135 ? 64.016  -6.700  64.933  0.25 25.51  ? 135  GLY D N     1 
ATOM   8261   C CA    A GLY D  1 135 ? 65.064  -6.576  63.933  0.25 25.52  ? 135  GLY D CA    1 
ATOM   8262   C C     A GLY D  1 135 ? 65.170  -7.755  62.989  0.25 26.36  ? 135  GLY D C     1 
ATOM   8263   O O     A GLY D  1 135 ? 65.723  -7.626  61.905  0.25 28.23  ? 135  GLY D O     1 
ATOM   8264   N N     A ALA D  1 136 ? 64.642  -8.910  63.379  0.25 27.17  ? 136  ALA D N     1 
ATOM   8265   C CA    A ALA D  1 136 ? 64.721  -10.088 62.519  0.25 26.50  ? 136  ALA D CA    1 
ATOM   8266   C C     A ALA D  1 136 ? 63.873  -9.875  61.281  0.25 27.00  ? 136  ALA D C     1 
ATOM   8267   O O     A ALA D  1 136 ? 62.939  -9.060  61.306  0.25 23.59  ? 136  ALA D O     1 
ATOM   8268   C CB    A ALA D  1 136 ? 64.236  -11.316 63.271  0.25 27.62  ? 136  ALA D CB    1 
ATOM   8269   N N     A GLU D  1 137 ? 64.198  -10.609 60.216  0.25 25.20  ? 137  GLU D N     1 
ATOM   8270   C CA    A GLU D  1 137 ? 63.462  -10.540 58.954  0.25 29.43  ? 137  GLU D CA    1 
ATOM   8271   C C     A GLU D  1 137 ? 62.211  -11.410 59.078  0.25 26.11  ? 137  GLU D C     1 
ATOM   8272   O O     A GLU D  1 137 ? 62.313  -12.570 59.413  0.25 27.62  ? 137  GLU D O     1 
ATOM   8273   C CB    A GLU D  1 137 ? 64.329  -11.082 57.819  0.25 33.42  ? 137  GLU D CB    1 
ATOM   8274   C CG    A GLU D  1 137 ? 63.682  -11.057 56.452  0.25 40.91  ? 137  GLU D CG    1 
ATOM   8275   C CD    A GLU D  1 137 ? 64.447  -11.907 55.448  0.25 46.89  ? 137  GLU D CD    1 
ATOM   8276   O OE1   A GLU D  1 137 ? 65.690  -11.797 55.407  0.25 49.90  ? 137  GLU D OE1   1 
ATOM   8277   O OE2   A GLU D  1 137 ? 63.816  -12.682 54.698  0.25 49.10  ? 137  GLU D OE2   1 
ATOM   8278   N N     A TYR D  1 138 ? 61.044  -10.848 58.793  0.25 25.70  ? 138  TYR D N     1 
ATOM   8279   C CA    A TYR D  1 138 ? 59.789  -11.603 58.895  0.25 25.31  ? 138  TYR D CA    1 
ATOM   8280   C C     A TYR D  1 138 ? 59.383  -12.196 57.558  0.25 23.99  ? 138  TYR D C     1 
ATOM   8281   O O     A TYR D  1 138 ? 59.360  -11.492 56.563  0.25 28.04  ? 138  TYR D O     1 
ATOM   8282   C CB    A TYR D  1 138 ? 58.661  -10.680 59.367  0.25 23.74  ? 138  TYR D CB    1 
ATOM   8283   C CG    A TYR D  1 138 ? 57.391  -11.416 59.757  0.25 25.06  ? 138  TYR D CG    1 
ATOM   8284   C CD1   A TYR D  1 138 ? 57.268  -12.005 61.012  0.25 23.48  ? 138  TYR D CD1   1 
ATOM   8285   C CD2   A TYR D  1 138 ? 56.316  -11.520 58.864  0.25 26.08  ? 138  TYR D CD2   1 
ATOM   8286   C CE1   A TYR D  1 138 ? 56.102  -12.676 61.385  0.25 25.07  ? 138  TYR D CE1   1 
ATOM   8287   C CE2   A TYR D  1 138 ? 55.135  -12.199 59.223  0.25 25.93  ? 138  TYR D CE2   1 
ATOM   8288   C CZ    A TYR D  1 138 ? 55.042  -12.765 60.491  0.25 24.91  ? 138  TYR D CZ    1 
ATOM   8289   O OH    A TYR D  1 138 ? 53.897  -13.387 60.893  0.25 21.83  ? 138  TYR D OH    1 
ATOM   8290   N N     A THR D  1 139 ? 59.064  -13.480 57.532  0.25 27.02  ? 139  THR D N     1 
ATOM   8291   C CA    A THR D  1 139 ? 58.612  -14.124 56.298  0.25 28.94  ? 139  THR D CA    1 
ATOM   8292   C C     A THR D  1 139 ? 57.115  -14.315 56.498  0.25 26.85  ? 139  THR D C     1 
ATOM   8293   O O     A THR D  1 139 ? 56.327  -13.561 55.944  0.25 26.90  ? 139  THR D O     1 
ATOM   8294   C CB    A THR D  1 139 ? 59.321  -15.480 56.064  0.25 27.09  ? 139  THR D CB    1 
ATOM   8295   O OG1   A THR D  1 139 ? 59.250  -16.277 57.251  0.25 32.54  ? 139  THR D OG1   1 
ATOM   8296   C CG2   A THR D  1 139 ? 60.788  -15.251 55.716  0.25 32.24  ? 139  THR D CG2   1 
ATOM   8297   N N     A ASP D  1 140 ? 56.728  -15.293 57.308  0.25 29.19  ? 140  ASP D N     1 
ATOM   8298   C CA    A ASP D  1 140 ? 55.302  -15.527 57.606  0.25 30.51  ? 140  ASP D CA    1 
ATOM   8299   C C     A ASP D  1 140 ? 55.244  -15.973 59.074  0.25 31.41  ? 140  ASP D C     1 
ATOM   8300   O O     A ASP D  1 140 ? 56.277  -15.957 59.744  0.25 29.54  ? 140  ASP D O     1 
ATOM   8301   C CB    A ASP D  1 140 ? 54.700  -16.550 56.621  0.25 30.48  ? 140  ASP D CB    1 
ATOM   8302   C CG    A ASP D  1 140 ? 55.281  -17.922 56.757  0.25 29.63  ? 140  ASP D CG    1 
ATOM   8303   O OD1   A ASP D  1 140 ? 55.011  -18.740 55.853  0.25 35.47  ? 140  ASP D OD1   1 
ATOM   8304   O OD2   A ASP D  1 140 ? 55.985  -18.192 57.749  0.25 34.45  ? 140  ASP D OD2   1 
ATOM   8305   N N     A ALA D  1 141 ? 54.069  -16.374 59.596  0.25 32.52  ? 141  ALA D N     1 
ATOM   8306   C CA    A ALA D  1 141 ? 54.007  -16.784 61.001  0.25 32.74  ? 141  ALA D CA    1 
ATOM   8307   C C     A ALA D  1 141 ? 54.645  -18.125 61.320  0.25 32.35  ? 141  ALA D C     1 
ATOM   8308   O O     A ALA D  1 141 ? 54.805  -18.463 62.493  0.25 32.34  ? 141  ALA D O     1 
ATOM   8309   C CB    A ALA D  1 141 ? 52.511  -16.806 61.282  0.25 31.81  ? 141  ALA D CB    1 
ATOM   8310   N N     A ASP D  1 142 ? 54.974  -18.895 60.288  0.25 33.15  ? 142  ASP D N     1 
ATOM   8311   C CA    A ASP D  1 142 ? 55.578  -20.212 60.476  0.25 33.80  ? 142  ASP D CA    1 
ATOM   8312   C C     A ASP D  1 142 ? 57.098  -20.156 60.415  0.25 33.61  ? 142  ASP D C     1 
ATOM   8313   O O     A ASP D  1 142 ? 57.772  -21.153 60.645  0.25 34.31  ? 142  ASP D O     1 
ATOM   8314   C CB    A ASP D  1 142 ? 55.062  -21.177 59.411  0.25 37.33  ? 142  ASP D CB    1 
ATOM   8315   C CG    A ASP D  1 142 ? 53.588  -21.471 59.562  0.25 39.08  ? 142  ASP D CG    1 
ATOM   8316   O OD1   A ASP D  1 142 ? 53.005  -22.010 58.602  0.25 43.55  ? 142  ASP D OD1   1 
ATOM   8317   O OD2   A ASP D  1 142 ? 53.025  -21.174 60.641  0.25 36.99  ? 142  ASP D OD2   1 
ATOM   8318   N N     A GLY D  1 143 ? 57.631  -18.982 60.115  0.25 32.93  ? 143  GLY D N     1 
ATOM   8319   C CA    A GLY D  1 143 ? 59.071  -18.819 60.024  0.25 33.55  ? 143  GLY D CA    1 
ATOM   8320   C C     A GLY D  1 143 ? 59.827  -19.213 61.283  0.25 33.83  ? 143  GLY D C     1 
ATOM   8321   O O     A GLY D  1 143 ? 59.301  -19.161 62.397  0.25 31.26  ? 143  GLY D O     1 
ATOM   8322   N N     A ASP D  1 144 ? 61.079  -19.620 61.099  0.25 35.33  ? 144  ASP D N     1 
ATOM   8323   C CA    A ASP D  1 144 ? 61.928  -20.030 62.209  0.25 35.01  ? 144  ASP D CA    1 
ATOM   8324   C C     A ASP D  1 144 ? 62.727  -18.811 62.659  0.25 34.55  ? 144  ASP D C     1 
ATOM   8325   O O     A ASP D  1 144 ? 63.670  -18.387 61.985  0.25 33.80  ? 144  ASP D O     1 
ATOM   8326   C CB    A ASP D  1 144 ? 62.870  -21.146 61.757  0.25 40.22  ? 144  ASP D CB    1 
ATOM   8327   C CG    A ASP D  1 144 ? 63.865  -21.537 62.833  0.25 43.01  ? 144  ASP D CG    1 
ATOM   8328   O OD1   A ASP D  1 144 ? 63.453  -21.664 64.006  0.25 46.26  ? 144  ASP D OD1   1 
ATOM   8329   O OD2   A ASP D  1 144 ? 65.052  -21.725 62.498  0.25 47.78  ? 144  ASP D OD2   1 
ATOM   8330   N N     A TYR D  1 145 ? 62.339  -18.248 63.799  0.25 30.35  ? 145  TYR D N     1 
ATOM   8331   C CA    A TYR D  1 145 ? 62.981  -17.049 64.323  0.25 30.70  ? 145  TYR D CA    1 
ATOM   8332   C C     A TYR D  1 145 ? 63.811  -17.297 65.583  0.25 29.83  ? 145  TYR D C     1 
ATOM   8333   O O     A TYR D  1 145 ? 64.414  -16.373 66.145  0.25 27.22  ? 145  TYR D O     1 
ATOM   8334   C CB    A TYR D  1 145 ? 61.902  -15.990 64.605  0.25 28.99  ? 145  TYR D CB    1 
ATOM   8335   C CG    A TYR D  1 145 ? 61.036  -15.704 63.389  0.25 30.54  ? 145  TYR D CG    1 
ATOM   8336   C CD1   A TYR D  1 145 ? 61.590  -15.184 62.222  0.25 26.91  ? 145  TYR D CD1   1 
ATOM   8337   C CD2   A TYR D  1 145 ? 59.662  -15.956 63.409  0.25 29.79  ? 145  TYR D CD2   1 
ATOM   8338   C CE1   A TYR D  1 145 ? 60.808  -14.920 61.106  0.25 29.12  ? 145  TYR D CE1   1 
ATOM   8339   C CE2   A TYR D  1 145 ? 58.865  -15.691 62.289  0.25 27.66  ? 145  TYR D CE2   1 
ATOM   8340   C CZ    A TYR D  1 145 ? 59.452  -15.174 61.147  0.25 27.85  ? 145  TYR D CZ    1 
ATOM   8341   O OH    A TYR D  1 145 ? 58.708  -14.897 60.033  0.25 29.49  ? 145  TYR D OH    1 
ATOM   8342   N N     A LYS D  1 146 ? 63.850  -18.542 66.024  0.25 30.66  ? 146  LYS D N     1 
ATOM   8343   C CA    A LYS D  1 146 ? 64.602  -18.876 67.226  0.25 34.90  ? 146  LYS D CA    1 
ATOM   8344   C C     A LYS D  1 146 ? 66.044  -18.378 67.127  0.25 34.31  ? 146  LYS D C     1 
ATOM   8345   O O     A LYS D  1 146 ? 66.741  -18.664 66.153  0.25 32.31  ? 146  LYS D O     1 
ATOM   8346   C CB    A LYS D  1 146 ? 64.580  -20.382 67.463  0.25 37.62  ? 146  LYS D CB    1 
ATOM   8347   C CG    A LYS D  1 146 ? 65.226  -20.793 68.774  0.25 45.57  ? 146  LYS D CG    1 
ATOM   8348   C CD    A LYS D  1 146 ? 65.072  -22.284 69.021  0.25 51.03  ? 146  LYS D CD    1 
ATOM   8349   C CE    A LYS D  1 146 ? 65.612  -22.684 70.385  0.25 52.59  ? 146  LYS D CE    1 
ATOM   8350   N NZ    A LYS D  1 146 ? 65.404  -24.147 70.637  0.25 56.00  ? 146  LYS D NZ    1 
ATOM   8351   N N     A GLY D  1 147 ? 66.464  -17.608 68.131  0.25 35.58  ? 147  GLY D N     1 
ATOM   8352   C CA    A GLY D  1 147 ? 67.812  -17.065 68.153  0.25 35.01  ? 147  GLY D CA    1 
ATOM   8353   C C     A GLY D  1 147 ? 68.041  -15.900 67.210  0.25 36.23  ? 147  GLY D C     1 
ATOM   8354   O O     A GLY D  1 147 ? 69.167  -15.429 67.075  0.25 38.56  ? 147  GLY D O     1 
ATOM   8355   N N     A LYS D  1 148 ? 66.983  -15.420 66.559  0.25 35.88  ? 148  LYS D N     1 
ATOM   8356   C CA    A LYS D  1 148 ? 67.109  -14.304 65.626  0.25 34.35  ? 148  LYS D CA    1 
ATOM   8357   C C     A LYS D  1 148 ? 66.485  -13.027 66.189  0.25 34.58  ? 148  LYS D C     1 
ATOM   8358   O O     A LYS D  1 148 ? 65.435  -13.072 66.869  0.25 30.77  ? 148  LYS D O     1 
ATOM   8359   C CB    A LYS D  1 148 ? 66.442  -14.660 64.290  0.25 34.20  ? 148  LYS D CB    1 
ATOM   8360   C CG    A LYS D  1 148 ? 67.073  -15.852 63.606  0.25 36.40  ? 148  LYS D CG    1 
ATOM   8361   C CD    A LYS D  1 148 ? 66.400  -16.182 62.297  0.25 38.77  ? 148  LYS D CD    1 
ATOM   8362   C CE    A LYS D  1 148 ? 66.972  -17.468 61.711  0.25 38.64  ? 148  LYS D CE    1 
ATOM   8363   N NZ    A LYS D  1 148 ? 66.301  -17.840 60.438  0.25 43.41  ? 148  LYS D NZ    1 
ATOM   8364   N N     A GLY D  1 149 ? 67.130  -11.896 65.904  0.25 30.09  ? 149  GLY D N     1 
ATOM   8365   C CA    A GLY D  1 149 ? 66.627  -10.617 66.377  0.25 28.48  ? 149  GLY D CA    1 
ATOM   8366   C C     A GLY D  1 149 ? 66.961  -10.380 67.838  0.25 26.01  ? 149  GLY D C     1 
ATOM   8367   O O     A GLY D  1 149 ? 67.606  -11.211 68.475  0.25 24.33  ? 149  GLY D O     1 
ATOM   8368   N N     A VAL D  1 150 ? 66.517  -9.249  68.377  0.25 23.24  ? 150  VAL D N     1 
ATOM   8369   C CA    A VAL D  1 150 ? 66.787  -8.930  69.774  0.25 24.37  ? 150  VAL D CA    1 
ATOM   8370   C C     A VAL D  1 150 ? 65.683  -9.429  70.713  0.25 25.48  ? 150  VAL D C     1 
ATOM   8371   O O     A VAL D  1 150 ? 64.519  -9.087  70.553  0.25 25.52  ? 150  VAL D O     1 
ATOM   8372   C CB    A VAL D  1 150 ? 66.955  -7.405  69.979  0.25 24.45  ? 150  VAL D CB    1 
ATOM   8373   C CG1   A VAL D  1 150 ? 67.234  -7.099  71.460  0.25 25.16  ? 150  VAL D CG1   1 
ATOM   8374   C CG2   A VAL D  1 150 ? 68.122  -6.879  69.110  0.25 23.94  ? 150  VAL D CG2   1 
ATOM   8375   N N     A ASP D  1 151 ? 66.053  -10.242 71.699  0.25 23.92  ? 151  ASP D N     1 
ATOM   8376   C CA    A ASP D  1 151 ? 65.074  -10.736 72.650  0.25 24.23  ? 151  ASP D CA    1 
ATOM   8377   C C     A ASP D  1 151 ? 64.968  -9.731  73.785  0.25 25.34  ? 151  ASP D C     1 
ATOM   8378   O O     A ASP D  1 151 ? 65.616  -9.891  74.823  0.25 25.15  ? 151  ASP D O     1 
ATOM   8379   C CB    A ASP D  1 151 ? 65.491  -12.088 73.222  0.25 23.06  ? 151  ASP D CB    1 
ATOM   8380   C CG    A ASP D  1 151 ? 64.414  -12.697 74.111  0.25 22.81  ? 151  ASP D CG    1 
ATOM   8381   O OD1   A ASP D  1 151 ? 64.521  -13.881 74.428  0.25 24.66  ? 151  ASP D OD1   1 
ATOM   8382   O OD2   A ASP D  1 151 ? 63.452  -11.997 74.512  0.25 21.87  ? 151  ASP D OD2   1 
ATOM   8383   N N     A GLN D  1 152 ? 64.147  -8.703  73.585  0.25 24.05  ? 152  GLN D N     1 
ATOM   8384   C CA    A GLN D  1 152 ? 63.970  -7.658  74.585  0.25 25.05  ? 152  GLN D CA    1 
ATOM   8385   C C     A GLN D  1 152 ? 63.443  -8.162  75.919  0.25 25.21  ? 152  GLN D C     1 
ATOM   8386   O O     A GLN D  1 152 ? 63.860  -7.685  76.976  0.25 26.46  ? 152  GLN D O     1 
ATOM   8387   C CB    A GLN D  1 152 ? 63.011  -6.587  74.082  0.25 23.00  ? 152  GLN D CB    1 
ATOM   8388   C CG    A GLN D  1 152 ? 63.375  -5.954  72.751  0.25 22.14  ? 152  GLN D CG    1 
ATOM   8389   C CD    A GLN D  1 152 ? 62.328  -4.950  72.347  0.25 21.03  ? 152  GLN D CD    1 
ATOM   8390   O OE1   A GLN D  1 152 ? 62.162  -3.920  73.006  0.25 23.06  ? 152  GLN D OE1   1 
ATOM   8391   N NE2   A GLN D  1 152 ? 61.599  -5.248  71.273  0.25 21.19  ? 152  GLN D NE2   1 
ATOM   8392   N N     A LEU D  1 153 ? 62.518  -9.112  75.874  0.25 23.33  ? 153  LEU D N     1 
ATOM   8393   C CA    A LEU D  1 153 ? 61.916  -9.630  77.101  0.25 23.13  ? 153  LEU D CA    1 
ATOM   8394   C C     A LEU D  1 153 ? 62.919  -10.315 78.010  0.25 23.68  ? 153  LEU D C     1 
ATOM   8395   O O     A LEU D  1 153 ? 62.974  -10.034 79.198  0.25 23.48  ? 153  LEU D O     1 
ATOM   8396   C CB    A LEU D  1 153 ? 60.764  -10.595 76.761  0.25 23.78  ? 153  LEU D CB    1 
ATOM   8397   C CG    A LEU D  1 153 ? 60.008  -11.136 77.985  0.25 24.34  ? 153  LEU D CG    1 
ATOM   8398   C CD1   A LEU D  1 153 ? 59.480  -9.968  78.818  0.25 23.31  ? 153  LEU D CD1   1 
ATOM   8399   C CD2   A LEU D  1 153 ? 58.848  -12.025 77.527  0.25 25.13  ? 153  LEU D CD2   1 
ATOM   8400   N N     A GLN D  1 154 ? 63.715  -11.228 77.462  0.25 25.80  ? 154  GLN D N     1 
ATOM   8401   C CA    A GLN D  1 154 ? 64.713  -11.893 78.284  0.25 26.10  ? 154  GLN D CA    1 
ATOM   8402   C C     A GLN D  1 154 ? 65.751  -10.884 78.784  0.25 25.84  ? 154  GLN D C     1 
ATOM   8403   O O     A GLN D  1 154 ? 66.265  -11.017 79.898  0.25 28.85  ? 154  GLN D O     1 
ATOM   8404   C CB    A GLN D  1 154 ? 65.415  -13.007 77.500  0.25 27.44  ? 154  GLN D CB    1 
ATOM   8405   C CG    A GLN D  1 154 ? 66.358  -13.852 78.381  0.25 28.96  ? 154  GLN D CG    1 
ATOM   8406   C CD    A GLN D  1 154 ? 65.661  -14.442 79.621  0.25 33.20  ? 154  GLN D CD    1 
ATOM   8407   O OE1   A GLN D  1 154 ? 66.237  -14.467 80.717  0.25 36.64  ? 154  GLN D OE1   1 
ATOM   8408   N NE2   A GLN D  1 154 ? 64.436  -14.924 79.450  0.25 29.07  ? 154  GLN D NE2   1 
ATOM   8409   N N     A ARG D  1 155 ? 66.058  -9.869  77.979  0.25 25.61  ? 155  ARG D N     1 
ATOM   8410   C CA    A ARG D  1 155 ? 67.045  -8.881  78.395  0.25 26.67  ? 155  ARG D CA    1 
ATOM   8411   C C     A ARG D  1 155 ? 66.502  -8.119  79.594  0.25 28.01  ? 155  ARG D C     1 
ATOM   8412   O O     A ARG D  1 155 ? 67.249  -7.771  80.520  0.25 24.15  ? 155  ARG D O     1 
ATOM   8413   C CB    A ARG D  1 155 ? 67.373  -7.920  77.245  0.25 29.84  ? 155  ARG D CB    1 
ATOM   8414   C CG    A ARG D  1 155 ? 68.399  -6.819  77.598  0.25 34.96  ? 155  ARG D CG    1 
ATOM   8415   C CD    A ARG D  1 155 ? 69.630  -7.391  78.328  0.25 41.67  ? 155  ARG D CD    1 
ATOM   8416   N NE    A ARG D  1 155 ? 70.380  -8.351  77.511  0.25 47.37  ? 155  ARG D NE    1 
ATOM   8417   C CZ    A ARG D  1 155 ? 71.219  -8.017  76.529  0.25 48.95  ? 155  ARG D CZ    1 
ATOM   8418   N NH1   A ARG D  1 155 ? 71.851  -8.965  75.843  0.25 51.18  ? 155  ARG D NH1   1 
ATOM   8419   N NH2   A ARG D  1 155 ? 71.440  -6.739  76.239  0.25 50.51  ? 155  ARG D NH2   1 
ATOM   8420   N N     A VAL D  1 156 ? 65.194  -7.857  79.576  0.25 25.28  ? 156  VAL D N     1 
ATOM   8421   C CA    A VAL D  1 156 ? 64.559  -7.165  80.688  0.25 25.53  ? 156  VAL D CA    1 
ATOM   8422   C C     A VAL D  1 156 ? 64.710  -8.005  81.961  0.25 25.21  ? 156  VAL D C     1 
ATOM   8423   O O     A VAL D  1 156 ? 65.047  -7.496  83.033  0.25 26.82  ? 156  VAL D O     1 
ATOM   8424   C CB    A VAL D  1 156 ? 63.048  -6.933  80.403  0.25 25.89  ? 156  VAL D CB    1 
ATOM   8425   C CG1   A VAL D  1 156 ? 62.308  -6.586  81.688  0.25 23.46  ? 156  VAL D CG1   1 
ATOM   8426   C CG2   A VAL D  1 156 ? 62.888  -5.809  79.386  0.25 20.88  ? 156  VAL D CG2   1 
ATOM   8427   N N     A ILE D  1 157 ? 64.453  -9.298  81.834  0.25 28.74  ? 157  ILE D N     1 
ATOM   8428   C CA    A ILE D  1 157 ? 64.565  -10.219 82.970  0.25 30.05  ? 157  ILE D CA    1 
ATOM   8429   C C     A ILE D  1 157 ? 66.009  -10.218 83.515  0.25 29.67  ? 157  ILE D C     1 
ATOM   8430   O O     A ILE D  1 157 ? 66.238  -10.053 84.705  0.25 28.00  ? 157  ILE D O     1 
ATOM   8431   C CB    A ILE D  1 157 ? 64.219  -11.658 82.547  0.25 30.35  ? 157  ILE D CB    1 
ATOM   8432   C CG1   A ILE D  1 157 ? 62.772  -11.733 82.047  0.25 32.68  ? 157  ILE D CG1   1 
ATOM   8433   C CG2   A ILE D  1 157 ? 64.450  -12.611 83.710  0.25 29.53  ? 157  ILE D CG2   1 
ATOM   8434   C CD1   A ILE D  1 157 ? 61.763  -11.446 83.088  0.25 36.39  ? 157  ILE D CD1   1 
ATOM   8435   N N     A ASP D  1 158 ? 66.970  -10.405 82.619  0.25 29.24  ? 158  ASP D N     1 
ATOM   8436   C CA    A ASP D  1 158 ? 68.380  -10.450 83.012  0.25 31.10  ? 158  ASP D CA    1 
ATOM   8437   C C     A ASP D  1 158 ? 68.840  -9.173  83.688  0.25 30.32  ? 158  ASP D C     1 
ATOM   8438   O O     A ASP D  1 158 ? 69.596  -9.216  84.651  0.25 32.19  ? 158  ASP D O     1 
ATOM   8439   C CB    A ASP D  1 158 ? 69.257  -10.721 81.786  0.25 29.63  ? 158  ASP D CB    1 
ATOM   8440   C CG    A ASP D  1 158 ? 69.050  -12.110 81.212  0.25 31.84  ? 158  ASP D CG    1 
ATOM   8441   O OD1   A ASP D  1 158 ? 69.499  -12.345 80.078  0.25 37.82  ? 158  ASP D OD1   1 
ATOM   8442   O OD2   A ASP D  1 158 ? 68.454  -12.976 81.883  0.25 36.43  ? 158  ASP D OD2   1 
ATOM   8443   N N     A THR D  1 159 ? 68.374  -8.039  83.188  0.25 29.09  ? 159  THR D N     1 
ATOM   8444   C CA    A THR D  1 159 ? 68.758  -6.744  83.721  0.25 28.67  ? 159  THR D CA    1 
ATOM   8445   C C     A THR D  1 159 ? 68.156  -6.493  85.104  0.25 29.26  ? 159  THR D C     1 
ATOM   8446   O O     A THR D  1 159 ? 68.811  -5.938  85.988  0.25 28.59  ? 159  THR D O     1 
ATOM   8447   C CB    A THR D  1 159 ? 68.328  -5.620  82.742  0.25 27.34  ? 159  THR D CB    1 
ATOM   8448   O OG1   A THR D  1 159 ? 68.933  -5.869  81.468  0.25 24.86  ? 159  THR D OG1   1 
ATOM   8449   C CG2   A THR D  1 159 ? 68.761  -4.248  83.250  0.25 27.52  ? 159  THR D CG2   1 
ATOM   8450   N N     A ILE D  1 160 ? 66.904  -6.891  85.292  0.25 27.78  ? 160  ILE D N     1 
ATOM   8451   C CA    A ILE D  1 160 ? 66.262  -6.693  86.579  0.25 28.17  ? 160  ILE D CA    1 
ATOM   8452   C C     A ILE D  1 160 ? 67.013  -7.488  87.649  0.25 29.96  ? 160  ILE D C     1 
