data_2ABJ
# 
_entry.id   2ABJ 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ABJ         
RCSB  RCSB033713   
WWPDB D_1000033713 
# 
_pdbx_database_status.entry_id                        2ABJ 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-15 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Ohren, J.F.'     1 
'Moreland, D.W.'  2 
'Rubin, J.R.'     3 
'Hu, H.L.'        4 
'McConnell, P.C.' 5 
'Mistry, A.'      6 
'Mueller, W.T.'   7 
'Scholten, J.D.'  8 
'Hasemann, C.H.'  9 
# 
_citation.id                        primary 
_citation.title                     
;The design and synthesis of human branched-chain amino acid aminotransferase inhibitors for treatment of neurodegenerative diseases.
;
_citation.journal_abbrev            Bioorg.Med.Chem.Lett. 
_citation.journal_volume            16 
_citation.page_first                2337 
_citation.page_last                 2340 
_citation.year                      2006 
_citation.journal_id_ASTM           BMCLE8 
_citation.country                   UK 
_citation.journal_id_ISSN           0960-894X 
_citation.journal_id_CSD            1127 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16143519 
_citation.pdbx_database_id_DOI      10.1016/j.bmcl.2005.07.058 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Hu, L.Y.'       1  
primary 'Boxer, P.A.'    2  
primary 'Kesten, S.R.'   3  
primary 'Lei, H.J.'      4  
primary 'Wustrow, D.J.'  5  
primary 'Moreland, D.W.' 6  
primary 'Zhang, L.'      7  
primary 'Ahn, K.'        8  
primary 'Ryder, T.R.'    9  
primary 'Liu, X.'        10 
primary 'Rubin, J.R.'    11 
primary 'Fahnoe, K.'     12 
primary 'Carroll, R.T.'  13 
primary 'Dutta, S.'      14 
primary 'Fahnoe, D.C.'   15 
primary 'Probert, A.W.'  16 
primary 'Roof, R.L.'     17 
primary 'Rafferty, M.F.' 18 
primary 'Kostlan, C.R.'  19 
primary 'Scholten, J.D.' 20 
primary 'Hood, M.'       21 
primary 'Ren, X.D.'      22 
primary 'Schielke, G.P.' 23 
primary 'Su, T.Z.'       24 
primary 'Taylor, C.P.'   25 
primary 'Mistry, A.'     26 
primary 'McConnell, P.'  27 
primary 'Hasemann, C.'   28 
primary 'Ohren, J.'      29 
# 
_cell.entry_id           2ABJ 
_cell.length_a           110.327 
_cell.length_b           114.517 
_cell.length_c           148.869 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              16 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ABJ 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Branched-chain-amino-acid aminotransferase, cytosolic'                         41103.941 4    2.6.1.42 ? 
'BCAT(c)' ? 
2 non-polymer syn "N'-(5-CHLOROBENZOFURAN-2-CARBONYL)-2-(TRIFLUOROMETHYL)BENZENESULFONOHYDRAZIDE" 418.775   4    ?        ? ? ? 
3 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"                                                        247.142   4    ?        ? ? ? 
4 water       nat water                                                                           18.015    1413 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'BCATc, ECA39 protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;VVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKA
FRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGT
MNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPV
SDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
;
_entity_poly.pdbx_seq_one_letter_code_can   
;VVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTVEWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKA
FRGVDNKIRLFQPNLNMDRMYRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPAFIGTEPSLGVKKPTK
ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEDVDNGCQQVLWLYGRDHQITEVGT
MNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQWGEFKVSERYLTMDDLTTALEGNRVREMFSSGTACVVCPV
SDILYKGETIHIPTMENGPKLASRILSKLTDIQYGREESDWTIVLS
;
_entity_poly.pdbx_strand_id                 A,D,G,J 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   VAL n 
1 2   VAL n 
1 3   GLY n 
1 4   THR n 
1 5   PHE n 
1 6   LYS n 
1 7   ALA n 
1 8   LYS n 
1 9   ASP n 
1 10  LEU n 
1 11  ILE n 
1 12  VAL n 
1 13  THR n 
1 14  PRO n 
1 15  ALA n 
1 16  THR n 
1 17  ILE n 
1 18  LEU n 
1 19  LYS n 
1 20  GLU n 
1 21  LYS n 
1 22  PRO n 
1 23  ASP n 
1 24  PRO n 
1 25  ASN n 
1 26  ASN n 
1 27  LEU n 
1 28  VAL n 
1 29  PHE n 
1 30  GLY n 
1 31  THR n 
1 32  VAL n 
1 33  PHE n 
1 34  THR n 
1 35  ASP n 
1 36  HIS n 
1 37  MET n 
1 38  LEU n 
1 39  THR n 
1 40  VAL n 
1 41  GLU n 
1 42  TRP n 
1 43  SER n 
1 44  SER n 
1 45  GLU n 
1 46  PHE n 
1 47  GLY n 
1 48  TRP n 
1 49  GLU n 
1 50  LYS n 
1 51  PRO n 
1 52  HIS n 
1 53  ILE n 
1 54  LYS n 
1 55  PRO n 
1 56  LEU n 
1 57  GLN n 
1 58  ASN n 
1 59  LEU n 
1 60  SER n 
1 61  LEU n 
1 62  HIS n 
1 63  PRO n 
1 64  GLY n 
1 65  SER n 
1 66  SER n 
1 67  ALA n 
1 68  LEU n 
1 69  HIS n 
1 70  TYR n 
1 71  ALA n 
1 72  VAL n 
1 73  GLU n 
1 74  LEU n 
1 75  PHE n 
1 76  GLU n 
1 77  GLY n 
1 78  LEU n 
1 79  LYS n 
1 80  ALA n 
1 81  PHE n 
1 82  ARG n 
1 83  GLY n 
1 84  VAL n 
1 85  ASP n 
1 86  ASN n 
1 87  LYS n 
1 88  ILE n 
1 89  ARG n 
1 90  LEU n 
1 91  PHE n 
1 92  GLN n 
1 93  PRO n 
1 94  ASN n 
1 95  LEU n 
1 96  ASN n 
1 97  MET n 
1 98  ASP n 
1 99  ARG n 
1 100 MET n 
1 101 TYR n 
1 102 ARG n 
1 103 SER n 
1 104 ALA n 
1 105 VAL n 
1 106 ARG n 
1 107 ALA n 
1 108 THR n 
1 109 LEU n 
1 110 PRO n 
1 111 VAL n 
1 112 PHE n 
1 113 ASP n 
1 114 LYS n 
1 115 GLU n 
1 116 GLU n 
1 117 LEU n 
1 118 LEU n 
1 119 GLU n 
1 120 CYS n 
1 121 ILE n 
1 122 GLN n 
1 123 GLN n 
1 124 LEU n 
1 125 VAL n 
1 126 LYS n 
1 127 LEU n 
1 128 ASP n 
1 129 GLN n 
1 130 GLU n 
1 131 TRP n 
1 132 VAL n 
1 133 PRO n 
1 134 TYR n 
1 135 SER n 
1 136 THR n 
1 137 SER n 
1 138 ALA n 
1 139 SER n 
1 140 LEU n 
1 141 TYR n 
1 142 ILE n 
1 143 ARG n 
1 144 PRO n 
1 145 ALA n 
1 146 PHE n 
1 147 ILE n 
1 148 GLY n 
1 149 THR n 
1 150 GLU n 
1 151 PRO n 
1 152 SER n 
1 153 LEU n 
1 154 GLY n 
1 155 VAL n 
1 156 LYS n 
1 157 LYS n 
1 158 PRO n 
1 159 THR n 
1 160 LYS n 
1 161 ALA n 
1 162 LEU n 
1 163 LEU n 
1 164 PHE n 
1 165 VAL n 
1 166 LEU n 
1 167 LEU n 
1 168 SER n 
1 169 PRO n 
1 170 VAL n 
1 171 GLY n 
1 172 PRO n 
1 173 TYR n 
1 174 PHE n 
1 175 SER n 
1 176 SER n 
1 177 GLY n 
1 178 THR n 
1 179 PHE n 
1 180 ASN n 
1 181 PRO n 
1 182 VAL n 
1 183 SER n 
1 184 LEU n 
1 185 TRP n 
1 186 ALA n 
1 187 ASN n 
1 188 PRO n 
1 189 LYS n 
1 190 TYR n 
1 191 VAL n 
1 192 ARG n 
1 193 ALA n 
1 194 TRP n 
1 195 LYS n 
1 196 GLY n 
1 197 GLY n 
1 198 THR n 
1 199 GLY n 
1 200 ASP n 
1 201 CYS n 
1 202 LYS n 
1 203 MET n 
1 204 GLY n 
1 205 GLY n 
1 206 ASN n 
1 207 TYR n 
1 208 GLY n 
1 209 SER n 
1 210 SER n 
1 211 LEU n 
1 212 PHE n 
1 213 ALA n 
1 214 GLN n 
1 215 CYS n 
1 216 GLU n 
1 217 ASP n 
1 218 VAL n 
1 219 ASP n 
1 220 ASN n 
1 221 GLY n 
1 222 CYS n 
1 223 GLN n 
1 224 GLN n 
1 225 VAL n 
1 226 LEU n 
1 227 TRP n 
1 228 LEU n 
1 229 TYR n 
1 230 GLY n 
1 231 ARG n 
1 232 ASP n 
1 233 HIS n 
1 234 GLN n 
1 235 ILE n 
1 236 THR n 
1 237 GLU n 
1 238 VAL n 
1 239 GLY n 
1 240 THR n 
1 241 MET n 
1 242 ASN n 
1 243 LEU n 
1 244 PHE n 
1 245 LEU n 
1 246 TYR n 
1 247 TRP n 
1 248 ILE n 
1 249 ASN n 
1 250 GLU n 
1 251 ASP n 
1 252 GLY n 
1 253 GLU n 
1 254 GLU n 
1 255 GLU n 
1 256 LEU n 
1 257 ALA n 
1 258 THR n 
1 259 PRO n 
1 260 PRO n 
1 261 LEU n 
1 262 ASP n 
1 263 GLY n 
1 264 ILE n 
1 265 ILE n 
1 266 LEU n 
1 267 PRO n 
1 268 GLY n 
1 269 VAL n 
1 270 THR n 
1 271 ARG n 
1 272 ARG n 
1 273 CYS n 
1 274 ILE n 
1 275 LEU n 
1 276 ASP n 
1 277 LEU n 
1 278 ALA n 
1 279 HIS n 
1 280 GLN n 
1 281 TRP n 
1 282 GLY n 
1 283 GLU n 
1 284 PHE n 
1 285 LYS n 
1 286 VAL n 
1 287 SER n 
1 288 GLU n 
1 289 ARG n 
1 290 TYR n 
1 291 LEU n 
1 292 THR n 
1 293 MET n 
1 294 ASP n 
1 295 ASP n 
1 296 LEU n 
1 297 THR n 
1 298 THR n 
1 299 ALA n 
1 300 LEU n 
1 301 GLU n 
1 302 GLY n 
1 303 ASN n 
1 304 ARG n 
1 305 VAL n 
1 306 ARG n 
1 307 GLU n 
1 308 MET n 
1 309 PHE n 
1 310 SER n 
1 311 SER n 
1 312 GLY n 
1 313 THR n 
1 314 ALA n 
1 315 CYS n 
1 316 VAL n 
1 317 VAL n 
1 318 CYS n 
1 319 PRO n 
1 320 VAL n 
1 321 SER n 
1 322 ASP n 
1 323 ILE n 
1 324 LEU n 
1 325 TYR n 
1 326 LYS n 
1 327 GLY n 
1 328 GLU n 
1 329 THR n 
1 330 ILE n 
1 331 HIS n 
1 332 ILE n 
1 333 PRO n 
1 334 THR n 
1 335 MET n 
1 336 GLU n 
1 337 ASN n 
1 338 GLY n 
1 339 PRO n 
1 340 LYS n 
1 341 LEU n 
1 342 ALA n 
1 343 SER n 
1 344 ARG n 
1 345 ILE n 
1 346 LEU n 
1 347 SER n 
1 348 LYS n 
1 349 LEU n 
1 350 THR n 
1 351 ASP n 
1 352 ILE n 
1 353 GLN n 
1 354 TYR n 
1 355 GLY n 
1 356 ARG n 
1 357 GLU n 
1 358 GLU n 
1 359 SER n 
1 360 ASP n 
1 361 TRP n 
1 362 THR n 
1 363 ILE n 
1 364 VAL n 
1 365 LEU n 
1 366 SER n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 'BCAT1, BCT1, ECA39' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    BCAT1_HUMAN 
_struct_ref.pdbx_db_accession          P54687 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_align_begin           21 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.pdbx_seq_one_letter_code   ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2ABJ A 1 ? 366 ? P54687 21 ? 386 ? 19 384 
2 1 2ABJ D 1 ? 366 ? P54687 21 ? 386 ? 19 384 
3 1 2ABJ G 1 ? 366 ? P54687 21 ? 386 ? 19 384 
4 1 2ABJ J 1 ? 366 ? P54687 21 ? 386 ? 19 384 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2ABJ ALA A 145 ? UNP P54687 THR 165 VARIANT 163 1  
1 2ABJ ASP A 217 ? UNP P54687 ALA 237 VARIANT 235 2  
1 2ABJ ARG A 231 ? UNP P54687 GLU 251 VARIANT 249 3  
1 2ABJ THR A 297 ? UNP P54687 SER 317 VARIANT 315 4  
1 2ABJ SER A 310 ? UNP P54687 GLY 330 VARIANT 328 5  
2 2ABJ ALA D 145 ? UNP P54687 THR 165 VARIANT 163 6  
2 2ABJ ASP D 217 ? UNP P54687 ALA 237 VARIANT 235 7  
2 2ABJ ARG D 231 ? UNP P54687 GLU 251 VARIANT 249 8  
2 2ABJ THR D 297 ? UNP P54687 SER 317 VARIANT 315 9  
2 2ABJ SER D 310 ? UNP P54687 GLY 330 VARIANT 328 10 
3 2ABJ ALA G 145 ? UNP P54687 THR 165 VARIANT 163 11 
3 2ABJ ASP G 217 ? UNP P54687 ALA 237 VARIANT 235 12 
3 2ABJ ARG G 231 ? UNP P54687 GLU 251 VARIANT 249 13 
3 2ABJ THR G 297 ? UNP P54687 SER 317 VARIANT 315 14 
3 2ABJ SER G 310 ? UNP P54687 GLY 330 VARIANT 328 15 
4 2ABJ ALA J 145 ? UNP P54687 THR 165 VARIANT 163 16 
4 2ABJ ASP J 217 ? UNP P54687 ALA 237 VARIANT 235 17 
4 2ABJ ARG J 231 ? UNP P54687 GLU 251 VARIANT 249 18 
4 2ABJ THR J 297 ? UNP P54687 SER 317 VARIANT 315 19 
4 2ABJ SER J 310 ? UNP P54687 GLY 330 VARIANT 328 20 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                         ?                      
'C3 H7 N O2'            89.093  
ARG 'L-peptide linking' y ARGININE                                                                        ?                      
'C6 H15 N4 O2 1'        175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                      ?                      
'C4 H8 N2 O3'           132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                 ?                      
'C4 H7 N O4'            133.103 
CBC non-polymer         . "N'-(5-CHLOROBENZOFURAN-2-CARBONYL)-2-(TRIFLUOROMETHYL)BENZENESULFONOHYDRAZIDE" ?                      
'C16 H10 Cl F3 N2 O4 S' 418.775 
CYS 'L-peptide linking' y CYSTEINE                                                                        ?                      
'C3 H7 N O2 S'          121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                       ?                      
'C5 H10 N2 O3'          146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                 ?                      
'C5 H9 N O4'            147.129 
GLY 'peptide linking'   y GLYCINE                                                                         ?                      
'C2 H5 N O2'            75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                       ?                      
'C6 H10 N3 O2 1'        156.162 
HOH non-polymer         . WATER                                                                           ?                      
'H2 O'                  18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                      ?                      
'C6 H13 N O2'           131.173 
LEU 'L-peptide linking' y LEUCINE                                                                         ?                      
'C6 H13 N O2'           131.173 
LYS 'L-peptide linking' y LYSINE                                                                          ?                      
'C6 H15 N2 O2 1'        147.195 
MET 'L-peptide linking' y METHIONINE                                                                      ?                      
'C5 H11 N O2 S'         149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                   ?                      
'C9 H11 N O2'           165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE"                                                        'VITAMIN B6 Phosphate' 
'C8 H10 N O6 P'         247.142 
PRO 'L-peptide linking' y PROLINE                                                                         ?                      
'C5 H9 N O2'            115.130 
SER 'L-peptide linking' y SERINE                                                                          ?                      
'C3 H7 N O3'            105.093 
THR 'L-peptide linking' y THREONINE                                                                       ?                      
'C4 H9 N O3'            119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                      ?                      
'C11 H12 N2 O2'         204.225 
TYR 'L-peptide linking' y TYROSINE                                                                        ?                      
'C9 H11 N O3'           181.189 
VAL 'L-peptide linking' y VALINE                                                                          ?                      
'C5 H11 N O2'           117.146 
# 
_exptl.entry_id          2ABJ 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.9 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   56.6 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG4K, Ammonium Acetate, Sodium Citrate, TCEP, EDTA, pH 5.6, VAPOR DIFFUSION, HANGING DROP, temperature 278K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   2002-09-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 17-ID' 
_diffrn_source.pdbx_wavelength             1.000 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   17-ID 
# 
_reflns.entry_id                     2ABJ 
_reflns.d_resolution_low             90.91 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   94429 
_reflns.percent_possible_obs         98.100 
_reflns.pdbx_Rmerge_I_obs            0.059 
_reflns.pdbx_chi_squared             0.943 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   0 
_reflns.observed_criterion_sigma_I   0 
_reflns.number_all                   94429 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_low              2.28 
_reflns_shell.d_res_high             2.20 
_reflns_shell.number_measured_obs    8378 
_reflns_shell.percent_possible_obs   88.600 
_reflns_shell.Rmerge_I_obs           0.214 
_reflns_shell.pdbx_chi_squared       0.786 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.percent_possible_all   88.6 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.ls_d_res_high                            2.200 
_refine.ls_d_res_low                             90.910 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    98.120 
_refine.ls_number_reflns_obs                     94358 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.208 
_refine.ls_R_factor_R_work                       0.205 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  4719 
_refine.B_iso_mean                               20.798 
_refine.aniso_B[1][1]                            -0.400 
_refine.aniso_B[2][2]                            2.540 
_refine.aniso_B[3][3]                            -2.140 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.927 
_refine.pdbx_overall_ESU_R                       0.272 
_refine.pdbx_overall_ESU_R_Free                  0.221 
_refine.overall_SU_ML                            0.143 
_refine.overall_SU_B                             5.514 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2ABJ 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     94429 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        11456 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         168 
_refine_hist.number_atoms_solvent             1413 
_refine_hist.number_atoms_total               13037 
_refine_hist.d_res_high                       2.200 
_refine_hist.d_res_low                        90.910 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         11922 0.008  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      16236 1.339  1.983  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   1443  5.881  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   508   38.989 24.252 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   1987  16.453 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   60    19.215 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           1787  0.083  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     8978  0.003  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            5690  0.193  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          8026  0.302  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    1080  0.124  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   47    0.146  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 24    0.094  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              7467  0.739  1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             11708 0.840  2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              5242  1.439  3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             4528  2.139  4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.200 
_refine_ls_shell.d_res_low                        2.257 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               85.740 
_refine_ls_shell.number_reflns_R_work             5714 
_refine_ls_shell.R_factor_R_work                  0.226 
_refine_ls_shell.R_factor_R_free                  0.288 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                6012 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2ABJ 
_struct.title                     
;Crystal structure of human branched chain amino acid transaminase in a complex with an inhibitor, C16H10N2O4F3SCl, and pyridoxal 5' phosphate.
;
_struct.pdbx_descriptor           'Branched-chain-amino-acid aminotransferase, cytosolic (E.C.2.6.1.42)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ABJ 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;branched-chain-amino-acid aminotransferase, cytosolic, pyridoxal-phosphate-dependent aminotransferase, PLP-Lys220 Schiff base, inhibitor-bound, TRANSFERASE
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 3 ? 
G N N 2 ? 
H N N 3 ? 
I N N 2 ? 
J N N 3 ? 
K N N 2 ? 
L N N 3 ? 
M N N 4 ? 
N N N 4 ? 
O N N 4 ? 
P N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 6   ? LEU A 10  ? LYS A 24  LEU A 28  5 ? 5  
HELX_P HELX_P2  2  ASP A 23  ? LEU A 27  ? ASP A 41  LEU A 45  5 ? 5  
HELX_P HELX_P3  3  SER A 65  ? TYR A 70  ? SER A 83  TYR A 88  1 ? 6  
HELX_P HELX_P4  4  GLN A 92  ? THR A 108 ? GLN A 110 THR A 126 1 ? 17 
HELX_P HELX_P5  5  ASP A 113 ? ASP A 128 ? ASP A 131 ASP A 146 1 ? 16 
HELX_P HELX_P6  6  GLN A 129 ? VAL A 132 ? GLN A 147 VAL A 150 5 ? 4  
HELX_P HELX_P7  7  GLY A 204 ? SER A 209 ? GLY A 222 SER A 227 1 ? 6  
HELX_P HELX_P8  8  SER A 210 ? ASN A 220 ? SER A 228 ASN A 238 1 ? 11 
HELX_P HELX_P9  9  GLY A 268 ? GLY A 282 ? GLY A 286 GLY A 300 1 ? 15 
HELX_P HELX_P10 10 THR A 292 ? GLY A 302 ? THR A 310 GLY A 320 1 ? 11 
HELX_P HELX_P11 11 THR A 334 ? GLY A 338 ? THR A 352 GLY A 356 5 ? 5  
HELX_P HELX_P12 12 PRO A 339 ? TYR A 354 ? PRO A 357 TYR A 372 1 ? 16 
HELX_P HELX_P13 13 LYS B 6   ? LEU B 10  ? LYS D 24  LEU D 28  5 ? 5  
HELX_P HELX_P14 14 ASP B 23  ? LEU B 27  ? ASP D 41  LEU D 45  5 ? 5  
HELX_P HELX_P15 15 SER B 65  ? TYR B 70  ? SER D 83  TYR D 88  1 ? 6  
HELX_P HELX_P16 16 GLN B 92  ? THR B 108 ? GLN D 110 THR D 126 1 ? 17 
HELX_P HELX_P17 17 ASP B 113 ? ASP B 128 ? ASP D 131 ASP D 146 1 ? 16 
HELX_P HELX_P18 18 GLN B 129 ? VAL B 132 ? GLN D 147 VAL D 150 5 ? 4  
HELX_P HELX_P19 19 GLY B 204 ? SER B 209 ? GLY D 222 SER D 227 1 ? 6  
HELX_P HELX_P20 20 SER B 210 ? ASN B 220 ? SER D 228 ASN D 238 1 ? 11 
HELX_P HELX_P21 21 GLY B 268 ? GLY B 282 ? GLY D 286 GLY D 300 1 ? 15 
HELX_P HELX_P22 22 THR B 292 ? GLY B 302 ? THR D 310 GLY D 320 1 ? 11 
HELX_P HELX_P23 23 THR B 334 ? GLY B 338 ? THR D 352 GLY D 356 5 ? 5  
HELX_P HELX_P24 24 PRO B 339 ? TYR B 354 ? PRO D 357 TYR D 372 1 ? 16 
HELX_P HELX_P25 25 LYS C 6   ? LEU C 10  ? LYS G 24  LEU G 28  5 ? 5  
HELX_P HELX_P26 26 ASP C 23  ? LEU C 27  ? ASP G 41  LEU G 45  5 ? 5  
HELX_P HELX_P27 27 SER C 65  ? TYR C 70  ? SER G 83  TYR G 88  1 ? 6  
HELX_P HELX_P28 28 GLN C 92  ? THR C 108 ? GLN G 110 THR G 126 1 ? 17 
HELX_P HELX_P29 29 ASP C 113 ? ASP C 128 ? ASP G 131 ASP G 146 1 ? 16 
HELX_P HELX_P30 30 GLN C 129 ? VAL C 132 ? GLN G 147 VAL G 150 5 ? 4  
HELX_P HELX_P31 31 GLY C 204 ? SER C 209 ? GLY G 222 SER G 227 1 ? 6  
HELX_P HELX_P32 32 SER C 210 ? ASN C 220 ? SER G 228 ASN G 238 1 ? 11 
HELX_P HELX_P33 33 GLY C 268 ? GLY C 282 ? GLY G 286 GLY G 300 1 ? 15 
HELX_P HELX_P34 34 THR C 292 ? GLY C 302 ? THR G 310 GLY G 320 1 ? 11 
HELX_P HELX_P35 35 THR C 334 ? GLY C 338 ? THR G 352 GLY G 356 5 ? 5  
HELX_P HELX_P36 36 PRO C 339 ? TYR C 354 ? PRO G 357 TYR G 372 1 ? 16 
HELX_P HELX_P37 37 LYS D 6   ? LEU D 10  ? LYS J 24  LEU J 28  5 ? 5  
HELX_P HELX_P38 38 ASP D 23  ? LEU D 27  ? ASP J 41  LEU J 45  5 ? 5  
HELX_P HELX_P39 39 SER D 65  ? TYR D 70  ? SER J 83  TYR J 88  1 ? 6  
HELX_P HELX_P40 40 GLN D 92  ? THR D 108 ? GLN J 110 THR J 126 1 ? 17 
HELX_P HELX_P41 41 ASP D 113 ? ASP D 128 ? ASP J 131 ASP J 146 1 ? 16 
HELX_P HELX_P42 42 GLN D 129 ? VAL D 132 ? GLN J 147 VAL J 150 5 ? 4  
HELX_P HELX_P43 43 GLY D 204 ? SER D 209 ? GLY J 222 SER J 227 1 ? 6  
HELX_P HELX_P44 44 SER D 210 ? ASN D 220 ? SER J 228 ASN J 238 1 ? 11 
HELX_P HELX_P45 45 GLY D 268 ? GLY D 282 ? GLY J 286 GLY J 300 1 ? 15 
HELX_P HELX_P46 46 THR D 292 ? GLY D 302 ? THR J 310 GLY J 320 1 ? 11 
HELX_P HELX_P47 47 THR D 334 ? GLY D 338 ? THR J 352 GLY J 356 5 ? 5  
HELX_P HELX_P48 48 PRO D 339 ? TYR D 354 ? PRO J 357 TYR J 372 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 202 NZ ? ? ? 1_555 F PLP . C4A ? ? A LYS 220 A PLP 420 1_555 ? ? ? ? ? ? ? 2.045 ? 
covale2 covale ? ? B LYS 202 NZ ? ? ? 1_555 H PLP . C4A ? ? D LYS 220 D PLP 420 1_555 ? ? ? ? ? ? ? 1.877 ? 
covale3 covale ? ? C LYS 202 NZ ? ? ? 1_555 J PLP . C4A ? ? G LYS 220 G PLP 420 1_555 ? ? ? ? ? ? ? 1.926 ? 
covale4 covale ? ? D LYS 202 NZ ? ? ? 1_555 L PLP . C4A ? ? J LYS 220 J PLP 420 1_555 ? ? ? ? ? ? ? 1.994 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 338 A . ? GLY 356 A PRO 339 A ? PRO 357 A 1 5.00  
2 GLY 338 B . ? GLY 356 D PRO 339 B ? PRO 357 D 1 -3.44 
3 GLY 338 C . ? GLY 356 G PRO 339 C ? PRO 357 G 1 0.42  
4 GLY 338 D . ? GLY 356 J PRO 339 D ? PRO 357 J 1 2.67  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 7 ? 
C ? 2 ? 
D ? 8 ? 
E ? 6 ? 
F ? 6 ? 
G ? 7 ? 
H ? 8 ? 
I ? 6 ? 
J ? 6 ? 
K ? 7 ? 
L ? 2 ? 
M ? 8 ? 
N ? 6 ? 
O ? 6 ? 
P ? 7 ? 
Q ? 8 ? 
R ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
C 1 2 ? anti-parallel 
D 1 2 ? parallel      
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
D 4 5 ? anti-parallel 
D 5 6 ? parallel      
D 6 7 ? parallel      
D 7 8 ? anti-parallel 
E 1 2 ? parallel      
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
F 5 6 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
G 4 5 ? anti-parallel 
G 5 6 ? anti-parallel 
G 6 7 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? parallel      
H 6 7 ? parallel      
H 7 8 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
I 4 5 ? anti-parallel 
I 5 6 ? anti-parallel 
J 1 2 ? parallel      
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
J 4 5 ? anti-parallel 
J 5 6 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
K 4 5 ? anti-parallel 
K 5 6 ? anti-parallel 
K 6 7 ? anti-parallel 
L 1 2 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? parallel      
M 6 7 ? parallel      
M 7 8 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
N 4 5 ? anti-parallel 
N 5 6 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
O 4 5 ? anti-parallel 
O 5 6 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
P 4 5 ? anti-parallel 
P 5 6 ? anti-parallel 
P 6 7 ? anti-parallel 
Q 1 2 ? parallel      
Q 2 3 ? anti-parallel 
Q 3 4 ? anti-parallel 
Q 4 5 ? anti-parallel 
Q 5 6 ? parallel      
Q 6 7 ? parallel      
Q 7 8 ? anti-parallel 
R 1 2 ? parallel      
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
R 4 5 ? anti-parallel 
R 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 11  ? VAL A 12  ? ILE A 29  VAL A 30  
A 2 HIS A 52  ? PRO A 55  ? HIS A 70  PRO A 73  
A 3 HIS A 36  ? SER A 43  ? HIS A 54  SER A 61  
A 4 LYS A 160 ? VAL A 170 ? LYS A 178 VAL A 188 
A 5 SER A 139 ? GLY A 148 ? SER A 157 GLY A 166 
A 6 GLU A 73  ? PHE A 75  ? GLU A 91  PHE A 93  
B 1 GLY A 47  ? TRP A 48  ? GLY A 65  TRP A 66  
B 2 HIS A 36  ? SER A 43  ? HIS A 54  SER A 61  
B 3 LYS A 160 ? VAL A 170 ? LYS A 178 VAL A 188 
B 4 SER A 139 ? GLY A 148 ? SER A 157 GLY A 166 
B 5 LEU A 78  ? ARG A 82  ? LEU A 96  ARG A 100 
B 6 ILE A 88  ? PHE A 91  ? ILE A 106 PHE A 109 
B 7 THR A 362 ? VAL A 364 ? THR A 380 VAL A 382 
C 1 LEU A 59  ? LEU A 61  ? LEU A 77  LEU A 79  
C 2 LEU B 59  ? LEU B 61  ? LEU D 77  LEU D 79  
D 1 LYS A 285 ? GLU A 288 ? LYS A 303 GLU A 306 
D 2 GLU A 254 ? THR A 258 ? GLU A 272 THR A 276 
D 3 MET A 241 ? ILE A 248 ? MET A 259 ILE A 266 
D 4 GLN A 234 ? VAL A 238 ? GLN A 252 VAL A 256 
D 5 GLN A 224 ? TYR A 229 ? GLN A 242 TYR A 247 
D 6 VAL A 182 ? TRP A 185 ? VAL A 200 TRP A 203 
D 7 VAL A 316 ? TYR A 325 ? VAL A 334 TYR A 343 
D 8 GLU A 328 ? HIS A 331 ? GLU A 346 HIS A 349 
E 1 LYS A 285 ? GLU A 288 ? LYS A 303 GLU A 306 
E 2 GLU A 254 ? THR A 258 ? GLU A 272 THR A 276 
E 3 MET A 241 ? ILE A 248 ? MET A 259 ILE A 266 
E 4 VAL A 305 ? GLY A 312 ? VAL A 323 GLY A 330 
E 5 VAL A 316 ? TYR A 325 ? VAL A 334 TYR A 343 
E 6 GLU A 328 ? HIS A 331 ? GLU A 346 HIS A 349 
F 1 ILE B 11  ? VAL B 12  ? ILE D 29  VAL D 30  
F 2 HIS B 52  ? PRO B 55  ? HIS D 70  PRO D 73  
F 3 HIS B 36  ? SER B 43  ? HIS D 54  SER D 61  
F 4 LYS B 160 ? VAL B 170 ? LYS D 178 VAL D 188 
F 5 SER B 139 ? GLY B 148 ? SER D 157 GLY D 166 
F 6 GLU B 73  ? PHE B 75  ? GLU D 91  PHE D 93  
G 1 GLY B 47  ? TRP B 48  ? GLY D 65  TRP D 66  
G 2 HIS B 36  ? SER B 43  ? HIS D 54  SER D 61  
G 3 LYS B 160 ? VAL B 170 ? LYS D 178 VAL D 188 
G 4 SER B 139 ? GLY B 148 ? SER D 157 GLY D 166 
G 5 LEU B 78  ? ARG B 82  ? LEU D 96  ARG D 100 
G 6 ILE B 88  ? PHE B 91  ? ILE D 106 PHE D 109 
G 7 THR B 362 ? VAL B 364 ? THR D 380 VAL D 382 
H 1 LYS B 285 ? GLU B 288 ? LYS D 303 GLU D 306 
H 2 GLU B 254 ? THR B 258 ? GLU D 272 THR D 276 
H 3 MET B 241 ? ILE B 248 ? MET D 259 ILE D 266 
H 4 GLN B 234 ? VAL B 238 ? GLN D 252 VAL D 256 
H 5 GLN B 224 ? TYR B 229 ? GLN D 242 TYR D 247 
H 6 VAL B 182 ? ALA B 186 ? VAL D 200 ALA D 204 
H 7 VAL B 316 ? TYR B 325 ? VAL D 334 TYR D 343 
H 8 GLU B 328 ? HIS B 331 ? GLU D 346 HIS D 349 
I 1 LYS B 285 ? GLU B 288 ? LYS D 303 GLU D 306 
I 2 GLU B 254 ? THR B 258 ? GLU D 272 THR D 276 
I 3 MET B 241 ? ILE B 248 ? MET D 259 ILE D 266 
I 4 VAL B 305 ? GLY B 312 ? VAL D 323 GLY D 330 
I 5 VAL B 316 ? TYR B 325 ? VAL D 334 TYR D 343 
I 6 GLU B 328 ? HIS B 331 ? GLU D 346 HIS D 349 
J 1 ILE C 11  ? VAL C 12  ? ILE G 29  VAL G 30  
J 2 HIS C 52  ? PRO C 55  ? HIS G 70  PRO G 73  
J 3 HIS C 36  ? SER C 43  ? HIS G 54  SER G 61  
J 4 LYS C 160 ? VAL C 170 ? LYS G 178 VAL G 188 
J 5 SER C 139 ? GLY C 148 ? SER G 157 GLY G 166 
J 6 GLU C 73  ? PHE C 75  ? GLU G 91  PHE G 93  
K 1 GLY C 47  ? TRP C 48  ? GLY G 65  TRP G 66  
K 2 HIS C 36  ? SER C 43  ? HIS G 54  SER G 61  
K 3 LYS C 160 ? VAL C 170 ? LYS G 178 VAL G 188 
K 4 SER C 139 ? GLY C 148 ? SER G 157 GLY G 166 
K 5 LEU C 78  ? ARG C 82  ? LEU G 96  ARG G 100 
K 6 ILE C 88  ? PHE C 91  ? ILE G 106 PHE G 109 
K 7 THR C 362 ? VAL C 364 ? THR G 380 VAL G 382 
L 1 LEU C 59  ? LEU C 61  ? LEU G 77  LEU G 79  
L 2 LEU D 59  ? LEU D 61  ? LEU J 77  LEU J 79  
M 1 LYS C 285 ? GLU C 288 ? LYS G 303 GLU G 306 
M 2 GLU C 254 ? THR C 258 ? GLU G 272 THR G 276 
M 3 MET C 241 ? ILE C 248 ? MET G 259 ILE G 266 
M 4 GLN C 234 ? VAL C 238 ? GLN G 252 VAL G 256 
M 5 GLN C 224 ? TYR C 229 ? GLN G 242 TYR G 247 
M 6 VAL C 182 ? ALA C 186 ? VAL G 200 ALA G 204 
M 7 VAL C 316 ? TYR C 325 ? VAL G 334 TYR G 343 
M 8 GLU C 328 ? HIS C 331 ? GLU G 346 HIS G 349 
N 1 LYS C 285 ? GLU C 288 ? LYS G 303 GLU G 306 
N 2 GLU C 254 ? THR C 258 ? GLU G 272 THR G 276 
N 3 MET C 241 ? ILE C 248 ? MET G 259 ILE G 266 
N 4 VAL C 305 ? GLY C 312 ? VAL G 323 GLY G 330 
N 5 VAL C 316 ? TYR C 325 ? VAL G 334 TYR G 343 
N 6 GLU C 328 ? HIS C 331 ? GLU G 346 HIS G 349 
O 1 ILE D 11  ? VAL D 12  ? ILE J 29  VAL J 30  
O 2 HIS D 52  ? PRO D 55  ? HIS J 70  PRO J 73  
O 3 HIS D 36  ? SER D 43  ? HIS J 54  SER J 61  
O 4 LYS D 160 ? VAL D 170 ? LYS J 178 VAL J 188 
O 5 SER D 139 ? GLY D 148 ? SER J 157 GLY J 166 
O 6 GLU D 73  ? PHE D 75  ? GLU J 91  PHE J 93  
P 1 GLY D 47  ? TRP D 48  ? GLY J 65  TRP J 66  
P 2 HIS D 36  ? SER D 43  ? HIS J 54  SER J 61  
P 3 LYS D 160 ? VAL D 170 ? LYS J 178 VAL J 188 
P 4 SER D 139 ? GLY D 148 ? SER J 157 GLY J 166 
P 5 LEU D 78  ? ARG D 82  ? LEU J 96  ARG J 100 
P 6 ILE D 88  ? PHE D 91  ? ILE J 106 PHE J 109 
P 7 THR D 362 ? VAL D 364 ? THR J 380 VAL J 382 
Q 1 LYS D 285 ? GLU D 288 ? LYS J 303 GLU J 306 
Q 2 GLU D 254 ? THR D 258 ? GLU J 272 THR J 276 
Q 3 MET D 241 ? ILE D 248 ? MET J 259 ILE J 266 
Q 4 GLN D 234 ? VAL D 238 ? GLN J 252 VAL J 256 
Q 5 GLN D 224 ? TYR D 229 ? GLN J 242 TYR J 247 
Q 6 VAL D 182 ? ALA D 186 ? VAL J 200 ALA J 204 
Q 7 VAL D 316 ? TYR D 325 ? VAL J 334 TYR J 343 
Q 8 GLU D 328 ? HIS D 331 ? GLU J 346 HIS J 349 
R 1 LYS D 285 ? GLU D 288 ? LYS J 303 GLU J 306 
R 2 GLU D 254 ? THR D 258 ? GLU J 272 THR J 276 
R 3 MET D 241 ? ILE D 248 ? MET J 259 ILE J 266 
R 4 VAL D 305 ? GLY D 312 ? VAL J 323 GLY J 330 
R 5 VAL D 316 ? TYR D 325 ? VAL J 334 TYR J 343 
R 6 GLU D 328 ? HIS D 331 ? GLU J 346 HIS J 349 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 11  ? N ILE A 29  O ILE A 53  ? O ILE A 71  
A 2 3 O LYS A 54  ? O LYS A 72  N MET A 37  ? N MET A 55  
A 3 4 N VAL A 40  ? N VAL A 58  O LEU A 163 ? O LEU A 181 
A 4 5 O PHE A 164 ? O PHE A 182 N ALA A 145 ? N ALA A 163 
A 5 6 O PHE A 146 ? O PHE A 164 N LEU A 74  ? N LEU A 92  
B 1 2 O GLY A 47  ? O GLY A 65  N SER A 43  ? N SER A 61  
B 2 3 N VAL A 40  ? N VAL A 58  O LEU A 163 ? O LEU A 181 
B 3 4 O PHE A 164 ? O PHE A 182 N ALA A 145 ? N ALA A 163 
B 4 5 O ILE A 142 ? O ILE A 160 N LEU A 78  ? N LEU A 96  
B 5 6 N PHE A 81  ? N PHE A 99  O ARG A 89  ? O ARG A 107 
B 6 7 N LEU A 90  ? N LEU A 108 O ILE A 363 ? O ILE A 381 
C 1 2 N LEU A 59  ? N LEU A 77  O LEU B 61  ? O LEU D 79  
D 1 2 O LYS A 285 ? O LYS A 303 N LEU A 256 ? N LEU A 274 
D 2 3 O GLU A 255 ? O GLU A 273 N TRP A 247 ? N TRP A 265 
D 3 4 O MET A 241 ? O MET A 259 N VAL A 238 ? N VAL A 256 
D 4 5 O GLU A 237 ? O GLU A 255 N TRP A 227 ? N TRP A 245 
D 5 6 O GLN A 224 ? O GLN A 242 N TRP A 185 ? N TRP A 203 
D 6 7 N LEU A 184 ? N LEU A 202 O LEU A 324 ? O LEU A 342 
D 7 8 N ILE A 323 ? N ILE A 341 O ILE A 330 ? O ILE A 348 
E 1 2 O LYS A 285 ? O LYS A 303 N LEU A 256 ? N LEU A 274 
E 2 3 O GLU A 255 ? O GLU A 273 N TRP A 247 ? N TRP A 265 
E 3 4 N TYR A 246 ? N TYR A 264 O GLU A 307 ? O GLU A 325 
E 4 5 N MET A 308 ? N MET A 326 O VAL A 320 ? O VAL A 338 
E 5 6 N ILE A 323 ? N ILE A 341 O ILE A 330 ? O ILE A 348 
F 1 2 N ILE B 11  ? N ILE D 29  O ILE B 53  ? O ILE D 71  
F 2 3 O HIS B 52  ? O HIS D 70  N THR B 39  ? N THR D 57  
F 3 4 N VAL B 40  ? N VAL D 58  O LEU B 163 ? O LEU D 181 
F 4 5 O PHE B 164 ? O PHE D 182 N ALA B 145 ? N ALA D 163 
F 5 6 O PHE B 146 ? O PHE D 164 N LEU B 74  ? N LEU D 92  
G 1 2 O GLY B 47  ? O GLY D 65  N SER B 43  ? N SER D 61  
G 2 3 N VAL B 40  ? N VAL D 58  O LEU B 163 ? O LEU D 181 
G 3 4 O PHE B 164 ? O PHE D 182 N ALA B 145 ? N ALA D 163 
G 4 5 O ILE B 142 ? O ILE D 160 N LEU B 78  ? N LEU D 96  
G 5 6 N PHE B 81  ? N PHE D 99  O ARG B 89  ? O ARG D 107 
G 6 7 N LEU B 90  ? N LEU D 108 O ILE B 363 ? O ILE D 381 
H 1 2 O LYS B 285 ? O LYS D 303 N LEU B 256 ? N LEU D 274 
H 2 3 O GLU B 255 ? O GLU D 273 N TRP B 247 ? N TRP D 265 
H 3 4 O MET B 241 ? O MET D 259 N VAL B 238 ? N VAL D 256 
H 4 5 O GLN B 234 ? O GLN D 252 N TYR B 229 ? N TYR D 247 
H 5 6 O GLN B 224 ? O GLN D 242 N TRP B 185 ? N TRP D 203 
H 6 7 N LEU B 184 ? N LEU D 202 O LEU B 324 ? O LEU D 342 
H 7 8 N ILE B 323 ? N ILE D 341 O ILE B 330 ? O ILE D 348 
I 1 2 O LYS B 285 ? O LYS D 303 N LEU B 256 ? N LEU D 274 
I 2 3 O GLU B 255 ? O GLU D 273 N TRP B 247 ? N TRP D 265 
I 3 4 N TYR B 246 ? N TYR D 264 O GLU B 307 ? O GLU D 325 
I 4 5 N MET B 308 ? N MET D 326 O VAL B 320 ? O VAL D 338 
I 5 6 N ILE B 323 ? N ILE D 341 O ILE B 330 ? O ILE D 348 
J 1 2 N ILE C 11  ? N ILE G 29  O ILE C 53  ? O ILE G 71  
J 2 3 O HIS C 52  ? O HIS G 70  N THR C 39  ? N THR G 57  
J 3 4 N VAL C 40  ? N VAL G 58  O LEU C 163 ? O LEU G 181 
J 4 5 O PHE C 164 ? O PHE G 182 N ALA C 145 ? N ALA G 163 
J 5 6 O PHE C 146 ? O PHE G 164 N LEU C 74  ? N LEU G 92  
K 1 2 O GLY C 47  ? O GLY G 65  N SER C 43  ? N SER G 61  
K 2 3 N VAL C 40  ? N VAL G 58  O LEU C 163 ? O LEU G 181 
K 3 4 O PHE C 164 ? O PHE G 182 N ALA C 145 ? N ALA G 163 
K 4 5 O ILE C 142 ? O ILE G 160 N LEU C 78  ? N LEU G 96  
K 5 6 N PHE C 81  ? N PHE G 99  O ARG C 89  ? O ARG G 107 
K 6 7 N LEU C 90  ? N LEU G 108 O ILE C 363 ? O ILE G 381 
L 1 2 N LEU C 61  ? N LEU G 79  O LEU D 59  ? O LEU J 77  
M 1 2 O LYS C 285 ? O LYS G 303 N LEU C 256 ? N LEU G 274 
M 2 3 O GLU C 255 ? O GLU G 273 N TRP C 247 ? N TRP G 265 
M 3 4 O MET C 241 ? O MET G 259 N VAL C 238 ? N VAL G 256 
M 4 5 O GLN C 234 ? O GLN G 252 N TYR C 229 ? N TYR G 247 
M 5 6 O LEU C 226 ? O LEU G 244 N TRP C 185 ? N TRP G 203 
M 6 7 N LEU C 184 ? N LEU G 202 O LEU C 324 ? O LEU G 342 
M 7 8 N ILE C 323 ? N ILE G 341 O ILE C 330 ? O ILE G 348 
N 1 2 O LYS C 285 ? O LYS G 303 N LEU C 256 ? N LEU G 274 
N 2 3 O GLU C 255 ? O GLU G 273 N TRP C 247 ? N TRP G 265 
N 3 4 N TYR C 246 ? N TYR G 264 O GLU C 307 ? O GLU G 325 
N 4 5 N MET C 308 ? N MET G 326 O VAL C 320 ? O VAL G 338 
N 5 6 N ILE C 323 ? N ILE G 341 O ILE C 330 ? O ILE G 348 
O 1 2 N ILE D 11  ? N ILE J 29  O ILE D 53  ? O ILE J 71  
O 2 3 O HIS D 52  ? O HIS J 70  N THR D 39  ? N THR J 57  
O 3 4 N VAL D 40  ? N VAL J 58  O LEU D 163 ? O LEU J 181 
O 4 5 O PHE D 164 ? O PHE J 182 N ALA D 145 ? N ALA J 163 
O 5 6 O PHE D 146 ? O PHE J 164 N LEU D 74  ? N LEU J 92  
P 1 2 O GLY D 47  ? O GLY J 65  N SER D 43  ? N SER J 61  
P 2 3 N VAL D 40  ? N VAL J 58  O LEU D 163 ? O LEU J 181 
P 3 4 O PHE D 164 ? O PHE J 182 N ALA D 145 ? N ALA J 163 
P 4 5 O ILE D 142 ? O ILE J 160 N LEU D 78  ? N LEU J 96  
P 5 6 N PHE D 81  ? N PHE J 99  O ARG D 89  ? O ARG J 107 
P 6 7 N LEU D 90  ? N LEU J 108 O ILE D 363 ? O ILE J 381 
Q 1 2 O LYS D 285 ? O LYS J 303 N LEU D 256 ? N LEU J 274 
Q 2 3 O GLU D 255 ? O GLU J 273 N TRP D 247 ? N TRP J 265 
Q 3 4 O MET D 241 ? O MET J 259 N VAL D 238 ? N VAL J 256 
Q 4 5 O GLN D 234 ? O GLN J 252 N TYR D 229 ? N TYR J 247 
Q 5 6 O LEU D 226 ? O LEU J 244 N TRP D 185 ? N TRP J 203 
Q 6 7 N LEU D 184 ? N LEU J 202 O LEU D 324 ? O LEU J 342 
Q 7 8 N ILE D 323 ? N ILE J 341 O ILE D 330 ? O ILE J 348 
R 1 2 O LYS D 285 ? O LYS J 303 N LEU D 256 ? N LEU J 274 
R 2 3 O GLU D 255 ? O GLU J 273 N TRP D 247 ? N TRP J 265 
R 3 4 N TYR D 246 ? N TYR J 264 O GLU D 307 ? O GLU J 325 
R 4 5 N MET D 308 ? N MET J 326 O VAL D 320 ? O VAL J 338 
R 5 6 N ILE D 323 ? N ILE J 341 O ILE D 330 ? O ILE J 348 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CBC A 1401' 
AC2 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PLP A 420'  
AC3 Software ? ? ? ? 13 'BINDING SITE FOR RESIDUE CBC D 2401' 
AC4 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE PLP D 420'  
AC5 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE CBC G 3401' 
AC6 Software ? ? ? ? 18 'BINDING SITE FOR RESIDUE PLP G 420'  
AC7 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE CBC J 4401' 
AC8 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE PLP J 420'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 14 PHE A 29  ? PHE A 47   . ? 1_555 ? 
2   AC1 14 PHE A 75  ? PHE A 93   . ? 1_555 ? 
3   AC1 14 TYR A 141 ? TYR A 159  . ? 1_555 ? 
4   AC1 14 TYR A 173 ? TYR A 191  . ? 1_555 ? 
5   AC1 14 LYS A 202 ? LYS A 220  . ? 1_555 ? 
6   AC1 14 GLN A 224 ? GLN A 242  . ? 1_555 ? 
7   AC1 14 THR A 240 ? THR A 258  . ? 1_555 ? 
8   AC1 14 MET A 241 ? MET A 259  . ? 1_555 ? 
9   AC1 14 GLY A 312 ? GLY A 330  . ? 1_555 ? 
10  AC1 14 THR A 313 ? THR A 331  . ? 1_555 ? 
11  AC1 14 ALA A 314 ? ALA A 332  . ? 1_555 ? 
12  AC1 14 CYS A 315 ? CYS A 333  . ? 1_555 ? 
13  AC1 14 PLP F .   ? PLP A 420  . ? 1_555 ? 
14  AC1 14 HOH M .   ? HOH A 1746 . ? 1_555 ? 
15  AC2 17 ARG A 99  ? ARG A 117  . ? 1_555 ? 
16  AC2 17 ARG A 192 ? ARG A 210  . ? 1_555 ? 
17  AC2 17 LYS A 202 ? LYS A 220  . ? 1_555 ? 
18  AC2 17 TYR A 207 ? TYR A 225  . ? 1_555 ? 
19  AC2 17 GLU A 237 ? GLU A 255  . ? 1_555 ? 
20  AC2 17 THR A 240 ? THR A 258  . ? 1_555 ? 
21  AC2 17 ASN A 242 ? ASN A 260  . ? 1_555 ? 
22  AC2 17 LEU A 266 ? LEU A 284  . ? 1_555 ? 
23  AC2 17 GLY A 268 ? GLY A 286  . ? 1_555 ? 
24  AC2 17 VAL A 269 ? VAL A 287  . ? 1_555 ? 
25  AC2 17 THR A 270 ? THR A 288  . ? 1_555 ? 
26  AC2 17 GLY A 312 ? GLY A 330  . ? 1_555 ? 
27  AC2 17 THR A 313 ? THR A 331  . ? 1_555 ? 
28  AC2 17 CBC E .   ? CBC A 1401 . ? 1_555 ? 
29  AC2 17 HOH M .   ? HOH A 1402 . ? 1_555 ? 
30  AC2 17 HOH M .   ? HOH A 1403 . ? 1_555 ? 
31  AC2 17 HOH M .   ? HOH A 1404 . ? 1_555 ? 
32  AC3 13 VAL A 155 ? VAL A 173  . ? 1_555 ? 
33  AC3 13 PHE B 29  ? PHE D 47   . ? 1_555 ? 
34  AC3 13 PHE B 75  ? PHE D 93   . ? 1_555 ? 
35  AC3 13 TYR B 141 ? TYR D 159  . ? 1_555 ? 
36  AC3 13 LYS B 202 ? LYS D 220  . ? 1_555 ? 
37  AC3 13 GLN B 224 ? GLN D 242  . ? 1_555 ? 
38  AC3 13 THR B 240 ? THR D 258  . ? 1_555 ? 
39  AC3 13 MET B 241 ? MET D 259  . ? 1_555 ? 
40  AC3 13 GLY B 312 ? GLY D 330  . ? 1_555 ? 
41  AC3 13 ALA B 314 ? ALA D 332  . ? 1_555 ? 
42  AC3 13 CYS B 315 ? CYS D 333  . ? 1_555 ? 
43  AC3 13 PLP H .   ? PLP D 420  . ? 1_555 ? 
44  AC3 13 HOH N .   ? HOH D 2454 . ? 1_555 ? 
45  AC4 17 ARG B 99  ? ARG D 117  . ? 1_555 ? 
46  AC4 17 ARG B 192 ? ARG D 210  . ? 1_555 ? 
47  AC4 17 LYS B 202 ? LYS D 220  . ? 1_555 ? 
48  AC4 17 TYR B 207 ? TYR D 225  . ? 1_555 ? 
49  AC4 17 GLU B 237 ? GLU D 255  . ? 1_555 ? 
50  AC4 17 THR B 240 ? THR D 258  . ? 1_555 ? 
51  AC4 17 MET B 241 ? MET D 259  . ? 1_555 ? 
52  AC4 17 ASN B 242 ? ASN D 260  . ? 1_555 ? 
53  AC4 17 LEU B 266 ? LEU D 284  . ? 1_555 ? 
54  AC4 17 GLY B 268 ? GLY D 286  . ? 1_555 ? 
55  AC4 17 VAL B 269 ? VAL D 287  . ? 1_555 ? 
56  AC4 17 THR B 270 ? THR D 288  . ? 1_555 ? 
57  AC4 17 THR B 313 ? THR D 331  . ? 1_555 ? 
58  AC4 17 CBC G .   ? CBC D 2401 . ? 1_555 ? 
59  AC4 17 HOH N .   ? HOH D 2405 . ? 1_555 ? 
60  AC4 17 HOH N .   ? HOH D 2408 . ? 1_555 ? 
61  AC4 17 HOH N .   ? HOH D 2457 . ? 1_555 ? 
62  AC5 14 PHE C 29  ? PHE G 47   . ? 1_555 ? 
63  AC5 14 PHE C 75  ? PHE G 93   . ? 1_555 ? 
64  AC5 14 TYR C 141 ? TYR G 159  . ? 1_555 ? 
65  AC5 14 LYS C 202 ? LYS G 220  . ? 1_555 ? 
66  AC5 14 GLN C 224 ? GLN G 242  . ? 1_555 ? 
67  AC5 14 THR C 240 ? THR G 258  . ? 1_555 ? 
68  AC5 14 MET C 241 ? MET G 259  . ? 1_555 ? 
69  AC5 14 GLY C 312 ? GLY G 330  . ? 1_555 ? 
70  AC5 14 ALA C 314 ? ALA G 332  . ? 1_555 ? 
71  AC5 14 CYS C 315 ? CYS G 333  . ? 1_555 ? 
72  AC5 14 PLP J .   ? PLP G 420  . ? 1_555 ? 
73  AC5 14 HOH O .   ? HOH G 3444 . ? 1_555 ? 
74  AC5 14 TYR D 70  ? TYR J 88   . ? 1_555 ? 
75  AC5 14 VAL D 155 ? VAL J 173  . ? 1_555 ? 
76  AC6 18 ARG C 99  ? ARG G 117  . ? 1_555 ? 
77  AC6 18 ARG C 192 ? ARG G 210  . ? 1_555 ? 
78  AC6 18 LYS C 202 ? LYS G 220  . ? 1_555 ? 
79  AC6 18 TYR C 207 ? TYR G 225  . ? 1_555 ? 
80  AC6 18 GLU C 237 ? GLU G 255  . ? 1_555 ? 
81  AC6 18 THR C 240 ? THR G 258  . ? 1_555 ? 
82  AC6 18 MET C 241 ? MET G 259  . ? 1_555 ? 
83  AC6 18 ASN C 242 ? ASN G 260  . ? 1_555 ? 
84  AC6 18 LEU C 266 ? LEU G 284  . ? 1_555 ? 
85  AC6 18 GLY C 268 ? GLY G 286  . ? 1_555 ? 
86  AC6 18 VAL C 269 ? VAL G 287  . ? 1_555 ? 
87  AC6 18 THR C 270 ? THR G 288  . ? 1_555 ? 
88  AC6 18 GLY C 312 ? GLY G 330  . ? 1_555 ? 
89  AC6 18 THR C 313 ? THR G 331  . ? 1_555 ? 
90  AC6 18 CBC I .   ? CBC G 3401 . ? 1_555 ? 
91  AC6 18 HOH O .   ? HOH G 3406 . ? 1_555 ? 
92  AC6 18 HOH O .   ? HOH G 3407 . ? 1_555 ? 
93  AC6 18 HOH O .   ? HOH G 3428 . ? 1_555 ? 
94  AC7 15 VAL C 155 ? VAL G 173  . ? 1_555 ? 
95  AC7 15 PHE D 29  ? PHE J 47   . ? 1_555 ? 
96  AC7 15 PHE D 75  ? PHE J 93   . ? 1_555 ? 
97  AC7 15 TYR D 141 ? TYR J 159  . ? 1_555 ? 
98  AC7 15 TYR D 173 ? TYR J 191  . ? 1_555 ? 
99  AC7 15 LYS D 202 ? LYS J 220  . ? 1_555 ? 
100 AC7 15 GLN D 224 ? GLN J 242  . ? 1_555 ? 
101 AC7 15 THR D 240 ? THR J 258  . ? 1_555 ? 
102 AC7 15 MET D 241 ? MET J 259  . ? 1_555 ? 
103 AC7 15 GLY D 312 ? GLY J 330  . ? 1_555 ? 
104 AC7 15 THR D 313 ? THR J 331  . ? 1_555 ? 
105 AC7 15 ALA D 314 ? ALA J 332  . ? 1_555 ? 
106 AC7 15 CYS D 315 ? CYS J 333  . ? 1_555 ? 
107 AC7 15 PLP L .   ? PLP J 420  . ? 1_555 ? 
108 AC7 15 HOH P .   ? HOH J 4421 . ? 1_555 ? 
109 AC8 16 ARG D 99  ? ARG J 117  . ? 1_555 ? 
110 AC8 16 ARG D 192 ? ARG J 210  . ? 1_555 ? 
111 AC8 16 LYS D 202 ? LYS J 220  . ? 1_555 ? 
112 AC8 16 TYR D 207 ? TYR J 225  . ? 1_555 ? 
113 AC8 16 GLU D 237 ? GLU J 255  . ? 1_555 ? 
114 AC8 16 THR D 240 ? THR J 258  . ? 1_555 ? 
115 AC8 16 ASN D 242 ? ASN J 260  . ? 1_555 ? 
116 AC8 16 LEU D 266 ? LEU J 284  . ? 1_555 ? 
117 AC8 16 GLY D 268 ? GLY J 286  . ? 1_555 ? 
118 AC8 16 VAL D 269 ? VAL J 287  . ? 1_555 ? 
119 AC8 16 THR D 270 ? THR J 288  . ? 1_555 ? 
120 AC8 16 THR D 313 ? THR J 331  . ? 1_555 ? 
121 AC8 16 CBC K .   ? CBC J 4401 . ? 1_555 ? 
122 AC8 16 HOH P .   ? HOH J 4402 . ? 1_555 ? 
123 AC8 16 HOH P .   ? HOH J 4403 . ? 1_555 ? 
124 AC8 16 HOH P .   ? HOH J 4419 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2ABJ 
_atom_sites.fract_transf_matrix[1][1]   0.009064 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008732 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006717 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
F  
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N   . VAL A 1 1   ? 48.614  74.219 120.029 1.00 39.12 ? 19   VAL A N   1 
ATOM   2     C  CA  . VAL A 1 1   ? 49.729  75.208 119.846 1.00 39.05 ? 19   VAL A CA  1 
ATOM   3     C  C   . VAL A 1 1   ? 50.001  75.556 118.373 1.00 38.51 ? 19   VAL A C   1 
ATOM   4     O  O   . VAL A 1 1   ? 50.231  76.722 118.033 1.00 38.86 ? 19   VAL A O   1 
ATOM   5     C  CB  . VAL A 1 1   ? 51.057  74.754 120.543 1.00 39.18 ? 19   VAL A CB  1 
ATOM   6     C  CG1 . VAL A 1 1   ? 50.980  74.971 122.052 1.00 39.94 ? 19   VAL A CG1 1 
ATOM   7     C  CG2 . VAL A 1 1   ? 51.399  73.296 120.219 1.00 39.34 ? 19   VAL A CG2 1 
ATOM   8     N  N   . VAL A 1 2   ? 49.967  74.546 117.508 1.00 37.62 ? 20   VAL A N   1 
ATOM   9     C  CA  . VAL A 1 2   ? 50.286  74.725 116.087 1.00 36.64 ? 20   VAL A CA  1 
ATOM   10    C  C   . VAL A 1 2   ? 49.021  74.883 115.224 1.00 35.82 ? 20   VAL A C   1 
ATOM   11    O  O   . VAL A 1 2   ? 48.171  73.981 115.164 1.00 35.78 ? 20   VAL A O   1 
ATOM   12    C  CB  . VAL A 1 2   ? 51.274  73.625 115.573 1.00 36.72 ? 20   VAL A CB  1 
ATOM   13    C  CG1 . VAL A 1 2   ? 50.958  72.270 116.181 1.00 36.80 ? 20   VAL A CG1 1 
ATOM   14    C  CG2 . VAL A 1 2   ? 51.324  73.563 114.050 1.00 36.72 ? 20   VAL A CG2 1 
ATOM   15    N  N   . GLY A 1 3   ? 48.914  76.047 114.579 1.00 34.72 ? 21   GLY A N   1 
ATOM   16    C  CA  . GLY A 1 3   ? 47.745  76.430 113.780 1.00 33.09 ? 21   GLY A CA  1 
ATOM   17    C  C   . GLY A 1 3   ? 47.545  75.631 112.501 1.00 31.98 ? 21   GLY A C   1 
ATOM   18    O  O   . GLY A 1 3   ? 46.419  75.526 112.000 1.00 31.98 ? 21   GLY A O   1 
ATOM   19    N  N   . THR A 1 4   ? 48.634  75.079 111.964 1.00 30.60 ? 22   THR A N   1 
ATOM   20    C  CA  . THR A 1 4   ? 48.568  74.247 110.761 1.00 29.50 ? 22   THR A CA  1 
ATOM   21    C  C   . THR A 1 4   ? 49.767  73.321 110.600 1.00 28.76 ? 22   THR A C   1 
ATOM   22    O  O   . THR A 1 4   ? 50.896  73.674 110.959 1.00 28.74 ? 22   THR A O   1 
ATOM   23    C  CB  . THR A 1 4   ? 48.401  75.084 109.461 1.00 29.61 ? 22   THR A CB  1 
ATOM   24    O  OG1 . THR A 1 4   ? 48.382  74.206 108.325 1.00 29.63 ? 22   THR A OG1 1 
ATOM   25    C  CG2 . THR A 1 4   ? 49.536  76.099 109.300 1.00 29.43 ? 22   THR A CG2 1 
ATOM   26    N  N   . PHE A 1 5   ? 49.503  72.136 110.052 1.00 27.69 ? 23   PHE A N   1 
ATOM   27    C  CA  . PHE A 1 5   ? 50.552  71.243 109.564 1.00 26.89 ? 23   PHE A CA  1 
ATOM   28    C  C   . PHE A 1 5   ? 51.257  71.905 108.379 1.00 26.75 ? 23   PHE A C   1 
ATOM   29    O  O   . PHE A 1 5   ? 50.685  72.772 107.716 1.00 26.44 ? 23   PHE A O   1 
ATOM   30    C  CB  . PHE A 1 5   ? 49.981  69.870 109.169 1.00 26.51 ? 23   PHE A CB  1 
ATOM   31    C  CG  . PHE A 1 5   ? 48.867  69.929 108.139 1.00 25.71 ? 23   PHE A CG  1 
ATOM   32    C  CD1 . PHE A 1 5   ? 49.144  69.790 106.780 1.00 25.16 ? 23   PHE A CD1 1 
ATOM   33    C  CD2 . PHE A 1 5   ? 47.540  70.106 108.534 1.00 24.06 ? 23   PHE A CD2 1 
ATOM   34    C  CE1 . PHE A 1 5   ? 48.114  69.836 105.828 1.00 24.61 ? 23   PHE A CE1 1 
ATOM   35    C  CE2 . PHE A 1 5   ? 46.511  70.152 107.598 1.00 23.75 ? 23   PHE A CE2 1 
ATOM   36    C  CZ  . PHE A 1 5   ? 46.798  70.012 106.241 1.00 23.54 ? 23   PHE A CZ  1 
ATOM   37    N  N   . LYS A 1 6   ? 52.498  71.507 108.125 1.00 26.69 ? 24   LYS A N   1 
ATOM   38    C  CA  . LYS A 1 6   ? 53.287  72.129 107.065 1.00 27.03 ? 24   LYS A CA  1 
ATOM   39    C  C   . LYS A 1 6   ? 53.898  71.082 106.152 1.00 26.79 ? 24   LYS A C   1 
ATOM   40    O  O   . LYS A 1 6   ? 54.438  70.078 106.625 1.00 26.66 ? 24   LYS A O   1 
ATOM   41    C  CB  . LYS A 1 6   ? 54.378  73.029 107.656 1.00 27.20 ? 24   LYS A CB  1 
ATOM   42    C  CG  . LYS A 1 6   ? 53.849  74.273 108.355 1.00 28.48 ? 24   LYS A CG  1 
ATOM   43    C  CD  . LYS A 1 6   ? 54.934  74.947 109.178 1.00 31.05 ? 24   LYS A CD  1 
ATOM   44    C  CE  . LYS A 1 6   ? 54.345  75.979 110.138 1.00 32.77 ? 24   LYS A CE  1 
ATOM   45    N  NZ  . LYS A 1 6   ? 54.009  77.265 109.454 1.00 34.58 ? 24   LYS A NZ  1 
ATOM   46    N  N   . ALA A 1 7   ? 53.790  71.320 104.845 1.00 26.92 ? 25   ALA A N   1 
ATOM   47    C  CA  . ALA A 1 7   ? 54.375  70.451 103.819 1.00 27.35 ? 25   ALA A CA  1 
ATOM   48    C  C   . ALA A 1 7   ? 55.880  70.271 104.026 1.00 27.62 ? 25   ALA A C   1 
ATOM   49    O  O   . ALA A 1 7   ? 56.413  69.193 103.786 1.00 27.81 ? 25   ALA A O   1 
ATOM   50    C  CB  . ALA A 1 7   ? 54.093  71.008 102.441 1.00 27.12 ? 25   ALA A CB  1 
ATOM   51    N  N   . LYS A 1 8   ? 56.542  71.334 104.484 1.00 28.05 ? 26   LYS A N   1 
ATOM   52    C  CA  . LYS A 1 8   ? 57.945  71.307 104.908 1.00 28.59 ? 26   LYS A CA  1 
ATOM   53    C  C   . LYS A 1 8   ? 58.252  70.155 105.878 1.00 28.20 ? 26   LYS A C   1 
ATOM   54    O  O   . LYS A 1 8   ? 59.357  69.614 105.871 1.00 28.14 ? 26   LYS A O   1 
ATOM   55    C  CB  . LYS A 1 8   ? 58.294  72.646 105.576 1.00 28.99 ? 26   LYS A CB  1 
ATOM   56    C  CG  . LYS A 1 8   ? 59.775  72.902 105.786 1.00 31.44 ? 26   LYS A CG  1 
ATOM   57    C  CD  . LYS A 1 8   ? 60.008  73.947 106.879 1.00 34.55 ? 26   LYS A CD  1 
ATOM   58    C  CE  . LYS A 1 8   ? 61.504  74.247 107.060 1.00 36.10 ? 26   LYS A CE  1 
ATOM   59    N  NZ  . LYS A 1 8   ? 61.775  75.085 108.270 1.00 36.59 ? 26   LYS A NZ  1 
ATOM   60    N  N   . ASP A 1 9   ? 57.272  69.797 106.708 1.00 27.96 ? 27   ASP A N   1 
ATOM   61    C  CA  . ASP A 1 9   ? 57.445  68.803 107.778 1.00 27.73 ? 27   ASP A CA  1 
ATOM   62    C  C   . ASP A 1 9   ? 57.043  67.386 107.382 1.00 27.30 ? 27   ASP A C   1 
ATOM   63    O  O   . ASP A 1 9   ? 57.073  66.481 108.209 1.00 27.32 ? 27   ASP A O   1 
ATOM   64    C  CB  . ASP A 1 9   ? 56.643  69.216 109.019 1.00 28.01 ? 27   ASP A CB  1 
ATOM   65    C  CG  . ASP A 1 9   ? 57.144  70.502 109.648 1.00 29.05 ? 27   ASP A CG  1 
ATOM   66    O  OD1 . ASP A 1 9   ? 56.302  71.258 110.183 1.00 30.56 ? 27   ASP A OD1 1 
ATOM   67    O  OD2 . ASP A 1 9   ? 58.368  70.760 109.616 1.00 29.85 ? 27   ASP A OD2 1 
ATOM   68    N  N   . LEU A 1 10  ? 56.671  67.202 106.118 1.00 27.00 ? 28   LEU A N   1 
ATOM   69    C  CA  . LEU A 1 10  ? 56.167  65.926 105.603 1.00 26.51 ? 28   LEU A CA  1 
ATOM   70    C  C   . LEU A 1 10  ? 57.100  64.759 105.920 1.00 26.30 ? 28   LEU A C   1 
ATOM   71    O  O   . LEU A 1 10  ? 58.306  64.831 105.667 1.00 26.60 ? 28   LEU A O   1 
ATOM   72    C  CB  . LEU A 1 10  ? 55.964  66.050 104.090 1.00 26.75 ? 28   LEU A CB  1 
ATOM   73    C  CG  . LEU A 1 10  ? 54.818  65.432 103.269 1.00 26.65 ? 28   LEU A CG  1 
ATOM   74    C  CD1 . LEU A 1 10  ? 53.554  65.146 104.053 1.00 25.34 ? 28   LEU A CD1 1 
ATOM   75    C  CD2 . LEU A 1 10  ? 54.524  66.358 102.094 1.00 25.79 ? 28   LEU A CD2 1 
ATOM   76    N  N   . ILE A 1 11  ? 56.535  63.699 106.494 1.00 25.79 ? 29   ILE A N   1 
ATOM   77    C  CA  . ILE A 1 11  ? 57.263  62.463 106.765 1.00 25.31 ? 29   ILE A CA  1 
ATOM   78    C  C   . ILE A 1 11  ? 56.745  61.370 105.830 1.00 25.35 ? 29   ILE A C   1 
ATOM   79    O  O   . ILE A 1 11  ? 55.594  60.936 105.939 1.00 25.24 ? 29   ILE A O   1 
ATOM   80    C  CB  . ILE A 1 11  ? 57.127  62.006 108.248 1.00 25.17 ? 29   ILE A CB  1 
ATOM   81    C  CG1 . ILE A 1 11  ? 57.659  63.079 109.203 1.00 25.06 ? 29   ILE A CG1 1 
ATOM   82    C  CG2 . ILE A 1 11  ? 57.864  60.683 108.476 1.00 25.12 ? 29   ILE A CG2 1 
ATOM   83    C  CD1 . ILE A 1 11  ? 57.232  62.896 110.648 1.00 25.66 ? 29   ILE A CD1 1 
ATOM   84    N  N   . VAL A 1 12  ? 57.595  60.931 104.906 1.00 25.41 ? 30   VAL A N   1 
ATOM   85    C  CA  . VAL A 1 12  ? 57.169  59.946 103.912 1.00 25.38 ? 30   VAL A CA  1 
ATOM   86    C  C   . VAL A 1 12  ? 57.738  58.554 104.175 1.00 25.51 ? 30   VAL A C   1 
ATOM   87    O  O   . VAL A 1 12  ? 58.946  58.383 104.375 1.00 25.78 ? 30   VAL A O   1 
ATOM   88    C  CB  . VAL A 1 12  ? 57.323  60.458 102.426 1.00 25.34 ? 30   VAL A CB  1 
ATOM   89    C  CG1 . VAL A 1 12  ? 58.128  61.735 102.358 1.00 25.30 ? 30   VAL A CG1 1 
ATOM   90    C  CG2 . VAL A 1 12  ? 57.871  59.375 101.484 1.00 25.00 ? 30   VAL A CG2 1 
ATOM   91    N  N   . THR A 1 13  ? 56.831  57.580 104.205 1.00 25.42 ? 31   THR A N   1 
ATOM   92    C  CA  . THR A 1 13  ? 57.152  56.175 104.439 1.00 25.48 ? 31   THR A CA  1 
ATOM   93    C  C   . THR A 1 13  ? 56.737  55.371 103.199 1.00 25.25 ? 31   THR A C   1 
ATOM   94    O  O   . THR A 1 13  ? 55.591  54.934 103.092 1.00 24.80 ? 31   THR A O   1 
ATOM   95    C  CB  . THR A 1 13  ? 56.425  55.641 105.716 1.00 25.62 ? 31   THR A CB  1 
ATOM   96    O  OG1 . THR A 1 13  ? 56.811  56.429 106.846 1.00 26.28 ? 31   THR A OG1 1 
ATOM   97    C  CG2 . THR A 1 13  ? 56.758  54.175 105.989 1.00 25.55 ? 31   THR A CG2 1 
ATOM   98    N  N   . PRO A 1 14  ? 57.664  55.212 102.235 1.00 25.30 ? 32   PRO A N   1 
ATOM   99    C  CA  . PRO A 1 14  ? 57.385  54.427 101.033 1.00 25.18 ? 32   PRO A CA  1 
ATOM   100   C  C   . PRO A 1 14  ? 56.933  53.000 101.336 1.00 24.94 ? 32   PRO A C   1 
ATOM   101   O  O   . PRO A 1 14  ? 57.409  52.389 102.289 1.00 25.26 ? 32   PRO A O   1 
ATOM   102   C  CB  . PRO A 1 14  ? 58.736  54.414 100.308 1.00 25.20 ? 32   PRO A CB  1 
ATOM   103   C  CG  . PRO A 1 14  ? 59.401  55.664 100.757 1.00 25.29 ? 32   PRO A CG  1 
ATOM   104   C  CD  . PRO A 1 14  ? 59.018  55.797 102.198 1.00 25.18 ? 32   PRO A CD  1 
ATOM   105   N  N   . ALA A 1 15  ? 56.001  52.497 100.529 1.00 24.72 ? 33   ALA A N   1 
ATOM   106   C  CA  . ALA A 1 15  ? 55.590  51.100 100.561 1.00 24.43 ? 33   ALA A CA  1 
ATOM   107   C  C   . ALA A 1 15  ? 56.757  50.224 100.116 1.00 24.40 ? 33   ALA A C   1 
ATOM   108   O  O   . ALA A 1 15  ? 57.550  50.630 99.269  1.00 24.35 ? 33   ALA A O   1 
ATOM   109   C  CB  . ALA A 1 15  ? 54.396  50.889 99.653  1.00 24.20 ? 33   ALA A CB  1 
ATOM   110   N  N   . THR A 1 16  ? 56.869  49.029 100.687 1.00 24.36 ? 34   THR A N   1 
ATOM   111   C  CA  . THR A 1 16  ? 57.988  48.146 100.338 1.00 24.49 ? 34   THR A CA  1 
ATOM   112   C  C   . THR A 1 16  ? 57.583  47.191 99.224  1.00 24.16 ? 34   THR A C   1 
ATOM   113   O  O   . THR A 1 16  ? 58.431  46.664 98.506  1.00 24.02 ? 34   THR A O   1 
ATOM   114   C  CB  . THR A 1 16  ? 58.545  47.367 101.557 1.00 24.30 ? 34   THR A CB  1 
ATOM   115   O  OG1 . THR A 1 16  ? 57.461  46.872 102.352 1.00 24.95 ? 34   THR A OG1 1 
ATOM   116   C  CG2 . THR A 1 16  ? 59.425  48.271 102.412 1.00 24.77 ? 34   THR A CG2 1 
ATOM   117   N  N   . ILE A 1 17  ? 56.277  46.978 99.099  1.00 23.82 ? 35   ILE A N   1 
ATOM   118   C  CA  . ILE A 1 17  ? 55.702  46.209 98.008  1.00 23.66 ? 35   ILE A CA  1 
ATOM   119   C  C   . ILE A 1 17  ? 54.775  47.147 97.241  1.00 23.48 ? 35   ILE A C   1 
ATOM   120   O  O   . ILE A 1 17  ? 53.964  47.863 97.843  1.00 23.76 ? 35   ILE A O   1 
ATOM   121   C  CB  . ILE A 1 17  ? 54.935  44.962 98.529  1.00 23.64 ? 35   ILE A CB  1 
ATOM   122   C  CG1 . ILE A 1 17  ? 55.804  44.145 99.499  1.00 24.60 ? 35   ILE A CG1 1 
ATOM   123   C  CG2 . ILE A 1 17  ? 54.460  44.080 97.381  1.00 23.91 ? 35   ILE A CG2 1 
ATOM   124   C  CD1 . ILE A 1 17  ? 57.096  43.595 98.890  1.00 24.78 ? 35   ILE A CD1 1 
ATOM   125   N  N   . LEU A 1 18  ? 54.913  47.164 95.918  1.00 22.84 ? 36   LEU A N   1 
ATOM   126   C  CA  . LEU A 1 18  ? 54.094  48.037 95.084  1.00 22.21 ? 36   LEU A CA  1 
ATOM   127   C  C   . LEU A 1 18  ? 53.059  47.237 94.306  1.00 22.04 ? 36   LEU A C   1 
ATOM   128   O  O   . LEU A 1 18  ? 53.345  46.151 93.805  1.00 22.08 ? 36   LEU A O   1 
ATOM   129   C  CB  . LEU A 1 18  ? 54.963  48.892 94.152  1.00 22.02 ? 36   LEU A CB  1 
ATOM   130   C  CG  . LEU A 1 18  ? 55.951  49.877 94.797  1.00 21.29 ? 36   LEU A CG  1 
ATOM   131   C  CD1 . LEU A 1 18  ? 56.687  50.653 93.714  1.00 21.19 ? 36   LEU A CD1 1 
ATOM   132   C  CD2 . LEU A 1 18  ? 55.269  50.834 95.773  1.00 19.60 ? 36   LEU A CD2 1 
ATOM   133   N  N   . LYS A 1 19  ? 51.845  47.771 94.237  1.00 21.97 ? 37   LYS A N   1 
ATOM   134   C  CA  . LYS A 1 19  ? 50.740  47.088 93.568  1.00 21.97 ? 37   LYS A CA  1 
ATOM   135   C  C   . LYS A 1 19  ? 50.787  47.314 92.067  1.00 21.88 ? 37   LYS A C   1 
ATOM   136   O  O   . LYS A 1 19  ? 51.259  48.351 91.595  1.00 21.44 ? 37   LYS A O   1 
ATOM   137   C  CB  . LYS A 1 19  ? 49.393  47.572 94.116  1.00 22.07 ? 37   LYS A CB  1 
ATOM   138   C  CG  . LYS A 1 19  ? 49.122  47.195 95.571  1.00 22.64 ? 37   LYS A CG  1 
ATOM   139   C  CD  . LYS A 1 19  ? 47.806  47.771 96.068  1.00 22.42 ? 37   LYS A CD  1 
ATOM   140   C  CE  . LYS A 1 19  ? 47.892  49.278 96.247  1.00 23.18 ? 37   LYS A CE  1 
ATOM   141   N  NZ  . LYS A 1 19  ? 46.739  49.813 97.025  1.00 23.27 ? 37   LYS A NZ  1 
ATOM   142   N  N   . GLU A 1 20  ? 50.284  46.338 91.320  1.00 22.11 ? 38   GLU A N   1 
ATOM   143   C  CA  . GLU A 1 20  ? 50.104  46.496 89.883  1.00 22.50 ? 38   GLU A CA  1 
ATOM   144   C  C   . GLU A 1 20  ? 48.965  47.481 89.589  1.00 22.49 ? 38   GLU A C   1 
ATOM   145   O  O   . GLU A 1 20  ? 47.948  47.497 90.292  1.00 22.29 ? 38   GLU A O   1 
ATOM   146   C  CB  . GLU A 1 20  ? 49.855  45.136 89.226  1.00 22.61 ? 38   GLU A CB  1 
ATOM   147   C  CG  . GLU A 1 20  ? 51.091  44.236 89.205  1.00 23.53 ? 38   GLU A CG  1 
ATOM   148   C  CD  . GLU A 1 20  ? 50.795  42.821 88.731  1.00 25.87 ? 38   GLU A CD  1 
ATOM   149   O  OE1 . GLU A 1 20  ? 49.854  42.641 87.927  1.00 27.71 ? 38   GLU A OE1 1 
ATOM   150   O  OE2 . GLU A 1 20  ? 51.510  41.885 89.158  1.00 25.65 ? 38   GLU A OE2 1 
ATOM   151   N  N   . LYS A 1 21  ? 49.164  48.321 88.574  1.00 22.69 ? 39   LYS A N   1 
ATOM   152   C  CA  . LYS A 1 21  ? 48.167  49.312 88.154  1.00 23.02 ? 39   LYS A CA  1 
ATOM   153   C  C   . LYS A 1 21  ? 47.027  48.633 87.389  1.00 23.14 ? 39   LYS A C   1 
ATOM   154   O  O   . LYS A 1 21  ? 47.233  47.586 86.766  1.00 23.14 ? 39   LYS A O   1 
ATOM   155   C  CB  . LYS A 1 21  ? 48.801  50.411 87.284  1.00 22.97 ? 39   LYS A CB  1 
ATOM   156   C  CG  . LYS A 1 21  ? 50.164  50.926 87.748  1.00 23.31 ? 39   LYS A CG  1 
ATOM   157   C  CD  . LYS A 1 21  ? 50.052  51.794 88.977  1.00 23.43 ? 39   LYS A CD  1 
ATOM   158   C  CE  . LYS A 1 21  ? 51.246  52.705 89.144  1.00 23.76 ? 39   LYS A CE  1 
ATOM   159   N  NZ  . LYS A 1 21  ? 52.497  51.987 89.519  1.00 24.86 ? 39   LYS A NZ  1 
ATOM   160   N  N   . PRO A 1 22  ? 45.816  49.221 87.436  1.00 23.43 ? 40   PRO A N   1 
ATOM   161   C  CA  . PRO A 1 22  ? 44.687  48.639 86.715  1.00 23.95 ? 40   PRO A CA  1 
ATOM   162   C  C   . PRO A 1 22  ? 44.613  49.106 85.261  1.00 24.50 ? 40   PRO A C   1 
ATOM   163   O  O   . PRO A 1 22  ? 45.138  50.161 84.917  1.00 24.22 ? 40   PRO A O   1 
ATOM   164   C  CB  . PRO A 1 22  ? 43.482  49.174 87.492  1.00 23.83 ? 40   PRO A CB  1 
ATOM   165   C  CG  . PRO A 1 22  ? 43.931  50.509 87.970  1.00 23.13 ? 40   PRO A CG  1 
ATOM   166   C  CD  . PRO A 1 22  ? 45.424  50.444 88.161  1.00 23.43 ? 40   PRO A CD  1 
ATOM   167   N  N   . ASP A 1 23  ? 43.954  48.311 84.427  1.00 25.77 ? 41   ASP A N   1 
ATOM   168   C  CA  . ASP A 1 23  ? 43.636  48.685 83.050  1.00 26.58 ? 41   ASP A CA  1 
ATOM   169   C  C   . ASP A 1 23  ? 42.755  49.941 83.060  1.00 27.15 ? 41   ASP A C   1 
ATOM   170   O  O   . ASP A 1 23  ? 41.654  49.913 83.617  1.00 27.30 ? 41   ASP A O   1 
ATOM   171   C  CB  . ASP A 1 23  ? 42.905  47.518 82.374  1.00 26.67 ? 41   ASP A CB  1 
ATOM   172   C  CG  . ASP A 1 23  ? 42.826  47.648 80.855  1.00 27.39 ? 41   ASP A CG  1 
ATOM   173   O  OD1 . ASP A 1 23  ? 43.131  48.718 80.293  1.00 27.37 ? 41   ASP A OD1 1 
ATOM   174   O  OD2 . ASP A 1 23  ? 42.439  46.649 80.211  1.00 30.30 ? 41   ASP A OD2 1 
ATOM   175   N  N   . PRO A 1 24  ? 43.240  51.050 82.456  1.00 27.73 ? 42   PRO A N   1 
ATOM   176   C  CA  . PRO A 1 24  ? 42.482  52.310 82.420  1.00 28.17 ? 42   PRO A CA  1 
ATOM   177   C  C   . PRO A 1 24  ? 41.172  52.242 81.617  1.00 28.75 ? 42   PRO A C   1 
ATOM   178   O  O   . PRO A 1 24  ? 40.305  53.107 81.784  1.00 28.87 ? 42   PRO A O   1 
ATOM   179   C  CB  . PRO A 1 24  ? 43.459  53.294 81.767  1.00 28.04 ? 42   PRO A CB  1 
ATOM   180   C  CG  . PRO A 1 24  ? 44.388  52.444 80.978  1.00 28.04 ? 42   PRO A CG  1 
ATOM   181   C  CD  . PRO A 1 24  ? 44.545  51.183 81.780  1.00 27.82 ? 42   PRO A CD  1 
ATOM   182   N  N   . ASN A 1 25  ? 41.033  51.231 80.761  1.00 29.14 ? 43   ASN A N   1 
ATOM   183   C  CA  . ASN A 1 25  ? 39.799  51.042 79.996  1.00 29.73 ? 43   ASN A CA  1 
ATOM   184   C  C   . ASN A 1 25  ? 38.746  50.264 80.797  1.00 29.76 ? 43   ASN A C   1 
ATOM   185   O  O   . ASN A 1 25  ? 37.592  50.137 80.371  1.00 29.84 ? 43   ASN A O   1 
ATOM   186   C  CB  . ASN A 1 25  ? 40.085  50.340 78.661  1.00 29.72 ? 43   ASN A CB  1 
ATOM   187   C  CG  . ASN A 1 25  ? 41.187  51.019 77.857  1.00 31.56 ? 43   ASN A CG  1 
ATOM   188   O  OD1 . ASN A 1 25  ? 41.205  52.250 77.696  1.00 32.49 ? 43   ASN A OD1 1 
ATOM   189   N  ND2 . ASN A 1 25  ? 42.118  50.212 77.342  1.00 32.15 ? 43   ASN A ND2 1 
ATOM   190   N  N   . ASN A 1 26  ? 39.152  49.748 81.957  1.00 29.56 ? 44   ASN A N   1 
ATOM   191   C  CA  . ASN A 1 26  ? 38.271  48.940 82.799  1.00 29.66 ? 44   ASN A CA  1 
ATOM   192   C  C   . ASN A 1 26  ? 38.233  49.404 84.265  1.00 28.99 ? 44   ASN A C   1 
ATOM   193   O  O   . ASN A 1 26  ? 38.282  48.590 85.192  1.00 29.36 ? 44   ASN A O   1 
ATOM   194   C  CB  . ASN A 1 26  ? 38.651  47.453 82.691  1.00 29.86 ? 44   ASN A CB  1 
ATOM   195   C  CG  . ASN A 1 26  ? 38.700  46.963 81.243  1.00 32.06 ? 44   ASN A CG  1 
ATOM   196   O  OD1 . ASN A 1 26  ? 37.766  47.190 80.454  1.00 33.18 ? 44   ASN A OD1 1 
ATOM   197   N  ND2 . ASN A 1 26  ? 39.800  46.294 80.883  1.00 33.32 ? 44   ASN A ND2 1 
ATOM   198   N  N   . LEU A 1 27  ? 38.143  50.716 84.465  1.00 28.08 ? 45   LEU A N   1 
ATOM   199   C  CA  . LEU A 1 27  ? 38.059  51.291 85.810  1.00 26.98 ? 45   LEU A CA  1 
ATOM   200   C  C   . LEU A 1 27  ? 36.607  51.482 86.260  1.00 25.85 ? 45   LEU A C   1 
ATOM   201   O  O   . LEU A 1 27  ? 35.782  51.987 85.508  1.00 25.87 ? 45   LEU A O   1 
ATOM   202   C  CB  . LEU A 1 27  ? 38.808  52.630 85.873  1.00 26.99 ? 45   LEU A CB  1 
ATOM   203   C  CG  . LEU A 1 27  ? 40.299  52.658 85.509  1.00 27.61 ? 45   LEU A CG  1 
ATOM   204   C  CD1 . LEU A 1 27  ? 40.789  54.076 85.223  1.00 27.93 ? 45   LEU A CD1 1 
ATOM   205   C  CD2 . LEU A 1 27  ? 41.139  52.034 86.599  1.00 27.50 ? 45   LEU A CD2 1 
ATOM   206   N  N   . VAL A 1 28  ? 36.305  51.057 87.483  1.00 24.57 ? 46   VAL A N   1 
ATOM   207   C  CA  . VAL A 1 28  ? 35.035  51.378 88.135  1.00 23.53 ? 46   VAL A CA  1 
ATOM   208   C  C   . VAL A 1 28  ? 35.345  52.427 89.201  1.00 22.60 ? 46   VAL A C   1 
ATOM   209   O  O   . VAL A 1 28  ? 36.278  52.252 89.989  1.00 22.53 ? 46   VAL A O   1 
ATOM   210   C  CB  . VAL A 1 28  ? 34.363  50.133 88.767  1.00 23.64 ? 46   VAL A CB  1 
ATOM   211   C  CG1 . VAL A 1 28  ? 33.058  50.503 89.460  1.00 23.30 ? 46   VAL A CG1 1 
ATOM   212   C  CG2 . VAL A 1 28  ? 34.100  49.073 87.710  1.00 24.26 ? 46   VAL A CG2 1 
ATOM   213   N  N   . PHE A 1 29  ? 34.582  53.520 89.201  1.00 21.33 ? 47   PHE A N   1 
ATOM   214   C  CA  . PHE A 1 29  ? 34.864  54.675 90.060  1.00 20.08 ? 47   PHE A CA  1 
ATOM   215   C  C   . PHE A 1 29  ? 35.018  54.311 91.536  1.00 19.28 ? 47   PHE A C   1 
ATOM   216   O  O   . PHE A 1 29  ? 34.183  53.604 92.097  1.00 19.13 ? 47   PHE A O   1 
ATOM   217   C  CB  . PHE A 1 29  ? 33.795  55.769 89.903  1.00 19.87 ? 47   PHE A CB  1 
ATOM   218   C  CG  . PHE A 1 29  ? 33.932  56.884 90.905  1.00 19.70 ? 47   PHE A CG  1 
ATOM   219   C  CD1 . PHE A 1 29  ? 34.774  57.959 90.657  1.00 19.40 ? 47   PHE A CD1 1 
ATOM   220   C  CD2 . PHE A 1 29  ? 33.246  56.834 92.120  1.00 20.08 ? 47   PHE A CD2 1 
ATOM   221   C  CE1 . PHE A 1 29  ? 34.925  58.976 91.593  1.00 20.43 ? 47   PHE A CE1 1 
ATOM   222   C  CE2 . PHE A 1 29  ? 33.392  57.837 93.060  1.00 20.19 ? 47   PHE A CE2 1 
ATOM   223   C  CZ  . PHE A 1 29  ? 34.231  58.914 92.798  1.00 20.12 ? 47   PHE A CZ  1 
ATOM   224   N  N   . GLY A 1 30  ? 36.098  54.798 92.143  1.00 18.59 ? 48   GLY A N   1 
ATOM   225   C  CA  . GLY A 1 30  ? 36.311  54.728 93.587  1.00 17.66 ? 48   GLY A CA  1 
ATOM   226   C  C   . GLY A 1 30  ? 36.454  53.339 94.185  1.00 17.31 ? 48   GLY A C   1 
ATOM   227   O  O   . GLY A 1 30  ? 36.226  53.163 95.379  1.00 17.14 ? 48   GLY A O   1 
ATOM   228   N  N   . THR A 1 31  ? 36.822  52.352 93.365  1.00 16.89 ? 49   THR A N   1 
ATOM   229   C  CA  . THR A 1 31  ? 36.979  50.978 93.842  1.00 16.44 ? 49   THR A CA  1 
ATOM   230   C  C   . THR A 1 31  ? 38.440  50.526 93.982  1.00 16.56 ? 49   THR A C   1 
ATOM   231   O  O   . THR A 1 31  ? 38.746  49.670 94.818  1.00 16.73 ? 49   THR A O   1 
ATOM   232   C  CB  . THR A 1 31  ? 36.203  49.953 92.972  1.00 16.58 ? 49   THR A CB  1 
ATOM   233   O  OG1 . THR A 1 31  ? 36.745  49.927 91.646  1.00 17.11 ? 49   THR A OG1 1 
ATOM   234   C  CG2 . THR A 1 31  ? 34.709  50.296 92.914  1.00 16.39 ? 49   THR A CG2 1 
ATOM   235   N  N   . VAL A 1 32  ? 39.337  51.060 93.157  1.00 16.18 ? 50   VAL A N   1 
ATOM   236   C  CA  . VAL A 1 32  ? 40.753  50.713 93.296  1.00 15.74 ? 50   VAL A CA  1 
ATOM   237   C  C   . VAL A 1 32  ? 41.547  51.897 93.849  1.00 15.53 ? 50   VAL A C   1 
ATOM   238   O  O   . VAL A 1 32  ? 41.336  53.047 93.460  1.00 15.02 ? 50   VAL A O   1 
ATOM   239   C  CB  . VAL A 1 32  ? 41.406  50.059 92.011  1.00 15.99 ? 50   VAL A CB  1 
ATOM   240   C  CG1 . VAL A 1 32  ? 40.402  49.205 91.213  1.00 14.94 ? 50   VAL A CG1 1 
ATOM   241   C  CG2 . VAL A 1 32  ? 42.067  51.072 91.126  1.00 16.22 ? 50   VAL A CG2 1 
ATOM   242   N  N   . PHE A 1 33  ? 42.426  51.606 94.800  1.00 15.18 ? 51   PHE A N   1 
ATOM   243   C  CA  . PHE A 1 33  ? 43.194  52.648 95.464  1.00 15.10 ? 51   PHE A CA  1 
ATOM   244   C  C   . PHE A 1 33  ? 44.682  52.443 95.204  1.00 15.19 ? 51   PHE A C   1 
ATOM   245   O  O   . PHE A 1 33  ? 45.137  51.323 94.986  1.00 15.06 ? 51   PHE A O   1 
ATOM   246   C  CB  . PHE A 1 33  ? 42.880  52.686 96.969  1.00 14.92 ? 51   PHE A CB  1 
ATOM   247   C  CG  . PHE A 1 33  ? 41.434  52.999 97.281  1.00 15.09 ? 51   PHE A CG  1 
ATOM   248   C  CD1 . PHE A 1 33  ? 40.509  51.973 97.466  1.00 14.35 ? 51   PHE A CD1 1 
ATOM   249   C  CD2 . PHE A 1 33  ? 40.993  54.323 97.364  1.00 15.14 ? 51   PHE A CD2 1 
ATOM   250   C  CE1 . PHE A 1 33  ? 39.165  52.255 97.740  1.00 14.44 ? 51   PHE A CE1 1 
ATOM   251   C  CE2 . PHE A 1 33  ? 39.657  54.617 97.640  1.00 15.15 ? 51   PHE A CE2 1 
ATOM   252   C  CZ  . PHE A 1 33  ? 38.738  53.572 97.828  1.00 14.90 ? 51   PHE A CZ  1 
ATOM   253   N  N   . THR A 1 34  ? 45.422  53.545 95.222  1.00 15.33 ? 52   THR A N   1 
ATOM   254   C  CA  . THR A 1 34  ? 46.854  53.546 94.949  1.00 15.45 ? 52   THR A CA  1 
ATOM   255   C  C   . THR A 1 34  ? 47.683  52.986 96.117  1.00 15.89 ? 52   THR A C   1 
ATOM   256   O  O   . THR A 1 34  ? 47.140  52.392 97.052  1.00 15.82 ? 52   THR A O   1 
ATOM   257   C  CB  . THR A 1 34  ? 47.335  54.966 94.581  1.00 15.20 ? 52   THR A CB  1 
ATOM   258   O  OG1 . THR A 1 34  ? 47.230  55.811 95.728  1.00 14.79 ? 52   THR A OG1 1 
ATOM   259   C  CG2 . THR A 1 34  ? 46.487  55.538 93.464  1.00 13.96 ? 52   THR A CG2 1 
ATOM   260   N  N   . ASP A 1 35  ? 49.000  53.167 96.047  1.00 16.25 ? 53   ASP A N   1 
ATOM   261   C  CA  . ASP A 1 35  ? 49.919  52.579 97.026  1.00 16.55 ? 53   ASP A CA  1 
ATOM   262   C  C   . ASP A 1 35  ? 49.930  53.338 98.353  1.00 16.87 ? 53   ASP A C   1 
ATOM   263   O  O   . ASP A 1 35  ? 50.084  52.727 99.417  1.00 16.93 ? 53   ASP A O   1 
ATOM   264   C  CB  . ASP A 1 35  ? 51.349  52.540 96.462  1.00 16.55 ? 53   ASP A CB  1 
ATOM   265   C  CG  . ASP A 1 35  ? 51.516  51.550 95.320  1.00 16.40 ? 53   ASP A CG  1 
ATOM   266   O  OD1 . ASP A 1 35  ? 51.235  50.341 95.503  1.00 15.75 ? 53   ASP A OD1 1 
ATOM   267   O  OD2 . ASP A 1 35  ? 51.963  51.984 94.236  1.00 16.58 ? 53   ASP A OD2 1 
ATOM   268   N  N   . HIS A 1 36  ? 49.774  54.663 98.277  1.00 17.06 ? 54   HIS A N   1 
ATOM   269   C  CA  . HIS A 1 36  ? 50.000  55.560 99.412  1.00 17.48 ? 54   HIS A CA  1 
ATOM   270   C  C   . HIS A 1 36  ? 48.809  56.461 99.761  1.00 17.68 ? 54   HIS A C   1 
ATOM   271   O  O   . HIS A 1 36  ? 47.924  56.712 98.931  1.00 17.70 ? 54   HIS A O   1 
ATOM   272   C  CB  . HIS A 1 36  ? 51.233  56.446 99.151  1.00 17.71 ? 54   HIS A CB  1 
ATOM   273   C  CG  . HIS A 1 36  ? 52.506  55.678 98.971  1.00 18.20 ? 54   HIS A CG  1 
ATOM   274   N  ND1 . HIS A 1 36  ? 53.040  55.397 97.730  1.00 18.12 ? 54   HIS A ND1 1 
ATOM   275   C  CD2 . HIS A 1 36  ? 53.348  55.125 99.876  1.00 18.48 ? 54   HIS A CD2 1 
ATOM   276   C  CE1 . HIS A 1 36  ? 54.155  54.706 97.882  1.00 18.76 ? 54   HIS A CE1 1 
ATOM   277   N  NE2 . HIS A 1 36  ? 54.362  54.524 99.173  1.00 18.27 ? 54   HIS A NE2 1 
ATOM   278   N  N   . MET A 1 37  ? 48.820  56.964 100.994 1.00 17.54 ? 55   MET A N   1 
ATOM   279   C  CA  . MET A 1 37  ? 47.814  57.912 101.474 1.00 17.23 ? 55   MET A CA  1 
ATOM   280   C  C   . MET A 1 37  ? 48.481  59.025 102.274 1.00 17.12 ? 55   MET A C   1 
ATOM   281   O  O   . MET A 1 37  ? 49.586  58.841 102.790 1.00 17.28 ? 55   MET A O   1 
ATOM   282   C  CB  . MET A 1 37  ? 46.755  57.184 102.326 1.00 17.25 ? 55   MET A CB  1 
ATOM   283   C  CG  . MET A 1 37  ? 47.245  56.646 103.684 1.00 17.33 ? 55   MET A CG  1 
ATOM   284   S  SD  . MET A 1 37  ? 46.070  55.572 104.559 1.00 18.07 ? 55   MET A SD  1 
ATOM   285   C  CE  . MET A 1 37  ? 44.653  56.656 104.723 1.00 18.32 ? 55   MET A CE  1 
ATOM   286   N  N   . LEU A 1 38  ? 47.819  60.175 102.372 1.00 16.87 ? 56   LEU A N   1 
ATOM   287   C  CA  . LEU A 1 38  ? 48.237  61.217 103.314 1.00 16.86 ? 56   LEU A CA  1 
ATOM   288   C  C   . LEU A 1 38  ? 47.401  61.116 104.589 1.00 17.26 ? 56   LEU A C   1 
ATOM   289   O  O   . LEU A 1 38  ? 46.190  60.918 104.520 1.00 17.34 ? 56   LEU A O   1 
ATOM   290   C  CB  . LEU A 1 38  ? 48.100  62.619 102.707 1.00 16.50 ? 56   LEU A CB  1 
ATOM   291   C  CG  . LEU A 1 38  ? 48.481  63.829 103.576 1.00 16.29 ? 56   LEU A CG  1 
ATOM   292   C  CD1 . LEU A 1 38  ? 49.971  64.135 103.525 1.00 16.41 ? 56   LEU A CD1 1 
ATOM   293   C  CD2 . LEU A 1 38  ? 47.697  65.064 103.163 1.00 17.85 ? 56   LEU A CD2 1 
ATOM   294   N  N   . THR A 1 39  ? 48.051  61.239 105.745 1.00 17.38 ? 57   THR A N   1 
ATOM   295   C  CA  . THR A 1 39  ? 47.353  61.327 107.027 1.00 17.59 ? 57   THR A CA  1 
ATOM   296   C  C   . THR A 1 39  ? 47.937  62.462 107.856 1.00 17.75 ? 57   THR A C   1 
ATOM   297   O  O   . THR A 1 39  ? 49.148  62.686 107.845 1.00 17.79 ? 57   THR A O   1 
ATOM   298   C  CB  . THR A 1 39  ? 47.419  60.008 107.852 1.00 17.82 ? 57   THR A CB  1 
ATOM   299   O  OG1 . THR A 1 39  ? 48.786  59.634 108.075 1.00 18.21 ? 57   THR A OG1 1 
ATOM   300   C  CG2 . THR A 1 39  ? 46.675  58.859 107.157 1.00 16.85 ? 57   THR A CG2 1 
ATOM   301   N  N   . VAL A 1 40  ? 47.066  63.192 108.549 1.00 17.70 ? 58   VAL A N   1 
ATOM   302   C  CA  . VAL A 1 40  ? 47.489  64.204 109.512 1.00 17.73 ? 58   VAL A CA  1 
ATOM   303   C  C   . VAL A 1 40  ? 46.584  64.185 110.757 1.00 18.03 ? 58   VAL A C   1 
ATOM   304   O  O   . VAL A 1 40  ? 45.368  64.347 110.650 1.00 17.82 ? 58   VAL A O   1 
ATOM   305   C  CB  . VAL A 1 40  ? 47.528  65.652 108.932 1.00 17.89 ? 58   VAL A CB  1 
ATOM   306   C  CG1 . VAL A 1 40  ? 48.558  66.474 109.695 1.00 17.00 ? 58   VAL A CG1 1 
ATOM   307   C  CG2 . VAL A 1 40  ? 47.837  65.680 107.430 1.00 17.19 ? 58   VAL A CG2 1 
ATOM   308   N  N   . GLU A 1 41  ? 47.197  63.988 111.926 1.00 18.01 ? 59   GLU A N   1 
ATOM   309   C  CA  . GLU A 1 41  ? 46.498  64.023 113.209 1.00 17.99 ? 59   GLU A CA  1 
ATOM   310   C  C   . GLU A 1 41  ? 46.372  65.434 113.768 1.00 17.85 ? 59   GLU A C   1 
ATOM   311   O  O   . GLU A 1 41  ? 47.259  66.266 113.578 1.00 17.62 ? 59   GLU A O   1 
ATOM   312   C  CB  . GLU A 1 41  ? 47.232  63.161 114.237 1.00 18.08 ? 59   GLU A CB  1 
ATOM   313   C  CG  . GLU A 1 41  ? 47.315  61.690 113.887 1.00 19.75 ? 59   GLU A CG  1 
ATOM   314   C  CD  . GLU A 1 41  ? 46.015  60.941 114.114 1.00 21.78 ? 59   GLU A CD  1 
ATOM   315   O  OE1 . GLU A 1 41  ? 45.957  59.747 113.760 1.00 24.05 ? 59   GLU A OE1 1 
ATOM   316   O  OE2 . GLU A 1 41  ? 45.053  61.530 114.655 1.00 23.41 ? 59   GLU A OE2 1 
ATOM   317   N  N   . TRP A 1 42  ? 45.270  65.685 114.476 1.00 17.68 ? 60   TRP A N   1 
ATOM   318   C  CA  . TRP A 1 42  ? 45.074  66.927 115.222 1.00 17.83 ? 60   TRP A CA  1 
ATOM   319   C  C   . TRP A 1 42  ? 44.487  66.621 116.601 1.00 18.34 ? 60   TRP A C   1 
ATOM   320   O  O   . TRP A 1 42  ? 43.743  65.657 116.780 1.00 18.29 ? 60   TRP A O   1 
ATOM   321   C  CB  . TRP A 1 42  ? 44.169  67.900 114.451 1.00 17.34 ? 60   TRP A CB  1 
ATOM   322   C  CG  . TRP A 1 42  ? 43.838  69.193 115.167 1.00 16.57 ? 60   TRP A CG  1 
ATOM   323   C  CD1 . TRP A 1 42  ? 44.519  70.372 115.081 1.00 16.68 ? 60   TRP A CD1 1 
ATOM   324   C  CD2 . TRP A 1 42  ? 42.730  69.440 116.056 1.00 16.37 ? 60   TRP A CD2 1 
ATOM   325   N  NE1 . TRP A 1 42  ? 43.916  71.334 115.860 1.00 15.75 ? 60   TRP A NE1 1 
ATOM   326   C  CE2 . TRP A 1 42  ? 42.817  70.790 116.469 1.00 15.90 ? 60   TRP A CE2 1 
ATOM   327   C  CE3 . TRP A 1 42  ? 41.673  68.651 116.542 1.00 16.67 ? 60   TRP A CE3 1 
ATOM   328   C  CZ2 . TRP A 1 42  ? 41.887  71.374 117.346 1.00 15.79 ? 60   TRP A CZ2 1 
ATOM   329   C  CZ3 . TRP A 1 42  ? 40.749  69.234 117.418 1.00 16.46 ? 60   TRP A CZ3 1 
ATOM   330   C  CH2 . TRP A 1 42  ? 40.867  70.582 117.810 1.00 15.38 ? 60   TRP A CH2 1 
ATOM   331   N  N   . SER A 1 43  ? 44.858  67.438 117.577 1.00 19.02 ? 61   SER A N   1 
ATOM   332   C  CA  . SER A 1 43  ? 44.221  67.429 118.884 1.00 20.04 ? 61   SER A CA  1 
ATOM   333   C  C   . SER A 1 43  ? 44.124  68.872 119.344 1.00 20.48 ? 61   SER A C   1 
ATOM   334   O  O   . SER A 1 43  ? 44.926  69.707 118.927 1.00 20.43 ? 61   SER A O   1 
ATOM   335   C  CB  . SER A 1 43  ? 45.024  66.593 119.878 1.00 19.88 ? 61   SER A CB  1 
ATOM   336   O  OG  . SER A 1 43  ? 46.291  67.178 120.114 1.00 21.00 ? 61   SER A OG  1 
ATOM   337   N  N   . SER A 1 44  ? 43.136  69.173 120.183 1.00 21.52 ? 62   SER A N   1 
ATOM   338   C  CA  . SER A 1 44  ? 43.029  70.501 120.778 1.00 22.74 ? 62   SER A CA  1 
ATOM   339   C  C   . SER A 1 44  ? 44.251  70.814 121.656 1.00 23.38 ? 62   SER A C   1 
ATOM   340   O  O   . SER A 1 44  ? 44.691  71.960 121.717 1.00 23.64 ? 62   SER A O   1 
ATOM   341   C  CB  . SER A 1 44  ? 41.741  70.625 121.591 1.00 22.78 ? 62   SER A CB  1 
ATOM   342   O  OG  . SER A 1 44  ? 41.741  69.678 122.649 1.00 23.88 ? 62   SER A OG  1 
ATOM   343   N  N   . GLU A 1 45  ? 44.799  69.792 122.311 1.00 24.25 ? 63   GLU A N   1 
ATOM   344   C  CA  . GLU A 1 45  ? 45.920  69.961 123.244 1.00 25.48 ? 63   GLU A CA  1 
ATOM   345   C  C   . GLU A 1 45  ? 47.211  70.393 122.535 1.00 25.70 ? 63   GLU A C   1 
ATOM   346   O  O   . GLU A 1 45  ? 47.829  71.392 122.917 1.00 26.03 ? 63   GLU A O   1 
ATOM   347   C  CB  . GLU A 1 45  ? 46.137  68.679 124.071 1.00 25.76 ? 63   GLU A CB  1 
ATOM   348   C  CG  . GLU A 1 45  ? 47.134  68.816 125.228 1.00 28.26 ? 63   GLU A CG  1 
ATOM   349   C  CD  . GLU A 1 45  ? 47.012  67.703 126.276 1.00 32.02 ? 63   GLU A CD  1 
ATOM   350   O  OE1 . GLU A 1 45  ? 47.755  66.703 126.187 1.00 33.51 ? 63   GLU A OE1 1 
ATOM   351   O  OE2 . GLU A 1 45  ? 46.176  67.826 127.202 1.00 34.20 ? 63   GLU A OE2 1 
ATOM   352   N  N   . PHE A 1 46  ? 47.598  69.656 121.493 1.00 25.70 ? 64   PHE A N   1 
ATOM   353   C  CA  . PHE A 1 46  ? 48.868  69.893 120.800 1.00 25.58 ? 64   PHE A CA  1 
ATOM   354   C  C   . PHE A 1 46  ? 48.732  70.501 119.400 1.00 25.06 ? 64   PHE A C   1 
ATOM   355   O  O   . PHE A 1 46  ? 49.738  70.815 118.763 1.00 25.53 ? 64   PHE A O   1 
ATOM   356   C  CB  . PHE A 1 46  ? 49.677  68.596 120.716 1.00 25.78 ? 64   PHE A CB  1 
ATOM   357   C  CG  . PHE A 1 46  ? 49.943  67.960 122.048 1.00 27.11 ? 64   PHE A CG  1 
ATOM   358   C  CD1 . PHE A 1 46  ? 50.850  68.531 122.939 1.00 28.39 ? 64   PHE A CD1 1 
ATOM   359   C  CD2 . PHE A 1 46  ? 49.295  66.784 122.409 1.00 28.26 ? 64   PHE A CD2 1 
ATOM   360   C  CE1 . PHE A 1 46  ? 51.100  67.944 124.174 1.00 29.70 ? 64   PHE A CE1 1 
ATOM   361   C  CE2 . PHE A 1 46  ? 49.538  66.186 123.639 1.00 29.32 ? 64   PHE A CE2 1 
ATOM   362   C  CZ  . PHE A 1 46  ? 50.444  66.767 124.527 1.00 29.72 ? 64   PHE A CZ  1 
ATOM   363   N  N   . GLY A 1 47  ? 47.501  70.661 118.919 1.00 24.20 ? 65   GLY A N   1 
ATOM   364   C  CA  . GLY A 1 47  ? 47.272  71.216 117.584 1.00 22.86 ? 65   GLY A CA  1 
ATOM   365   C  C   . GLY A 1 47  ? 47.590  70.205 116.496 1.00 21.93 ? 65   GLY A C   1 
ATOM   366   O  O   . GLY A 1 47  ? 47.462  68.998 116.700 1.00 21.52 ? 65   GLY A O   1 
ATOM   367   N  N   . TRP A 1 48  ? 48.011  70.707 115.341 1.00 21.31 ? 66   TRP A N   1 
ATOM   368   C  CA  . TRP A 1 48  ? 48.320  69.859 114.193 1.00 21.09 ? 66   TRP A CA  1 
ATOM   369   C  C   . TRP A 1 48  ? 49.650  69.139 114.336 1.00 21.43 ? 66   TRP A C   1 
ATOM   370   O  O   . TRP A 1 48  ? 50.687  69.756 114.584 1.00 21.45 ? 66   TRP A O   1 
ATOM   371   C  CB  . TRP A 1 48  ? 48.318  70.672 112.900 1.00 20.65 ? 66   TRP A CB  1 
ATOM   372   C  CG  . TRP A 1 48  ? 46.952  71.007 112.405 1.00 18.70 ? 66   TRP A CG  1 
ATOM   373   C  CD1 . TRP A 1 48  ? 46.336  72.214 112.472 1.00 18.23 ? 66   TRP A CD1 1 
ATOM   374   C  CD2 . TRP A 1 48  ? 46.033  70.118 111.758 1.00 17.36 ? 66   TRP A CD2 1 
ATOM   375   N  NE1 . TRP A 1 48  ? 45.082  72.142 111.907 1.00 18.91 ? 66   TRP A NE1 1 
ATOM   376   C  CE2 . TRP A 1 48  ? 44.871  70.864 111.460 1.00 17.86 ? 66   TRP A CE2 1 
ATOM   377   C  CE3 . TRP A 1 48  ? 46.077  68.761 111.405 1.00 16.08 ? 66   TRP A CE3 1 
ATOM   378   C  CZ2 . TRP A 1 48  ? 43.759  70.302 110.815 1.00 17.01 ? 66   TRP A CZ2 1 
ATOM   379   C  CZ3 . TRP A 1 48  ? 44.970  68.202 110.772 1.00 16.83 ? 66   TRP A CZ3 1 
ATOM   380   C  CH2 . TRP A 1 48  ? 43.828  68.975 110.483 1.00 16.25 ? 66   TRP A CH2 1 
ATOM   381   N  N   . GLU A 1 49  ? 49.598  67.824 114.172 1.00 21.64 ? 67   GLU A N   1 
ATOM   382   C  CA  . GLU A 1 49  ? 50.774  66.975 114.142 1.00 22.17 ? 67   GLU A CA  1 
ATOM   383   C  C   . GLU A 1 49  ? 51.455  67.108 112.767 1.00 21.72 ? 67   GLU A C   1 
ATOM   384   O  O   . GLU A 1 49  ? 50.930  67.783 111.869 1.00 21.49 ? 67   GLU A O   1 
ATOM   385   C  CB  . GLU A 1 49  ? 50.330  65.541 114.408 1.00 22.61 ? 67   GLU A CB  1 
ATOM   386   C  CG  . GLU A 1 49  ? 51.304  64.679 115.175 1.00 25.98 ? 67   GLU A CG  1 
ATOM   387   C  CD  . GLU A 1 49  ? 51.431  65.029 116.656 1.00 29.30 ? 67   GLU A CD  1 
ATOM   388   O  OE1 . GLU A 1 49  ? 50.639  65.847 117.184 1.00 30.55 ? 67   GLU A OE1 1 
ATOM   389   O  OE2 . GLU A 1 49  ? 52.341  64.455 117.300 1.00 31.04 ? 67   GLU A OE2 1 
ATOM   390   N  N   . LYS A 1 50  ? 52.632  66.503 112.604 1.00 21.24 ? 68   LYS A N   1 
ATOM   391   C  CA  . LYS A 1 50  ? 53.316  66.519 111.305 1.00 20.67 ? 68   LYS A CA  1 
ATOM   392   C  C   . LYS A 1 50  ? 52.574  65.612 110.328 1.00 20.01 ? 68   LYS A C   1 
ATOM   393   O  O   . LYS A 1 50  ? 52.111  64.538 110.719 1.00 19.50 ? 68   LYS A O   1 
ATOM   394   C  CB  . LYS A 1 50  ? 54.773  66.063 111.423 1.00 20.80 ? 68   LYS A CB  1 
ATOM   395   C  CG  . LYS A 1 50  ? 55.720  67.073 112.063 1.00 21.89 ? 68   LYS A CG  1 
ATOM   396   C  CD  . LYS A 1 50  ? 57.163  66.582 111.957 1.00 23.66 ? 68   LYS A CD  1 
ATOM   397   C  CE  . LYS A 1 50  ? 58.032  67.099 113.097 1.00 25.19 ? 68   LYS A CE  1 
ATOM   398   N  NZ  . LYS A 1 50  ? 58.189  68.582 113.073 1.00 25.95 ? 68   LYS A NZ  1 
ATOM   399   N  N   . PRO A 1 51  ? 52.447  66.046 109.058 1.00 19.71 ? 69   PRO A N   1 
ATOM   400   C  CA  . PRO A 1 51  ? 51.760  65.234 108.053 1.00 19.65 ? 69   PRO A CA  1 
ATOM   401   C  C   . PRO A 1 51  ? 52.584  64.032 107.584 1.00 19.76 ? 69   PRO A C   1 
ATOM   402   O  O   . PRO A 1 51  ? 53.819  64.119 107.474 1.00 19.61 ? 69   PRO A O   1 
ATOM   403   C  CB  . PRO A 1 51  ? 51.520  66.217 106.905 1.00 19.66 ? 69   PRO A CB  1 
ATOM   404   C  CG  . PRO A 1 51  ? 52.580  67.247 107.050 1.00 19.87 ? 69   PRO A CG  1 
ATOM   405   C  CD  . PRO A 1 51  ? 52.921  67.331 108.510 1.00 19.59 ? 69   PRO A CD  1 
ATOM   406   N  N   . HIS A 1 52  ? 51.891  62.924 107.327 1.00 19.55 ? 70   HIS A N   1 
ATOM   407   C  CA  . HIS A 1 52  ? 52.514  61.683 106.878 1.00 19.65 ? 70   HIS A CA  1 
ATOM   408   C  C   . HIS A 1 52  ? 52.002  61.237 105.515 1.00 19.49 ? 70   HIS A C   1 
ATOM   409   O  O   . HIS A 1 52  ? 50.792  61.162 105.293 1.00 19.54 ? 70   HIS A O   1 
ATOM   410   C  CB  . HIS A 1 52  ? 52.258  60.558 107.884 1.00 19.67 ? 70   HIS A CB  1 
ATOM   411   C  CG  . HIS A 1 52  ? 53.039  60.690 109.154 1.00 21.07 ? 70   HIS A CG  1 
ATOM   412   N  ND1 . HIS A 1 52  ? 54.051  59.818 109.499 1.00 21.62 ? 70   HIS A ND1 1 
ATOM   413   C  CD2 . HIS A 1 52  ? 52.961  61.594 110.160 1.00 21.74 ? 70   HIS A CD2 1 
ATOM   414   C  CE1 . HIS A 1 52  ? 54.562  60.179 110.663 1.00 22.17 ? 70   HIS A CE1 1 
ATOM   415   N  NE2 . HIS A 1 52  ? 53.918  61.253 111.086 1.00 22.81 ? 70   HIS A NE2 1 
ATOM   416   N  N   . ILE A 1 53  ? 52.928  60.959 104.601 1.00 18.89 ? 71   ILE A N   1 
ATOM   417   C  CA  . ILE A 1 53  ? 52.606  60.135 103.443 1.00 18.35 ? 71   ILE A CA  1 
ATOM   418   C  C   . ILE A 1 53  ? 53.116  58.741 103.766 1.00 18.18 ? 71   ILE A C   1 
ATOM   419   O  O   . ILE A 1 53  ? 54.283  58.557 104.092 1.00 18.03 ? 71   ILE A O   1 
ATOM   420   C  CB  . ILE A 1 53  ? 53.194  60.664 102.100 1.00 18.29 ? 71   ILE A CB  1 
ATOM   421   C  CG1 . ILE A 1 53  ? 52.643  62.063 101.782 1.00 17.89 ? 71   ILE A CG1 1 
ATOM   422   C  CG2 . ILE A 1 53  ? 52.865  59.699 100.975 1.00 17.17 ? 71   ILE A CG2 1 
ATOM   423   C  CD1 . ILE A 1 53  ? 53.325  62.783 100.633 1.00 17.07 ? 71   ILE A CD1 1 
ATOM   424   N  N   . LYS A 1 54  ? 52.221  57.765 103.688 1.00 17.91 ? 72   LYS A N   1 
ATOM   425   C  CA  . LYS A 1 54  ? 52.535  56.403 104.071 1.00 17.86 ? 72   LYS A CA  1 
ATOM   426   C  C   . LYS A 1 54  ? 51.705  55.414 103.247 1.00 17.93 ? 72   LYS A C   1 
ATOM   427   O  O   . LYS A 1 54  ? 50.799  55.831 102.516 1.00 17.95 ? 72   LYS A O   1 
ATOM   428   C  CB  . LYS A 1 54  ? 52.314  56.226 105.580 1.00 18.03 ? 72   LYS A CB  1 
ATOM   429   C  CG  . LYS A 1 54  ? 50.894  56.488 106.081 1.00 17.80 ? 72   LYS A CG  1 
ATOM   430   C  CD  . LYS A 1 54  ? 50.887  56.515 107.599 1.00 18.73 ? 72   LYS A CD  1 
ATOM   431   C  CE  . LYS A 1 54  ? 49.479  56.433 108.160 1.00 19.27 ? 72   LYS A CE  1 
ATOM   432   N  NZ  . LYS A 1 54  ? 49.506  56.452 109.648 1.00 18.22 ? 72   LYS A NZ  1 
ATOM   433   N  N   . PRO A 1 55  ? 52.013  54.105 103.345 1.00 18.04 ? 73   PRO A N   1 
ATOM   434   C  CA  . PRO A 1 55  ? 51.252  53.114 102.601 1.00 18.05 ? 73   PRO A CA  1 
ATOM   435   C  C   . PRO A 1 55  ? 49.775  53.138 102.955 1.00 18.36 ? 73   PRO A C   1 
ATOM   436   O  O   . PRO A 1 55  ? 49.417  53.353 104.123 1.00 18.65 ? 73   PRO A O   1 
ATOM   437   C  CB  . PRO A 1 55  ? 51.865  51.787 103.064 1.00 18.21 ? 73   PRO A CB  1 
ATOM   438   C  CG  . PRO A 1 55  ? 53.258  52.147 103.467 1.00 18.21 ? 73   PRO A CG  1 
ATOM   439   C  CD  . PRO A 1 55  ? 53.083  53.473 104.139 1.00 18.02 ? 73   PRO A CD  1 
ATOM   440   N  N   . LEU A 1 56  ? 48.930  52.923 101.948 1.00 18.30 ? 74   LEU A N   1 
ATOM   441   C  CA  . LEU A 1 56  ? 47.497  52.798 102.152 1.00 18.11 ? 74   LEU A CA  1 
ATOM   442   C  C   . LEU A 1 56  ? 47.243  51.700 103.175 1.00 18.07 ? 74   LEU A C   1 
ATOM   443   O  O   . LEU A 1 56  ? 47.767  50.594 103.053 1.00 18.19 ? 74   LEU A O   1 
ATOM   444   C  CB  . LEU A 1 56  ? 46.785  52.473 100.835 1.00 18.06 ? 74   LEU A CB  1 
ATOM   445   C  CG  . LEU A 1 56  ? 45.270  52.230 100.922 1.00 18.03 ? 74   LEU A CG  1 
ATOM   446   C  CD1 . LEU A 1 56  ? 44.498  53.542 100.965 1.00 16.70 ? 74   LEU A CD1 1 
ATOM   447   C  CD2 . LEU A 1 56  ? 44.802  51.354 99.770  1.00 16.34 ? 74   LEU A CD2 1 
ATOM   448   N  N   . GLN A 1 57  ? 46.454  52.026 104.190 1.00 17.69 ? 75   GLN A N   1 
ATOM   449   C  CA  . GLN A 1 57  ? 46.143  51.088 105.259 1.00 17.76 ? 75   GLN A CA  1 
ATOM   450   C  C   . GLN A 1 57  ? 44.828  51.456 105.924 1.00 17.17 ? 75   GLN A C   1 
ATOM   451   O  O   . GLN A 1 57  ? 44.336  52.573 105.770 1.00 16.85 ? 75   GLN A O   1 
ATOM   452   C  CB  . GLN A 1 57  ? 47.264  51.068 106.301 1.00 17.89 ? 75   GLN A CB  1 
ATOM   453   C  CG  . GLN A 1 57  ? 47.731  52.446 106.749 1.00 20.34 ? 75   GLN A CG  1 
ATOM   454   C  CD  . GLN A 1 57  ? 49.090  52.404 107.441 1.00 24.04 ? 75   GLN A CD  1 
ATOM   455   O  OE1 . GLN A 1 57  ? 50.145  52.578 106.802 1.00 24.17 ? 75   GLN A OE1 1 
ATOM   456   N  NE2 . GLN A 1 57  ? 49.073  52.156 108.749 1.00 24.51 ? 75   GLN A NE2 1 
ATOM   457   N  N   . ASN A 1 58  ? 44.264  50.501 106.659 1.00 16.96 ? 76   ASN A N   1 
ATOM   458   C  CA  . ASN A 1 58  ? 43.092  50.741 107.484 1.00 16.70 ? 76   ASN A CA  1 
ATOM   459   C  C   . ASN A 1 58  ? 43.332  51.832 108.515 1.00 16.69 ? 76   ASN A C   1 
ATOM   460   O  O   . ASN A 1 58  ? 44.463  52.070 108.944 1.00 16.81 ? 76   ASN A O   1 
ATOM   461   C  CB  . ASN A 1 58  ? 42.673  49.460 108.194 1.00 16.82 ? 76   ASN A CB  1 
ATOM   462   C  CG  . ASN A 1 58  ? 41.905  48.522 107.301 1.00 16.83 ? 76   ASN A CG  1 
ATOM   463   O  OD1 . ASN A 1 58  ? 41.736  48.772 106.110 1.00 18.44 ? 76   ASN A OD1 1 
ATOM   464   N  ND2 . ASN A 1 58  ? 41.426  47.431 107.874 1.00 17.64 ? 76   ASN A ND2 1 
ATOM   465   N  N   . LEU A 1 59  ? 42.260  52.508 108.899 1.00 16.60 ? 77   LEU A N   1 
ATOM   466   C  CA  . LEU A 1 59  ? 42.327  53.493 109.959 1.00 16.41 ? 77   LEU A CA  1 
ATOM   467   C  C   . LEU A 1 59  ? 42.045  52.765 111.260 1.00 16.52 ? 77   LEU A C   1 
ATOM   468   O  O   . LEU A 1 59  ? 41.177  51.890 111.313 1.00 17.01 ? 77   LEU A O   1 
ATOM   469   C  CB  . LEU A 1 59  ? 41.323  54.622 109.711 1.00 16.29 ? 77   LEU A CB  1 
ATOM   470   C  CG  . LEU A 1 59  ? 41.414  55.336 108.350 1.00 16.13 ? 77   LEU A CG  1 
ATOM   471   C  CD1 . LEU A 1 59  ? 40.357  56.414 108.221 1.00 15.26 ? 77   LEU A CD1 1 
ATOM   472   C  CD2 . LEU A 1 59  ? 42.803  55.930 108.118 1.00 16.09 ? 77   LEU A CD2 1 
ATOM   473   N  N   . SER A 1 60  ? 42.817  53.089 112.293 1.00 16.42 ? 78   SER A N   1 
ATOM   474   C  CA  . SER A 1 60  ? 42.572  52.562 113.624 1.00 16.16 ? 78   SER A CA  1 
ATOM   475   C  C   . SER A 1 60  ? 41.839  53.644 114.401 1.00 16.02 ? 78   SER A C   1 
ATOM   476   O  O   . SER A 1 60  ? 42.413  54.682 114.735 1.00 15.52 ? 78   SER A O   1 
ATOM   477   C  CB  . SER A 1 60  ? 43.878  52.201 114.321 1.00 16.34 ? 78   SER A CB  1 
ATOM   478   O  OG  . SER A 1 60  ? 43.609  51.456 115.492 1.00 16.73 ? 78   SER A OG  1 
ATOM   479   N  N   . LEU A 1 61  ? 40.561  53.404 114.667 1.00 15.47 ? 79   LEU A N   1 
ATOM   480   C  CA  . LEU A 1 61  ? 39.716  54.426 115.253 1.00 15.68 ? 79   LEU A CA  1 
ATOM   481   C  C   . LEU A 1 61  ? 39.077  53.931 116.541 1.00 15.39 ? 79   LEU A C   1 
ATOM   482   O  O   . LEU A 1 61  ? 38.542  52.827 116.590 1.00 14.79 ? 79   LEU A O   1 
ATOM   483   C  CB  . LEU A 1 61  ? 38.628  54.836 114.254 1.00 15.84 ? 79   LEU A CB  1 
ATOM   484   C  CG  . LEU A 1 61  ? 38.833  55.938 113.197 1.00 16.64 ? 79   LEU A CG  1 
ATOM   485   C  CD1 . LEU A 1 61  ? 40.284  56.317 112.913 1.00 16.03 ? 79   LEU A CD1 1 
ATOM   486   C  CD2 . LEU A 1 61  ? 38.104  55.579 111.909 1.00 16.27 ? 79   LEU A CD2 1 
ATOM   487   N  N   . HIS A 1 62  ? 39.148  54.753 117.584 1.00 15.24 ? 80   HIS A N   1 