ATOM   8453   O O     A ILE D  1 160 ? 67.210  -7.020  88.780  0.25 32.41  ? 160  ILE D O     1 
ATOM   8454   C CB    A ILE D  1 160 ? 64.786  -7.150  86.531  0.25 28.34  ? 160  ILE D CB    1 
ATOM   8455   C CG1   A ILE D  1 160 ? 63.969  -6.162  85.687  0.25 26.58  ? 160  ILE D CG1   1 
ATOM   8456   C CG2   A ILE D  1 160 ? 64.224  -7.251  87.951  0.25 26.91  ? 160  ILE D CG2   1 
ATOM   8457   C CD1   A ILE D  1 160 ? 62.560  -6.624  85.388  0.25 26.17  ? 160  ILE D CD1   1 
ATOM   8458   N N     A LYS D  1 161 ? 67.458  -8.680  87.283  0.25 28.06  ? 161  LYS D N     1 
ATOM   8459   C CA    A LYS D  1 161 ? 68.176  -9.547  88.208  0.25 30.88  ? 161  LYS D CA    1 
ATOM   8460   C C     A LYS D  1 161 ? 69.638  -9.161  88.467  0.25 32.59  ? 161  LYS D C     1 
ATOM   8461   O O     A LYS D  1 161 ? 70.110  -9.228  89.594  0.25 32.76  ? 161  LYS D O     1 
ATOM   8462   C CB    A LYS D  1 161 ? 68.141  -10.984 87.692  0.25 31.58  ? 161  LYS D CB    1 
ATOM   8463   C CG    A LYS D  1 161 ? 66.745  -11.632 87.744  0.25 35.51  ? 161  LYS D CG    1 
ATOM   8464   C CD    A LYS D  1 161 ? 66.702  -12.928 86.935  0.25 38.08  ? 161  LYS D CD    1 
ATOM   8465   C CE    A LYS D  1 161 ? 67.608  -13.986 87.543  0.25 40.72  ? 161  LYS D CE    1 
ATOM   8466   N NZ    A LYS D  1 161 ? 67.689  -15.180 86.670  0.25 43.35  ? 161  LYS D NZ    1 
ATOM   8467   N N     A ASN D  1 162 ? 70.352  -8.747  87.425  0.25 31.79  ? 162  ASN D N     1 
ATOM   8468   C CA    A ASN D  1 162 ? 71.770  -8.425  87.583  0.25 32.57  ? 162  ASN D CA    1 
ATOM   8469   C C     A ASN D  1 162 ? 72.184  -6.963  87.600  0.25 31.66  ? 162  ASN D C     1 
ATOM   8470   O O     A ASN D  1 162 ? 73.298  -6.639  88.009  0.25 33.84  ? 162  ASN D O     1 
ATOM   8471   C CB    A ASN D  1 162 ? 72.565  -9.173  86.512  0.25 33.99  ? 162  ASN D CB    1 
ATOM   8472   C CG    A ASN D  1 162 ? 72.295  -10.659 86.542  0.25 34.99  ? 162  ASN D CG    1 
ATOM   8473   O OD1   A ASN D  1 162 ? 72.473  -11.307 87.571  0.25 41.28  ? 162  ASN D OD1   1 
ATOM   8474   N ND2   A ASN D  1 162 ? 71.855  -11.205 85.425  0.25 35.97  ? 162  ASN D ND2   1 
ATOM   8475   N N     A ASN D  1 163 ? 71.307  -6.073  87.158  0.25 29.97  ? 163  ASN D N     1 
ATOM   8476   C CA    A ASN D  1 163 ? 71.619  -4.659  87.162  0.25 26.95  ? 163  ASN D CA    1 
ATOM   8477   C C     A ASN D  1 163 ? 70.330  -3.844  87.210  0.25 28.37  ? 163  ASN D C     1 
ATOM   8478   O O     A ASN D  1 163 ? 70.041  -3.065  86.296  0.25 23.68  ? 163  ASN D O     1 
ATOM   8479   C CB    A ASN D  1 163 ? 72.427  -4.297  85.925  0.25 28.53  ? 163  ASN D CB    1 
ATOM   8480   C CG    A ASN D  1 163 ? 73.010  -2.909  86.016  0.25 28.89  ? 163  ASN D CG    1 
ATOM   8481   O OD1   A ASN D  1 163 ? 73.356  -2.456  87.103  0.25 30.76  ? 163  ASN D OD1   1 
ATOM   8482   N ND2   A ASN D  1 163 ? 73.132  -2.230  84.887  0.25 32.05  ? 163  ASN D ND2   1 
ATOM   8483   N N     A PRO D  1 164 ? 69.568  -3.986  88.311  0.25 28.76  ? 164  PRO D N     1 
ATOM   8484   C CA    A PRO D  1 164 ? 68.277  -3.311  88.569  0.25 29.42  ? 164  PRO D CA    1 
ATOM   8485   C C     A PRO D  1 164 ? 68.202  -1.807  88.415  0.25 29.76  ? 164  PRO D C     1 
ATOM   8486   O O     A PRO D  1 164 ? 67.164  -1.279  88.022  0.25 33.10  ? 164  PRO D O     1 
ATOM   8487   C CB    A PRO D  1 164 ? 67.913  -3.773  89.993  0.25 29.65  ? 164  PRO D CB    1 
ATOM   8488   C CG    A PRO D  1 164 ? 69.272  -4.030  90.635  0.25 29.79  ? 164  PRO D CG    1 
ATOM   8489   C CD    A PRO D  1 164 ? 70.013  -4.739  89.504  0.25 27.80  ? 164  PRO D CD    1 
ATOM   8490   N N     A THR D  1 165 ? 69.287  -1.100  88.710  0.25 28.68  ? 165  THR D N     1 
ATOM   8491   C CA    A THR D  1 165 ? 69.272  0.343   88.592  0.25 28.36  ? 165  THR D CA    1 
ATOM   8492   C C     A THR D  1 165 ? 69.485  0.826   87.161  0.25 29.10  ? 165  THR D C     1 
ATOM   8493   O O     A THR D  1 165 ? 69.513  2.030   86.898  0.25 31.03  ? 165  THR D O     1 
ATOM   8494   C CB    A THR D  1 165 ? 70.320  0.993   89.537  0.25 29.52  ? 165  THR D CB    1 
ATOM   8495   O OG1   A THR D  1 165 ? 71.634  0.501   89.226  0.25 33.20  ? 165  THR D OG1   1 
ATOM   8496   C CG2   A THR D  1 165 ? 70.001  0.637   90.979  0.25 29.33  ? 165  THR D CG2   1 
ATOM   8497   N N     A ASP D  1 166 ? 69.644  -0.106  86.228  0.25 30.70  ? 166  ASP D N     1 
ATOM   8498   C CA    A ASP D  1 166 ? 69.811  0.260   84.819  0.25 27.98  ? 166  ASP D CA    1 
ATOM   8499   C C     A ASP D  1 166 ? 68.597  1.113   84.443  0.25 28.32  ? 166  ASP D C     1 
ATOM   8500   O O     A ASP D  1 166 ? 67.507  0.929   84.988  0.25 26.46  ? 166  ASP D O     1 
ATOM   8501   C CB    A ASP D  1 166 ? 69.878  -1.010  83.962  0.25 29.71  ? 166  ASP D CB    1 
ATOM   8502   C CG    A ASP D  1 166 ? 70.021  -0.719  82.482  0.25 31.39  ? 166  ASP D CG    1 
ATOM   8503   O OD1   A ASP D  1 166 ? 68.989  -0.506  81.807  0.25 32.47  ? 166  ASP D OD1   1 
ATOM   8504   O OD2   A ASP D  1 166 ? 71.170  -0.696  81.988  0.25 33.08  ? 166  ASP D OD2   1 
ATOM   8505   N N     A ARG D  1 167 ? 68.784  2.059   83.528  0.25 26.23  ? 167  ARG D N     1 
ATOM   8506   C CA    A ARG D  1 167 ? 67.694  2.938   83.111  0.25 24.27  ? 167  ARG D CA    1 
ATOM   8507   C C     A ARG D  1 167 ? 67.174  2.640   81.706  0.25 23.14  ? 167  ARG D C     1 
ATOM   8508   O O     A ARG D  1 167 ? 66.480  3.477   81.125  0.25 26.12  ? 167  ARG D O     1 
ATOM   8509   C CB    A ARG D  1 167 ? 68.155  4.396   83.136  0.25 19.90  ? 167  ARG D CB    1 
ATOM   8510   C CG    A ARG D  1 167 ? 68.582  4.937   84.494  0.25 28.51  ? 167  ARG D CG    1 
ATOM   8511   C CD    A ARG D  1 167 ? 69.587  6.050   84.225  0.25 31.63  ? 167  ARG D CD    1 
ATOM   8512   N NE    A ARG D  1 167 ? 69.967  6.739   85.425  0.25 34.55  ? 167  ARG D NE    1 
ATOM   8513   C CZ    A ARG D  1 167 ? 71.104  7.399   85.561  0.25 30.03  ? 167  ARG D CZ    1 
ATOM   8514   N NH1   A ARG D  1 167 ? 71.970  7.447   84.560  0.25 28.83  ? 167  ARG D NH1   1 
ATOM   8515   N NH2   A ARG D  1 167 ? 71.364  7.993   86.706  0.25 30.50  ? 167  ARG D NH2   1 
ATOM   8516   N N     A ARG D  1 168 ? 67.521  1.482   81.158  0.25 23.27  ? 168  ARG D N     1 
ATOM   8517   C CA    A ARG D  1 168 ? 67.098  1.112   79.799  0.25 22.87  ? 168  ARG D CA    1 
ATOM   8518   C C     A ARG D  1 168 ? 66.265  -0.166  79.808  0.25 21.49  ? 168  ARG D C     1 
ATOM   8519   O O     A ARG D  1 168 ? 66.272  -0.908  78.843  0.25 23.30  ? 168  ARG D O     1 
ATOM   8520   C CB    A ARG D  1 168 ? 68.326  0.873   78.898  0.25 23.65  ? 168  ARG D CB    1 
ATOM   8521   C CG    A ARG D  1 168 ? 69.239  2.080   78.660  0.25 19.71  ? 168  ARG D CG    1 
ATOM   8522   C CD    A ARG D  1 168 ? 70.212  2.293   79.800  0.25 24.35  ? 168  ARG D CD    1 
ATOM   8523   N NE    A ARG D  1 168 ? 71.215  3.325   79.500  0.25 27.20  ? 168  ARG D NE    1 
ATOM   8524   C CZ    A ARG D  1 168 ? 72.438  3.093   79.016  0.25 28.80  ? 168  ARG D CZ    1 
ATOM   8525   N NH1   A ARG D  1 168 ? 73.272  4.109   78.782  0.25 30.11  ? 168  ARG D NH1   1 
ATOM   8526   N NH2   A ARG D  1 168 ? 72.843  1.863   78.763  0.25 28.97  ? 168  ARG D NH2   1 
ATOM   8527   N N     A ILE D  1 169 ? 65.556  -0.437  80.894  0.25 20.55  ? 169  ILE D N     1 
ATOM   8528   C CA    A ILE D  1 169 ? 64.763  -1.668  80.974  0.25 23.07  ? 169  ILE D CA    1 
ATOM   8529   C C     A ILE D  1 169 ? 63.478  -1.437  80.201  0.25 22.21  ? 169  ILE D C     1 
ATOM   8530   O O     A ILE D  1 169 ? 62.405  -1.190  80.770  0.25 23.20  ? 169  ILE D O     1 
ATOM   8531   C CB    A ILE D  1 169 ? 64.464  -2.022  82.447  0.25 22.64  ? 169  ILE D CB    1 
ATOM   8532   C CG1   A ILE D  1 169 ? 65.763  -1.982  83.255  0.25 24.22  ? 169  ILE D CG1   1 
ATOM   8533   C CG2   A ILE D  1 169 ? 63.881  -3.407  82.538  0.25 24.25  ? 169  ILE D CG2   1 
ATOM   8534   C CD1   A ILE D  1 169 ? 65.562  -2.272  84.743  0.25 26.63  ? 169  ILE D CD1   1 
ATOM   8535   N N     A ILE D  1 170 ? 63.603  -1.529  78.885  0.25 23.31  ? 170  ILE D N     1 
ATOM   8536   C CA    A ILE D  1 170 ? 62.499  -1.240  77.971  0.25 23.02  ? 170  ILE D CA    1 
ATOM   8537   C C     A ILE D  1 170 ? 62.038  -2.447  77.150  0.25 22.28  ? 170  ILE D C     1 
ATOM   8538   O O     A ILE D  1 170 ? 62.846  -3.275  76.699  0.25 19.01  ? 170  ILE D O     1 
ATOM   8539   C CB    A ILE D  1 170 ? 62.918  -0.119  76.968  0.25 24.82  ? 170  ILE D CB    1 
ATOM   8540   C CG1   A ILE D  1 170 ? 63.419  1.115   77.717  0.25 26.02  ? 170  ILE D CG1   1 
ATOM   8541   C CG2   A ILE D  1 170 ? 61.741  0.228   76.033  0.25 25.05  ? 170  ILE D CG2   1 
ATOM   8542   C CD1   A ILE D  1 170 ? 62.352  1.806   78.584  0.25 23.56  ? 170  ILE D CD1   1 
ATOM   8543   N N     A LEU D  1 171 ? 60.727  -2.537  76.958  0.25 20.74  ? 171  LEU D N     1 
ATOM   8544   C CA    A LEU D  1 171 ? 60.142  -3.608  76.166  0.25 20.85  ? 171  LEU D CA    1 
ATOM   8545   C C     A LEU D  1 171 ? 59.278  -2.874  75.155  0.25 21.66  ? 171  LEU D C     1 
ATOM   8546   O O     A LEU D  1 171 ? 58.280  -2.269  75.532  0.25 24.87  ? 171  LEU D O     1 
ATOM   8547   C CB    A LEU D  1 171 ? 59.269  -4.499  77.049  0.25 22.83  ? 171  LEU D CB    1 
ATOM   8548   C CG    A LEU D  1 171 ? 58.517  -5.611  76.328  0.25 22.14  ? 171  LEU D CG    1 
ATOM   8549   C CD1   A LEU D  1 171 ? 59.539  -6.547  75.636  0.25 24.94  ? 171  LEU D CD1   1 
ATOM   8550   C CD2   A LEU D  1 171 ? 57.665  -6.380  77.314  0.25 23.46  ? 171  LEU D CD2   1 
ATOM   8551   N N     A SER D  1 172 ? 59.641  -2.927  73.880  0.25 20.77  ? 172  SER D N     1 
ATOM   8552   C CA    A SER D  1 172 ? 58.899  -2.178  72.858  0.25 23.54  ? 172  SER D CA    1 
ATOM   8553   C C     A SER D  1 172 ? 58.542  -2.986  71.620  0.25 26.23  ? 172  SER D C     1 
ATOM   8554   O O     A SER D  1 172 ? 59.336  -3.816  71.132  0.25 24.23  ? 172  SER D O     1 
ATOM   8555   C CB    A SER D  1 172 ? 59.712  -0.956  72.415  0.25 22.93  ? 172  SER D CB    1 
ATOM   8556   O OG    A SER D  1 172 ? 59.009  -0.183  71.455  0.25 22.07  ? 172  SER D OG    1 
ATOM   8557   N N     A ALA D  1 173 ? 57.352  -2.717  71.098  0.25 21.68  ? 173  ALA D N     1 
ATOM   8558   C CA    A ALA D  1 173 ? 56.878  -3.403  69.911  0.25 25.10  ? 173  ALA D CA    1 
ATOM   8559   C C     A ALA D  1 173 ? 56.867  -2.448  68.722  0.25 22.31  ? 173  ALA D C     1 
ATOM   8560   O O     A ALA D  1 173 ? 56.612  -2.850  67.585  0.25 24.18  ? 173  ALA D O     1 
ATOM   8561   C CB    A ALA D  1 173 ? 55.463  -3.979  70.152  0.25 21.11  ? 173  ALA D CB    1 
ATOM   8562   N N     A TRP D  1 174 ? 57.161  -1.181  68.971  0.25 21.57  ? 174  TRP D N     1 
ATOM   8563   C CA    A TRP D  1 174 ? 57.147  -0.207  67.879  0.25 24.07  ? 174  TRP D CA    1 
ATOM   8564   C C     A TRP D  1 174 ? 58.331  -0.381  66.928  0.25 24.82  ? 174  TRP D C     1 
ATOM   8565   O O     A TRP D  1 174 ? 59.487  -0.307  67.355  0.25 23.87  ? 174  TRP D O     1 
ATOM   8566   C CB    A TRP D  1 174 ? 57.128  1.227   68.438  0.25 22.79  ? 174  TRP D CB    1 
ATOM   8567   C CG    A TRP D  1 174 ? 56.708  2.233   67.423  0.25 24.14  ? 174  TRP D CG    1 
ATOM   8568   C CD1   A TRP D  1 174 ? 57.510  3.137   66.777  0.25 23.78  ? 174  TRP D CD1   1 
ATOM   8569   C CD2   A TRP D  1 174 ? 55.391  2.411   66.888  0.25 21.86  ? 174  TRP D CD2   1 
ATOM   8570   N NE1   A TRP D  1 174 ? 56.774  3.857   65.877  0.25 23.78  ? 174  TRP D NE1   1 
ATOM   8571   C CE2   A TRP D  1 174 ? 55.471  3.434   65.923  0.25 23.02  ? 174  TRP D CE2   1 
ATOM   8572   C CE3   A TRP D  1 174 ? 54.150  1.800   67.131  0.25 23.39  ? 174  TRP D CE3   1 
ATOM   8573   C CZ2   A TRP D  1 174 ? 54.352  3.872   65.194  0.25 22.85  ? 174  TRP D CZ2   1 
ATOM   8574   C CZ3   A TRP D  1 174 ? 53.033  2.236   66.408  0.25 20.79  ? 174  TRP D CZ3   1 
ATOM   8575   C CH2   A TRP D  1 174 ? 53.146  3.264   65.453  0.25 23.93  ? 174  TRP D CH2   1 
ATOM   8576   N N     A ASN D  1 175 ? 58.040  -0.613  65.648  0.25 20.16  ? 175  ASN D N     1 
ATOM   8577   C CA    A ASN D  1 175 ? 59.080  -0.804  64.650  0.25 20.23  ? 175  ASN D CA    1 
ATOM   8578   C C     A ASN D  1 175 ? 58.632  -0.145  63.356  0.25 20.40  ? 175  ASN D C     1 
ATOM   8579   O O     A ASN D  1 175 ? 57.884  -0.730  62.562  0.25 19.33  ? 175  ASN D O     1 
ATOM   8580   C CB    A ASN D  1 175 ? 59.324  -2.298  64.424  0.25 20.80  ? 175  ASN D CB    1 
ATOM   8581   C CG    A ASN D  1 175 ? 60.546  -2.572  63.560  0.25 19.90  ? 175  ASN D CG    1 
ATOM   8582   O OD1   A ASN D  1 175 ? 60.829  -1.834  62.630  0.25 22.10  ? 175  ASN D OD1   1 
ATOM   8583   N ND2   A ASN D  1 175 ? 61.255  -3.658  63.856  0.25 19.46  ? 175  ASN D ND2   1 
ATOM   8584   N N     A PRO D  1 176 ? 59.080  1.099   63.126  0.25 20.90  ? 176  PRO D N     1 
ATOM   8585   C CA    A PRO D  1 176 ? 58.722  1.860   61.931  0.25 21.33  ? 176  PRO D CA    1 
ATOM   8586   C C     A PRO D  1 176 ? 58.957  1.120   60.624  0.25 23.63  ? 176  PRO D C     1 
ATOM   8587   O O     A PRO D  1 176 ? 58.204  1.296   59.657  0.25 24.70  ? 176  PRO D O     1 
ATOM   8588   C CB    A PRO D  1 176 ? 59.580  3.120   62.056  0.25 23.89  ? 176  PRO D CB    1 
ATOM   8589   C CG    A PRO D  1 176 ? 59.646  3.314   63.549  0.25 21.23  ? 176  PRO D CG    1 
ATOM   8590   C CD    A PRO D  1 176 ? 59.930  1.905   64.027  0.25 20.25  ? 176  PRO D CD    1 
ATOM   8591   N N     A LYS D  1 177 ? 59.998  0.296   60.581  0.25 21.39  ? 177  LYS D N     1 
ATOM   8592   C CA    A LYS D  1 177 ? 60.285  -0.453  59.362  0.25 19.71  ? 177  LYS D CA    1 
ATOM   8593   C C     A LYS D  1 177 ? 59.285  -1.565  59.096  0.25 19.67  ? 177  LYS D C     1 
ATOM   8594   O O     A LYS D  1 177 ? 58.908  -1.777  57.945  0.25 19.52  ? 177  LYS D O     1 
ATOM   8595   C CB    A LYS D  1 177 ? 61.684  -1.064  59.416  0.25 18.76  ? 177  LYS D CB    1 
ATOM   8596   C CG    A LYS D  1 177 ? 62.036  -1.837  58.144  0.25 20.37  ? 177  LYS D CG    1 
ATOM   8597   C CD    A LYS D  1 177 ? 63.399  -2.466  58.255  0.25 24.44  ? 177  LYS D CD    1 
ATOM   8598   C CE    A LYS D  1 177 ? 63.770  -3.174  56.955  0.25 30.78  ? 177  LYS D CE    1 
ATOM   8599   N NZ    A LYS D  1 177 ? 65.033  -3.949  57.105  0.25 35.29  ? 177  LYS D NZ    1 
ATOM   8600   N N     A ASP D  1 178 ? 58.874  -2.276  60.152  0.25 19.30  ? 178  ASP D N     1 
ATOM   8601   C CA    A ASP D  1 178 ? 57.912  -3.389  60.024  0.25 20.46  ? 178  ASP D CA    1 
ATOM   8602   C C     A ASP D  1 178 ? 56.422  -3.004  60.000  0.25 20.04  ? 178  ASP D C     1 
ATOM   8603   O O     A ASP D  1 178 ? 55.572  -3.834  59.640  0.25 26.17  ? 178  ASP D O     1 
ATOM   8604   C CB    A ASP D  1 178 ? 58.126  -4.408  61.157  0.25 16.20  ? 178  ASP D CB    1 
ATOM   8605   C CG    A ASP D  1 178 ? 59.411  -5.239  60.969  0.25 21.89  ? 178  ASP D CG    1 
ATOM   8606   O OD1   A ASP D  1 178 ? 60.122  -5.045  59.957  0.25 19.46  ? 178  ASP D OD1   1 
ATOM   8607   O OD2   A ASP D  1 178 ? 59.715  -6.073  61.839  0.25 18.11  ? 178  ASP D OD2   1 
ATOM   8608   N N     A LEU D  1 179 ? 56.102  -1.780  60.376  0.25 20.15  ? 179  LEU D N     1 
ATOM   8609   C CA    A LEU D  1 179 ? 54.696  -1.337  60.416  0.25 23.98  ? 179  LEU D CA    1 
ATOM   8610   C C     A LEU D  1 179 ? 53.818  -1.765  59.252  0.25 25.77  ? 179  LEU D C     1 
ATOM   8611   O O     A LEU D  1 179 ? 52.754  -2.327  59.453  0.25 30.09  ? 179  LEU D O     1 
ATOM   8612   C CB    A LEU D  1 179 ? 54.605  0.181   60.548  0.25 24.62  ? 179  LEU D CB    1 
ATOM   8613   C CG    A LEU D  1 179 ? 55.072  0.831   61.849  0.25 29.38  ? 179  LEU D CG    1 
ATOM   8614   C CD1   A LEU D  1 179 ? 54.756  2.323   61.780  0.25 28.77  ? 179  LEU D CD1   1 
ATOM   8615   C CD2   A LEU D  1 179 ? 54.375  0.180   63.045  0.25 25.46  ? 179  LEU D CD2   1 
ATOM   8616   N N     A PRO D  1 180 ? 54.253  -1.508  58.011  0.25 28.63  ? 180  PRO D N     1 
ATOM   8617   C CA    A PRO D  1 180 ? 53.419  -1.905  56.863  0.25 27.80  ? 180  PRO D CA    1 
ATOM   8618   C C     A PRO D  1 180 ? 53.145  -3.396  56.729  0.25 27.53  ? 180  PRO D C     1 
ATOM   8619   O O     A PRO D  1 180 ? 52.214  -3.793  56.026  0.25 27.43  ? 180  PRO D O     1 
ATOM   8620   C CB    A PRO D  1 180 ? 54.175  -1.326  55.650  0.25 29.48  ? 180  PRO D CB    1 
ATOM   8621   C CG    A PRO D  1 180 ? 55.603  -1.195  56.143  0.25 33.05  ? 180  PRO D CG    1 
ATOM   8622   C CD    A PRO D  1 180 ? 55.455  -0.764  57.582  0.25 26.94  ? 180  PRO D CD    1 
ATOM   8623   N N     A LEU D  1 181 ? 53.940  -4.222  57.405  0.25 25.68  ? 181  LEU D N     1 
ATOM   8624   C CA    A LEU D  1 181 ? 53.746  -5.664  57.344  0.25 24.81  ? 181  LEU D CA    1 
ATOM   8625   C C     A LEU D  1 181 ? 52.744  -6.107  58.420  0.25 24.27  ? 181  LEU D C     1 
ATOM   8626   O O     A LEU D  1 181 ? 52.317  -7.254  58.427  0.25 23.26  ? 181  LEU D O     1 
ATOM   8627   C CB    A LEU D  1 181 ? 55.076  -6.400  57.567  0.25 23.93  ? 181  LEU D CB    1 
ATOM   8628   C CG    A LEU D  1 181 ? 56.230  -6.113  56.593  0.25 30.44  ? 181  LEU D CG    1 
ATOM   8629   C CD1   A LEU D  1 181 ? 57.453  -6.924  57.000  0.25 29.73  ? 181  LEU D CD1   1 
ATOM   8630   C CD2   A LEU D  1 181 ? 55.829  -6.478  55.189  0.25 30.34  ? 181  LEU D CD2   1 
ATOM   8631   N N     A MET D  1 182 ? 52.385  -5.186  59.315  0.25 22.73  ? 182  MET D N     1 
ATOM   8632   C CA    A MET D  1 182 ? 51.483  -5.484  60.425  0.25 23.68  ? 182  MET D CA    1 
ATOM   8633   C C     A MET D  1 182 ? 50.015  -5.248  60.097  0.25 20.99  ? 182  MET D C     1 
ATOM   8634   O O     A MET D  1 182 ? 49.662  -4.239  59.511  0.25 23.47  ? 182  MET D O     1 
ATOM   8635   C CB    A MET D  1 182 ? 51.843  -4.628  61.631  0.25 22.85  ? 182  MET D CB    1 
ATOM   8636   C CG    A MET D  1 182 ? 53.191  -4.952  62.272  0.25 22.87  ? 182  MET D CG    1 
ATOM   8637   S SD    A MET D  1 182 ? 53.481  -3.809  63.617  0.25 19.22  ? 182  MET D SD    1 
ATOM   8638   C CE    A MET D  1 182 ? 55.326  -3.535  63.459  0.25 26.32  ? 182  MET D CE    1 
ATOM   8639   N N     A ALA D  1 183 ? 49.162  -6.186  60.479  0.25 21.99  ? 183  ALA D N     1 
ATOM   8640   C CA    A ALA D  1 183 ? 47.736  -6.044  60.226  0.25 20.09  ? 183  ALA D CA    1 
ATOM   8641   C C     A ALA D  1 183 ? 47.261  -4.799  60.945  0.25 22.34  ? 183  ALA D C     1 
ATOM   8642   O O     A ALA D  1 183 ? 46.340  -4.122  60.491  0.25 27.33  ? 183  ALA D O     1 
ATOM   8643   C CB    A ALA D  1 183 ? 47.005  -7.255  60.750  0.25 21.99  ? 183  ALA D CB    1 
ATOM   8644   N N     A LEU D  1 184 ? 47.914  -4.479  62.059  0.25 21.93  ? 184  LEU D N     1 
ATOM   8645   C CA    A LEU D  1 184 ? 47.560  -3.309  62.841  0.25 23.67  ? 184  LEU D CA    1 