ATOM   488   C  CA  . HIS A 1 62  ? 38.349  54.516 118.772 1.00 15.03 ? 80   HIS A CA  1 
ATOM   489   C  C   . HIS A 1 62  ? 36.877  54.366 118.334 1.00 14.44 ? 80   HIS A C   1 
ATOM   490   O  O   . HIS A 1 62  ? 36.388  55.159 117.531 1.00 14.55 ? 80   HIS A O   1 
ATOM   491   C  CB  . HIS A 1 62  ? 38.520  55.656 119.785 1.00 15.01 ? 80   HIS A CB  1 
ATOM   492   C  CG  . HIS A 1 62  ? 37.945  55.340 121.131 1.00 16.41 ? 80   HIS A CG  1 
ATOM   493   N  ND1 . HIS A 1 62  ? 36.589  55.346 121.380 1.00 16.22 ? 80   HIS A ND1 1 
ATOM   494   C  CD2 . HIS A 1 62  ? 38.538  54.974 122.294 1.00 17.47 ? 80   HIS A CD2 1 
ATOM   495   C  CE1 . HIS A 1 62  ? 36.370  55.010 122.638 1.00 17.15 ? 80   HIS A CE1 1 
ATOM   496   N  NE2 . HIS A 1 62  ? 37.537  54.784 123.216 1.00 18.16 ? 80   HIS A NE2 1 
ATOM   497   N  N   . PRO A 1 63  ? 36.180  53.329 118.826 1.00 13.97 ? 81   PRO A N   1 
ATOM   498   C  CA  . PRO A 1 63  ? 34.789  53.104 118.412 1.00 13.48 ? 81   PRO A CA  1 
ATOM   499   C  C   . PRO A 1 63  ? 33.813  54.235 118.797 1.00 13.19 ? 81   PRO A C   1 
ATOM   500   O  O   . PRO A 1 63  ? 32.695  54.286 118.278 1.00 12.98 ? 81   PRO A O   1 
ATOM   501   C  CB  . PRO A 1 63  ? 34.425  51.787 119.104 1.00 13.56 ? 81   PRO A CB  1 
ATOM   502   C  CG  . PRO A 1 63  ? 35.393  51.660 120.253 1.00 13.65 ? 81   PRO A CG  1 
ATOM   503   C  CD  . PRO A 1 63  ? 36.655  52.297 119.772 1.00 14.03 ? 81   PRO A CD  1 
ATOM   504   N  N   . GLY A 1 64  ? 34.255  55.143 119.669 1.00 12.85 ? 82   GLY A N   1 
ATOM   505   C  CA  . GLY A 1 64  ? 33.484  56.324 120.064 1.00 12.38 ? 82   GLY A CA  1 
ATOM   506   C  C   . GLY A 1 64  ? 33.675  57.541 119.167 1.00 12.44 ? 82   GLY A C   1 
ATOM   507   O  O   . GLY A 1 64  ? 33.032  58.580 119.379 1.00 12.02 ? 82   GLY A O   1 
ATOM   508   N  N   . SER A 1 65  ? 34.541  57.408 118.157 1.00 12.20 ? 83   SER A N   1 
ATOM   509   C  CA  . SER A 1 65  ? 34.876  58.506 117.229 1.00 12.29 ? 83   SER A CA  1 
ATOM   510   C  C   . SER A 1 65  ? 33.637  59.211 116.689 1.00 12.21 ? 83   SER A C   1 
ATOM   511   O  O   . SER A 1 65  ? 32.757  58.568 116.113 1.00 12.40 ? 83   SER A O   1 
ATOM   512   C  CB  . SER A 1 65  ? 35.718  57.994 116.056 1.00 12.02 ? 83   SER A CB  1 
ATOM   513   O  OG  . SER A 1 65  ? 36.944  57.458 116.505 1.00 12.22 ? 83   SER A OG  1 
ATOM   514   N  N   . SER A 1 66  ? 33.582  60.530 116.860 1.00 12.03 ? 84   SER A N   1 
ATOM   515   C  CA  . SER A 1 66  ? 32.377  61.298 116.535 1.00 12.05 ? 84   SER A CA  1 
ATOM   516   C  C   . SER A 1 66  ? 31.952  61.207 115.063 1.00 12.00 ? 84   SER A C   1 
ATOM   517   O  O   . SER A 1 66  ? 30.777  61.422 114.736 1.00 11.53 ? 84   SER A O   1 
ATOM   518   C  CB  . SER A 1 66  ? 32.535  62.760 116.964 1.00 12.22 ? 84   SER A CB  1 
ATOM   519   O  OG  . SER A 1 66  ? 33.716  63.329 116.425 1.00 13.09 ? 84   SER A OG  1 
ATOM   520   N  N   . ALA A 1 67  ? 32.909  60.895 114.185 1.00 11.91 ? 85   ALA A N   1 
ATOM   521   C  CA  . ALA A 1 67  ? 32.622  60.663 112.767 1.00 11.92 ? 85   ALA A CA  1 
ATOM   522   C  C   . ALA A 1 67  ? 31.692  59.472 112.573 1.00 11.81 ? 85   ALA A C   1 
ATOM   523   O  O   . ALA A 1 67  ? 30.991  59.404 111.573 1.00 11.70 ? 85   ALA A O   1 
ATOM   524   C  CB  . ALA A 1 67  ? 33.914  60.426 111.989 1.00 11.94 ? 85   ALA A CB  1 
ATOM   525   N  N   . LEU A 1 68  ? 31.712  58.533 113.522 1.00 11.77 ? 86   LEU A N   1 
ATOM   526   C  CA  . LEU A 1 68  ? 30.916  57.308 113.433 1.00 11.72 ? 86   LEU A CA  1 
ATOM   527   C  C   . LEU A 1 68  ? 29.557  57.450 114.100 1.00 11.58 ? 86   LEU A C   1 
ATOM   528   O  O   . LEU A 1 68  ? 28.644  56.664 113.838 1.00 11.60 ? 86   LEU A O   1 
ATOM   529   C  CB  . LEU A 1 68  ? 31.669  56.125 114.049 1.00 11.88 ? 86   LEU A CB  1 
ATOM   530   C  CG  . LEU A 1 68  ? 33.068  55.800 113.512 1.00 12.26 ? 86   LEU A CG  1 
ATOM   531   C  CD1 . LEU A 1 68  ? 33.661  54.666 114.324 1.00 12.69 ? 86   LEU A CD1 1 
ATOM   532   C  CD2 . LEU A 1 68  ? 33.031  55.441 112.024 1.00 12.08 ? 86   LEU A CD2 1 
ATOM   533   N  N   . HIS A 1 69  ? 29.421  58.454 114.960 1.00 11.35 ? 87   HIS A N   1 
ATOM   534   C  CA  . HIS A 1 69  ? 28.196  58.624 115.739 1.00 10.81 ? 87   HIS A CA  1 
ATOM   535   C  C   . HIS A 1 69  ? 27.382  59.813 115.289 1.00 10.57 ? 87   HIS A C   1 
ATOM   536   O  O   . HIS A 1 69  ? 26.175  59.698 115.111 1.00 10.21 ? 87   HIS A O   1 
ATOM   537   C  CB  . HIS A 1 69  ? 28.510  58.731 117.233 1.00 10.48 ? 87   HIS A CB  1 
ATOM   538   C  CG  . HIS A 1 69  ? 29.102  57.487 117.809 1.00 10.17 ? 87   HIS A CG  1 
ATOM   539   N  ND1 . HIS A 1 69  ? 28.352  56.555 118.496 1.00 9.09  ? 87   HIS A ND1 1 
ATOM   540   C  CD2 . HIS A 1 69  ? 30.368  57.004 117.779 1.00 10.12 ? 87   HIS A CD2 1 
ATOM   541   C  CE1 . HIS A 1 69  ? 29.133  55.559 118.875 1.00 8.83  ? 87   HIS A CE1 1 
ATOM   542   N  NE2 . HIS A 1 69  ? 30.360  55.806 118.454 1.00 10.55 ? 87   HIS A NE2 1 
ATOM   543   N  N   . TYR A 1 70  ? 28.052  60.950 115.102 1.00 10.87 ? 88   TYR A N   1 
ATOM   544   C  CA  . TYR A 1 70  ? 27.376  62.224 114.811 1.00 10.71 ? 88   TYR A CA  1 
ATOM   545   C  C   . TYR A 1 70  ? 27.797  62.851 113.483 1.00 10.83 ? 88   TYR A C   1 
ATOM   546   O  O   . TYR A 1 70  ? 27.641  64.062 113.289 1.00 10.86 ? 88   TYR A O   1 
ATOM   547   C  CB  . TYR A 1 70  ? 27.583  63.216 115.972 1.00 10.31 ? 88   TYR A CB  1 
ATOM   548   C  CG  . TYR A 1 70  ? 27.327  62.599 117.338 1.00 10.30 ? 88   TYR A CG  1 
ATOM   549   C  CD1 . TYR A 1 70  ? 26.093  61.998 117.638 1.00 10.00 ? 88   TYR A CD1 1 
ATOM   550   C  CD2 . TYR A 1 70  ? 28.322  62.609 118.328 1.00 9.59  ? 88   TYR A CD2 1 
ATOM   551   C  CE1 . TYR A 1 70  ? 25.857  61.414 118.890 1.00 10.86 ? 88   TYR A CE1 1 
ATOM   552   C  CE2 . TYR A 1 70  ? 28.097  62.040 119.584 1.00 9.67  ? 88   TYR A CE2 1 
ATOM   553   C  CZ  . TYR A 1 70  ? 26.866  61.440 119.859 1.00 10.34 ? 88   TYR A CZ  1 
ATOM   554   O  OH  . TYR A 1 70  ? 26.634  60.876 121.093 1.00 9.25  ? 88   TYR A OH  1 
ATOM   555   N  N   . ALA A 1 71  ? 28.345  62.027 112.587 1.00 10.63 ? 89   ALA A N   1 
ATOM   556   C  CA  . ALA A 1 71  ? 28.717  62.444 111.221 1.00 10.41 ? 89   ALA A CA  1 
ATOM   557   C  C   . ALA A 1 71  ? 29.582  63.695 111.169 1.00 10.29 ? 89   ALA A C   1 
ATOM   558   O  O   . ALA A 1 71  ? 29.400  64.557 110.312 1.00 9.66  ? 89   ALA A O   1 
ATOM   559   C  CB  . ALA A 1 71  ? 27.467  62.599 110.330 1.00 10.43 ? 89   ALA A CB  1 
ATOM   560   N  N   . VAL A 1 72  ? 30.527  63.775 112.102 1.00 10.91 ? 90   VAL A N   1 
ATOM   561   C  CA  . VAL A 1 72  ? 31.487  64.865 112.161 1.00 11.16 ? 90   VAL A CA  1 
ATOM   562   C  C   . VAL A 1 72  ? 32.560  64.556 111.108 1.00 11.31 ? 90   VAL A C   1 
ATOM   563   O  O   . VAL A 1 72  ? 33.581  63.928 111.394 1.00 11.39 ? 90   VAL A O   1 
ATOM   564   C  CB  . VAL A 1 72  ? 32.065  65.031 113.611 1.00 11.45 ? 90   VAL A CB  1 
ATOM   565   C  CG1 . VAL A 1 72  ? 33.050  66.194 113.696 1.00 11.72 ? 90   VAL A CG1 1 
ATOM   566   C  CG2 . VAL A 1 72  ? 30.925  65.230 114.625 1.00 10.83 ? 90   VAL A CG2 1 
ATOM   567   N  N   . GLU A 1 73  ? 32.291  64.990 109.879 1.00 11.20 ? 91   GLU A N   1 
ATOM   568   C  CA  . GLU A 1 73  ? 33.087  64.610 108.718 1.00 11.19 ? 91   GLU A CA  1 
ATOM   569   C  C   . GLU A 1 73  ? 32.768  65.480 107.501 1.00 11.23 ? 91   GLU A C   1 
ATOM   570   O  O   . GLU A 1 73  ? 31.663  66.037 107.376 1.00 11.13 ? 91   GLU A O   1 
ATOM   571   C  CB  . GLU A 1 73  ? 32.834  63.140 108.360 1.00 10.83 ? 91   GLU A CB  1 
ATOM   572   C  CG  . GLU A 1 73  ? 31.390  62.858 107.946 1.00 11.21 ? 91   GLU A CG  1 
ATOM   573   C  CD  . GLU A 1 73  ? 31.074  61.385 107.842 1.00 10.98 ? 91   GLU A CD  1 
ATOM   574   O  OE1 . GLU A 1 73  ? 30.470  60.992 106.832 1.00 11.10 ? 91   GLU A OE1 1 
ATOM   575   O  OE2 . GLU A 1 73  ? 31.435  60.619 108.757 1.00 12.20 ? 91   GLU A OE2 1 
ATOM   576   N  N   . LEU A 1 74  ? 33.748  65.582 106.611 1.00 10.92 ? 92   LEU A N   1 
ATOM   577   C  CA  . LEU A 1 74  ? 33.570  66.210 105.309 1.00 10.96 ? 92   LEU A CA  1 
ATOM   578   C  C   . LEU A 1 74  ? 34.582  65.635 104.320 1.00 11.01 ? 92   LEU A C   1 
ATOM   579   O  O   . LEU A 1 74  ? 35.573  65.002 104.723 1.00 10.79 ? 92   LEU A O   1 
ATOM   580   C  CB  . LEU A 1 74  ? 33.636  67.750 105.376 1.00 10.94 ? 92   LEU A CB  1 
ATOM   581   C  CG  . LEU A 1 74  ? 34.848  68.668 105.662 1.00 11.65 ? 92   LEU A CG  1 
ATOM   582   C  CD1 . LEU A 1 74  ? 35.113  68.869 107.157 1.00 11.28 ? 92   LEU A CD1 1 
ATOM   583   C  CD2 . LEU A 1 74  ? 36.124  68.312 104.905 1.00 11.41 ? 92   LEU A CD2 1 
ATOM   584   N  N   . PHE A 1 75  ? 34.323  65.850 103.034 1.00 10.89 ? 93   PHE A N   1 
ATOM   585   C  CA  . PHE A 1 75  ? 35.203  65.356 101.984 1.00 11.39 ? 93   PHE A CA  1 
ATOM   586   C  C   . PHE A 1 75  ? 35.355  66.373 100.860 1.00 11.62 ? 93   PHE A C   1 
ATOM   587   O  O   . PHE A 1 75  ? 34.638  67.386 100.800 1.00 11.70 ? 93   PHE A O   1 
ATOM   588   C  CB  . PHE A 1 75  ? 34.726  63.981 101.447 1.00 11.19 ? 93   PHE A CB  1 
ATOM   589   C  CG  . PHE A 1 75  ? 33.390  64.023 100.731 1.00 11.88 ? 93   PHE A CG  1 
ATOM   590   C  CD1 . PHE A 1 75  ? 32.195  63.945 101.449 1.00 11.87 ? 93   PHE A CD1 1 
ATOM   591   C  CD2 . PHE A 1 75  ? 33.328  64.137 99.345  1.00 10.25 ? 93   PHE A CD2 1 
ATOM   592   C  CE1 . PHE A 1 75  ? 30.970  63.993 100.797 1.00 11.34 ? 93   PHE A CE1 1 
ATOM   593   C  CE2 . PHE A 1 75  ? 32.104  64.180 98.684  1.00 10.78 ? 93   PHE A CE2 1 
ATOM   594   C  CZ  . PHE A 1 75  ? 30.923  64.104 99.408  1.00 10.54 ? 93   PHE A CZ  1 
ATOM   595   N  N   . GLU A 1 76  ? 36.325  66.113 99.996  1.00 11.97 ? 94   GLU A N   1 
ATOM   596   C  CA  . GLU A 1 76  ? 36.411  66.804 98.721  1.00 12.45 ? 94   GLU A CA  1 
ATOM   597   C  C   . GLU A 1 76  ? 36.601  65.817 97.585  1.00 12.37 ? 94   GLU A C   1 
ATOM   598   O  O   . GLU A 1 76  ? 36.777  64.616 97.804  1.00 12.20 ? 94   GLU A O   1 
ATOM   599   C  CB  . GLU A 1 76  ? 37.530  67.849 98.711  1.00 12.17 ? 94   GLU A CB  1 
ATOM   600   C  CG  . GLU A 1 76  ? 37.090  69.218 99.165  1.00 12.96 ? 94   GLU A CG  1 
ATOM   601   C  CD  . GLU A 1 76  ? 36.066  69.856 98.251  1.00 13.94 ? 94   GLU A CD  1 
ATOM   602   O  OE1 . GLU A 1 76  ? 35.350  70.755 98.732  1.00 15.16 ? 94   GLU A OE1 1 
ATOM   603   O  OE2 . GLU A 1 76  ? 35.977  69.475 97.061  1.00 14.06 ? 94   GLU A OE2 1 
ATOM   604   N  N   . GLY A 1 77  ? 36.545  66.348 96.370  1.00 12.26 ? 95   GLY A N   1 
ATOM   605   C  CA  . GLY A 1 77  ? 36.737  65.570 95.168  1.00 12.16 ? 95   GLY A CA  1 
ATOM   606   C  C   . GLY A 1 77  ? 37.331  66.446 94.097  1.00 12.10 ? 95   GLY A C   1 
ATOM   607   O  O   . GLY A 1 77  ? 36.735  67.444 93.697  1.00 12.00 ? 95   GLY A O   1 
ATOM   608   N  N   . LEU A 1 78  ? 38.523  66.070 93.654  1.00 12.38 ? 96   LEU A N   1 
ATOM   609   C  CA  . LEU A 1 78  ? 39.223  66.751 92.572  1.00 12.63 ? 96   LEU A CA  1 
ATOM   610   C  C   . LEU A 1 78  ? 40.118  65.744 91.848  1.00 12.75 ? 96   LEU A C   1 
ATOM   611   O  O   . LEU A 1 78  ? 40.242  64.600 92.291  1.00 12.44 ? 96   LEU A O   1 
ATOM   612   C  CB  . LEU A 1 78  ? 39.979  68.001 93.072  1.00 12.85 ? 96   LEU A CB  1 
ATOM   613   C  CG  . LEU A 1 78  ? 40.938  68.215 94.267  1.00 13.08 ? 96   LEU A CG  1 
ATOM   614   C  CD1 . LEU A 1 78  ? 40.792  67.231 95.442  1.00 13.27 ? 96   LEU A CD1 1 
ATOM   615   C  CD2 . LEU A 1 78  ? 42.373  68.297 93.809  1.00 12.69 ? 96   LEU A CD2 1 
ATOM   616   N  N   . LYS A 1 79  ? 40.708  66.147 90.724  1.00 13.02 ? 97   LYS A N   1 
ATOM   617   C  CA  . LYS A 1 79  ? 41.404  65.189 89.859  1.00 13.65 ? 97   LYS A CA  1 
ATOM   618   C  C   . LYS A 1 79  ? 42.783  65.639 89.378  1.00 13.72 ? 97   LYS A C   1 
ATOM   619   O  O   . LYS A 1 79  ? 43.039  66.833 89.224  1.00 13.55 ? 97   LYS A O   1 
ATOM   620   C  CB  . LYS A 1 79  ? 40.539  64.839 88.646  1.00 13.48 ? 97   LYS A CB  1 
ATOM   621   C  CG  . LYS A 1 79  ? 39.280  64.044 88.958  1.00 14.47 ? 97   LYS A CG  1 
ATOM   622   C  CD  . LYS A 1 79  ? 38.447  63.890 87.703  1.00 16.76 ? 97   LYS A CD  1 
ATOM   623   C  CE  . LYS A 1 79  ? 37.503  62.732 87.816  1.00 19.63 ? 97   LYS A CE  1 
ATOM   624   N  NZ  . LYS A 1 79  ? 36.791  62.515 86.510  1.00 23.70 ? 97   LYS A NZ  1 
ATOM   625   N  N   . ALA A 1 80  ? 43.655  64.658 89.150  1.00 13.83 ? 98   ALA A N   1 
ATOM   626   C  CA  . ALA A 1 80  ? 44.921  64.867 88.452  1.00 14.37 ? 98   ALA A CA  1 
ATOM   627   C  C   . ALA A 1 80  ? 44.820  64.277 87.046  1.00 14.61 ? 98   ALA A C   1 
ATOM   628   O  O   . ALA A 1 80  ? 44.255  63.188 86.855  1.00 14.33 ? 98   ALA A O   1 
ATOM   629   C  CB  . ALA A 1 80  ? 46.091  64.231 89.226  1.00 14.08 ? 98   ALA A CB  1 
ATOM   630   N  N   . PHE A 1 81  ? 45.361  65.005 86.070  1.00 14.97 ? 99   PHE A N   1 
ATOM   631   C  CA  . PHE A 1 81  ? 45.273  64.615 84.659  1.00 15.41 ? 99   PHE A CA  1 
ATOM   632   C  C   . PHE A 1 81  ? 46.651  64.522 84.018  1.00 15.77 ? 99   PHE A C   1 
ATOM   633   O  O   . PHE A 1 81  ? 47.419  65.478 84.070  1.00 16.08 ? 99   PHE A O   1 
ATOM   634   C  CB  . PHE A 1 81  ? 44.442  65.634 83.871  1.00 14.83 ? 99   PHE A CB  1 
ATOM   635   C  CG  . PHE A 1 81  ? 43.051  65.847 84.408  1.00 14.36 ? 99   PHE A CG  1 
ATOM   636   C  CD1 . PHE A 1 81  ? 42.808  66.815 85.386  1.00 12.60 ? 99   PHE A CD1 1 
ATOM   637   C  CD2 . PHE A 1 81  ? 41.981  65.094 83.924  1.00 11.68 ? 99   PHE A CD2 1 
ATOM   638   C  CE1 . PHE A 1 81  ? 41.518  67.017 85.884  1.00 12.67 ? 99   PHE A CE1 1 
ATOM   639   C  CE2 . PHE A 1 81  ? 40.688  65.297 84.408  1.00 12.00 ? 99   PHE A CE2 1 
ATOM   640   C  CZ  . PHE A 1 81  ? 40.457  66.259 85.393  1.00 11.88 ? 99   PHE A CZ  1 
ATOM   641   N  N   . ARG A 1 82  ? 46.962  63.381 83.411  1.00 16.54 ? 100  ARG A N   1 
ATOM   642   C  CA  . ARG A 1 82  ? 48.175  63.272 82.592  1.00 17.33 ? 100  ARG A CA  1 
ATOM   643   C  C   . ARG A 1 82  ? 47.921  63.854 81.199  1.00 17.58 ? 100  ARG A C   1 
ATOM   644   O  O   . ARG A 1 82  ? 47.096  63.339 80.435  1.00 17.76 ? 100  ARG A O   1 
ATOM   645   C  CB  . ARG A 1 82  ? 48.664  61.832 82.499  1.00 17.39 ? 100  ARG A CB  1 
ATOM   646   C  CG  . ARG A 1 82  ? 49.807  61.647 81.499  1.00 18.19 ? 100  ARG A CG  1 
ATOM   647   C  CD  . ARG A 1 82  ? 50.373  60.256 81.560  1.00 19.49 ? 100  ARG A CD  1 
ATOM   648   N  NE  . ARG A 1 82  ? 51.203  60.088 82.754  1.00 23.10 ? 100  ARG A NE  1 
ATOM   649   C  CZ  . ARG A 1 82  ? 50.913  59.237 83.723  1.00 23.33 ? 100  ARG A CZ  1 
ATOM   650   N  NH1 . ARG A 1 82  ? 49.837  58.487 83.592  1.00 26.01 ? 100  ARG A NH1 1 
ATOM   651   N  NH2 . ARG A 1 82  ? 51.689  59.112 84.797  1.00 21.56 ? 100  ARG A NH2 1 
ATOM   652   N  N   . GLY A 1 83  ? 48.629  64.931 80.886  1.00 17.92 ? 101  GLY A N   1 
ATOM   653   C  CA  . GLY A 1 83  ? 48.347  65.717 79.687  1.00 18.65 ? 101  GLY A CA  1 
ATOM   654   C  C   . GLY A 1 83  ? 48.777  65.081 78.381  1.00 19.00 ? 101  GLY A C   1 
ATOM   655   O  O   . GLY A 1 83  ? 49.480  64.070 78.377  1.00 18.68 ? 101  GLY A O   1 
ATOM   656   N  N   . VAL A 1 84  ? 48.351  65.688 77.272  1.00 19.42 ? 102  VAL A N   1 
ATOM   657   C  CA  . VAL A 1 84  ? 48.835  65.318 75.933  1.00 20.00 ? 102  VAL A CA  1 
ATOM   658   C  C   . VAL A 1 84  ? 50.362  65.414 75.822  1.00 20.31 ? 102  VAL A C   1 
ATOM   659   O  O   . VAL A 1 84  ? 50.970  64.706 75.026  1.00 20.43 ? 102  VAL A O   1 
ATOM   660   C  CB  . VAL A 1 84  ? 48.161  66.158 74.799  1.00 20.41 ? 102  VAL A CB  1 
ATOM   661   C  CG1 . VAL A 1 84  ? 46.712  65.727 74.607  1.00 20.43 ? 102  VAL A CG1 1 
ATOM   662   C  CG2 . VAL A 1 84  ? 48.261  67.670 75.073  1.00 19.26 ? 102  VAL A CG2 1 
ATOM   663   N  N   . ASP A 1 85  ? 50.961  66.290 76.632  1.00 20.59 ? 103  ASP A N   1 
ATOM   664   C  CA  . ASP A 1 85  ? 52.412  66.464 76.706  1.00 20.72 ? 103  ASP A CA  1 
ATOM   665   C  C   . ASP A 1 85  ? 53.047  65.633 77.834  1.00 20.81 ? 103  ASP A C   1 
ATOM   666   O  O   . ASP A 1 85  ? 54.200  65.849 78.194  1.00 20.67 ? 103  ASP A O   1 
ATOM   667   C  CB  . ASP A 1 85  ? 52.746  67.945 76.895  1.00 20.76 ? 103  ASP A CB  1 
ATOM   668   C  CG  . ASP A 1 85  ? 52.068  68.554 78.127  1.00 21.30 ? 103  ASP A CG  1 
ATOM   669   O  OD1 . ASP A 1 85  ? 52.344  69.731 78.437  1.00 20.60 ? 103  ASP A OD1 1 
ATOM   670   O  OD2 . ASP A 1 85  ? 51.261  67.863 78.784  1.00 20.41 ? 103  ASP A OD2 1 
ATOM   671   N  N   . ASN A 1 86  ? 52.278  64.691 78.382  1.00 21.15 ? 104  ASN A N   1 
ATOM   672   C  CA  . ASN A 1 86  ? 52.696  63.839 79.506  1.00 21.15 ? 104  ASN A CA  1 
ATOM   673   C  C   . ASN A 1 86  ? 53.034  64.593 80.804  1.00 21.18 ? 104  ASN A C   1 
ATOM   674   O  O   . ASN A 1 86  ? 53.732  64.070 81.679  1.00 21.40 ? 104  ASN A O   1 
ATOM   675   C  CB  . ASN A 1 86  ? 53.849  62.903 79.103  1.00 21.26 ? 104  ASN A CB  1 
ATOM   676   C  CG  . ASN A 1 86  ? 53.970  61.701 80.021  1.00 21.59 ? 104  ASN A CG  1 
ATOM   677   O  OD1 . ASN A 1 86  ? 52.966  61.112 80.424  1.00 20.60 ? 104  ASN A OD1 1 
ATOM   678   N  ND2 . ASN A 1 86  ? 55.203  61.331 80.359  1.00 22.43 ? 104  ASN A ND2 1 
ATOM   679   N  N   . LYS A 1 87  ? 52.540  65.821 80.920  1.00 20.71 ? 105  LYS A N   1 
ATOM   680   C  CA  . LYS A 1 87  ? 52.639  66.564 82.166  1.00 20.54 ? 105  LYS A CA  1 
ATOM   681   C  C   . LYS A 1 87  ? 51.359  66.371 82.961  1.00 20.14 ? 105  LYS A C   1 
ATOM   682   O  O   . LYS A 1 87  ? 50.255  66.420 82.413  1.00 19.90 ? 105  LYS A O   1 
ATOM   683   C  CB  . LYS A 1 87  ? 52.903  68.048 81.913  1.00 20.66 ? 105  LYS A CB  1 
ATOM   684   C  CG  . LYS A 1 87  ? 54.278  68.324 81.312  1.00 22.33 ? 105  LYS A CG  1 
ATOM   685   C  CD  . LYS A 1 87  ? 54.534  69.814 81.152  1.00 25.43 ? 105  LYS A CD  1 
ATOM   686   C  CE  . LYS A 1 87  ? 55.857  70.055 80.418  1.00 27.95 ? 105  LYS A CE  1 
ATOM   687   N  NZ  . LYS A 1 87  ? 55.978  71.465 79.942  1.00 29.54 ? 105  LYS A NZ  1 
ATOM   688   N  N   . ILE A 1 88  ? 51.519  66.120 84.255  1.00 19.89 ? 106  ILE A N   1 
ATOM   689   C  CA  . ILE A 1 88  ? 50.382  65.923 85.145  1.00 19.24 ? 106  ILE A CA  1 
ATOM   690   C  C   . ILE A 1 88  ? 49.919  67.276 85.662  1.00 19.09 ? 106  ILE A C   1 
ATOM   691   O  O   . ILE A 1 88  ? 50.732  68.097 86.101  1.00 18.99 ? 106  ILE A O   1 
ATOM   692   C  CB  . ILE A 1 88  ? 50.716  64.938 86.288  1.00 19.14 ? 106  ILE A CB  1 
ATOM   693   C  CG1 . ILE A 1 88  ? 51.025  63.553 85.695  1.00 19.19 ? 106  ILE A CG1 1 
ATOM   694   C  CG2 . ILE A 1 88  ? 49.564  64.850 87.301  1.00 18.33 ? 106  ILE A CG2 1 
ATOM   695   C  CD1 . ILE A 1 88  ? 51.807  62.637 86.603  1.00 18.25 ? 106  ILE A CD1 1 
ATOM   696   N  N   . ARG A 1 89  ? 48.610  67.502 85.578  1.00 18.78 ? 107  ARG A N   1 
ATOM   697   C  CA  . ARG A 1 89  ? 48.000  68.752 86.007  1.00 18.77 ? 107  ARG A CA  1 
ATOM   698   C  C   . ARG A 1 89  ? 46.853  68.549 86.995  1.00 18.56 ? 107  ARG A C   1 
ATOM   699   O  O   . ARG A 1 89  ? 46.105  67.567 86.918  1.00 18.29 ? 107  ARG A O   1 
ATOM   700   C  CB  . ARG A 1 89  ? 47.500  69.545 84.800  1.00 19.16 ? 107  ARG A CB  1 
ATOM   701   C  CG  . ARG A 1 89  ? 48.499  70.550 84.251  1.00 20.39 ? 107  ARG A CG  1 
ATOM   702   C  CD  . ARG A 1 89  ? 48.126  70.996 82.848  1.00 21.72 ? 107  ARG A CD  1 
ATOM   703   N  NE  . ARG A 1 89  ? 48.424  69.930 81.908  1.00 23.77 ? 107  ARG A NE  1 
ATOM   704   C  CZ  . ARG A 1 89  ? 49.388  69.956 80.994  1.00 20.79 ? 107  ARG A CZ  1 
ATOM   705   N  NH1 . ARG A 1 89  ? 50.166  71.017 80.838  1.00 20.55 ? 107  ARG A NH1 1 
ATOM   706   N  NH2 . ARG A 1 89  ? 49.555  68.902 80.230  1.00 19.78 ? 107  ARG A NH2 1 
ATOM   707   N  N   . LEU A 1 90  ? 46.747  69.484 87.933  1.00 18.08 ? 108  LEU A N   1 
ATOM   708   C  CA  . LEU A 1 90  ? 45.571  69.622 88.773  1.00 17.74 ? 108  LEU A CA  1 
ATOM   709   C  C   . LEU A 1 90  ? 44.688  70.694 88.163  1.00 17.45 ? 108  LEU A C   1 
ATOM   710   O  O   . LEU A 1 90  ? 45.179  71.579 87.469  1.00 17.47 ? 108  LEU A O   1 
ATOM   711   C  CB  . LEU A 1 90  ? 45.968  69.995 90.204  1.00 17.74 ? 108  LEU A CB  1 
ATOM   712   C  CG  . LEU A 1 90  ? 46.767  68.947 90.991  1.00 17.77 ? 108  LEU A CG  1 
ATOM   713   C  CD1 . LEU A 1 90  ? 47.057  69.414 92.411  1.00 17.65 ? 108  LEU A CD1 1 
ATOM   714   C  CD2 . LEU A 1 90  ? 46.043  67.610 91.004  1.00 18.27 ? 108  LEU A CD2 1 
ATOM   715   N  N   . PHE A 1 91  ? 43.385  70.597 88.406  1.00 17.34 ? 109  PHE A N   1 
ATOM   716   C  CA  . PHE A 1 91  ? 42.406  71.504 87.814  1.00 17.13 ? 109  PHE A CA  1 
ATOM   717   C  C   . PHE A 1 91  ? 41.691  72.280 88.918  1.00 17.31 ? 109  PHE A C   1 
ATOM   718   O  O   . PHE A 1 91  ? 40.979  71.695 89.747  1.00 16.97 ? 109  PHE A O   1 
ATOM   719   C  CB  . PHE A 1 91  ? 41.405  70.724 86.936  1.00 17.14 ? 109  PHE A CB  1 
ATOM   720   C  CG  . PHE A 1 91  ? 40.355  71.589 86.277  1.00 16.78 ? 109  PHE A CG  1 
ATOM   721   C  CD1 . PHE A 1 91  ? 40.625  72.248 85.083  1.00 17.36 ? 109  PHE A CD1 1 
ATOM   722   C  CD2 . PHE A 1 91  ? 39.090  71.729 86.847  1.00 17.79 ? 109  PHE A CD2 1 
ATOM   723   C  CE1 . PHE A 1 91  ? 39.655  73.053 84.469  1.00 17.93 ? 109  PHE A CE1 1 
ATOM   724   C  CE2 . PHE A 1 91  ? 38.111  72.530 86.245  1.00 17.92 ? 109  PHE A CE2 1 
ATOM   725   C  CZ  . PHE A 1 91  ? 38.395  73.191 85.052  1.00 18.45 ? 109  PHE A CZ  1 
ATOM   726   N  N   . GLN A 1 92  ? 41.911  73.597 88.930  1.00 17.59 ? 110  GLN A N   1 
ATOM   727   C  CA  . GLN A 1 92  ? 41.274  74.518 89.877  1.00 17.77 ? 110  GLN A CA  1 
ATOM   728   C  C   . GLN A 1 92  ? 41.321  74.030 91.338  1.00 17.89 ? 110  GLN A C   1 
ATOM   729   O  O   . GLN A 1 92  ? 40.327  74.167 92.061  1.00 17.95 ? 110  GLN A O   1 
ATOM   730   C  CB  . GLN A 1 92  ? 39.822  74.790 89.451  1.00 18.14 ? 110  GLN A CB  1 
ATOM   731   C  CG  . GLN A 1 92  ? 39.669  75.544 88.126  1.00 18.95 ? 110  GLN A CG  1 
ATOM   732   C  CD  . GLN A 1 92  ? 39.407  77.025 88.322  1.00 21.05 ? 110  GLN A CD  1 
ATOM   733   O  OE1 . GLN A 1 92  ? 38.330  77.518 87.994  1.00 23.09 ? 110  GLN A OE1 1 
ATOM   734   N  NE2 . GLN A 1 92  ? 40.376  77.736 88.877  1.00 21.14 ? 110  GLN A NE2 1 
ATOM   735   N  N   . PRO A 1 93  ? 42.479  73.485 91.786  1.00 17.75 ? 111  PRO A N   1 
ATOM   736   C  CA  . PRO A 1 93  ? 42.494  72.816 93.091  1.00 17.93 ? 111  PRO A CA  1 
ATOM   737   C  C   . PRO A 1 93  ? 42.348  73.768 94.287  1.00 18.48 ? 111  PRO A C   1 
ATOM   738   O  O   . PRO A 1 93  ? 41.920  73.336 95.361  1.00 18.25 ? 111  PRO A O   1 
ATOM   739   C  CB  . PRO A 1 93  ? 43.851  72.108 93.111  1.00 17.52 ? 111  PRO A CB  1 
ATOM   740   C  CG  . PRO A 1 93  ? 44.720  72.929 92.225  1.00 17.53 ? 111  PRO A CG  1 
ATOM   741   C  CD  . PRO A 1 93  ? 43.814  73.476 91.151  1.00 17.70 ? 111  PRO A CD  1 
ATOM   742   N  N   . ASN A 1 94  ? 42.685  75.046 94.094  1.00 18.89 ? 112  ASN A N   1 
ATOM   743   C  CA  . ASN A 1 94  ? 42.495  76.064 95.136  1.00 19.61 ? 112  ASN A CA  1 
ATOM   744   C  C   . ASN A 1 94  ? 41.029  76.303 95.487  1.00 18.85 ? 112  ASN A C   1 
ATOM   745   O  O   . ASN A 1 94  ? 40.715  76.672 96.615  1.00 19.17 ? 112  ASN A O   1 
ATOM   746   C  CB  . ASN A 1 94  ? 43.166  77.392 94.757  1.00 20.30 ? 112  ASN A CB  1 
ATOM   747   C  CG  . ASN A 1 94  ? 44.676  77.365 94.958  1.00 22.99 ? 112  ASN A CG  1 
ATOM   748   O  OD1 . ASN A 1 94  ? 45.443  77.485 93.998  1.00 26.54 ? 112  ASN A OD1 1 
ATOM   749   N  ND2 . ASN A 1 94  ? 45.111  77.204 96.212  1.00 26.44 ? 112  ASN A ND2 1 
ATOM   750   N  N   . LEU A 1 95  ? 40.139  76.094 94.522  1.00 18.15 ? 113  LEU A N   1 
ATOM   751   C  CA  . LEU A 1 95  ? 38.702  76.166 94.782  1.00 17.43 ? 113  LEU A CA  1 
ATOM   752   C  C   . LEU A 1 95  ? 38.230  75.041 95.709  1.00 16.99 ? 113  LEU A C   1 
ATOM   753   O  O   . LEU A 1 95  ? 37.346  75.252 96.538  1.00 16.56 ? 113  LEU A O   1 
ATOM   754   C  CB  . LEU A 1 95  ? 37.903  76.161 93.473  1.00 17.59 ? 113  LEU A CB  1 
ATOM   755   C  CG  . LEU A 1 95  ? 38.005  77.371 92.534  1.00 17.81 ? 113  LEU A CG  1 
ATOM   756   C  CD1 . LEU A 1 95  ? 36.928  77.282 91.473  1.00 17.88 ? 113  LEU A CD1 1 
ATOM   757   C  CD2 . LEU A 1 95  ? 37.893  78.697 93.281  1.00 18.57 ? 113  LEU A CD2 1 
ATOM   758   N  N   . ASN A 1 96  ? 38.823  73.854 95.562  1.00 16.49 ? 114  ASN A N   1 
ATOM   759   C  CA  . ASN A 1 96  ? 38.546  72.722 96.456  1.00 16.43 ? 114  ASN A CA  1 
ATOM   760   C  C   . ASN A 1 96  ? 39.096  72.947 97.864  1.00 16.45 ? 114  ASN A C   1 
ATOM   761   O  O   . ASN A 1 96  ? 38.485  72.539 98.845  1.00 16.60 ? 114  ASN A O   1 
ATOM   762   C  CB  . ASN A 1 96  ? 39.114  71.421 95.886  1.00 15.97 ? 114  ASN A CB  1 
ATOM   763   C  CG  . ASN A 1 96  ? 38.467  71.023 94.579  1.00 15.79 ? 114  ASN A CG  1 
ATOM   764   O  OD1 . ASN A 1 96  ? 37.432  70.342 94.562  1.00 14.57 ? 114  ASN A OD1 1 
ATOM   765   N  ND2 . ASN A 1 96  ? 39.079  71.435 93.467  1.00 14.09 ? 114  ASN A ND2 1 
ATOM   766   N  N   . MET A 1 97  ? 40.261  73.583 97.957  1.00 16.91 ? 115  MET A N   1 
ATOM   767   C  CA  . MET A 1 97  ? 40.838  73.942 99.252  1.00 16.98 ? 115  MET A CA  1 
ATOM   768   C  C   . MET A 1 97  ? 39.971  74.979 99.957  1.00 16.95 ? 115  MET A C   1 
ATOM   769   O  O   . MET A 1 97  ? 39.734  74.865 101.161 1.00 16.59 ? 115  MET A O   1 
ATOM   770   C  CB  . MET A 1 97  ? 42.276  74.453 99.105  1.00 17.09 ? 115  MET A CB  1 
ATOM   771   C  CG  . MET A 1 97  ? 43.254  73.466 98.498  1.00 17.26 ? 115  MET A CG  1 
ATOM   772   S  SD  . MET A 1 97  ? 43.481  71.937 99.429  1.00 20.39 ? 115  MET A SD  1 
ATOM   773   C  CE  . MET A 1 97  ? 42.373  70.807 98.579  1.00 20.08 ? 115  MET A CE  1 
ATOM   774   N  N   . ASP A 1 98  ? 39.497  75.973 99.197  1.00 16.89 ? 116  ASP A N   1 
ATOM   775   C  CA  . ASP A 1 98  ? 38.568  76.993 99.697  1.00 17.47 ? 116  ASP A CA  1 
ATOM   776   C  C   . ASP A 1 98  ? 37.311  76.354 100.275 1.00 17.13 ? 116  ASP A C   1 
ATOM   777   O  O   . ASP A 1 98  ? 36.880  76.697 101.374 1.00 16.89 ? 116  ASP A O   1 
ATOM   778   C  CB  . ASP A 1 98  ? 38.148  77.963 98.579  1.00 17.87 ? 116  ASP A CB  1 
ATOM   779   C  CG  . ASP A 1 98  ? 39.278  78.889 98.121  1.00 20.17 ? 116  ASP A CG  1 
ATOM   780   O  OD1 . ASP A 1 98  ? 40.425  78.765 98.613  1.00 22.75 ? 116  ASP A OD1 1 
ATOM   781   O  OD2 . ASP A 1 98  ? 39.006  79.754 97.252  1.00 22.80 ? 116  ASP A OD2 1 
ATOM   782   N  N   . ARG A 1 99  ? 36.728  75.431 99.511  1.00 16.82 ? 117  ARG A N   1 
ATOM   783   C  CA  . ARG A 1 99  ? 35.488  74.765 99.883  1.00 16.53 ? 117  ARG A CA  1 
ATOM   784   C  C   . ARG A 1 99  ? 35.672  73.850 101.102 1.00 16.26 ? 117  ARG A C   1 
ATOM   785   O  O   . ARG A 1 99  ? 34.818  73.815 101.988 1.00 16.30 ? 117  ARG A O   1 
ATOM   786   C  CB  . ARG A 1 99  ? 34.930  73.994 98.685  1.00 16.21 ? 117  ARG A CB  1 
ATOM   787   C  CG  . ARG A 1 99  ? 33.481  73.565 98.822  1.00 16.46 ? 117  ARG A CG  1 
ATOM   788   C  CD  . ARG A 1 99  ? 32.913  73.077 97.480  1.00 16.27 ? 117  ARG A CD  1 
ATOM   789   N  NE  . ARG A 1 99  ? 33.569  71.861 97.003  1.00 15.14 ? 117  ARG A NE  1 
ATOM   790   C  CZ  . ARG A 1 99  ? 33.427  71.352 95.778  1.00 15.43 ? 117  ARG A CZ  1 
ATOM   791   N  NH1 . ARG A 1 99  ? 32.655  71.953 94.881  1.00 14.80 ? 117  ARG A NH1 1 
ATOM   792   N  NH2 . ARG A 1 99  ? 34.069  70.240 95.442  1.00 14.76 ? 117  ARG A NH2 1 
ATOM   793   N  N   . MET A 1 100 ? 36.789  73.132 101.147 1.00 15.99 ? 118  MET A N   1 
ATOM   794   C  CA  . MET A 1 100 ? 37.086  72.228 102.254 1.00 16.20 ? 118  MET A CA  1 
ATOM   795   C  C   . MET A 1 100 ? 37.286  72.963 103.587 1.00 16.58 ? 118  MET A C   1 
ATOM   796   O  O   . MET A 1 100 ? 36.798  72.518 104.635 1.00 16.07 ? 118  MET A O   1 
ATOM   797   C  CB  . MET A 1 100 ? 38.316  71.389 101.935 1.00 16.18 ? 118  MET A CB  1 
ATOM   798   C  CG  . MET A 1 100 ? 38.525  70.251 102.892 1.00 15.85 ? 118  MET A CG  1 
ATOM   799   S  SD  . MET A 1 100 ? 39.917  69.271 102.377 1.00 17.18 ? 118  MET A SD  1 
ATOM   800   C  CE  . MET A 1 100 ? 39.854  67.953 103.583 1.00 13.02 ? 118  MET A CE  1 
ATOM   801   N  N   . TYR A 1 101 ? 38.011  74.078 103.527 1.00 17.14 ? 119  TYR A N   1 
ATOM   802   C  CA  . TYR A 1 101 ? 38.205  74.977 104.663 1.00 17.77 ? 119  TYR A CA  1 
ATOM   803   C  C   . TYR A 1 101 ? 36.854  75.472 105.194 1.00 18.22 ? 119  TYR A C   1 
ATOM   804   O  O   . TYR A 1 101 ? 36.603  75.424 106.400 1.00 18.53 ? 119  TYR A O   1 
ATOM   805   C  CB  . TYR A 1 101 ? 39.076  76.162 104.235 1.00 17.83 ? 119  TYR A CB  1 
ATOM   806   C  CG  . TYR A 1 101 ? 39.498  77.074 105.360 1.00 18.31 ? 119  TYR A CG  1 
ATOM   807   C  CD1 . TYR A 1 101 ? 40.773  76.983 105.911 1.00 18.59 ? 119  TYR A CD1 1 
ATOM   808   C  CD2 . TYR A 1 101 ? 38.620  78.030 105.876 1.00 18.96 ? 119  TYR A CD2 1 
ATOM   809   C  CE1 . TYR A 1 101 ? 41.165  77.826 106.951 1.00 20.06 ? 119  TYR A CE1 1 
ATOM   810   C  CE2 . TYR A 1 101 ? 38.999  78.869 106.913 1.00 19.68 ? 119  TYR A CE2 1 
ATOM   811   C  CZ  . TYR A 1 101 ? 40.272  78.766 107.441 1.00 20.23 ? 119  TYR A CZ  1 
ATOM   812   O  OH  . TYR A 1 101 ? 40.649  79.604 108.466 1.00 21.43 ? 119  TYR A OH  1 
ATOM   813   N  N   . ARG A 1 102 ? 35.991  75.934 104.288 1.00 18.56 ? 120  ARG A N   1 
ATOM   814   C  CA  . ARG A 1 102 ? 34.648  76.418 104.647 1.00 19.10 ? 120  ARG A CA  1 
ATOM   815   C  C   . ARG A 1 102 ? 33.752  75.338 105.246 1.00 18.79 ? 120  ARG A C   1 
ATOM   816   O  O   . ARG A 1 102 ? 33.004  75.606 106.175 1.00 18.64 ? 120  ARG A O   1 
ATOM   817   C  CB  . ARG A 1 102 ? 33.948  77.031 103.438 1.00 19.31 ? 120  ARG A CB  1 
ATOM   818   C  CG  . ARG A 1 102 ? 34.434  78.397 103.075 1.00 21.60 ? 120  ARG A CG  1 
ATOM   819   C  CD  . ARG A 1 102 ? 33.820  78.833 101.762 1.00 26.79 ? 120  ARG A CD  1 
ATOM   820   N  NE  . ARG A 1 102 ? 34.589  79.918 101.150 1.00 31.40 ? 120  ARG A NE  1 
ATOM   821   C  CZ  . ARG A 1 102 ? 34.762  80.065 99.837  1.00 33.79 ? 120  ARG A CZ  1 
ATOM   822   N  NH1 . ARG A 1 102 ? 35.481  81.084 99.374  1.00 34.64 ? 120  ARG A NH1 1 
ATOM   823   N  NH2 . ARG A 1 102 ? 34.224  79.188 98.987  1.00 34.22 ? 120  ARG A NH2 1 
ATOM   824   N  N   . SER A 1 103 ? 33.825  74.128 104.694 1.00 18.82 ? 121  SER A N   1 
ATOM   825   C  CA  . SER A 1 103 ? 33.104  72.982 105.231 1.00 18.67 ? 121  SER A CA  1 
ATOM   826   C  C   . SER A 1 103 ? 33.618  72.610 106.619 1.00 18.18 ? 121  SER A C   1 
ATOM   827   O  O   . SER A 1 103 ? 32.844  72.176 107.468 1.00 17.82 ? 121  SER A O   1 
ATOM   828   C  CB  . SER A 1 103 ? 33.220  71.783 104.290 1.00 18.61 ? 121  SER A CB  1 
ATOM   829   O  OG  . SER A 1 103 ? 32.677  72.089 103.019 1.00 21.09 ? 121  SER A OG  1 
ATOM   830   N  N   . ALA A 1 104 ? 34.922  72.771 106.835 1.00 17.94 ? 122  ALA A N   1 
ATOM   831   C  CA  . ALA A 1 104 ? 35.539  72.475 108.135 1.00 17.78 ? 122  ALA A CA  1 
ATOM   832   C  C   . ALA A 1 104 ? 34.997  73.400 109.222 1.00 17.70 ? 122  ALA A C   1 
ATOM   833   O  O   . ALA A 1 104 ? 34.669  72.945 110.319 1.00 17.78 ? 122  ALA A O   1 
ATOM   834   C  CB  . ALA A 1 104 ? 37.047  72.576 108.053 1.00 17.72 ? 122  ALA A CB  1 
ATOM   835   N  N   . VAL A 1 105 ? 34.904  74.688 108.901 1.00 17.68 ? 123  VAL A N   1 
ATOM   836   C  CA  . VAL A 1 105 ? 34.345  75.704 109.795 1.00 17.82 ? 123  VAL A CA  1 
ATOM   837   C  C   . VAL A 1 105 ? 32.882  75.382 110.128 1.00 17.80 ? 123  VAL A C   1 
ATOM   838   O  O   . VAL A 1 105 ? 32.467  75.468 111.281 1.00 17.96 ? 123  VAL A O   1 
ATOM   839   C  CB  . VAL A 1 105 ? 34.481  77.137 109.185 1.00 17.95 ? 123  VAL A CB  1 
ATOM   840   C  CG1 . VAL A 1 105 ? 33.758  78.190 110.036 1.00 17.79 ? 123  VAL A CG1 1 
ATOM   841   C  CG2 . VAL A 1 105 ? 35.957  77.517 109.017 1.00 18.09 ? 123  VAL A CG2 1 
ATOM   842   N  N   . ARG A 1 106 ? 32.119  74.992 109.113 1.00 17.50 ? 124  ARG A N   1 
ATOM   843   C  CA  . ARG A 1 106 ? 30.723  74.629 109.297 1.00 17.74 ? 124  ARG A CA  1 
ATOM   844   C  C   . ARG A 1 106 ? 30.559  73.339 110.131 1.00 17.19 ? 124  ARG A C   1 
ATOM   845   O  O   . ARG A 1 106 ? 29.590  73.207 110.884 1.00 16.86 ? 124  ARG A O   1 
ATOM   846   C  CB  . ARG A 1 106 ? 30.038  74.511 107.933 1.00 18.26 ? 124  ARG A CB  1 
ATOM   847   C  CG  . ARG A 1 106 ? 28.525  74.481 107.976 1.00 20.76 ? 124  ARG A CG  1 
ATOM   848   C  CD  . ARG A 1 106 ? 27.904  75.854 107.874 1.00 24.88 ? 124  ARG A CD  1 
ATOM   849   N  NE  . ARG A 1 106 ? 26.617  75.774 107.185 1.00 29.56 ? 124  ARG A NE  1 
ATOM   850   C  CZ  . ARG A 1 106 ? 26.427  76.073 105.900 1.00 31.06 ? 124  ARG A CZ  1 
ATOM   851   N  NH1 . ARG A 1 106 ? 27.437  76.491 105.145 1.00 31.76 ? 124  ARG A NH1 1 
ATOM   852   N  NH2 . ARG A 1 106 ? 25.217  75.963 105.371 1.00 32.30 ? 124  ARG A NH2 1 
ATOM   853   N  N   . ALA A 1 107 ? 31.520  72.417 110.007 1.00 16.48 ? 125  ALA A N   1 
ATOM   854   C  CA  . ALA A 1 107 ? 31.531  71.150 110.755 1.00 16.19 ? 125  ALA A CA  1 
ATOM   855   C  C   . ALA A 1 107 ? 32.079  71.266 112.187 1.00 15.94 ? 125  ALA A C   1 
ATOM   856   O  O   . ALA A 1 107 ? 31.844  70.381 113.027 1.00 15.69 ? 125  ALA A O   1 
ATOM   857   C  CB  . ALA A 1 107 ? 32.326  70.080 109.975 1.00 15.92 ? 125  ALA A CB  1 
ATOM   858   N  N   . THR A 1 108 ? 32.802  72.360 112.440 1.00 15.76 ? 126  THR A N   1 
ATOM   859   C  CA  . THR A 1 108 ? 33.580  72.626 113.675 1.00 15.61 ? 126  THR A CA  1 
ATOM   860   C  C   . THR A 1 108 ? 34.846  71.785 113.778 1.00 15.33 ? 126  THR A C   1 
ATOM   861   O  O   . THR A 1 108 ? 35.407  71.609 114.866 1.00 15.22 ? 126  THR A O   1 
ATOM   862   C  CB  . THR A 1 108 ? 32.758  72.570 115.006 1.00 15.43 ? 126  THR A CB  1 
ATOM   863   O  OG1 . THR A 1 108 ? 32.533  71.204 115.392 1.00 16.21 ? 126  THR A OG1 1 
ATOM   864   C  CG2 . THR A 1 108 ? 31.438  73.321 114.869 1.00 15.29 ? 126  THR A CG2 1 
ATOM   865   N  N   . LEU A 1 109 ? 35.292  71.270 112.634 1.00 15.33 ? 127  LEU A N   1 
ATOM   866   C  CA  . LEU A 1 109 ? 36.581  70.592 112.537 1.00 15.04 ? 127  LEU A CA  1 
ATOM   867   C  C   . LEU A 1 109 ? 37.687  71.643 112.471 1.00 15.46 ? 127  LEU A C   1 
ATOM   868   O  O   . LEU A 1 109 ? 37.423  72.779 112.054 1.00 15.48 ? 127  LEU A O   1 
ATOM   869   C  CB  . LEU A 1 109 ? 36.621  69.662 111.318 1.00 14.54 ? 127  LEU A CB  1 
ATOM   870   C  CG  . LEU A 1 109 ? 35.947  68.305 111.535 1.00 14.04 ? 127  LEU A CG  1 
ATOM   871   C  CD1 . LEU A 1 109 ? 35.526  67.669 110.220 1.00 11.87 ? 127  LEU A CD1 1 
ATOM   872   C  CD2 . LEU A 1 109 ? 36.847  67.356 112.332 1.00 14.18 ? 127  LEU A CD2 1 
ATOM   873   N  N   . PRO A 1 110 ? 38.919  71.284 112.903 1.00 15.87 ? 128  PRO A N   1 
ATOM   874   C  CA  . PRO A 1 110 ? 39.998  72.278 112.985 1.00 16.64 ? 128  PRO A CA  1 
ATOM   875   C  C   . PRO A 1 110 ? 40.386  72.913 111.654 1.00 17.35 ? 128  PRO A C   1 
ATOM   876   O  O   . PRO A 1 110 ? 40.446  72.249 110.617 1.00 17.66 ? 128  PRO A O   1 
ATOM   877   C  CB  . PRO A 1 110 ? 41.185  71.483 113.547 1.00 16.69 ? 128  PRO A CB  1 
ATOM   878   C  CG  . PRO A 1 110 ? 40.868  70.062 113.284 1.00 16.10 ? 128  PRO A CG  1 
ATOM   879   C  CD  . PRO A 1 110 ? 39.370  69.959 113.361 1.00 15.71 ? 128  PRO A CD  1 
ATOM   880   N  N   . VAL A 1 111 ? 40.650  74.206 111.715 1.00 17.99 ? 129  VAL A N   1 
ATOM   881   C  CA  . VAL A 1 111 ? 41.105  74.981 110.581 1.00 18.76 ? 129  VAL A CA  1 
ATOM   882   C  C   . VAL A 1 111 ? 42.563  74.630 110.209 1.00 18.87 ? 129  VAL A C   1 
ATOM   883   O  O   . VAL A 1 111 ? 43.338  74.171 111.055 1.00 18.47 ? 129  VAL A O   1 
ATOM   884   C  CB  . VAL A 1 111 ? 40.871  76.476 110.893 1.00 19.02 ? 129  VAL A CB  1 
ATOM   885   C  CG1 . VAL A 1 111 ? 42.078  77.320 110.605 1.00 20.62 ? 129  VAL A CG1 1 
ATOM   886   C  CG2 . VAL A 1 111 ? 39.619  76.972 110.179 1.00 19.33 ? 129  VAL A CG2 1 
ATOM   887   N  N   . PHE A 1 112 ? 42.914  74.814 108.937 1.00 19.17 ? 130  PHE A N   1 
ATOM   888   C  CA  . PHE A 1 112 ? 44.256  74.489 108.433 1.00 19.57 ? 130  PHE A CA  1 
ATOM   889   C  C   . PHE A 1 112 ? 44.678  75.499 107.359 1.00 19.93 ? 130  PHE A C   1 
ATOM   890   O  O   . PHE A 1 112 ? 43.848  76.263 106.872 1.00 19.93 ? 130  PHE A O   1 
ATOM   891   C  CB  . PHE A 1 112 ? 44.276  73.062 107.863 1.00 19.45 ? 130  PHE A CB  1 
ATOM   892   C  CG  . PHE A 1 112 ? 43.305  72.848 106.722 1.00 19.93 ? 130  PHE A CG  1 
ATOM   893   C  CD1 . PHE A 1 112 ? 43.684  73.107 105.403 1.00 19.03 ? 130  PHE A CD1 1 
ATOM   894   C  CD2 . PHE A 1 112 ? 42.010  72.400 106.966 1.00 20.40 ? 130  PHE A CD2 1 
ATOM   895   C  CE1 . PHE A 1 112 ? 42.795  72.921 104.353 1.00 19.02 ? 130  PHE A CE1 1 
ATOM   896   C  CE2 . PHE A 1 112 ? 41.106  72.208 105.911 1.00 20.96 ? 130  PHE A CE2 1 
ATOM   897   C  CZ  . PHE A 1 112 ? 41.504  72.471 104.604 1.00 20.30 ? 130  PHE A CZ  1 
ATOM   898   N  N   . ASP A 1 113 ? 45.961  75.504 106.996 1.00 20.52 ? 131  ASP A N   1 
ATOM   899   C  CA  . ASP A 1 113 ? 46.452  76.338 105.893 1.00 21.07 ? 131  ASP A CA  1 
ATOM   900   C  C   . ASP A 1 113 ? 46.200  75.626 104.564 1.00 20.95 ? 131  ASP A C   1 
ATOM   901   O  O   . ASP A 1 113 ? 46.689  74.512 104.336 1.00 20.51 ? 131  ASP A O   1 
ATOM   902   C  CB  . ASP A 1 113 ? 47.943  76.656 106.067 1.00 21.53 ? 131  ASP A CB  1 
ATOM   903   C  CG  . ASP A 1 113 ? 48.431  77.761 105.132 1.00 23.42 ? 131  ASP A CG  1 
ATOM   904   O  OD1 . ASP A 1 113 ? 48.344  77.606 103.895 1.00 24.61 ? 131  ASP A OD1 1 
ATOM   905   O  OD2 . ASP A 1 113 ? 48.936  78.784 105.641 1.00 26.45 ? 131  ASP A OD2 1 
ATOM   906   N  N   . LYS A 1 114 ? 45.436  76.289 103.699 1.00 21.19 ? 132  LYS A N   1 
ATOM   907   C  CA  . LYS A 1 114 ? 44.975  75.724 102.424 1.00 21.51 ? 132  LYS A CA  1 
ATOM   908   C  C   . LYS A 1 114 ? 46.100  75.422 101.435 1.00 21.67 ? 132  LYS A C   1 
ATOM   909   O  O   . LYS A 1 114 ? 46.026  74.451 100.689 1.00 21.41 ? 132  LYS A O   1 
ATOM   910   C  CB  . LYS A 1 114 ? 43.932  76.644 101.779 1.00 21.51 ? 132  LYS A CB  1 
ATOM   911   C  CG  . LYS A 1 114 ? 42.624  76.728 102.557 1.00 21.51 ? 132  LYS A CG  1 
ATOM   912   C  CD  . LYS A 1 114 ? 41.582  77.564 101.840 1.00 21.86 ? 132  LYS A CD  1 
ATOM   913   C  CE  . LYS A 1 114 ? 41.815  79.052 102.020 1.00 23.56 ? 132  LYS A CE  1 
ATOM   914   N  NZ  . LYS A 1 114 ? 40.822  79.860 101.253 1.00 24.39 ? 132  LYS A NZ  1 
ATOM   915   N  N   . GLU A 1 115 ? 47.144  76.248 101.450 1.00 22.24 ? 133  GLU A N   1 
ATOM   916   C  CA  . GLU A 1 115 ? 48.296  76.060 100.563 1.00 22.63 ? 133  GLU A CA  1 
ATOM   917   C  C   . GLU A 1 115 ? 49.201  74.925 101.032 1.00 22.24 ? 133  GLU A C   1 
ATOM   918   O  O   . GLU A 1 115 ? 49.806  74.225 100.209 1.00 22.41 ? 133  GLU A O   1 
ATOM   919   C  CB  . GLU A 1 115 ? 49.096  77.362 100.423 1.00 23.17 ? 133  GLU A CB  1 
ATOM   920   C  CG  . GLU A 1 115 ? 48.325  78.507 99.759  1.00 25.69 ? 133  GLU A CG  1 
ATOM   921   C  CD  . GLU A 1 115 ? 47.953  78.234 98.302  1.00 29.87 ? 133  GLU A CD  1 
ATOM   922   O  OE1 . GLU A 1 115 ? 48.780  77.661 97.548  1.00 31.16 ? 133  GLU A OE1 1 
ATOM   923   O  OE2 . GLU A 1 115 ? 46.826  78.616 97.905  1.00 32.57 ? 133  GLU A OE2 1 
ATOM   924   N  N   . GLU A 1 116 ? 49.290  74.744 102.350 1.00 21.59 ? 134  GLU A N   1 
ATOM   925   C  CA  . GLU A 1 116 ? 50.021  73.615 102.927 1.00 21.10 ? 134  GLU A CA  1 
ATOM   926   C  C   . GLU A 1 116 ? 49.357  72.284 102.588 1.00 20.30 ? 134  GLU A C   1 
ATOM   927   O  O   . GLU A 1 116 ? 50.041  71.332 102.226 1.00 20.21 ? 134  GLU A O   1 
ATOM   928   C  CB  . GLU A 1 116 ? 50.172  73.756 104.445 1.00 21.24 ? 134  GLU A CB  1 
ATOM   929   C  CG  . GLU A 1 116 ? 51.009  74.956 104.894 1.00 22.78 ? 134  GLU A CG  1 
ATOM   930   C  CD  . GLU A 1 116 ? 52.478  74.869 104.484 1.00 24.16 ? 134  GLU A CD  1 
ATOM   931   O  OE1 . GLU A 1 116 ? 52.983  73.756 104.220 1.00 24.09 ? 134  GLU A OE1 1 
ATOM   932   O  OE2 . GLU A 1 116 ? 53.132  75.929 104.442 1.00 25.83 ? 134  GLU A OE2 1 
ATOM   933   N  N   . LEU A 1 117 ? 48.030  72.218 102.710 1.00 19.46 ? 135  LEU A N   1 
ATOM   934   C  CA  . LEU A 1 117 ? 47.304  71.013 102.309 1.00 18.72 ? 135  LEU A CA  1 
ATOM   935   C  C   . LEU A 1 117 ? 47.489  70.739 100.816 1.00 18.27 ? 135  LEU A C   1 
ATOM   936   O  O   . LEU A 1 117 ? 47.780  69.609 100.424 1.00 17.81 ? 135  LEU A O   1 
ATOM   937   C  CB  . LEU A 1 117 ? 45.812  71.081 102.676 1.00 18.61 ? 135  LEU A CB  1 
ATOM   938   C  CG  . LEU A 1 117 ? 44.950  69.878 102.236 1.00 18.22 ? 135  LEU A CG  1 
ATOM   939   C  CD1 . LEU A 1 117 ? 45.500  68.542 102.728 1.00 17.53 ? 135  LEU A CD1 1 
ATOM   940   C  CD2 . LEU A 1 117 ? 43.505  70.040 102.668 1.00 17.61 ? 135  LEU A CD2 1 
ATOM   941   N  N   . LEU A 1 118 ? 47.331  71.780 99.997  1.00 18.01 ? 136  LEU A N   1 
ATOM   942   C  CA  . LEU A 1 118 ? 47.547  71.655 98.561  1.00 18.05 ? 136  LEU A CA  1 
ATOM   943   C  C   . LEU A 1 118 ? 48.925  71.061 98.240  1.00 18.11 ? 136  LEU A C   1 
ATOM   944   O  O   . LEU A 1 118 ? 49.026  70.149 97.419  1.00 17.88 ? 136  LEU A O   1 
ATOM   945   C  CB  . LEU A 1 118 ? 47.337  72.994 97.843  1.00 17.92 ? 136  LEU A CB  1 
ATOM   946   C  CG  . LEU A 1 118 ? 47.483  72.993 96.315  1.00 18.21 ? 136  LEU A CG  1 
ATOM   947   C  CD1 . LEU A 1 118 ? 46.656  71.882 95.647  1.00 17.90 ? 136  LEU A CD1 1 
ATOM   948   C  CD2 . LEU A 1 118 ? 47.111  74.350 95.752  1.00 18.94 ? 136  LEU A CD2 1 
ATOM   949   N  N   . GLU A 1 119 ? 49.968  71.553 98.911  1.00 18.19 ? 137  GLU A N   1 
ATOM   950   C  CA  . GLU A 1 119 ? 51.322  71.035 98.697  1.00 18.55 ? 137  GLU A CA  1 
ATOM   951   C  C   . GLU A 1 119 ? 51.501  69.588 99.162  1.00 18.37 ? 137  GLU A C   1 
ATOM   952   O  O   . GLU A 1 119 ? 52.217  68.827 98.518  1.00 18.69 ? 137  GLU A O   1 
ATOM   953   C  CB  . GLU A 1 119 ? 52.388  71.967 99.299  1.00 18.65 ? 137  GLU A CB  1 
ATOM   954   C  CG  . GLU A 1 119 ? 53.858  71.555 99.021  1.00 20.35 ? 137  GLU A CG  1 
ATOM   955   C  CD  . GLU A 1 119 ? 54.230  71.445 97.535  1.00 21.61 ? 137  GLU A CD  1 
ATOM   956   O  OE1 . GLU A 1 119 ? 55.171  70.686 97.225  1.00 23.69 ? 137  GLU A OE1 1 
ATOM   957   O  OE2 . GLU A 1 119 ? 53.605  72.103 96.677  1.00 22.32 ? 137  GLU A OE2 1 
ATOM   958   N  N   . CYS A 1 120 ? 50.845  69.207 100.257 1.00 18.08 ? 138  CYS A N   1 
ATOM   959   C  CA  . CYS A 1 120 ? 50.862  67.811 100.715 1.00 18.24 ? 138  CYS A CA  1 
ATOM   960   C  C   . CYS A 1 120 ? 50.185  66.864 99.715  1.00 17.64 ? 138  CYS A C   1 
ATOM   961   O  O   . CYS A 1 120 ? 50.661  65.752 99.492  1.00 17.52 ? 138  CYS A O   1 
ATOM   962   C  CB  . CYS A 1 120 ? 50.200  67.669 102.093 1.00 18.43 ? 138  CYS A CB  1 
ATOM   963   S  SG  . CYS A 1 120 ? 51.114  68.408 103.472 1.00 20.23 ? 138  CYS A SG  1 
ATOM   964   N  N   . ILE A 1 121 ? 49.069  67.307 99.133  1.00 17.24 ? 139  ILE A N   1 
ATOM   965   C  CA  . ILE A 1 121 ? 48.376  66.551 98.084  1.00 16.90 ? 139  ILE A CA  1 
ATOM   966   C  C   . ILE A 1 121 ? 49.275  66.424 96.841  1.00 16.97 ? 139  ILE A C   1 
ATOM   967   O  O   . ILE A 1 121 ? 49.418  65.338 96.286  1.00 17.20 ? 139  ILE A O   1 
ATOM   968   C  CB  . ILE A 1 121 ? 46.994  67.196 97.729  1.00 16.70 ? 139  ILE A CB  1 
ATOM   969   C  CG1 . ILE A 1 121 ? 46.025  67.080 98.919  1.00 16.29 ? 139  ILE A CG1 1 
ATOM   970   C  CG2 . ILE A 1 121 ? 46.403  66.581 96.454  1.00 16.16 ? 139  ILE A CG2 1 
ATOM   971   C  CD1 . ILE A 1 121 ? 44.708  67.859 98.757  1.00 15.59 ? 139  ILE A CD1 1 
ATOM   972   N  N   . GLN A 1 122 ? 49.886  67.533 96.429  1.00 17.35 ? 140  GLN A N   1 
ATOM   973   C  CA  . GLN A 1 122 ? 50.852  67.554 95.315  1.00 17.57 ? 140  GLN A CA  1 
ATOM   974   C  C   . GLN A 1 122 ? 51.925  66.494 95.515  1.00 17.22 ? 140  GLN A C   1 
ATOM   975   O  O   . GLN A 1 122 ? 52.201  65.704 94.612  1.00 17.30 ? 140  GLN A O   1 
ATOM   976   C  CB  . GLN A 1 122 ? 51.518  68.928 95.200  1.00 17.79 ? 140  GLN A CB  1 
ATOM   977   C  CG  . GLN A 1 122 ? 50.575  70.085 94.896  1.00 19.23 ? 140  GLN A CG  1 
ATOM   978   C  CD  . GLN A 1 122 ? 50.685  70.610 93.476  1.00 21.88 ? 140  GLN A CD  1 
ATOM   979   O  OE1 . GLN A 1 122 ? 50.449  71.795 93.232  1.00 23.80 ? 140  GLN A OE1 1 
ATOM   980   N  NE2 . GLN A 1 122 ? 51.039  69.740 92.534  1.00 21.63 ? 140  GLN A NE2 1 
ATOM   981   N  N   . GLN A 1 123 ? 52.506  66.466 96.715  1.00 17.07 ? 141  GLN A N   1 
ATOM   982   C  CA  . GLN A 1 123 ? 53.548  65.491 97.066  1.00 16.82 ? 141  GLN A CA  1 
ATOM   983   C  C   . GLN A 1 123 ? 53.072  64.047 97.066  1.00 16.44 ? 141  GLN A C   1 
ATOM   984   O  O   . GLN A 1 123 ? 53.818  63.146 96.681  1.00 16.58 ? 141  GLN A O   1 
ATOM   985   C  CB  . GLN A 1 123 ? 54.186  65.835 98.416  1.00 16.93 ? 141  GLN A CB  1 
ATOM   986   C  CG  . GLN A 1 123 ? 55.054  67.094 98.385  1.00 18.51 ? 141  GLN A CG  1 
ATOM   987   C  CD  . GLN A 1 123 ? 56.119  67.060 97.290  1.00 19.40 ? 141  GLN A CD  1 
ATOM   988   O  OE1 . GLN A 1 123 ? 56.777  66.042 97.075  1.00 19.97 ? 141  GLN A OE1 1 
ATOM   989   N  NE2 . GLN A 1 123 ? 56.292  68.184 96.598  1.00 20.45 ? 141  GLN A NE2 1 
ATOM   990   N  N   . LEU A 1 124 ? 51.832  63.828 97.500  1.00 16.13 ? 142  LEU A N   1 
ATOM   991   C  CA  . LEU A 1 124 ? 51.227  62.496 97.468  1.00 15.34 ? 142  LEU A CA  1 
ATOM   992   C  C   . LEU A 1 124 ? 50.976  62.014 96.031  1.00 15.20 ? 142  LEU A C   1 
ATOM   993   O  O   . LEU A 1 124 ? 51.272  60.867 95.694  1.00 15.27 ? 142  LEU A O   1 
ATOM   994   C  CB  . LEU A 1 124 ? 49.923  62.485 98.284  1.00 15.20 ? 142  LEU A CB  1 
ATOM   995   C  CG  . LEU A 1 124 ? 48.982  61.282 98.126  1.00 14.87 ? 142  LEU A CG  1 
ATOM   996   C  CD1 . LEU A 1 124 ? 49.579  59.993 98.698  1.00 13.69 ? 142  LEU A CD1 1 
ATOM   997   C  CD2 . LEU A 1 124 ? 47.625  61.583 98.750  1.00 13.61 ? 142  LEU A CD2 1 
ATOM   998   N  N   . VAL A 1 125 ? 50.405  62.888 95.205  1.00 15.19 ? 143  VAL A N   1 
ATOM   999   C  CA  . VAL A 1 125 ? 50.166  62.598 93.789  1.00 15.03 ? 143  VAL A CA  1 
ATOM   1000  C  C   . VAL A 1 125 ? 51.502  62.385 93.065  1.00 15.62 ? 143  VAL A C   1 
ATOM   1001  O  O   . VAL A 1 125 ? 51.624  61.473 92.254  1.00 15.58 ? 143  VAL A O   1 
ATOM   1002  C  CB  . VAL A 1 125 ? 49.327  63.722 93.102  1.00 14.97 ? 143  VAL A CB  1 
ATOM   1003  C  CG1 . VAL A 1 125 ? 49.240  63.511 91.577  1.00 15.32 ? 143  VAL A CG1 1 
ATOM   1004  C  CG2 . VAL A 1 125 ? 47.928  63.791 93.694  1.00 13.46 ? 143  VAL A CG2 1 
ATOM   1005  N  N   . LYS A 1 126 ? 52.506  63.209 93.380  1.00 15.93 ? 144  LYS A N   1 
ATOM   1006  C  CA  . LYS A 1 126 ? 53.842  63.047 92.799  1.00 16.50 ? 144  LYS A CA  1 
ATOM   1007  C  C   . LYS A 1 126 ? 54.426  61.676 93.118  1.00 16.30 ? 144  LYS A C   1 
ATOM   1008  O  O   . LYS A 1 126 ? 55.032  61.045 92.255  1.00 16.37 ? 144  LYS A O   1 
ATOM   1009  C  CB  . LYS A 1 126 ? 54.792  64.154 93.267  1.00 16.93 ? 144  LYS A CB  1 
ATOM   1010  C  CG  . LYS A 1 126 ? 56.187  64.104 92.648  1.00 18.58 ? 144  LYS A CG  1 
ATOM   1011  C  CD  . LYS A 1 126 ? 57.110  65.164 93.275  1.00 21.80 ? 144  LYS A CD  1 
ATOM   1012  C  CE  . LYS A 1 126 ? 58.547  65.060 92.751  1.00 23.33 ? 144  LYS A CE  1 
ATOM   1013  N  NZ  . LYS A 1 126 ? 59.498  65.847 93.616  1.00 25.17 ? 144  LYS A NZ  1 
ATOM   1014  N  N   . LEU A 1 127 ? 54.234  61.211 94.350  1.00 16.31 ? 145  LEU A N   1 
ATOM   1015  C  CA  . LEU A 1 127 ? 54.771  59.918 94.753  1.00 16.10 ? 145  LEU A CA  1 
ATOM   1016  C  C   . LEU A 1 127 ? 54.058  58.769 94.044  1.00 15.87 ? 145  LEU A C   1 
ATOM   1017  O  O   . LEU A 1 127 ? 54.682  57.782 93.668  1.00 15.70 ? 145  LEU A O   1 
ATOM   1018  C  CB  . LEU A 1 127 ? 54.715  59.744 96.277  1.00 16.31 ? 145  LEU A CB  1 
ATOM   1019  C  CG  . LEU A 1 127 ? 55.349  58.464 96.843  1.00 16.68 ? 145  LEU A CG  1 
ATOM   1020  C  CD1 . LEU A 1 127 ? 56.827  58.390 96.492  1.00 16.89 ? 145  LEU A CD1 1 
ATOM   1021  C  CD2 . LEU A 1 127 ? 55.159  58.363 98.365  1.00 17.49 ? 145  LEU A CD2 1 
ATOM   1022  N  N   . ASP A 1 128 ? 52.749  58.908 93.868  1.00 15.85 ? 146  ASP A N   1 
ATOM   1023  C  CA  . ASP A 1 128 ? 51.948  57.891 93.193  1.00 15.66 ? 146  ASP A CA  1 
ATOM   1024  C  C   . ASP A 1 128 ? 51.604  58.266 91.750  1.00 15.55 ? 146  ASP A C   1 
ATOM   1025  O  O   . ASP A 1 128 ? 50.655  57.734 91.184  1.00 15.58 ? 146  ASP A O   1 
ATOM   1026  C  CB  . ASP A 1 128 ? 50.675  57.603 94.000  1.00 15.60 ? 146  ASP A CB  1 
ATOM   1027  C  CG  . ASP A 1 128 ? 50.911  56.618 95.133  1.00 15.66 ? 146  ASP A CG  1 
ATOM   1028  O  OD1 . ASP A 1 128 ? 52.060  56.137 95.276  1.00 15.83 ? 146  ASP A OD1 1 
ATOM   1029  O  OD2 . ASP A 1 128 ? 49.950  56.321 95.875  1.00 14.37 ? 146  ASP A OD2 1 
ATOM   1030  N  N   . GLN A 1 129 ? 52.400  59.155 91.154  1.00 15.30 ? 147  GLN A N   1 
ATOM   1031  C  CA  . GLN A 1 129 ? 52.096  59.734 89.837  1.00 15.19 ? 147  GLN A CA  1 
ATOM   1032  C  C   . GLN A 1 129 ? 51.911  58.720 88.701  1.00 14.87 ? 147  GLN A C   1 
ATOM   1033  O  O   . GLN A 1 129 ? 51.166  58.978 87.761  1.00 15.34 ? 147  GLN A O   1 
ATOM   1034  C  CB  . GLN A 1 129 ? 53.115  60.818 89.460  1.00 15.05 ? 147  GLN A CB  1 
ATOM   1035  C  CG  . GLN A 1 129 ? 54.511  60.319 89.067  1.00 15.58 ? 147  GLN A CG  1 
ATOM   1036  C  CD  . GLN A 1 129 ? 55.428  61.470 88.707  1.00 16.97 ? 147  GLN A CD  1 
ATOM   1037  O  OE1 . GLN A 1 129 ? 56.047  62.083 89.586  1.00 18.56 ? 147  GLN A OE1 1 
ATOM   1038  N  NE2 . GLN A 1 129 ? 55.503  61.791 87.413  1.00 13.89 ? 147  GLN A NE2 1 
ATOM   1039  N  N   . GLU A 1 130 ? 52.572  57.572 88.790  1.00 14.66 ? 148  GLU A N   1 
ATOM   1040  C  CA  . GLU A 1 130 ? 52.372  56.504 87.806  1.00 14.34 ? 148  GLU A CA  1 
ATOM   1041  C  C   . GLU A 1 130 ? 50.944  55.925 87.834  1.00 14.11 ? 148  GLU A C   1 
ATOM   1042  O  O   . GLU A 1 130 ? 50.546  55.202 86.922  1.00 14.21 ? 148  GLU A O   1 
ATOM   1043  C  CB  . GLU A 1 130 ? 53.412  55.397 87.985  1.00 14.41 ? 148  GLU A CB  1 
ATOM   1044  C  CG  . GLU A 1 130 ? 54.842  55.799 87.635  1.00 15.21 ? 148  GLU A CG  1 
ATOM   1045  C  CD  . GLU A 1 130 ? 54.944  56.547 86.315  1.00 16.43 ? 148  GLU A CD  1 
ATOM   1046  O  OE1 . GLU A 1 130 ? 54.376  56.083 85.293  1.00 16.65 ? 148  GLU A OE1 1 
ATOM   1047  O  OE2 . GLU A 1 130 ? 55.597  57.608 86.306  1.00 17.27 ? 148  GLU A OE2 1 
ATOM   1048  N  N   . TRP A 1 131 ? 50.190  56.244 88.885  1.00 13.76 ? 149  TRP A N   1 
ATOM   1049  C  CA  . TRP A 1 131 ? 48.789  55.841 89.001  1.00 13.72 ? 149  TRP A CA  1 
ATOM   1050  C  C   . TRP A 1 131 ? 47.850  56.761 88.223  1.00 13.65 ? 149  TRP A C   1 
ATOM   1051  O  O   . TRP A 1 131 ? 46.705  56.395 87.974  1.00 13.79 ? 149  TRP A O   1 
ATOM   1052  C  CB  . TRP A 1 131 ? 48.346  55.787 90.465  1.00 13.20 ? 149  TRP A CB  1 
ATOM   1053  C  CG  . TRP A 1 131 ? 48.861  54.616 91.248  1.00 13.12 ? 149  TRP A CG  1 
ATOM   1054  C  CD1 . TRP A 1 131 ? 50.024  54.557 91.958  1.00 12.50 ? 149  TRP A CD1 1 
ATOM   1055  C  CD2 . TRP A 1 131 ? 48.210  53.344 91.436  1.00 13.33 ? 149  TRP A CD2 1 
ATOM   1056  N  NE1 . TRP A 1 131 ? 50.147  53.326 92.566  1.00 13.02 ? 149  TRP A NE1 1 
ATOM   1057  C  CE2 . TRP A 1 131 ? 49.049  52.564 92.264  1.00 13.19 ? 149  TRP A CE2 1 
ATOM   1058  C  CE3 . TRP A 1 131 ? 46.997  52.792 90.987  1.00 13.27 ? 149  TRP A CE3 1 
ATOM   1059  C  CZ2 . TRP A 1 131 ? 48.720  51.252 92.650  1.00 13.47 ? 149  TRP A CZ2 1 
ATOM   1060  C  CZ3 . TRP A 1 131 ? 46.669  51.486 91.370  1.00 12.08 ? 149  TRP A CZ3 1 
ATOM   1061  C  CH2 . TRP A 1 131 ? 47.531  50.733 92.193  1.00 12.95 ? 149  TRP A CH2 1 
ATOM   1062  N  N   . VAL A 1 132 ? 48.320  57.956 87.868  1.00 13.97 ? 150  VAL A N   1 
ATOM   1063  C  CA  . VAL A 1 132 ? 47.568  58.847 86.982  1.00 13.82 ? 150  VAL A CA  1 
ATOM   1064  C  C   . VAL A 1 132 ? 47.540  58.145 85.626  1.00 14.28 ? 150  VAL A C   1 
ATOM   1065  O  O   . VAL A 1 132 ? 48.594  57.956 85.020  1.00 13.87 ? 150  VAL A O   1 
ATOM   1066  C  CB  . VAL A 1 132 ? 48.219  60.267 86.870  1.00 13.96 ? 150  VAL A CB  1 
ATOM   1067  C  CG1 . VAL A 1 132 ? 47.311  61.240 86.107  1.00 12.87 ? 150  VAL A CG1 1 
ATOM   1068  C  CG2 . VAL A 1 132 ? 48.544  60.844 88.255  1.00 13.36 ? 150  VAL A CG2 1 
ATOM   1069  N  N   . PRO A 1 133 ? 46.349  57.693 85.171  1.00 14.39 ? 151  PRO A N   1 
ATOM   1070  C  CA  . PRO A 1 133 ? 46.275  56.843 83.970  1.00 14.73 ? 151  PRO A CA  1 
ATOM   1071  C  C   . PRO A 1 133 ? 46.918  57.392 82.679  1.00 15.30 ? 151  PRO A C   1 
ATOM   1072  O  O   . PRO A 1 133 ? 46.826  58.595 82.375  1.00 14.89 ? 151  PRO A O   1 
ATOM   1073  C  CB  . PRO A 1 133 ? 44.769  56.623 83.786  1.00 14.70 ? 151  PRO A CB  1 
ATOM   1074  C  CG  . PRO A 1 133 ? 44.203  56.782 85.163  1.00 14.57 ? 151  PRO A CG  1 
ATOM   1075  C  CD  . PRO A 1 133 ? 45.017  57.906 85.761  1.00 14.36 ? 151  PRO A CD  1 
ATOM   1076  N  N   . TYR A 1 134 ? 47.580  56.496 81.946  1.00 15.63 ? 152  TYR A N   1 
ATOM   1077  C  CA  . TYR A 1 134 ? 48.091  56.800 80.614  1.00 16.17 ? 152  TYR A CA  1 
ATOM   1078  C  C   . TYR A 1 134 ? 46.948  56.645 79.604  1.00 16.94 ? 152  TYR A C   1 
ATOM   1079  O  O   . TYR A 1 134 ? 46.893  55.679 78.831  1.00 17.09 ? 152  TYR A O   1 
ATOM   1080  C  CB  . TYR A 1 134 ? 49.282  55.888 80.268  1.00 16.09 ? 152  TYR A CB  1 
ATOM   1081  C  CG  . TYR A 1 134 ? 50.537  56.238 81.030  1.00 14.75 ? 152  TYR A CG  1 
ATOM   1082  C  CD1 . TYR A 1 134 ? 50.751  55.739 82.314  1.00 13.69 ? 152  TYR A CD1 1 
ATOM   1083  C  CD2 . TYR A 1 134 ? 51.499  57.086 80.480  1.00 14.26 ? 152  TYR A CD2 1 
ATOM   1084  C  CE1 . TYR A 1 134 ? 51.890  56.067 83.035  1.00 13.64 ? 152  TYR A CE1 1 
ATOM   1085  C  CE2 . TYR A 1 134 ? 52.656  57.421 81.196  1.00 14.13 ? 152  TYR A CE2 1 
ATOM   1086  C  CZ  . TYR A 1 134 ? 52.839  56.898 82.475  1.00 14.01 ? 152  TYR A CZ  1 
ATOM   1087  O  OH  . TYR A 1 134 ? 53.965  57.213 83.203  1.00 14.90 ? 152  TYR A OH  1 
ATOM   1088  N  N   . SER A 1 135 ? 46.025  57.601 79.659  1.00 17.48 ? 153  SER A N   1 
ATOM   1089  C  CA  . SER A 1 135 ? 44.806  57.609 78.861  1.00 18.35 ? 153  SER A CA  1 
ATOM   1090  C  C   . SER A 1 135 ? 44.288  59.029 78.842  1.00 19.01 ? 153  SER A C   1 
ATOM   1091  O  O   . SER A 1 135 ? 44.320  59.715 79.862  1.00 19.77 ? 153  SER A O   1 
ATOM   1092  C  CB  . SER A 1 135 ? 43.748  56.682 79.471  1.00 18.29 ? 153  SER A CB  1 
ATOM   1093  O  OG  . SER A 1 135 ? 42.481  56.847 78.840  1.00 18.90 ? 153  SER A OG  1 
ATOM   1094  N  N   . THR A 1 136 ? 43.806  59.471 77.687  1.00 19.64 ? 154  THR A N   1 
ATOM   1095  C  CA  . THR A 1 136 ? 43.236  60.807 77.551  1.00 20.15 ? 154  THR A CA  1 
ATOM   1096  C  C   . THR A 1 136 ? 41.758  60.832 77.941  1.00 20.07 ? 154  THR A C   1 
ATOM   1097  O  O   . THR A 1 136 ? 41.074  61.838 77.751  1.00 20.13 ? 154  THR A O   1 
ATOM   1098  C  CB  . THR A 1 136 ? 43.372  61.325 76.110  1.00 20.35 ? 154  THR A CB  1 
ATOM   1099  O  OG1 . THR A 1 136 ? 42.954  60.296 75.204  1.00 21.21 ? 154  THR A OG1 1 
ATOM   1100  C  CG2 . THR A 1 136 ? 44.817  61.714 75.814  1.00 21.18 ? 154  THR A CG2 1 
ATOM   1101  N  N   . SER A 1 137 ? 41.268  59.721 78.481  1.00 20.20 ? 155  SER A N   1 
ATOM   1102  C  CA  . SER A 1 137 ? 39.881  59.636 78.926  1.00 20.53 ? 155  SER A CA  1 
ATOM   1103  C  C   . SER A 1 137 ? 39.757  59.276 80.417  1.00 20.16 ? 155  SER A C   1 
ATOM   1104  O  O   . SER A 1 137 ? 38.692  59.439 81.018  1.00 20.88 ? 155  SER A O   1 
ATOM   1105  C  CB  . SER A 1 137 ? 39.110  58.646 78.049  1.00 20.45 ? 155  SER A CB  1 
ATOM   1106  O  OG  . SER A 1 137 ? 39.649  57.341 78.169  1.00 22.67 ? 155  SER A OG  1 
ATOM   1107  N  N   . ALA A 1 138 ? 40.855  58.810 81.009  1.00 19.59 ? 156  ALA A N   1 
ATOM   1108  C  CA  . ALA A 1 138 ? 40.895  58.443 82.428  1.00 18.72 ? 156  ALA A CA  1 
ATOM   1109  C  C   . ALA A 1 138 ? 41.735  59.435 83.244  1.00 18.12 ? 156  ALA A C   1 
ATOM   1110  O  O   . ALA A 1 138 ? 42.564  60.158 82.694  1.00 18.52 ? 156  ALA A O   1 
ATOM   1111  C  CB  . ALA A 1 138 ? 41.423  57.031 82.586  1.00 18.65 ? 156  ALA A CB  1 
ATOM   1112  N  N   . SER A 1 139 ? 41.497  59.487 84.551  1.00 17.18 ? 157  SER A N   1 
ATOM   1113  C  CA  . SER A 1 139 ? 42.221  60.402 85.440  1.00 16.16 ? 157  SER A CA  1 
ATOM   1114  C  C   . SER A 1 139 ? 42.392  59.797 86.839  1.00 15.43 ? 157  SER A C   1 
ATOM   1115  O  O   . SER A 1 139 ? 41.914  58.697 87.105  1.00 15.46 ? 157  SER A O   1 
ATOM   1116  C  CB  . SER A 1 139 ? 41.508  61.759 85.517  1.00 15.89 ? 157  SER A CB  1 
ATOM   1117  O  OG  . SER A 1 139 ? 40.241  61.634 86.132  1.00 15.66 ? 157  SER A OG  1 
ATOM   1118  N  N   . LEU A 1 140 ? 43.098  60.506 87.714  1.00 14.50 ? 158  LEU A N   1 
ATOM   1119  C  CA  . LEU A 1 140 ? 43.272  60.069 89.094  1.00 13.80 ? 158  LEU A CA  1 
ATOM   1120  C  C   . LEU A 1 140 ? 42.395  60.915 90.010  1.00 13.20 ? 158  LEU A C   1 
ATOM   1121  O  O   . LEU A 1 140 ? 42.602  62.118 90.148  1.00 12.94 ? 158  LEU A O   1 
ATOM   1122  C  CB  . LEU A 1 140 ? 44.747  60.147 89.527  1.00 13.47 ? 158  LEU A CB  1 
ATOM   1123  C  CG  . LEU A 1 140 ? 45.138  59.631 90.928  1.00 13.14 ? 158  LEU A CG  1 
ATOM   1124  C  CD1 . LEU A 1 140 ? 44.907  58.134 91.078  1.00 12.33 ? 158  LEU A CD1 1 
ATOM   1125  C  CD2 . LEU A 1 140 ? 46.601  59.961 91.246  1.00 12.92 ? 158  LEU A CD2 1 
ATOM   1126  N  N   . TYR A 1 141 ? 41.412  60.271 90.630  1.00 12.84 ? 159  TYR A N   1 
ATOM   1127  C  CA  . TYR A 1 141 ? 40.517  60.953 91.559  1.00 12.48 ? 159  TYR A CA  1 
ATOM   1128  C  C   . TYR A 1 141 ? 41.200  61.114 92.912  1.00 12.09 ? 159  TYR A C   1 
ATOM   1129  O  O   . TYR A 1 141 ? 41.816  60.180 93.422  1.00 11.73 ? 159  TYR A O   1 
ATOM   1130  C  CB  . TYR A 1 141 ? 39.197  60.189 91.700  1.00 12.35 ? 159  TYR A CB  1 
ATOM   1131  C  CG  . TYR A 1 141 ? 38.153  60.872 92.554  1.00 12.43 ? 159  TYR A CG  1 
ATOM   1132  C  CD1 . TYR A 1 141 ? 37.461  61.991 92.091  1.00 11.01 ? 159  TYR A CD1 1 
ATOM   1133  C  CD2 . TYR A 1 141 ? 37.844  60.382 93.828  1.00 12.65 ? 159  TYR A CD2 1 
ATOM   1134  C  CE1 . TYR A 1 141 ? 36.492  62.610 92.878  1.00 11.34 ? 159  TYR A CE1 1 
ATOM   1135  C  CE2 . TYR A 1 141 ? 36.879  60.989 94.616  1.00 10.65 ? 159  TYR A CE2 1 
ATOM   1136  C  CZ  . TYR A 1 141 ? 36.208  62.097 94.141  1.00 11.17 ? 159  TYR A CZ  1 
ATOM   1137  O  OH  . TYR A 1 141 ? 35.255  62.693 94.940  1.00 10.46 ? 159  TYR A OH  1 
ATOM   1138  N  N   . ILE A 1 142 ? 41.092  62.321 93.462  1.00 11.73 ? 160  ILE A N   1 
ATOM   1139  C  CA  . ILE A 1 142 ? 41.701  62.678 94.739  1.00 11.19 ? 160  ILE A CA  1 
ATOM   1140  C  C   . ILE A 1 142 ? 40.573  62.896 95.747  1.00 10.84 ? 160  ILE A C   1 
ATOM   1141  O  O   . ILE A 1 142 ? 39.672  63.693 95.500  1.00 10.54 ? 160  ILE A O   1 
ATOM   1142  C  CB  . ILE A 1 142 ? 42.594  63.958 94.606  1.00 11.45 ? 160  ILE A CB  1 
ATOM   1143  C  CG1 . ILE A 1 142 ? 43.574  63.821 93.416  1.00 11.38 ? 160  ILE A CG1 1 
ATOM   1144  C  CG2 . ILE A 1 142 ? 43.341  64.254 95.925  1.00 9.96  ? 160  ILE A CG2 1 
ATOM   1145  C  CD1 . ILE A 1 142 ? 44.270  65.126 93.012  1.00 11.94 ? 160  ILE A CD1 1 
ATOM   1146  N  N   . ARG A 1 143 ? 40.624  62.163 96.863  1.00 10.36 ? 161  ARG A N   1 
ATOM   1147  C  CA  . ARG A 1 143 ? 39.594  62.204 97.901  1.00 9.75  ? 161  ARG A CA  1 
ATOM   1148  C  C   . ARG A 1 143 ? 40.165  62.669 99.263  1.00 9.85  ? 161  ARG A C   1 
ATOM   1149  O  O   . ARG A 1 143 ? 40.551  61.848 100.107 1.00 9.25  ? 161  ARG A O   1 
ATOM   1150  C  CB  . ARG A 1 143 ? 38.898  60.833 97.995  1.00 9.82  ? 161  ARG A CB  1 
ATOM   1151  C  CG  . ARG A 1 143 ? 37.891  60.626 99.153  1.00 8.60  ? 161  ARG A CG  1 
ATOM   1152  C  CD  . ARG A 1 143 ? 36.883  61.766 99.306  1.00 8.36  ? 161  ARG A CD  1 
ATOM   1153  N  NE  . ARG A 1 143 ? 35.961  61.863 98.174  1.00 8.21  ? 161  ARG A NE  1 
ATOM   1154  C  CZ  . ARG A 1 143 ? 34.800  61.220 98.095  1.00 9.13  ? 161  ARG A CZ  1 
ATOM   1155  N  NH1 . ARG A 1 143 ? 34.408  60.419 99.083  1.00 8.80  ? 161  ARG A NH1 1 
ATOM   1156  N  NH2 . ARG A 1 143 ? 34.024  61.377 97.026  1.00 9.13  ? 161  ARG A NH2 1 
ATOM   1157  N  N   . PRO A 1 144 ? 40.246  63.998 99.467  1.00 9.82  ? 162  PRO A N   1 
ATOM   1158  C  CA  . PRO A 1 144 ? 40.584  64.502 100.788 1.00 10.14 ? 162  PRO A CA  1 
ATOM   1159  C  C   . PRO A 1 144 ? 39.392  64.332 101.712 1.00 10.59 ? 162  PRO A C   1 
ATOM   1160  O  O   . PRO A 1 144 ? 38.249  64.610 101.327 1.00 10.18 ? 162  PRO A O   1 
ATOM   1161  C  CB  . PRO A 1 144 ? 40.871  65.997 100.551 1.00 10.13 ? 162  PRO A CB  1 
ATOM   1162  C  CG  . PRO A 1 144 ? 40.915  66.185 99.062  1.00 9.78  ? 162  PRO A CG  1 
ATOM   1163  C  CD  . PRO A 1 144 ? 40.053  65.090 98.502  1.00 9.77  ? 162  PRO A CD  1 
ATOM   1164  N  N   . ALA A 1 145 ? 39.669  63.866 102.925 1.00 11.12 ? 163  ALA A N   1 
ATOM   1165  C  CA  . ALA A 1 145 ? 38.621  63.486 103.858 1.00 11.24 ? 163  ALA A CA  1 
ATOM   1166  C  C   . ALA A 1 145 ? 39.038  63.914 105.255 1.00 11.06 ? 163  ALA A C   1 
ATOM   1167  O  O   . ALA A 1 145 ? 40.199  63.801 105.619 1.00 10.89 ? 163  ALA A O   1 
ATOM   1168  C  CB  . ALA A 1 145 ? 38.357  61.968 103.770 1.00 11.38 ? 163  ALA A CB  1 
ATOM   1169  N  N   . PHE A 1 146 ? 38.088  64.436 106.021 1.00 11.58 ? 164  PHE A N   1 
ATOM   1170  C  CA  . PHE A 1 146 ? 38.384  65.108 107.290 1.00 11.72 ? 164  PHE A CA  1 
ATOM   1171  C  C   . PHE A 1 146 ? 37.345  64.608 108.281 1.00 12.31 ? 164  PHE A C   1 
ATOM   1172  O  O   . PHE A 1 146 ? 36.150  64.876 108.119 1.00 12.93 ? 164  PHE A O   1 
ATOM   1173  C  CB  . PHE A 1 146 ? 38.288  66.634 107.093 1.00 11.26 ? 164  PHE A CB  1 
ATOM   1174  C  CG  . PHE A 1 146 ? 39.046  67.471 108.118 1.00 10.97 ? 164  PHE A CG  1 
ATOM   1175  C  CD1 . PHE A 1 146 ? 39.678  66.904 109.224 1.00 10.51 ? 164  PHE A CD1 1 
ATOM   1176  C  CD2 . PHE A 1 146 ? 39.087  68.856 107.975 1.00 10.87 ? 164  PHE A CD2 1 
ATOM   1177  C  CE1 . PHE A 1 146 ? 40.356  67.711 110.156 1.00 10.16 ? 164  PHE A CE1 1 
ATOM   1178  C  CE2 . PHE A 1 146 ? 39.759  69.660 108.895 1.00 9.48  ? 164  PHE A CE2 1 
ATOM   1179  C  CZ  . PHE A 1 146 ? 40.387  69.082 109.986 1.00 8.95  ? 164  PHE A CZ  1 
ATOM   1180  N  N   . ILE A 1 147 ? 37.795  63.870 109.294 1.00 12.63 ? 165  ILE A N   1 
ATOM   1181  C  CA  . ILE A 1 147 ? 36.890  63.215 110.242 1.00 12.75 ? 165  ILE A CA  1 
ATOM   1182  C  C   . ILE A 1 147 ? 37.169  63.572 111.714 1.00 13.64 ? 165  ILE A C   1 
ATOM   1183  O  O   . ILE A 1 147 ? 38.327  63.770 112.120 1.00 13.26 ? 165  ILE A O   1 
ATOM   1184  C  CB  . ILE A 1 147 ? 36.895  61.662 110.072 1.00 12.58 ? 165  ILE A CB  1 
ATOM   1185  C  CG1 . ILE A 1 147 ? 38.295  61.075 110.333 1.00 11.75 ? 165  ILE A CG1 1 
ATOM   1186  C  CG2 . ILE A 1 147 ? 36.345  61.257 108.687 1.00 12.30 ? 165  ILE A CG2 1 
ATOM   1187  C  CD1 . ILE A 1 147 ? 38.326  59.579 110.618 1.00 9.52  ? 165  ILE A CD1 1 
ATOM   1188  N  N   . GLY A 1 148 ? 36.098  63.658 112.504 1.00 14.05 ? 166  GLY A N   1 
ATOM   1189  C  CA  . GLY A 1 148 ? 36.224  63.796 113.956 1.00 14.83 ? 166  GLY A CA  1 
ATOM   1190  C  C   . GLY A 1 148 ? 36.551  62.451 114.572 1.00 15.23 ? 166  GLY A C   1 
ATOM   1191  O  O   . GLY A 1 148 ? 35.905  61.447 114.267 1.00 15.21 ? 166  GLY A O   1 
ATOM   1192  N  N   . THR A 1 149 ? 37.565  62.422 115.430 1.00 16.08 ? 167  THR A N   1 
ATOM   1193  C  CA  . THR A 1 149 ? 37.994  61.177 116.077 1.00 17.00 ? 167  THR A CA  1 
ATOM   1194  C  C   . THR A 1 149 ? 37.899  61.266 117.601 1.00 17.75 ? 167  THR A C   1 
ATOM   1195  O  O   . THR A 1 149 ? 38.480  60.458 118.315 1.00 17.71 ? 167  THR A O   1 
ATOM   1196  C  CB  . THR A 1 149 ? 39.411  60.757 115.640 1.00 16.91 ? 167  THR A CB  1 
ATOM   1197  O  OG1 . THR A 1 149 ? 40.292  61.878 115.745 1.00 17.80 ? 167  THR A OG1 1 
ATOM   1198  C  CG2 . THR A 1 149 ? 39.405  60.266 114.180 1.00 16.98 ? 167  THR A CG2 1 
ATOM   1199  N  N   . GLU A 1 150 ? 37.156  62.271 118.067 1.00 18.85 ? 168  GLU A N   1 
ATOM   1200  C  CA  . GLU A 1 150 ? 36.754  62.435 119.462 1.00 20.16 ? 168  GLU A CA  1 
ATOM   1201  C  C   . GLU A 1 150 ? 36.202  61.117 120.038 1.00 20.22 ? 168  GLU A C   1 
ATOM   1202  O  O   . GLU A 1 150 ? 35.188  60.626 119.556 1.00 20.39 ? 168  GLU A O   1 
ATOM   1203  C  CB  . GLU A 1 150 ? 35.676  63.532 119.537 1.00 20.47 ? 168  GLU A CB  1 
ATOM   1204  C  CG  . GLU A 1 150 ? 35.093  63.763 120.918 1.00 22.13 ? 168  GLU A CG  1 
ATOM   1205  C  CD  . GLU A 1 150 ? 36.128  64.298 121.883 1.00 24.23 ? 168  GLU A CD  1 
ATOM   1206  O  OE1 . GLU A 1 150 ? 36.284  63.733 122.986 1.00 26.03 ? 168  GLU A OE1 1 
ATOM   1207  O  OE2 . GLU A 1 150 ? 36.793  65.287 121.529 1.00 24.92 ? 168  GLU A OE2 1 
ATOM   1208  N  N   . PRO A 1 151 ? 36.868  60.550 121.069 1.00 20.57 ? 169  PRO A N   1 
ATOM   1209  C  CA  . PRO A 1 151 ? 36.471  59.266 121.654 1.00 20.76 ? 169  PRO A CA  1 
ATOM   1210  C  C   . PRO A 1 151 ? 35.224  59.313 122.556 1.00 20.88 ? 169  PRO A C   1 
ATOM   1211  O  O   . PRO A 1 151 ? 34.573  58.279 122.748 1.00 21.33 ? 169  PRO A O   1 
ATOM   1212  C  CB  . PRO A 1 151 ? 37.699  58.859 122.492 1.00 20.84 ? 169  PRO A CB  1 
ATOM   1213  C  CG  . PRO A 1 151 ? 38.752  59.876 122.217 1.00 20.60 ? 169  PRO A CG  1 
ATOM   1214  C  CD  . PRO A 1 151 ? 38.052  61.097 121.751 1.00 20.86 ? 169  PRO A CD  1 
ATOM   1215  N  N   . SER A 1 152 ? 34.896  60.484 123.101 1.00 20.66 ? 170  SER A N   1 
ATOM   1216  C  CA  . SER A 1 152 ? 33.749  60.604 124.000 1.00 20.43 ? 170  SER A CA  1 
ATOM   1217  C  C   . SER A 1 152 ? 32.421  60.769 123.262 1.00 20.16 ? 170  SER A C   1 
ATOM   1218  O  O   . SER A 1 152 ? 32.385  61.211 122.113 1.00 19.98 ? 170  SER A O   1 
ATOM   1219  C  CB  . SER A 1 152 ? 33.951  61.713 125.040 1.00 20.39 ? 170  SER A CB  1 
ATOM   1220  O  OG  . SER A 1 152 ? 34.135  62.975 124.437 1.00 21.37 ? 170  SER A OG  1 
ATOM   1221  N  N   . LEU A 1 153 ? 31.339  60.400 123.944 1.00 19.79 ? 171  LEU A N   1 
ATOM   1222  C  CA  . LEU A 1 153 ? 30.013  60.318 123.344 1.00 19.70 ? 171  LEU A CA  1 
ATOM   1223  C  C   . LEU A 1 153 ? 29.194  61.608 123.426 1.00 19.78 ? 171  LEU A C   1 
ATOM   1224  O  O   . LEU A 1 153 ? 28.122  61.696 122.832 1.00 19.78 ? 171  LEU A O   1 
ATOM   1225  C  CB  . LEU A 1 153 ? 29.229  59.133 123.933 1.00 19.58 ? 171  LEU A CB  1 
ATOM   1226  C  CG  . LEU A 1 153 ? 29.842  57.728 123.796 1.00 18.99 ? 171  LEU A CG  1 
ATOM   1227  C  CD1 . LEU A 1 153 ? 28.925  56.668 124.407 1.00 18.34 ? 171  LEU A CD1 1 
ATOM   1228  C  CD2 . LEU A 1 153 ? 30.174  57.383 122.342 1.00 16.95 ? 171  LEU A CD2 1 
ATOM   1229  N  N   . GLY A 1 154 ? 29.696  62.608 124.147 1.00 19.88 ? 172  GLY A N   1 
ATOM   1230  C  CA  . GLY A 1 154 ? 29.052  63.924 124.165 1.00 19.93 ? 172  GLY A CA  1 
ATOM   1231  C  C   . GLY A 1 154 ? 28.995  64.510 122.770 1.00 19.94 ? 172  GLY A C   1 
ATOM   1232  O  O   . GLY A 1 154 ? 29.928  64.330 121.986 1.00 19.47 ? 172  GLY A O   1 
ATOM   1233  N  N   . VAL A 1 155 ? 27.889  65.186 122.455 1.00 20.23 ? 173  VAL A N   1 
ATOM   1234  C  CA  . VAL A 1 155 ? 27.717  65.846 121.161 1.00 20.39 ? 173  VAL A CA  1 
ATOM   1235  C  C   . VAL A 1 155 ? 28.368  67.226 121.215 1.00 20.59 ? 173  VAL A C   1 
ATOM   1236  O  O   . VAL A 1 155 ? 27.763  68.202 121.654 1.00 20.86 ? 173  VAL A O   1 
ATOM   1237  C  CB  . VAL A 1 155 ? 26.223  65.959 120.732 1.00 20.46 ? 173  VAL A CB  1 
ATOM   1238  C  CG1 . VAL A 1 155 ? 26.123  66.398 119.272 1.00 20.47 ? 173  VAL A CG1 1 
ATOM   1239  C  CG2 . VAL A 1 155 ? 25.509  64.643 120.921 1.00 19.76 ? 173  VAL A CG2 1 
ATOM   1240  N  N   . LYS A 1 156 ? 29.606  67.294 120.748 1.00 20.64 ? 174  LYS A N   1 
ATOM   1241  C  CA  . LYS A 1 156 ? 30.452  68.447 120.989 1.00 20.90 ? 174  LYS A CA  1 
ATOM   1242  C  C   . LYS A 1 156 ? 31.468  68.616 119.874 1.00 20.40 ? 174  LYS A C   1 
ATOM   1243  O  O   . LYS A 1 156 ? 31.786  67.656 119.170 1.00 20.62 ? 174  LYS A O   1 
ATOM   1244  C  CB  . LYS A 1 156 ? 31.202  68.252 122.307 1.00 21.30 ? 174  LYS A CB  1 
ATOM   1245  C  CG  . LYS A 1 156 ? 32.284  67.154 122.236 1.00 23.56 ? 174  LYS A CG  1 
ATOM   1246  C  CD  . LYS A 1 156 ? 33.015  66.949 123.559 1.00 26.67 ? 174  LYS A CD  1 
ATOM   1247  C  CE  . LYS A 1 156 ? 32.338  65.867 124.391 1.00 28.45 ? 174  LYS A CE  1 
ATOM   1248  N  NZ  . LYS A 1 156 ? 32.302  64.576 123.639 1.00 29.21 ? 174  LYS A NZ  1 
ATOM   1249  N  N   . LYS A 1 157 ? 31.979  69.836 119.734 1.00 19.82 ? 175  LYS A N   1 
ATOM   1250  C  CA  . LYS A 1 157 ? 33.142  70.114 118.904 1.00 19.45 ? 175  LYS A CA  1 
ATOM   1251  C  C   . LYS A 1 157 ? 34.251  69.111 119.246 1.00 18.85 ? 175  LYS A C   1 
ATOM   1252  O  O   . LYS A 1 157 ? 34.602  68.958 120.414 1.00 18.85 ? 175  LYS A O   1 
ATOM   1253  C  CB  . LYS A 1 157 ? 33.618  71.546 119.164 1.00 19.56 ? 175  LYS A CB  1 
ATOM   1254  C  CG  . LYS A 1 157 ? 34.666  72.069 118.200 1.00 20.21 ? 175  LYS A CG  1 
ATOM   1255  C  CD  . LYS A 1 157 ? 35.303  73.332 118.767 1.00 23.77 ? 175  LYS A CD  1 
ATOM   1256  C  CE  . LYS A 1 157 ? 35.886  74.222 117.683 1.00 25.80 ? 175  LYS A CE  1 
ATOM   1257  N  NZ  . LYS A 1 157 ? 36.097  75.603 118.223 1.00 27.04 ? 175  LYS A NZ  1 
ATOM   1258  N  N   . PRO A 1 158 ? 34.784  68.402 118.231 1.00 18.30 ? 176  PRO A N   1 
ATOM   1259  C  CA  . PRO A 1 158 ? 35.831  67.401 118.467 1.00 17.79 ? 176  PRO A CA  1 
ATOM   1260  C  C   . PRO A 1 158 ? 37.134  68.002 119.003 1.00 17.75 ? 176  PRO A C   1 
ATOM   1261  O  O   . PRO A 1 158 ? 37.541  69.095 118.597 1.00 17.41 ? 176  PRO A O   1 
ATOM   1262  C  CB  . PRO A 1 158 ? 36.055  66.787 117.076 1.00 17.81 ? 176  PRO A CB  1 
ATOM   1263  C  CG  . PRO A 1 158 ? 35.572  67.833 116.109 1.00 17.30 ? 176  PRO A CG  1 
ATOM   1264  C  CD  . PRO A 1 158 ? 34.422  68.497 116.802 1.00 18.30 ? 176  PRO A CD  1 
ATOM   1265  N  N   . THR A 1 159 ? 37.766  67.286 119.925 1.00 17.52 ? 177  THR A N   1 
ATOM   1266  C  CA  . THR A 1 159 ? 39.061  67.686 120.471 1.00 17.60 ? 177  THR A CA  1 
ATOM   1267  C  C   . THR A 1 159 ? 40.147  66.820 119.826 1.00 17.62 ? 177  THR A C   1 
ATOM   1268  O  O   . THR A 1 159 ? 41.321  66.896 120.185 1.00 17.24 ? 177  THR A O   1 
ATOM   1269  C  CB  . THR A 1 159 ? 39.105  67.531 122.008 1.00 17.33 ? 177  THR A CB  1 
ATOM   1270  O  OG1 . THR A 1 159 ? 38.934  66.153 122.351 1.00 17.29 ? 177  THR A OG1 1 
ATOM   1271  C  CG2 . THR A 1 159 ? 38.006  68.336 122.665 1.00 17.77 ? 177  THR A CG2 1 
ATOM   1272  N  N   . LYS A 1 160 ? 39.726  65.999 118.865 1.00 17.73 ? 178  LYS A N   1 
ATOM   1273  C  CA  . LYS A 1 160 ? 40.611  65.093 118.151 1.00 18.26 ? 178  LYS A CA  1 
ATOM   1274  C  C   . LYS A 1 160 ? 40.086  64.930 116.717 1.00 17.72 ? 178  LYS A C   1 
ATOM   1275  O  O   . LYS A 1 160 ? 38.882  64.749 116.514 1.00 17.81 ? 178  LYS A O   1 
ATOM   1276  C  CB  . LYS A 1 160 ? 40.665  63.749 118.894 1.00 18.65 ? 178  LYS A CB  1 
ATOM   1277  C  CG  . LYS A 1 160 ? 41.787  62.825 118.484 1.00 21.19 ? 178  LYS A CG  1 
ATOM   1278  C  CD  . LYS A 1 160 ? 41.630  61.446 119.141 1.00 24.56 ? 178  LYS A CD  1 
ATOM   1279  C  CE  . LYS A 1 160 ? 42.495  60.379 118.467 1.00 25.03 ? 178  LYS A CE  1 
ATOM   1280  N  NZ  . LYS A 1 160 ? 43.939  60.544 118.804 1.00 27.09 ? 178  LYS A NZ  1 
ATOM   1281  N  N   . ALA A 1 161 ? 40.977  65.020 115.732 1.00 17.25 ? 179  ALA A N   1 
ATOM   1282  C  CA  . ALA A 1 161 ? 40.587  64.886 114.320 1.00 17.23 ? 179  ALA A CA  1 
ATOM   1283  C  C   . ALA A 1 161 ? 41.644  64.201 113.442 1.00 17.14 ? 179  ALA A C   1 
ATOM   1284  O  O   . ALA A 1 161 ? 42.829  64.178 113.782 1.00 17.43 ? 179  ALA A O   1 
ATOM   1285  C  CB  . ALA A 1 161 ? 40.193  66.251 113.727 1.00 16.99 ? 179  ALA A CB  1 
ATOM   1286  N  N   . LEU A 1 162 ? 41.195  63.648 112.313 1.00 16.79 ? 180  LEU A N   1 
ATOM   1287  C  CA  . LEU A 1 162 ? 42.077  63.087 111.290 1.00 16.38 ? 180  LEU A CA  1 
ATOM   1288  C  C   . LEU A 1 162 ? 41.724  63.664 109.923 1.00 15.89 ? 180  LEU A C   1 
ATOM   1289  O  O   . LEU A 1 162 ? 40.584  63.545 109.471 1.00 16.07 ? 180  LEU A O   1 
ATOM   1290  C  CB  . LEU A 1 162 ? 41.926  61.564 111.224 1.00 16.37 ? 180  LEU A CB  1 
ATOM   1291  C  CG  . LEU A 1 162 ? 43.061  60.616 110.813 1.00 16.89 ? 180  LEU A CG  1 
ATOM   1292  C  CD1 . LEU A 1 162 ? 42.506  59.480 109.984 1.00 16.55 ? 180  LEU A CD1 1 
ATOM   1293  C  CD2 . LEU A 1 162 ? 44.217  61.278 110.091 1.00 17.72 ? 180  LEU A CD2 1 
ATOM   1294  N  N   . LEU A 1 163 ? 42.699  64.292 109.274 1.00 15.23 ? 181  LEU A N   1 
ATOM   1295  C  CA  . LEU A 1 163 ? 42.576  64.645 107.864 1.00 14.64 ? 181  LEU A CA  1 
ATOM   1296  C  C   . LEU A 1 163 ? 43.371  63.616 107.078 1.00 14.47 ? 181  LEU A C   1 
ATOM   1297  O  O   . LEU A 1 163 ? 44.524  63.339 107.409 1.00 14.48 ? 181  LEU A O   1 
ATOM   1298  C  CB  . LEU A 1 163 ? 43.100  66.060 107.593 1.00 14.40 ? 181  LEU A CB  1 
ATOM   1299  C  CG  . LEU A 1 163 ? 42.694  66.751 106.286 1.00 14.09 ? 181  LEU A CG  1 
ATOM   1300  C  CD1 . LEU A 1 163 ? 42.814  68.260 106.421 1.00 13.63 ? 181  LEU A CD1 1 
ATOM   1301  C  CD2 . LEU A 1 163 ? 43.520  66.261 105.103 1.00 15.75 ? 181  LEU A CD2 1 
ATOM   1302  N  N   . PHE A 1 164 ? 42.743  63.017 106.069 1.00 13.91 ? 182  PHE A N   1 
ATOM   1303  C  CA  . PHE A 1 164 ? 43.433  62.049 105.214 1.00 13.52 ? 182  PHE A CA  1 
ATOM   1304  C  C   . PHE A 1 164 ? 43.069  62.224 103.741 1.00 13.27 ? 182  PHE A C   1 
ATOM   1305  O  O   . PHE A 1 164 ? 42.041  62.822 103.421 1.00 13.27 ? 182  PHE A O   1 
ATOM   1306  C  CB  . PHE A 1 164 ? 43.268  60.593 105.714 1.00 13.24 ? 182  PHE A CB  1 
ATOM   1307  C  CG  . PHE A 1 164 ? 41.857  60.066 105.663 1.00 13.42 ? 182  PHE A CG  1 
ATOM   1308  C  CD1 . PHE A 1 164 ? 40.980  60.278 106.729 1.00 13.26 ? 182  PHE A CD1 1 
ATOM   1309  C  CD2 . PHE A 1 164 ? 41.413  59.331 104.559 1.00 12.58 ? 182  PHE A CD2 1 
ATOM   1310  C  CE1 . PHE A 1 164 ? 39.672  59.781 106.689 1.00 13.24 ? 182  PHE A CE1 1 
ATOM   1311  C  CE2 . PHE A 1 164 ? 40.115  58.838 104.501 1.00 12.01 ? 182  PHE A CE2 1 
ATOM   1312  C  CZ  . PHE A 1 164 ? 39.241  59.055 105.578 1.00 12.87 ? 182  PHE A CZ  1 
ATOM   1313  N  N   . VAL A 1 165 ? 43.941  61.742 102.856 1.00 13.13 ? 183  VAL A N   1 
ATOM   1314  C  CA  . VAL A 1 165 ? 43.725  61.861 101.412 1.00 13.30 ? 183  VAL A CA  1 
ATOM   1315  C  C   . VAL A 1 165 ? 43.949  60.521 100.712 1.00 13.83 ? 183  VAL A C   1 
ATOM   1316  O  O   . VAL A 1 165 ? 45.008  59.897 100.854 1.00 14.12 ? 183  VAL A O   1 
ATOM   1317  C  CB  . VAL A 1 165 ? 44.622  62.960 100.752 1.00 13.26 ? 183  VAL A CB  1 
ATOM   1318  C  CG1 . VAL A 1 165 ? 44.345  63.055 99.250  1.00 12.57 ? 183  VAL A CG1 1 
ATOM   1319  C  CG2 . VAL A 1 165 ? 44.404  64.317 101.404 1.00 12.49 ? 183  VAL A CG2 1 
ATOM   1320  N  N   . LEU A 1 166 ? 42.939  60.098 99.954  1.00 13.90 ? 184  LEU A N   1 
ATOM   1321  C  CA  . LEU A 1 166 ? 42.982  58.864 99.171  1.00 14.37 ? 184  LEU A CA  1 
ATOM   1322  C  C   . LEU A 1 166 ? 43.108  59.171 97.686  1.00 14.13 ? 184  LEU A C   1 
ATOM   1323  O  O   . LEU A 1 166 ? 42.632  60.201 97.219  1.00 14.06 ? 184  LEU A O   1 
ATOM   1324  C  CB  . LEU A 1 166 ? 41.689  58.074 99.388  1.00 14.51 ? 184  LEU A CB  1 
ATOM   1325  C  CG  . LEU A 1 166 ? 41.541  57.061 100.518 1.00 15.12 ? 184  LEU A CG  1 
ATOM   1326  C  CD1 . LEU A 1 166 ? 42.534  57.243 101.668 1.00 14.65 ? 184  LEU A CD1 1 
ATOM   1327  C  CD2 . LEU A 1 166 ? 40.104  57.066 101.007 1.00 14.68 ? 184  LEU A CD2 1 
ATOM   1328  N  N   . LEU A 1 167 ? 43.731  58.266 96.941  1.00 14.25 ? 185  LEU A N   1 
ATOM   1329  C  CA  . LEU A 1 167 ? 43.810  58.415 95.485  1.00 14.40 ? 185  LEU A CA  1 
ATOM   1330  C  C   . LEU A 1 167 ? 43.204  57.199 94.800  1.00 14.45 ? 185  LEU A C   1 
ATOM   1331  O  O   . LEU A 1 167 ? 43.384  56.069 95.256  1.00 14.38 ? 185  LEU A O   1 
ATOM   1332  C  CB  . LEU A 1 167 ? 45.261  58.622 95.025  1.00 14.38 ? 185  LEU A CB  1 
ATOM   1333  C  CG  . LEU A 1 167 ? 46.098  59.751 95.641  1.00 13.36 ? 185  LEU A CG  1 
ATOM   1334  C  CD1 . LEU A 1 167 ? 47.553  59.610 95.193  1.00 11.90 ? 185  LEU A CD1 1 
ATOM   1335  C  CD2 . LEU A 1 167 ? 45.532  61.131 95.301  1.00 11.56 ? 185  LEU A CD2 1 
ATOM   1336  N  N   . SER A 1 168 ? 42.490  57.432 93.706  1.00 14.69 ? 186  SER A N   1 
ATOM   1337  C  CA  . SER A 1 168 ? 41.785  56.353 93.010  1.00 14.82 ? 186  SER A CA  1 
ATOM   1338  C  C   . SER A 1 168 ? 41.653  56.644 91.520  1.00 14.91 ? 186  SER A C   1 
ATOM   1339  O  O   . SER A 1 168 ? 41.060  57.658 91.145  1.00 15.11 ? 186  SER A O   1 
ATOM   1340  C  CB  . SER A 1 168 ? 40.392  56.134 93.630  1.00 14.97 ? 186  SER A CB  1 
ATOM   1341  O  OG  . SER A 1 168 ? 39.699  55.088 92.968  1.00 14.96 ? 186  SER A OG  1 
ATOM   1342  N  N   . PRO A 1 169 ? 42.207  55.759 90.663  1.00 15.30 ? 187  PRO A N   1 
ATOM   1343  C  CA  . PRO A 1 169 ? 42.041  55.909 89.216  1.00 15.48 ? 187  PRO A CA  1 
ATOM   1344  C  C   . PRO A 1 169 ? 40.575  55.791 88.801  1.00 15.98 ? 187  PRO A C   1 
ATOM   1345  O  O   . PRO A 1 169 ? 39.853  54.901 89.271  1.00 15.47 ? 187  PRO A O   1 
ATOM   1346  C  CB  . PRO A 1 169 ? 42.848  54.742 88.633  1.00 15.57 ? 187  PRO A CB  1 
ATOM   1347  C  CG  . PRO A 1 169 ? 43.708  54.251 89.739  1.00 15.73 ? 187  PRO A CG  1 
ATOM   1348  C  CD  . PRO A 1 169 ? 43.012  54.572 91.009  1.00 15.07 ? 187  PRO A CD  1 
ATOM   1349  N  N   . VAL A 1 170 ? 40.144  56.697 87.932  1.00 16.60 ? 188  VAL A N   1 
ATOM   1350  C  CA  . VAL A 1 170 ? 38.764  56.708 87.442  1.00 17.50 ? 188  VAL A CA  1 
ATOM   1351  C  C   . VAL A 1 170 ? 38.777  56.811 85.924  1.00 18.24 ? 188  VAL A C   1 
ATOM   1352  O  O   . VAL A 1 170 ? 39.635  57.481 85.357  1.00 18.10 ? 188  VAL A O   1 
ATOM   1353  C  CB  . VAL A 1 170 ? 37.922  57.868 88.077  1.00 17.43 ? 188  VAL A CB  1 
ATOM   1354  C  CG1 . VAL A 1 170 ? 38.602  59.217 87.882  1.00 16.60 ? 188  VAL A CG1 1 
ATOM   1355  C  CG2 . VAL A 1 170 ? 36.497  57.890 87.514  1.00 17.92 ? 188  VAL A CG2 1 
ATOM   1356  N  N   . GLY A 1 171 ? 37.835  56.132 85.276  1.00 19.34 ? 189  GLY A N   1 
ATOM   1357  C  CA  . GLY A 1 171 ? 37.758  56.104 83.819  1.00 20.91 ? 189  GLY A CA  1 
ATOM   1358  C  C   . GLY A 1 171 ? 36.679  57.000 83.240  1.00 22.28 ? 189  GLY A C   1 
ATOM   1359  O  O   . GLY A 1 171 ? 36.050  57.778 83.971  1.00 22.31 ? 189  GLY A O   1 
ATOM   1360  N  N   . PRO A 1 172 ? 36.464  56.909 81.911  1.00 23.47 ? 190  PRO A N   1 
ATOM   1361  C  CA  . PRO A 1 172 ? 35.402  57.696 81.252  1.00 24.22 ? 190  PRO A CA  1 
ATOM   1362  C  C   . PRO A 1 172 ? 33.997  57.214 81.635  1.00 24.79 ? 190  PRO A C   1 
ATOM   1363  O  O   . PRO A 1 172 ? 33.825  56.049 81.995  1.00 24.80 ? 190  PRO A O   1 
ATOM   1364  C  CB  . PRO A 1 172 ? 35.659  57.453 79.762  1.00 24.01 ? 190  PRO A CB  1 
ATOM   1365  C  CG  . PRO A 1 172 ? 36.386  56.138 79.705  1.00 24.22 ? 190  PRO A CG  1 
ATOM   1366  C  CD  . PRO A 1 172 ? 37.211  56.066 80.957  1.00 23.34 ? 190  PRO A CD  1 
ATOM   1367  N  N   . TYR A 1 173 ? 33.016  58.113 81.568  1.00 25.63 ? 191  TYR A N   1 
ATOM   1368  C  CA  . TYR A 1 173 ? 31.604  57.748 81.742  1.00 26.42 ? 191  TYR A CA  1 
ATOM   1369  C  C   . TYR A 1 173 ? 30.912  57.579 80.387  1.00 26.70 ? 191  TYR A C   1 
ATOM   1370  O  O   . TYR A 1 173 ? 29.826  56.998 80.302  1.00 27.06 ? 191  TYR A O   1 
ATOM   1371  C  CB  . TYR A 1 173 ? 30.865  58.769 82.625  1.00 26.69 ? 191  TYR A CB  1 
ATOM   1372  C  CG  . TYR A 1 173 ? 31.153  58.599 84.104  1.00 27.05 ? 191  TYR A CG  1 
ATOM   1373  C  CD1 . TYR A 1 173 ? 32.407  58.913 84.631  1.00 27.15 ? 191  TYR A CD1 1 
ATOM   1374  C  CD2 . TYR A 1 173 ? 30.181  58.108 84.970  1.00 27.69 ? 191  TYR A CD2 1 
ATOM   1375  C  CE1 . TYR A 1 173 ? 32.683  58.741 85.979  1.00 27.66 ? 191  TYR A CE1 1 
ATOM   1376  C  CE2 . TYR A 1 173 ? 30.448  57.937 86.326  1.00 28.01 ? 191  TYR A CE2 1 
ATOM   1377  C  CZ  . TYR A 1 173 ? 31.701  58.256 86.821  1.00 27.59 ? 191  TYR A CZ  1 
ATOM   1378  O  OH  . TYR A 1 173 ? 31.975  58.094 88.161  1.00 28.04 ? 191  TYR A OH  1 
ATOM   1379  N  N   . PHE A 1 174 ? 31.547  58.095 79.336  1.00 26.89 ? 192  PHE A N   1 
ATOM   1380  C  CA  . PHE A 1 174 ? 31.131  57.810 77.966  1.00 27.04 ? 192  PHE A CA  1 
ATOM   1381  C  C   . PHE A 1 174 ? 31.788  56.509 77.508  1.00 26.83 ? 192  PHE A C   1 
ATOM   1382  O  O   . PHE A 1 174 ? 32.823  56.109 78.036  1.00 26.90 ? 192  PHE A O   1 
ATOM   1383  C  CB  . PHE A 1 174 ? 31.458  58.979 77.016  1.00 27.14 ? 192  PHE A CB  1 
ATOM   1384  C  CG  . PHE A 1 174 ? 32.886  59.463 77.098  1.00 27.60 ? 192  PHE A CG  1 
ATOM   1385  C  CD1 . PHE A 1 174 ? 33.916  58.762 76.471  1.00 27.81 ? 192  PHE A CD1 1 
ATOM   1386  C  CD2 . PHE A 1 174 ? 33.196  60.631 77.786  1.00 27.91 ? 192  PHE A CD2 1 
ATOM   1387  C  CE1 . PHE A 1 174 ? 35.236  59.206 76.546  1.00 27.99 ? 192  PHE A CE1 1 
ATOM   1388  C  CE2 . PHE A 1 174 ? 34.514  61.093 77.862  1.00 27.50 ? 192  PHE A CE2 1 
ATOM   1389  C  CZ  . PHE A 1 174 ? 35.536  60.374 77.245  1.00 28.21 ? 192  PHE A CZ  1 
ATOM   1390  N  N   . SER A 1 175 ? 31.165  55.852 76.534  1.00 26.95 ? 193  SER A N   1 
ATOM   1391  C  CA  . SER A 1 175 ? 31.623  54.565 76.015  1.00 26.80 ? 193  SER A CA  1 
ATOM   1392  C  C   . SER A 1 175 ? 31.072  54.332 74.611  1.00 26.66 ? 193  SER A C   1 
ATOM   1393  O  O   . SER A 1 175 ? 30.028  54.893 74.240  1.00 26.89 ? 193  SER A O   1 
ATOM   1394  C  CB  . SER A 1 175 ? 31.178  53.425 76.939  1.00 26.83 ? 193  SER A CB  1 
ATOM   1395  O  OG  . SER A 1 175 ? 29.768  53.367 77.027  1.00 26.77 ? 193  SER A OG  1 
ATOM   1396  N  N   . SER A 1 176 ? 31.767  53.494 73.837  1.00 26.24 ? 194  SER A N   1 
ATOM   1397  C  CA  . SER A 1 176 ? 31.400  53.210 72.440  1.00 25.55 ? 194  SER A CA  1 
ATOM   1398  C  C   . SER A 1 176 ? 31.253  54.486 71.601  1.00 24.82 ? 194  SER A C   1 
ATOM   1399  O  O   . SER A 1 176 ? 30.485  54.519 70.642  1.00 24.78 ? 194  SER A O   1 
ATOM   1400  C  CB  . SER A 1 176 ? 30.120  52.361 72.361  1.00 25.76 ? 194  SER A CB  1 
ATOM   1401  O  OG  . SER A 1 176 ? 30.299  51.105 72.987  1.00 26.67 ? 194  SER A OG  1 
ATOM   1402  N  N   . GLY A 1 177 ? 31.994  55.527 71.980  1.00 24.10 ? 195  GLY A N   1 
ATOM   1403  C  CA  . GLY A 1 177 ? 32.042  56.782 71.236  1.00 22.92 ? 195  GLY A CA  1 
ATOM   1404  C  C   . GLY A 1 177 ? 31.110  57.880 71.719  1.00 22.34 ? 195  GLY A C   1 
ATOM   1405  O  O   . GLY A 1 177 ? 31.329  59.057 71.419  1.00 22.03 ? 195  GLY A O   1 
ATOM   1406  N  N   . THR A 1 178 ? 30.070  57.502 72.462  1.00 21.70 ? 196  THR A N   1 
ATOM   1407  C  CA  . THR A 1 178 ? 29.020  58.447 72.868  1.00 21.47 ? 196  THR A CA  1 
ATOM   1408  C  C   . THR A 1 178 ? 28.802  58.526 74.390  1.00 21.20 ? 196  THR A C   1 
ATOM   1409  O  O   . THR A 1 178 ? 29.185  57.617 75.134  1.00 20.94 ? 196  THR A O   1 
ATOM   1410  C  CB  . THR A 1 178 ? 27.652  58.126 72.172  1.00 21.53 ? 196  THR A CB  1 
ATOM   1411  O  OG1 . THR A 1 178 ? 27.181  56.833 72.576  1.00 21.67 ? 196  THR A OG1 1 
ATOM   1412  C  CG2 . THR A 1 178 ? 27.795  58.139 70.661  1.00 21.35 ? 196  THR A CG2 1 
ATOM   1413  N  N   . PHE A 1 179 ? 28.186  59.626 74.833  1.00 20.55 ? 197  PHE A N   1 
ATOM   1414  C  CA  . PHE A 1 179 ? 27.672  59.758 76.194  1.00 20.13 ? 197  PHE A CA  1 
ATOM   1415  C  C   . PHE A 1 179 ? 26.775  58.578 76.589  1.00 19.77 ? 197  PHE A C   1 
ATOM   1416  O  O   . PHE A 1 179 ? 26.158  57.935 75.736  1.00 19.80 ? 197  PHE A O   1 
ATOM   1417  C  CB  . PHE A 1 179 ? 26.831  61.033 76.314  1.00 20.22 ? 197  PHE A CB  1 
ATOM   1418  C  CG  . PHE A 1 179 ? 27.622  62.290 76.590  1.00 19.79 ? 197  PHE A CG  1 
ATOM   1419  C  CD1 . PHE A 1 179 ? 27.554  63.368 75.711  1.00 18.67 ? 197  PHE A CD1 1 
ATOM   1420  C  CD2 . PHE A 1 179 ? 28.384  62.417 77.744  1.00 20.15 ? 197  PHE A CD2 1 
ATOM   1421  C  CE1 . PHE A 1 179 ? 28.252  64.543 75.961  1.00 19.08 ? 197  PHE A CE1 1 
ATOM   1422  C  CE2 . PHE A 1 179 ? 29.091  63.594 78.008  1.00 20.40 ? 197  PHE A CE2 1 
ATOM   1423  C  CZ  . PHE A 1 179 ? 29.019  64.660 77.109  1.00 20.13 ? 197  PHE A CZ  1 
ATOM   1424  N  N   . ASN A 1 180 ? 26.702  58.310 77.888  1.00 19.50 ? 198  ASN A N   1 
ATOM   1425  C  CA  . ASN A 1 180 ? 25.712  57.391 78.443  1.00 19.45 ? 198  ASN A CA  1 
ATOM   1426  C  C   . ASN A 1 180 ? 24.696  58.181 79.269  1.00 19.21 ? 198  ASN A C   1 
ATOM   1427  O  O   . ASN A 1 180 ? 24.936  58.439 80.450  1.00 19.14 ? 198  ASN A O   1 
ATOM   1428  C  CB  . ASN A 1 180 ? 26.384  56.297 79.285  1.00 19.51 ? 198  ASN A CB  1 
ATOM   1429  C  CG  . ASN A 1 180 ? 27.163  55.305 78.438  1.00 20.28 ? 198  ASN A CG  1 
ATOM   1430  O  OD1 . ASN A 1 180 ? 28.376  55.135 78.606  1.00 20.22 ? 198  ASN A OD1 1 
ATOM   1431  N  ND2 . ASN A 1 180 ? 26.471  54.650 77.512  1.00 20.99 ? 198  ASN A ND2 1 
ATOM   1432  N  N   . PRO A 1 181 ? 23.570  58.591 78.639  1.00 18.98 ? 199  PRO A N   1 
ATOM   1433  C  CA  . PRO A 1 181 ? 22.529  59.390 79.296  1.00 18.84 ? 199  PRO A CA  1 
ATOM   1434  C  C   . PRO A 1 181 ? 21.886  58.702 80.504  1.00 18.33 ? 199  PRO A C   1 
ATOM   1435  O  O   . PRO A 1 181 ? 21.844  57.475 80.576  1.00 18.07 ? 199  PRO A O   1 
ATOM   1436  C  CB  . PRO A 1 181 ? 21.481  59.600 78.180  1.00 18.65 ? 199  PRO A CB  1 
ATOM   1437  C  CG  . PRO A 1 181 ? 21.718  58.505 77.215  1.00 18.77 ? 199  PRO A CG  1 
ATOM   1438  C  CD  . PRO A 1 181 ? 23.217  58.315 77.232  1.00 19.18 ? 199  PRO A CD  1 
ATOM   1439  N  N   . VAL A 1 182 ? 21.392  59.502 81.445  1.00 18.12 ? 200  VAL A N   1 
ATOM   1440  C  CA  . VAL A 1 182 ? 20.729  58.957 82.634  1.00 17.77 ? 200  VAL A CA  1 
ATOM   1441  C  C   . VAL A 1 182 ? 19.234  59.240 82.678  1.00 17.63 ? 200  VAL A C   1 
ATOM   1442  O  O   . VAL A 1 182 ? 18.770  60.282 82.214  1.00 17.26 ? 200  VAL A O   1 
ATOM   1443  C  CB  . VAL A 1 182 ? 21.387  59.431 83.956  1.00 17.73 ? 200  VAL A CB  1 
ATOM   1444  C  CG1 . VAL A 1 182 ? 22.791  58.853 84.086  1.00 17.49 ? 200  VAL A CG1 1 
ATOM   1445  C  CG2 . VAL A 1 182 ? 21.398  60.962 84.064  1.00 17.50 ? 200  VAL A CG2 1 
ATOM   1446  N  N   . SER A 1 183 ? 18.490  58.291 83.239  1.00 17.71 ? 201  SER A N   1 
ATOM   1447  C  CA  . SER A 1 183 ? 17.109  58.523 83.639  1.00 17.91 ? 201  SER A CA  1 
ATOM   1448  C  C   . SER A 1 183 ? 17.076  58.928 85.107  1.00 17.49 ? 201  SER A C   1 
ATOM   1449  O  O   . SER A 1 183 ? 17.765  58.330 85.937  1.00 17.02 ? 201  SER A O   1 