ATOM   8646   C C     A LEU D  1 184 ? 48.815  -2.886  63.604  0.25 23.63  ? 184  LEU D C     1 
ATOM   8647   O O     A LEU D  1 184 ? 49.532  -3.731  64.130  0.25 21.78  ? 184  LEU D O     1 
ATOM   8648   C CB    A LEU D  1 184 ? 46.455  -3.683  63.841  0.25 26.84  ? 184  LEU D CB    1 
ATOM   8649   C CG    A LEU D  1 184 ? 45.485  -2.614  64.340  0.25 30.05  ? 184  LEU D CG    1 
ATOM   8650   C CD1   A LEU D  1 184 ? 44.707  -2.050  63.166  0.25 26.22  ? 184  LEU D CD1   1 
ATOM   8651   C CD2   A LEU D  1 184 ? 44.523  -3.228  65.368  0.25 27.43  ? 184  LEU D CD2   1 
ATOM   8652   N N     A PRO D  1 185 ? 49.100  -1.577  63.661  0.25 24.28  ? 185  PRO D N     1 
ATOM   8653   C CA    A PRO D  1 185 ? 50.292  -1.110  64.385  0.25 23.59  ? 185  PRO D CA    1 
ATOM   8654   C C     A PRO D  1 185 ? 50.067  -1.260  65.883  0.25 21.76  ? 185  PRO D C     1 
ATOM   8655   O O     A PRO D  1 185 ? 48.953  -1.187  66.364  0.25 20.86  ? 185  PRO D O     1 
ATOM   8656   C CB    A PRO D  1 185 ? 50.410  0.356   63.964  0.25 25.59  ? 185  PRO D CB    1 
ATOM   8657   C CG    A PRO D  1 185 ? 49.710  0.400   62.629  0.25 24.90  ? 185  PRO D CG    1 
ATOM   8658   C CD    A PRO D  1 185 ? 48.515  -0.487  62.856  0.25 22.59  ? 185  PRO D CD    1 
ATOM   8659   N N     A PRO D  1 186 ? 51.138  -1.479  66.645  0.25 23.45  ? 186  PRO D N     1 
ATOM   8660   C CA    A PRO D  1 186 ? 51.034  -1.645  68.099  0.25 20.45  ? 186  PRO D CA    1 
ATOM   8661   C C     A PRO D  1 186 ? 50.300  -0.503  68.799  0.25 19.94  ? 186  PRO D C     1 
ATOM   8662   O O     A PRO D  1 186 ? 50.586  0.659   68.538  0.25 18.76  ? 186  PRO D O     1 
ATOM   8663   C CB    A PRO D  1 186 ? 52.493  -1.711  68.534  0.25 20.85  ? 186  PRO D CB    1 
ATOM   8664   C CG    A PRO D  1 186 ? 53.179  -2.330  67.316  0.25 20.25  ? 186  PRO D CG    1 
ATOM   8665   C CD    A PRO D  1 186 ? 52.545  -1.544  66.204  0.25 21.09  ? 186  PRO D CD    1 
ATOM   8666   N N     A CYS D  1 187 ? 49.356  -0.837  69.677  0.25 18.72  ? 187  CYS D N     1 
ATOM   8667   C CA    A CYS D  1 187 ? 48.632  0.167   70.433  0.25 21.91  ? 187  CYS D CA    1 
ATOM   8668   C C     A CYS D  1 187 ? 49.481  0.423   71.676  0.25 21.17  ? 187  CYS D C     1 
ATOM   8669   O O     A CYS D  1 187 ? 49.845  1.552   71.948  0.25 20.70  ? 187  CYS D O     1 
ATOM   8670   C CB    A CYS D  1 187 ? 47.227  -0.334  70.828  0.25 25.64  ? 187  CYS D CB    1 
ATOM   8671   S SG    A CYS D  1 187 ? 46.087  -0.426  69.420  0.25 29.85  ? 187  CYS D SG    1 
ATOM   8672   N N     A HIS D  1 188 ? 49.767  -0.624  72.447  0.25 21.28  ? 188  HIS D N     1 
ATOM   8673   C CA    A HIS D  1 188 ? 50.627  -0.478  73.602  0.25 21.70  ? 188  HIS D CA    1 
ATOM   8674   C C     A HIS D  1 188 ? 52.002  -0.629  72.935  0.25 24.33  ? 188  HIS D C     1 
ATOM   8675   O O     A HIS D  1 188 ? 52.468  -1.733  72.678  0.25 21.59  ? 188  HIS D O     1 
ATOM   8676   C CB    A HIS D  1 188 ? 50.378  -1.574  74.642  0.25 20.57  ? 188  HIS D CB    1 
ATOM   8677   C CG    A HIS D  1 188 ? 50.099  -2.934  74.081  0.25 20.51  ? 188  HIS D CG    1 
ATOM   8678   N ND1   A HIS D  1 188 ? 50.979  -3.990  74.225  0.25 19.43  ? 188  HIS D ND1   1 
ATOM   8679   C CD2   A HIS D  1 188 ? 48.994  -3.444  73.479  0.25 16.97  ? 188  HIS D CD2   1 
ATOM   8680   C CE1   A HIS D  1 188 ? 50.429  -5.090  73.740  0.25 18.53  ? 188  HIS D CE1   1 
ATOM   8681   N NE2   A HIS D  1 188 ? 49.224  -4.783  73.279  0.25 19.78  ? 188  HIS D NE2   1 
ATOM   8682   N N     A MET D  1 189 ? 52.618  0.502   72.619  0.25 24.73  ? 189  MET D N     1 
ATOM   8683   C CA    A MET D  1 189 ? 53.884  0.473   71.907  0.25 27.21  ? 189  MET D CA    1 
ATOM   8684   C C     A MET D  1 189 ? 55.131  0.179   72.705  0.25 27.77  ? 189  MET D C     1 
ATOM   8685   O O     A MET D  1 189 ? 56.131  -0.241  72.142  0.25 26.79  ? 189  MET D O     1 
ATOM   8686   C CB    A MET D  1 189 ? 54.050  1.740   71.071  0.25 28.97  ? 189  MET D CB    1 
ATOM   8687   C CG    A MET D  1 189 ? 53.564  3.042   71.663  0.25 32.82  ? 189  MET D CG    1 
ATOM   8688   S SD    A MET D  1 189 ? 53.550  4.364   70.343  0.25 35.07  ? 189  MET D SD    1 
ATOM   8689   C CE    A MET D  1 189 ? 55.265  4.815   70.319  0.25 39.12  ? 189  MET D CE    1 
ATOM   8690   N N     A PHE D  1 190 ? 55.079  0.378   74.014  0.25 28.59  ? 190  PHE D N     1 
ATOM   8691   C CA    A PHE D  1 190 ? 56.240  0.049   74.833  0.25 29.28  ? 190  PHE D CA    1 
ATOM   8692   C C     A PHE D  1 190 ? 55.991  0.265   76.316  0.25 26.82  ? 190  PHE D C     1 
ATOM   8693   O O     A PHE D  1 190 ? 55.065  0.969   76.713  0.25 28.99  ? 190  PHE D O     1 
ATOM   8694   C CB    A PHE D  1 190 ? 57.441  0.899   74.408  0.25 33.44  ? 190  PHE D CB    1 
ATOM   8695   C CG    A PHE D  1 190 ? 57.553  2.180   75.162  0.25 35.73  ? 190  PHE D CG    1 
ATOM   8696   C CD1   A PHE D  1 190 ? 58.244  2.222   76.367  0.25 37.70  ? 190  PHE D CD1   1 
ATOM   8697   C CD2   A PHE D  1 190 ? 56.891  3.310   74.735  0.25 38.33  ? 190  PHE D CD2   1 
ATOM   8698   C CE1   A PHE D  1 190 ? 58.269  3.364   77.138  0.25 38.04  ? 190  PHE D CE1   1 
ATOM   8699   C CE2   A PHE D  1 190 ? 56.907  4.472   75.514  0.25 40.14  ? 190  PHE D CE2   1 
ATOM   8700   C CZ    A PHE D  1 190 ? 57.595  4.496   76.714  0.25 39.42  ? 190  PHE D CZ    1 
ATOM   8701   N N     A CYS D  1 191 ? 56.839  -0.340  77.133  0.25 22.87  ? 191  CYS D N     1 
ATOM   8702   C CA    A CYS D  1 191 ? 56.748  -0.150  78.561  0.25 24.27  ? 191  CYS D CA    1 
ATOM   8703   C C     A CYS D  1 191 ? 58.149  -0.111  79.168  0.25 22.72  ? 191  CYS D C     1 
ATOM   8704   O O     A CYS D  1 191 ? 59.113  -0.633  78.592  0.25 21.93  ? 191  CYS D O     1 
ATOM   8705   C CB    A CYS D  1 191 ? 55.920  -1.265  79.201  0.25 20.50  ? 191  CYS D CB    1 
ATOM   8706   S SG    A CYS D  1 191 ? 56.691  -2.859  79.239  0.25 27.12  ? 191  CYS D SG    1 
ATOM   8707   N N     A GLN D  1 192 ? 58.256  0.509   80.329  0.25 19.70  ? 192  GLN D N     1 
ATOM   8708   C CA    A GLN D  1 192 ? 59.526  0.611   81.021  0.25 22.24  ? 192  GLN D CA    1 
ATOM   8709   C C     A GLN D  1 192 ? 59.373  0.082   82.443  0.25 22.39  ? 192  GLN D C     1 
ATOM   8710   O O     A GLN D  1 192 ? 58.396  0.403   83.135  0.25 21.32  ? 192  GLN D O     1 
ATOM   8711   C CB    A GLN D  1 192 ? 60.002  2.066   81.042  0.25 21.76  ? 192  GLN D CB    1 
ATOM   8712   C CG    A GLN D  1 192 ? 61.155  2.328   82.034  0.25 23.85  ? 192  GLN D CG    1 
ATOM   8713   C CD    A GLN D  1 192 ? 61.785  3.716   81.874  0.25 21.40  ? 192  GLN D CD    1 
ATOM   8714   O OE1   A GLN D  1 192 ? 61.133  4.674   81.435  0.25 22.84  ? 192  GLN D OE1   1 
ATOM   8715   N NE2   A GLN D  1 192 ? 63.054  3.832   82.258  0.25 21.04  ? 192  GLN D NE2   1 
ATOM   8716   N N     A PHE D  1 193 ? 60.308  -0.772  82.855  0.25 22.42  ? 193  PHE D N     1 
ATOM   8717   C CA    A PHE D  1 193 ? 60.290  -1.320  84.207  0.25 22.85  ? 193  PHE D CA    1 
ATOM   8718   C C     A PHE D  1 193 ? 61.274  -0.583  85.096  0.25 23.32  ? 193  PHE D C     1 
ATOM   8719   O O     A PHE D  1 193 ? 62.311  -0.092  84.632  0.25 25.89  ? 193  PHE D O     1 
ATOM   8720   C CB    A PHE D  1 193 ? 60.620  -2.813  84.183  0.25 24.02  ? 193  PHE D CB    1 
ATOM   8721   C CG    A PHE D  1 193 ? 59.612  -3.638  83.432  0.25 26.32  ? 193  PHE D CG    1 
ATOM   8722   C CD1   A PHE D  1 193 ? 59.748  -3.854  82.068  0.25 23.46  ? 193  PHE D CD1   1 
ATOM   8723   C CD2   A PHE D  1 193 ? 58.504  -4.169  84.089  0.25 26.25  ? 193  PHE D CD2   1 
ATOM   8724   C CE1   A PHE D  1 193 ? 58.803  -4.582  81.368  0.25 26.38  ? 193  PHE D CE1   1 
ATOM   8725   C CE2   A PHE D  1 193 ? 57.540  -4.909  83.386  0.25 26.50  ? 193  PHE D CE2   1 
ATOM   8726   C CZ    A PHE D  1 193 ? 57.694  -5.114  82.027  0.25 24.24  ? 193  PHE D CZ    1 
ATOM   8727   N N     A PHE D  1 194 ? 60.945  -0.503  86.378  0.25 23.35  ? 194  PHE D N     1 
ATOM   8728   C CA    A PHE D  1 194 ? 61.779  0.177   87.366  0.25 22.49  ? 194  PHE D CA    1 
ATOM   8729   C C     A PHE D  1 194 ? 61.846  -0.706  88.618  0.25 25.40  ? 194  PHE D C     1 
ATOM   8730   O O     A PHE D  1 194 ? 60.835  -1.296  89.046  0.25 21.45  ? 194  PHE D O     1 
ATOM   8731   C CB    A PHE D  1 194 ? 61.168  1.544   87.693  0.25 20.47  ? 194  PHE D CB    1 
ATOM   8732   C CG    A PHE D  1 194 ? 61.949  2.348   88.700  0.25 24.39  ? 194  PHE D CG    1 
ATOM   8733   C CD1   A PHE D  1 194 ? 61.746  2.171   90.073  0.25 20.62  ? 194  PHE D CD1   1 
ATOM   8734   C CD2   A PHE D  1 194 ? 62.899  3.282   88.277  0.25 22.41  ? 194  PHE D CD2   1 
ATOM   8735   C CE1   A PHE D  1 194 ? 62.464  2.899   91.004  0.25 22.06  ? 194  PHE D CE1   1 
ATOM   8736   C CE2   A PHE D  1 194 ? 63.634  4.034   89.219  0.25 24.14  ? 194  PHE D CE2   1 
ATOM   8737   C CZ    A PHE D  1 194 ? 63.416  3.841   90.578  0.25 24.26  ? 194  PHE D CZ    1 
ATOM   8738   N N     A VAL D  1 195 ? 63.045  -0.813  89.188  0.25 25.22  ? 195  VAL D N     1 
ATOM   8739   C CA    A VAL D  1 195 ? 63.255  -1.621  90.377  0.25 28.01  ? 195  VAL D CA    1 
ATOM   8740   C C     A VAL D  1 195 ? 63.736  -0.772  91.553  0.25 30.12  ? 195  VAL D C     1 
ATOM   8741   O O     A VAL D  1 195 ? 64.769  -0.093  91.468  0.25 29.46  ? 195  VAL D O     1 
ATOM   8742   C CB    A VAL D  1 195 ? 64.304  -2.712  90.112  0.25 30.23  ? 195  VAL D CB    1 
ATOM   8743   C CG1   A VAL D  1 195 ? 64.417  -3.634  91.326  0.25 30.03  ? 195  VAL D CG1   1 
ATOM   8744   C CG2   A VAL D  1 195 ? 63.930  -3.509  88.862  0.25 29.43  ? 195  VAL D CG2   1 
ATOM   8745   N N     A SER D  1 196 ? 62.982  -0.789  92.643  0.25 28.70  ? 196  SER D N     1 
ATOM   8746   C CA    A SER D  1 196 ? 63.373  -0.048  93.828  0.25 33.71  ? 196  SER D CA    1 
ATOM   8747   C C     A SER D  1 196 ? 64.191  -0.994  94.673  0.25 34.50  ? 196  SER D C     1 
ATOM   8748   O O     A SER D  1 196 ? 63.764  -2.113  94.927  0.25 36.61  ? 196  SER D O     1 
ATOM   8749   C CB    A SER D  1 196 ? 62.149  0.415   94.633  0.25 34.85  ? 196  SER D CB    1 
ATOM   8750   O OG    A SER D  1 196 ? 61.365  1.347   93.893  0.25 40.16  ? 196  SER D OG    1 
ATOM   8751   N N     A LEU D  1 197 ? 65.365  -0.546  95.106  0.25 36.12  ? 197  LEU D N     1 
ATOM   8752   C CA    A LEU D  1 197 ? 66.234  -1.367  95.940  0.25 38.14  ? 197  LEU D CA    1 
ATOM   8753   C C     A LEU D  1 197 ? 65.666  -1.485  97.352  0.25 38.11  ? 197  LEU D C     1 
ATOM   8754   O O     A LEU D  1 197 ? 64.919  -0.612  97.805  0.25 36.77  ? 197  LEU D O     1 
ATOM   8755   C CB    A LEU D  1 197 ? 67.637  -0.755  95.994  0.25 37.03  ? 197  LEU D CB    1 
ATOM   8756   C CG    A LEU D  1 197 ? 68.320  -0.589  94.633  0.25 37.40  ? 197  LEU D CG    1 
ATOM   8757   C CD1   A LEU D  1 197 ? 69.703  0.034   94.822  0.25 37.42  ? 197  LEU D CD1   1 
ATOM   8758   C CD2   A LEU D  1 197 ? 68.442  -1.928  93.944  0.25 38.18  ? 197  LEU D CD2   1 
ATOM   8759   N N     A PRO D  1 198 ? 66.005  -2.577  98.060  0.25 41.46  ? 198  PRO D N     1 
ATOM   8760   C CA    A PRO D  1 198 ? 65.533  -2.816  99.428  0.25 43.68  ? 198  PRO D CA    1 
ATOM   8761   C C     A PRO D  1 198 ? 65.963  -1.675  100.349 0.25 47.06  ? 198  PRO D C     1 
ATOM   8762   O O     A PRO D  1 198 ? 67.124  -1.261  100.326 0.25 48.07  ? 198  PRO D O     1 
ATOM   8763   C CB    A PRO D  1 198 ? 66.217  -4.132  99.800  0.25 43.49  ? 198  PRO D CB    1 
ATOM   8764   C CG    A PRO D  1 198 ? 66.370  -4.835  98.488  0.25 41.19  ? 198  PRO D CG    1 
ATOM   8765   C CD    A PRO D  1 198 ? 66.815  -3.715  97.579  0.25 42.01  ? 198  PRO D CD    1 
ATOM   8766   N N     A PRO D  1 199 ? 65.032  -1.146  101.162 0.25 49.32  ? 199  PRO D N     1 
ATOM   8767   C CA    A PRO D  1 199 ? 65.351  -0.048  102.085 0.25 51.14  ? 199  PRO D CA    1 
ATOM   8768   C C     A PRO D  1 199 ? 66.499  -0.449  103.010 0.25 52.73  ? 199  PRO D C     1 
ATOM   8769   O O     A PRO D  1 199 ? 66.698  -1.633  103.291 0.25 53.16  ? 199  PRO D O     1 
ATOM   8770   C CB    A PRO D  1 199 ? 64.038  0.172   102.835 0.25 51.45  ? 199  PRO D CB    1 
ATOM   8771   C CG    A PRO D  1 199 ? 62.995  -0.229  101.814 0.25 50.56  ? 199  PRO D CG    1 
ATOM   8772   C CD    A PRO D  1 199 ? 63.598  -1.485  101.220 0.25 49.94  ? 199  PRO D CD    1 
ATOM   8773   N N     A ALA D  1 200 ? 67.268  0.549   103.440 0.25 55.12  ? 200  ALA D N     1 
ATOM   8774   C CA    A ALA D  1 200 ? 68.433  0.348   104.300 0.25 57.49  ? 200  ALA D CA    1 
ATOM   8775   C C     A ALA D  1 200 ? 68.183  -0.469  105.564 0.25 59.13  ? 200  ALA D C     1 
ATOM   8776   O O     A ALA D  1 200 ? 68.925  -1.408  105.866 0.25 60.41  ? 200  ALA D O     1 
ATOM   8777   C CB    A ALA D  1 200 ? 69.019  1.702   104.673 0.25 58.82  ? 200  ALA D CB    1 
ATOM   8778   N N     A ASP D  1 201 ? 67.139  -0.099  106.295 0.25 60.42  ? 201  ASP D N     1 
ATOM   8779   C CA    A ASP D  1 201 ? 66.763  -0.753  107.546 0.25 61.67  ? 201  ASP D CA    1 
ATOM   8780   C C     A ASP D  1 201 ? 65.973  -2.053  107.337 0.25 61.92  ? 201  ASP D C     1 
ATOM   8781   O O     A ASP D  1 201 ? 64.988  -2.295  108.044 0.25 61.93  ? 201  ASP D O     1 
ATOM   8782   C CB    A ASP D  1 201 ? 65.915  0.222   108.354 0.25 63.52  ? 201  ASP D CB    1 
ATOM   8783   C CG    A ASP D  1 201 ? 64.710  0.705   107.570 0.25 64.32  ? 201  ASP D CG    1 
ATOM   8784   O OD1   A ASP D  1 201 ? 64.904  1.210   106.439 0.25 65.98  ? 201  ASP D OD1   1 
ATOM   8785   O OD2   A ASP D  1 201 ? 63.576  0.581   108.076 0.25 64.88  ? 201  ASP D OD2   1 
ATOM   8786   N N     A SER D  1 202 ? 66.410  -2.880  106.387 0.25 62.29  ? 202  SER D N     1 
ATOM   8787   C CA    A SER D  1 202 ? 65.747  -4.144  106.075 0.25 62.00  ? 202  SER D CA    1 
ATOM   8788   C C     A SER D  1 202 ? 66.139  -4.579  104.674 0.25 60.93  ? 202  SER D C     1 
ATOM   8789   O O     A SER D  1 202 ? 65.289  -4.649  103.782 0.25 62.60  ? 202  SER D O     1 
ATOM   8790   C CB    A SER D  1 202 ? 64.225  -3.986  106.128 0.25 63.11  ? 202  SER D CB    1 
ATOM   8791   O OG    A SER D  1 202 ? 63.811  -2.891  105.327 0.25 64.43  ? 202  SER D OG    1 
ATOM   8792   N N     A PRO D  1 203 ? 67.422  -4.903  104.468 0.25 60.22  ? 203  PRO D N     1 
ATOM   8793   C CA    A PRO D  1 203 ? 67.998  -5.333  103.190 0.25 58.92  ? 203  PRO D CA    1 
ATOM   8794   C C     A PRO D  1 203 ? 67.612  -6.728  102.721 0.25 58.07  ? 203  PRO D C     1 
ATOM   8795   O O     A PRO D  1 203 ? 68.013  -7.155  101.637 0.25 58.33  ? 203  PRO D O     1 
ATOM   8796   C CB    A PRO D  1 203 ? 69.494  -5.210  103.446 0.25 59.10  ? 203  PRO D CB    1 
ATOM   8797   C CG    A PRO D  1 203 ? 69.595  -5.645  104.874 0.25 58.71  ? 203  PRO D CG    1 
ATOM   8798   C CD    A PRO D  1 203 ? 68.456  -4.869  105.518 0.25 59.03  ? 203  PRO D CD    1 
ATOM   8799   N N     A GLY D  1 204 ? 66.849  -7.439  103.542 0.25 56.74  ? 204  GLY D N     1 
ATOM   8800   C CA    A GLY D  1 204 ? 66.446  -8.779  103.170 0.25 54.04  ? 204  GLY D CA    1 
ATOM   8801   C C     A GLY D  1 204 ? 65.208  -8.773  102.295 0.25 52.12  ? 204  GLY D C     1 
ATOM   8802   O O     A GLY D  1 204 ? 64.942  -9.738  101.577 0.25 52.71  ? 204  GLY D O     1 
ATOM   8803   N N     A SER D  1 205 ? 64.454  -7.680  102.349 0.25 49.43  ? 205  SER D N     1 
ATOM   8804   C CA    A SER D  1 205 ? 63.237  -7.554  101.567 0.25 46.80  ? 205  SER D CA    1 
ATOM   8805   C C     A SER D  1 205 ? 63.486  -7.683  100.073 0.25 43.79  ? 205  SER D C     1 
ATOM   8806   O O     A SER D  1 205 ? 64.603  -7.490  99.599  0.25 43.75  ? 205  SER D O     1 
ATOM   8807   C CB    A SER D  1 205 ? 62.580  -6.209  101.858 0.25 47.98  ? 205  SER D CB    1 
ATOM   8808   O OG    A SER D  1 205 ? 62.323  -6.069  103.241 0.25 51.10  ? 205  SER D OG    1 
ATOM   8809   N N     A LYS D  1 206 ? 62.439  -8.018  99.334  0.25 40.49  ? 206  LYS D N     1 
ATOM   8810   C CA    A LYS D  1 206 ? 62.551  -8.151  97.885  0.25 39.54  ? 206  LYS D CA    1 
ATOM   8811   C C     A LYS D  1 206 ? 62.472  -6.771  97.222  0.25 35.72  ? 206  LYS D C     1 
ATOM   8812   O O     A LYS D  1 206 ? 61.729  -5.901  97.665  0.25 33.66  ? 206  LYS D O     1 
ATOM   8813   C CB    A LYS D  1 206 ? 61.409  -9.017  97.318  0.25 40.24  ? 206  LYS D CB    1 
ATOM   8814   C CG    A LYS D  1 206 ? 61.405  -10.477 97.728  0.25 42.78  ? 206  LYS D CG    1 
ATOM   8815   C CD    A LYS D  1 206 ? 60.235  -11.187 97.053  0.25 43.92  ? 206  LYS D CD    1 
ATOM   8816   C CE    A LYS D  1 206 ? 60.161  -12.660 97.424  0.25 46.33  ? 206  LYS D CE    1 
ATOM   8817   N NZ    A LYS D  1 206 ? 58.979  -13.322 96.781  0.25 45.36  ? 206  LYS D NZ    1 
ATOM   8818   N N     A PRO D  1 207 ? 63.267  -6.548  96.171  0.25 34.25  ? 207  PRO D N     1 
ATOM   8819   C CA    A PRO D  1 207 ? 63.213  -5.251  95.488  0.25 32.74  ? 207  PRO D CA    1 
ATOM   8820   C C     A PRO D  1 207 ? 61.791  -5.088  94.936  0.25 31.76  ? 207  PRO D C     1 
ATOM   8821   O O     A PRO D  1 207 ? 61.134  -6.081  94.632  0.25 32.81  ? 207  PRO D O     1 
ATOM   8822   C CB    A PRO D  1 207 ? 64.228  -5.419  94.365  0.25 32.63  ? 207  PRO D CB    1 
ATOM   8823   C CG    A PRO D  1 207 ? 65.236  -6.374  94.952  0.25 31.96  ? 207  PRO D CG    1 
ATOM   8824   C CD    A PRO D  1 207 ? 64.349  -7.389  95.638  0.25 32.76  ? 207  PRO D CD    1 
ATOM   8825   N N     A LYS D  1 208 ? 61.315  -3.855  94.813  0.25 31.50  ? 208  LYS D N     1 
ATOM   8826   C CA    A LYS D  1 208 ? 59.975  -3.626  94.277  0.25 30.80  ? 208  LYS D CA    1 
ATOM   8827   C C     A LYS D  1 208 ? 60.000  -3.335  92.761  0.25 30.53  ? 208  LYS D C     1 
ATOM   8828   O O     A LYS D  1 208 ? 60.793  -2.518  92.284  0.25 26.92  ? 208  LYS D O     1 
ATOM   8829   C CB    A LYS D  1 208 ? 59.310  -2.476  95.017  0.25 31.30  ? 208  LYS D CB    1 
ATOM   8830   C CG    A LYS D  1 208 ? 58.989  -2.789  96.469  0.25 36.19  ? 208  LYS D CG    1 
ATOM   8831   C CD    A LYS D  1 208 ? 58.223  -1.638  97.100  0.25 39.70  ? 208  LYS D CD    1 
ATOM   8832   C CE    A LYS D  1 208 ? 57.912  -1.909  98.568  0.25 44.57  ? 208  LYS D CE    1 
ATOM   8833   N NZ    A LYS D  1 208 ? 57.147  -3.171  98.754  0.25 46.39  ? 208  LYS D NZ    1 
ATOM   8834   N N     A LEU D  1 209 ? 59.115  -3.999  92.015  0.25 27.17  ? 209  LEU D N     1 
ATOM   8835   C CA    A LEU D  1 209 ? 59.060  -3.833  90.569  0.25 25.35  ? 209  LEU D CA    1 
ATOM   8836   C C     A LEU D  1 209 ? 57.868  -3.015  90.098  0.25 27.68  ? 209  LEU D C     1 
ATOM   8837   O O     A LEU D  1 209 ? 56.714  -3.315  90.457  0.25 26.74  ? 209  LEU D O     1 
ATOM   8838   C CB    A LEU D  1 209 ? 59.028  -5.205  89.899  0.25 23.30  ? 209  LEU D CB    1 
ATOM   8839   C CG    A LEU D  1 209 ? 58.963  -5.249  88.372  0.25 22.96  ? 209  LEU D CG    1 
ATOM   8840   C CD1   A LEU D  1 209 ? 60.272  -4.713  87.786  0.25 19.26  ? 209  LEU D CD1   1 
ATOM   8841   C CD2   A LEU D  1 209 ? 58.704  -6.670  87.906  0.25 18.32  ? 209  LEU D CD2   1 
ATOM   8842   N N     A SER D  1 210 ? 58.143  -1.982  89.295  0.25 24.50  ? 210  SER D N     1 
ATOM   8843   C CA    A SER D  1 210 ? 57.095  -1.134  88.743  0.25 23.04  ? 210  SER D CA    1 
ATOM   8844   C C     A SER D  1 210 ? 57.171  -1.138  87.211  0.25 25.39  ? 210  SER D C     1 
ATOM   8845   O O     A SER D  1 210 ? 58.223  -1.457  86.610  0.25 23.07  ? 210  SER D O     1 
ATOM   8846   C CB    A SER D  1 210 ? 57.206  0.291   89.266  0.25 21.86  ? 210  SER D CB    1 
ATOM   8847   O OG    A SER D  1 210 ? 56.932  0.336   90.654  0.25 22.94  ? 210  SER D OG    1 
ATOM   8848   N N     A CYS D  1 211 ? 56.059  -0.781  86.584  0.25 22.49  ? 211  CYS D N     1 
ATOM   8849   C CA    A CYS D  1 211 ? 55.967  -0.781  85.133  0.25 21.69  ? 211  CYS D CA    1 
ATOM   8850   C C     A CYS D  1 211 ? 55.156  0.391   84.627  0.25 23.12  ? 211  CYS D C     1 
ATOM   8851   O O     A CYS D  1 211 ? 54.047  0.650   85.113  0.25 22.23  ? 211  CYS D O     1 
ATOM   8852   C CB    A CYS D  1 211 ? 55.321  -2.089  84.656  0.25 23.42  ? 211  CYS D CB    1 
ATOM   8853   S SG    A CYS D  1 211 ? 54.886  -2.186  82.888  0.25 24.88  ? 211  CYS D SG    1 
ATOM   8854   N N     A LEU D  1 212 ? 55.725  1.125   83.671  0.25 20.28  ? 212  LEU D N     1 
ATOM   8855   C CA    A LEU D  1 212 ? 54.999  2.214   83.047  0.25 20.81  ? 212  LEU D CA    1 
ATOM   8856   C C     A LEU D  1 212 ? 54.829  1.801   81.579  0.25 22.70  ? 212  LEU D C     1 
ATOM   8857   O O     A LEU D  1 212 ? 55.813  1.417   80.921  0.25 20.60  ? 212  LEU D O     1 
ATOM   8858   C CB    A LEU D  1 212 ? 55.783  3.526   83.148  0.25 23.52  ? 212  LEU D CB    1 
ATOM   8859   C CG    A LEU D  1 212 ? 55.034  4.778   82.636  0.25 28.41  ? 212  LEU D CG    1 
ATOM   8860   C CD1   A LEU D  1 212 ? 55.768  6.013   83.099  0.25 30.31  ? 212  LEU D CD1   1 
ATOM   8861   C CD2   A LEU D  1 212 ? 54.936  4.785   81.124  0.25 30.30  ? 212  LEU D CD2   1 
ATOM   8862   N N     A MET D  1 213 ? 53.590  1.854   81.076  0.25 18.00  ? 213  MET D N     1 
ATOM   8863   C CA    A MET D  1 213 ? 53.315  1.490   79.686  0.25 18.73  ? 213  MET D CA    1 
ATOM   8864   C C     A MET D  1 213 ? 52.695  2.673   78.994  0.25 18.48  ? 213  MET D C     1 
ATOM   8865   O O     A MET D  1 213 ? 51.884  3.396   79.582  0.25 20.35  ? 213  MET D O     1 
ATOM   8866   C CB    A MET D  1 213 ? 52.371  0.261   79.617  0.25 16.61  ? 213  MET D CB    1 
ATOM   8867   C CG    A MET D  1 213 ? 52.051  -0.273  78.210  0.25 14.57  ? 213  MET D CG    1 
ATOM   8868   S SD    A MET D  1 213 ? 50.775  0.640   77.367  0.25 17.75  ? 213  MET D SD    1 
ATOM   8869   C CE    A MET D  1 213 ? 49.291  -0.336  77.963  0.25 22.61  ? 213  MET D CE    1 
ATOM   8870   N N     A TYR D  1 214 ? 53.082  2.892   77.740  0.25 18.84  ? 214  TYR D N     1 
ATOM   8871   C CA    A TYR D  1 214 ? 52.540  4.016   76.984  0.25 19.99  ? 214  TYR D CA    1 
ATOM   8872   C C     A TYR D  1 214 ? 51.725  3.455   75.827  0.25 19.44  ? 214  TYR D C     1 
ATOM   8873   O O     A TYR D  1 214 ? 52.228  2.653   75.025  0.25 16.10  ? 214  TYR D O     1 
ATOM   8874   C CB    A TYR D  1 214 ? 53.658  4.909   76.416  0.25 22.19  ? 214  TYR D CB    1 
ATOM   8875   C CG    A TYR D  1 214 ? 53.109  6.094   75.649  0.25 23.03  ? 214  TYR D CG    1 
ATOM   8876   C CD1   A TYR D  1 214 ? 52.766  7.274   76.308  0.25 29.52  ? 214  TYR D CD1   1 
ATOM   8877   C CD2   A TYR D  1 214 ? 52.871  6.019   74.281  0.25 25.78  ? 214  TYR D CD2   1 
ATOM   8878   C CE1   A TYR D  1 214 ? 52.194  8.352   75.622  0.25 30.32  ? 214  TYR D CE1   1 
ATOM   8879   C CE2   A TYR D  1 214 ? 52.303  7.095   73.582  0.25 27.17  ? 214  TYR D CE2   1 
ATOM   8880   C CZ    A TYR D  1 214 ? 51.965  8.247   74.253  0.25 28.12  ? 214  TYR D CZ    1 
ATOM   8881   O OH    A TYR D  1 214 ? 51.356  9.277   73.569  0.25 27.67  ? 214  TYR D OH    1 
ATOM   8882   N N     A GLN D  1 215 ? 50.486  3.916   75.718  0.25 18.45  ? 215  GLN D N     1 
ATOM   8883   C CA    A GLN D  1 215 ? 49.584  3.432   74.689  0.25 18.17  ? 215  GLN D CA    1 
ATOM   8884   C C     A GLN D  1 215 ? 49.206  4.601   73.806  0.25 17.55  ? 215  GLN D C     1 
ATOM   8885   O O     A GLN D  1 215 ? 48.564  5.524   74.260  0.25 19.73  ? 215  GLN D O     1 
ATOM   8886   C CB    A GLN D  1 215 ? 48.329  2.844   75.369  0.25 20.65  ? 215  GLN D CB    1 
ATOM   8887   C CG    A GLN D  1 215 ? 47.491  1.917   74.476  0.25 22.65  ? 215  GLN D CG    1 
ATOM   8888   C CD    A GLN D  1 215 ? 46.350  1.242   75.247  0.25 21.53  ? 215  GLN D CD    1 
ATOM   8889   O OE1   A GLN D  1 215 ? 46.492  0.914   76.439  0.25 16.87  ? 215  GLN D OE1   1 
ATOM   8890   N NE2   A GLN D  1 215 ? 45.222  1.034   74.567  0.25 18.74  ? 215  GLN D NE2   1 
ATOM   8891   N N     A ARG D  1 216 ? 49.598  4.551   72.539  0.25 19.45  ? 216  ARG D N     1 
ATOM   8892   C CA    A ARG D  1 216 ? 49.323  5.623   71.580  0.25 18.96  ? 216  ARG D CA    1 
ATOM   8893   C C     A ARG D  1 216 ? 47.857  5.851   71.244  0.25 19.90  ? 216  ARG D C     1 
ATOM   8894   O O     A ARG D  1 216 ? 47.449  6.986   70.972  0.25 18.27  ? 216  ARG D O     1 
ATOM   8895   C CB    A ARG D  1 216 ? 50.054  5.340   70.257  0.25 17.48  ? 216  ARG D CB    1 
ATOM   8896   C CG    A ARG D  1 216 ? 49.445  4.185   69.452  0.25 19.32  ? 216  ARG D CG    1 
ATOM   8897   C CD    A ARG D  1 216 ? 50.057  4.020   68.051  0.25 18.00  ? 216  ARG D CD    1 
ATOM   8898   N NE    A ARG D  1 216 ? 49.510  2.818   67.417  0.25 20.14  ? 216  ARG D NE    1 
ATOM   8899   C CZ    A ARG D  1 216 ? 48.287  2.734   66.890  0.25 22.75  ? 216  ARG D CZ    1 
ATOM   8900   N NH1   A ARG D  1 216 ? 47.467  3.789   66.894  0.25 21.60  ? 216  ARG D NH1   1 
ATOM   8901   N NH2   A ARG D  1 216 ? 47.862  1.588   66.382  0.25 22.51  ? 216  ARG D NH2   1 
ATOM   8902   N N     A SER D  1 217 ? 47.080  4.764   71.235  0.25 22.06  ? 217  SER D N     1 
ATOM   8903   C CA    A SER D  1 217 ? 45.665  4.804   70.859  0.25 21.29  ? 217  SER D CA    1 
ATOM   8904   C C     A SER D  1 217 ? 44.934  3.909   71.851  0.25 21.16  ? 217  SER D C     1 
ATOM   8905   O O     A SER D  1 217 ? 45.289  2.751   72.015  0.25 17.72  ? 217  SER D O     1 
ATOM   8906   C CB    A SER D  1 217 ? 45.504  4.256   69.426  0.25 23.59  ? 217  SER D CB    1 
ATOM   8907   O OG    A SER D  1 217 ? 44.177  4.378   68.940  0.25 25.74  ? 217  SER D OG    1 
ATOM   8908   N N     A CYS D  1 218 ? 43.887  4.439   72.486  0.25 20.19  ? 218  CYS D N     1 
ATOM   8909   C CA    A CYS D  1 218 ? 43.200  3.690   73.512  0.25 19.04  ? 218  CYS D CA    1 
ATOM   8910   C C     A CYS D  1 218 ? 41.678  3.634   73.376  0.25 20.67  ? 218  CYS D C     1 
ATOM   8911   O O     A CYS D  1 218 ? 40.980  4.638   73.539  0.25 19.17  ? 218  CYS D O     1 
ATOM   8912   C CB    A CYS D  1 218 ? 43.562  4.288   74.866  0.25 20.20  ? 218  CYS D CB    1 
ATOM   8913   S SG    A CYS D  1 218 ? 45.357  4.771   74.995  0.25 21.93  ? 218  CYS D SG    1 
ATOM   8914   N N     A ASP D  1 219 ? 41.181  2.450   73.066  0.25 21.08  ? 219  ASP D N     1 
ATOM   8915   C CA    A ASP D  1 219 ? 39.743  2.209   72.954  0.25 19.58  ? 219  ASP D CA    1 
ATOM   8916   C C     A ASP D  1 219 ? 39.351  1.963   74.411  0.25 17.80  ? 219  ASP D C     1 
ATOM   8917   O O     A ASP D  1 219 ? 39.554  0.888   74.949  0.25 20.36  ? 219  ASP D O     1 
ATOM   8918   C CB    A ASP D  1 219 ? 39.526  0.972   72.099  0.25 17.87  ? 219  ASP D CB    1 
ATOM   8919   C CG    A ASP D  1 219 ? 38.055  0.570   71.982  0.25 22.05  ? 219  ASP D CG    1 
ATOM   8920   O OD1   A ASP D  1 219 ? 37.763  -0.208  71.051  0.25 17.20  ? 219  ASP D OD1   1 
ATOM   8921   O OD2   A ASP D  1 219 ? 37.215  1.019   72.807  0.25 20.15  ? 219  ASP D OD2   1 
ATOM   8922   N N     A LEU D  1 220 ? 38.819  2.976   75.073  0.25 19.22  ? 220  LEU D N     1 
ATOM   8923   C CA    A LEU D  1 220 ? 38.473  2.806   76.479  0.25 21.16  ? 220  LEU D CA    1 
ATOM   8924   C C     A LEU D  1 220 ? 37.420  1.745   76.766  0.25 22.42  ? 220  LEU D C     1 
ATOM   8925   O O     A LEU D  1 220 ? 37.515  1.042   77.772  0.25 24.79  ? 220  LEU D O     1 
ATOM   8926   C CB    A LEU D  1 220 ? 38.054  4.146   77.098  0.25 23.83  ? 220  LEU D CB    1 
ATOM   8927   C CG    A LEU D  1 220 ? 39.329  4.827   77.609  0.25 25.64  ? 220  LEU D CG    1 
ATOM   8928   C CD1   A LEU D  1 220 ? 39.822  5.850   76.594  0.25 25.55  ? 220  LEU D CD1   1 
ATOM   8929   C CD2   A LEU D  1 220 ? 39.072  5.443   78.962  0.25 26.05  ? 220  LEU D CD2   1 
ATOM   8930   N N     A GLY D  1 221 ? 36.437  1.613   75.878  0.25 21.27  ? 221  GLY D N     1 
ATOM   8931   C CA    A GLY D  1 221 ? 35.401  0.613   76.097  0.25 21.91  ? 221  GLY D CA    1 
ATOM   8932   C C     A GLY D  1 221 ? 35.907  -0.818  76.057  0.25 21.07  ? 221  GLY D C     1 
ATOM   8933   O O     A GLY D  1 221 ? 35.720  -1.572  77.004  0.25 21.79  ? 221  GLY D O     1 
ATOM   8934   N N     A LEU D  1 222 ? 36.610  -1.176  74.983  0.25 20.96  ? 222  LEU D N     1 
ATOM   8935   C CA    A LEU D  1 222 ? 37.092  -2.529  74.802  0.25 19.45  ? 222  LEU D CA    1 
ATOM   8936   C C     A LEU D  1 222 ? 38.553  -2.820  75.072  0.25 19.83  ? 222  LEU D C     1 
ATOM   8937   O O     A LEU D  1 222 ? 38.889  -3.808  75.737  0.25 17.29  ? 222  LEU D O     1 
ATOM   8938   C CB    A LEU D  1 222 ? 36.764  -2.989  73.372  0.25 21.77  ? 222  LEU D CB    1 
ATOM   8939   C CG    A LEU D  1 222 ? 35.283  -3.241  73.069  0.25 22.90  ? 222  LEU D CG    1 
ATOM   8940   C CD1   A LEU D  1 222 ? 35.126  -3.657  71.606  0.25 21.67  ? 222  LEU D CD1   1 
ATOM   8941   C CD2   A LEU D  1 222 ? 34.746  -4.349  74.001  0.25 16.47  ? 222  LEU D CD2   1 
ATOM   8942   N N     A GLY D  1 223 ? 39.431  -1.978  74.553  0.25 19.10  ? 223  GLY D N     1 
ATOM   8943   C CA    A GLY D  1 223 ? 40.851  -2.233  74.740  0.25 22.07  ? 223  GLY D CA    1 
ATOM   8944   C C     A GLY D  1 223 ? 41.483  -1.999  76.099  0.25 18.04  ? 223  GLY D C     1 
ATOM   8945   O O     A GLY D  1 223 ? 42.133  -2.887  76.629  0.25 22.34  ? 223  GLY D O     1 
ATOM   8946   N N     A VAL D  1 224 ? 41.281  -0.815  76.671  0.25 20.70  ? 224  VAL D N     1 
ATOM   8947   C CA    A VAL D  1 224 ? 41.894  -0.445  77.951  0.25 19.39  ? 224  VAL D CA    1 
ATOM   8948   C C     A VAL D  1 224 ? 41.702  -1.459  79.068  0.25 21.20  ? 224  VAL D C     1 
ATOM   8949   O O     A VAL D  1 224 ? 42.648  -1.748  79.828  0.25 20.13  ? 224  VAL D O     1 
ATOM   8950   C CB    A VAL D  1 224 ? 41.412  0.977   78.377  0.25 21.47  ? 224  VAL D CB    1 
ATOM   8951   C CG1   A VAL D  1 224 ? 41.910  1.364   79.746  0.25 17.84  ? 224  VAL D CG1   1 
ATOM   8952   C CG2   A VAL D  1 224 ? 41.914  1.980   77.356  0.25 24.34  ? 224  VAL D CG2   1 
ATOM   8953   N N     A PRO D  1 225 ? 40.484  -2.030  79.196  0.25 20.05  ? 225  PRO D N     1 
ATOM   8954   C CA    A PRO D  1 225 ? 40.310  -3.009  80.271  0.25 16.62  ? 225  PRO D CA    1 
ATOM   8955   C C     A PRO D  1 225 ? 41.293  -4.182  80.087  0.25 19.17  ? 225  PRO D C     1 
ATOM   8956   O O     A PRO D  1 225 ? 41.804  -4.738  81.055  0.25 17.03  ? 225  PRO D O     1 
ATOM   8957   C CB    A PRO D  1 225 ? 38.856  -3.448  80.105  0.25 19.75  ? 225  PRO D CB    1 
ATOM   8958   C CG    A PRO D  1 225 ? 38.178  -2.180  79.594  0.25 18.50  ? 225  PRO D CG    1 
ATOM   8959   C CD    A PRO D  1 225 ? 39.198  -1.669  78.568  0.25 19.46  ? 225  PRO D CD    1 
ATOM   8960   N N     A PHE D  1 226 ? 41.527  -4.586  78.844  0.25 17.32  ? 226  PHE D N     1 
ATOM   8961   C CA    A PHE D  1 226 ? 42.460  -5.686  78.589  0.25 20.00  ? 226  PHE D CA    1 
ATOM   8962   C C     A PHE D  1 226 ? 43.906  -5.201  78.824  0.25 18.92  ? 226  PHE D C     1 
ATOM   8963   O O     A PHE D  1 226 ? 44.692  -5.891  79.468  0.25 21.44  ? 226  PHE D O     1 
ATOM   8964   C CB    A PHE D  1 226 ? 42.346  -6.183  77.133  0.25 18.37  ? 226  PHE D CB    1 
ATOM   8965   C CG    A PHE D  1 226 ? 41.398  -7.333  76.943  0.25 21.55  ? 226  PHE D CG    1 
ATOM   8966   C CD1   A PHE D  1 226 ? 40.049  -7.202  77.247  0.25 22.82  ? 226  PHE D CD1   1 
ATOM   8967   C CD2   A PHE D  1 226 ? 41.859  -8.550  76.442  0.25 18.74  ? 226  PHE D CD2   1 
ATOM   8968   C CE1   A PHE D  1 226 ? 39.155  -8.264  77.053  0.25 24.30  ? 226  PHE D CE1   1 
ATOM   8969   C CE2   A PHE D  1 226 ? 40.989  -9.616  76.244  0.25 23.32  ? 226  PHE D CE2   1 
ATOM   8970   C CZ    A PHE D  1 226 ? 39.622  -9.478  76.549  0.25 25.08  ? 226  PHE D CZ    1 
ATOM   8971   N N     A ASN D  1 227 ? 44.234  -4.026  78.301  0.25 18.49  ? 227  ASN D N     1 
ATOM   8972   C CA    A ASN D  1 227 ? 45.602  -3.489  78.427  0.25 19.93  ? 227  ASN D CA    1 
ATOM   8973   C C     A ASN D  1 227 ? 46.037  -3.357  79.869  0.25 22.28  ? 227  ASN D C     1 
ATOM   8974   O O     A ASN D  1 227 ? 47.163  -3.721  80.222  0.25 22.36  ? 227  ASN D O     1 
ATOM   8975   C CB    A ASN D  1 227 ? 45.697  -2.130  77.743  0.25 17.70  ? 227  ASN D CB    1 
ATOM   8976   C CG    A ASN D  1 227 ? 45.536  -2.227  76.234  0.25 16.09  ? 227  ASN D CG    1 
ATOM   8977   O OD1   A ASN D  1 227 ? 44.648  -1.602  75.653  0.25 19.61  ? 227  ASN D OD1   1 
ATOM   8978   N ND2   A ASN D  1 227 ? 46.388  -3.011  75.599  0.25 14.20  ? 227  ASN D ND2   1 
ATOM   8979   N N     A ILE D  1 228 ? 45.140  -2.843  80.714  0.25 24.21  ? 228  ILE D N     1 
ATOM   8980   C CA    A ILE D  1 228 ? 45.452  -2.682  82.140  0.25 21.09  ? 228  ILE D CA    1 
ATOM   8981   C C     A ILE D  1 228 ? 45.755  -4.021  82.800  0.25 23.45  ? 228  ILE D C     1 
ATOM   8982   O O     A ILE D  1 228 ? 46.789  -4.178  83.484  0.25 21.07  ? 228  ILE D O     1 
ATOM   8983   C CB    A ILE D  1 228 ? 44.276  -1.999  82.889  0.25 24.03  ? 228  ILE D CB    1 
ATOM   8984   C CG1   A ILE D  1 228 ? 44.143  -0.558  82.410  0.25 22.43  ? 228  ILE D CG1   1 
ATOM   8985   C CG2   A ILE D  1 228 ? 44.505  -2.021  84.415  0.25 20.24  ? 228  ILE D CG2   1 
ATOM   8986   C CD1   A ILE D  1 228 ? 42.927  0.181   82.980  0.25 24.25  ? 228  ILE D CD1   1 
ATOM   8987   N N     A ALA D  1 229 ? 44.876  -5.005  82.585  0.25 22.22  ? 229  ALA D N     1 
ATOM   8988   C CA    A ALA D  1 229 ? 45.074  -6.311  83.209  0.25 23.00  ? 229  ALA D CA    1 
ATOM   8989   C C     A ALA D  1 229 ? 46.288  -7.032  82.586  0.25 20.90  ? 229  ALA D C     1 
ATOM   8990   O O     A ALA D  1 229 ? 47.041  -7.704  83.267  0.25 19.99  ? 229  ALA D O     1 
ATOM   8991   C CB    A ALA D  1 229 ? 43.787  -7.169  83.065  0.25 23.65  ? 229  ALA D CB    1 
ATOM   8992   N N     A SER D  1 230 ? 46.455  -6.898  81.281  0.25 19.71  ? 230  SER D N     1 
ATOM   8993   C CA    A SER D  1 230 ? 47.582  -7.542  80.611  0.25 22.15  ? 230  SER D CA    1 
ATOM   8994   C C     A SER D  1 230 ? 48.945  -7.102  81.188  0.25 21.95  ? 230  SER D C     1 
ATOM   8995   O O     A SER D  1 230 ? 49.751  -7.937  81.599  0.25 24.36  ? 230  SER D O     1 
ATOM   8996   C CB    A SER D  1 230 ? 47.549  -7.223  79.115  0.25 23.03  ? 230  SER D CB    1 
ATOM   8997   O OG    A SER D  1 230 ? 48.479  -8.031  78.391  0.25 22.70  ? 230  SER D OG    1 
ATOM   8998   N N     A TYR D  1 231 ? 49.201  -5.795  81.225  0.25 22.30  ? 231  TYR D N     1 
ATOM   8999   C CA    A TYR D  1 231 ? 50.487  -5.328  81.744  0.25 24.82  ? 231  TYR D CA    1 
ATOM   9000   C C     A TYR D  1 231 ? 50.652  -5.554  83.237  0.25 25.12  ? 231  TYR D C     1 
ATOM   9001   O O     A TYR D  1 231 ? 51.777  -5.751  83.730  0.25 25.07  ? 231  TYR D O     1 
ATOM   9002   C CB    A TYR D  1 231 ? 50.723  -3.875  81.355  0.25 21.38  ? 231  TYR D CB    1 
ATOM   9003   C CG    A TYR D  1 231 ? 51.292  -3.771  79.960  0.25 21.33  ? 231  TYR D CG    1 
ATOM   9004   C CD1   A TYR D  1 231 ? 52.677  -3.794  79.746  0.25 21.62  ? 231  TYR D CD1   1 
ATOM   9005   C CD2   A TYR D  1 231 ? 50.450  -3.757  78.849  0.25 20.07  ? 231  TYR D CD2   1 
ATOM   9006   C CE1   A TYR D  1 231 ? 53.205  -3.811  78.448  0.25 22.78  ? 231  TYR D CE1   1 
ATOM   9007   C CE2   A TYR D  1 231 ? 50.951  -3.777  77.566  0.25 20.99  ? 231  TYR D CE2   1 
ATOM   9008   C CZ    A TYR D  1 231 ? 52.335  -3.805  77.362  0.25 21.10  ? 231  TYR D CZ    1 
ATOM   9009   O OH    A TYR D  1 231 ? 52.817  -3.832  76.071  0.25 19.39  ? 231  TYR D OH    1 
ATOM   9010   N N     A ALA D  1 232 ? 49.538  -5.558  83.964  0.25 24.92  ? 232  ALA D N     1 
ATOM   9011   C CA    A ALA D  1 232 ? 49.605  -5.848  85.397  0.25 24.73  ? 232  ALA D CA    1 
ATOM   9012   C C     A ALA D  1 232 ? 50.060  -7.299  85.529  0.25 24.91  ? 232  ALA D C     1 
ATOM   9013   O O     A ALA D  1 232 ? 50.925  -7.610  86.350  0.25 25.30  ? 232  ALA D O     1 
ATOM   9014   C CB    A ALA D  1 232 ? 48.236  -5.676  86.051  0.25 25.84  ? 232  ALA D CB    1 
ATOM   9015   N N     A LEU D  1 233 ? 49.480  -8.192  84.717  0.25 23.15  ? 233  LEU D N     1 
ATOM   9016   C CA    A LEU D  1 233 ? 49.848  -9.604  84.762  0.25 22.86  ? 233  LEU D CA    1 
ATOM   9017   C C     A LEU D  1 233 ? 51.304  -9.822  84.318  0.25 22.41  ? 233  LEU D C     1 
ATOM   9018   O O     A LEU D  1 233 ? 52.034  -10.632 84.881  0.25 22.51  ? 233  LEU D O     1 
ATOM   9019   C CB    A LEU D  1 233 ? 48.903  -10.426 83.882  0.25 23.28  ? 233  LEU D CB    1 
ATOM   9020   C CG    A LEU D  1 233 ? 47.461  -10.556 84.392  0.25 23.97  ? 233  LEU D CG    1 
ATOM   9021   C CD1   A LEU D  1 233 ? 46.572  -11.131 83.283  0.25 26.73  ? 233  LEU D CD1   1 
ATOM   9022   C CD2   A LEU D  1 233 ? 47.458  -11.458 85.612  0.25 19.88  ? 233  LEU D CD2   1 
ATOM   9023   N N     A LEU D  1 234 ? 51.718  -9.107  83.292  0.25 23.19  ? 234  LEU D N     1 
ATOM   9024   C CA    A LEU D  1 234 ? 53.091  -9.239  82.823  0.25 22.80  ? 234  LEU D CA    1 
ATOM   9025   C C     A LEU D  1 234 ? 54.056  -8.893  83.958  0.25 22.88  ? 234  LEU D C     1 
ATOM   9026   O O     A LEU D  1 234 ? 55.078  -9.567  84.164  0.25 26.42  ? 234  LEU D O     1 
ATOM   9027   C CB    A LEU D  1 234 ? 53.330  -8.292  81.636  0.25 21.08  ? 234  LEU D CB    1 
ATOM   9028   C CG    A LEU D  1 234 ? 54.762  -8.301  81.060  0.25 23.96  ? 234  LEU D CG    1 
ATOM   9029   C CD1   A LEU D  1 234 ? 55.156  -9.713  80.659  0.25 20.97  ? 234  LEU D CD1   1 
ATOM   9030   C CD2   A LEU D  1 234 ? 54.827  -7.348  79.865  0.25 21.54  ? 234  LEU D CD2   1 
ATOM   9031   N N     A THR D  1 235 ? 53.739  -7.834  84.689  0.25 21.68  ? 235  THR D N     1 