ATOM   1450  C  CB  . SER A 1 183 ? 16.262  57.271 83.427  1.00 18.03 ? 201  SER A CB  1 
ATOM   1451  O  OG  . SER A 1 183 ? 16.194  56.964 82.050  1.00 20.19 ? 201  SER A OG  1 
ATOM   1452  N  N   . LEU A 1 184 ? 16.256  59.933 85.406  1.00 17.59 ? 202  LEU A N   1 
ATOM   1453  C  CA  . LEU A 1 184 ? 16.123  60.487 86.752  1.00 17.77 ? 202  LEU A CA  1 
ATOM   1454  C  C   . LEU A 1 184 ? 14.796  60.115 87.414  1.00 18.25 ? 202  LEU A C   1 
ATOM   1455  O  O   . LEU A 1 184 ? 13.751  60.100 86.770  1.00 18.85 ? 202  LEU A O   1 
ATOM   1456  C  CB  . LEU A 1 184 ? 16.289  62.009 86.722  1.00 17.51 ? 202  LEU A CB  1 
ATOM   1457  C  CG  . LEU A 1 184 ? 17.557  62.578 86.074  1.00 16.80 ? 202  LEU A CG  1 
ATOM   1458  C  CD1 . LEU A 1 184 ? 17.619  64.097 86.211  1.00 16.14 ? 202  LEU A CD1 1 
ATOM   1459  C  CD2 . LEU A 1 184 ? 18.809  61.928 86.658  1.00 16.87 ? 202  LEU A CD2 1 
ATOM   1460  N  N   . TRP A 1 185 ? 14.856  59.790 88.699  1.00 18.68 ? 203  TRP A N   1 
ATOM   1461  C  CA  . TRP A 1 185 ? 13.672  59.496 89.495  1.00 19.09 ? 203  TRP A CA  1 
ATOM   1462  C  C   . TRP A 1 185 ? 13.321  60.748 90.301  1.00 19.10 ? 203  TRP A C   1 
ATOM   1463  O  O   . TRP A 1 185 ? 14.105  61.185 91.136  1.00 18.96 ? 203  TRP A O   1 
ATOM   1464  C  CB  . TRP A 1 185 ? 13.965  58.305 90.404  1.00 19.30 ? 203  TRP A CB  1 
ATOM   1465  C  CG  . TRP A 1 185 ? 12.881  57.913 91.365  1.00 20.52 ? 203  TRP A CG  1 
ATOM   1466  C  CD1 . TRP A 1 185 ? 12.891  58.087 92.717  1.00 21.69 ? 203  TRP A CD1 1 
ATOM   1467  C  CD2 . TRP A 1 185 ? 11.646  57.252 91.053  1.00 22.12 ? 203  TRP A CD2 1 
ATOM   1468  N  NE1 . TRP A 1 185 ? 11.736  57.585 93.271  1.00 22.92 ? 203  TRP A NE1 1 
ATOM   1469  C  CE2 . TRP A 1 185 ? 10.950  57.071 92.272  1.00 22.71 ? 203  TRP A CE2 1 
ATOM   1470  C  CE3 . TRP A 1 185 ? 11.057  56.800 89.862  1.00 22.53 ? 203  TRP A CE3 1 
ATOM   1471  C  CZ2 . TRP A 1 185 ? 9.693   56.452 92.338  1.00 23.31 ? 203  TRP A CZ2 1 
ATOM   1472  C  CZ3 . TRP A 1 185 ? 9.798   56.192 89.925  1.00 23.08 ? 203  TRP A CZ3 1 
ATOM   1473  C  CH2 . TRP A 1 185 ? 9.136   56.016 91.158  1.00 23.69 ? 203  TRP A CH2 1 
ATOM   1474  N  N   . ALA A 1 186 ? 12.163  61.340 90.011  1.00 19.32 ? 204  ALA A N   1 
ATOM   1475  C  CA  . ALA A 1 186 ? 11.719  62.566 90.683  1.00 19.86 ? 204  ALA A CA  1 
ATOM   1476  C  C   . ALA A 1 186 ? 10.534  62.303 91.611  1.00 20.29 ? 204  ALA A C   1 
ATOM   1477  O  O   . ALA A 1 186 ? 9.393   62.188 91.162  1.00 20.59 ? 204  ALA A O   1 
ATOM   1478  C  CB  . ALA A 1 186 ? 11.374  63.648 89.665  1.00 19.40 ? 204  ALA A CB  1 
ATOM   1479  N  N   . ASN A 1 187 ? 10.826  62.210 92.905  1.00 20.61 ? 205  ASN A N   1 
ATOM   1480  C  CA  . ASN A 1 187 ? 9.819   62.004 93.938  1.00 20.99 ? 205  ASN A CA  1 
ATOM   1481  C  C   . ASN A 1 187 ? 9.906   63.138 94.964  1.00 21.06 ? 205  ASN A C   1 
ATOM   1482  O  O   . ASN A 1 187 ? 10.854  63.194 95.743  1.00 20.87 ? 205  ASN A O   1 
ATOM   1483  C  CB  . ASN A 1 187 ? 10.026  60.639 94.611  1.00 20.99 ? 205  ASN A CB  1 
ATOM   1484  C  CG  . ASN A 1 187 ? 8.913   60.282 95.589  1.00 21.91 ? 205  ASN A CG  1 
ATOM   1485  O  OD1 . ASN A 1 187 ? 7.992   61.072 95.830  1.00 21.42 ? 205  ASN A OD1 1 
ATOM   1486  N  ND2 . ASN A 1 187 ? 8.993   59.074 96.155  1.00 21.91 ? 205  ASN A ND2 1 
ATOM   1487  N  N   . PRO A 1 188 ? 8.907   64.038 94.977  1.00 21.45 ? 206  PRO A N   1 
ATOM   1488  C  CA  . PRO A 1 188 ? 8.975   65.222 95.835  1.00 21.67 ? 206  PRO A CA  1 
ATOM   1489  C  C   . PRO A 1 188 ? 8.878   64.912 97.335  1.00 22.02 ? 206  PRO A C   1 
ATOM   1490  O  O   . PRO A 1 188 ? 9.036   65.821 98.152  1.00 21.69 ? 206  PRO A O   1 
ATOM   1491  C  CB  . PRO A 1 188 ? 7.773   66.050 95.376  1.00 21.61 ? 206  PRO A CB  1 
ATOM   1492  C  CG  . PRO A 1 188 ? 6.817   65.052 94.870  1.00 21.56 ? 206  PRO A CG  1 
ATOM   1493  C  CD  . PRO A 1 188 ? 7.650   63.996 94.209  1.00 21.26 ? 206  PRO A CD  1 
ATOM   1494  N  N   . LYS A 1 189 ? 8.634   63.644 97.681  1.00 22.46 ? 207  LYS A N   1 
ATOM   1495  C  CA  . LYS A 1 189 ? 8.606   63.195 99.083  1.00 23.26 ? 207  LYS A CA  1 
ATOM   1496  C  C   . LYS A 1 189 ? 9.977   63.272 99.769  1.00 23.15 ? 207  LYS A C   1 
ATOM   1497  O  O   . LYS A 1 189 ? 10.054  63.342 100.994 1.00 23.16 ? 207  LYS A O   1 
ATOM   1498  C  CB  . LYS A 1 189 ? 8.038   61.770 99.209  1.00 23.30 ? 207  LYS A CB  1 
ATOM   1499  C  CG  . LYS A 1 189 ? 6.507   61.692 99.193  1.00 25.41 ? 207  LYS A CG  1 
ATOM   1500  C  CD  . LYS A 1 189 ? 6.007   60.348 99.776  1.00 28.55 ? 207  LYS A CD  1 
ATOM   1501  C  CE  . LYS A 1 189 ? 4.567   60.002 99.337  1.00 29.43 ? 207  LYS A CE  1 
ATOM   1502  N  NZ  . LYS A 1 189 ? 4.235   58.524 99.450  1.00 28.27 ? 207  LYS A NZ  1 
ATOM   1503  N  N   . TYR A 1 190 ? 11.051  63.249 98.982  1.00 23.24 ? 208  TYR A N   1 
ATOM   1504  C  CA  . TYR A 1 190 ? 12.402  63.382 99.533  1.00 23.30 ? 208  TYR A CA  1 
ATOM   1505  C  C   . TYR A 1 190 ? 12.981  64.763 99.253  1.00 22.75 ? 208  TYR A C   1 
ATOM   1506  O  O   . TYR A 1 190 ? 12.712  65.366 98.210  1.00 22.85 ? 208  TYR A O   1 
ATOM   1507  C  CB  . TYR A 1 190 ? 13.344  62.301 98.989  1.00 23.75 ? 208  TYR A CB  1 
ATOM   1508  C  CG  . TYR A 1 190 ? 12.801  60.895 99.071  1.00 25.40 ? 208  TYR A CG  1 
ATOM   1509  C  CD1 . TYR A 1 190 ? 12.717  60.224 100.288 1.00 27.82 ? 208  TYR A CD1 1 
ATOM   1510  C  CD2 . TYR A 1 190 ? 12.388  60.229 97.926  1.00 27.75 ? 208  TYR A CD2 1 
ATOM   1511  C  CE1 . TYR A 1 190 ? 12.214  58.923 100.358 1.00 29.24 ? 208  TYR A CE1 1 
ATOM   1512  C  CE2 . TYR A 1 190 ? 11.890  58.937 97.982  1.00 28.97 ? 208  TYR A CE2 1 
ATOM   1513  C  CZ  . TYR A 1 190 ? 11.805  58.290 99.198  1.00 29.85 ? 208  TYR A CZ  1 
ATOM   1514  O  OH  . TYR A 1 190 ? 11.306  57.004 99.244  1.00 31.36 ? 208  TYR A OH  1 
ATOM   1515  N  N   . VAL A 1 191 ? 13.765  65.259 100.205 1.00 22.04 ? 209  VAL A N   1 
ATOM   1516  C  CA  . VAL A 1 191 ? 14.465  66.532 100.061 1.00 21.39 ? 209  VAL A CA  1 
ATOM   1517  C  C   . VAL A 1 191 ? 15.962  66.294 100.296 1.00 20.72 ? 209  VAL A C   1 
ATOM   1518  O  O   . VAL A 1 191 ? 16.344  65.610 101.247 1.00 20.87 ? 209  VAL A O   1 
ATOM   1519  C  CB  . VAL A 1 191 ? 13.869  67.626 101.011 1.00 21.45 ? 209  VAL A CB  1 
ATOM   1520  C  CG1 . VAL A 1 191 ? 14.109  67.296 102.475 1.00 22.28 ? 209  VAL A CG1 1 
ATOM   1521  C  CG2 . VAL A 1 191 ? 14.431  68.984 100.700 1.00 21.78 ? 209  VAL A CG2 1 
ATOM   1522  N  N   . ARG A 1 192 ? 16.804  66.829 99.417  1.00 19.69 ? 210  ARG A N   1 
ATOM   1523  C  CA  . ARG A 1 192 ? 18.254  66.669 99.565  1.00 18.96 ? 210  ARG A CA  1 
ATOM   1524  C  C   . ARG A 1 192 ? 18.792  67.586 100.657 1.00 18.43 ? 210  ARG A C   1 
ATOM   1525  O  O   . ARG A 1 192 ? 19.638  67.189 101.463 1.00 18.25 ? 210  ARG A O   1 
ATOM   1526  C  CB  . ARG A 1 192 ? 18.985  66.950 98.245  1.00 18.30 ? 210  ARG A CB  1 
ATOM   1527  C  CG  . ARG A 1 192 ? 20.414  66.429 98.231  1.00 18.17 ? 210  ARG A CG  1 
ATOM   1528  C  CD  . ARG A 1 192 ? 21.252  66.987 97.080  1.00 16.52 ? 210  ARG A CD  1 
ATOM   1529  N  NE  . ARG A 1 192 ? 21.578  68.408 97.233  1.00 16.58 ? 210  ARG A NE  1 
ATOM   1530  C  CZ  . ARG A 1 192 ? 22.575  68.890 97.981  1.00 16.21 ? 210  ARG A CZ  1 
ATOM   1531  N  NH1 . ARG A 1 192 ? 23.358  68.073 98.686  1.00 15.22 ? 210  ARG A NH1 1 
ATOM   1532  N  NH2 . ARG A 1 192 ? 22.783  70.202 98.033  1.00 13.99 ? 210  ARG A NH2 1 
ATOM   1533  N  N   . ALA A 1 193 ? 18.272  68.811 100.672 1.00 17.84 ? 211  ALA A N   1 
ATOM   1534  C  CA  . ALA A 1 193 ? 18.805  69.888 101.482 1.00 17.60 ? 211  ALA A CA  1 
ATOM   1535  C  C   . ALA A 1 193 ? 17.740  70.953 101.650 1.00 17.52 ? 211  ALA A C   1 
ATOM   1536  O  O   . ALA A 1 193 ? 16.861  71.096 100.804 1.00 17.80 ? 211  ALA A O   1 
ATOM   1537  C  CB  . ALA A 1 193 ? 20.039  70.486 100.813 1.00 17.23 ? 211  ALA A CB  1 
ATOM   1538  N  N   . TRP A 1 194 ? 17.836  71.719 102.730 1.00 17.48 ? 212  TRP A N   1 
ATOM   1539  C  CA  . TRP A 1 194 ? 16.840  72.740 103.031 1.00 17.75 ? 212  TRP A CA  1 
ATOM   1540  C  C   . TRP A 1 194 ? 17.490  74.059 103.417 1.00 17.65 ? 212  TRP A C   1 
ATOM   1541  O  O   . TRP A 1 194 ? 18.638  74.084 103.856 1.00 17.64 ? 212  TRP A O   1 
ATOM   1542  C  CB  . TRP A 1 194 ? 15.897  72.256 104.145 1.00 17.67 ? 212  TRP A CB  1 
ATOM   1543  C  CG  . TRP A 1 194 ? 16.611  71.686 105.330 1.00 18.28 ? 212  TRP A CG  1 
ATOM   1544  C  CD1 . TRP A 1 194 ? 16.937  72.340 106.481 1.00 18.00 ? 212  TRP A CD1 1 
ATOM   1545  C  CD2 . TRP A 1 194 ? 17.099  70.339 105.480 1.00 18.85 ? 212  TRP A CD2 1 
ATOM   1546  N  NE1 . TRP A 1 194 ? 17.589  71.490 107.342 1.00 18.93 ? 212  TRP A NE1 1 
ATOM   1547  C  CE2 . TRP A 1 194 ? 17.701  70.256 106.754 1.00 18.17 ? 212  TRP A CE2 1 
ATOM   1548  C  CE3 . TRP A 1 194 ? 17.075  69.196 104.663 1.00 18.44 ? 212  TRP A CE3 1 
ATOM   1549  C  CZ2 . TRP A 1 194 ? 18.279  69.084 107.231 1.00 17.66 ? 212  TRP A CZ2 1 
ATOM   1550  C  CZ3 . TRP A 1 194 ? 17.656  68.030 105.136 1.00 18.27 ? 212  TRP A CZ3 1 
ATOM   1551  C  CH2 . TRP A 1 194 ? 18.253  67.985 106.409 1.00 18.28 ? 212  TRP A CH2 1 
ATOM   1552  N  N   . LYS A 1 195 ? 16.752  75.153 103.226 1.00 18.08 ? 213  LYS A N   1 
ATOM   1553  C  CA  . LYS A 1 195 ? 17.166  76.469 103.703 1.00 18.50 ? 213  LYS A CA  1 
ATOM   1554  C  C   . LYS A 1 195 ? 17.358  76.359 105.209 1.00 18.19 ? 213  LYS A C   1 
ATOM   1555  O  O   . LYS A 1 195 ? 16.459  75.901 105.923 1.00 17.93 ? 213  LYS A O   1 
ATOM   1556  C  CB  . LYS A 1 195 ? 16.101  77.526 103.391 1.00 19.07 ? 213  LYS A CB  1 
ATOM   1557  C  CG  . LYS A 1 195 ? 15.627  77.559 101.940 1.00 21.30 ? 213  LYS A CG  1 
ATOM   1558  C  CD  . LYS A 1 195 ? 16.380  78.578 101.102 1.00 23.58 ? 213  LYS A CD  1 
ATOM   1559  C  CE  . LYS A 1 195 ? 15.678  78.759 99.767  1.00 25.62 ? 213  LYS A CE  1 
ATOM   1560  N  NZ  . LYS A 1 195 ? 15.642  80.187 99.325  1.00 27.05 ? 213  LYS A NZ  1 
ATOM   1561  N  N   . GLY A 1 196 ? 18.540  76.751 105.677 1.00 17.85 ? 214  GLY A N   1 
ATOM   1562  C  CA  . GLY A 1 196 ? 18.918  76.577 107.079 1.00 17.49 ? 214  GLY A CA  1 
ATOM   1563  C  C   . GLY A 1 196 ? 19.769  75.344 107.336 1.00 17.19 ? 214  GLY A C   1 
ATOM   1564  O  O   . GLY A 1 196 ? 20.335  75.190 108.421 1.00 17.01 ? 214  GLY A O   1 
ATOM   1565  N  N   . GLY A 1 197 ? 19.860  74.468 106.334 1.00 17.12 ? 215  GLY A N   1 
ATOM   1566  C  CA  . GLY A 1 197 ? 20.662  73.243 106.421 1.00 16.56 ? 215  GLY A CA  1 
ATOM   1567  C  C   . GLY A 1 197 ? 22.089  73.422 105.927 1.00 16.65 ? 215  GLY A C   1 
ATOM   1568  O  O   . GLY A 1 197 ? 22.621  74.535 105.933 1.00 16.46 ? 215  GLY A O   1 
ATOM   1569  N  N   . THR A 1 198 ? 22.700  72.322 105.482 1.00 16.63 ? 216  THR A N   1 
ATOM   1570  C  CA  . THR A 1 198 ? 24.119  72.298 105.117 1.00 16.65 ? 216  THR A CA  1 
ATOM   1571  C  C   . THR A 1 198 ? 24.385  71.815 103.678 1.00 16.65 ? 216  THR A C   1 
ATOM   1572  O  O   . THR A 1 198 ? 25.485  71.356 103.358 1.00 16.34 ? 216  THR A O   1 
ATOM   1573  C  CB  . THR A 1 198 ? 24.933  71.436 106.124 1.00 16.84 ? 216  THR A CB  1 
ATOM   1574  O  OG1 . THR A 1 198 ? 24.350  70.128 106.220 1.00 16.19 ? 216  THR A OG1 1 
ATOM   1575  C  CG2 . THR A 1 198 ? 24.960  72.098 107.510 1.00 16.94 ? 216  THR A CG2 1 
ATOM   1576  N  N   . GLY A 1 199 ? 23.379  71.948 102.816 1.00 16.84 ? 217  GLY A N   1 
ATOM   1577  C  CA  . GLY A 1 199 ? 23.455  71.491 101.431 1.00 17.05 ? 217  GLY A CA  1 
ATOM   1578  C  C   . GLY A 1 199 ? 24.478  72.197 100.561 1.00 17.51 ? 217  GLY A C   1 
ATOM   1579  O  O   . GLY A 1 199 ? 24.872  71.671 99.521  1.00 17.17 ? 217  GLY A O   1 
ATOM   1580  N  N   . ASP A 1 200 ? 24.910  73.382 100.985 1.00 17.98 ? 218  ASP A N   1 
ATOM   1581  C  CA  . ASP A 1 200 ? 25.949  74.120 100.269 1.00 18.94 ? 218  ASP A CA  1 
ATOM   1582  C  C   . ASP A 1 200 ? 27.361  73.768 100.755 1.00 19.31 ? 218  ASP A C   1 
ATOM   1583  O  O   . ASP A 1 200 ? 28.327  74.437 100.408 1.00 19.28 ? 218  ASP A O   1 
ATOM   1584  C  CB  . ASP A 1 200 ? 25.684  75.639 100.303 1.00 19.45 ? 218  ASP A CB  1 
ATOM   1585  C  CG  . ASP A 1 200 ? 25.631  76.218 101.727 1.00 20.41 ? 218  ASP A CG  1 
ATOM   1586  O  OD1 . ASP A 1 200 ? 25.351  75.476 102.696 1.00 20.75 ? 218  ASP A OD1 1 
ATOM   1587  O  OD2 . ASP A 1 200 ? 25.859  77.441 101.862 1.00 21.81 ? 218  ASP A OD2 1 
ATOM   1588  N  N   . CYS A 1 201 ? 27.460  72.700 101.546 1.00 20.09 ? 219  CYS A N   1 
ATOM   1589  C  CA  . CYS A 1 201 ? 28.736  72.172 102.029 1.00 20.91 ? 219  CYS A CA  1 
ATOM   1590  C  C   . CYS A 1 201 ? 28.847  70.690 101.721 1.00 20.29 ? 219  CYS A C   1 
ATOM   1591  O  O   . CYS A 1 201 ? 27.841  70.005 101.551 1.00 20.35 ? 219  CYS A O   1 
ATOM   1592  C  CB  . CYS A 1 201 ? 28.860  72.355 103.545 1.00 21.00 ? 219  CYS A CB  1 
ATOM   1593  S  SG  . CYS A 1 201 ? 28.987  74.047 104.075 1.00 25.65 ? 219  CYS A SG  1 
ATOM   1594  N  N   . LYS A 1 202 ? 30.080  70.200 101.671 1.00 20.45 ? 220  LYS A N   1 
ATOM   1595  C  CA  . LYS A 1 202 ? 30.346  68.788 101.431 1.00 20.08 ? 220  LYS A CA  1 
ATOM   1596  C  C   . LYS A 1 202 ? 30.546  68.015 102.731 1.00 20.01 ? 220  LYS A C   1 
ATOM   1597  O  O   . LYS A 1 202 ? 31.524  67.282 102.899 1.00 19.92 ? 220  LYS A O   1 
ATOM   1598  C  CB  . LYS A 1 202 ? 31.540  68.629 100.499 1.00 20.35 ? 220  LYS A CB  1 
ATOM   1599  C  CG  . LYS A 1 202 ? 31.157  68.284 99.080  1.00 20.59 ? 220  LYS A CG  1 
ATOM   1600  C  CD  . LYS A 1 202 ? 32.254  68.696 98.118  1.00 21.93 ? 220  LYS A CD  1 
ATOM   1601  C  CE  . LYS A 1 202 ? 32.570  67.586 97.161  1.00 22.66 ? 220  LYS A CE  1 
ATOM   1602  N  NZ  . LYS A 1 202 ? 31.352  67.215 96.391  1.00 24.50 ? 220  LYS A NZ  1 
ATOM   1603  N  N   . MET A 1 203 ? 29.604  68.193 103.650 1.00 19.79 ? 221  MET A N   1 
ATOM   1604  C  CA  . MET A 1 203 ? 29.593  67.451 104.893 1.00 19.67 ? 221  MET A CA  1 
ATOM   1605  C  C   . MET A 1 203 ? 28.893  66.125 104.656 1.00 19.30 ? 221  MET A C   1 
ATOM   1606  O  O   . MET A 1 203 ? 27.885  66.070 103.936 1.00 19.35 ? 221  MET A O   1 
ATOM   1607  C  CB  . MET A 1 203 ? 28.921  68.267 105.998 1.00 20.21 ? 221  MET A CB  1 
ATOM   1608  C  CG  . MET A 1 203 ? 29.830  69.374 106.568 1.00 21.66 ? 221  MET A CG  1 
ATOM   1609  S  SD  . MET A 1 203 ? 28.965  70.530 107.665 1.00 26.32 ? 221  MET A SD  1 
ATOM   1610  C  CE  . MET A 1 203 ? 28.245  71.602 106.455 1.00 27.73 ? 221  MET A CE  1 
ATOM   1611  N  N   . GLY A 1 204 ? 29.445  65.065 105.245 1.00 18.57 ? 222  GLY A N   1 
ATOM   1612  C  CA  . GLY A 1 204 ? 28.993  63.693 105.016 1.00 18.24 ? 222  GLY A CA  1 
ATOM   1613  C  C   . GLY A 1 204 ? 27.511  63.471 105.225 1.00 18.21 ? 222  GLY A C   1 
ATOM   1614  O  O   . GLY A 1 204 ? 26.884  62.720 104.484 1.00 17.93 ? 222  GLY A O   1 
ATOM   1615  N  N   . GLY A 1 205 ? 26.955  64.151 106.228 1.00 18.28 ? 223  GLY A N   1 
ATOM   1616  C  CA  . GLY A 1 205 ? 25.536  64.056 106.581 1.00 17.96 ? 223  GLY A CA  1 
ATOM   1617  C  C   . GLY A 1 205 ? 24.524  64.326 105.477 1.00 17.81 ? 223  GLY A C   1 
ATOM   1618  O  O   . GLY A 1 205 ? 23.405  63.812 105.533 1.00 17.80 ? 223  GLY A O   1 
ATOM   1619  N  N   . ASN A 1 206 ? 24.910  65.129 104.485 1.00 17.47 ? 224  ASN A N   1 
ATOM   1620  C  CA  . ASN A 1 206 ? 24.059  65.438 103.325 1.00 17.33 ? 224  ASN A CA  1 
ATOM   1621  C  C   . ASN A 1 206 ? 23.816  64.241 102.419 1.00 17.27 ? 224  ASN A C   1 
ATOM   1622  O  O   . ASN A 1 206 ? 22.879  64.246 101.614 1.00 17.89 ? 224  ASN A O   1 
ATOM   1623  C  CB  . ASN A 1 206 ? 24.694  66.546 102.471 1.00 17.32 ? 224  ASN A CB  1 
ATOM   1624  C  CG  . ASN A 1 206 ? 24.900  67.844 103.228 1.00 17.68 ? 224  ASN A CG  1 
ATOM   1625  O  OD1 . ASN A 1 206 ? 25.863  68.557 102.979 1.00 19.08 ? 224  ASN A OD1 1 
ATOM   1626  N  ND2 . ASN A 1 206 ? 24.004  68.155 104.151 1.00 18.88 ? 224  ASN A ND2 1 
ATOM   1627  N  N   . TYR A 1 207 ? 24.660  63.220 102.552 1.00 16.95 ? 225  TYR A N   1 
ATOM   1628  C  CA  . TYR A 1 207 ? 24.725  62.125 101.588 1.00 16.70 ? 225  TYR A CA  1 
ATOM   1629  C  C   . TYR A 1 207 ? 24.142  60.810 102.096 1.00 16.95 ? 225  TYR A C   1 
ATOM   1630  O  O   . TYR A 1 207 ? 23.560  60.055 101.318 1.00 17.01 ? 225  TYR A O   1 
ATOM   1631  C  CB  . TYR A 1 207 ? 26.166  61.962 101.075 1.00 16.26 ? 225  TYR A CB  1 
ATOM   1632  C  CG  . TYR A 1 207 ? 26.673  63.260 100.469 1.00 16.57 ? 225  TYR A CG  1 
ATOM   1633  C  CD1 . TYR A 1 207 ? 27.342  64.201 101.251 1.00 15.15 ? 225  TYR A CD1 1 
ATOM   1634  C  CD2 . TYR A 1 207 ? 26.427  63.570 99.129  1.00 15.99 ? 225  TYR A CD2 1 
ATOM   1635  C  CE1 . TYR A 1 207 ? 27.765  65.413 100.718 1.00 15.85 ? 225  TYR A CE1 1 
ATOM   1636  C  CE2 . TYR A 1 207 ? 26.851  64.776 98.586  1.00 16.59 ? 225  TYR A CE2 1 
ATOM   1637  C  CZ  . TYR A 1 207 ? 27.519  65.693 99.391  1.00 16.22 ? 225  TYR A CZ  1 
ATOM   1638  O  OH  . TYR A 1 207 ? 27.941  66.886 98.865  1.00 16.39 ? 225  TYR A OH  1 
ATOM   1639  N  N   . GLY A 1 208 ? 24.308  60.537 103.390 1.00 17.14 ? 226  GLY A N   1 
ATOM   1640  C  CA  . GLY A 1 208 ? 23.733  59.344 104.019 1.00 17.54 ? 226  GLY A CA  1 
ATOM   1641  C  C   . GLY A 1 208 ? 22.217  59.315 103.942 1.00 17.64 ? 226  GLY A C   1 
ATOM   1642  O  O   . GLY A 1 208 ? 21.615  58.246 103.869 1.00 17.52 ? 226  GLY A O   1 
ATOM   1643  N  N   . SER A 1 209 ? 21.614  60.502 103.950 1.00 17.96 ? 227  SER A N   1 
ATOM   1644  C  CA  . SER A 1 209 ? 20.162  60.670 103.851 1.00 18.53 ? 227  SER A CA  1 
ATOM   1645  C  C   . SER A 1 209 ? 19.611  60.446 102.437 1.00 18.32 ? 227  SER A C   1 
ATOM   1646  O  O   . SER A 1 209 ? 18.408  60.263 102.259 1.00 18.50 ? 227  SER A O   1 
ATOM   1647  C  CB  . SER A 1 209 ? 19.768  62.065 104.351 1.00 18.74 ? 227  SER A CB  1 
ATOM   1648  O  OG  . SER A 1 209 ? 20.536  63.063 103.701 1.00 20.09 ? 227  SER A OG  1 
ATOM   1649  N  N   . SER A 1 210 ? 20.494  60.437 101.441 1.00 18.05 ? 228  SER A N   1 
ATOM   1650  C  CA  . SER A 1 210 ? 20.089  60.361 100.037 1.00 17.87 ? 228  SER A CA  1 
ATOM   1651  C  C   . SER A 1 210 ? 20.060  58.924 99.491  1.00 17.81 ? 228  SER A C   1 
ATOM   1652  O  O   . SER A 1 210 ? 19.562  58.682 98.386  1.00 17.73 ? 228  SER A O   1 
ATOM   1653  C  CB  . SER A 1 210 ? 21.017  61.233 99.181  1.00 17.90 ? 228  SER A CB  1 
ATOM   1654  O  OG  . SER A 1 210 ? 22.210  60.533 98.864  1.00 18.50 ? 228  SER A OG  1 
ATOM   1655  N  N   . LEU A 1 211 ? 20.584  57.981 100.271 1.00 17.43 ? 229  LEU A N   1 
ATOM   1656  C  CA  . LEU A 1 211 ? 20.723  56.591 99.833  1.00 17.63 ? 229  LEU A CA  1 
ATOM   1657  C  C   . LEU A 1 211 ? 19.403  55.864 99.587  1.00 17.79 ? 229  LEU A C   1 
ATOM   1658  O  O   . LEU A 1 211 ? 19.302  55.065 98.645  1.00 17.87 ? 229  LEU A O   1 
ATOM   1659  C  CB  . LEU A 1 211 ? 21.587  55.797 100.817 1.00 17.52 ? 229  LEU A CB  1 
ATOM   1660  C  CG  . LEU A 1 211 ? 23.071  56.161 100.890 1.00 17.63 ? 229  LEU A CG  1 
ATOM   1661  C  CD1 . LEU A 1 211 ? 23.823  55.154 101.744 1.00 17.19 ? 229  LEU A CD1 1 
ATOM   1662  C  CD2 . LEU A 1 211 ? 23.662  56.202 99.494  1.00 19.86 ? 229  LEU A CD2 1 
ATOM   1663  N  N   . PHE A 1 212 ? 18.409  56.132 100.435 1.00 18.13 ? 230  PHE A N   1 
ATOM   1664  C  CA  . PHE A 1 212 ? 17.089  55.518 100.316 1.00 18.56 ? 230  PHE A CA  1 
ATOM   1665  C  C   . PHE A 1 212 ? 16.426  55.902 99.004  1.00 18.93 ? 230  PHE A C   1 
ATOM   1666  O  O   . PHE A 1 212 ? 15.934  55.041 98.285  1.00 18.99 ? 230  PHE A O   1 
ATOM   1667  C  CB  . PHE A 1 212 ? 16.185  55.906 101.495 1.00 18.47 ? 230  PHE A CB  1 
ATOM   1668  C  CG  . PHE A 1 212 ? 14.934  55.064 101.602 1.00 18.62 ? 230  PHE A CG  1 
ATOM   1669  C  CD1 . PHE A 1 212 ? 13.769  55.425 100.922 1.00 18.94 ? 230  PHE A CD1 1 
ATOM   1670  C  CD2 . PHE A 1 212 ? 14.927  53.905 102.371 1.00 18.31 ? 230  PHE A CD2 1 
ATOM   1671  C  CE1 . PHE A 1 212 ? 12.612  54.646 101.011 1.00 18.97 ? 230  PHE A CE1 1 
ATOM   1672  C  CE2 . PHE A 1 212 ? 13.776  53.117 102.471 1.00 18.61 ? 230  PHE A CE2 1 
ATOM   1673  C  CZ  . PHE A 1 212 ? 12.614  53.489 101.791 1.00 19.31 ? 230  PHE A CZ  1 
ATOM   1674  N  N   . ALA A 1 213 ? 16.416  57.200 98.710  1.00 19.60 ? 231  ALA A N   1 
ATOM   1675  C  CA  . ALA A 1 213 ? 15.863  57.710 97.464  1.00 20.54 ? 231  ALA A CA  1 
ATOM   1676  C  C   . ALA A 1 213 ? 16.588  57.118 96.247  1.00 21.22 ? 231  ALA A C   1 
ATOM   1677  O  O   . ALA A 1 213 ? 15.952  56.813 95.236  1.00 21.58 ? 231  ALA A O   1 
ATOM   1678  C  CB  . ALA A 1 213 ? 15.898  59.248 97.447  1.00 20.18 ? 231  ALA A CB  1 
ATOM   1679  N  N   . GLN A 1 214 ? 17.904  56.936 96.363  1.00 21.69 ? 232  GLN A N   1 
ATOM   1680  C  CA  . GLN A 1 214 ? 18.714  56.343 95.298  1.00 22.56 ? 232  GLN A CA  1 
ATOM   1681  C  C   . GLN A 1 214 ? 18.396  54.875 95.025  1.00 23.00 ? 232  GLN A C   1 
ATOM   1682  O  O   . GLN A 1 214 ? 18.442  54.437 93.873  1.00 23.09 ? 232  GLN A O   1 
ATOM   1683  C  CB  . GLN A 1 214 ? 20.213  56.525 95.592  1.00 22.71 ? 232  GLN A CB  1 
ATOM   1684  C  CG  . GLN A 1 214 ? 21.165  55.798 94.636  1.00 23.62 ? 232  GLN A CG  1 
ATOM   1685  C  CD  . GLN A 1 214 ? 21.119  56.326 93.205  1.00 25.12 ? 232  GLN A CD  1 
ATOM   1686  O  OE1 . GLN A 1 214 ? 20.689  57.452 92.953  1.00 26.01 ? 232  GLN A OE1 1 
ATOM   1687  N  NE2 . GLN A 1 214 ? 21.576  55.509 92.261  1.00 25.58 ? 232  GLN A NE2 1 
ATOM   1688  N  N   . CYS A 1 215 ? 18.100  54.116 96.079  1.00 23.58 ? 233  CYS A N   1 
ATOM   1689  C  CA  . CYS A 1 215 ? 17.705  52.716 95.929  1.00 24.47 ? 233  CYS A CA  1 
ATOM   1690  C  C   . CYS A 1 215 ? 16.353  52.597 95.239  1.00 24.79 ? 233  CYS A C   1 
ATOM   1691  O  O   . CYS A 1 215 ? 16.179  51.768 94.346  1.00 24.93 ? 233  CYS A O   1 
ATOM   1692  C  CB  . CYS A 1 215 ? 17.668  52.005 97.283  1.00 24.47 ? 233  CYS A CB  1 
ATOM   1693  S  SG  . CYS A 1 215 ? 19.289  51.739 97.986  1.00 25.54 ? 233  CYS A SG  1 
ATOM   1694  N  N   . GLU A 1 216 ? 15.409  53.435 95.661  1.00 25.32 ? 234  GLU A N   1 
ATOM   1695  C  CA  . GLU A 1 216 ? 14.083  53.503 95.058  1.00 26.06 ? 234  GLU A CA  1 
ATOM   1696  C  C   . GLU A 1 216 ? 14.192  53.926 93.594  1.00 26.43 ? 234  GLU A C   1 
ATOM   1697  O  O   . GLU A 1 216 ? 13.488  53.406 92.729  1.00 26.37 ? 234  GLU A O   1 
ATOM   1698  C  CB  . GLU A 1 216 ? 13.217  54.488 95.835  1.00 26.05 ? 234  GLU A CB  1 
ATOM   1699  C  CG  . GLU A 1 216 ? 11.776  54.534 95.398  1.00 27.36 ? 234  GLU A CG  1 
ATOM   1700  C  CD  . GLU A 1 216 ? 10.967  55.494 96.230  1.00 29.18 ? 234  GLU A CD  1 
ATOM   1701  O  OE1 . GLU A 1 216 ? 10.795  56.654 95.795  1.00 30.35 ? 234  GLU A OE1 1 
ATOM   1702  O  OE2 . GLU A 1 216 ? 10.524  55.095 97.329  1.00 29.61 ? 234  GLU A OE2 1 
ATOM   1703  N  N   . ASP A 1 217 ? 15.083  54.877 93.340  1.00 26.82 ? 235  ASP A N   1 
ATOM   1704  C  CA  . ASP A 1 217 ? 15.463  55.280 91.997  1.00 27.63 ? 235  ASP A CA  1 
ATOM   1705  C  C   . ASP A 1 217 ? 15.905  54.074 91.137  1.00 27.41 ? 235  ASP A C   1 
ATOM   1706  O  O   . ASP A 1 217 ? 15.378  53.855 90.042  1.00 27.06 ? 235  ASP A O   1 
ATOM   1707  C  CB  . ASP A 1 217 ? 16.554  56.351 92.109  1.00 28.08 ? 235  ASP A CB  1 
ATOM   1708  C  CG  . ASP A 1 217 ? 17.408  56.458 90.883  1.00 31.16 ? 235  ASP A CG  1 
ATOM   1709  O  OD1 . ASP A 1 217 ? 18.574  55.989 90.916  1.00 35.17 ? 235  ASP A OD1 1 
ATOM   1710  O  OD2 . ASP A 1 217 ? 16.923  57.020 89.885  1.00 34.92 ? 235  ASP A OD2 1 
ATOM   1711  N  N   . VAL A 1 218 ? 16.847  53.289 91.651  1.00 27.42 ? 236  VAL A N   1 
ATOM   1712  C  CA  . VAL A 1 218 ? 17.361  52.105 90.949  1.00 27.65 ? 236  VAL A CA  1 
ATOM   1713  C  C   . VAL A 1 218 ? 16.276  51.030 90.757  1.00 27.99 ? 236  VAL A C   1 
ATOM   1714  O  O   . VAL A 1 218 ? 16.204  50.394 89.700  1.00 28.15 ? 236  VAL A O   1 
ATOM   1715  C  CB  . VAL A 1 218 ? 18.614  51.530 91.661  1.00 27.56 ? 236  VAL A CB  1 
ATOM   1716  C  CG1 . VAL A 1 218 ? 18.983  50.153 91.119  1.00 28.05 ? 236  VAL A CG1 1 
ATOM   1717  C  CG2 . VAL A 1 218 ? 19.791  52.481 91.502  1.00 27.62 ? 236  VAL A CG2 1 
ATOM   1718  N  N   . ASP A 1 219 ? 15.427  50.848 91.769  1.00 28.11 ? 237  ASP A N   1 
ATOM   1719  C  CA  . ASP A 1 219 ? 14.317  49.894 91.697  1.00 28.38 ? 237  ASP A CA  1 
ATOM   1720  C  C   . ASP A 1 219 ? 13.328  50.225 90.585  1.00 28.01 ? 237  ASP A C   1 
ATOM   1721  O  O   . ASP A 1 219 ? 12.587  49.349 90.128  1.00 27.86 ? 237  ASP A O   1 
ATOM   1722  C  CB  . ASP A 1 219 ? 13.576  49.821 93.035  1.00 28.75 ? 237  ASP A CB  1 
ATOM   1723  C  CG  . ASP A 1 219 ? 14.356  49.077 94.099  1.00 30.08 ? 237  ASP A CG  1 
ATOM   1724  O  OD1 . ASP A 1 219 ? 13.922  49.110 95.269  1.00 31.66 ? 237  ASP A OD1 1 
ATOM   1725  O  OD2 . ASP A 1 219 ? 15.399  48.463 93.777  1.00 31.81 ? 237  ASP A OD2 1 
ATOM   1726  N  N   . ASN A 1 220 ? 13.323  51.490 90.164  1.00 27.50 ? 238  ASN A N   1 
ATOM   1727  C  CA  . ASN A 1 220 ? 12.450  51.965 89.092  1.00 26.97 ? 238  ASN A CA  1 
ATOM   1728  C  C   . ASN A 1 220 ? 13.181  52.202 87.764  1.00 26.31 ? 238  ASN A C   1 
ATOM   1729  O  O   . ASN A 1 220 ? 12.651  52.849 86.860  1.00 26.10 ? 238  ASN A O   1 
ATOM   1730  C  CB  . ASN A 1 220 ? 11.701  53.217 89.543  1.00 27.22 ? 238  ASN A CB  1 
ATOM   1731  C  CG  . ASN A 1 220 ? 10.662  52.917 90.612  1.00 28.27 ? 238  ASN A CG  1 
ATOM   1732  O  OD1 . ASN A 1 220 ? 10.894  53.138 91.805  1.00 29.15 ? 238  ASN A OD1 1 
ATOM   1733  N  ND2 . ASN A 1 220 ? 9.514   52.401 90.189  1.00 28.31 ? 238  ASN A ND2 1 
ATOM   1734  N  N   . GLY A 1 221 ? 14.397  51.669 87.664  1.00 25.73 ? 239  GLY A N   1 
ATOM   1735  C  CA  . GLY A 1 221 ? 15.176  51.702 86.424  1.00 25.07 ? 239  GLY A CA  1 
ATOM   1736  C  C   . GLY A 1 221 ? 15.816  53.041 86.111  1.00 24.55 ? 239  GLY A C   1 
ATOM   1737  O  O   . GLY A 1 221 ? 16.124  53.330 84.956  1.00 24.65 ? 239  GLY A O   1 
ATOM   1738  N  N   . CYS A 1 222 ? 16.017  53.857 87.139  1.00 23.79 ? 240  CYS A N   1 
ATOM   1739  C  CA  . CYS A 1 222 ? 16.671  55.149 86.977  1.00 23.17 ? 240  CYS A CA  1 
ATOM   1740  C  C   . CYS A 1 222 ? 18.065  55.095 87.586  1.00 22.84 ? 240  CYS A C   1 
ATOM   1741  O  O   . CYS A 1 222 ? 18.310  54.318 88.509  1.00 23.08 ? 240  CYS A O   1 
ATOM   1742  C  CB  . CYS A 1 222 ? 15.841  56.257 87.619  1.00 23.05 ? 240  CYS A CB  1 
ATOM   1743  S  SG  . CYS A 1 222 ? 14.204  56.478 86.919  1.00 23.06 ? 240  CYS A SG  1 
ATOM   1744  N  N   . GLN A 1 223 ? 18.975  55.915 87.065  1.00 22.13 ? 241  GLN A N   1 
ATOM   1745  C  CA  . GLN A 1 223 ? 20.371  55.900 87.502  1.00 21.69 ? 241  GLN A CA  1 
ATOM   1746  C  C   . GLN A 1 223 ? 20.654  56.890 88.628  1.00 20.99 ? 241  GLN A C   1 
ATOM   1747  O  O   . GLN A 1 223 ? 21.521  56.650 89.464  1.00 21.42 ? 241  GLN A O   1 
ATOM   1748  C  CB  . GLN A 1 223 ? 21.315  56.162 86.318  1.00 21.86 ? 241  GLN A CB  1 
ATOM   1749  C  CG  . GLN A 1 223 ? 21.360  55.031 85.281  1.00 22.55 ? 241  GLN A CG  1 
ATOM   1750  C  CD  . GLN A 1 223 ? 20.089  54.939 84.447  1.00 23.67 ? 241  GLN A CD  1 
ATOM   1751  O  OE1 . GLN A 1 223 ? 19.628  55.935 83.890  1.00 23.26 ? 241  GLN A OE1 1 
ATOM   1752  N  NE2 . GLN A 1 223 ? 19.516  53.737 84.361  1.00 24.51 ? 241  GLN A NE2 1 
ATOM   1753  N  N   . GLN A 1 224 ? 19.931  58.004 88.634  1.00 20.06 ? 242  GLN A N   1 
ATOM   1754  C  CA  . GLN A 1 224 ? 20.120  59.049 89.629  1.00 18.98 ? 242  GLN A CA  1 
ATOM   1755  C  C   . GLN A 1 224 ? 18.775  59.626 90.074  1.00 18.28 ? 242  GLN A C   1 
ATOM   1756  O  O   . GLN A 1 224 ? 17.735  59.398 89.443  1.00 17.96 ? 242  GLN A O   1 
ATOM   1757  C  CB  . GLN A 1 224 ? 21.019  60.170 89.083  1.00 19.25 ? 242  GLN A CB  1 
ATOM   1758  C  CG  . GLN A 1 224 ? 22.494  59.806 88.881  1.00 20.14 ? 242  GLN A CG  1 
ATOM   1759  C  CD  . GLN A 1 224 ? 23.262  59.650 90.185  1.00 21.84 ? 242  GLN A CD  1 
ATOM   1760  O  OE1 . GLN A 1 224 ? 23.791  60.620 90.735  1.00 23.17 ? 242  GLN A OE1 1 
ATOM   1761  N  NE2 . GLN A 1 224 ? 23.346  58.419 90.676  1.00 22.45 ? 242  GLN A NE2 1 
ATOM   1762  N  N   . VAL A 1 225 ? 18.814  60.377 91.169  1.00 17.26 ? 243  VAL A N   1 
ATOM   1763  C  CA  . VAL A 1 225 ? 17.652  61.083 91.699  1.00 16.21 ? 243  VAL A CA  1 
ATOM   1764  C  C   . VAL A 1 225 ? 17.637  62.537 91.198  1.00 15.75 ? 243  VAL A C   1 
ATOM   1765  O  O   . VAL A 1 225 ? 18.663  63.224 91.237  1.00 15.31 ? 243  VAL A O   1 
ATOM   1766  C  CB  . VAL A 1 225 ? 17.679  61.052 93.259  1.00 16.30 ? 243  VAL A CB  1 
ATOM   1767  C  CG1 . VAL A 1 225 ? 16.585  61.937 93.862  1.00 16.38 ? 243  VAL A CG1 1 
ATOM   1768  C  CG2 . VAL A 1 225 ? 17.577  59.616 93.772  1.00 15.36 ? 243  VAL A CG2 1 
ATOM   1769  N  N   . LEU A 1 226 ? 16.486  63.004 90.715  1.00 15.08 ? 244  LEU A N   1 
ATOM   1770  C  CA  . LEU A 1 226 ? 16.296  64.439 90.513  1.00 14.91 ? 244  LEU A CA  1 
ATOM   1771  C  C   . LEU A 1 226 ? 15.743  65.044 91.808  1.00 14.71 ? 244  LEU A C   1 
ATOM   1772  O  O   . LEU A 1 226 ? 14.657  64.678 92.254  1.00 14.62 ? 244  LEU A O   1 
ATOM   1773  C  CB  . LEU A 1 226 ? 15.375  64.730 89.315  1.00 14.88 ? 244  LEU A CB  1 
ATOM   1774  C  CG  . LEU A 1 226 ? 14.990  66.192 89.046  1.00 15.03 ? 244  LEU A CG  1 
ATOM   1775  C  CD1 . LEU A 1 226 ? 16.214  67.047 88.726  1.00 14.72 ? 244  LEU A CD1 1 
ATOM   1776  C  CD2 . LEU A 1 226 ? 13.952  66.306 87.921  1.00 15.23 ? 244  LEU A CD2 1 
ATOM   1777  N  N   . TRP A 1 227 ? 16.498  65.958 92.411  1.00 14.67 ? 245  TRP A N   1 
ATOM   1778  C  CA  . TRP A 1 227 ? 16.159  66.496 93.726  1.00 14.83 ? 245  TRP A CA  1 
ATOM   1779  C  C   . TRP A 1 227 ? 15.218  67.697 93.635  1.00 15.67 ? 245  TRP A C   1 
ATOM   1780  O  O   . TRP A 1 227 ? 15.573  68.745 93.075  1.00 16.05 ? 245  TRP A O   1 
ATOM   1781  C  CB  . TRP A 1 227 ? 17.425  66.855 94.515  1.00 14.38 ? 245  TRP A CB  1 
ATOM   1782  C  CG  . TRP A 1 227 ? 18.266  65.657 94.873  1.00 13.02 ? 245  TRP A CG  1 
ATOM   1783  C  CD1 . TRP A 1 227 ? 19.468  65.312 94.329  1.00 11.95 ? 245  TRP A CD1 1 
ATOM   1784  C  CD2 . TRP A 1 227 ? 17.953  64.640 95.837  1.00 11.83 ? 245  TRP A CD2 1 
ATOM   1785  N  NE1 . TRP A 1 227 ? 19.929  64.151 94.903  1.00 12.33 ? 245  TRP A NE1 1 
ATOM   1786  C  CE2 . TRP A 1 227 ? 19.021  63.719 95.833  1.00 11.32 ? 245  TRP A CE2 1 
ATOM   1787  C  CE3 . TRP A 1 227 ? 16.875  64.425 96.712  1.00 11.60 ? 245  TRP A CE3 1 
ATOM   1788  C  CZ2 . TRP A 1 227 ? 19.044  62.587 96.665  1.00 11.37 ? 245  TRP A CZ2 1 
ATOM   1789  C  CZ3 . TRP A 1 227 ? 16.900  63.307 97.543  1.00 11.55 ? 245  TRP A CZ3 1 
ATOM   1790  C  CH2 . TRP A 1 227 ? 17.982  62.400 97.512  1.00 11.11 ? 245  TRP A CH2 1 
ATOM   1791  N  N   . LEU A 1 228 ? 14.024  67.532 94.204  1.00 16.12 ? 246  LEU A N   1 
ATOM   1792  C  CA  . LEU A 1 228 ? 12.975  68.553 94.155  1.00 16.57 ? 246  LEU A CA  1 
ATOM   1793  C  C   . LEU A 1 228 ? 12.877  69.286 95.483  1.00 16.83 ? 246  LEU A C   1 
ATOM   1794  O  O   . LEU A 1 228 ? 13.060  68.682 96.544  1.00 16.56 ? 246  LEU A O   1 
ATOM   1795  C  CB  . LEU A 1 228 ? 11.621  67.926 93.791  1.00 16.25 ? 246  LEU A CB  1 
ATOM   1796  C  CG  . LEU A 1 228 ? 11.540  67.096 92.503  1.00 16.59 ? 246  LEU A CG  1 
ATOM   1797  C  CD1 . LEU A 1 228 ? 10.158  66.503 92.356  1.00 17.42 ? 246  LEU A CD1 1 
ATOM   1798  C  CD2 . LEU A 1 228 ? 11.909  67.912 91.255  1.00 15.78 ? 246  LEU A CD2 1 
ATOM   1799  N  N   . TYR A 1 229 ? 12.598  70.589 95.418  1.00 17.29 ? 247  TYR A N   1 
ATOM   1800  C  CA  . TYR A 1 229 ? 12.470  71.399 96.629  1.00 18.01 ? 247  TYR A CA  1 
ATOM   1801  C  C   . TYR A 1 229 ? 11.295  72.368 96.606  1.00 18.52 ? 247  TYR A C   1 
ATOM   1802  O  O   . TYR A 1 229 ? 11.080  73.081 95.628  1.00 17.98 ? 247  TYR A O   1 
ATOM   1803  C  CB  . TYR A 1 229 ? 13.755  72.173 96.901  1.00 17.95 ? 247  TYR A CB  1 
ATOM   1804  C  CG  . TYR A 1 229 ? 13.773  72.882 98.236  1.00 18.59 ? 247  TYR A CG  1 
ATOM   1805  C  CD1 . TYR A 1 229 ? 14.022  72.177 99.412  1.00 18.97 ? 247  TYR A CD1 1 
ATOM   1806  C  CD2 . TYR A 1 229 ? 13.543  74.257 98.327  1.00 19.30 ? 247  TYR A CD2 1 
ATOM   1807  C  CE1 . TYR A 1 229 ? 14.046  72.814 100.640 1.00 19.55 ? 247  TYR A CE1 1 
ATOM   1808  C  CE2 . TYR A 1 229 ? 13.570  74.908 99.566  1.00 19.65 ? 247  TYR A CE2 1 
ATOM   1809  C  CZ  . TYR A 1 229 ? 13.823  74.175 100.714 1.00 19.75 ? 247  TYR A CZ  1 
ATOM   1810  O  OH  . TYR A 1 229 ? 13.859  74.792 101.951 1.00 21.45 ? 247  TYR A OH  1 
ATOM   1811  N  N   . GLY A 1 230 ? 10.557  72.400 97.714  1.00 19.61 ? 248  GLY A N   1 
ATOM   1812  C  CA  . GLY A 1 230 ? 9.486   73.374 97.905  1.00 20.89 ? 248  GLY A CA  1 
ATOM   1813  C  C   . GLY A 1 230 ? 8.152   72.977 97.305  1.00 21.85 ? 248  GLY A C   1 
ATOM   1814  O  O   . GLY A 1 230 ? 8.027   71.922 96.677  1.00 21.68 ? 248  GLY A O   1 
ATOM   1815  N  N   . ARG A 1 231 ? 7.159   73.840 97.500  1.00 22.88 ? 249  ARG A N   1 
ATOM   1816  C  CA  . ARG A 1 231 ? 5.790   73.584 97.045  1.00 24.51 ? 249  ARG A CA  1 
ATOM   1817  C  C   . ARG A 1 231 ? 5.710   73.695 95.523  1.00 24.30 ? 249  ARG A C   1 
ATOM   1818  O  O   . ARG A 1 231 ? 4.884   73.040 94.889  1.00 24.66 ? 249  ARG A O   1 
ATOM   1819  C  CB  . ARG A 1 231 ? 4.795   74.548 97.724  1.00 24.80 ? 249  ARG A CB  1 
ATOM   1820  C  CG  . ARG A 1 231 ? 5.099   74.794 99.199  1.00 28.17 ? 249  ARG A CG  1 
ATOM   1821  C  CD  . ARG A 1 231 ? 3.861   75.070 100.047 1.00 34.01 ? 249  ARG A CD  1 
ATOM   1822  N  NE  . ARG A 1 231 ? 4.216   75.225 101.464 1.00 38.00 ? 249  ARG A NE  1 
ATOM   1823  C  CZ  . ARG A 1 231 ? 3.363   75.575 102.429 1.00 40.25 ? 249  ARG A CZ  1 
ATOM   1824  N  NH1 . ARG A 1 231 ? 3.790   75.686 103.685 1.00 40.83 ? 249  ARG A NH1 1 
ATOM   1825  N  NH2 . ARG A 1 231 ? 2.084   75.819 102.145 1.00 41.03 ? 249  ARG A NH2 1 
ATOM   1826  N  N   . ASP A 1 232 ? 6.603   74.511 94.967  1.00 24.39 ? 250  ASP A N   1 
ATOM   1827  C  CA  . ASP A 1 232 ? 6.733   74.758 93.530  1.00 24.60 ? 250  ASP A CA  1 
ATOM   1828  C  C   . ASP A 1 232 ? 7.428   73.626 92.781  1.00 23.98 ? 250  ASP A C   1 
ATOM   1829  O  O   . ASP A 1 232 ? 7.418   73.600 91.548  1.00 23.93 ? 250  ASP A O   1 
ATOM   1830  C  CB  . ASP A 1 232 ? 7.544   76.036 93.307  1.00 25.08 ? 250  ASP A CB  1 
ATOM   1831  C  CG  . ASP A 1 232 ? 6.717   77.288 93.461  1.00 27.77 ? 250  ASP A CG  1 
ATOM   1832  O  OD1 . ASP A 1 232 ? 5.483   77.228 93.234  1.00 29.93 ? 250  ASP A OD1 1 
ATOM   1833  O  OD2 . ASP A 1 232 ? 7.310   78.344 93.794  1.00 31.17 ? 250  ASP A OD2 1 
ATOM   1834  N  N   . HIS A 1 233 ? 8.044   72.712 93.531  1.00 23.06 ? 251  HIS A N   1 
ATOM   1835  C  CA  . HIS A 1 233 ? 8.831   71.611 92.974  1.00 22.40 ? 251  HIS A CA  1 
ATOM   1836  C  C   . HIS A 1 233 ? 9.970   72.119 92.093  1.00 21.56 ? 251  HIS A C   1 
ATOM   1837  O  O   . HIS A 1 233 ? 10.068  71.783 90.914  1.00 21.48 ? 251  HIS A O   1 
ATOM   1838  C  CB  . HIS A 1 233 ? 7.945   70.601 92.235  1.00 22.49 ? 251  HIS A CB  1 
ATOM   1839  C  CG  . HIS A 1 233 ? 6.799   70.093 93.054  1.00 23.94 ? 251  HIS A CG  1 
ATOM   1840  N  ND1 . HIS A 1 233 ? 5.490   70.161 92.627  1.00 25.15 ? 251  HIS A ND1 1 
ATOM   1841  C  CD2 . HIS A 1 233 ? 6.763   69.524 94.284  1.00 24.36 ? 251  HIS A CD2 1 
ATOM   1842  C  CE1 . HIS A 1 233 ? 4.700   69.643 93.551  1.00 24.95 ? 251  HIS A CE1 1 
ATOM   1843  N  NE2 . HIS A 1 233 ? 5.447   69.252 94.567  1.00 24.91 ? 251  HIS A NE2 1 
ATOM   1844  N  N   . GLN A 1 234 ? 10.818  72.948 92.688  1.00 20.65 ? 252  GLN A N   1 
ATOM   1845  C  CA  . GLN A 1 234 ? 12.039  73.409 92.051  1.00 20.14 ? 252  GLN A CA  1 
ATOM   1846  C  C   . GLN A 1 234 ? 12.931  72.209 91.751  1.00 19.41 ? 252  GLN A C   1 
ATOM   1847  O  O   . GLN A 1 234 ? 13.087  71.327 92.590  1.00 19.55 ? 252  GLN A O   1 
ATOM   1848  C  CB  . GLN A 1 234 ? 12.782  74.389 92.968  1.00 20.16 ? 252  GLN A CB  1 
ATOM   1849  C  CG  . GLN A 1 234 ? 12.049  75.697 93.211  1.00 20.76 ? 252  GLN A CG  1 
ATOM   1850  C  CD  . GLN A 1 234 ? 12.760  76.622 94.188  1.00 22.53 ? 252  GLN A CD  1 
ATOM   1851  O  OE1 . GLN A 1 234 ? 12.344  77.766 94.373  1.00 24.35 ? 252  GLN A OE1 1 
ATOM   1852  N  NE2 . GLN A 1 234 ? 13.836  76.142 94.807  1.00 21.46 ? 252  GLN A NE2 1 
ATOM   1853  N  N   . ILE A 1 235 ? 13.482  72.165 90.545  1.00 18.64 ? 253  ILE A N   1 
ATOM   1854  C  CA  . ILE A 1 235 ? 14.524  71.200 90.223  1.00 18.14 ? 253  ILE A CA  1 
ATOM   1855  C  C   . ILE A 1 235 ? 15.861  71.788 90.682  1.00 17.77 ? 253  ILE A C   1 
ATOM   1856  O  O   . ILE A 1 235 ? 16.220  72.909 90.316  1.00 17.74 ? 253  ILE A O   1 
ATOM   1857  C  CB  . ILE A 1 235 ? 14.514  70.770 88.718  1.00 18.26 ? 253  ILE A CB  1 
ATOM   1858  C  CG1 . ILE A 1 235 ? 14.826  71.943 87.779  1.00 18.02 ? 253  ILE A CG1 1 
ATOM   1859  C  CG2 . ILE A 1 235 ? 13.175  70.117 88.366  1.00 17.27 ? 253  ILE A CG2 1 
ATOM   1860  C  CD1 . ILE A 1 235 ? 14.787  71.597 86.283  1.00 17.58 ? 253  ILE A CD1 1 
ATOM   1861  N  N   . THR A 1 236 ? 16.570  71.055 91.533  1.00 17.42 ? 254  THR A N   1 
ATOM   1862  C  CA  . THR A 1 236 ? 17.755  71.615 92.184  1.00 17.17 ? 254  THR A CA  1 
ATOM   1863  C  C   . THR A 1 236 ? 19.062  70.970 91.725  1.00 17.41 ? 254  THR A C   1 
ATOM   1864  O  O   . THR A 1 236 ? 19.943  71.658 91.210  1.00 17.58 ? 254  THR A O   1 
ATOM   1865  C  CB  . THR A 1 236 ? 17.651  71.584 93.745  1.00 17.20 ? 254  THR A CB  1 
ATOM   1866  O  OG1 . THR A 1 236 ? 17.759  70.236 94.225  1.00 15.92 ? 254  THR A OG1 1 
ATOM   1867  C  CG2 . THR A 1 236 ? 16.340  72.217 94.231  1.00 16.57 ? 254  THR A CG2 1 
ATOM   1868  N  N   . GLU A 1 237 ? 19.183  69.657 91.929  1.00 17.49 ? 255  GLU A N   1 
ATOM   1869  C  CA  . GLU A 1 237 ? 20.404  68.918 91.599  1.00 17.78 ? 255  GLU A CA  1 
ATOM   1870  C  C   . GLU A 1 237 ? 20.100  67.534 91.054  1.00 17.41 ? 255  GLU A C   1 
ATOM   1871  O  O   . GLU A 1 237 ? 19.040  66.966 91.332  1.00 17.53 ? 255  GLU A O   1 
ATOM   1872  C  CB  . GLU A 1 237 ? 21.324  68.808 92.822  1.00 17.91 ? 255  GLU A CB  1 
ATOM   1873  C  CG  . GLU A 1 237 ? 21.860  70.156 93.303  1.00 19.53 ? 255  GLU A CG  1 
ATOM   1874  C  CD  . GLU A 1 237 ? 23.192  70.042 93.969  1.00 21.78 ? 255  GLU A CD  1 
ATOM   1875  O  OE1 . GLU A 1 237 ? 23.992  69.187 93.539  1.00 25.95 ? 255  GLU A OE1 1 
ATOM   1876  O  OE2 . GLU A 1 237 ? 23.454  70.796 94.916  1.00 22.24 ? 255  GLU A OE2 1 
ATOM   1877  N  N   . VAL A 1 238 ? 21.025  67.006 90.260  1.00 17.04 ? 256  VAL A N   1 
ATOM   1878  C  CA  . VAL A 1 238 ? 20.900  65.650 89.731  1.00 16.99 ? 256  VAL A CA  1 
ATOM   1879  C  C   . VAL A 1 238 ? 21.882  64.736 90.460  1.00 16.74 ? 256  VAL A C   1 
ATOM   1880  O  O   . VAL A 1 238 ? 23.083  64.756 90.180  1.00 16.66 ? 256  VAL A O   1 
ATOM   1881  C  CB  . VAL A 1 238 ? 21.152  65.593 88.199  1.00 17.16 ? 256  VAL A CB  1 
ATOM   1882  C  CG1 . VAL A 1 238 ? 21.114  64.148 87.695  1.00 16.68 ? 256  VAL A CG1 1 
ATOM   1883  C  CG2 . VAL A 1 238 ? 20.137  66.433 87.453  1.00 16.91 ? 256  VAL A CG2 1 
ATOM   1884  N  N   . GLY A 1 239 ? 21.359  63.949 91.396  1.00 16.38 ? 257  GLY A N   1 
ATOM   1885  C  CA  . GLY A 1 239 ? 22.174  63.096 92.247  1.00 16.21 ? 257  GLY A CA  1 
ATOM   1886  C  C   . GLY A 1 239 ? 23.164  63.925 93.042  1.00 16.32 ? 257  GLY A C   1 
ATOM   1887  O  O   . GLY A 1 239 ? 22.769  64.740 93.880  1.00 16.42 ? 257  GLY A O   1 
ATOM   1888  N  N   . THR A 1 240 ? 24.449  63.728 92.749  1.00 16.08 ? 258  THR A N   1 
ATOM   1889  C  CA  . THR A 1 240 ? 25.535  64.490 93.368  1.00 15.64 ? 258  THR A CA  1 
ATOM   1890  C  C   . THR A 1 240 ? 26.149  65.467 92.357  1.00 15.59 ? 258  THR A C   1 
ATOM   1891  O  O   . THR A 1 240 ? 27.336  65.806 92.446  1.00 15.26 ? 258  THR A O   1 
ATOM   1892  C  CB  . THR A 1 240 ? 26.642  63.549 93.883  1.00 15.78 ? 258  THR A CB  1 
ATOM   1893  O  OG1 . THR A 1 240 ? 27.112  62.731 92.798  1.00 16.35 ? 258  THR A OG1 1 
ATOM   1894  C  CG2 . THR A 1 240 ? 26.128  62.659 95.015  1.00 15.09 ? 258  THR A CG2 1 
ATOM   1895  N  N   . MET A 1 241 ? 25.331  65.909 91.398  1.00 15.34 ? 259  MET A N   1 
ATOM   1896  C  CA  . MET A 1 241 ? 25.766  66.805 90.318  1.00 15.15 ? 259  MET A CA  1 
ATOM   1897  C  C   . MET A 1 241 ? 24.895  68.055 90.265  1.00 14.84 ? 259  MET A C   1 
ATOM   1898  O  O   . MET A 1 241 ? 23.722  68.007 90.630  1.00 14.81 ? 259  MET A O   1 
ATOM   1899  C  CB  . MET A 1 241 ? 25.665  66.102 88.965  1.00 15.13 ? 259  MET A CB  1 
ATOM   1900  C  CG  . MET A 1 241 ? 26.663  64.978 88.727  1.00 16.34 ? 259  MET A CG  1 
ATOM   1901  S  SD  . MET A 1 241 ? 26.358  64.104 87.169  1.00 17.57 ? 259  MET A SD  1 
ATOM   1902  C  CE  . MET A 1 241 ? 24.957  63.085 87.625  1.00 17.49 ? 259  MET A CE  1 
ATOM   1903  N  N   . ASN A 1 242 ? 25.459  69.169 89.806  1.00 14.02 ? 260  ASN A N   1 
ATOM   1904  C  CA  . ASN A 1 242 ? 24.655  70.368 89.576  1.00 14.11 ? 260  ASN A CA  1 
ATOM   1905  C  C   . ASN A 1 242 ? 23.752  70.253 88.342  1.00 13.96 ? 260  ASN A C   1 
ATOM   1906  O  O   . ASN A 1 242 ? 24.050  69.498 87.425  1.00 13.96 ? 260  ASN A O   1 
ATOM   1907  C  CB  . ASN A 1 242 ? 25.533  71.611 89.518  1.00 13.81 ? 260  ASN A CB  1 
ATOM   1908  C  CG  . ASN A 1 242 ? 26.070  71.983 90.875  1.00 14.56 ? 260  ASN A CG  1 
ATOM   1909  O  OD1 . ASN A 1 242 ? 25.302  72.289 91.793  1.00 15.52 ? 260  ASN A OD1 1 
ATOM   1910  N  ND2 . ASN A 1 242 ? 27.389  71.940 91.026  1.00 13.71 ? 260  ASN A ND2 1 
ATOM   1911  N  N   . LEU A 1 243 ? 22.651  70.997 88.333  1.00 13.68 ? 261  LEU A N   1 
ATOM   1912  C  CA  . LEU A 1 243 ? 21.662  70.879 87.267  1.00 13.62 ? 261  LEU A CA  1 
ATOM   1913  C  C   . LEU A 1 243 ? 21.754  72.028 86.260  1.00 13.30 ? 261  LEU A C   1 
ATOM   1914  O  O   . LEU A 1 243 ? 21.692  73.190 86.641  1.00 12.98 ? 261  LEU A O   1 
ATOM   1915  C  CB  . LEU A 1 243 ? 20.250  70.798 87.872  1.00 13.75 ? 261  LEU A CB  1 
ATOM   1916  C  CG  . LEU A 1 243 ? 19.027  70.448 87.008  1.00 14.15 ? 261  LEU A CG  1 
ATOM   1917  C  CD1 . LEU A 1 243 ? 18.583  71.622 86.136  1.00 14.45 ? 261  LEU A CD1 1 
ATOM   1918  C  CD2 . LEU A 1 243 ? 19.301  69.217 86.146  1.00 15.56 ? 261  LEU A CD2 1 
ATOM   1919  N  N   . PHE A 1 244 ? 21.907  71.686 84.979  1.00 13.18 ? 262  PHE A N   1 
ATOM   1920  C  CA  . PHE A 1 244 ? 21.855  72.667 83.887  1.00 13.27 ? 262  PHE A CA  1 
ATOM   1921  C  C   . PHE A 1 244 ? 20.735  72.355 82.895  1.00 13.52 ? 262  PHE A C   1 
ATOM   1922  O  O   . PHE A 1 244 ? 20.486  71.199 82.566  1.00 13.19 ? 262  PHE A O   1 
ATOM   1923  C  CB  . PHE A 1 244 ? 23.191  72.748 83.139  1.00 12.86 ? 262  PHE A CB  1 
ATOM   1924  C  CG  . PHE A 1 244 ? 24.270  73.484 83.884  1.00 12.71 ? 262  PHE A CG  1 
ATOM   1925  C  CD1 . PHE A 1 244 ? 25.134  72.800 84.742  1.00 11.96 ? 262  PHE A CD1 1 
ATOM   1926  C  CD2 . PHE A 1 244 ? 24.439  74.863 83.719  1.00 12.76 ? 262  PHE A CD2 1 
ATOM   1927  C  CE1 . PHE A 1 244 ? 26.136  73.474 85.431  1.00 10.25 ? 262  PHE A CE1 1 
ATOM   1928  C  CE2 . PHE A 1 244 ? 25.448  75.554 84.410  1.00 11.16 ? 262  PHE A CE2 1 
ATOM   1929  C  CZ  . PHE A 1 244 ? 26.299  74.851 85.263  1.00 11.57 ? 262  PHE A CZ  1 
ATOM   1930  N  N   . LEU A 1 245 ? 20.075  73.403 82.415  1.00 14.16 ? 263  LEU A N   1 
ATOM   1931  C  CA  . LEU A 1 245 ? 18.990  73.272 81.453  1.00 15.12 ? 263  LEU A CA  1 
ATOM   1932  C  C   . LEU A 1 245 ? 19.256  74.259 80.328  1.00 15.60 ? 263  LEU A C   1 
ATOM   1933  O  O   . LEU A 1 245 ? 19.376  75.460 80.566  1.00 15.87 ? 263  LEU A O   1 
ATOM   1934  C  CB  . LEU A 1 245 ? 17.650  73.614 82.114  1.00 14.86 ? 263  LEU A CB  1 
ATOM   1935  C  CG  . LEU A 1 245 ? 16.312  72.938 81.769  1.00 15.81 ? 263  LEU A CG  1 
ATOM   1936  C  CD1 . LEU A 1 245 ? 15.216  73.997 81.811  1.00 16.13 ? 263  LEU A CD1 1 
ATOM   1937  C  CD2 . LEU A 1 245 ? 16.248  72.180 80.439  1.00 15.39 ? 263  LEU A CD2 1 
ATOM   1938  N  N   . TYR A 1 246 ? 19.348  73.745 79.108  1.00 16.36 ? 264  TYR A N   1 
ATOM   1939  C  CA  . TYR A 1 246 ? 19.615  74.562 77.934  1.00 17.07 ? 264  TYR A CA  1 
ATOM   1940  C  C   . TYR A 1 246 ? 18.331  74.600 77.121  1.00 17.74 ? 264  TYR A C   1 
ATOM   1941  O  O   . TYR A 1 246 ? 17.852  73.570 76.645  1.00 17.63 ? 264  TYR A O   1 
ATOM   1942  C  CB  . TYR A 1 246 ? 20.792  73.972 77.143  1.00 16.93 ? 264  TYR A CB  1 
ATOM   1943  C  CG  . TYR A 1 246 ? 21.153  74.684 75.851  1.00 17.28 ? 264  TYR A CG  1 
ATOM   1944  C  CD1 . TYR A 1 246 ? 21.254  76.079 75.790  1.00 17.54 ? 264  TYR A CD1 1 
ATOM   1945  C  CD2 . TYR A 1 246 ? 21.433  73.952 74.696  1.00 16.66 ? 264  TYR A CD2 1 
ATOM   1946  C  CE1 . TYR A 1 246 ? 21.596  76.724 74.601  1.00 18.06 ? 264  TYR A CE1 1 
ATOM   1947  C  CE2 . TYR A 1 246 ? 21.781  74.582 73.510  1.00 16.85 ? 264  TYR A CE2 1 
ATOM   1948  C  CZ  . TYR A 1 246 ? 21.858  75.963 73.466  1.00 17.97 ? 264  TYR A CZ  1 
ATOM   1949  O  OH  . TYR A 1 246 ? 22.192  76.577 72.285  1.00 17.98 ? 264  TYR A OH  1 
ATOM   1950  N  N   . TRP A 1 247 ? 17.757  75.790 76.985  1.00 18.45 ? 265  TRP A N   1 
ATOM   1951  C  CA  . TRP A 1 247 ? 16.395  75.885 76.488  1.00 19.63 ? 265  TRP A CA  1 
ATOM   1952  C  C   . TRP A 1 247 ? 16.048  77.249 75.904  1.00 20.43 ? 265  TRP A C   1 
ATOM   1953  O  O   . TRP A 1 247 ? 16.851  78.188 75.941  1.00 20.72 ? 265  TRP A O   1 
ATOM   1954  C  CB  . TRP A 1 247 ? 15.406  75.496 77.612  1.00 19.42 ? 265  TRP A CB  1 
ATOM   1955  C  CG  . TRP A 1 247 ? 15.262  76.517 78.729  1.00 19.85 ? 265  TRP A CG  1 
ATOM   1956  C  CD1 . TRP A 1 247 ? 16.183  77.459 79.123  1.00 19.66 ? 265  TRP A CD1 1 
ATOM   1957  C  CD2 . TRP A 1 247 ? 14.138  76.676 79.602  1.00 19.79 ? 265  TRP A CD2 1 
ATOM   1958  N  NE1 . TRP A 1 247 ? 15.690  78.199 80.169  1.00 19.53 ? 265  TRP A NE1 1 
ATOM   1959  C  CE2 . TRP A 1 247 ? 14.438  77.739 80.486  1.00 20.14 ? 265  TRP A CE2 1 
ATOM   1960  C  CE3 . TRP A 1 247 ? 12.903  76.027 79.722  1.00 20.05 ? 265  TRP A CE3 1 
ATOM   1961  C  CZ2 . TRP A 1 247 ? 13.545  78.166 81.477  1.00 19.46 ? 265  TRP A CZ2 1 
ATOM   1962  C  CZ3 . TRP A 1 247 ? 12.016  76.457 80.711  1.00 20.62 ? 265  TRP A CZ3 1 
ATOM   1963  C  CH2 . TRP A 1 247 ? 12.346  77.513 81.574  1.00 19.02 ? 265  TRP A CH2 1 
ATOM   1964  N  N   . ILE A 1 248 ? 14.848  77.335 75.346  1.00 21.36 ? 266  ILE A N   1 
ATOM   1965  C  CA  . ILE A 1 248 ? 14.251  78.610 75.007  1.00 22.31 ? 266  ILE A CA  1 
ATOM   1966  C  C   . ILE A 1 248 ? 13.388  78.956 76.214  1.00 22.94 ? 266  ILE A C   1 
ATOM   1967  O  O   . ILE A 1 248 ? 12.455  78.215 76.549  1.00 23.07 ? 266  ILE A O   1 
ATOM   1968  C  CB  . ILE A 1 248 ? 13.403  78.530 73.703  1.00 22.21 ? 266  ILE A CB  1 
ATOM   1969  C  CG1 . ILE A 1 248 ? 14.211  77.931 72.530  1.00 22.51 ? 266  ILE A CG1 1 
ATOM   1970  C  CG2 . ILE A 1 248 ? 12.803  79.888 73.345  1.00 22.50 ? 266  ILE A CG2 1 
ATOM   1971  C  CD1 . ILE A 1 248 ? 15.501  78.675 72.142  1.00 22.18 ? 266  ILE A CD1 1 
ATOM   1972  N  N   . ASN A 1 249 ? 13.726  80.049 76.893  1.00 23.84 ? 267  ASN A N   1 
ATOM   1973  C  CA  . ASN A 1 249 ? 12.991  80.461 78.093  1.00 25.10 ? 267  ASN A CA  1 
ATOM   1974  C  C   . ASN A 1 249 ? 11.630  81.100 77.756  1.00 25.88 ? 267  ASN A C   1 
ATOM   1975  O  O   . ASN A 1 249 ? 11.243  81.156 76.585  1.00 26.03 ? 267  ASN A O   1 
ATOM   1976  C  CB  . ASN A 1 249 ? 13.856  81.362 78.996  1.00 24.65 ? 267  ASN A CB  1 
ATOM   1977  C  CG  . ASN A 1 249 ? 14.057  82.760 78.431  1.00 25.52 ? 267  ASN A CG  1 
ATOM   1978  O  OD1 . ASN A 1 249 ? 13.338  83.194 77.529  1.00 26.30 ? 267  ASN A OD1 1 
ATOM   1979  N  ND2 . ASN A 1 249 ? 15.036  83.479 78.972  1.00 25.14 ? 267  ASN A ND2 1 
ATOM   1980  N  N   . GLU A 1 250 ? 10.923  81.578 78.786  1.00 26.89 ? 268  GLU A N   1 
ATOM   1981  C  CA  . GLU A 1 250 ? 9.574   82.161 78.657  1.00 27.49 ? 268  GLU A CA  1 
ATOM   1982  C  C   . GLU A 1 250 ? 9.508   83.420 77.786  1.00 27.96 ? 268  GLU A C   1 
ATOM   1983  O  O   . GLU A 1 250 ? 8.439   83.773 77.276  1.00 28.09 ? 268  GLU A O   1 
ATOM   1984  C  CB  . GLU A 1 250 ? 8.995   82.482 80.040  1.00 27.61 ? 268  GLU A CB  1 
ATOM   1985  C  CG  . GLU A 1 250 ? 8.907   81.300 80.999  1.00 27.56 ? 268  GLU A CG  1 
ATOM   1986  C  CD  . GLU A 1 250 ? 10.154  81.116 81.864  1.00 28.28 ? 268  GLU A CD  1 
ATOM   1987  O  OE1 . GLU A 1 250 ? 10.109  80.265 82.783  1.00 27.59 ? 268  GLU A OE1 1 
ATOM   1988  O  OE2 . GLU A 1 250 ? 11.171  81.813 81.634  1.00 28.16 ? 268  GLU A OE2 1 
ATOM   1989  N  N   . ASP A 1 251 ? 10.647  84.093 77.633  1.00 28.51 ? 269  ASP A N   1 
ATOM   1990  C  CA  . ASP A 1 251 ? 10.749  85.305 76.820  1.00 28.79 ? 269  ASP A CA  1 
ATOM   1991  C  C   . ASP A 1 251 ? 11.096  84.994 75.363  1.00 28.58 ? 269  ASP A C   1 
ATOM   1992  O  O   . ASP A 1 251 ? 11.262  85.903 74.548  1.00 28.54 ? 269  ASP A O   1 
ATOM   1993  C  CB  . ASP A 1 251 ? 11.798  86.255 77.410  1.00 29.29 ? 269  ASP A CB  1 
ATOM   1994  C  CG  . ASP A 1 251 ? 11.422  86.767 78.795  1.00 30.97 ? 269  ASP A CG  1 
ATOM   1995  O  OD1 . ASP A 1 251 ? 12.295  86.754 79.695  1.00 33.05 ? 269  ASP A OD1 1 
ATOM   1996  O  OD2 . ASP A 1 251 ? 10.261  87.183 78.987  1.00 32.76 ? 269  ASP A OD2 1 
ATOM   1997  N  N   . GLY A 1 252 ? 11.203  83.709 75.039  1.00 28.33 ? 270  GLY A N   1 
ATOM   1998  C  CA  . GLY A 1 252 ? 11.591  83.279 73.697  1.00 28.10 ? 270  GLY A CA  1 
ATOM   1999  C  C   . GLY A 1 252 ? 13.088  83.353 73.432  1.00 27.99 ? 270  GLY A C   1 
ATOM   2000  O  O   . GLY A 1 252 ? 13.517  83.236 72.281  1.00 28.17 ? 270  GLY A O   1 
ATOM   2001  N  N   . GLU A 1 253 ? 13.880  83.536 74.491  1.00 27.67 ? 271  GLU A N   1 
ATOM   2002  C  CA  . GLU A 1 253 ? 15.340  83.665 74.384  1.00 27.41 ? 271  GLU A CA  1 
ATOM   2003  C  C   . GLU A 1 253 ? 16.054  82.337 74.633  1.00 26.53 ? 271  GLU A C   1 
ATOM   2004  O  O   . GLU A 1 253 ? 15.723  81.618 75.578  1.00 26.54 ? 271  GLU A O   1 
ATOM   2005  C  CB  . GLU A 1 253 ? 15.876  84.680 75.395  1.00 27.96 ? 271  GLU A CB  1 
ATOM   2006  C  CG  . GLU A 1 253 ? 15.259  86.069 75.359  1.00 29.90 ? 271  GLU A CG  1 
ATOM   2007  C  CD  . GLU A 1 253 ? 15.786  86.947 76.488  1.00 32.78 ? 271  GLU A CD  1 
ATOM   2008  O  OE1 . GLU A 1 253 ? 16.554  87.893 76.200  1.00 34.53 ? 271  GLU A OE1 1 
ATOM   2009  O  OE2 . GLU A 1 253 ? 15.456  86.679 77.668  1.00 34.05 ? 271  GLU A OE2 1 
ATOM   2010  N  N   . GLU A 1 254 ? 17.042  82.037 73.789  1.00 25.47 ? 272  GLU A N   1 
ATOM   2011  C  CA  . GLU A 1 254 ? 17.963  80.912 73.980  1.00 24.22 ? 272  GLU A CA  1 
ATOM   2012  C  C   . GLU A 1 254 ? 18.765  81.114 75.279  1.00 23.28 ? 272  GLU A C   1 
ATOM   2013  O  O   . GLU A 1 254 ? 19.424  82.146 75.459  1.00 22.85 ? 272  GLU A O   1 
ATOM   2014  C  CB  . GLU A 1 254 ? 18.905  80.819 72.776  1.00 24.33 ? 272  GLU A CB  1 
ATOM   2015  C  CG  . GLU A 1 254 ? 19.682  79.507 72.649  1.00 25.23 ? 272  GLU A CG  1 
ATOM   2016  C  CD  . GLU A 1 254 ? 20.854  79.596 71.672  1.00 26.30 ? 272  GLU A CD  1 
ATOM   2017  O  OE1 . GLU A 1 254 ? 20.870  80.504 70.814  1.00 27.57 ? 272  GLU A OE1 1 
ATOM   2018  O  OE2 . GLU A 1 254 ? 21.776  78.760 71.765  1.00 26.54 ? 272  GLU A OE2 1 
ATOM   2019  N  N   . GLU A 1 255 ? 18.706  80.129 76.177  1.00 22.01 ? 273  GLU A N   1 
ATOM   2020  C  CA  . GLU A 1 255 ? 19.226  80.306 77.541  1.00 20.87 ? 273  GLU A CA  1 
ATOM   2021  C  C   . GLU A 1 255 ? 19.856  79.055 78.169  1.00 19.94 ? 273  GLU A C   1 
ATOM   2022  O  O   . GLU A 1 255 ? 19.339  77.949 78.027  1.00 19.59 ? 273  GLU A O   1 
ATOM   2023  C  CB  . GLU A 1 255 ? 18.109  80.842 78.457  1.00 20.90 ? 273  GLU A CB  1 
ATOM   2024  C  CG  . GLU A 1 255 ? 18.503  81.032 79.923  1.00 21.02 ? 273  GLU A CG  1 
ATOM   2025  C  CD  . GLU A 1 255 ? 17.370  81.557 80.770  1.00 21.25 ? 273  GLU A CD  1 
ATOM   2026  O  OE1 . GLU A 1 255 ? 17.359  82.770 81.046  1.00 22.90 ? 273  GLU A OE1 1 
ATOM   2027  O  OE2 . GLU A 1 255 ? 16.486  80.770 81.154  1.00 21.02 ? 273  GLU A OE2 1 
ATOM   2028  N  N   . LEU A 1 256 ? 20.980  79.253 78.857  1.00 18.83 ? 274  LEU A N   1 
ATOM   2029  C  CA  . LEU A 1 256 ? 21.526  78.248 79.760  1.00 18.12 ? 274  LEU A CA  1 
ATOM   2030  C  C   . LEU A 1 256 ? 21.163  78.628 81.200  1.00 17.59 ? 274  LEU A C   1 
ATOM   2031  O  O   . LEU A 1 256 ? 21.623  79.647 81.721  1.00 17.72 ? 274  LEU A O   1 
ATOM   2032  C  CB  . LEU A 1 256 ? 23.049  78.100 79.593  1.00 17.73 ? 274  LEU A CB  1 
ATOM   2033  C  CG  . LEU A 1 256 ? 23.753  77.035 80.460  1.00 17.49 ? 274  LEU A CG  1 
ATOM   2034  C  CD1 . LEU A 1 256 ? 23.316  75.604 80.093  1.00 16.08 ? 274  LEU A CD1 1 
ATOM   2035  C  CD2 . LEU A 1 256 ? 25.274  77.166 80.410  1.00 15.30 ? 274  LEU A CD2 1 
ATOM   2036  N  N   . ALA A 1 257 ? 20.329  77.809 81.828  1.00 16.91 ? 275  ALA A N   1 
ATOM   2037  C  CA  . ALA A 1 257 ? 19.873  78.073 83.192  1.00 16.64 ? 275  ALA A CA  1 
ATOM   2038  C  C   . ALA A 1 257 ? 20.358  77.023 84.196  1.00 16.41 ? 275  ALA A C   1 
ATOM   2039  O  O   . ALA A 1 257 ? 20.493  75.841 83.866  1.00 16.17 ? 275  ALA A O   1 
ATOM   2040  C  CB  . ALA A 1 257 ? 18.364  78.185 83.231  1.00 16.35 ? 275  ALA A CB  1 
ATOM   2041  N  N   . THR A 1 258 ? 20.627  77.479 85.418  1.00 16.16 ? 276  THR A N   1 
ATOM   2042  C  CA  . THR A 1 258 ? 21.010  76.614 86.539  1.00 15.63 ? 276  THR A CA  1 
ATOM   2043  C  C   . THR A 1 258 ? 20.471  77.258 87.837  1.00 15.77 ? 276  THR A C   1 
ATOM   2044  O  O   . THR A 1 258 ? 20.401  78.485 87.923  1.00 16.15 ? 276  THR A O   1 
ATOM   2045  C  CB  . THR A 1 258 ? 22.557  76.396 86.575  1.00 15.60 ? 276  THR A CB  1 
ATOM   2046  O  OG1 . THR A 1 258 ? 22.889  75.273 87.402  1.00 14.44 ? 276  THR A OG1 1 
ATOM   2047  C  CG2 . THR A 1 258 ? 23.306  77.649 87.060  1.00 15.03 ? 276  THR A CG2 1 
ATOM   2048  N  N   . PRO A 1 259 ? 20.045  76.445 88.828  1.00 15.67 ? 277  PRO A N   1 
ATOM   2049  C  CA  . PRO A 1 259 ? 19.547  77.032 90.089  1.00 15.70 ? 277  PRO A CA  1 
ATOM   2050  C  C   . PRO A 1 259 ? 20.565  77.934 90.799  1.00 15.84 ? 277  PRO A C   1 
ATOM   2051  O  O   . PRO A 1 259 ? 21.770  77.676 90.725  1.00 16.14 ? 277  PRO A O   1 
ATOM   2052  C  CB  . PRO A 1 259 ? 19.233  75.806 90.948  1.00 15.51 ? 277  PRO A CB  1 
ATOM   2053  C  CG  . PRO A 1 259 ? 18.991  74.717 89.973  1.00 15.28 ? 277  PRO A CG  1 
ATOM   2054  C  CD  . PRO A 1 259 ? 19.947  74.974 88.844  1.00 15.40 ? 277  PRO A CD  1 
ATOM   2055  N  N   . PRO A 1 260 ? 20.085  78.997 91.475  1.00 15.89 ? 278  PRO A N   1 
ATOM   2056  C  CA  . PRO A 1 260 ? 21.000  79.910 92.151  1.00 15.64 ? 278  PRO A CA  1 
ATOM   2057  C  C   . PRO A 1 260 ? 21.538  79.338 93.458  1.00 15.60 ? 278  PRO A C   1 
ATOM   2058  O  O   . PRO A 1 260 ? 20.940  78.427 94.029  1.00 15.41 ? 278  PRO A O   1 
ATOM   2059  C  CB  . PRO A 1 260 ? 20.127  81.138 92.424  1.00 15.56 ? 278  PRO A CB  1 
ATOM   2060  C  CG  . PRO A 1 260 ? 18.760  80.602 92.571  1.00 15.69 ? 278  PRO A CG  1 
ATOM   2061  C  CD  . PRO A 1 260 ? 18.673  79.402 91.652  1.00 16.02 ? 278  PRO A CD  1 
ATOM   2062  N  N   . LEU A 1 261 ? 22.666  79.880 93.912  1.00 15.74 ? 279  LEU A N   1 
ATOM   2063  C  CA  . LEU A 1 261 ? 23.273  79.504 95.185  1.00 15.79 ? 279  LEU A CA  1 
ATOM   2064  C  C   . LEU A 1 261 ? 22.549  80.169 96.366  1.00 16.09 ? 279  LEU A C   1 
ATOM   2065  O  O   . LEU A 1 261 ? 23.065  81.103 96.992  1.00 15.76 ? 279  LEU A O   1 
ATOM   2066  C  CB  . LEU A 1 261 ? 24.771  79.855 95.183  1.00 15.48 ? 279  LEU A CB  1 
ATOM   2067  C  CG  . LEU A 1 261 ? 25.674  79.200 94.127  1.00 15.49 ? 279  LEU A CG  1 
ATOM   2068  C  CD1 . LEU A 1 261 ? 27.104  79.692 94.271  1.00 15.63 ? 279  LEU A CD1 1 
ATOM   2069  C  CD2 . LEU A 1 261 ? 25.631  77.683 94.192  1.00 12.34 ? 279  LEU A CD2 1 
ATOM   2070  N  N   . ASP A 1 262 ? 21.348  79.680 96.662  1.00 16.52 ? 280  ASP A N   1 
ATOM   2071  C  CA  . ASP A 1 262 ? 20.521  80.256 97.726  1.00 16.82 ? 280  ASP A CA  1 
ATOM   2072  C  C   . ASP A 1 262 ? 20.567  79.446 99.035  1.00 16.68 ? 280  ASP A C   1 
ATOM   2073  O  O   . ASP A 1 262 ? 19.774  79.679 99.953  1.00 16.86 ? 280  ASP A O   1 
ATOM   2074  C  CB  . ASP A 1 262 ? 19.077  80.436 97.231  1.00 17.11 ? 280  ASP A CB  1 
ATOM   2075  C  CG  . ASP A 1 262 ? 18.352  79.108 97.009  1.00 17.72 ? 280  ASP A CG  1 
ATOM   2076  O  OD1 . ASP A 1 262 ? 17.126  79.129 96.779  1.00 18.72 ? 280  ASP A OD1 1 
ATOM   2077  O  OD2 . ASP A 1 262 ? 18.994  78.042 97.063  1.00 19.21 ? 280  ASP A OD2 1 
ATOM   2078  N  N   . GLY A 1 263 ? 21.488  78.486 99.104  1.00 16.41 ? 281  GLY A N   1 
ATOM   2079  C  CA  . GLY A 1 263 ? 21.722  77.715 100.328 1.00 15.54 ? 281  GLY A CA  1 
ATOM   2080  C  C   . GLY A 1 263 ? 21.473  76.222 100.239 1.00 15.07 ? 281  GLY A C   1 
ATOM   2081  O  O   . GLY A 1 263 ? 21.947  75.475 101.090 1.00 15.39 ? 281  GLY A O   1 
ATOM   2082  N  N   . ILE A 1 264 ? 20.725  75.785 99.226  1.00 14.74 ? 282  ILE A N   1 
ATOM   2083  C  CA  . ILE A 1 264 ? 20.383  74.362 99.046  1.00 14.34 ? 282  ILE A CA  1 
ATOM   2084  C  C   . ILE A 1 264 ? 21.164  73.698 97.901  1.00 14.10 ? 282  ILE A C   1 
ATOM   2085  O  O   . ILE A 1 264 ? 21.023  72.493 97.655  1.00 14.03 ? 282  ILE A O   1 
ATOM   2086  C  CB  . ILE A 1 264 ? 18.851  74.142 98.838  1.00 14.42 ? 282  ILE A CB  1 
ATOM   2087  C  CG1 . ILE A 1 264 ? 18.374  74.753 97.509  1.00 15.09 ? 282  ILE A CG1 1 
ATOM   2088  C  CG2 . ILE A 1 264 ? 18.055  74.706 100.019 1.00 14.67 ? 282  ILE A CG2 1 
ATOM   2089  C  CD1 . ILE A 1 264 ? 16.922  74.423 97.143  1.00 14.54 ? 282  ILE A CD1 1 
ATOM   2090  N  N   . ILE A 1 265 ? 21.995  74.492 97.229  1.00 13.64 ? 283  ILE A N   1 
ATOM   2091  C  CA  . ILE A 1 265 ? 22.805  74.052 96.085  1.00 13.53 ? 283  ILE A CA  1 
ATOM   2092  C  C   . ILE A 1 265 ? 24.281  73.981 96.481  1.00 13.43 ? 283  ILE A C   1 
ATOM   2093  O  O   . ILE A 1 265 ? 24.823  74.929 97.060  1.00 13.34 ? 283  ILE A O   1 
ATOM   2094  C  CB  . ILE A 1 265 ? 22.641  75.037 94.873  1.00 13.41 ? 283  ILE A CB  1 
ATOM   2095  C  CG1 . ILE A 1 265 ? 21.170  75.159 94.442  1.00 13.06 ? 283  ILE A CG1 1 
ATOM   2096  C  CG2 . ILE A 1 265 ? 23.530  74.649 93.688  1.00 13.21 ? 283  ILE A CG2 1 
ATOM   2097  C  CD1 . ILE A 1 265 ? 20.477  73.831 94.114  1.00 13.57 ? 283  ILE A CD1 1 
ATOM   2098  N  N   . LEU A 1 266 ? 24.929  72.855 96.185  1.00 13.21 ? 284  LEU A N   1 
ATOM   2099  C  CA  . LEU A 1 266 ? 26.365  72.749 96.398  1.00 13.03 ? 284  LEU A CA  1 
ATOM   2100  C  C   . LEU A 1 266 ? 27.057  73.541 95.287  1.00 13.29 ? 284  LEU A C   1 
ATOM   2101  O  O   . LEU A 1 266 ? 26.802  73.282 94.109  1.00 13.21 ? 284  LEU A O   1 
ATOM   2102  C  CB  . LEU A 1 266 ? 26.811  71.279 96.399  1.00 12.81 ? 284  LEU A CB  1 
ATOM   2103  C  CG  . LEU A 1 266 ? 28.207  70.846 96.903  1.00 12.84 ? 284  LEU A CG  1 
ATOM   2104  C  CD1 . LEU A 1 266 ? 29.342  71.252 95.942  1.00 11.15 ? 284  LEU A CD1 1 
ATOM   2105  C  CD2 . LEU A 1 266 ? 28.497  71.336 98.323  1.00 11.97 ? 284  LEU A CD2 1 
ATOM   2106  N  N   . PRO A 1 267 ? 27.908  74.528 95.656  1.00 13.44 ? 285  PRO A N   1 
ATOM   2107  C  CA  . PRO A 1 267 ? 28.624  75.347 94.667  1.00 13.39 ? 285  PRO A CA  1 
ATOM   2108  C  C   . PRO A 1 267 ? 29.745  74.566 93.978  1.00 13.25 ? 285  PRO A C   1 
ATOM   2109  O  O   . PRO A 1 267 ? 30.907  74.646 94.389  1.00 13.00 ? 285  PRO A O   1 
ATOM   2110  C  CB  . PRO A 1 267 ? 29.207  76.506 95.502  1.00 13.36 ? 285  PRO A CB  1 
ATOM   2111  C  CG  . PRO A 1 267 ? 28.621  76.366 96.883  1.00 13.98 ? 285  PRO A CG  1 
ATOM   2112  C  CD  . PRO A 1 267 ? 28.239  74.931 97.036  1.00 13.69 ? 285  PRO A CD  1 
ATOM   2113  N  N   . GLY A 1 268 ? 29.394  73.814 92.938  1.00 13.14 ? 286  GLY A N   1 
ATOM   2114  C  CA  . GLY A 1 268 ? 30.372  73.003 92.226  1.00 13.10 ? 286  GLY A CA  1 
ATOM   2115  C  C   . GLY A 1 268 ? 31.429  73.811 91.494  1.00 13.28 ? 286  GLY A C   1 
ATOM   2116  O  O   . GLY A 1 268 ? 31.171  74.933 91.045  1.00 13.35 ? 286  GLY A O   1 
ATOM   2117  N  N   . VAL A 1 269 ? 32.625  73.237 91.392  1.00 13.37 ? 287  VAL A N   1 
ATOM   2118  C  CA  . VAL A 1 269 ? 33.711  73.802 90.590  1.00 13.28 ? 287  VAL A CA  1 
ATOM   2119  C  C   . VAL A 1 269 ? 33.359  73.705 89.107  1.00 13.45 ? 287  VAL A C   1 
ATOM   2120  O  O   . VAL A 1 269 ? 33.540  74.670 88.356  1.00 13.23 ? 287  VAL A O   1 
ATOM   2121  C  CB  . VAL A 1 269 ? 35.048  73.072 90.865  1.00 13.48 ? 287  VAL A CB  1 
ATOM   2122  C  CG1 . VAL A 1 269 ? 36.151  73.543 89.906  1.00 12.99 ? 287  VAL A CG1 1 
ATOM   2123  C  CG2 . VAL A 1 269 ? 35.477  73.291 92.305  1.00 13.23 ? 287  VAL A CG2 1 
ATOM   2124  N  N   . THR A 1 270 ? 32.850  72.542 88.694  1.00 13.42 ? 288  THR A N   1 
ATOM   2125  C  CA  . THR A 1 270 ? 32.436  72.333 87.310  1.00 13.43 ? 288  THR A CA  1 
ATOM   2126  C  C   . THR A 1 270 ? 31.341  73.326 86.932  1.00 13.67 ? 288  THR A C   1 
ATOM   2127  O  O   . THR A 1 270 ? 31.408  73.961 85.878  1.00 13.66 ? 288  THR A O   1 
ATOM   2128  C  CB  . THR A 1 270 ? 31.944  70.894 87.072  1.00 13.34 ? 288  THR A CB  1 
ATOM   2129  O  OG1 . THR A 1 270 ? 32.827  69.978 87.728  1.00 13.40 ? 288  THR A OG1 1 
ATOM   2130  C  CG2 . THR A 1 270 ? 31.899  70.578 85.575  1.00 13.06 ? 288  THR A CG2 1 
ATOM   2131  N  N   . ARG A 1 271 ? 30.346  73.452 87.810  1.00 14.10 ? 289  ARG A N   1 
ATOM   2132  C  CA  . ARG A 1 271 ? 29.275  74.441 87.682  1.00 14.42 ? 289  ARG A CA  1 
ATOM   2133  C  C   . ARG A 1 271 ? 29.810  75.870 87.466  1.00 14.99 ? 289  ARG A C   1 
ATOM   2134  O  O   . ARG A 1 271 ? 29.338  76.575 86.575  1.00 15.26 ? 289  ARG A O   1 
ATOM   2135  C  CB  . ARG A 1 271 ? 28.361  74.378 88.915  1.00 13.88 ? 289  ARG A CB  1 
ATOM   2136  C  CG  . ARG A 1 271 ? 27.184  75.352 88.909  1.00 13.33 ? 289  ARG A CG  1 
ATOM   2137  C  CD  . ARG A 1 271 ? 26.613  75.535 90.317  1.00 11.48 ? 289  ARG A CD  1 
ATOM   2138  N  NE  . ARG A 1 271 ? 25.534  76.520 90.353  1.00 10.36 ? 289  ARG A NE  1 
ATOM   2139  C  CZ  . ARG A 1 271 ? 25.711  77.833 90.510  1.00 9.54  ? 289  ARG A CZ  1 
ATOM   2140  N  NH1 . ARG A 1 271 ? 26.932  78.335 90.645  1.00 7.93  ? 289  ARG A NH1 1 
ATOM   2141  N  NH2 . ARG A 1 271 ? 24.662  78.648 90.524  1.00 8.54  ? 289  ARG A NH2 1 
ATOM   2142  N  N   . ARG A 1 272 ? 30.785  76.290 88.276  1.00 15.74 ? 290  ARG A N   1 
ATOM   2143  C  CA  . ARG A 1 272 ? 31.404  77.623 88.135  1.00 16.46 ? 290  ARG A CA  1 
ATOM   2144  C  C   . ARG A 1 272 ? 32.125  77.778 86.790  1.00 16.34 ? 290  ARG A C   1 
ATOM   2145  O  O   . ARG A 1 272 ? 31.960  78.788 86.101  1.00 16.40 ? 290  ARG A O   1 
ATOM   2146  C  CB  . ARG A 1 272 ? 32.347  77.908 89.320  1.00 16.87 ? 290  ARG A CB  1 
ATOM   2147  C  CG  . ARG A 1 272 ? 33.281  79.151 89.214  1.00 18.97 ? 290  ARG A CG  1 
ATOM   2148  C  CD  . ARG A 1 272 ? 32.557  80.467 88.883  1.00 24.03 ? 290  ARG A CD  1 
ATOM   2149  N  NE  . ARG A 1 272 ? 31.247  80.581 89.527  1.00 28.11 ? 290  ARG A NE  1 
ATOM   2150  C  CZ  . ARG A 1 272 ? 30.204  81.222 89.007  1.00 29.77 ? 290  ARG A CZ  1 
ATOM   2151  N  NH1 . ARG A 1 272 ? 30.297  81.810 87.821  1.00 30.65 ? 290  ARG A NH1 1 
ATOM   2152  N  NH2 . ARG A 1 272 ? 29.059  81.266 89.674  1.00 31.94 ? 290  ARG A NH2 1 
ATOM   2153  N  N   . CYS A 1 273 ? 32.903  76.765 86.418  1.00 16.16 ? 291  CYS A N   1 
ATOM   2154  C  CA  . CYS A 1 273 ? 33.617  76.753 85.141  1.00 16.40 ? 291  CYS A CA  1 
ATOM   2155  C  C   . CYS A 1 273 ? 32.690  76.863 83.932  1.00 16.22 ? 291  CYS A C   1 
ATOM   2156  O  O   . CYS A 1 273 ? 33.010  77.562 82.970  1.00 16.23 ? 291  CYS A O   1 
ATOM   2157  C  CB  . CYS A 1 273 ? 34.479  75.495 85.023  1.00 16.22 ? 291  CYS A CB  1 
ATOM   2158  S  SG  . CYS A 1 273 ? 35.817  75.449 86.210  1.00 18.43 ? 291  CYS A SG  1 
ATOM   2159  N  N   . ILE A 1 274 ? 31.557  76.160 83.980  1.00 16.24 ? 292  ILE A N   1 
ATOM   2160  C  CA  . ILE A 1 274 ? 30.579  76.178 82.884  1.00 16.37 ? 292  ILE A CA  1 
ATOM   2161  C  C   . ILE A 1 274 ? 29.926  77.559 82.757  1.00 16.93 ? 292  ILE A C   1 
ATOM   2162  O  O   . ILE A 1 274 ? 29.803  78.093 81.656  1.00 17.24 ? 292  ILE A O   1 
ATOM   2163  C  CB  . ILE A 1 274 ? 29.503  75.055 83.043  1.00 15.99 ? 292  ILE A CB  1 
ATOM   2164  C  CG1 . ILE A 1 274 ? 30.137  73.672 82.856  1.00 15.01 ? 292  ILE A CG1 1 
ATOM   2165  C  CG2 . ILE A 1 274 ? 28.337  75.254 82.070  1.00 15.41 ? 292  ILE A CG2 1 
ATOM   2166  C  CD1 . ILE A 1 274 ? 29.260  72.516 83.310  1.00 13.76 ? 292  ILE A CD1 1 
ATOM   2167  N  N   . LEU A 1 275 ? 29.516  78.126 83.889  1.00 17.51 ? 293  LEU A N   1 
ATOM   2168  C  CA  . LEU A 1 275 ? 29.014  79.498 83.939  1.00 18.09 ? 293  LEU A CA  1 
ATOM   2169  C  C   . LEU A 1 275 ? 30.031  80.493 83.366  1.00 18.39 ? 293  LEU A C   1 
ATOM   2170  O  O   . LEU A 1 275 ? 29.672  81.323 82.528  1.00 18.57 ? 293  LEU A O   1 
ATOM   2171  C  CB  . LEU A 1 275 ? 28.622  79.871 85.373  1.00 17.99 ? 293  LEU A CB  1 
ATOM   2172  C  CG  . LEU A 1 275 ? 27.150  79.901 85.838  1.00 18.74 ? 293  LEU A CG  1 
ATOM   2173  C  CD1 . LEU A 1 275 ? 26.132  79.279 84.869  1.00 17.56 ? 293  LEU A CD1 1 
ATOM   2174  C  CD2 . LEU A 1 275 ? 27.008  79.313 87.245  1.00 17.65 ? 293  LEU A CD2 1 
ATOM   2175  N  N   . ASP A 1 276 ? 31.292  80.390 83.799  1.00 18.49 ? 294  ASP A N   1 
ATOM   2176  C  CA  . ASP A 1 276 ? 32.378  81.219 83.262  1.00 18.83 ? 294  ASP A CA  1 
ATOM   2177  C  C   . ASP A 1 276 ? 32.502  81.085 81.748  1.00 19.08 ? 294  ASP A C   1 
ATOM   2178  O  O   . ASP A 1 276 ? 32.565  82.093 81.049  1.00 18.99 ? 294  ASP A O   1 
ATOM   2179  C  CB  . ASP A 1 276 ? 33.729  80.883 83.915  1.00 18.95 ? 294  ASP A CB  1 
ATOM   2180  C  CG  . ASP A 1 276 ? 33.810  81.316 85.368  1.00 19.71 ? 294  ASP A CG  1 
ATOM   2181  O  OD1 . ASP A 1 276 ? 34.814  80.970 86.034  1.00 19.41 ? 294  ASP A OD1 1 
ATOM   2182  O  OD2 . ASP A 1 276 ? 32.879  82.003 85.849  1.00 20.77 ? 294  ASP A OD2 1 
ATOM   2183  N  N   . LEU A 1 277 ? 32.532  79.843 81.261  1.00 19.13 ? 295  LEU A N   1 
ATOM   2184  C  CA  . LEU A 1 277 ? 32.649  79.543 79.825  1.00 19.52 ? 295  LEU A CA  1 
ATOM   2185  C  C   . LEU A 1 277 ? 31.520  80.143 79.010  1.00 19.66 ? 295  LEU A C   1 
ATOM   2186  O  O   . LEU A 1 277 ? 31.765  80.806 78.011  1.00 19.60 ? 295  LEU A O   1 
ATOM   2187  C  CB  . LEU A 1 277 ? 32.699  78.025 79.587  1.00 19.15 ? 295  LEU A CB  1 
ATOM   2188  C  CG  . LEU A 1 277 ? 34.007  77.297 79.247  1.00 19.45 ? 295  LEU A CG  1 
ATOM   2189  C  CD1 . LEU A 1 277 ? 35.281  78.103 79.536  1.00 18.56 ? 295  LEU A CD1 1 
ATOM   2190  C  CD2 . LEU A 1 277 ? 34.040  75.916 79.910  1.00 17.51 ? 295  LEU A CD2 1 
ATOM   2191  N  N   . ALA A 1 278 ? 30.290  79.909 79.455  1.00 20.32 ? 296  ALA A N   1 
ATOM   2192  C  CA  . ALA A 1 278 ? 29.092  80.349 78.746  1.00 21.11 ? 296  ALA A CA  1 
ATOM   2193  C  C   . ALA A 1 278 ? 28.978  81.870 78.698  1.00 21.86 ? 296  ALA A C   1 
ATOM   2194  O  O   . ALA A 1 278 ? 28.568  82.430 77.678  1.00 22.10 ? 296  ALA A O   1 
ATOM   2195  C  CB  . ALA A 1 278 ? 27.847  79.729 79.365  1.00 20.68 ? 296  ALA A CB  1 
ATOM   2196  N  N   . HIS A 1 279 ? 29.349  82.527 79.798  1.00 22.83 ? 297  HIS A N   1 
ATOM   2197  C  CA  . HIS A 1 279 ? 29.433  83.982 79.841  1.00 23.60 ? 297  HIS A CA  1 
ATOM   2198  C  C   . HIS A 1 279 ? 30.444  84.495 78.824  1.00 23.96 ? 297  HIS A C   1 
ATOM   2199  O  O   . HIS A 1 279 ? 30.175  85.464 78.118  1.00 24.39 ? 297  HIS A O   1 
ATOM   2200  C  CB  . HIS A 1 279 ? 29.824  84.479 81.232  1.00 23.46 ? 297  HIS A CB  1 
ATOM   2201  C  CG  . HIS A 1 279 ? 28.692  84.515 82.210  1.00 24.11 ? 297  HIS A CG  1 
ATOM   2202  N  ND1 . HIS A 1 279 ? 28.814  84.052 83.503  1.00 23.54 ? 297  HIS A ND1 1 
ATOM   2203  C  CD2 . HIS A 1 279 ? 27.419  84.966 82.090  1.00 23.87 ? 297  HIS A CD2 1 
ATOM   2204  C  CE1 . HIS A 1 279 ? 27.664  84.210 84.134  1.00 23.70 ? 297  HIS A CE1 1 
ATOM   2205  N  NE2 . HIS A 1 279 ? 26.802  84.761 83.299  1.00 23.75 ? 297  HIS A NE2 1 
ATOM   2206  N  N   . GLN A 1 280 ? 31.600  83.839 78.750  1.00 24.54 ? 298  GLN A N   1 
ATOM   2207  C  CA  . GLN A 1 280 ? 32.688  84.285 77.871  1.00 25.03 ? 298  GLN A CA  1 
ATOM   2208  C  C   . GLN A 1 280 ? 32.326  84.164 76.392  1.00 24.54 ? 298  GLN A C   1 
ATOM   2209  O  O   . GLN A 1 280 ? 32.521  85.111 75.627  1.00 24.73 ? 298  GLN A O   1 
ATOM   2210  C  CB  . GLN A 1 280 ? 34.003  83.548 78.171  1.00 25.39 ? 298  GLN A CB  1 
ATOM   2211  C  CG  . GLN A 1 280 ? 34.509  83.643 79.620  1.00 28.37 ? 298  GLN A CG  1 
ATOM   2212  C  CD  . GLN A 1 280 ? 34.091  84.918 80.358  1.00 32.40 ? 298  GLN A CD  1 
ATOM   2213  O  OE1 . GLN A 1 280 ? 34.202  86.034 79.833  1.00 34.61 ? 298  GLN A OE1 1 
ATOM   2214  N  NE2 . GLN A 1 280 ? 33.620  84.752 81.597  1.00 33.15 ? 298  GLN A NE2 1 
ATOM   2215  N  N   . TRP A 1 281 ? 31.795  83.005 76.005  1.00 23.83 ? 299  TRP A N   1 
ATOM   2216  C  CA  . TRP A 1 281 ? 31.294  82.778 74.645  1.00 23.40 ? 299  TRP A CA  1 
ATOM   2217  C  C   . TRP A 1 281 ? 30.358  83.883 74.174  1.00 23.38 ? 299  TRP A C   1 
ATOM   2218  O  O   . TRP A 1 281 ? 30.491  84.372 73.055  1.00 23.62 ? 299  TRP A O   1 
ATOM   2219  C  CB  . TRP A 1 281 ? 30.585  81.422 74.541  1.00 22.86 ? 299  TRP A CB  1 
ATOM   2220  C  CG  . TRP A 1 281 ? 31.493  80.244 74.757  1.00 22.12 ? 299  TRP A CG  1 
ATOM   2221  C  CD1 . TRP A 1 281 ? 32.840  80.190 74.526  1.00 21.29 ? 299  TRP A CD1 1 
ATOM   2222  C  CD2 . TRP A 1 281 ? 31.114  78.939 75.217  1.00 21.68 ? 299  TRP A CD2 1 
ATOM   2223  N  NE1 . TRP A 1 281 ? 33.322  78.942 74.827  1.00 21.38 ? 299  TRP A NE1 1 
ATOM   2224  C  CE2 . TRP A 1 281 ? 32.286  78.152 75.250  1.00 21.12 ? 299  TRP A CE2 1 
ATOM   2225  C  CE3 . TRP A 1 281 ? 29.896  78.358 75.608  1.00 20.38 ? 299  TRP A CE3 1 
ATOM   2226  C  CZ2 . TRP A 1 281 ? 32.278  76.812 75.661  1.00 20.57 ? 299  TRP A CZ2 1 
ATOM   2227  C  CZ3 . TRP A 1 281 ? 29.891  77.037 76.017  1.00 19.53 ? 299  TRP A CZ3 1 
ATOM   2228  C  CH2 . TRP A 1 281 ? 31.075  76.277 76.040  1.00 19.92 ? 299  TRP A CH2 1 
ATOM   2229  N  N   . GLY A 1 282 ? 29.409  84.258 75.030  1.00 23.28 ? 300  GLY A N   1 
ATOM   2230  C  CA  . GLY A 1 282 ? 28.482  85.346 74.746  1.00 23.09 ? 300  GLY A CA  1 
ATOM   2231  C  C   . GLY A 1 282 ? 27.512  85.065 73.617  1.00 22.95 ? 300  GLY A C   1 
ATOM   2232  O  O   . GLY A 1 282 ? 27.164  85.970 72.856  1.00 23.31 ? 300  GLY A O   1 
ATOM   2233  N  N   . GLU A 1 283 ? 27.054  83.819 73.523  1.00 22.58 ? 301  GLU A N   1 
ATOM   2234  C  CA  . GLU A 1 283 ? 26.217  83.383 72.408  1.00 22.30 ? 301  GLU A CA  1 
ATOM   2235  C  C   . GLU A 1 283 ? 24.745  83.241 72.784  1.00 22.39 ? 301  GLU A C   1 
ATOM   2236  O  O   . GLU A 1 283 ? 23.862  83.260 71.920  1.00 22.68 ? 301  GLU A O   1 
ATOM   2237  C  CB  . GLU A 1 283 ? 26.755  82.066 71.838  1.00 22.17 ? 301  GLU A CB  1 
ATOM   2238  C  CG  . GLU A 1 283 ? 28.128  82.216 71.185  1.00 21.88 ? 301  GLU A CG  1 
ATOM   2239  C  CD  . GLU A 1 283 ? 28.782  80.901 70.826  1.00 22.00 ? 301  GLU A CD  1 
ATOM   2240  O  OE1 . GLU A 1 283 ? 30.018  80.901 70.663  1.00 22.58 ? 301  GLU A OE1 1 
ATOM   2241  O  OE2 . GLU A 1 283 ? 28.080  79.874 70.700  1.00 22.48 ? 301  GLU A OE2 1 
ATOM   2242  N  N   . PHE A 1 284 ? 24.489  83.070 74.074  1.00 22.00 ? 302  PHE A N   1 
ATOM   2243  C  CA  . PHE A 1 284 ? 23.133  82.930 74.585  1.00 22.00 ? 302  PHE A CA  1 
ATOM   2244  C  C   . PHE A 1 284 ? 23.068  83.503 75.998  1.00 22.12 ? 302  PHE A C   1 
ATOM   2245  O  O   . PHE A 1 284 ? 24.104  83.829 76.592  1.00 22.03 ? 302  PHE A O   1 
ATOM   2246  C  CB  . PHE A 1 284 ? 22.668  81.462 74.555  1.00 21.68 ? 302  PHE A CB  1 
ATOM   2247  C  CG  . PHE A 1 284 ? 23.727  80.476 74.962  1.00 21.61 ? 302  PHE A CG  1 
ATOM   2248  C  CD1 . PHE A 1 284 ? 24.429  79.754 73.995  1.00 21.14 ? 302  PHE A CD1 1 
ATOM   2249  C  CD2 . PHE A 1 284 ? 24.033  80.272 76.308  1.00 21.21 ? 302  PHE A CD2 1 
ATOM   2250  C  CE1 . PHE A 1 284 ? 25.423  78.841 74.368  1.00 21.60 ? 302  PHE A CE1 1 
ATOM   2251  C  CE2 . PHE A 1 284 ? 25.024  79.366 76.692  1.00 21.05 ? 302  PHE A CE2 1 
ATOM   2252  C  CZ  . PHE A 1 284 ? 25.720  78.647 75.722  1.00 20.56 ? 302  PHE A CZ  1 
ATOM   2253  N  N   . LYS A 1 285 ? 21.851  83.633 76.521  1.00 22.31 ? 303  LYS A N   1 
ATOM   2254  C  CA  . LYS A 1 285 ? 21.636  84.102 77.885  1.00 22.54 ? 303  LYS A CA  1 
ATOM   2255  C  C   . LYS A 1 285 ? 22.086  83.031 78.886  1.00 22.41 ? 303  LYS A C   1 
ATOM   2256  O  O   . LYS A 1 285 ? 21.895  81.837 78.662  1.00 22.22 ? 303  LYS A O   1 
ATOM   2257  C  CB  . LYS A 1 285 ? 20.157  84.444 78.092  1.00 22.71 ? 303  LYS A CB  1 
ATOM   2258  C  CG  . LYS A 1 285 ? 19.866  85.245 79.346  1.00 23.60 ? 303  LYS A CG  1 
ATOM   2259  C  CD  . LYS A 1 285 ? 18.387  85.568 79.447  1.00 25.47 ? 303  LYS A CD  1 
ATOM   2260  C  CE  . LYS A 1 285 ? 18.058  86.238 80.769  1.00 26.91 ? 303  LYS A CE  1 
ATOM   2261  N  NZ  . LYS A 1 285 ? 16.584  86.224 81.009  1.00 27.96 ? 303  LYS A NZ  1 
ATOM   2262  N  N   . VAL A 1 286 ? 22.707  83.481 79.971  1.00 22.30 ? 304  VAL A N   1 
ATOM   2263  C  CA  . VAL A 1 286 ? 23.142  82.617 81.058  1.00 22.00 ? 304  VAL A CA  1 
ATOM   2264  C  C   . VAL A 1 286 ? 22.476  83.118 82.340  1.00 22.16 ? 304  VAL A C   1 
ATOM   2265  O  O   . VAL A 1 286 ? 22.720  84.250 82.773  1.00 22.20 ? 304  VAL A O   1 
ATOM   2266  C  CB  . VAL A 1 286 ? 24.682  82.652 81.221  1.00 22.20 ? 304  VAL A CB  1 
ATOM   2267  C  CG1 . VAL A 1 286 ? 25.128  81.746 82.366  1.00 21.80 ? 304  VAL A CG1 1 
ATOM   2268  C  CG2 . VAL A 1 286 ? 25.381  82.265 79.913  1.00 21.48 ? 304  VAL A CG2 1 
ATOM   2269  N  N   . SER A 1 287 ? 21.632  82.279 82.938  1.00 21.98 ? 305  SER A N   1 
ATOM   2270  C  CA  . SER A 1 287 ? 20.855  82.678 84.116  1.00 21.74 ? 305  SER A CA  1 
ATOM   2271  C  C   . SER A 1 287 ? 21.004  81.718 85.289  1.00 21.51 ? 305  SER A C   1 
ATOM   2272  O  O   . SER A 1 287 ? 20.796  80.511 85.149  1.00 21.32 ? 305  SER A O   1 
ATOM   2273  C  CB  . SER A 1 287 ? 19.370  82.805 83.772  1.00 21.69 ? 305  SER A CB  1 
ATOM   2274  O  OG  . SER A 1 287 ? 19.168  83.604 82.623  1.00 22.52 ? 305  SER A OG  1 
ATOM   2275  N  N   . GLU A 1 288 ? 21.368  82.263 86.445  1.00 21.32 ? 306  GLU A N   1 
ATOM   2276  C  CA  . GLU A 1 288 ? 21.235  81.531 87.694  1.00 21.34 ? 306  GLU A CA  1 
ATOM   2277  C  C   . GLU A 1 288 ? 19.845  81.858 88.195  1.00 21.21 ? 306  GLU A C   1 
ATOM   2278  O  O   . GLU A 1 288 ? 19.533  83.005 88.511  1.00 21.53 ? 306  GLU A O   1 
ATOM   2279  C  CB  . GLU A 1 288 ? 22.314  81.928 88.693  1.00 21.37 ? 306  GLU A CB  1 
ATOM   2280  C  CG  . GLU A 1 288 ? 23.702  81.517 88.242  1.00 21.43 ? 306  GLU A CG  1 
ATOM   2281  C  CD  . GLU A 1 288 ? 24.769  81.939 89.213  1.00 21.99 ? 306  GLU A CD  1 
ATOM   2282  O  OE1 . GLU A 1 288 ? 24.875  81.316 90.293  1.00 22.07 ? 306  GLU A OE1 1 
ATOM   2283  O  OE2 . GLU A 1 288 ? 25.513  82.887 88.887  1.00 22.21 ? 306  GLU A OE2 1 
ATOM   2284  N  N   . ARG A 1 289 ? 18.992  80.848 88.236  1.00 20.99 ? 307  ARG A N   1 
ATOM   2285  C  CA  . ARG A 1 289 ? 17.571  81.109 88.292  1.00 20.95 ? 307  ARG A CA  1 
ATOM   2286  C  C   . ARG A 1 289 ? 16.783  79.852 88.664  1.00 20.60 ? 307  ARG A C   1 
ATOM   2287  O  O   . ARG A 1 289 ? 17.227  78.729 88.403  1.00 20.10 ? 307  ARG A O   1 
ATOM   2288  C  CB  . ARG A 1 289 ? 17.167  81.725 86.940  1.00 21.11 ? 307  ARG A CB  1 
ATOM   2289  C  CG  . ARG A 1 289 ? 15.756  81.598 86.499  1.00 22.69 ? 307  ARG A CG  1 
ATOM   2290  C  CD  . ARG A 1 289 ? 15.665  80.780 85.221  1.00 22.52 ? 307  ARG A CD  1 
ATOM   2291  N  NE  . ARG A 1 289 ? 14.313  80.254 85.123  1.00 23.51 ? 307  ARG A NE  1 
ATOM   2292  C  CZ  . ARG A 1 289 ? 13.378  80.691 84.290  1.00 24.33 ? 307  ARG A CZ  1 
ATOM   2293  N  NH1 . ARG A 1 289 ? 13.640  81.657 83.416  1.00 24.62 ? 307  ARG A NH1 1 
ATOM   2294  N  NH2 . ARG A 1 289 ? 12.179  80.133 84.325  1.00 24.13 ? 307  ARG A NH2 1 
ATOM   2295  N  N   . TYR A 1 290 ? 15.637  80.051 89.315  1.00 20.32 ? 308  TYR A N   1 
ATOM   2296  C  CA  . TYR A 1 290 ? 14.765  78.949 89.701  1.00 20.19 ? 308  TYR A CA  1 
ATOM   2297  C  C   . TYR A 1 290 ? 14.126  78.289 88.497  1.00 20.10 ? 308  TYR A C   1 
ATOM   2298  O  O   . TYR A 1 290 ? 13.773  78.943 87.520  1.00 20.16 ? 308  TYR A O   1 
ATOM   2299  C  CB  . TYR A 1 290 ? 13.708  79.398 90.716  1.00 20.07 ? 308  TYR A CB  1 
ATOM   2300  C  CG  . TYR A 1 290 ? 14.338  79.840 92.013  1.00 20.72 ? 308  TYR A CG  1 
ATOM   2301  C  CD1 . TYR A 1 290 ? 14.192  81.152 92.475  1.00 20.90 ? 308  TYR A CD1 1 
ATOM   2302  C  CD2 . TYR A 1 290 ? 15.120  78.957 92.760  1.00 19.88 ? 308  TYR A CD2 1 
ATOM   2303  C  CE1 . TYR A 1 290 ? 14.790  81.561 93.659  1.00 20.71 ? 308  TYR A CE1 1 
ATOM   2304  C  CE2 . TYR A 1 290 ? 15.718  79.357 93.935  1.00 20.24 ? 308  TYR A CE2 1 
ATOM   2305  C  CZ  . TYR A 1 290 ? 15.551  80.656 94.382  1.00 20.42 ? 308  TYR A CZ  1 
ATOM   2306  O  OH  . TYR A 1 290 ? 16.155  81.049 95.550  1.00 20.98 ? 308  TYR A OH  1 
ATOM   2307  N  N   . LEU A 1 291 ? 14.009  76.975 88.595  1.00 20.00 ? 309  LEU A N   1 
ATOM   2308  C  CA  . LEU A 1 291 ? 13.526  76.127 87.531  1.00 20.16 ? 309  LEU A CA  1 
ATOM   2309  C  C   . LEU A 1 291 ? 12.629  75.119 88.220  1.00 20.26 ? 309  LEU A C   1 
ATOM   2310  O  O   . LEU A 1 291 ? 13.081  74.386 89.102  1.00 20.19 ? 309  LEU A O   1 
ATOM   2311  C  CB  . LEU A 1 291 ? 14.705  75.387 86.887  1.00 19.79 ? 309  LEU A CB  1 
ATOM   2312  C  CG  . LEU A 1 291 ? 15.504  75.801 85.644  1.00 19.99 ? 309  LEU A CG  1 
ATOM   2313  C  CD1 . LEU A 1 291 ? 15.266  77.217 85.150  1.00 18.42 ? 309  LEU A CD1 1 
ATOM   2314  C  CD2 . LEU A 1 291 ? 16.992  75.531 85.873  1.00 18.92 ? 309  LEU A CD2 1 
ATOM   2315  N  N   . THR A 1 292 ? 11.356  75.101 87.846  1.00 20.62 ? 310  THR A N   1 
ATOM   2316  C  CA  . THR A 1 292 ? 10.411  74.168 88.453  1.00 21.08 ? 310  THR A CA  1 
ATOM   2317  C  C   . THR A 1 292 ? 10.074  73.049 87.476  1.00 21.44 ? 310  THR A C   1 
ATOM   2318  O  O   . THR A 1 292 ? 10.418  73.135 86.300  1.00 21.34 ? 310  THR A O   1 
ATOM   2319  C  CB  . THR A 1 292 ? 9.127   74.882 88.910  1.00 21.00 ? 310  THR A CB  1 
ATOM   2320  O  OG1 . THR A 1 292 ? 8.469   75.455 87.774  1.00 20.47 ? 310  THR A OG1 1 
ATOM   2321  C  CG2 . THR A 1 292 ? 9.459   75.983 89.930  1.00 21.42 ? 310  THR A CG2 1 
ATOM   2322  N  N   . MET A 1 293 ? 9.413   72.003 87.972  1.00 22.18 ? 311  MET A N   1 
ATOM   2323  C  CA  . MET A 1 293 ? 8.927   70.918 87.123  1.00 23.05 ? 311  MET A CA  1 
ATOM   2324  C  C   . MET A 1 293 ? 7.894   71.407 86.107  1.00 23.59 ? 311  MET A C   1 
ATOM   2325  O  O   . MET A 1 293 ? 7.862   70.921 84.974  1.00 23.72 ? 311  MET A O   1 
ATOM   2326  C  CB  . MET A 1 293 ? 8.329   69.779 87.959  1.00 23.02 ? 311  MET A CB  1 
ATOM   2327  C  CG  . MET A 1 293 ? 9.348   68.844 88.602  1.00 23.91 ? 311  MET A CG  1 
ATOM   2328  S  SD  . MET A 1 293 ? 10.525  68.087 87.451  1.00 25.67 ? 311  MET A SD  1 
ATOM   2329  C  CE  . MET A 1 293 ? 9.456   67.148 86.360  1.00 25.04 ? 311  MET A CE  1 
ATOM   2330  N  N   . ASP A 1 294 ? 7.051   72.357 86.520  1.00 24.09 ? 312  ASP A N   1 
ATOM   2331  C  CA  . ASP A 1 294 ? 6.030   72.925 85.638  1.00 24.55 ? 312  ASP A CA  1 
ATOM   2332  C  C   . ASP A 1 294 ? 6.652   73.771 84.530  1.00 24.21 ? 312  ASP A C   1 
ATOM   2333  O  O   . ASP A 1 294 ? 6.206   73.708 83.387  1.00 24.06 ? 312  ASP A O   1 
ATOM   2334  C  CB  . ASP A 1 294 ? 4.984   73.728 86.429  1.00 24.83 ? 312  ASP A CB  1 
ATOM   2335  C  CG  . ASP A 1 294 ? 4.010   72.835 87.202  1.00 26.68 ? 312  ASP A CG  1 
ATOM   2336  O  OD1 . ASP A 1 294 ? 3.289   73.365 88.073  1.00 29.14 ? 312  ASP A OD1 1 
ATOM   2337  O  OD2 . ASP A 1 294 ? 3.951   71.609 86.945  1.00 28.82 ? 312  ASP A OD2 1 
ATOM   2338  N  N   . ASP A 1 295 ? 7.672   74.559 84.877  1.00 24.07 ? 313  ASP A N   1 
ATOM   2339  C  CA  . ASP A 1 295 ? 8.499   75.251 83.883  1.00 23.96 ? 313  ASP A CA  1 
ATOM   2340  C  C   . ASP A 1 295 ? 9.006   74.276 82.825  1.00 23.86 ? 313  ASP A C   1 
ATOM   2341  O  O   . ASP A 1 295 ? 8.954   74.567 81.635  1.00 23.73 ? 313  ASP A O   1 
ATOM   2342  C  CB  . ASP A 1 295 ? 9.720   75.904 84.535  1.00 24.16 ? 313  ASP A CB  1 
ATOM   2343  C  CG  . ASP A 1 295 ? 9.372   77.078 85.425  1.00 24.50 ? 313  ASP A CG  1 
ATOM   2344  O  OD1 . ASP A 1 295 ? 8.217   77.562 85.408  1.00 24.90 ? 313  ASP A OD1 1 
ATOM   2345  O  OD2 . ASP A 1 295 ? 10.286  77.519 86.149  1.00 24.98 ? 313  ASP A OD2 1 
ATOM   2346  N  N   . LEU A 1 296 ? 9.497   73.125 83.285  1.00 23.92 ? 314  LEU A N   1 
ATOM   2347  C  CA  . LEU A 1 296 ? 10.114  72.105 82.434  1.00 24.21 ? 314  LEU A CA  1 
ATOM   2348  C  C   . LEU A 1 296 ? 9.101   71.453 81.496  1.00 24.35 ? 314  LEU A C   1 
ATOM   2349  O  O   . LEU A 1 296 ? 9.335   71.367 80.291  1.00 24.09 ? 314  LEU A O   1 
ATOM   2350  C  CB  . LEU A 1 296 ? 10.762  71.018 83.302  1.00 23.92 ? 314  LEU A CB  1 
ATOM   2351  C  CG  . LEU A 1 296 ? 12.100  70.357 82.951  1.00 24.39 ? 314  LEU A CG  1 
ATOM   2352  C  CD1 . LEU A 1 296 ? 12.116  68.953 83.530  1.00 24.19 ? 314  LEU A CD1 1 
ATOM   2353  C  CD2 . LEU A 1 296 ? 12.421  70.319 81.456  1.00 24.21 ? 314  LEU A CD2 1 
ATOM   2354  N  N   . THR A 1 297 ? 7.988   70.983 82.063  1.00 24.72 ? 315  THR A N   1 
ATOM   2355  C  CA  . THR A 1 297 ? 6.961   70.264 81.308  1.00 25.21 ? 315  THR A CA  1 
ATOM   2356  C  C   . THR A 1 297 ? 6.239   71.164 80.302  1.00 25.59 ? 315  THR A C   1 
ATOM   2357  O  O   . THR A 1 297 ? 5.912   70.728 79.199  1.00 25.93 ? 315  THR A O   1 
ATOM   2358  C  CB  . THR A 1 297 ? 5.940   69.575 82.236  1.00 25.24 ? 315  THR A CB  1 
ATOM   2359  O  OG1 . THR A 1 297 ? 5.327   70.551 83.089  1.00 25.22 ? 315  THR A OG1 1 
ATOM   2360  C  CG2 . THR A 1 297 ? 6.625   68.507 83.087  1.00 25.27 ? 315  THR A CG2 1 
ATOM   2361  N  N   . THR A 1 298 ? 6.011   72.419 80.687  1.00 25.89 ? 316  THR A N   1 
ATOM   2362  C  CA  . THR A 1 298 ? 5.446   73.430 79.795  1.00 26.19 ? 316  THR A CA  1 
ATOM   2363  C  C   . THR A 1 298 ? 6.379   73.671 78.604  1.00 26.37 ? 316  THR A C   1 
ATOM   2364  O  O   . THR A 1 298 ? 5.931   73.700 77.453  1.00 26.62 ? 316  THR A O   1 
ATOM   2365  C  CB  . THR A 1 298 ? 5.153   74.755 80.559  1.00 26.14 ? 316  THR A CB  1 
ATOM   2366  O  OG1 . THR A 1 298 ? 4.159   74.513 81.563  1.00 26.40 ? 316  THR A OG1 1 
ATOM   2367  C  CG2 . THR A 1 298 ? 4.649   75.850 79.628  1.00 26.47 ? 316  THR A CG2 1 
ATOM   2368  N  N   . ALA A 1 299 ? 7.671   73.817 78.884  1.00 26.28 ? 317  ALA A N   1 
ATOM   2369  C  CA  . ALA A 1 299 ? 8.663   74.046 77.834  1.00 26.65 ? 317  ALA A CA  1 
ATOM   2370  C  C   . ALA A 1 299 ? 8.804   72.848 76.889  1.00 26.81 ? 317  ALA A C   1 
ATOM   2371  O  O   . ALA A 1 299 ? 8.978   73.028 75.682  1.00 26.53 ? 317  ALA A O   1 
ATOM   2372  C  CB  . ALA A 1 299 ? 10.002  74.426 78.437  1.00 26.37 ? 317  ALA A CB  1 
ATOM   2373  N  N   . LEU A 1 300 ? 8.711   71.638 77.446  1.00 27.15 ? 318  LEU A N   1 
ATOM   2374  C  CA  . LEU A 1 300 ? 8.763   70.394 76.671  1.00 27.72 ? 318  LEU A CA  1 
ATOM   2375  C  C   . LEU A 1 300 ? 7.546   70.243 75.759  1.00 28.39 ? 318  LEU A C   1 
ATOM   2376  O  O   . LEU A 1 300 ? 7.652   69.740 74.633  1.00 28.19 ? 318  LEU A O   1 
ATOM   2377  C  CB  . LEU A 1 300 ? 8.857   69.185 77.603  1.00 27.31 ? 318  LEU A CB  1 
ATOM   2378  C  CG  . LEU A 1 300 ? 10.191  68.937 78.311  1.00 27.35 ? 318  LEU A CG  1 
ATOM   2379  C  CD1 . LEU A 1 300 ? 9.974   68.061 79.540  1.00 27.29 ? 318  LEU A CD1 1 
ATOM   2380  C  CD2 . LEU A 1 300 ? 11.216  68.320 77.367  1.00 26.05 ? 318  LEU A CD2 1 
ATOM   2381  N  N   . GLU A 1 301 ? 6.399   70.682 76.274  1.00 29.11 ? 319  GLU A N   1 
ATOM   2382  C  CA  . GLU A 1 301 ? 5.127   70.679 75.565  1.00 29.91 ? 319  GLU A CA  1 
ATOM   2383  C  C   . GLU A 1 301 ? 5.227   71.532 74.296  1.00 29.68 ? 319  GLU A C   1 
ATOM   2384  O  O   . GLU A 1 301 ? 4.701   71.158 73.241  1.00 29.91 ? 319  GLU A O   1 
ATOM   2385  C  CB  . GLU A 1 301 ? 4.046   71.236 76.497  1.00 30.36 ? 319  GLU A CB  1 
ATOM   2386  C  CG  . GLU A 1 301 ? 2.640   70.688 76.307  1.00 32.97 ? 319  GLU A CG  1 
ATOM   2387  C  CD  . GLU A 1 301 ? 1.671   71.171 77.399  1.00 36.59 ? 319  GLU A CD  1 
ATOM   2388  O  OE1 . GLU A 1 301 ? 2.095   71.292 78.581  1.00 37.41 ? 319  GLU A OE1 1 
ATOM   2389  O  OE2 . GLU A 1 301 ? 0.482   71.421 77.073  1.00 36.80 ? 319  GLU A OE2 1 
ATOM   2390  N  N   . GLY A 1 302 ? 5.916   72.666 74.404  1.00 29.25 ? 320  GLY A N   1 
ATOM   2391  C  CA  . GLY A 1 302 ? 6.099   73.582 73.282  1.00 28.95 ? 320  GLY A CA  1 
ATOM   2392  C  C   . GLY A 1 302 ? 7.429   73.453 72.563  1.00 28.47 ? 320  GLY A C   1 
ATOM   2393  O  O   . GLY A 1 302 ? 7.860   74.390 71.893  1.00 28.71 ? 320  GLY A O   1 
ATOM   2394  N  N   . ASN A 1 303 ? 8.069   72.291 72.700  1.00 28.21 ? 321  ASN A N   1 
ATOM   2395  C  CA  . ASN A 1 303 ? 9.388   72.001 72.102  1.00 27.85 ? 321  ASN A CA  1 
ATOM   2396  C  C   . ASN A 1 303 ? 10.481  73.065 72.347  1.00 27.24 ? 321  ASN A C   1 
ATOM   2397  O  O   . ASN A 1 303 ? 11.293  73.358 71.458  1.00 27.15 ? 321  ASN A O   1 
ATOM   2398  C  CB  . ASN A 1 303 ? 9.249   71.696 70.602  1.00 28.23 ? 321  ASN A CB  1 
ATOM   2399  C  CG  . ASN A 1 303 ? 8.275   70.554 70.317  1.00 29.54 ? 321  ASN A CG  1 
ATOM   2400  O  OD1 . ASN A 1 303 ? 8.396   69.451 70.866  1.00 29.60 ? 321  ASN A OD1 1 
ATOM   2401  N  ND2 . ASN A 1 303 ? 7.306   70.817 69.443  1.00 30.45 ? 321  ASN A ND2 1 
ATOM   2402  N  N   . ARG A 1 304 ? 10.502  73.629 73.555  1.00 26.31 ? 322  ARG A N   1 
ATOM   2403  C  CA  . ARG A 1 304 ? 11.454  74.692 73.898  1.00 25.49 ? 322  ARG A CA  1 
ATOM   2404  C  C   . ARG A 1 304 ? 12.725  74.174 74.577  1.00 24.68 ? 322  ARG A C   1 
ATOM   2405  O  O   . ARG A 1 304 ? 13.705  74.904 74.692  1.00 24.30 ? 322  ARG A O   1 
ATOM   2406  C  CB  . ARG A 1 304 ? 10.790  75.747 74.785  1.00 25.51 ? 322  ARG A CB  1 
ATOM   2407  C  CG  . ARG A 1 304 ? 9.834   76.699 74.067  1.00 25.96 ? 322  ARG A CG  1 
ATOM   2408  C  CD  . ARG A 1 304 ? 8.940   77.402 75.075  1.00 26.14 ? 322  ARG A CD  1 
ATOM   2409  N  NE  . ARG A 1 304 ? 9.713   77.830 76.239  1.00 27.03 ? 322  ARG A NE  1 
ATOM   2410  C  CZ  . ARG A 1 304 ? 9.264   77.846 77.491  1.00 27.18 ? 322  ARG A CZ  1 