ATOM   9032   C CA    A THR D  1 235 ? 54.595  -7.388  85.796  0.25 23.24  ? 235  THR D CA    1 
ATOM   9033   C C     A THR D  1 235 ? 54.643  -8.443  86.895  0.25 25.34  ? 235  THR D C     1 
ATOM   9034   O O     A THR D  1 235 ? 55.716  -8.725  87.450  0.25 24.61  ? 235  THR D O     1 
ATOM   9035   C CB    A THR D  1 235 ? 54.094  -6.050  86.337  0.25 23.84  ? 235  THR D CB    1 
ATOM   9036   O OG1   A THR D  1 235 ? 54.068  -5.114  85.252  0.25 22.84  ? 235  THR D OG1   1 
ATOM   9037   C CG2   A THR D  1 235 ? 55.006  -5.500  87.445  0.25 22.94  ? 235  THR D CG2   1 
ATOM   9038   N N     A HIS D  1 236 ? 53.488  -9.046  87.197  0.25 25.97  ? 236  HIS D N     1 
ATOM   9039   C CA    A HIS D  1 236 ? 53.443  -10.116 88.196  0.25 24.66  ? 236  HIS D CA    1 
ATOM   9040   C C     A HIS D  1 236 ? 54.322  -11.279 87.718  0.25 24.20  ? 236  HIS D C     1 
ATOM   9041   O O     A HIS D  1 236 ? 55.073  -11.841 88.510  0.25 24.18  ? 236  HIS D O     1 
ATOM   9042   C CB    A HIS D  1 236 ? 52.011  -10.622 88.392  0.25 22.00  ? 236  HIS D CB    1 
ATOM   9043   C CG    A HIS D  1 236 ? 51.186  -9.758  89.293  0.25 23.09  ? 236  HIS D CG    1 
ATOM   9044   N ND1   A HIS D  1 236 ? 51.351  -9.748  90.660  0.25 24.27  ? 236  HIS D ND1   1 
ATOM   9045   C CD2   A HIS D  1 236 ? 50.208  -8.858  89.024  0.25 22.62  ? 236  HIS D CD2   1 
ATOM   9046   C CE1   A HIS D  1 236 ? 50.513  -8.875  91.195  0.25 26.68  ? 236  HIS D CE1   1 
ATOM   9047   N NE2   A HIS D  1 236 ? 49.807  -8.324  90.224  0.25 24.81  ? 236  HIS D NE2   1 
ATOM   9048   N N     A MET D  1 237 ? 54.209  -11.640 86.435  0.25 23.55  ? 237  MET D N     1 
ATOM   9049   C CA    A MET D  1 237 ? 54.988  -12.736 85.863  0.25 23.32  ? 237  MET D CA    1 
ATOM   9050   C C     A MET D  1 237 ? 56.481  -12.457 85.996  0.25 25.38  ? 237  MET D C     1 
ATOM   9051   O O     A MET D  1 237 ? 57.239  -13.288 86.497  0.25 27.62  ? 237  MET D O     1 
ATOM   9052   C CB    A MET D  1 237 ? 54.663  -12.922 84.373  0.25 23.95  ? 237  MET D CB    1 
ATOM   9053   C CG    A MET D  1 237 ? 53.292  -13.502 84.066  0.25 24.18  ? 237  MET D CG    1 
ATOM   9054   S SD    A MET D  1 237 ? 52.922  -13.421 82.305  0.25 25.71  ? 237  MET D SD    1 
ATOM   9055   C CE    A MET D  1 237 ? 54.025  -14.635 81.668  0.25 16.19  ? 237  MET D CE    1 
ATOM   9056   N N     A ILE D  1 238 ? 56.899  -11.289 85.530  0.25 24.25  ? 238  ILE D N     1 
ATOM   9057   C CA    A ILE D  1 238 ? 58.300  -10.918 85.598  0.25 25.74  ? 238  ILE D CA    1 
ATOM   9058   C C     A ILE D  1 238 ? 58.799  -10.882 87.030  0.25 25.90  ? 238  ILE D C     1 
ATOM   9059   O O     A ILE D  1 238 ? 59.938  -11.272 87.310  0.25 26.88  ? 238  ILE D O     1 
ATOM   9060   C CB    A ILE D  1 238 ? 58.535  -9.559  84.909  0.25 23.71  ? 238  ILE D CB    1 
ATOM   9061   C CG1   A ILE D  1 238 ? 58.297  -9.716  83.403  0.25 23.16  ? 238  ILE D CG1   1 
ATOM   9062   C CG2   A ILE D  1 238 ? 59.972  -9.067  85.161  0.25 24.48  ? 238  ILE D CG2   1 
ATOM   9063   C CD1   A ILE D  1 238 ? 58.278  -8.387  82.632  0.25 22.85  ? 238  ILE D CD1   1 
ATOM   9064   N N     A ALA D  1 239 ? 57.946  -10.434 87.941  0.25 26.13  ? 239  ALA D N     1 
ATOM   9065   C CA    A ALA D  1 239 ? 58.318  -10.365 89.348  0.25 26.24  ? 239  ALA D CA    1 
ATOM   9066   C C     A ALA D  1 239 ? 58.649  -11.744 89.897  0.25 29.30  ? 239  ALA D C     1 
ATOM   9067   O O     A ALA D  1 239 ? 59.599  -11.908 90.672  0.25 29.52  ? 239  ALA D O     1 
ATOM   9068   C CB    A ALA D  1 239 ? 57.182  -9.734  90.166  0.25 25.39  ? 239  ALA D CB    1 
ATOM   9069   N N     A LEU D  1 240 ? 57.858  -12.739 89.503  0.25 29.38  ? 240  LEU D N     1 
ATOM   9070   C CA    A LEU D  1 240 ? 58.076  -14.096 89.966  0.25 30.80  ? 240  LEU D CA    1 
ATOM   9071   C C     A LEU D  1 240 ? 59.429  -14.642 89.486  0.25 31.32  ? 240  LEU D C     1 
ATOM   9072   O O     A LEU D  1 240 ? 60.186  -15.237 90.253  0.25 30.94  ? 240  LEU D O     1 
ATOM   9073   C CB    A LEU D  1 240 ? 56.946  -15.015 89.471  0.25 28.76  ? 240  LEU D CB    1 
ATOM   9074   C CG    A LEU D  1 240 ? 57.066  -16.491 89.874  0.25 30.16  ? 240  LEU D CG    1 
ATOM   9075   C CD1   A LEU D  1 240 ? 57.031  -16.624 91.396  0.25 29.76  ? 240  LEU D CD1   1 
ATOM   9076   C CD2   A LEU D  1 240 ? 55.915  -17.290 89.253  0.25 29.91  ? 240  LEU D CD2   1 
ATOM   9077   N N     A ILE D  1 241 ? 59.721  -14.445 88.209  0.25 29.46  ? 241  ILE D N     1 
ATOM   9078   C CA    A ILE D  1 241 ? 60.963  -14.946 87.636  0.25 27.82  ? 241  ILE D CA    1 
ATOM   9079   C C     A ILE D  1 241 ? 62.203  -14.207 88.128  0.25 28.76  ? 241  ILE D C     1 
ATOM   9080   O O     A ILE D  1 241 ? 63.290  -14.785 88.170  0.25 31.50  ? 241  ILE D O     1 
ATOM   9081   C CB    A ILE D  1 241 ? 60.925  -14.861 86.091  0.25 28.61  ? 241  ILE D CB    1 
ATOM   9082   C CG1   A ILE D  1 241 ? 59.690  -15.598 85.558  0.25 28.17  ? 241  ILE D CG1   1 
ATOM   9083   C CG2   A ILE D  1 241 ? 62.195  -15.467 85.488  0.25 29.69  ? 241  ILE D CG2   1 
ATOM   9084   C CD1   A ILE D  1 241 ? 59.604  -17.056 85.969  0.25 28.45  ? 241  ILE D CD1   1 
ATOM   9085   N N     A THR D  1 242 ? 62.048  -12.943 88.511  0.25 29.20  ? 242  THR D N     1 
ATOM   9086   C CA    A THR D  1 242 ? 63.188  -12.133 88.957  0.25 28.54  ? 242  THR D CA    1 
ATOM   9087   C C     A THR D  1 242 ? 63.311  -11.970 90.476  0.25 30.11  ? 242  THR D C     1 
ATOM   9088   O O     A THR D  1 242 ? 64.163  -11.206 90.959  0.25 27.89  ? 242  THR D O     1 
ATOM   9089   C CB    A THR D  1 242 ? 63.124  -10.728 88.346  0.25 27.45  ? 242  THR D CB    1 
ATOM   9090   O OG1   A THR D  1 242 ? 61.913  -10.086 88.764  0.25 27.90  ? 242  THR D OG1   1 
ATOM   9091   C CG2   A THR D  1 242 ? 63.150  -10.798 86.816  0.25 25.66  ? 242  THR D CG2   1 
ATOM   9092   N N     A ASP D  1 243 ? 62.465  -12.676 91.223  0.25 29.86  ? 243  ASP D N     1 
ATOM   9093   C CA    A ASP D  1 243 ? 62.491  -12.588 92.676  0.25 32.06  ? 243  ASP D CA    1 
ATOM   9094   C C     A ASP D  1 243 ? 62.255  -11.166 93.175  0.25 32.10  ? 243  ASP D C     1 
ATOM   9095   O O     A ASP D  1 243 ? 62.894  -10.724 94.127  0.25 33.06  ? 243  ASP D O     1 
ATOM   9096   C CB    A ASP D  1 243 ? 63.831  -13.108 93.220  0.25 34.53  ? 243  ASP D CB    1 
ATOM   9097   C CG    A ASP D  1 243 ? 63.957  -14.618 93.110  0.25 36.46  ? 243  ASP D CG    1 
ATOM   9098   O OD1   A ASP D  1 243 ? 65.089  -15.126 93.081  0.25 41.04  ? 243  ASP D OD1   1 
ATOM   9099   O OD2   A ASP D  1 243 ? 62.920  -15.309 93.064  0.25 40.77  ? 243  ASP D OD2   1 
ATOM   9100   N N     A THR D  1 244 ? 61.352  -10.436 92.519  0.25 31.57  ? 244  THR D N     1 
ATOM   9101   C CA    A THR D  1 244 ? 61.024  -9.079  92.953  0.25 26.90  ? 244  THR D CA    1 
ATOM   9102   C C     A THR D  1 244 ? 59.555  -9.042  93.352  0.25 27.73  ? 244  THR D C     1 
ATOM   9103   O O     A THR D  1 244 ? 58.804  -9.963  93.067  0.25 29.48  ? 244  THR D O     1 
ATOM   9104   C CB    A THR D  1 244 ? 61.278  -8.034  91.837  0.25 25.43  ? 244  THR D CB    1 
ATOM   9105   O OG1   A THR D  1 244 ? 60.606  -8.433  90.635  0.25 23.11  ? 244  THR D OG1   1 
ATOM   9106   C CG2   A THR D  1 244 ? 62.779  -7.918  91.554  0.25 27.02  ? 244  THR D CG2   1 
ATOM   9107   N N     A GLU D  1 245 ? 59.144  -7.968  94.009  0.25 29.05  ? 245  GLU D N     1 
ATOM   9108   C CA    A GLU D  1 245 ? 57.770  -7.820  94.454  0.25 30.74  ? 245  GLU D CA    1 
ATOM   9109   C C     A GLU D  1 245 ? 57.039  -6.785  93.605  0.25 29.41  ? 245  GLU D C     1 
ATOM   9110   O O     A GLU D  1 245 ? 57.440  -5.633  93.554  0.25 29.98  ? 245  GLU D O     1 
ATOM   9111   C CB    A GLU D  1 245 ? 57.763  -7.380  95.918  0.25 31.91  ? 245  GLU D CB    1 
ATOM   9112   C CG    A GLU D  1 245 ? 56.400  -7.148  96.521  0.25 34.86  ? 245  GLU D CG    1 
ATOM   9113   C CD    A GLU D  1 245 ? 55.578  -8.417  96.605  0.25 40.00  ? 245  GLU D CD    1 
ATOM   9114   O OE1   A GLU D  1 245 ? 56.177  -9.505  96.795  0.25 43.49  ? 245  GLU D OE1   1 
ATOM   9115   O OE2   A GLU D  1 245 ? 54.333  -8.335  96.500  0.25 41.27  ? 245  GLU D OE2   1 
ATOM   9116   N N     A PRO D  1 246 ? 55.956  -7.187  92.929  0.25 29.54  ? 246  PRO D N     1 
ATOM   9117   C CA    A PRO D  1 246 ? 55.214  -6.229  92.106  0.25 29.56  ? 246  PRO D CA    1 
ATOM   9118   C C     A PRO D  1 246 ? 54.775  -5.044  92.963  0.25 29.82  ? 246  PRO D C     1 
ATOM   9119   O O     A PRO D  1 246 ? 54.292  -5.214  94.095  0.25 30.59  ? 246  PRO D O     1 
ATOM   9120   C CB    A PRO D  1 246 ? 54.045  -7.061  91.566  0.25 30.23  ? 246  PRO D CB    1 
ATOM   9121   C CG    A PRO D  1 246 ? 53.860  -8.120  92.601  0.25 35.00  ? 246  PRO D CG    1 
ATOM   9122   C CD    A PRO D  1 246 ? 55.272  -8.492  92.985  0.25 30.67  ? 246  PRO D CD    1 
ATOM   9123   N N     A HIS D  1 247 ? 54.950  -3.841  92.433  0.25 29.13  ? 247  HIS D N     1 
ATOM   9124   C CA    A HIS D  1 247 ? 54.609  -2.651  93.189  0.25 30.58  ? 247  HIS D CA    1 
ATOM   9125   C C     A HIS D  1 247 ? 53.549  -1.765  92.555  0.25 30.63  ? 247  HIS D C     1 
ATOM   9126   O O     A HIS D  1 247 ? 52.450  -1.612  93.097  0.25 30.89  ? 247  HIS D O     1 
ATOM   9127   C CB    A HIS D  1 247 ? 55.894  -1.843  93.477  0.25 30.47  ? 247  HIS D CB    1 
ATOM   9128   C CG    A HIS D  1 247 ? 55.661  -0.581  94.250  0.25 33.40  ? 247  HIS D CG    1 
ATOM   9129   N ND1   A HIS D  1 247 ? 55.021  -0.563  95.469  0.25 33.44  ? 247  HIS D ND1   1 
ATOM   9130   C CD2   A HIS D  1 247 ? 55.965  0.709   93.965  0.25 32.12  ? 247  HIS D CD2   1 
ATOM   9131   C CE1   A HIS D  1 247 ? 54.935  0.684   95.900  0.25 32.86  ? 247  HIS D CE1   1 
ATOM   9132   N NE2   A HIS D  1 247 ? 55.501  1.473   95.005  0.25 34.33  ? 247  HIS D NE2   1 
ATOM   9133   N N     A GLU D  1 248 ? 53.860  -1.196  91.395  0.25 31.33  ? 248  GLU D N     1 
ATOM   9134   C CA    A GLU D  1 248 ? 52.919  -0.285  90.747  0.25 28.98  ? 248  GLU D CA    1 
ATOM   9135   C C     A GLU D  1 248 ? 52.938  -0.399  89.227  0.25 28.72  ? 248  GLU D C     1 
ATOM   9136   O O     A GLU D  1 248 ? 53.985  -0.691  88.631  0.25 24.57  ? 248  GLU D O     1 
ATOM   9137   C CB    A GLU D  1 248 ? 53.291  1.142   91.139  0.25 31.69  ? 248  GLU D CB    1 
ATOM   9138   C CG    A GLU D  1 248 ? 52.304  2.220   90.749  0.25 37.98  ? 248  GLU D CG    1 
ATOM   9139   C CD    A GLU D  1 248 ? 52.752  3.612   91.238  0.25 42.02  ? 248  GLU D CD    1 
ATOM   9140   O OE1   A GLU D  1 248 ? 51.950  4.576   91.179  0.25 44.49  ? 248  GLU D OE1   1 
ATOM   9141   O OE2   A GLU D  1 248 ? 53.918  3.738   91.668  0.25 42.82  ? 248  GLU D OE2   1 
ATOM   9142   N N     A PHE D  1 249 ? 51.778  -0.168  88.618  0.25 24.63  ? 249  PHE D N     1 
ATOM   9143   C CA    A PHE D  1 249 ? 51.633  -0.164  87.172  0.25 24.02  ? 249  PHE D CA    1 
ATOM   9144   C C     A PHE D  1 249 ? 51.078  1.196   86.790  0.25 25.77  ? 249  PHE D C     1 
ATOM   9145   O O     A PHE D  1 249 ? 50.050  1.640   87.348  0.25 25.59  ? 249  PHE D O     1 
ATOM   9146   C CB    A PHE D  1 249 ? 50.664  -1.257  86.692  0.25 27.75  ? 249  PHE D CB    1 
ATOM   9147   C CG    A PHE D  1 249 ? 50.262  -1.100  85.253  0.25 27.65  ? 249  PHE D CG    1 
ATOM   9148   C CD1   A PHE D  1 249 ? 51.231  -1.003  84.253  0.25 28.21  ? 249  PHE D CD1   1 
ATOM   9149   C CD2   A PHE D  1 249 ? 48.925  -0.979  84.903  0.25 28.83  ? 249  PHE D CD2   1 
ATOM   9150   C CE1   A PHE D  1 249 ? 50.872  -0.777  82.911  0.25 28.48  ? 249  PHE D CE1   1 
ATOM   9151   C CE2   A PHE D  1 249 ? 48.547  -0.753  83.573  0.25 30.41  ? 249  PHE D CE2   1 
ATOM   9152   C CZ    A PHE D  1 249 ? 49.528  -0.649  82.571  0.25 27.87  ? 249  PHE D CZ    1 
ATOM   9153   N N     A ILE D  1 250 ? 51.755  1.872   85.863  0.25 23.37  ? 250  ILE D N     1 
ATOM   9154   C CA    A ILE D  1 250 ? 51.325  3.182   85.410  0.25 22.64  ? 250  ILE D CA    1 
ATOM   9155   C C     A ILE D  1 250 ? 50.999  3.099   83.928  0.25 24.43  ? 250  ILE D C     1 
ATOM   9156   O O     A ILE D  1 250 ? 51.744  2.507   83.143  0.25 25.00  ? 250  ILE D O     1 
ATOM   9157   C CB    A ILE D  1 250 ? 52.433  4.261   85.601  0.25 23.60  ? 250  ILE D CB    1 
ATOM   9158   C CG1   A ILE D  1 250 ? 52.897  4.319   87.059  0.25 24.74  ? 250  ILE D CG1   1 
ATOM   9159   C CG2   A ILE D  1 250 ? 51.904  5.618   85.169  0.25 24.94  ? 250  ILE D CG2   1 
ATOM   9160   C CD1   A ILE D  1 250 ? 53.899  3.245   87.445  0.25 24.24  ? 250  ILE D CD1   1 
ATOM   9161   N N     A LEU D  1 251 ? 49.893  3.712   83.539  0.25 24.46  ? 251  LEU D N     1 
ATOM   9162   C CA    A LEU D  1 251 ? 49.485  3.691   82.151  0.25 25.31  ? 251  LEU D CA    1 
ATOM   9163   C C     A LEU D  1 251 ? 49.289  5.101   81.615  0.25 24.70  ? 251  LEU D C     1 
ATOM   9164   O O     A LEU D  1 251 ? 48.431  5.850   82.103  0.25 23.22  ? 251  LEU D O     1 
ATOM   9165   C CB    A LEU D  1 251 ? 48.185  2.866   82.005  0.25 24.80  ? 251  LEU D CB    1 
ATOM   9166   C CG    A LEU D  1 251 ? 47.469  2.839   80.661  0.25 26.84  ? 251  LEU D CG    1 
ATOM   9167   C CD1   A LEU D  1 251 ? 48.430  2.543   79.539  0.25 28.20  ? 251  LEU D CD1   1 
ATOM   9168   C CD2   A LEU D  1 251 ? 46.372  1.786   80.708  0.25 28.33  ? 251  LEU D CD2   1 
ATOM   9169   N N     A GLN D  1 252 ? 50.105  5.472   80.621  0.25 24.48  ? 252  GLN D N     1 
ATOM   9170   C CA    A GLN D  1 252 ? 49.985  6.792   79.991  0.25 22.54  ? 252  GLN D CA    1 
ATOM   9171   C C     A GLN D  1 252 ? 49.360  6.619   78.619  0.25 20.19  ? 252  GLN D C     1 
ATOM   9172   O O     A GLN D  1 252 ? 49.808  5.821   77.814  0.25 18.29  ? 252  GLN D O     1 
ATOM   9173   C CB    A GLN D  1 252 ? 51.349  7.488   79.850  0.25 27.77  ? 252  GLN D CB    1 
ATOM   9174   C CG    A GLN D  1 252 ? 51.292  8.798   79.086  0.25 23.99  ? 252  GLN D CG    1 
ATOM   9175   C CD    A GLN D  1 252 ? 50.408  9.841   79.740  0.25 29.68  ? 252  GLN D CD    1 
ATOM   9176   O OE1   A GLN D  1 252 ? 49.580  10.489  79.072  0.25 29.08  ? 252  GLN D OE1   1 
ATOM   9177   N NE2   A GLN D  1 252 ? 50.576  10.029  81.046  0.25 29.73  ? 252  GLN D NE2   1 
ATOM   9178   N N     A MET D  1 253 ? 48.326  7.396   78.355  0.25 19.19  ? 253  MET D N     1 
ATOM   9179   C CA    A MET D  1 253 ? 47.623  7.312   77.090  0.25 23.05  ? 253  MET D CA    1 
ATOM   9180   C C     A MET D  1 253 ? 47.921  8.476   76.161  0.25 19.53  ? 253  MET D C     1 
ATOM   9181   O O     A MET D  1 253 ? 48.218  9.568   76.608  0.25 19.64  ? 253  MET D O     1 
ATOM   9182   C CB    A MET D  1 253 ? 46.113  7.283   77.332  0.25 19.01  ? 253  MET D CB    1 
ATOM   9183   C CG    A MET D  1 253 ? 45.665  6.173   78.218  0.25 23.08  ? 253  MET D CG    1 
ATOM   9184   S SD    A MET D  1 253 ? 43.840  6.248   78.319  0.25 24.53  ? 253  MET D SD    1 
ATOM   9185   C CE    A MET D  1 253 ? 43.622  5.146   79.786  0.25 24.05  ? 253  MET D CE    1 
ATOM   9186   N N     A GLY D  1 254 ? 47.824  8.210   74.865  0.25 19.35  ? 254  GLY D N     1 
ATOM   9187   C CA    A GLY D  1 254 ? 48.018  9.247   73.868  0.25 17.25  ? 254  GLY D CA    1 
ATOM   9188   C C     A GLY D  1 254 ? 46.610  9.596   73.406  0.25 20.54  ? 254  GLY D C     1 
ATOM   9189   O O     A GLY D  1 254 ? 45.919  10.372  74.055  0.25 17.50  ? 254  GLY D O     1 
ATOM   9190   N N     A ASP D  1 255 ? 46.164  9.011   72.292  0.25 19.70  ? 255  ASP D N     1 
ATOM   9191   C CA    A ASP D  1 255 ? 44.824  9.301   71.785  0.25 21.49  ? 255  ASP D CA    1 
ATOM   9192   C C     A ASP D  1 255 ? 43.845  8.442   72.594  0.25 21.99  ? 255  ASP D C     1 
ATOM   9193   O O     A ASP D  1 255 ? 43.687  7.266   72.311  0.25 22.87  ? 255  ASP D O     1 
ATOM   9194   C CB    A ASP D  1 255 ? 44.732  8.947   70.293  0.25 22.86  ? 255  ASP D CB    1 
ATOM   9195   C CG    A ASP D  1 255 ? 43.415  9.410   69.652  0.25 26.24  ? 255  ASP D CG    1 
ATOM   9196   O OD1   A ASP D  1 255 ? 43.460  10.072  68.584  0.25 22.83  ? 255  ASP D OD1   1 
ATOM   9197   O OD2   A ASP D  1 255 ? 42.329  9.118   70.193  0.25 26.57  ? 255  ASP D OD2   1 
ATOM   9198   N N     A ALA D  1 256 ? 43.230  9.029   73.610  0.25 20.03  ? 256  ALA D N     1 
ATOM   9199   C CA    A ALA D  1 256 ? 42.285  8.310   74.467  0.25 22.98  ? 256  ALA D CA    1 
ATOM   9200   C C     A ALA D  1 256 ? 40.889  8.611   73.949  0.25 21.64  ? 256  ALA D C     1 
ATOM   9201   O O     A ALA D  1 256 ? 40.436  9.745   74.016  0.25 22.00  ? 256  ALA D O     1 
ATOM   9202   C CB    A ALA D  1 256 ? 42.431  8.779   75.923  0.25 23.43  ? 256  ALA D CB    1 
ATOM   9203   N N     A HIS D  1 257 ? 40.201  7.583   73.470  0.25 24.77  ? 257  HIS D N     1 
ATOM   9204   C CA    A HIS D  1 257 ? 38.881  7.757   72.885  0.25 23.28  ? 257  HIS D CA    1 
ATOM   9205   C C     A HIS D  1 257 ? 37.800  6.732   73.258  0.25 23.12  ? 257  HIS D C     1 
ATOM   9206   O O     A HIS D  1 257 ? 38.076  5.619   73.719  0.25 22.06  ? 257  HIS D O     1 
ATOM   9207   C CB    A HIS D  1 257 ? 39.029  7.754   71.368  0.25 21.25  ? 257  HIS D CB    1 
ATOM   9208   C CG    A HIS D  1 257 ? 39.754  6.553   70.842  0.25 22.55  ? 257  HIS D CG    1 
ATOM   9209   N ND1   A HIS D  1 257 ? 41.127  6.503   70.732  0.25 25.38  ? 257  HIS D ND1   1 
ATOM   9210   C CD2   A HIS D  1 257 ? 39.298  5.346   70.420  0.25 24.03  ? 257  HIS D CD2   1 
ATOM   9211   C CE1   A HIS D  1 257 ? 41.485  5.319   70.262  0.25 26.92  ? 257  HIS D CE1   1 
ATOM   9212   N NE2   A HIS D  1 257 ? 40.393  4.596   70.066  0.25 23.55  ? 257  HIS D NE2   1 
ATOM   9213   N N     A VAL D  1 258 ? 36.559  7.131   73.005  0.25 23.35  ? 258  VAL D N     1 
ATOM   9214   C CA    A VAL D  1 258 ? 35.379  6.303   73.239  0.25 21.54  ? 258  VAL D CA    1 
ATOM   9215   C C     A VAL D  1 258 ? 34.648  6.256   71.901  0.25 22.24  ? 258  VAL D C     1 
ATOM   9216   O O     A VAL D  1 258 ? 34.255  7.294   71.386  0.25 25.10  ? 258  VAL D O     1 
ATOM   9217   C CB    A VAL D  1 258 ? 34.450  6.941   74.282  0.25 21.69  ? 258  VAL D CB    1 
ATOM   9218   C CG1   A VAL D  1 258 ? 33.137  6.144   74.365  0.25 21.24  ? 258  VAL D CG1   1 
ATOM   9219   C CG2   A VAL D  1 258 ? 35.144  6.959   75.644  0.25 24.33  ? 258  VAL D CG2   1 
ATOM   9220   N N     A TYR D  1 259 ? 34.497  5.069   71.324  0.25 22.60  ? 259  TYR D N     1 
ATOM   9221   C CA    A TYR D  1 259 ? 33.802  4.936   70.044  0.25 22.59  ? 259  TYR D CA    1 
ATOM   9222   C C     A TYR D  1 259 ? 32.337  5.356   70.170  0.25 22.53  ? 259  TYR D C     1 
ATOM   9223   O O     A TYR D  1 259 ? 31.722  5.191   71.218  0.25 21.93  ? 259  TYR D O     1 
ATOM   9224   C CB    A TYR D  1 259 ? 33.891  3.514   69.523  0.25 21.14  ? 259  TYR D CB    1 
ATOM   9225   C CG    A TYR D  1 259 ? 35.214  3.227   68.849  0.25 24.13  ? 259  TYR D CG    1 
ATOM   9226   C CD1   A TYR D  1 259 ? 36.300  2.751   69.579  0.25 22.32  ? 259  TYR D CD1   1 
ATOM   9227   C CD2   A TYR D  1 259 ? 35.397  3.496   67.490  0.25 24.78  ? 259  TYR D CD2   1 
ATOM   9228   C CE1   A TYR D  1 259 ? 37.543  2.547   68.979  0.25 19.59  ? 259  TYR D CE1   1 
ATOM   9229   C CE2   A TYR D  1 259 ? 36.633  3.302   66.886  0.25 26.10  ? 259  TYR D CE2   1 
ATOM   9230   C CZ    A TYR D  1 259 ? 37.702  2.826   67.639  0.25 23.24  ? 259  TYR D CZ    1 
ATOM   9231   O OH    A TYR D  1 259 ? 38.929  2.637   67.027  0.25 26.38  ? 259  TYR D OH    1 
ATOM   9232   N N     A ARG D  1 260 ? 31.810  5.913   69.090  0.25 25.52  ? 260  ARG D N     1 
ATOM   9233   C CA    A ARG D  1 260 ? 30.436  6.408   69.073  0.25 30.39  ? 260  ARG D CA    1 
ATOM   9234   C C     A ARG D  1 260 ? 29.429  5.360   69.526  0.25 26.87  ? 260  ARG D C     1 
ATOM   9235   O O     A ARG D  1 260 ? 28.522  5.664   70.271  0.25 27.67  ? 260  ARG D O     1 
ATOM   9236   C CB    A ARG D  1 260 ? 30.068  6.906   67.668  0.25 35.63  ? 260  ARG D CB    1 
ATOM   9237   C CG    A ARG D  1 260 ? 31.101  7.850   67.050  0.25 45.39  ? 260  ARG D CG    1 
ATOM   9238   C CD    A ARG D  1 260 ? 31.176  9.199   67.762  0.25 50.28  ? 260  ARG D CD    1 
ATOM   9239   N NE    A ARG D  1 260 ? 30.296  10.179  67.132  0.25 56.19  ? 260  ARG D NE    1 
ATOM   9240   C CZ    A ARG D  1 260 ? 30.476  10.672  65.906  0.25 58.24  ? 260  ARG D CZ    1 
ATOM   9241   N NH1   A ARG D  1 260 ? 31.510  10.281  65.169  0.25 59.02  ? 260  ARG D NH1   1 
ATOM   9242   N NH2   A ARG D  1 260 ? 29.617  11.561  65.413  0.25 58.68  ? 260  ARG D NH2   1 
ATOM   9243   N N     A ASP D  1 261 ? 29.612  4.120   69.092  0.25 26.99  ? 261  ASP D N     1 
ATOM   9244   C CA    A ASP D  1 261 ? 28.669  3.061   69.446  0.25 28.02  ? 261  ASP D CA    1 
ATOM   9245   C C     A ASP D  1 261 ? 28.928  2.458   70.815  0.25 26.77  ? 261  ASP D C     1 
ATOM   9246   O O     A ASP D  1 261 ? 28.303  1.463   71.179  0.25 28.39  ? 261  ASP D O     1 
ATOM   9247   C CB    A ASP D  1 261 ? 28.658  1.973   68.356  0.25 26.24  ? 261  ASP D CB    1 
ATOM   9248   C CG    A ASP D  1 261 ? 30.034  1.381   68.113  0.25 30.52  ? 261  ASP D CG    1 
ATOM   9249   O OD1   A ASP D  1 261 ? 31.054  2.017   68.492  0.25 26.42  ? 261  ASP D OD1   1 
ATOM   9250   O OD2   A ASP D  1 261 ? 30.098  0.282   67.532  0.25 31.40  ? 261  ASP D OD2   1 
ATOM   9251   N N     A HIS D  1 262 ? 29.831  3.070   71.584  0.25 25.48  ? 262  HIS D N     1 
ATOM   9252   C CA    A HIS D  1 262 ? 30.139  2.593   72.926  0.25 25.16  ? 262  HIS D CA    1 
ATOM   9253   C C     A HIS D  1 262 ? 29.580  3.547   73.997  0.25 26.23  ? 262  HIS D C     1 
ATOM   9254   O O     A HIS D  1 262 ? 29.480  3.193   75.176  0.25 28.10  ? 262  HIS D O     1 
ATOM   9255   C CB    A HIS D  1 262 ? 31.661  2.474   73.139  0.25 24.93  ? 262  HIS D CB    1 
ATOM   9256   C CG    A HIS D  1 262 ? 32.300  1.336   72.406  0.25 22.66  ? 262  HIS D CG    1 
ATOM   9257   N ND1   A HIS D  1 262 ? 33.649  1.049   72.512  0.25 23.18  ? 262  HIS D ND1   1 
ATOM   9258   C CD2   A HIS D  1 262 ? 31.778  0.399   71.577  0.25 20.48  ? 262  HIS D CD2   1 
ATOM   9259   C CE1   A HIS D  1 262 ? 33.925  -0.015  71.781  0.25 22.32  ? 262  HIS D CE1   1 
ATOM   9260   N NE2   A HIS D  1 262 ? 32.809  -0.428  71.204  0.25 20.61  ? 262  HIS D NE2   1 
ATOM   9261   N N     A VAL D  1 263 ? 29.240  4.758   73.590  0.25 26.81  ? 263  VAL D N     1 
ATOM   9262   C CA    A VAL D  1 263 ? 28.733  5.767   74.524  0.25 29.84  ? 263  VAL D CA    1 
ATOM   9263   C C     A VAL D  1 263 ? 27.571  5.288   75.404  0.25 30.82  ? 263  VAL D C     1 
ATOM   9264   O O     A VAL D  1 263 ? 27.655  5.354   76.632  0.25 31.27  ? 263  VAL D O     1 
ATOM   9265   C CB    A VAL D  1 263 ? 28.307  7.051   73.774  0.25 31.33  ? 263  VAL D CB    1 
ATOM   9266   C CG1   A VAL D  1 263 ? 27.654  8.040   74.743  0.25 32.62  ? 263  VAL D CG1   1 
ATOM   9267   C CG2   A VAL D  1 263 ? 29.545  7.699   73.126  0.25 31.57  ? 263  VAL D CG2   1 
ATOM   9268   N N     A GLU D  1 264 ? 26.495  4.806   74.786  0.25 30.17  ? 264  GLU D N     1 
ATOM   9269   C CA    A GLU D  1 264 ? 25.352  4.329   75.549  0.25 30.50  ? 264  GLU D CA    1 
ATOM   9270   C C     A GLU D  1 264 ? 25.685  3.123   76.424  0.25 28.98  ? 264  GLU D C     1 
ATOM   9271   O O     A GLU D  1 264 ? 25.323  3.080   77.590  0.25 29.23  ? 264  GLU D O     1 
ATOM   9272   C CB    A GLU D  1 264 ? 24.199  4.015   74.604  0.25 34.25  ? 264  GLU D CB    1 
ATOM   9273   C CG    A GLU D  1 264 ? 23.598  5.258   73.965  0.25 37.81  ? 264  GLU D CG    1 
ATOM   9274   C CD    A GLU D  1 264 ? 23.274  6.328   74.997  0.25 43.62  ? 264  GLU D CD    1 
ATOM   9275   O OE1   A GLU D  1 264 ? 22.553  6.017   75.979  0.25 43.63  ? 264  GLU D OE1   1 
ATOM   9276   O OE2   A GLU D  1 264 ? 23.743  7.483   74.830  0.25 42.86  ? 264  GLU D OE2   1 
ATOM   9277   N N     A PRO D  1 265 ? 26.374  2.111   75.871  0.25 28.44  ? 265  PRO D N     1 
ATOM   9278   C CA    A PRO D  1 265 ? 26.701  0.962   76.720  0.25 27.22  ? 265  PRO D CA    1 
ATOM   9279   C C     A PRO D  1 265 ? 27.539  1.356   77.949  0.25 27.82  ? 265  PRO D C     1 
ATOM   9280   O O     A PRO D  1 265 ? 27.353  0.811   79.048  0.25 28.41  ? 265  PRO D O     1 
ATOM   9281   C CB    A PRO D  1 265 ? 27.472  0.054   75.772  0.25 25.08  ? 265  PRO D CB    1 
ATOM   9282   C CG    A PRO D  1 265 ? 26.847  0.334   74.471  0.25 24.83  ? 265  PRO D CG    1 
ATOM   9283   C CD    A PRO D  1 265 ? 26.705  1.828   74.461  0.25 27.72  ? 265  PRO D CD    1 
ATOM   9284   N N     A LEU D  1 266 ? 28.467  2.296   77.765  0.25 26.38  ? 266  LEU D N     1 
ATOM   9285   C CA    A LEU D  1 266 ? 29.333  2.730   78.865  0.25 27.22  ? 266  LEU D CA    1 
ATOM   9286   C C     A LEU D  1 266 ? 28.552  3.511   79.926  0.25 29.04  ? 266  LEU D C     1 
ATOM   9287   O O     A LEU D  1 266 ? 28.881  3.458   81.111  0.25 28.44  ? 266  LEU D O     1 
ATOM   9288   C CB    A LEU D  1 266 ? 30.501  3.589   78.326  0.25 25.47  ? 266  LEU D CB    1 
ATOM   9289   C CG    A LEU D  1 266 ? 31.577  2.811   77.541  0.25 25.99  ? 266  LEU D CG    1 
ATOM   9290   C CD1   A LEU D  1 266 ? 32.620  3.757   76.929  0.25 24.01  ? 266  LEU D CD1   1 
ATOM   9291   C CD2   A LEU D  1 266 ? 32.252  1.816   78.483  0.25 18.29  ? 266  LEU D CD2   1 
ATOM   9292   N N     A LYS D  1 267 ? 27.523  4.243   79.507  0.25 29.73  ? 267  LYS D N     1 
ATOM   9293   C CA    A LYS D  1 267 ? 26.721  5.002   80.477  0.25 33.15  ? 267  LYS D CA    1 
ATOM   9294   C C     A LYS D  1 267 ? 26.135  4.059   81.506  0.25 30.53  ? 267  LYS D C     1 
ATOM   9295   O O     A LYS D  1 267 ? 26.021  4.392   82.675  0.25 34.47  ? 267  LYS D O     1 
ATOM   9296   C CB    A LYS D  1 267 ? 25.602  5.777   79.778  0.25 35.21  ? 267  LYS D CB    1 
ATOM   9297   C CG    A LYS D  1 267 ? 26.104  6.973   78.975  0.25 38.42  ? 267  LYS D CG    1 
ATOM   9298   C CD    A LYS D  1 267 ? 24.953  7.705   78.320  0.25 39.62  ? 267  LYS D CD    1 
ATOM   9299   C CE    A LYS D  1 267 ? 25.452  8.891   77.520  0.25 42.69  ? 267  LYS D CE    1 
ATOM   9300   N NZ    A LYS D  1 267 ? 24.336  9.561   76.795  0.25 45.86  ? 267  LYS D NZ    1 
ATOM   9301   N N     A THR D  1 268 ? 25.787  2.862   81.070  0.25 32.42  ? 268  THR D N     1 
ATOM   9302   C CA    A THR D  1 268 ? 25.242  1.852   81.974  0.25 32.47  ? 268  THR D CA    1 
ATOM   9303   C C     A THR D  1 268 ? 26.332  1.425   82.952  0.25 32.24  ? 268  THR D C     1 
ATOM   9304   O O     A THR D  1 268 ? 26.080  1.237   84.150  0.25 32.94  ? 268  THR D O     1 
ATOM   9305   C CB    A THR D  1 268 ? 24.777  0.601   81.191  0.25 34.92  ? 268  THR D CB    1 
ATOM   9306   O OG1   A THR D  1 268 ? 23.696  0.955   80.321  0.25 36.07  ? 268  THR D OG1   1 
ATOM   9307   C CG2   A THR D  1 268 ? 24.327  -0.488  82.149  0.25 36.36  ? 268  THR D CG2   1 
ATOM   9308   N N     A GLN D  1 269 ? 27.556  1.288   82.449  0.25 28.60  ? 269  GLN D N     1 
ATOM   9309   C CA    A GLN D  1 269 ? 28.658  0.869   83.304  0.25 29.46  ? 269  GLN D CA    1 
ATOM   9310   C C     A GLN D  1 269 ? 29.014  1.945   84.329  0.25 28.16  ? 269  GLN D C     1 
ATOM   9311   O O     A GLN D  1 269 ? 29.377  1.636   85.462  0.25 26.48  ? 269  GLN D O     1 
ATOM   9312   C CB    A GLN D  1 269 ? 29.899  0.524   82.456  0.25 27.51  ? 269  GLN D CB    1 
ATOM   9313   C CG    A GLN D  1 269 ? 31.045  -0.071  83.263  0.25 26.55  ? 269  GLN D CG    1 
ATOM   9314   C CD    A GLN D  1 269 ? 32.177  -0.609  82.389  0.25 25.47  ? 269  GLN D CD    1 
ATOM   9315   O OE1   A GLN D  1 269 ? 33.248  -0.958  82.899  0.25 26.56  ? 269  GLN D OE1   1 
ATOM   9316   N NE2   A GLN D  1 269 ? 31.944  -0.683  81.081  0.25 19.48  ? 269  GLN D NE2   1 
ATOM   9317   N N     A LEU D  1 270 ? 28.902  3.203   83.920  0.25 32.15  ? 270  LEU D N     1 
ATOM   9318   C CA    A LEU D  1 270 ? 29.235  4.332   84.797  0.25 34.68  ? 270  LEU D CA    1 
ATOM   9319   C C     A LEU D  1 270 ? 28.372  4.412   86.042  0.25 34.92  ? 270  LEU D C     1 
ATOM   9320   O O     A LEU D  1 270 ? 28.748  5.062   87.010  0.25 35.20  ? 270  LEU D O     1 
ATOM   9321   C CB    A LEU D  1 270 ? 29.125  5.651   84.025  0.25 35.18  ? 270  LEU D CB    1 
ATOM   9322   C CG    A LEU D  1 270 ? 30.133  5.865   82.886  0.25 37.24  ? 270  LEU D CG    1 
ATOM   9323   C CD1   A LEU D  1 270 ? 29.803  7.129   82.132  0.25 35.60  ? 270  LEU D CD1   1 
ATOM   9324   C CD2   A LEU D  1 270 ? 31.541  5.940   83.453  0.25 35.31  ? 270  LEU D CD2   1 
ATOM   9325   N N     A GLU D  1 271 ? 27.217  3.749   86.015  0.25 34.94  ? 271  GLU D N     1 
ATOM   9326   C CA    A GLU D  1 271 ? 26.299  3.753   87.151  0.25 36.79  ? 271  GLU D CA    1 
ATOM   9327   C C     A GLU D  1 271 ? 26.690  2.745   88.214  0.25 35.23  ? 271  GLU D C     1 
ATOM   9328   O O     A GLU D  1 271 ? 26.159  2.765   89.314  0.25 36.36  ? 271  GLU D O     1 
ATOM   9329   C CB    A GLU D  1 271 ? 24.877  3.427   86.688  0.25 41.16  ? 271  GLU D CB    1 
ATOM   9330   C CG    A GLU D  1 271 ? 24.294  4.380   85.661  0.25 47.64  ? 271  GLU D CG    1 
ATOM   9331   C CD    A GLU D  1 271 ? 22.972  3.876   85.109  0.25 54.03  ? 271  GLU D CD    1 
ATOM   9332   O OE1   A GLU D  1 271 ? 22.075  3.547   85.922  0.25 56.89  ? 271  GLU D OE1   1 
ATOM   9333   O OE2   A GLU D  1 271 ? 22.822  3.803   83.867  0.25 56.24  ? 271  GLU D OE2   1 
ATOM   9334   N N     A ARG D  1 272 ? 27.635  1.872   87.897  0.25 32.88  ? 272  ARG D N     1 
ATOM   9335   C CA    A ARG D  1 272 ? 28.034  0.825   88.826  0.25 30.79  ? 272  ARG D CA    1 
ATOM   9336   C C     A ARG D  1 272 ? 29.183  1.162   89.747  0.25 32.24  ? 272  ARG D C     1 
ATOM   9337   O O     A ARG D  1 272 ? 30.154  1.811   89.344  0.25 33.41  ? 272  ARG D O     1 
ATOM   9338   C CB    A ARG D  1 272 ? 28.382  -0.439  88.037  0.25 33.05  ? 272  ARG D CB    1 
ATOM   9339   C CG    A ARG D  1 272 ? 27.226  -0.991  87.216  0.25 31.19  ? 272  ARG D CG    1 
ATOM   9340   C CD    A ARG D  1 272 ? 27.693  -2.048  86.231  0.25 31.41  ? 272  ARG D CD    1 
ATOM   9341   N NE    A ARG D  1 272 ? 26.567  -2.663  85.529  0.25 31.76  ? 272  ARG D NE    1 
ATOM   9342   C CZ    A ARG D  1 272 ? 26.676  -3.668  84.668  0.25 31.60  ? 272  ARG D CZ    1 
ATOM   9343   N NH1   A ARG D  1 272 ? 25.587  -4.161  84.094  0.25 27.53  ? 272  ARG D NH1   1 
ATOM   9344   N NH2   A ARG D  1 272 ? 27.878  -4.174  84.374  0.25 29.18  ? 272  ARG D NH2   1 
ATOM   9345   N N     A GLU D  1 273 ? 29.081  0.683   90.982  0.25 30.94  ? 273  GLU D N     1 
ATOM   9346   C CA    A GLU D  1 273 ? 30.102  0.894   91.986  0.25 33.60  ? 273  GLU D CA    1 
ATOM   9347   C C     A GLU D  1 273 ? 31.091  -0.270  91.954  0.25 32.53  ? 273  GLU D C     1 
ATOM   9348   O O     A GLU D  1 273 ? 30.711  -1.435  92.053  0.25 30.79  ? 273  GLU D O     1 
ATOM   9349   C CB    A GLU D  1 273 ? 29.464  0.999   93.378  0.25 37.43  ? 273  GLU D CB    1 
ATOM   9350   C CG    A GLU D  1 273 ? 30.467  1.094   94.515  0.25 42.89  ? 273  GLU D CG    1 
ATOM   9351   C CD    A GLU D  1 273 ? 29.807  1.274   95.872  0.25 47.22  ? 273  GLU D CD    1 
ATOM   9352   O OE1   A GLU D  1 273 ? 30.508  1.122   96.897  0.25 50.05  ? 273  GLU D OE1   1 
ATOM   9353   O OE2   A GLU D  1 273 ? 28.594  1.568   95.911  0.25 49.92  ? 273  GLU D OE2   1 
ATOM   9354   N N     A PRO D  1 274 ? 32.386  0.039   91.839  0.25 31.43  ? 274  PRO D N     1 
ATOM   9355   C CA    A PRO D  1 274 ? 33.434  -0.983  91.794  0.25 29.66  ? 274  PRO D CA    1 
ATOM   9356   C C     A PRO D  1 274 ? 33.477  -1.879  93.036  0.25 30.41  ? 274  PRO D C     1 
ATOM   9357   O O     A PRO D  1 274 ? 33.115  -1.455  94.133  0.25 29.33  ? 274  PRO D O     1 
ATOM   9358   C CB    A PRO D  1 274 ? 34.715  -0.160  91.662  0.25 28.22  ? 274  PRO D CB    1 
ATOM   9359   C CG    A PRO D  1 274 ? 34.248  1.109   90.994  0.25 30.97  ? 274  PRO D CG    1 
ATOM   9360   C CD    A PRO D  1 274 ? 32.953  1.389   91.690  0.25 30.44  ? 274  PRO D CD    1 
ATOM   9361   N N     A ARG D  1 275 ? 33.899  -3.123  92.838  0.25 29.12  ? 275  ARG D N     1 
ATOM   9362   C CA    A ARG D  1 275 ? 34.075  -4.085  93.913  0.25 30.17  ? 275  ARG D CA    1 
ATOM   9363   C C     A ARG D  1 275 ? 35.593  -4.132  94.096  0.25 29.79  ? 275  ARG D C     1 
ATOM   9364   O O     A ARG D  1 275 ? 36.332  -3.785  93.168  0.25 27.94  ? 275  ARG D O     1 
ATOM   9365   C CB    A ARG D  1 275 ? 33.582  -5.480  93.488  0.25 31.16  ? 275  ARG D CB    1 
ATOM   9366   C CG    A ARG D  1 275 ? 32.085  -5.749  93.681  0.25 29.71  ? 275  ARG D CG    1 
ATOM   9367   C CD    A ARG D  1 275 ? 31.225  -5.067  92.657  0.25 29.85  ? 275  ARG D CD    1 
ATOM   9368   N NE    A ARG D  1 275 ? 29.796  -5.286  92.925  0.25 31.57  ? 275  ARG D NE    1 
ATOM   9369   C CZ    A ARG D  1 275 ? 29.117  -6.391  92.614  0.25 31.33  ? 275  ARG D CZ    1 
ATOM   9370   N NH1   A ARG D  1 275 ? 29.713  -7.411  92.003  0.25 23.91  ? 275  ARG D NH1   1 
ATOM   9371   N NH2   A ARG D  1 275 ? 27.828  -6.484  92.928  0.25 28.02  ? 275  ARG D NH2   1 
ATOM   9372   N N     A ASP D  1 276 ? 36.057  -4.548  95.266  0.25 27.58  ? 276  ASP D N     1 
ATOM   9373   C CA    A ASP D  1 276 ? 37.494  -4.640  95.508  0.25 29.61  ? 276  ASP D CA    1 
ATOM   9374   C C     A ASP D  1 276 ? 38.157  -5.522  94.444  0.25 30.35  ? 276  ASP D C     1 
ATOM   9375   O O     A ASP D  1 276 ? 37.621  -6.551  94.052  0.25 27.95  ? 276  ASP D O     1 
ATOM   9376   C CB    A ASP D  1 276 ? 37.785  -5.235  96.884  0.25 32.13  ? 276  ASP D CB    1 
ATOM   9377   C CG    A ASP D  1 276 ? 37.256  -4.380  98.012  0.25 35.39  ? 276  ASP D CG    1 
ATOM   9378   O OD1   A ASP D  1 276 ? 37.201  -3.145  97.855  0.25 38.84  ? 276  ASP D OD1   1 
ATOM   9379   O OD2   A ASP D  1 276 ? 36.905  -4.942  99.063  0.25 40.61  ? 276  ASP D OD2   1 
ATOM   9380   N N     A PHE D  1 277 ? 39.335  -5.117  93.982  0.25 29.86  ? 277  PHE D N     1 
ATOM   9381   C CA    A PHE D  1 277 ? 40.034  -5.880  92.958  0.25 28.25  ? 277  PHE D CA    1 
ATOM   9382   C C     A PHE D  1 277 ? 40.384  -7.265  93.468  0.25 28.24  ? 277  PHE D C     1 
ATOM   9383   O O     A PHE D  1 277 ? 40.577  -7.466  94.670  0.25 27.91  ? 277  PHE D O     1 
ATOM   9384   C CB    A PHE D  1 277 ? 41.341  -5.178  92.535  0.25 27.66  ? 277  PHE D CB    1 
ATOM   9385   C CG    A PHE D  1 277 ? 41.140  -3.997  91.616  0.25 24.90  ? 277  PHE D CG    1 
ATOM   9386   C CD1   A PHE D  1 277 ? 40.221  -4.051  90.568  0.25 22.54  ? 277  PHE D CD1   1 
ATOM   9387   C CD2   A PHE D  1 277 ? 41.935  -2.857  91.752  0.25 23.72  ? 277  PHE D CD2   1 
ATOM   9388   C CE1   A PHE D  1 277 ? 40.096  -2.986  89.663  0.25 21.24  ? 277  PHE D CE1   1 
ATOM   9389   C CE2   A PHE D  1 277 ? 41.815  -1.789  90.852  0.25 20.68  ? 277  PHE D CE2   1 
ATOM   9390   C CZ    A PHE D  1 277 ? 40.903  -1.856  89.813  0.25 22.78  ? 277  PHE D CZ    1 
ATOM   9391   N N     A PRO D  1 278 ? 40.478  -8.240  92.554  0.25 26.56  ? 278  PRO D N     1 
ATOM   9392   C CA    A PRO D  1 278 ? 40.817  -9.607  92.917  0.25 27.33  ? 278  PRO D CA    1 
ATOM   9393   C C     A PRO D  1 278 ? 42.307  -9.735  93.186  0.25 29.13  ? 278  PRO D C     1 
ATOM   9394   O O     A PRO D  1 278 ? 43.067  -8.778  92.990  0.25 29.87  ? 278  PRO D O     1 
ATOM   9395   C CB    A PRO D  1 278 ? 40.392  -10.405 91.685  0.25 26.12  ? 278  PRO D CB    1 
ATOM   9396   C CG    A PRO D  1 278 ? 40.642  -9.442  90.574  0.25 23.76  ? 278  PRO D CG    1 
ATOM   9397   C CD    A PRO D  1 278 ? 40.091  -8.158  91.132  0.25 26.28  ? 278  PRO D CD    1 
ATOM   9398   N N     A LYS D  1 279 ? 42.720  -10.911 93.652  0.25 29.99  ? 279  LYS D N     1 
ATOM   9399   C CA    A LYS D  1 279 ? 44.135  -11.156 93.901  0.25 32.86  ? 279  LYS D CA    1 
ATOM   9400   C C     A LYS D  1 279 ? 44.649  -12.283 93.007  0.25 30.31  ? 279  LYS D C     1 
ATOM   9401   O O     A LYS D  1 279 ? 43.887  -13.160 92.598  0.25 27.57  ? 279  LYS D O     1 
ATOM   9402   C CB    A LYS D  1 279 ? 44.370  -11.474 95.377  0.25 34.54  ? 279  LYS D CB    1 
ATOM   9403   C CG    A LYS D  1 279 ? 44.125  -10.268 96.253  0.25 40.62  ? 279  LYS D CG    1 
ATOM   9404   C CD    A LYS D  1 279 ? 44.587  -10.497 97.677  0.25 45.54  ? 279  LYS D CD    1 
ATOM   9405   C CE    A LYS D  1 279 ? 44.456  -9.206  98.490  0.25 47.34  ? 279  LYS D CE    1 
ATOM   9406   N NZ    A LYS D  1 279 ? 44.934  -9.367  99.902  0.25 51.77  ? 279  LYS D NZ    1 
ATOM   9407   N N     A LEU D  1 280 ? 45.935  -12.231 92.690  0.25 29.65  ? 280  LEU D N     1 
ATOM   9408   C CA    A LEU D  1 280 ? 46.548  -13.233 91.832  0.25 30.21  ? 280  LEU D CA    1 
ATOM   9409   C C     A LEU D  1 280 ? 47.440  -14.154 92.639  0.25 31.37  ? 280  LEU D C     1 
ATOM   9410   O O     A LEU D  1 280 ? 48.204  -13.698 93.481  0.25 31.01  ? 280  LEU D O     1 
ATOM   9411   C CB    A LEU D  1 280 ? 47.388  -12.561 90.734  0.25 26.93  ? 280  LEU D CB    1 
ATOM   9412   C CG    A LEU D  1 280 ? 48.234  -13.502 89.867  0.25 29.36  ? 280  LEU D CG    1 
ATOM   9413   C CD1   A LEU D  1 280 ? 47.328  -14.361 88.980  0.25 26.04  ? 280  LEU D CD1   1 
ATOM   9414   C CD2   A LEU D  1 280 ? 49.208  -12.657 88.997  0.25 27.11  ? 280  LEU D CD2   1 
ATOM   9415   N N     A LYS D  1 281 ? 47.334  -15.455 92.371  0.25 32.43  ? 281  LYS D N     1 
ATOM   9416   C CA    A LYS D  1 281 ? 48.153  -16.462 93.050  0.25 32.62  ? 281  LYS D CA    1 
ATOM   9417   C C     A LYS D  1 281 ? 48.656  -17.400 91.965  0.25 29.62  ? 281  LYS D C     1 