ATOM   2411  N  NH1 . ARG A 1 304 ? 8.025   77.459 77.775  1.00 27.54 ? 322  ARG A NH1 1 
ATOM   2412  N  NH2 . ARG A 1 304 ? 10.068  78.246 78.467  1.00 27.48 ? 322  ARG A NH2 1 
ATOM   2413  N  N   . VAL A 1 305 ? 12.700  72.924 75.033  1.00 24.19 ? 323  VAL A N   1 
ATOM   2414  C  CA  . VAL A 1 305 ? 13.866  72.324 75.688  1.00 23.60 ? 323  VAL A CA  1 
ATOM   2415  C  C   . VAL A 1 305 ? 14.849  71.727 74.670  1.00 23.32 ? 323  VAL A C   1 
ATOM   2416  O  O   . VAL A 1 305 ? 14.468  70.990 73.750  1.00 23.14 ? 323  VAL A O   1 
ATOM   2417  C  CB  . VAL A 1 305 ? 13.470  71.281 76.776  1.00 23.63 ? 323  VAL A CB  1 
ATOM   2418  C  CG1 . VAL A 1 305 ? 14.709  70.584 77.349  1.00 23.44 ? 323  VAL A CG1 1 
ATOM   2419  C  CG2 . VAL A 1 305 ? 12.688  71.954 77.907  1.00 23.18 ? 323  VAL A CG2 1 
ATOM   2420  N  N   . ARG A 1 306 ? 16.118  72.070 74.843  1.00 22.77 ? 324  ARG A N   1 
ATOM   2421  C  CA  . ARG A 1 306 ? 17.174  71.514 74.022  1.00 22.46 ? 324  ARG A CA  1 
ATOM   2422  C  C   . ARG A 1 306 ? 17.898  70.386 74.743  1.00 21.53 ? 324  ARG A C   1 
ATOM   2423  O  O   . ARG A 1 306 ? 17.866  69.235 74.304  1.00 21.07 ? 324  ARG A O   1 
ATOM   2424  C  CB  . ARG A 1 306 ? 18.156  72.607 73.619  1.00 22.91 ? 324  ARG A CB  1 
ATOM   2425  C  CG  . ARG A 1 306 ? 17.572  73.633 72.664  1.00 25.40 ? 324  ARG A CG  1 
ATOM   2426  C  CD  . ARG A 1 306 ? 18.676  74.205 71.811  1.00 30.38 ? 324  ARG A CD  1 
ATOM   2427  N  NE  . ARG A 1 306 ? 19.547  73.128 71.339  1.00 33.96 ? 324  ARG A NE  1 
ATOM   2428  C  CZ  . ARG A 1 306 ? 20.533  73.274 70.461  1.00 35.58 ? 324  ARG A CZ  1 
ATOM   2429  N  NH1 . ARG A 1 306 ? 20.791  74.468 69.933  1.00 35.17 ? 324  ARG A NH1 1 
ATOM   2430  N  NH2 . ARG A 1 306 ? 21.257  72.213 70.115  1.00 36.54 ? 324  ARG A NH2 1 
ATOM   2431  N  N   . GLU A 1 307 ? 18.548  70.722 75.853  1.00 20.67 ? 325  GLU A N   1 
ATOM   2432  C  CA  . GLU A 1 307 ? 19.348  69.752 76.595  1.00 19.85 ? 325  GLU A CA  1 
ATOM   2433  C  C   . GLU A 1 307 ? 19.214  69.938 78.095  1.00 19.38 ? 325  GLU A C   1 
ATOM   2434  O  O   . GLU A 1 307 ? 19.022  71.049 78.590  1.00 18.86 ? 325  GLU A O   1 
ATOM   2435  C  CB  . GLU A 1 307 ? 20.836  69.868 76.238  1.00 19.87 ? 325  GLU A CB  1 
ATOM   2436  C  CG  . GLU A 1 307 ? 21.197  69.738 74.754  1.00 20.06 ? 325  GLU A CG  1 
ATOM   2437  C  CD  . GLU A 1 307 ? 22.622  70.195 74.480  1.00 20.13 ? 325  GLU A CD  1 
ATOM   2438  O  OE1 . GLU A 1 307 ? 22.836  70.942 73.509  1.00 18.93 ? 325  GLU A OE1 1 
ATOM   2439  O  OE2 . GLU A 1 307 ? 23.531  69.823 75.255  1.00 21.33 ? 325  GLU A OE2 1 
ATOM   2440  N  N   . MET A 1 308 ? 19.341  68.828 78.809  1.00 18.99 ? 326  MET A N   1 
ATOM   2441  C  CA  . MET A 1 308 ? 19.493  68.857 80.242  1.00 18.65 ? 326  MET A CA  1 
ATOM   2442  C  C   . MET A 1 308 ? 20.660  67.958 80.603  1.00 18.26 ? 326  MET A C   1 
ATOM   2443  O  O   . MET A 1 308 ? 20.744  66.812 80.149  1.00 17.84 ? 326  MET A O   1 
ATOM   2444  C  CB  . MET A 1 308 ? 18.226  68.374 80.927  1.00 18.94 ? 326  MET A CB  1 
ATOM   2445  C  CG  . MET A 1 308 ? 18.167  68.677 82.398  1.00 19.52 ? 326  MET A CG  1 
ATOM   2446  S  SD  . MET A 1 308 ? 16.797  67.777 83.130  1.00 21.90 ? 326  MET A SD  1 
ATOM   2447  C  CE  . MET A 1 308 ? 16.238  68.950 84.355  1.00 23.80 ? 326  MET A CE  1 
ATOM   2448  N  N   . PHE A 1 309 ? 21.561  68.493 81.419  1.00 17.78 ? 327  PHE A N   1 
ATOM   2449  C  CA  . PHE A 1 309 ? 22.722  67.745 81.861  1.00 17.64 ? 327  PHE A CA  1 
ATOM   2450  C  C   . PHE A 1 309 ? 23.109  68.090 83.288  1.00 17.60 ? 327  PHE A C   1 
ATOM   2451  O  O   . PHE A 1 309 ? 22.783  69.154 83.811  1.00 16.91 ? 327  PHE A O   1 
ATOM   2452  C  CB  . PHE A 1 309 ? 23.914  67.908 80.893  1.00 17.66 ? 327  PHE A CB  1 
ATOM   2453  C  CG  . PHE A 1 309 ? 24.325  69.339 80.646  1.00 17.33 ? 327  PHE A CG  1 
ATOM   2454  C  CD1 . PHE A 1 309 ? 23.678  70.107 79.686  1.00 16.65 ? 327  PHE A CD1 1 
ATOM   2455  C  CD2 . PHE A 1 309 ? 25.370  69.907 81.363  1.00 17.09 ? 327  PHE A CD2 1 
ATOM   2456  C  CE1 . PHE A 1 309 ? 24.061  71.422 79.450  1.00 17.53 ? 327  PHE A CE1 1 
ATOM   2457  C  CE2 . PHE A 1 309 ? 25.763  71.227 81.132  1.00 17.19 ? 327  PHE A CE2 1 
ATOM   2458  C  CZ  . PHE A 1 309 ? 25.106  71.984 80.177  1.00 16.40 ? 327  PHE A CZ  1 
ATOM   2459  N  N   . SER A 1 310 ? 23.791  67.148 83.918  1.00 17.85 ? 328  SER A N   1 
ATOM   2460  C  CA  . SER A 1 310 ? 24.302  67.346 85.248  1.00 18.34 ? 328  SER A CA  1 
ATOM   2461  C  C   . SER A 1 310 ? 25.806  67.599 85.168  1.00 17.74 ? 328  SER A C   1 
ATOM   2462  O  O   . SER A 1 310 ? 26.451  67.175 84.208  1.00 16.92 ? 328  SER A O   1 
ATOM   2463  C  CB  . SER A 1 310 ? 24.000  66.108 86.073  1.00 19.33 ? 328  SER A CB  1 
ATOM   2464  O  OG  . SER A 1 310 ? 22.893  65.376 85.537  1.00 23.13 ? 328  SER A OG  1 
ATOM   2465  N  N   . SER A 1 311 ? 26.352  68.303 86.164  1.00 17.55 ? 329  SER A N   1 
ATOM   2466  C  CA  . SER A 1 311 ? 27.787  68.606 86.207  1.00 17.07 ? 329  SER A CA  1 
ATOM   2467  C  C   . SER A 1 311 ? 28.431  68.265 87.548  1.00 16.82 ? 329  SER A C   1 
ATOM   2468  O  O   . SER A 1 311 ? 27.873  68.550 88.609  1.00 16.55 ? 329  SER A O   1 
ATOM   2469  C  CB  . SER A 1 311 ? 28.069  70.074 85.826  1.00 17.06 ? 329  SER A CB  1 
ATOM   2470  O  OG  . SER A 1 311 ? 27.776  70.981 86.883  1.00 16.78 ? 329  SER A OG  1 
ATOM   2471  N  N   . GLY A 1 312 ? 29.622  67.670 87.481  1.00 16.65 ? 330  GLY A N   1 
ATOM   2472  C  CA  . GLY A 1 312 ? 30.381  67.279 88.671  1.00 16.43 ? 330  GLY A CA  1 
ATOM   2473  C  C   . GLY A 1 312 ? 31.765  66.796 88.301  1.00 16.57 ? 330  GLY A C   1 
ATOM   2474  O  O   . GLY A 1 312 ? 32.045  66.544 87.127  1.00 16.58 ? 330  GLY A O   1 
ATOM   2475  N  N   . THR A 1 313 ? 32.633  66.641 89.299  1.00 16.69 ? 331  THR A N   1 
ATOM   2476  C  CA  . THR A 1 313 ? 34.029  66.280 89.048  1.00 16.59 ? 331  THR A CA  1 
ATOM   2477  C  C   . THR A 1 313 ? 34.194  64.919 88.358  1.00 16.98 ? 331  THR A C   1 
ATOM   2478  O  O   . THR A 1 313 ? 34.946  64.815 87.388  1.00 16.60 ? 331  THR A O   1 
ATOM   2479  C  CB  . THR A 1 313 ? 34.876  66.395 90.333  1.00 16.53 ? 331  THR A CB  1 
ATOM   2480  O  OG1 . THR A 1 313 ? 34.966  67.772 90.683  1.00 15.78 ? 331  THR A OG1 1 
ATOM   2481  C  CG2 . THR A 1 313 ? 36.300  65.862 90.136  1.00 16.19 ? 331  THR A CG2 1 
ATOM   2482  N  N   . ALA A 1 314 ? 33.472  63.904 88.839  1.00 17.61 ? 332  ALA A N   1 
ATOM   2483  C  CA  . ALA A 1 314 ? 33.576  62.535 88.309  1.00 18.56 ? 332  ALA A CA  1 
ATOM   2484  C  C   . ALA A 1 314 ? 33.348  62.415 86.796  1.00 19.28 ? 332  ALA A C   1 
ATOM   2485  O  O   . ALA A 1 314 ? 34.177  61.836 86.091  1.00 19.83 ? 332  ALA A O   1 
ATOM   2486  C  CB  . ALA A 1 314 ? 32.642  61.591 89.062  1.00 18.48 ? 332  ALA A CB  1 
ATOM   2487  N  N   . CYS A 1 315 ? 32.245  62.973 86.300  1.00 19.81 ? 333  CYS A N   1 
ATOM   2488  C  CA  . CYS A 1 315 ? 31.879  62.826 84.886  1.00 20.47 ? 333  CYS A CA  1 
ATOM   2489  C  C   . CYS A 1 315 ? 32.047  64.097 84.029  1.00 20.43 ? 333  CYS A C   1 
ATOM   2490  O  O   . CYS A 1 315 ? 31.884  64.048 82.803  1.00 20.47 ? 333  CYS A O   1 
ATOM   2491  C  CB  . CYS A 1 315 ? 30.440  62.336 84.784  1.00 20.42 ? 333  CYS A CB  1 
ATOM   2492  S  SG  . CYS A 1 315 ? 29.284  63.652 85.092  1.00 22.39 ? 333  CYS A SG  1 
ATOM   2493  N  N   . VAL A 1 316 ? 32.407  65.207 84.674  1.00 20.38 ? 334  VAL A N   1 
ATOM   2494  C  CA  . VAL A 1 316 ? 32.308  66.580 84.114  1.00 20.55 ? 334  VAL A CA  1 
ATOM   2495  C  C   . VAL A 1 316 ? 30.907  66.980 83.628  1.00 20.23 ? 334  VAL A C   1 
ATOM   2496  O  O   . VAL A 1 316 ? 30.343  67.953 84.121  1.00 20.38 ? 334  VAL A O   1 
ATOM   2497  C  CB  . VAL A 1 316 ? 33.510  67.033 83.149  1.00 20.56 ? 334  VAL A CB  1 
ATOM   2498  C  CG1 . VAL A 1 316 ? 34.395  65.884 82.692  1.00 20.95 ? 334  VAL A CG1 1 
ATOM   2499  C  CG2 . VAL A 1 316 ? 33.039  67.907 81.979  1.00 20.74 ? 334  VAL A CG2 1 
ATOM   2500  N  N   . VAL A 1 317 ? 30.353  66.225 82.683  1.00 20.22 ? 335  VAL A N   1 
ATOM   2501  C  CA  . VAL A 1 317 ? 29.010  66.478 82.157  1.00 20.06 ? 335  VAL A CA  1 
ATOM   2502  C  C   . VAL A 1 317 ? 28.279  65.161 81.884  1.00 19.73 ? 335  VAL A C   1 
ATOM   2503  O  O   . VAL A 1 317 ? 28.847  64.241 81.296  1.00 19.47 ? 335  VAL A O   1 
ATOM   2504  C  CB  . VAL A 1 317 ? 29.057  67.401 80.907  1.00 20.19 ? 335  VAL A CB  1 
ATOM   2505  C  CG1 . VAL A 1 317 ? 28.061  66.986 79.842  1.00 20.81 ? 335  VAL A CG1 1 
ATOM   2506  C  CG2 . VAL A 1 317 ? 28.832  68.843 81.324  1.00 21.23 ? 335  VAL A CG2 1 
ATOM   2507  N  N   . CYS A 1 318 ? 27.026  65.089 82.332  1.00 19.39 ? 336  CYS A N   1 
ATOM   2508  C  CA  . CYS A 1 318 ? 26.206  63.901 82.190  1.00 19.21 ? 336  CYS A CA  1 
ATOM   2509  C  C   . CYS A 1 318 ? 24.803  64.228 81.658  1.00 18.70 ? 336  CYS A C   1 
ATOM   2510  O  O   . CYS A 1 318 ? 23.964  64.744 82.399  1.00 18.47 ? 336  CYS A O   1 
ATOM   2511  C  CB  . CYS A 1 318 ? 26.097  63.181 83.531  1.00 19.28 ? 336  CYS A CB  1 
ATOM   2512  S  SG  . CYS A 1 318 ? 25.255  61.590 83.402  1.00 21.40 ? 336  CYS A SG  1 
ATOM   2513  N  N   . PRO A 1 319 ? 24.539  63.915 80.376  1.00 18.37 ? 337  PRO A N   1 
ATOM   2514  C  CA  . PRO A 1 319 ? 23.243  64.226 79.770  1.00 18.24 ? 337  PRO A CA  1 
ATOM   2515  C  C   . PRO A 1 319 ? 22.074  63.460 80.388  1.00 17.91 ? 337  PRO A C   1 
ATOM   2516  O  O   . PRO A 1 319 ? 22.230  62.315 80.820  1.00 17.50 ? 337  PRO A O   1 
ATOM   2517  C  CB  . PRO A 1 319 ? 23.429  63.824 78.300  1.00 18.17 ? 337  PRO A CB  1 
ATOM   2518  C  CG  . PRO A 1 319 ? 24.511  62.817 78.324  1.00 19.09 ? 337  PRO A CG  1 
ATOM   2519  C  CD  . PRO A 1 319 ? 25.441  63.257 79.416  1.00 18.47 ? 337  PRO A CD  1 
ATOM   2520  N  N   . VAL A 1 320 ? 20.917  64.113 80.418  1.00 18.04 ? 338  VAL A N   1 
ATOM   2521  C  CA  . VAL A 1 320 ? 19.691  63.538 80.965  1.00 18.30 ? 338  VAL A CA  1 
ATOM   2522  C  C   . VAL A 1 320 ? 18.695  63.294 79.831  1.00 18.67 ? 338  VAL A C   1 
ATOM   2523  O  O   . VAL A 1 320 ? 18.351  64.216 79.082  1.00 18.70 ? 338  VAL A O   1 
ATOM   2524  C  CB  . VAL A 1 320 ? 19.074  64.463 82.055  1.00 18.28 ? 338  VAL A CB  1 
ATOM   2525  C  CG1 . VAL A 1 320 ? 17.687  63.965 82.501  1.00 17.53 ? 338  VAL A CG1 1 
ATOM   2526  C  CG2 . VAL A 1 320 ? 20.018  64.572 83.240  1.00 17.49 ? 338  VAL A CG2 1 
ATOM   2527  N  N   . SER A 1 321 ? 18.234  62.054 79.715  1.00 18.91 ? 339  SER A N   1 
ATOM   2528  C  CA  . SER A 1 321 ? 17.320  61.664 78.645  1.00 19.53 ? 339  SER A CA  1 
ATOM   2529  C  C   . SER A 1 321 ? 15.857  61.533 79.100  1.00 20.15 ? 339  SER A C   1 
ATOM   2530  O  O   . SER A 1 321 ? 14.942  61.700 78.290  1.00 20.18 ? 339  SER A O   1 
ATOM   2531  C  CB  . SER A 1 321 ? 17.788  60.349 78.003  1.00 19.37 ? 339  SER A CB  1 
ATOM   2532  O  OG  . SER A 1 321 ? 17.705  59.269 78.920  1.00 18.99 ? 339  SER A OG  1 
ATOM   2533  N  N   . ASP A 1 322 ? 15.646  61.211 80.380  1.00 20.66 ? 340  ASP A N   1 
ATOM   2534  C  CA  . ASP A 1 322 ? 14.304  60.914 80.909  1.00 21.06 ? 340  ASP A CA  1 
ATOM   2535  C  C   . ASP A 1 322 ? 14.165  61.275 82.384  1.00 21.34 ? 340  ASP A C   1 
ATOM   2536  O  O   . ASP A 1 322 ? 15.137  61.197 83.154  1.00 20.95 ? 340  ASP A O   1 
ATOM   2537  C  CB  . ASP A 1 322 ? 13.951  59.430 80.727  1.00 21.00 ? 340  ASP A CB  1 
ATOM   2538  C  CG  . ASP A 1 322 ? 13.916  59.006 79.272  1.00 22.10 ? 340  ASP A CG  1 
ATOM   2539  O  OD1 . ASP A 1 322 ? 12.944  59.347 78.563  1.00 23.22 ? 340  ASP A OD1 1 
ATOM   2540  O  OD2 . ASP A 1 322 ? 14.869  58.330 78.831  1.00 23.97 ? 340  ASP A OD2 1 
ATOM   2541  N  N   . ILE A 1 323 ? 12.949  61.667 82.766  1.00 21.95 ? 341  ILE A N   1 
ATOM   2542  C  CA  . ILE A 1 323 ? 12.592  61.904 84.170  1.00 22.50 ? 341  ILE A CA  1 
ATOM   2543  C  C   . ILE A 1 323 ? 11.307  61.153 84.512  1.00 23.26 ? 341  ILE A C   1 
ATOM   2544  O  O   . ILE A 1 323 ? 10.280  61.346 83.853  1.00 23.49 ? 341  ILE A O   1 
ATOM   2545  C  CB  . ILE A 1 323 ? 12.411  63.411 84.488  1.00 22.29 ? 341  ILE A CB  1 
ATOM   2546  C  CG1 . ILE A 1 323 ? 13.711  64.181 84.229  1.00 22.01 ? 341  ILE A CG1 1 
ATOM   2547  C  CG2 . ILE A 1 323 ? 11.933  63.604 85.935  1.00 21.56 ? 341  ILE A CG2 1 
ATOM   2548  C  CD1 . ILE A 1 323 ? 13.535  65.691 84.138  1.00 21.73 ? 341  ILE A CD1 1 
ATOM   2549  N  N   . LEU A 1 324 ? 11.369  60.298 85.531  1.00 23.86 ? 342  LEU A N   1 
ATOM   2550  C  CA  . LEU A 1 324 ? 10.190  59.575 86.003  1.00 24.56 ? 342  LEU A CA  1 
ATOM   2551  C  C   . LEU A 1 324 ? 9.509   60.411 87.081  1.00 25.01 ? 342  LEU A C   1 
ATOM   2552  O  O   . LEU A 1 324 ? 10.086  60.664 88.141  1.00 25.22 ? 342  LEU A O   1 
ATOM   2553  C  CB  . LEU A 1 324 ? 10.566  58.185 86.529  1.00 24.55 ? 342  LEU A CB  1 
ATOM   2554  C  CG  . LEU A 1 324 ? 10.819  56.983 85.595  1.00 24.90 ? 342  LEU A CG  1 
ATOM   2555  C  CD1 . LEU A 1 324 ? 9.598   56.084 85.503  1.00 25.24 ? 342  LEU A CD1 1 
ATOM   2556  C  CD2 . LEU A 1 324 ? 11.330  57.362 84.197  1.00 24.64 ? 342  LEU A CD2 1 
ATOM   2557  N  N   . TYR A 1 325 ? 8.287   60.854 86.794  1.00 25.47 ? 343  TYR A N   1 
ATOM   2558  C  CA  . TYR A 1 325 ? 7.603   61.838 87.629  1.00 26.07 ? 343  TYR A CA  1 
ATOM   2559  C  C   . TYR A 1 325 ? 6.097   61.642 87.558  1.00 26.69 ? 343  TYR A C   1 
ATOM   2560  O  O   . TYR A 1 325 ? 5.519   61.613 86.468  1.00 26.93 ? 343  TYR A O   1 
ATOM   2561  C  CB  . TYR A 1 325 ? 7.984   63.250 87.168  1.00 25.79 ? 343  TYR A CB  1 
ATOM   2562  C  CG  . TYR A 1 325 ? 7.421   64.398 87.988  1.00 25.63 ? 343  TYR A CG  1 
ATOM   2563  C  CD1 . TYR A 1 325 ? 6.596   65.357 87.397  1.00 24.81 ? 343  TYR A CD1 1 
ATOM   2564  C  CD2 . TYR A 1 325 ? 7.737   64.546 89.342  1.00 24.79 ? 343  TYR A CD2 1 
ATOM   2565  C  CE1 . TYR A 1 325 ? 6.093   66.432 88.135  1.00 25.13 ? 343  TYR A CE1 1 
ATOM   2566  C  CE2 . TYR A 1 325 ? 7.236   65.614 90.091  1.00 24.66 ? 343  TYR A CE2 1 
ATOM   2567  C  CZ  . TYR A 1 325 ? 6.416   66.552 89.481  1.00 24.85 ? 343  TYR A CZ  1 
ATOM   2568  O  OH  . TYR A 1 325 ? 5.919   67.608 90.210  1.00 24.52 ? 343  TYR A OH  1 
ATOM   2569  N  N   . LYS A 1 326 ? 5.473   61.512 88.729  1.00 27.43 ? 344  LYS A N   1 
ATOM   2570  C  CA  . LYS A 1 326 ? 4.025   61.299 88.856  1.00 28.13 ? 344  LYS A CA  1 
ATOM   2571  C  C   . LYS A 1 326 ? 3.533   60.135 87.985  1.00 28.47 ? 344  LYS A C   1 
ATOM   2572  O  O   . LYS A 1 326 ? 2.558   60.265 87.237  1.00 28.57 ? 344  LYS A O   1 
ATOM   2573  C  CB  . LYS A 1 326 ? 3.233   62.589 88.564  1.00 28.19 ? 344  LYS A CB  1 
ATOM   2574  C  CG  . LYS A 1 326 ? 3.695   63.823 89.350  1.00 29.45 ? 344  LYS A CG  1 
ATOM   2575  C  CD  . LYS A 1 326 ? 2.595   64.883 89.472  1.00 31.64 ? 344  LYS A CD  1 
ATOM   2576  C  CE  . LYS A 1 326 ? 1.764   64.660 90.741  1.00 33.73 ? 344  LYS A CE  1 
ATOM   2577  N  NZ  . LYS A 1 326 ? 0.467   65.412 90.748  1.00 34.72 ? 344  LYS A NZ  1 
ATOM   2578  N  N   . GLY A 1 327 ? 4.233   59.007 88.077  1.00 28.70 ? 345  GLY A N   1 
ATOM   2579  C  CA  . GLY A 1 327 ? 3.851   57.785 87.369  1.00 28.95 ? 345  GLY A CA  1 
ATOM   2580  C  C   . GLY A 1 327 ? 4.153   57.749 85.880  1.00 29.22 ? 345  GLY A C   1 
ATOM   2581  O  O   . GLY A 1 327 ? 3.972   56.710 85.239  1.00 29.22 ? 345  GLY A O   1 
ATOM   2582  N  N   . GLU A 1 328 ? 4.614   58.875 85.332  1.00 29.20 ? 346  GLU A N   1 
ATOM   2583  C  CA  . GLU A 1 328 ? 4.918   58.988 83.905  1.00 29.34 ? 346  GLU A CA  1 
ATOM   2584  C  C   . GLU A 1 328 ? 6.418   59.045 83.600  1.00 28.62 ? 346  GLU A C   1 
ATOM   2585  O  O   . GLU A 1 328 ? 7.230   59.444 84.441  1.00 28.37 ? 346  GLU A O   1 
ATOM   2586  C  CB  . GLU A 1 328 ? 4.246   60.223 83.316  1.00 29.92 ? 346  GLU A CB  1 
ATOM   2587  C  CG  . GLU A 1 328 ? 2.733   60.115 83.166  1.00 32.87 ? 346  GLU A CG  1 
ATOM   2588  C  CD  . GLU A 1 328 ? 2.090   61.442 82.777  1.00 36.80 ? 346  GLU A CD  1 
ATOM   2589  O  OE1 . GLU A 1 328 ? 2.833   62.402 82.435  1.00 38.20 ? 346  GLU A OE1 1 
ATOM   2590  O  OE2 . GLU A 1 328 ? 0.838   61.524 82.817  1.00 38.32 ? 346  GLU A OE2 1 
ATOM   2591  N  N   . THR A 1 329 ? 6.768   58.646 82.380  1.00 27.72 ? 347  THR A N   1 
ATOM   2592  C  CA  . THR A 1 329 ? 8.118   58.809 81.865  1.00 26.74 ? 347  THR A CA  1 
ATOM   2593  C  C   . THR A 1 329 ? 8.129   60.012 80.931  1.00 25.85 ? 347  THR A C   1 
ATOM   2594  O  O   . THR A 1 329 ? 7.528   59.977 79.857  1.00 25.99 ? 347  THR A O   1 
ATOM   2595  C  CB  . THR A 1 329 ? 8.590   57.545 81.130  1.00 26.90 ? 347  THR A CB  1 
ATOM   2596  O  OG1 . THR A 1 329 ? 8.462   56.417 82.002  1.00 27.12 ? 347  THR A OG1 1 
ATOM   2597  C  CG2 . THR A 1 329 ? 10.049  57.675 80.682  1.00 27.15 ? 347  THR A CG2 1 
ATOM   2598  N  N   . ILE A 1 330 ? 8.785   61.083 81.368  1.00 24.68 ? 348  ILE A N   1 
ATOM   2599  C  CA  . ILE A 1 330 ? 8.910   62.306 80.578  1.00 23.56 ? 348  ILE A CA  1 
ATOM   2600  C  C   . ILE A 1 330 ? 10.252  62.286 79.852  1.00 23.00 ? 348  ILE A C   1 
ATOM   2601  O  O   . ILE A 1 330 ? 11.304  62.175 80.487  1.00 22.72 ? 348  ILE A O   1 
ATOM   2602  C  CB  . ILE A 1 330 ? 8.822   63.578 81.468  1.00 23.70 ? 348  ILE A CB  1 
ATOM   2603  C  CG1 . ILE A 1 330 ? 7.565   63.546 82.353  1.00 23.31 ? 348  ILE A CG1 1 
ATOM   2604  C  CG2 . ILE A 1 330 ? 8.854   64.839 80.612  1.00 23.60 ? 348  ILE A CG2 1 
ATOM   2605  C  CD1 . ILE A 1 330 ? 7.617   64.495 83.543  1.00 22.72 ? 348  ILE A CD1 1 
ATOM   2606  N  N   . HIS A 1 331 ? 10.209  62.379 78.523  1.00 22.14 ? 349  HIS A N   1 
ATOM   2607  C  CA  . HIS A 1 331 ? 11.417  62.351 77.712  1.00 21.25 ? 349  HIS A CA  1 
ATOM   2608  C  C   . HIS A 1 331 ? 12.044  63.731 77.584  1.00 20.82 ? 349  HIS A C   1 
ATOM   2609  O  O   . HIS A 1 331 ? 11.351  64.722 77.331  1.00 20.83 ? 349  HIS A O   1 
ATOM   2610  C  CB  . HIS A 1 331 ? 11.140  61.763 76.321  1.00 21.29 ? 349  HIS A CB  1 
ATOM   2611  C  CG  . HIS A 1 331 ? 12.382  61.519 75.520  1.00 20.67 ? 349  HIS A CG  1 
ATOM   2612  N  ND1 . HIS A 1 331 ? 13.268  60.508 75.817  1.00 19.88 ? 349  HIS A ND1 1 
ATOM   2613  C  CD2 . HIS A 1 331 ? 12.899  62.171 74.452  1.00 20.97 ? 349  HIS A CD2 1 
ATOM   2614  C  CE1 . HIS A 1 331 ? 14.273  60.538 74.961  1.00 20.49 ? 349  HIS A CE1 1 
ATOM   2615  N  NE2 . HIS A 1 331 ? 14.071  61.536 74.119  1.00 21.07 ? 349  HIS A NE2 1 
ATOM   2616  N  N   . ILE A 1 332 ? 13.359  63.788 77.775  1.00 20.22 ? 350  ILE A N   1 
ATOM   2617  C  CA  . ILE A 1 332 ? 14.127  65.013 77.528  1.00 19.69 ? 350  ILE A CA  1 
ATOM   2618  C  C   . ILE A 1 332 ? 14.926  64.813 76.239  1.00 19.51 ? 350  ILE A C   1 
ATOM   2619  O  O   . ILE A 1 332 ? 15.663  63.836 76.116  1.00 19.64 ? 350  ILE A O   1 
ATOM   2620  C  CB  . ILE A 1 332 ? 15.071  65.389 78.716  1.00 19.49 ? 350  ILE A CB  1 
ATOM   2621  C  CG1 . ILE A 1 332 ? 14.394  65.147 80.079  1.00 18.92 ? 350  ILE A CG1 1 
ATOM   2622  C  CG2 . ILE A 1 332 ? 15.574  66.842 78.587  1.00 18.95 ? 350  ILE A CG2 1 
ATOM   2623  C  CD1 . ILE A 1 332 ? 13.193  66.037 80.374  1.00 18.29 ? 350  ILE A CD1 1 
ATOM   2624  N  N   . PRO A 1 333 ? 14.773  65.732 75.269  1.00 19.37 ? 351  PRO A N   1 
ATOM   2625  C  CA  . PRO A 1 333 ? 15.356  65.525 73.941  1.00 19.10 ? 351  PRO A CA  1 
ATOM   2626  C  C   . PRO A 1 333 ? 16.859  65.815 73.831  1.00 18.81 ? 351  PRO A C   1 
ATOM   2627  O  O   . PRO A 1 333 ? 17.337  66.164 72.751  1.00 18.84 ? 351  PRO A O   1 
ATOM   2628  C  CB  . PRO A 1 333 ? 14.553  66.493 73.069  1.00 19.06 ? 351  PRO A CB  1 
ATOM   2629  C  CG  . PRO A 1 333 ? 14.235  67.625 73.989  1.00 19.62 ? 351  PRO A CG  1 
ATOM   2630  C  CD  . PRO A 1 333 ? 14.031  67.006 75.350  1.00 19.27 ? 351  PRO A CD  1 
ATOM   2631  N  N   . THR A 1 334 ? 17.588  65.658 74.936  1.00 18.62 ? 352  THR A N   1 
ATOM   2632  C  CA  . THR A 1 334 ? 19.017  65.988 75.015  1.00 17.58 ? 352  THR A CA  1 
ATOM   2633  C  C   . THR A 1 334 ? 19.831  65.309 73.918  1.00 17.58 ? 352  THR A C   1 
ATOM   2634  O  O   . THR A 1 334 ? 20.579  65.968 73.191  1.00 16.55 ? 352  THR A O   1 
ATOM   2635  C  CB  . THR A 1 334 ? 19.604  65.594 76.404  1.00 17.50 ? 352  THR A CB  1 
ATOM   2636  O  OG1 . THR A 1 334 ? 18.811  66.179 77.445  1.00 16.52 ? 352  THR A OG1 1 
ATOM   2637  C  CG2 . THR A 1 334 ? 21.060  66.048 76.553  1.00 16.91 ? 352  THR A CG2 1 
ATOM   2638  N  N   . MET A 1 335 ? 19.674  63.989 73.812  1.00 18.06 ? 353  MET A N   1 
ATOM   2639  C  CA  . MET A 1 335 ? 20.485  63.182 72.898  1.00 18.66 ? 353  MET A CA  1 
ATOM   2640  C  C   . MET A 1 335 ? 20.093  63.424 71.447  1.00 19.10 ? 353  MET A C   1 
ATOM   2641  O  O   . MET A 1 335 ? 20.935  63.326 70.547  1.00 19.33 ? 353  MET A O   1 
ATOM   2642  C  CB  . MET A 1 335 ? 20.417  61.693 73.258  1.00 18.43 ? 353  MET A CB  1 
ATOM   2643  C  CG  . MET A 1 335 ? 20.992  61.355 74.650  1.00 19.03 ? 353  MET A CG  1 
ATOM   2644  S  SD  . MET A 1 335 ? 22.599  62.112 75.039  1.00 20.10 ? 353  MET A SD  1 
ATOM   2645  C  CE  . MET A 1 335 ? 23.706  61.222 73.937  1.00 18.75 ? 353  MET A CE  1 
ATOM   2646  N  N   . GLU A 1 336 ? 18.826  63.777 71.236  1.00 19.55 ? 354  GLU A N   1 
ATOM   2647  C  CA  . GLU A 1 336 ? 18.308  64.092 69.905  1.00 20.22 ? 354  GLU A CA  1 
ATOM   2648  C  C   . GLU A 1 336 ? 18.814  65.438 69.415  1.00 20.23 ? 354  GLU A C   1 
ATOM   2649  O  O   . GLU A 1 336 ? 18.874  65.678 68.204  1.00 21.10 ? 354  GLU A O   1 
ATOM   2650  C  CB  . GLU A 1 336 ? 16.777  64.045 69.870  1.00 20.26 ? 354  GLU A CB  1 
ATOM   2651  C  CG  . GLU A 1 336 ? 16.214  62.631 69.886  1.00 21.80 ? 354  GLU A CG  1 
ATOM   2652  C  CD  . GLU A 1 336 ? 16.147  62.040 71.287  1.00 24.71 ? 354  GLU A CD  1 
ATOM   2653  O  OE1 . GLU A 1 336 ? 15.440  62.618 72.140  1.00 26.13 ? 354  GLU A OE1 1 
ATOM   2654  O  OE2 . GLU A 1 336 ? 16.790  60.994 71.533  1.00 25.79 ? 354  GLU A OE2 1 
ATOM   2655  N  N   . ASN A 1 337 ? 19.198  66.303 70.349  1.00 19.54 ? 355  ASN A N   1 
ATOM   2656  C  CA  . ASN A 1 337 ? 19.769  67.602 70.004  1.00 19.10 ? 355  ASN A CA  1 
ATOM   2657  C  C   . ASN A 1 337 ? 21.294  67.649 70.087  1.00 18.63 ? 355  ASN A C   1 
ATOM   2658  O  O   . ASN A 1 337 ? 21.875  68.701 70.348  1.00 18.55 ? 355  ASN A O   1 
ATOM   2659  C  CB  . ASN A 1 337 ? 19.128  68.694 70.861  1.00 19.44 ? 355  ASN A CB  1 
ATOM   2660  C  CG  . ASN A 1 337 ? 17.645  68.842 70.584  1.00 20.14 ? 355  ASN A CG  1 
ATOM   2661  O  OD1 . ASN A 1 337 ? 17.241  69.082 69.447  1.00 21.80 ? 355  ASN A OD1 1 
ATOM   2662  N  ND2 . ASN A 1 337 ? 16.827  68.680 71.614  1.00 20.16 ? 355  ASN A ND2 1 
ATOM   2663  N  N   . GLY A 1 338 ? 21.930  66.501 69.859  1.00 18.25 ? 356  GLY A N   1 
ATOM   2664  C  CA  . GLY A 1 338 ? 23.387  66.397 69.812  1.00 17.62 ? 356  GLY A CA  1 
ATOM   2665  C  C   . GLY A 1 338 ? 23.972  65.317 70.715  1.00 17.22 ? 356  GLY A C   1 
ATOM   2666  O  O   . GLY A 1 338 ? 24.181  64.187 70.274  1.00 17.69 ? 356  GLY A O   1 
ATOM   2667  N  N   . PRO A 1 339 ? 24.238  65.649 71.991  1.00 16.88 ? 357  PRO A N   1 
ATOM   2668  C  CA  . PRO A 1 339 ? 23.912  66.936 72.603  1.00 16.53 ? 357  PRO A CA  1 
ATOM   2669  C  C   . PRO A 1 339 ? 24.937  68.019 72.263  1.00 16.25 ? 357  PRO A C   1 
ATOM   2670  O  O   . PRO A 1 339 ? 26.111  67.909 72.628  1.00 16.31 ? 357  PRO A O   1 
ATOM   2671  C  CB  . PRO A 1 339 ? 23.892  66.612 74.103  1.00 16.64 ? 357  PRO A CB  1 
ATOM   2672  C  CG  . PRO A 1 339 ? 24.800  65.428 74.267  1.00 16.23 ? 357  PRO A CG  1 
ATOM   2673  C  CD  . PRO A 1 339 ? 24.915  64.736 72.939  1.00 16.63 ? 357  PRO A CD  1 
ATOM   2674  N  N   . LYS A 1 340 ? 24.483  69.053 71.559  1.00 16.03 ? 358  LYS A N   1 
ATOM   2675  C  CA  . LYS A 1 340 ? 25.365  70.099 71.032  1.00 16.03 ? 358  LYS A CA  1 
ATOM   2676  C  C   . LYS A 1 340 ? 26.209  70.810 72.091  1.00 15.74 ? 358  LYS A C   1 
ATOM   2677  O  O   . LYS A 1 340 ? 27.443  70.846 71.983  1.00 15.41 ? 358  LYS A O   1 
ATOM   2678  C  CB  . LYS A 1 340 ? 24.572  71.128 70.215  1.00 16.20 ? 358  LYS A CB  1 
ATOM   2679  C  CG  . LYS A 1 340 ? 25.447  72.248 69.663  1.00 17.58 ? 358  LYS A CG  1 
ATOM   2680  C  CD  . LYS A 1 340 ? 24.782  73.008 68.539  1.00 20.91 ? 358  LYS A CD  1 
ATOM   2681  C  CE  . LYS A 1 340 ? 24.052  74.224 69.029  1.00 23.63 ? 358  LYS A CE  1 
ATOM   2682  N  NZ  . LYS A 1 340 ? 23.838  75.197 67.914  1.00 25.10 ? 358  LYS A NZ  1 
ATOM   2683  N  N   . LEU A 1 341 ? 25.542  71.376 73.101  1.00 15.34 ? 359  LEU A N   1 
ATOM   2684  C  CA  . LEU A 1 341 ? 26.223  72.154 74.135  1.00 15.08 ? 359  LEU A CA  1 
ATOM   2685  C  C   . LEU A 1 341 ? 26.991  71.269 75.114  1.00 15.02 ? 359  LEU A C   1 
ATOM   2686  O  O   . LEU A 1 341 ? 28.158  71.540 75.410  1.00 14.88 ? 359  LEU A O   1 
ATOM   2687  C  CB  . LEU A 1 341 ? 25.251  73.086 74.875  1.00 14.77 ? 359  LEU A CB  1 
ATOM   2688  C  CG  . LEU A 1 341 ? 25.836  74.079 75.897  1.00 15.42 ? 359  LEU A CG  1 
ATOM   2689  C  CD1 . LEU A 1 341 ? 26.838  75.050 75.268  1.00 14.51 ? 359  LEU A CD1 1 
ATOM   2690  C  CD2 . LEU A 1 341 ? 24.728  74.856 76.617  1.00 15.57 ? 359  LEU A CD2 1 
ATOM   2691  N  N   . ALA A 1 342 ? 26.340  70.212 75.593  1.00 14.87 ? 360  ALA A N   1 
ATOM   2692  C  CA  . ALA A 1 342 ? 26.965  69.258 76.513  1.00 15.09 ? 360  ALA A CA  1 
ATOM   2693  C  C   . ALA A 1 342 ? 28.280  68.710 75.951  1.00 14.96 ? 360  ALA A C   1 
ATOM   2694  O  O   . ALA A 1 342 ? 29.280  68.623 76.669  1.00 14.67 ? 360  ALA A O   1 
ATOM   2695  C  CB  . ALA A 1 342 ? 25.996  68.121 76.846  1.00 15.15 ? 360  ALA A CB  1 
ATOM   2696  N  N   . SER A 1 343 ? 28.274  68.352 74.666  1.00 14.97 ? 361  SER A N   1 
ATOM   2697  C  CA  . SER A 1 343 ? 29.493  67.892 73.997  1.00 15.12 ? 361  SER A CA  1 
ATOM   2698  C  C   . SER A 1 343 ? 30.525  69.008 73.879  1.00 15.06 ? 361  SER A C   1 
ATOM   2699  O  O   . SER A 1 343 ? 31.714  68.773 74.071  1.00 14.97 ? 361  SER A O   1 
ATOM   2700  C  CB  . SER A 1 343 ? 29.178  67.320 72.615  1.00 14.96 ? 361  SER A CB  1 
ATOM   2701  O  OG  . SER A 1 343 ? 28.258  66.244 72.716  1.00 15.27 ? 361  SER A OG  1 
ATOM   2702  N  N   . ARG A 1 344 ? 30.065  70.219 73.563  1.00 15.19 ? 362  ARG A N   1 
ATOM   2703  C  CA  . ARG A 1 344 ? 30.959  71.379 73.447  1.00 15.20 ? 362  ARG A CA  1 
ATOM   2704  C  C   . ARG A 1 344 ? 31.663  71.692 74.767  1.00 15.29 ? 362  ARG A C   1 
ATOM   2705  O  O   . ARG A 1 344 ? 32.855  72.006 74.781  1.00 15.44 ? 362  ARG A O   1 
ATOM   2706  C  CB  . ARG A 1 344 ? 30.196  72.612 72.959  1.00 15.21 ? 362  ARG A CB  1 
ATOM   2707  C  CG  . ARG A 1 344 ? 31.071  73.840 72.711  1.00 15.36 ? 362  ARG A CG  1 
ATOM   2708  C  CD  . ARG A 1 344 ? 30.215  75.057 72.490  1.00 16.05 ? 362  ARG A CD  1 
ATOM   2709  N  NE  . ARG A 1 344 ? 30.989  76.275 72.255  1.00 16.77 ? 362  ARG A NE  1 
ATOM   2710  C  CZ  . ARG A 1 344 ? 30.449  77.429 71.862  1.00 17.17 ? 362  ARG A CZ  1 
ATOM   2711  N  NH1 . ARG A 1 344 ? 29.142  77.517 71.648  1.00 16.43 ? 362  ARG A NH1 1 
ATOM   2712  N  NH2 . ARG A 1 344 ? 31.213  78.495 71.671  1.00 17.35 ? 362  ARG A NH2 1 
ATOM   2713  N  N   . ILE A 1 345 ? 30.905  71.616 75.860  1.00 15.15 ? 363  ILE A N   1 
ATOM   2714  C  CA  . ILE A 1 345 ? 31.414  71.845 77.207  1.00 15.03 ? 363  ILE A CA  1 
ATOM   2715  C  C   . ILE A 1 345 ? 32.418  70.759 77.612  1.00 14.91 ? 363  ILE A C   1 
ATOM   2716  O  O   . ILE A 1 345 ? 33.503  71.072 78.109  1.00 14.80 ? 363  ILE A O   1 
ATOM   2717  C  CB  . ILE A 1 345 ? 30.255  71.912 78.247  1.00 14.98 ? 363  ILE A CB  1 
ATOM   2718  C  CG1 . ILE A 1 345 ? 29.407  73.171 78.033  1.00 14.80 ? 363  ILE A CG1 1 
ATOM   2719  C  CG2 . ILE A 1 345 ? 30.801  71.864 79.670  1.00 14.42 ? 363  ILE A CG2 1 
ATOM   2720  C  CD1 . ILE A 1 345 ? 28.074  73.162 78.777  1.00 13.99 ? 363  ILE A CD1 1 
ATOM   2721  N  N   . LEU A 1 346 ? 32.049  69.494 77.404  1.00 14.73 ? 364  LEU A N   1 
ATOM   2722  C  CA  . LEU A 1 346 ? 32.934  68.375 77.718  1.00 14.86 ? 364  LEU A CA  1 
ATOM   2723  C  C   . LEU A 1 346 ? 34.266  68.506 76.985  1.00 14.71 ? 364  LEU A C   1 
ATOM   2724  O  O   . LEU A 1 346 ? 35.325  68.319 77.583  1.00 15.24 ? 364  LEU A O   1 
ATOM   2725  C  CB  . LEU A 1 346 ? 32.280  67.017 77.408  1.00 14.69 ? 364  LEU A CB  1 
ATOM   2726  C  CG  . LEU A 1 346 ? 33.182  65.785 77.618  1.00 15.43 ? 364  LEU A CG  1 
ATOM   2727  C  CD1 . LEU A 1 346 ? 33.411  65.499 79.100  1.00 15.75 ? 364  LEU A CD1 1 
ATOM   2728  C  CD2 . LEU A 1 346 ? 32.644  64.535 76.916  1.00 14.81 ? 364  LEU A CD2 1 
ATOM   2729  N  N   . SER A 1 347 ? 34.206  68.821 75.693  1.00 14.32 ? 365  SER A N   1 
ATOM   2730  C  CA  . SER A 1 347 ? 35.405  69.008 74.892  1.00 14.48 ? 365  SER A CA  1 
ATOM   2731  C  C   . SER A 1 347 ? 36.274  70.149 75.421  1.00 14.34 ? 365  SER A C   1 
ATOM   2732  O  O   . SER A 1 347 ? 37.492  70.007 75.522  1.00 14.50 ? 365  SER A O   1 
ATOM   2733  C  CB  . SER A 1 347 ? 35.033  69.266 73.433  1.00 14.45 ? 365  SER A CB  1 
ATOM   2734  O  OG  . SER A 1 347 ? 34.507  68.096 72.839  1.00 15.08 ? 365  SER A OG  1 
ATOM   2735  N  N   . LYS A 1 348 ? 35.642  71.271 75.757  1.00 13.97 ? 366  LYS A N   1 
ATOM   2736  C  CA  . LYS A 1 348 ? 36.362  72.437 76.256  1.00 14.29 ? 366  LYS A CA  1 
ATOM   2737  C  C   . LYS A 1 348 ? 37.069  72.131 77.580  1.00 14.14 ? 366  LYS A C   1 
ATOM   2738  O  O   . LYS A 1 348 ? 38.276  72.364 77.719  1.00 13.35 ? 366  LYS A O   1 
ATOM   2739  C  CB  . LYS A 1 348 ? 35.417  73.643 76.395  1.00 14.38 ? 366  LYS A CB  1 
ATOM   2740  C  CG  . LYS A 1 348 ? 36.084  74.897 76.951  1.00 15.92 ? 366  LYS A CG  1 
ATOM   2741  C  CD  . LYS A 1 348 ? 36.392  75.950 75.891  1.00 18.75 ? 366  LYS A CD  1 
ATOM   2742  C  CE  . LYS A 1 348 ? 37.280  75.452 74.776  1.00 21.34 ? 366  LYS A CE  1 
ATOM   2743  N  NZ  . LYS A 1 348 ? 37.770  76.593 73.942  1.00 23.65 ? 366  LYS A NZ  1 
ATOM   2744  N  N   . LEU A 1 349 ? 36.313  71.592 78.536  1.00 14.29 ? 367  LEU A N   1 
ATOM   2745  C  CA  . LEU A 1 349 ? 36.853  71.226 79.845  1.00 14.63 ? 367  LEU A CA  1 
ATOM   2746  C  C   . LEU A 1 349 ? 37.968  70.181 79.778  1.00 15.04 ? 367  LEU A C   1 
ATOM   2747  O  O   . LEU A 1 349 ? 38.995  70.337 80.431  1.00 14.79 ? 367  LEU A O   1 
ATOM   2748  C  CB  . LEU A 1 349 ? 35.725  70.801 80.799  1.00 14.83 ? 367  LEU A CB  1 
ATOM   2749  C  CG  . LEU A 1 349 ? 34.801  71.957 81.233  1.00 15.17 ? 367  LEU A CG  1 
ATOM   2750  C  CD1 . LEU A 1 349 ? 33.618  71.468 82.052  1.00 15.74 ? 367  LEU A CD1 1 
ATOM   2751  C  CD2 . LEU A 1 349 ? 35.568  73.043 81.995  1.00 13.94 ? 367  LEU A CD2 1 
ATOM   2752  N  N   . THR A 1 350 ? 37.785  69.138 78.970  1.00 15.69 ? 368  THR A N   1 
ATOM   2753  C  CA  . THR A 1 350 ? 38.829  68.118 78.819  1.00 16.57 ? 368  THR A CA  1 
ATOM   2754  C  C   . THR A 1 350 ? 40.081  68.651 78.099  1.00 16.58 ? 368  THR A C   1 
ATOM   2755  O  O   . THR A 1 350 ? 41.199  68.305 78.479  1.00 16.29 ? 368  THR A O   1 
ATOM   2756  C  CB  . THR A 1 350 ? 38.311  66.823 78.151  1.00 16.61 ? 368  THR A CB  1 
ATOM   2757  O  OG1 . THR A 1 350 ? 37.708  67.139 76.895  1.00 18.60 ? 368  THR A OG1 1 
ATOM   2758  C  CG2 . THR A 1 350 ? 37.274  66.134 79.042  1.00 16.67 ? 368  THR A CG2 1 
ATOM   2759  N  N   . ASP A 1 351 ? 39.891  69.502 77.084  1.00 16.87 ? 369  ASP A N   1 
ATOM   2760  C  CA  . ASP A 1 351 ? 41.010  70.209 76.431  1.00 17.12 ? 369  ASP A CA  1 
ATOM   2761  C  C   . ASP A 1 351 ? 41.897  70.855 77.478  1.00 16.79 ? 369  ASP A C   1 
ATOM   2762  O  O   . ASP A 1 351 ? 43.105  70.620 77.513  1.00 16.54 ? 369  ASP A O   1 
ATOM   2763  C  CB  . ASP A 1 351 ? 40.504  71.317 75.500  1.00 17.50 ? 369  ASP A CB  1 
ATOM   2764  C  CG  . ASP A 1 351 ? 40.238  70.837 74.084  1.00 19.53 ? 369  ASP A CG  1 
ATOM   2765  O  OD1 . ASP A 1 351 ? 40.392  69.631 73.790  1.00 20.19 ? 369  ASP A OD1 1 
ATOM   2766  O  OD2 . ASP A 1 351 ? 39.860  71.699 73.255  1.00 22.51 ? 369  ASP A OD2 1 
ATOM   2767  N  N   . ILE A 1 352 ? 41.270  71.663 78.335  1.00 16.58 ? 370  ILE A N   1 
ATOM   2768  C  CA  . ILE A 1 352 ? 41.956  72.383 79.404  1.00 16.28 ? 370  ILE A CA  1 
ATOM   2769  C  C   . ILE A 1 352 ? 42.637  71.410 80.386  1.00 16.49 ? 370  ILE A C   1 
ATOM   2770  O  O   . ILE A 1 352 ? 43.834  71.527 80.651  1.00 16.80 ? 370  ILE A O   1 
ATOM   2771  C  CB  . ILE A 1 352 ? 40.982  73.369 80.124  1.00 16.01 ? 370  ILE A CB  1 
ATOM   2772  C  CG1 . ILE A 1 352 ? 40.540  74.481 79.159  1.00 15.82 ? 370  ILE A CG1 1 
ATOM   2773  C  CG2 . ILE A 1 352 ? 41.616  73.973 81.385  1.00 15.66 ? 370  ILE A CG2 1 
ATOM   2774  C  CD1 . ILE A 1 352 ? 39.175  75.118 79.500  1.00 15.54 ? 370  ILE A CD1 1 
ATOM   2775  N  N   . GLN A 1 353 ? 41.877  70.434 80.884  1.00 16.32 ? 371  GLN A N   1 
ATOM   2776  C  CA  . GLN A 1 353 ? 42.359  69.472 81.881  1.00 16.23 ? 371  GLN A CA  1 
ATOM   2777  C  C   . GLN A 1 353 ? 43.590  68.691 81.418  1.00 16.56 ? 371  GLN A C   1 
ATOM   2778  O  O   . GLN A 1 353 ? 44.531  68.477 82.198  1.00 16.14 ? 371  GLN A O   1 
ATOM   2779  C  CB  . GLN A 1 353 ? 41.239  68.495 82.267  1.00 16.01 ? 371  GLN A CB  1 
ATOM   2780  C  CG  . GLN A 1 353 ? 40.172  69.091 83.172  1.00 14.76 ? 371  GLN A CG  1 
ATOM   2781  C  CD  . GLN A 1 353 ? 38.872  68.290 83.188  1.00 15.11 ? 371  GLN A CD  1 
ATOM   2782  O  OE1 . GLN A 1 353 ? 38.692  67.335 82.422  1.00 12.47 ? 371  GLN A OE1 1 
ATOM   2783  N  NE2 . GLN A 1 353 ? 37.950  68.693 84.059  1.00 14.87 ? 371  GLN A NE2 1 
ATOM   2784  N  N   . TYR A 1 354 ? 43.568  68.278 80.149  1.00 16.72 ? 372  TYR A N   1 
ATOM   2785  C  CA  . TYR A 1 354 ? 44.632  67.471 79.550  1.00 17.31 ? 372  TYR A CA  1 
ATOM   2786  C  C   . TYR A 1 354 ? 45.709  68.279 78.825  1.00 18.24 ? 372  TYR A C   1 
ATOM   2787  O  O   . TYR A 1 354 ? 46.551  67.714 78.129  1.00 18.62 ? 372  TYR A O   1 
ATOM   2788  C  CB  . TYR A 1 354 ? 44.034  66.420 78.608  1.00 16.87 ? 372  TYR A CB  1 
ATOM   2789  C  CG  . TYR A 1 354 ? 43.292  65.329 79.332  1.00 15.74 ? 372  TYR A CG  1 
ATOM   2790  C  CD1 . TYR A 1 354 ? 41.916  65.412 79.533  1.00 15.34 ? 372  TYR A CD1 1 
ATOM   2791  C  CD2 . TYR A 1 354 ? 43.968  64.218 79.836  1.00 14.78 ? 372  TYR A CD2 1 
ATOM   2792  C  CE1 . TYR A 1 354 ? 41.225  64.403 80.204  1.00 15.80 ? 372  TYR A CE1 1 
ATOM   2793  C  CE2 . TYR A 1 354 ? 43.288  63.202 80.504  1.00 15.02 ? 372  TYR A CE2 1 
ATOM   2794  C  CZ  . TYR A 1 354 ? 41.918  63.305 80.684  1.00 15.17 ? 372  TYR A CZ  1 
ATOM   2795  O  OH  . TYR A 1 354 ? 41.240  62.313 81.351  1.00 16.66 ? 372  TYR A OH  1 
ATOM   2796  N  N   . GLY A 1 355 ? 45.677  69.595 78.987  1.00 19.43 ? 373  GLY A N   1 
ATOM   2797  C  CA  . GLY A 1 355 ? 46.717  70.466 78.446  1.00 21.08 ? 373  GLY A CA  1 
ATOM   2798  C  C   . GLY A 1 355 ? 46.664  70.769 76.959  1.00 22.04 ? 373  GLY A C   1 
ATOM   2799  O  O   . GLY A 1 355 ? 47.640  71.272 76.407  1.00 22.13 ? 373  GLY A O   1 
ATOM   2800  N  N   . ARG A 1 356 ? 45.538  70.473 76.310  1.00 23.26 ? 374  ARG A N   1 
ATOM   2801  C  CA  . ARG A 1 356 ? 45.338  70.826 74.896  1.00 24.76 ? 374  ARG A CA  1 
ATOM   2802  C  C   . ARG A 1 356 ? 45.154  72.335 74.721  1.00 25.58 ? 374  ARG A C   1 
ATOM   2803  O  O   . ARG A 1 356 ? 45.573  72.907 73.707  1.00 25.69 ? 374  ARG A O   1 
ATOM   2804  C  CB  . ARG A 1 356 ? 44.141  70.085 74.287  1.00 24.81 ? 374  ARG A CB  1 
ATOM   2805  C  CG  . ARG A 1 356 ? 44.286  68.569 74.190  1.00 26.32 ? 374  ARG A CG  1 
ATOM   2806  C  CD  . ARG A 1 356 ? 43.259  67.993 73.213  1.00 30.09 ? 374  ARG A CD  1 
ATOM   2807  N  NE  . ARG A 1 356 ? 43.110  66.546 73.350  1.00 33.68 ? 374  ARG A NE  1 
ATOM   2808  C  CZ  . ARG A 1 356 ? 43.756  65.636 72.617  1.00 35.28 ? 374  ARG A CZ  1 
ATOM   2809  N  NH1 . ARG A 1 356 ? 44.615  66.011 71.668  1.00 34.63 ? 374  ARG A NH1 1 
ATOM   2810  N  NH2 . ARG A 1 356 ? 43.542  64.338 72.839  1.00 35.36 ? 374  ARG A NH2 1 
ATOM   2811  N  N   . GLU A 1 357 ? 44.510  72.963 75.705  1.00 26.50 ? 375  GLU A N   1 
ATOM   2812  C  CA  . GLU A 1 357 ? 44.373  74.415 75.768  1.00 27.75 ? 375  GLU A CA  1 
ATOM   2813  C  C   . GLU A 1 357 ? 45.044  74.941 77.043  1.00 28.29 ? 375  GLU A C   1 
ATOM   2814  O  O   . GLU A 1 357 ? 44.765  74.464 78.143  1.00 28.30 ? 375  GLU A O   1 
ATOM   2815  C  CB  . GLU A 1 357 ? 42.893  74.823 75.729  1.00 27.88 ? 375  GLU A CB  1 
ATOM   2816  C  CG  . GLU A 1 357 ? 42.650  76.341 75.780  1.00 29.22 ? 375  GLU A CG  1 
ATOM   2817  C  CD  . GLU A 1 357 ? 41.175  76.714 75.933  1.00 30.60 ? 375  GLU A CD  1 
ATOM   2818  O  OE1 . GLU A 1 357 ? 40.337  76.208 75.145  1.00 30.42 ? 375  GLU A OE1 1 
ATOM   2819  O  OE2 . GLU A 1 357 ? 40.862  77.524 76.841  1.00 30.68 ? 375  GLU A OE2 1 
ATOM   2820  N  N   . GLU A 1 358 ? 45.941  75.910 76.880  1.00 29.12 ? 376  GLU A N   1 
ATOM   2821  C  CA  . GLU A 1 358 ? 46.608  76.560 78.007  1.00 29.96 ? 376  GLU A CA  1 
ATOM   2822  C  C   . GLU A 1 358 ? 45.618  77.468 78.728  1.00 29.86 ? 376  GLU A C   1 
ATOM   2823  O  O   . GLU A 1 358 ? 44.996  78.334 78.111  1.00 30.06 ? 376  GLU A O   1 
ATOM   2824  C  CB  . GLU A 1 358 ? 47.829  77.371 77.534  1.00 30.44 ? 376  GLU A CB  1 
ATOM   2825  C  CG  . GLU A 1 358 ? 49.006  76.527 77.007  1.00 32.58 ? 376  GLU A CG  1 
ATOM   2826  C  CD  . GLU A 1 358 ? 49.989  77.323 76.137  1.00 36.17 ? 376  GLU A CD  1 
ATOM   2827  O  OE1 . GLU A 1 358 ? 50.026  78.575 76.238  1.00 37.35 ? 376  GLU A OE1 1 
ATOM   2828  O  OE2 . GLU A 1 358 ? 50.733  76.690 75.348  1.00 37.15 ? 376  GLU A OE2 1 
ATOM   2829  N  N   . SER A 1 359 ? 45.460  77.253 80.030  1.00 29.66 ? 377  SER A N   1 
ATOM   2830  C  CA  . SER A 1 359 ? 44.576  78.085 80.839  1.00 29.50 ? 377  SER A CA  1 
ATOM   2831  C  C   . SER A 1 359 ? 45.129  78.198 82.252  1.00 29.19 ? 377  SER A C   1 
ATOM   2832  O  O   . SER A 1 359 ? 45.848  77.302 82.716  1.00 29.13 ? 377  SER A O   1 
ATOM   2833  C  CB  . SER A 1 359 ? 43.158  77.500 80.863  1.00 29.57 ? 377  SER A CB  1 
ATOM   2834  O  OG  . SER A 1 359 ? 42.179  78.520 80.995  1.00 29.96 ? 377  SER A OG  1 
ATOM   2835  N  N   . ASP A 1 360 ? 44.791  79.292 82.936  1.00 28.58 ? 378  ASP A N   1 
ATOM   2836  C  CA  . ASP A 1 360 ? 45.206  79.475 84.328  1.00 28.16 ? 378  ASP A CA  1 
ATOM   2837  C  C   . ASP A 1 360 ? 44.450  78.546 85.294  1.00 27.21 ? 378  ASP A C   1 
ATOM   2838  O  O   . ASP A 1 360 ? 44.799  78.450 86.474  1.00 27.22 ? 378  ASP A O   1 
ATOM   2839  C  CB  . ASP A 1 360 ? 45.086  80.947 84.750  1.00 28.75 ? 378  ASP A CB  1 
ATOM   2840  C  CG  . ASP A 1 360 ? 43.642  81.432 84.830  1.00 30.75 ? 378  ASP A CG  1 
ATOM   2841  O  OD1 . ASP A 1 360 ? 42.718  80.718 84.365  1.00 32.99 ? 378  ASP A OD1 1 
ATOM   2842  O  OD2 . ASP A 1 360 ? 43.434  82.544 85.366  1.00 32.69 ? 378  ASP A OD2 1 
ATOM   2843  N  N   . TRP A 1 361 ? 43.435  77.855 84.771  1.00 25.95 ? 379  TRP A N   1 
ATOM   2844  C  CA  . TRP A 1 361 ? 42.638  76.885 85.527  1.00 24.85 ? 379  TRP A CA  1 
ATOM   2845  C  C   . TRP A 1 361 ? 43.420  75.636 85.936  1.00 24.61 ? 379  TRP A C   1 
ATOM   2846  O  O   . TRP A 1 361 ? 43.022  74.934 86.864  1.00 24.38 ? 379  TRP A O   1 
ATOM   2847  C  CB  . TRP A 1 361 ? 41.405  76.474 84.716  1.00 24.32 ? 379  TRP A CB  1 
ATOM   2848  C  CG  . TRP A 1 361 ? 40.295  77.494 84.712  1.00 23.12 ? 379  TRP A CG  1 
ATOM   2849  C  CD1 . TRP A 1 361 ? 40.305  78.735 85.299  1.00 22.41 ? 379  TRP A CD1 1 
ATOM   2850  C  CD2 . TRP A 1 361 ? 39.027  77.376 84.058  1.00 22.15 ? 379  TRP A CD2 1 
ATOM   2851  N  NE1 . TRP A 1 361 ? 39.116  79.381 85.065  1.00 21.97 ? 379  TRP A NE1 1 
ATOM   2852  C  CE2 . TRP A 1 361 ? 38.313  78.571 84.306  1.00 21.79 ? 379  TRP A CE2 1 
ATOM   2853  C  CE3 . TRP A 1 361 ? 38.417  76.370 83.294  1.00 21.58 ? 379  TRP A CE3 1 
ATOM   2854  C  CZ2 . TRP A 1 361 ? 37.022  78.789 83.814  1.00 21.35 ? 379  TRP A CZ2 1 
ATOM   2855  C  CZ3 . TRP A 1 361 ? 37.131  76.592 82.804  1.00 20.99 ? 379  TRP A CZ3 1 
ATOM   2856  C  CH2 . TRP A 1 361 ? 36.453  77.791 83.066  1.00 20.81 ? 379  TRP A CH2 1 
ATOM   2857  N  N   . THR A 1 362 ? 44.513  75.347 85.235  1.00 24.36 ? 380  THR A N   1 
ATOM   2858  C  CA  . THR A 1 362 ? 45.329  74.179 85.563  1.00 24.44 ? 380  THR A CA  1 
ATOM   2859  C  C   . THR A 1 362 ? 46.668  74.569 86.168  1.00 24.65 ? 380  THR A C   1 
ATOM   2860  O  O   . THR A 1 362 ? 47.173  75.669 85.943  1.00 24.79 ? 380  THR A O   1 
ATOM   2861  C  CB  . THR A 1 362 ? 45.572  73.231 84.357  1.00 24.41 ? 380  THR A CB  1 
ATOM   2862  O  OG1 . THR A 1 362 ? 46.253  73.932 83.310  1.00 24.58 ? 380  THR A OG1 1 
ATOM   2863  C  CG2 . THR A 1 362 ? 44.267  72.646 83.834  1.00 23.68 ? 380  THR A CG2 1 
ATOM   2864  N  N   . ILE A 1 363 ? 47.222  73.643 86.942  1.00 24.88 ? 381  ILE A N   1 
ATOM   2865  C  CA  . ILE A 1 363 ? 48.502  73.798 87.605  1.00 25.36 ? 381  ILE A CA  1 
ATOM   2866  C  C   . ILE A 1 363 ? 49.280  72.510 87.371  1.00 25.51 ? 381  ILE A C   1 
ATOM   2867  O  O   . ILE A 1 363 ? 48.740  71.420 87.560  1.00 25.30 ? 381  ILE A O   1 
ATOM   2868  C  CB  . ILE A 1 363 ? 48.299  74.048 89.123  1.00 25.50 ? 381  ILE A CB  1 
ATOM   2869  C  CG1 . ILE A 1 363 ? 47.755  75.464 89.350  1.00 26.19 ? 381  ILE A CG1 1 
ATOM   2870  C  CG2 . ILE A 1 363 ? 49.593  73.831 89.904  1.00 25.69 ? 381  ILE A CG2 1 
ATOM   2871  C  CD1 . ILE A 1 363 ? 46.933  75.621 90.610  1.00 28.04 ? 381  ILE A CD1 1 
ATOM   2872  N  N   . VAL A 1 364 ? 50.533  72.642 86.940  1.00 25.98 ? 382  VAL A N   1 
ATOM   2873  C  CA  . VAL A 1 364 ? 51.432  71.495 86.743  1.00 26.86 ? 382  VAL A CA  1 
ATOM   2874  C  C   . VAL A 1 364 ? 51.900  70.939 88.097  1.00 27.22 ? 382  VAL A C   1 
ATOM   2875  O  O   . VAL A 1 364 ? 52.149  71.698 89.032  1.00 27.34 ? 382  VAL A O   1 
ATOM   2876  C  CB  . VAL A 1 364 ? 52.647  71.866 85.832  1.00 26.71 ? 382  VAL A CB  1 
ATOM   2877  C  CG1 . VAL A 1 364 ? 53.640  70.715 85.724  1.00 27.29 ? 382  VAL A CG1 1 
ATOM   2878  C  CG2 . VAL A 1 364 ? 52.172  72.269 84.439  1.00 27.13 ? 382  VAL A CG2 1 
ATOM   2879  N  N   . LEU A 1 365 ? 52.003  69.614 88.186  1.00 28.02 ? 383  LEU A N   1 
ATOM   2880  C  CA  . LEU A 1 365 ? 52.416  68.906 89.406  1.00 28.81 ? 383  LEU A CA  1 
ATOM   2881  C  C   . LEU A 1 365 ? 53.725  69.456 89.990  1.00 29.35 ? 383  LEU A C   1 
ATOM   2882  O  O   . LEU A 1 365 ? 54.685  69.708 89.249  1.00 29.59 ? 383  LEU A O   1 
ATOM   2883  C  CB  . LEU A 1 365 ? 52.590  67.415 89.099  1.00 28.72 ? 383  LEU A CB  1 
ATOM   2884  C  CG  . LEU A 1 365 ? 52.040  66.290 89.986  1.00 29.54 ? 383  LEU A CG  1 
ATOM   2885  C  CD1 . LEU A 1 365 ? 52.810  65.003 89.697  1.00 30.32 ? 383  LEU A CD1 1 
ATOM   2886  C  CD2 . LEU A 1 365 ? 52.097  66.598 91.470  1.00 29.96 ? 383  LEU A CD2 1 
ATOM   2887  N  N   . SER A 1 366 ? 53.751  69.624 91.315  1.00 29.80 ? 384  SER A N   1 
ATOM   2888  C  CA  . SER A 1 366 ? 54.942  70.048 92.061  1.00 30.32 ? 384  SER A CA  1 
ATOM   2889  C  C   . SER A 1 366 ? 56.163  69.185 91.757  1.00 30.52 ? 384  SER A C   1 
ATOM   2890  O  O   . SER A 1 366 ? 56.031  68.013 91.401  1.00 31.02 ? 384  SER A O   1 
ATOM   2891  C  CB  . SER A 1 366 ? 54.671  70.015 93.569  1.00 30.29 ? 384  SER A CB  1 
ATOM   2892  O  OG  . SER A 1 366 ? 53.927  71.144 93.991  1.00 31.04 ? 384  SER A OG  1 
ATOM   2893  N  N   . VAL B 1 1   ? 23.197  36.282 102.631 1.00 40.98 ? 19   VAL D N   1 
ATOM   2894  C  CA  . VAL B 1 1   ? 22.284  35.108 102.801 1.00 40.94 ? 19   VAL D CA  1 
ATOM   2895  C  C   . VAL B 1 1   ? 21.705  35.001 104.227 1.00 40.40 ? 19   VAL D C   1 
ATOM   2896  O  O   . VAL B 1 1   ? 20.488  34.850 104.395 1.00 40.69 ? 19   VAL D O   1 
ATOM   2897  C  CB  . VAL B 1 1   ? 22.950  33.763 102.323 1.00 41.10 ? 19   VAL D CB  1 
ATOM   2898  C  CG1 . VAL B 1 1   ? 24.136  33.356 103.213 1.00 41.41 ? 19   VAL D CG1 1 
ATOM   2899  C  CG2 . VAL B 1 1   ? 21.914  32.628 102.225 1.00 41.67 ? 19   VAL D CG2 1 
ATOM   2900  N  N   . VAL B 1 2   ? 22.570  35.097 105.239 1.00 39.51 ? 20   VAL D N   1 
ATOM   2901  C  CA  . VAL B 1 2   ? 22.159  34.982 106.646 1.00 38.38 ? 20   VAL D CA  1 
ATOM   2902  C  C   . VAL B 1 2   ? 21.373  36.228 107.080 1.00 37.33 ? 20   VAL D C   1 
ATOM   2903  O  O   . VAL B 1 2   ? 21.957  37.297 107.298 1.00 37.20 ? 20   VAL D O   1 
ATOM   2904  C  CB  . VAL B 1 2   ? 23.373  34.726 107.593 1.00 38.61 ? 20   VAL D CB  1 
ATOM   2905  C  CG1 . VAL B 1 2   ? 22.898  34.386 109.012 1.00 38.48 ? 20   VAL D CG1 1 
ATOM   2906  C  CG2 . VAL B 1 2   ? 24.258  33.605 107.049 1.00 38.68 ? 20   VAL D CG2 1 
ATOM   2907  N  N   . GLY B 1 3   ? 20.050  36.065 107.196 1.00 36.09 ? 21   GLY D N   1 
ATOM   2908  C  CA  . GLY B 1 3   ? 19.104  37.161 107.468 1.00 34.20 ? 21   GLY D CA  1 
ATOM   2909  C  C   . GLY B 1 3   ? 19.337  37.926 108.760 1.00 32.90 ? 21   GLY D C   1 
ATOM   2910  O  O   . GLY B 1 3   ? 19.140  39.147 108.815 1.00 32.80 ? 21   GLY D O   1 
ATOM   2911  N  N   . THR B 1 4   ? 19.745  37.209 109.804 1.00 31.49 ? 22   THR D N   1 
ATOM   2912  C  CA  . THR B 1 4   ? 20.080  37.837 111.080 1.00 30.04 ? 22   THR D CA  1 
ATOM   2913  C  C   . THR B 1 4   ? 21.209  37.106 111.781 1.00 29.15 ? 22   THR D C   1 
ATOM   2914  O  O   . THR B 1 4   ? 21.378  35.904 111.596 1.00 29.17 ? 22   THR D O   1 
ATOM   2915  C  CB  . THR B 1 4   ? 18.839  37.955 112.025 1.00 30.02 ? 22   THR D CB  1 
ATOM   2916  O  OG1 . THR B 1 4   ? 19.151  38.817 113.121 1.00 29.48 ? 22   THR D OG1 1 
ATOM   2917  C  CG2 . THR B 1 4   ? 18.395  36.589 112.563 1.00 29.67 ? 22   THR D CG2 1 
ATOM   2918  N  N   . PHE B 1 5   ? 21.989  37.840 112.571 1.00 28.05 ? 23   PHE D N   1 
ATOM   2919  C  CA  . PHE B 1 5   ? 22.866  37.223 113.558 1.00 27.03 ? 23   PHE D CA  1 
ATOM   2920  C  C   . PHE B 1 5   ? 21.991  36.689 114.701 1.00 27.26 ? 23   PHE D C   1 
ATOM   2921  O  O   . PHE B 1 5   ? 20.862  37.145 114.897 1.00 26.96 ? 23   PHE D O   1 
ATOM   2922  C  CB  . PHE B 1 5   ? 23.924  38.212 114.073 1.00 26.55 ? 23   PHE D CB  1 
ATOM   2923  C  CG  . PHE B 1 5   ? 23.355  39.510 114.603 1.00 24.60 ? 23   PHE D CG  1 
ATOM   2924  C  CD1 . PHE B 1 5   ? 23.050  39.654 115.953 1.00 23.06 ? 23   PHE D CD1 1 
ATOM   2925  C  CD2 . PHE B 1 5   ? 23.128  40.589 113.749 1.00 22.21 ? 23   PHE D CD2 1 
ATOM   2926  C  CE1 . PHE B 1 5   ? 22.520  40.856 116.447 1.00 22.88 ? 23   PHE D CE1 1 
ATOM   2927  C  CE2 . PHE B 1 5   ? 22.605  41.793 114.229 1.00 20.75 ? 23   PHE D CE2 1 
ATOM   2928  C  CZ  . PHE B 1 5   ? 22.298  41.928 115.576 1.00 20.89 ? 23   PHE D CZ  1 
ATOM   2929  N  N   . LYS B 1 6   ? 22.507  35.713 115.441 1.00 27.55 ? 24   LYS D N   1 
ATOM   2930  C  CA  . LYS B 1 6   ? 21.745  35.089 116.518 1.00 27.94 ? 24   LYS D CA  1 
ATOM   2931  C  C   . LYS B 1 6   ? 22.554  35.026 117.801 1.00 27.99 ? 24   LYS D C   1 
ATOM   2932  O  O   . LYS B 1 6   ? 23.750  34.733 117.776 1.00 27.71 ? 24   LYS D O   1 
ATOM   2933  C  CB  . LYS B 1 6   ? 21.270  33.692 116.100 1.00 28.15 ? 24   LYS D CB  1 
ATOM   2934  C  CG  . LYS B 1 6   ? 20.177  33.727 115.040 1.00 29.41 ? 24   LYS D CG  1 
ATOM   2935  C  CD  . LYS B 1 6   ? 19.864  32.362 114.478 1.00 31.90 ? 24   LYS D CD  1 
ATOM   2936  C  CE  . LYS B 1 6   ? 18.682  32.445 113.513 1.00 33.83 ? 24   LYS D CE  1 
ATOM   2937  N  NZ  . LYS B 1 6   ? 18.125  31.096 113.173 1.00 34.72 ? 24   LYS D NZ  1 
ATOM   2938  N  N   . ALA B 1 7   ? 21.889  35.315 118.918 1.00 28.20 ? 25   ALA D N   1 
ATOM   2939  C  CA  . ALA B 1 7   ? 22.523  35.302 120.234 1.00 28.73 ? 25   ALA D CA  1 
ATOM   2940  C  C   . ALA B 1 7   ? 23.063  33.915 120.610 1.00 29.00 ? 25   ALA D C   1 
ATOM   2941  O  O   . ALA B 1 7   ? 23.999  33.807 121.407 1.00 28.78 ? 25   ALA D O   1 
ATOM   2942  C  CB  . ALA B 1 7   ? 21.552  35.810 121.290 1.00 28.61 ? 25   ALA D CB  1 
ATOM   2943  N  N   . LYS B 1 8   ? 22.458  32.879 120.021 1.00 29.37 ? 26   LYS D N   1 
ATOM   2944  C  CA  . LYS B 1 8   ? 22.890  31.477 120.128 1.00 29.99 ? 26   LYS D CA  1 
ATOM   2945  C  C   . LYS B 1 8   ? 24.361  31.253 119.800 1.00 29.96 ? 26   LYS D C   1 
ATOM   2946  O  O   . LYS B 1 8   ? 25.058  30.547 120.532 1.00 30.14 ? 26   LYS D O   1 
ATOM   2947  C  CB  . LYS B 1 8   ? 22.088  30.609 119.160 1.00 30.27 ? 26   LYS D CB  1 
ATOM   2948  C  CG  . LYS B 1 8   ? 20.825  29.994 119.693 1.00 31.45 ? 26   LYS D CG  1 
ATOM   2949  C  CD  . LYS B 1 8   ? 19.927  29.557 118.525 1.00 34.19 ? 26   LYS D CD  1 
ATOM   2950  C  CE  . LYS B 1 8   ? 20.704  28.787 117.447 1.00 34.85 ? 26   LYS D CE  1 
ATOM   2951  N  NZ  . LYS B 1 8   ? 19.874  28.478 116.245 1.00 36.10 ? 26   LYS D NZ  1 
ATOM   2952  N  N   . ASP B 1 9   ? 24.822  31.820 118.685 1.00 29.84 ? 27   ASP D N   1 
ATOM   2953  C  CA  . ASP B 1 9   ? 26.205  31.606 118.255 1.00 29.97 ? 27   ASP D CA  1 
ATOM   2954  C  C   . ASP B 1 9   ? 27.148  32.760 118.608 1.00 29.44 ? 27   ASP D C   1 
ATOM   2955  O  O   . ASP B 1 9   ? 28.140  33.017 117.922 1.00 29.43 ? 27   ASP D O   1 
ATOM   2956  C  CB  . ASP B 1 9   ? 26.302  31.169 116.776 1.00 30.59 ? 27   ASP D CB  1 
ATOM   2957  C  CG  . ASP B 1 9   ? 25.243  31.794 115.895 1.00 31.87 ? 27   ASP D CG  1 
ATOM   2958  O  OD1 . ASP B 1 9   ? 25.239  33.030 115.750 1.00 34.71 ? 27   ASP D OD1 1 
ATOM   2959  O  OD2 . ASP B 1 9   ? 24.430  31.046 115.320 1.00 32.99 ? 27   ASP D OD2 1 
ATOM   2960  N  N   . LEU B 1 10  ? 26.831  33.423 119.715 1.00 28.90 ? 28   LEU D N   1 
ATOM   2961  C  CA  . LEU B 1 10  ? 27.677  34.447 120.309 1.00 28.41 ? 28   LEU D CA  1 
ATOM   2962  C  C   . LEU B 1 10  ? 29.027  33.830 120.665 1.00 28.29 ? 28   LEU D C   1 
ATOM   2963  O  O   . LEU B 1 10  ? 29.091  32.763 121.282 1.00 28.25 ? 28   LEU D O   1 
ATOM   2964  C  CB  . LEU B 1 10  ? 26.983  35.006 121.558 1.00 28.29 ? 28   LEU D CB  1 
ATOM   2965  C  CG  . LEU B 1 10  ? 27.109  36.429 122.115 1.00 27.90 ? 28   LEU D CG  1 
ATOM   2966  C  CD1 . LEU B 1 10  ? 27.365  37.501 121.079 1.00 25.98 ? 28   LEU D CD1 1 
ATOM   2967  C  CD2 . LEU B 1 10  ? 25.850  36.754 122.907 1.00 27.53 ? 28   LEU D CD2 1 
ATOM   2968  N  N   . ILE B 1 11  ? 30.097  34.488 120.232 1.00 28.07 ? 29   ILE D N   1 
ATOM   2969  C  CA  . ILE B 1 11  ? 31.455  34.076 120.554 1.00 28.00 ? 29   ILE D CA  1 
ATOM   2970  C  C   . ILE B 1 11  ? 31.980  35.063 121.582 1.00 28.10 ? 29   ILE D C   1 
ATOM   2971  O  O   . ILE B 1 11  ? 32.090  36.262 121.304 1.00 28.04 ? 29   ILE D O   1 
ATOM   2972  C  CB  . ILE B 1 11  ? 32.371  34.047 119.295 1.00 28.03 ? 29   ILE D CB  1 
ATOM   2973  C  CG1 . ILE B 1 11  ? 31.890  32.979 118.305 1.00 27.75 ? 29   ILE D CG1 1 
ATOM   2974  C  CG2 . ILE B 1 11  ? 33.836  33.799 119.686 1.00 27.91 ? 29   ILE D CG2 1 
ATOM   2975  C  CD1 . ILE B 1 11  ? 32.199  33.280 116.846 1.00 28.16 ? 29   ILE D CD1 1 
ATOM   2976  N  N   . VAL B 1 12  ? 32.281  34.556 122.775 1.00 28.11 ? 30   VAL D N   1 
ATOM   2977  C  CA  . VAL B 1 12  ? 32.696  35.405 123.887 1.00 28.18 ? 30   VAL D CA  1 
ATOM   2978  C  C   . VAL B 1 12  ? 34.194  35.248 124.159 1.00 28.51 ? 30   VAL D C   1 
ATOM   2979  O  O   . VAL B 1 12  ? 34.674  34.152 124.465 1.00 28.70 ? 30   VAL D O   1 
ATOM   2980  C  CB  . VAL B 1 12  ? 31.850  35.139 125.167 1.00 28.12 ? 30   VAL D CB  1 
ATOM   2981  C  CG1 . VAL B 1 12  ? 32.222  36.113 126.269 1.00 27.81 ? 30   VAL D CG1 1 
ATOM   2982  C  CG2 . VAL B 1 12  ? 30.356  35.241 124.860 1.00 27.71 ? 30   VAL D CG2 1 
ATOM   2983  N  N   . THR B 1 13  ? 34.919  36.354 124.023 1.00 28.71 ? 31   THR D N   1 
ATOM   2984  C  CA  . THR B 1 13  ? 36.354  36.401 124.251 1.00 29.10 ? 31   THR D CA  1 
ATOM   2985  C  C   . THR B 1 13  ? 36.627  37.419 125.365 1.00 29.52 ? 31   THR D C   1 
ATOM   2986  O  O   . THR B 1 13  ? 36.815  38.605 125.090 1.00 29.28 ? 31   THR D O   1 
ATOM   2987  C  CB  . THR B 1 13  ? 37.125  36.782 122.952 1.00 29.25 ? 31   THR D CB  1 
ATOM   2988  O  OG1 . THR B 1 13  ? 36.694  35.950 121.868 1.00 28.73 ? 31   THR D OG1 1 
ATOM   2989  C  CG2 . THR B 1 13  ? 38.640  36.625 123.135 1.00 29.32 ? 31   THR D CG2 1 
ATOM   2990  N  N   . PRO B 1 14  ? 36.632  36.958 126.634 1.00 30.00 ? 32   PRO D N   1 
ATOM   2991  C  CA  . PRO B 1 14  ? 36.806  37.854 127.778 1.00 30.35 ? 32   PRO D CA  1 
ATOM   2992  C  C   . PRO B 1 14  ? 38.193  38.483 127.830 1.00 30.70 ? 32   PRO D C   1 
ATOM   2993  O  O   . PRO B 1 14  ? 39.164  37.877 127.377 1.00 30.90 ? 32   PRO D O   1 
ATOM   2994  C  CB  . PRO B 1 14  ? 36.603  36.930 128.987 1.00 30.29 ? 32   PRO D CB  1 
ATOM   2995  C  CG  . PRO B 1 14  ? 35.912  35.716 128.445 1.00 30.60 ? 32   PRO D CG  1 
ATOM   2996  C  CD  . PRO B 1 14  ? 36.459  35.560 127.068 1.00 30.08 ? 32   PRO D CD  1 
ATOM   2997  N  N   . ALA B 1 15  ? 38.274  39.695 128.372 1.00 31.09 ? 33   ALA D N   1 
ATOM   2998  C  CA  . ALA B 1 15  ? 39.551  40.363 128.592 1.00 31.71 ? 33   ALA D CA  1 
ATOM   2999  C  C   . ALA B 1 15  ? 40.297  39.676 129.732 1.00 32.17 ? 33   ALA D C   1 
ATOM   3000  O  O   . ALA B 1 15  ? 39.684  39.220 130.703 1.00 32.34 ? 33   ALA D O   1 
ATOM   3001  C  CB  . ALA B 1 15  ? 39.338  41.831 128.902 1.00 31.58 ? 33   ALA D CB  1 
ATOM   3002  N  N   . THR B 1 16  ? 41.615  39.584 129.602 1.00 32.58 ? 34   THR D N   1 
ATOM   3003  C  CA  . THR B 1 16  ? 42.433  38.941 130.626 1.00 33.04 ? 34   THR D CA  1 
ATOM   3004  C  C   . THR B 1 16  ? 42.864  39.964 131.673 1.00 32.91 ? 34   THR D C   1 
ATOM   3005  O  O   . THR B 1 16  ? 42.961  39.645 132.862 1.00 32.75 ? 34   THR D O   1 
ATOM   3006  C  CB  . THR B 1 16  ? 43.655  38.206 130.019 1.00 33.26 ? 34   THR D CB  1 
ATOM   3007  O  OG1 . THR B 1 16  ? 44.439  39.121 129.242 1.00 34.02 ? 34   THR D OG1 1 
ATOM   3008  C  CG2 . THR B 1 16  ? 43.198  37.051 129.124 1.00 33.63 ? 34   THR D CG2 1 
ATOM   3009  N  N   . ILE B 1 17  ? 43.101  41.192 131.211 1.00 32.78 ? 35   ILE D N   1 
ATOM   3010  C  CA  . ILE B 1 17  ? 43.387  42.337 132.073 1.00 32.73 ? 35   ILE D CA  1 
ATOM   3011  C  C   . ILE B 1 17  ? 42.155  43.250 132.135 1.00 32.45 ? 35   ILE D C   1 
ATOM   3012  O  O   . ILE B 1 17  ? 41.777  43.861 131.133 1.00 32.69 ? 35   ILE D O   1 
ATOM   3013  C  CB  . ILE B 1 17  ? 44.614  43.139 131.568 1.00 32.77 ? 35   ILE D CB  1 
ATOM   3014  C  CG1 . ILE B 1 17  ? 45.814  42.209 131.337 1.00 33.12 ? 35   ILE D CG1 1 
ATOM   3015  C  CG2 . ILE B 1 17  ? 44.979  44.225 132.563 1.00 33.32 ? 35   ILE D CG2 1 
ATOM   3016  C  CD1 . ILE B 1 17  ? 46.768  42.674 130.250 1.00 34.15 ? 35   ILE D CD1 1 
ATOM   3017  N  N   . LEU B 1 18  ? 41.538  43.321 133.315 1.00 31.98 ? 36   LEU D N   1 
ATOM   3018  C  CA  . LEU B 1 18  ? 40.331  44.114 133.558 1.00 31.13 ? 36   LEU D CA  1 
ATOM   3019  C  C   . LEU B 1 18  ? 40.671  45.478 134.152 1.00 30.62 ? 36   LEU D C   1 
ATOM   3020  O  O   . LEU B 1 18  ? 41.602  45.598 134.955 1.00 30.46 ? 36   LEU D O   1 
ATOM   3021  C  CB  . LEU B 1 18  ? 39.383  43.350 134.492 1.00 31.31 ? 36   LEU D CB  1 
ATOM   3022  C  CG  . LEU B 1 18  ? 38.253  42.456 133.941 1.00 31.60 ? 36   LEU D CG  1 
ATOM   3023  C  CD1 . LEU B 1 18  ? 38.501  41.875 132.546 1.00 31.23 ? 36   LEU D CD1 1 
ATOM   3024  C  CD2 . LEU B 1 18  ? 37.932  41.343 134.925 1.00 32.45 ? 36   LEU D CD2 1 
ATOM   3025  N  N   . LYS B 1 19  ? 39.917  46.500 133.750 1.00 29.76 ? 37   LYS D N   1 
ATOM   3026  C  CA  . LYS B 1 19  ? 40.148  47.880 134.199 1.00 29.13 ? 37   LYS D CA  1 
ATOM   3027  C  C   . LYS B 1 19  ? 39.418  48.185 135.504 1.00 28.80 ? 37   LYS D C   1 
ATOM   3028  O  O   . LYS B 1 19  ? 38.402  47.557 135.825 1.00 28.31 ? 37   LYS D O   1 
ATOM   3029  C  CB  . LYS B 1 19  ? 39.704  48.886 133.127 1.00 29.07 ? 37   LYS D CB  1 
ATOM   3030  C  CG  . LYS B 1 19  ? 40.531  48.862 131.836 1.00 29.59 ? 37   LYS D CG  1 
ATOM   3031  C  CD  . LYS B 1 19  ? 39.920  49.744 130.741 1.00 30.21 ? 37   LYS D CD  1 
ATOM   3032  C  CE  . LYS B 1 19  ? 38.581  49.189 130.229 1.00 30.48 ? 37   LYS D CE  1 
ATOM   3033  N  NZ  . LYS B 1 19  ? 38.111  49.913 129.021 1.00 30.39 ? 37   LYS D NZ  1 
ATOM   3034  N  N   . GLU B 1 20  ? 39.939  49.158 136.247 1.00 28.47 ? 38   GLU D N   1 
ATOM   3035  C  CA  . GLU B 1 20  ? 39.281  49.641 137.455 1.00 28.26 ? 38   GLU D CA  1 
ATOM   3036  C  C   . GLU B 1 20  ? 38.103  50.517 137.067 1.00 27.62 ? 38   GLU D C   1 
ATOM   3037  O  O   . GLU B 1 20  ? 38.227  51.365 136.183 1.00 27.66 ? 38   GLU D O   1 
ATOM   3038  C  CB  . GLU B 1 20  ? 40.257  50.435 138.337 1.00 28.44 ? 38   GLU D CB  1 
ATOM   3039  C  CG  . GLU B 1 20  ? 39.649  50.934 139.658 1.00 29.53 ? 38   GLU D CG  1 
ATOM   3040  C  CD  . GLU B 1 20  ? 40.700  51.337 140.679 1.00 31.67 ? 38   GLU D CD  1 
ATOM   3041  O  OE1 . GLU B 1 20  ? 40.799  52.542 140.995 1.00 31.65 ? 38   GLU D OE1 1 
ATOM   3042  O  OE2 . GLU B 1 20  ? 41.437  50.447 141.159 1.00 33.27 ? 38   GLU D OE2 1 
ATOM   3043  N  N   . LYS B 1 21  ? 36.969  50.307 137.732 1.00 26.99 ? 39   LYS D N   1 
ATOM   3044  C  CA  . LYS B 1 21  ? 35.769  51.110 137.500 1.00 26.48 ? 39   LYS D CA  1 
ATOM   3045  C  C   . LYS B 1 21  ? 35.998  52.518 138.020 1.00 26.02 ? 39   LYS D C   1 
ATOM   3046  O  O   . LYS B 1 21  ? 36.775  52.708 138.957 1.00 25.92 ? 39   LYS D O   1 
ATOM   3047  C  CB  . LYS B 1 21  ? 34.536  50.504 138.186 1.00 26.44 ? 39   LYS D CB  1 
ATOM   3048  C  CG  . LYS B 1 21  ? 34.618  49.017 138.442 1.00 26.32 ? 39   LYS D CG  1 
ATOM   3049  C  CD  . LYS B 1 21  ? 34.180  48.155 137.279 1.00 24.46 ? 39   LYS D CD  1 
ATOM   3050  C  CE  . LYS B 1 21  ? 34.761  46.772 137.490 1.00 24.60 ? 39   LYS D CE  1 
ATOM   3051  N  NZ  . LYS B 1 21  ? 34.101  45.695 136.731 1.00 24.89 ? 39   LYS D NZ  1 
ATOM   3052  N  N   . PRO B 1 22  ? 35.345  53.514 137.397 1.00 25.59 ? 40   PRO D N   1 
ATOM   3053  C  CA  . PRO B 1 22  ? 35.446  54.890 137.875 1.00 25.45 ? 40   PRO D CA  1 
ATOM   3054  C  C   . PRO B 1 22  ? 34.608  55.127 139.131 1.00 25.58 ? 40   PRO D C   1 
ATOM   3055  O  O   . PRO B 1 22  ? 33.650  54.388 139.394 1.00 25.39 ? 40   PRO D O   1 
ATOM   3056  C  CB  . PRO B 1 22  ? 34.877  55.698 136.712 1.00 25.34 ? 40   PRO D CB  1 
ATOM   3057  C  CG  . PRO B 1 22  ? 33.907  54.764 136.061 1.00 25.08 ? 40   PRO D CG  1 
ATOM   3058  C  CD  . PRO B 1 22  ? 34.490  53.403 136.201 1.00 25.40 ? 40   PRO D CD  1 
ATOM   3059  N  N   . ASP B 1 23  ? 34.988  56.144 139.899 1.00 25.77 ? 41   ASP D N   1 
ATOM   3060  C  CA  . ASP B 1 23  ? 34.197  56.636 141.016 1.00 26.15 ? 41   ASP D CA  1 
ATOM   3061  C  C   . ASP B 1 23  ? 32.818  57.052 140.482 1.00 26.37 ? 41   ASP D C   1 
ATOM   3062  O  O   . ASP B 1 23  ? 32.728  57.949 139.634 1.00 26.13 ? 41   ASP D O   1 
ATOM   3063  C  CB  . ASP B 1 23  ? 34.932  57.818 141.666 1.00 26.31 ? 41   ASP D CB  1 
ATOM   3064  C  CG  . ASP B 1 23  ? 34.177  58.441 142.838 1.00 26.91 ? 41   ASP D CG  1 
ATOM   3065  O  OD1 . ASP B 1 23  ? 34.669  59.452 143.379 1.00 29.31 ? 41   ASP D OD1 1 
ATOM   3066  O  OD2 . ASP B 1 23  ? 33.105  57.948 143.227 1.00 27.93 ? 41   ASP D OD2 1 
ATOM   3067  N  N   . PRO B 1 24  ? 31.742  56.385 140.961 1.00 26.56 ? 42   PRO D N   1 
ATOM   3068  C  CA  . PRO B 1 24  ? 30.388  56.688 140.491 1.00 26.72 ? 42   PRO D CA  1 
ATOM   3069  C  C   . PRO B 1 24  ? 29.921  58.085 140.872 1.00 26.89 ? 42   PRO D C   1 
ATOM   3070  O  O   . PRO B 1 24  ? 28.936  58.566 140.312 1.00 27.38 ? 42   PRO D O   1 
ATOM   3071  C  CB  . PRO B 1 24  ? 29.521  55.624 141.183 1.00 26.80 ? 42   PRO D CB  1 
ATOM   3072  C  CG  . PRO B 1 24  ? 30.305  55.189 142.354 1.00 26.56 ? 42   PRO D CG  1 
ATOM   3073  C  CD  . PRO B 1 24  ? 31.741  55.296 141.959 1.00 26.57 ? 42   PRO D CD  1 
ATOM   3074  N  N   . ASN B 1 25  ? 30.638  58.722 141.799 1.00 27.04 ? 43   ASN D N   1 
ATOM   3075  C  CA  . ASN B 1 25  ? 30.327  60.070 142.287 1.00 27.15 ? 43   ASN D CA  1 
ATOM   3076  C  C   . ASN B 1 25  ? 30.772  61.205 141.361 1.00 27.14 ? 43   ASN D C   1 
ATOM   3077  O  O   . ASN B 1 25  ? 30.354  62.346 141.536 1.00 27.27 ? 43   ASN D O   1 
ATOM   3078  C  CB  . ASN B 1 25  ? 30.971  60.297 143.664 1.00 27.10 ? 43   ASN D CB  1 
ATOM   3079  C  CG  . ASN B 1 25  ? 30.405  59.393 144.748 1.00 26.84 ? 43   ASN D CG  1 
ATOM   3080  O  OD1 . ASN B 1 25  ? 31.158  58.693 145.431 1.00 26.45 ? 43   ASN D OD1 1 
ATOM   3081  N  ND2 . ASN B 1 25  ? 29.081  59.419 144.928 1.00 25.66 ? 43   ASN D ND2 1 
ATOM   3082  N  N   . ASN B 1 26  ? 31.632  60.900 140.395 1.00 27.32 ? 44   ASN D N   1 
ATOM   3083  C  CA  . ASN B 1 26  ? 32.249  61.937 139.561 1.00 27.76 ? 44   ASN D CA  1 
ATOM   3084  C  C   . ASN B 1 26  ? 32.360  61.555 138.088 1.00 27.52 ? 44   ASN D C   1 
ATOM   3085  O  O   . ASN B 1 26  ? 33.352  61.878 137.425 1.00 28.11 ? 44   ASN D O   1 
ATOM   3086  C  CB  . ASN B 1 26  ? 33.636  62.308 140.111 1.00 28.05 ? 44   ASN D CB  1 
ATOM   3087  C  CG  . ASN B 1 26  ? 33.580  62.828 141.531 1.00 29.72 ? 44   ASN D CG  1 
ATOM   3088  O  OD1 . ASN B 1 26  ? 33.017  63.898 141.797 1.00 31.54 ? 44   ASN D OD1 1 
ATOM   3089  N  ND2 . ASN B 1 26  ? 34.157  62.065 142.463 1.00 31.50 ? 44   ASN D ND2 1 
ATOM   3090  N  N   . LEU B 1 27  ? 31.338  60.875 137.577 1.00 27.02 ? 45   LEU D N   1 
ATOM   3091  C  CA  . LEU B 1 27  ? 31.335  60.396 136.195 1.00 26.11 ? 45   LEU D CA  1 
ATOM   3092  C  C   . LEU B 1 27  ? 31.094  61.529 135.201 1.00 25.71 ? 45   LEU D C   1 
ATOM   3093  O  O   . LEU B 1 27  ? 30.225  62.373 135.418 1.00 25.39 ? 45   LEU D O   1 
ATOM   3094  C  CB  . LEU B 1 27  ? 30.276  59.300 136.015 1.00 26.04 ? 45   LEU D CB  1 
ATOM   3095  C  CG  . LEU B 1 27  ? 30.515  57.969 136.739 1.00 26.15 ? 45   LEU D CG  1 
ATOM   3096  C  CD1 . LEU B 1 27  ? 29.245  57.146 136.831 1.00 25.61 ? 45   LEU D CD1 1 
ATOM   3097  C  CD2 . LEU B 1 27  ? 31.604  57.169 136.053 1.00 26.91 ? 45   LEU D CD2 1 
ATOM   3098  N  N   . VAL B 1 28  ? 31.879  61.553 134.122 1.00 25.43 ? 46   VAL D N   1 
ATOM   3099  C  CA  . VAL B 1 28  ? 31.641  62.485 133.009 1.00 25.21 ? 46   VAL D CA  1 
ATOM   3100  C  C   . VAL B 1 28  ? 30.980  61.698 131.868 1.00 24.78 ? 46   VAL D C   1 
ATOM   3101  O  O   . VAL B 1 28  ? 31.482  60.647 131.459 1.00 24.21 ? 46   VAL D O   1 
ATOM   3102  C  CB  . VAL B 1 28  ? 32.937  63.216 132.534 1.00 25.24 ? 46   VAL D CB  1 
ATOM   3103  C  CG1 . VAL B 1 28  ? 32.625  64.196 131.409 1.00 24.75 ? 46   VAL D CG1 1 
ATOM   3104  C  CG2 . VAL B 1 28  ? 33.593  63.962 133.690 1.00 25.66 ? 46   VAL D CG2 1 
ATOM   3105  N  N   . PHE B 1 29  ? 29.868  62.229 131.357 1.00 24.65 ? 47   PHE D N   1 
ATOM   3106  C  CA  . PHE B 1 29  ? 28.906  61.440 130.574 1.00 24.35 ? 47   PHE D CA  1 
ATOM   3107  C  C   . PHE B 1 29  ? 29.487  60.256 129.779 1.00 24.51 ? 47   PHE D C   1 
ATOM   3108  O  O   . PHE B 1 29  ? 29.481  59.123 130.262 1.00 26.05 ? 47   PHE D O   1 
ATOM   3109  C  CB  . PHE B 1 29  ? 27.979  62.311 129.705 1.00 24.28 ? 47   PHE D CB  1 
ATOM   3110  C  CG  . PHE B 1 29  ? 27.057  61.506 128.822 1.00 23.09 ? 47   PHE D CG  1 
ATOM   3111  C  CD1 . PHE B 1 29  ? 25.993  60.797 129.371 1.00 22.91 ? 47   PHE D CD1 1 
ATOM   3112  C  CD2 . PHE B 1 29  ? 27.274  61.433 127.446 1.00 21.94 ? 47   PHE D CD2 1 
ATOM   3113  C  CE1 . PHE B 1 29  ? 25.149  60.028 128.560 1.00 22.57 ? 47   PHE D CE1 1 
ATOM   3114  C  CE2 . PHE B 1 29  ? 26.445  60.670 126.630 1.00 22.17 ? 47   PHE D CE2 1 
ATOM   3115  C  CZ  . PHE B 1 29  ? 25.377  59.971 127.186 1.00 22.63 ? 47   PHE D CZ  1 
ATOM   3116  N  N   . GLY B 1 30  ? 29.989  60.494 128.578 1.00 23.69 ? 48   GLY D N   1 
ATOM   3117  C  CA  . GLY B 1 30  ? 30.346  59.364 127.729 1.00 22.53 ? 48   GLY D CA  1 
ATOM   3118  C  C   . GLY B 1 30  ? 31.832  59.286 127.497 1.00 21.79 ? 48   GLY D C   1 
ATOM   3119  O  O   . GLY B 1 30  ? 32.269  59.099 126.371 1.00 21.52 ? 48   GLY D O   1 
ATOM   3120  N  N   . THR B 1 31  ? 32.603  59.416 128.576 1.00 21.38 ? 49   THR D N   1 
ATOM   3121  C  CA  . THR B 1 31  ? 34.064  59.483 128.483 1.00 21.00 ? 49   THR D CA  1 
ATOM   3122  C  C   . THR B 1 31  ? 34.768  58.187 128.911 1.00 20.52 ? 49   THR D C   1 
ATOM   3123  O  O   . THR B 1 31  ? 35.880  57.911 128.461 1.00 20.86 ? 49   THR D O   1 
ATOM   3124  C  CB  . THR B 1 31  ? 34.645  60.715 129.244 1.00 20.90 ? 49   THR D CB  1 
ATOM   3125  O  OG1 . THR B 1 31  ? 34.371  60.606 130.645 1.00 21.63 ? 49   THR D OG1 1 
ATOM   3126  C  CG2 . THR B 1 31  ? 34.030  62.001 128.730 1.00 20.68 ? 49   THR D CG2 1 
ATOM   3127  N  N   . VAL B 1 32  ? 34.113  57.390 129.752 1.00 19.92 ? 50   VAL D N   1 
ATOM   3128  C  CA  . VAL B 1 32  ? 34.709  56.157 130.286 1.00 19.11 ? 50   VAL D CA  1 
ATOM   3129  C  C   . VAL B 1 32  ? 33.996  54.937 129.724 1.00 18.84 ? 50   VAL D C   1 
ATOM   3130  O  O   . VAL B 1 32  ? 32.774  54.895 129.688 1.00 19.15 ? 50   VAL D O   1 
ATOM   3131  C  CB  . VAL B 1 32  ? 34.717  56.145 131.863 1.00 19.46 ? 50   VAL D CB  1 
ATOM   3132  C  CG1 . VAL B 1 32  ? 35.136  54.781 132.425 1.00 18.39 ? 50   VAL D CG1 1 
ATOM   3133  C  CG2 . VAL B 1 32  ? 35.642  57.241 132.400 1.00 18.10 ? 50   VAL D CG2 1 
ATOM   3134  N  N   . PHE B 1 33  ? 34.768  53.950 129.280 1.00 18.14 ? 51   PHE D N   1 
ATOM   3135  C  CA  . PHE B 1 33  ? 34.207  52.755 128.669 1.00 17.76 ? 51   PHE D CA  1 
ATOM   3136  C  C   . PHE B 1 33  ? 34.591  51.488 129.434 1.00 17.76 ? 51   PHE D C   1 
ATOM   3137  O  O   . PHE B 1 33  ? 35.635  51.435 130.084 1.00 17.43 ? 51   PHE D O   1 
ATOM   3138  C  CB  . PHE B 1 33  ? 34.621  52.668 127.196 1.00 17.47 ? 51   PHE D CB  1 
ATOM   3139  C  CG  . PHE B 1 33  ? 34.172  53.846 126.373 1.00 17.12 ? 51   PHE D CG  1 
ATOM   3140  C  CD1 . PHE B 1 33  ? 34.977  54.978 126.254 1.00 16.32 ? 51   PHE D CD1 1 
ATOM   3141  C  CD2 . PHE B 1 33  ? 32.939  53.830 125.730 1.00 16.53 ? 51   PHE D CD2 1 
ATOM   3142  C  CE1 . PHE B 1 33  ? 34.563  56.075 125.509 1.00 15.64 ? 51   PHE D CE1 1 
ATOM   3143  C  CE2 . PHE B 1 33  ? 32.518  54.924 124.974 1.00 16.06 ? 51   PHE D CE2 1 
ATOM   3144  C  CZ  . PHE B 1 33  ? 33.332  56.047 124.864 1.00 15.99 ? 51   PHE D CZ  1 
ATOM   3145  N  N   . THR B 1 34  ? 33.732  50.480 129.347 1.00 17.59 ? 52   THR D N   1 
ATOM   3146  C  CA  . THR B 1 34  ? 33.902  49.227 130.090 1.00 17.67 ? 52   THR D CA  1 
ATOM   3147  C  C   . THR B 1 34  ? 34.941  48.298 129.439 1.00 18.00 ? 52   THR D C   1 
ATOM   3148  O  O   . THR B 1 34  ? 35.655  48.710 128.516 1.00 18.16 ? 52   THR D O   1 
ATOM   3149  C  CB  . THR B 1 34  ? 32.547  48.502 130.260 1.00 17.31 ? 52   THR D CB  1 
ATOM   3150  O  OG1 . THR B 1 34  ? 32.098  48.009 128.991 1.00 17.41 ? 52   THR D OG1 1 
ATOM   3151  C  CG2 . THR B 1 34  ? 31.501  49.446 130.830 1.00 16.58 ? 52   THR D CG2 1 
ATOM   3152  N  N   . ASP B 1 35  ? 35.018  47.054 129.919 1.00 18.02 ? 53   ASP D N   1 
ATOM   3153  C  CA  . ASP B 1 35  ? 36.014  46.091 129.442 1.00 18.22 ? 53   ASP D CA  1 
ATOM   3154  C  C   . ASP B 1 35  ? 35.681  45.506 128.081 1.00 18.45 ? 53   ASP D C   1 
ATOM   3155  O  O   . ASP B 1 35  ? 36.581  45.255 127.280 1.00 18.91 ? 53   ASP D O   1 
ATOM   3156  C  CB  . ASP B 1 35  ? 36.189  44.931 130.432 1.00 18.20 ? 53   ASP D CB  1 
ATOM   3157  C  CG  . ASP B 1 35  ? 36.787  45.364 131.754 1.00 18.01 ? 53   ASP D CG  1 
ATOM   3158  O  OD1 . ASP B 1 35  ? 37.824  46.051 131.748 1.00 18.05 ? 53   ASP D OD1 1 
ATOM   3159  O  OD2 . ASP B 1 35  ? 36.220  44.995 132.804 1.00 18.85 ? 53   ASP D OD2 1 
ATOM   3160  N  N   . HIS B 1 36  ? 34.395  45.258 127.837 1.00 18.32 ? 54   HIS D N   1 
ATOM   3161  C  CA  . HIS B 1 36  ? 33.967  44.559 126.633 1.00 18.24 ? 54   HIS D CA  1 
ATOM   3162  C  C   . HIS B 1 36  ? 33.066  45.383 125.705 1.00 18.11 ? 54   HIS D C   1 
ATOM   3163  O  O   . HIS B 1 36  ? 32.578  46.463 126.062 1.00 17.99 ? 54   HIS D O   1 
ATOM   3164  C  CB  . HIS B 1 36  ? 33.322  43.214 126.993 1.00 18.27 ? 54   HIS D CB  1 
ATOM   3165  C  CG  . HIS B 1 36  ? 34.196  42.342 127.845 1.00 19.35 ? 54   HIS D CG  1 
ATOM   3166  N  ND1 . HIS B 1 36  ? 34.133  42.342 129.221 1.00 19.10 ? 54   HIS D ND1 1 
ATOM   3167  C  CD2 . HIS B 1 36  ? 35.174  41.463 127.514 1.00 19.59 ? 54   HIS D CD2 1 
ATOM   3168  C  CE1 . HIS B 1 36  ? 35.026  41.496 129.702 1.00 19.52 ? 54   HIS D CE1 1 
ATOM   3169  N  NE2 . HIS B 1 36  ? 35.672  40.952 128.687 1.00 19.82 ? 54   HIS D NE2 1 
ATOM   3170  N  N   . MET B 1 37  ? 32.877  44.851 124.502 1.00 17.96 ? 55   MET D N   1 
ATOM   3171  C  CA  . MET B 1 37  ? 32.067  45.465 123.468 1.00 17.88 ? 55   MET D CA  1 
ATOM   3172  C  C   . MET B 1 37  ? 31.441  44.346 122.645 1.00 17.68 ? 55   MET D C   1 
ATOM   3173  O  O   . MET B 1 37  ? 31.950  43.227 122.631 1.00 17.49 ? 55   MET D O   1 
ATOM   3174  C  CB  . MET B 1 37  ? 32.928  46.386 122.583 1.00 17.83 ? 55   MET D CB  1 
ATOM   3175  C  CG  . MET B 1 37  ? 33.848  45.655 121.582 1.00 18.02 ? 55   MET D CG  1 
ATOM   3176  S  SD  . MET B 1 37  ? 34.979  46.725 120.668 1.00 19.10 ? 55   MET D SD  1 
ATOM   3177  C  CE  . MET B 1 37  ? 33.843  47.790 119.776 1.00 18.65 ? 55   MET D CE  1 
ATOM   3178  N  N   . LEU B 1 38  ? 30.321  44.643 121.992 1.00 17.68 ? 56   LEU D N   1 
ATOM   3179  C  CA  . LEU B 1 38  ? 29.750  43.737 121.002 1.00 17.70 ? 56   LEU D CA  1 
ATOM   3180  C  C   . LEU B 1 38  ? 30.117  44.226 119.600 1.00 17.85 ? 56   LEU D C   1 
ATOM   3181  O  O   . LEU B 1 38  ? 30.083  45.423 119.334 1.00 17.39 ? 56   LEU D O   1 
ATOM   3182  C  CB  . LEU B 1 38  ? 28.226  43.641 121.155 1.00 17.48 ? 56   LEU D CB  1 
ATOM   3183  C  CG  . LEU B 1 38  ? 27.493  42.713 120.171 1.00 17.69 ? 56   LEU D CG  1 
ATOM   3184  C  CD1 . LEU B 1 38  ? 27.601  41.255 120.583 1.00 17.32 ? 56   LEU D CD1 1 
ATOM   3185  C  CD2 . LEU B 1 38  ? 26.031  43.114 119.994 1.00 17.82 ? 56   LEU D CD2 1 
ATOM   3186  N  N   . THR B 1 39  ? 30.503  43.300 118.722 1.00 18.35 ? 57   THR D N   1 
ATOM   3187  C  CA  . THR B 1 39  ? 30.684  43.601 117.296 1.00 18.50 ? 57   THR D CA  1 
ATOM   3188  C  C   . THR B 1 39  ? 30.022  42.515 116.462 1.00 18.84 ? 57   THR D C   1 
ATOM   3189  O  O   . THR B 1 39  ? 30.144  41.323 116.778 1.00 19.26 ? 57   THR D O   1 
ATOM   3190  C  CB  . THR B 1 39  ? 32.172  43.703 116.869 1.00 18.39 ? 57   THR D CB  1 
ATOM   3191  O  OG1 . THR B 1 39  ? 32.828  42.458 117.117 1.00 18.59 ? 57   THR D OG1 1 
ATOM   3192  C  CG2 . THR B 1 39  ? 32.901  44.822 117.607 1.00 17.54 ? 57   THR D CG2 1 
ATOM   3193  N  N   . VAL B 1 40  ? 29.306  42.930 115.416 1.00 18.88 ? 58   VAL D N   1 
ATOM   3194  C  CA  . VAL B 1 40  ? 28.739  42.000 114.431 1.00 18.98 ? 58   VAL D CA  1 
ATOM   3195  C  C   . VAL B 1 40  ? 28.976  42.521 113.018 1.00 19.47 ? 58   VAL D C   1 
ATOM   3196  O  O   . VAL B 1 40  ? 28.606  43.650 112.682 1.00 19.32 ? 58   VAL D O   1 
ATOM   3197  C  CB  . VAL B 1 40  ? 27.220  41.722 114.598 1.00 19.11 ? 58   VAL D CB  1 
ATOM   3198  C  CG1 . VAL B 1 40  ? 26.894  40.330 114.053 1.00 18.27 ? 58   VAL D CG1 1 
ATOM   3199  C  CG2 . VAL B 1 40  ? 26.747  41.856 116.059 1.00 18.44 ? 58   VAL D CG2 1 
ATOM   3200  N  N   . GLU B 1 41  ? 29.584  41.661 112.208 1.00 19.90 ? 59   GLU D N   1 
ATOM   3201  C  CA  . GLU B 1 41  ? 30.001  41.951 110.844 1.00 20.48 ? 59   GLU D CA  1 
ATOM   3202  C  C   . GLU B 1 41  ? 28.924  41.529 109.833 1.00 20.30 ? 59   GLU D C   1 
ATOM   3203  O  O   . GLU B 1 41  ? 28.284  40.489 109.998 1.00 20.12 ? 59   GLU D O   1 
ATOM   3204  C  CB  . GLU B 1 41  ? 31.287  41.165 110.585 1.00 20.81 ? 59   GLU D CB  1 
ATOM   3205  C  CG  . GLU B 1 41  ? 32.222  41.751 109.572 1.00 23.57 ? 59   GLU D CG  1 
ATOM   3206  C  CD  . GLU B 1 41  ? 32.910  43.011 110.057 1.00 25.34 ? 59   GLU D CD  1 
ATOM   3207  O  OE1 . GLU B 1 41  ? 32.741  44.043 109.385 1.00 26.99 ? 59   GLU D OE1 1 
ATOM   3208  O  OE2 . GLU B 1 41  ? 33.615  42.974 111.092 1.00 25.54 ? 59   GLU D OE2 1 
ATOM   3209  N  N   . TRP B 1 42  ? 28.723  42.350 108.799 1.00 20.13 ? 60   TRP D N   1 
ATOM   3210  C  CA  . TRP B 1 42  ? 27.809  42.030 107.701 1.00 20.09 ? 60   TRP D CA  1 
ATOM   3211  C  C   . TRP B 1 42  ? 28.451  42.297 106.337 1.00 20.79 ? 60   TRP D C   1 
ATOM   3212  O  O   . TRP B 1 42  ? 29.310  43.168 106.199 1.00 20.75 ? 60   TRP D O   1 
ATOM   3213  C  CB  . TRP B 1 42  ? 26.512  42.838 107.825 1.00 19.53 ? 60   TRP D CB  1 
ATOM   3214  C  CG  . TRP B 1 42  ? 25.463  42.524 106.783 1.00 18.07 ? 60   TRP D CG  1 
ATOM   3215  C  CD1 . TRP B 1 42  ? 24.500  41.558 106.858 1.00 17.43 ? 60   TRP D CD1 1 
ATOM   3216  C  CD2 . TRP B 1 42  ? 25.259  43.191 105.523 1.00 16.86 ? 60   TRP D CD2 1 
ATOM   3217  N  NE1 . TRP B 1 42  ? 23.715  41.576 105.729 1.00 16.00 ? 60   TRP D NE1 1 
ATOM   3218  C  CE2 . TRP B 1 42  ? 24.160  42.564 104.891 1.00 16.49 ? 60   TRP D CE2 1 
ATOM   3219  C  CE3 . TRP B 1 42  ? 25.896  44.256 104.871 1.00 16.58 ? 60   TRP D CE3 1 
ATOM   3220  C  CZ2 . TRP B 1 42  ? 23.677  42.972 103.638 1.00 16.62 ? 60   TRP D CZ2 1 
ATOM   3221  C  CZ3 . TRP B 1 42  ? 25.421  44.658 103.623 1.00 16.65 ? 60   TRP D CZ3 1 
ATOM   3222  C  CH2 . TRP B 1 42  ? 24.319  44.016 103.022 1.00 16.34 ? 60   TRP D CH2 1 
ATOM   3223  N  N   . SER B 1 43  ? 28.025  41.529 105.340 1.00 21.52 ? 61   SER D N   1 
ATOM   3224  C  CA  . SER B 1 43  ? 28.356  41.778 103.938 1.00 22.69 ? 61   SER D CA  1 
ATOM   3225  C  C   . SER B 1 43  ? 27.175  41.309 103.104 1.00 23.24 ? 61   SER D C   1 
ATOM   3226  O  O   . SER B 1 43  ? 26.426  40.427 103.529 1.00 23.33 ? 61   SER D O   1 
ATOM   3227  C  CB  . SER B 1 43  ? 29.626  41.030 103.525 1.00 22.77 ? 61   SER D CB  1 
ATOM   3228  O  OG  . SER B 1 43  ? 29.415  39.626 103.527 1.00 23.48 ? 61   SER D OG  1 
ATOM   3229  N  N   . SER B 1 44  ? 26.991  41.904 101.930 1.00 24.13 ? 62   SER D N   1 
ATOM   3230  C  CA  . SER B 1 44  ? 25.899  41.492 101.045 1.00 25.20 ? 62   SER D CA  1 
ATOM   3231  C  C   . SER B 1 44  ? 26.072  40.057 100.538 1.00 25.76 ? 62   SER D C   1 
ATOM   3232  O  O   . SER B 1 44  ? 25.083  39.340 100.371 1.00 25.61 ? 62   SER D O   1 
ATOM   3233  C  CB  . SER B 1 44  ? 25.730  42.464 99.874  1.00 24.95 ? 62   SER D CB  1 
ATOM   3234  O  OG  . SER B 1 44  ? 26.929  42.575 99.128  1.00 25.79 ? 62   SER D OG  1 
ATOM   3235  N  N   . GLU B 1 45  ? 27.324  39.653 100.311 1.00 26.83 ? 63   GLU D N   1 
ATOM   3236  C  CA  . GLU B 1 45  ? 27.655  38.309 99.814  1.00 28.04 ? 63   GLU D CA  1 
ATOM   3237  C  C   . GLU B 1 45  ? 27.283  37.185 100.791 1.00 28.14 ? 63   GLU D C   1 
ATOM   3238  O  O   . GLU B 1 45  ? 26.715  36.169 100.378 1.00 28.57 ? 63   GLU D O   1 
ATOM   3239  C  CB  . GLU B 1 45  ? 29.145  38.214 99.445  1.00 28.45 ? 63   GLU D CB  1 
ATOM   3240  C  CG  . GLU B 1 45  ? 29.541  36.916 98.706  1.00 30.70 ? 63   GLU D CG  1 
ATOM   3241  C  CD  . GLU B 1 45  ? 30.974  36.924 98.161  1.00 34.36 ? 63   GLU D CD  1 
ATOM   3242  O  OE1 . GLU B 1 45  ? 31.782  37.794 98.569  1.00 35.24 ? 63   GLU D OE1 1 
ATOM   3243  O  OE2 . GLU B 1 45  ? 31.295  36.046 97.319  1.00 35.73 ? 63   GLU D OE2 1 
ATOM   3244  N  N   . PHE B 1 46  ? 27.592  37.364 102.076 1.00 28.05 ? 64   PHE D N   1 
ATOM   3245  C  CA  . PHE B 1 46  ? 27.399  36.285 103.057 1.00 28.00 ? 64   PHE D CA  1 
ATOM   3246  C  C   . PHE B 1 46  ? 26.370  36.562 104.161 1.00 27.42 ? 64   PHE D C   1 
ATOM   3247  O  O   . PHE B 1 46  ? 26.069  35.683 104.971 1.00 27.57 ? 64   PHE D O   1 
ATOM   3248  C  CB  . PHE B 1 46  ? 28.744  35.873 103.665 1.00 28.34 ? 64   PHE D CB  1 
ATOM   3249  C  CG  . PHE B 1 46  ? 29.718  35.320 102.662 1.00 29.94 ? 64   PHE D CG  1 
ATOM   3250  C  CD1 . PHE B 1 46  ? 30.928  35.968 102.420 1.00 31.16 ? 64   PHE D CD1 1 
ATOM   3251  C  CD2 . PHE B 1 46  ? 29.422  34.155 101.952 1.00 30.83 ? 64   PHE D CD2 1 
ATOM   3252  C  CE1 . PHE B 1 46  ? 31.836  35.462 101.491 1.00 32.14 ? 64   PHE D CE1 1 
ATOM   3253  C  CE2 . PHE B 1 46  ? 30.320  33.642 101.019 1.00 32.08 ? 64   PHE D CE2 1 
ATOM   3254  C  CZ  . PHE B 1 46  ? 31.530  34.295 100.788 1.00 32.18 ? 64   PHE D CZ  1 
ATOM   3255  N  N   . GLY B 1 47  ? 25.827  37.777 104.180 1.00 26.75 ? 65   GLY D N   1 
ATOM   3256  C  CA  . GLY B 1 47  ? 24.891  38.189 105.221 1.00 25.61 ? 65   GLY D CA  1 
ATOM   3257  C  C   . GLY B 1 47  ? 25.583  38.418 106.553 1.00 24.95 ? 65   GLY D C   1 
ATOM   3258  O  O   . GLY B 1 47  ? 26.784  38.699 106.602 1.00 24.45 ? 65   GLY D O   1 
ATOM   3259  N  N   . TRP B 1 48  ? 24.818  38.274 107.633 1.00 24.52 ? 66   TRP D N   1 
ATOM   3260  C  CA  . TRP B 1 48  ? 25.316  38.501 108.986 1.00 24.13 ? 66   TRP D CA  1 
ATOM   3261  C  C   . TRP B 1 48  ? 26.279  37.424 109.459 1.00 24.64 ? 66   TRP D C   1 
ATOM   3262  O  O   . TRP B 1 48  ? 25.976  36.230 109.420 1.00 24.87 ? 66   TRP D O   1 
ATOM   3263  C  CB  . TRP B 1 48  ? 24.159  38.622 109.978 1.00 23.45 ? 66   TRP D CB  1 
ATOM   3264  C  CG  . TRP B 1 48  ? 23.452  39.937 109.922 1.00 21.38 ? 66   TRP D CG  1 
ATOM   3265  C  CD1 . TRP B 1 48  ? 22.226  40.185 109.378 1.00 20.24 ? 66   TRP D CD1 1 
ATOM   3266  C  CD2 . TRP B 1 48  ? 23.927  41.192 110.428 1.00 19.55 ? 66   TRP D CD2 1 
ATOM   3267  N  NE1 . TRP B 1 48  ? 21.904  41.515 109.514 1.00 19.58 ? 66   TRP D NE1 1 
ATOM   3268  C  CE2 . TRP B 1 48  ? 22.928  42.155 110.160 1.00 19.05 ? 66   TRP D CE2 1 
ATOM   3269  C  CE3 . TRP B 1 48  ? 25.098  41.596 111.082 1.00 18.81 ? 66   TRP D CE3 1 
ATOM   3270  C  CZ2 . TRP B 1 48  ? 23.066  43.500 110.522 1.00 18.10 ? 66   TRP D CZ2 1 
ATOM   3271  C  CZ3 . TRP B 1 48  ? 25.228  42.937 111.448 1.00 18.16 ? 66   TRP D CZ3 1 
ATOM   3272  C  CH2 . TRP B 1 48  ? 24.220  43.866 111.164 1.00 17.25 ? 66   TRP D CH2 1 
ATOM   3273  N  N   . GLU B 1 49  ? 27.443  37.869 109.918 1.00 25.03 ? 67   GLU D N   1 
ATOM   3274  C  CA  . GLU B 1 49  ? 28.430  36.998 110.533 1.00 25.21 ? 67   GLU D CA  1 
ATOM   3275  C  C   . GLU B 1 49  ? 27.966  36.681 111.966 1.00 24.80 ? 67   GLU D C   1 
ATOM   3276  O  O   . GLU B 1 49  ? 26.965  37.240 112.440 1.00 24.60 ? 67   GLU D O   1 
ATOM   3277  C  CB  . GLU B 1 49  ? 29.783  37.716 110.528 1.00 25.58 ? 67   GLU D CB  1 
ATOM   3278  C  CG  . GLU B 1 49  ? 30.980  36.869 110.149 1.00 28.32 ? 67   GLU D CG  1 
ATOM   3279  C  CD  . GLU B 1 49  ? 30.875  36.244 108.767 1.00 31.29 ? 67   GLU D CD  1 
ATOM   3280  O  OE1 . GLU B 1 49  ? 30.576  36.969 107.788 1.00 32.98 ? 67   GLU D OE1 1 
ATOM   3281  O  OE2 . GLU B 1 49  ? 31.104  35.019 108.666 1.00 31.82 ? 67   GLU D OE2 1 
ATOM   3282  N  N   . LYS B 1 50  ? 28.671  35.777 112.646 1.00 24.14 ? 68   LYS D N   1 
ATOM   3283  C  CA  . LYS B 1 50  ? 28.374  35.468 114.049 1.00 23.73 ? 68   LYS D CA  1 
ATOM   3284  C  C   . LYS B 1 50  ? 28.757  36.643 114.957 1.00 22.91 ? 68   LYS D C   1 
ATOM   3285  O  O   . LYS B 1 50  ? 29.774  37.295 114.724 1.00 22.91 ? 68   LYS D O   1 
ATOM   3286  C  CB  . LYS B 1 50  ? 29.103  34.198 114.500 1.00 23.85 ? 68   LYS D CB  1 
ATOM   3287  C  CG  . LYS B 1 50  ? 28.576  32.920 113.873 1.00 24.94 ? 68   LYS D CG  1 
ATOM   3288  C  CD  . LYS B 1 50  ? 29.298  31.685 114.416 1.00 27.53 ? 68   LYS D CD  1 
ATOM   3289  C  CE  . LYS B 1 50  ? 28.645  30.413 113.877 1.00 29.18 ? 68   LYS D CE  1 
ATOM   3290  N  NZ  . LYS B 1 50  ? 29.366  29.186 114.306 1.00 30.96 ? 68   LYS D NZ  1 
ATOM   3291  N  N   . PRO B 1 51  ? 27.939  36.926 115.988 1.00 22.32 ? 69   PRO D N   1 
ATOM   3292  C  CA  . PRO B 1 51  ? 28.264  38.052 116.864 1.00 22.06 ? 69   PRO D CA  1 
ATOM   3293  C  C   . PRO B 1 51  ? 29.382  37.734 117.857 1.00 21.94 ? 69   PRO D C   1 
ATOM   3294  O  O   . PRO B 1 51  ? 29.553  36.576 118.256 1.00 21.58 ? 69   PRO D O   1 
ATOM   3295  C  CB  . PRO B 1 51  ? 26.940  38.331 117.587 1.00 22.00 ? 69   PRO D CB  1 
ATOM   3296  C  CG  . PRO B 1 51  ? 26.224  37.021 117.583 1.00 21.83 ? 69   PRO D CG  1 
ATOM   3297  C  CD  . PRO B 1 51  ? 26.687  36.248 116.387 1.00 22.28 ? 69   PRO D CD  1 
ATOM   3298  N  N   . HIS B 1 52  ? 30.135  38.766 118.237 1.00 21.71 ? 70   HIS D N   1 
ATOM   3299  C  CA  . HIS B 1 52  ? 31.263  38.628 119.151 1.00 21.79 ? 70   HIS D CA  1 
ATOM   3300  C  C   . HIS B 1 52  ? 31.140  39.576 120.334 1.00 21.67 ? 70   HIS D C   1 
ATOM   3301  O  O   . HIS B 1 52  ? 30.871  40.765 120.158 1.00 22.03 ? 70   HIS D O   1 
ATOM   3302  C  CB  . HIS B 1 52  ? 32.580  38.929 118.427 1.00 21.94 ? 70   HIS D CB  1 
ATOM   3303  C  CG  . HIS B 1 52  ? 33.009  37.863 117.466 1.00 22.88 ? 70   HIS D CG  1 
ATOM   3304  N  ND1 . HIS B 1 52  ? 34.123  37.077 117.678 1.00 23.15 ? 70   HIS D ND1 1 
ATOM   3305  C  CD2 . HIS B 1 52  ? 32.480  37.454 116.289 1.00 22.69 ? 70   HIS D CD2 1 
ATOM   3306  C  CE1 . HIS B 1 52  ? 34.259  36.230 116.673 1.00 22.90 ? 70   HIS D CE1 1 
ATOM   3307  N  NE2 . HIS B 1 52  ? 33.273  36.435 115.819 1.00 23.11 ? 70   HIS D NE2 1 
ATOM   3308  N  N   . ILE B 1 53  ? 31.328  39.046 121.538 1.00 21.31 ? 71   ILE D N   1 
ATOM   3309  C  CA  . ILE B 1 53  ? 31.640  39.882 122.690 1.00 21.02 ? 71   ILE D CA  1 
ATOM   3310  C  C   . ILE B 1 53  ? 33.136  39.734 122.954 1.00 20.96 ? 71   ILE D C   1 
ATOM   3311  O  O   . ILE B 1 53  ? 33.626  38.634 123.183 1.00 20.92 ? 71   ILE D O   1 
ATOM   3312  C  CB  . ILE B 1 53  ? 30.780  39.540 123.943 1.00 20.95 ? 71   ILE D CB  1 
ATOM   3313  C  CG1 . ILE B 1 53  ? 29.315  39.924 123.698 1.00 20.65 ? 71   ILE D CG1 1 
ATOM   3314  C  CG2 . ILE B 1 53  ? 31.307  40.284 125.166 1.00 19.82 ? 71   ILE D CG2 1 
ATOM   3315  C  CD1 . ILE B 1 53  ? 28.318  39.281 124.660 1.00 21.01 ? 71   ILE D CD1 1 
ATOM   3316  N  N   . LYS B 1 54  ? 33.859  40.845 122.892 1.00 21.00 ? 72   LYS D N   1 
ATOM   3317  C  CA  . LYS B 1 54  ? 35.313  40.813 122.983 1.00 21.17 ? 72   LYS D CA  1 
ATOM   3318  C  C   . LYS B 1 54  ? 35.824  42.040 123.733 1.00 21.14 ? 72   LYS D C   1 
ATOM   3319  O  O   . LYS B 1 54  ? 35.037  42.929 124.054 1.00 21.40 ? 72   LYS D O   1 
ATOM   3320  C  CB  . LYS B 1 54  ? 35.936  40.684 121.580 1.00 21.48 ? 72   LYS D CB  1 
ATOM   3321  C  CG  . LYS B 1 54  ? 35.568  41.786 120.584 1.00 22.11 ? 72   LYS D CG  1 
ATOM   3322  C  CD  . LYS B 1 54  ? 36.116  41.441 119.202 1.00 23.08 ? 72   LYS D CD  1 
ATOM   3323  C  CE  . LYS B 1 54  ? 35.927  42.591 118.231 1.00 24.00 ? 72   LYS D CE  1 
ATOM   3324  N  NZ  . LYS B 1 54  ? 36.456  42.260 116.876 1.00 24.27 ? 72   LYS D NZ  1 
ATOM   3325  N  N   . PRO B 1 55  ? 37.134  42.096 124.041 1.00 21.07 ? 73   PRO D N   1 
ATOM   3326  C  CA  . PRO B 1 55  ? 37.587  43.299 124.725 1.00 20.95 ? 73   PRO D CA  1 
ATOM   3327  C  C   . PRO B 1 55  ? 37.337  44.532 123.879 1.00 20.90 ? 73   PRO D C   1 
ATOM   3328  O  O   . PRO B 1 55  ? 37.341  44.448 122.650 1.00 21.40 ? 73   PRO D O   1 
ATOM   3329  C  CB  . PRO B 1 55  ? 39.093  43.072 124.887 1.00 20.71 ? 73   PRO D CB  1 
ATOM   3330  C  CG  . PRO B 1 55  ? 39.257  41.609 124.821 1.00 21.25 ? 73   PRO D CG  1 
ATOM   3331  C  CD  . PRO B 1 55  ? 38.238  41.144 123.832 1.00 21.09 ? 73   PRO D CD  1 
ATOM   3332  N  N   . LEU B 1 56  ? 37.096  45.656 124.543 1.00 20.47 ? 74   LEU D N   1 
ATOM   3333  C  CA  . LEU B 1 56  ? 36.993  46.943 123.885 1.00 20.23 ? 74   LEU D CA  1 
ATOM   3334  C  C   . LEU B 1 56  ? 38.285  47.216 123.121 1.00 20.34 ? 74   LEU D C   1 
ATOM   3335  O  O   . LEU B 1 56  ? 39.384  47.069 123.662 1.00 20.72 ? 74   LEU D O   1 
ATOM   3336  C  CB  . LEU B 1 56  ? 36.744  48.043 124.918 1.00 19.89 ? 74   LEU D CB  1 
ATOM   3337  C  CG  . LEU B 1 56  ? 36.716  49.488 124.429 1.00 20.10 ? 74   LEU D CG  1 
ATOM   3338  C  CD1 . LEU B 1 56  ? 35.396  49.788 123.722 1.00 19.85 ? 74   LEU D CD1 1 
ATOM   3339  C  CD2 . LEU B 1 56  ? 36.941  50.431 125.600 1.00 19.12 ? 74   LEU D CD2 1 
ATOM   3340  N  N   . GLN B 1 57  ? 38.148  47.610 121.862 1.00 19.89 ? 75   GLN D N   1 
ATOM   3341  C  CA  . GLN B 1 57  ? 39.304  47.818 121.004 1.00 20.05 ? 75   GLN D CA  1 
ATOM   3342  C  C   . GLN B 1 57  ? 38.970  48.824 119.922 1.00 19.58 ? 75   GLN D C   1 
ATOM   3343  O  O   . GLN B 1 57  ? 37.796  49.078 119.641 1.00 19.45 ? 75   GLN D O   1 
ATOM   3344  C  CB  . GLN B 1 57  ? 39.766  46.489 120.379 1.00 20.10 ? 75   GLN D CB  1 
ATOM   3345  C  CG  . GLN B 1 57  ? 38.646  45.669 119.757 1.00 21.68 ? 75   GLN D CG  1 
ATOM   3346  C  CD  . GLN B 1 57  ? 39.018  44.208 119.559 1.00 23.84 ? 75   GLN D CD  1 
ATOM   3347  O  OE1 . GLN B 1 57  ? 39.139  43.427 120.526 1.00 24.25 ? 75   GLN D OE1 1 
ATOM   3348  N  NE2 . GLN B 1 57  ? 39.175  43.819 118.299 1.00 22.74 ? 75   GLN D NE2 1 
ATOM   3349  N  N   . ASN B 1 58  ? 40.009  49.399 119.324 1.00 18.94 ? 76   ASN D N   1 
ATOM   3350  C  CA  . ASN B 1 58  ? 39.833  50.253 118.168 1.00 18.72 ? 76   ASN D CA  1 
ATOM   3351  C  C   . ASN B 1 58  ? 39.209  49.467 117.025 1.00 18.23 ? 76   ASN D C   1 
ATOM   3352  O  O   . ASN B 1 58  ? 39.372  48.245 116.918 1.00 18.03 ? 76   ASN D O   1 
ATOM   3353  C  CB  . ASN B 1 58  ? 41.165  50.861 117.726 1.00 18.79 ? 76   ASN D CB  1 
ATOM   3354  C  CG  . ASN B 1 58  ? 41.541  52.106 118.521 1.00 19.68 ? 76   ASN D CG  1 
ATOM   3355  O  OD1 . ASN B 1 58  ? 40.897  52.457 119.516 1.00 20.13 ? 76   ASN D OD1 1 
ATOM   3356  N  ND2 . ASN B 1 58  ? 42.591  52.785 118.078 1.00 20.15 ? 76   ASN D ND2 1 
ATOM   3357  N  N   . LEU B 1 59  ? 38.478  50.171 116.180 1.00 17.71 ? 77   LEU D N   1 
ATOM   3358  C  CA  . LEU B 1 59  ? 37.970  49.574 114.960 1.00 17.30 ? 77   LEU D CA  1 
ATOM   3359  C  C   . LEU B 1 59  ? 39.009  49.730 113.858 1.00 16.97 ? 77   LEU D C   1 
ATOM   3360  O  O   . LEU B 1 59  ? 39.595  50.797 113.692 1.00 16.96 ? 77   LEU D O   1 
ATOM   3361  C  CB  . LEU B 1 59  ? 36.643  50.224 114.569 1.00 17.18 ? 77   LEU D CB  1 
ATOM   3362  C  CG  . LEU B 1 59  ? 35.571  50.330 115.663 1.00 16.88 ? 77   LEU D CG  1 
ATOM   3363  C  CD1 . LEU B 1 59  ? 34.350  51.063 115.125 1.00 16.47 ? 77   LEU D CD1 1 
ATOM   3364  C  CD2 . LEU B 1 59  ? 35.184  48.949 116.213 1.00 16.21 ? 77   LEU D CD2 1 
ATOM   3365  N  N   . SER B 1 60  ? 39.254  48.648 113.129 1.00 17.12 ? 78   SER D N   1 
ATOM   3366  C  CA  . SER B 1 60  ? 40.129  48.682 111.957 1.00 17.01 ? 78   SER D CA  1 
ATOM   3367  C  C   . SER B 1 60  ? 39.262  48.881 110.721 1.00 16.31 ? 78   SER D C   1 
ATOM   3368  O  O   . SER B 1 60  ? 38.560  47.966 110.297 1.00 16.40 ? 78   SER D O   1 
ATOM   3369  C  CB  . SER B 1 60  ? 40.919  47.382 111.838 1.00 17.10 ? 78   SER D CB  1 
ATOM   3370  O  OG  . SER B 1 60  ? 41.792  47.441 110.721 1.00 18.96 ? 78   SER D OG  1 
ATOM   3371  N  N   . LEU B 1 61  ? 39.302  50.083 110.156 1.00 15.78 ? 79   LEU D N   1 
ATOM   3372  C  CA  . LEU B 1 61  ? 38.369  50.461 109.094 1.00 15.47 ? 79   LEU D CA  1 