ATOM   9418   O O     A LYS D  1 281 ? 48.018  -17.539 90.924  0.25 29.59  ? 281  LYS D O     1 
ATOM   9419   C CB    A LYS D  1 281 ? 47.306  -17.256 94.058  0.25 35.77  ? 281  LYS D CB    1 
ATOM   9420   C CG    A LYS D  1 281 ? 46.575  -16.385 95.065  0.25 38.76  ? 281  LYS D CG    1 
ATOM   9421   C CD    A LYS D  1 281 ? 47.568  -15.652 95.955  0.25 43.75  ? 281  LYS D CD    1 
ATOM   9422   C CE    A LYS D  1 281 ? 46.852  -14.946 97.085  0.25 44.52  ? 281  LYS D CE    1 
ATOM   9423   N NZ    A LYS D  1 281 ? 47.820  -14.279 97.991  0.25 50.06  ? 281  LYS D NZ    1 
ATOM   9424   N N     A TRP D  1 282 ? 49.791  -18.043 92.205  0.25 29.42  ? 282  TRP D N     1 
ATOM   9425   C CA    A TRP D  1 282 ? 50.344  -18.968 91.220  0.25 30.95  ? 282  TRP D CA    1 
ATOM   9426   C C     A TRP D  1 282 ? 50.027  -20.419 91.585  0.25 31.99  ? 282  TRP D C     1 
ATOM   9427   O O     A TRP D  1 282 ? 50.151  -20.811 92.745  0.25 33.47  ? 282  TRP D O     1 
ATOM   9428   C CB    A TRP D  1 282 ? 51.855  -18.785 91.115  0.25 31.75  ? 282  TRP D CB    1 
ATOM   9429   C CG    A TRP D  1 282 ? 52.255  -17.405 90.669  0.25 32.26  ? 282  TRP D CG    1 
ATOM   9430   C CD1   A TRP D  1 282 ? 52.982  -16.489 91.381  0.25 29.53  ? 282  TRP D CD1   1 
ATOM   9431   C CD2   A TRP D  1 282 ? 51.968  -16.798 89.400  0.25 30.47  ? 282  TRP D CD2   1 
ATOM   9432   N NE1   A TRP D  1 282 ? 53.170  -15.348 90.628  0.25 29.36  ? 282  TRP D NE1   1 
ATOM   9433   C CE2   A TRP D  1 282 ? 52.560  -15.511 89.411  0.25 28.17  ? 282  TRP D CE2   1 
ATOM   9434   C CE3   A TRP D  1 282 ? 51.270  -17.216 88.254  0.25 29.28  ? 282  TRP D CE3   1 
ATOM   9435   C CZ2   A TRP D  1 282 ? 52.478  -14.639 88.322  0.25 26.39  ? 282  TRP D CZ2   1 
ATOM   9436   C CZ3   A TRP D  1 282 ? 51.189  -16.338 87.157  0.25 29.22  ? 282  TRP D CZ3   1 
ATOM   9437   C CH2   A TRP D  1 282 ? 51.794  -15.063 87.208  0.25 28.01  ? 282  TRP D CH2   1 
ATOM   9438   N N     A ALA D  1 283 ? 49.614  -21.205 90.594  0.25 31.47  ? 283  ALA D N     1 
ATOM   9439   C CA    A ALA D  1 283 ? 49.289  -22.603 90.823  0.25 33.57  ? 283  ALA D CA    1 
ATOM   9440   C C     A ALA D  1 283 ? 50.560  -23.435 90.936  0.25 33.48  ? 283  ALA D C     1 
ATOM   9441   O O     A ALA D  1 283 ? 50.509  -24.574 91.377  0.25 33.94  ? 283  ALA D O     1 
ATOM   9442   C CB    A ALA D  1 283 ? 48.408  -23.138 89.690  0.25 32.91  ? 283  ALA D CB    1 
ATOM   9443   N N     A ARG D  1 284 ? 51.694  -22.868 90.530  0.25 32.60  ? 284  ARG D N     1 
ATOM   9444   C CA    A ARG D  1 284 ? 52.966  -23.577 90.602  0.25 33.08  ? 284  ARG D CA    1 
ATOM   9445   C C     A ARG D  1 284 ? 54.050  -22.671 91.162  0.25 32.66  ? 284  ARG D C     1 
ATOM   9446   O O     A ARG D  1 284 ? 53.849  -21.479 91.298  0.25 34.29  ? 284  ARG D O     1 
ATOM   9447   C CB    A ARG D  1 284 ? 53.388  -24.097 89.229  0.25 30.70  ? 284  ARG D CB    1 
ATOM   9448   C CG    A ARG D  1 284 ? 52.496  -25.201 88.661  0.25 32.53  ? 284  ARG D CG    1 
ATOM   9449   C CD    A ARG D  1 284 ? 53.062  -25.792 87.363  0.25 29.81  ? 284  ARG D CD    1 
ATOM   9450   N NE    A ARG D  1 284 ? 53.120  -24.812 86.281  0.25 32.14  ? 284  ARG D NE    1 
ATOM   9451   C CZ    A ARG D  1 284 ? 53.949  -24.861 85.234  0.25 32.98  ? 284  ARG D CZ    1 
ATOM   9452   N NH1   A ARG D  1 284 ? 53.901  -23.898 84.318  0.25 28.77  ? 284  ARG D NH1   1 
ATOM   9453   N NH2   A ARG D  1 284 ? 54.834  -25.849 85.109  0.25 30.76  ? 284  ARG D NH2   1 
ATOM   9454   N N     A SER D  1 285 ? 55.203  -23.244 91.488  0.25 34.20  ? 285  SER D N     1 
ATOM   9455   C CA    A SER D  1 285 ? 56.299  -22.464 92.055  0.25 34.44  ? 285  SER D CA    1 
ATOM   9456   C C     A SER D  1 285 ? 57.200  -21.869 90.969  0.25 34.27  ? 285  SER D C     1 
ATOM   9457   O O     A SER D  1 285 ? 57.114  -22.237 89.795  0.25 33.39  ? 285  SER D O     1 
ATOM   9458   C CB    A SER D  1 285 ? 57.145  -23.341 92.983  0.25 34.75  ? 285  SER D CB    1 
ATOM   9459   O OG    A SER D  1 285 ? 57.770  -24.397 92.262  0.25 35.94  ? 285  SER D OG    1 
ATOM   9460   N N     A LYS D  1 286 ? 58.063  -20.951 91.379  0.25 33.90  ? 286  LYS D N     1 
ATOM   9461   C CA    A LYS D  1 286 ? 58.998  -20.316 90.468  0.25 36.00  ? 286  LYS D CA    1 
ATOM   9462   C C     A LYS D  1 286 ? 59.851  -21.370 89.785  0.25 37.42  ? 286  LYS D C     1 
ATOM   9463   O O     A LYS D  1 286 ? 60.065  -21.323 88.571  0.25 39.53  ? 286  LYS D O     1 
ATOM   9464   C CB    A LYS D  1 286 ? 59.911  -19.353 91.235  0.25 39.03  ? 286  LYS D CB    1 
ATOM   9465   C CG    A LYS D  1 286 ? 61.072  -18.823 90.398  0.25 39.88  ? 286  LYS D CG    1 
ATOM   9466   C CD    A LYS D  1 286 ? 62.066  -18.077 91.254  0.25 41.92  ? 286  LYS D CD    1 
ATOM   9467   C CE    A LYS D  1 286 ? 63.271  -17.642 90.428  0.25 41.05  ? 286  LYS D CE    1 
ATOM   9468   N NZ    A LYS D  1 286 ? 64.294  -16.999 91.302  0.25 45.89  ? 286  LYS D NZ    1 
ATOM   9469   N N     A GLU D  1 287 ? 60.334  -22.326 90.574  0.25 37.88  ? 287  GLU D N     1 
ATOM   9470   C CA    A GLU D  1 287 ? 61.163  -23.412 90.057  0.25 38.17  ? 287  GLU D CA    1 
ATOM   9471   C C     A GLU D  1 287 ? 60.425  -24.255 89.024  0.25 37.55  ? 287  GLU D C     1 
ATOM   9472   O O     A GLU D  1 287 ? 60.993  -24.639 88.008  0.25 37.14  ? 287  GLU D O     1 
ATOM   9473   C CB    A GLU D  1 287 ? 61.620  -24.321 91.204  0.25 39.56  ? 287  GLU D CB    1 
ATOM   9474   C CG    A GLU D  1 287 ? 62.534  -23.663 92.223  0.25 42.96  ? 287  GLU D CG    1 
ATOM   9475   C CD    A GLU D  1 287 ? 61.869  -22.530 92.988  0.25 47.67  ? 287  GLU D CD    1 
ATOM   9476   O OE1   A GLU D  1 287 ? 60.702  -22.692 93.426  0.25 48.30  ? 287  GLU D OE1   1 
ATOM   9477   O OE2   A GLU D  1 287 ? 62.524  -21.476 93.168  0.25 50.58  ? 287  GLU D OE2   1 
ATOM   9478   N N     A GLU D  1 288 ? 59.160  -24.559 89.292  0.25 35.46  ? 288  GLU D N     1 
ATOM   9479   C CA    A GLU D  1 288 ? 58.383  -25.367 88.368  0.25 35.52  ? 288  GLU D CA    1 
ATOM   9480   C C     A GLU D  1 288 ? 58.150  -24.618 87.066  0.25 34.80  ? 288  GLU D C     1 
ATOM   9481   O O     A GLU D  1 288 ? 58.291  -25.181 85.982  0.25 33.44  ? 288  GLU D O     1 
ATOM   9482   C CB    A GLU D  1 288 ? 57.042  -25.757 89.000  0.25 38.74  ? 288  GLU D CB    1 
ATOM   9483   C CG    A GLU D  1 288 ? 57.184  -26.622 90.256  0.25 42.70  ? 288  GLU D CG    1 
ATOM   9484   C CD    A GLU D  1 288 ? 55.844  -26.970 90.882  0.25 46.39  ? 288  GLU D CD    1 
ATOM   9485   O OE1   A GLU D  1 288 ? 55.114  -26.041 91.295  0.25 49.04  ? 288  GLU D OE1   1 
ATOM   9486   O OE2   A GLU D  1 288 ? 55.516  -28.171 90.962  0.25 48.59  ? 288  GLU D OE2   1 
ATOM   9487   N N     A ILE D  1 289 ? 57.781  -23.346 87.173  0.25 34.40  ? 289  ILE D N     1 
ATOM   9488   C CA    A ILE D  1 289 ? 57.538  -22.539 85.983  0.25 32.44  ? 289  ILE D CA    1 
ATOM   9489   C C     A ILE D  1 289 ? 58.862  -22.361 85.235  0.25 32.65  ? 289  ILE D C     1 
ATOM   9490   O O     A ILE D  1 289 ? 58.898  -22.424 84.007  0.25 30.56  ? 289  ILE D O     1 
ATOM   9491   C CB    A ILE D  1 289 ? 56.914  -21.187 86.360  0.25 31.67  ? 289  ILE D CB    1 
ATOM   9492   C CG1   A ILE D  1 289 ? 55.486  -21.432 86.879  0.25 30.32  ? 289  ILE D CG1   1 
ATOM   9493   C CG2   A ILE D  1 289 ? 56.898  -20.250 85.143  0.25 28.83  ? 289  ILE D CG2   1 
ATOM   9494   C CD1   A ILE D  1 289 ? 54.797  -20.205 87.467  0.25 28.59  ? 289  ILE D CD1   1 
ATOM   9495   N N     A GLY D  1 290 ? 59.942  -22.156 85.987  0.25 34.07  ? 290  GLY D N     1 
ATOM   9496   C CA    A GLY D  1 290 ? 61.261  -22.032 85.377  0.25 34.70  ? 290  GLY D CA    1 
ATOM   9497   C C     A GLY D  1 290 ? 61.654  -20.645 84.905  0.25 34.62  ? 290  GLY D C     1 
ATOM   9498   O O     A GLY D  1 290 ? 62.451  -19.965 85.547  0.25 37.08  ? 290  GLY D O     1 
ATOM   9499   N N     A ASP D  1 291 ? 61.106  -20.217 83.777  0.25 33.31  ? 291  ASP D N     1 
ATOM   9500   C CA    A ASP D  1 291 ? 61.421  -18.907 83.250  0.25 30.59  ? 291  ASP D CA    1 
ATOM   9501   C C     A ASP D  1 291 ? 60.180  -18.258 82.653  0.25 31.55  ? 291  ASP D C     1 
ATOM   9502   O O     A ASP D  1 291 ? 59.084  -18.810 82.740  0.25 30.78  ? 291  ASP D O     1 
ATOM   9503   C CB    A ASP D  1 291 ? 62.518  -19.010 82.188  0.25 32.99  ? 291  ASP D CB    1 
ATOM   9504   C CG    A ASP D  1 291 ? 62.194  -20.011 81.108  0.25 32.07  ? 291  ASP D CG    1 
ATOM   9505   O OD1   A ASP D  1 291 ? 61.038  -20.053 80.640  0.25 35.06  ? 291  ASP D OD1   1 
ATOM   9506   O OD2   A ASP D  1 291 ? 63.109  -20.754 80.702  0.25 38.86  ? 291  ASP D OD2   1 
ATOM   9507   N N     A ILE D  1 292 ? 60.362  -17.095 82.032  0.25 30.01  ? 292  ILE D N     1 
ATOM   9508   C CA    A ILE D  1 292 ? 59.254  -16.351 81.438  0.25 29.76  ? 292  ILE D CA    1 
ATOM   9509   C C     A ILE D  1 292 ? 58.487  -17.128 80.358  0.25 29.02  ? 292  ILE D C     1 
ATOM   9510   O O     A ILE D  1 292 ? 57.328  -16.814 80.052  0.25 31.07  ? 292  ILE D O     1 
ATOM   9511   C CB    A ILE D  1 292 ? 59.755  -15.010 80.850  0.25 27.67  ? 292  ILE D CB    1 
ATOM   9512   C CG1   A ILE D  1 292 ? 58.577  -14.039 80.670  0.25 28.09  ? 292  ILE D CG1   1 
ATOM   9513   C CG2   A ILE D  1 292 ? 60.440  -15.256 79.496  0.25 25.55  ? 292  ILE D CG2   1 
ATOM   9514   C CD1   A ILE D  1 292 ? 57.930  -13.602 81.975  0.25 26.83  ? 292  ILE D CD1   1 
ATOM   9515   N N     A ASP D  1 293 ? 59.119  -18.141 79.788  0.25 27.03  ? 293  ASP D N     1 
ATOM   9516   C CA    A ASP D  1 293 ? 58.471  -18.936 78.753  0.25 28.93  ? 293  ASP D CA    1 
ATOM   9517   C C     A ASP D  1 293 ? 57.797  -20.192 79.290  0.25 29.59  ? 293  ASP D C     1 
ATOM   9518   O O     A ASP D  1 293 ? 57.275  -20.979 78.510  0.25 30.94  ? 293  ASP D O     1 
ATOM   9519   C CB    A ASP D  1 293 ? 59.490  -19.353 77.696  0.25 32.16  ? 293  ASP D CB    1 
ATOM   9520   C CG    A ASP D  1 293 ? 60.012  -18.175 76.896  0.25 32.86  ? 293  ASP D CG    1 
ATOM   9521   O OD1   A ASP D  1 293 ? 59.185  -17.509 76.237  0.25 34.20  ? 293  ASP D OD1   1 
ATOM   9522   O OD2   A ASP D  1 293 ? 61.244  -17.920 76.931  0.25 33.74  ? 293  ASP D OD2   1 
ATOM   9523   N N     A GLY D  1 294 ? 57.806  -20.383 80.611  0.25 28.89  ? 294  GLY D N     1 
ATOM   9524   C CA    A GLY D  1 294 ? 57.201  -21.579 81.167  0.25 30.42  ? 294  GLY D CA    1 
ATOM   9525   C C     A GLY D  1 294 ? 55.815  -21.428 81.767  0.25 30.26  ? 294  GLY D C     1 
ATOM   9526   O O     A GLY D  1 294 ? 55.330  -22.360 82.393  0.25 32.51  ? 294  GLY D O     1 
ATOM   9527   N N     A PHE D  1 295 ? 55.178  -20.277 81.593  0.25 30.00  ? 295  PHE D N     1 
ATOM   9528   C CA    A PHE D  1 295 ? 53.843  -20.066 82.162  0.25 28.69  ? 295  PHE D CA    1 
ATOM   9529   C C     A PHE D  1 295 ? 52.745  -20.725 81.343  0.25 29.30  ? 295  PHE D C     1 
ATOM   9530   O O     A PHE D  1 295 ? 52.862  -20.861 80.117  0.25 29.63  ? 295  PHE D O     1 
ATOM   9531   C CB    A PHE D  1 295 ? 53.530  -18.573 82.294  0.25 25.19  ? 295  PHE D CB    1 
ATOM   9532   C CG    A PHE D  1 295 ? 54.294  -17.876 83.391  0.25 26.69  ? 295  PHE D CG    1 
ATOM   9533   C CD1   A PHE D  1 295 ? 55.623  -17.497 83.206  0.25 25.47  ? 295  PHE D CD1   1 
ATOM   9534   C CD2   A PHE D  1 295 ? 53.677  -17.579 84.604  0.25 23.57  ? 295  PHE D CD2   1 
ATOM   9535   C CE1   A PHE D  1 295 ? 56.319  -16.828 84.213  0.25 23.68  ? 295  PHE D CE1   1 
ATOM   9536   C CE2   A PHE D  1 295 ? 54.363  -16.922 85.609  0.25 22.87  ? 295  PHE D CE2   1 
ATOM   9537   C CZ    A PHE D  1 295 ? 55.696  -16.541 85.411  0.25 24.52  ? 295  PHE D CZ    1 
ATOM   9538   N N     A LYS D  1 296 ? 51.677  -21.136 82.032  0.25 28.30  ? 296  LYS D N     1 
ATOM   9539   C CA    A LYS D  1 296 ? 50.523  -21.766 81.391  0.25 29.02  ? 296  LYS D CA    1 
ATOM   9540   C C     A LYS D  1 296 ? 49.277  -21.068 81.901  0.25 28.45  ? 296  LYS D C     1 
ATOM   9541   O O     A LYS D  1 296 ? 49.279  -20.540 83.004  0.25 26.83  ? 296  LYS D O     1 
ATOM   9542   C CB    A LYS D  1 296 ? 50.454  -23.247 81.744  0.25 34.45  ? 296  LYS D CB    1 
ATOM   9543   C CG    A LYS D  1 296 ? 51.616  -24.071 81.217  0.25 40.50  ? 296  LYS D CG    1 
ATOM   9544   C CD    A LYS D  1 296 ? 51.611  -25.473 81.799  0.25 43.98  ? 296  LYS D CD    1 
ATOM   9545   C CE    A LYS D  1 296 ? 52.876  -26.237 81.396  0.25 48.39  ? 296  LYS D CE    1 
ATOM   9546   N NZ    A LYS D  1 296 ? 52.951  -27.585 82.029  0.25 50.63  ? 296  LYS D NZ    1 
ATOM   9547   N N     A VAL D  1 297 ? 48.215  -21.070 81.109  0.25 28.11  ? 297  VAL D N     1 
ATOM   9548   C CA    A VAL D  1 297 ? 46.987  -20.390 81.519  0.25 31.15  ? 297  VAL D CA    1 
ATOM   9549   C C     A VAL D  1 297 ? 46.542  -20.814 82.916  0.25 29.58  ? 297  VAL D C     1 
ATOM   9550   O O     A VAL D  1 297 ? 46.189  -19.980 83.744  0.25 29.88  ? 297  VAL D O     1 
ATOM   9551   C CB    A VAL D  1 297 ? 45.832  -20.665 80.529  0.25 31.48  ? 297  VAL D CB    1 
ATOM   9552   C CG1   A VAL D  1 297 ? 44.544  -19.998 81.032  0.25 33.96  ? 297  VAL D CG1   1 
ATOM   9553   C CG2   A VAL D  1 297 ? 46.192  -20.124 79.178  0.25 36.01  ? 297  VAL D CG2   1 
ATOM   9554   N N     A GLU D  1 298 ? 46.580  -22.114 83.175  0.25 31.99  ? 298  GLU D N     1 
ATOM   9555   C CA    A GLU D  1 298 ? 46.160  -22.661 84.471  0.25 33.01  ? 298  GLU D CA    1 
ATOM   9556   C C     A GLU D  1 298 ? 47.046  -22.245 85.643  0.25 32.57  ? 298  GLU D C     1 
ATOM   9557   O O     A GLU D  1 298 ? 46.706  -22.510 86.797  0.25 27.97  ? 298  GLU D O     1 
ATOM   9558   C CB    A GLU D  1 298 ? 46.082  -24.190 84.407  0.25 35.92  ? 298  GLU D CB    1 
ATOM   9559   C CG    A GLU D  1 298 ? 47.102  -24.825 83.460  0.25 43.73  ? 298  GLU D CG    1 
ATOM   9560   C CD    A GLU D  1 298 ? 46.657  -24.768 82.003  0.25 45.59  ? 298  GLU D CD    1 
ATOM   9561   O OE1   A GLU D  1 298 ? 47.520  -24.879 81.110  0.25 47.77  ? 298  GLU D OE1   1 
ATOM   9562   O OE2   A GLU D  1 298 ? 45.437  -24.630 81.752  0.25 49.57  ? 298  GLU D OE2   1 
ATOM   9563   N N     A ASP D  1 299 ? 48.175  -21.588 85.363  0.25 30.13  ? 299  ASP D N     1 
ATOM   9564   C CA    A ASP D  1 299 ? 49.043  -21.152 86.446  0.25 28.26  ? 299  ASP D CA    1 
ATOM   9565   C C     A ASP D  1 299 ? 48.470  -19.932 87.145  0.25 28.39  ? 299  ASP D C     1 
ATOM   9566   O O     A ASP D  1 299 ? 48.782  -19.662 88.308  0.25 29.67  ? 299  ASP D O     1 
ATOM   9567   C CB    A ASP D  1 299 ? 50.443  -20.799 85.929  0.25 31.08  ? 299  ASP D CB    1 
ATOM   9568   C CG    A ASP D  1 299 ? 51.260  -22.017 85.543  0.25 30.27  ? 299  ASP D CG    1 
ATOM   9569   O OD1   A ASP D  1 299 ? 51.201  -23.020 86.276  0.25 32.93  ? 299  ASP D OD1   1 
ATOM   9570   O OD2   A ASP D  1 299 ? 51.980  -21.966 84.521  0.25 32.63  ? 299  ASP D OD2   1 
ATOM   9571   N N     A PHE D  1 300 ? 47.627  -19.194 86.430  0.25 28.55  ? 300  PHE D N     1 
ATOM   9572   C CA    A PHE D  1 300 ? 47.033  -17.965 86.934  0.25 26.80  ? 300  PHE D CA    1 
ATOM   9573   C C     A PHE D  1 300 ? 45.772  -18.216 87.756  0.25 29.67  ? 300  PHE D C     1 
ATOM   9574   O O     A PHE D  1 300 ? 44.697  -18.431 87.196  0.25 27.97  ? 300  PHE D O     1 
ATOM   9575   C CB    A PHE D  1 300 ? 46.684  -17.021 85.768  0.25 27.35  ? 300  PHE D CB    1 
ATOM   9576   C CG    A PHE D  1 300 ? 47.885  -16.560 84.957  0.25 28.57  ? 300  PHE D CG    1 
ATOM   9577   C CD1   A PHE D  1 300 ? 48.554  -17.443 84.120  0.25 26.99  ? 300  PHE D CD1   1 
ATOM   9578   C CD2   A PHE D  1 300 ? 48.350  -15.245 85.053  0.25 26.15  ? 300  PHE D CD2   1 
ATOM   9579   C CE1   A PHE D  1 300 ? 49.675  -17.032 83.382  0.25 27.96  ? 300  PHE D CE1   1 
ATOM   9580   C CE2   A PHE D  1 300 ? 49.467  -14.820 84.327  0.25 28.14  ? 300  PHE D CE2   1 
ATOM   9581   C CZ    A PHE D  1 300 ? 50.134  -15.722 83.484  0.25 26.83  ? 300  PHE D CZ    1 
ATOM   9582   N N     A VAL D  1 301 ? 45.910  -18.175 89.079  0.25 29.00  ? 301  VAL D N     1 
ATOM   9583   C CA    A VAL D  1 301 ? 44.776  -18.371 89.971  0.25 29.55  ? 301  VAL D CA    1 
ATOM   9584   C C     A VAL D  1 301 ? 44.293  -17.034 90.506  0.25 29.44  ? 301  VAL D C     1 
ATOM   9585   O O     A VAL D  1 301 ? 44.890  -16.484 91.433  0.25 31.47  ? 301  VAL D O     1 
ATOM   9586   C CB    A VAL D  1 301 ? 45.164  -19.269 91.160  0.25 32.57  ? 301  VAL D CB    1 
ATOM   9587   C CG1   A VAL D  1 301 ? 43.945  -19.477 92.089  0.25 31.36  ? 301  VAL D CG1   1 
ATOM   9588   C CG2   A VAL D  1 301 ? 45.688  -20.604 90.641  0.25 28.33  ? 301  VAL D CG2   1 
ATOM   9589   N N     A VAL D  1 302 ? 43.215  -16.518 89.918  0.25 28.17  ? 302  VAL D N     1 
ATOM   9590   C CA    A VAL D  1 302 ? 42.637  -15.249 90.309  0.25 28.28  ? 302  VAL D CA    1 
ATOM   9591   C C     A VAL D  1 302 ? 41.479  -15.482 91.281  0.25 32.42  ? 302  VAL D C     1 
ATOM   9592   O O     A VAL D  1 302 ? 40.444  -16.085 90.939  0.25 31.06  ? 302  VAL D O     1 
ATOM   9593   C CB    A VAL D  1 302 ? 42.131  -14.475 89.071  0.25 26.81  ? 302  VAL D CB    1 
ATOM   9594   C CG1   A VAL D  1 302 ? 41.527  -13.154 89.487  0.25 27.16  ? 302  VAL D CG1   1 
ATOM   9595   C CG2   A VAL D  1 302 ? 43.283  -14.235 88.107  0.25 26.39  ? 302  VAL D CG2   1 
ATOM   9596   N N     A GLU D  1 303 ? 41.642  -14.994 92.500  0.25 33.40  ? 303  GLU D N     1 
ATOM   9597   C CA    A GLU D  1 303 ? 40.600  -15.201 93.495  0.25 34.82  ? 303  GLU D CA    1 
ATOM   9598   C C     A GLU D  1 303 ? 39.948  -13.914 93.943  0.25 33.15  ? 303  GLU D C     1 
ATOM   9599   O O     A GLU D  1 303 ? 40.583  -12.857 93.967  0.25 32.40  ? 303  GLU D O     1 
ATOM   9600   C CB    A GLU D  1 303 ? 41.179  -15.969 94.691  0.25 37.30  ? 303  GLU D CB    1 
ATOM   9601   C CG    A GLU D  1 303 ? 42.340  -15.279 95.362  0.25 41.77  ? 303  GLU D CG    1 
ATOM   9602   C CD    A GLU D  1 303 ? 43.211  -16.240 96.146  0.25 43.54  ? 303  GLU D CD    1 
ATOM   9603   O OE1   A GLU D  1 303 ? 44.049  -15.768 96.948  0.25 45.25  ? 303  GLU D OE1   1 
ATOM   9604   O OE2   A GLU D  1 303 ? 43.061  -17.463 95.946  0.25 45.50  ? 303  GLU D OE2   1 
ATOM   9605   N N     A GLY D  1 304 ? 38.660  -14.002 94.263  0.25 32.16  ? 304  GLY D N     1 
ATOM   9606   C CA    A GLY D  1 304 ? 37.934  -12.836 94.718  0.25 28.69  ? 304  GLY D CA    1 
ATOM   9607   C C     A GLY D  1 304 ? 37.412  -11.930 93.626  0.25 28.31  ? 304  GLY D C     1 
ATOM   9608   O O     A GLY D  1 304 ? 37.021  -10.792 93.901  0.25 29.94  ? 304  GLY D O     1 
ATOM   9609   N N     A TYR D  1 305 ? 37.384  -12.403 92.384  0.25 27.42  ? 305  TYR D N     1 
ATOM   9610   C CA    A TYR D  1 305 ? 36.885  -11.565 91.304  0.25 26.50  ? 305  TYR D CA    1 