ATOM   3373  C  C   . LEU B 1 61  ? 39.080  50.895 107.821 1.00 15.31 ? 79   LEU D C   1 
ATOM   3374  O  O   . LEU B 1 61  ? 39.988  51.720 107.869 1.00 15.05 ? 79   LEU D O   1 
ATOM   3375  C  CB  . LEU B 1 61  ? 37.480  51.611 109.580 1.00 15.61 ? 79   LEU D CB  1 
ATOM   3376  C  CG  . LEU B 1 61  ? 36.101  51.414 110.229 1.00 15.93 ? 79   LEU D CG  1 
ATOM   3377  C  CD1 . LEU B 1 61  ? 35.907  50.098 110.973 1.00 16.18 ? 79   LEU D CD1 1 
ATOM   3378  C  CD2 . LEU B 1 61  ? 35.815  52.595 111.137 1.00 15.96 ? 79   LEU D CD2 1 
ATOM   3379  N  N   . HIS B 1 62  ? 38.643  50.363 106.680 1.00 15.11 ? 80   HIS D N   1 
ATOM   3380  C  CA  . HIS B 1 62  ? 39.130  50.839 105.386 1.00 14.81 ? 80   HIS D CA  1 
ATOM   3381  C  C   . HIS B 1 62  ? 38.870  52.345 105.307 1.00 14.38 ? 80   HIS D C   1 
ATOM   3382  O  O   . HIS B 1 62  ? 37.771  52.794 105.639 1.00 14.20 ? 80   HIS D O   1 
ATOM   3383  C  CB  . HIS B 1 62  ? 38.443  50.091 104.226 1.00 15.29 ? 80   HIS D CB  1 
ATOM   3384  C  CG  . HIS B 1 62  ? 39.123  50.267 102.899 1.00 15.83 ? 80   HIS D CG  1 
ATOM   3385  N  ND1 . HIS B 1 62  ? 39.106  51.459 102.204 1.00 16.76 ? 80   HIS D ND1 1 
ATOM   3386  C  CD2 . HIS B 1 62  ? 39.833  49.398 102.135 1.00 15.78 ? 80   HIS D CD2 1 
ATOM   3387  C  CE1 . HIS B 1 62  ? 39.786  51.322 101.078 1.00 16.97 ? 80   HIS D CE1 1 
ATOM   3388  N  NE2 . HIS B 1 62  ? 40.235  50.081 101.010 1.00 16.09 ? 80   HIS D NE2 1 
ATOM   3389  N  N   . PRO B 1 63  ? 39.885  53.136 104.898 1.00 13.99 ? 81   PRO D N   1 
ATOM   3390  C  CA  . PRO B 1 63  ? 39.744  54.594 104.822 1.00 13.86 ? 81   PRO D CA  1 
ATOM   3391  C  C   . PRO B 1 63  ? 38.607  55.063 103.901 1.00 13.76 ? 81   PRO D C   1 
ATOM   3392  O  O   . PRO B 1 63  ? 38.134  56.190 104.043 1.00 13.91 ? 81   PRO D O   1 
ATOM   3393  C  CB  . PRO B 1 63  ? 41.109  55.052 104.284 1.00 13.94 ? 81   PRO D CB  1 
ATOM   3394  C  CG  . PRO B 1 63  ? 41.706  53.835 103.651 1.00 13.44 ? 81   PRO D CG  1 
ATOM   3395  C  CD  . PRO B 1 63  ? 41.235  52.704 104.494 1.00 13.96 ? 81   PRO D CD  1 
ATOM   3396  N  N   . GLY B 1 64  ? 38.176  54.199 102.981 1.00 13.77 ? 82   GLY D N   1 
ATOM   3397  C  CA  . GLY B 1 64  ? 37.033  54.474 102.106 1.00 13.48 ? 82   GLY D CA  1 
ATOM   3398  C  C   . GLY B 1 64  ? 35.659  54.151 102.698 1.00 13.46 ? 82   GLY D C   1 
ATOM   3399  O  O   . GLY B 1 64  ? 34.639  54.412 102.051 1.00 13.39 ? 82   GLY D O   1 
ATOM   3400  N  N   . SER B 1 65  ? 35.629  53.595 103.916 1.00 13.14 ? 83   SER D N   1 
ATOM   3401  C  CA  . SER B 1 65  ? 34.371  53.191 104.590 1.00 12.79 ? 83   SER D CA  1 
ATOM   3402  C  C   . SER B 1 65  ? 33.318  54.286 104.504 1.00 12.33 ? 83   SER D C   1 
ATOM   3403  O  O   . SER B 1 65  ? 33.581  55.419 104.906 1.00 12.11 ? 83   SER D O   1 
ATOM   3404  C  CB  . SER B 1 65  ? 34.618  52.833 106.067 1.00 12.76 ? 83   SER D CB  1 
ATOM   3405  O  OG  . SER B 1 65  ? 35.473  51.705 106.194 1.00 13.16 ? 83   SER D OG  1 
ATOM   3406  N  N   . SER B 1 66  ? 32.129  53.950 103.992 1.00 11.90 ? 84   SER D N   1 
ATOM   3407  C  CA  . SER B 1 66  ? 31.079  54.958 103.743 1.00 11.69 ? 84   SER D CA  1 
ATOM   3408  C  C   . SER B 1 66  ? 30.594  55.730 104.978 1.00 11.71 ? 84   SER D C   1 
ATOM   3409  O  O   . SER B 1 66  ? 30.045  56.836 104.849 1.00 11.45 ? 84   SER D O   1 
ATOM   3410  C  CB  . SER B 1 66  ? 29.896  54.350 102.990 1.00 11.60 ? 84   SER D CB  1 
ATOM   3411  O  OG  . SER B 1 66  ? 29.447  53.158 103.611 1.00 12.12 ? 84   SER D OG  1 
ATOM   3412  N  N   . ALA B 1 67  ? 30.800  55.158 106.168 1.00 11.80 ? 85   ALA D N   1 
ATOM   3413  C  CA  . ALA B 1 67  ? 30.502  55.868 107.416 1.00 11.65 ? 85   ALA D CA  1 
ATOM   3414  C  C   . ALA B 1 67  ? 31.363  57.128 107.568 1.00 11.56 ? 85   ALA D C   1 
ATOM   3415  O  O   . ALA B 1 67  ? 30.991  58.070 108.265 1.00 11.84 ? 85   ALA D O   1 
ATOM   3416  C  CB  . ALA B 1 67  ? 30.685  54.947 108.614 1.00 11.15 ? 85   ALA D CB  1 
ATOM   3417  N  N   . LEU B 1 68  ? 32.507  57.141 106.895 1.00 11.74 ? 86   LEU D N   1 
ATOM   3418  C  CA  . LEU B 1 68  ? 33.492  58.210 107.054 1.00 11.79 ? 86   LEU D CA  1 
ATOM   3419  C  C   . LEU B 1 68  ? 33.296  59.295 106.001 1.00 11.66 ? 86   LEU D C   1 
ATOM   3420  O  O   . LEU B 1 68  ? 33.682  60.450 106.206 1.00 11.92 ? 86   LEU D O   1 
ATOM   3421  C  CB  . LEU B 1 68  ? 34.916  57.632 107.006 1.00 11.99 ? 86   LEU D CB  1 
ATOM   3422  C  CG  . LEU B 1 68  ? 35.259  56.536 108.036 1.00 12.96 ? 86   LEU D CG  1 
ATOM   3423  C  CD1 . LEU B 1 68  ? 36.642  55.964 107.795 1.00 13.57 ? 86   LEU D CD1 1 
ATOM   3424  C  CD2 . LEU B 1 68  ? 35.134  57.074 109.473 1.00 13.27 ? 86   LEU D CD2 1 
ATOM   3425  N  N   . HIS B 1 69  ? 32.658  58.922 104.893 1.00 11.36 ? 87   HIS D N   1 
ATOM   3426  C  CA  . HIS B 1 69  ? 32.499  59.812 103.741 1.00 11.06 ? 87   HIS D CA  1 
ATOM   3427  C  C   . HIS B 1 69  ? 31.094  60.357 103.594 1.00 10.86 ? 87   HIS D C   1 
ATOM   3428  O  O   . HIS B 1 69  ? 30.916  61.550 103.353 1.00 10.93 ? 87   HIS D O   1 
ATOM   3429  C  CB  . HIS B 1 69  ? 32.921  59.098 102.453 1.00 10.78 ? 87   HIS D CB  1 
ATOM   3430  C  CG  . HIS B 1 69  ? 34.361  58.700 102.442 1.00 10.42 ? 87   HIS D CG  1 
ATOM   3431  N  ND1 . HIS B 1 69  ? 35.334  59.446 101.815 1.00 9.18  ? 87   HIS D ND1 1 
ATOM   3432  C  CD2 . HIS B 1 69  ? 34.999  57.658 103.020 1.00 9.77  ? 87   HIS D CD2 1 
ATOM   3433  C  CE1 . HIS B 1 69  ? 36.505  58.865 101.984 1.00 9.34  ? 87   HIS D CE1 1 
ATOM   3434  N  NE2 . HIS B 1 69  ? 36.331  57.782 102.716 1.00 10.49 ? 87   HIS D NE2 1 
ATOM   3435  N  N   . TYR B 1 70  ? 30.107  59.476 103.748 1.00 10.76 ? 88   TYR D N   1 
ATOM   3436  C  CA  . TYR B 1 70  ? 28.718  59.793 103.428 1.00 10.66 ? 88   TYR D CA  1 
ATOM   3437  C  C   . TYR B 1 70  ? 27.786  59.574 104.626 1.00 10.75 ? 88   TYR D C   1 
ATOM   3438  O  O   . TYR B 1 70  ? 26.573  59.469 104.455 1.00 10.85 ? 88   TYR D O   1 
ATOM   3439  C  CB  . TYR B 1 70  ? 28.257  58.954 102.219 1.00 10.48 ? 88   TYR D CB  1 
ATOM   3440  C  CG  . TYR B 1 70  ? 29.201  59.038 101.034 1.00 10.82 ? 88   TYR D CG  1 
ATOM   3441  C  CD1 . TYR B 1 70  ? 29.651  60.283 100.560 1.00 10.73 ? 88   TYR D CD1 1 
ATOM   3442  C  CD2 . TYR B 1 70  ? 29.664  57.888 100.402 1.00 9.91  ? 88   TYR D CD2 1 
ATOM   3443  C  CE1 . TYR B 1 70  ? 30.528  60.370 99.502  1.00 10.48 ? 88   TYR D CE1 1 
ATOM   3444  C  CE2 . TYR B 1 70  ? 30.545  57.970 99.327  1.00 10.52 ? 88   TYR D CE2 1 
ATOM   3445  C  CZ  . TYR B 1 70  ? 30.967  59.217 98.882  1.00 10.91 ? 88   TYR D CZ  1 
ATOM   3446  O  OH  . TYR B 1 70  ? 31.836  59.323 97.817  1.00 12.33 ? 88   TYR D OH  1 
ATOM   3447  N  N   . ALA B 1 71  ? 28.365  59.496 105.828 1.00 10.39 ? 89   ALA D N   1 
ATOM   3448  C  CA  . ALA B 1 71  ? 27.608  59.323 107.077 1.00 10.16 ? 89   ALA D CA  1 
ATOM   3449  C  C   . ALA B 1 71  ? 26.586  58.174 107.047 1.00 9.91  ? 89   ALA D C   1 
ATOM   3450  O  O   . ALA B 1 71  ? 25.461  58.305 107.529 1.00 9.39  ? 89   ALA D O   1 
ATOM   3451  C  CB  . ALA B 1 71  ? 26.939  60.637 107.482 1.00 10.28 ? 89   ALA D CB  1 
ATOM   3452  N  N   . VAL B 1 72  ? 26.996  57.041 106.483 1.00 10.11 ? 90   VAL D N   1 
ATOM   3453  C  CA  . VAL B 1 72  ? 26.166  55.853 106.463 1.00 9.82  ? 90   VAL D CA  1 
ATOM   3454  C  C   . VAL B 1 72  ? 26.316  55.234 107.848 1.00 9.99  ? 90   VAL D C   1 
ATOM   3455  O  O   . VAL B 1 72  ? 27.191  54.399 108.083 1.00 10.13 ? 90   VAL D O   1 
ATOM   3456  C  CB  . VAL B 1 72  ? 26.566  54.868 105.324 1.00 10.20 ? 90   VAL D CB  1 
ATOM   3457  C  CG1 . VAL B 1 72  ? 25.654  53.639 105.313 1.00 9.40  ? 90   VAL D CG1 1 
ATOM   3458  C  CG2 . VAL B 1 72  ? 26.507  55.561 103.966 1.00 9.79  ? 90   VAL D CG2 1 
ATOM   3459  N  N   . GLU B 1 73  ? 25.452  55.675 108.765 1.00 9.43  ? 91   GLU D N   1 
ATOM   3460  C  CA  . GLU B 1 73  ? 25.605  55.385 110.184 1.00 8.94  ? 91   GLU D CA  1 
ATOM   3461  C  C   . GLU B 1 73  ? 24.348  55.755 110.963 1.00 9.06  ? 91   GLU D C   1 
ATOM   3462  O  O   . GLU B 1 73  ? 23.636  56.693 110.605 1.00 8.36  ? 91   GLU D O   1 
ATOM   3463  C  CB  . GLU B 1 73  ? 26.784  56.180 110.760 1.00 8.81  ? 91   GLU D CB  1 
ATOM   3464  C  CG  . GLU B 1 73  ? 26.602  57.688 110.649 1.00 7.31  ? 91   GLU D CG  1 
ATOM   3465  C  CD  . GLU B 1 73  ? 27.810  58.463 111.079 1.00 7.87  ? 91   GLU D CD  1 
ATOM   3466  O  OE1 . GLU B 1 73  ? 27.656  59.403 111.898 1.00 6.89  ? 91   GLU D OE1 1 
ATOM   3467  O  OE2 . GLU B 1 73  ? 28.909  58.138 110.585 1.00 8.52  ? 91   GLU D OE2 1 
ATOM   3468  N  N   . LEU B 1 74  ? 24.097  55.006 112.029 1.00 9.16  ? 92   LEU D N   1 
ATOM   3469  C  CA  . LEU B 1 74  ? 23.092  55.358 113.019 1.00 9.96  ? 92   LEU D CA  1 
ATOM   3470  C  C   . LEU B 1 74  ? 23.500  54.842 114.395 1.00 9.76  ? 92   LEU D C   1 
ATOM   3471  O  O   . LEU B 1 74  ? 24.428  54.049 114.525 1.00 9.77  ? 92   LEU D O   1 
ATOM   3472  C  CB  . LEU B 1 74  ? 21.677  54.876 112.617 1.00 10.44 ? 92   LEU D CB  1 
ATOM   3473  C  CG  . LEU B 1 74  ? 21.134  53.435 112.530 1.00 11.75 ? 92   LEU D CG  1 
ATOM   3474  C  CD1 . LEU B 1 74  ? 21.519  52.742 111.239 1.00 12.67 ? 92   LEU D CD1 1 
ATOM   3475  C  CD2 . LEU B 1 74  ? 21.393  52.538 113.757 1.00 11.07 ? 92   LEU D CD2 1 
ATOM   3476  N  N   . PHE B 1 75  ? 22.809  55.308 115.420 1.00 9.72  ? 93   PHE D N   1 
ATOM   3477  C  CA  . PHE B 1 75  ? 23.092  54.877 116.773 1.00 10.21 ? 93   PHE D CA  1 
ATOM   3478  C  C   . PHE B 1 75  ? 21.797  54.813 117.575 1.00 10.56 ? 93   PHE D C   1 
ATOM   3479  O  O   . PHE B 1 75  ? 20.729  55.237 117.109 1.00 10.14 ? 93   PHE D O   1 
ATOM   3480  C  CB  . PHE B 1 75  ? 24.118  55.811 117.454 1.00 10.11 ? 93   PHE D CB  1 
ATOM   3481  C  CG  . PHE B 1 75  ? 23.610  57.212 117.679 1.00 10.71 ? 93   PHE D CG  1 
ATOM   3482  C  CD1 . PHE B 1 75  ? 23.633  58.149 116.647 1.00 10.18 ? 93   PHE D CD1 1 
ATOM   3483  C  CD2 . PHE B 1 75  ? 23.102  57.594 118.923 1.00 11.38 ? 93   PHE D CD2 1 
ATOM   3484  C  CE1 . PHE B 1 75  ? 23.154  59.446 116.838 1.00 9.67  ? 93   PHE D CE1 1 
ATOM   3485  C  CE2 . PHE B 1 75  ? 22.616  58.892 119.132 1.00 10.96 ? 93   PHE D CE2 1 
ATOM   3486  C  CZ  . PHE B 1 75  ? 22.644  59.822 118.082 1.00 10.89 ? 93   PHE D CZ  1 
ATOM   3487  N  N   . GLU B 1 76  ? 21.914  54.253 118.773 1.00 10.94 ? 94   GLU D N   1 
ATOM   3488  C  CA  . GLU B 1 76  ? 20.848  54.249 119.752 1.00 11.13 ? 94   GLU D CA  1 
ATOM   3489  C  C   . GLU B 1 76  ? 21.425  54.660 121.105 1.00 11.26 ? 94   GLU D C   1 
ATOM   3490  O  O   . GLU B 1 76  ? 22.645  54.704 121.284 1.00 10.89 ? 94   GLU D O   1 
ATOM   3491  C  CB  . GLU B 1 76  ? 20.180  52.866 119.828 1.00 11.29 ? 94   GLU D CB  1 
ATOM   3492  C  CG  . GLU B 1 76  ? 18.888  52.761 119.026 1.00 11.83 ? 94   GLU D CG  1 
ATOM   3493  C  CD  . GLU B 1 76  ? 17.907  53.902 119.319 1.00 13.35 ? 94   GLU D CD  1 
ATOM   3494  O  OE1 . GLU B 1 76  ? 17.191  54.323 118.381 1.00 12.05 ? 94   GLU D OE1 1 
ATOM   3495  O  OE2 . GLU B 1 76  ? 17.869  54.383 120.480 1.00 13.28 ? 94   GLU D OE2 1 
ATOM   3496  N  N   . GLY B 1 77  ? 20.537  54.978 122.044 1.00 11.47 ? 95   GLY D N   1 
ATOM   3497  C  CA  . GLY B 1 77  ? 20.928  55.350 123.396 1.00 11.45 ? 95   GLY D CA  1 
ATOM   3498  C  C   . GLY B 1 77  ? 19.902  54.831 124.377 1.00 11.41 ? 95   GLY D C   1 
ATOM   3499  O  O   . GLY B 1 77  ? 18.731  55.167 124.288 1.00 11.34 ? 95   GLY D O   1 
ATOM   3500  N  N   . LEU B 1 78  ? 20.358  53.986 125.294 1.00 11.49 ? 96   LEU D N   1 
ATOM   3501  C  CA  . LEU B 1 78  ? 19.528  53.393 126.340 1.00 11.22 ? 96   LEU D CA  1 
ATOM   3502  C  C   . LEU B 1 78  ? 20.411  53.098 127.559 1.00 11.20 ? 96   LEU D C   1 
ATOM   3503  O  O   . LEU B 1 78  ? 21.639  53.218 127.489 1.00 10.93 ? 96   LEU D O   1 
ATOM   3504  C  CB  . LEU B 1 78  ? 18.791  52.137 125.838 1.00 11.10 ? 96   LEU D CB  1 
ATOM   3505  C  CG  . LEU B 1 78  ? 19.539  50.879 125.366 1.00 11.33 ? 96   LEU D CG  1 
ATOM   3506  C  CD1 . LEU B 1 78  ? 18.643  49.659 125.489 1.00 10.57 ? 96   LEU D CD1 1 
ATOM   3507  C  CD2 . LEU B 1 78  ? 20.070  50.999 123.940 1.00 10.59 ? 96   LEU D CD2 1 
ATOM   3508  N  N   . LYS B 1 79  ? 19.785  52.746 128.678 1.00 11.00 ? 97   LYS D N   1 
ATOM   3509  C  CA  . LYS B 1 79  ? 20.507  52.607 129.943 1.00 11.04 ? 97   LYS D CA  1 
ATOM   3510  C  C   . LYS B 1 79  ? 20.156  51.344 130.700 1.00 11.12 ? 97   LYS D C   1 
ATOM   3511  O  O   . LYS B 1 79  ? 19.054  50.811 130.551 1.00 10.85 ? 97   LYS D O   1 
ATOM   3512  C  CB  . LYS B 1 79  ? 20.253  53.812 130.847 1.00 10.79 ? 97   LYS D CB  1 
ATOM   3513  C  CG  . LYS B 1 79  ? 20.923  55.082 130.391 1.00 10.77 ? 97   LYS D CG  1 
ATOM   3514  C  CD  . LYS B 1 79  ? 20.563  56.225 131.298 1.00 12.62 ? 97   LYS D CD  1 
ATOM   3515  C  CE  . LYS B 1 79  ? 21.513  57.386 131.103 1.00 13.12 ? 97   LYS D CE  1 
ATOM   3516  N  NZ  . LYS B 1 79  ? 21.126  58.516 131.993 1.00 15.71 ? 97   LYS D NZ  1 
ATOM   3517  N  N   . ALA B 1 80  ? 21.122  50.882 131.499 1.00 11.29 ? 98   ALA D N   1 
ATOM   3518  C  CA  . ALA B 1 80  ? 20.917  49.853 132.522 1.00 11.78 ? 98   ALA D CA  1 
ATOM   3519  C  C   . ALA B 1 80  ? 21.061  50.497 133.912 1.00 12.00 ? 98   ALA D C   1 
ATOM   3520  O  O   . ALA B 1 80  ? 21.899  51.378 134.116 1.00 11.78 ? 98   ALA D O   1 
ATOM   3521  C  CB  . ALA B 1 80  ? 21.907  48.704 132.345 1.00 11.17 ? 98   ALA D CB  1 
ATOM   3522  N  N   . PHE B 1 81  ? 20.227  50.067 134.858 1.00 12.46 ? 99   PHE D N   1 
ATOM   3523  C  CA  . PHE B 1 81  ? 20.210  50.671 136.188 1.00 12.40 ? 99   PHE D CA  1 
ATOM   3524  C  C   . PHE B 1 81  ? 20.318  49.601 137.274 1.00 12.88 ? 99   PHE D C   1 
ATOM   3525  O  O   . PHE B 1 81  ? 19.570  48.608 137.257 1.00 13.13 ? 99   PHE D O   1 
ATOM   3526  C  CB  . PHE B 1 81  ? 18.926  51.481 136.416 1.00 12.26 ? 99   PHE D CB  1 
ATOM   3527  C  CG  . PHE B 1 81  ? 18.565  52.424 135.294 1.00 11.61 ? 99   PHE D CG  1 
ATOM   3528  C  CD1 . PHE B 1 81  ? 17.852  51.972 134.181 1.00 11.58 ? 99   PHE D CD1 1 
ATOM   3529  C  CD2 . PHE B 1 81  ? 18.883  53.768 135.375 1.00 11.04 ? 99   PHE D CD2 1 
ATOM   3530  C  CE1 . PHE B 1 81  ? 17.507  52.838 133.157 1.00 10.87 ? 99   PHE D CE1 1 
ATOM   3531  C  CE2 . PHE B 1 81  ? 18.532  54.642 134.363 1.00 10.34 ? 99   PHE D CE2 1 
ATOM   3532  C  CZ  . PHE B 1 81  ? 17.847  54.179 133.252 1.00 11.37 ? 99   PHE D CZ  1 
ATOM   3533  N  N   . ARG B 1 82  ? 21.233  49.816 138.221 1.00 12.71 ? 100  ARG D N   1 
ATOM   3534  C  CA  . ARG B 1 82  ? 21.360  48.952 139.393 1.00 13.17 ? 100  ARG D CA  1 
ATOM   3535  C  C   . ARG B 1 82  ? 20.277  49.366 140.393 1.00 13.50 ? 100  ARG D C   1 
ATOM   3536  O  O   . ARG B 1 82  ? 20.326  50.462 140.968 1.00 13.46 ? 100  ARG D O   1 
ATOM   3537  C  CB  . ARG B 1 82  ? 22.769  49.078 139.989 1.00 13.16 ? 100  ARG D CB  1 
ATOM   3538  C  CG  . ARG B 1 82  ? 23.096  48.206 141.214 1.00 13.92 ? 100  ARG D CG  1 
ATOM   3539  C  CD  . ARG B 1 82  ? 24.616  47.876 141.251 1.00 15.62 ? 100  ARG D CD  1 
ATOM   3540  N  NE  . ARG B 1 82  ? 24.855  46.470 140.898 1.00 19.30 ? 100  ARG D NE  1 
ATOM   3541  C  CZ  . ARG B 1 82  ? 25.817  46.027 140.097 1.00 21.06 ? 100  ARG D CZ  1 
ATOM   3542  N  NH1 . ARG B 1 82  ? 26.667  46.865 139.536 1.00 21.18 ? 100  ARG D NH1 1 
ATOM   3543  N  NH2 . ARG B 1 82  ? 25.929  44.723 139.854 1.00 25.97 ? 100  ARG D NH2 1 
ATOM   3544  N  N   . GLY B 1 83  ? 19.283  48.499 140.573 1.00 13.78 ? 101  GLY D N   1 
ATOM   3545  C  CA  . GLY B 1 83  ? 18.114  48.827 141.388 1.00 14.71 ? 101  GLY D CA  1 
ATOM   3546  C  C   . GLY B 1 83  ? 18.392  48.972 142.873 1.00 15.39 ? 101  GLY D C   1 
ATOM   3547  O  O   . GLY B 1 83  ? 19.459  48.584 143.348 1.00 15.39 ? 101  GLY D O   1 
ATOM   3548  N  N   . VAL B 1 84  ? 17.417  49.514 143.609 1.00 16.25 ? 102  VAL D N   1 
ATOM   3549  C  CA  . VAL B 1 84  ? 17.481  49.570 145.078 1.00 16.51 ? 102  VAL D CA  1 
ATOM   3550  C  C   . VAL B 1 84  ? 17.607  48.174 145.691 1.00 16.63 ? 102  VAL D C   1 
ATOM   3551  O  O   . VAL B 1 84  ? 18.078  48.009 146.824 1.00 16.97 ? 102  VAL D O   1 
ATOM   3552  C  CB  . VAL B 1 84  ? 16.266  50.319 145.698 1.00 16.55 ? 102  VAL D CB  1 
ATOM   3553  C  CG1 . VAL B 1 84  ? 16.267  51.778 145.254 1.00 17.01 ? 102  VAL D CG1 1 
ATOM   3554  C  CG2 . VAL B 1 84  ? 14.944  49.630 145.356 1.00 16.45 ? 102  VAL D CG2 1 
ATOM   3555  N  N   . ASP B 1 85  ? 17.197  47.176 144.915 1.00 16.82 ? 103  ASP D N   1 
ATOM   3556  C  CA  . ASP B 1 85  ? 17.246  45.779 145.313 1.00 16.75 ? 103  ASP D CA  1 
ATOM   3557  C  C   . ASP B 1 85  ? 18.457  45.055 144.710 1.00 16.99 ? 103  ASP D C   1 
ATOM   3558  O  O   . ASP B 1 85  ? 18.554  43.827 144.782 1.00 16.96 ? 103  ASP D O   1 
ATOM   3559  C  CB  . ASP B 1 85  ? 15.938  45.083 144.924 1.00 16.73 ? 103  ASP D CB  1 
ATOM   3560  C  CG  . ASP B 1 85  ? 15.645  45.155 143.433 1.00 17.39 ? 103  ASP D CG  1 
ATOM   3561  O  OD1 . ASP B 1 85  ? 14.701  44.472 142.989 1.00 17.53 ? 103  ASP D OD1 1 
ATOM   3562  O  OD2 . ASP B 1 85  ? 16.354  45.880 142.699 1.00 17.33 ? 103  ASP D OD2 1 
ATOM   3563  N  N   . ASN B 1 86  ? 19.374  45.834 144.129 1.00 17.05 ? 104  ASN D N   1 
ATOM   3564  C  CA  . ASN B 1 86  ? 20.590  45.327 143.473 1.00 17.32 ? 104  ASN D CA  1 
ATOM   3565  C  C   . ASN B 1 86  ? 20.362  44.543 142.172 1.00 17.64 ? 104  ASN D C   1 
ATOM   3566  O  O   . ASN B 1 86  ? 21.317  44.057 141.563 1.00 17.93 ? 104  ASN D O   1 
ATOM   3567  C  CB  . ASN B 1 86  ? 21.478  44.535 144.456 1.00 17.21 ? 104  ASN D CB  1 
ATOM   3568  C  CG  . ASN B 1 86  ? 22.954  44.590 144.091 1.00 16.71 ? 104  ASN D CG  1 
ATOM   3569  O  OD1 . ASN B 1 86  ? 23.491  45.659 143.789 1.00 15.73 ? 104  ASN D OD1 1 
ATOM   3570  N  ND2 . ASN B 1 86  ? 23.618  43.434 144.120 1.00 15.42 ? 104  ASN D ND2 1 
ATOM   3571  N  N   . LYS B 1 87  ? 19.106  44.411 141.749 1.00 17.85 ? 105  LYS D N   1 
ATOM   3572  C  CA  . LYS B 1 87  ? 18.797  43.824 140.443 1.00 17.98 ? 105  LYS D CA  1 
ATOM   3573  C  C   . LYS B 1 87  ? 19.075  44.847 139.341 1.00 17.42 ? 105  LYS D C   1 
ATOM   3574  O  O   . LYS B 1 87  ? 18.723  46.011 139.481 1.00 17.44 ? 105  LYS D O   1 
ATOM   3575  C  CB  . LYS B 1 87  ? 17.337  43.374 140.376 1.00 18.08 ? 105  LYS D CB  1 
ATOM   3576  C  CG  . LYS B 1 87  ? 17.022  42.101 141.169 1.00 20.18 ? 105  LYS D CG  1 
ATOM   3577  C  CD  . LYS B 1 87  ? 15.547  41.751 141.036 1.00 23.02 ? 105  LYS D CD  1 
ATOM   3578  C  CE  . LYS B 1 87  ? 15.193  40.457 141.764 1.00 25.74 ? 105  LYS D CE  1 
ATOM   3579  N  NZ  . LYS B 1 87  ? 15.046  40.656 143.234 1.00 27.61 ? 105  LYS D NZ  1 
ATOM   3580  N  N   . ILE B 1 88  ? 19.716  44.409 138.259 1.00 16.99 ? 106  ILE D N   1 
ATOM   3581  C  CA  . ILE B 1 88  ? 19.976  45.278 137.105 1.00 16.74 ? 106  ILE D CA  1 
ATOM   3582  C  C   . ILE B 1 88  ? 18.788  45.266 136.133 1.00 16.74 ? 106  ILE D C   1 
ATOM   3583  O  O   . ILE B 1 88  ? 18.280  44.196 135.765 1.00 16.48 ? 106  ILE D O   1 
ATOM   3584  C  CB  . ILE B 1 88  ? 21.299  44.903 136.373 1.00 16.79 ? 106  ILE D CB  1 
ATOM   3585  C  CG1 . ILE B 1 88  ? 22.505  45.139 137.297 1.00 16.39 ? 106  ILE D CG1 1 
ATOM   3586  C  CG2 . ILE B 1 88  ? 21.457  45.701 135.063 1.00 15.33 ? 106  ILE D CG2 1 
ATOM   3587  C  CD1 . ILE B 1 88  ? 23.729  44.325 136.924 1.00 17.73 ? 106  ILE D CD1 1 
ATOM   3588  N  N   . ARG B 1 89  ? 18.360  46.460 135.729 1.00 16.36 ? 107  ARG D N   1 
ATOM   3589  C  CA  . ARG B 1 89  ? 17.199  46.611 134.864 1.00 16.67 ? 107  ARG D CA  1 
ATOM   3590  C  C   . ARG B 1 89  ? 17.456  47.431 133.602 1.00 16.53 ? 107  ARG D C   1 
ATOM   3591  O  O   . ARG B 1 89  ? 18.178  48.431 133.619 1.00 16.61 ? 107  ARG D O   1 
ATOM   3592  C  CB  . ARG B 1 89  ? 16.003  47.181 135.646 1.00 17.11 ? 107  ARG D CB  1 
ATOM   3593  C  CG  . ARG B 1 89  ? 15.135  46.102 136.310 1.00 18.35 ? 107  ARG D CG  1 
ATOM   3594  C  CD  . ARG B 1 89  ? 14.081  46.681 137.249 1.00 20.72 ? 107  ARG D CD  1 
ATOM   3595  N  NE  . ARG B 1 89  ? 14.728  47.049 138.491 1.00 24.40 ? 107  ARG D NE  1 
ATOM   3596  C  CZ  . ARG B 1 89  ? 14.597  46.416 139.651 1.00 22.71 ? 107  ARG D CZ  1 
ATOM   3597  N  NH1 . ARG B 1 89  ? 13.768  45.390 139.798 1.00 21.17 ? 107  ARG D NH1 1 
ATOM   3598  N  NH2 . ARG B 1 89  ? 15.294  46.856 140.679 1.00 22.90 ? 107  ARG D NH2 1 
ATOM   3599  N  N   . LEU B 1 90  ? 16.867  46.974 132.504 1.00 16.36 ? 108  LEU D N   1 
ATOM   3600  C  CA  . LEU B 1 90  ? 16.760  47.766 131.292 1.00 16.58 ? 108  LEU D CA  1 
ATOM   3601  C  C   . LEU B 1 90  ? 15.404  48.455 131.293 1.00 16.43 ? 108  LEU D C   1 
ATOM   3602  O  O   . LEU B 1 90  ? 14.461  47.992 131.939 1.00 16.56 ? 108  LEU D O   1 
ATOM   3603  C  CB  . LEU B 1 90  ? 16.930  46.893 130.047 1.00 16.71 ? 108  LEU D CB  1 
ATOM   3604  C  CG  . LEU B 1 90  ? 18.297  46.219 129.881 1.00 17.39 ? 108  LEU D CG  1 
ATOM   3605  C  CD1 . LEU B 1 90  ? 18.317  45.329 128.649 1.00 17.96 ? 108  LEU D CD1 1 
ATOM   3606  C  CD2 . LEU B 1 90  ? 19.414  47.263 129.806 1.00 18.17 ? 108  LEU D CD2 1 
ATOM   3607  N  N   . PHE B 1 91  ? 15.325  49.574 130.582 1.00 16.41 ? 109  PHE D N   1 
ATOM   3608  C  CA  . PHE B 1 91  ? 14.138  50.416 130.561 1.00 16.19 ? 109  PHE D CA  1 
ATOM   3609  C  C   . PHE B 1 91  ? 13.660  50.595 129.125 1.00 16.33 ? 109  PHE D C   1 
ATOM   3610  O  O   . PHE B 1 91  ? 14.383  51.151 128.289 1.00 16.43 ? 109  PHE D O   1 
ATOM   3611  C  CB  . PHE B 1 91  ? 14.453  51.781 131.189 1.00 16.18 ? 109  PHE D CB  1 
ATOM   3612  C  CG  . PHE B 1 91  ? 13.276  52.714 131.234 1.00 16.00 ? 109  PHE D CG  1 
ATOM   3613  C  CD1 . PHE B 1 91  ? 12.354  52.640 132.275 1.00 15.18 ? 109  PHE D CD1 1 
ATOM   3614  C  CD2 . PHE B 1 91  ? 13.090  53.667 130.238 1.00 16.43 ? 109  PHE D CD2 1 
ATOM   3615  C  CE1 . PHE B 1 91  ? 11.259  53.499 132.325 1.00 14.71 ? 109  PHE D CE1 1 
ATOM   3616  C  CE2 . PHE B 1 91  ? 11.991  54.530 130.278 1.00 16.20 ? 109  PHE D CE2 1 
ATOM   3617  C  CZ  . PHE B 1 91  ? 11.082  54.444 131.329 1.00 16.01 ? 109  PHE D CZ  1 
ATOM   3618  N  N   . GLN B 1 92  ? 12.451  50.103 128.842 1.00 16.36 ? 110  GLN D N   1 
ATOM   3619  C  CA  . GLN B 1 92  ? 11.843  50.172 127.504 1.00 16.32 ? 110  GLN D CA  1 
ATOM   3620  C  C   . GLN B 1 92  ? 12.805  49.801 126.351 1.00 16.07 ? 110  GLN D C   1 
ATOM   3621  O  O   . GLN B 1 92  ? 12.769  50.434 125.291 1.00 15.42 ? 110  GLN D O   1 
ATOM   3622  C  CB  . GLN B 1 92  ? 11.236  51.566 127.267 1.00 16.29 ? 110  GLN D CB  1 
ATOM   3623  C  CG  . GLN B 1 92  ? 10.086  51.937 128.203 1.00 17.80 ? 110  GLN D CG  1 
ATOM   3624  C  CD  . GLN B 1 92  ? 8.714   51.564 127.657 1.00 20.38 ? 110  GLN D CD  1 
ATOM   3625  O  OE1 . GLN B 1 92  ? 7.850   52.428 127.492 1.00 22.50 ? 110  GLN D OE1 1 
ATOM   3626  N  NE2 . GLN B 1 92  ? 8.509   50.282 127.369 1.00 20.14 ? 110  GLN D NE2 1 
ATOM   3627  N  N   . PRO B 1 93  ? 13.650  48.759 126.543 1.00 16.11 ? 111  PRO D N   1 
ATOM   3628  C  CA  . PRO B 1 93  ? 14.696  48.488 125.553 1.00 16.24 ? 111  PRO D CA  1 
ATOM   3629  C  C   . PRO B 1 93  ? 14.167  48.064 124.183 1.00 16.68 ? 111  PRO D C   1 
ATOM   3630  O  O   . PRO B 1 93  ? 14.863  48.232 123.181 1.00 16.67 ? 111  PRO D O   1 
ATOM   3631  C  CB  . PRO B 1 93  ? 15.491  47.350 126.192 1.00 16.15 ? 111  PRO D CB  1 
ATOM   3632  C  CG  . PRO B 1 93  ? 14.529  46.683 127.109 1.00 15.78 ? 111  PRO D CG  1 
ATOM   3633  C  CD  . PRO B 1 93  ? 13.681  47.777 127.646 1.00 15.86 ? 111  PRO D CD  1 
ATOM   3634  N  N   . ASN B 1 94  ? 12.951  47.520 124.141 1.00 17.16 ? 112  ASN D N   1 
ATOM   3635  C  CA  . ASN B 1 94  ? 12.341  47.101 122.877 1.00 17.61 ? 112  ASN D CA  1 
ATOM   3636  C  C   . ASN B 1 94  ? 11.978  48.285 121.989 1.00 16.97 ? 112  ASN D C   1 
ATOM   3637  O  O   . ASN B 1 94  ? 11.969  48.161 120.767 1.00 17.32 ? 112  ASN D O   1 
ATOM   3638  C  CB  . ASN B 1 94  ? 11.126  46.202 123.124 1.00 17.99 ? 112  ASN D CB  1 
ATOM   3639  C  CG  . ASN B 1 94  ? 11.522  44.809 123.600 1.00 20.36 ? 112  ASN D CG  1 
ATOM   3640  O  OD1 . ASN B 1 94  ? 11.977  43.971 122.812 1.00 23.68 ? 112  ASN D OD1 1 
ATOM   3641  N  ND2 . ASN B 1 94  ? 11.347  44.551 124.895 1.00 22.54 ? 112  ASN D ND2 1 
ATOM   3642  N  N   . LEU B 1 95  ? 11.696  49.430 122.608 1.00 16.47 ? 113  LEU D N   1 
ATOM   3643  C  CA  . LEU B 1 95  ? 11.454  50.679 121.877 1.00 15.84 ? 113  LEU D CA  1 
ATOM   3644  C  C   . LEU B 1 95  ? 12.706  51.199 121.182 1.00 15.30 ? 113  LEU D C   1 
ATOM   3645  O  O   . LEU B 1 95  ? 12.626  51.801 120.120 1.00 15.50 ? 113  LEU D O   1 
ATOM   3646  C  CB  . LEU B 1 95  ? 10.899  51.765 122.800 1.00 15.85 ? 113  LEU D CB  1 
ATOM   3647  C  CG  . LEU B 1 95  ? 9.540   51.551 123.478 1.00 16.18 ? 113  LEU D CG  1 
ATOM   3648  C  CD1 . LEU B 1 95  ? 9.064   52.867 124.053 1.00 14.46 ? 113  LEU D CD1 1 
ATOM   3649  C  CD2 . LEU B 1 95  ? 8.489   50.956 122.527 1.00 16.61 ? 113  LEU D CD2 1 
ATOM   3650  N  N   . ASN B 1 96  ? 13.859  50.976 121.796 1.00 14.85 ? 114  ASN D N   1 
ATOM   3651  C  CA  . ASN B 1 96  ? 15.127  51.313 121.172 1.00 14.31 ? 114  ASN D CA  1 
ATOM   3652  C  C   . ASN B 1 96  ? 15.435  50.365 120.009 1.00 14.09 ? 114  ASN D C   1 
ATOM   3653  O  O   . ASN B 1 96  ? 15.953  50.801 118.986 1.00 14.30 ? 114  ASN D O   1 
ATOM   3654  C  CB  . ASN B 1 96  ? 16.255  51.305 122.209 1.00 14.03 ? 114  ASN D CB  1 
ATOM   3655  C  CG  . ASN B 1 96  ? 16.048  52.344 123.300 1.00 13.67 ? 114  ASN D CG  1 
ATOM   3656  O  OD1 . ASN B 1 96  ? 16.441  53.504 123.159 1.00 14.11 ? 114  ASN D OD1 1 
ATOM   3657  N  ND2 . ASN B 1 96  ? 15.424  51.932 124.390 1.00 10.99 ? 114  ASN D ND2 1 
ATOM   3658  N  N   . MET B 1 97  ? 15.101  49.081 120.161 1.00 13.71 ? 115  MET D N   1 
ATOM   3659  C  CA  . MET B 1 97  ? 15.295  48.097 119.079 1.00 13.50 ? 115  MET D CA  1 
ATOM   3660  C  C   . MET B 1 97  ? 14.402  48.419 117.884 1.00 13.35 ? 115  MET D C   1 
ATOM   3661  O  O   . MET B 1 97  ? 14.848  48.344 116.741 1.00 13.33 ? 115  MET D O   1 
ATOM   3662  C  CB  . MET B 1 97  ? 15.067  46.654 119.557 1.00 13.23 ? 115  MET D CB  1 
ATOM   3663  C  CG  . MET B 1 97  ? 15.998  46.160 120.678 1.00 12.91 ? 115  MET D CG  1 
ATOM   3664  S  SD  . MET B 1 97  ? 17.762  46.092 120.263 1.00 14.03 ? 115  MET D SD  1 
ATOM   3665  C  CE  . MET B 1 97  ? 18.300  47.735 120.773 1.00 13.12 ? 115  MET D CE  1 
ATOM   3666  N  N   . ASP B 1 98  ? 13.158  48.802 118.166 1.00 13.33 ? 116  ASP D N   1 
ATOM   3667  C  CA  . ASP B 1 98  ? 12.197  49.225 117.144 1.00 13.49 ? 116  ASP D CA  1 
ATOM   3668  C  C   . ASP B 1 98  ? 12.705  50.424 116.345 1.00 13.30 ? 116  ASP D C   1 
ATOM   3669  O  O   . ASP B 1 98  ? 12.601  50.447 115.113 1.00 13.00 ? 116  ASP D O   1 
ATOM   3670  C  CB  . ASP B 1 98  ? 10.850  49.589 117.777 1.00 13.56 ? 116  ASP D CB  1 
ATOM   3671  C  CG  . ASP B 1 98  ? 10.125  48.391 118.388 1.00 15.06 ? 116  ASP D CG  1 
ATOM   3672  O  OD1 . ASP B 1 98  ? 10.494  47.220 118.117 1.00 16.52 ? 116  ASP D OD1 1 
ATOM   3673  O  OD2 . ASP B 1 98  ? 9.163   48.633 119.149 1.00 16.11 ? 116  ASP D OD2 1 
ATOM   3674  N  N   . ARG B 1 99  ? 13.230  51.419 117.061 1.00 12.97 ? 117  ARG D N   1 
ATOM   3675  C  CA  . ARG B 1 99  ? 13.715  52.654 116.456 1.00 12.74 ? 117  ARG D CA  1 
ATOM   3676  C  C   . ARG B 1 99  ? 15.006  52.428 115.665 1.00 12.84 ? 117  ARG D C   1 
ATOM   3677  O  O   . ARG B 1 99  ? 15.155  52.951 114.572 1.00 12.85 ? 117  ARG D O   1 
ATOM   3678  C  CB  . ARG B 1 99  ? 13.901  53.728 117.525 1.00 12.53 ? 117  ARG D CB  1 
ATOM   3679  C  CG  . ARG B 1 99  ? 14.136  55.127 116.973 1.00 12.48 ? 117  ARG D CG  1 
ATOM   3680  C  CD  . ARG B 1 99  ? 14.017  56.175 118.055 1.00 11.08 ? 117  ARG D CD  1 
ATOM   3681  N  NE  . ARG B 1 99  ? 15.092  56.067 119.041 1.00 11.60 ? 117  ARG D NE  1 
ATOM   3682  C  CZ  . ARG B 1 99  ? 15.062  56.613 120.253 1.00 10.93 ? 117  ARG D CZ  1 
ATOM   3683  N  NH1 . ARG B 1 99  ? 14.003  57.297 120.648 1.00 10.90 ? 117  ARG D NH1 1 
ATOM   3684  N  NH2 . ARG B 1 99  ? 16.091  56.459 121.079 1.00 11.54 ? 117  ARG D NH2 1 
ATOM   3685  N  N   . MET B 1 100 ? 15.920  51.632 116.217 1.00 13.12 ? 118  MET D N   1 
ATOM   3686  C  CA  . MET B 1 100 ? 17.157  51.274 115.531 1.00 13.61 ? 118  MET D CA  1 
ATOM   3687  C  C   . MET B 1 100 ? 16.887  50.567 114.191 1.00 13.93 ? 118  MET D C   1 
ATOM   3688  O  O   . MET B 1 100 ? 17.568  50.829 113.197 1.00 13.90 ? 118  MET D O   1 
ATOM   3689  C  CB  . MET B 1 100 ? 18.024  50.395 116.431 1.00 13.63 ? 118  MET D CB  1 
ATOM   3690  C  CG  . MET B 1 100 ? 19.458  50.257 115.951 1.00 14.17 ? 118  MET D CG  1 
ATOM   3691  S  SD  . MET B 1 100 ? 20.508  49.341 117.085 1.00 15.49 ? 118  MET D SD  1 
ATOM   3692  C  CE  . MET B 1 100 ? 22.059  49.411 116.188 1.00 14.38 ? 118  MET D CE  1 
ATOM   3693  N  N   . TYR B 1 101 ? 15.893  49.677 114.187 1.00 14.38 ? 119  TYR D N   1 
ATOM   3694  C  CA  . TYR B 1 101 ? 15.458  48.943 112.993 1.00 14.81 ? 119  TYR D CA  1 
ATOM   3695  C  C   . TYR B 1 101 ? 14.917  49.904 111.932 1.00 14.97 ? 119  TYR D C   1 
ATOM   3696  O  O   . TYR B 1 101 ? 15.296  49.810 110.765 1.00 14.91 ? 119  TYR D O   1 
ATOM   3697  C  CB  . TYR B 1 101 ? 14.391  47.899 113.369 1.00 14.89 ? 119  TYR D CB  1 
ATOM   3698  C  CG  . TYR B 1 101 ? 14.009  46.928 112.262 1.00 15.19 ? 119  TYR D CG  1 
ATOM   3699  C  CD1 . TYR B 1 101 ? 14.559  45.651 112.217 1.00 16.34 ? 119  TYR D CD1 1 
ATOM   3700  C  CD2 . TYR B 1 101 ? 13.095  47.286 111.268 1.00 16.37 ? 119  TYR D CD2 1 
ATOM   3701  C  CE1 . TYR B 1 101 ? 14.211  44.744 111.214 1.00 17.33 ? 119  TYR D CE1 1 
ATOM   3702  C  CE2 . TYR B 1 101 ? 12.742  46.386 110.243 1.00 17.44 ? 119  TYR D CE2 1 
ATOM   3703  C  CZ  . TYR B 1 101 ? 13.307  45.120 110.229 1.00 18.24 ? 119  TYR D CZ  1 
ATOM   3704  O  OH  . TYR B 1 101 ? 12.970  44.216 109.243 1.00 20.07 ? 119  TYR D OH  1 
ATOM   3705  N  N   . ARG B 1 102 ? 14.037  50.816 112.347 1.00 15.11 ? 120  ARG D N   1 
ATOM   3706  C  CA  . ARG B 1 102 ? 13.551  51.911 111.496 1.00 15.46 ? 120  ARG D CA  1 
ATOM   3707  C  C   . ARG B 1 102 ? 14.686  52.760 110.922 1.00 14.87 ? 120  ARG D C   1 
ATOM   3708  O  O   . ARG B 1 102 ? 14.668  53.099 109.744 1.00 14.97 ? 120  ARG D O   1 
ATOM   3709  C  CB  . ARG B 1 102 ? 12.628  52.853 112.277 1.00 15.95 ? 120  ARG D CB  1 
ATOM   3710  C  CG  . ARG B 1 102 ? 11.200  52.371 112.521 1.00 18.61 ? 120  ARG D CG  1 
ATOM   3711  C  CD  . ARG B 1 102 ? 10.259  53.563 112.856 1.00 22.22 ? 120  ARG D CD  1 
ATOM   3712  N  NE  . ARG B 1 102 ? 10.828  54.477 113.856 1.00 25.06 ? 120  ARG D NE  1 
ATOM   3713  C  CZ  . ARG B 1 102 ? 11.310  55.697 113.599 1.00 26.64 ? 120  ARG D CZ  1 
ATOM   3714  N  NH1 . ARG B 1 102 ? 11.286  56.202 112.367 1.00 27.47 ? 120  ARG D NH1 1 
ATOM   3715  N  NH2 . ARG B 1 102 ? 11.809  56.426 114.588 1.00 26.77 ? 120  ARG D NH2 1 
ATOM   3716  N  N   . SER B 1 103 ? 15.653  53.124 111.765 1.00 14.42 ? 121  SER D N   1 
ATOM   3717  C  CA  . SER B 1 103 ? 16.780  53.956 111.337 1.00 13.97 ? 121  SER D CA  1 
ATOM   3718  C  C   . SER B 1 103 ? 17.638  53.228 110.291 1.00 13.76 ? 121  SER D C   1 
ATOM   3719  O  O   . SER B 1 103 ? 18.069  53.837 109.317 1.00 13.40 ? 121  SER D O   1 
ATOM   3720  C  CB  . SER B 1 103 ? 17.629  54.401 112.533 1.00 13.90 ? 121  SER D CB  1 
ATOM   3721  O  OG  . SER B 1 103 ? 16.912  55.264 113.408 1.00 13.70 ? 121  SER D OG  1 
ATOM   3722  N  N   . ALA B 1 104 ? 17.846  51.925 110.481 1.00 13.77 ? 122  ALA D N   1 
ATOM   3723  C  CA  . ALA B 1 104 ? 18.625  51.109 109.540 1.00 14.23 ? 122  ALA D CA  1 
ATOM   3724  C  C   . ALA B 1 104 ? 17.969  51.002 108.167 1.00 14.71 ? 122  ALA D C   1 
ATOM   3725  O  O   . ALA B 1 104 ? 18.654  51.048 107.142 1.00 14.94 ? 122  ALA D O   1 
ATOM   3726  C  CB  . ALA B 1 104 ? 18.889  49.720 110.120 1.00 14.08 ? 122  ALA D CB  1 
ATOM   3727  N  N   . VAL B 1 105 ? 16.645  50.845 108.152 1.00 15.12 ? 123  VAL D N   1 
ATOM   3728  C  CA  . VAL B 1 105 ? 15.869  50.837 106.907 1.00 15.50 ? 123  VAL D CA  1 
ATOM   3729  C  C   . VAL B 1 105 ? 16.028  52.166 106.154 1.00 15.68 ? 123  VAL D C   1 
ATOM   3730  O  O   . VAL B 1 105 ? 16.396  52.171 104.980 1.00 15.77 ? 123  VAL D O   1 
ATOM   3731  C  CB  . VAL B 1 105 ? 14.365  50.499 107.162 1.00 15.73 ? 123  VAL D CB  1 
ATOM   3732  C  CG1 . VAL B 1 105 ? 13.517  50.752 105.918 1.00 15.78 ? 123  VAL D CG1 1 
ATOM   3733  C  CG2 . VAL B 1 105 ? 14.213  49.043 107.626 1.00 15.35 ? 123  VAL D CG2 1 
ATOM   3734  N  N   . ARG B 1 106 ? 15.780  53.285 106.840 1.00 15.53 ? 124  ARG D N   1 
ATOM   3735  C  CA  . ARG B 1 106 ? 15.954  54.614 106.241 1.00 15.53 ? 124  ARG D CA  1 
ATOM   3736  C  C   . ARG B 1 106 ? 17.393  54.882 105.749 1.00 14.97 ? 124  ARG D C   1 
ATOM   3737  O  O   . ARG B 1 106 ? 17.593  55.622 104.776 1.00 14.53 ? 124  ARG D O   1 
ATOM   3738  C  CB  . ARG B 1 106 ? 15.472  55.712 107.210 1.00 15.67 ? 124  ARG D CB  1 
ATOM   3739  C  CG  . ARG B 1 106 ? 15.505  57.150 106.656 1.00 17.18 ? 124  ARG D CG  1 
ATOM   3740  C  CD  . ARG B 1 106 ? 14.595  57.383 105.423 1.00 19.53 ? 124  ARG D CD  1 
ATOM   3741  N  NE  . ARG B 1 106 ? 15.201  58.372 104.522 1.00 23.19 ? 124  ARG D NE  1 
ATOM   3742  C  CZ  . ARG B 1 106 ? 14.775  59.623 104.350 1.00 25.09 ? 124  ARG D CZ  1 
ATOM   3743  N  NH1 . ARG B 1 106 ? 13.699  60.072 104.987 1.00 26.76 ? 124  ARG D NH1 1 
ATOM   3744  N  NH2 . ARG B 1 106 ? 15.424  60.432 103.523 1.00 25.29 ? 124  ARG D NH2 1 
ATOM   3745  N  N   . ALA B 1 107 ? 18.374  54.270 106.418 1.00 14.66 ? 125  ALA D N   1 
ATOM   3746  C  CA  . ALA B 1 107 ? 19.796  54.439 106.101 1.00 14.29 ? 125  ALA D CA  1 
ATOM   3747  C  C   . ALA B 1 107 ? 20.293  53.516 104.987 1.00 14.22 ? 125  ALA D C   1 
ATOM   3748  O  O   . ALA B 1 107 ? 21.368  53.739 104.428 1.00 14.22 ? 125  ALA D O   1 
ATOM   3749  C  CB  . ALA B 1 107 ? 20.645  54.251 107.362 1.00 14.14 ? 125  ALA D CB  1 
ATOM   3750  N  N   . THR B 1 108 ? 19.491  52.499 104.667 1.00 14.22 ? 126  THR D N   1 
ATOM   3751  C  CA  . THR B 1 108 ? 19.832  51.394 103.740 1.00 14.43 ? 126  THR D CA  1 
ATOM   3752  C  C   . THR B 1 108 ? 20.898  50.435 104.292 1.00 14.64 ? 126  THR D C   1 
ATOM   3753  O  O   . THR B 1 108 ? 21.588  49.737 103.540 1.00 14.34 ? 126  THR D O   1 
ATOM   3754  C  CB  . THR B 1 108 ? 20.163  51.842 102.270 1.00 14.40 ? 126  THR D CB  1 
ATOM   3755  O  OG1 . THR B 1 108 ? 21.508  52.329 102.192 1.00 14.38 ? 126  THR D OG1 1 
ATOM   3756  C  CG2 . THR B 1 108 ? 19.189  52.905 101.780 1.00 14.03 ? 126  THR D CG2 1 
ATOM   3757  N  N   . LEU B 1 109 ? 21.006  50.388 105.616 1.00 15.06 ? 127  LEU D N   1 
ATOM   3758  C  CA  . LEU B 1 109 ? 21.864  49.407 106.273 1.00 15.56 ? 127  LEU D CA  1 
ATOM   3759  C  C   . LEU B 1 109 ? 21.076  48.103 106.426 1.00 15.73 ? 127  LEU D C   1 
ATOM   3760  O  O   . LEU B 1 109 ? 19.844  48.132 106.400 1.00 16.12 ? 127  LEU D O   1 
ATOM   3761  C  CB  . LEU B 1 109 ? 22.367  49.943 107.618 1.00 15.37 ? 127  LEU D CB  1 
ATOM   3762  C  CG  . LEU B 1 109 ? 23.534  50.941 107.487 1.00 15.62 ? 127  LEU D CG  1 
ATOM   3763  C  CD1 . LEU B 1 109 ? 23.648  51.824 108.710 1.00 14.83 ? 127  LEU D CD1 1 
ATOM   3764  C  CD2 . LEU B 1 109 ? 24.849  50.223 107.216 1.00 15.13 ? 127  LEU D CD2 1 
ATOM   3765  N  N   . PRO B 1 110 ? 21.772  46.955 106.549 1.00 16.01 ? 128  PRO D N   1 
ATOM   3766  C  CA  . PRO B 1 110 ? 21.022  45.701 106.619 1.00 16.37 ? 128  PRO D CA  1 
ATOM   3767  C  C   . PRO B 1 110 ? 20.133  45.582 107.858 1.00 16.85 ? 128  PRO D C   1 
ATOM   3768  O  O   . PRO B 1 110 ? 20.503  46.004 108.953 1.00 16.73 ? 128  PRO D O   1 
ATOM   3769  C  CB  . PRO B 1 110 ? 22.117  44.627 106.646 1.00 16.12 ? 128  PRO D CB  1 
ATOM   3770  C  CG  . PRO B 1 110 ? 23.324  45.333 107.161 1.00 16.03 ? 128  PRO D CG  1 
ATOM   3771  C  CD  . PRO B 1 110 ? 23.229  46.723 106.613 1.00 15.96 ? 128  PRO D CD  1 
ATOM   3772  N  N   . VAL B 1 111 ? 18.960  45.005 107.647 1.00 17.24 ? 129  VAL D N   1 
ATOM   3773  C  CA  . VAL B 1 111 ? 18.027  44.667 108.700 1.00 17.78 ? 129  VAL D CA  1 
ATOM   3774  C  C   . VAL B 1 111 ? 18.533  43.481 109.558 1.00 17.97 ? 129  VAL D C   1 
ATOM   3775  O  O   . VAL B 1 111 ? 19.377  42.694 109.118 1.00 17.69 ? 129  VAL D O   1 
ATOM   3776  C  CB  . VAL B 1 111 ? 16.636  44.457 108.052 1.00 18.19 ? 129  VAL D CB  1 
ATOM   3777  C  CG1 . VAL B 1 111 ? 15.902  43.241 108.590 1.00 19.60 ? 129  VAL D CG1 1 
ATOM   3778  C  CG2 . VAL B 1 111 ? 15.817  45.750 108.147 1.00 17.39 ? 129  VAL D CG2 1 
ATOM   3779  N  N   . PHE B 1 112 ? 18.043  43.395 110.797 1.00 18.33 ? 130  PHE D N   1 
ATOM   3780  C  CA  . PHE B 1 112 ? 18.450  42.364 111.763 1.00 18.34 ? 130  PHE D CA  1 
ATOM   3781  C  C   . PHE B 1 112 ? 17.248  41.981 112.627 1.00 18.52 ? 130  PHE D C   1 
ATOM   3782  O  O   . PHE B 1 112 ? 16.227  42.678 112.622 1.00 18.48 ? 130  PHE D O   1 
ATOM   3783  C  CB  . PHE B 1 112 ? 19.594  42.886 112.653 1.00 18.45 ? 130  PHE D CB  1 
ATOM   3784  C  CG  . PHE B 1 112 ? 19.286  44.208 113.325 1.00 17.97 ? 130  PHE D CG  1 
ATOM   3785  C  CD1 . PHE B 1 112 ? 18.684  44.246 114.582 1.00 17.98 ? 130  PHE D CD1 1 
ATOM   3786  C  CD2 . PHE B 1 112 ? 19.573  45.414 112.685 1.00 17.97 ? 130  PHE D CD2 1 
ATOM   3787  C  CE1 . PHE B 1 112 ? 18.377  45.464 115.191 1.00 18.35 ? 130  PHE D CE1 1 
ATOM   3788  C  CE2 . PHE B 1 112 ? 19.270  46.639 113.281 1.00 17.27 ? 130  PHE D CE2 1 
ATOM   3789  C  CZ  . PHE B 1 112 ? 18.677  46.666 114.535 1.00 18.57 ? 130  PHE D CZ  1 
ATOM   3790  N  N   . ASP B 1 113 ? 17.358  40.882 113.370 1.00 18.81 ? 131  ASP D N   1 
ATOM   3791  C  CA  . ASP B 1 113 ? 16.304  40.515 114.321 1.00 19.17 ? 131  ASP D CA  1 
ATOM   3792  C  C   . ASP B 1 113 ? 16.455  41.315 115.615 1.00 19.04 ? 131  ASP D C   1 
ATOM   3793  O  O   . ASP B 1 113 ? 17.496  41.259 116.269 1.00 18.81 ? 131  ASP D O   1 
ATOM   3794  C  CB  . ASP B 1 113 ? 16.292  39.012 114.609 1.00 19.32 ? 131  ASP D CB  1 
ATOM   3795  C  CG  . ASP B 1 113 ? 15.087  38.585 115.433 1.00 20.45 ? 131  ASP D CG  1 
ATOM   3796  O  OD1 . ASP B 1 113 ? 14.941  39.063 116.579 1.00 21.30 ? 131  ASP D OD1 1 
ATOM   3797  O  OD2 . ASP B 1 113 ? 14.283  37.769 114.936 1.00 21.55 ? 131  ASP D OD2 1 
ATOM   3798  N  N   . LYS B 1 114 ? 15.409  42.059 115.965 1.00 19.32 ? 132  LYS D N   1 
ATOM   3799  C  CA  . LYS B 1 114 ? 15.422  42.934 117.139 1.00 19.59 ? 132  LYS D CA  1 
ATOM   3800  C  C   . LYS B 1 114 ? 15.591  42.177 118.461 1.00 19.75 ? 132  LYS D C   1 
ATOM   3801  O  O   . LYS B 1 114 ? 16.321  42.629 119.341 1.00 19.69 ? 132  LYS D O   1 
ATOM   3802  C  CB  . LYS B 1 114 ? 14.155  43.789 117.183 1.00 19.50 ? 132  LYS D CB  1 
ATOM   3803  C  CG  . LYS B 1 114 ? 14.121  44.891 116.149 1.00 20.30 ? 132  LYS D CG  1 
ATOM   3804  C  CD  . LYS B 1 114 ? 12.869  45.746 116.280 1.00 20.71 ? 132  LYS D CD  1 
ATOM   3805  C  CE  . LYS B 1 114 ? 11.657  45.103 115.638 1.00 22.33 ? 132  LYS D CE  1 
ATOM   3806  N  NZ  . LYS B 1 114 ? 10.526  46.072 115.542 1.00 23.27 ? 132  LYS D NZ  1 
ATOM   3807  N  N   . GLU B 1 115 ? 14.918  41.032 118.586 1.00 20.08 ? 133  GLU D N   1 
ATOM   3808  C  CA  . GLU B 1 115 ? 15.041  40.159 119.763 1.00 20.53 ? 133  GLU D CA  1 
ATOM   3809  C  C   . GLU B 1 115 ? 16.451  39.589 119.919 1.00 20.00 ? 133  GLU D C   1 
ATOM   3810  O  O   . GLU B 1 115 ? 16.930  39.425 121.046 1.00 20.13 ? 133  GLU D O   1 
ATOM   3811  C  CB  . GLU B 1 115 ? 14.003  39.021 119.725 1.00 21.00 ? 133  GLU D CB  1 
ATOM   3812  C  CG  . GLU B 1 115 ? 12.553  39.473 119.973 1.00 24.13 ? 133  GLU D CG  1 
ATOM   3813  C  CD  . GLU B 1 115 ? 11.499  38.425 119.571 1.00 29.52 ? 133  GLU D CD  1 
ATOM   3814  O  OE1 . GLU B 1 115 ? 11.857  37.262 119.253 1.00 31.23 ? 133  GLU D OE1 1 
ATOM   3815  O  OE2 . GLU B 1 115 ? 10.290  38.770 119.561 1.00 32.04 ? 133  GLU D OE2 1 
ATOM   3816  N  N   . GLU B 1 116 ? 17.112  39.297 118.796 1.00 19.40 ? 134  GLU D N   1 
ATOM   3817  C  CA  . GLU B 1 116 ? 18.484  38.778 118.816 1.00 19.04 ? 134  GLU D CA  1 
ATOM   3818  C  C   . GLU B 1 116 ? 19.491  39.831 119.276 1.00 18.67 ? 134  GLU D C   1 
ATOM   3819  O  O   . GLU B 1 116 ? 20.425  39.511 120.007 1.00 18.68 ? 134  GLU D O   1 
ATOM   3820  C  CB  . GLU B 1 116 ? 18.913  38.219 117.444 1.00 18.94 ? 134  GLU D CB  1 
ATOM   3821  C  CG  . GLU B 1 116 ? 18.115  37.024 116.917 1.00 19.78 ? 134  GLU D CG  1 
ATOM   3822  C  CD  . GLU B 1 116 ? 18.096  35.810 117.851 1.00 21.34 ? 134  GLU D CD  1 
ATOM   3823  O  OE1 . GLU B 1 116 ? 19.067  35.589 118.607 1.00 21.38 ? 134  GLU D OE1 1 
ATOM   3824  O  OE2 . GLU B 1 116 ? 17.091  35.069 117.819 1.00 22.73 ? 134  GLU D OE2 1 
ATOM   3825  N  N   . LEU B 1 117 ? 19.317  41.077 118.835 1.00 18.09 ? 135  LEU D N   1 
ATOM   3826  C  CA  . LEU B 1 117 ? 20.216  42.149 119.258 1.00 17.79 ? 135  LEU D CA  1 
ATOM   3827  C  C   . LEU B 1 117 ? 20.054  42.461 120.748 1.00 17.65 ? 135  LEU D C   1 
ATOM   3828  O  O   . LEU B 1 117 ? 21.046  42.553 121.465 1.00 17.47 ? 135  LEU D O   1 
ATOM   3829  C  CB  . LEU B 1 117 ? 20.043  43.417 118.407 1.00 17.62 ? 135  LEU D CB  1 
ATOM   3830  C  CG  . LEU B 1 117 ? 20.890  44.648 118.779 1.00 16.95 ? 135  LEU D CG  1 
ATOM   3831  C  CD1 . LEU B 1 117 ? 22.386  44.345 118.842 1.00 17.27 ? 135  LEU D CD1 1 
ATOM   3832  C  CD2 . LEU B 1 117 ? 20.632  45.776 117.818 1.00 16.55 ? 135  LEU D CD2 1 
ATOM   3833  N  N   . LEU B 1 118 ? 18.809  42.609 121.201 1.00 17.70 ? 136  LEU D N   1 
ATOM   3834  C  CA  . LEU B 1 118 ? 18.533  42.860 122.614 1.00 17.85 ? 136  LEU D CA  1 
ATOM   3835  C  C   . LEU B 1 118 ? 19.187  41.801 123.500 1.00 18.06 ? 136  LEU D C   1 
ATOM   3836  O  O   . LEU B 1 118 ? 19.800  42.135 124.514 1.00 18.16 ? 136  LEU D O   1 
ATOM   3837  C  CB  . LEU B 1 118 ? 17.025  42.956 122.893 1.00 17.56 ? 136  LEU D CB  1 
ATOM   3838  C  CG  . LEU B 1 118 ? 16.590  43.273 124.339 1.00 17.82 ? 136  LEU D CG  1 
ATOM   3839  C  CD1 . LEU B 1 118 ? 17.298  44.506 124.899 1.00 17.29 ? 136  LEU D CD1 1 
ATOM   3840  C  CD2 . LEU B 1 118 ? 15.072  43.440 124.438 1.00 18.28 ? 136  LEU D CD2 1 
ATOM   3841  N  N   . GLU B 1 119 ? 19.077  40.536 123.103 1.00 18.58 ? 137  GLU D N   1 
ATOM   3842  C  CA  . GLU B 1 119 ? 19.707  39.439 123.849 1.00 19.23 ? 137  GLU D CA  1 
ATOM   3843  C  C   . GLU B 1 119 ? 21.238  39.506 123.818 1.00 19.05 ? 137  GLU D C   1 
ATOM   3844  O  O   . GLU B 1 119 ? 21.887  39.206 124.816 1.00 19.58 ? 137  GLU D O   1 
ATOM   3845  C  CB  . GLU B 1 119 ? 19.189  38.075 123.372 1.00 19.53 ? 137  GLU D CB  1 
ATOM   3846  C  CG  . GLU B 1 119 ? 19.748  36.849 124.129 1.00 21.81 ? 137  GLU D CG  1 
ATOM   3847  C  CD  . GLU B 1 119 ? 19.516  36.884 125.639 1.00 25.24 ? 137  GLU D CD  1 
ATOM   3848  O  OE1 . GLU B 1 119 ? 20.387  36.373 126.373 1.00 27.63 ? 137  GLU D OE1 1 
ATOM   3849  O  OE2 . GLU B 1 119 ? 18.474  37.409 126.098 1.00 25.74 ? 137  GLU D OE2 1 
ATOM   3850  N  N   . CYS B 1 120 ? 21.813  39.907 122.685 1.00 18.84 ? 138  CYS D N   1 
ATOM   3851  C  CA  . CYS B 1 120 ? 23.262  40.105 122.598 1.00 18.50 ? 138  CYS D CA  1 
ATOM   3852  C  C   . CYS B 1 120 ? 23.713  41.235 123.524 1.00 18.49 ? 138  CYS D C   1 
ATOM   3853  O  O   . CYS B 1 120 ? 24.763  41.137 124.162 1.00 18.23 ? 138  CYS D O   1 
ATOM   3854  C  CB  . CYS B 1 120 ? 23.696  40.388 121.159 1.00 18.46 ? 138  CYS D CB  1 
ATOM   3855  S  SG  . CYS B 1 120 ? 23.624  38.951 120.070 1.00 18.89 ? 138  CYS D SG  1 
ATOM   3856  N  N   . ILE B 1 121 ? 22.905  42.295 123.590 1.00 18.50 ? 139  ILE D N   1 
ATOM   3857  C  CA  . ILE B 1 121 ? 23.140  43.431 124.487 1.00 18.71 ? 139  ILE D CA  1 
ATOM   3858  C  C   . ILE B 1 121 ? 23.021  43.009 125.954 1.00 18.84 ? 139  ILE D C   1 
ATOM   3859  O  O   . ILE B 1 121 ? 23.856  43.375 126.778 1.00 19.06 ? 139  ILE D O   1 
ATOM   3860  C  CB  . ILE B 1 121 ? 22.171  44.619 124.175 1.00 18.57 ? 139  ILE D CB  1 
ATOM   3861  C  CG1 . ILE B 1 121 ? 22.528  45.265 122.827 1.00 18.50 ? 139  ILE D CG1 1 
ATOM   3862  C  CG2 . ILE B 1 121 ? 22.176  45.654 125.314 1.00 18.24 ? 139  ILE D CG2 1 
ATOM   3863  C  CD1 . ILE B 1 121 ? 21.543  46.325 122.343 1.00 17.56 ? 139  ILE D CD1 1 
ATOM   3864  N  N   . GLN B 1 122 ? 21.988  42.233 126.272 1.00 19.12 ? 140  GLN D N   1 
ATOM   3865  C  CA  . GLN B 1 122 ? 21.811  41.708 127.627 1.00 19.43 ? 140  GLN D CA  1 
ATOM   3866  C  C   . GLN B 1 122 ? 23.007  40.867 128.071 1.00 19.27 ? 140  GLN D C   1 
ATOM   3867  O  O   . GLN B 1 122 ? 23.474  41.008 129.206 1.00 19.00 ? 140  GLN D O   1 
ATOM   3868  C  CB  . GLN B 1 122 ? 20.495  40.929 127.762 1.00 19.74 ? 140  GLN D CB  1 
ATOM   3869  C  CG  . GLN B 1 122 ? 19.263  41.794 127.508 1.00 21.44 ? 140  GLN D CG  1 
ATOM   3870  C  CD  . GLN B 1 122 ? 18.097  41.470 128.413 1.00 24.64 ? 140  GLN D CD  1 
ATOM   3871  O  OE1 . GLN B 1 122 ? 18.198  41.575 129.636 1.00 26.65 ? 140  GLN D OE1 1 
ATOM   3872  N  NE2 . GLN B 1 122 ? 16.968  41.106 127.816 1.00 25.46 ? 140  GLN D NE2 1 
ATOM   3873  N  N   . GLN B 1 123 ? 23.517  40.023 127.170 1.00 19.04 ? 141  GLN D N   1 
ATOM   3874  C  CA  . GLN B 1 123 ? 24.706  39.209 127.459 1.00 18.87 ? 141  GLN D CA  1 
ATOM   3875  C  C   . GLN B 1 123 ? 25.961  40.055 127.647 1.00 18.25 ? 141  GLN D C   1 
ATOM   3876  O  O   . GLN B 1 123 ? 26.821  39.731 128.466 1.00 18.43 ? 141  GLN D O   1 
ATOM   3877  C  CB  . GLN B 1 123 ? 24.934  38.148 126.372 1.00 19.11 ? 141  GLN D CB  1 
ATOM   3878  C  CG  . GLN B 1 123 ? 23.877  37.029 126.349 1.00 20.57 ? 141  GLN D CG  1 
ATOM   3879  C  CD  . GLN B 1 123 ? 23.677  36.353 127.704 1.00 23.27 ? 141  GLN D CD  1 
ATOM   3880  O  OE1 . GLN B 1 123 ? 22.542  36.137 128.140 1.00 24.69 ? 141  GLN D OE1 1 
ATOM   3881  N  NE2 . GLN B 1 123 ? 24.780  36.011 128.374 1.00 23.68 ? 141  GLN D NE2 1 
ATOM   3882  N  N   . LEU B 1 124 ? 26.054  41.145 126.892 1.00 17.77 ? 142  LEU D N   1 
ATOM   3883  C  CA  . LEU B 1 124 ? 27.164  42.092 127.018 1.00 17.38 ? 142  LEU D CA  1 
ATOM   3884  C  C   . LEU B 1 124 ? 27.126  42.829 128.358 1.00 17.29 ? 142  LEU D C   1 
ATOM   3885  O  O   . LEU B 1 124 ? 28.132  42.891 129.065 1.00 16.94 ? 142  LEU D O   1 
ATOM   3886  C  CB  . LEU B 1 124 ? 27.159  43.093 125.856 1.00 17.08 ? 142  LEU D CB  1 
ATOM   3887  C  CG  . LEU B 1 124 ? 28.207  44.211 125.894 1.00 16.65 ? 142  LEU D CG  1 
ATOM   3888  C  CD1 . LEU B 1 124 ? 29.601  43.643 125.682 1.00 15.17 ? 142  LEU D CD1 1 
ATOM   3889  C  CD2 . LEU B 1 124 ? 27.897  45.288 124.864 1.00 15.82 ? 142  LEU D CD2 1 
ATOM   3890  N  N   . VAL B 1 125 ? 25.964  43.391 128.689 1.00 17.36 ? 143  VAL D N   1 
ATOM   3891  C  CA  . VAL B 1 125 ? 25.749  44.031 129.989 1.00 17.61 ? 143  VAL D CA  1 
ATOM   3892  C  C   . VAL B 1 125 ? 25.976  43.014 131.116 1.00 17.87 ? 143  VAL D C   1 
ATOM   3893  O  O   . VAL B 1 125 ? 26.594  43.336 132.120 1.00 17.89 ? 143  VAL D O   1 
ATOM   3894  C  CB  . VAL B 1 125 ? 24.344  44.687 130.097 1.00 17.23 ? 143  VAL D CB  1 
ATOM   3895  C  CG1 . VAL B 1 125 ? 24.180  45.401 131.424 1.00 17.22 ? 143  VAL D CG1 1 
ATOM   3896  C  CG2 . VAL B 1 125 ? 24.129  45.690 128.961 1.00 17.81 ? 143  VAL D CG2 1 
ATOM   3897  N  N   . LYS B 1 126 ? 25.503  41.785 130.927 1.00 18.42 ? 144  LYS D N   1 
ATOM   3898  C  CA  . LYS B 1 126 ? 25.702  40.719 131.915 1.00 19.40 ? 144  LYS D CA  1 
ATOM   3899  C  C   . LYS B 1 126 ? 27.190  40.458 132.194 1.00 19.32 ? 144  LYS D C   1 
ATOM   3900  O  O   . LYS B 1 126 ? 27.609  40.456 133.344 1.00 19.62 ? 144  LYS D O   1 
ATOM   3901  C  CB  . LYS B 1 126 ? 24.981  39.433 131.490 1.00 19.45 ? 144  LYS D CB  1 
ATOM   3902  C  CG  . LYS B 1 126 ? 24.833  38.412 132.593 1.00 21.46 ? 144  LYS D CG  1 
ATOM   3903  C  CD  . LYS B 1 126 ? 24.322  37.076 132.058 1.00 23.60 ? 144  LYS D CD  1 
ATOM   3904  C  CE  . LYS B 1 126 ? 24.255  36.034 133.169 1.00 25.27 ? 144  LYS D CE  1 
ATOM   3905  N  NZ  . LYS B 1 126 ? 24.538  34.652 132.668 1.00 26.91 ? 144  LYS D NZ  1 
ATOM   3906  N  N   . LEU B 1 127 ? 27.989  40.271 131.144 1.00 19.45 ? 145  LEU D N   1 
ATOM   3907  C  CA  . LEU B 1 127 ? 29.439  40.113 131.293 1.00 19.23 ? 145  LEU D CA  1 
ATOM   3908  C  C   . LEU B 1 127 ? 30.045  41.269 132.099 1.00 19.01 ? 145  LEU D C   1 
ATOM   3909  O  O   . LEU B 1 127 ? 30.830  41.046 133.024 1.00 18.62 ? 145  LEU D O   1 
ATOM   3910  C  CB  . LEU B 1 127 ? 30.114  40.061 129.917 1.00 19.46 ? 145  LEU D CB  1 
ATOM   3911  C  CG  . LEU B 1 127 ? 31.195  39.026 129.588 1.00 20.63 ? 145  LEU D CG  1 
ATOM   3912  C  CD1 . LEU B 1 127 ? 32.113  39.594 128.513 1.00 21.30 ? 145  LEU D CD1 1 
ATOM   3913  C  CD2 . LEU B 1 127 ? 32.008  38.530 130.798 1.00 20.46 ? 145  LEU D CD2 1 
ATOM   3914  N  N   . ASP B 1 128 ? 29.671  42.497 131.728 1.00 18.66 ? 146  ASP D N   1 
ATOM   3915  C  CA  . ASP B 1 128 ? 30.196  43.717 132.339 1.00 18.70 ? 146  ASP D CA  1 
ATOM   3916  C  C   . ASP B 1 128 ? 29.286  44.275 133.444 1.00 18.49 ? 146  ASP D C   1 
ATOM   3917  O  O   . ASP B 1 128 ? 29.252  45.480 133.680 1.00 18.40 ? 146  ASP D O   1 
ATOM   3918  C  CB  . ASP B 1 128 ? 30.450  44.784 131.257 1.00 18.70 ? 146  ASP D CB  1 
ATOM   3919  C  CG  . ASP B 1 128 ? 31.786  44.601 130.542 1.00 19.41 ? 146  ASP D CG  1 
ATOM   3920  O  OD1 . ASP B 1 128 ? 32.114  45.445 129.686 1.00 20.51 ? 146  ASP D OD1 1 
ATOM   3921  O  OD2 . ASP B 1 128 ? 32.518  43.626 130.826 1.00 19.97 ? 146  ASP D OD2 1 
ATOM   3922  N  N   . GLN B 1 129 ? 28.555  43.377 134.103 1.00 18.47 ? 147  GLN D N   1 
ATOM   3923  C  CA  . GLN B 1 129 ? 27.658  43.690 135.221 1.00 18.60 ? 147  GLN D CA  1 
ATOM   3924  C  C   . GLN B 1 129 ? 28.191  44.705 136.213 1.00 18.00 ? 147  GLN D C   1 
ATOM   3925  O  O   . GLN B 1 129 ? 27.504  45.662 136.566 1.00 17.97 ? 147  GLN D O   1 
ATOM   3926  C  CB  . GLN B 1 129 ? 27.409  42.424 136.028 1.00 18.88 ? 147  GLN D CB  1 
ATOM   3927  C  CG  . GLN B 1 129 ? 26.173  41.719 135.685 1.00 20.13 ? 147  GLN D CG  1 
ATOM   3928  C  CD  . GLN B 1 129 ? 25.893  40.653 136.680 1.00 19.80 ? 147  GLN D CD  1 
ATOM   3929  O  OE1 . GLN B 1 129 ? 25.450  40.932 137.795 1.00 19.96 ? 147  GLN D OE1 1 
ATOM   3930  N  NE2 . GLN B 1 129 ? 26.145  39.414 136.294 1.00 20.31 ? 147  GLN D NE2 1 
ATOM   3931  N  N   . GLU B 1 130 ? 29.408  44.456 136.683 1.00 17.32 ? 148  GLU D N   1 
ATOM   3932  C  CA  . GLU B 1 130 ? 30.003  45.230 137.768 1.00 17.06 ? 148  GLU D CA  1 
ATOM   3933  C  C   . GLU B 1 130 ? 30.276  46.676 137.389 1.00 16.57 ? 148  GLU D C   1 
ATOM   3934  O  O   . GLU B 1 130 ? 30.550  47.507 138.256 1.00 16.75 ? 148  GLU D O   1 
ATOM   3935  C  CB  . GLU B 1 130 ? 31.261  44.525 138.303 1.00 17.25 ? 148  GLU D CB  1 
ATOM   3936  C  CG  . GLU B 1 130 ? 30.951  43.174 138.981 1.00 16.35 ? 148  GLU D CG  1 
ATOM   3937  C  CD  . GLU B 1 130 ? 29.923  43.313 140.095 1.00 17.65 ? 148  GLU D CD  1 
ATOM   3938  O  OE1 . GLU B 1 130 ? 28.943  42.525 140.125 1.00 17.43 ? 148  GLU D OE1 1 
ATOM   3939  O  OE2 . GLU B 1 130 ? 30.093  44.223 140.938 1.00 17.84 ? 148  GLU D OE2 1 
ATOM   3940  N  N   . TRP B 1 131 ? 30.174  46.967 136.094 1.00 16.03 ? 149  TRP D N   1 
ATOM   3941  C  CA  . TRP B 1 131 ? 30.307  48.330 135.565 1.00 15.54 ? 149  TRP D CA  1 
ATOM   3942  C  C   . TRP B 1 131 ? 29.025  49.154 135.714 1.00 15.08 ? 149  TRP D C   1 
ATOM   3943  O  O   . TRP B 1 131 ? 29.060  50.381 135.607 1.00 15.39 ? 149  TRP D O   1 
ATOM   3944  C  CB  . TRP B 1 131 ? 30.701  48.298 134.085 1.00 15.35 ? 149  TRP D CB  1 
ATOM   3945  C  CG  . TRP B 1 131 ? 32.123  47.898 133.829 1.00 14.89 ? 149  TRP D CG  1 
ATOM   3946  C  CD1 . TRP B 1 131 ? 32.586  46.641 133.583 1.00 14.99 ? 149  TRP D CD1 1 
ATOM   3947  C  CD2 . TRP B 1 131 ? 33.267  48.767 133.778 1.00 14.20 ? 149  TRP D CD2 1 
ATOM   3948  N  NE1 . TRP B 1 131 ? 33.950  46.665 133.386 1.00 14.83 ? 149  TRP D NE1 1 
ATOM   3949  C  CE2 . TRP B 1 131 ? 34.394  47.957 133.501 1.00 14.22 ? 149  TRP D CE2 1 
ATOM   3950  C  CE3 . TRP B 1 131 ? 33.449  50.145 133.944 1.00 12.59 ? 149  TRP D CE3 1 
ATOM   3951  C  CZ2 . TRP B 1 131 ? 35.687  48.480 133.385 1.00 14.24 ? 149  TRP D CZ2 1 
ATOM   3952  C  CZ3 . TRP B 1 131 ? 34.730  50.665 133.824 1.00 13.76 ? 149  TRP D CZ3 1 
ATOM   3953  C  CH2 . TRP B 1 131 ? 35.835  49.834 133.549 1.00 13.99 ? 149  TRP D CH2 1 
ATOM   3954  N  N   . VAL B 1 132 ? 27.893  48.489 135.920 1.00 14.71 ? 150  VAL D N   1 
ATOM   3955  C  CA  . VAL B 1 132 ? 26.649  49.199 136.210 1.00 14.33 ? 150  VAL D CA  1 
ATOM   3956  C  C   . VAL B 1 132 ? 26.851  49.808 137.599 1.00 14.47 ? 150  VAL D C   1 
ATOM   3957  O  O   . VAL B 1 132 ? 27.012  49.079 138.581 1.00 14.12 ? 150  VAL D O   1 
ATOM   3958  C  CB  . VAL B 1 132 ? 25.402  48.275 136.154 1.00 14.38 ? 150  VAL D CB  1 
ATOM   3959  C  CG1 . VAL B 1 132 ? 24.126  49.056 136.464 1.00 13.73 ? 150  VAL D CG1 1 
ATOM   3960  C  CG2 . VAL B 1 132 ? 25.279  47.618 134.786 1.00 13.60 ? 150  VAL D CG2 1 
ATOM   3961  N  N   . PRO B 1 133 ? 26.901  51.150 137.672 1.00 14.39 ? 151  PRO D N   1 
ATOM   3962  C  CA  . PRO B 1 133 ? 27.352  51.821 138.885 1.00 14.50 ? 151  PRO D CA  1 
ATOM   3963  C  C   . PRO B 1 133 ? 26.596  51.427 140.149 1.00 14.82 ? 151  PRO D C   1 
ATOM   3964  O  O   . PRO B 1 133 ? 25.380  51.204 140.115 1.00 14.30 ? 151  PRO D O   1 
ATOM   3965  C  CB  . PRO B 1 133 ? 27.120  53.299 138.570 1.00 14.30 ? 151  PRO D CB  1 
ATOM   3966  C  CG  . PRO B 1 133 ? 27.220  53.387 137.098 1.00 14.44 ? 151  PRO D CG  1 
ATOM   3967  C  CD  . PRO B 1 133 ? 26.565  52.121 136.613 1.00 14.51 ? 151  PRO D CD  1 
ATOM   3968  N  N   . TYR B 1 134 ? 27.342  51.329 141.248 1.00 15.20 ? 152  TYR D N   1 
ATOM   3969  C  CA  . TYR B 1 134 ? 26.763  51.169 142.574 1.00 15.42 ? 152  TYR D CA  1 
ATOM   3970  C  C   . TYR B 1 134 ? 26.377  52.547 143.093 1.00 15.79 ? 152  TYR D C   1 
ATOM   3971  O  O   . TYR B 1 134 ? 27.071  53.151 143.914 1.00 16.11 ? 152  TYR D O   1 
ATOM   3972  C  CB  . TYR B 1 134 ? 27.728  50.433 143.501 1.00 15.29 ? 152  TYR D CB  1 
ATOM   3973  C  CG  . TYR B 1 134 ? 27.823  48.946 143.194 1.00 14.59 ? 152  TYR D CG  1 
ATOM   3974  C  CD1 . TYR B 1 134 ? 28.729  48.461 142.253 1.00 14.42 ? 152  TYR D CD1 1 
ATOM   3975  C  CD2 . TYR B 1 134 ? 26.994  48.035 143.835 1.00 14.63 ? 152  TYR D CD2 1 
ATOM   3976  C  CE1 . TYR B 1 134 ? 28.817  47.095 141.974 1.00 14.61 ? 152  TYR D CE1 1 
ATOM   3977  C  CE2 . TYR B 1 134 ? 27.068  46.672 143.565 1.00 14.12 ? 152  TYR D CE2 1 
ATOM   3978  C  CZ  . TYR B 1 134 ? 27.979  46.210 142.637 1.00 14.22 ? 152  TYR D CZ  1 
ATOM   3979  O  OH  . TYR B 1 134 ? 28.037  44.865 142.373 1.00 12.73 ? 152  TYR D OH  1 
ATOM   3980  N  N   . SER B 1 135 ? 25.260  53.034 142.557 1.00 16.15 ? 153  SER D N   1 
ATOM   3981  C  CA  . SER B 1 135 ? 24.729  54.368 142.810 1.00 16.66 ? 153  SER D CA  1 
ATOM   3982  C  C   . SER B 1 135 ? 23.327  54.481 142.226 1.00 17.02 ? 153  SER D C   1 
ATOM   3983  O  O   . SER B 1 135 ? 23.098  54.119 141.072 1.00 17.02 ? 153  SER D O   1 
ATOM   3984  C  CB  . SER B 1 135 ? 25.596  55.434 142.160 1.00 15.99 ? 153  SER D CB  1 
ATOM   3985  O  OG  . SER B 1 135 ? 25.065  56.712 142.450 1.00 16.77 ? 153  SER D OG  1 
ATOM   3986  N  N   . THR B 1 136 ? 22.393  54.999 143.018 1.00 17.55 ? 154  THR D N   1 
ATOM   3987  C  CA  . THR B 1 136 ? 21.034  55.236 142.534 1.00 18.06 ? 154  THR D CA  1 
ATOM   3988  C  C   . THR B 1 136 ? 20.945  56.578 141.796 1.00 17.74 ? 154  THR D C   1 
ATOM   3989  O  O   . THR B 1 136 ? 19.865  57.004 141.387 1.00 17.90 ? 154  THR D O   1 
ATOM   3990  C  CB  . THR B 1 136 ? 20.002  55.168 143.677 1.00 18.23 ? 154  THR D CB  1 
ATOM   3991  O  OG1 . THR B 1 136 ? 20.386  56.070 144.720 1.00 19.75 ? 154  THR D OG1 1 
ATOM   3992  C  CG2 . THR B 1 136 ? 19.925  53.751 144.239 1.00 18.31 ? 154  THR D CG2 1 
ATOM   3993  N  N   . SER B 1 137 ? 22.090  57.234 141.622 1.00 17.35 ? 155  SER D N   1 
ATOM   3994  C  CA  . SER B 1 137 ? 22.155  58.482 140.860 1.00 17.23 ? 155  SER D CA  1 
ATOM   3995  C  C   . SER B 1 137 ? 22.928  58.298 139.561 1.00 16.73 ? 155  SER D C   1 
ATOM   3996  O  O   . SER B 1 137 ? 23.193  59.264 138.848 1.00 17.22 ? 155  SER D O   1 
ATOM   3997  C  CB  . SER B 1 137 ? 22.796  59.582 141.699 1.00 17.07 ? 155  SER D CB  1 
ATOM   3998  O  OG  . SER B 1 137 ? 22.018  59.826 142.855 1.00 19.08 ? 155  SER D OG  1 
ATOM   3999  N  N   . ALA B 1 138 ? 23.287  57.053 139.260 1.00 15.83 ? 156  ALA D N   1 
ATOM   4000  C  CA  . ALA B 1 138 ? 24.118  56.746 138.103 1.00 15.07 ? 156  ALA D CA  1 
ATOM   4001  C  C   . ALA B 1 138 ? 23.593  55.509 137.391 1.00 14.52 ? 156  ALA D C   1 
ATOM   4002  O  O   . ALA B 1 138 ? 22.765  54.779 137.934 1.00 14.56 ? 156  ALA D O   1 
ATOM   4003  C  CB  . ALA B 1 138 ? 25.583  56.557 138.528 1.00 14.91 ? 156  ALA D CB  1 
ATOM   4004  N  N   . SER B 1 139 ? 24.084  55.274 136.176 1.00 13.85 ? 157  SER D N   1 
ATOM   4005  C  CA  . SER B 1 139 ? 23.586  54.194 135.335 1.00 13.16 ? 157  SER D CA  1 
ATOM   4006  C  C   . SER B 1 139 ? 24.652  53.809 134.331 1.00 12.84 ? 157  SER D C   1 
ATOM   4007  O  O   . SER B 1 139 ? 25.671  54.480 134.232 1.00 13.17 ? 157  SER D O   1 
ATOM   4008  C  CB  . SER B 1 139 ? 22.328  54.655 134.599 1.00 12.96 ? 157  SER D CB  1 
ATOM   4009  O  OG  . SER B 1 139 ? 22.645  55.717 133.722 1.00 12.78 ? 157  SER D OG  1 
ATOM   4010  N  N   . LEU B 1 140 ? 24.424  52.718 133.601 1.00 12.41 ? 158  LEU D N   1 
ATOM   4011  C  CA  . LEU B 1 140 ? 25.304  52.320 132.508 1.00 11.63 ? 158  LEU D CA  1 
ATOM   4012  C  C   . LEU B 1 140 ? 24.677  52.710 131.174 1.00 11.22 ? 158  LEU D C   1 
ATOM   4013  O  O   . LEU B 1 140 ? 23.631  52.175 130.797 1.00 10.62 ? 158  LEU D O   1 
ATOM   4014  C  CB  . LEU B 1 140 ? 25.555  50.808 132.536 1.00 11.60 ? 158  LEU D CB  1 
ATOM   4015  C  CG  . LEU B 1 140 ? 26.609  50.290 131.546 1.00 12.54 ? 158  LEU D CG  1 
ATOM   4016  C  CD1 . LEU B 1 140 ? 28.004  50.815 131.888 1.00 11.41 ? 158  LEU D CD1 1 
ATOM   4017  C  CD2 . LEU B 1 140 ? 26.616  48.766 131.479 1.00 12.39 ? 158  LEU D CD2 1 
ATOM   4018  N  N   . TYR B 1 141 ? 25.314  53.638 130.463 1.00 10.64 ? 159  TYR D N   1 
ATOM   4019  C  CA  . TYR B 1 141 ? 24.823  54.043 129.149 1.00 10.45 ? 159  TYR D CA  1 
ATOM   4020  C  C   . TYR B 1 141 ? 25.209  52.991 128.118 1.00 10.51 ? 159  TYR D C   1 
ATOM   4021  O  O   . TYR B 1 141 ? 26.349  52.503 128.095 1.00 10.67 ? 159  TYR D O   1 
ATOM   4022  C  CB  . TYR B 1 141 ? 25.348  55.426 128.756 1.00 10.46 ? 159  TYR D CB  1 
ATOM   4023  C  CG  . TYR B 1 141 ? 24.763  56.002 127.472 1.00 10.54 ? 159  TYR D CG  1 
ATOM   4024  C  CD1 . TYR B 1 141 ? 23.445  56.484 127.426 1.00 10.64 ? 159  TYR D CD1 1 
ATOM   4025  C  CD2 . TYR B 1 141 ? 25.539  56.086 126.312 1.00 9.05  ? 159  TYR D CD2 1 
ATOM   4026  C  CE1 . TYR B 1 141 ? 22.918  57.033 126.240 1.00 10.83 ? 159  TYR D CE1 1 
ATOM   4027  C  CE2 . TYR B 1 141 ? 25.032  56.622 125.134 1.00 10.24 ? 159  TYR D CE2 1 
ATOM   4028  C  CZ  . TYR B 1 141 ? 23.726  57.098 125.099 1.00 10.64 ? 159  TYR D CZ  1 
ATOM   4029  O  OH  . TYR B 1 141 ? 23.239  57.631 123.926 1.00 10.05 ? 159  TYR D OH  1 
ATOM   4030  N  N   . ILE B 1 142 ? 24.239  52.631 127.284 1.00 10.25 ? 160  ILE D N   1 
ATOM   4031  C  CA  . ILE B 1 142 ? 24.426  51.604 126.267 1.00 9.97  ? 160  ILE D CA  1 
ATOM   4032  C  C   . ILE B 1 142 ? 24.331  52.268 124.907 1.00 10.16 ? 160  ILE D C   1 
ATOM   4033  O  O   . ILE B 1 142 ? 23.354  52.949 124.617 1.00 9.82  ? 160  ILE D O   1 
ATOM   4034  C  CB  . ILE B 1 142 ? 23.369  50.485 126.382 1.00 9.73  ? 160  ILE D CB  1 
ATOM   4035  C  CG1 . ILE B 1 142 ? 23.399  49.844 127.779 1.00 9.10  ? 160  ILE D CG1 1 
ATOM   4036  C  CG2 . ILE B 1 142 ? 23.578  49.432 125.289 1.00 9.53  ? 160  ILE D CG2 1 
ATOM   4037  C  CD1 . ILE B 1 142 ? 22.172  49.022 128.103 1.00 7.09  ? 160  ILE D CD1 1 
ATOM   4038  N  N   . ARG B 1 143 ? 25.351  52.057 124.079 1.00 10.48 ? 161  ARG D N   1 
ATOM   4039  C  CA  . ARG B 1 143 ? 25.451  52.737 122.796 1.00 10.54 ? 161  ARG D CA  1 
ATOM   4040  C  C   . ARG B 1 143 ? 25.585  51.764 121.617 1.00 10.57 ? 161  ARG D C   1 
ATOM   4041  O  O   . ARG B 1 143 ? 26.703  51.442 121.191 1.00 10.29 ? 161  ARG D O   1 
ATOM   4042  C  CB  . ARG B 1 143 ? 26.616  53.735 122.831 1.00 10.58 ? 161  ARG D CB  1 
ATOM   4043  C  CG  . ARG B 1 143 ? 26.943  54.374 121.496 1.00 11.85 ? 161  ARG D CG  1 
ATOM   4044  C  CD  . ARG B 1 143 ? 25.765  55.138 120.946 1.00 13.79 ? 161  ARG D CD  1 
ATOM   4045  N  NE  . ARG B 1 143 ? 26.265  56.395 120.449 1.00 18.45 ? 161  ARG D NE  1 
ATOM   4046  C  CZ  . ARG B 1 143 ? 25.952  57.597 120.906 1.00 16.43 ? 161  ARG D CZ  1 
ATOM   4047  N  NH1 . ARG B 1 143 ? 25.064  57.775 121.874 1.00 15.64 ? 161  ARG D NH1 1 
ATOM   4048  N  NH2 . ARG B 1 143 ? 26.528  58.632 120.339 1.00 17.11 ? 161  ARG D NH2 1 
ATOM   4049  N  N   . PRO B 1 144 ? 24.440  51.269 121.103 1.00 10.72 ? 162  PRO D N   1 
ATOM   4050  C  CA  . PRO B 1 144 ? 24.488  50.521 119.862 1.00 10.89 ? 162  PRO D CA  1 
ATOM   4051  C  C   . PRO B 1 144 ? 24.783  51.476 118.716 1.00 11.29 ? 162  PRO D C   1 
ATOM   4052  O  O   . PRO B 1 144 ? 24.293  52.617 118.686 1.00 10.85 ? 162  PRO D O   1 
ATOM   4053  C  CB  . PRO B 1 144 ? 23.077  49.920 119.749 1.00 10.96 ? 162  PRO D CB  1 
ATOM   4054  C  CG  . PRO B 1 144 ? 22.473  50.065 121.129 1.00 10.86 ? 162  PRO D CG  1 
ATOM   4055  C  CD  . PRO B 1 144 ? 23.070  51.342 121.632 1.00 10.42 ? 162  PRO D CD  1 
ATOM   4056  N  N   . ALA B 1 145 ? 25.628  51.020 117.803 1.00 11.72 ? 163  ALA D N   1 
ATOM   4057  C  CA  . ALA B 1 145 ? 26.074  51.844 116.704 1.00 11.85 ? 163  ALA D CA  1 
ATOM   4058  C  C   . ALA B 1 145 ? 26.177  50.966 115.467 1.00 11.69 ? 163  ALA D C   1 
ATOM   4059  O  O   . ALA B 1 145 ? 26.561  49.801 115.556 1.00 11.83 ? 163  ALA D O   1 
ATOM   4060  C  CB  . ALA B 1 145 ? 27.414  52.532 117.055 1.00 12.01 ? 163  ALA D CB  1 
ATOM   4061  N  N   . PHE B 1 146 ? 25.802  51.521 114.315 1.00 11.83 ? 164  PHE D N   1 
ATOM   4062  C  CA  . PHE B 1 146 ? 25.631  50.734 113.091 1.00 11.48 ? 164  PHE D CA  1 
ATOM   4063  C  C   . PHE B 1 146 ? 26.198  51.553 111.941 1.00 11.64 ? 164  PHE D C   1 
ATOM   4064  O  O   . PHE B 1 146 ? 25.686  52.629 111.643 1.00 11.36 ? 164  PHE D O   1 
ATOM   4065  C  CB  . PHE B 1 146 ? 24.138  50.470 112.877 1.00 11.19 ? 164  PHE D CB  1 
ATOM   4066  C  CG  . PHE B 1 146 ? 23.814  49.283 111.986 1.00 10.83 ? 164  PHE D CG  1 
ATOM   4067  C  CD1 . PHE B 1 146 ? 24.806  48.579 111.312 1.00 8.76  ? 164  PHE D CD1 1 
ATOM   4068  C  CD2 . PHE B 1 146 ? 22.478  48.907 111.794 1.00 10.91 ? 164  PHE D CD2 1 
ATOM   4069  C  CE1 . PHE B 1 146 ? 24.480  47.511 110.491 1.00 9.93  ? 164  PHE D CE1 1 
ATOM   4070  C  CE2 . PHE B 1 146 ? 22.141  47.839 110.970 1.00 9.93  ? 164  PHE D CE2 1 
ATOM   4071  C  CZ  . PHE B 1 146 ? 23.143  47.136 110.322 1.00 9.30  ? 164  PHE D CZ  1 
ATOM   4072  N  N   . ILE B 1 147 ? 27.261  51.048 111.311 1.00 11.66 ? 165  ILE D N   1 
ATOM   4073  C  CA  . ILE B 1 147 ? 28.027  51.827 110.324 1.00 11.79 ? 165  ILE D CA  1 
ATOM   4074  C  C   . ILE B 1 147 ? 28.285  51.099 109.002 1.00 12.17 ? 165  ILE D C   1 
ATOM   4075  O  O   . ILE B 1 147 ? 28.466  49.882 108.976 1.00 11.82 ? 165  ILE D O   1 
ATOM   4076  C  CB  . ILE B 1 147 ? 29.397  52.320 110.893 1.00 11.74 ? 165  ILE D CB  1 
ATOM   4077  C  CG1 . ILE B 1 147 ? 30.308  51.140 111.281 1.00 11.54 ? 165  ILE D CG1 1 
ATOM   4078  C  CG2 . ILE B 1 147 ? 29.182  53.277 112.068 1.00 11.81 ? 165  ILE D CG2 1 
ATOM   4079  C  CD1 . ILE B 1 147 ? 31.773  51.511 111.510 1.00 10.18 ? 165  ILE D CD1 1 
ATOM   4080  N  N   . GLY B 1 148 ? 28.313  51.861 107.911 1.00 12.50 ? 166  GLY D N   1 
ATOM   4081  C  CA  . GLY B 1 148 ? 28.705  51.328 106.606 1.00 13.39 ? 166  GLY D CA  1 
ATOM   4082  C  C   . GLY B 1 148 ? 30.218  51.276 106.507 1.00 14.07 ? 166  GLY D C   1 
ATOM   4083  O  O   . GLY B 1 148 ? 30.903  52.257 106.805 1.00 14.12 ? 166  GLY D O   1 
ATOM   4084  N  N   . THR B 1 149 ? 30.747  50.127 106.104 1.00 14.98 ? 167  THR D N   1 
ATOM   4085  C  CA  . THR B 1 149 ? 32.194  49.935 106.041 1.00 16.19 ? 167  THR D CA  1 
ATOM   4086  C  C   . THR B 1 149 ? 32.622  49.585 104.618 1.00 16.94 ? 167  THR D C   1 
ATOM   4087  O  O   . THR B 1 149 ? 33.718  49.067 104.378 1.00 17.04 ? 167  THR D O   1 
ATOM   4088  C  CB  . THR B 1 149 ? 32.676  48.875 107.063 1.00 15.99 ? 167  THR D CB  1 
ATOM   4089  O  OG1 . THR B 1 149 ? 31.929  47.669 106.882 1.00 17.27 ? 167  THR D OG1 1 
ATOM   4090  C  CG2 . THR B 1 149 ? 32.479  49.371 108.495 1.00 15.03 ? 167  THR D CG2 1 
ATOM   4091  N  N   . GLU B 1 150 ? 31.725  49.891 103.686 1.00 17.96 ? 168  GLU D N   1 
ATOM   4092  C  CA  . GLU B 1 150 ? 31.939  49.744 102.255 1.00 19.17 ? 168  GLU D CA  1 
ATOM   4093  C  C   . GLU B 1 150 ? 33.203  50.495 101.820 1.00 19.09 ? 168  GLU D C   1 
ATOM   4094  O  O   . GLU B 1 150 ? 33.254  51.718 101.919 1.00 19.15 ? 168  GLU D O   1 
ATOM   4095  C  CB  . GLU B 1 150 ? 30.704  50.291 101.519 1.00 19.38 ? 168  GLU D CB  1 
ATOM   4096  C  CG  . GLU B 1 150 ? 30.870  50.465 100.018 1.00 21.87 ? 168  GLU D CG  1 
ATOM   4097  C  CD  . GLU B 1 150 ? 30.759  49.160 99.258  1.00 24.53 ? 168  GLU D CD  1 
ATOM   4098  O  OE1 . GLU B 1 150 ? 31.574  48.920 98.339  1.00 26.27 ? 168  GLU D OE1 1 
ATOM   4099  O  OE2 . GLU B 1 150 ? 29.851  48.373 99.574  1.00 25.97 ? 168  GLU D OE2 1 
ATOM   4100  N  N   . PRO B 1 151 ? 34.227  49.759 101.342 1.00 19.45 ? 169  PRO D N   1 
ATOM   4101  C  CA  . PRO B 1 151 ? 35.494  50.364 100.917 1.00 19.72 ? 169  PRO D CA  1 
ATOM   4102  C  C   . PRO B 1 151 ? 35.434  51.323 99.712  1.00 19.87 ? 169  PRO D C   1 
ATOM   4103  O  O   . PRO B 1 151 ? 36.362  52.103 99.519  1.00 20.64 ? 169  PRO D O   1 
ATOM   4104  C  CB  . PRO B 1 151 ? 36.382  49.149 100.605 1.00 19.91 ? 169  PRO D CB  1 
ATOM   4105  C  CG  . PRO B 1 151 ? 35.445  48.035 100.348 1.00 19.27 ? 169  PRO D CG  1 
ATOM   4106  C  CD  . PRO B 1 151 ? 34.250  48.289 101.204 1.00 19.52 ? 169  PRO D CD  1 
ATOM   4107  N  N   . SER B 1 152 ? 34.361  51.302 98.930  1.00 19.92 ? 170  SER D N   1 
ATOM   4108  C  CA  . SER B 1 152 ? 34.316  52.111 97.701  1.00 19.68 ? 170  SER D CA  1 
ATOM   4109  C  C   . SER B 1 152 ? 33.650  53.493 97.845  1.00 19.21 ? 170  SER D C   1 
ATOM   4110  O  O   . SER B 1 152 ? 32.776  53.692 98.695  1.00 19.12 ? 170  SER D O   1 
ATOM   4111  C  CB  . SER B 1 152 ? 33.711  51.304 96.542  1.00 19.95 ? 170  SER D CB  1 
ATOM   4112  O  OG  . SER B 1 152 ? 32.312  51.161 96.670  1.00 21.12 ? 170  SER D OG  1 
ATOM   4113  N  N   . LEU B 1 153 ? 34.074  54.438 97.006  1.00 18.95 ? 171  LEU D N   1 
ATOM   4114  C  CA  . LEU B 1 153 ? 33.642  55.842 97.109  1.00 18.89 ? 171  LEU D CA  1 
ATOM   4115  C  C   . LEU B 1 153 ? 32.327  56.175 96.388  1.00 19.11 ? 171  LEU D C   1 
ATOM   4116  O  O   . LEU B 1 153 ? 31.811  57.291 96.512  1.00 19.19 ? 171  LEU D O   1 
ATOM   4117  C  CB  . LEU B 1 153 ? 34.755  56.799 96.639  1.00 18.30 ? 171  LEU D CB  1 
ATOM   4118  C  CG  . LEU B 1 153 ? 36.162  56.715 97.252  1.00 18.23 ? 171  LEU D CG  1 
ATOM   4119  C  CD1 . LEU B 1 153 ? 37.047  57.845 96.698  1.00 16.04 ? 171  LEU D CD1 1 
ATOM   4120  C  CD2 . LEU B 1 153 ? 36.155  56.733 98.780  1.00 15.15 ? 171  LEU D CD2 1 
ATOM   4121  N  N   . GLY B 1 154 ? 31.796  55.231 95.617  1.00 19.51 ? 172  GLY D N   1 
ATOM   4122  C  CA  . GLY B 1 154 ? 30.475  55.414 95.002  1.00 20.39 ? 172  GLY D CA  1 
ATOM   4123  C  C   . GLY B 1 154 ? 29.425  55.636 96.081  1.00 20.89 ? 172  GLY D C   1 
ATOM   4124  O  O   . GLY B 1 154 ? 29.414  54.934 97.094  1.00 20.70 ? 172  GLY D O   1 
ATOM   4125  N  N   . VAL B 1 155 ? 28.566  56.632 95.892  1.00 21.51 ? 173  VAL D N   1 
ATOM   4126  C  CA  . VAL B 1 155 ? 27.509  56.894 96.868  1.00 22.20 ? 173  VAL D CA  1 
ATOM   4127  C  C   . VAL B 1 155 ? 26.297  55.996 96.593  1.00 22.24 ? 173  VAL D C   1 
ATOM   4128  O  O   . VAL B 1 155 ? 25.500  56.236 95.674  1.00 22.59 ? 173  VAL D O   1 
ATOM   4129  C  CB  . VAL B 1 155 ? 27.177  58.418 97.015  1.00 22.25 ? 173  VAL D CB  1 
ATOM   4130  C  CG1 . VAL B 1 155 ? 26.765  59.026 95.701  1.00 23.61 ? 173  VAL D CG1 1 
ATOM   4131  C  CG2 . VAL B 1 155 ? 26.108  58.653 98.085  1.00 22.82 ? 173  VAL D CG2 1 
ATOM   4132  N  N   . LYS B 1 156 ? 26.204  54.933 97.392  1.00 22.05 ? 174  LYS D N   1 
ATOM   4133  C  CA  . LYS B 1 156 ? 25.201  53.883 97.219  1.00 21.74 ? 174  LYS D CA  1 
ATOM   4134  C  C   . LYS B 1 156 ? 25.035  53.022 98.484  1.00 20.97 ? 174  LYS D C   1 
ATOM   4135  O  O   . LYS B 1 156 ? 25.832  53.112 99.419  1.00 20.17 ? 174  LYS D O   1 
ATOM   4136  C  CB  . LYS B 1 156 ? 25.560  52.995 96.023  1.00 22.11 ? 174  LYS D CB  1 
ATOM   4137  C  CG  . LYS B 1 156 ? 26.826  52.179 96.201  1.00 24.03 ? 174  LYS D CG  1 
ATOM   4138  C  CD  . LYS B 1 156 ? 27.181  51.459 94.912  1.00 28.10 ? 174  LYS D CD  1 
ATOM   4139  C  CE  . LYS B 1 156 ? 28.497  50.705 95.050  1.00 29.36 ? 174  LYS D CE  1 
ATOM   4140  N  NZ  . LYS B 1 156 ? 28.323  49.409 95.777  1.00 31.19 ? 174  LYS D NZ  1 
ATOM   4141  N  N   . LYS B 1 157 ? 23.988  52.198 98.482  1.00 20.10 ? 175  LYS D N   1 
ATOM   4142  C  CA  . LYS B 1 157 ? 23.727  51.206 99.527  1.00 19.84 ? 175  LYS D CA  1 
ATOM   4143  C  C   . LYS B 1 157 ? 24.980  50.395 99.852  1.00 19.18 ? 175  LYS D C   1 
ATOM   4144  O  O   . LYS B 1 157 ? 25.583  49.800 98.956  1.00 19.11 ? 175  LYS D O   1 
ATOM   4145  C  CB  . LYS B 1 157 ? 22.596  50.283 99.071  1.00 19.84 ? 175  LYS D CB  1 
ATOM   4146  C  CG  . LYS B 1 157 ? 22.081  49.273 100.083 1.00 20.81 ? 175  LYS D CG  1 
ATOM   4147  C  CD  . LYS B 1 157 ? 20.767  48.685 99.557  1.00 23.68 ? 175  LYS D CD  1 
ATOM   4148  C  CE  . LYS B 1 157 ? 20.394  47.378 100.220 1.00 26.07 ? 175  LYS D CE  1 
ATOM   4149  N  NZ  . LYS B 1 157 ? 19.809  47.559 101.576 1.00 28.63 ? 175  LYS D NZ  1 
ATOM   4150  N  N   . PRO B 1 158 ? 25.381  50.379 101.138 1.00 18.76 ? 176  PRO D N   1 
ATOM   4151  C  CA  . PRO B 1 158 ? 26.581  49.648 101.559 1.00 18.37 ? 176  PRO D CA  1 
ATOM   4152  C  C   . PRO B 1 158 ? 26.469  48.142 101.338 1.00 18.23 ? 176  PRO D C   1 
ATOM   4153  O  O   . PRO B 1 158 ? 25.409  47.553 101.580 1.00 18.17 ? 176  PRO D O   1 
ATOM   4154  C  CB  . PRO B 1 158 ? 26.685  49.967 103.060 1.00 18.40 ? 176  PRO D CB  1 
ATOM   4155  C  CG  . PRO B 1 158 ? 25.309  50.402 103.467 1.00 18.39 ? 176  PRO D CG  1 
ATOM   4156  C  CD  . PRO B 1 158 ? 24.719  51.064 102.269 1.00 18.58 ? 176  PRO D CD  1 
ATOM   4157  N  N   . THR B 1 159 ? 27.551  47.537 100.852 1.00 17.92 ? 177  THR D N   1 
ATOM   4158  C  CA  . THR B 1 159 ? 27.639  46.085 100.735 1.00 17.92 ? 177  THR D CA  1 
ATOM   4159  C  C   . THR B 1 159 ? 28.453  45.520 101.909 1.00 17.85 ? 177  THR D C   1 
ATOM   4160  O  O   . THR B 1 159 ? 28.662  44.311 102.012 1.00 17.91 ? 177  THR D O   1 
ATOM   4161  C  CB  . THR B 1 159 ? 28.266  45.635 99.386  1.00 18.07 ? 177  THR D CB  1 
ATOM   4162  O  OG1 . THR B 1 159 ? 29.644  46.025 99.345  1.00 18.24 ? 177  THR D OG1 1 
ATOM   4163  C  CG2 . THR B 1 159 ? 27.515  46.243 98.182  1.00 17.71 ? 177  THR D CG2 1 
ATOM   4164  N  N   . LYS B 1 160 ? 28.907  46.416 102.785 1.00 17.62 ? 178  LYS D N   1 
ATOM   4165  C  CA  . LYS B 1 160 ? 29.649  46.061 103.987 1.00 17.48 ? 178  LYS D CA  1 
ATOM   4166  C  C   . LYS B 1 160 ? 29.178  46.949 105.137 1.00 16.92 ? 178  LYS D C   1 
ATOM   4167  O  O   . LYS B 1 160 ? 29.000  48.160 104.958 1.00 16.74 ? 178  LYS D O   1 
ATOM   4168  C  CB  . LYS B 1 160 ? 31.150  46.265 103.748 1.00 17.97 ? 178  LYS D CB  1 
ATOM   4169  C  CG  . LYS B 1 160 ? 31.984  45.018 103.748 1.00 19.58 ? 178  LYS D CG  1 
ATOM   4170  C  CD  . LYS B 1 160 ? 32.506  44.745 105.156 1.00 23.54 ? 178  LYS D CD  1 
ATOM   4171  C  CE  . LYS B 1 160 ? 34.031  44.738 105.241 1.00 25.80 ? 178  LYS D CE  1 
ATOM   4172  N  NZ  . LYS B 1 160 ? 34.537  43.327 105.246 1.00 27.21 ? 178  LYS D NZ  1 
ATOM   4173  N  N   . ALA B 1 161 ? 28.988  46.345 106.312 1.00 16.45 ? 179  ALA D N   1 
ATOM   4174  C  CA  . ALA B 1 161 ? 28.544  47.065 107.513 1.00 16.05 ? 179  ALA D CA  1 
ATOM   4175  C  C   . ALA B 1 161 ? 29.084  46.457 108.808 1.00 15.79 ? 179  ALA D C   1 
ATOM   4176  O  O   . ALA B 1 161 ? 29.390  45.268 108.859 1.00 15.76 ? 179  ALA D O   1 
ATOM   4177  C  CB  . ALA B 1 161 ? 27.014  47.138 107.565 1.00 15.87 ? 179  ALA D CB  1 
ATOM   4178  N  N   . LEU B 1 162 ? 29.194  47.287 109.848 1.00 15.22 ? 180  LEU D N   1 
ATOM   4179  C  CA  . LEU B 1 162 ? 29.570  46.830 111.187 1.00 14.82 ? 180  LEU D CA  1 
ATOM   4180  C  C   . LEU B 1 162 ? 28.561  47.342 112.210 1.00 14.42 ? 180  LEU D C   1 
ATOM   4181  O  O   . LEU B 1 162 ? 28.305  48.543 112.289 1.00 14.03 ? 180  LEU D O   1 
ATOM   4182  C  CB  . LEU B 1 162 ? 30.983  47.312 111.544 1.00 14.65 ? 180  LEU D CB  1 
ATOM   4183  C  CG  . LEU B 1 162 ? 31.891  46.693 112.635 1.00 15.38 ? 180  LEU D CG  1 
ATOM   4184  C  CD1 . LEU B 1 162 ? 32.404  47.716 113.667 1.00 14.79 ? 180  LEU D CD1 1 
ATOM   4185  C  CD2 . LEU B 1 162 ? 31.353  45.439 113.314 1.00 15.65 ? 180  LEU D CD2 1 
ATOM   4186  N  N   . LEU B 1 163 ? 27.984  46.415 112.973 1.00 14.26 ? 181  LEU D N   1 
ATOM   4187  C  CA  . LEU B 1 163 ? 27.153  46.756 114.127 1.00 14.05 ? 181  LEU D CA  1 
ATOM   4188  C  C   . LEU B 1 163 ? 27.975  46.546 115.409 1.00 14.05 ? 181  LEU D C   1 
ATOM   4189  O  O   . LEU B 1 163 ? 28.503  45.457 115.647 1.00 13.68 ? 181  LEU D O   1 
ATOM   4190  C  CB  . LEU B 1 163 ? 25.859  45.920 114.144 1.00 13.97 ? 181  LEU D CB  1 
ATOM   4191  C  CG  . LEU B 1 163 ? 24.695  46.413 115.027 1.00 14.14 ? 181  LEU D CG  1 
ATOM   4192  C  CD1 . LEU B 1 163 ? 23.341  45.981 114.459 1.00 14.02 ? 181  LEU D CD1 1 
ATOM   4193  C  CD2 . LEU B 1 163 ? 24.847  45.953 116.485 1.00 12.49 ? 181  LEU D CD2 1 
ATOM   4194  N  N   . PHE B 1 164 ? 28.114  47.601 116.212 1.00 13.64 ? 182  PHE D N   1 
ATOM   4195  C  CA  . PHE B 1 164 ? 28.795  47.465 117.499 1.00 13.38 ? 182  PHE D CA  1 
ATOM   4196  C  C   . PHE B 1 164 ? 28.027  48.080 118.669 1.00 13.08 ? 182  PHE D C   1 
ATOM   4197  O  O   . PHE B 1 164 ? 27.121  48.890 118.470 1.00 13.35 ? 182  PHE D O   1 
ATOM   4198  C  CB  . PHE B 1 164 ? 30.271  47.926 117.437 1.00 13.07 ? 182  PHE D CB  1 
ATOM   4199  C  CG  . PHE B 1 164 ? 30.464  49.389 117.150 1.00 13.05 ? 182  PHE D CG  1 
ATOM   4200  C  CD1 . PHE B 1 164 ? 30.496  49.859 115.837 1.00 11.82 ? 182  PHE D CD1 1 
ATOM   4201  C  CD2 . PHE B 1 164 ? 30.669  50.291 118.192 1.00 12.43 ? 182  PHE D CD2 1 
ATOM   4202  C  CE1 . PHE B 1 164 ? 30.693  51.207 115.568 1.00 11.88 ? 182  PHE D CE1 1 
ATOM   4203  C  CE2 . PHE B 1 164 ? 30.865  51.647 117.933 1.00 12.27 ? 182  PHE D CE2 1 
ATOM   4204  C  CZ  . PHE B 1 164 ? 30.884  52.103 116.615 1.00 12.16 ? 182  PHE D CZ  1 
ATOM   4205  N  N   . VAL B 1 165 ? 28.359  47.646 119.882 1.00 12.61 ? 183  VAL D N   1 
ATOM   4206  C  CA  . VAL B 1 165 ? 27.762  48.206 121.095 1.00 12.18 ? 183  VAL D CA  1 
ATOM   4207  C  C   . VAL B 1 165 ? 28.840  48.549 122.120 1.00 11.99 ? 183  VAL D C   1 
ATOM   4208  O  O   . VAL B 1 165 ? 29.671  47.716 122.465 1.00 12.10 ? 183  VAL D O   1 
ATOM   4209  C  CB  . VAL B 1 165 ? 26.690  47.270 121.740 1.00 12.07 ? 183  VAL D CB  1 
ATOM   4210  C  CG1 . VAL B 1 165 ? 26.045  47.946 122.944 1.00 11.13 ? 183  VAL D CG1 1 
ATOM   4211  C  CG2 . VAL B 1 165 ? 25.618  46.880 120.732 1.00 11.43 ? 183  VAL D CG2 1 
ATOM   4212  N  N   . LEU B 1 166 ? 28.800  49.788 122.595 1.00 11.85 ? 184  LEU D N   1 
ATOM   4213  C  CA  . LEU B 1 166 ? 29.697  50.290 123.620 1.00 11.76 ? 184  LEU D CA  1 
ATOM   4214  C  C   . LEU B 1 166 ? 28.926  50.481 124.922 1.00 12.04 ? 184  LEU D C   1 
ATOM   4215  O  O   . LEU B 1 166 ? 27.736  50.785 124.897 1.00 11.94 ? 184  LEU D O   1 
ATOM   4216  C  CB  . LEU B 1 166 ? 30.280  51.631 123.172 1.00 11.66 ? 184  LEU D CB  1 
ATOM   4217  C  CG  . LEU B 1 166 ? 31.659  51.766 122.510 1.00 12.00 ? 184  LEU D CG  1 
ATOM   4218  C  CD1 . LEU B 1 166 ? 32.141  50.521 121.766 1.00 10.29 ? 184  LEU D CD1 1 
ATOM   4219  C  CD2 . LEU B 1 166 ? 31.706  53.019 121.632 1.00 9.27  ? 184  LEU D CD2 1 
ATOM   4220  N  N   . LEU B 1 167 ? 29.616  50.313 126.050 1.00 12.23 ? 185  LEU D N   1 
ATOM   4221  C  CA  . LEU B 1 167 ? 29.036  50.579 127.368 1.00 12.54 ? 185  LEU D CA  1 
ATOM   4222  C  C   . LEU B 1 167 ? 29.822  51.664 128.089 1.00 12.65 ? 185  LEU D C   1 
ATOM   4223  O  O   . LEU B 1 167 ? 31.051  51.663 128.080 1.00 12.32 ? 185  LEU D O   1 
ATOM   4224  C  CB  . LEU B 1 167 ? 28.997  49.311 128.228 1.00 12.01 ? 185  LEU D CB  1 
ATOM   4225  C  CG  . LEU B 1 167 ? 28.339  48.026 127.717 1.00 11.84 ? 185  LEU D CG  1 
ATOM   4226  C  CD1 . LEU B 1 167 ? 28.525  46.933 128.752 1.00 10.30 ? 185  LEU D CD1 1 
ATOM   4227  C  CD2 . LEU B 1 167 ? 26.859  48.198 127.373 1.00 10.59 ? 185  LEU D CD2 1 
ATOM   4228  N  N   . SER B 1 168 ? 29.102  52.588 128.719 1.00 13.08 ? 186  SER D N   1 
ATOM   4229  C  CA  . SER B 1 168 ? 29.737  53.730 129.357 1.00 13.75 ? 186  SER D CA  1 
ATOM   4230  C  C   . SER B 1 168 ? 29.049  54.110 130.671 1.00 14.56 ? 186  SER D C   1 
ATOM   4231  O  O   . SER B 1 168 ? 27.898  54.544 130.656 1.00 14.20 ? 186  SER D O   1 
ATOM   4232  C  CB  . SER B 1 168 ? 29.752  54.925 128.399 1.00 13.48 ? 186  SER D CB  1 
ATOM   4233  O  OG  . SER B 1 168 ? 30.459  56.006 128.971 1.00 14.20 ? 186  SER D OG  1 
ATOM   4234  N  N   . PRO B 1 169 ? 29.754  53.948 131.814 1.00 15.60 ? 187  PRO D N   1 
ATOM   4235  C  CA  . PRO B 1 169 ? 29.203  54.404 133.094 1.00 16.55 ? 187  PRO D CA  1 
ATOM   4236  C  C   . PRO B 1 169 ? 28.930  55.905 133.061 1.00 17.42 ? 187  PRO D C   1 
ATOM   4237  O  O   . PRO B 1 169 ? 29.825  56.678 132.745 1.00 17.52 ? 187  PRO D O   1 
ATOM   4238  C  CB  . PRO B 1 169 ? 30.323  54.101 134.104 1.00 16.65 ? 187  PRO D CB  1 
ATOM   4239  C  CG  . PRO B 1 169 ? 31.213  53.110 133.441 1.00 16.34 ? 187  PRO D CG  1 
ATOM   4240  C  CD  . PRO B 1 169 ? 31.086  53.328 131.963 1.00 15.59 ? 187  PRO D CD  1 
ATOM   4241  N  N   . VAL B 1 170 ? 27.695  56.314 133.359 1.00 18.66 ? 188  VAL D N   1 
ATOM   4242  C  CA  . VAL B 1 170 ? 27.359  57.741 133.410 1.00 19.66 ? 188  VAL D CA  1 
ATOM   4243  C  C   . VAL B 1 170 ? 26.631  58.098 134.703 1.00 20.79 ? 188  VAL D C   1 
ATOM   4244  O  O   . VAL B 1 170 ? 25.921  57.264 135.280 1.00 20.91 ? 188  VAL D O   1 
ATOM   4245  C  CB  . VAL B 1 170 ? 26.539  58.233 132.160 1.00 19.78 ? 188  VAL D CB  1 
ATOM   4246  C  CG1 . VAL B 1 170 ? 27.198  57.786 130.854 1.00 19.98 ? 188  VAL D CG1 1 
ATOM   4247  C  CG2 . VAL B 1 170 ? 25.086  57.776 132.215 1.00 18.96 ? 188  VAL D CG2 1 
ATOM   4248  N  N   . GLY B 1 171 ? 26.810  59.337 135.149 1.00 21.77 ? 189  GLY D N   1 
ATOM   4249  C  CA  . GLY B 1 171 ? 26.160  59.820 136.353 1.00 23.75 ? 189  GLY D CA  1 
ATOM   4250  C  C   . GLY B 1 171 ? 25.037  60.806 136.073 1.00 25.59 ? 189  GLY D C   1 
ATOM   4251  O  O   . GLY B 1 171 ? 24.499  60.845 134.953 1.00 25.39 ? 189  GLY D O   1 
ATOM   4252  N  N   . PRO B 1 172 ? 24.668  61.607 137.097 1.00 26.90 ? 190  PRO D N   1 
ATOM   4253  C  CA  . PRO B 1 172 ? 23.591  62.603 137.001 1.00 27.54 ? 190  PRO D CA  1 
ATOM   4254  C  C   . PRO B 1 172 ? 23.906  63.697 135.977 1.00 28.27 ? 190  PRO D C   1 
ATOM   4255  O  O   . PRO B 1 172 ? 25.069  64.077 135.813 1.00 28.69 ? 190  PRO D O   1 
ATOM   4256  C  CB  . PRO B 1 172 ? 23.545  63.216 138.407 1.00 27.85 ? 190  PRO D CB  1 
ATOM   4257  C  CG  . PRO B 1 172 ? 24.262  62.235 139.303 1.00 27.89 ? 190  PRO D CG  1 
ATOM   4258  C  CD  . PRO B 1 172 ? 25.298  61.600 138.435 1.00 27.19 ? 190  PRO D CD  1 
ATOM   4259  N  N   . PHE B 1 179 ? 18.182  70.313 140.221 1.00 29.11 ? 197  PHE D N   1 
ATOM   4260  C  CA  . PHE B 1 179 ? 18.072  70.675 138.810 1.00 29.07 ? 197  PHE D CA  1 
ATOM   4261  C  C   . PHE B 1 179 ? 18.984  71.833 138.432 1.00 29.15 ? 197  PHE D C   1 
ATOM   4262  O  O   . PHE B 1 179 ? 19.019  72.861 139.119 1.00 29.18 ? 197  PHE D O   1 
ATOM   4263  C  CB  . PHE B 1 179 ? 16.638  71.067 138.458 1.00 28.91 ? 197  PHE D CB  1 
ATOM   4264  C  CG  . PHE B 1 179 ? 15.766  69.915 138.045 1.00 28.84 ? 197  PHE D CG  1 
ATOM   4265  C  CD1 . PHE B 1 179 ? 14.457  69.825 138.511 1.00 27.94 ? 197  PHE D CD1 1 
ATOM   4266  C  CD2 . PHE B 1 179 ? 16.241  68.930 137.175 1.00 28.31 ? 197  PHE D CD2 1 
ATOM   4267  C  CE1 . PHE B 1 179 ? 13.637  68.779 138.121 1.00 27.94 ? 197  PHE D CE1 1 
ATOM   4268  C  CE2 . PHE B 1 179 ? 15.429  67.884 136.782 1.00 27.91 ? 197  PHE D CE2 1 
ATOM   4269  C  CZ  . PHE B 1 179 ? 14.123  67.808 137.257 1.00 28.14 ? 197  PHE D CZ  1 
ATOM   4270  N  N   . ASN B 1 180 ? 19.710  71.667 137.329 1.00 28.91 ? 198  ASN D N   1 
ATOM   4271  C  CA  . ASN B 1 180 ? 20.485  72.763 136.750 1.00 28.79 ? 198  ASN D CA  1 
ATOM   4272  C  C   . ASN B 1 180 ? 19.850  73.238 135.441 1.00 27.79 ? 198  ASN D C   1 
ATOM   4273  O  O   . ASN B 1 180 ? 20.130  72.677 134.380 1.00 28.17 ? 198  ASN D O   1 
ATOM   4274  C  CB  . ASN B 1 180 ? 21.946  72.344 136.540 1.00 29.28 ? 198  ASN D CB  1 
ATOM   4275  C  CG  . ASN B 1 180 ? 22.703  72.186 137.852 1.00 30.63 ? 198  ASN D CG  1 
ATOM   4276  O  OD1 . ASN B 1 180 ? 22.982  73.170 138.540 1.00 31.98 ? 198  ASN D OD1 1 
ATOM   4277  N  ND2 . ASN B 1 180 ? 23.039  70.940 138.203 1.00 31.48 ? 198  ASN D ND2 1 
ATOM   4278  N  N   . PRO B 1 181 ? 18.985  74.271 135.510 1.00 26.78 ? 199  PRO D N   1 
ATOM   4279  C  CA  . PRO B 1 181 ? 18.270  74.720 134.312 1.00 25.84 ? 199  PRO D CA  1 
ATOM   4280  C  C   . PRO B 1 181 ? 19.225  75.234 133.233 1.00 24.96 ? 199  PRO D C   1 
ATOM   4281  O  O   . PRO B 1 181 ? 20.349  75.641 133.540 1.00 24.89 ? 199  PRO D O   1 
ATOM   4282  C  CB  . PRO B 1 181 ? 17.370  75.846 134.836 1.00 25.81 ? 199  PRO D CB  1 
ATOM   4283  C  CG  . PRO B 1 181 ? 18.023  76.305 136.097 1.00 26.35 ? 199  PRO D CG  1 
ATOM   4284  C  CD  . PRO B 1 181 ? 18.643  75.084 136.691 1.00 26.65 ? 199  PRO D CD  1 
ATOM   4285  N  N   . VAL B 1 182 ? 18.784  75.191 131.980 1.00 23.91 ? 200  VAL D N   1 
ATOM   4286  C  CA  . VAL B 1 182 ? 19.619  75.614 130.855 1.00 22.81 ? 200  VAL D CA  1 
ATOM   4287  C  C   . VAL B 1 182 ? 19.044  76.840 130.150 1.00 22.42 ? 200  VAL D C   1 
ATOM   4288  O  O   . VAL B 1 182 ? 17.832  77.070 130.180 1.00 22.04 ? 200  VAL D O   1 
ATOM   4289  C  CB  . VAL B 1 182 ? 19.830  74.468 129.815 1.00 22.70 ? 200  VAL D CB  1 
ATOM   4290  C  CG1 . VAL B 1 182 ? 20.678  73.347 130.401 1.00 21.78 ? 200  VAL D CG1 1 
ATOM   4291  C  CG2 . VAL B 1 182 ? 18.489  73.933 129.292 1.00 22.22 ? 200  VAL D CG2 1 
ATOM   4292  N  N   . SER B 1 183 ? 19.927  77.619 129.531 1.00 21.82 ? 201  SER D N   1 
ATOM   4293  C  CA  . SER B 1 183 ? 19.534  78.686 128.615 1.00 21.62 ? 201  SER D CA  1 
ATOM   4294  C  C   . SER B 1 183 ? 19.615  78.194 127.177 1.00 21.17 ? 201  SER D C   1 
ATOM   4295  O  O   . SER B 1 183 ? 20.577  77.522 126.796 1.00 20.76 ? 201  SER D O   1 
ATOM   4296  C  CB  . SER B 1 183 ? 20.431  79.914 128.788 1.00 21.60 ? 201  SER D CB  1 
ATOM   4297  O  OG  . SER B 1 183 ? 19.988  80.700 129.869 1.00 22.81 ? 201  SER D OG  1 
ATOM   4298  N  N   . LEU B 1 184 ? 18.603  78.537 126.386 1.00 20.87 ? 202  LEU D N   1 
ATOM   4299  C  CA  . LEU B 1 184 ? 18.523  78.089 124.997 1.00 20.57 ? 202  LEU D CA  1 
ATOM   4300  C  C   . LEU B 1 184 ? 18.829  79.217 124.022 1.00 20.76 ? 202  LEU D C   1 
ATOM   4301  O  O   . LEU B 1 184 ? 18.349  80.342 124.185 1.00 20.34 ? 202  LEU D O   1 
ATOM   4302  C  CB  . LEU B 1 184 ? 17.144  77.499 124.684 1.00 20.46 ? 202  LEU D CB  1 
ATOM   4303  C  CG  . LEU B 1 184 ? 16.564  76.370 125.546 1.00 19.69 ? 202  LEU D CG  1 
ATOM   4304  C  CD1 . LEU B 1 184 ? 15.273  75.864 124.936 1.00 18.96 ? 202  LEU D CD1 1 
ATOM   4305  C  CD2 . LEU B 1 184 ? 17.549  75.230 125.726 1.00 19.94 ? 202  LEU D CD2 1 
ATOM   4306  N  N   . TRP B 1 185 ? 19.633  78.894 123.013 1.00 20.88 ? 203  TRP D N   1 
ATOM   4307  C  CA  . TRP B 1 185 ? 19.957  79.809 121.932 1.00 21.09 ? 203  TRP D CA  1 
ATOM   4308  C  C   . TRP B 1 185 ? 19.056  79.504 120.736 1.00 21.21 ? 203  TRP D C   1 
ATOM   4309  O  O   . TRP B 1 185 ? 19.090  78.398 120.185 1.00 21.16 ? 203  TRP D O   1 
ATOM   4310  C  CB  . TRP B 1 185 ? 21.434  79.665 121.568 1.00 21.37 ? 203  TRP D CB  1 
ATOM   4311  C  CG  . TRP B 1 185 ? 21.886  80.531 120.439 1.00 22.87 ? 203  TRP D CG  1 
ATOM   4312  C  CD1 . TRP B 1 185 ? 22.157  80.133 119.161 1.00 23.70 ? 203  TRP D CD1 1 
ATOM   4313  C  CD2 . TRP B 1 185 ? 22.116  81.946 120.478 1.00 23.42 ? 203  TRP D CD2 1 
ATOM   4314  N  NE1 . TRP B 1 185 ? 22.536  81.212 118.400 1.00 24.29 ? 203  TRP D NE1 1 
ATOM   4315  C  CE2 . TRP B 1 185 ? 22.524  82.337 119.182 1.00 24.07 ? 203  TRP D CE2 1 
ATOM   4316  C  CE3 . TRP B 1 185 ? 22.018  82.921 121.481 1.00 23.51 ? 203  TRP D CE3 1 
ATOM   4317  C  CZ2 . TRP B 1 185 ? 22.845  83.665 118.860 1.00 24.53 ? 203  TRP D CZ2 1 
ATOM   4318  C  CZ3 . TRP B 1 185 ? 22.329  84.244 121.163 1.00 24.33 ? 203  TRP D CZ3 1 
ATOM   4319  C  CH2 . TRP B 1 185 ? 22.739  84.602 119.858 1.00 24.36 ? 203  TRP D CH2 1 
ATOM   4320  N  N   . ALA B 1 186 ? 18.250  80.494 120.350 1.00 21.03 ? 204  ALA D N   1 
ATOM   4321  C  CA  . ALA B 1 186 ? 17.242  80.332 119.314 1.00 21.13 ? 204  ALA D CA  1 
ATOM   4322  C  C   . ALA B 1 186 ? 17.571  81.187 118.091 1.00 21.55 ? 204  ALA D C   1 
ATOM   4323  O  O   . ALA B 1 186 ? 17.418  82.413 118.104 1.00 21.48 ? 204  ALA D O   1 
ATOM   4324  C  CB  . ALA B 1 186 ? 15.859  80.674 119.862 1.00 20.78 ? 204  ALA D CB  1 
ATOM   4325  N  N   . ASN B 1 187 ? 18.033  80.520 117.038 1.00 21.69 ? 205  ASN D N   1 
ATOM   4326  C  CA  . ASN B 1 187 ? 18.397  81.176 115.792 1.00 21.94 ? 205  ASN D CA  1 
ATOM   4327  C  C   . ASN B 1 187 ? 17.703  80.488 114.618 1.00 21.93 ? 205  ASN D C   1 
ATOM   4328  O  O   . ASN B 1 187 ? 18.071  79.376 114.251 1.00 21.64 ? 205  ASN D O   1 
ATOM   4329  C  CB  . ASN B 1 187 ? 19.920  81.158 115.611 1.00 22.09 ? 205  ASN D CB  1 
ATOM   4330  C  CG  . ASN B 1 187 ? 20.405  82.166 114.582 1.00 22.30 ? 205  ASN D CG  1 
ATOM   4331  O  OD1 . ASN B 1 187 ? 19.624  82.701 113.791 1.00 21.88 ? 205  ASN D OD1 1 
ATOM   4332  N  ND2 . ASN B 1 187 ? 21.711  82.436 114.596 1.00 22.09 ? 205  ASN D ND2 1 
ATOM   4333  N  N   . PRO B 1 188 ? 16.697  81.152 114.022 1.00 22.02 ? 206  PRO D N   1 
ATOM   4334  C  CA  . PRO B 1 188 ? 15.876  80.502 112.999 1.00 22.27 ? 206  PRO D CA  1 