ATOM   9611   C C     A TYR D  1 305 ? 35.360  -11.547 91.370  0.25 26.33  ? 305  TYR D C     1 
ATOM   9612   O O     A TYR D  1 305 ? 34.733  -12.564 91.166  0.25 27.14  ? 305  TYR D O     1 
ATOM   9613   C CB    A TYR D  1 305 ? 37.345  -12.098 89.946  0.25 27.88  ? 305  TYR D CB    1 
ATOM   9614   C CG    A TYR D  1 305 ? 36.990  -11.193 88.782  0.25 25.22  ? 305  TYR D CG    1 
ATOM   9615   C CD1   A TYR D  1 305 ? 36.583  -11.724 87.562  0.25 24.64  ? 305  TYR D CD1   1 
ATOM   9616   C CD2   A TYR D  1 305 ? 37.055  -9.805  88.907  0.25 25.92  ? 305  TYR D CD2   1 
ATOM   9617   C CE1   A TYR D  1 305 ? 36.240  -10.898 86.493  0.25 26.44  ? 305  TYR D CE1   1 
ATOM   9618   C CE2   A TYR D  1 305 ? 36.720  -8.966  87.844  0.25 24.59  ? 305  TYR D CE2   1 
ATOM   9619   C CZ    A TYR D  1 305 ? 36.312  -9.514  86.645  0.25 24.77  ? 305  TYR D CZ    1 
ATOM   9620   O OH    A TYR D  1 305 ? 35.956  -8.695  85.594  0.25 23.74  ? 305  TYR D OH    1 
ATOM   9621   N N     A LYS D  1 306 ? 34.781  -10.378 91.618  0.25 27.86  ? 306  LYS D N     1 
ATOM   9622   C CA    A LYS D  1 306 ? 33.339  -10.223 91.751  0.25 29.04  ? 306  LYS D CA    1 
ATOM   9623   C C     A LYS D  1 306 ? 32.814  -9.081  90.919  0.25 26.37  ? 306  LYS D C     1 
ATOM   9624   O O     A LYS D  1 306 ? 32.422  -8.053  91.434  0.25 28.96  ? 306  LYS D O     1 
ATOM   9625   C CB    A LYS D  1 306 ? 32.996  -9.994  93.232  0.25 33.00  ? 306  LYS D CB    1 
ATOM   9626   C CG    A LYS D  1 306 ? 33.383  -11.184 94.110  0.25 36.96  ? 306  LYS D CG    1 
ATOM   9627   C CD    A LYS D  1 306 ? 33.087  -10.929 95.575  0.25 41.48  ? 306  LYS D CD    1 
ATOM   9628   C CE    A LYS D  1 306 ? 33.503  -12.139 96.428  0.25 42.17  ? 306  LYS D CE    1 
ATOM   9629   N NZ    A LYS D  1 306 ? 33.301  -11.878 97.882  0.25 45.86  ? 306  LYS D NZ    1 
ATOM   9630   N N     A PRO D  1 307 ? 32.773  -9.263  89.603  0.25 26.85  ? 307  PRO D N     1 
ATOM   9631   C CA    A PRO D  1 307 ? 32.297  -8.227  88.696  0.25 27.52  ? 307  PRO D CA    1 
ATOM   9632   C C     A PRO D  1 307 ? 30.790  -8.151  88.508  0.25 27.45  ? 307  PRO D C     1 
ATOM   9633   O O     A PRO D  1 307 ? 30.059  -9.080  88.852  0.25 26.75  ? 307  PRO D O     1 
ATOM   9634   C CB    A PRO D  1 307 ? 32.990  -8.594  87.398  0.25 26.31  ? 307  PRO D CB    1 
ATOM   9635   C CG    A PRO D  1 307 ? 32.871  -10.096 87.416  0.25 27.87  ? 307  PRO D CG    1 
ATOM   9636   C CD    A PRO D  1 307 ? 33.272  -10.431 88.853  0.25 27.42  ? 307  PRO D CD    1 
ATOM   9637   N N     A TRP D  1 308 ? 30.347  -7.024  87.957  0.25 28.44  ? 308  TRP D N     1 
ATOM   9638   C CA    A TRP D  1 308 ? 28.956  -6.830  87.619  0.25 28.89  ? 308  TRP D CA    1 
ATOM   9639   C C     A TRP D  1 308 ? 28.788  -7.542  86.278  0.25 29.24  ? 308  TRP D C     1 
ATOM   9640   O O     A TRP D  1 308 ? 29.734  -8.164  85.772  0.25 26.45  ? 308  TRP D O     1 
ATOM   9641   C CB    A TRP D  1 308 ? 28.624  -5.358  87.450  0.25 30.27  ? 308  TRP D CB    1 
ATOM   9642   C CG    A TRP D  1 308 ? 28.605  -4.585  88.740  0.25 34.20  ? 308  TRP D CG    1 
ATOM   9643   C CD1   A TRP D  1 308 ? 29.654  -3.922  89.320  0.25 33.69  ? 308  TRP D CD1   1 
ATOM   9644   C CD2   A TRP D  1 308 ? 27.477  -4.393  89.609  0.25 32.90  ? 308  TRP D CD2   1 
ATOM   9645   N NE1   A TRP D  1 308 ? 29.246  -3.327  90.489  0.25 32.96  ? 308  TRP D NE1   1 
ATOM   9646   C CE2   A TRP D  1 308 ? 27.918  -3.602  90.693  0.25 34.77  ? 308  TRP D CE2   1 
ATOM   9647   C CE3   A TRP D  1 308 ? 26.136  -4.816  89.576  0.25 36.09  ? 308  TRP D CE3   1 
ATOM   9648   C CZ2   A TRP D  1 308 ? 27.064  -3.219  91.745  0.25 36.24  ? 308  TRP D CZ2   1 
ATOM   9649   C CZ3   A TRP D  1 308 ? 25.280  -4.437  90.625  0.25 35.26  ? 308  TRP D CZ3   1 
ATOM   9650   C CH2   A TRP D  1 308 ? 25.754  -3.645  91.694  0.25 36.38  ? 308  TRP D CH2   1 
ATOM   9651   N N     A GLY D  1 309 ? 27.594  -7.440  85.707  0.25 26.20  ? 309  GLY D N     1 
ATOM   9652   C CA    A GLY D  1 309 ? 27.312  -8.103  84.449  0.25 28.09  ? 309  GLY D CA    1 
ATOM   9653   C C     A GLY D  1 309 ? 28.140  -7.623  83.266  0.25 30.41  ? 309  GLY D C     1 
ATOM   9654   O O     A GLY D  1 309 ? 28.750  -6.540  83.296  0.25 26.91  ? 309  GLY D O     1 
ATOM   9655   N N     A LYS D  1 310 ? 28.155  -8.434  82.211  0.25 30.26  ? 310  LYS D N     1 
ATOM   9656   C CA    A LYS D  1 310 ? 28.900  -8.090  81.019  0.25 30.49  ? 310  LYS D CA    1 
ATOM   9657   C C     A LYS D  1 310 ? 28.184  -6.958  80.314  0.25 32.00  ? 310  LYS D C     1 
ATOM   9658   O O     A LYS D  1 310 ? 26.971  -6.772  80.479  0.25 29.57  ? 310  LYS D O     1 
ATOM   9659   C CB    A LYS D  1 310 ? 29.005  -9.291  80.079  0.25 32.47  ? 310  LYS D CB    1 
ATOM   9660   C CG    A LYS D  1 310 ? 27.665  -9.694  79.436  0.25 35.65  ? 310  LYS D CG    1 
ATOM   9661   C CD    A LYS D  1 310 ? 27.839  -10.838 78.454  0.25 37.51  ? 310  LYS D CD    1 
ATOM   9662   C CE    A LYS D  1 310 ? 26.499  -11.280 77.868  0.25 38.86  ? 310  LYS D CE    1 
ATOM   9663   N NZ    A LYS D  1 310 ? 25.818  -10.191 77.117  0.25 40.49  ? 310  LYS D NZ    1 
ATOM   9664   N N     A ILE D  1 311 ? 28.948  -6.191  79.537  0.25 31.24  ? 311  ILE D N     1 
ATOM   9665   C CA    A ILE D  1 311 ? 28.408  -5.081  78.776  0.25 31.01  ? 311  ILE D CA    1 
ATOM   9666   C C     A ILE D  1 311 ? 28.838  -5.264  77.337  0.25 31.37  ? 311  ILE D C     1 
ATOM   9667   O O     A ILE D  1 311 ? 30.032  -5.184  77.022  0.25 32.10  ? 311  ILE D O     1 
ATOM   9668   C CB    A ILE D  1 311 ? 28.944  -3.735  79.312  0.25 33.90  ? 311  ILE D CB    1 
ATOM   9669   C CG1   A ILE D  1 311 ? 28.417  -3.517  80.735  0.25 35.93  ? 311  ILE D CG1   1 
ATOM   9670   C CG2   A ILE D  1 311 ? 28.515  -2.587  78.398  0.25 32.25  ? 311  ILE D CG2   1 
ATOM   9671   C CD1   A ILE D  1 311 ? 28.903  -2.252  81.381  0.25 35.65  ? 311  ILE D CD1   1 
ATOM   9672   N N     A ASP D  1 312 ? 27.873  -5.518  76.461  0.25 29.71  ? 312  ASP D N     1 
ATOM   9673   C CA    A ASP D  1 312 ? 28.171  -5.741  75.057  0.25 30.25  ? 312  ASP D CA    1 
ATOM   9674   C C     A ASP D  1 312 ? 28.629  -4.475  74.325  0.25 28.68  ? 312  ASP D C     1 
ATOM   9675   O O     A ASP D  1 312 ? 27.988  -3.421  74.395  0.25 24.69  ? 312  ASP D O     1 
ATOM   9676   C CB    A ASP D  1 312 ? 26.942  -6.328  74.336  0.25 33.56  ? 312  ASP D CB    1 
ATOM   9677   C CG    A ASP D  1 312 ? 26.433  -7.606  74.986  0.25 36.43  ? 312  ASP D CG    1 
ATOM   9678   O OD1   A ASP D  1 312 ? 27.253  -8.456  75.365  0.25 42.06  ? 312  ASP D OD1   1 
ATOM   9679   O OD2   A ASP D  1 312 ? 25.209  -7.780  75.104  0.25 41.30  ? 312  ASP D OD2   1 
ATOM   9680   N N     A MET D  1 313 ? 29.753  -4.596  73.626  0.25 25.84  ? 313  MET D N     1 
ATOM   9681   C CA    A MET D  1 313 ? 30.309  -3.491  72.848  0.25 27.15  ? 313  MET D CA    1 
ATOM   9682   C C     A MET D  1 313 ? 30.936  -4.071  71.589  0.25 26.41  ? 313  MET D C     1 
ATOM   9683   O O     A MET D  1 313 ? 31.706  -5.031  71.658  0.25 26.29  ? 313  MET D O     1 
ATOM   9684   C CB    A MET D  1 313 ? 31.347  -2.712  73.664  0.25 24.91  ? 313  MET D CB    1 
ATOM   9685   C CG    A MET D  1 313 ? 30.708  -1.777  74.691  0.25 27.02  ? 313  MET D CG    1 
ATOM   9686   S SD    A MET D  1 313 ? 31.883  -0.705  75.611  0.25 26.93  ? 313  MET D SD    1 
ATOM   9687   C CE    A MET D  1 313 ? 32.267  -1.736  76.952  0.25 22.71  ? 313  MET D CE    1 
ATOM   9688   N N     A LYS D  1 314 ? 30.584  -3.508  70.440  0.25 24.51  ? 314  LYS D N     1 
ATOM   9689   C CA    A LYS D  1 314 ? 31.108  -3.997  69.181  0.25 27.05  ? 314  LYS D CA    1 
ATOM   9690   C C     A LYS D  1 314 ? 32.492  -3.388  68.908  0.25 28.44  ? 314  LYS D C     1 
ATOM   9691   O O     A LYS D  1 314 ? 32.727  -2.208  69.182  0.25 28.29  ? 314  LYS D O     1 
ATOM   9692   C CB    A LYS D  1 314 ? 30.155  -3.634  68.046  0.25 29.43  ? 314  LYS D CB    1 
ATOM   9693   C CG    A LYS D  1 314 ? 30.670  -4.006  66.670  0.25 34.48  ? 314  LYS D CG    1 
ATOM   9694   C CD    A LYS D  1 314 ? 29.752  -3.495  65.571  0.25 38.85  ? 314  LYS D CD    1 
ATOM   9695   C CE    A LYS D  1 314 ? 30.325  -3.818  64.197  0.25 43.81  ? 314  LYS D CE    1 
ATOM   9696   N NZ    A LYS D  1 314 ? 29.461  -3.297  63.100  0.25 48.39  ? 314  LYS D NZ    1 
ATOM   9697   N N     A MET D  1 315 ? 33.401  -4.196  68.372  0.25 27.46  ? 315  MET D N     1 
ATOM   9698   C CA    A MET D  1 315 ? 34.732  -3.713  68.069  0.25 27.38  ? 315  MET D CA    1 
ATOM   9699   C C     A MET D  1 315 ? 34.743  -3.201  66.640  0.25 28.21  ? 315  MET D C     1 
ATOM   9700   O O     A MET D  1 315 ? 34.192  -3.841  65.745  0.25 28.90  ? 315  MET D O     1 
ATOM   9701   C CB    A MET D  1 315 ? 35.767  -4.835  68.210  0.25 26.66  ? 315  MET D CB    1 
ATOM   9702   C CG    A MET D  1 315 ? 37.206  -4.318  68.064  0.25 28.40  ? 315  MET D CG    1 
ATOM   9703   S SD    A MET D  1 315 ? 38.441  -5.582  67.743  0.25 32.60  ? 315  MET D SD    1 
ATOM   9704   C CE    A MET D  1 315 ? 38.494  -5.484  65.959  0.25 32.65  ? 315  MET D CE    1 
ATOM   9705   N N     A SER D  1 316 ? 35.347  -2.041  66.420  0.25 28.58  ? 316  SER D N     1 
ATOM   9706   C CA    A SER D  1 316 ? 35.427  -1.494  65.069  0.25 29.00  ? 316  SER D CA    1 
ATOM   9707   C C     A SER D  1 316 ? 36.754  -1.932  64.467  0.25 29.56  ? 316  SER D C     1 
ATOM   9708   O O     A SER D  1 316 ? 37.812  -1.600  64.994  0.25 27.54  ? 316  SER D O     1 
ATOM   9709   C CB    A SER D  1 316 ? 35.332  0.024   65.091  0.25 28.56  ? 316  SER D CB    1 
ATOM   9710   O OG    A SER D  1 316 ? 34.079  0.437   65.618  0.25 26.76  ? 316  SER D OG    1 
ATOM   9711   N N     A ALA D  1 317 ? 36.673  -2.681  63.371  0.25 29.22  ? 317  ALA D N     1 
ATOM   9712   C CA    A ALA D  1 317 ? 37.849  -3.214  62.680  0.25 31.71  ? 317  ALA D CA    1 
ATOM   9713   C C     A ALA D  1 317 ? 38.666  -2.146  61.968  0.25 32.31  ? 317  ALA D C     1 
ATOM   9714   O O     A ALA D  1 317 ? 39.913  -2.210  62.072  0.25 32.81  ? 317  ALA D O     1 
ATOM   9715   C CB    A ALA D  1 317 ? 37.428  -4.289  61.677  0.25 31.60  ? 317  ALA D CB    1 
ATOM   9716   O OXT   A ALA D  1 317 ? 38.056  -1.290  61.305  0.25 31.33  ? 317  ALA D OXT   1 
ATOM   9717   N N     A ARG E  1 13  ? 123.869 53.069  60.377  0.25 47.33  ? 13   ARG E N     1 
ATOM   9718   C CA    A ARG E  1 13  ? 123.848 53.257  61.860  0.25 48.28  ? 13   ARG E CA    1 
ATOM   9719   C C     A ARG E  1 13  ? 124.875 52.343  62.506  0.25 49.25  ? 13   ARG E C     1 
ATOM   9720   O O     A ARG E  1 13  ? 124.747 51.120  62.451  0.25 51.04  ? 13   ARG E O     1 
ATOM   9721   C CB    A ARG E  1 13  ? 122.454 52.939  62.430  0.25 45.97  ? 13   ARG E CB    1 
ATOM   9722   C CG    A ARG E  1 13  ? 121.353 53.891  61.984  0.25 44.38  ? 13   ARG E CG    1 
ATOM   9723   C CD    A ARG E  1 13  ? 119.988 53.527  62.585  0.25 41.71  ? 13   ARG E CD    1 
ATOM   9724   N NE    A ARG E  1 13  ? 118.960 54.455  62.120  0.25 40.52  ? 13   ARG E NE    1 
ATOM   9725   C CZ    A ARG E  1 13  ? 117.682 54.424  62.491  0.25 39.31  ? 13   ARG E CZ    1 
ATOM   9726   N NH1   A ARG E  1 13  ? 117.263 53.509  63.347  0.25 36.56  ? 13   ARG E NH1   1 
ATOM   9727   N NH2   A ARG E  1 13  ? 116.819 55.303  61.986  0.25 39.10  ? 13   ARG E NH2   1 
ATOM   9728   N N     A SER E  1 14  ? 125.899 52.928  63.113  0.25 50.25  ? 14   SER E N     1 
ATOM   9729   C CA    A SER E  1 14  ? 126.925 52.129  63.764  0.25 51.79  ? 14   SER E CA    1 
ATOM   9730   C C     A SER E  1 14  ? 126.336 51.217  64.842  0.25 51.84  ? 14   SER E C     1 
ATOM   9731   O O     A SER E  1 14  ? 126.793 50.092  65.026  0.25 52.33  ? 14   SER E O     1 
ATOM   9732   C CB    A SER E  1 14  ? 127.987 53.031  64.383  0.25 53.74  ? 14   SER E CB    1 
ATOM   9733   O OG    A SER E  1 14  ? 128.927 52.250  65.106  0.25 58.66  ? 14   SER E OG    1 
ATOM   9734   N N     A ASN E  1 15  ? 125.335 51.709  65.569  0.25 50.75  ? 15   ASN E N     1 
ATOM   9735   C CA    A ASN E  1 15  ? 124.692 50.909  66.604  0.25 48.95  ? 15   ASN E CA    1 
ATOM   9736   C C     A ASN E  1 15  ? 123.173 51.042  66.480  0.25 46.73  ? 15   ASN E C     1 
ATOM   9737   O O     A ASN E  1 15  ? 122.535 51.797  67.214  0.25 45.42  ? 15   ASN E O     1 
ATOM   9738   C CB    A ASN E  1 15  ? 125.154 51.341  68.000  0.25 48.91  ? 15   ASN E CB    1 
ATOM   9739   C CG    A ASN E  1 15  ? 124.480 50.533  69.099  0.25 51.34  ? 15   ASN E CG    1 
ATOM   9740   O OD1   A ASN E  1 15  ? 123.964 49.437  68.841  0.25 50.70  ? 15   ASN E OD1   1 
ATOM   9741   N ND2   A ASN E  1 15  ? 124.484 51.057  70.325  0.25 49.82  ? 15   ASN E ND2   1 
ATOM   9742   N N     A PRO E  1 16  ? 122.578 50.273  65.560  0.25 45.00  ? 16   PRO E N     1 
ATOM   9743   C CA    A PRO E  1 16  ? 121.142 50.254  65.268  0.25 42.36  ? 16   PRO E CA    1 
ATOM   9744   C C     A PRO E  1 16  ? 120.242 49.930  66.452  0.25 39.93  ? 16   PRO E C     1 
ATOM   9745   O O     A PRO E  1 16  ? 119.047 50.220  66.413  0.25 41.27  ? 16   PRO E O     1 
ATOM   9746   C CB    A PRO E  1 16  ? 121.020 49.186  64.175  0.25 43.18  ? 16   PRO E CB    1 
ATOM   9747   C CG    A PRO E  1 16  ? 122.433 49.012  63.653  0.25 43.58  ? 16   PRO E CG    1 
ATOM   9748   C CD    A PRO E  1 16  ? 123.247 49.142  64.894  0.25 44.56  ? 16   PRO E CD    1 
ATOM   9749   N N     A ASP E  1 17  ? 120.802 49.336  67.499  0.25 36.99  ? 17   ASP E N     1 
ATOM   9750   C CA    A ASP E  1 17  ? 119.987 48.962  68.646  0.25 36.72  ? 17   ASP E CA    1 
ATOM   9751   C C     A ASP E  1 17  ? 119.943 50.031  69.723  0.25 35.86  ? 17   ASP E C     1 
ATOM   9752   O O     A ASP E  1 17  ? 119.336 49.817  70.776  0.25 34.86  ? 17   ASP E O     1 
ATOM   9753   C CB    A ASP E  1 17  ? 120.488 47.646  69.271  0.25 39.95  ? 17   ASP E CB    1 
ATOM   9754   C CG    A ASP E  1 17  ? 120.495 46.483  68.279  0.25 43.98  ? 17   ASP E CG    1 
ATOM   9755   O OD1   A ASP E  1 17  ? 119.522 46.353  67.497  0.25 44.28  ? 17   ASP E OD1   1 
ATOM   9756   O OD2   A ASP E  1 17  ? 121.474 45.697  68.291  0.25 46.71  ? 17   ASP E OD2   1 
ATOM   9757   N N     A HIS E  1 18  ? 120.590 51.174  69.479  0.25 32.22  ? 18   HIS E N     1 
ATOM   9758   C CA    A HIS E  1 18  ? 120.588 52.238  70.473  0.25 27.88  ? 18   HIS E CA    1 
ATOM   9759   C C     A HIS E  1 18  ? 119.145 52.665  70.709  0.25 25.25  ? 18   HIS E C     1 
ATOM   9760   O O     A HIS E  1 18  ? 118.447 53.026  69.778  0.25 23.80  ? 18   HIS E O     1 
ATOM   9761   C CB    A HIS E  1 18  ? 121.412 53.438  70.008  0.25 23.87  ? 18   HIS E CB    1 
ATOM   9762   C CG    A HIS E  1 18  ? 121.701 54.423  71.099  0.25 27.75  ? 18   HIS E CG    1 
ATOM   9763   N ND1   A HIS E  1 18  ? 120.709 55.131  71.749  0.25 23.95  ? 18   HIS E ND1   1 
ATOM   9764   C CD2   A HIS E  1 18  ? 122.871 54.797  71.678  0.25 25.98  ? 18   HIS E CD2   1 
ATOM   9765   C CE1   A HIS E  1 18  ? 121.252 55.892  72.683  0.25 24.79  ? 18   HIS E CE1   1 
ATOM   9766   N NE2   A HIS E  1 18  ? 122.562 55.708  72.661  0.25 26.74  ? 18   HIS E NE2   1 
ATOM   9767   N N     A GLU E  1 19  ? 118.724 52.645  71.970  0.25 26.14  ? 19   GLU E N     1 
ATOM   9768   C CA    A GLU E  1 19  ? 117.353 53.000  72.348  0.25 25.86  ? 19   GLU E CA    1 
ATOM   9769   C C     A GLU E  1 19  ? 116.894 54.371  71.908  0.25 23.53  ? 19   GLU E C     1 
ATOM   9770   O O     A GLU E  1 19  ? 115.707 54.600  71.762  0.25 24.14  ? 19   GLU E O     1 
ATOM   9771   C CB    A GLU E  1 19  ? 117.184 52.867  73.865  0.25 27.74  ? 19   GLU E CB    1 
ATOM   9772   C CG    A GLU E  1 19  ? 117.242 51.437  74.361  0.25 27.99  ? 19   GLU E CG    1 
ATOM   9773   C CD    A GLU E  1 19  ? 117.349 51.338  75.871  0.25 28.12  ? 19   GLU E CD    1 
ATOM   9774   O OE1   A GLU E  1 19  ? 117.329 50.220  76.392  0.25 32.25  ? 19   GLU E OE1   1 
ATOM   9775   O OE2   A GLU E  1 19  ? 117.463 52.372  76.542  0.25 37.07  ? 19   GLU E OE2   1 
ATOM   9776   N N     A GLU E  1 20  ? 117.826 55.291  71.684  0.25 22.10  ? 20   GLU E N     1 
ATOM   9777   C CA    A GLU E  1 20  ? 117.443 56.632  71.261  0.25 21.92  ? 20   GLU E CA    1 
ATOM   9778   C C     A GLU E  1 20  ? 116.822 56.669  69.872  0.25 20.46  ? 20   GLU E C     1 
ATOM   9779   O O     A GLU E  1 20  ? 116.107 57.606  69.526  0.25 19.93  ? 20   GLU E O     1 
ATOM   9780   C CB    A GLU E  1 20  ? 118.652 57.598  71.356  0.25 22.80  ? 20   GLU E CB    1 
ATOM   9781   C CG    A GLU E  1 20  ? 118.318 59.061  71.049  0.25 20.38  ? 20   GLU E CG    1 
ATOM   9782   C CD    A GLU E  1 20  ? 119.326 60.072  71.643  0.25 23.65  ? 20   GLU E CD    1 
ATOM   9783   O OE1   A GLU E  1 20  ? 119.199 61.276  71.350  0.25 24.01  ? 20   GLU E OE1   1 
ATOM   9784   O OE2   A GLU E  1 20  ? 120.234 59.686  72.407  0.25 21.11  ? 20   GLU E OE2   1 
ATOM   9785   N N     A TYR E  1 21  ? 117.083 55.644  69.067  0.25 23.15  ? 21   TYR E N     1 
ATOM   9786   C CA    A TYR E  1 21  ? 116.487 55.587  67.734  0.25 24.43  ? 21   TYR E CA    1 
ATOM   9787   C C     A TYR E  1 21  ? 114.962 55.469  67.796  0.25 25.28  ? 21   TYR E C     1 
ATOM   9788   O O     A TYR E  1 21  ? 114.273 55.802  66.839  0.25 24.78  ? 21   TYR E O     1 
ATOM   9789   C CB    A TYR E  1 21  ? 117.088 54.420  66.928  0.25 26.10  ? 21   TYR E CB    1 
ATOM   9790   C CG    A TYR E  1 21  ? 118.460 54.758  66.370  0.25 26.77  ? 21   TYR E CG    1 
ATOM   9791   C CD1   A TYR E  1 21  ? 119.580 54.030  66.739  0.25 28.74  ? 21   TYR E CD1   1 
ATOM   9792   C CD2   A TYR E  1 21  ? 118.630 55.838  65.488  0.25 27.76  ? 21   TYR E CD2   1 
ATOM   9793   C CE1   A TYR E  1 21  ? 120.854 54.364  66.245  0.25 31.09  ? 21   TYR E CE1   1 
ATOM   9794   C CE2   A TYR E  1 21  ? 119.888 56.177  64.989  0.25 26.19  ? 21   TYR E CE2   1 
ATOM   9795   C CZ    A TYR E  1 21  ? 120.990 55.435  65.372  0.25 29.19  ? 21   TYR E CZ    1 
ATOM   9796   O OH    A TYR E  1 21  ? 122.238 55.749  64.881  0.25 35.15  ? 21   TYR E OH    1 
ATOM   9797   N N     A GLN E  1 22  ? 114.432 54.995  68.923  0.25 26.73  ? 22   GLN E N     1 
ATOM   9798   C CA    A GLN E  1 22  ? 112.975 54.888  69.087  0.25 25.49  ? 22   GLN E CA    1 
ATOM   9799   C C     A GLN E  1 22  ? 112.418 56.292  69.000  0.25 24.56  ? 22   GLN E C     1 
ATOM   9800   O O     A GLN E  1 22  ? 111.423 56.532  68.342  0.25 23.47  ? 22   GLN E O     1 
ATOM   9801   C CB    A GLN E  1 22  ? 112.607 54.331  70.474  0.25 27.50  ? 22   GLN E CB    1 
ATOM   9802   C CG    A GLN E  1 22  ? 112.970 52.886  70.723  0.25 25.82  ? 22   GLN E CG    1 
ATOM   9803   C CD    A GLN E  1 22  ? 112.792 52.510  72.174  0.25 25.86  ? 22   GLN E CD