ATOM   4335  C  C   . PRO B 1 188 ? 16.607  80.243 111.674 1.00 22.82 ? 206  PRO D C   1 
ATOM   4336  O  O   . PRO B 1 188 ? 16.049  79.606 110.777 1.00 22.84 ? 206  PRO D O   1 
ATOM   4337  C  CB  . PRO B 1 188 ? 14.711  81.479 112.799 1.00 22.51 ? 206  PRO D CB  1 
ATOM   4338  C  CG  . PRO B 1 188 ? 15.224  82.802 113.249 1.00 22.25 ? 206  PRO D CG  1 
ATOM   4339  C  CD  . PRO B 1 188 ? 16.281  82.542 114.283 1.00 21.95 ? 206  PRO D CD  1 
ATOM   4340  N  N   . LYS B 1 189 ? 17.845  80.717 111.564 1.00 23.02 ? 207  LYS D N   1 
ATOM   4341  C  CA  . LYS B 1 189 ? 18.617  80.527 110.344 1.00 23.70 ? 207  LYS D CA  1 
ATOM   4342  C  C   . LYS B 1 189 ? 19.241  79.131 110.267 1.00 23.60 ? 207  LYS D C   1 
ATOM   4343  O  O   . LYS B 1 189 ? 19.723  78.726 109.215 1.00 24.01 ? 207  LYS D O   1 
ATOM   4344  C  CB  . LYS B 1 189 ? 19.658  81.644 110.161 1.00 23.86 ? 207  LYS D CB  1 
ATOM   4345  C  CG  . LYS B 1 189 ? 20.907  81.528 111.017 1.00 25.03 ? 207  LYS D CG  1 
ATOM   4346  C  CD  . LYS B 1 189 ? 21.772  82.794 110.905 1.00 27.17 ? 207  LYS D CD  1 
ATOM   4347  C  CE  . LYS B 1 189 ? 23.026  82.687 111.771 1.00 27.50 ? 207  LYS D CE  1 
ATOM   4348  N  NZ  . LYS B 1 189 ? 23.565  84.012 112.176 1.00 27.97 ? 207  LYS D NZ  1 
ATOM   4349  N  N   . TYR B 1 190 ? 19.227  78.407 111.383 1.00 23.40 ? 208  TYR D N   1 
ATOM   4350  C  CA  . TYR B 1 190 ? 19.623  77.003 111.400 1.00 23.01 ? 208  TYR D CA  1 
ATOM   4351  C  C   . TYR B 1 190 ? 18.387  76.141 111.560 1.00 22.52 ? 208  TYR D C   1 
ATOM   4352  O  O   . TYR B 1 190 ? 17.592  76.348 112.482 1.00 22.78 ? 208  TYR D O   1 
ATOM   4353  C  CB  . TYR B 1 190 ? 20.582  76.708 112.548 1.00 23.38 ? 208  TYR D CB  1 
ATOM   4354  C  CG  . TYR B 1 190 ? 21.739  77.665 112.662 1.00 24.42 ? 208  TYR D CG  1 
ATOM   4355  C  CD1 . TYR B 1 190 ? 21.828  78.544 113.736 1.00 25.69 ? 208  TYR D CD1 1 
ATOM   4356  C  CD2 . TYR B 1 190 ? 22.748  77.685 111.703 1.00 25.90 ? 208  TYR D CD2 1 
ATOM   4357  C  CE1 . TYR B 1 190 ? 22.892  79.419 113.856 1.00 26.43 ? 208  TYR D CE1 1 
ATOM   4358  C  CE2 . TYR B 1 190 ? 23.812  78.565 111.805 1.00 27.04 ? 208  TYR D CE2 1 
ATOM   4359  C  CZ  . TYR B 1 190 ? 23.880  79.425 112.885 1.00 26.99 ? 208  TYR D CZ  1 
ATOM   4360  O  OH  . TYR B 1 190 ? 24.935  80.298 112.989 1.00 27.73 ? 208  TYR D OH  1 
ATOM   4361  N  N   . VAL B 1 191 ? 18.223  75.183 110.656 1.00 21.46 ? 209  VAL D N   1 
ATOM   4362  C  CA  . VAL B 1 191 ? 17.106  74.261 110.709 1.00 20.40 ? 209  VAL D CA  1 
ATOM   4363  C  C   . VAL B 1 191 ? 17.652  72.842 110.888 1.00 19.88 ? 209  VAL D C   1 
ATOM   4364  O  O   . VAL B 1 191 ? 18.465  72.386 110.088 1.00 19.86 ? 209  VAL D O   1 
ATOM   4365  C  CB  . VAL B 1 191 ? 16.220  74.385 109.441 1.00 20.70 ? 209  VAL D CB  1 
ATOM   4366  C  CG1 . VAL B 1 191 ? 15.049  73.406 109.484 1.00 19.05 ? 209  VAL D CG1 1 
ATOM   4367  C  CG2 . VAL B 1 191 ? 15.721  75.824 109.282 1.00 19.98 ? 209  VAL D CG2 1 
ATOM   4368  N  N   . ARG B 1 192 ? 17.200  72.166 111.946 1.00 19.09 ? 210  ARG D N   1 
ATOM   4369  C  CA  . ARG B 1 192 ? 17.676  70.821 112.305 1.00 18.42 ? 210  ARG D CA  1 
ATOM   4370  C  C   . ARG B 1 192 ? 17.191  69.747 111.337 1.00 17.87 ? 210  ARG D C   1 
ATOM   4371  O  O   . ARG B 1 192 ? 17.918  68.808 111.026 1.00 17.78 ? 210  ARG D O   1 
ATOM   4372  C  CB  . ARG B 1 192 ? 17.232  70.444 113.725 1.00 17.91 ? 210  ARG D CB  1 
ATOM   4373  C  CG  . ARG B 1 192 ? 18.007  69.265 114.327 1.00 18.03 ? 210  ARG D CG  1 
ATOM   4374  C  CD  . ARG B 1 192 ? 17.311  68.644 115.541 1.00 16.93 ? 210  ARG D CD  1 
ATOM   4375  N  NE  . ARG B 1 192 ? 16.058  67.975 115.203 1.00 15.84 ? 210  ARG D NE  1 
ATOM   4376  C  CZ  . ARG B 1 192 ? 15.946  66.699 114.831 1.00 16.34 ? 210  ARG D CZ  1 
ATOM   4377  N  NH1 . ARG B 1 192 ? 17.013  65.915 114.735 1.00 17.11 ? 210  ARG D NH1 1 
ATOM   4378  N  NH2 . ARG B 1 192 ? 14.750  66.203 114.552 1.00 16.53 ? 210  ARG D NH2 1 
ATOM   4379  N  N   . ALA B 1 193 ? 15.950  69.888 110.886 1.00 17.62 ? 211  ALA D N   1 
ATOM   4380  C  CA  . ALA B 1 193 ? 15.285  68.846 110.110 1.00 17.49 ? 211  ALA D CA  1 
ATOM   4381  C  C   . ALA B 1 193 ? 14.169  69.412 109.244 1.00 17.15 ? 211  ALA D C   1 
ATOM   4382  O  O   . ALA B 1 193 ? 13.590  70.450 109.562 1.00 16.64 ? 211  ALA D O   1 
ATOM   4383  C  CB  . ALA B 1 193 ? 14.741  67.751 111.040 1.00 16.90 ? 211  ALA D CB  1 
ATOM   4384  N  N   . TRP B 1 194 ? 13.868  68.700 108.163 1.00 17.71 ? 212  TRP D N   1 
ATOM   4385  C  CA  . TRP B 1 194 ? 12.880  69.126 107.175 1.00 18.47 ? 212  TRP D CA  1 
ATOM   4386  C  C   . TRP B 1 194 ? 11.965  67.953 106.841 1.00 18.71 ? 212  TRP D C   1 
ATOM   4387  O  O   . TRP B 1 194 ? 12.344  66.786 107.014 1.00 18.84 ? 212  TRP D O   1 
ATOM   4388  C  CB  . TRP B 1 194 ? 13.607  69.610 105.918 1.00 18.76 ? 212  TRP D CB  1 
ATOM   4389  C  CG  . TRP B 1 194 ? 12.846  70.587 105.060 1.00 20.39 ? 212  TRP D CG  1 
ATOM   4390  C  CD1 . TRP B 1 194 ? 12.204  70.322 103.875 1.00 22.13 ? 212  TRP D CD1 1 
ATOM   4391  C  CD2 . TRP B 1 194 ? 12.687  71.994 105.294 1.00 21.81 ? 212  TRP D CD2 1 
ATOM   4392  N  NE1 . TRP B 1 194 ? 11.644  71.479 103.370 1.00 22.86 ? 212  TRP D NE1 1 
ATOM   4393  C  CE2 . TRP B 1 194 ? 11.925  72.516 104.221 1.00 21.97 ? 212  TRP D CE2 1 
ATOM   4394  C  CE3 . TRP B 1 194 ? 13.111  72.864 106.309 1.00 21.85 ? 212  TRP D CE3 1 
ATOM   4395  C  CZ2 . TRP B 1 194 ? 11.575  73.859 104.140 1.00 22.00 ? 212  TRP D CZ2 1 
ATOM   4396  C  CZ3 . TRP B 1 194 ? 12.765  74.203 106.220 1.00 22.59 ? 212  TRP D CZ3 1 
ATOM   4397  C  CH2 . TRP B 1 194 ? 12.005  74.684 105.143 1.00 21.61 ? 212  TRP D CH2 1 
ATOM   4398  N  N   . LYS B 1 195 ? 10.754  68.262 106.382 1.00 19.17 ? 213  LYS D N   1 
ATOM   4399  C  CA  . LYS B 1 195 ? 9.816   67.235 105.924 1.00 19.47 ? 213  LYS D CA  1 
ATOM   4400  C  C   . LYS B 1 195 ? 10.401  66.638 104.651 1.00 19.66 ? 213  LYS D C   1 
ATOM   4401  O  O   . LYS B 1 195 ? 10.816  67.371 103.753 1.00 19.72 ? 213  LYS D O   1 
ATOM   4402  C  CB  . LYS B 1 195 ? 8.435   67.836 105.644 1.00 19.47 ? 213  LYS D CB  1 
ATOM   4403  C  CG  . LYS B 1 195 ? 7.888   68.759 106.737 1.00 19.57 ? 213  LYS D CG  1 
ATOM   4404  C  CD  . LYS B 1 195 ? 7.156   67.990 107.819 1.00 19.69 ? 213  LYS D CD  1 
ATOM   4405  C  CE  . LYS B 1 195 ? 6.700   68.906 108.944 1.00 19.41 ? 213  LYS D CE  1 
ATOM   4406  N  NZ  . LYS B 1 195 ? 5.459   69.654 108.627 1.00 18.14 ? 213  LYS D NZ  1 
ATOM   4407  N  N   . GLY B 1 196 ? 10.448  65.312 104.586 1.00 19.85 ? 214  GLY D N   1 
ATOM   4408  C  CA  . GLY B 1 196 ? 11.164  64.626 103.513 1.00 19.79 ? 214  GLY D CA  1 
ATOM   4409  C  C   . GLY B 1 196 ? 12.614  64.358 103.871 1.00 19.73 ? 214  GLY D C   1 
ATOM   4410  O  O   . GLY B 1 196 ? 13.403  63.911 103.025 1.00 19.78 ? 214  GLY D O   1 
ATOM   4411  N  N   . GLY B 1 197 ? 12.957  64.637 105.131 1.00 19.31 ? 215  GLY D N   1 
ATOM   4412  C  CA  . GLY B 1 197 ? 14.296  64.410 105.664 1.00 18.60 ? 215  GLY D CA  1 
ATOM   4413  C  C   . GLY B 1 197 ? 14.357  63.204 106.584 1.00 18.10 ? 215  GLY D C   1 
ATOM   4414  O  O   . GLY B 1 197 ? 13.527  62.299 106.493 1.00 17.88 ? 215  GLY D O   1 
ATOM   4415  N  N   . THR B 1 198 ? 15.342  63.200 107.476 1.00 17.51 ? 216  THR D N   1 
ATOM   4416  C  CA  . THR B 1 198 ? 15.631  62.039 108.318 1.00 17.19 ? 216  THR D CA  1 
ATOM   4417  C  C   . THR B 1 198 ? 15.569  62.379 109.812 1.00 17.00 ? 216  THR D C   1 
ATOM   4418  O  O   . THR B 1 198 ? 16.106  61.639 110.648 1.00 16.74 ? 216  THR D O   1 
ATOM   4419  C  CB  . THR B 1 198 ? 17.032  61.440 107.999 1.00 17.22 ? 216  THR D CB  1 
ATOM   4420  O  OG1 . THR B 1 198 ? 18.027  62.466 108.111 1.00 16.67 ? 216  THR D OG1 1 
ATOM   4421  C  CG2 . THR B 1 198 ? 17.072  60.852 106.602 1.00 17.56 ? 216  THR D CG2 1 
ATOM   4422  N  N   . GLY B 1 199 ? 14.901  63.484 110.135 1.00 16.70 ? 217  GLY D N   1 
ATOM   4423  C  CA  . GLY B 1 199 ? 14.858  64.013 111.499 1.00 16.85 ? 217  GLY D CA  1 
ATOM   4424  C  C   . GLY B 1 199 ? 14.137  63.147 112.516 1.00 16.91 ? 217  GLY D C   1 
ATOM   4425  O  O   . GLY B 1 199 ? 14.304  63.334 113.724 1.00 16.92 ? 217  GLY D O   1 
ATOM   4426  N  N   . ASP B 1 200 ? 13.341  62.201 112.027 1.00 16.75 ? 218  ASP D N   1 
ATOM   4427  C  CA  . ASP B 1 200 ? 12.640  61.254 112.885 1.00 17.01 ? 218  ASP D CA  1 
ATOM   4428  C  C   . ASP B 1 200 ? 13.395  59.935 113.034 1.00 16.80 ? 218  ASP D C   1 
ATOM   4429  O  O   . ASP B 1 200 ? 12.853  58.974 113.570 1.00 17.07 ? 218  ASP D O   1 
ATOM   4430  C  CB  . ASP B 1 200 ? 11.192  61.027 112.402 1.00 17.21 ? 218  ASP D CB  1 
ATOM   4431  C  CG  . ASP B 1 200 ? 11.107  60.596 110.940 1.00 18.19 ? 218  ASP D CG  1 
ATOM   4432  O  OD1 . ASP B 1 200 ? 12.153  60.521 110.259 1.00 18.67 ? 218  ASP D OD1 1 
ATOM   4433  O  OD2 . ASP B 1 200 ? 9.975   60.330 110.467 1.00 20.42 ? 218  ASP D OD2 1 
ATOM   4434  N  N   . CYS B 1 201 ? 14.641  59.900 112.559 1.00 16.57 ? 219  CYS D N   1 
ATOM   4435  C  CA  . CYS B 1 201 ? 15.543  58.764 112.776 1.00 16.84 ? 219  CYS D CA  1 
ATOM   4436  C  C   . CYS B 1 201 ? 16.787  59.206 113.522 1.00 15.88 ? 219  CYS D C   1 
ATOM   4437  O  O   . CYS B 1 201 ? 17.161  60.373 113.476 1.00 15.52 ? 219  CYS D O   1 
ATOM   4438  C  CB  . CYS B 1 201 ? 15.970  58.131 111.449 1.00 16.72 ? 219  CYS D CB  1 
ATOM   4439  S  SG  . CYS B 1 201 ? 14.607  57.529 110.488 1.00 21.10 ? 219  CYS D SG  1 
ATOM   4440  N  N   . LYS B 1 202 ? 17.429  58.269 114.212 1.00 15.56 ? 220  LYS D N   1 
ATOM   4441  C  CA  . LYS B 1 202 ? 18.700  58.559 114.868 1.00 15.11 ? 220  LYS D CA  1 
ATOM   4442  C  C   . LYS B 1 202 ? 19.899  58.246 113.978 1.00 15.06 ? 220  LYS D C   1 
ATOM   4443  O  O   . LYS B 1 202 ? 20.865  57.619 114.414 1.00 15.25 ? 220  LYS D O   1 
ATOM   4444  C  CB  . LYS B 1 202 ? 18.806  57.811 116.186 1.00 15.32 ? 220  LYS D CB  1 
ATOM   4445  C  CG  . LYS B 1 202 ? 18.622  58.684 117.389 1.00 14.68 ? 220  LYS D CG  1 
ATOM   4446  C  CD  . LYS B 1 202 ? 18.300  57.833 118.584 1.00 14.69 ? 220  LYS D CD  1 
ATOM   4447  C  CE  . LYS B 1 202 ? 19.036  58.324 119.792 1.00 16.47 ? 220  LYS D CE  1 
ATOM   4448  N  NZ  . LYS B 1 202 ? 18.751  59.762 119.978 1.00 15.27 ? 220  LYS D NZ  1 
ATOM   4449  N  N   . MET B 1 203 ? 19.822  58.696 112.729 1.00 14.89 ? 221  MET D N   1 
ATOM   4450  C  CA  . MET B 1 203 ? 20.927  58.601 111.782 1.00 14.51 ? 221  MET D CA  1 
ATOM   4451  C  C   . MET B 1 203 ? 21.919  59.710 112.086 1.00 14.37 ? 221  MET D C   1 
ATOM   4452  O  O   . MET B 1 203 ? 21.519  60.847 112.350 1.00 14.35 ? 221  MET D O   1 
ATOM   4453  C  CB  . MET B 1 203 ? 20.407  58.731 110.355 1.00 14.45 ? 221  MET D CB  1 
ATOM   4454  C  CG  . MET B 1 203 ? 19.650  57.506 109.852 1.00 14.71 ? 221  MET D CG  1 
ATOM   4455  S  SD  . MET B 1 203 ? 18.765  57.788 108.294 1.00 16.94 ? 221  MET D SD  1 
ATOM   4456  C  CE  . MET B 1 203 ? 20.102  58.233 107.179 1.00 13.46 ? 221  MET D CE  1 
ATOM   4457  N  N   . GLY B 1 204 ? 23.209  59.379 112.054 1.00 14.15 ? 222  GLY D N   1 
ATOM   4458  C  CA  . GLY B 1 204 ? 24.271  60.316 112.458 1.00 14.01 ? 222  GLY D CA  1 
ATOM   4459  C  C   . GLY B 1 204 ? 24.309  61.652 111.737 1.00 13.69 ? 222  GLY D C   1 
ATOM   4460  O  O   . GLY B 1 204 ? 24.700  62.666 112.318 1.00 13.71 ? 222  GLY D O   1 
ATOM   4461  N  N   . GLY B 1 205 ? 23.895  61.648 110.474 1.00 13.77 ? 223  GLY D N   1 
ATOM   4462  C  CA  . GLY B 1 205 ? 23.820  62.854 109.658 1.00 14.36 ? 223  GLY D CA  1 
ATOM   4463  C  C   . GLY B 1 205 ? 23.011  63.997 110.243 1.00 14.78 ? 223  GLY D C   1 
ATOM   4464  O  O   . GLY B 1 205 ? 23.266  65.155 109.915 1.00 15.12 ? 223  GLY D O   1 
ATOM   4465  N  N   . ASN B 1 206 ? 22.043  63.673 111.104 1.00 15.06 ? 224  ASN D N   1 
ATOM   4466  C  CA  . ASN B 1 206 ? 21.190  64.668 111.775 1.00 15.55 ? 224  ASN D CA  1 
ATOM   4467  C  C   . ASN B 1 206 ? 21.934  65.536 112.775 1.00 15.82 ? 224  ASN D C   1 
ATOM   4468  O  O   . ASN B 1 206 ? 21.453  66.612 113.153 1.00 15.66 ? 224  ASN D O   1 
ATOM   4469  C  CB  . ASN B 1 206 ? 20.045  63.980 112.530 1.00 15.58 ? 224  ASN D CB  1 
ATOM   4470  C  CG  . ASN B 1 206 ? 19.085  63.255 111.617 1.00 15.15 ? 224  ASN D CG  1 
ATOM   4471  O  OD1 . ASN B 1 206 ? 18.649  62.150 111.917 1.00 14.99 ? 224  ASN D OD1 1 
ATOM   4472  N  ND2 . ASN B 1 206 ? 18.753  63.870 110.501 1.00 15.54 ? 224  ASN D ND2 1 
ATOM   4473  N  N   . TYR B 1 207 ? 23.104  65.058 113.196 1.00 16.12 ? 225  TYR D N   1 
ATOM   4474  C  CA  . TYR B 1 207 ? 23.796  65.600 114.364 1.00 16.51 ? 225  TYR D CA  1 
ATOM   4475  C  C   . TYR B 1 207 ? 25.056  66.390 114.025 1.00 17.40 ? 225  TYR D C   1 
ATOM   4476  O  O   . TYR B 1 207 ? 25.374  67.361 114.721 1.00 17.70 ? 225  TYR D O   1 
ATOM   4477  C  CB  . TYR B 1 207 ? 24.053  64.471 115.380 1.00 16.18 ? 225  TYR D CB  1 
ATOM   4478  C  CG  . TYR B 1 207 ? 22.749  63.798 115.753 1.00 15.29 ? 225  TYR D CG  1 
ATOM   4479  C  CD1 . TYR B 1 207 ? 22.322  62.642 115.097 1.00 14.98 ? 225  TYR D CD1 1 
ATOM   4480  C  CD2 . TYR B 1 207 ? 21.901  64.366 116.703 1.00 15.43 ? 225  TYR D CD2 1 
ATOM   4481  C  CE1 . TYR B 1 207 ? 21.097  62.051 115.403 1.00 14.57 ? 225  TYR D CE1 1 
ATOM   4482  C  CE2 . TYR B 1 207 ? 20.674  63.777 117.026 1.00 14.74 ? 225  TYR D CE2 1 
ATOM   4483  C  CZ  . TYR B 1 207 ? 20.277  62.630 116.366 1.00 15.53 ? 225  TYR D CZ  1 
ATOM   4484  O  OH  . TYR B 1 207 ? 19.066  62.054 116.675 1.00 15.18 ? 225  TYR D OH  1 
ATOM   4485  N  N   . GLY B 1 208 ? 25.745  66.002 112.949 1.00 18.00 ? 226  GLY D N   1 
ATOM   4486  C  CA  . GLY B 1 208 ? 26.955  66.692 112.506 1.00 19.24 ? 226  GLY D CA  1 
ATOM   4487  C  C   . GLY B 1 208 ? 26.679  68.141 112.178 1.00 20.30 ? 226  GLY D C   1 
ATOM   4488  O  O   . GLY B 1 208 ? 27.477  69.023 112.494 1.00 20.06 ? 226  GLY D O   1 
ATOM   4489  N  N   . SER B 1 209 ? 25.522  68.367 111.561 1.00 21.50 ? 227  SER D N   1 
ATOM   4490  C  CA  . SER B 1 209 ? 25.046  69.684 111.151 1.00 22.86 ? 227  SER D CA  1 
ATOM   4491  C  C   . SER B 1 209 ? 24.593  70.575 112.310 1.00 23.56 ? 227  SER D C   1 
ATOM   4492  O  O   . SER B 1 209 ? 24.135  71.692 112.081 1.00 23.87 ? 227  SER D O   1 
ATOM   4493  C  CB  . SER B 1 209 ? 23.890  69.516 110.156 1.00 23.22 ? 227  SER D CB  1 
ATOM   4494  O  OG  . SER B 1 209 ? 23.103  68.365 110.472 1.00 23.74 ? 227  SER D OG  1 
ATOM   4495  N  N   . SER B 1 210 ? 24.731  70.092 113.545 1.00 24.13 ? 228  SER D N   1 
ATOM   4496  C  CA  . SER B 1 210 ? 24.193  70.802 114.705 1.00 24.77 ? 228  SER D CA  1 
ATOM   4497  C  C   . SER B 1 210 ? 25.273  71.407 115.614 1.00 25.08 ? 228  SER D C   1 
ATOM   4498  O  O   . SER B 1 210 ? 24.983  72.297 116.424 1.00 25.41 ? 228  SER D O   1 
ATOM   4499  C  CB  . SER B 1 210 ? 23.206  69.903 115.487 1.00 24.86 ? 228  SER D CB  1 
ATOM   4500  O  OG  . SER B 1 210 ? 23.854  69.003 116.367 1.00 24.98 ? 228  SER D OG  1 
ATOM   4501  N  N   . LEU B 1 211 ? 26.514  70.947 115.439 1.00 25.09 ? 229  LEU D N   1 
ATOM   4502  C  CA  . LEU B 1 211 ? 27.660  71.361 116.255 1.00 25.14 ? 229  LEU D CA  1 
ATOM   4503  C  C   . LEU B 1 211 ? 28.040  72.835 116.144 1.00 25.07 ? 229  LEU D C   1 
ATOM   4504  O  O   . LEU B 1 211 ? 28.496  73.437 117.125 1.00 25.14 ? 229  LEU D O   1 
ATOM   4505  C  CB  . LEU B 1 211 ? 28.879  70.498 115.927 1.00 25.30 ? 229  LEU D CB  1 
ATOM   4506  C  CG  . LEU B 1 211 ? 29.179  69.251 116.757 1.00 25.68 ? 229  LEU D CG  1 
ATOM   4507  C  CD1 . LEU B 1 211 ? 28.004  68.302 116.819 1.00 26.89 ? 229  LEU D CD1 1 
ATOM   4508  C  CD2 . LEU B 1 211 ? 30.389  68.546 116.185 1.00 25.06 ? 229  LEU D CD2 1 
ATOM   4509  N  N   . PHE B 1 212 ? 27.872  73.407 114.955 1.00 25.10 ? 230  PHE D N   1 
ATOM   4510  C  CA  . PHE B 1 212 ? 28.150  74.829 114.732 1.00 24.84 ? 230  PHE D CA  1 
ATOM   4511  C  C   . PHE B 1 212 ? 27.170  75.673 115.535 1.00 24.68 ? 230  PHE D C   1 
ATOM   4512  O  O   . PHE B 1 212 ? 27.577  76.590 116.242 1.00 24.77 ? 230  PHE D O   1 
ATOM   4513  C  CB  . PHE B 1 212 ? 28.080  75.179 113.239 1.00 24.82 ? 230  PHE D CB  1 
ATOM   4514  C  CG  . PHE B 1 212 ? 28.484  76.600 112.919 1.00 25.50 ? 230  PHE D CG  1 
ATOM   4515  C  CD1 . PHE B 1 212 ? 27.537  77.629 112.922 1.00 25.39 ? 230  PHE D CD1 1 
ATOM   4516  C  CD2 . PHE B 1 212 ? 29.808  76.907 112.603 1.00 25.57 ? 230  PHE D CD2 1 
ATOM   4517  C  CE1 . PHE B 1 212 ? 27.901  78.944 112.623 1.00 25.69 ? 230  PHE D CE1 1 
ATOM   4518  C  CE2 . PHE B 1 212 ? 30.189  78.219 112.302 1.00 26.29 ? 230  PHE D CE2 1 
ATOM   4519  C  CZ  . PHE B 1 212 ? 29.232  79.240 112.309 1.00 26.71 ? 230  PHE D CZ  1 
ATOM   4520  N  N   . ALA B 1 213 ? 25.882  75.344 115.433 1.00 24.60 ? 231  ALA D N   1 
ATOM   4521  C  CA  . ALA B 1 213 ? 24.837  76.016 116.210 1.00 24.53 ? 231  ALA D CA  1 
ATOM   4522  C  C   . ALA B 1 213 ? 25.056  75.906 117.726 1.00 24.41 ? 231  ALA D C   1 
ATOM   4523  O  O   . ALA B 1 213 ? 24.794  76.859 118.461 1.00 24.28 ? 231  ALA D O   1 
ATOM   4524  C  CB  . ALA B 1 213 ? 23.461  75.488 115.822 1.00 24.54 ? 231  ALA D CB  1 
ATOM   4525  N  N   . GLN B 1 214 ? 25.541  74.752 118.184 1.00 24.36 ? 232  GLN D N   1 
ATOM   4526  C  CA  . GLN B 1 214 ? 25.808  74.540 119.606 1.00 24.64 ? 232  GLN D CA  1 
ATOM   4527  C  C   . GLN B 1 214 ? 27.010  75.332 120.112 1.00 24.91 ? 232  GLN D C   1 
ATOM   4528  O  O   . GLN B 1 214 ? 26.983  75.834 121.239 1.00 24.87 ? 232  GLN D O   1 
ATOM   4529  C  CB  . GLN B 1 214 ? 25.957  73.048 119.929 1.00 24.61 ? 232  GLN D CB  1 
ATOM   4530  C  CG  . GLN B 1 214 ? 26.478  72.728 121.341 1.00 24.55 ? 232  GLN D CG  1 
ATOM   4531  C  CD  . GLN B 1 214 ? 25.534  73.133 122.479 1.00 24.71 ? 232  GLN D CD  1 
ATOM   4532  O  OE1 . GLN B 1 214 ? 24.401  73.573 122.257 1.00 23.98 ? 232  GLN D OE1 1 
ATOM   4533  N  NE2 . GLN B 1 214 ? 26.009  72.976 123.709 1.00 23.29 ? 232  GLN D NE2 1 
ATOM   4534  N  N   . CYS B 1 215 ? 28.054  75.435 119.285 1.00 25.12 ? 233  CYS D N   1 
ATOM   4535  C  CA  . CYS B 1 215 ? 29.208  76.285 119.585 1.00 25.32 ? 233  CYS D CA  1 
ATOM   4536  C  C   . CYS B 1 215 ? 28.794  77.752 119.683 1.00 25.30 ? 233  CYS D C   1 
ATOM   4537  O  O   . CYS B 1 215 ? 29.213  78.453 120.607 1.00 25.24 ? 233  CYS D O   1 
ATOM   4538  C  CB  . CYS B 1 215 ? 30.305  76.123 118.532 1.00 25.47 ? 233  CYS D CB  1 
ATOM   4539  S  SG  . CYS B 1 215 ? 31.248  74.592 118.661 1.00 26.74 ? 233  CYS D SG  1 
ATOM   4540  N  N   . GLU B 1 216 ? 27.977  78.201 118.728 1.00 25.17 ? 234  GLU D N   1 
ATOM   4541  C  CA  . GLU B 1 216 ? 27.422  79.550 118.724 1.00 25.44 ? 234  GLU D CA  1 
ATOM   4542  C  C   . GLU B 1 216 ? 26.598  79.804 119.988 1.00 25.93 ? 234  GLU D C   1 
ATOM   4543  O  O   . GLU B 1 216 ? 26.692  80.858 120.616 1.00 25.62 ? 234  GLU D O   1 
ATOM   4544  C  CB  . GLU B 1 216 ? 26.551  79.756 117.489 1.00 25.18 ? 234  GLU D CB  1 
ATOM   4545  C  CG  . GLU B 1 216 ? 26.022  81.169 117.341 1.00 25.62 ? 234  GLU D CG  1 
ATOM   4546  C  CD  . GLU B 1 216 ? 25.368  81.410 116.004 1.00 26.91 ? 234  GLU D CD  1 
ATOM   4547  O  OE1 . GLU B 1 216 ? 24.124  81.491 115.956 1.00 26.60 ? 234  GLU D OE1 1 
ATOM   4548  O  OE2 . GLU B 1 216 ? 26.099  81.518 114.994 1.00 29.32 ? 234  GLU D OE2 1 
ATOM   4549  N  N   . ASP B 1 217 ? 25.780  78.816 120.329 1.00 26.67 ? 235  ASP D N   1 
ATOM   4550  C  CA  . ASP B 1 217 ? 25.027  78.781 121.562 1.00 27.47 ? 235  ASP D CA  1 
ATOM   4551  C  C   . ASP B 1 217 ? 25.921  79.033 122.789 1.00 27.33 ? 235  ASP D C   1 
ATOM   4552  O  O   . ASP B 1 217 ? 25.653  79.954 123.569 1.00 27.06 ? 235  ASP D O   1 
ATOM   4553  C  CB  . ASP B 1 217 ? 24.263  77.454 121.616 1.00 28.26 ? 235  ASP D CB  1 
ATOM   4554  C  CG  . ASP B 1 217 ? 24.193  76.873 122.984 1.00 31.05 ? 235  ASP D CG  1 
ATOM   4555  O  OD1 . ASP B 1 217 ? 25.158  76.191 123.402 1.00 35.12 ? 235  ASP D OD1 1 
ATOM   4556  O  OD2 . ASP B 1 217 ? 23.157  77.075 123.638 1.00 35.85 ? 235  ASP D OD2 1 
ATOM   4557  N  N   . VAL B 1 218 ? 26.992  78.252 122.926 1.00 27.11 ? 236  VAL D N   1 
ATOM   4558  C  CA  . VAL B 1 218 ? 27.947  78.409 124.031 1.00 27.65 ? 236  VAL D CA  1 
ATOM   4559  C  C   . VAL B 1 218 ? 28.618  79.797 124.034 1.00 27.91 ? 236  VAL D C   1 
ATOM   4560  O  O   . VAL B 1 218 ? 28.749  80.424 125.091 1.00 27.80 ? 236  VAL D O   1 
ATOM   4561  C  CB  . VAL B 1 218 ? 29.012  77.275 124.040 1.00 27.64 ? 236  VAL D CB  1 
ATOM   4562  C  CG1 . VAL B 1 218 ? 30.100  77.545 125.078 1.00 28.45 ? 236  VAL D CG1 1 
ATOM   4563  C  CG2 . VAL B 1 218 ? 28.359  75.933 124.317 1.00 27.62 ? 236  VAL D CG2 1 
ATOM   4564  N  N   . ASP B 1 219 ? 29.007  80.272 122.849 1.00 28.14 ? 237  ASP D N   1 
ATOM   4565  C  CA  . ASP B 1 219 ? 29.585  81.606 122.673 1.00 28.44 ? 237  ASP D CA  1 
ATOM   4566  C  C   . ASP B 1 219 ? 28.713  82.691 123.296 1.00 28.35 ? 237  ASP D C   1 
ATOM   4567  O  O   . ASP B 1 219 ? 29.201  83.771 123.635 1.00 28.71 ? 237  ASP D O   1 
ATOM   4568  C  CB  . ASP B 1 219 ? 29.797  81.921 121.181 1.00 28.59 ? 237  ASP D CB  1 
ATOM   4569  C  CG  . ASP B 1 219 ? 31.002  81.193 120.575 1.00 29.32 ? 237  ASP D CG  1 
ATOM   4570  O  OD1 . ASP B 1 219 ? 31.178  81.294 119.341 1.00 30.77 ? 237  ASP D OD1 1 
ATOM   4571  O  OD2 . ASP B 1 219 ? 31.769  80.527 121.307 1.00 29.59 ? 237  ASP D OD2 1 
ATOM   4572  N  N   . ASN B 1 220 ? 27.425  82.396 123.449 1.00 28.00 ? 238  ASN D N   1 
ATOM   4573  C  CA  . ASN B 1 220 ? 26.463  83.365 123.974 1.00 27.63 ? 238  ASN D CA  1 
ATOM   4574  C  C   . ASN B 1 220 ? 25.886  82.993 125.342 1.00 27.02 ? 238  ASN D C   1 
ATOM   4575  O  O   . ASN B 1 220 ? 24.790  83.421 125.696 1.00 27.18 ? 238  ASN D O   1 
ATOM   4576  C  CB  . ASN B 1 220 ? 25.344  83.582 122.959 1.00 27.93 ? 238  ASN D CB  1 
ATOM   4577  C  CG  . ASN B 1 220 ? 25.823  84.288 121.716 1.00 29.01 ? 238  ASN D CG  1 
ATOM   4578  O  OD1 . ASN B 1 220 ? 25.886  85.515 121.675 1.00 30.32 ? 238  ASN D OD1 1 
ATOM   4579  N  ND2 . ASN B 1 220 ? 26.157  83.519 120.686 1.00 29.95 ? 238  ASN D ND2 1 
ATOM   4580  N  N   . GLY B 1 221 ? 26.625  82.187 126.098 1.00 26.47 ? 239  GLY D N   1 
ATOM   4581  C  CA  . GLY B 1 221 ? 26.244  81.830 127.464 1.00 25.90 ? 239  GLY D CA  1 
ATOM   4582  C  C   . GLY B 1 221 ? 25.048  80.903 127.579 1.00 25.38 ? 239  GLY D C   1 
ATOM   4583  O  O   . GLY B 1 221 ? 24.418  80.822 128.638 1.00 25.69 ? 239  GLY D O   1 
ATOM   4584  N  N   . CYS B 1 222 ? 24.730  80.213 126.488 1.00 24.59 ? 240  CYS D N   1 
ATOM   4585  C  CA  . CYS B 1 222 ? 23.634  79.249 126.465 1.00 23.62 ? 240  CYS D CA  1 
ATOM   4586  C  C   . CYS B 1 222 ? 24.180  77.832 126.437 1.00 23.03 ? 240  CYS D C   1 
ATOM   4587  O  O   . CYS B 1 222 ? 25.295  77.595 125.967 1.00 22.99 ? 240  CYS D O   1 
ATOM   4588  C  CB  . CYS B 1 222 ? 22.732  79.486 125.255 1.00 23.69 ? 240  CYS D CB  1 
ATOM   4589  S  SG  . CYS B 1 222 ? 21.842  81.025 125.295 1.00 23.74 ? 240  CYS D SG  1 
ATOM   4590  N  N   . GLN B 1 223 ? 23.380  76.890 126.928 1.00 22.25 ? 241  GLN D N   1 
ATOM   4591  C  CA  . GLN B 1 223 ? 23.817  75.508 127.087 1.00 21.57 ? 241  GLN D CA  1 
ATOM   4592  C  C   . GLN B 1 223 ? 23.313  74.589 125.978 1.00 21.05 ? 241  GLN D C   1 
ATOM   4593  O  O   . GLN B 1 223 ? 23.978  73.612 125.634 1.00 21.06 ? 241  GLN D O   1 
ATOM   4594  C  CB  . GLN B 1 223 ? 23.421  74.973 128.470 1.00 21.93 ? 241  GLN D CB  1 
ATOM   4595  C  CG  . GLN B 1 223 ? 24.163  75.642 129.644 1.00 21.59 ? 241  GLN D CG  1 
ATOM   4596  C  CD  . GLN B 1 223 ? 23.746  77.089 129.871 1.00 21.15 ? 241  GLN D CD  1 
ATOM   4597  O  OE1 . GLN B 1 223 ? 22.576  77.375 130.093 1.00 21.70 ? 241  GLN D OE1 1 
ATOM   4598  N  NE2 . GLN B 1 223 ? 24.707  78.006 129.817 1.00 20.99 ? 241  GLN D NE2 1 
ATOM   4599  N  N   . GLN B 1 224 ? 22.140  74.901 125.429 1.00 20.46 ? 242  GLN D N   1 
ATOM   4600  C  CA  . GLN B 1 224 ? 21.565  74.141 124.315 1.00 19.61 ? 242  GLN D CA  1 
ATOM   4601  C  C   . GLN B 1 224 ? 20.936  75.062 123.267 1.00 18.71 ? 242  GLN D C   1 
ATOM   4602  O  O   . GLN B 1 224 ? 20.750  76.258 123.494 1.00 18.51 ? 242  GLN D O   1 
ATOM   4603  C  CB  . GLN B 1 224 ? 20.530  73.114 124.815 1.00 19.88 ? 242  GLN D CB  1 
ATOM   4604  C  CG  . GLN B 1 224 ? 21.098  71.886 125.516 1.00 20.56 ? 242  GLN D CG  1 
ATOM   4605  C  CD  . GLN B 1 224 ? 21.854  70.947 124.584 1.00 22.63 ? 242  GLN D CD  1 
ATOM   4606  O  OE1 . GLN B 1 224 ? 21.272  70.047 123.971 1.00 23.69 ? 242  GLN D OE1 1 
ATOM   4607  N  NE2 . GLN B 1 224 ? 23.166  71.132 124.503 1.00 23.34 ? 242  GLN D NE2 1 
ATOM   4608  N  N   . VAL B 1 225 ? 20.620  74.485 122.115 1.00 17.93 ? 243  VAL D N   1 
ATOM   4609  C  CA  . VAL B 1 225 ? 20.023  75.200 121.000 1.00 17.18 ? 243  VAL D CA  1 
ATOM   4610  C  C   . VAL B 1 225 ? 18.544  74.869 120.988 1.00 17.02 ? 243  VAL D C   1 
ATOM   4611  O  O   . VAL B 1 225 ? 18.169  73.709 121.170 1.00 17.22 ? 243  VAL D O   1 
ATOM   4612  C  CB  . VAL B 1 225 ? 20.648  74.739 119.663 1.00 17.26 ? 243  VAL D CB  1 
ATOM   4613  C  CG1 . VAL B 1 225 ? 19.915  75.329 118.467 1.00 17.39 ? 243  VAL D CG1 1 
ATOM   4614  C  CG2 . VAL B 1 225 ? 22.141  75.078 119.614 1.00 17.14 ? 243  VAL D CG2 1 
ATOM   4615  N  N   . LEU B 1 226 ? 17.711  75.889 120.792 1.00 16.55 ? 244  LEU D N   1 
ATOM   4616  C  CA  . LEU B 1 226 ? 16.295  75.685 120.537 1.00 16.33 ? 244  LEU D CA  1 
ATOM   4617  C  C   . LEU B 1 226 ? 16.059  75.661 119.022 1.00 16.04 ? 244  LEU D C   1 
ATOM   4618  O  O   . LEU B 1 226 ? 16.240  76.671 118.329 1.00 15.77 ? 244  LEU D O   1 
ATOM   4619  C  CB  . LEU B 1 226 ? 15.436  76.764 121.224 1.00 16.36 ? 244  LEU D CB  1 
ATOM   4620  C  CG  . LEU B 1 226 ? 13.916  76.652 121.029 1.00 16.43 ? 244  LEU D CG  1 
ATOM   4621  C  CD1 . LEU B 1 226 ? 13.415  75.276 121.440 1.00 14.99 ? 244  LEU D CD1 1 
ATOM   4622  C  CD2 . LEU B 1 226 ? 13.170  77.735 121.793 1.00 16.41 ? 244  LEU D CD2 1 
ATOM   4623  N  N   . TRP B 1 227 ? 15.663  74.499 118.515 1.00 15.72 ? 245  TRP D N   1 
ATOM   4624  C  CA  . TRP B 1 227 ? 15.497  74.322 117.080 1.00 15.48 ? 245  TRP D CA  1 
ATOM   4625  C  C   . TRP B 1 227 ? 14.152  74.849 116.607 1.00 15.51 ? 245  TRP D C   1 
ATOM   4626  O  O   . TRP B 1 227 ? 13.100  74.367 117.032 1.00 15.73 ? 245  TRP D O   1 
ATOM   4627  C  CB  . TRP B 1 227 ? 15.700  72.867 116.673 1.00 15.13 ? 245  TRP D CB  1 
ATOM   4628  C  CG  . TRP B 1 227 ? 17.081  72.380 116.942 1.00 14.89 ? 245  TRP D CG  1 
ATOM   4629  C  CD1 . TRP B 1 227 ? 17.480  71.586 117.977 1.00 15.42 ? 245  TRP D CD1 1 
ATOM   4630  C  CD2 . TRP B 1 227 ? 18.259  72.667 116.179 1.00 14.92 ? 245  TRP D CD2 1 
ATOM   4631  N  NE1 . TRP B 1 227 ? 18.831  71.347 117.899 1.00 15.55 ? 245  TRP D NE1 1 
ATOM   4632  C  CE2 . TRP B 1 227 ? 19.335  72.003 116.807 1.00 15.21 ? 245  TRP D CE2 1 
ATOM   4633  C  CE3 . TRP B 1 227 ? 18.508  73.411 115.016 1.00 14.38 ? 245  TRP D CE3 1 
ATOM   4634  C  CZ2 . TRP B 1 227 ? 20.644  72.059 116.314 1.00 15.83 ? 245  TRP D CZ2 1 
ATOM   4635  C  CZ3 . TRP B 1 227 ? 19.808  73.469 114.526 1.00 14.93 ? 245  TRP D CZ3 1 
ATOM   4636  C  CH2 . TRP B 1 227 ? 20.860  72.799 115.178 1.00 15.48 ? 245  TRP D CH2 1 
ATOM   4637  N  N   . LEU B 1 228 ? 14.204  75.848 115.730 1.00 15.42 ? 246  LEU D N   1 
ATOM   4638  C  CA  . LEU B 1 228 ? 12.998  76.471 115.176 1.00 15.28 ? 246  LEU D CA  1 
ATOM   4639  C  C   . LEU B 1 228 ? 12.742  76.010 113.751 1.00 15.58 ? 246  LEU D C   1 
ATOM   4640  O  O   . LEU B 1 228 ? 13.678  75.767 112.982 1.00 15.61 ? 246  LEU D O   1 
ATOM   4641  C  CB  . LEU B 1 228 ? 13.114  78.000 115.205 1.00 14.66 ? 246  LEU D CB  1 
ATOM   4642  C  CG  . LEU B 1 228 ? 13.404  78.704 116.536 1.00 14.36 ? 246  LEU D CG  1 
ATOM   4643  C  CD1 . LEU B 1 228 ? 13.519  80.219 116.316 1.00 13.22 ? 246  LEU D CD1 1 
ATOM   4644  C  CD2 . LEU B 1 228 ? 12.353  78.388 117.579 1.00 10.81 ? 246  LEU D CD2 1 
ATOM   4645  N  N   . TYR B 1 229 ? 11.467  75.913 113.399 1.00 16.06 ? 247  TYR D N   1 
ATOM   4646  C  CA  . TYR B 1 229 ? 11.077  75.438 112.087 1.00 16.83 ? 247  TYR D CA  1 
ATOM   4647  C  C   . TYR B 1 229 ? 9.955   76.273 111.446 1.00 17.53 ? 247  TYR D C   1 
ATOM   4648  O  O   . TYR B 1 229 ? 8.953   76.611 112.093 1.00 16.78 ? 247  TYR D O   1 
ATOM   4649  C  CB  . TYR B 1 229 ? 10.666  73.961 112.157 1.00 16.92 ? 247  TYR D CB  1 
ATOM   4650  C  CG  . TYR B 1 229 ? 10.004  73.485 110.894 1.00 16.83 ? 247  TYR D CG  1 
ATOM   4651  C  CD1 . TYR B 1 229 ? 10.761  73.016 109.819 1.00 17.28 ? 247  TYR D CD1 1 
ATOM   4652  C  CD2 . TYR B 1 229 ? 8.621   73.531 110.762 1.00 16.75 ? 247  TYR D CD2 1 
ATOM   4653  C  CE1 . TYR B 1 229 ? 10.140  72.597 108.638 1.00 17.65 ? 247  TYR D CE1 1 
ATOM   4654  C  CE2 . TYR B 1 229 ? 8.003   73.122 109.604 1.00 17.67 ? 247  TYR D CE2 1 
ATOM   4655  C  CZ  . TYR B 1 229 ? 8.761   72.665 108.547 1.00 16.87 ? 247  TYR D CZ  1 
ATOM   4656  O  OH  . TYR B 1 229 ? 8.113   72.262 107.405 1.00 19.46 ? 247  TYR D OH  1 
ATOM   4657  N  N   . GLY B 1 230 ? 10.138  76.583 110.164 1.00 18.24 ? 248  GLY D N   1 
ATOM   4658  C  CA  . GLY B 1 230 ? 9.085   77.171 109.355 1.00 19.39 ? 248  GLY D CA  1 
ATOM   4659  C  C   . GLY B 1 230 ? 8.938   78.669 109.502 1.00 20.46 ? 248  GLY D C   1 
ATOM   4660  O  O   . GLY B 1 230 ? 9.610   79.304 110.330 1.00 19.84 ? 248  GLY D O   1 
ATOM   4661  N  N   . ARG B 1 231 ? 8.037   79.214 108.685 1.00 21.51 ? 249  ARG D N   1 
ATOM   4662  C  CA  . ARG B 1 231 ? 7.725   80.641 108.641 1.00 22.93 ? 249  ARG D CA  1 
ATOM   4663  C  C   . ARG B 1 231 ? 7.125   81.159 109.949 1.00 22.81 ? 249  ARG D C   1 
ATOM   4664  O  O   . ARG B 1 231 ? 7.292   82.337 110.289 1.00 22.99 ? 249  ARG D O   1 
ATOM   4665  C  CB  . ARG B 1 231 ? 6.774   80.933 107.470 1.00 23.44 ? 249  ARG D CB  1 
ATOM   4666  C  CG  . ARG B 1 231 ? 7.424   80.805 106.092 1.00 27.33 ? 249  ARG D CG  1 
ATOM   4667  C  CD  . ARG B 1 231 ? 6.458   81.174 104.947 1.00 33.15 ? 249  ARG D CD  1 
ATOM   4668  N  NE  . ARG B 1 231 ? 7.180   81.679 103.776 1.00 37.33 ? 249  ARG D NE  1 
ATOM   4669  C  CZ  . ARG B 1 231 ? 6.630   81.941 102.587 1.00 40.30 ? 249  ARG D CZ  1 
ATOM   4670  N  NH1 . ARG B 1 231 ? 7.391   82.401 101.596 1.00 40.92 ? 249  ARG D NH1 1 
ATOM   4671  N  NH2 . ARG B 1 231 ? 5.328   81.744 102.376 1.00 40.81 ? 249  ARG D NH2 1 
ATOM   4672  N  N   . ASP B 1 232 ? 6.434   80.278 110.673 1.00 22.82 ? 250  ASP D N   1 
ATOM   4673  C  CA  . ASP B 1 232 ? 5.807   80.629 111.956 1.00 22.88 ? 250  ASP D CA  1 
ATOM   4674  C  C   . ASP B 1 232 ? 6.731   80.432 113.164 1.00 21.81 ? 250  ASP D C   1 
ATOM   4675  O  O   . ASP B 1 232 ? 6.322   80.673 114.299 1.00 21.39 ? 250  ASP D O   1 
ATOM   4676  C  CB  . ASP B 1 232 ? 4.516   79.827 112.155 1.00 23.75 ? 250  ASP D CB  1 
ATOM   4677  C  CG  . ASP B 1 232 ? 3.431   80.213 111.168 1.00 27.08 ? 250  ASP D CG  1 
ATOM   4678  O  OD1 . ASP B 1 232 ? 3.385   81.400 110.764 1.00 30.48 ? 250  ASP D OD1 1 
ATOM   4679  O  OD2 . ASP B 1 232 ? 2.615   79.331 110.797 1.00 31.00 ? 250  ASP D OD2 1 
ATOM   4680  N  N   . HIS B 1 233 ? 7.963   79.987 112.905 1.00 20.70 ? 251  HIS D N   1 
ATOM   4681  C  CA  . HIS B 1 233 ? 8.972   79.701 113.943 1.00 20.02 ? 251  HIS D CA  1 
ATOM   4682  C  C   . HIS B 1 233 ? 8.494   78.706 115.004 1.00 19.36 ? 251  HIS D C   1 
ATOM   4683  O  O   . HIS B 1 233 ? 8.470   79.005 116.205 1.00 18.96 ? 251  HIS D O   1 
ATOM   4684  C  CB  . HIS B 1 233 ? 9.492   80.989 114.591 1.00 19.90 ? 251  HIS D CB  1 
ATOM   4685  C  CG  . HIS B 1 233 ? 9.960   82.011 113.603 1.00 20.35 ? 251  HIS D CG  1 
ATOM   4686  N  ND1 . HIS B 1 233 ? 10.995  81.777 112.723 1.00 20.71 ? 251  HIS D ND1 1 
ATOM   4687  C  CD2 . HIS B 1 233 ? 9.543   83.278 113.365 1.00 20.00 ? 251  HIS D CD2 1 
ATOM   4688  C  CE1 . HIS B 1 233 ? 11.192  82.854 111.983 1.00 20.57 ? 251  HIS D CE1 1 
ATOM   4689  N  NE2 . HIS B 1 233 ? 10.326  83.779 112.354 1.00 20.55 ? 251  HIS D NE2 1 
ATOM   4690  N  N   . GLN B 1 234 ? 8.112   77.521 114.540 1.00 18.53 ? 252  GLN D N   1 
ATOM   4691  C  CA  . GLN B 1 234 ? 7.711   76.440 115.427 1.00 17.79 ? 252  GLN D CA  1 
ATOM   4692  C  C   . GLN B 1 234 ? 8.882   76.018 116.300 1.00 17.21 ? 252  GLN D C   1 
ATOM   4693  O  O   . GLN B 1 234 ? 10.005  75.891 115.823 1.00 17.18 ? 252  GLN D O   1 
ATOM   4694  C  CB  . GLN B 1 234 ? 7.194   75.248 114.624 1.00 17.85 ? 252  GLN D CB  1 
ATOM   4695  C  CG  . GLN B 1 234 ? 5.835   75.491 113.994 1.00 18.23 ? 252  GLN D CG  1 
ATOM   4696  C  CD  . GLN B 1 234 ? 5.370   74.346 113.126 1.00 19.75 ? 252  GLN D CD  1 
ATOM   4697  O  OE1 . GLN B 1 234 ? 6.061   73.337 112.967 1.00 18.07 ? 252  GLN D OE1 1 
ATOM   4698  N  NE2 . GLN B 1 234 ? 4.176   74.495 112.562 1.00 22.22 ? 252  GLN D NE2 1 
ATOM   4699  N  N   . ILE B 1 235 ? 8.618   75.845 117.587 1.00 16.38 ? 253  ILE D N   1 
ATOM   4700  C  CA  . ILE B 1 235 ? 9.618   75.312 118.495 1.00 16.12 ? 253  ILE D CA  1 
ATOM   4701  C  C   . ILE B 1 235 ? 9.487   73.790 118.456 1.00 15.71 ? 253  ILE D C   1 
ATOM   4702  O  O   . ILE B 1 235 ? 8.398   73.245 118.646 1.00 15.93 ? 253  ILE D O   1 
ATOM   4703  C  CB  . ILE B 1 235 ? 9.491   75.905 119.929 1.00 15.99 ? 253  ILE D CB  1 
ATOM   4704  C  CG1 . ILE B 1 235 ? 8.183   75.485 120.602 1.00 16.08 ? 253  ILE D CG1 1 
ATOM   4705  C  CG2 . ILE B 1 235 ? 9.605   77.427 119.874 1.00 15.97 ? 253  ILE D CG2 1 
ATOM   4706  C  CD1 . ILE B 1 235 ? 7.954   76.096 121.998 1.00 17.03 ? 253  ILE D CD1 1 
ATOM   4707  N  N   . THR B 1 236 ? 10.585  73.108 118.161 1.00 15.53 ? 254  THR D N   1 
ATOM   4708  C  CA  . THR B 1 236 ? 10.512  71.680 117.835 1.00 15.45 ? 254  THR D CA  1 
ATOM   4709  C  C   . THR B 1 236 ? 11.241  70.817 118.852 1.00 15.76 ? 254  THR D C   1 
ATOM   4710  O  O   . THR B 1 236 ? 10.625  69.988 119.524 1.00 16.34 ? 254  THR D O   1 
ATOM   4711  C  CB  . THR B 1 236 ? 11.038  71.386 116.400 1.00 15.28 ? 254  THR D CB  1 
ATOM   4712  O  OG1 . THR B 1 236 ? 12.407  71.798 116.291 1.00 15.17 ? 254  THR D OG1 1 
ATOM   4713  C  CG2 . THR B 1 236 ? 10.208  72.128 115.365 1.00 14.69 ? 254  THR D CG2 1 
ATOM   4714  N  N   . GLU B 1 237 ? 12.550  71.013 118.961 1.00 15.69 ? 255  GLU D N   1 
ATOM   4715  C  CA  . GLU B 1 237 ? 13.371  70.230 119.872 1.00 15.96 ? 255  GLU D CA  1 
ATOM   4716  C  C   . GLU B 1 237 ? 14.362  71.114 120.620 1.00 15.72 ? 255  GLU D C   1 
ATOM   4717  O  O   . GLU B 1 237 ? 14.711  72.206 120.155 1.00 15.81 ? 255  GLU D O   1 
ATOM   4718  C  CB  . GLU B 1 237 ? 14.101  69.105 119.122 1.00 16.02 ? 255  GLU D CB  1 
ATOM   4719  C  CG  . GLU B 1 237 ? 13.159  68.104 118.450 1.00 17.94 ? 255  GLU D CG  1 
ATOM   4720  C  CD  . GLU B 1 237 ? 13.554  66.659 118.667 1.00 19.97 ? 255  GLU D CD  1 
ATOM   4721  O  OE1 . GLU B 1 237 ? 13.275  65.819 117.785 1.00 20.87 ? 255  GLU D OE1 1 
ATOM   4722  O  OE2 . GLU B 1 237 ? 14.139  66.354 119.722 1.00 22.63 ? 255  GLU D OE2 1 
ATOM   4723  N  N   . VAL B 1 238 ? 14.785  70.641 121.788 1.00 15.43 ? 256  VAL D N   1 
ATOM   4724  C  CA  . VAL B 1 238 ? 15.771  71.332 122.625 1.00 15.65 ? 256  VAL D CA  1 
ATOM   4725  C  C   . VAL B 1 238 ? 17.080  70.558 122.563 1.00 15.15 ? 256  VAL D C   1 
ATOM   4726  O  O   . VAL B 1 238 ? 17.249  69.561 123.268 1.00 15.39 ? 256  VAL D O   1 
ATOM   4727  C  CB  . VAL B 1 238 ? 15.317  71.404 124.099 1.00 15.74 ? 256  VAL D CB  1 
ATOM   4728  C  CG1 . VAL B 1 238 ? 16.332  72.195 124.921 1.00 16.65 ? 256  VAL D CG1 1 
ATOM   4729  C  CG2 . VAL B 1 238 ? 13.925  72.031 124.215 1.00 16.07 ? 256  VAL D CG2 1 
ATOM   4730  N  N   . GLY B 1 239 ? 17.997  71.004 121.714 1.00 14.75 ? 257  GLY D N   1 
ATOM   4731  C  CA  . GLY B 1 239 ? 19.236  70.261 121.464 1.00 14.20 ? 257  GLY D CA  1 
ATOM   4732  C  C   . GLY B 1 239 ? 18.911  68.861 120.982 1.00 14.00 ? 257  GLY D C   1 
ATOM   4733  O  O   . GLY B 1 239 ? 18.211  68.693 119.975 1.00 14.11 ? 257  GLY D O   1 
ATOM   4734  N  N   . THR B 1 240 ? 19.391  67.861 121.722 1.00 13.48 ? 258  THR D N   1 
ATOM   4735  C  CA  . THR B 1 240 ? 19.111  66.456 121.426 1.00 12.87 ? 258  THR D CA  1 
ATOM   4736  C  C   . THR B 1 240 ? 17.982  65.894 122.304 1.00 12.89 ? 258  THR D C   1 
ATOM   4737  O  O   . THR B 1 240 ? 17.937  64.693 122.588 1.00 12.88 ? 258  THR D O   1 
ATOM   4738  C  CB  . THR B 1 240 ? 20.370  65.582 121.600 1.00 12.80 ? 258  THR D CB  1 
ATOM   4739  O  OG1 . THR B 1 240 ? 20.897  65.765 122.916 1.00 12.28 ? 258  THR D OG1 1 
ATOM   4740  C  CG2 . THR B 1 240 ? 21.439  65.935 120.570 1.00 12.07 ? 258  THR D CG2 1 
ATOM   4741  N  N   . MET B 1 241 ? 17.069  66.770 122.714 1.00 12.79 ? 259  MET D N   1 
ATOM   4742  C  CA  . MET B 1 241 ? 15.943  66.401 123.567 1.00 12.68 ? 259  MET D CA  1 
ATOM   4743  C  C   . MET B 1 241 ? 14.620  66.852 122.958 1.00 12.49 ? 259  MET D C   1 
ATOM   4744  O  O   . MET B 1 241 ? 14.560  67.858 122.248 1.00 12.56 ? 259  MET D O   1 
ATOM   4745  C  CB  . MET B 1 241 ? 16.094  67.048 124.952 1.00 12.97 ? 259  MET D CB  1 
ATOM   4746  C  CG  . MET B 1 241 ? 17.225  66.513 125.816 1.00 12.79 ? 259  MET D CG  1 
ATOM   4747  S  SD  . MET B 1 241 ? 17.607  67.599 127.221 1.00 15.82 ? 259  MET D SD  1 
ATOM   4748  C  CE  . MET B 1 241 ? 18.369  69.015 126.409 1.00 14.60 ? 259  MET D CE  1 
ATOM   4749  N  N   . ASN B 1 242 ? 13.554  66.117 123.256 1.00 12.02 ? 260  ASN D N   1 
ATOM   4750  C  CA  . ASN B 1 242 ? 12.214  66.554 122.907 1.00 11.99 ? 260  ASN D CA  1 
ATOM   4751  C  C   . ASN B 1 242 ? 11.767  67.696 123.814 1.00 12.08 ? 260  ASN D C   1 
ATOM   4752  O  O   . ASN B 1 242 ? 12.243  67.808 124.942 1.00 12.23 ? 260  ASN D O   1 
ATOM   4753  C  CB  . ASN B 1 242 ? 11.226  65.389 122.974 1.00 11.74 ? 260  ASN D CB  1 
ATOM   4754  C  CG  . ASN B 1 242 ? 11.529  64.315 121.957 1.00 11.07 ? 260  ASN D CG  1 
ATOM   4755  O  OD1 . ASN B 1 242 ? 11.452  64.539 120.742 1.00 12.30 ? 260  ASN D OD1 1 
ATOM   4756  N  ND2 . ASN B 1 242 ? 11.867  63.149 122.439 1.00 6.78  ? 260  ASN D ND2 1 
ATOM   4757  N  N   . LEU B 1 243 ? 10.852  68.528 123.308 1.00 12.09 ? 261  LEU D N   1 
ATOM   4758  C  CA  . LEU B 1 243 ? 10.400  69.748 123.994 1.00 12.01 ? 261  LEU D CA  1 
ATOM   4759  C  C   . LEU B 1 243 ? 8.998   69.610 124.600 1.00 11.96 ? 261  LEU D C   1 
ATOM   4760  O  O   . LEU B 1 243 ? 8.031   69.277 123.896 1.00 12.03 ? 261  LEU D O   1 
ATOM   4761  C  CB  . LEU B 1 243 ? 10.415  70.934 123.014 1.00 11.84 ? 261  LEU D CB  1 
ATOM   4762  C  CG  . LEU B 1 243 ? 10.129  72.356 123.534 1.00 12.83 ? 261  LEU D CG  1 
ATOM   4763  C  CD1 . LEU B 1 243 ? 10.747  73.385 122.588 1.00 14.64 ? 261  LEU D CD1 1 
ATOM   4764  C  CD2 . LEU B 1 243 ? 8.640   72.644 123.712 1.00 13.18 ? 261  LEU D CD2 1 
ATOM   4765  N  N   . PHE B 1 244 ? 8.884   69.902 125.893 1.00 11.99 ? 262  PHE D N   1 
ATOM   4766  C  CA  . PHE B 1 244 ? 7.585   69.928 126.570 1.00 12.22 ? 262  PHE D CA  1 
ATOM   4767  C  C   . PHE B 1 244 ? 7.285   71.323 127.121 1.00 12.70 ? 262  PHE D C   1 
ATOM   4768  O  O   . PHE B 1 244 ? 8.170   71.991 127.657 1.00 12.17 ? 262  PHE D O   1 
ATOM   4769  C  CB  . PHE B 1 244 ? 7.536   68.893 127.695 1.00 11.75 ? 262  PHE D CB  1 
ATOM   4770  C  CG  . PHE B 1 244 ? 7.345   67.474 127.215 1.00 11.80 ? 262  PHE D CG  1 
ATOM   4771  C  CD1 . PHE B 1 244 ? 8.441   66.677 126.894 1.00 10.21 ? 262  PHE D CD1 1 
ATOM   4772  C  CD2 . PHE B 1 244 ? 6.068   66.936 127.094 1.00 11.12 ? 262  PHE D CD2 1 
ATOM   4773  C  CE1 . PHE B 1 244 ? 8.269   65.368 126.455 1.00 11.48 ? 262  PHE D CE1 1 
ATOM   4774  C  CE2 . PHE B 1 244 ? 5.879   65.619 126.650 1.00 12.01 ? 262  PHE D CE2 1 
ATOM   4775  C  CZ  . PHE B 1 244 ? 6.981   64.833 126.329 1.00 11.31 ? 262  PHE D CZ  1 
ATOM   4776  N  N   . LEU B 1 245 ? 6.032   71.752 126.983 1.00 13.62 ? 263  LEU D N   1 
ATOM   4777  C  CA  . LEU B 1 245 ? 5.579   73.032 127.533 1.00 14.39 ? 263  LEU D CA  1 
ATOM   4778  C  C   . LEU B 1 245 ? 4.400   72.792 128.467 1.00 14.84 ? 263  LEU D C   1 
ATOM   4779  O  O   . LEU B 1 245 ? 3.355   72.284 128.046 1.00 14.64 ? 263  LEU D O   1 
ATOM   4780  C  CB  . LEU B 1 245 ? 5.155   73.981 126.410 1.00 14.36 ? 263  LEU D CB  1 
ATOM   4781  C  CG  . LEU B 1 245 ? 5.350   75.510 126.471 1.00 15.60 ? 263  LEU D CG  1 
ATOM   4782  C  CD1 . LEU B 1 245 ? 4.281   76.195 125.619 1.00 13.12 ? 263  LEU D CD1 1 
ATOM   4783  C  CD2 . LEU B 1 245 ? 5.384   76.109 127.879 1.00 15.29 ? 263  LEU D CD2 1 
ATOM   4784  N  N   . TYR B 1 246 ? 4.573   73.165 129.732 1.00 15.68 ? 264  TYR D N   1 
ATOM   4785  C  CA  . TYR B 1 246 ? 3.502   73.080 130.725 1.00 16.59 ? 264  TYR D CA  1 
ATOM   4786  C  C   . TYR B 1 246 ? 2.949   74.484 130.953 1.00 17.34 ? 264  TYR D C   1 
ATOM   4787  O  O   . TYR B 1 246 ? 3.642   75.361 131.473 1.00 17.34 ? 264  TYR D O   1 
ATOM   4788  C  CB  . TYR B 1 246 ? 4.033   72.481 132.029 1.00 16.60 ? 264  TYR D CB  1 
ATOM   4789  C  CG  . TYR B 1 246 ? 2.992   72.172 133.088 1.00 16.35 ? 264  TYR D CG  1 
ATOM   4790  C  CD1 . TYR B 1 246 ? 1.754   71.616 132.750 1.00 17.15 ? 264  TYR D CD1 1 
ATOM   4791  C  CD2 . TYR B 1 246 ? 3.266   72.392 134.434 1.00 16.47 ? 264  TYR D CD2 1 
ATOM   4792  C  CE1 . TYR B 1 246 ? 0.809   71.319 133.723 1.00 16.66 ? 264  TYR D CE1 1 
ATOM   4793  C  CE2 . TYR B 1 246 ? 2.332   72.098 135.413 1.00 16.99 ? 264  TYR D CE2 1 
ATOM   4794  C  CZ  . TYR B 1 246 ? 1.110   71.558 135.050 1.00 17.25 ? 264  TYR D CZ  1 
ATOM   4795  O  OH  . TYR B 1 246 ? 0.184   71.265 136.023 1.00 19.68 ? 264  TYR D OH  1 
ATOM   4796  N  N   . TRP B 1 247 ? 1.700   74.691 130.550 1.00 17.75 ? 265  TRP D N   1 
ATOM   4797  C  CA  . TRP B 1 247 ? 1.153   76.037 130.451 1.00 18.71 ? 265  TRP D CA  1 
ATOM   4798  C  C   . TRP B 1 247 ? -0.374  76.049 130.500 1.00 19.15 ? 265  TRP D C   1 
ATOM   4799  O  O   . TRP B 1 247 ? -1.013  74.999 130.485 1.00 19.66 ? 265  TRP D O   1 
ATOM   4800  C  CB  . TRP B 1 247 ? 1.669   76.716 129.165 1.00 18.19 ? 265  TRP D CB  1 
ATOM   4801  C  CG  . TRP B 1 247 ? 1.041   76.224 127.863 1.00 18.76 ? 265  TRP D CG  1 
ATOM   4802  C  CD1 . TRP B 1 247 ? 0.492   74.989 127.616 1.00 18.33 ? 265  TRP D CD1 1 
ATOM   4803  C  CD2 . TRP B 1 247 ? 0.932   76.958 126.635 1.00 19.10 ? 265  TRP D CD2 1 
ATOM   4804  N  NE1 . TRP B 1 247 ? 0.030   74.923 126.322 1.00 18.82 ? 265  TRP D NE1 1 
ATOM   4805  C  CE2 . TRP B 1 247 ? 0.291   76.113 125.696 1.00 19.06 ? 265  TRP D CE2 1 
ATOM   4806  C  CE3 . TRP B 1 247 ? 1.309   78.248 126.237 1.00 18.83 ? 265  TRP D CE3 1 
ATOM   4807  C  CZ2 . TRP B 1 247 ? 0.019   76.519 124.381 1.00 19.23 ? 265  TRP D CZ2 1 
ATOM   4808  C  CZ3 . TRP B 1 247 ? 1.038   78.652 124.925 1.00 19.49 ? 265  TRP D CZ3 1 
ATOM   4809  C  CH2 . TRP B 1 247 ? 0.398   77.787 124.016 1.00 19.06 ? 265  TRP D CH2 1 
ATOM   4810  N  N   . ILE B 1 248 ? -0.943  77.246 130.577 1.00 20.10 ? 266  ILE D N   1 
ATOM   4811  C  CA  . ILE B 1 248 ? -2.364  77.449 130.351 1.00 20.82 ? 266  ILE D CA  1 
ATOM   4812  C  C   . ILE B 1 248 ? -2.497  77.815 128.885 1.00 21.03 ? 266  ILE D C   1 
ATOM   4813  O  O   . ILE B 1 248 ? -1.918  78.803 128.438 1.00 21.07 ? 266  ILE D O   1 
ATOM   4814  C  CB  . ILE B 1 248 ? -2.930  78.574 131.257 1.00 21.24 ? 266  ILE D CB  1 
ATOM   4815  C  CG1 . ILE B 1 248 ? -2.910  78.139 132.727 1.00 22.36 ? 266  ILE D CG1 1 
ATOM   4816  C  CG2 . ILE B 1 248 ? -4.349  78.961 130.832 1.00 21.27 ? 266  ILE D CG2 1 
ATOM   4817  C  CD1 . ILE B 1 248 ? -3.430  79.194 133.686 1.00 25.22 ? 266  ILE D CD1 1 
ATOM   4818  N  N   . ASN B 1 249 ? -3.235  77.006 128.133 1.00 21.60 ? 267  ASN D N   1 
ATOM   4819  C  CA  . ASN B 1 249 ? -3.369  77.215 126.696 1.00 22.47 ? 267  ASN D CA  1 
ATOM   4820  C  C   . ASN B 1 249 ? -4.320  78.374 126.353 1.00 23.21 ? 267  ASN D C   1 
ATOM   4821  O  O   . ASN B 1 249 ? -4.758  79.112 127.244 1.00 23.15 ? 267  ASN D O   1 
ATOM   4822  C  CB  . ASN B 1 249 ? -3.763  75.909 125.981 1.00 22.20 ? 267  ASN D CB  1 
ATOM   4823  C  CG  . ASN B 1 249 ? -5.191  75.480 126.268 1.00 22.13 ? 267  ASN D CG  1 
ATOM   4824  O  OD1 . ASN B 1 249 ? -6.021  76.274 126.715 1.00 21.53 ? 267  ASN D OD1 1 
ATOM   4825  N  ND2 . ASN B 1 249 ? -5.486  74.213 126.003 1.00 21.24 ? 267  ASN D ND2 1 
ATOM   4826  N  N   . GLU B 1 250 ? -4.637  78.514 125.066 1.00 24.06 ? 268  GLU D N   1 
ATOM   4827  C  CA  . GLU B 1 250 ? -5.401  79.660 124.559 1.00 24.74 ? 268  GLU D CA  1 
ATOM   4828  C  C   . GLU B 1 250 ? -6.875  79.587 124.953 1.00 25.21 ? 268  GLU D C   1 
ATOM   4829  O  O   . GLU B 1 250 ? -7.572  80.607 124.955 1.00 25.45 ? 268  GLU D O   1 
ATOM   4830  C  CB  . GLU B 1 250 ? -5.267  79.770 123.032 1.00 24.73 ? 268  GLU D CB  1 
ATOM   4831  C  CG  . GLU B 1 250 ? -3.839  79.933 122.517 1.00 24.25 ? 268  GLU D CG  1 
ATOM   4832  C  CD  . GLU B 1 250 ? -3.139  78.606 122.216 1.00 23.70 ? 268  GLU D CD  1 
ATOM   4833  O  OE1 . GLU B 1 250 ? -2.185  78.614 121.410 1.00 23.49 ? 268  GLU D OE1 1 
ATOM   4834  O  OE2 . GLU B 1 250 ? -3.524  77.560 122.781 1.00 22.73 ? 268  GLU D OE2 1 
ATOM   4835  N  N   . ASP B 1 251 ? -7.340  78.377 125.270 1.00 25.63 ? 269  ASP D N   1 
ATOM   4836  C  CA  . ASP B 1 251 ? -8.707  78.140 125.742 1.00 25.97 ? 269  ASP D CA  1 
ATOM   4837  C  C   . ASP B 1 251 ? -8.839  78.279 127.259 1.00 25.77 ? 269  ASP D C   1 
ATOM   4838  O  O   . ASP B 1 251 ? -9.907  78.024 127.820 1.00 25.76 ? 269  ASP D O   1 
ATOM   4839  C  CB  . ASP B 1 251 ? -9.172  76.741 125.327 1.00 26.44 ? 269  ASP D CB  1 
ATOM   4840  C  CG  . ASP B 1 251 ? -9.371  76.605 123.825 1.00 28.01 ? 269  ASP D CG  1 
ATOM   4841  O  OD1 . ASP B 1 251 ? -9.489  75.452 123.352 1.00 30.11 ? 269  ASP D OD1 1 
ATOM   4842  O  OD2 . ASP B 1 251 ? -9.415  77.635 123.119 1.00 29.19 ? 269  ASP D OD2 1 
ATOM   4843  N  N   . GLY B 1 252 ? -7.747  78.662 127.917 1.00 25.57 ? 270  GLY D N   1 
ATOM   4844  C  CA  . GLY B 1 252 ? -7.718  78.805 129.371 1.00 25.37 ? 270  GLY D CA  1 
ATOM   4845  C  C   . GLY B 1 252 ? -7.625  77.486 130.125 1.00 25.33 ? 270  GLY D C   1 
ATOM   4846  O  O   . GLY B 1 252 ? -7.924  77.438 131.322 1.00 25.23 ? 270  GLY D O   1 
ATOM   4847  N  N   . GLU B 1 253 ? -7.215  76.422 129.425 1.00 24.80 ? 271  GLU D N   1 
ATOM   4848  C  CA  . GLU B 1 253 ? -7.041  75.095 130.026 1.00 24.48 ? 271  GLU D CA  1 
ATOM   4849  C  C   . GLU B 1 253 ? -5.580  74.840 130.364 1.00 23.70 ? 271  GLU D C   1 
ATOM   4850  O  O   . GLU B 1 253 ? -4.690  75.109 129.551 1.00 23.55 ? 271  GLU D O   1 
ATOM   4851  C  CB  . GLU B 1 253 ? -7.481  73.989 129.063 1.00 24.85 ? 271  GLU D CB  1 
ATOM   4852  C  CG  . GLU B 1 253 ? -8.945  73.967 128.667 1.00 26.98 ? 271  GLU D CG  1 
ATOM   4853  C  CD  . GLU B 1 253 ? -9.180  73.086 127.453 1.00 29.29 ? 271  GLU D CD  1 
ATOM   4854  O  OE1 . GLU B 1 253 ? -9.930  72.090 127.580 1.00 30.96 ? 271  GLU D OE1 1 
ATOM   4855  O  OE2 . GLU B 1 253 ? -8.600  73.377 126.375 1.00 30.35 ? 271  GLU D OE2 1 
ATOM   4856  N  N   . GLU B 1 254 ? -5.338  74.286 131.546 1.00 22.85 ? 272  GLU D N   1 
ATOM   4857  C  CA  . GLU B 1 254 ? -4.009  73.800 131.898 1.00 22.10 ? 272  GLU D CA  1 
ATOM   4858  C  C   . GLU B 1 254 ? -3.631  72.606 131.007 1.00 20.88 ? 272  GLU D C   1 
ATOM   4859  O  O   . GLU B 1 254 ? -4.391  71.643 130.881 1.00 20.51 ? 272  GLU D O   1 
ATOM   4860  C  CB  . GLU B 1 254 ? -3.960  73.409 133.374 1.00 22.50 ? 272  GLU D CB  1 
ATOM   4861  C  CG  . GLU B 1 254 ? -2.556  73.186 133.895 1.00 24.74 ? 272  GLU D CG  1 
ATOM   4862  C  CD  . GLU B 1 254 ? -2.531  72.976 135.387 1.00 28.17 ? 272  GLU D CD  1 
ATOM   4863  O  OE1 . GLU B 1 254 ? -2.135  73.925 136.107 1.00 30.15 ? 272  GLU D OE1 1 
ATOM   4864  O  OE2 . GLU B 1 254 ? -2.921  71.875 135.833 1.00 28.21 ? 272  GLU D OE2 1 
ATOM   4865  N  N   . GLU B 1 255 ? -2.446  72.675 130.404 1.00 19.57 ? 273  GLU D N   1 
ATOM   4866  C  CA  . GLU B 1 255 ? -2.076  71.746 129.349 1.00 18.17 ? 273  GLU D CA  1 
ATOM   4867  C  C   . GLU B 1 255 ? -0.586  71.388 129.354 1.00 17.33 ? 273  GLU D C   1 
ATOM   4868  O  O   . GLU B 1 255 ? 0.266   72.249 129.567 1.00 17.11 ? 273  GLU D O   1 
ATOM   4869  C  CB  . GLU B 1 255 ? -2.460  72.364 128.008 1.00 18.18 ? 273  GLU D CB  1 
ATOM   4870  C  CG  . GLU B 1 255 ? -2.275  71.488 126.775 1.00 18.11 ? 273  GLU D CG  1 
ATOM   4871  C  CD  . GLU B 1 255 ? -2.600  72.246 125.503 1.00 17.83 ? 273  GLU D CD  1 
ATOM   4872  O  OE1 . GLU B 1 255 ? -3.669  71.993 124.918 1.00 18.90 ? 273  GLU D OE1 1 
ATOM   4873  O  OE2 . GLU B 1 255 ? -1.797  73.112 125.098 1.00 18.13 ? 273  GLU D OE2 1 
ATOM   4874  N  N   . LEU B 1 256 ? -0.286  70.110 129.137 1.00 16.16 ? 274  LEU D N   1 
ATOM   4875  C  CA  . LEU B 1 256 ? 1.059   69.714 128.753 1.00 15.23 ? 274  LEU D CA  1 
ATOM   4876  C  C   . LEU B 1 256 ? 1.083   69.543 127.241 1.00 14.41 ? 274  LEU D C   1 
ATOM   4877  O  O   . LEU B 1 256 ? 0.379   68.693 126.699 1.00 14.09 ? 274  LEU D O   1 
ATOM   4878  C  CB  . LEU B 1 256 ? 1.498   68.425 129.453 1.00 15.18 ? 274  LEU D CB  1 
ATOM   4879  C  CG  . LEU B 1 256 ? 2.930   67.949 129.162 1.00 14.88 ? 274  LEU D CG  1 
ATOM   4880  C  CD1 . LEU B 1 256 ? 3.951   68.988 129.656 1.00 14.58 ? 274  LEU D CD1 1 
ATOM   4881  C  CD2 . LEU B 1 256 ? 3.183   66.587 129.793 1.00 13.99 ? 274  LEU D CD2 1 
ATOM   4882  N  N   . ALA B 1 257 ? 1.880   70.371 126.571 1.00 13.75 ? 275  ALA D N   1 
ATOM   4883  C  CA  . ALA B 1 257 ? 1.998   70.333 125.114 1.00 13.44 ? 275  ALA D CA  1 
ATOM   4884  C  C   . ALA B 1 257 ? 3.401   69.935 124.652 1.00 13.36 ? 275  ALA D C   1 
ATOM   4885  O  O   . ALA B 1 257 ? 4.405   70.261 125.300 1.00 13.35 ? 275  ALA D O   1 
ATOM   4886  C  CB  . ALA B 1 257 ? 1.586   71.666 124.502 1.00 13.04 ? 275  ALA D CB  1 
ATOM   4887  N  N   . THR B 1 258 ? 3.444   69.212 123.536 1.00 12.94 ? 276  THR D N   1 
ATOM   4888  C  CA  . THR B 1 258 ? 4.687   68.824 122.878 1.00 12.85 ? 276  THR D CA  1 
ATOM   4889  C  C   . THR B 1 258 ? 4.434   68.799 121.362 1.00 12.74 ? 276  THR D C   1 
ATOM   4890  O  O   . THR B 1 258 ? 3.320   68.472 120.936 1.00 12.75 ? 276  THR D O   1 
ATOM   4891  C  CB  . THR B 1 258 ? 5.234   67.453 123.424 1.00 12.64 ? 276  THR D CB  1 
ATOM   4892  O  OG1 . THR B 1 258 ? 6.607   67.296 123.062 1.00 12.56 ? 276  THR D OG1 1 
ATOM   4893  C  CG2 . THR B 1 258 ? 4.441   66.252 122.904 1.00 12.63 ? 276  THR D CG2 1 
ATOM   4894  N  N   . PRO B 1 259 ? 5.439   69.196 120.546 1.00 12.80 ? 277  PRO D N   1 
ATOM   4895  C  CA  . PRO B 1 259 ? 5.309   69.102 119.087 1.00 12.59 ? 277  PRO D CA  1 
ATOM   4896  C  C   . PRO B 1 259 ? 4.949   67.693 118.587 1.00 12.52 ? 277  PRO D C   1 
ATOM   4897  O  O   . PRO B 1 259 ? 5.440   66.708 119.132 1.00 12.40 ? 277  PRO D O   1 
ATOM   4898  C  CB  . PRO B 1 259 ? 6.700   69.515 118.594 1.00 12.74 ? 277  PRO D CB  1 
ATOM   4899  C  CG  . PRO B 1 259 ? 7.188   70.452 119.654 1.00 12.78 ? 277  PRO D CG  1 
ATOM   4900  C  CD  . PRO B 1 259 ? 6.731   69.807 120.927 1.00 12.48 ? 277  PRO D CD  1 
ATOM   4901  N  N   . PRO B 1 260 ? 4.082   67.599 117.556 1.00 12.52 ? 278  PRO D N   1 
ATOM   4902  C  CA  . PRO B 1 260 ? 3.655   66.306 117.026 1.00 12.39 ? 278  PRO D CA  1 
ATOM   4903  C  C   . PRO B 1 260 ? 4.679   65.647 116.098 1.00 12.58 ? 278  PRO D C   1 
ATOM   4904  O  O   . PRO B 1 260 ? 5.580   66.316 115.577 1.00 12.25 ? 278  PRO D O   1 
ATOM   4905  C  CB  . PRO B 1 260 ? 2.375   66.644 116.255 1.00 12.65 ? 278  PRO D CB  1 
ATOM   4906  C  CG  . PRO B 1 260 ? 2.477   68.057 115.920 1.00 12.40 ? 278  PRO D CG  1 
ATOM   4907  C  CD  . PRO B 1 260 ? 3.453   68.722 116.838 1.00 12.43 ? 278  PRO D CD  1 
ATOM   4908  N  N   . LEU B 1 261 ? 4.512   64.342 115.886 1.00 12.49 ? 279  LEU D N   1 
ATOM   4909  C  CA  . LEU B 1 261 ? 5.446   63.557 115.092 1.00 12.92 ? 279  LEU D CA  1 
ATOM   4910  C  C   . LEU B 1 261 ? 5.138   63.615 113.597 1.00 12.84 ? 279  LEU D C   1 
ATOM   4911  O  O   . LEU B 1 261 ? 4.726   62.620 113.000 1.00 12.62 ? 279  LEU D O   1 
ATOM   4912  C  CB  . LEU B 1 261 ? 5.489   62.100 115.589 1.00 12.63 ? 279  LEU D CB  1 
ATOM   4913  C  CG  . LEU B 1 261 ? 5.873   61.835 117.048 1.00 13.24 ? 279  LEU D CG  1 
ATOM   4914  C  CD1 . LEU B 1 261 ? 5.933   60.328 117.318 1.00 13.26 ? 279  LEU D CD1 1 
ATOM   4915  C  CD2 . LEU B 1 261 ? 7.190   62.516 117.434 1.00 12.08 ? 279  LEU D CD2 1 
ATOM   4916  N  N   . ASP B 1 262 ? 5.348   64.786 112.999 1.00 13.27 ? 280  ASP D N   1 
ATOM   4917  C  CA  . ASP B 1 262 ? 5.036   65.000 111.583 1.00 13.35 ? 280  ASP D CA  1 
ATOM   4918  C  C   . ASP B 1 262 ? 6.250   64.869 110.648 1.00 13.15 ? 280  ASP D C   1 
ATOM   4919  O  O   . ASP B 1 262 ? 6.184   65.249 109.473 1.00 13.41 ? 280  ASP D O   1 
ATOM   4920  C  CB  . ASP B 1 262 ? 4.300   66.343 111.381 1.00 13.25 ? 280  ASP D CB  1 
ATOM   4921  C  CG  . ASP B 1 262 ? 5.134   67.552 111.786 1.00 14.21 ? 280  ASP D CG  1 
ATOM   4922  O  OD1 . ASP B 1 262 ? 4.628   68.680 111.616 1.00 14.09 ? 280  ASP D OD1 1 
ATOM   4923  O  OD2 . ASP B 1 262 ? 6.286   67.393 112.264 1.00 15.45 ? 280  ASP D OD2 1 
ATOM   4924  N  N   . GLY B 1 263 ? 7.356   64.357 111.177 1.00 12.79 ? 281  GLY D N   1 
ATOM   4925  C  CA  . GLY B 1 263 ? 8.551   64.098 110.373 1.00 12.77 ? 281  GLY D CA  1 
ATOM   4926  C  C   . GLY B 1 263 ? 9.830   64.792 110.818 1.00 12.90 ? 281  GLY D C   1 
ATOM   4927  O  O   . GLY B 1 263 ? 10.937  64.357 110.471 1.00 12.64 ? 281  GLY D O   1 
ATOM   4928  N  N   . ILE B 1 264 ? 9.685   65.870 111.586 1.00 12.70 ? 282  ILE D N   1 
ATOM   4929  C  CA  . ILE B 1 264 ? 10.831  66.690 111.979 1.00 12.91 ? 282  ILE D CA  1 
ATOM   4930  C  C   . ILE B 1 264 ? 11.190  66.555 113.472 1.00 13.00 ? 282  ILE D C   1 
ATOM   4931  O  O   . ILE B 1 264 ? 12.063  67.265 113.982 1.00 13.34 ? 282  ILE D O   1 
ATOM   4932  C  CB  . ILE B 1 264 ? 10.651  68.185 111.555 1.00 12.86 ? 282  ILE D CB  1 
ATOM   4933  C  CG1 . ILE B 1 264 ? 9.435   68.813 112.240 1.00 12.79 ? 282  ILE D CG1 1 
ATOM   4934  C  CG2 . ILE B 1 264 ? 10.527  68.289 110.033 1.00 12.22 ? 282  ILE D CG2 1 
ATOM   4935  C  CD1 . ILE B 1 264 ? 9.426   70.330 112.243 1.00 10.73 ? 282  ILE D CD1 1 
ATOM   4936  N  N   . ILE B 1 265 ? 10.528  65.619 114.144 1.00 12.67 ? 283  ILE D N   1 
ATOM   4937  C  CA  . ILE B 1 265 ? 10.743  65.362 115.562 1.00 12.42 ? 283  ILE D CA  1 
ATOM   4938  C  C   . ILE B 1 265 ? 11.163  63.914 115.769 1.00 12.03 ? 283  ILE D C   1 
ATOM   4939  O  O   . ILE B 1 265 ? 10.558  62.997 115.216 1.00 12.63 ? 283  ILE D O   1 
ATOM   4940  C  CB  . ILE B 1 265 ? 9.493   65.745 116.432 1.00 12.66 ? 283  ILE D CB  1 
ATOM   4941  C  CG1 . ILE B 1 265 ? 9.529   67.235 116.793 1.00 13.78 ? 283  ILE D CG1 1 
ATOM   4942  C  CG2 . ILE B 1 265 ? 9.539   65.092 117.798 1.00 11.98 ? 283  ILE D CG2 1 
ATOM   4943  C  CD1 . ILE B 1 265 ? 8.885   68.123 115.856 1.00 13.40 ? 283  ILE D CD1 1 
ATOM   4944  N  N   . LEU B 1 266 ? 12.226  63.715 116.538 1.00 11.36 ? 284  LEU D N   1 
ATOM   4945  C  CA  . LEU B 1 266 ? 12.647  62.376 116.915 1.00 10.70 ? 284  LEU D CA  1 
ATOM   4946  C  C   . LEU B 1 266 ? 11.654  61.809 117.942 1.00 10.51 ? 284  LEU D C   1 
ATOM   4947  O  O   . LEU B 1 266 ? 11.418  62.435 118.981 1.00 10.20 ? 284  LEU D O   1 
ATOM   4948  C  CB  . LEU B 1 266 ? 14.073  62.412 117.486 1.00 10.38 ? 284  LEU D CB  1 
ATOM   4949  C  CG  . LEU B 1 266 ? 14.920  61.129 117.580 1.00 10.29 ? 284  LEU D CG  1 
ATOM   4950  C  CD1 . LEU B 1 266 ? 14.493  60.207 118.734 1.00 7.77  ? 284  LEU D CD1 1 
ATOM   4951  C  CD2 . LEU B 1 266 ? 14.946  60.377 116.234 1.00 8.69  ? 284  LEU D CD2 1 
ATOM   4952  N  N   . PRO B 1 267 ? 11.049  60.637 117.651 1.00 10.12 ? 285  PRO D N   1 
ATOM   4953  C  CA  . PRO B 1 267 ? 10.128  60.018 118.619 1.00 10.15 ? 285  PRO D CA  1 
ATOM   4954  C  C   . PRO B 1 267 ? 10.844  59.472 119.855 1.00 10.27 ? 285  PRO D C   1 
ATOM   4955  O  O   . PRO B 1 267 ? 11.153  58.275 119.914 1.00 10.30 ? 285  PRO D O   1 
ATOM   4956  C  CB  . PRO B 1 267 ? 9.488   58.863 117.824 1.00 10.55 ? 285  PRO D CB  1 
ATOM   4957  C  CG  . PRO B 1 267 ? 9.889   59.073 116.389 1.00 10.51 ? 285  PRO D CG  1 
ATOM   4958  C  CD  . PRO B 1 267 ? 11.164  59.848 116.414 1.00 10.16 ? 285  PRO D CD  1 
ATOM   4959  N  N   . GLY B 1 268 ? 11.114  60.345 120.826 1.00 9.99  ? 286  GLY D N   1 
ATOM   4960  C  CA  . GLY B 1 268 ? 11.823  59.953 122.042 1.00 9.77  ? 286  GLY D CA  1 
ATOM   4961  C  C   . GLY B 1 268 ? 11.082  58.904 122.854 1.00 10.02 ? 286  GLY D C   1 
ATOM   4962  O  O   . GLY B 1 268 ? 9.848   58.910 122.899 1.00 10.01 ? 286  GLY D O   1 
ATOM   4963  N  N   . VAL B 1 269 ? 11.838  57.987 123.462 1.00 9.93  ? 287  VAL D N   1 
ATOM   4964  C  CA  . VAL B 1 269 ? 11.292  57.034 124.429 1.00 10.30 ? 287  VAL D CA  1 
ATOM   4965  C  C   . VAL B 1 269 ? 10.805  57.769 125.676 1.00 10.54 ? 287  VAL D C   1 
ATOM   4966  O  O   . VAL B 1 269 ? 9.694   57.522 126.145 1.00 10.84 ? 287  VAL D O   1 
ATOM   4967  C  CB  . VAL B 1 269 ? 12.311  55.929 124.805 1.00 10.51 ? 287  VAL D CB  1 
ATOM   4968  C  CG1 . VAL B 1 269 ? 11.844  55.115 126.038 1.00 9.74  ? 287  VAL D CG1 1 
ATOM   4969  C  CG2 . VAL B 1 269 ? 12.545  55.009 123.617 1.00 9.74  ? 287  VAL D CG2 1 
ATOM   4970  N  N   . THR B 1 270 ? 11.627  58.688 126.184 1.00 10.74 ? 288  THR D N   1 
ATOM   4971  C  CA  . THR B 1 270 ? 11.270  59.494 127.353 1.00 10.43 ? 288  THR D CA  1 
ATOM   4972  C  C   . THR B 1 270 ? 9.999   60.303 127.087 1.00 10.53 ? 288  THR D C   1 
ATOM   4973  O  O   . THR B 1 270 ? 9.110   60.365 127.936 1.00 10.53 ? 288  THR D O   1 
ATOM   4974  C  CB  . THR B 1 270 ? 12.438  60.431 127.779 1.00 10.59 ? 288  THR D CB  1 
ATOM   4975  O  OG1 . THR B 1 270 ? 13.680  59.737 127.632 1.00 9.99  ? 288  THR D OG1 1 
ATOM   4976  C  CG2 . THR B 1 270 ? 12.285  60.864 129.233 1.00 9.40  ? 288  THR D CG2 1 
ATOM   4977  N  N   . ARG B 1 271 ? 9.938   60.908 125.898 1.00 10.73 ? 289  ARG D N   1 
ATOM   4978  C  CA  . ARG B 1 271 ? 8.763   61.620 125.380 1.00 10.76 ? 289  ARG D CA  1 
ATOM   4979  C  C   . ARG B 1 271 ? 7.494   60.751 125.462 1.00 11.19 ? 289  ARG D C   1 
ATOM   4980  O  O   . ARG B 1 271 ? 6.474   61.159 126.044 1.00 10.73 ? 289  ARG D O   1 
ATOM   4981  C  CB  . ARG B 1 271 ? 9.039   62.045 123.930 1.00 10.36 ? 289  ARG D CB  1 
ATOM   4982  C  CG  . ARG B 1 271 ? 7.942   62.859 123.252 1.00 10.89 ? 289  ARG D CG  1 
ATOM   4983  C  CD  . ARG B 1 271 ? 8.211   62.970 121.753 1.00 10.69 ? 289  ARG D CD  1 
ATOM   4984  N  NE  . ARG B 1 271 ? 7.149   63.668 121.034 1.00 9.72  ? 289  ARG D NE  1 
ATOM   4985  C  CZ  . ARG B 1 271 ? 6.005   63.116 120.625 1.00 10.48 ? 289  ARG D CZ  1 
ATOM   4986  N  NH1 . ARG B 1 271 ? 5.744   61.830 120.859 1.00 8.86  ? 289  ARG D NH1 1 
ATOM   4987  N  NH2 . ARG B 1 271 ? 5.113   63.863 119.977 1.00 9.34  ? 289  ARG D NH2 1 
ATOM   4988  N  N   . ARG B 1 272 ? 7.577   59.553 124.881 1.00 11.50 ? 290  ARG D N   1 
ATOM   4989  C  CA  . ARG B 1 272 ? 6.507   58.559 124.941 1.00 12.00 ? 290  ARG D CA  1 
ATOM   4990  C  C   . ARG B 1 272 ? 6.056   58.252 126.379 1.00 11.80 ? 290  ARG D C   1 
ATOM   4991  O  O   . ARG B 1 272 ? 4.867   58.287 126.679 1.00 11.87 ? 290  ARG D O   1 
ATOM   4992  C  CB  . ARG B 1 272 ? 6.943   57.274 124.222 1.00 12.03 ? 290  ARG D CB  1 
ATOM   4993  C  CG  . ARG B 1 272 ? 5.981   56.105 124.367 1.00 12.76 ? 290  ARG D CG  1 
ATOM   4994  C  CD  . ARG B 1 272 ? 4.821   56.170 123.380 1.00 13.85 ? 290  ARG D CD  1 
ATOM   4995  N  NE  . ARG B 1 272 ? 3.801   57.171 123.704 1.00 13.22 ? 290  ARG D NE  1 
ATOM   4996  C  CZ  . ARG B 1 272 ? 3.448   58.182 122.908 1.00 14.44 ? 290  ARG D CZ  1 
ATOM   4997  N  NH1 . ARG B 1 272 ? 2.497   59.023 123.291 1.00 14.51 ? 290  ARG D NH1 1 
ATOM   4998  N  NH2 . ARG B 1 272 ? 4.031   58.359 121.726 1.00 13.80 ? 290  ARG D NH2 1 
ATOM   4999  N  N   . CYS B 1 273 ? 7.012   57.964 127.257 1.00 12.02 ? 291  CYS D N   1 
ATOM   5000  C  CA  . CYS B 1 273 ? 6.732   57.658 128.658 1.00 11.87 ? 291  CYS D CA  1 
ATOM   5001  C  C   . CYS B 1 273 ? 6.057   58.817 129.398 1.00 11.83 ? 291  CYS D C   1 
ATOM   5002  O  O   . CYS B 1 273 ? 5.137   58.596 130.182 1.00 12.29 ? 291  CYS D O   1 
ATOM   5003  C  CB  . CYS B 1 273 ? 8.021   57.268 129.383 1.00 11.86 ? 291  CYS D CB  1 
ATOM   5004  S  SG  . CYS B 1 273 ? 8.711   55.693 128.889 1.00 13.25 ? 291  CYS D SG  1 
ATOM   5005  N  N   . ILE B 1 274 ? 6.523   60.041 129.152 1.00 11.65 ? 292  ILE D N   1 
ATOM   5006  C  CA  . ILE B 1 274 ? 5.939   61.251 129.746 1.00 11.73 ? 292  ILE D CA  1 
ATOM   5007  C  C   . ILE B 1 274 ? 4.496   61.470 129.280 1.00 12.15 ? 292  ILE D C   1 
ATOM   5008  O  O   . ILE B 1 274 ? 3.620   61.816 130.078 1.00 12.07 ? 292  ILE D O   1 
ATOM   5009  C  CB  . ILE B 1 274 ? 6.790   62.517 129.426 1.00 11.46 ? 292  ILE D CB  1 
ATOM   5010  C  CG1 . ILE B 1 274 ? 8.171   62.420 130.081 1.00 11.41 ? 292  ILE D CG1 1 
ATOM   5011  C  CG2 . ILE B 1 274 ? 6.074   63.795 129.878 1.00 10.59 ? 292  ILE D CG2 1 
ATOM   5012  C  CD1 . ILE B 1 274 ? 9.114   63.546 129.708 1.00 10.00 ? 292  ILE D CD1 1 
ATOM   5013  N  N   . LEU B 1 275 ? 4.262   61.273 127.984 1.00 12.43 ? 293  LEU D N   1 
ATOM   5014  C  CA  . LEU B 1 275 ? 2.920   61.344 127.409 1.00 12.79 ? 293  LEU D CA  1 
ATOM   5015  C  C   . LEU B 1 275 ? 1.998   60.296 128.034 1.00 12.89 ? 293  LEU D C   1 
ATOM   5016  O  O   . LEU B 1 275 ? 0.889   60.617 128.451 1.00 12.85 ? 293  LEU D O   1 
ATOM   5017  C  CB  . LEU B 1 275 ? 2.986   61.194 125.877 1.00 12.53 ? 293  LEU D CB  1 
ATOM   5018  C  CG  . LEU B 1 275 ? 2.877   62.408 124.933 1.00 13.08 ? 293  LEU D CG  1 
ATOM   5019  C  CD1 . LEU B 1 275 ? 2.883   63.775 125.618 1.00 12.88 ? 293  LEU D CD1 1 
ATOM   5020  C  CD2 . LEU B 1 275 ? 3.898   62.337 123.781 1.00 10.89 ? 293  LEU D CD2 1 
ATOM   5021  N  N   . ASP B 1 276 ? 2.468   59.051 128.105 1.00 13.45 ? 294  ASP D N   1 
ATOM   5022  C  CA  . ASP B 1 276 ? 1.720   57.957 128.735 1.00 13.95 ? 294  ASP D CA  1 
ATOM   5023  C  C   . ASP B 1 276 ? 1.318   58.290 130.172 1.00 14.59 ? 294  ASP D C   1 
ATOM   5024  O  O   . ASP B 1 276 ? 0.155   58.130 130.554 1.00 14.79 ? 294  ASP D O   1 
ATOM   5025  C  CB  . ASP B 1 276 ? 2.556   56.680 128.749 1.00 13.74 ? 294  ASP D CB  1 
ATOM   5026  C  CG  . ASP B 1 276 ? 2.644   56.019 127.398 1.00 14.18 ? 294  ASP D CG  1 
ATOM   5027  O  OD1 . ASP B 1 276 ? 3.249   54.933 127.339 1.00 16.15 ? 294  ASP D OD1 1 
ATOM   5028  O  OD2 . ASP B 1 276 ? 2.117   56.565 126.403 1.00 14.75 ? 294  ASP D OD2 1 
ATOM   5029  N  N   . LEU B 1 277 ? 2.300   58.731 130.958 1.00 15.03 ? 295  LEU D N   1 
ATOM   5030  C  CA  . LEU B 1 277 ? 2.100   59.118 132.353 1.00 15.46 ? 295  LEU D CA  1 
ATOM   5031  C  C   . LEU B 1 277 ? 1.084   60.248 132.491 1.00 15.69 ? 295  LEU D C   1 
ATOM   5032  O  O   . LEU B 1 277 ? 0.126   60.124 133.257 1.00 15.68 ? 295  LEU D O   1 
ATOM   5033  C  CB  . LEU B 1 277 ? 3.438   59.524 132.981 1.00 15.30 ? 295  LEU D CB  1 
ATOM   5034  C  CG  . LEU B 1 277 ? 4.238   58.574 133.891 1.00 16.38 ? 295  LEU D CG  1 
ATOM   5035  C  CD1 . LEU B 1 277 ? 3.705   57.140 133.987 1.00 17.37 ? 295  LEU D CD1 1 
ATOM   5036  C  CD2 . LEU B 1 277 ? 5.727   58.592 133.542 1.00 16.16 ? 295  LEU D CD2 1 
ATOM   5037  N  N   . ALA B 1 278 ? 1.285   61.334 131.737 1.00 15.61 ? 296  ALA D N   1 
ATOM   5038  C  CA  . ALA B 1 278 ? 0.396   62.500 131.796 1.00 15.68 ? 296  ALA D CA  1 
ATOM   5039  C  C   . ALA B 1 278 ? -1.041  62.167 131.366 1.00 16.14 ? 296  ALA D C   1 
ATOM   5040  O  O   . ALA B 1 278 ? -2.000  62.714 131.915 1.00 16.05 ? 296  ALA D O   1 
ATOM   5041  C  CB  . ALA B 1 278 ? 0.953   63.638 130.971 1.00 15.26 ? 296  ALA D CB  1 
ATOM   5042  N  N   . HIS B 1 279 ? -1.177  61.279 130.383 1.00 16.58 ? 297  HIS D N   1 
ATOM   5043  C  CA  . HIS B 1 279 ? -2.479  60.741 129.997 1.00 17.17 ? 297  HIS D CA  1 
ATOM   5044  C  C   . HIS B 1 279 ? -3.108  59.943 131.143 1.00 17.92 ? 297  HIS D C   1 
ATOM   5045  O  O   . HIS B 1 279 ? -4.292  60.117 131.433 1.00 18.17 ? 297  HIS D O   1 
ATOM   5046  C  CB  . HIS B 1 279 ? -2.370  59.862 128.743 1.00 16.98 ? 297  HIS D CB  1 
ATOM   5047  C  CG  . HIS B 1 279 ? -2.393  60.628 127.452 1.00 16.22 ? 297  HIS D CG  1 
ATOM   5048  N  ND1 . HIS B 1 279 ? -1.405  60.510 126.500 1.00 15.58 ? 297  HIS D ND1 1 
ATOM   5049  C  CD2 . HIS B 1 279 ? -3.291  61.508 126.950 1.00 15.29 ? 297  HIS D CD2 1 
ATOM   5050  C  CE1 . HIS B 1 279 ? -1.689  61.288 125.471 1.00 13.89 ? 297  HIS D CE1 1 
ATOM   5051  N  NE2 . HIS B 1 279 ? -2.830  61.902 125.718 1.00 14.83 ? 297  HIS D NE2 1 
ATOM   5052  N  N   . GLN B 1 280 ? -2.309  59.085 131.786 1.00 18.64 ? 298  GLN D N   1 
ATOM   5053  C  CA  . GLN B 1 280 ? -2.755  58.230 132.899 1.00 19.66 ? 298  GLN D CA  1 
ATOM   5054  C  C   . GLN B 1 280 ? -3.248  59.051 134.093 1.00 19.47 ? 298  GLN D C   1 
ATOM   5055  O  O   . GLN B 1 280 ? -4.312  58.771 134.646 1.00 19.72 ? 298  GLN D O   1 
ATOM   5056  C  CB  . GLN B 1 280 ? -1.634  57.262 133.325 1.00 20.21 ? 298  GLN D CB  1 
ATOM   5057  C  CG  . GLN B 1 280 ? -1.784  56.652 134.740 1.00 23.39 ? 298  GLN D CG  1 
ATOM   5058  C  CD  . GLN B 1 280 ? -0.647  55.688 135.124 1.00 26.99 ? 298  GLN D CD  1 
ATOM   5059  O  OE1 . GLN B 1 280 ? -0.867  54.476 135.272 1.00 29.44 ? 298  GLN D OE1 1 
ATOM   5060  N  NE2 . GLN B 1 280 ? 0.564   56.222 135.295 1.00 26.73 ? 298  GLN D NE2 1 
ATOM   5061  N  N   . TRP B 1 281 ? -2.478  60.073 134.466 1.00 19.06 ? 299  TRP D N   1 
ATOM   5062  C  CA  . TRP B 1 281 ? -2.804  60.942 135.588 1.00 18.88 ? 299  TRP D CA  1 
ATOM   5063  C  C   . TRP B 1 281 ? -4.171  61.621 135.417 1.00 19.31 ? 299  TRP D C   1 
ATOM   5064  O  O   . TRP B 1 281 ? -4.976  61.664 136.360 1.00 19.22 ? 299  TRP D O   1 
ATOM   5065  C  CB  . TRP B 1 281 ? -1.695  61.978 135.801 1.00 18.89 ? 299  TRP D CB  1 
ATOM   5066  C  CG  . TRP B 1 281 ? -0.349  61.375 136.176 1.00 18.80 ? 299  TRP D CG  1 
ATOM   5067  C  CD1 . TRP B 1 281 ? -0.128  60.156 136.754 1.00 18.38 ? 299  TRP D CD1 1 
ATOM   5068  C  CD2 . TRP B 1 281 ? 0.946   61.983 136.019 1.00 19.00 ? 299  TRP D CD2 1 
ATOM   5069  N  NE1 . TRP B 1 281 ? 1.218   59.961 136.954 1.00 19.85 ? 299  TRP D NE1 1 
ATOM   5070  C  CE2 . TRP B 1 281 ? 1.899   61.068 136.517 1.00 19.52 ? 299  TRP D CE2 1 
ATOM   5071  C  CE3 . TRP B 1 281 ? 1.389   63.208 135.502 1.00 18.39 ? 299  TRP D CE3 1 
ATOM   5072  C  CZ2 . TRP B 1 281 ? 3.273   61.337 136.514 1.00 19.35 ? 299  TRP D CZ2 1 
ATOM   5073  C  CZ3 . TRP B 1 281 ? 2.756   63.477 135.498 1.00 19.29 ? 299  TRP D CZ3 1 
ATOM   5074  C  CH2 . TRP B 1 281 ? 3.681   62.542 136.000 1.00 19.38 ? 299  TRP D CH2 1 
ATOM   5075  N  N   . GLY B 1 282 ? -4.435  62.126 134.210 1.00 19.12 ? 300  GLY D N   1 
ATOM   5076  C  CA  . GLY B 1 282 ? -5.720  62.749 133.890 1.00 19.09 ? 300  GLY D CA  1 
ATOM   5077  C  C   . GLY B 1 282 ? -6.024  63.967 134.739 1.00 19.19 ? 300  GLY D C   1 
ATOM   5078  O  O   . GLY B 1 282 ? -7.173  64.181 135.135 1.00 19.58 ? 300  GLY D O   1 
ATOM   5079  N  N   . GLU B 1 283 ? -4.990  64.761 135.018 1.00 19.07 ? 301  GLU D N   1 
ATOM   5080  C  CA  . GLU B 1 283 ? -5.103  65.953 135.858 1.00 18.64 ? 301  GLU D CA  1 
ATOM   5081  C  C   . GLU B 1 283 ? -5.126  67.233 135.031 1.00 18.71 ? 301  GLU D C   1 
ATOM   5082  O  O   . GLU B 1 283 ? -5.570  68.283 135.505 1.00 18.59 ? 301  GLU D O   1 
ATOM   5083  C  CB  . GLU B 1 283 ? -3.953  65.998 136.863 1.00 18.66 ? 301  GLU D CB  1 
ATOM   5084  C  CG  . GLU B 1 283 ? -4.008  64.890 137.908 1.00 18.03 ? 301  GLU D CG  1 
ATOM   5085  C  CD  . GLU B 1 283 ? -2.719  64.749 138.683 1.00 17.96 ? 301  GLU D CD  1 
ATOM   5086  O  OE1 . GLU B 1 283 ? -2.067  65.788 138.938 1.00 16.43 ? 301  GLU D OE1 1 
ATOM   5087  O  OE2 . GLU B 1 283 ? -2.367  63.594 139.039 1.00 17.55 ? 301  GLU D OE2 1 
ATOM   5088  N  N   . PHE B 1 284 ? -4.636  67.132 133.796 1.00 18.28 ? 302  PHE D N   1 
ATOM   5089  C  CA  . PHE B 1 284 ? -4.593  68.251 132.857 1.00 18.05 ? 302  PHE D CA  1 
ATOM   5090  C  C   . PHE B 1 284 ? -4.644  67.732 131.422 1.00 17.79 ? 302  PHE D C   1 
ATOM   5091  O  O   . PHE B 1 284 ? -4.405  66.548 131.172 1.00 17.69 ? 302  PHE D O   1 
ATOM   5092  C  CB  . PHE B 1 284 ? -3.337  69.112 133.076 1.00 17.93 ? 302  PHE D CB  1 
ATOM   5093  C  CG  . PHE B 1 284 ? -2.069  68.312 133.243 1.00 18.67 ? 302  PHE D CG  1 
ATOM   5094  C  CD1 . PHE B 1 284 ? -1.556  68.056 134.514 1.00 18.18 ? 302  PHE D CD1 1 
ATOM   5095  C  CD2 . PHE B 1 284 ? -1.389  67.807 132.130 1.00 18.34 ? 302  PHE D CD2 1 
ATOM   5096  C  CE1 . PHE B 1 284 ? -0.385  67.311 134.675 1.00 18.09 ? 302  PHE D CE1 1 
ATOM   5097  C  CE2 . PHE B 1 284 ? -0.223  67.061 132.283 1.00 17.73 ? 302  PHE D CE2 1 
ATOM   5098  C  CZ  . PHE B 1 284 ? 0.283   66.814 133.552 1.00 18.78 ? 302  PHE D CZ  1 
ATOM   5099  N  N   . LYS B 1 285 ? -4.962  68.626 130.490 1.00 17.70 ? 303  LYS D N   1 
ATOM   5100  C  CA  . LYS B 1 285 ? -4.970  68.310 129.062 1.00 17.45 ? 303  LYS D CA  1 
ATOM   5101  C  C   . LYS B 1 285 ? -3.571  67.936 128.571 1.00 16.97 ? 303  LYS D C   1 
ATOM   5102  O  O   . LYS B 1 285 ? -2.571  68.523 128.989 1.00 16.83 ? 303  LYS D O   1 
ATOM   5103  C  CB  . LYS B 1 285 ? -5.506  69.498 128.256 1.00 17.52 ? 303  LYS D CB  1 
ATOM   5104  C  CG  . LYS B 1 285 ? -5.963  69.134 126.858 1.00 18.49 ? 303  LYS D CG  1 
ATOM   5105  C  CD  . LYS B 1 285 ? -6.436  70.348 126.082 1.00 20.51 ? 303  LYS D CD  1 
ATOM   5106  C  CE  . LYS B 1 285 ? -6.962  69.944 124.711 1.00 21.54 ? 303  LYS D CE  1 
ATOM   5107  N  NZ  . LYS B 1 285 ? -7.405  71.140 123.927 1.00 22.80 ? 303  LYS D NZ  1 
ATOM   5108  N  N   . VAL B 1 286 ? -3.520  66.940 127.697 1.00 16.67 ? 304  VAL D N   1 
ATOM   5109  C  CA  . VAL B 1 286 ? -2.287  66.480 127.088 1.00 16.48 ? 304  VAL D CA  1 
ATOM   5110  C  C   . VAL B 1 286 ? -2.441  66.650 125.576 1.00 16.83 ? 304  VAL D C   1 
ATOM   5111  O  O   . VAL B 1 286 ? -3.325  66.041 124.968 1.00 16.87 ? 304  VAL D O   1 
ATOM   5112  C  CB  . VAL B 1 286 ? -2.004  64.993 127.445 1.00 16.57 ? 304  VAL D CB  1 
ATOM   5113  C  CG1 . VAL B 1 286 ? -0.651  64.557 126.910 1.00 15.68 ? 304  VAL D CG1 1 
ATOM   5114  C  CG2 . VAL B 1 286 ? -2.069  64.773 128.962 1.00 16.09 ? 304  VAL D CG2 1 
ATOM   5115  N  N   . SER B 1 287 ? -1.599  67.496 124.979 1.00 16.85 ? 305  SER D N   1 
ATOM   5116  C  CA  . SER B 1 287 ? -1.738  67.859 123.566 1.00 16.84 ? 305  SER D CA  1 
ATOM   5117  C  C   . SER B 1 287 ? -0.440  67.749 122.784 1.00 16.57 ? 305  SER D C   1 
ATOM   5118  O  O   . SER B 1 287 ? 0.517   68.482 123.052 1.00 16.67 ? 305  SER D O   1 
ATOM   5119  C  CB  . SER B 1 287 ? -2.252  69.297 123.412 1.00 16.79 ? 305  SER D CB  1 
ATOM   5120  O  OG  . SER B 1 287 ? -3.491  69.481 124.053 1.00 18.50 ? 305  SER D OG  1 
ATOM   5121  N  N   . GLU B 1 288 ? -0.421  66.847 121.810 1.00 16.03 ? 306  GLU D N   1 
ATOM   5122  C  CA  . GLU B 1 288 ? 0.578   66.898 120.756 1.00 15.76 ? 306  GLU D CA  1 
ATOM   5123  C  C   . GLU B 1 288 ? 0.057   67.926 119.763 1.00 15.47 ? 306  GLU D C   1 
ATOM   5124  O  O   . GLU B 1 288 ? -0.987  67.733 119.127 1.00 15.70 ? 306  GLU D O   1 
ATOM   5125  C  CB  . GLU B 1 288 ? 0.791   65.525 120.112 1.00 15.70 ? 306  GLU D CB  1 
ATOM   5126  C  CG  . GLU B 1 288 ? 1.249   64.447 121.104 1.00 16.14 ? 306  GLU D CG  1 
ATOM   5127  C  CD  . GLU B 1 288 ? 1.636   63.149 120.432 1.00 17.37 ? 306  GLU D CD  1 
ATOM   5128  O  OE1 . GLU B 1 288 ? 2.575   63.153 119.602 1.00 18.54 ? 306  GLU D OE1 1 
ATOM   5129  O  OE2 . GLU B 1 288 ? 1.017   62.114 120.741 1.00 17.29 ? 306  GLU D OE2 1 
ATOM   5130  N  N   . ARG B 1 289 ? 0.765   69.044 119.677 1.00 14.99 ? 307  ARG D N   1 
ATOM   5131  C  CA  . ARG B 1 289 ? 0.296   70.202 118.926 1.00 14.67 ? 307  ARG D CA  1 
ATOM   5132  C  C   . ARG B 1 289 ? 1.471   71.091 118.568 1.00 14.60 ? 307  ARG D C   1 
ATOM   5133  O  O   . ARG B 1 289 ? 2.533   71.000 119.184 1.00 14.49 ? 307  ARG D O   1 
ATOM   5134  C  CB  . ARG B 1 289 ? -0.724  71.009 119.753 1.00 14.74 ? 307  ARG D CB  1 
ATOM   5135  C  CG  . ARG B 1 289 ? -0.189  71.528 121.092 1.00 13.99 ? 307  ARG D CG  1 
ATOM   5136  C  CD  . ARG B 1 289 ? -1.015  72.691 121.605 1.00 14.05 ? 307  ARG D CD  1 
ATOM   5137  N  NE  . ARG B 1 289 ? -0.745  73.924 120.865 1.00 14.24 ? 307  ARG D NE  1 
ATOM   5138  C  CZ  . ARG B 1 289 ? -1.377  75.077 121.064 1.00 14.75 ? 307  ARG D CZ  1 
ATOM   5139  N  NH1 . ARG B 1 289 ? -2.335  75.174 121.980 1.00 14.39 ? 307  ARG D NH1 1 
ATOM   5140  N  NH2 . ARG B 1 289 ? -1.053  76.138 120.340 1.00 15.23 ? 307  ARG D NH2 1 
ATOM   5141  N  N   . TYR B 1 290 ? 1.267   71.955 117.580 1.00 14.44 ? 308  TYR D N   1 
ATOM   5142  C  CA  . TYR B 1 290 ? 2.280   72.911 117.173 1.00 14.47 ? 308  TYR D CA  1 
ATOM   5143  C  C   . TYR B 1 290 ? 2.379   74.070 118.153 1.00 14.70 ? 308  TYR D C   1 
ATOM   5144  O  O   . TYR B 1 290 ? 1.379   74.561 118.676 1.00 14.67 ? 308  TYR D O   1 
ATOM   5145  C  CB  . TYR B 1 290 ? 2.038   73.381 115.735 1.00 14.31 ? 308  TYR D CB  1 
ATOM   5146  C  CG  . TYR B 1 290 ? 1.991   72.219 114.769 1.00 13.73 ? 308  TYR D CG  1 
ATOM   5147  C  CD1 . TYR B 1 290 ? 0.788   71.805 114.193 1.00 13.28 ? 308  TYR D CD1 1 
ATOM   5148  C  CD2 . TYR B 1 290 ? 3.147   71.509 114.461 1.00 12.87 ? 308  TYR D CD2 1 
ATOM   5149  C  CE1 . TYR B 1 290 ? 0.744   70.715 113.309 1.00 13.16 ? 308  TYR D CE1 1 
ATOM   5150  C  CE2 . TYR B 1 290 ? 3.119   70.424 113.592 1.00 13.39 ? 308  TYR D CE2 1 
ATOM   5151  C  CZ  . TYR B 1 290 ? 1.917   70.030 113.019 1.00 14.10 ? 308  TYR D CZ  1 
ATOM   5152  O  OH  . TYR B 1 290 ? 1.904   68.951 112.165 1.00 13.64 ? 308  TYR D OH  1 
ATOM   5153  N  N   . LEU B 1 291 ? 3.615   74.464 118.415 1.00 15.12 ? 309  LEU D N   1 
ATOM   5154  C  CA  . LEU B 1 291 ? 3.937   75.512 119.357 1.00 15.53 ? 309  LEU D CA  1 
ATOM   5155  C  C   . LEU B 1 291 ? 4.910   76.455 118.653 1.00 15.81 ? 309  LEU D C   1 
ATOM   5156  O  O   . LEU B 1 291 ? 5.925   76.012 118.109 1.00 16.21 ? 309  LEU D O   1 
ATOM   5157  C  CB  . LEU B 1 291 ? 4.590   74.894 120.601 1.00 15.51 ? 309  LEU D CB  1 
ATOM   5158  C  CG  . LEU B 1 291 ? 3.902   74.587 121.947 1.00 16.33 ? 309  LEU D CG  1 
ATOM   5159  C  CD1 . LEU B 1 291 ? 2.365   74.566 121.943 1.00 15.26 ? 309  LEU D CD1 1 
ATOM   5160  C  CD2 . LEU B 1 291 ? 4.489   73.312 122.570 1.00 15.43 ? 309  LEU D CD2 1 
ATOM   5161  N  N   . THR B 1 292 ? 4.597   77.746 118.644 1.00 15.87 ? 310  THR D N   1 
ATOM   5162  C  CA  . THR B 1 292 ? 5.463   78.728 117.995 1.00 16.02 ? 310  THR D CA  1 
ATOM   5163  C  C   . THR B 1 292 ? 6.075   79.674 119.021 1.00 16.42 ? 310  THR D C   1 
ATOM   5164  O  O   . THR B 1 292 ? 5.644   79.705 120.177 1.00 16.31 ? 310  THR D O   1 
ATOM   5165  C  CB  . THR B 1 292 ? 4.711   79.546 116.913 1.00 15.68 ? 310  THR D CB  1 
ATOM   5166  O  OG1 . THR B 1 292 ? 3.812   80.473 117.538 1.00 16.18 ? 310  THR D OG1 1 
ATOM   5167  C  CG2 . THR B 1 292 ? 3.934   78.628 115.964 1.00 15.32 ? 310  THR D CG2 1 
ATOM   5168  N  N   . MET B 1 293 ? 7.079   80.439 118.598 1.00 16.95 ? 311  MET D N   1 
ATOM   5169  C  CA  . MET B 1 293 ? 7.673   81.463 119.459 1.00 17.69 ? 311  MET D CA  1 
ATOM   5170  C  C   . MET B 1 293 ? 6.644   82.509 119.908 1.00 18.02 ? 311  MET D C   1 
ATOM   5171  O  O   . MET B 1 293 ? 6.683   82.970 121.052 1.00 18.19 ? 311  MET D O   1 
ATOM   5172  C  CB  . MET B 1 293 ? 8.873   82.129 118.780 1.00 17.26 ? 311  MET D CB  1 
ATOM   5173  C  CG  . MET B 1 293 ? 10.130  81.254 118.733 1.00 17.02 ? 311  MET D CG  1 
ATOM   5174  S  SD  . MET B 1 293 ? 10.693  80.670 120.354 1.00 17.77 ? 311  MET D SD  1 
ATOM   5175  C  CE  . MET B 1 293 ? 11.141  82.204 121.179 1.00 17.11 ? 311  MET D CE  1 
ATOM   5176  N  N   . ASP B 1 294 ? 5.719   82.855 119.014 1.00 18.73 ? 312  ASP D N   1 
ATOM   5177  C  CA  . ASP B 1 294 ? 4.656   83.822 119.315 1.00 19.49 ? 312  ASP D CA  1 
ATOM   5178  C  C   . ASP B 1 294 ? 3.620   83.294 120.306 1.00 19.23 ? 312  ASP D C   1 
ATOM   5179  O  O   . ASP B 1 294 ? 3.183   84.042 121.181 1.00 18.66 ? 312  ASP D O   1 
ATOM   5180  C  CB  . ASP B 1 294 ? 3.973   84.314 118.035 1.00 20.14 ? 312  ASP D CB  1 
ATOM   5181  C  CG  . ASP B 1 294 ? 4.813   85.337 117.273 1.00 23.38 ? 312  ASP D CG  1 
ATOM   5182  O  OD1 . ASP B 1 294 ? 5.787   85.888 117.848 1.00 26.14 ? 312  ASP D OD1 1 
ATOM   5183  O  OD2 . ASP B 1 294 ? 4.490   85.595 116.087 1.00 27.35 ? 312  ASP D OD2 1 
ATOM   5184  N  N   . ASP B 1 295 ? 3.231   82.020 120.163 1.00 19.23 ? 313  ASP D N   1 
ATOM   5185  C  CA  . ASP B 1 295 ? 2.409   81.324 121.170 1.00 19.40 ? 313  ASP D CA  1 
ATOM   5186  C  C   . ASP B 1 295 ? 3.022   81.482 122.555 1.00 19.59 ? 313  ASP D C   1 
ATOM   5187  O  O   . ASP B 1 295 ? 2.333   81.793 123.526 1.00 19.60 ? 313  ASP D O   1 
ATOM   5188  C  CB  . ASP B 1 295 ? 2.323   79.818 120.884 1.00 19.43 ? 313  ASP D CB  1 
ATOM   5189  C  CG  . ASP B 1 295 ? 1.496   79.483 119.665 1.00 19.16 ? 313  ASP D CG  1 
ATOM   5190  O  OD1 . ASP B 1 295 ? 0.794   80.366 119.131 1.00 19.47 ? 313  ASP D OD1 1 
ATOM   5191  O  OD2 . ASP B 1 295 ? 1.550   78.306 119.243 1.00 19.50 ? 313  ASP D OD2 1 
ATOM   5192  N  N   . LEU B 1 296 ? 4.329   81.249 122.616 1.00 19.74 ? 314  LEU D N   1 
ATOM   5193  C  CA  . LEU B 1 296 ? 5.098   81.220 123.852 1.00 20.17 ? 314  LEU D CA  1 
ATOM   5194  C  C   . LEU B 1 296 ? 5.244   82.620 124.476 1.00 20.48 ? 314  LEU D C   1 
ATOM   5195  O  O   . LEU B 1 296 ? 4.948   82.804 125.664 1.00 20.21 ? 314  LEU D O   1 
ATOM   5196  C  CB  . LEU B 1 296 ? 6.465   80.584 123.568 1.00 19.98 ? 314  LEU D CB  1 
ATOM   5197  C  CG  . LEU B 1 296 ? 7.359   79.875 124.597 1.00 20.55 ? 314  LEU D CG  1 
ATOM   5198  C  CD1 . LEU B 1 296 ? 8.660   80.627 124.813 1.00 21.39 ? 314  LEU D CD1 1 
ATOM   5199  C  CD2 . LEU B 1 296 ? 6.669   79.553 125.919 1.00 20.66 ? 314  LEU D CD2 1 
ATOM   5200  N  N   . THR B 1 297 ? 5.686   83.597 123.681 1.00 20.72 ? 315  THR D N   1 
ATOM   5201  C  CA  . THR B 1 297 ? 5.838   84.971 124.177 1.00 21.43 ? 315  THR D CA  1 
ATOM   5202  C  C   . THR B 1 297 ? 4.497   85.606 124.571 1.00 21.59 ? 315  THR D C   1 
ATOM   5203  O  O   . THR B 1 297 ? 4.432   86.351 125.546 1.00 21.81 ? 315  THR D O   1 
ATOM   5204  C  CB  . THR B 1 297 ? 6.626   85.896 123.205 1.00 21.19 ? 315  THR D CB  1 
ATOM   5205  O  OG1 . THR B 1 297 ? 5.995   85.918 121.924 1.00 21.71 ? 315  THR D OG1 1 
ATOM   5206  C  CG2 . THR B 1 297 ? 8.063   85.426 123.054 1.00 21.38 ? 315  THR D CG2 1 
ATOM   5207  N  N   . THR B 1 298 ? 3.439   85.290 123.826 1.00 22.10 ? 316  THR D N   1 
ATOM   5208  C  CA  . THR B 1 298 ? 2.076   85.723 124.157 1.00 22.93 ? 316  THR D CA  1 
ATOM   5209  C  C   . THR B 1 298 ? 1.600   85.117 125.486 1.00 23.28 ? 316  THR D C   1 
ATOM   5210  O  O   . THR B 1 298 ? 0.968   85.801 126.296 1.00 23.53 ? 316  THR D O   1 
ATOM   5211  C  CB  . THR B 1 298 ? 1.078   85.383 123.017 1.00 22.74 ? 316  THR D CB  1 
ATOM   5212  O  OG1 . THR B 1 298 ? 1.448   86.099 121.832 1.00 23.57 ? 316  THR D OG1 1 
ATOM   5213  C  CG2 . THR B 1 298 ? -0.348  85.751 123.384 1.00 23.09 ? 316  THR D CG2 1 
ATOM   5214  N  N   . ALA B 1 299 ? 1.904   83.839 125.700 1.00 23.64 ? 317  ALA D N   1 
ATOM   5215  C  CA  . ALA B 1 299 ? 1.555   83.159 126.942 1.00 23.83 ? 317  ALA D CA  1 
ATOM   5216  C  C   . ALA B 1 299 ? 2.339   83.721 128.126 1.00 24.15 ? 317  ALA D C   1 
ATOM   5217  O  O   . ALA B 1 299 ? 1.789   83.894 129.214 1.00 24.15 ? 317  ALA D O   1 
ATOM   5218  C  CB  . ALA B 1 299 ? 1.783   81.666 126.812 1.00 23.80 ? 317  ALA D CB  1 
ATOM   5219  N  N   . LEU B 1 300 ? 3.617   84.012 127.901 1.00 24.57 ? 318  LEU D N   1 
ATOM   5220  C  CA  . LEU B 1 300 ? 4.493   84.552 128.939 1.00 25.27 ? 318  LEU D CA  1 
ATOM   5221  C  C   . LEU B 1 300 ? 4.062   85.940 129.407 1.00 25.88 ? 318  LEU D C   1 
ATOM   5222  O  O   . LEU B 1 300 ? 4.149   86.255 130.599 1.00 25.83 ? 318  LEU D O   1 
ATOM   5223  C  CB  . LEU B 1 300 ? 5.948   84.581 128.461 1.00 24.96 ? 318  LEU D CB  1 
ATOM   5224  C  CG  . LEU B 1 300 ? 6.675   83.232 128.439 1.00 24.75 ? 318  LEU D CG  1 
ATOM   5225  C  CD1 . LEU B 1 300 ? 7.852   83.279 127.483 1.00 23.07 ? 318  LEU D CD1 1 
ATOM   5226  C  CD2 . LEU B 1 300 ? 7.116   82.801 129.838 1.00 23.23 ? 318  LEU D CD2 1 
ATOM   5227  N  N   . GLU B 1 301 ? 3.607   86.758 128.460 1.00 26.68 ? 319  GLU D N   1 
ATOM   5228  C  CA  . GLU B 1 301 ? 3.070   88.084 128.753 1.00 27.52 ? 319  GLU D CA  1 
ATOM   5229  C  C   . GLU B 1 301 ? 1.830   87.971 129.642 1.00 27.24 ? 319  GLU D C   1 
ATOM   5230  O  O   . GLU B 1 301 ? 1.690   88.715 130.607 1.00 27.38 ? 319  GLU D O   1 
ATOM   5231  C  CB  . GLU B 1 301 ? 2.756   88.837 127.454 1.00 28.05 ? 319  GLU D CB  1 
ATOM   5232  C  CG  . GLU B 1 301 ? 4.002   89.343 126.717 1.00 30.75 ? 319  GLU D CG  1 
ATOM   5233  C  CD  . GLU B 1 301 ? 3.776   89.645 125.227 1.00 34.02 ? 319  GLU D CD  1 
ATOM   5234  O  OE1 . GLU B 1 301 ? 2.608   89.795 124.784 1.00 35.19 ? 319  GLU D OE1 1 
ATOM   5235  O  OE2 . GLU B 1 301 ? 4.790   89.743 124.494 1.00 35.62 ? 319  GLU D OE2 1 
ATOM   5236  N  N   . GLY B 1 302 ? 0.957   87.013 129.327 1.00 27.14 ? 320  GLY D N   1 
ATOM   5237  C  CA  . GLY B 1 302 ? -0.245  86.753 130.118 1.00 26.65 ? 320  GLY D CA  1 
ATOM   5238  C  C   . GLY B 1 302 ? -0.048  85.846 131.323 1.00 26.47 ? 320  GLY D C   1 
ATOM   5239  O  O   . GLY B 1 302 ? -1.027  85.370 131.898 1.00 26.89 ? 320  GLY D O   1 
ATOM   5240  N  N   . ASN B 1 303 ? 1.212   85.617 131.707 1.00 26.11 ? 321  ASN D N   1 
ATOM   5241  C  CA  . ASN B 1 303 ? 1.592   84.757 132.849 1.00 25.69 ? 321  ASN D CA  1 
ATOM   5242  C  C   . ASN B 1 303 ? 0.966   83.356 132.834 1.00 24.83 ? 321  ASN D C   1 
ATOM   5243  O  O   . ASN B 1 303 ? 0.572   82.826 133.877 1.00 24.61 ? 321  ASN D O   1 
ATOM   5244  C  CB  . ASN B 1 303 ? 1.324   85.460 134.192 1.00 26.06 ? 321  ASN D CB  1 
ATOM   5245  C  CG  . ASN B 1 303 ? 2.011   86.809 134.296 1.00 27.74 ? 321  ASN D CG  1 
ATOM   5246  O  OD1 . ASN B 1 303 ? 3.247   86.898 134.342 1.00 29.48 ? 321  ASN D OD1 1 
ATOM   5247  N  ND2 . ASN B 1 303 ? 1.212   87.876 134.331 1.00 28.61 ? 321  ASN D ND2 1 
ATOM   5248  N  N   . ARG B 1 304 ? 0.902   82.759 131.645 1.00 23.76 ? 322  ARG D N   1 
ATOM   5249  C  CA  . ARG B 1 304 ? 0.234   81.477 131.444 1.00 22.73 ? 322  ARG D CA  1 
ATOM   5250  C  C   . ARG B 1 304 ? 1.184   80.274 131.432 1.00 22.16 ? 322  ARG D C   1 
ATOM   5251  O  O   . ARG B 1 304 ? 0.734   79.127 131.485 1.00 21.80 ? 322  ARG D O   1 
ATOM   5252  C  CB  . ARG B 1 304 ? -0.572  81.521 130.146 1.00 22.78 ? 322  ARG D CB  1 
ATOM   5253  C  CG  . ARG B 1 304 ? -1.881  82.303 130.231 1.00 22.86 ? 322  ARG D CG  1 
ATOM   5254  C  CD  . ARG B 1 304 ? -2.405  82.638 128.836 1.00 23.80 ? 322  ARG D CD  1 
ATOM   5255  N  NE  . ARG B 1 304 ? -2.177  81.530 127.907 1.00 25.23 ? 322  ARG D NE  1 
ATOM   5256  C  CZ  . ARG B 1 304 ? -1.914  81.664 126.610 1.00 24.72 ? 322  ARG D CZ  1 
ATOM   5257  N  NH1 . ARG B 1 304 ? -1.849  82.869 126.059 1.00 23.70 ? 322  ARG D NH1 1 
ATOM   5258  N  NH2 . ARG B 1 304 ? -1.711  80.583 125.864 1.00 24.19 ? 322  ARG D NH2 1 
ATOM   5259  N  N   . VAL B 1 305 ? 2.490   80.534 131.366 1.00 21.51 ? 323  VAL D N   1 
ATOM   5260  C  CA  . VAL B 1 305 ? 3.490   79.467 131.274 1.00 21.05 ? 323  VAL D CA  1 
ATOM   5261  C  C   . VAL B 1 305 ? 3.935   79.047 132.666 1.00 20.93 ? 323  VAL D C   1 
ATOM   5262  O  O   . VAL B 1 305 ? 4.270   79.895 133.494 1.00 20.78 ? 323  VAL D O   1 
ATOM   5263  C  CB  . VAL B 1 305 ? 4.736   79.894 130.433 1.00 20.94 ? 323  VAL D CB  1 
ATOM   5264  C  CG1 . VAL B 1 305 ? 5.795   78.788 130.400 1.00 20.92 ? 323  VAL D CG1 1 
ATOM   5265  C  CG2 . VAL B 1 305 ? 4.337   80.266 129.022 1.00 20.91 ? 323  VAL D CG2 1 
ATOM   5266  N  N   . ARG B 1 306 ? 3.935   77.739 132.916 1.00 20.83 ? 324  ARG D N   1 
ATOM   5267  C  CA  . ARG B 1 306 ? 4.428   77.194 134.177 1.00 20.73 ? 324  ARG D CA  1 
ATOM   5268  C  C   . ARG B 1 306 ? 5.862   76.698 134.029 1.00 20.12 ? 324  ARG D C   1 
ATOM   5269  O  O   . ARG B 1 306 ? 6.765   77.182 134.712 1.00 19.84 ? 324  ARG D O   1 
ATOM   5270  C  CB  . ARG B 1 306 ? 3.531   76.055 134.686 1.00 21.23 ? 324  ARG D CB  1 
ATOM   5271  C  CG  . ARG B 1 306 ? 2.034   76.354 134.770 1.00 23.47 ? 324  ARG D CG  1 
ATOM   5272  C  CD  . ARG B 1 306 ? 1.676   77.141 136.015 1.00 28.70 ? 324  ARG D CD  1 
ATOM   5273  N  NE  . ARG B 1 306 ? 1.728   78.583 135.770 1.00 33.05 ? 324  ARG D NE  1 
ATOM   5274  C  CZ  . ARG B 1 306 ? 0.663   79.359 135.566 1.00 34.90 ? 324  ARG D CZ  1 
ATOM   5275  N  NH1 . ARG B 1 306 ? -0.563  78.845 135.590 1.00 35.85 ? 324  ARG D NH1 1 
ATOM   5276  N  NH2 . ARG B 1 306 ? 0.825   80.659 135.345 1.00 35.38 ? 324  ARG D NH2 1 
ATOM   5277  N  N   . GLU B 1 307 ? 6.061   75.729 133.136 1.00 19.43 ? 325  GLU D N   1 
ATOM   5278  C  CA  . GLU B 1 307 ? 7.347   75.061 132.982 1.00 19.10 ? 325  GLU D CA  1 
ATOM   5279  C  C   . GLU B 1 307 ? 7.659   74.769 131.519 1.00 19.11 ? 325  GLU D C   1 
ATOM   5280  O  O   . GLU B 1 307 ? 6.758   74.531 130.702 1.00 19.03 ? 325  GLU D O   1 
ATOM   5281  C  CB  . GLU B 1 307 ? 7.371   73.727 133.750 1.00 18.98 ? 325  GLU D CB  1 
ATOM   5282  C  CG  . GLU B 1 307 ? 7.049   73.799 135.245 1.00 18.96 ? 325  GLU D CG  1 
ATOM   5283  C  CD  . GLU B 1 307 ? 6.973   72.425 135.899 1.00 18.99 ? 325  GLU D CD  1 
ATOM   5284  O  OE1 . GLU B 1 307 ? 6.098   72.237 136.768 1.00 17.86 ? 325  GLU D OE1 1 
ATOM   5285  O  OE2 . GLU B 1 307 ? 7.774   71.528 135.537 1.00 19.01 ? 325  GLU D OE2 1 
ATOM   5286  N  N   . MET B 1 308 ? 8.949   74.772 131.204 1.00 18.76 ? 326  MET D N   1 
ATOM   5287  C  CA  . MET B 1 308 ? 9.436   74.221 129.953 1.00 18.22 ? 326  MET D CA  1 
ATOM   5288  C  C   . MET B 1 308 ? 10.600  73.294 130.255 1.00 17.60 ? 326  MET D C   1 
ATOM   5289  O  O   . MET B 1 308 ? 11.487  73.627 131.043 1.00 17.88 ? 326  MET D O   1 
ATOM   5290  C  CB  . MET B 1 308 ? 9.867   75.319 128.985 1.00 18.44 ? 326  MET D CB  1 
ATOM   5291  C  CG  . MET B 1 308 ? 10.234  74.794 127.599 1.00 19.36 ? 326  MET D CG  1 
ATOM   5292  S  SD  . MET B 1 308 ? 10.841  76.076 126.489 1.00 21.92 ? 326  MET D SD  1 
ATOM   5293  C  CE  . MET B 1 308 ? 9.425   77.164 126.441 1.00 21.35 ? 326  MET D CE  1 
ATOM   5294  N  N   . PHE B 1 309 ? 10.590  72.122 129.636 1.00 16.85 ? 327  PHE D N   1 
ATOM   5295  C  CA  . PHE B 1 309 ? 11.677  71.178 129.819 1.00 16.37 ? 327  PHE D CA  1 
ATOM   5296  C  C   . PHE B 1 309 ? 11.902  70.330 128.589 1.00 16.33 ? 327  PHE D C   1 
ATOM   5297  O  O   . PHE B 1 309 ? 11.011  70.145 127.761 1.00 16.27 ? 327  PHE D O   1 
ATOM   5298  C  CB  . PHE B 1 309 ? 11.483  70.303 131.080 1.00 16.06 ? 327  PHE D CB  1 
ATOM   5299  C  CG  . PHE B 1 309 ? 10.152  69.584 131.145 1.00 15.89 ? 327  PHE D CG  1 
ATOM   5300  C  CD1 . PHE B 1 309 ? 9.029   70.212 131.678 1.00 16.05 ? 327  PHE D CD1 1 
ATOM   5301  C  CD2 . PHE B 1 309 ? 10.033  68.270 130.702 1.00 15.81 ? 327  PHE D CD2 1 
ATOM   5302  C  CE1 . PHE B 1 309 ? 7.803   69.553 131.742 1.00 15.67 ? 327  PHE D CE1 1 
ATOM   5303  C  CE2 . PHE B 1 309 ? 8.806   67.599 130.770 1.00 16.31 ? 327  PHE D CE2 1 
ATOM   5304  C  CZ  . PHE B 1 309 ? 7.693   68.245 131.289 1.00 15.81 ? 327  PHE D CZ  1 
ATOM   5305  N  N   . SER B 1 310 ? 13.121  69.832 128.475 1.00 16.29 ? 328  SER D N   1 
ATOM   5306  C  CA  . SER B 1 310 ? 13.445  68.865 127.470 1.00 16.60 ? 328  SER D CA  1 
ATOM   5307  C  C   . SER B 1 310 ? 13.486  67.486 128.100 1.00 15.78 ? 328  SER D C   1 
ATOM   5308  O  O   . SER B 1 310 ? 13.590  67.357 129.317 1.00 15.15 ? 328  SER D O   1 
ATOM   5309  C  CB  . SER B 1 310 ? 14.783  69.220 126.870 1.00 17.74 ? 328  SER D CB  1 
ATOM   5310  O  OG  . SER B 1 310 ? 15.638  69.769 127.870 1.00 21.54 ? 328  SER D OG  1 
ATOM   5311  N  N   . SER B 1 311 ? 13.375  66.459 127.262 1.00 15.07 ? 329  SER D N   1 
ATOM   5312  C  CA  . SER B 1 311 ? 13.443  65.076 127.716 1.00 13.96 ? 329  SER D CA  1 
ATOM   5313  C  C   . SER B 1 311 ? 14.362  64.264 126.816 1.00 13.62 ? 329  SER D C   1 
ATOM   5314  O  O   . SER B 1 311 ? 14.342  64.413 125.597 1.00 13.69 ? 329  SER D O   1 
ATOM   5315  C  CB  . SER B 1 311 ? 12.044  64.445 127.754 1.00 13.90 ? 329  SER D CB  1 
ATOM   5316  O  OG  . SER B 1 311 ? 11.541  64.186 126.446 1.00 12.08 ? 329  SER D OG  1 
ATOM   5317  N  N   . GLY B 1 312 ? 15.156  63.399 127.431 1.00 13.12 ? 330  GLY D N   1 
ATOM   5318  C  CA  . GLY B 1 312 ? 16.026  62.480 126.710 1.00 13.21 ? 330  GLY D CA  1 
ATOM   5319  C  C   . GLY B 1 312 ? 16.580  61.453 127.674 1.00 13.58 ? 330  GLY D C   1 
ATOM   5320  O  O   . GLY B 1 312 ? 16.456  61.608 128.889 1.00 13.14 ? 330  GLY D O   1 
ATOM   5321  N  N   . THR B 1 313 ? 17.196  60.410 127.130 1.00 13.90 ? 331  THR D N   1 
ATOM   5322  C  CA  . THR B 1 313 ? 17.739  59.315 127.929 1.00 14.44 ? 331  THR D CA  1 
ATOM   5323  C  C   . THR B 1 313 ? 18.858  59.745 128.891 1.00 15.19 ? 331  THR D C   1 
ATOM   5324  O  O   . THR B 1 313 ? 18.935  59.232 130.013 1.00 15.52 ? 331  THR D O   1 
ATOM   5325  C  CB  . THR B 1 313 ? 18.207  58.150 127.015 1.00 14.43 ? 331  THR D CB  1 
ATOM   5326  O  OG1 . THR B 1 313 ? 17.058  57.542 126.412 1.00 14.50 ? 331  THR D OG1 1 
ATOM   5327  C  CG2 . THR B 1 313 ? 19.003  57.094 127.791 1.00 12.92 ? 331  THR D CG2 1 
ATOM   5328  N  N   . ALA B 1 314 ? 19.702  60.681 128.461 1.00 15.95 ? 332  ALA D N   1 
ATOM   5329  C  CA  . ALA B 1 314 ? 20.825  61.157 129.284 1.00 17.18 ? 332  ALA D CA  1 
ATOM   5330  C  C   . ALA B 1 314 ? 20.434  61.995 130.521 1.00 18.06 ? 332  ALA D C   1 
ATOM   5331  O  O   . ALA B 1 314 ? 21.104  61.914 131.552 1.00 18.71 ? 332  ALA D O   1 
ATOM   5332  C  CB  . ALA B 1 314 ? 21.855  61.903 128.429 1.00 16.69 ? 332  ALA D CB  1 
ATOM   5333  N  N   . CYS B 1 315 ? 19.358  62.776 130.438 1.00 18.65 ? 333  CYS D N   1 
ATOM   5334  C  CA  . CYS B 1 315 ? 18.966  63.642 131.562 1.00 19.51 ? 333  CYS D CA  1 
ATOM   5335  C  C   . CYS B 1 315 ? 17.639  63.233 132.201 1.00 19.42 ? 333  CYS D C   1 
ATOM   5336  O  O   . CYS B 1 315 ? 17.319  63.656 133.320 1.00 19.63 ? 333  CYS D O   1 
ATOM   5337  C  CB  . CYS B 1 315 ? 18.862  65.103 131.103 1.00 19.44 ? 333  CYS D CB  1 
ATOM   5338  S  SG  . CYS B 1 315 ? 17.416  65.400 130.053 1.00 22.29 ? 333  CYS D SG  1 
ATOM   5339  N  N   . VAL B 1 316 ? 16.896  62.395 131.480 1.00 19.62 ? 334  VAL D N   1 
ATOM   5340  C  CA  . VAL B 1 316 ? 15.444  62.179 131.645 1.00 19.41 ? 334  VAL D CA  1 
ATOM   5341  C  C   . VAL B 1 316 ? 14.635  63.469 131.448 1.00 19.17 ? 334  VAL D C   1 
ATOM   5342  O  O   . VAL B 1 316 ? 13.837  63.556 130.528 1.00 18.88 ? 334  VAL D O   1 
ATOM   5343  C  CB  . VAL B 1 316 ? 15.004  61.235 132.864 1.00 19.75 ? 334  VAL D CB  1 
ATOM   5344  C  CG1 . VAL B 1 316 ? 16.074  61.078 133.950 1.00 20.71 ? 334  VAL D CG1 1 
ATOM   5345  C  CG2 . VAL B 1 316 ? 13.641  61.594 133.439 1.00 18.88 ? 334  VAL D CG2 1 
ATOM   5346  N  N   . VAL B 1 317 ? 14.881  64.475 132.275 1.00 19.04 ? 335  VAL D N   1 
ATOM   5347  C  CA  . VAL B 1 317 ? 14.189  65.752 132.155 1.00 19.11 ? 335  VAL D CA  1 
ATOM   5348  C  C   . VAL B 1 317 ? 15.177  66.893 132.426 1.00 18.79 ? 335  VAL D C   1 
ATOM   5349  O  O   . VAL B 1 317 ? 16.040  66.765 133.288 1.00 18.65 ? 335  VAL D O   1 
ATOM   5350  C  CB  . VAL B 1 317 ? 12.915  65.754 133.059 1.00 19.22 ? 335  VAL D CB  1 
ATOM   5351  C  CG1 . VAL B 1 317 ? 12.791  66.996 133.902 1.00 19.83 ? 335  VAL D CG1 1 
ATOM   5352  C  CG2 . VAL B 1 317 ? 11.669  65.511 132.206 1.00 20.09 ? 335  VAL D CG2 1 
ATOM   5353  N  N   . CYS B 1 318 ? 15.065  67.978 131.661 1.00 18.64 ? 336  CYS D N   1 
ATOM   5354  C  CA  . CYS B 1 318 ? 15.966  69.131 131.774 1.00 18.83 ? 336  CYS D CA  1 
ATOM   5355  C  C   . CYS B 1 318 ? 15.201  70.465 131.736 1.00 17.92 ? 336  CYS D C   1 
ATOM   5356  O  O   . CYS B 1 318 ? 14.773  70.897 130.674 1.00 18.26 ? 336  CYS D O   1 
ATOM   5357  C  CB  . CYS B 1 318 ? 17.008  69.086 130.650 1.00 18.95 ? 336  CYS D CB  1 
ATOM   5358  S  SG  . CYS B 1 318 ? 18.248  70.413 130.663 1.00 23.15 ? 336  CYS D SG  1 
ATOM   5359  N  N   . PRO B 1 319 ? 15.029  71.123 132.895 1.00 17.45 ? 337  PRO D N   1 
ATOM   5360  C  CA  . PRO B 1 319 ? 14.305  72.403 132.946 1.00 17.06 ? 337  PRO D CA  1 
ATOM   5361  C  C   . PRO B 1 319 ? 14.957  73.521 132.123 1.00 16.79 ? 337  PRO D C   1 
ATOM   5362  O  O   . PRO B 1 319 ? 16.188  73.590 132.023 1.00 16.03 ? 337  PRO D O   1 
ATOM   5363  C  CB  . PRO B 1 319 ? 14.324  72.766 134.438 1.00 17.16 ? 337  PRO D CB  1 
ATOM   5364  C  CG  . PRO B 1 319 ? 14.579  71.471 135.139 1.00 17.30 ? 337  PRO D CG  1 
ATOM   5365  C  CD  . PRO B 1 319 ? 15.482  70.703 134.233 1.00 17.21 ? 337  PRO D CD  1 
ATOM   5366  N  N   . VAL B 1 320 ? 14.117  74.371 131.531 1.00 16.48 ? 338  VAL D N   1 
ATOM   5367  C  CA  . VAL B 1 320 ? 14.572  75.511 130.739 1.00 16.48 ? 338  VAL D CA  1 
ATOM   5368  C  C   . VAL B 1 320 ? 14.188  76.815 131.442 1.00 16.96 ? 338  VAL D C   1 
ATOM   5369  O  O   . VAL B 1 320 ? 13.025  77.018 131.776 1.00 16.75 ? 338  VAL D O   1 
ATOM   5370  C  CB  . VAL B 1 320 ? 13.977  75.478 129.303 1.00 16.49 ? 338  VAL D CB  1 
ATOM   5371  C  CG1 . VAL B 1 320 ? 14.325  76.763 128.523 1.00 15.39 ? 338  VAL D CG1 1 
ATOM   5372  C  CG2 . VAL B 1 320 ? 14.445  74.222 128.549 1.00 15.99 ? 338  VAL D CG2 1 
ATOM   5373  N  N   . SER B 1 321 ? 15.168  77.693 131.651 1.00 17.44 ? 339  SER D N   1 
ATOM   5374  C  CA  . SER B 1 321 ? 14.945  78.958 132.350 1.00 18.21 ? 339  SER D CA  1 
ATOM   5375  C  C   . SER B 1 321 ? 14.901  80.182 131.430 1.00 18.71 ? 339  SER D C   1 
ATOM   5376  O  O   . SER B 1 321 ? 14.251  81.183 131.757 1.00 18.97 ? 339  SER D O   1 
ATOM   5377  C  CB  . SER B 1 321 ? 15.996  79.161 133.455 1.00 18.30 ? 339  SER D CB  1 
ATOM   5378  O  OG  . SER B 1 321 ? 17.299  79.310 132.911 1.00 19.03 ? 339  SER D OG  1 
ATOM   5379  N  N   . ASP B 1 322 ? 15.591  80.106 130.293 1.00 19.27 ? 340  ASP D N   1 
ATOM   5380  C  CA  . ASP B 1 322 ? 15.715  81.246 129.381 1.00 19.82 ? 340  ASP D CA  1 
ATOM   5381  C  C   . ASP B 1 322 ? 15.852  80.856 127.910 1.00 19.95 ? 340  ASP D C   1 
ATOM   5382  O  O   . ASP B 1 322 ? 16.418  79.817 127.576 1.00 19.97 ? 340  ASP D O   1 
ATOM   5383  C  CB  . ASP B 1 322 ? 16.912  82.127 129.773 1.00 20.02 ? 340  ASP D CB  1 
ATOM   5384  C  CG  . ASP B 1 322 ? 16.796  82.679 131.180 1.00 20.81 ? 340  ASP D CG  1 
ATOM   5385  O  OD1 . ASP B 1 322 ? 16.107  83.698 131.361 1.00 22.18 ? 340  ASP D OD1 1 
ATOM   5386  O  OD2 . ASP B 1 322 ? 17.393  82.086 132.106 1.00 22.06 ? 340  ASP D OD2 1 
ATOM   5387  N  N   . ILE B 1 323 ? 15.332  81.715 127.041 1.00 20.41 ? 341  ILE D N   1 
ATOM   5388  C  CA  . ILE B 1 323 ? 15.509  81.589 125.603 1.00 20.80 ? 341  ILE D CA  1 
ATOM   5389  C  C   . ILE B 1 323 ? 16.055  82.915 125.067 1.00 21.49 ? 341  ILE D C   1 
ATOM   5390  O  O   . ILE B 1 323 ? 15.450  83.965 125.281 1.00 21.47 ? 341  ILE D O   1 
ATOM   5391  C  CB  . ILE B 1 323 ? 14.183  81.226 124.881 1.00 20.57 ? 341  ILE D CB  1 
ATOM   5392  C  CG1 . ILE B 1 323 ? 13.639  79.885 125.389 1.00 20.18 ? 341  ILE D CG1 1 
ATOM   5393  C  CG2 . ILE B 1 323 ? 14.394  81.165 123.369 1.00 20.83 ? 341  ILE D CG2 1 
ATOM   5394  C  CD1 . ILE B 1 323 ? 12.234  79.570 124.949 1.00 19.46 ? 341  ILE D CD1 1 
ATOM   5395  N  N   . LEU B 1 324 ? 17.206  82.861 124.394 1.00 22.04 ? 342  LEU D N   1 
ATOM   5396  C  CA  . LEU B 1 324 ? 17.741  84.023 123.696 1.00 22.87 ? 342  LEU D CA  1 
ATOM   5397  C  C   . LEU B 1 324 ? 17.330  83.968 122.229 1.00 23.42 ? 342  LEU D C   1 
ATOM   5398  O  O   . LEU B 1 324 ? 17.735  83.071 121.486 1.00 23.39 ? 342  LEU D O   1 
ATOM   5399  C  CB  . LEU B 1 324 ? 19.264  84.119 123.825 1.00 22.88 ? 342  LEU D CB  1 
ATOM   5400  C  CG  . LEU B 1 324 ? 19.984  84.034 125.180 1.00 23.78 ? 342  LEU D CG  1 
ATOM   5401  C  CD1 . LEU B 1 324 ? 21.333  84.760 125.093 1.00 24.03 ? 342  LEU D CD1 1 
ATOM   5402  C  CD2 . LEU B 1 324 ? 19.175  84.546 126.362 1.00 23.26 ? 342  LEU D CD2 1 
ATOM   5403  N  N   . TYR B 1 325 ? 16.517  84.939 121.833 1.00 24.06 ? 343  TYR D N   1 
ATOM   5404  C  CA  . TYR B 1 325 ? 15.869  84.956 120.530 1.00 24.71 ? 343  TYR D CA  1 
ATOM   5405  C  C   . TYR B 1 325 ? 15.788  86.404 120.062 1.00 25.22 ? 343  TYR D C   1 
ATOM   5406  O  O   . TYR B 1 325 ? 15.274  87.253 120.787 1.00 25.46 ? 343  TYR D O   1 
ATOM   5407  C  CB  . TYR B 1 325 ? 14.465  84.361 120.668 1.00 24.49 ? 343  TYR D CB  1 
ATOM   5408  C  CG  . TYR B 1 325 ? 13.625  84.335 119.414 1.00 24.70 ? 343  TYR D CG  1 
ATOM   5409  C  CD1 . TYR B 1 325 ? 12.432  85.055 119.342 1.00 25.07 ? 343  TYR D CD1 1 
ATOM   5410  C  CD2 . TYR B 1 325 ? 14.003  83.571 118.307 1.00 25.05 ? 343  TYR D CD2 1 
ATOM   5411  C  CE1 . TYR B 1 325 ? 11.643  85.028 118.194 1.00 25.32 ? 343  TYR D CE1 1 
ATOM   5412  C  CE2 . TYR B 1 325 ? 13.225  83.536 117.152 1.00 25.02 ? 343  TYR D CE2 1 
ATOM   5413  C  CZ  . TYR B 1 325 ? 12.046  84.263 117.102 1.00 26.18 ? 343  TYR D CZ  1 
ATOM   5414  O  OH  . TYR B 1 325 ? 11.270  84.226 115.961 1.00 26.64 ? 343  TYR D OH  1 
ATOM   5415  N  N   . LYS B 1 326 ? 16.316  86.676 118.866 1.00 25.68 ? 344  LYS D N   1 
ATOM   5416  C  CA  . LYS B 1 326 ? 16.320  88.021 118.259 1.00 26.14 ? 344  LYS D CA  1 
ATOM   5417  C  C   . LYS B 1 326 ? 16.864  89.133 119.180 1.00 26.05 ? 344  LYS D C   1 
ATOM   5418  O  O   . LYS B 1 326 ? 16.305  90.235 119.238 1.00 26.21 ? 344  LYS D O   1 
ATOM   5419  C  CB  . LYS B 1 326 ? 14.921  88.387 117.733 1.00 26.41 ? 344  LYS D CB  1 
ATOM   5420  C  CG  . LYS B 1 326 ? 14.397  87.453 116.642 1.00 28.05 ? 344  LYS D CG  1 
ATOM   5421  C  CD  . LYS B 1 326 ? 13.160  88.020 115.960 1.00 29.64 ? 344  LYS D CD  1 
ATOM   5422  C  CE  . LYS B 1 326 ? 13.015  87.438 114.547 1.00 32.03 ? 344  LYS D CE  1 
ATOM   5423  N  NZ  . LYS B 1 326 ? 11.875  88.025 113.775 1.00 32.25 ? 344  LYS D NZ  1 
ATOM   5424  N  N   . GLY B 1 327 ? 17.950  88.840 119.891 1.00 25.75 ? 345  GLY D N   1 
ATOM   5425  C  CA  . GLY B 1 327 ? 18.565  89.806 120.803 1.00 25.49 ? 345  GLY D CA  1 
ATOM   5426  C  C   . GLY B 1 327 ? 17.895  89.962 122.162 1.00 25.60 ? 345  GLY D C   1 
ATOM   5427  O  O   . GLY B 1 327 ? 18.430  90.641 123.043 1.00 25.59 ? 345  GLY D O   1 
ATOM   5428  N  N   . GLU B 1 328 ? 16.733  89.331 122.339 1.00 25.39 ? 346  GLU D N   1 
ATOM   5429  C  CA  . GLU B 1 328 ? 16.009  89.367 123.611 1.00 25.27 ? 346  GLU D CA  1 
ATOM   5430  C  C   . GLU B 1 328 ? 16.431  88.212 124.507 1.00 24.61 ? 346  GLU D C   1 
ATOM   5431  O  O   . GLU B 1 328 ? 16.838  87.152 124.019 1.00 24.69 ? 346  GLU D O   1 
ATOM   5432  C  CB  . GLU B 1 328 ? 14.497  89.260 123.389 1.00 25.53 ? 346  GLU D CB  1 
ATOM   5433  C  CG  . GLU B 1 328 ? 13.949  90.008 122.189 1.00 27.76 ? 346  GLU D CG  1 
ATOM   5434  C  CD  . GLU B 1 328 ? 12.533  89.570 121.838 1.00 31.74 ? 346  GLU D CD  1 
ATOM   5435  O  OE1 . GLU B 1 328 ? 12.287  89.269 120.647 1.00 32.92 ? 346  GLU D OE1 1 
ATOM   5436  O  OE2 . GLU B 1 328 ? 11.673  89.508 122.756 1.00 32.99 ? 346  GLU D OE2 1 
ATOM   5437  N  N   . THR B 1 329 ? 16.322  88.418 125.818 1.00 23.66 ? 347  THR D N   1 
ATOM   5438  C  CA  . THR B 1 329 ? 16.436  87.323 126.779 1.00 22.85 ? 347  THR D CA  1 
ATOM   5439  C  C   . THR B 1 329 ? 15.053  87.056 127.349 1.00 22.51 ? 347  THR D C   1 
ATOM   5440  O  O   . THR B 1 329 ? 14.515  87.862 128.113 1.00 22.65 ? 347  THR D O   1 
ATOM   5441  C  CB  . THR B 1 329 ? 17.448  87.628 127.901 1.00 22.88 ? 347  THR D CB  1 
ATOM   5442  O  OG1 . THR B 1 329 ? 18.758  87.748 127.335 1.00 21.71 ? 347  THR D OG1 1 
ATOM   5443  C  CG2 . THR B 1 329 ? 17.446  86.520 128.950 1.00 22.29 ? 347  THR D CG2 1 
ATOM   5444  N  N   . ILE B 1 330 ? 14.480  85.925 126.946 1.00 21.72 ? 348  ILE D N   1 
ATOM   5445  C  CA  . ILE B 1 330 ? 13.120  85.557 127.309 1.00 20.87 ? 348  ILE D CA  1 
ATOM   5446  C  C   . ILE B 1 330 ? 13.171  84.587 128.483 1.00 20.62 ? 348  ILE D C   1 
ATOM   5447  O  O   . ILE B 1 330 ? 13.640  83.458 128.353 1.00 20.40 ? 348  ILE D O   1 
ATOM   5448  C  CB  . ILE B 1 330 ? 12.370  84.945 126.100 1.00 20.97 ? 348  ILE D CB  1 
ATOM   5449  C  CG1 . ILE B 1 330 ? 12.339  85.954 124.941 1.00 20.71 ? 348  ILE D CG1 1 
ATOM   5450  C  CG2 . ILE B 1 330 ? 10.955  84.511 126.491 1.00 20.78 ? 348  ILE D CG2 1 
ATOM   5451  C  CD1 . ILE B 1 330 ? 12.137  85.337 123.577 1.00 21.63 ? 348  ILE D CD1 1 
ATOM   5452  N  N   . HIS B 1 331 ? 12.707  85.049 129.639 1.00 20.02 ? 349  HIS D N   1 
ATOM   5453  C  CA  . HIS B 1 331 ? 12.743  84.234 130.835 1.00 19.47 ? 349  HIS D CA  1 
ATOM   5454  C  C   . HIS B 1 331 ? 11.551  83.292 130.890 1.00 19.16 ? 349  HIS D C   1 
ATOM   5455  O  O   . HIS B 1 331 ? 10.422  83.685 130.612 1.00 19.24 ? 349  HIS D O   1 
ATOM   5456  C  CB  . HIS B 1 331 ? 12.804  85.095 132.101 1.00 19.17 ? 349  HIS D CB  1 
ATOM   5457  C  CG  . HIS B 1 331 ? 12.954  84.294 133.353 1.00 18.39 ? 349  HIS D CG  1 
ATOM   5458  N  ND1 . HIS B 1 331 ? 14.118  83.628 133.671 1.00 18.54 ? 349  HIS D ND1 1 
ATOM   5459  C  CD2 . HIS B 1 331 ? 12.080  84.023 134.350 1.00 17.95 ? 349  HIS D CD2 1 
ATOM   5460  C  CE1 . HIS B 1 331 ? 13.960  82.996 134.819 1.00 18.18 ? 349  HIS D CE1 1 
ATOM   5461  N  NE2 . HIS B 1 331 ? 12.732  83.220 135.251 1.00 18.32 ? 349  HIS D NE2 1 
ATOM   5462  N  N   . ILE B 1 332 ? 11.830  82.043 131.246 1.00 18.99 ? 350  ILE D N   1 
ATOM   5463  C  CA  . ILE B 1 332 ? 10.797  81.029 131.440 1.00 18.52 ? 350  ILE D CA  1 
ATOM   5464  C  C   . ILE B 1 332 ? 10.757  80.730 132.936 1.00 18.39 ? 350  ILE D C   1 
ATOM   5465  O  O   . ILE B 1 332 ? 11.790  80.387 133.521 1.00 18.36 ? 350  ILE D O   1 
ATOM   5466  C  CB  . ILE B 1 332 ? 11.084  79.733 130.614 1.00 18.50 ? 350  ILE D CB  1 
ATOM   5467  C  CG1 . ILE B 1 332 ? 11.619  80.065 129.202 1.00 18.33 ? 350  ILE D CG1 1 
ATOM   5468  C  CG2 . ILE B 1 332 ? 9.860   78.811 130.582 1.00 17.45 ? 350  ILE D CG2 1 
ATOM   5469  C  CD1 . ILE B 1 332 ? 10.635  80.762 128.255 1.00 19.46 ? 350  ILE D CD1 1 
ATOM   5470  N  N   . PRO B 1 333 ? 9.571   80.879 133.564 1.00 18.38 ? 351  PRO D N   1 
ATOM   5471  C  CA  . PRO B 1 333 ? 9.422   80.782 135.026 1.00 18.49 ? 351  PRO D CA  1 
ATOM   5472  C  C   . PRO B 1 333 ? 9.413   79.351 135.577 1.00 18.47 ? 351  PRO D C   1 
ATOM   5473  O  O   . PRO B 1 333 ? 8.841   79.096 136.644 1.00 18.35 ? 351  PRO D O   1 
ATOM   5474  C  CB  . PRO B 1 333 ? 8.073   81.463 135.276 1.00 18.43 ? 351  PRO D CB  1 
ATOM   5475  C  CG  . PRO B 1 333 ? 7.295   81.178 134.042 1.00 18.61 ? 351  PRO D CG  1 
ATOM   5476  C  CD  . PRO B 1 333 ? 8.283   81.175 132.904 1.00 18.19 ? 351  PRO D CD  1 
ATOM   5477  N  N   . THR B 1 334 ? 10.058  78.438 134.856 1.00 18.45 ? 352  THR D N   1 
ATOM   5478  C  CA  . THR B 1 334 ? 10.136  77.027 135.225 1.00 18.38 ? 352  THR D CA  1 
ATOM   5479  C  C   . THR B 1 334 ? 10.563  76.816 136.679 1.00 18.75 ? 352  THR D C   1 
ATOM   5480  O  O   . THR B 1 334 ? 9.894   76.106 137.434 1.00 18.33 ? 352  THR D O   1 
ATOM   5481  C  CB  . THR B 1 334 ? 11.120  76.277 134.294 1.00 18.30 ? 352  THR D CB  1 
ATOM   5482  O  OG1 . THR B 1 334 ? 10.707  76.447 132.933 1.00 17.27 ? 352  THR D OG1 1 
ATOM   5483  C  CG2 . THR B 1 334 ? 11.172  74.793 134.632 1.00 17.77 ? 352  THR D CG2 1 
ATOM   5484  N  N   . MET B 1 335 ? 11.677  77.441 137.056 1.00 19.28 ? 353  MET D N   1 
ATOM   5485  C  CA  . MET B 1 335 ? 12.285  77.218 138.365 1.00 19.93 ? 353  MET D CA  1 
ATOM   5486  C  C   . MET B 1 335 ? 11.527  77.916 139.493 1.00 20.37 ? 353  MET D C   1 
ATOM   5487  O  O   . MET B 1 335 ? 11.637  77.518 140.650 1.00 20.59 ? 353  MET D O   1 
ATOM   5488  C  CB  . MET B 1 335 ? 13.757  77.642 138.352 1.00 19.85 ? 353  MET D CB  1 
ATOM   5489  C  CG  . MET B 1 335 ? 14.632  76.842 137.394 1.00 20.21 ? 353  MET D CG  1 
ATOM   5490  S  SD  . MET B 1 335 ? 14.520  75.041 137.552 1.00 22.00 ? 353  MET D SD  1 
ATOM   5491  C  CE  . MET B 1 335 ? 15.430  74.759 139.074 1.00 20.47 ? 353  MET D CE  1 
ATOM   5492  N  N   . GLU B 1 336 ? 10.766  78.952 139.137 1.00 20.95 ? 354  GLU D N   1 
ATOM   5493  C  CA  . GLU B 1 336 ? 9.909   79.684 140.069 1.00 21.39 ? 354  GLU D CA  1 
ATOM   5494  C  C   . GLU B 1 336 ? 8.573   78.974 140.268 1.00 21.52 ? 354  GLU D C   1 
ATOM   5495  O  O   . GLU B 1 336 ? 7.796   79.347 141.139 1.00 21.85 ? 354  GLU D O   1 
ATOM   5496  C  CB  . GLU B 1 336 ? 9.669   81.116 139.573 1.00 21.65 ? 354  GLU D CB  1 
ATOM   5497  C  CG  . GLU B 1 336 ? 10.887  82.048 139.678 1.00 22.61 ? 354  GLU D CG  1 
ATOM   5498  C  CD  . GLU B 1 336 ? 11.898  81.848 138.556 1.00 24.15 ? 354  GLU D CD  1 
ATOM   5499  O  OE1 . GLU B 1 336 ? 13.096  81.676 138.865 1.00 26.51 ? 354  GLU D OE1 1 
ATOM   5500  O  OE2 . GLU B 1 336 ? 11.505  81.865 137.371 1.00 23.95 ? 354  GLU D OE2 1 
ATOM   5501  N  N   . ASN B 1 337 ? 8.310   77.953 139.453 1.00 21.71 ? 355  ASN D N   1 
ATOM   5502  C  CA  . ASN B 1 337 ? 7.118   77.115 139.603 1.00 21.60 ? 355  ASN D CA  1 
ATOM   5503  C  C   . ASN B 1 337 ? 7.450   75.689 140.081 1.00 21.50 ? 355  ASN D C   1 
ATOM   5504  O  O   . ASN B 1 337 ? 6.759   74.732 139.735 1.00 21.76 ? 355  ASN D O   1 
ATOM   5505  C  CB  . ASN B 1 337 ? 6.310   77.086 138.293 1.00 21.56 ? 355  ASN D CB  1 
ATOM   5506  C  CG  . ASN B 1 337 ? 5.615   78.419 137.992 1.00 22.46 ? 355  ASN D CG  1 
ATOM   5507  O  OD1 . ASN B 1 337 ? 4.782   78.891 138.770 1.00 24.25 ? 355  ASN D OD1 1 
ATOM   5508  N  ND2 . ASN B 1 337 ? 5.943   79.019 136.850 1.00 20.83 ? 355  ASN D ND2 1 
ATOM   5509  N  N   . GLY B 1 338 ? 8.503   75.549 140.882 1.00 21.35 ? 356  GLY D N   1 
ATOM   5510  C  CA  . GLY B 1 338 ? 8.905   74.233 141.405 1.00 21.41 ? 356  GLY D CA  1 
ATOM   5511  C  C   . GLY B 1 338 ? 10.311  73.812 140.989 1.00 21.11 ? 356  GLY D C   1 
ATOM   5512  O  O   . GLY B 1 338 ? 11.245  73.967 141.758 1.00 21.57 ? 356  GLY D O   1 
ATOM   5513  N  N   . PRO B 1 339 ? 10.475  73.268 139.767 1.00 21.11 ? 357  PRO D N   1 
ATOM   5514  C  CA  . PRO B 1 339 ? 9.427   72.961 138.788 1.00 20.81 ? 357  PRO D CA  1 
ATOM   5515  C  C   . PRO B 1 339 ? 8.706   71.686 139.194 1.00 20.43 ? 357  PRO D C   1 
ATOM   5516  O  O   . PRO B 1 339 ? 9.314   70.617 139.188 1.00 20.49 ? 357  PRO D O   1 
ATOM   5517  C  CB  . PRO B 1 339 ? 10.215  72.734 137.495 1.00 20.53 ? 357  PRO D CB  1 
ATOM   5518  C  CG  . PRO B 1 339 ? 11.556  72.262 137.948 1.00 20.93 ? 357  PRO D CG  1 
ATOM   5519  C  CD  . PRO B 1 339 ? 11.821  72.906 139.272 1.00 20.90 ? 357  PRO D CD  1 
ATOM   5520  N  N   . LYS B 1 340 ? 7.432   71.787 139.560 1.00 20.28 ? 358  LYS D N   1 
ATOM   5521  C  CA  . LYS B 1 340 ? 6.744   70.605 140.109 1.00 20.40 ? 358  LYS D CA  1 
ATOM   5522  C  C   . LYS B 1 340 ? 6.463   69.472 139.121 1.00 19.43 ? 358  LYS D C   1 
ATOM   5523  O  O   . LYS B 1 340 ? 6.647   68.310 139.473 1.00 19.35 ? 358  LYS D O   1 
ATOM   5524  C  CB  . LYS B 1 340 ? 5.502   70.955 140.950 1.00 21.00 ? 358  LYS D CB  1 
ATOM   5525  C  CG  . LYS B 1 340 ? 4.834   72.278 140.658 1.00 22.89 ? 358  LYS D CG  1 
ATOM   5526  C  CD  . LYS B 1 340 ? 3.897   72.709 141.807 1.00 25.75 ? 358  LYS D CD  1 
ATOM   5527  C  CE  . LYS B 1 340 ? 2.620   71.857 141.900 1.00 26.69 ? 358  LYS D CE  1 
ATOM   5528  N  NZ  . LYS B 1 340 ? 2.787   70.681 142.812 1.00 28.05 ? 358  LYS D NZ  1 
ATOM   5529  N  N   . LEU B 1 341 ? 6.040   69.791 137.898 1.00 18.50 ? 359  LEU D N   1 
ATOM   5530  C  CA  . LEU B 1 341 ? 5.790   68.738 136.908 1.00 17.54 ? 359  LEU D CA  1 
ATOM   5531  C  C   . LEU B 1 341 ? 7.090   68.044 136.494 1.00 17.10 ? 359  LEU D C   1 
ATOM   5532  O  O   . LEU B 1 341 ? 7.158   66.812 136.464 1.00 16.90 ? 359  LEU D O   1 
ATOM   5533  C  CB  . LEU B 1 341 ? 5.020   69.253 135.686 1.00 17.27 ? 359  LEU D CB  1 
ATOM   5534  C  CG  . LEU B 1 341 ? 4.679   68.169 134.649 1.00 17.28 ? 359  LEU D CG  1 
ATOM   5535  C  CD1 . LEU B 1 341 ? 3.756   67.092 135.241 1.00 16.34 ? 359  LEU D CD1 1 
ATOM   5536  C  CD2 . LEU B 1 341 ? 4.094   68.757 133.360 1.00 16.54 ? 359  LEU D CD2 1 
ATOM   5537  N  N   . ALA B 1 342 ? 8.117   68.840 136.201 1.00 16.63 ? 360  ALA D N   1 
ATOM   5538  C  CA  . ALA B 1 342 ? 9.432   68.312 135.850 1.00 16.20 ? 360  ALA D CA  1 
ATOM   5539  C  C   . ALA B 1 342 ? 9.990   67.399 136.946 1.00 15.99 ? 360  ALA D C   1 
ATOM   5540  O  O   . ALA B 1 342 ? 10.516  66.319 136.658 1.00 15.55 ? 360  ALA D O   1 
ATOM   5541  C  CB  . ALA B 1 342 ? 10.406  69.459 135.550 1.00 16.13 ? 360  ALA D CB  1 
ATOM   5542  N  N   . SER B 1 343 ? 9.870   67.822 138.203 1.00 15.84 ? 361  SER D N   1 
ATOM   5543  C  CA  . SER B 1 343 ? 10.418  67.021 139.283 1.00 16.44 ? 361  SER D CA  1 
ATOM   5544  C  C   . SER B 1 343 ? 9.554   65.784 139.567 1.00 15.89 ? 361  SER D C   1 
ATOM   5545  O  O   . SER B 1 343 ? 10.089  64.727 139.898 1.00 15.60 ? 361  SER D O   1 
ATOM   5546  C  CB  . SER B 1 343 ? 10.730  67.864 140.537 1.00 16.69 ? 361  SER D CB  1 
ATOM   5547  O  OG  . SER B 1 343 ? 9.554   68.268 141.201 1.00 19.65 ? 361  SER D OG  1 
ATOM   5548  N  N   . ARG B 1 344 ? 8.238   65.903 139.373 1.00 15.79 ? 362  ARG D N   1 
ATOM   5549  C  CA  . ARG B 1 344 ? 7.324   64.746 139.452 1.00 15.36 ? 362  ARG D CA  1 
ATOM   5550  C  C   . ARG B 1 344 ? 7.670   63.659 138.416 1.00 15.50 ? 362  ARG D C   1 
ATOM   5551  O  O   . ARG B 1 344 ? 7.688   62.467 138.741 1.00 15.22 ? 362  ARG D O   1 
ATOM   5552  C  CB  . ARG B 1 344 ? 5.857   65.184 139.311 1.00 15.08 ? 362  ARG D CB  1 
ATOM   5553  C  CG  . ARG B 1 344 ? 4.836   64.039 139.400 1.00 14.69 ? 362  ARG D CG  1 
ATOM   5554  C  CD  . ARG B 1 344 ? 3.416   64.562 139.292 1.00 14.99 ? 362  ARG D CD  1 
ATOM   5555  N  NE  . ARG B 1 344 ? 2.415   63.502 139.337 1.00 13.56 ? 362  ARG D NE  1 
ATOM   5556  C  CZ  . ARG B 1 344 ? 1.108   63.696 139.166 1.00 14.06 ? 362  ARG D CZ  1 
ATOM   5557  N  NH1 . ARG B 1 344 ? 0.626   64.916 138.939 1.00 13.06 ? 362  ARG D NH1 1 
ATOM   5558  N  NH2 . ARG B 1 344 ? 0.274   62.667 139.221 1.00 14.15 ? 362  ARG D NH2 1 
ATOM   5559  N  N   . ILE B 1 345 ? 7.951   64.088 137.184 1.00 15.51 ? 363  ILE D N   1 
ATOM   5560  C  CA  . ILE B 1 345 ? 8.357   63.197 136.093 1.00 15.47 ? 363  ILE D CA  1 
ATOM   5561  C  C   . ILE B 1 345 ? 9.707   62.550 136.383 1.00 15.60 ? 363  ILE D C   1 
ATOM   5562  O  O   . ILE B 1 345 ? 9.880   61.328 136.235 1.00 15.59 ? 363  ILE D O   1 
ATOM   5563  C  CB  . ILE B 1 345 ? 8.420   63.969 134.738 1.00 15.47 ? 363  ILE D CB  1 
ATOM   5564  C  CG1 . ILE B 1 345 ? 7.012   64.387 134.301 1.00 15.53 ? 363  ILE D CG1 1 
ATOM   5565  C  CG2 . ILE B 1 345 ? 9.115   63.128 133.647 1.00 14.75 ? 363  ILE D CG2 1 
ATOM   5566  C  CD1 . ILE B 1 345 ? 6.979   65.360 133.139 1.00 15.14 ? 363  ILE D CD1 1 
ATOM   5567  N  N   . LEU B 1 346 ? 10.669  63.375 136.790 1.00 15.84 ? 364  LEU D N   1 
ATOM   5568  C  CA  . LEU B 1 346 ? 11.988  62.871 137.149 1.00 15.78 ? 364  LEU D CA  1 
ATOM   5569  C  C   . LEU B 1 346 ? 11.865  61.793 138.226 1.00 15.53 ? 364  LEU D C   1 
ATOM   5570  O  O   . LEU B 1 346 ? 12.398  60.700 138.065 1.00 15.48 ? 364  LEU D O   1 
ATOM   5571  C  CB  . LEU B 1 346 ? 12.924  64.009 137.592 1.00 15.68 ? 364  LEU D CB  1 
ATOM   5572  C  CG  . LEU B 1 346 ? 14.313  63.560 138.088 1.00 16.70 ? 364  LEU D CG  1 
ATOM   5573  C  CD1 . LEU B 1 346 ? 15.146  62.942 136.967 1.00 15.65 ? 364  LEU D CD1 1 
ATOM   5574  C  CD2 . LEU B 1 346 ? 15.073  64.694 138.744 1.00 16.52 ? 364  LEU D CD2 1 
ATOM   5575  N  N   . SER B 1 347 ? 11.140  62.095 139.305 1.00 15.66 ? 365  SER D N   1 
ATOM   5576  C  CA  . SER B 1 347 ? 10.914  61.128 140.390 1.00 15.76 ? 365  SER D CA  1 
ATOM   5577  C  C   . SER B 1 347 ? 10.221  59.865 139.907 1.00 15.64 ? 365  SER D C   1 
ATOM   5578  O  O   . SER B 1 347 ? 10.650  58.757 140.232 1.00 15.26 ? 365  SER D O   1 
ATOM   5579  C  CB  . SER B 1 347 ? 10.090  61.754 141.520 1.00 15.76 ? 365  SER D CB  1 
ATOM   5580  O  OG  . SER B 1 347 ? 10.856  62.730 142.197 1.00 17.51 ? 365  SER D OG  1 
ATOM   5581  N  N   . LYS B 1 348 ? 9.152   60.035 139.130 1.00 15.61 ? 366  LYS D N   1 
ATOM   5582  C  CA  . LYS B 1 348 ? 8.404   58.891 138.621 1.00 16.25 ? 366  LYS D CA  1 
ATOM   5583  C  C   . LYS B 1 348 ? 9.266   57.932 137.793 1.00 16.09 ? 366  LYS D C   1 
ATOM   5584  O  O   . LYS B 1 348 ? 9.303   56.740 138.076 1.00 15.95 ? 366  LYS D O   1 
ATOM   5585  C  CB  . LYS B 1 348 ? 7.169   59.329 137.819 1.00 16.38 ? 366  LYS D CB  1 
ATOM   5586  C  CG  . LYS B 1 348 ? 6.330   58.150 137.323 1.00 18.18 ? 366  LYS D CG  1 
ATOM   5587  C  CD  . LYS B 1 348 ? 5.124   57.843 138.216 1.00 21.19 ? 366  LYS D CD  1 
ATOM   5588  C  CE  . LYS B 1 348 ? 5.497   57.419 139.627 1.00 23.34 ? 366  LYS D CE  1 
ATOM   5589  N  NZ  . LYS B 1 348 ? 4.290   57.379 140.518 1.00 24.90 ? 366  LYS D NZ  1 
ATOM   5590  N  N   . LEU B 1 349 ? 9.953   58.455 136.779 1.00 16.25 ? 367  LEU D N   1 
ATOM   5591  C  CA  . LEU B 1 349 ? 10.772  57.617 135.895 1.00 16.30 ? 367  LEU D CA  1 
ATOM   5592  C  C   . LEU B 1 349 ? 11.963  56.977 136.628 1.00 16.31 ? 367  LEU D C   1 
ATOM   5593  O  O   . LEU B 1 349 ? 12.235  55.796 136.453 1.00 16.28 ? 367  LEU D O   1 
ATOM   5594  C  CB  . LEU B 1 349 ? 11.203  58.394 134.638 1.00 16.32 ? 367  LEU D CB  1 
ATOM   5595  C  CG  . LEU B 1 349 ? 10.046  58.807 133.705 1.00 16.89 ? 367  LEU D CG  1 
ATOM   5596  C  CD1 . LEU B 1 349 ? 10.498  59.786 132.619 1.00 17.77 ? 367  LEU D CD1 1 
ATOM   5597  C  CD2 . LEU B 1 349 ? 9.365   57.596 133.072 1.00 17.27 ? 367  LEU D CD2 1 
ATOM   5598  N  N   . THR B 1 350 ? 12.642  57.760 137.463 1.00 16.55 ? 368  THR D N   1 
ATOM   5599  C  CA  . THR B 1 350 ? 13.722  57.276 138.332 1.00 16.99 ? 368  THR D CA  1 
ATOM   5600  C  C   . THR B 1 350 ? 13.267  56.097 139.210 1.00 16.84 ? 368  THR D C   1 
ATOM   5601  O  O   . THR B 1 350 ? 13.960  55.077 139.304 1.00 16.59 ? 368  THR D O   1 
ATOM   5602  C  CB  . THR B 1 350 ? 14.259  58.441 139.217 1.00 17.14 ? 368  THR D CB  1 
ATOM   5603  O  OG1 . THR B 1 350 ? 14.833  59.441 138.372 1.00 19.21 ? 368  THR D OG1 1 
ATOM   5604  C  CG2 . THR B 1 350 ? 15.329  57.972 140.191 1.00 18.54 ? 368  THR D CG2 1 
ATOM   5605  N  N   . ASP B 1 351 ? 12.092  56.243 139.829 1.00 16.86 ? 369  ASP D N   1 
ATOM   5606  C  CA  . ASP B 1 351 ? 11.501  55.201 140.682 1.00 16.59 ? 369  ASP D CA  1 
ATOM   5607  C  C   . ASP B 1 351 ? 11.273  53.892 139.950 1.00 16.34 ? 369  ASP D C   1 
ATOM   5608  O  O   . ASP B 1 351 ? 11.579  52.825 140.483 1.00 15.74 ? 369  ASP D O   1 
ATOM   5609  C  CB  . ASP B 1 351 ? 10.189  55.689 141.298 1.00 16.71 ? 369  ASP D CB  1 
ATOM   5610  C  CG  . ASP B 1 351 ? 10.409  56.650 142.456 1.00 17.71 ? 369  ASP D CG  1 
ATOM   5611  O  OD1 . ASP B 1 351 ? 11.580  56.916 142.824 1.00 18.06 ? 369  ASP D OD1 1 
ATOM   5612  O  OD2 . ASP B 1 351 ? 9.398   57.138 143.004 1.00 20.09 ? 369  ASP D OD2 1 
ATOM   5613  N  N   . ILE B 1 352 ? 10.748  53.982 138.729 1.00 16.22 ? 370  ILE D N   1 
ATOM   5614  C  CA  . ILE B 1 352 ? 10.567  52.809 137.866 1.00 16.36 ? 370  ILE D CA  1 
ATOM   5615  C  C   . ILE B 1 352 ? 11.921  52.212 137.451 1.00 16.26 ? 370  ILE D C   1 
ATOM   5616  O  O   . ILE B 1 352 ? 12.132  50.997 137.560 1.00 15.96 ? 370  ILE D O   1 
ATOM   5617  C  CB  . ILE B 1 352 ? 9.698   53.140 136.612 1.00 16.26 ? 370  ILE D CB  1 
ATOM   5618  C  CG1 . ILE B 1 352 ? 8.270   53.512 137.038 1.00 16.61 ? 370  ILE D CG1 1 
ATOM   5619  C  CG2 . ILE B 1 352 ? 9.685   51.952 135.627 1.00 16.62 ? 370  ILE D CG2 1 
ATOM   5620  C  CD1 . ILE B 1 352 ? 7.530   54.441 136.081 1.00 16.47 ? 370  ILE D CD1 1 
ATOM   5621  N  N   . GLN B 1 353 ? 12.830  53.072 136.990 1.00 16.18 ? 371  GLN D N   1 
ATOM   5622  C  CA  . GLN B 1 353 ? 14.144  52.637 136.489 1.00 16.25 ? 371  GLN D CA  1 
ATOM   5623  C  C   . GLN B 1 353 ? 14.978  51.908 137.549 1.00 16.52 ? 371  GLN D C   1 
ATOM   5624  O  O   . GLN B 1 353 ? 15.656  50.923 137.241 1.00 16.61 ? 371  GLN D O   1 
ATOM   5625  C  CB  . GLN B 1 353 ? 14.938  53.828 135.937 1.00 15.99 ? 371  GLN D CB  1 
ATOM   5626  C  CG  . GLN B 1 353 ? 14.412  54.404 134.620 1.00 14.83 ? 371  GLN D CG  1 
ATOM   5627  C  CD  . GLN B 1 353 ? 14.951  55.794 134.321 1.00 13.89 ? 371  GLN D CD  1 
ATOM   5628  O  OE1 . GLN B 1 353 ? 15.519  56.460 135.184 1.00 12.30 ? 371  GLN D OE1 1 
ATOM   5629  N  NE2 . GLN B 1 353 ? 14.764  56.238 133.094 1.00 14.65 ? 371  GLN D NE2 1 
ATOM   5630  N  N   . TYR B 1 354 ? 14.915  52.397 138.789 1.00 16.76 ? 372  TYR D N   1 
ATOM   5631  C  CA  . TYR B 1 354 ? 15.678  51.826 139.908 1.00 16.98 ? 372  TYR D CA  1 
ATOM   5632  C  C   . TYR B 1 354 ? 14.866  50.820 140.733 1.00 17.58 ? 372  TYR D C   1 
ATOM   5633  O  O   . TYR B 1 354 ? 15.255  50.445 141.847 1.00 17.43 ? 372  TYR D O   1 
ATOM   5634  C  CB  . TYR B 1 354 ? 16.265  52.938 140.787 1.00 16.49 ? 372  TYR D CB  1 
ATOM   5635  C  CG  . TYR B 1 354 ? 17.391  53.695 140.108 1.00 15.48 ? 372  TYR D CG  1 
ATOM   5636  C  CD1 . TYR B 1 354 ? 17.136  54.860 139.387 1.00 14.35 ? 372  TYR D CD1 1 
ATOM   5637  C  CD2 . TYR B 1 354 ? 18.713  53.235 140.175 1.00 13.97 ? 372  TYR D CD2 1 
ATOM   5638  C  CE1 . TYR B 1 354 ? 18.164  55.556 138.751 1.00 13.80 ? 372  TYR D CE1 1 
ATOM   5639  C  CE2 . TYR B 1 354 ? 19.753  53.926 139.541 1.00 13.51 ? 372  TYR D CE2 1 
ATOM   5640  C  CZ  . TYR B 1 354 ? 19.470  55.084 138.835 1.00 14.02 ? 372  TYR D CZ  1 
ATOM   5641  O  OH  . TYR B 1 354 ? 20.486  55.778 138.208 1.00 13.75 ? 372  TYR D OH  1 
ATOM   5642  N  N   . GLY B 1 355 ? 13.746  50.383 140.162 1.00 18.27 ? 373  GLY D N   1 
ATOM   5643  C  CA  . GLY B 1 355 ? 12.942  49.305 140.720 1.00 19.94 ? 373  GLY D CA  1 
ATOM   5644  C  C   . GLY B 1 355 ? 12.194  49.602 142.009 1.00 20.97 ? 373  GLY D C   1 
ATOM   5645  O  O   . GLY B 1 355 ? 11.705  48.681 142.659 1.00 20.90 ? 373  GLY D O   1 
ATOM   5646  N  N   . ARG B 1 356 ? 12.109  50.877 142.383 1.00 22.08 ? 374  ARG D N   1 
ATOM   5647  C  CA  . ARG B 1 356 ? 11.342  51.283 143.559 1.00 23.81 ? 374  ARG D CA  1 
ATOM   5648  C  C   . ARG B 1 356 ? 9.850   51.007 143.373 1.00 24.84 ? 374  ARG D C   1 
ATOM   5649  O  O   . ARG B 1 356 ? 9.140   50.755 144.343 1.00 25.25 ? 374  ARG D O   1 
ATOM   5650  C  CB  . ARG B 1 356 ? 11.598  52.750 143.917 1.00 23.63 ? 374  ARG D CB  1 
ATOM   5651  C  CG  . ARG B 1 356 ? 12.934  52.982 144.585 1.00 25.06 ? 374  ARG D CG  1 
ATOM   5652  C  CD  . ARG B 1 356 ? 13.073  54.388 145.152 1.00 27.52 ? 374  ARG D CD  1 
ATOM   5653  N  NE  . ARG B 1 356 ? 13.587  55.314 144.151 1.00 30.57 ? 374  ARG D NE  1 
ATOM   5654  C  CZ  . ARG B 1 356 ? 14.867  55.644 144.007 1.00 31.95 ? 374  ARG D CZ  1 
ATOM   5655  N  NH1 . ARG B 1 356 ? 15.798  55.142 144.817 1.00 32.76 ? 374  ARG D NH1 1 
ATOM   5656  N  NH2 . ARG B 1 356 ? 15.218  56.492 143.051 1.00 32.90 ? 374  ARG D NH2 1 
ATOM   5657  N  N   . GLU B 1 357 ? 9.382   51.042 142.128 1.00 26.07 ? 375  GLU D N   1 
ATOM   5658  C  CA  . GLU B 1 357 ? 8.038   50.558 141.806 1.00 27.45 ? 375  GLU D CA  1 
ATOM   5659  C  C   . GLU B 1 357 ? 8.017   49.695 140.544 1.00 28.10 ? 375  GLU D C   1 
ATOM   5660  O  O   . GLU B 1 357 ? 8.847   49.864 139.641 1.00 28.12 ? 375  GLU D O   1 
ATOM   5661  C  CB  . GLU B 1 357 ? 7.029   51.708 141.708 1.00 27.65 ? 375  GLU D CB  1 
ATOM   5662  C  CG  . GLU B 1 357 ? 7.294   52.713 140.615 1.00 28.69 ? 375  GLU D CG  1 
ATOM   5663  C  CD  . GLU B 1 357 ? 6.201   53.757 140.535 1.00 31.07 ? 375  GLU D CD  1 
ATOM   5664  O  OE1 . GLU B 1 357 ? 6.162   54.654 141.413 1.00 30.91 ? 375  GLU D OE1 1 
ATOM   5665  O  OE2 . GLU B 1 357 ? 5.379   53.674 139.590 1.00 31.77 ? 375  GLU D OE2 1 
ATOM   5666  N  N   . GLU B 1 358 ? 7.063   48.767 140.501 1.00 28.85 ? 376  GLU D N   1 
ATOM   5667  C  CA  . GLU B 1 358 ? 6.924   47.854 139.376 1.00 29.63 ? 376  GLU D CA  1 
ATOM   5668  C  C   . GLU B 1 358 ? 6.146   48.486 138.232 1.00 29.34 ? 376  GLU D C   1 
ATOM   5669  O  O   . GLU B 1 358 ? 5.156   49.186 138.445 1.00 29.49 ? 376  GLU D O   1 
ATOM   5670  C  CB  . GLU B 1 358 ? 6.331   46.492 139.808 1.00 30.29 ? 376  GLU D CB  1 
ATOM   5671  C  CG  . GLU B 1 358 ? 5.040   46.537 140.646 1.00 33.05 ? 376  GLU D CG  1 
ATOM   5672  C  CD  . GLU B 1 358 ? 4.920   45.374 141.652 1.00 36.22 ? 376  GLU D CD  1 
ATOM   5673  O  OE1 . GLU B 1 358 ? 3.879   45.288 142.346 1.00 37.30 ? 376  GLU D OE1 1 
ATOM   5674  O  OE2 . GLU B 1 358 ? 5.865   44.558 141.767 1.00 37.68 ? 376  GLU D OE2 1 
ATOM   5675  N  N   . SER B 1 359 ? 6.635   48.247 137.018 1.00 29.12 ? 377  SER D N   1 
ATOM   5676  C  CA  . SER B 1 359 ? 6.005   48.698 135.781 1.00 28.62 ? 377  SER D CA  1 
ATOM   5677  C  C   . SER B 1 359 ? 6.530   47.764 134.708 1.00 28.29 ? 377  SER D C   1 
ATOM   5678  O  O   . SER B 1 359 ? 7.682   47.309 134.782 1.00 28.16 ? 377  SER D O   1 
ATOM   5679  C  CB  . SER B 1 359 ? 6.397   50.152 135.461 1.00 28.97 ? 377  SER D CB  1 
ATOM   5680  O  OG  . SER B 1 359 ? 5.386   50.873 134.747 1.00 29.37 ? 377  SER D OG  1 
ATOM   5681  N  N   . ASP B 1 360 ? 5.688   47.458 133.721 1.00 27.50 ? 378  ASP D N   1 
ATOM   5682  C  CA  . ASP B 1 360 ? 6.095   46.606 132.605 1.00 26.90 ? 378  ASP D CA  1 
ATOM   5683  C  C   . ASP B 1 360 ? 7.173   47.272 131.731 1.00 25.83 ? 378  ASP D C   1 
ATOM   5684  O  O   . ASP B 1 360 ? 7.692   46.654 130.808 1.00 25.53 ? 378  ASP D O   1 
ATOM   5685  C  CB  . ASP B 1 360 ? 4.879   46.196 131.763 1.00 27.22 ? 378  ASP D CB  1 
ATOM   5686  C  CG  . ASP B 1 360 ? 4.252   47.369 131.015 1.00 28.84 ? 378  ASP D CG  1 
ATOM   5687  O  OD1 . ASP B 1 360 ? 4.182   48.491 131.564 1.00 30.85 ? 378  ASP D OD1 1 
ATOM   5688  O  OD2 . ASP B 1 360 ? 3.819   47.163 129.864 1.00 31.77 ? 378  ASP D OD2 1 
ATOM   5689  N  N   . TRP B 1 361 ? 7.504   48.524 132.046 1.00 24.88 ? 379  TRP D N   1 
ATOM   5690  C  CA  . TRP B 1 361 ? 8.548   49.269 131.339 1.00 24.25 ? 379  TRP D CA  1 
ATOM   5691  C  C   . TRP B 1 361 ? 9.972   48.758 131.593 1.00 23.99 ? 379  TRP D C   1 
ATOM   5692  O  O   . TRP B 1 361 ? 10.866  49.013 130.793 1.00 23.90 ? 379  TRP D O   1 
ATOM   5693  C  CB  . TRP B 1 361 ? 8.478   50.762 131.674 1.00 23.96 ? 379  TRP D CB  1 
ATOM   5694  C  CG  . TRP B 1 361 ? 7.297   51.491 131.081 1.00 23.19 ? 379  TRP D CG  1 
ATOM   5695  C  CD1 . TRP B 1 361 ? 6.406   51.010 130.157 1.00 22.66 ? 379  TRP D CD1 1 
ATOM   5696  C  CD2 . TRP B 1 361 ? 6.906   52.846 131.343 1.00 22.18 ? 379  TRP D CD2 1 
ATOM   5697  N  NE1 . TRP B 1 361 ? 5.476   51.973 129.846 1.00 22.07 ? 379  TRP D NE1 1 
ATOM   5698  C  CE2 . TRP B 1 361 ? 5.758   53.111 130.557 1.00 22.42 ? 379  TRP D CE2 1 
ATOM   5699  C  CE3 . TRP B 1 361 ? 7.404   53.860 132.176 1.00 21.69 ? 379  TRP D CE3 1 
ATOM   5700  C  CZ2 . TRP B 1 361 ? 5.103   54.351 130.574 1.00 21.85 ? 379  TRP D CZ2 1 
ATOM   5701  C  CZ3 . TRP B 1 361 ? 6.750   55.091 132.196 1.00 21.45 ? 379  TRP D CZ3 1 
ATOM   5702  C  CH2 . TRP B 1 361 ? 5.612   55.324 131.398 1.00 21.37 ? 379  TRP D CH2 1 
ATOM   5703  N  N   . THR B 1 362 ? 10.185  48.061 132.705 1.00 23.83 ? 380  THR D N   1 
ATOM   5704  C  CA  . THR B 1 362 ? 11.519  47.547 133.034 1.00 24.05 ? 380  THR D CA  1 
ATOM   5705  C  C   . THR B 1 362 ? 11.656  46.045 132.821 1.00 24.48 ? 380  THR D C   1 
ATOM   5706  O  O   . THR B 1 362 ? 10.716  45.289 133.069 1.00 24.22 ? 380  THR D O   1 
ATOM   5707  C  CB  . THR B 1 362 ? 11.969  47.906 134.477 1.00 23.86 ? 380  THR D CB  1 
ATOM   5708  O  OG1 . THR B 1 362 ? 10.939  47.575 135.414 1.00 23.88 ? 380  THR D OG1 1 
ATOM   5709  C  CG2 . THR B 1 362 ? 12.316  49.392 134.590 1.00 22.87 ? 380  THR D CG2 1 
ATOM   5710  N  N   . ILE B 1 363 ? 12.833  45.633 132.344 1.00 25.12 ? 381  ILE D N   1 
ATOM   5711  C  CA  . ILE B 1 363 ? 13.193  44.217 132.235 1.00 25.71 ? 381  ILE D CA  1 
ATOM   5712  C  C   . ILE B 1 363 ? 14.415  43.947 133.108 1.00 25.75 ? 381  ILE D C   1 
ATOM   5713  O  O   . ILE B 1 363 ? 15.442  44.608 132.963 1.00 25.53 ? 381  ILE D O   1 
ATOM   5714  C  CB  . ILE B 1 363 ? 13.525  43.783 130.766 1.00 26.03 ? 381  ILE D CB  1 
ATOM   5715  C  CG1 . ILE B 1 363 ? 12.498  44.318 129.751 1.00 27.14 ? 381  ILE D CG1 1 
ATOM   5716  C  CG2 . ILE B 1 363 ? 13.658  42.262 130.659 1.00 26.20 ? 381  ILE D CG2 1 
ATOM   5717  C  CD1 . ILE B 1 363 ? 11.061  43.837 129.966 1.00 29.24 ? 381  ILE D CD1 1 
ATOM   5718  N  N   . VAL B 1 364 ? 14.295  42.981 134.014 1.00 25.91 ? 382  VAL D N   1 
ATOM   5719  C  CA  . VAL B 1 364 ? 15.426  42.527 134.816 1.00 26.30 ? 382  VAL D CA  1 
ATOM   5720  C  C   . VAL B 1 364 ? 16.399  41.755 133.918 1.00 26.67 ? 382  VAL D C   1 
ATOM   5721  O  O   . VAL B 1 364 ? 15.982  40.907 133.126 1.00 26.90 ? 382  VAL D O   1 
ATOM   5722  C  CB  . VAL B 1 364 ? 14.964  41.658 136.027 1.00 26.38 ? 382  VAL D CB  1 
ATOM   5723  C  CG1 . VAL B 1 364 ? 16.153  41.023 136.748 1.00 26.13 ? 382  VAL D CG1 1 
ATOM   5724  C  CG2 . VAL B 1 364 ? 14.143  42.498 137.005 1.00 26.19 ? 382  VAL D CG2 1 
ATOM   5725  N  N   . LEU B 1 365 ? 17.684  42.078 134.031 1.00 27.01 ? 383  LEU D N   1 
ATOM   5726  C  CA  . LEU B 1 365 ? 18.740  41.408 133.271 1.00 27.75 ? 383  LEU D CA  1 
ATOM   5727  C  C   . LEU B 1 365 ? 18.778  39.902 133.564 1.00 28.18 ? 383  LEU D C   1 
ATOM   5728  O  O   . LEU B 1 365 ? 18.764  39.480 134.730 1.00 28.75 ? 383  LEU D O   1 
ATOM   5729  C  CB  . LEU B 1 365 ? 20.094  42.046 133.597 1.00 27.84 ? 383  LEU D CB  1 
ATOM   5730  C  CG  . LEU B 1 365 ? 21.317  41.789 132.714 1.00 28.57 ? 383  LEU D CG  1 
ATOM   5731  C  CD1 . LEU B 1 365 ? 21.192  42.498 131.363 1.00 29.28 ? 383  LEU D CD1 1 
ATOM   5732  C  CD2 . LEU B 1 365 ? 22.574  42.240 133.440 1.00 28.92 ? 383  LEU D CD2 1 
ATOM   5733  N  N   . GLY C 1 3   ? 74.772  78.514 99.722  1.00 28.16 ? 21   GLY G N   1 
ATOM   5734  C  CA  . GLY C 1 3   ? 73.935  77.295 99.494  1.00 27.74 ? 21   GLY G CA  1 
ATOM   5735  C  C   . GLY C 1 3   ? 74.322  76.522 98.244  1.00 27.43 ? 21   GLY G C   1 
ATOM   5736  O  O   . GLY C 1 3   ? 74.149  75.298 98.183  1.00 27.62 ? 21   GLY G O   1 
ATOM   5737  N  N   . THR C 1 4   ? 74.841  77.235 97.245  1.00 26.74 ? 22   THR G N   1 
ATOM   5738  C  CA  . THR C 1 4   ? 75.198  76.625 95.965  1.00 25.93 ? 22   THR G CA  1 
ATOM   5739  C  C   . THR C 1 4   ? 76.341  77.363 95.278  1.00 25.37 ? 22   THR G C   1 
ATOM   5740  O  O   . THR C 1 4   ? 76.537  78.554 95.506  1.00 25.40 ? 22   THR G O   1 
ATOM   5741  C  CB  . THR C 1 4   ? 73.965  76.525 95.003  1.00 25.95 ? 22   THR G CB  1 
ATOM   5742  O  OG1 . THR C 1 4   ? 74.312  75.746 93.855  1.00 25.28 ? 22   THR G OG1 1 
ATOM   5743  C  CG2 . THR C 1 4   ? 73.478  77.906 94.545  1.00 25.96 ? 22   THR G CG2 1 
ATOM   5744  N  N   . PHE C 1 5   ? 77.107  76.643 94.460  1.00 24.49 ? 23   PHE G N   1 
ATOM   5745  C  CA  . PHE C 1 5   ? 77.981  77.278 93.481  1.00 23.86 ? 23   PHE G CA  1 
ATOM   5746  C  C   . PHE C 1 5   ? 77.094  77.810 92.351  1.00 24.19 ? 23   PHE G C   1 
ATOM   5747  O  O   . PHE C 1 5   ? 75.962  77.345 92.167  1.00 23.91 ? 23   PHE G O   1 
ATOM   5748  C  CB  . PHE C 1 5   ? 79.049  76.305 92.946  1.00 23.44 ? 23   PHE G CB  1 
ATOM   5749  C  CG  . PHE C 1 5   ? 78.488  75.011 92.404  1.00 21.83 ? 23   PHE G CG  1 
ATOM   5750  C  CD1 . PHE C 1 5   ? 78.218  74.867 91.045  1.00 20.01 ? 23   PHE G CD1 1 
ATOM   5751  C  CD2 . PHE C 1 5   ? 78.221  73.938 93.259  1.00 20.15 ? 23   PHE G CD2 1 
ATOM   5752  C  CE1 . PHE C 1 5   ? 77.688  73.665 90.541  1.00 20.14 ? 23   PHE G CE1 1 
ATOM   5753  C  CE2 . PHE C 1 5   ? 77.689  72.736 92.768  1.00 19.22 ? 23   PHE G CE2 1 
ATOM   5754  C  CZ  . PHE C 1 5   ? 77.424  72.599 91.408  1.00 18.94 ? 23   PHE G CZ  1 
ATOM   5755  N  N   . LYS C 1 6   ? 77.597  78.796 91.614  1.00 24.58 ? 24   LYS G N   1 
ATOM   5756  C  CA  . LYS C 1 6   ? 76.827  79.422 90.544  1.00 24.96 ? 24   LYS G CA  1 
ATOM   5757  C  C   . LYS C 1 6   ? 77.650  79.467 89.272  1.00 25.03 ? 24   LYS G C   1 
ATOM   5758  O  O   . LYS C 1 6   ? 78.841  79.775 89.307  1.00 24.95 ? 24   LYS G O   1 
ATOM   5759  C  CB  . LYS C 1 6   ? 76.361  80.823 90.956  1.00 25.10 ? 24   LYS G CB  1 
ATOM   5760  C  CG  . LYS C 1 6   ? 75.282  80.824 92.049  1.00 26.32 ? 24   LYS G CG  1 
ATOM   5761  C  CD  . LYS C 1 6   ? 75.131  82.197 92.709  1.00 29.30 ? 24   LYS G CD  1 
ATOM   5762  C  CE  . LYS C 1 6   ? 74.270  82.138 93.978  1.00 30.91 ? 24   LYS G CE  1 
ATOM   5763  N  NZ  . LYS C 1 6   ? 72.822  81.825 93.703  1.00 32.80 ? 24   LYS G NZ  1 
ATOM   5764  N  N   . ALA C 1 7   ? 77.010  79.141 88.151  1.00 25.35 ? 25   ALA G N   1 
ATOM   5765  C  CA  . ALA C 1 7   ? 77.673  79.111 86.847  1.00 25.73 ? 25   ALA G CA  1 
ATOM   5766  C  C   . ALA C 1 7   ? 78.212  80.485 86.431  1.00 26.05 ? 25   ALA G C   1 
ATOM   5767  O  O   . ALA C 1 7   ? 79.159  80.576 85.652  1.00 26.02 ? 25   ALA G O   1 
ATOM   5768  C  CB  . ALA C 1 7   ? 76.727  78.563 85.795  1.00 25.56 ? 25   ALA G CB  1 
ATOM   5769  N  N   . LYS C 1 8   ? 77.601  81.535 86.976  1.00 26.64 ? 26   LYS G N   1 
ATOM   5770  C  CA  . LYS C 1 8   ? 77.951  82.935 86.701  1.00 27.62 ? 26   LYS G CA  1 
ATOM   5771  C  C   . LYS C 1 8   ? 79.372  83.294 87.154  1.00 27.66 ? 26   LYS G C   1 
ATOM   5772  O  O   . LYS C 1 8   ? 80.045  84.115 86.517  1.00 27.61 ? 26   LYS G O   1 
ATOM   5773  C  CB  . LYS C 1 8   ? 76.939  83.879 87.376  1.00 27.75 ? 26   LYS G CB  1 
ATOM   5774  C  CG  . LYS C 1 8   ? 75.467  83.606 87.027  1.00 29.75 ? 26   LYS G CG  1 
ATOM   5775  C  CD  . LYS C 1 8   ? 74.971  82.215 87.523  1.00 31.12 ? 26   LYS G CD  1 
ATOM   5776  C  CE  . LYS C 1 8   ? 73.801  81.694 86.685  1.00 32.97 ? 26   LYS G CE  1 
ATOM   5777  N  NZ  . LYS C 1 8   ? 74.123  81.567 85.214  1.00 33.01 ? 26   LYS G NZ  1 
ATOM   5778  N  N   . ASP C 1 9   ? 79.826  82.685 88.248  1.00 27.55 ? 27   ASP G N   1 
ATOM   5779  C  CA  . ASP C 1 9   ? 81.179  82.953 88.732  1.00 27.72 ? 27   ASP G CA  1 
ATOM   5780  C  C   . ASP C 1 9   ? 82.168  81.826 88.418  1.00 27.10 ? 27   ASP G C   1 
ATOM   5781  O  O   . ASP C 1 9   ? 83.142  81.598 89.137  1.00 27.17 ? 27   ASP G O   1 
ATOM   5782  C  CB  . ASP C 1 9   ? 81.194  83.405 90.211  1.00 28.40 ? 27   ASP G CB  1 
ATOM   5783  C  CG  . ASP C 1 9   ? 80.273  82.595 91.093  1.00 29.63 ? 27   ASP G CG  1 
ATOM   5784  O  OD1 . ASP C 1 9   ? 80.436  81.358 91.150  1.00 32.98 ? 27   ASP G OD1 1 
ATOM   5785  O  OD2 . ASP C 1 9   ? 79.404  83.200 91.757  1.00 29.16 ? 27   ASP G OD2 1 
ATOM   5786  N  N   . LEU C 1 10  ? 81.903  81.151 87.303  1.00 26.47 ? 28   LEU G N   1 
ATOM   5787  C  CA  . LEU C 1 10  ? 82.770  80.118 86.750  1.00 25.69 ? 28   LEU G CA  1 
ATOM   5788  C  C   . LEU C 1 10  ? 84.129  80.723 86.397  1.00 25.56 ? 28   LEU G C   1 
ATOM   5789  O  O   . LEU C 1 10  ? 84.206  81.788 85.766  1.00 25.22 ? 28   LEU G O   1 
ATOM   5790  C  CB  . LEU C 1 10  ? 82.098  79.529 85.504  1.00 25.46 ? 28   LEU G CB  1 
ATOM   5791  C  CG  . LEU C 1 10  ? 82.224  78.109 84.938  1.00 24.79 ? 28   LEU G CG  1 
ATOM   5792  C  CD1 . LEU C 1 10  ? 82.368  77.018 85.968  1.00 22.93 ? 28   LEU G CD1 1 
ATOM   5793  C  CD2 . LEU C 1 10  ? 81.008  77.840 84.058  1.00 24.06 ? 28   LEU G CD2 1 
ATOM   5794  N  N   . ILE C 1 11  ? 85.193  80.059 86.841  1.00 25.11 ? 29   ILE G N   1 
ATOM   5795  C  CA  . ILE C 1 11  ? 86.551  80.456 86.493  1.00 25.15 ? 29   ILE G CA  1 
ATOM   5796  C  C   . ILE C 1 11  ? 87.092  79.457 85.478  1.00 25.25 ? 29   ILE G C   1 
ATOM   5797  O  O   . ILE C 1 11  ? 87.239  78.272 85.779  1.00 24.91 ? 29   ILE G O   1 
ATOM   5798  C  CB  . ILE C 1 11  ? 87.482  80.549 87.736  1.00 25.10 ? 29   ILE G CB  1 
ATOM   5799  C  CG1 . ILE C 1 11  ? 86.923  81.562 88.745  1.00 25.38 ? 29   ILE G CG1 1 
ATOM   5800  C  CG2 . ILE C 1 11  ? 88.898  80.954 87.319  1.00 24.44 ? 29   ILE G CG2 1 
ATOM   5801  C  CD1 . ILE C 1 11  ? 87.181  81.225 90.200  1.00 24.67 ? 29   ILE G CD1 1 
ATOM   5802  N  N   . VAL C 1 12  ? 87.375  79.950 84.273  1.00 25.39 ? 30   VAL G N   1 
ATOM   5803  C  CA  . VAL C 1 12  ? 87.795  79.099 83.166  1.00 25.81 ? 30   VAL G CA  1 
ATOM   5804  C  C   . VAL C 1 12  ? 89.285  79.273 82.906  1.00 26.35 ? 30   VAL G C   1 
ATOM   5805  O  O   . VAL C 1 12  ? 89.744  80.372 82.585  1.00 26.85 ? 30   VAL G O   1 
ATOM   5806  C  CB  . VAL C 1 12  ? 86.970  79.380 81.871  1.00 25.81 ? 30   VAL G CB  1 
ATOM   5807  C  CG1 . VAL C 1 12  ? 87.368  78.427 80.752  1.00 25.12 ? 30   VAL G CG1 1 
ATOM   5808  C  CG2 . VAL C 1 12  ? 85.469  79.279 82.147  1.00 25.17 ? 30   VAL G CG2 1 
ATOM   5809  N  N   . THR C 1 13  ? 90.027  78.182 83.064  1.00 26.80 ? 31   THR G N   1 
ATOM   5810  C  CA  . THR C 1 13  ? 91.460  78.138 82.802  1.00 27.43 ? 31   THR G CA  1 
ATOM   5811  C  C   . THR C 1 13  ? 91.712  77.137 81.670  1.00 27.73 ? 31   THR G C   1 
ATOM   5812  O  O   . THR C 1 13  ? 91.883  75.944 81.921  1.00 27.51 ? 31   THR G O   1 
ATOM   5813  C  CB  . THR C 1 13  ? 92.263  77.721 84.076  1.00 27.47 ? 31   THR G CB  1 
ATOM   5814  O  OG1 . THR C 1 13  ? 91.859  78.525 85.189  1.00 27.77 ? 31   THR G OG1 1 
ATOM   5815  C  CG2 . THR C 1 13  ? 93.763  77.884 83.868  1.00 27.64 ? 31   THR G CG2 1 
ATOM   5816  N  N   . PRO C 1 14  ? 91.726  77.619 80.413  1.00 28.35 ? 32   PRO G N   1 
ATOM   5817  C  CA  . PRO C 1 14  ? 91.910  76.720 79.273  1.00 28.62 ? 32   PRO G CA  1 
ATOM   5818  C  C   . PRO C 1 14  ? 93.300  76.094 79.223  1.00 28.96 ? 32   PRO G C   1 
ATOM   5819  O  O   . PRO C 1 14  ? 94.273  76.706 79.671  1.00 28.94 ? 32   PRO G O   1 
ATOM   5820  C  CB  . PRO C 1 14  ? 91.701  77.640 78.059  1.00 28.63 ? 32   PRO G CB  1 
ATOM   5821  C  CG  . PRO C 1 14  ? 91.029  78.856 78.592  1.00 28.76 ? 32   PRO G CG  1 
ATOM   5822  C  CD  . PRO C 1 14  ? 91.563  79.016 79.976  1.00 28.43 ? 32   PRO G CD  1 
ATOM   5823  N  N   . ALA C 1 15  ? 93.378  74.878 78.685  1.00 29.42 ? 33   ALA G N   1 
ATOM   5824  C  CA  . ALA C 1 15  ? 94.652  74.203 78.470  1.00 30.18 ? 33   ALA G CA  1 
ATOM   5825  C  C   . ALA C 1 15  ? 95.390  74.879 77.325  1.00 30.71 ? 33   ALA G C   1 
ATOM   5826  O  O   . ALA C 1 15  ? 94.774  75.344 76.362  1.00 31.04 ? 33   ALA G O   1 
ATOM   5827  C  CB  . ALA C 1 15  ? 94.437  72.725 78.163  1.00 30.03 ? 33   ALA G CB  1 
ATOM   5828  N  N   . THR C 1 16  ? 96.709  74.937 77.438  1.00 31.22 ? 34   THR G N   1 
ATOM   5829  C  CA  . THR C 1 16  ? 97.529  75.575 76.417  1.00 31.72 ? 34   THR G CA  1 
ATOM   5830  C  C   . THR C 1 16  ? 97.948  74.553 75.363  1.00 31.65 ? 34   THR G C   1 
ATOM   5831  O  O   . THR C 1 16  ? 98.090  74.884 74.183  1.00 31.84 ? 34   THR G O   1 
ATOM   5832  C  CB  . THR C 1 16  ? 98.759  76.281 77.037  1.00 31.91 ? 34   THR G CB  1 
ATOM   5833  O  OG1 . THR C 1 16  ? 99.447  75.374 77.908  1.00 32.59 ? 34   THR G OG1 1 
ATOM   5834  C  CG2 . THR C 1 16  ? 98.324  77.498 77.851  1.00 32.30 ? 34   THR G CG2 1 
ATOM   5835  N  N   . ILE C 1 17  ? 98.131  73.312 75.802  1.00 31.55 ? 35   ILE G N   1 
ATOM   5836  C  CA  . ILE C 1 17  ? 98.445  72.198 74.913  1.00 31.44 ? 35   ILE G CA  1 
ATOM   5837  C  C   . ILE C 1 17  ? 97.237  71.266 74.828  1.00 31.09 ? 35   ILE G C   1 
ATOM   5838  O  O   . ILE C 1 17  ? 96.850  70.645 75.825  1.00 31.33 ? 35   ILE G O   1 
ATOM   5839  C  CB  . ILE C 1 17  ? 99.686  71.409 75.396  1.00 31.50 ? 35   ILE G CB  1 
ATOM   5840  C  CG1 . ILE C 1 17  ? 100.907 72.333 75.508  1.00 32.06 ? 35   ILE G CG1 1 
ATOM   5841  C  CG2 . ILE C 1 17  ? 99.975  70.250 74.452  1.00 31.83 ? 35   ILE G CG2 1 
ATOM   5842  C  CD1 . ILE C 1 17  ? 101.977 71.851 76.477  1.00 32.80 ? 35   ILE G CD1 1 
ATOM   5843  N  N   . LEU C 1 18  ? 96.647  71.182 73.636  1.00 30.47 ? 36   LEU G N   1 
ATOM   5844  C  CA  . LEU C 1 18  ? 95.460  70.361 73.410  1.00 29.67 ? 36   LEU G CA  1 
ATOM   5845  C  C   . LEU C 1 18  ? 95.789  68.983 72.844  1.00 29.11 ? 36   LEU G C   1 
ATOM   5846  O  O   . LEU C 1 18  ? 96.698  68.829 72.027  1.00 29.22 ? 36   LEU G O   1 
ATOM   5847  C  CB  . LEU C 1 18  ? 94.465  71.089 72.505  1.00 29.65 ? 36   LEU G CB  1 
ATOM   5848  C  CG  . LEU C 1 18  ? 93.939  72.451 72.979  1.00 29.66 ? 36   LEU G CG  1 
ATOM   5849  C  CD1 . LEU C 1 18  ? 92.895  72.979 72.004  1.00 31.11 ? 36   LEU G CD1 1 
ATOM   5850  C  CD2 . LEU C 1 18  ? 93.369  72.408 74.394  1.00 29.08 ? 36   LEU G CD2 1 
ATOM   5851  N  N   . LYS C 1 19  ? 95.040  67.982 73.293  1.00 28.35 ? 37   LYS G N   1 
ATOM   5852  C  CA  . LYS C 1 19  ? 95.259  66.598 72.886  1.00 27.53 ? 37   LYS G CA  1 
ATOM   5853  C  C   . LYS C 1 19  ? 94.554  66.286 71.570  1.00 27.06 ? 37   LYS G C   1 
ATOM   5854  O  O   . LYS C 1 19  ? 93.487  66.840 71.269  1.00 26.62 ? 37   LYS G O   1 
ATOM   5855  C  CB  . LYS C 1 19  ? 94.769  65.637 73.973  1.00 27.59 ? 37   LYS G CB  1 
ATOM   5856  C  CG  . LYS C 1 19  ? 95.490  65.779 75.320  1.00 28.08 ? 37   LYS G CG  1 
ATOM   5857  C  CD  . LYS C 1 19  ? 94.953  64.803 76.372  1.00 28.24 ? 37   LYS G CD  1 
ATOM   5858  C  CE  . LYS C 1 19  ? 93.616  65.269 76.952  1.00 28.45 ? 37   LYS G CE  1 
ATOM   5859  N  NZ  . LYS C 1 19  ? 93.213  64.472 78.150  1.00 28.46 ? 37   LYS G NZ  1 
ATOM   5860  N  N   . GLU C 1 20  ? 95.159  65.392 70.791  1.00 26.46 ? 38   GLU G N   1 
ATOM   5861  C  CA  . GLU C 1 20  ? 94.521  64.871 69.590  1.00 25.87 ? 38   GLU G CA  1 
ATOM   5862  C  C   . GLU C 1 20  ? 93.314  64.026 69.981  1.00 25.00 ? 38   GLU G C   1 
ATOM   5863  O  O   . GLU C 1 20  ? 93.397  63.189 70.892  1.00 24.61 ? 38   GLU G O   1 
ATOM   5864  C  CB  . GLU C 1 20  ? 95.503  64.046 68.748  1.00 26.04 ? 38   GLU G CB  1 
ATOM   5865  C  CG  . GLU C 1 20  ? 94.892  63.521 67.444  1.00 27.89 ? 38   GLU G CG  1 
ATOM   5866  C  CD  . GLU C 1 20  ? 95.904  63.369 66.326  1.00 30.22 ? 38   GLU G CD  1 
ATOM   5867  O  OE1 . GLU C 1 20  ? 96.202  62.218 65.938  1.00 30.65 ? 38   GLU G OE1 1 
ATOM   5868  O  OE2 . GLU C 1 20  ? 96.404  64.405 65.836  1.00 32.66 ? 38   GLU G OE2 1 
ATOM   5869  N  N   . LYS C 1 21  ? 92.197  64.268 69.296  1.00 23.85 ? 39   LYS G N   1 
ATOM   5870  C  CA  . LYS C 1 21  ? 90.984  63.486 69.477  1.00 23.04 ? 39   LYS G CA  1 
ATOM   5871  C  C   . LYS C 1 21  ? 91.185  62.059 68.968  1.00 22.95 ? 39   LYS G C   1 
ATOM   5872  O  O   . LYS C 1 21  ? 91.936  61.842 68.018  1.00 22.83 ? 39   LYS G O   1 
ATOM   5873  C  CB  . LYS C 1 21  ? 89.805  64.138 68.754  1.00 22.73 ? 39   LYS G CB  1 
ATOM   5874  C  CG  . LYS C 1 21  ? 89.117  65.241 69.531  1.00 21.69 ? 39   LYS G CG  1 
ATOM   5875  C  CD  . LYS C 1 21  ? 89.816  66.582 69.356  1.00 20.05 ? 39   LYS G CD  1 
ATOM   5876  C  CE  . LYS C 1 21  ? 89.066  67.679 70.060  1.00 18.31 ? 39   LYS G CE  1 
ATOM   5877  N  NZ  . LYS C 1 21  ? 89.824  68.952 70.013  1.00 18.30 ? 39   LYS G NZ  1 
ATOM   5878  N  N   . PRO C 1 22  ? 90.523  61.079 69.610  1.00 22.93 ? 40   PRO G N   1 
ATOM   5879  C  CA  . PRO C 1 22  ? 90.604  59.700 69.141  1.00 23.09 ? 40   PRO G CA  1 
ATOM   5880  C  C   . PRO C 1 22  ? 89.715  59.444 67.927  1.00 23.67 ? 40   PRO G C   1 
ATOM   5881  O  O   . PRO C 1 22  ? 88.736  60.168 67.701  1.00 23.60 ? 40   PRO G O   1 
ATOM   5882  C  CB  . PRO C 1 22  ? 90.099  58.900 70.339  1.00 22.96 ? 40   PRO G CB  1 
ATOM   5883  C  CG  . PRO C 1 22  ? 89.155  59.831 71.034  1.00 22.37 ? 40   PRO G CG  1 
ATOM   5884  C  CD  . PRO C 1 22  ? 89.682  61.209 70.817  1.00 22.78 ? 40   PRO G CD  1 
ATOM   5885  N  N   . ASP C 1 23  ? 90.073  58.425 67.153  1.00 24.22 ? 41   ASP G N   1 
ATOM   5886  C  CA  . ASP C 1 23  ? 89.260  57.933 66.051  1.00 25.06 ? 41   ASP G CA  1 
ATOM   5887  C  C   . ASP C 1 23  ? 87.917  57.408 66.582  1.00 25.38 ? 41   ASP G C   1 
ATOM   5888  O  O   . ASP C 1 23  ? 87.897  56.466 67.383  1.00 25.32 ? 41   ASP G O   1 
ATOM   5889  C  CB  . ASP C 1 23  ? 90.027  56.820 65.323  1.00 25.30 ? 41   ASP G CB  1 
ATOM   5890  C  CG  . ASP C 1 23  ? 89.237  56.189 64.199  1.00 26.09 ? 41   ASP G CG  1 
ATOM   5891  O  OD1 . ASP C 1 23  ? 88.288  56.805 63.683  1.00 28.16 ? 41   ASP G OD1 1 
ATOM   5892  O  OD2 . ASP C 1 23  ? 89.582  55.059 63.813  1.00 28.94 ? 41   ASP G OD2 1 
ATOM   5893  N  N   . PRO C 1 24  ? 86.789  58.027 66.146  1.00 25.70 ? 42   PRO G N   1 
ATOM   5894  C  CA  . PRO C 1 24  ? 85.458  57.647 66.637  1.00 25.91 ? 42   PRO G CA  1 
ATOM   5895  C  C   . PRO C 1 24  ? 85.034  56.239 66.225  1.00 26.41 ? 42   PRO G C   1 
ATOM   5896  O  O   . PRO C 1 24  ? 84.096  55.691 66.805  1.00 26.85 ? 42   PRO G O   1 
ATOM   5897  C  CB  . PRO C 1 24  ? 84.533  58.693 65.998  1.00 25.97 ? 42   PRO G CB  1 
ATOM   5898  C  CG  . PRO C 1 24  ? 85.265  59.167 64.797  1.00 25.55 ? 42   PRO G CG  1 
ATOM   5899  C  CD  . PRO C 1 24  ? 86.713  59.131 65.167  1.00 25.64 ? 42   PRO G CD  1 
ATOM   5900  N  N   . ASN C 1 25  ? 85.734  55.661 65.248  1.00 26.71 ? 43   ASN G N   1 
ATOM   5901  C  CA  . ASN C 1 25  ? 85.451  54.314 64.755  1.00 27.11 ? 43   ASN G CA  1 
ATOM   5902  C  C   . ASN C 1 25  ? 85.879  53.201 65.715  1.00 27.07 ? 43   ASN G C   1 
ATOM   5903  O  O   . ASN C 1 25  ? 85.393  52.076 65.616  1.00 27.13 ? 43   ASN G O   1 
ATOM   5904  C  CB  . ASN C 1 25  ? 86.141  54.085 63.402  1.00 27.47 ? 43   ASN G CB  1 
ATOM   5905  C  CG  . ASN C 1 25  ? 85.665  55.040 62.310  1.00 28.23 ? 43   ASN G CG  1 
ATOM   5906  O  OD1 . ASN C 1 25  ? 86.478  55.706 61.668  1.00 30.80 ? 43   ASN G OD1 1 
ATOM   5907  N  ND2 . ASN C 1 25  ? 84.355  55.095 62.081  1.00 27.25 ? 43   ASN G ND2 1 
ATOM   5908  N  N   . ASN C 1 26  ? 86.794  53.521 66.632  1.00 27.11 ? 44   ASN G N   1 
ATOM   5909  C  CA  . ASN C 1 26  ? 87.445  52.521 67.484  1.00 27.14 ? 44   ASN G CA  1 
ATOM   5910  C  C   . ASN C 1 26  ? 87.542  52.928 68.963  1.00 26.54 ? 44   ASN G C   1 
ATOM   5911  O  O   . ASN C 1 26  ? 88.575  52.731 69.604  1.00 26.60 ? 44   ASN G O   1 
ATOM   5912  C  CB  . ASN C 1 26  ? 88.849  52.206 66.939  1.00 27.56 ? 44   ASN G CB  1 
ATOM   5913  C  CG  . ASN C 1 26  ? 88.815  51.584 65.551  1.00 29.13 ? 44   ASN G CG  1 
ATOM   5914  O  OD1 . ASN C 1 26  ? 89.268  52.194 64.572  1.00 31.39 ? 44   ASN G OD1 1 
ATOM   5915  N  ND2 . ASN C 1 26  ? 88.263  50.370 65.453  1.00 29.59 ? 44   ASN G ND2 1 
ATOM   5916  N  N   . LEU C 1 27  ? 86.469  53.489 69.507  1.00 25.79 ? 45   LEU G N   1 
ATOM   5917  C  CA  . LEU C 1 27  ? 86.499  53.978 70.886  1.00 24.97 ? 45   LEU G CA  1 
ATOM   5918  C  C   . LEU C 1 27  ? 86.284  52.857 71.900  1.00 24.58 ? 45   LEU G C   1 
ATOM   5919  O  O   . LEU C 1 27  ? 85.443  51.980 71.698  1.00 24.30 ? 45   LEU G O   1 
ATOM   5920  C  CB  . LEU C 1 27  ? 85.468  55.095 71.096  1.00 24.77 ? 45   LEU G CB  1 
ATOM   5921  C  CG  . LEU C 1 27  ? 85.666  56.397 70.315  1.00 24.18 ? 45   LEU G CG  1 
ATOM   5922  C  CD1 . LEU C 1 27  ? 84.403  57.229 70.338  1.00 23.44 ? 45   LEU G CD1 1 
ATOM   5923  C  CD2 . LEU C 1 27  ? 86.839  57.192 70.852  1.00 23.82 ? 45   LEU G CD2 1 
ATOM   5924  N  N   . VAL C 1 28  ? 87.065  52.881 72.975  1.00 24.15 ? 46   VAL G N   1 
ATOM   5925  C  CA  . VAL C 1 28  ? 86.846  51.975 74.107  1.00 23.94 ? 46   VAL G CA  1 
ATOM   5926  C  C   . VAL C 1 28  ? 86.197  52.782 75.226  1.00 23.57 ? 46   VAL G C   1 
ATOM   5927  O  O   . VAL C 1 28  ? 86.745  53.799 75.667  1.00 23.24 ? 46   VAL G O   1 
ATOM   5928  C  CB  . VAL C 1 28  ? 88.147  51.299 74.599  1.00 23.83 ? 46   VAL G CB  1 
ATOM   5929  C  CG1 . VAL C 1 28  ? 87.838  50.302 75.711  1.00 23.57 ? 46   VAL G CG1 1 
ATOM   5930  C  CG2 . VAL C 1 28  ? 88.850  50.591 73.443  1.00 24.83 ? 46   VAL G CG2 1 
ATOM   5931  N  N   . PHE C 1 29  ? 85.040  52.303 75.679  1.00 23.48 ? 47   PHE G N   1 
ATOM   5932  C  CA  . PHE C 1 29  ? 84.089  53.102 76.466  1.00 23.39 ? 47   PHE G CA  1 
ATOM   5933  C  C   . PHE C 1 29  ? 84.676  54.268 77.282  1.00 23.58 ? 47   PHE G C   1 
ATOM   5934  O  O   . PHE C 1 29  ? 84.637  55.417 76.836  1.00 24.87 ? 47   PHE G O   1 
ATOM   5935  C  CB  . PHE C 1 29  ? 83.160  52.214 77.317  1.00 23.33 ? 47   PHE G CB  1 
ATOM   5936  C  CG  . PHE C 1 29  ? 82.265  52.991 78.249  1.00 22.50 ? 47   PHE G CG  1 
ATOM   5937  C  CD1 . PHE C 1 29  ? 81.172  53.699 77.757  1.00 22.51 ? 47   PHE G CD1 1 
ATOM   5938  C  CD2 . PHE C 1 29  ? 82.526  53.024 79.620  1.00 21.45 ? 47   PHE G CD2 1 
ATOM   5939  C  CE1 . PHE C 1 29  ? 80.349  54.432 78.616  1.00 21.58 ? 47   PHE G CE1 1 
ATOM   5940  C  CE2 . PHE C 1 29  ? 81.716  53.753 80.481  1.00 21.84 ? 47   PHE G CE2 1 
ATOM   5941  C  CZ  . PHE C 1 29  ? 80.621  54.455 79.976  1.00 21.87 ? 47   PHE G CZ  1 
ATOM   5942  N  N   . GLY C 1 30  ? 85.213  54.008 78.462  1.00 22.80 ? 48   GLY G N   1 
ATOM   5943  C  CA  . GLY C 1 30  ? 85.550  55.133 79.334  1.00 21.66 ? 48   GLY G CA  1 
ATOM   5944  C  C   . GLY C 1 30  ? 87.036  55.241 79.569  1.00 20.96 ? 48   GLY G C   1 
ATOM   5945  O  O   . GLY C 1 30  ? 87.466  55.433 80.696  1.00 20.76 ? 48   GLY G O   1 
ATOM   5946  N  N   . THR C 1 31  ? 87.814  55.125 78.495  1.00 20.39 ? 49   THR G N   1 
ATOM   5947  C  CA  . THR C 1 31  ? 89.268  55.068 78.598  1.00 20.04 ? 49   THR G CA  1 
ATOM   5948  C  C   . THR C 1 31  ? 89.965  56.366 78.171  1.00 19.32 ? 49   THR G C   1 
ATOM   5949  O  O   . THR C 1 31  ? 91.057  56.664 78.654  1.00 19.64 ? 49   THR G O   1 
ATOM   5950  C  CB  . THR C 1 31  ? 89.850  53.846 77.831  1.00 20.04 ? 49   THR G CB  1 
ATOM   5951  O  OG1 . THR C 1 31  ? 89.512  53.939 76.443  1.00 21.29 ? 49   THR G OG1 1 
ATOM   5952  C  CG2 . THR C 1 31  ? 89.284  52.554 78.375  1.00 19.85 ? 49   THR G CG2 1 
ATOM   5953  N  N   . VAL C 1 32  ? 89.332  57.135 77.287  1.00 18.47 ? 50   VAL G N   1 
ATOM   5954  C  CA  . VAL C 1 32  ? 89.910  58.384 76.774  1.00 17.65 ? 50   VAL G CA  1 
ATOM   5955  C  C   . VAL C 1 32  ? 89.174  59.598 77.350  1.00 17.25 ? 50   VAL G C   1 
ATOM   5956  O  O   . VAL C 1 32  ? 87.943  59.632 77.375  1.00 16.95 ? 50   VAL G O   1 
ATOM   5957  C  CB  . VAL C 1 32  ? 89.908  58.431 75.205  1.00 18.03 ? 50   VAL G CB  1 
ATOM   5958  C  CG1 . VAL C 1 32  ? 90.415  59.774 74.682  1.00 17.51 ? 50   VAL G CG1 1 
ATOM   5959  C  CG2 . VAL C 1 32  ? 90.762  57.287 74.625  1.00 17.76 ? 50   VAL G CG2 1 
ATOM   5960  N  N   . PHE C 1 33  ? 89.936  60.586 77.813  1.00 16.09 ? 51   PHE G N   1 
ATOM   5961  C  CA  . PHE C 1 33  ? 89.355  61.793 78.393  1.00 15.52 ? 51   PHE G CA  1 
ATOM   5962  C  C   . PHE C 1 33  ? 89.744  63.052 77.616  1.00 15.21 ? 51   PHE G C   1 
ATOM   5963  O  O   . PHE C 1 33  ? 90.791  63.102 76.967  1.00 14.64 ? 51   PHE G O   1 
ATOM   5964  C  CB  . PHE C 1 33  ? 89.721  61.913 79.879  1.00 15.40 ? 51   PHE G CB  1 
ATOM   5965  C  CG  . PHE C 1 33  ? 89.286  60.731 80.700  1.00 14.69 ? 51   PHE G CG  1 
ATOM   5966  C  CD1 . PHE C 1 33  ? 90.128  59.635 80.863  1.00 14.59 ? 51   PHE G CD1 1 
ATOM   5967  C  CD2 . PHE C 1 33  ? 88.026  60.702 81.284  1.00 15.09 ? 51   PHE G CD2 1 
ATOM   5968  C  CE1 . PHE C 1 33  ? 89.733  58.535 81.601  1.00 13.46 ? 51   PHE G CE1 1 
ATOM   5969  C  CE2 . PHE C 1 33  ? 87.616  59.603 82.027  1.00 14.68 ? 51   PHE G CE2 1 
ATOM   5970  C  CZ  . PHE C 1 33  ? 88.477  58.521 82.192  1.00 15.29 ? 51   PHE G CZ  1 
ATOM   5971  N  N   . THR C 1 34  ? 88.877  64.055 77.696  1.00 14.86 ? 52   THR G N   1 
ATOM   5972  C  CA  . THR C 1 34  ? 89.028  65.302 76.960  1.00 14.78 ? 52   THR G CA  1 
ATOM   5973  C  C   . THR C 1 34  ? 90.066  66.228 77.613  1.00 15.18 ? 52   THR G C   1 
ATOM   5974  O  O   . THR C 1 34  ? 90.755  65.829 78.555  1.00 15.19 ? 52   THR G O   1 
ATOM   5975  C  CB  . THR C 1 34  ? 87.654  66.007 76.793  1.00 14.49 ? 52   THR G CB  1 
ATOM   5976  O  OG1 . THR C 1 34  ? 87.180  66.462 78.065  1.00 14.84 ? 52   THR G OG1 1 
ATOM   5977  C  CG2 . THR C 1 34  ? 86.630  65.050 76.191  1.00 13.05 ? 52   THR G CG2 1 
ATOM   5978  N  N   . ASP C 1 35  ? 90.176  67.455 77.103  1.00 15.60 ? 53   ASP G N   1 
ATOM   5979  C  CA  . ASP C 1 35  ? 91.151  68.430 77.604  1.00 16.05 ? 53   ASP G CA  1 
ATOM   5980  C  C   . ASP C 1 35  ? 90.810  68.990 78.975  1.00 16.03 ? 53   ASP G C   1 
ATOM   5981  O  O   . ASP C 1 35  ? 91.707  69.230 79.778  1.00 16.25 ? 53   ASP G O   1 
ATOM   5982  C  CB  . ASP C 1 35  ? 91.321  69.602 76.620  1.00 16.16 ? 53   ASP G CB  1 
ATOM   5983  C  CG  . ASP C 1 35  ? 91.933  69.179 75.296  1.00 16.53 ? 53   ASP G CG  1 
ATOM   5984  O  OD1 . ASP C 1 35  ? 92.922  68.418 75.303  1.00 17.03 ? 53   ASP G OD1 1 
ATOM   5985  O  OD2 . ASP C 1 35  ? 91.422  69.613 74.242  1.00 18.30 ? 53   ASP G OD2 1 
ATOM   5986  N  N   . HIS C 1 36  ? 89.521  69.218 79.230  1.00 16.14 ? 54   HIS G N   1 
ATOM   5987  C  CA  . HIS C 1 36  ? 89.091  69.942 80.426  1.00 16.27 ? 54   HIS G CA  1 
ATOM   5988  C  C   . HIS C 1 36  ? 88.162  69.150 81.342  1.00 16.23 ? 54   HIS G C   1 
ATOM   5989  O  O   . HIS C 1 36  ? 87.574  68.143 80.942  1.00 16.26 ? 54   HIS G O   1 
ATOM   5990  C  CB  . HIS C 1 36  ? 88.444  71.288 80.060  1.00 16.13 ? 54   HIS G CB  1 
ATOM   5991  C  CG  . HIS C 1 36  ? 89.316  72.167 79.219  1.00 17.26 ? 54   HIS G CG  1 
ATOM   5992  N  ND1 . HIS C 1 36  ? 89.243  72.190 77.843  1.00 17.61 ? 54   HIS G ND1 1 
ATOM   5993  C  CD2 . HIS C 1 36  ? 90.299  73.035 79.558  1.00 17.77 ? 54   HIS G CD2 1 
ATOM   5994  C  CE1 . HIS C 1 36  ? 90.136  73.041 77.371  1.00 18.02 ? 54   HIS G CE1 1 
ATOM   5995  N  NE2 . HIS C 1 36  ? 90.793  73.563 78.391  1.00 17.87 ? 54   HIS G NE2 1 
ATOM   5996  N  N   . MET C 1 37  ? 88.050  69.631 82.576  1.00 16.23 ? 55   MET G N   1 
ATOM   5997  C  CA  . MET C 1 37  ? 87.215  69.026 83.599  1.00 16.50 ? 55   MET G CA  1 
ATOM   5998  C  C   . MET C 1 37  ? 86.564  70.139 84.413  1.00 16.51 ? 55   MET G C   1 
ATOM   5999  O  O   . MET C 1 37  ? 87.071  71.260 84.447  1.00 16.61 ? 55   MET G O   1 
ATOM   6000  C  CB  . MET C 1 37  ? 88.055  68.105 84.499  1.00 16.45 ? 55   MET G CB  1 
ATOM   6001  C  CG  . MET C 1 37  ? 89.064  68.839 85.424  1.00 16.66 ? 55   MET G CG  1 
ATOM   6002  S  SD  . MET C 1 37  ? 90.095  67.733 86.418  1.00 17.73 ? 55   MET G SD  1 
ATOM   6003  C  CE  . MET C 1 37  ? 88.865  66.847 87.382  1.00 17.03 ? 55   MET G CE  1 
ATOM   6004  N  N   . LEU C 1 38  ? 85.429  69.840 85.036  1.00 16.79 ? 56   LEU G N   1 
ATOM   6005  C  CA  . LEU C 1 38  ? 84.835  70.756 86.005  1.00 17.12 ? 56   LEU G CA  1 
ATOM   6006  C  C   . LEU C 1 38  ? 85.209  70.292 87.409  1.00 17.53 ? 56   LEU G C   1 
ATOM   6007  O  O   . LEU C 1 38  ? 85.270  69.092 87.681  1.00 17.36 ? 56   LEU G O   1 
ATOM   6008  C  CB  . LEU C 1 38  ? 83.311  70.836 85.865  1.00 16.98 ? 56   LEU G CB  1 
ATOM   6009  C  CG  . LEU C 1 38  ? 82.577  71.800 86.823  1.00 17.39 ? 56   LEU G CG  1 
ATOM   6010  C  CD1 . LEU C 1 38  ? 82.592  73.253 86.326  1.00 16.24 ? 56   LEU G CD1 1 
ATOM   6011  C  CD2 . LEU C 1 38  ? 81.146  71.359 87.077  1.00 17.84 ? 56   LEU G CD2 1 
ATOM   6012  N  N   . THR C 1 39  ? 85.448  71.259 88.288  1.00 17.66 ? 57   THR G N   1 
ATOM   6013  C  CA  . THR C 1 39  ? 85.829  71.012 89.670  1.00 18.07 ? 57   THR G CA  1 
ATOM   6014  C  C   . THR C 1 39  ? 85.158  72.074 90.545  1.00 17.86 ? 57   THR G C   1 
ATOM   6015  O  O   . THR C 1 39  ? 85.184  73.262 90.208  1.00 17.60 ? 57   THR G O   1 
ATOM   6016  C  CB  . THR C 1 39  ? 87.369  71.058 89.805  1.00 18.08 ? 57   THR G CB  1 
ATOM   6017  O  OG1 . THR C 1 39  ? 87.908  69.751 89.563  1.00 19.71 ? 57   THR G OG1 1 
ATOM   6018  C  CG2 . THR C 1 39  ? 87.776  71.473 91.149  1.00 19.47 ? 57   THR G CG2 1 
ATOM   6019  N  N   . VAL C 1 40  ? 84.525  71.635 91.636  1.00 17.61 ? 58   VAL G N   1 
ATOM   6020  C  CA  . VAL C 1 40  ? 83.928  72.542 92.623  1.00 17.75 ? 58   VAL G CA  1 
ATOM   6021  C  C   . VAL C 1 40  ? 84.196  72.032 94.044  1.00 18.12 ? 58   VAL G C   1 
ATOM   6022  O  O   . VAL C 1 40  ? 83.848  70.897 94.375  1.00 18.06 ? 58   VAL G O   1 
ATOM   6023  C  CB  . VAL C 1 40  ? 82.390  72.728 92.454  1.00 17.64 ? 58   VAL G CB  1 
ATOM   6024  C  CG1 . VAL C 1 40  ? 81.970  74.073 93.024  1.00 17.33 ? 58   VAL G CG1 1 
ATOM   6025  C  CG2 . VAL C 1 40  ? 81.935  72.591 90.990  1.00 17.34 ? 58   VAL G CG2 1 
ATOM   6026  N  N   . GLU C 1 41  ? 84.808  72.885 94.868  1.00 18.27 ? 59   GLU G N   1 
ATOM   6027  C  CA  . GLU C 1 41  ? 85.114  72.574 96.267  1.00 18.66 ? 59   GLU G CA  1 
ATOM   6028  C  C   . GLU C 1 41  ? 84.008  73.019 97.219  1.00 18.82 ? 59   GLU G C   1 
ATOM   6029  O  O   . GLU C 1 41  ? 83.338  74.027 96.982  1.00 18.45 ? 59   GLU G O   1 
ATOM   6030  C  CB  . GLU C 1 41  ? 86.413  73.251 96.688  1.00 18.60 ? 59   GLU G CB  1 
ATOM   6031  C  CG  . GLU C 1 41  ? 87.626  72.836 95.877  1.00 19.96 ? 59   GLU G CG  1 
ATOM   6032  C  CD  . GLU C 1 41  ? 88.304  71.580 96.395  1.00 20.63 ? 59   GLU G CD  1 
ATOM   6033  O  OE1 . GLU C 1 41  ? 87.861  71.018 97.423  1.00 20.29 ? 59   GLU G OE1 1 
ATOM   6034  O  OE2 . GLU C 1 41  ? 89.299  71.161 95.768  1.00 22.14 ? 59   GLU G OE2 1 
ATOM   6035  N  N   . TRP C 1 42  ? 83.847  72.266 98.306  1.00 19.14 ? 60   TRP G N   1 
ATOM   6036  C  CA  . TRP C 1 42  ? 82.890  72.580 99.356  1.00 19.63 ? 60   TRP G CA  1 
ATOM   6037  C  C   . TRP C 1 42  ? 83.515  72.379 100.734 1.00 20.61 ? 60   TRP G C   1 
ATOM   6038  O  O   . TRP C 1 42  ? 84.319  71.468 100.937 1.00 20.51 ? 60   TRP G O   1 
ATOM   6039  C  CB  . TRP C 1 42  ? 81.634  71.720 99.226  1.00 19.04 ? 60   TRP G CB  1 
ATOM   6040  C  CG  . TRP C 1 42  ? 80.599  71.995 100.288 1.00 18.78 ? 60   TRP G CG  1 
ATOM   6041  C  CD1 . TRP C 1 42  ? 79.636  72.968 100.265 1.00 17.91 ? 60   TRP G CD1 1 
ATOM   6042  C  CD2 . TRP C 1 42  ? 80.425  71.289 101.530 1.00 17.49 ? 60   TRP G CD2 1 
ATOM   6043  N  NE1 . TRP C 1 42  ? 78.875  72.908 101.409 1.00 17.41 ? 60   TRP G NE1 1 
ATOM   6044  C  CE2 . TRP C 1 42  ? 79.338  71.890 102.202 1.00 17.69 ? 60   TRP G CE2 1 
ATOM   6045  C  CE3 . TRP C 1 42  ? 81.075  70.204 102.131 1.00 17.38 ? 60   TRP G CE3 1 
ATOM   6046  C  CZ2 . TRP C 1 42  ? 78.885  71.439 103.449 1.00 17.84 ? 60   TRP G CZ2 1 
ATOM   6047  C  CZ3 . TRP C 1 42  ? 80.630  69.758 103.371 1.00 17.12 ? 60   TRP G CZ3 1 
ATOM   6048  C  CH2 . TRP C 1 42  ? 79.543  70.376 104.016 1.00 17.40 ? 60   TRP G CH2 1 
ATOM   6049  N  N   . SER C 1 43  ? 83.133  73.253 101.662 1.00 21.66 ? 61   SER G N   1 
ATOM   6050  C  CA  . SER C 1 43  ? 83.521  73.182 103.066 1.00 23.13 ? 61   SER G CA  1 
ATOM   6051  C  C   . SER C 1 43  ? 82.267  73.307 103.879 1.00 23.55 ? 61   SER G C   1 
ATOM   6052  O  O   . SER C 1 43  ? 81.325  73.999 103.481 1.00 23.49 ? 61   SER G O   1 
ATOM   6053  C  CB  . SER C 1 43  ? 84.409  74.364 103.463 1.00 22.93 ? 61   SER G CB  1 
ATOM   6054  O  OG  . SER C 1 43  ? 85.744  74.172 103.056 1.00 26.45 ? 61   SER G OG  1 
ATOM   6055  N  N   . SER C 1 44  ? 82.279  72.664 105.038 1.00 24.56 ? 62   SER G N   1 
ATOM   6056  C  CA  . SER C 1 44  ? 81.269  72.891 106.060 1.00 25.49 ? 62   SER G CA  1 
ATOM   6057  C  C   . SER C 1 44  ? 81.264  74.354 106.527 1.00 25.83 ? 62   SER G C   1 
ATOM   6058  O  O   . SER C 1 44  ? 80.198  74.958 106.675 1.00 25.67 ? 62   SER G O   1 
ATOM   6059  C  CB  . SER C 1 44  ? 81.523  71.970 107.248 1.00 25.09 ? 62   SER G CB  1 
ATOM   6060  O  OG  . SER C 1 44  ? 80.405  71.982 108.096 1.00 27.05 ? 62   SER G OG  1 
ATOM   6061  N  N   . GLU C 1 45  ? 82.451  74.919 106.750 1.00 26.70 ? 63   GLU G N   1 
ATOM   6062  C  CA  . GLU C 1 45  ? 82.549  76.281 107.291 1.00 27.95 ? 63   GLU G CA  1 
ATOM   6063  C  C   . GLU C 1 45  ? 82.321  77.405 106.276 1.00 27.81 ? 63   GLU G C   1 
ATOM   6064  O  O   . GLU C 1 45  ? 81.823  78.471 106.643 1.00 28.18 ? 63   GLU G O   1 
ATOM   6065  C  CB  . GLU C 1 45  ? 83.860  76.505 108.060 1.00 28.32 ? 63   GLU G CB  1 
ATOM   6066  C  CG  . GLU C 1 45  ? 85.129  76.163 107.310 1.00 30.78 ? 63   GLU G CG  1 
ATOM   6067  C  CD  . GLU C 1 45  ? 86.396  76.414 108.132 1.00 33.95 ? 63   GLU G CD  1 
ATOM   6068  O  OE1 . GLU C 1 45  ? 86.455  77.425 108.877 1.00 35.04 ? 63   GLU G OE1 1 
ATOM   6069  O  OE2 . GLU C 1 45  ? 87.345  75.603 108.012 1.00 35.47 ? 63   GLU G OE2 1 
ATOM   6070  N  N   . PHE C 1 46  ? 82.671  77.172 105.013 1.00 27.63 ? 64   PHE G N   1 
ATOM   6071  C  CA  . PHE C 1 46  ? 82.552  78.224 103.995 1.00 27.45 ? 64   PHE G CA  1 
ATOM   6072  C  C   . PHE C 1 46  ? 81.518  77.981 102.895 1.00 26.78 ? 64   PHE G C   1 
ATOM   6073  O  O   . PHE C 1 46  ? 81.241  78.877 102.098 1.00 27.12 ? 64   PHE G O   1 
ATOM   6074  C  CB  . PHE C 1 46  ? 83.923  78.547 103.393 1.00 27.75 ? 64   PHE G CB  1 
ATOM   6075  C  CG  . PHE C 1 46  ? 84.914  79.044 104.403 1.00 29.18 ? 64   PHE G CG  1 
ATOM   6076  C  CD1 . PHE C 1 46  ? 86.083  78.336 104.654 1.00 30.26 ? 64   PHE G CD1 1 
ATOM   6077  C  CD2 . PHE C 1 46  ? 84.663  80.213 105.126 1.00 30.17 ? 64   PHE G CD2 1 
ATOM   6078  C  CE1 . PHE C 1 46  ? 86.998  78.789 105.603 1.00 31.37 ? 64   PHE G CE1 1 
ATOM   6079  C  CE2 . PHE C 1 46  ? 85.570  80.672 106.076 1.00 31.20 ? 64   PHE G CE2 1 
ATOM   6080  C  CZ  . PHE C 1 46  ? 86.739  79.959 106.315 1.00 30.87 ? 64   PHE G CZ  1 
ATOM   6081  N  N   . GLY C 1 47  ? 80.938  76.784 102.868 1.00 26.05 ? 65   GLY G N   1 
ATOM   6082  C  CA  . GLY C 1 47  ? 79.992  76.409 101.824 1.00 24.72 ? 65   GLY G CA  1 
ATOM   6083  C  C   . GLY C 1 47  ? 80.685  76.161 100.495 1.00 23.94 ? 65   GLY G C   1 
ATOM   6084  O  O   . GLY C 1 47  ? 81.889  75.878 100.450 1.00 23.42 ? 65   GLY G O   1 
ATOM   6085  N  N   . TRP C 1 48  ? 79.917  76.278 99.414  1.00 23.30 ? 66   TRP G N   1 
ATOM   6086  C  CA  . TRP C 1 48  ? 80.434  76.066 98.066  1.00 22.94 ? 66   TRP G CA  1 
ATOM   6087  C  C   . TRP C 1 48  ? 81.391  77.163 97.612  1.00 23.15 ? 66   TRP G C   1 
ATOM   6088  O  O   . TRP C 1 48  ? 81.109  78.359 97.741  1.00 23.12 ? 66   TRP G O   1 
ATOM   6089  C  CB  . TRP C 1 48  ? 79.293  75.911 97.057  1.00 22.44 ? 66   TRP G CB  1 
ATOM   6090  C  CG  . TRP C 1 48  ? 78.590  74.584 97.118  1.00 20.61 ? 66   TRP G CG  1 
ATOM   6091  C  CD1 . TRP C 1 48  ? 77.364  74.333 97.660  1.00 19.88 ? 66   TRP G CD1 1 
ATOM   6092  C  CD2 . TRP C 1 48  ? 79.070  73.326 96.616  1.00 19.46 ? 66   TRP G CD2 1 
ATOM   6093  N  NE1 . TRP C 1 48  ? 77.045  73.002 97.525  1.00 19.37 ? 66   TRP G NE1 1 
ATOM   6094  C  CE2 . TRP C 1 48  ? 78.075  72.361 96.887  1.00 18.72 ? 66   TRP G CE2 1 
ATOM   6095  C  CE3 . TRP C 1 48  ? 80.247  72.921 95.964  1.00 18.66 ? 66   TRP G CE3 1 
ATOM   6096  C  CZ2 . TRP C 1 48  ? 78.217  71.015 96.530  1.00 18.72 ? 66   TRP G CZ2 1 
ATOM   6097  C  CZ3 . TRP C 1 48  ? 80.385  71.581 95.604  1.00 17.80 ? 66   TRP G CZ3 1 
ATOM   6098  C  CH2 . TRP C 1 48  ? 79.375  70.648 95.887  1.00 18.71 ? 66   TRP G CH2 1 
ATOM   6099  N  N   . GLU C 1 49  ? 82.530  76.727 97.085  1.00 23.38 ? 67   GLU G N   1 
ATOM   6100  C  CA  . GLU C 1 49  ? 83.516  77.597 96.476  1.00 23.56 ? 67   GLU G CA  1 
ATOM   6101  C  C   . GLU C 1 49  ? 83.052  77.892 95.036  1.00 23.37 ? 67   GLU G C   1 
ATOM   6102  O  O   . GLU C 1 49  ? 82.065  77.307 94.558  1.00 23.06 ? 67   GLU G O   1 
ATOM   6103  C  CB  . GLU C 1 49  ? 84.855  76.861 96.483  1.00 23.93 ? 67   GLU G CB  1 
ATOM   6104  C  CG  . GLU C 1 49  ? 86.080  77.659 96.886  1.00 26.78 ? 67   GLU G CG  1 
ATOM   6105  C  CD  . GLU C 1 49  ? 85.941  78.392 98.213  1.00 30.14 ? 67   GLU G CD  1 
ATOM   6106  O  OE1 . GLU C 1 49  ? 85.642  77.747 99.245  1.00 31.65 ? 67   GLU G OE1 1 
ATOM   6107  O  OE2 . GLU C 1 49  ? 86.153  79.624 98.215  1.00 31.26 ? 67   GLU G OE2 1 
ATOM   6108  N  N   . LYS C 1 50  ? 83.741  78.806 94.352  1.00 23.05 ? 68   LYS G N   1 
ATOM   6109  C  CA  . LYS C 1 50  ? 83.451  79.085 92.940  1.00 22.87 ? 68   LYS G CA  1 
ATOM   6110  C  C   . LYS C 1 50  ? 83.801  77.871 92.066  1.00 22.39 ? 68   LYS G C   1 
ATOM   6111  O  O   . LYS C 1 50  ? 84.776  77.176 92.346  1.00 22.46 ? 68   LYS G O   1 
ATOM   6112  C  CB  . LYS C 1 50  ? 84.217  80.320 92.451  1.00 22.99 ? 68   LYS G CB  1 
ATOM   6113  C  CG  . LYS C 1 50  ? 83.813  81.650 93.098  1.00 23.54 ? 68   LYS G CG  1 
ATOM   6114  C  CD  . LYS C 1 50  ? 84.281  82.826 92.224  1.00 25.49 ? 68   LYS G CD  1 
ATOM   6115  C  CE  . LYS C 1 50  ? 84.443  84.118 93.007  1.00 26.73 ? 68   LYS G CE  1 
ATOM   6116  N  NZ  . LYS C 1 50  ? 83.241  84.476 93.812  1.00 28.96 ? 68   LYS G NZ  1 
ATOM   6117  N  N   . PRO C 1 51  ? 83.003  77.604 91.012  1.00 22.01 ? 69   PRO G N   1 
ATOM   6118  C  CA  . PRO C 1 51  ? 83.343  76.455 90.167  1.00 21.60 ? 69   PRO G CA  1 
ATOM   6119  C  C   . PRO C 1 51  ? 84.473  76.751 89.183  1.00 21.42 ? 69   PRO G C   1 
ATOM   6120  O  O   . PRO C 1 51  ? 84.644  77.906 88.759  1.00 21.00 ? 69   PRO G O   1 
ATOM   6121  C  CB  . PRO C 1 51  ? 82.029  76.149 89.440  1.00 21.54 ? 69   PRO G CB  1 
ATOM   6122  C  CG  . PRO C 1 51  ? 81.271  77.436 89.431  1.00 21.68 ? 69   PRO G CG  1 
ATOM   6123  C  CD  . PRO C 1 51  ? 81.778  78.295 90.558  1.00 21.94 ? 69   PRO G CD  1 
ATOM   6124  N  N   . HIS C 1 52  ? 85.239  75.714 88.843  1.00 21.02 ? 70   HIS G N   1 
ATOM   6125  C  CA  . HIS C 1 52  ? 86.368  75.833 87.918  1.00 21.30 ? 70   HIS G CA  1 
ATOM   6126  C  C   . HIS C 1 52  ? 86.237  74.909 86.710  1.00 21.26 ? 70   HIS G C   1 
ATOM   6127  O  O   . HIS C 1 52  ? 85.914  73.730 86.856  1.00 21.48 ? 70   HIS G O   1 
ATOM   6128  C  CB  . HIS C 1 52  ? 87.689  75.510 88.624  1.00 21.30 ? 70   HIS G CB  1 
ATOM   6129  C  CG  . HIS C 1 52  ? 88.205  76.617 89.488  1.00 22.25 ? 70   HIS G CG  1 
ATOM   6130  N  ND1 . HIS C 1 52  ? 87.644  76.936 90.706  1.00 23.14 ? 70   HIS G ND1 1 
ATOM   6131  C  CD2 . HIS C 1 52  ? 89.238  77.475 89.313  1.00 22.73 ? 70   HIS G CD2 1 
ATOM   6132  C  CE1 . HIS C 1 52  ? 88.305  77.946 91.242  1.00 22.81 ? 70   HIS G CE1 1 
ATOM   6133  N  NE2 . HIS C 1 52  ? 89.277  78.291 90.418  1.00 23.17 ? 70   HIS G NE2 1 
ATOM   6134  N  N   . ILE C 1 53  ? 86.481  75.453 85.521  1.00 20.95 ? 71   ILE G N   1 
ATOM   6135  C  CA  . ILE C 1 53  ? 86.798  74.626 84.361  1.00 20.63 ? 71   ILE G CA  1 
ATOM   6136  C  C   . ILE C 1 53  ? 88.285  74.805 84.096  1.00 20.43 ? 71   ILE G C   1 
ATOM   6137  O  O   . ILE C 1 53  ? 88.755  75.911 83.855  1.00 20.53 ? 71   ILE G O   1 
ATOM   6138  C  CB  . ILE C 1 53  ? 85.937  74.951 83.113  1.00 20.55 ? 71   ILE G CB  1 
ATOM   6139  C  CG1 . ILE C 1 53  ? 84.487  74.519 83.349  1.00 20.63 ? 71   ILE G CG1 1 
ATOM   6140  C  CG2 . ILE C 1 53  ? 86.483  74.224 81.889  1.00 20.00 ? 71   ILE G CG2 1 
ATOM   6141  C  CD1 . ILE C 1 53  ? 83.460  75.198 82.448  1.00 21.51 ? 71   ILE G CD1 1 
ATOM   6142  N  N   . LYS C 1 54  ? 89.023  73.707 84.174  1.00 20.32 ? 72   LYS G N   1 
ATOM   6143  C  CA  . LYS C 1 54  ? 90.477  73.745 84.082  1.00 20.13 ? 72   LYS G CA  1 
ATOM   6144  C  C   . LYS C 1 54  ? 90.973  72.513 83.330  1.00 20.05 ? 72   LYS G C   1 
ATOM   6145  O  O   . LYS C 1 54  ? 90.169  71.644 82.976  1.00 20.29 ? 72   LYS G O   1 
ATOM   6146  C  CB  . LYS C 1 54  ? 91.098  73.872 85.490  1.00 20.37 ? 72   LYS G CB  1 
ATOM   6147  C  CG  . LYS C 1 54  ? 90.869  72.686 86.436  1.00 20.33 ? 72   LYS G CG  1 
ATOM   6148  C  CD  . LYS C 1 54  ? 91.213  73.084 87.871  1.00 20.72 ? 72   LYS G CD  1 
ATOM   6149  C  CE  . LYS C 1 54  ? 91.146  71.900 88.819  1.00 21.40 ? 72   LYS G CE  1 
ATOM   6150  N  NZ  . LYS C 1 54  ? 91.572  72.261 90.207  1.00 20.96 ? 72   LYS G NZ  1 
ATOM   6151  N  N   . PRO C 1 55  ? 92.284  72.435 83.040  1.00 19.86 ? 73   PRO G N   1 
ATOM   6152  C  CA  . PRO C 1 55  ? 92.737  71.222 82.363  1.00 19.45 ? 73   PRO G CA  1 
ATOM   6153  C  C   . PRO C 1 55  ? 92.500  69.959 83.186  1.00 19.39 ? 73   PRO G C   1 
ATOM   6154  O  O   . PRO C 1 55  ? 92.553  69.997 84.415  1.00 19.73 ? 73   PRO G O   1 
ATOM   6155  C  CB  . PRO C 1 55  ? 94.237  71.469 82.171  1.00 19.21 ? 73   PRO G CB  1 
ATOM   6156  C  CG  . PRO C 1 55  ? 94.363  72.966 82.174  1.00 19.79 ? 73   PRO G CG  1 
ATOM   6157  C  CD  . PRO C 1 55  ? 93.389  73.394 83.226  1.00 19.75 ? 73   PRO G CD  1 
ATOM   6158  N  N   . LEU C 1 56  ? 92.228  68.855 82.500  1.00 18.86 ? 74   LEU G N   1 
ATOM   6159  C  CA  . LEU C 1 56  ? 92.118  67.567 83.145  1.00 18.66 ? 74   LEU G CA  1 
ATOM   6160  C  C   . LEU C 1 56  ? 93.411  67.290 83.906  1.00 18.68 ? 74   LEU G C   1 
ATOM   6161  O  O   . LEU C 1 56  ? 94.508  67.416 83.352  1.00 18.75 ? 74   LEU G O   1 
ATOM   6162  C  CB  . LEU C 1 56  ? 91.875  66.471 82.111  1.00 18.39 ? 74   LEU G CB  1 
ATOM   6163  C  CG  . LEU C 1 56  ? 91.840  65.037 82.631  1.00 18.16 ? 74   LEU G CG  1 
ATOM   6164  C  CD1 . LEU C 1 56  ? 90.463  64.704 83.205  1.00 17.72 ? 74   LEU G CD1 1 
ATOM   6165  C  CD2 . LEU C 1 56  ? 92.209  64.087 81.513  1.00 17.76 ? 74   LEU G CD2 1 
ATOM   6166  N  N   . GLN C 1 57  ? 93.271  66.923 85.175  1.00 18.11 ? 75   GLN G N   1 
ATOM   6167  C  CA  . GLN C 1 57  ? 94.421  66.700 86.039  1.00 18.16 ? 75   GLN G CA  1 
ATOM   6168  C  C   . GLN C 1 57  ? 94.065  65.706 87.133  1.00 18.13 ? 75   GLN G C   1 
ATOM   6169  O  O   . GLN C 1 57  ? 92.880  65.465 87.406  1.00 17.63 ? 75   GLN G O   1 
ATOM   6170  C  CB  . GLN C 1 57  ? 94.913  68.024 86.646  1.00 18.05 ? 75   GLN G CB  1 
ATOM   6171  C  CG  . GLN C 1 57  ? 93.825  68.860 87.308  1.00 19.34 ? 75   GLN G CG  1 
ATOM   6172  C  CD  . GLN C 1 57  ? 94.234  70.312 87.535  1.00 21.03 ? 75   GLN G CD  1 
ATOM   6173  O  OE1 . GLN C 1 57  ? 94.433  70.730 88.676  1.00 21.82 ? 75   GLN G OE1 1 
ATOM   6174  N  NE2 . GLN C 1 57  ? 94.334  71.094 86.449  1.00 20.83 ? 75   GLN G NE2 1 
ATOM   6175  N  N   . ASN C 1 58  ? 95.100  65.124 87.740  1.00 17.91 ? 76   ASN G N   1 
ATOM   6176  C  CA  . ASN C 1 58  ? 94.934  64.274 88.902  1.00 17.62 ? 76   ASN G CA  1 
ATOM   6177  C  C   . ASN C 1 58  ? 94.337  65.046 90.062  1.00 17.37 ? 76   ASN G C   1 
ATOM   6178  O  O   . ASN C 1 58  ? 94.526  66.255 90.191  1.00 17.43 ? 76   ASN G O   1 
ATOM   6179  C  CB  . ASN C 1 58  ? 96.272  63.661 89.318  1.00 17.79 ? 76   ASN G CB  1 
ATOM   6180  C  CG  . ASN C 1 58  ? 96.622  62.413 88.521  1.00 18.46 ? 76   ASN G CG  1 
ATOM   6181  O  OD1 . ASN C 1 58  ? 95.976  62.087 87.513  1.00 18.40 ? 76   ASN G OD1 1 
ATOM   6182  N  ND2 . ASN C 1 58  ? 97.649  61.704 88.972  1.00 18.52 ? 76   ASN G ND2 1 
ATOM   6183  N  N   . LEU C 1 59  ? 93.590  64.341 90.895  1.00 17.11 ? 77   LEU G N   1 
ATOM   6184  C  CA  . LEU C 1 59  ? 93.082  64.918 92.125  1.00 16.90 ? 77   LEU G CA  1 
ATOM   6185  C  C   . LEU C 1 59  ? 94.139  64.788 93.215  1.00 16.70 ? 77   LEU G C   1 
ATOM   6186  O  O   . LEU C 1 59  ? 94.752  63.734 93.373  1.00 16.73 ? 77   LEU G O   1 
ATOM   6187  C  CB  . LEU C 1 59  ? 91.788  64.221 92.539  1.00 16.71 ? 77   LEU G CB  1 
ATOM   6188  C  CG  . LEU C 1 59  ? 90.683  64.170 91.477  1.00 17.05 ? 77   LEU G CG  1 
ATOM   6189  C  CD1 . LEU C 1 59  ? 89.498  63.354 91.993  1.00 16.46 ? 77   LEU G CD1 1 
ATOM   6190  C  CD2 . LEU C 1 59  ? 90.249  65.582 91.047  1.00 15.47 ? 77   LEU G CD2 1 
ATOM   6191  N  N   . SER C 1 60  ? 94.370  65.877 93.939  1.00 16.62 ? 78   SER G N   1 
ATOM   6192  C  CA  . SER C 1 60  ? 95.253  65.858 95.097  1.00 16.54 ? 78   SER G CA  1 
ATOM   6193  C  C   . SER C 1 60  ? 94.392  65.697 96.343  1.00 15.73 ? 78   SER G C   1 
ATOM   6194  O  O   . SER C 1 60  ? 93.727  66.640 96.773  1.00 15.77 ? 78   SER G O   1 
ATOM   6195  C  CB  . SER C 1 60  ? 96.087  67.136 95.178  1.00 16.76 ? 78   SER G CB  1 
ATOM   6196  O  OG  . SER C 1 60  ? 97.037  67.040 96.225  1.00 18.28 ? 78   SER G OG  1 
ATOM   6197  N  N   . LEU C 1 61  ? 94.411  64.493 96.909  1.00 14.90 ? 79   LEU G N   1 
ATOM   6198  C  CA  . LEU C 1 61  ? 93.495  64.117 97.988  1.00 14.69 ? 79   LEU G CA  1 
ATOM   6199  C  C   . LEU C 1 61  ? 94.220  63.679 99.255  1.00 14.18 ? 79   LEU G C   1 
ATOM   6200  O  O   . LEU C 1 61  ? 95.102  62.821 99.202  1.00 13.59 ? 79   LEU G O   1 
ATOM   6201  C  CB  . LEU C 1 61  ? 92.604  62.958 97.520  1.00 14.73 ? 79   LEU G CB  1 
ATOM   6202  C  CG  . LEU C 1 61  ? 91.205  63.149 96.918  1.00 15.59 ? 79   LEU G CG  1 
ATOM   6203  C  CD1 . LEU C 1 61  ? 90.999  64.451 96.158  1.00 15.34 ? 79   LEU G CD1 1 
ATOM   6204  C  CD2 . LEU C 1 61  ? 90.846  61.921 96.064  1.00 14.30 ? 79   LEU G CD2 1 
ATOM   6205  N  N   . HIS C 1 62  ? 93.830  64.250 100.392 1.00 13.83 ? 80   HIS G N   1 
ATOM   6206  C  CA  . HIS C 1 62  ? 94.301  63.760 101.684 1.00 13.80 ? 80   HIS G CA  1 
ATOM   6207  C  C   . HIS C 1 62  ? 94.044  62.251 101.731 1.00 13.35 ? 80   HIS G C   1 
ATOM   6208  O  O   . HIS C 1 62  ? 92.960  61.808 101.346 1.00 13.19 ? 80   HIS G O   1 
ATOM   6209  C  CB  . HIS C 1 62  ? 93.574  64.471 102.836 1.00 14.00 ? 80   HIS G CB  1 
ATOM   6210  C  CG  . HIS C 1 62  ? 94.269  64.342 104.157 1.00 15.20 ? 80   HIS G CG  1 
ATOM   6211  N  ND1 . HIS C 1 62  ? 94.304  63.160 104.869 1.00 16.01 ? 80   HIS G ND1 1 
ATOM   6212  C  CD2 . HIS C 1 62  ? 94.963  65.246 104.891 1.00 14.85 ? 80   HIS G CD2 1 
ATOM   6213  C  CE1 . HIS C 1 62  ? 94.989  63.343 105.986 1.00 15.79 ? 80   HIS G CE1 1 
ATOM   6214  N  NE2 . HIS C 1 62  ? 95.399  64.599 106.023 1.00 15.65 ? 80   HIS G NE2 1 
ATOM   6215  N  N   . PRO C 1 63  ? 95.045  61.451 102.168 1.00 13.07 ? 81   PRO G N   1 
ATOM   6216  C  CA  . PRO C 1 63  ? 94.878  59.991 102.230 1.00 12.76 ? 81   PRO G CA  1 
ATOM   6217  C  C   . PRO C 1 63  ? 93.750  59.531 103.167 1.00 12.65 ? 81   PRO G C   1 
ATOM   6218  O  O   . PRO C 1 63  ? 93.312  58.377 103.089 1.00 12.74 ? 81   PRO G O   1 
ATOM   6219  C  CB  . PRO C 1 63  ? 96.241  59.500 102.741 1.00 12.98 ? 81   PRO G CB  1 
ATOM   6220  C  CG  . PRO C 1 63  ? 96.870  60.694 103.397 1.00 12.51 ? 81   PRO G CG  1 
ATOM   6221  C  CD  . PRO C 1 63  ? 96.392  61.865 102.604 1.00 13.05 ? 81   PRO G CD  1 
ATOM   6222  N  N   . GLY C 1 64  ? 93.290  60.432 104.036 1.00 12.49 ? 82   GLY G N   1 
ATOM   6223  C  CA  . GLY C 1 64  ? 92.193  60.149 104.961 1.00 12.10 ? 82   GLY G CA  1 
ATOM   6224  C  C   . GLY C 1 64  ? 90.819  60.467 104.381 1.00 12.19 ? 82   GLY G C   1 
ATOM   6225  O  O   . GLY C 1 64  ? 89.803  60.229 105.040 1.00 11.93 ? 82   GLY G O   1 
ATOM   6226  N  N   . SER C 1 65  ? 90.787  60.995 103.151 1.00 11.94 ? 83   SER G N   1 
ATOM   6227  C  CA  . SER C 1 65  ? 89.524  61.348 102.473 1.00 11.89 ? 83   SER G CA  1 
ATOM   6228  C  C   . SER C 1 65  ? 88.488  60.238 102.590 1.00 11.64 ? 83   SER G C   1 
ATOM   6229  O  O   . SER C 1 65  ? 88.750  59.106 102.189 1.00 11.73 ? 83   SER G O   1 
ATOM   6230  C  CB  . SER C 1 65  ? 89.755  61.676 100.993 1.00 11.85 ? 83   SER G CB  1 
ATOM   6231  O  OG  . SER C 1 65  ? 90.639  62.775 100.837 1.00 11.37 ? 83   SER G OG  1 
ATOM   6232  N  N   . SER C 1 66  ? 87.310  60.576 103.121 1.00 11.44 ? 84   SER G N   1 
ATOM   6233  C  CA  . SER C 1 66  ? 86.241  59.589 103.373 1.00 11.33 ? 84   SER G CA  1 
ATOM   6234  C  C   . SER C 1 66  ? 85.758  58.818 102.134 1.00 11.30 ? 84   SER G C   1 
ATOM   6235  O  O   . SER C 1 66  ? 85.220  57.715 102.262 1.00 11.28 ? 84   SER G O   1 
ATOM   6236  C  CB  . SER C 1 66  ? 85.059  60.239 104.101 1.00 11.18 ? 84   SER G CB  1 
ATOM   6237  O  OG  . SER C 1 66  ? 84.544  61.354 103.383 1.00 11.53 ? 84   SER G OG  1 
ATOM   6238  N  N   . ALA C 1 67  ? 85.958  59.385 100.942 1.00 11.47 ? 85   ALA G N   1 
ATOM   6239  C  CA  . ALA C 1 67  ? 85.627  58.684 99.688  1.00 11.25 ? 85   ALA G CA  1 
ATOM   6240  C  C   . ALA C 1 67  ? 86.460  57.410 99.504  1.00 11.03 ? 85   ALA G C   1 
ATOM   6241  O  O   . ALA C 1 67  ? 86.070  56.507 98.765  1.00 11.24 ? 85   ALA G O   1 
ATOM   6242  C  CB  . ALA C 1 67  ? 85.814  59.606 98.490  1.00 10.68 ? 85   ALA G CB  1 
ATOM   6243  N  N   . LEU C 1 68  ? 87.600  57.355 100.188 1.00 11.09 ? 86   LEU G N   1 
ATOM   6244  C  CA  . LEU C 1 68  ? 88.586  56.288 100.027 1.00 10.88 ? 86   LEU G CA  1 
ATOM   6245  C  C   . LEU C 1 68  ? 88.459  55.225 101.109 1.00 10.86 ? 86   LEU G C   1 
ATOM   6246  O  O   . LEU C 1 68  ? 88.948  54.104 100.949 1.00 11.16 ? 86   LEU G O   1 
ATOM   6247  C  CB  . LEU C 1 68  ? 90.007  56.878 100.040 1.00 11.20 ? 86   LEU G CB  1 
ATOM   6248  C  CG  . LEU C 1 68  ? 90.380  57.948 99.007  1.00 11.24 ? 86   LEU G CG  1 
ATOM   6249  C  CD1 . LEU C 1 68  ? 91.762  58.511 99.286  1.00 12.24 ? 86   LEU G CD1 1 
ATOM   6250  C  CD2 . LEU C 1 68  ? 90.315  57.377 97.604  1.00 10.91 ? 86   LEU G CD2 1 
ATOM   6251  N  N   . HIS C 1 69  ? 87.790  55.581 102.208 1.00 10.70 ? 87   HIS G N   1 
ATOM   6252  C  CA  . HIS C 1 69  ? 87.637  54.697 103.361 1.00 10.04 ? 87   HIS G CA  1 
ATOM   6253  C  C   . HIS C 1 69  ? 86.218  54.176 103.516 1.00 9.82  ? 87   HIS G C   1 
ATOM   6254  O  O   . HIS C 1 69  ? 86.018  52.996 103.788 1.00 9.42  ? 87   HIS G O   1 
ATOM   6255  C  CB  . HIS C 1 69  ? 88.074  55.410 104.648 1.00 9.76  ? 87   HIS G CB  1 
ATOM   6256  C  CG  . HIS C 1 69  ? 89.514  55.809 104.648 1.00 10.72 ? 87   HIS G CG  1 
ATOM   6257  N  ND1 . HIS C 1 69  ? 90.499  55.044 105.234 1.00 9.90  ? 87   HIS G ND1 1 
ATOM   6258  C  CD2 . HIS C 1 69  ? 90.142  56.874 104.096 1.00 10.45 ? 87   HIS G CD2 1 
ATOM   6259  C  CE1 . HIS C 1 69  ? 91.669  55.631 105.061 1.00 9.72  ? 87   HIS G CE1 1 
ATOM   6260  N  NE2 . HIS C 1 69  ? 91.481  56.740 104.370 1.00 10.62 ? 87   HIS G NE2 1 
ATOM   6261  N  N   . TYR C 1 70  ? 85.238  55.068 103.350 1.00 9.83  ? 88   TYR G N   1 
ATOM   6262  C  CA  . TYR C 1 70  ? 83.849  54.762 103.666 1.00 9.38  ? 88   TYR G CA  1 
ATOM   6263  C  C   . TYR C 1 70  ? 82.927  54.993 102.469 1.00 9.54  ? 88   TYR G C   1 
ATOM   6264  O  O   . TYR C 1 70  ? 81.712  55.117 102.630 1.00 8.95  ? 88   TYR G O   1 
ATOM   6265  C  CB  . TYR C 1 70  ? 83.391  55.577 104.890 1.00 9.51  ? 88   TYR G CB  1 
ATOM   6266  C  CG  . TYR C 1 70  ? 84.355  55.499 106.073 1.00 9.85  ? 88   TYR G CG  1 
ATOM   6267  C  CD1 . TYR C 1 70  ? 84.816  54.264 106.554 1.00 9.59  ? 88   TYR G CD1 1 
ATOM   6268  C  CD2 . TYR C 1 70  ? 84.805  56.657 106.708 1.00 9.44  ? 88   TYR G CD2 1 
ATOM   6269  C  CE1 . TYR C 1 70  ? 85.718  54.189 107.621 1.00 9.91  ? 88   TYR G CE1 1 
ATOM   6270  C  CE2 . TYR C 1 70  ? 85.697  56.590 107.783 1.00 8.97  ? 88   TYR G CE2 1 
ATOM   6271  C  CZ  . TYR C 1 70  ? 86.145  55.360 108.227 1.00 9.67  ? 88   TYR G CZ  1 
ATOM   6272  O  OH  . TYR C 1 70  ? 87.020  55.295 109.282 1.00 11.39 ? 88   TYR G OH  1 
ATOM   6273  N  N   . ALA C 1 71  ? 83.520  55.050 101.275 1.00 9.23  ? 89   ALA G N   1 
ATOM   6274  C  CA  . ALA C 1 71  ? 82.777  55.203 100.011 1.00 9.60  ? 89   ALA G CA  1 
ATOM   6275  C  C   . ALA C 1 71  ? 81.745  56.339 100.005 1.00 9.64  ? 89   ALA G C   1 
ATOM   6276  O  O   . ALA C 1 71  ? 80.618  56.168 99.518  1.00 9.25  ? 89   ALA G O   1 
ATOM   6277  C  CB  . ALA C 1 71  ? 82.128  53.868 99.601  1.00 9.37  ? 89   ALA G CB  1 
ATOM   6278  N  N   . VAL C 1 72  ? 82.142  57.493 100.550 1.00 9.87  ? 90   VAL G N   1 
ATOM   6279  C  CA  . VAL C 1 72  ? 81.301  58.691 100.571 1.00 9.77  ? 90   VAL G CA  1 
ATOM   6280  C  C   . VAL C 1 72  ? 81.439  59.335 99.198  1.00 9.75  ? 90   VAL G C   1 
ATOM   6281  O  O   . VAL C 1 72  ? 82.293  60.198 98.974  1.00 9.95  ? 90   VAL G O   1 
ATOM   6282  C  CB  . VAL C 1 72  ? 81.700  59.682 101.713 1.00 10.09 ? 90   VAL G CB  1 
ATOM   6283  C  CG1 . VAL C 1 72  ? 80.765  60.896 101.748 1.00 10.12 ? 90   VAL G CG1 1 
ATOM   6284  C  CG2 . VAL C 1 72  ? 81.705  58.984 103.070 1.00 10.17 ? 90   VAL G CG2 1 
ATOM   6285  N  N   . GLU C 1 73  ? 80.596  58.885 98.275  1.00 9.40  ? 91   GLU G N   1 
ATOM   6286  C  CA  . GLU C 1 73  ? 80.764  59.175 96.866  1.00 9.18  ? 91   GLU G CA  1 
ATOM   6287  C  C   . GLU C 1 73  ? 79.514  58.790 96.083  1.00 9.46  ? 91   GLU G C   1 
ATOM   6288  O  O   . GLU C 1 73  ? 78.809  57.852 96.444  1.00 9.25  ? 91   GLU G O   1 
ATOM   6289  C  CB  . GLU C 1 73  ? 81.959  58.385 96.316  1.00 9.13  ? 91   GLU G CB  1 
ATOM   6290  C  CG  . GLU C 1 73  ? 81.721  56.864 96.258  1.00 8.52  ? 91   GLU G CG  1 
ATOM   6291  C  CD  . GLU C 1 73  ? 82.966  56.076 95.971  1.00 9.23  ? 91   GLU G CD  1 
ATOM   6292  O  OE1 . GLU C 1 73  ? 82.883  55.089 95.209  1.00 8.34  ? 91   GLU G OE1 1 
ATOM   6293  O  OE2 . GLU C 1 73  ? 84.027  56.435 96.520  1.00 10.68 ? 91   GLU G OE2 1 
ATOM   6294  N  N   . LEU C 1 74  ? 79.253  59.524 95.009  1.00 9.63  ? 92   LEU G N   1 
ATOM   6295  C  CA  . LEU C 1 74  ? 78.231  59.143 94.045  1.00 10.47 ? 92   LEU G CA  1 
ATOM   6296  C  C   . LEU C 1 74  ? 78.610  59.663 92.677  1.00 10.44 ? 92   LEU G C   1 
ATOM   6297  O  O   . LEU C 1 74  ? 79.505  60.507 92.546  1.00 10.68 ? 92   LEU G O   1 
ATOM   6298  C  CB  . LEU C 1 74  ? 76.813  59.610 94.458  1.00 10.37 ? 92   LEU G CB  1 
ATOM   6299  C  CG  . LEU C 1 74  ? 76.281  61.052 94.582  1.00 11.91 ? 92   LEU G CG  1 
ATOM   6300  C  CD1 . LEU C 1 74  ? 76.642  61.694 95.898  1.00 13.21 ? 92   LEU G CD1 1 
ATOM   6301  C  CD2 . LEU C 1 74  ? 76.553  62.008 93.392  1.00 9.80  ? 92   LEU G CD2 1 
ATOM   6302  N  N   . PHE C 1 75  ? 77.928  59.164 91.660  1.00 10.49 ? 93   PHE G N   1 
ATOM   6303  C  CA  . PHE C 1 75  ? 78.210  59.578 90.299  1.00 10.93 ? 93   PHE G CA  1 
ATOM   6304  C  C   . PHE C 1 75  ? 76.923  59.638 89.489  1.00 11.35 ? 93   PHE G C   1 
ATOM   6305  O  O   . PHE C 1 75  ? 75.868  59.159 89.922  1.00 11.25 ? 93   PHE G O   1 
ATOM   6306  C  CB  . PHE C 1 75  ? 79.234  58.640 89.622  1.00 10.56 ? 93   PHE G CB  1 
ATOM   6307  C  CG  . PHE C 1 75  ? 78.726  57.240 89.397  1.00 10.34 ? 93   PHE G CG  1 
ATOM   6308  C  CD1 . PHE C 1 75  ? 78.713  56.314 90.439  1.00 9.53  ? 93   PHE G CD1 1 
ATOM   6309  C  CD2 . PHE C 1 75  ? 78.262  56.843 88.140  1.00 9.74  ? 93   PHE G CD2 1 
ATOM   6310  C  CE1 . PHE C 1 75  ? 78.244  55.014 90.244  1.00 9.21  ? 93   PHE G CE1 1 
ATOM   6311  C  CE2 . PHE C 1 75  ? 77.788  55.549 87.932  1.00 10.56 ? 93   PHE G CE2 1 
ATOM   6312  C  CZ  . PHE C 1 75  ? 77.779  54.630 88.989  1.00 10.16 ? 93   PHE G CZ  1 
ATOM   6313  N  N   . GLU C 1 76  ? 77.036  60.241 88.315  1.00 11.48 ? 94   GLU G N   1 
ATOM   6314  C  CA  . GLU C 1 76  ? 75.987  60.214 87.323  1.00 11.40 ? 94   GLU G CA  1 
ATOM   6315  C  C   . GLU C 1 76  ? 76.571  59.798 85.977  1.00 11.13 ? 94   GLU G C   1 
ATOM   6316  O  O   . GLU C 1 76  ? 77.790  59.740 85.808  1.00 10.52 ? 94   GLU G O   1 
ATOM   6317  C  CB  . GLU C 1 76  ? 75.307  61.585 87.229  1.00 11.37 ? 94   GLU G CB  1 
ATOM   6318  C  CG  . GLU C 1 76  ? 74.029  61.680 88.053  1.00 11.97 ? 94   GLU G CG  1 
ATOM   6319  C  CD  . GLU C 1 76  ? 73.042  60.584 87.703  1.00 13.00 ? 94   GLU G CD  1 
ATOM   6320  O  OE1 . GLU C 1 76  ? 72.312  60.131 88.613  1.00 12.80 ? 94   GLU G OE1 1 
ATOM   6321  O  OE2 . GLU C 1 76  ? 73.016  60.159 86.520  1.00 13.02 ? 94   GLU G OE2 1 
ATOM   6322  N  N   . GLY C 1 77  ? 75.691  59.501 85.028  1.00 11.22 ? 95   GLY G N   1 
ATOM   6323  C  CA  . GLY C 1 77  ? 76.103  59.191 83.665  1.00 11.50 ? 95   GLY G CA  1 
ATOM   6324  C  C   . GLY C 1 77  ? 75.085  59.693 82.666  1.00 11.45 ? 95   GLY G C   1 
ATOM   6325  O  O   . GLY C 1 77  ? 73.926  59.293 82.700  1.00 11.62 ? 95   GLY G O   1 
ATOM   6326  N  N   . LEU C 1 78  ? 75.527  60.586 81.789  1.00 11.51 ? 96   LEU G N   1 
ATOM   6327  C  CA  . LEU C 1 78  ? 74.711  61.102 80.691  1.00 11.60 ? 96   LEU G CA  1 
ATOM   6328  C  C   . LEU C 1 78  ? 75.581  61.386 79.472  1.00 11.50 ? 96   LEU G C   1 
ATOM   6329  O  O   . LEU C 1 78  ? 76.803  61.340 79.558  1.00 11.42 ? 96   LEU G O   1 
ATOM   6330  C  CB  . LEU C 1 78  ? 73.882  62.346 81.083  1.00 11.33 ? 96   LEU G CB  1 
ATOM   6331  C  CG  . LEU C 1 78  ? 74.136  63.445 82.133  1.00 11.88 ? 96   LEU G CG  1 
ATOM   6332  C  CD1 . LEU C 1 78  ? 75.475  63.432 82.866  1.00 11.21 ? 96   LEU G CD1 1 
ATOM   6333  C  CD2 . LEU C 1 78  ? 73.827  64.829 81.539  1.00 10.20 ? 96   LEU G CD2 1 
ATOM   6334  N  N   . LYS C 1 79  ? 74.948  61.681 78.342  1.00 11.63 ? 97   LYS G N   1 
ATOM   6335  C  CA  . LYS C 1 79  ? 75.672  61.831 77.080  1.00 11.90 ? 97   LYS G CA  1 
ATOM   6336  C  C   . LYS C 1 79  ? 75.328  63.113 76.328  1.00 12.23 ? 97   LYS G C   1 
ATOM   6337  O  O   . LYS C 1 79  ? 74.206  63.622 76.433  1.00 12.29 ? 97   LYS G O   1 
ATOM   6338  C  CB  . LYS C 1 79  ? 75.425  60.622 76.172  1.00 11.69 ? 97   LYS G CB  1 
ATOM   6339  C  CG  . LYS C 1 79  ? 75.978  59.304 76.695  1.00 11.55 ? 97   LYS G CG  1 
ATOM   6340  C  CD  . LYS C 1 79  ? 75.708  58.159 75.728  1.00 12.51 ? 97   LYS G CD  1 
ATOM   6341  C  CE  . LYS C 1 79  ? 76.722  57.038 75.933  1.00 13.75 ? 97   LYS G CE  1 
ATOM   6342  N  NZ  . LYS C 1 79  ? 76.428  55.826 75.125  1.00 14.37 ? 97   LYS G NZ  1 
ATOM   6343  N  N   . ALA C 1 80  ? 76.320  63.626 75.596  1.00 12.25 ? 98   ALA G N   1 
ATOM   6344  C  CA  . ALA C 1 80  ? 76.126  64.639 74.556  1.00 12.77 ? 98   ALA G CA  1 
ATOM   6345  C  C   . ALA C 1 80  ? 76.249  63.980 73.175  1.00 12.76 ? 98   ALA G C   1 
ATOM   6346  O  O   . ALA C 1 80  ? 77.088  63.097 72.978  1.00 12.68 ? 98   ALA G O   1 
ATOM   6347  C  CB  . ALA C 1 80  ? 77.138  65.787 74.703  1.00 12.26 ? 98   ALA G CB  1 
ATOM   6348  N  N   . PHE C 1 81  ? 75.405  64.406 72.234  1.00 13.04 ? 99   PHE G N   1 
ATOM   6349  C  CA  . PHE C 1 81  ? 75.342  63.801 70.897  1.00 13.22 ? 99   PHE G CA  1 
ATOM   6350  C  C   . PHE C 1 81  ? 75.416  64.861 69.794  1.00 13.37 ? 99   PHE G C   1 
ATOM   6351  O  O   . PHE C 1 81  ? 74.595  65.790 69.755  1.00 13.23 ? 99   PHE G O   1 
ATOM   6352  C  CB  . PHE C 1 81  ? 74.038  63.017 70.690  1.00 13.19 ? 99   PHE G CB  1 
ATOM   6353  C  CG  . PHE C 1 81  ? 73.748  61.977 71.736  1.00 13.15 ? 99   PHE G CG  1 
ATOM   6354  C  CD1 . PHE C 1 81  ? 73.040  62.311 72.892  1.00 13.53 ? 99   PHE G CD1 1 
ATOM   6355  C  CD2 . PHE C 1 81  ? 74.111  60.655 71.532  1.00 13.77 ? 99   PHE G CD2 1 
ATOM   6356  C  CE1 . PHE C 1 81  ? 72.746  61.355 73.851  1.00 13.01 ? 99   PHE G CE1 1 
ATOM   6357  C  CE2 . PHE C 1 81  ? 73.817  59.680 72.480  1.00 14.19 ? 99   PHE G CE2 1 
ATOM   6358  C  CZ  . PHE C 1 81  ? 73.134  60.036 73.649  1.00 14.16 ? 99   PHE G CZ  1 
ATOM   6359  N  N   . ARG C 1 82  ? 76.383  64.696 68.894  1.00 13.56 ? 100  ARG G N   1 
ATOM   6360  C  CA  . ARG C 1 82  ? 76.504  65.528 67.697  1.00 13.91 ? 100  ARG G CA  1 
ATOM   6361  C  C   . ARG C 1 82  ? 75.438  65.066 66.702  1.00 14.24 ? 100  ARG G C   1 
ATOM   6362  O  O   . ARG C 1 82  ? 75.523  63.965 66.133  1.00 14.26 ? 100  ARG G O   1 
ATOM   6363  C  CB  . ARG C 1 82  ? 77.912  65.399 67.111  1.00 13.98 ? 100  ARG G CB  1 
ATOM   6364  C  CG  . ARG C 1 82  ? 78.225  66.260 65.877  1.00 14.52 ? 100  ARG G CG  1 
ATOM   6365  C  CD  . ARG C 1 82  ? 79.739  66.601 65.806  1.00 15.38 ? 100  ARG G CD  1 
ATOM   6366  N  NE  . ARG C 1 82  ? 79.978  68.031 66.071  1.00 18.20 ? 100  ARG G NE  1 
ATOM   6367  C  CZ  . ARG C 1 82  ? 80.863  68.520 66.929  1.00 20.13 ? 100  ARG G CZ  1 
ATOM   6368  N  NH1 . ARG C 1 82  ? 81.649  67.714 67.629  1.00 19.81 ? 100  ARG G NH1 1 
ATOM   6369  N  NH2 . ARG C 1 82  ? 80.983  69.842 67.069  1.00 24.26 ? 100  ARG G NH2 1 
ATOM   6370  N  N   . GLY C 1 83  ? 74.431  65.909 66.512  1.00 14.45 ? 101  GLY G N   1 
ATOM   6371  C  CA  . GLY C 1 83  ? 73.272  65.549 65.721  1.00 15.24 ? 101  GLY G CA  1 
ATOM   6372  C  C   . GLY C 1 83  ? 73.520  65.420 64.236  1.00 15.71 ? 101  GLY G C   1 
ATOM   6373  O  O   . GLY C 1 83  ? 74.580  65.811 63.729  1.00 15.40 ? 101  GLY G O   1 
ATOM   6374  N  N   . VAL C 1 84  ? 72.517  64.881 63.546  1.00 16.15 ? 102  VAL G N   1 
ATOM   6375  C  CA  . VAL C 1 84  ? 72.512  64.793 62.089  1.00 16.84 ? 102  VAL G CA  1 
ATOM   6376  C  C   . VAL C 1 84  ? 72.704  66.182 61.446  1.00 16.77 ? 102  VAL G C   1 
ATOM   6377  O  O   . VAL C 1 84  ? 73.270  66.306 60.359  1.00 17.38 ? 102  VAL G O   1 
ATOM   6378  C  CB  . VAL C 1 84  ? 71.229  64.055 61.576  1.00 16.82 ? 102  VAL G CB  1 
ATOM   6379  C  CG1 . VAL C 1 84  ? 69.976  64.917 61.734  1.00 16.92 ? 102  VAL G CG1 1 
ATOM   6380  C  CG2 . VAL C 1 84  ? 71.403  63.611 60.128  1.00 18.74 ? 102  VAL G CG2 1 
ATOM   6381  N  N   . ASP C 1 85  ? 72.265  67.214 62.161  1.00 16.64 ? 103  ASP G N   1 
ATOM   6382  C  CA  . ASP C 1 85  ? 72.369  68.609 61.743  1.00 16.44 ? 103  ASP G CA  1 
ATOM   6383  C  C   . ASP C 1 85  ? 73.588  69.334 62.340  1.00 16.45 ? 103  ASP G C   1 
ATOM   6384  O  O   . ASP C 1 85  ? 73.691  70.559 62.233  1.00 16.53 ? 103  ASP G O   1 
ATOM   6385  C  CB  . ASP C 1 85  ? 71.084  69.354 62.124  1.00 16.18 ? 103  ASP G CB  1 
ATOM   6386  C  CG  . ASP C 1 85  ? 70.763  69.244 63.597  1.00 16.10 ? 103  ASP G CG  1 
ATOM   6387  O  OD1 . ASP C 1 85  ? 69.815  69.903 64.045  1.00 17.30 ? 103  ASP G OD1 1 
ATOM   6388  O  OD2 . ASP C 1 85  ? 71.458  68.506 64.319  1.00 15.60 ? 103  ASP G OD2 1 
ATOM   6389  N  N   . ASN C 1 86  ? 74.488  68.569 62.968  1.00 16.58 ? 104  ASN G N   1 
ATOM   6390  C  CA  . ASN C 1 86  ? 75.734  69.068 63.598  1.00 16.51 ? 104  ASN G CA  1 
ATOM   6391  C  C   . ASN C 1 86  ? 75.541  69.887 64.886  1.00 16.66 ? 104  ASN G C   1 
ATOM   6392  O  O   . ASN C 1 86  ? 76.509  70.390 65.465  1.00 16.65 ? 104  ASN G O   1 
ATOM   6393  C  CB  . ASN C 1 86  ? 76.632  69.818 62.584  1.00 16.45 ? 104  ASN G CB  1 
ATOM   6394  C  CG  . ASN C 1 86  ? 78.113  69.813 62.982  1.00 16.07 ? 104  ASN G CG  1 
ATOM   6395  O  OD1 . ASN C 1 86  ? 78.694  68.761 63.264  1.00 15.41 ? 104  ASN G OD1 1 
ATOM   6396  N  ND2 . ASN C 1 86  ? 78.728  70.992 62.987  1.00 14.26 ? 104  ASN G ND2 1 
ATOM   6397  N  N   . LYS C 1 87  ? 74.298  70.005 65.343  1.00 16.57 ? 105  LYS G N   1 
ATOM   6398  C  CA  . LYS C 1 87  ? 74.016  70.633 66.627  1.00 16.68 ? 105  LYS G CA  1 
ATOM   6399  C  C   . LYS C 1 87  ? 74.268  69.601 67.724  1.00 16.39 ? 105  LYS G C   1 
ATOM   6400  O  O   . LYS C 1 87  ? 73.921  68.424 67.571  1.00 16.61 ? 105  LYS G O   1 
ATOM   6401  C  CB  . LYS C 1 87  ? 72.567  71.135 66.689  1.00 16.91 ? 105  LYS G CB  1 
ATOM   6402  C  CG  . LYS C 1 87  ? 72.235  72.343 65.797  1.00 18.20 ? 105  LYS G CG  1 
ATOM   6403  C  CD  . LYS C 1 87  ? 70.757  72.720 65.944  1.00 20.48 ? 105  LYS G CD  1 
ATOM   6404  C  CE  . LYS C 1 87  ? 70.414  74.070 65.301  1.00 22.53 ? 105  LYS G CE  1 
ATOM   6405  N  NZ  . LYS C 1 87  ? 70.308  73.980 63.816  1.00 24.25 ? 105  LYS G NZ  1 
ATOM   6406  N  N   . ILE C 1 88  ? 74.892  70.030 68.814  1.00 15.93 ? 106  ILE G N   1 
ATOM   6407  C  CA  . ILE C 1 88  ? 75.124  69.127 69.937  1.00 16.12 ? 106  ILE G CA  1 
ATOM   6408  C  C   . ILE C 1 88  ? 73.932  69.145 70.903  1.00 16.17 ? 106  ILE G C   1 
ATOM   6409  O  O   . ILE C 1 88  ? 73.412  70.221 71.243  1.00 15.75 ? 106  ILE G O   1 
ATOM   6410  C  CB  . ILE C 1 88  ? 76.461  69.413 70.659  1.00 16.16 ? 106  ILE G CB  1 
ATOM   6411  C  CG1 . ILE C 1 88  ? 77.637  69.103 69.721  1.00 16.26 ? 106  ILE G CG1 1 
ATOM   6412  C  CG2 . ILE C 1 88  ? 76.585  68.561 71.936  1.00 15.89 ? 106  ILE G CG2 1 
ATOM   6413  C  CD1 . ILE C 1 88  ? 78.866  69.935 69.975  1.00 18.05 ? 106  ILE G CD1 1 
ATOM   6414  N  N   . ARG C 1 89  ? 73.503  67.950 71.315  1.00 15.77 ? 107  ARG G N   1 
ATOM   6415  C  CA  . ARG C 1 89  ? 72.349  67.802 72.197  1.00 16.36 ? 107  ARG G CA  1 
ATOM   6416  C  C   . ARG C 1 89  ? 72.621  66.983 73.461  1.00 16.36 ? 107  ARG G C   1 
ATOM   6417  O  O   . ARG C 1 89  ? 73.387  66.014 73.451  1.00 16.32 ? 107  ARG G O   1 
ATOM   6418  C  CB  . ARG C 1 89  ? 71.145  67.227 71.434  1.00 16.67 ? 107  ARG G CB  1 
ATOM   6419  C  CG  . ARG C 1 89  ? 70.224  68.297 70.835  1.00 18.23 ? 107  ARG G CG  1 
ATOM   6420  C  CD  . ARG C 1 89  ? 69.158  67.728 69.897  1.00 20.23 ? 107  ARG G CD  1 
ATOM   6421  N  NE  . ARG C 1 89  ? 69.769  67.353 68.634  1.00 23.70 ? 107  ARG G NE  1 
ATOM   6422  C  CZ  . ARG C 1 89  ? 69.706  68.045 67.499  1.00 22.24 ? 107  ARG G CZ  1 
ATOM   6423  N  NH1 . ARG C 1 89  ? 69.004  69.166 67.398  1.00 21.80 ? 107  ARG G NH1 1 
ATOM   6424  N  NH2 . ARG C 1 89  ? 70.352  67.584 66.448  1.00 22.21 ? 107  ARG G NH2 1 
ATOM   6425  N  N   . LEU C 1 90  ? 72.010  67.418 74.557  1.00 16.38 ? 108  LEU G N   1 
ATOM   6426  C  CA  . LEU C 1 90  ? 71.887  66.610 75.755  1.00 16.67 ? 108  LEU G CA  1 
ATOM   6427  C  C   . LEU C 1 90  ? 70.532  65.912 75.723  1.00 16.43 ? 108  LEU G C   1 
ATOM   6428  O  O   . LEU C 1 90  ? 69.593  66.399 75.090  1.00 16.38 ? 108  LEU G O   1 
ATOM   6429  C  CB  . LEU C 1 90  ? 71.994  67.463 77.022  1.00 16.61 ? 108  LEU G CB  1 
ATOM   6430  C  CG  . LEU C 1 90  ? 73.328  68.007 77.544  1.00 17.59 ? 108  LEU G CG  1 
ATOM   6431  C  CD1 . LEU C 1 90  ? 74.545  67.281 76.971  1.00 17.99 ? 108  LEU G CD1 1 
ATOM   6432  C  CD2 . LEU C 1 90  ? 73.433  69.483 77.283  1.00 18.89 ? 108  LEU G CD2 1 
ATOM   6433  N  N   . PHE C 1 91  ? 70.447  64.777 76.411  1.00 16.20 ? 109  PHE G N   1 
ATOM   6434  C  CA  . PHE C 1 91  ? 69.240  63.964 76.462  1.00 16.12 ? 109  PHE G CA  1 
ATOM   6435  C  C   . PHE C 1 91  ? 68.783  63.803 77.909  1.00 16.40 ? 109  PHE G C   1 
ATOM   6436  O  O   . PHE C 1 91  ? 69.495  63.214 78.739  1.00 16.65 ? 109  PHE G O   1 
ATOM   6437  C  CB  . PHE C 1 91  ? 69.531  62.591 75.850  1.00 16.06 ? 109  PHE G CB  1 
ATOM   6438  C  CG  . PHE C 1 91  ? 68.344  61.671 75.812  1.00 15.34 ? 109  PHE G CG  1 
ATOM   6439  C  CD1 . PHE C 1 91  ? 67.428  61.743 74.773  1.00 13.43 ? 109  PHE G CD1 1 
ATOM   6440  C  CD2 . PHE C 1 91  ? 68.154  60.718 76.809  1.00 15.52 ? 109  PHE G CD2 1 
ATOM   6441  C  CE1 . PHE C 1 91  ? 66.334  60.885 74.729  1.00 14.03 ? 109  PHE G CE1 1 
ATOM   6442  C  CE2 . PHE C 1 91  ? 67.061  59.859 76.773  1.00 14.51 ? 109  PHE G CE2 1 
ATOM   6443  C  CZ  . PHE C 1 91  ? 66.152  59.944 75.727  1.00 14.13 ? 109  PHE G CZ  1 
ATOM   6444  N  N   . GLN C 1 92  ? 67.604  64.342 78.207  1.00 16.54 ? 110  GLN G N   1 
ATOM   6445  C  CA  . GLN C 1 92  ? 66.995  64.270 79.546  1.00 16.75 ? 110  GLN G CA  1 
ATOM   6446  C  C   . GLN C 1 92  ? 67.953  64.630 80.700  1.00 16.45 ? 110  GLN G C   1 
ATOM   6447  O  O   . GLN C 1 92  ? 67.931  63.963 81.738  1.00 16.29 ? 110  GLN G O   1 
ATOM   6448  C  CB  . GLN C 1 92  ? 66.392  62.869 79.779  1.00 16.65 ? 110  GLN G CB  1 
ATOM   6449  C  CG  . GLN C 1 92  ? 65.234  62.506 78.858  1.00 17.62 ? 110  GLN G CG  1 
ATOM   6450  C  CD  . GLN C 1 92  ? 63.879  62.878 79.438  1.00 20.33 ? 110  GLN G CD  1 
ATOM   6451  O  OE1 . GLN C 1 92  ? 63.628  64.039 79.780  1.00 21.43 ? 110  GLN G OE1 1 
ATOM   6452  N  NE2 . GLN C 1 92  ? 62.994  61.890 79.553  1.00 19.31 ? 110  GLN G NE2 1 
ATOM   6453  N  N   . PRO C 1 93  ? 68.787  65.684 80.529  1.00 16.34 ? 111  PRO G N   1 
ATOM   6454  C  CA  . PRO C 1 93  ? 69.848  65.938 81.513  1.00 16.45 ? 111  PRO G CA  1 
ATOM   6455  C  C   . PRO C 1 93  ? 69.334  66.367 82.894  1.00 16.62 ? 111  PRO G C   1 
ATOM   6456  O  O   . PRO C 1 93  ? 70.038  66.198 83.887  1.00 16.18 ? 111  PRO G O   1 
ATOM   6457  C  CB  . PRO C 1 93  ? 70.665  67.063 80.869  1.00 16.26 ? 111  PRO G CB  1 
ATOM   6458  C  CG  . PRO C 1 93  ? 69.713  67.749 79.960  1.00 15.93 ? 111  PRO G CG  1 
ATOM   6459  C  CD  . PRO C 1 93  ? 68.801  66.688 79.447  1.00 16.34 ? 111  PRO G CD  1 
ATOM   6460  N  N   . ASN C 1 94  ? 68.117  66.904 82.946  1.00 17.09 ? 112  ASN G N   1 
ATOM   6461  C  CA  . ASN C 1 94  ? 67.495  67.306 84.214  1.00 17.60 ? 112  ASN G CA  1 
ATOM   6462  C  C   . ASN C 1 94  ? 67.101  66.104 85.071  1.00 17.10 ? 112  ASN G C   1 
ATOM   6463  O  O   . ASN C 1 94  ? 67.050  66.196 86.293  1.00 17.49 ? 112  ASN G O   1 
ATOM   6464  C  CB  . ASN C 1 94  ? 66.299  68.226 83.963  1.00 17.85 ? 112  ASN G CB  1 
ATOM   6465  C  CG  . ASN C 1 94  ? 66.717  69.588 83.420  1.00 20.49 ? 112  ASN G CG  1 
ATOM   6466  O  OD1 . ASN C 1 94  ? 67.317  70.401 84.133  1.00 24.34 ? 112  ASN G OD1 1 
ATOM   6467  N  ND2 . ASN C 1 94  ? 66.404  69.845 82.157  1.00 22.17 ? 112  ASN G ND2 1 
ATOM   6468  N  N   . LEU C 1 95  ? 66.836  64.973 84.423  1.00 16.59 ? 113  LEU G N   1 
ATOM   6469  C  CA  . LEU C 1 95  ? 66.581  63.727 85.136  1.00 15.72 ? 113  LEU G CA  1 
ATOM   6470  C  C   . LEU C 1 95  ? 67.825  63.221 85.853  1.00 15.54 ? 113  LEU G C   1 
ATOM   6471  O  O   . LEU C 1 95  ? 67.733  62.642 86.934  1.00 15.83 ? 113  LEU G O   1 
ATOM   6472  C  CB  . LEU C 1 95  ? 66.050  62.661 84.186  1.00 15.66 ? 113  LEU G CB  1 
ATOM   6473  C  CG  . LEU C 1 95  ? 64.668  62.869 83.553  1.00 15.18 ? 113  LEU G CG  1 
ATOM   6474  C  CD1 . LEU C 1 95  ? 64.183  61.535 83.036  1.00 13.16 ? 113  LEU G CD1 1 
ATOM   6475  C  CD2 . LEU C 1 95  ? 63.648  63.478 84.524  1.00 13.92 ? 113  LEU G CD2 1 
ATOM   6476  N  N   . ASN C 1 96  ? 68.988  63.445 85.251  1.00 15.00 ? 114  ASN G N   1 
ATOM   6477  C  CA  . ASN C 1 96  ? 70.260  63.130 85.894  1.00 14.59 ? 114  ASN G CA  1 
ATOM   6478  C  C   . ASN C 1 96  ? 70.586  64.098 87.040  1.00 14.49 ? 114  ASN G C   1 
ATOM   6479  O  O   . ASN C 1 96  ? 71.158  63.699 88.051  1.00 14.21 ? 114  ASN G O   1 
ATOM   6480  C  CB  . ASN C 1 96  ? 71.392  63.099 84.859  1.00 14.27 ? 114  ASN G CB  1 
ATOM   6481  C  CG  . ASN C 1 96  ? 71.178  62.034 83.797  1.00 13.61 ? 114  ASN G CG  1 
ATOM   6482  O  OD1 . ASN C 1 96  ? 71.545  60.868 83.981  1.00 13.87 ? 114  ASN G OD1 1 
ATOM   6483  N  ND2 . ASN C 1 96  ? 70.580  62.428 82.681  1.00 10.64 ? 114  ASN G ND2 1 
ATOM   6484  N  N   . MET C 1 97  ? 70.213  65.366 86.878  1.00 14.54 ? 115  MET G N   1 
ATOM   6485  C  CA  . MET C 1 97  ? 70.420  66.361 87.928  1.00 14.68 ? 115  MET G CA  1 
ATOM   6486  C  C   . MET C 1 97  ? 69.546  66.045 89.137  1.00 14.63 ? 115  MET G C   1 
ATOM   6487  O  O   . MET C 1 97  ? 70.000  66.167 90.276  1.00 14.69 ? 115  MET G O   1 
ATOM   6488  C  CB  . MET C 1 97  ? 70.171  67.792 87.420  1.00 14.63 ? 115  MET G CB  1 
ATOM   6489  C  CG  . MET C 1 97  ? 71.129  68.264 86.315  1.00 14.57 ? 115  MET G CG  1 
ATOM   6490  S  SD  . MET C 1 97  ? 72.887  68.309 86.780  1.00 15.64 ? 115  MET G SD  1 
ATOM   6491  C  CE  . MET C 1 97  ? 73.459  66.740 86.112  1.00 15.57 ? 115  MET G CE  1 
ATOM   6492  N  N   . ASP C 1 98  ? 68.312  65.615 88.877  1.00 14.63 ? 116  ASP G N   1 
ATOM   6493  C  CA  . ASP C 1 98  ? 67.358  65.257 89.924  1.00 14.68 ? 116  ASP G CA  1 
ATOM   6494  C  C   . ASP C 1 98  ? 67.865  64.052 90.717  1.00 14.32 ? 116  ASP G C   1 
ATOM   6495  O  O   . ASP C 1 98  ? 67.783  64.027 91.954  1.00 13.97 ? 116  ASP G O   1 
ATOM   6496  C  CB  . ASP C 1 98  ? 65.986  64.926 89.328  1.00 14.72 ? 116  ASP G CB  1 
ATOM   6497  C  CG  . ASP C 1 98  ? 65.299  66.129 88.683  1.00 17.27 ? 116  ASP G CG  1 
ATOM   6498  O  OD1 . ASP C 1 98  ? 64.356  65.902 87.889  1.00 18.88 ? 116  ASP G OD1 1 
ATOM   6499  O  OD2 . ASP C 1 98  ? 65.679  67.295 88.958  1.00 20.06 ? 116  ASP G OD2 1 
ATOM   6500  N  N   . ARG C 1 99  ? 68.369  63.058 89.984  1.00 13.54 ? 117  ARG G N   1 
ATOM   6501  C  CA  . ARG C 1 99  ? 68.862  61.821 90.564  1.00 13.03 ? 117  ARG G CA  1 
ATOM   6502  C  C   . ARG C 1 99  ? 70.147  62.045 91.357  1.00 13.03 ? 117  ARG G C   1 
ATOM   6503  O  O   . ARG C 1 99  ? 70.323  61.457 92.413  1.00 12.65 ? 117  ARG G O   1 
ATOM   6504  C  CB  . ARG C 1 99  ? 69.072  60.766 89.479  1.00 12.70 ? 117  ARG G CB  1 
ATOM   6505  C  CG  . ARG C 1 99  ? 69.329  59.370 90.015  1.00 12.46 ? 117  ARG G CG  1 
ATOM   6506  C  CD  . ARG C 1 99  ? 69.195  58.333 88.932  1.00 11.03 ? 117  ARG G CD  1 
ATOM   6507  N  NE  . ARG C 1 99  ? 70.294  58.406 87.966  1.00 11.60 ? 117  ARG G NE  1 
ATOM   6508  C  CZ  . ARG C 1 99  ? 70.292  57.812 86.776  1.00 10.63 ? 117  ARG G CZ  1 
ATOM   6509  N  NH1 . ARG C 1 99  ? 69.238  57.107 86.371  1.00 9.67  ? 117  ARG G NH1 1 
ATOM   6510  N  NH2 . ARG C 1 99  ? 71.338  57.942 85.982  1.00 10.97 ? 117  ARG G NH2 1 
ATOM   6511  N  N   . MET C 1 100 ? 71.029  62.905 90.843  1.00 13.29 ? 118  MET G N   1 
ATOM   6512  C  CA  . MET C 1 100 ? 72.271  63.257 91.530  1.00 13.67 ? 118  MET G CA  1 
ATOM   6513  C  C   . MET C 1 100 ? 72.000  63.947 92.877  1.00 13.95 ? 118  MET G C   1 
ATOM   6514  O  O   . MET C 1 100 ? 72.670  63.675 93.877  1.00 13.53 ? 118  MET G O   1 
ATOM   6515  C  CB  . MET C 1 100 ? 73.132  64.146 90.639  1.00 13.70 ? 118  MET G CB  1 
ATOM   6516  C  CG  . MET C 1 100 ? 74.546  64.333 91.161  1.00 14.18 ? 118  MET G CG  1 
ATOM   6517  S  SD  . MET C 1 100 ? 75.595  65.194 89.992  1.00 15.90 ? 118  MET G SD  1 
ATOM   6518  C  CE  . MET C 1 100 ? 77.093  65.346 90.966  1.00 14.19 ? 118  MET G CE  1 
ATOM   6519  N  N   . TYR C 1 101 ? 71.010  64.835 92.878  1.00 14.23 ? 119  TYR G N   1 
ATOM   6520  C  CA  . TYR C 1 101 ? 70.575  65.554 94.066  1.00 14.84 ? 119  TYR G CA  1 
ATOM   6521  C  C   . TYR C 1 101 ? 70.044  64.595 95.136  1.00 15.13 ? 119  TYR G C   1 
ATOM   6522  O  O   . TYR C 1 101 ? 70.437  64.696 96.303  1.00 15.44 ? 119  TYR G O   1 
ATOM   6523  C  CB  . TYR C 1 101 ? 69.510  66.592 93.684  1.00 14.98 ? 119  TYR G CB  1 
ATOM   6524  C  CG  . TYR C 1 101 ? 69.121  67.548 94.794  1.00 15.15 ? 119  TYR G CG  1 
ATOM   6525  C  CD1 . TYR C 1 101 ? 69.644  68.837 94.838  1.00 16.51 ? 119  TYR G CD1 1 
ATOM   6526  C  CD2 . TYR C 1 101 ? 68.226  67.164 95.793  1.00 16.24 ? 119  TYR G CD2 1 
ATOM   6527  C  CE1 . TYR C 1 101 ? 69.291  69.724 95.850  1.00 17.52 ? 119  TYR G CE1 1 
ATOM   6528  C  CE2 . TYR C 1 101 ? 67.863  68.042 96.816  1.00 17.50 ? 119  TYR G CE2 1 
ATOM   6529  C  CZ  . TYR C 1 101 ? 68.398  69.319 96.832  1.00 17.99 ? 119  TYR G CZ  1 
ATOM   6530  O  OH  . TYR C 1 101 ? 68.045  70.194 97.829  1.00 20.15 ? 119  TYR G OH  1 
ATOM   6531  N  N   . ARG C 1 102 ? 69.161  63.678 94.731  1.00 15.23 ? 120  ARG G N   1 
ATOM   6532  C  CA  . ARG C 1 102 ? 68.661  62.594 95.596  1.00 15.68 ? 120  ARG G CA  1 
ATOM   6533  C  C   . ARG C 1 102 ? 69.785  61.734 96.180  1.00 15.38 ? 120  ARG G C   1 
ATOM   6534  O  O   . ARG C 1 102 ? 69.750  61.377 97.359  1.00 15.57 ? 120  ARG G O   1 
ATOM   6535  C  CB  . ARG C 1 102 ? 67.736  61.658 94.819  1.00 15.97 ? 120  ARG G CB  1 
ATOM   6536  C  CG  . ARG C 1 102 ? 66.299  62.103 94.630  1.00 18.25 ? 120  ARG G CG  1 
ATOM   6537  C  CD  . ARG C 1 102 ? 65.387  60.886 94.290  1.00 21.91 ? 120  ARG G CD  1 
ATOM   6538  N  NE  . ARG C 1 102 ? 65.937  60.005 93.249  1.00 24.62 ? 120  ARG G NE  1 
ATOM   6539  C  CZ  . ARG C 1 102 ? 66.453  58.790 93.463  1.00 26.25 ? 120  ARG G CZ  1 
ATOM   6540  N  NH1 . ARG C 1 102 ? 66.490  58.261 94.683  1.00 27.37 ? 120  ARG G NH1 1 
ATOM   6541  N  NH2 . ARG C 1 102 ? 66.927  58.086 92.444  1.00 27.04 ? 120  ARG G NH2 1 
ATOM   6542  N  N   . SER C 1 103 ? 70.756  61.373 95.338  1.00 14.95 ? 121  SER G N   1 
ATOM   6543  C  CA  . SER C 1 103 ? 71.898  60.562 95.757  1.00 14.61 ? 121  SER G CA  1 
ATOM   6544  C  C   . SER C 1 103 ? 72.747  61.289 96.799  1.00 14.47 ? 121  SER G C   1 
ATOM   6545  O  O   . SER C 1 103 ? 73.149  60.690 97.799  1.00 14.53 ? 121  SER G O   1 
ATOM   6546  C  CB  . SER C 1 103 ? 72.753  60.154 94.552  1.00 14.53 ? 121  SER G CB  1 
ATOM   6547  O  OG  . SER C 1 103 ? 72.059  59.250 93.706  1.00 14.70 ? 121  SER G OG  1 
ATOM   6548  N  N   . ALA C 1 104 ? 72.990  62.581 96.572  1.00 14.36 ? 122  ALA G N   1 
ATOM   6549  C  CA  . ALA C 1 104 ? 73.731  63.429 97.515  1.00 14.55 ? 122  ALA G CA  1 
ATOM   6550  C  C   . ALA C 1 104 ? 73.056  63.492 98.882  1.00 14.82 ? 122  ALA G C   1 
ATOM   6551  O  O   . ALA C 1 104 ? 73.722  63.408 99.919  1.00 14.76 ? 122  ALA G O   1 
ATOM   6552  C  CB  . ALA C 1 104 ? 73.922  64.841 96.936  1.00 14.42 ? 122  ALA G CB  1 
ATOM   6553  N  N   . VAL C 1 105 ? 71.730  63.636 98.874  1.00 15.31 ? 123  VAL G N   1 
ATOM   6554  C  CA  . VAL C 1 105 ? 70.939  63.659 100.105 1.00 15.50 ? 123  VAL G CA  1 
ATOM   6555  C  C   . VAL C 1 105 ? 71.125  62.347 100.866 1.00 15.74 ? 123  VAL G C   1 
ATOM   6556  O  O   . VAL C 1 105 ? 71.456  62.362 102.055 1.00 15.96 ? 123  VAL G O   1 
ATOM   6557  C  CB  . VAL C 1 105 ? 69.438  63.975 99.826  1.00 15.75 ? 123  VAL G CB  1 
ATOM   6558  C  CG1 . VAL C 1 105 ? 68.570  63.730 101.071 1.00 15.63 ? 123  VAL G CG1 1 
ATOM   6559  C  CG2 . VAL C 1 105 ? 69.283  65.416 99.348  1.00 14.93 ? 123  VAL G CG2 1 
ATOM   6560  N  N   . ARG C 1 106 ? 70.974  61.224 100.163 1.00 15.75 ? 124  ARG G N   1 
ATOM   6561  C  CA  . ARG C 1 106 ? 71.148  59.892 100.760 1.00 15.91 ? 124  ARG G CA  1 
ATOM   6562  C  C   . ARG C 1 106 ? 72.593  59.620 101.238 1.00 15.43 ? 124  ARG G C   1 
ATOM   6563  O  O   . ARG C 1 106 ? 72.809  58.867 102.195 1.00 15.19 ? 124  ARG G O   1 
ATOM   6564  C  CB  . ARG C 1 106 ? 70.648  58.802 99.790  1.00 15.97 ? 124  ARG G CB  1 
ATOM   6565  C  CG  . ARG C 1 106 ? 70.644  57.354 100.338 1.00 18.64 ? 124  ARG G CG  1 
ATOM   6566  C  CD  . ARG C 1 106 ? 69.666  57.133 101.520 1.00 22.11 ? 124  ARG G CD  1 
ATOM   6567  N  NE  . ARG C 1 106 ? 70.227  56.169 102.472 1.00 26.24 ? 124  ARG G NE  1 
ATOM   6568  C  CZ  . ARG C 1 106 ? 69.792  54.925 102.656 1.00 27.93 ? 124  ARG G CZ  1 
ATOM   6569  N  NH1 . ARG C 1 106 ? 68.749  54.460 101.981 1.00 30.85 ? 124  ARG G NH1 1 
ATOM   6570  N  NH2 . ARG C 1 106 ? 70.396  54.142 103.536 1.00 29.23 ? 124  ARG G NH2 1 
ATOM   6571  N  N   . ALA C 1 107 ? 73.564  60.251 100.578 1.00 15.04 ? 125  ALA G N   1 
ATOM   6572  C  CA  . ALA C 1 107 ? 74.983  60.112 100.912 1.00 14.77 ? 125  ALA G CA  1 
ATOM   6573  C  C   . ALA C 1 107 ? 75.446  61.030 102.054 1.00 14.81 ? 125  ALA G C   1 
ATOM   6574  O  O   . ALA C 1 107 ? 76.511  60.811 102.629 1.00 14.77 ? 125  ALA G O   1 
ATOM   6575  C  CB  . ALA C 1 107 ? 75.837  60.356 99.665  1.00 14.38 ? 125  ALA G CB  1 
ATOM   6576  N  N   . THR C 1 108 ? 74.639  62.045 102.367 1.00 14.94 ? 126  THR G N   1 
ATOM   6577  C  CA  . THR C 1 108 ? 74.971  63.141 103.306 1.00 14.96 ? 126  THR G CA  1 
ATOM   6578  C  C   . THR C 1 108 ? 76.020  64.121 102.767 1.00 15.21 ? 126  THR G C   1 
ATOM   6579  O  O   . THR C 1 108 ? 76.670  64.842 103.530 1.00 15.42 ? 126  THR G O   1 
ATOM   6580  C  CB  . THR C 1 108 ? 75.303  62.672 104.767 1.00 15.19 ? 126  THR G CB  1 
ATOM   6581  O  OG1 . THR C 1 108 ? 76.622  62.105 104.834 1.00 14.12 ? 126  THR G OG1 1 
ATOM   6582  C  CG2 . THR C 1 108 ? 74.256  61.682 105.271 1.00 14.59 ? 126  THR G CG2 1 
ATOM   6583  N  N   . LEU C 1 109 ? 76.158  64.156 101.446 1.00 15.33 ? 127  LEU G N   1 
ATOM   6584  C  CA  . LEU C 1 109 ? 76.986  65.153 100.780 1.00 15.69 ? 127  LEU G CA  1 
ATOM   6585  C  C   . LEU C 1 109 ? 76.166  66.428 100.601 1.00 16.13 ? 127  LEU G C   1 
ATOM   6586  O  O   . LEU C 1 109 ? 74.929  66.369 100.597 1.00 16.21 ? 127  LEU G O   1 
ATOM   6587  C  CB  . LEU C 1 109 ? 77.514  64.626 99.437  1.00 15.57 ? 127  LEU G CB  1 
ATOM   6588  C  CG  . LEU C 1 109 ? 78.673  63.619 99.535  1.00 14.85 ? 127  LEU G CG  1 
ATOM   6589  C  CD1 . LEU C 1 109 ? 78.736  62.749 98.302  1.00 13.60 ? 127  LEU G CD1 1 
ATOM   6590  C  CD2 . LEU C 1 109 ? 80.003  64.320 99.767  1.00 14.32 ? 127  LEU G CD2 1 
ATOM   6591  N  N   . PRO C 1 110 ? 76.845  67.587 100.490 1.00 16.51 ? 128  PRO G N   1 
ATOM   6592  C  CA  . PRO C 1 110 ? 76.121  68.850 100.409 1.00 17.00 ? 128  PRO G CA  1 
ATOM   6593  C  C   . PRO C 1 110 ? 75.228  68.955 99.179  1.00 17.61 ? 128  PRO G C   1 
ATOM   6594  O  O   . PRO C 1 110 ? 75.597  68.530 98.082  1.00 17.59 ? 128  PRO G O   1 
ATOM   6595  C  CB  . PRO C 1 110 ? 77.239  69.896 100.343 1.00 16.90 ? 128  PRO G CB  1 
ATOM   6596  C  CG  . PRO C 1 110 ? 78.426  69.145 99.837  1.00 16.54 ? 128  PRO G CG  1 
ATOM   6597  C  CD  . PRO C 1 110 ? 78.304  67.800 100.457 1.00 16.49 ? 128  PRO G CD  1 
ATOM   6598  N  N   . VAL C 1 111 ? 74.052  69.521 99.404  1.00 17.76 ? 129  VAL G N   1 
ATOM   6599  C  CA  . VAL C 1 111 ? 73.099  69.853 98.367  1.00 18.11 ? 129  VAL G CA  1 
ATOM   6600  C  C   . VAL C 1 111 ? 73.608  71.018 97.496  1.00 18.13 ? 129  VAL G C   1 
ATOM   6601  O  O   . VAL C 1 111 ? 74.473  71.786 97.920  1.00 18.04 ? 129  VAL G O   1 
ATOM   6602  C  CB  . VAL C 1 111 ? 71.735  70.111 99.055  1.00 18.39 ? 129  VAL G CB  1 
ATOM   6603  C  CG1 . VAL C 1 111 ? 71.004  71.311 98.496  1.00 19.81 ? 129  VAL G CG1 1 
ATOM   6604  C  CG2 . VAL C 1 111 ? 70.895  68.830 99.042  1.00 18.31 ? 129  VAL G CG2 1 
ATOM   6605  N  N   . PHE C 1 112 ? 73.095  71.112 96.266  1.00 18.23 ? 130  PHE G N   1 
ATOM   6606  C  CA  . PHE C 1 112 ? 73.493  72.140 95.296  1.00 18.33 ? 130  PHE G CA  1 
ATOM   6607  C  C   . PHE C 1 112 ? 72.299  72.506 94.406  1.00 18.37 ? 130  PHE G C   1 
ATOM   6608  O  O   . PHE C 1 112 ? 71.267  71.833 94.431  1.00 18.30 ? 130  PHE G O   1 
ATOM   6609  C  CB  . PHE C 1 112 ? 74.657  71.627 94.429  1.00 18.17 ? 130  PHE G CB  1 
ATOM   6610  C  CG  . PHE C 1 112 ? 74.371  70.305 93.762  1.00 18.74 ? 130  PHE G CG  1 
ATOM   6611  C  CD1 . PHE C 1 112 ? 73.784  70.259 92.494  1.00 18.19 ? 130  PHE G CD1 1 
ATOM   6612  C  CD2 . PHE C 1 112 ? 74.658  69.101 94.414  1.00 18.52 ? 130  PHE G CD2 1 
ATOM   6613  C  CE1 . PHE C 1 112 ? 73.490  69.043 91.890  1.00 18.37 ? 130  PHE G CE1 1 
ATOM   6614  C  CE2 . PHE C 1 112 ? 74.371  67.878 93.813  1.00 18.67 ? 130  PHE G CE2 1 
ATOM   6615  C  CZ  . PHE C 1 112 ? 73.788  67.849 92.551  1.00 19.44 ? 130  PHE G CZ  1 
ATOM   6616  N  N   . ASP C 1 113 ? 72.442  73.563 93.612  1.00 18.56 ? 131  ASP G N   1 
ATOM   6617  C  CA  . ASP C 1 113 ? 71.394  73.942 92.668  1.00 18.85 ? 131  ASP G CA  1 
ATOM   6618  C  C   . ASP C 1 113 ? 71.561  73.157 91.372  1.00 18.69 ? 131  ASP G C   1 
ATOM   6619  O  O   . ASP C 1 113 ? 72.599  73.247 90.711  1.00 18.98 ? 131  ASP G O   1 
ATOM   6620  C  CB  . ASP C 1 113 ? 71.409  75.448 92.407  1.00 18.97 ? 131  ASP G CB  1 
ATOM   6621  C  CG  . ASP C 1 113 ? 70.194  75.926 91.626  1.00 20.33 ? 131  ASP G CG  1 
ATOM   6622  O  OD1 . ASP C 1 113 ? 70.008  75.503 90.464  1.00 20.49 ? 131  ASP G OD1 1 
ATOM   6623  O  OD2 . ASP C 1 113 ? 69.427  76.746 92.172  1.00 22.30 ? 131  ASP G OD2 1 
ATOM   6624  N  N   . LYS C 1 114 ? 70.541  72.382 91.022  1.00 18.41 ? 132  LYS G N   1 
ATOM   6625  C  CA  . LYS C 1 114 ? 70.578  71.537 89.826  1.00 18.44 ? 132  LYS G CA  1 
ATOM   6626  C  C   . LYS C 1 114 ? 70.737  72.329 88.520  1.00 18.75 ? 132  LYS G C   1 
ATOM   6627  O  O   . LYS C 1 114 ? 71.484  71.918 87.627  1.00 18.12 ? 132  LYS G O   1 
ATOM   6628  C  CB  . LYS C 1 114 ? 69.340  70.652 89.764  1.00 18.28 ? 132  LYS G CB  1 
ATOM   6629  C  CG  . LYS C 1 114 ? 69.236  69.695 90.924  1.00 18.37 ? 132  LYS G CG  1 
ATOM   6630  C  CD  . LYS C 1 114 ? 68.015  68.799 90.805  1.00 19.29 ? 132  LYS G CD  1 
ATOM   6631  C  CE  . LYS C 1 114 ? 66.755  69.488 91.283  1.00 20.73 ? 132  LYS G CE  1 
ATOM   6632  N  NZ  . LYS C 1 114 ? 65.664  68.496 91.451  1.00 22.18 ? 132  LYS G NZ  1 
ATOM   6633  N  N   . GLU C 1 115 ? 70.047  73.467 88.423  1.00 19.06 ? 133  GLU G N   1 
ATOM   6634  C  CA  . GLU C 1 115 ? 70.150  74.335 87.245  1.00 19.66 ? 133  GLU G CA  1 
ATOM   6635  C  C   . GLU C 1 115 ? 71.554  74.923 87.117  1.00 19.12 ? 133  GLU G C   1 
ATOM   6636  O  O   . GLU C 1 115 ? 72.056  75.089 86.007  1.00 19.41 ? 133  GLU G O   1 
ATOM   6637  C  CB  . GLU C 1 115 ? 69.068  75.428 87.255  1.00 20.24 ? 133  GLU G CB  1 
ATOM   6638  C  CG  . GLU C 1 115 ? 67.646  74.878 87.027  1.00 23.44 ? 133  GLU G CG  1 
ATOM   6639  C  CD  . GLU C 1 115 ? 66.522  75.852 87.412  1.00 28.86 ? 133  GLU G CD  1 
ATOM   6640  O  OE1 . GLU C 1 115 ? 65.371  75.375 87.614  1.00 30.72 ? 133  GLU G OE1 1 
ATOM   6641  O  OE2 . GLU C 1 115 ? 66.769  77.082 87.516  1.00 30.31 ? 133  GLU G OE2 1 
ATOM   6642  N  N   . GLU C 1 116 ? 72.195  75.205 88.252  1.00 18.70 ? 134  GLU G N   1 
ATOM   6643  C  CA  . GLU C 1 116 ? 73.569  75.711 88.257  1.00 18.34 ? 134  GLU G CA  1 
ATOM   6644  C  C   . GLU C 1 116 ? 74.582  74.662 87.792  1.00 18.14 ? 134  GLU G C   1 
ATOM   6645  O  O   . GLU C 1 116 ? 75.495  74.985 87.039  1.00 18.34 ? 134  GLU G O   1 
ATOM   6646  C  CB  . GLU C 1 116 ? 73.973  76.248 89.638  1.00 18.30 ? 134  GLU G CB  1 
ATOM   6647  C  CG  . GLU C 1 116 ? 73.167  77.446 90.149  1.00 19.09 ? 134  GLU G CG  1 
ATOM   6648  C  CD  . GLU C 1 116 ? 73.202  78.671 89.233  1.00 20.14 ? 134  GLU G CD  1 
ATOM   6649  O  OE1 . GLU C 1 116 ? 74.180  78.875 88.481  1.00 20.94 ? 134  GLU G OE1 1 
ATOM   6650  O  OE2 . GLU C 1 116 ? 72.229  79.444 89.276  1.00 21.43 ? 134  GLU G OE2 1 
ATOM   6651  N  N   . LEU C 1 117 ? 74.430  73.417 88.242  1.00 17.67 ? 135  LEU G N   1 
ATOM   6652  C  CA  . LEU C 1 117 ? 75.329  72.353 87.805  1.00 17.70 ? 135  LEU G CA  1 
ATOM   6653  C  C   . LEU C 1 117 ? 75.147  72.038 86.317  1.00 17.59 ? 135  LEU G C   1 
ATOM   6654  O  O   . LEU C 1 117 ? 76.126  71.917 85.589  1.00 17.66 ? 135  LEU G O   1 
ATOM   6655  C  CB  . LEU C 1 117 ? 75.193  71.087 88.669  1.00 17.42 ? 135  LEU G CB  1 
ATOM   6656  C  CG  . LEU C 1 117 ? 76.047  69.866 88.270  1.00 17.32 ? 135  LEU G CG  1 
ATOM   6657  C  CD1 . LEU C 1 117 ? 77.553  70.178 88.187  1.00 17.10 ? 135  LEU G CD1 1 
ATOM   6658  C  CD2 . LEU C 1 117 ? 75.795  68.710 89.214  1.00 16.20 ? 135  LEU G CD2 1 
ATOM   6659  N  N   . LEU C 1 118 ? 73.902  71.921 85.864  1.00 17.45 ? 136  LEU G N   1 
ATOM   6660  C  CA  . LEU C 1 118 ? 73.661  71.662 84.450  1.00 17.60 ? 136  LEU G CA  1 
ATOM   6661  C  C   . LEU C 1 118 ? 74.304  72.732 83.563  1.00 17.83 ? 136  LEU G C   1 
ATOM   6662  O  O   . LEU C 1 118 ? 74.919  72.405 82.549  1.00 17.78 ? 136  LEU G O   1 
ATOM   6663  C  CB  . LEU C 1 118 ? 72.165  71.503 84.151  1.00 17.48 ? 136  LEU G CB  1 
ATOM   6664  C  CG  . LEU C 1 118 ? 71.764  71.242 82.691  1.00 17.51 ? 136  LEU G CG  1 
ATOM   6665  C  CD1 . LEU C 1 118 ? 72.462  70.008 82.107  1.00 16.63 ? 136  LEU G CD1 1 
ATOM   6666  C  CD2 . LEU C 1 118 ? 70.257  71.116 82.580  1.00 17.24 ? 136  LEU G CD2 1 
ATOM   6667  N  N   . GLU C 1 119 ? 74.179  73.998 83.955  1.00 18.15 ? 137  GLU G N   1 
ATOM   6668  C  CA  . GLU C 1 119 ? 74.792  75.096 83.201  1.00 18.89 ? 137  GLU G CA  1 
ATOM   6669  C  C   . GLU C 1 119 ? 76.324  74.996 83.194  1.00 18.76 ? 137  GLU G C   1 
ATOM   6670  O  O   . GLU C 1 119 ? 76.955  75.235 82.169  1.00 19.12 ? 137  GLU G O   1 
ATOM   6671  C  CB  . GLU C 1 119 ? 74.294  76.455 83.712  1.00 18.99 ? 137  GLU G CB  1 
ATOM   6672  C  CG  . GLU C 1 119 ? 74.787  77.686 82.942  1.00 21.23 ? 137  GLU G CG  1 
ATOM   6673  C  CD  . GLU C 1 119 ? 74.470  77.661 81.455  1.00 23.99 ? 137  GLU G CD  1 
ATOM   6674  O  OE1 . GLU C 1 119 ? 75.315  78.139 80.675  1.00 25.63 ? 137  GLU G OE1 1 
ATOM   6675  O  OE2 . GLU C 1 119 ? 73.389  77.174 81.061  1.00 25.92 ? 137  GLU G OE2 1 
ATOM   6676  N  N   . CYS C 1 120 ? 76.912  74.625 84.332  1.00 18.68 ? 138  CYS G N   1 
ATOM   6677  C  CA  . CYS C 1 120 ? 78.351  74.372 84.415  1.00 18.14 ? 138  CYS G CA  1 
ATOM   6678  C  C   . CYS C 1 120 ? 78.783  73.242 83.483  1.00 18.04 ? 138  CYS G C   1 
ATOM   6679  O  O   . CYS C 1 120 ? 79.830  73.335 82.833  1.00 17.52 ? 138  CYS G O   1 
ATOM   6680  C  CB  . CYS C 1 120 ? 78.756  74.052 85.852  1.00 18.06 ? 138  CYS G CB  1 
ATOM   6681  S  SG  . CYS C 1 120 ? 78.746  75.494 86.940  1.00 18.46 ? 138  CYS G SG  1 
ATOM   6682  N  N   . ILE C 1 121 ? 77.968  72.184 83.423  1.00 18.03 ? 139  ILE G N   1 
ATOM   6683  C  CA  . ILE C 1 121 ? 78.216  71.036 82.539  1.00 18.12 ? 139  ILE G CA  1 
ATOM   6684  C  C   . ILE C 1 121 ? 78.132  71.431 81.059  1.00 18.31 ? 139  ILE G C   1 
ATOM   6685  O  O   . ILE C 1 121 ? 78.954  71.003 80.246  1.00 18.02 ? 139  ILE G O   1 
ATOM   6686  C  CB  . ILE C 1 121 ? 77.276  69.834 82.869  1.00 18.13 ? 139  ILE G CB  1 
ATOM   6687  C  CG1 . ILE C 1 121 ? 77.675  69.216 84.218  1.00 17.80 ? 139  ILE G CG1 1 
ATOM   6688  C  CG2 . ILE C 1 121 ? 77.302  68.771 81.747  1.00 17.55 ? 139  ILE G CG2 1 
ATOM   6689  C  CD1 . ILE C 1 121 ? 76.694  68.227 84.789  1.00 16.95 ? 139  ILE G CD1 1 
ATOM   6690  N  N   . GLN C 1 122 ? 77.150  72.265 80.730  1.00 18.85 ? 140  GLN G N   1 
ATOM   6691  C  CA  . GLN C 1 122 ? 76.978  72.767 79.371  1.00 19.44 ? 140  GLN G CA  1 
ATOM   6692  C  C   . GLN C 1 122 ? 78.165  73.615 78.925  1.00 19.10 ? 140  GLN G C   1 
ATOM   6693  O  O   . GLN C 1 122 ? 78.632  73.488 77.791  1.00 18.89 ? 140  GLN G O   1 
ATOM   6694  C  CB  . GLN C 1 122 ? 75.652  73.523 79.228  1.00 19.78 ? 140  GLN G CB  1 
ATOM   6695  C  CG  . GLN C 1 122 ? 74.438  72.625 79.444  1.00 22.13 ? 140  GLN G CG  1 
ATOM   6696  C  CD  . GLN C 1 122 ? 73.208  73.081 78.689  1.00 25.93 ? 140  GLN G CD  1 
ATOM   6697  O  OE1 . GLN C 1 122 ? 72.206  73.476 79.287  1.00 27.80 ? 140  GLN G OE1 1 
ATOM   6698  N  NE2 . GLN C 1 122 ? 73.272  73.015 77.365  1.00 27.94 ? 140  GLN G NE2 1 
ATOM   6699  N  N   . GLN C 1 123 ? 78.657  74.455 79.831  1.00 18.96 ? 141  GLN G N   1 
ATOM   6700  C  CA  . GLN C 1 123 ? 79.825  75.293 79.569  1.00 19.34 ? 141  GLN G CA  1 
ATOM   6701  C  C   . GLN C 1 123 ? 81.088  74.462 79.379  1.00 18.81 ? 141  GLN G C   1 
ATOM   6702  O  O   . GLN C 1 123 ? 81.933  74.789 78.545  1.00 19.07 ? 141  GLN G O   1 
ATOM   6703  C  CB  . GLN C 1 123 ? 80.016  76.326 80.688  1.00 19.53 ? 141  GLN G CB  1 
ATOM   6704  C  CG  . GLN C 1 123 ? 78.963  77.437 80.688  1.00 21.95 ? 141  GLN G CG  1 
ATOM   6705  C  CD  . GLN C 1 123 ? 78.809  78.096 79.321  1.00 24.50 ? 141  GLN G CD  1 
ATOM   6706  O  OE1 . GLN C 1 123 ? 79.776  78.612 78.753  1.00 26.57 ? 141  GLN G OE1 1 
ATOM   6707  N  NE2 . GLN C 1 123 ? 77.596  78.074 78.787  1.00 25.19 ? 141  GLN G NE2 1 
ATOM   6708  N  N   . LEU C 1 124 ? 81.199  73.385 80.152  1.00 18.28 ? 142  LEU G N   1 
ATOM   6709  C  CA  . LEU C 1 124 ? 82.304  72.439 80.026  1.00 18.00 ? 142  LEU G CA  1 
ATOM   6710  C  C   . LEU C 1 124 ? 82.274  71.695 78.689  1.00 17.92 ? 142  LEU G C   1 
ATOM   6711  O  O   . LEU C 1 124 ? 83.285  71.628 77.992  1.00 17.48 ? 142  LEU G O   1 
ATOM   6712  C  CB  . LEU C 1 124 ? 82.303  71.440 81.192  1.00 17.51 ? 142  LEU G CB  1 
ATOM   6713  C  CG  . LEU C 1 124 ? 83.370  70.341 81.137  1.00 16.67 ? 142  LEU G CG  1 
ATOM   6714  C  CD1 . LEU C 1 124 ? 84.751  70.930 81.380  1.00 14.98 ? 142  LEU G CD1 1 
ATOM   6715  C  CD2 . LEU C 1 124 ? 83.070  69.234 82.126  1.00 14.87 ? 142  LEU G CD2 1 
ATOM   6716  N  N   . VAL C 1 125 ? 81.118  71.139 78.339  1.00 18.25 ? 143  VAL G N   1 
ATOM   6717  C  CA  . VAL C 1 125 ? 80.964  70.477 77.042  1.00 18.89 ? 143  VAL G CA  1 
ATOM   6718  C  C   . VAL C 1 125 ? 81.142  71.469 75.882  1.00 18.86 ? 143  VAL G C   1 
ATOM   6719  O  O   . VAL C 1 125 ? 81.765  71.133 74.882  1.00 18.89 ? 143  VAL G O   1 
ATOM   6720  C  CB  . VAL C 1 125 ? 79.654  69.620 76.944  1.00 18.90 ? 143  VAL G CB  1 
ATOM   6721  C  CG1 . VAL C 1 125 ? 78.430  70.432 77.255  1.00 20.36 ? 143  VAL G CG1 1 
ATOM   6722  C  CG2 . VAL C 1 125 ? 79.512  68.975 75.570  1.00 19.70 ? 143  VAL G CG2 1 
ATOM   6723  N  N   . LYS C 1 126 ? 80.637  72.695 76.040  1.00 18.98 ? 144  LYS G N   1 
ATOM   6724  C  CA  . LYS C 1 126 ? 80.816  73.753 75.035  1.00 19.23 ? 144  LYS G CA  1 
ATOM   6725  C  C   . LYS C 1 126 ? 82.300  74.036 74.762  1.00 18.74 ? 144  LYS G C   1 
ATOM   6726  O  O   . LYS C 1 126 ? 82.710  74.111 73.604  1.00 18.88 ? 144  LYS G O   1 
ATOM   6727  C  CB  . LYS C 1 126 ? 80.058  75.033 75.430  1.00 19.50 ? 144  LYS G CB  1 
ATOM   6728  C  CG  . LYS C 1 126 ? 80.177  76.191 74.441  1.00 21.54 ? 144  LYS G CG  1 
ATOM   6729  C  CD  . LYS C 1 126 ? 79.252  77.341 74.838  1.00 24.37 ? 144  LYS G CD  1 
ATOM   6730  C  CE  . LYS C 1 126 ? 79.234  78.459 73.790  1.00 26.39 ? 144  LYS G CE  1 
ATOM   6731  N  NZ  . LYS C 1 126 ? 80.218  79.538 74.100  1.00 27.97 ? 144  LYS G NZ  1 
ATOM   6732  N  N   . LEU C 1 127 ? 83.100  74.177 75.819  1.00 18.23 ? 145  LEU G N   1 
ATOM   6733  C  CA  . LEU C 1 127 ? 84.552  74.324 75.670  1.00 17.78 ? 145  LEU G CA  1 
ATOM   6734  C  C   . LEU C 1 127 ? 85.190  73.136 74.927  1.00 17.57 ? 145  LEU G C   1 
ATOM   6735  O  O   . LEU C 1 127 ? 86.009  73.322 74.021  1.00 17.46 ? 145  LEU G O   1 
ATOM   6736  C  CB  . LEU C 1 127 ? 85.225  74.532 77.040  1.00 17.92 ? 145  LEU G CB  1 
ATOM   6737  C  CG  . LEU C 1 127 ? 86.712  74.913 77.098  1.00 17.80 ? 145  LEU G CG  1 
ATOM   6738  C  CD1 . LEU C 1 127 ? 87.011  76.239 76.386  1.00 18.36 ? 145  LEU G CD1 1 
ATOM   6739  C  CD2 . LEU C 1 127 ? 87.168  74.993 78.536  1.00 18.58 ? 145  LEU G CD2 1 
ATOM   6740  N  N   . ASP C 1 128 ? 84.809  71.920 75.309  1.00 17.00 ? 146  ASP G N   1 
ATOM   6741  C  CA  . ASP C 1 128 ? 85.374  70.721 74.706  1.00 16.62 ? 146  ASP G CA  1 
ATOM   6742  C  C   . ASP C 1 128 ? 84.464  70.149 73.611  1.00 16.66 ? 146  ASP G C   1 
ATOM   6743  O  O   . ASP C 1 128 ? 84.447  68.940 73.377  1.00 16.63 ? 146  ASP G O   1 
ATOM   6744  C  CB  . ASP C 1 128 ? 85.653  69.666 75.787  1.00 16.42 ? 146  ASP G CB  1 
ATOM   6745  C  CG  . ASP C 1 128 ? 86.946  69.926 76.558  1.00 16.05 ? 146  ASP G CG  1 
ATOM   6746  O  OD1 . ASP C 1 128 ? 87.683  70.877 76.246  1.00 15.05 ? 146  ASP G OD1 1 
ATOM   6747  O  OD2 . ASP C 1 128 ? 87.235  69.162 77.498  1.00 16.84 ? 146  ASP G OD2 1 
ATOM   6748  N  N   . GLN C 1 129 ? 83.724  71.016 72.926  1.00 16.56 ? 147  GLN G N   1 
ATOM   6749  C  CA  . GLN C 1 129 ? 82.697  70.533 72.004  1.00 16.67 ? 147  GLN G CA  1 
ATOM   6750  C  C   . GLN C 1 129 ? 83.228  69.693 70.842  1.00 16.20 ? 147  GLN G C   1 
ATOM   6751  O  O   . GLN C 1 129 ? 82.542  68.798 70.369  1.00 16.38 ? 147  GLN G O   1 
ATOM   6752  C  CB  . GLN C 1 129 ? 81.762  71.655 71.532  1.00 16.82 ? 147  GLN G CB  1 
ATOM   6753  C  CG  . GLN C 1 129 ? 82.357  72.715 70.632  1.00 17.36 ? 147  GLN G CG  1 
ATOM   6754  C  CD  . GLN C 1 129 ? 81.279  73.669 70.128  1.00 18.74 ? 147  GLN G CD  1 
ATOM   6755  O  OE1 . GLN C 1 129 ? 80.493  73.328 69.237  1.00 17.96 ? 147  GLN G OE1 1 
ATOM   6756  N  NE2 . GLN C 1 129 ? 81.225  74.859 70.713  1.00 19.24 ? 147  GLN G NE2 1 
ATOM   6757  N  N   . GLU C 1 130 ? 84.453  69.976 70.410  1.00 15.94 ? 148  GLU G N   1 
ATOM   6758  C  CA  . GLU C 1 130 ? 85.093  69.228 69.322  1.00 15.59 ? 148  GLU G CA  1 
ATOM   6759  C  C   . GLU C 1 130 ? 85.410  67.774 69.690  1.00 15.06 ? 148  GLU G C   1 
ATOM   6760  O  O   . GLU C 1 130 ? 85.731  66.966 68.820  1.00 15.01 ? 148  GLU G O   1 
ATOM   6761  C  CB  . GLU C 1 130 ? 86.349  69.965 68.827  1.00 15.70 ? 148  GLU G CB  1 
ATOM   6762  C  CG  . GLU C 1 130 ? 86.050  71.283 68.092  1.00 15.53 ? 148  GLU G CG  1 
ATOM   6763  C  CD  . GLU C 1 130 ? 85.078  71.119 66.927  1.00 15.91 ? 148  GLU G CD  1 
ATOM   6764  O  OE1 . GLU C 1 130 ? 84.104  71.897 66.839  1.00 16.43 ? 148  GLU G OE1 1 
ATOM   6765  O  OE2 . GLU C 1 130 ? 85.279  70.213 66.098  1.00 17.68 ? 148  GLU G OE2 1 
ATOM   6766  N  N   . TRP C 1 131 ? 85.316  67.460 70.982  1.00 14.55 ? 149  TRP G N   1 
ATOM   6767  C  CA  . TRP C 1 131 ? 85.461  66.094 71.494  1.00 13.96 ? 149  TRP G CA  1 
ATOM   6768  C  C   . TRP C 1 131 ? 84.189  65.260 71.321  1.00 13.73 ? 149  TRP G C   1 
ATOM   6769  O  O   . TRP C 1 131 ? 84.252  64.027 71.329  1.00 13.88 ? 149  TRP G O   1 
ATOM   6770  C  CB  . TRP C 1 131 ? 85.854  66.117 72.971  1.00 13.84 ? 149  TRP G CB  1 
ATOM   6771  C  CG  . TRP C 1 131 ? 87.281  66.535 73.226  1.00 13.65 ? 149  TRP G CG  1 
ATOM   6772  C  CD1 . TRP C 1 131 ? 87.744  67.809 73.442  1.00 13.97 ? 149  TRP G CD1 1 
ATOM   6773  C  CD2 . TRP C 1 131 ? 88.428  65.675 73.300  1.00 13.72 ? 149  TRP G CD2 1 
ATOM   6774  N  NE1 . TRP C 1 131 ? 89.105  67.792 73.644  1.00 13.40 ? 149  TRP G NE1 1 
ATOM   6775  C  CE2 . TRP C 1 131 ? 89.550  66.496 73.565  1.00 14.34 ? 149  TRP G CE2 1 
ATOM   6776  C  CE3 . TRP C 1 131 ? 88.615  64.291 73.176  1.00 12.43 ? 149  TRP G CE3 1 
ATOM   6777  C  CZ2 . TRP C 1 131 ? 90.846  65.976 73.693  1.00 14.56 ? 149  TRP G CZ2 1 
ATOM   6778  C  CZ3 . TRP C 1 131 ? 89.898  63.777 73.308  1.00 13.46 ? 149  TRP G CZ3 1 
ATOM   6779  C  CH2 . TRP C 1 131 ? 90.997  64.616 73.566  1.00 13.69 ? 149  TRP G CH2 1 
ATOM   6780  N  N   . VAL C 1 132 ? 83.041  65.923 71.191  1.00 13.42 ? 150  VAL G N   1 
ATOM   6781  C  CA  . VAL C 1 132 ? 81.782  65.239 70.870  1.00 13.39 ? 150  VAL G CA  1 
ATOM   6782  C  C   . VAL C 1 132 ? 81.982  64.614 69.487  1.00 13.34 ? 150  VAL G C   1 
ATOM   6783  O  O   . VAL C 1 132 ? 82.152  65.332 68.498  1.00 13.11 ? 150  VAL G O   1 
ATOM   6784  C  CB  . VAL C 1 132 ? 80.551  66.197 70.898  1.00 13.46 ? 150  VAL G CB  1 
ATOM   6785  C  CG1 . VAL C 1 132 ? 79.253  65.437 70.663  1.00 13.41 ? 150  VAL G CG1 1 
ATOM   6786  C  CG2 . VAL C 1 132 ? 80.460  66.919 72.231  1.00 13.31 ? 150  VAL G CG2 1 
ATOM   6787  N  N   . PRO C 1 133 ? 82.029  63.270 69.429  1.00 13.35 ? 151  PRO G N   1 
ATOM   6788  C  CA  . PRO C 1 133 ? 82.461  62.583 68.212  1.00 13.47 ? 151  PRO G CA  1 
ATOM   6789  C  C   . PRO C 1 133 ? 81.698  62.968 66.949  1.00 13.67 ? 151  PRO G C   1 
ATOM   6790  O  O   . PRO C 1 133 ? 80.476  63.159 66.973  1.00 13.18 ? 151  PRO G O   1 
ATOM   6791  C  CB  . PRO C 1 133 ? 82.251  61.107 68.548  1.00 13.58 ? 151  PRO G CB  1 
ATOM   6792  C  CG  . PRO C 1 133 ? 82.394  61.047 70.050  1.00 13.19 ? 151  PRO G CG  1 
ATOM   6793  C  CD  . PRO C 1 133 ? 81.723  62.314 70.513  1.00 13.40 ? 151  PRO G CD  1 
ATOM   6794  N  N   . TYR C 1 134 ? 82.454  63.092 65.861  1.00 13.95 ? 152  TYR G N   1 
ATOM   6795  C  CA  . TYR C 1 134 ? 81.901  63.228 64.517  1.00 13.90 ? 152  TYR G CA  1 
ATOM   6796  C  C   . TYR C 1 134 ? 81.516  61.845 63.985  1.00 14.32 ? 152  TYR G C   1 
ATOM   6797  O  O   . TYR C 1 134 ? 82.194  61.258 63.128  1.00 14.13 ? 152  TYR G O   1 
ATOM   6798  C  CB  . TYR C 1 134 ? 82.892  63.961 63.611  1.00 13.52 ? 152  TYR G CB  1 
ATOM   6799  C  CG  . TYR C 1 134 ? 82.962  65.451 63.907  1.00 13.15 ? 152  TYR G CG  1 
ATOM   6800  C  CD1 . TYR C 1 134 ? 82.151  66.352 63.231  1.00 12.83 ? 152  TYR G CD1 1 
ATOM   6801  C  CD2 . TYR C 1 134 ? 83.840  65.955 64.869  1.00 13.75 ? 152  TYR G CD2 1 
ATOM   6802  C  CE1 . TYR C 1 134 ? 82.213  67.729 63.495  1.00 12.61 ? 152  TYR G CE1 1 
ATOM   6803  C  CE2 . TYR C 1 134 ? 83.907  67.329 65.145  1.00 13.04 ? 152  TYR G CE2 1 
ATOM   6804  C  CZ  . TYR C 1 134 ? 83.093  68.206 64.453  1.00 12.89 ? 152  TYR G CZ  1 
ATOM   6805  O  OH  . TYR C 1 134 ? 83.157  69.561 64.720  1.00 11.87 ? 152  TYR G OH  1 
ATOM   6806  N  N   . SER C 1 135 ? 80.421  61.331 64.545  1.00 14.62 ? 153  SER G N   1 
ATOM   6807  C  CA  . SER C 1 135 ? 79.911  60.003 64.261  1.00 15.20 ? 153  SER G CA  1 
ATOM   6808  C  C   . SER C 1 135 ? 78.517  59.872 64.846  1.00 15.85 ? 153  SER G C   1 
ATOM   6809  O  O   . SER C 1 135 ? 78.313  60.186 66.023  1.00 16.45 ? 153  SER G O   1 
ATOM   6810  C  CB  . SER C 1 135 ? 80.808  58.937 64.883  1.00 14.93 ? 153  SER G CB  1 
ATOM   6811  O  OG  . SER C 1 135 ? 80.250  57.654 64.688  1.00 14.74 ? 153  SER G OG  1 
ATOM   6812  N  N   . THR C 1 136 ? 77.564  59.401 64.039  1.00 15.94 ? 154  THR G N   1 
ATOM   6813  C  CA  . THR C 1 136 ? 76.204  59.155 64.532  1.00 16.34 ? 154  THR G CA  1 
ATOM   6814  C  C   . THR C 1 136 ? 76.114  57.823 65.278  1.00 16.16 ? 154  THR G C   1 
ATOM   6815  O  O   . THR C 1 136 ? 75.035  57.421 65.717  1.00 16.38 ? 154  THR G O   1 
ATOM   6816  C  CB  . THR C 1 136 ? 75.135  59.231 63.406  1.00 16.22 ? 154  THR G CB  1 
ATOM   6817  O  OG1 . THR C 1 136 ? 75.424  58.261 62.391  1.00 16.95 ? 154  THR G OG1 1 
ATOM   6818  C  CG2 . THR C 1 136 ? 75.105  60.624 62.793  1.00 16.33 ? 154  THR G CG2 1 
ATOM   6819  N  N   . SER C 1 137 ? 77.256  57.151 65.419  1.00 16.05 ? 155  SER G N   1 
ATOM   6820  C  CA  . SER C 1 137 ? 77.358  55.924 66.208  1.00 16.30 ? 155  SER G CA  1 
ATOM   6821  C  C   . SER C 1 137 ? 78.129  56.131 67.516  1.00 15.85 ? 155  SER G C   1 
ATOM   6822  O  O   . SER C 1 137 ? 78.353  55.187 68.263  1.00 16.57 ? 155  SER G O   1 
ATOM   6823  C  CB  . SER C 1 137 ? 78.022  54.823 65.386  1.00 16.15 ? 155  SER G CB  1 
ATOM   6824  O  OG  . SER C 1 137 ? 77.295  54.590 64.199  1.00 18.13 ? 155  SER G OG  1 
ATOM   6825  N  N   . ALA C 1 138 ? 78.530  57.366 67.787  1.00 15.40 ? 156  ALA G N   1 
ATOM   6826  C  CA  . ALA C 1 138 ? 79.315  57.679 68.978  1.00 14.86 ? 156  ALA G CA  1 
ATOM   6827  C  C   . ALA C 1 138 ? 78.783  58.935 69.664  1.00 14.45 ? 156  ALA G C   1 
ATOM   6828  O  O   . ALA C 1 138 ? 77.960  59.656 69.091  1.00 14.69 ? 156  ALA G O   1 
ATOM   6829  C  CB  . ALA C 1 138 ? 80.790  57.835 68.614  1.00 14.75 ? 156  ALA G CB  1 
ATOM   6830  N  N   . SER C 1 139 ? 79.252  59.188 70.887  1.00 13.83 ? 157  SER G N   1 
ATOM   6831  C  CA  . SER C 1 139 ? 78.772  60.306 71.709  1.00 12.97 ? 157  SER G CA  1 
ATOM   6832  C  C   . SER C 1 139 ? 79.834  60.703 72.726  1.00 12.82 ? 157  SER G C   1 
ATOM   6833  O  O   . SER C 1 139 ? 80.870  60.052 72.834  1.00 12.72 ? 157  SER G O   1 
ATOM   6834  C  CB  . SER C 1 139 ? 77.503  59.888 72.451  1.00 13.00 ? 157  SER G CB  1 
ATOM   6835  O  OG  . SER C 1 139 ? 77.752  58.719 73.224  1.00 12.45 ? 157  SER G OG  1 
ATOM   6836  N  N   . LEU C 1 140 ? 79.579  61.778 73.469  1.00 12.58 ? 158  LEU G N   1 
ATOM   6837  C  CA  . LEU C 1 140 ? 80.449  62.166 74.578  1.00 12.17 ? 158  LEU G CA  1 
ATOM   6838  C  C   . LEU C 1 140 ? 79.780  61.780 75.903  1.00 11.82 ? 158  LEU G C   1 
ATOM   6839  O  O   . LEU C 1 140 ? 78.715  62.302 76.251  1.00 11.89 ? 158  LEU G O   1 
ATOM   6840  C  CB  . LEU C 1 140 ? 80.766  63.667 74.537  1.00 11.99 ? 158  LEU G CB  1 
ATOM   6841  C  CG  . LEU C 1 140 ? 81.838  64.207 75.491  1.00 12.48 ? 158  LEU G CG  1 
ATOM   6842  C  CD1 . LEU C 1 140 ? 83.237  63.727 75.105  1.00 10.96 ? 158  LEU G CD1 1 
ATOM   6843  C  CD2 . LEU C 1 140 ? 81.801  65.729 75.560  1.00 12.08 ? 158  LEU G CD2 1 
ATOM   6844  N  N   . TYR C 1 141 ? 80.397  60.848 76.626  1.00 10.81 ? 159  TYR G N   1 
ATOM   6845  C  CA  . TYR C 1 141 ? 79.887  60.447 77.931  1.00 10.04 ? 159  TYR G CA  1 
ATOM   6846  C  C   . TYR C 1 141 ? 80.292  61.491 78.963  1.00 9.84  ? 159  TYR G C   1 
ATOM   6847  O  O   . TYR C 1 141 ? 81.428  61.978 78.964  1.00 9.60  ? 159  TYR G O   1 
ATOM   6848  C  CB  . TYR C 1 141 ? 80.401  59.061 78.309  1.00 9.93  ? 159  TYR G CB  1 
ATOM   6849  C  CG  . TYR C 1 141 ? 79.857  58.499 79.602  1.00 10.12 ? 159  TYR G CG  1 
ATOM   6850  C  CD1 . TYR C 1 141 ? 78.542  58.032 79.690  1.00 9.88  ? 159  TYR G CD1 1 
ATOM   6851  C  CD2 . TYR C 1 141 ? 80.668  58.408 80.733  1.00 9.35  ? 159  TYR G CD2 1 
ATOM   6852  C  CE1 . TYR C 1 141 ? 78.050  57.495 80.891  1.00 10.11 ? 159  TYR G CE1 1 
ATOM   6853  C  CE2 . TYR C 1 141 ? 80.190  57.884 81.927  1.00 9.70  ? 159  TYR G CE2 1 
ATOM   6854  C  CZ  . TYR C 1 141 ? 78.889  57.425 82.000  1.00 9.73  ? 159  TYR G CZ  1 
ATOM   6855  O  OH  . TYR C 1 141 ? 78.434  56.901 83.186  1.00 9.42  ? 159  TYR G OH  1 
ATOM   6856  N  N   . ILE C 1 142 ? 79.340  61.843 79.822  1.00 9.38  ? 160  ILE G N   1 
ATOM   6857  C  CA  . ILE C 1 142 ? 79.529  62.870 80.842  1.00 9.01  ? 160  ILE G CA  1 
ATOM   6858  C  C   . ILE C 1 142 ? 79.441  62.205 82.210  1.00 8.95  ? 160  ILE G C   1 
ATOM   6859  O  O   . ILE C 1 142 ? 78.458  61.543 82.521  1.00 8.48  ? 160  ILE G O   1 
ATOM   6860  C  CB  . ILE C 1 142 ? 78.465  63.989 80.722  1.00 8.66  ? 160  ILE G CB  1 
ATOM   6861  C  CG1 . ILE C 1 142 ? 78.475  64.594 79.309  1.00 8.57  ? 160  ILE G CG1 1 
ATOM   6862  C  CG2 . ILE C 1 142 ? 78.685  65.061 81.791  1.00 9.04  ? 160  ILE G CG2 1 
ATOM   6863  C  CD1 . ILE C 1 142 ? 77.263  65.445 78.974  1.00 7.54  ? 160  ILE G CD1 1 
ATOM   6864  N  N   . ARG C 1 143 ? 80.476  62.403 83.022  1.00 9.29  ? 161  ARG G N   1 
ATOM   6865  C  CA  . ARG C 1 143 ? 80.594  61.741 84.315  1.00 9.40  ? 161  ARG G CA  1 
ATOM   6866  C  C   . ARG C 1 143 ? 80.727  62.732 85.500  1.00 9.78  ? 161  ARG G C   1 
ATOM   6867  O  O   . ARG C 1 143 ? 81.846  63.039 85.947  1.00 9.27  ? 161  ARG G O   1 
ATOM   6868  C  CB  . ARG C 1 143 ? 81.774  60.761 84.270  1.00 9.62  ? 161  ARG G CB  1 
ATOM   6869  C  CG  . ARG C 1 143 ? 82.097  60.068 85.576  1.00 9.96  ? 161  ARG G CG  1 
ATOM   6870  C  CD  . ARG C 1 143 ? 80.930  59.245 86.055  1.00 12.50 ? 161  ARG G CD  1 
ATOM   6871  N  NE  . ARG C 1 143 ? 81.463  58.011 86.575  1.00 17.63 ? 161  ARG G NE  1 
ATOM   6872  C  CZ  . ARG C 1 143 ? 81.151  56.792 86.168  1.00 15.15 ? 161  ARG G CZ  1 
ATOM   6873  N  NH1 . ARG C 1 143 ? 80.222  56.568 85.247  1.00 13.75 ? 161  ARG G NH1 1 
ATOM   6874  N  NH2 . ARG C 1 143 ? 81.763  55.790 86.752  1.00 16.77 ? 161  ARG G NH2 1 
ATOM   6875  N  N   . PRO C 1 144 ? 79.581  63.244 86.003  1.00 10.11 ? 162  PRO G N   1 
ATOM   6876  C  CA  . PRO C 1 144 ? 79.607  63.981 87.260  1.00 10.43 ? 162  PRO G CA  1 
ATOM   6877  C  C   . PRO C 1 144 ? 79.906  63.030 88.408  1.00 11.08 ? 162  PRO G C   1 
ATOM   6878  O  O   . PRO C 1 144 ? 79.384  61.908 88.463  1.00 11.05 ? 162  PRO G O   1 
ATOM   6879  C  CB  . PRO C 1 144 ? 78.185  64.558 87.374  1.00 10.34 ? 162  PRO G CB  1 
ATOM   6880  C  CG  . PRO C 1 144 ? 77.598  64.457 85.980  1.00 10.31 ? 162  PRO G CG  1 
ATOM   6881  C  CD  . PRO C 1 144 ? 78.219  63.190 85.442  1.00 10.02 ? 162  PRO G CD  1 
ATOM   6882  N  N   . ALA C 1 145 ? 80.791  63.465 89.291  1.00 11.94 ? 163  ALA G N   1 
ATOM   6883  C  CA  . ALA C 1 145 ? 81.206  62.658 90.412  1.00 12.45 ? 163  ALA G CA  1 
ATOM   6884  C  C   . ALA C 1 145 ? 81.305  63.557 91.631  1.00 12.36 ? 163  ALA G C   1 
ATOM   6885  O  O   . ALA C 1 145 ? 81.642  64.738 91.525  1.00 12.63 ? 163  ALA G O   1 
ATOM   6886  C  CB  . ALA C 1 145 ? 82.539  61.941 90.098  1.00 12.97 ? 163  ALA G CB  1 
ATOM   6887  N  N   . PHE C 1 146 ? 80.979  63.000 92.790  1.00 12.35 ? 164  PHE G N   1 
ATOM   6888  C  CA  . PHE C 1 146 ? 80.786  63.796 93.989  1.00 12.16 ? 164  PHE G CA  1 
ATOM   6889  C  C   . PHE C 1 146 ? 81.361  62.993 95.149  1.00 12.35 ? 164  PHE G C   1 
ATOM   6890  O  O   . PHE C 1 146 ? 80.863  61.912 95.477  1.00 12.27 ? 164  PHE G O   1 
ATOM   6891  C  CB  . PHE C 1 146 ? 79.284  64.053 94.172  1.00 12.20 ? 164  PHE G CB  1 
ATOM   6892  C  CG  . PHE C 1 146 ? 78.935  65.239 95.055  1.00 12.11 ? 164  PHE G CG  1 
ATOM   6893  C  CD1 . PHE C 1 146 ? 79.915  65.972 95.722  1.00 10.81 ? 164  PHE G CD1 1 
ATOM   6894  C  CD2 . PHE C 1 146 ? 77.591  65.580 95.253  1.00 12.26 ? 164  PHE G CD2 1 
ATOM   6895  C  CE1 . PHE C 1 146 ? 79.566  67.040 96.546  1.00 11.68 ? 164  PHE G CE1 1 
ATOM   6896  C  CE2 . PHE C 1 146 ? 77.233  66.650 96.076  1.00 10.95 ? 164  PHE G CE2 1 
ATOM   6897  C  CZ  . PHE C 1 146 ? 78.222  67.383 96.717  1.00 10.69 ? 164  PHE G CZ  1 
ATOM   6898  N  N   . ILE C 1 147 ? 82.426  63.513 95.752  1.00 12.05 ? 165  ILE G N   1 
ATOM   6899  C  CA  . ILE C 1 147 ? 83.188  62.741 96.732  1.00 12.15 ? 165  ILE G CA  1 
ATOM   6900  C  C   . ILE C 1 147 ? 83.409  63.465 98.060  1.00 12.68 ? 165  ILE G C   1 
ATOM   6901  O  O   . ILE C 1 147 ? 83.594  64.679 98.089  1.00 12.43 ? 165  ILE G O   1 
ATOM   6902  C  CB  . ILE C 1 147 ? 84.560  62.254 96.162  1.00 11.77 ? 165  ILE G CB  1 
ATOM   6903  C  CG1 . ILE C 1 147 ? 85.461  63.441 95.769  1.00 10.90 ? 165  ILE G CG1 1 
ATOM   6904  C  CG2 . ILE C 1 147 ? 84.340  61.292 94.986  1.00 11.32 ? 165  ILE G CG2 1 
ATOM   6905  C  CD1 . ILE C 1 147 ? 86.918  63.072 95.524  1.00 8.93  ? 165  ILE G CD1 1 
ATOM   6906  N  N   . GLY C 1 148 ? 83.373  62.699 99.148  1.00 13.33 ? 166  GLY G N   1 
ATOM   6907  C  CA  . GLY C 1 148 ? 83.765  63.181 100.462 1.00 14.53 ? 166  GLY G CA  1 
ATOM   6908  C  C   . GLY C 1 148 ? 85.277  63.285 100.518 1.00 15.59 ? 166  GLY G C   1 
ATOM   6909  O  O   . GLY C 1 148 ? 85.991  62.355 100.123 1.00 15.55 ? 166  GLY G O   1 
ATOM   6910  N  N   . THR C 1 149 ? 85.756  64.420 101.012 1.00 16.28 ? 167  THR G N   1 
ATOM   6911  C  CA  . THR C 1 149 ? 87.178  64.736 101.040 1.00 17.70 ? 167  THR G CA  1 
ATOM   6912  C  C   . THR C 1 149 ? 87.651  65.028 102.484 1.00 17.85 ? 167  THR G C   1 
ATOM   6913  O  O   . THR C 1 149 ? 88.760  65.530 102.705 1.00 17.44 ? 167  THR G O   1 
ATOM   6914  C  CB  . THR C 1 149 ? 87.492  65.888 100.022 1.00 17.50 ? 167  THR G CB  1 
ATOM   6915  O  OG1 . THR C 1 149 ? 87.495  65.349 98.687  1.00 19.19 ? 167  THR G OG1 1 
ATOM   6916  C  CG2 . THR C 1 149 ? 88.840  66.476 100.266 1.00 19.82 ? 167  THR G CG2 1 
ATOM   6917  N  N   . GLU C 1 150 ? 86.792  64.689 103.450 1.00 18.58 ? 168  GLU G N   1 
ATOM   6918  C  CA  . GLU C 1 150 ? 87.086  64.789 104.893 1.00 19.71 ? 168  GLU G CA  1 
ATOM   6919  C  C   . GLU C 1 150 ? 88.384  64.095 105.262 1.00 19.07 ? 168  GLU G C   1 
ATOM   6920  O  O   . GLU C 1 150 ? 88.481  62.881 105.127 1.00 19.09 ? 168  GLU G O   1 
ATOM   6921  C  CB  . GLU C 1 150 ? 85.966  64.140 105.721 1.00 20.07 ? 168  GLU G CB  1 
ATOM   6922  C  CG  . GLU C 1 150 ? 85.104  65.108 106.491 1.00 23.26 ? 168  GLU G CG  1 
ATOM   6923  C  CD  . GLU C 1 150 ? 85.738  65.651 107.764 1.00 26.82 ? 168  GLU G CD  1 
ATOM   6924  O  OE1 . GLU C 1 150 ? 86.703  65.070 108.308 1.00 28.72 ? 168  GLU G OE1 1 
ATOM   6925  O  OE2 . GLU C 1 150 ? 85.248  66.685 108.244 1.00 29.07 ? 168  GLU G OE2 1 
ATOM   6926  N  N   . PRO C 1 151 ? 89.377  64.858 105.743 1.00 19.13 ? 169  PRO G N   1 
ATOM   6927  C  CA  . PRO C 1 151 ? 90.651  64.245 106.105 1.00 19.31 ? 169  PRO G CA  1 
ATOM   6928  C  C   . PRO C 1 151 ? 90.624  63.312 107.327 1.00 19.45 ? 169  PRO G C   1 
ATOM   6929  O  O   . PRO C 1 151 ? 91.621  62.649 107.584 1.00 20.85 ? 169  PRO G O   1 
ATOM   6930  C  CB  . PRO C 1 151 ? 91.569  65.450 106.350 1.00 19.18 ? 169  PRO G CB  1 
ATOM   6931  C  CG  . PRO C 1 151 ? 90.663  66.579 106.657 1.00 18.72 ? 169  PRO G CG  1 
ATOM   6932  C  CD  . PRO C 1 151 ? 89.384  66.322 105.940 1.00 19.20 ? 169  PRO G CD  1 
ATOM   6933  N  N   . SER C 1 152 ? 89.508  63.215 108.046 1.00 19.16 ? 170  SER G N   1 
ATOM   6934  C  CA  . SER C 1 152 ? 89.484  62.429 109.291 1.00 18.74 ? 170  SER G CA  1 
ATOM   6935  C  C   . SER C 1 152 ? 88.797  61.058 109.176 1.00 17.95 ? 170  SER G C   1 
ATOM   6936  O  O   . SER C 1 152 ? 87.907  60.860 108.345 1.00 17.94 ? 170  SER G O   1 
ATOM   6937  C  CB  . SER C 1 152 ? 88.901  63.254 110.444 1.00 18.86 ? 170  SER G CB  1 
ATOM   6938  O  OG  . SER C 1 152 ? 87.505  63.420 110.308 1.00 20.48 ? 170  SER G OG  1 
ATOM   6939  N  N   . LEU C 1 153 ? 89.221  60.118 110.016 1.00 17.14 ? 171  LEU G N   1 
ATOM   6940  C  CA  . LEU C 1 153 ? 88.788  58.718 109.911 1.00 16.95 ? 171  LEU G CA  1 
ATOM   6941  C  C   . LEU C 1 153 ? 87.492  58.384 110.664 1.00 16.97 ? 171  LEU G C   1 
ATOM   6942  O  O   . LEU C 1 153 ? 86.999  57.262 110.576 1.00 17.05 ? 171  LEU G O   1 
ATOM   6943  C  CB  . LEU C 1 153 ? 89.904  57.757 110.351 1.00 16.32 ? 171  LEU G CB  1 
ATOM   6944  C  CG  . LEU C 1 153 ? 91.328  57.906 109.796 1.00 16.48 ? 171  LEU G CG  1 
ATOM   6945  C  CD1 . LEU C 1 153 ? 92.207  56.758 110.319 1.00 14.41 ? 171  LEU G CD1 1 
ATOM   6946  C  CD2 . LEU C 1 153 ? 91.378  57.982 108.264 1.00 14.21 ? 171  LEU G CD2 1 
ATOM   6947  N  N   . GLY C 1 154 ? 86.949  59.333 111.419 1.00 17.12 ? 172  GLY G N   1 
ATOM   6948  C  CA  . GLY C 1 154 ? 85.633  59.130 112.039 1.00 17.74 ? 172  GLY G CA  1 
ATOM   6949  C  C   . GLY C 1 154 ? 84.564  58.916 110.977 1.00 17.92 ? 172  GLY G C   1 
ATOM   6950  O  O   . GLY C 1 154 ? 84.546  59.615 109.966 1.00 17.83 ? 172  GLY G O   1 
ATOM   6951  N  N   . VAL C 1 155 ? 83.691  57.934 111.196 1.00 18.48 ? 173  VAL G N   1 
ATOM   6952  C  CA  . VAL C 1 155 ? 82.586  57.638 110.270 1.00 19.00 ? 173  VAL G CA  1 
ATOM   6953  C  C   . VAL C 1 155 ? 81.433  58.619 110.511 1.00 19.10 ? 173  VAL G C   1 
ATOM   6954  O  O   . VAL C 1 155 ? 80.586  58.412 111.384 1.00 19.35 ? 173  VAL G O   1 
ATOM   6955  C  CB  . VAL C 1 155 ? 82.095  56.169 110.391 1.00 18.96 ? 173  VAL G CB  1 
ATOM   6956  C  CG1 . VAL C 1 155 ? 81.286  55.774 109.161 1.00 20.02 ? 173  VAL G CG1 1 
ATOM   6957  C  CG2 . VAL C 1 155 ? 83.268  55.217 110.549 1.00 19.39 ? 173  VAL G CG2 1 
ATOM   6958  N  N   . LYS C 1 156 ? 81.423  59.704 109.742 1.00 19.41 ? 174  LYS G N   1 
ATOM   6959  C  CA  . LYS C 1 156 ? 80.445  60.770 109.920 1.00 19.23 ? 174  LYS G CA  1 
ATOM   6960  C  C   . LYS C 1 156 ? 80.225  61.568 108.635 1.00 18.82 ? 174  LYS G C   1 
ATOM   6961  O  O   . LYS C 1 156 ? 80.993  61.446 107.684 1.00 18.48 ? 174  LYS G O   1 
ATOM   6962  C  CB  . LYS C 1 156 ? 80.881  61.703 111.056 1.00 19.71 ? 174  LYS G CB  1 
ATOM   6963  C  CG  . LYS C 1 156 ? 82.186  62.441 110.803 1.00 21.58 ? 174  LYS G CG  1 
ATOM   6964  C  CD  . LYS C 1 156 ? 82.453  63.457 111.908 1.00 26.34 ? 174  LYS G CD  1 
ATOM   6965  C  CE  . LYS C 1 156 ? 83.766  64.206 111.682 1.00 27.73 ? 174  LYS G CE  1 
ATOM   6966  N  NZ  . LYS C 1 156 ? 84.911  63.577 112.403 1.00 29.95 ? 174  LYS G NZ  1 
ATOM   6967  N  N   . LYS C 1 157 ? 79.166  62.381 108.626 1.00 18.21 ? 175  LYS G N   1 
ATOM   6968  C  CA  . LYS C 1 157 ? 78.903  63.349 107.561 1.00 17.83 ? 175  LYS G CA  1 
ATOM   6969  C  C   . LYS C 1 157 ? 80.157  64.157 107.214 1.00 17.12 ? 175  LYS G C   1 
ATOM   6970  O  O   . LYS C 1 157 ? 80.773  64.752 108.099 1.00 16.93 ? 175  LYS G O   1 
ATOM   6971  C  CB  . LYS C 1 157 ? 77.773  64.293 107.994 1.00 17.97 ? 175  LYS G CB  1 
ATOM   6972  C  CG  . LYS C 1 157 ? 77.243  65.245 106.927 1.00 18.28 ? 175  LYS G CG  1 
ATOM   6973  C  CD  . LYS C 1 157 ? 76.140  66.107 107.505 1.00 19.99 ? 175  LYS G CD  1 
ATOM   6974  C  CE  . LYS C 1 157 ? 75.325  66.787 106.429 1.00 23.29 ? 175  LYS G CE  1 
ATOM   6975  N  NZ  . LYS C 1 157 ? 73.946  67.086 106.940 1.00 26.30 ? 175  LYS G NZ  1 
ATOM   6976  N  N   . PRO C 1 158 ? 80.539  64.177 105.921 1.00 16.73 ? 176  PRO G N   1 
ATOM   6977  C  CA  . PRO C 1 158 ? 81.729  64.924 105.482 1.00 16.39 ? 176  PRO G CA  1 
ATOM   6978  C  C   . PRO C 1 158 ? 81.598  66.431 105.695 1.00 16.26 ? 176  PRO G C   1 
ATOM   6979  O  O   . PRO C 1 158 ? 80.542  67.009 105.424 1.00 16.17 ? 176  PRO G O   1 
ATOM   6980  C  CB  . PRO C 1 158 ? 81.824  64.604 103.980 1.00 16.34 ? 176  PRO G CB  1 
ATOM   6981  C  CG  . PRO C 1 158 ? 80.467  64.124 103.588 1.00 16.51 ? 176  PRO G CG  1 
ATOM   6982  C  CD  . PRO C 1 158 ? 79.873  63.481 104.802 1.00 16.69 ? 176  PRO G CD  1 
ATOM   6983  N  N   . THR C 1 159 ? 82.663  67.046 106.201 1.00 16.13 ? 177  THR G N   1 
ATOM   6984  C  CA  . THR C 1 159 ? 82.740  68.501 106.334 1.00 16.00 ? 177  THR G CA  1 
ATOM   6985  C  C   . THR C 1 159 ? 83.564  69.104 105.186 1.00 16.19 ? 177  THR G C   1 
ATOM   6986  O  O   . THR C 1 159 ? 83.825  70.307 105.169 1.00 15.97 ? 177  THR G O   1 
ATOM   6987  C  CB  . THR C 1 159 ? 83.343  68.950 107.700 1.00 16.23 ? 177  THR G CB  1 
ATOM   6988  O  OG1 . THR C 1 159 ? 84.772  68.798 107.680 1.00 16.23 ? 177  THR G OG1 1 
ATOM   6989  C  CG2 . THR C 1 159 ? 82.722  68.188 108.894 1.00 15.19 ? 177  THR G CG2 1 
ATOM   6990  N  N   . LYS C 1 160 ? 83.947  68.250 104.229 1.00 16.18 ? 178  LYS G N   1 
ATOM   6991  C  CA  . LYS C 1 160 ? 84.758  68.625 103.073 1.00 16.36 ? 178  LYS G CA  1 
ATOM   6992  C  C   . LYS C 1 160 ? 84.326  67.732 101.896 1.00 15.66 ? 178  LYS G C   1 
ATOM   6993  O  O   . LYS C 1 160 ? 84.207  66.511 102.054 1.00 15.54 ? 178  LYS G O   1 
ATOM   6994  C  CB  . LYS C 1 160 ? 86.231  68.355 103.396 1.00 16.80 ? 178  LYS G CB  1 
ATOM   6995  C  CG  . LYS C 1 160 ? 87.188  69.519 103.227 1.00 19.46 ? 178  LYS G CG  1 
ATOM   6996  C  CD  . LYS C 1 160 ? 87.655  69.662 101.786 1.00 23.05 ? 178  LYS G CD  1 
ATOM   6997  C  CE  . LYS C 1 160 ? 88.825  70.645 101.661 1.00 26.06 ? 178  LYS G CE  1 
ATOM   6998  N  NZ  . LYS C 1 160 ? 90.144  69.954 101.585 1.00 27.55 ? 178  LYS G NZ  1 
ATOM   6999  N  N   . ALA C 1 161 ? 84.092  68.337 100.731 1.00 14.69 ? 179  ALA G N   1 
ATOM   7000  C  CA  . ALA C 1 161 ? 83.688  67.596 99.531  1.00 14.43 ? 179  ALA G CA  1 
ATOM   7001  C  C   . ALA C 1 161 ? 84.253  68.185 98.238  1.00 14.11 ? 179  ALA G C   1 
ATOM   7002  O  O   . ALA C 1 161 ? 84.579  69.368 98.183  1.00 14.12 ? 179  ALA G O   1 
ATOM   7003  C  CB  . ALA C 1 161 ? 82.155  67.484 99.443  1.00 14.24 ? 179  ALA G CB  1 
ATOM   7004  N  N   . LEU C 1 162 ? 84.374  67.341 97.212  1.00 14.01 ? 180  LEU G N   1 
ATOM   7005  C  CA  . LEU C 1 162 ? 84.725  67.772 95.850  1.00 13.83 ? 180  LEU G CA  1 
ATOM   7006  C  C   . LEU C 1 162 ? 83.691  67.224 94.867  1.00 13.47 ? 180  LEU G C   1 
ATOM   7007  O  O   . LEU C 1 162 ? 83.400  66.024 94.869  1.00 13.47 ? 180  LEU G O   1 
ATOM   7008  C  CB  . LEU C 1 162 ? 86.128  67.274 95.473  1.00 13.64 ? 180  LEU G CB  1 
ATOM   7009  C  CG  . LEU C 1 162 ? 87.027  67.882 94.367  1.00 15.14 ? 180  LEU G CG  1 
ATOM   7010  C  CD1 . LEU C 1 162 ? 87.478  66.881 93.304  1.00 15.48 ? 180  LEU G CD1 1 
ATOM   7011  C  CD2 . LEU C 1 162 ? 86.498  69.175 93.722  1.00 14.91 ? 180  LEU G CD2 1 
ATOM   7012  N  N   . LEU C 1 163 ? 83.123  68.110 94.050  1.00 13.08 ? 181  LEU G N   1 
ATOM   7013  C  CA  . LEU C 1 163 ? 82.279  67.701 92.923  1.00 12.96 ? 181  LEU G CA  1 
ATOM   7014  C  C   . LEU C 1 163 ? 83.069  67.942 91.635  1.00 12.76 ? 181  LEU G C   1 
ATOM   7015  O  O   . LEU C 1 163 ? 83.612  69.019 91.426  1.00 12.39 ? 181  LEU G O   1 
ATOM   7016  C  CB  . LEU C 1 163 ? 80.946  68.471 92.913  1.00 12.74 ? 181  LEU G CB  1 
ATOM   7017  C  CG  . LEU C 1 163 ? 79.804  68.017 91.984  1.00 12.93 ? 181  LEU G CG  1 
ATOM   7018  C  CD1 . LEU C 1 163 ? 78.480  68.585 92.465  1.00 13.08 ? 181  LEU G CD1 1 
ATOM   7019  C  CD2 . LEU C 1 163 ? 80.029  68.408 90.527  1.00 10.86 ? 181  LEU G CD2 1 
ATOM   7020  N  N   . PHE C 1 164 ? 83.165  66.918 90.793  1.00 12.49 ? 182  PHE G N   1 
ATOM   7021  C  CA  . PHE C 1 164 ? 83.850  67.071 89.514  1.00 12.32 ? 182  PHE G CA  1 
ATOM   7022  C  C   . PHE C 1 164 ? 83.119  66.426 88.340  1.00 11.98 ? 182  PHE G C   1 
ATOM   7023  O  O   . PHE C 1 164 ? 82.275  65.546 88.528  1.00 11.90 ? 182  PHE G O   1 
ATOM   7024  C  CB  . PHE C 1 164 ? 85.330  66.643 89.591  1.00 12.26 ? 182  PHE G CB  1 
ATOM   7025  C  CG  . PHE C 1 164 ? 85.543  65.203 89.940  1.00 12.01 ? 182  PHE G CG  1 
ATOM   7026  C  CD1 . PHE C 1 164 ? 85.551  64.786 91.265  1.00 11.05 ? 182  PHE G CD1 1 
ATOM   7027  C  CD2 . PHE C 1 164 ? 85.783  64.261 88.935  1.00 12.78 ? 182  PHE G CD2 1 
ATOM   7028  C  CE1 . PHE C 1 164 ? 85.766  63.448 91.588  1.00 11.51 ? 182  PHE G CE1 1 
ATOM   7029  C  CE2 . PHE C 1 164 ? 86.003  62.920 89.253  1.00 11.72 ? 182  PHE G CE2 1 
ATOM   7030  C  CZ  . PHE C 1 164 ? 85.997  62.516 90.577  1.00 10.77 ? 182  PHE G CZ  1 
ATOM   7031  N  N   . VAL C 1 165 ? 83.423  66.899 87.136  1.00 11.68 ? 183  VAL G N   1 
ATOM   7032  C  CA  . VAL C 1 165 ? 82.851  66.338 85.921  1.00 11.50 ? 183  VAL G CA  1 
ATOM   7033  C  C   . VAL C 1 165 ? 83.943  65.984 84.921  1.00 11.35 ? 183  VAL G C   1 
ATOM   7034  O  O   . VAL C 1 165 ? 84.785  66.805 84.588  1.00 11.11 ? 183  VAL G O   1 
ATOM   7035  C  CB  . VAL C 1 165 ? 81.801  67.272 85.257  1.00 11.58 ? 183  VAL G CB  1 
ATOM   7036  C  CG1 . VAL C 1 165 ? 81.191  66.604 84.025  1.00 10.83 ? 183  VAL G CG1 1 
ATOM   7037  C  CG2 . VAL C 1 165 ? 80.703  67.641 86.242  1.00 11.30 ? 183  VAL G CG2 1 
ATOM   7038  N  N   . LEU C 1 166 ? 83.892  64.747 84.442  1.00 11.51 ? 184  LEU G N   1 
ATOM   7039  C  CA  . LEU C 1 166 ? 84.798  64.246 83.431  1.00 11.31 ? 184  LEU G CA  1 
ATOM   7040  C  C   . LEU C 1 166 ? 84.027  64.029 82.134  1.00 11.61 ? 184  LEU G C   1 
ATOM   7041  O  O   . LEU C 1 166 ? 82.832  63.735 82.163  1.00 11.30 ? 184  LEU G O   1 
ATOM   7042  C  CB  . LEU C 1 166 ? 85.376  62.919 83.910  1.00 11.35 ? 184  LEU G CB  1 
ATOM   7043  C  CG  . LEU C 1 166 ? 86.752  62.792 84.572  1.00 11.85 ? 184  LEU G CG  1 
ATOM   7044  C  CD1 . LEU C 1 166 ? 87.211  64.024 85.352  1.00 10.93 ? 184  LEU G CD1 1 
ATOM   7045  C  CD2 . LEU C 1 166 ? 86.791  61.527 85.418  1.00 10.81 ? 184  LEU G CD2 1 
ATOM   7046  N  N   . LEU C 1 167 ? 84.718  64.186 81.005  1.00 11.94 ? 185  LEU G N   1 
ATOM   7047  C  CA  . LEU C 1 167 ? 84.154  63.912 79.678  1.00 12.39 ? 185  LEU G CA  1 
ATOM   7048  C  C   . LEU C 1 167 ? 84.975  62.845 78.964  1.00 12.65 ? 185  LEU G C   1 
ATOM   7049  O  O   . LEU C 1 167 ? 86.209  62.884 78.991  1.00 12.62 ? 185  LEU G O   1 
ATOM   7050  C  CB  . LEU C 1 167 ? 84.104  65.180 78.822  1.00 11.63 ? 185  LEU G CB  1 
ATOM   7051  C  CG  . LEU C 1 167 ? 83.429  66.441 79.369  1.00 12.01 ? 185  LEU G CG  1 
ATOM   7052  C  CD1 . LEU C 1 167 ? 83.673  67.608 78.416  1.00 9.81  ? 185  LEU G CD1 1 
ATOM   7053  C  CD2 . LEU C 1 167 ? 81.923  66.237 79.633  1.00 10.00 ? 185  LEU G CD2 1 
ATOM   7054  N  N   . SER C 1 168 ? 84.287  61.894 78.338  1.00 12.81 ? 186  SER G N   1 
ATOM   7055  C  CA  . SER C 1 168 ? 84.948  60.752 77.706  1.00 13.34 ? 186  SER G CA  1 
ATOM   7056  C  C   . SER C 1 168 ? 84.271  60.386 76.382  1.00 14.02 ? 186  SER G C   1 
ATOM   7057  O  O   . SER C 1 168 ? 83.112  59.971 76.388  1.00 14.07 ? 186  SER G O   1 
ATOM   7058  C  CB  . SER C 1 168 ? 84.952  59.540 78.657  1.00 13.42 ? 186  SER G CB  1 
ATOM   7059  O  OG  . SER C 1 168 ? 85.506  58.380 78.040  1.00 11.76 ? 186  SER G OG  1 
ATOM   7060  N  N   . PRO C 1 169 ? 84.984  60.551 75.244  1.00 14.97 ? 187  PRO G N   1 
ATOM   7061  C  CA  . PRO C 1 169 ? 84.425  60.115 73.952  1.00 15.74 ? 187  PRO G CA  1 
ATOM   7062  C  C   . PRO C 1 169 ? 84.186  58.615 73.956  1.00 16.75 ? 187  PRO G C   1 
ATOM   7063  O  O   . PRO C 1 169 ? 85.069  57.838 74.322  1.00 16.71 ? 187  PRO G O   1 
ATOM   7064  C  CB  . PRO C 1 169 ? 85.508  60.474 72.926  1.00 15.75 ? 187  PRO G CB  1 
ATOM   7065  C  CG  . PRO C 1 169 ? 86.512  61.293 73.633  1.00 15.09 ? 187  PRO G CG  1 
ATOM   7066  C  CD  . PRO C 1 169 ? 86.323  61.157 75.106  1.00 14.88 ? 187  PRO G CD  1 
ATOM   7067  N  N   . VAL C 1 170 ? 82.996  58.224 73.522  1.00 17.94 ? 188  VAL G N   1 
ATOM   7068  C  CA  . VAL C 1 170 ? 82.494  56.890 73.733  1.00 19.04 ? 188  VAL G CA  1 
ATOM   7069  C  C   . VAL C 1 170 ? 81.809  56.435 72.451  1.00 20.33 ? 188  VAL G C   1 
ATOM   7070  O  O   . VAL C 1 170 ? 81.146  57.228 71.787  1.00 20.47 ? 188  VAL G O   1 
ATOM   7071  C  CB  . VAL C 1 170 ? 81.548  56.923 74.974  1.00 19.30 ? 188  VAL G CB  1 
ATOM   7072  C  CG1 . VAL C 1 170 ? 80.309  56.110 74.798  1.00 18.04 ? 188  VAL G CG1 1 
ATOM   7073  C  CG2 . VAL C 1 170 ? 82.323  56.559 76.246  1.00 18.77 ? 188  VAL G CG2 1 
ATOM   7074  N  N   . GLY C 1 171 ? 81.996  55.171 72.089  1.00 21.50 ? 189  GLY G N   1 
ATOM   7075  C  CA  . GLY C 1 171 ? 81.404  54.624 70.877  1.00 23.41 ? 189  GLY G CA  1 
ATOM   7076  C  C   . GLY C 1 171 ? 80.239  53.683 71.137  1.00 25.07 ? 189  GLY G C   1 
ATOM   7077  O  O   . GLY C 1 171 ? 79.727  53.618 72.265  1.00 24.88 ? 189  GLY G O   1 
ATOM   7078  N  N   . PRO C 1 172 ? 79.804  52.950 70.087  1.00 26.36 ? 190  PRO G N   1 
ATOM   7079  C  CA  . PRO C 1 172 ? 78.705  51.989 70.204  1.00 26.99 ? 190  PRO G CA  1 
ATOM   7080  C  C   . PRO C 1 172 ? 79.176  50.645 70.767  1.00 27.50 ? 190  PRO G C   1 
ATOM   7081  O  O   . PRO C 1 172 ? 80.174  50.592 71.498  1.00 28.13 ? 190  PRO G O   1 
ATOM   7082  C  CB  . PRO C 1 172 ? 78.239  51.821 68.755  1.00 27.33 ? 190  PRO G CB  1 
ATOM   7083  C  CG  . PRO C 1 172 ? 79.484  52.043 67.931  1.00 27.08 ? 190  PRO G CG  1 
ATOM   7084  C  CD  . PRO C 1 172 ? 80.361  52.994 68.716  1.00 26.63 ? 190  PRO G CD  1 
ATOM   7085  N  N   . PHE C 1 179 ? 73.259  44.111 66.889  1.00 32.14 ? 197  PHE G N   1 
ATOM   7086  C  CA  . PHE C 1 179 ? 73.193  43.766 68.308  1.00 32.18 ? 197  PHE G CA  1 
ATOM   7087  C  C   . PHE C 1 179 ? 74.102  42.591 68.652  1.00 32.04 ? 197  PHE G C   1 
ATOM   7088  O  O   . PHE C 1 179 ? 74.146  41.597 67.923  1.00 31.94 ? 197  PHE G O   1 
ATOM   7089  C  CB  . PHE C 1 179 ? 71.760  43.403 68.714  1.00 32.07 ? 197  PHE G CB  1 
ATOM   7090  C  CG  . PHE C 1 179 ? 70.903  44.580 69.082  1.00 32.13 ? 197  PHE G CG  1 
ATOM   7091  C  CD1 . PHE C 1 179 ? 71.354  45.544 69.983  1.00 32.29 ? 197  PHE G CD1 1 
ATOM   7092  C  CD2 . PHE C 1 179 ? 69.622  44.704 68.558  1.00 32.27 ? 197  PHE G CD2 1 
ATOM   7093  C  CE1 . PHE C 1 179 ? 70.554  46.619 70.334  1.00 32.14 ? 197  PHE G CE1 1 
ATOM   7094  C  CE2 . PHE C 1 179 ? 68.810  45.778 68.906  1.00 31.85 ? 197  PHE G CE2 1 
ATOM   7095  C  CZ  . PHE C 1 179 ? 69.278  46.737 69.792  1.00 32.06 ? 197  PHE G CZ  1 
ATOM   7096  N  N   . ASN C 1 180 ? 74.816  42.713 69.769  1.00 31.87 ? 198  ASN G N   1 
ATOM   7097  C  CA  . ASN C 1 180 ? 75.578  41.601 70.337  1.00 31.64 ? 198  ASN G CA  1 
ATOM   7098  C  C   . ASN C 1 180 ? 74.942  41.141 71.648  1.00 30.69 ? 198  ASN G C   1 
ATOM   7099  O  O   . ASN C 1 180 ? 75.202  41.728 72.708  1.00 31.03 ? 198  ASN G O   1 
ATOM   7100  C  CB  . ASN C 1 180 ? 77.045  41.989 70.566  1.00 32.13 ? 198  ASN G CB  1 
ATOM   7101  C  CG  . ASN C 1 180 ? 77.890  41.865 69.311  1.00 33.87 ? 198  ASN G CG  1 
ATOM   7102  O  OD1 . ASN C 1 180 ? 78.400  42.862 68.797  1.00 35.42 ? 198  ASN G OD1 1 
ATOM   7103  N  ND2 . ASN C 1 180 ? 78.045  40.636 68.811  1.00 35.69 ? 198  ASN G ND2 1 
ATOM   7104  N  N   . PRO C 1 181 ? 74.112  40.083 71.586  1.00 29.55 ? 199  PRO G N   1 
ATOM   7105  C  CA  . PRO C 1 181 ? 73.374  39.623 72.771  1.00 28.50 ? 199  PRO G CA  1 
ATOM   7106  C  C   . PRO C 1 181 ? 74.313  39.142 73.880  1.00 27.63 ? 199  PRO G C   1 
ATOM   7107  O  O   . PRO C 1 181 ? 75.441  38.725 73.599  1.00 27.59 ? 199  PRO G O   1 
ATOM   7108  C  CB  . PRO C 1 181 ? 72.533  38.462 72.235  1.00 28.42 ? 199  PRO G CB  1 
ATOM   7109  C  CG  . PRO C 1 181 ? 73.249  38.004 71.003  1.00 29.07 ? 199  PRO G CG  1 
ATOM   7110  C  CD  . PRO C 1 181 ? 73.842  39.241 70.405  1.00 29.34 ? 199  PRO G CD  1 
ATOM   7111  N  N   . VAL C 1 182 ? 73.854  39.216 75.126  1.00 26.33 ? 200  VAL G N   1 
ATOM   7112  C  CA  . VAL C 1 182 ? 74.679  38.813 76.267  1.00 25.10 ? 200  VAL G CA  1 
ATOM   7113  C  C   . VAL C 1 182 ? 74.133  37.570 76.956  1.00 24.52 ? 200  VAL G C   1 
ATOM   7114  O  O   . VAL C 1 182 ? 72.929  37.311 76.933  1.00 24.21 ? 200  VAL G O   1 
ATOM   7115  C  CB  . VAL C 1 182 ? 74.866  39.962 77.310  1.00 25.00 ? 200  VAL G CB  1 
ATOM   7116  C  CG1 . VAL C 1 182 ? 75.724  41.075 76.737  1.00 24.30 ? 200  VAL G CG1 1 
ATOM   7117  C  CG2 . VAL C 1 182 ? 73.512  40.505 77.802  1.00 24.82 ? 200  VAL G CG2 1 
ATOM   7118  N  N   . SER C 1 183 ? 75.040  36.791 77.538  1.00 23.85 ? 201  SER G N   1 
ATOM   7119  C  CA  . SER C 1 183 ? 74.670  35.728 78.457  1.00 23.39 ? 201  SER G CA  1 
ATOM   7120  C  C   . SER C 1 183 ? 74.738  36.257 79.878  1.00 22.82 ? 201  SER G C   1 
ATOM   7121  O  O   . SER C 1 183 ? 75.656  37.008 80.228  1.00 22.42 ? 201  SER G O   1 
ATOM   7122  C  CB  . SER C 1 183 ? 75.589  34.518 78.298  1.00 23.52 ? 201  SER G CB  1 
ATOM   7123  O  OG  . SER C 1 183 ? 75.177  33.727 77.198  1.00 24.63 ? 201  SER G OG  1 
ATOM   7124  N  N   . LEU C 1 184 ? 73.757  35.865 80.686  1.00 22.33 ? 202  LEU G N   1 
ATOM   7125  C  CA  . LEU C 1 184 ? 73.673  36.315 82.070  1.00 22.10 ? 202  LEU G CA  1 
ATOM   7126  C  C   . LEU C 1 184 ? 73.917  35.167 83.040  1.00 22.18 ? 202  LEU G C   1 
ATOM   7127  O  O   . LEU C 1 184 ? 73.392  34.063 82.865  1.00 21.87 ? 202  LEU G O   1 
ATOM   7128  C  CB  . LEU C 1 184 ? 72.313  36.964 82.364  1.00 21.75 ? 202  LEU G CB  1 
ATOM   7129  C  CG  . LEU C 1 184 ? 71.769  38.118 81.513  1.00 20.65 ? 202  LEU G CG  1 
ATOM   7130  C  CD1 . LEU C 1 184 ? 70.416  38.564 82.055  1.00 18.79 ? 202  LEU G CD1 1 
ATOM   7131  C  CD2 . LEU C 1 184 ? 72.733  39.302 81.431  1.00 20.18 ? 202  LEU G CD2 1 
ATOM   7132  N  N   . TRP C 1 185 ? 74.724  35.437 84.061  1.00 22.48 ? 203  TRP G N   1 
ATOM   7133  C  CA  . TRP C 1 185 ? 74.948  34.470 85.120  1.00 22.79 ? 203  TRP G CA  1 
ATOM   7134  C  C   . TRP C 1 185 ? 74.109  34.813 86.345  1.00 22.44 ? 203  TRP G C   1 
ATOM   7135  O  O   . TRP C 1 185 ? 74.174  35.928 86.870  1.00 22.09 ? 203  TRP G O   1 
ATOM   7136  C  CB  . TRP C 1 185 ? 76.431  34.359 85.463  1.00 23.39 ? 203  TRP G CB  1 
ATOM   7137  C  CG  . TRP C 1 185 ? 76.820  32.949 85.813  1.00 26.00 ? 203  TRP G CG  1 
ATOM   7138  C  CD1 . TRP C 1 185 ? 76.845  31.864 84.971  1.00 27.96 ? 203  TRP G CD1 1 
ATOM   7139  C  CD2 . TRP C 1 185 ? 77.215  32.472 87.089  1.00 27.36 ? 203  TRP G CD2 1 
ATOM   7140  N  NE1 . TRP C 1 185 ? 77.231  30.737 85.655  1.00 28.39 ? 203  TRP G NE1 1 
ATOM   7141  C  CE2 . TRP C 1 185 ? 77.469  31.083 86.958  1.00 28.57 ? 203  TRP G CE2 1 
ATOM   7142  C  CE3 . TRP C 1 185 ? 77.382  33.081 88.336  1.00 27.39 ? 203  TRP G CE3 1 
ATOM   7143  C  CZ2 . TRP C 1 185 ? 77.887  30.298 88.025  1.00 28.56 ? 203  TRP G CZ2 1 
ATOM   7144  C  CZ3 . TRP C 1 185 ? 77.782  32.305 89.390  1.00 29.12 ? 203  TRP G CZ3 1 
ATOM   7145  C  CH2 . TRP C 1 185 ? 78.036  30.922 89.233  1.00 29.66 ? 203  TRP G CH2 1 
ATOM   7146  N  N   . ALA C 1 186 ? 73.308  33.842 86.774  1.00 22.32 ? 204  ALA G N   1 
ATOM   7147  C  CA  . ALA C 1 186 ? 72.321  34.039 87.821  1.00 22.28 ? 204  ALA G CA  1 
ATOM   7148  C  C   . ALA C 1 186 ? 72.646  33.186 89.042  1.00 22.43 ? 204  ALA G C   1 
ATOM   7149  O  O   . ALA C 1 186 ? 72.398  31.978 89.055  1.00 22.43 ? 204  ALA G O   1 
ATOM   7150  C  CB  . ALA C 1 186 ? 70.920  33.734 87.291  1.00 22.17 ? 204  ALA G CB  1 
ATOM   7151  N  N   . ASN C 1 187 ? 73.221  33.834 90.055  1.00 22.53 ? 205  ASN G N   1 
ATOM   7152  C  CA  . ASN C 1 187 ? 73.531  33.206 91.336  1.00 22.48 ? 205  ASN G CA  1 
ATOM   7153  C  C   . ASN C 1 187 ? 72.785  33.922 92.464  1.00 22.52 ? 205  ASN G C   1 
ATOM   7154  O  O   . ASN C 1 187 ? 73.112  35.063 92.791  1.00 22.37 ? 205  ASN G O   1 
ATOM   7155  C  CB  . ASN C 1 187 ? 75.044  33.240 91.592  1.00 22.49 ? 205  ASN G CB  1 
ATOM   7156  C  CG  . ASN C 1 187 ? 75.480  32.292 92.708  1.00 22.25 ? 205  ASN G CG  1 
ATOM   7157  O  OD1 . ASN C 1 187 ? 74.654  31.658 93.362  1.00 22.92 ? 205  ASN G OD1 1 
ATOM   7158  N  ND2 . ASN C 1 187 ? 76.784  32.194 92.923  1.00 20.87 ? 205  ASN G ND2 1 
ATOM   7159  N  N   . PRO C 1 188 ? 71.777  33.257 93.064  1.00 22.82 ? 206  PRO G N   1 
ATOM   7160  C  CA  . PRO C 1 188 ? 70.981  33.880 94.134  1.00 22.90 ? 206  PRO G CA  1 
ATOM   7161  C  C   . PRO C 1 188 ? 71.749  34.175 95.431  1.00 23.41 ? 206  PRO G C   1 
ATOM   7162  O  O   . PRO C 1 188 ? 71.209  34.835 96.323  1.00 23.23 ? 206  PRO G O   1 
ATOM   7163  C  CB  . PRO C 1 188 ? 69.870  32.857 94.393  1.00 22.93 ? 206  PRO G CB  1 
ATOM   7164  C  CG  . PRO C 1 188 ? 70.405  31.570 93.903  1.00 22.77 ? 206  PRO G CG  1 
ATOM   7165  C  CD  . PRO C 1 188 ? 71.310  31.891 92.755  1.00 22.68 ? 206  PRO G CD  1 
ATOM   7166  N  N   . LYS C 1 189 ? 72.994  33.708 95.531  1.00 23.75 ? 207  LYS G N   1 
ATOM   7167  C  CA  . LYS C 1 189 ? 73.786  33.922 96.745  1.00 24.63 ? 207  LYS G CA  1 
ATOM   7168  C  C   . LYS C 1 189 ? 74.421  35.308 96.815  1.00 24.21 ? 207  LYS G C   1 
ATOM   7169  O  O   . LYS C 1 189 ? 74.923  35.718 97.862  1.00 24.27 ? 207  LYS G O   1 
ATOM   7170  C  CB  . LYS C 1 189 ? 74.804  32.789 96.950  1.00 24.89 ? 207  LYS G CB  1 
ATOM   7171  C  CG  . LYS C 1 189 ? 74.122  31.508 97.488  1.00 27.69 ? 207  LYS G CG  1 
ATOM   7172  C  CD  . LYS C 1 189 ? 74.927  30.205 97.291  1.00 30.74 ? 207  LYS G CD  1 
ATOM   7173  C  CE  . LYS C 1 189 ? 75.007  29.749 95.817  1.00 32.77 ? 207  LYS G CE  1 
ATOM   7174  N  NZ  . LYS C 1 189 ? 73.701  29.699 95.076  1.00 32.89 ? 207  LYS G NZ  1 
ATOM   7175  N  N   . TYR C 1 190 ? 74.374  36.030 95.699  1.00 23.97 ? 208  TYR G N   1 
ATOM   7176  C  CA  . TYR C 1 190 ? 74.776  37.430 95.660  1.00 23.56 ? 208  TYR G CA  1 
ATOM   7177  C  C   . TYR C 1 190 ? 73.537  38.304 95.523  1.00 22.91 ? 208  TYR G C   1 
ATOM   7178  O  O   . TYR C 1 190 ? 72.679  38.047 94.679  1.00 23.05 ? 208  TYR G O   1 
ATOM   7179  C  CB  . TYR C 1 190 ? 75.742  37.695 94.506  1.00 23.93 ? 208  TYR G CB  1 
ATOM   7180  C  CG  . TYR C 1 190 ? 76.922  36.748 94.438  1.00 25.50 ? 208  TYR G CG  1 
ATOM   7181  C  CD1 . TYR C 1 190 ? 77.724  36.513 95.552  1.00 27.58 ? 208  TYR G CD1 1 
ATOM   7182  C  CD2 . TYR C 1 190 ? 77.248  36.104 93.248  1.00 27.60 ? 208  TYR G CD2 1 
ATOM   7183  C  CE1 . TYR C 1 190 ? 78.814  35.643 95.486  1.00 28.83 ? 208  TYR G CE1 1 
ATOM   7184  C  CE2 . TYR C 1 190 ? 78.335  35.242 93.168  1.00 28.33 ? 208  TYR G CE2 1 
ATOM   7185  C  CZ  . TYR C 1 190 ? 79.111  35.016 94.287  1.00 28.94 ? 208  TYR G CZ  1 
ATOM   7186  O  OH  . TYR C 1 190 ? 80.183  34.159 94.209  1.00 29.74 ? 208  TYR G OH  1 
ATOM   7187  N  N   . VAL C 1 191 ? 73.448  39.327 96.367  1.00 21.87 ? 209  VAL G N   1 
ATOM   7188  C  CA  . VAL C 1 191 ? 72.331  40.255 96.349  1.00 20.61 ? 209  VAL G CA  1 
ATOM   7189  C  C   . VAL C 1 191 ? 72.863  41.672 96.148  1.00 20.13 ? 209  VAL G C   1 
ATOM   7190  O  O   . VAL C 1 191 ? 73.702  42.144 96.923  1.00 19.96 ? 209  VAL G O   1 
ATOM   7191  C  CB  . VAL C 1 191 ? 71.490  40.161 97.645  1.00 20.90 ? 209  VAL G CB  1 
ATOM   7192  C  CG1 . VAL C 1 191 ? 70.309  41.119 97.592  1.00 20.13 ? 209  VAL G CG1 1 
ATOM   7193  C  CG2 . VAL C 1 191 ? 71.006  38.718 97.873  1.00 20.46 ? 209  VAL G CG2 1 
ATOM   7194  N  N   . ARG C 1 192 ? 72.372  42.334 95.100  1.00 19.23 ? 210  ARG G N   1 
ATOM   7195  C  CA  . ARG C 1 192 ? 72.822  43.674 94.717  1.00 18.87 ? 210  ARG G CA  1 
ATOM   7196  C  C   . ARG C 1 192 ? 72.357  44.748 95.695  1.00 18.42 ? 210  ARG G C   1 
ATOM   7197  O  O   . ARG C 1 192 ? 73.113  45.646 96.048  1.00 18.13 ? 210  ARG G O   1 
ATOM   7198  C  CB  . ARG C 1 192 ? 72.312  44.028 93.318  1.00 18.49 ? 210  ARG G CB  1 
ATOM   7199  C  CG  . ARG C 1 192 ? 73.016  45.227 92.689  1.00 18.88 ? 210  ARG G CG  1 
ATOM   7200  C  CD  . ARG C 1 192 ? 72.246  45.801 91.509  1.00 17.36 ? 210  ARG G CD  1 
ATOM   7201  N  NE  . ARG C 1 192 ? 71.045  46.530 91.917  1.00 17.49 ? 210  ARG G NE  1 
ATOM   7202  C  CZ  . ARG C 1 192 ? 71.021  47.808 92.287  1.00 17.57 ? 210  ARG G CZ  1 
ATOM   7203  N  NH1 . ARG C 1 192 ? 72.139  48.526 92.317  1.00 18.14 ? 210  ARG G NH1 1 
ATOM   7204  N  NH2 . ARG C 1 192 ? 69.868  48.377 92.626  1.00 18.45 ? 210  ARG G NH2 1 
ATOM   7205  N  N   . ALA C 1 193 ? 71.098  44.655 96.102  1.00 18.33 ? 211  ALA G N   1 
ATOM   7206  C  CA  . ALA C 1 193 ? 70.462  45.701 96.890  1.00 18.55 ? 211  ALA G CA  1 
ATOM   7207  C  C   . ALA C 1 193 ? 69.373  45.116 97.769  1.00 18.47 ? 211  ALA G C   1 
ATOM   7208  O  O   . ALA C 1 193 ? 68.764  44.104 97.428  1.00 18.44 ? 211  ALA G O   1 
ATOM   7209  C  CB  . ALA C 1 193 ? 69.880  46.784 95.972  1.00 18.26 ? 211  ALA G CB  1 
ATOM   7210  N  N   . TRP C 1 194 ? 69.139  45.768 98.901  1.00 18.84 ? 212  TRP G N   1 
ATOM   7211  C  CA  . TRP C 1 194 ? 68.087  45.381 99.827  1.00 19.01 ? 212  TRP G CA  1 
ATOM   7212  C  C   . TRP C 1 194 ? 67.223  46.571 100.199 1.00 18.70 ? 212  TRP G C   1 
ATOM   7213  O  O   . TRP C 1 194 ? 67.640  47.718 100.051 1.00 18.96 ? 212  TRP G O   1 
ATOM   7214  C  CB  . TRP C 1 194 ? 68.681  44.730 101.074 1.00 19.43 ? 212  TRP G CB  1 
ATOM   7215  C  CG  . TRP C 1 194 ? 68.302  43.270 101.196 1.00 22.18 ? 212  TRP G CG  1 
ATOM   7216  C  CD1 . TRP C 1 194 ? 68.581  42.264 100.304 1.00 23.39 ? 212  TRP G CD1 1 
ATOM   7217  C  CD2 . TRP C 1 194 ? 67.582  42.659 102.268 1.00 23.44 ? 212  TRP G CD2 1 
ATOM   7218  N  NE1 . TRP C 1 194 ? 68.081  41.064 100.759 1.00 24.05 ? 212  TRP G NE1 1 
ATOM   7219  C  CE2 . TRP C 1 194 ? 67.460  41.278 101.960 1.00 24.26 ? 212  TRP G CE2 1 
ATOM   7220  C  CE3 . TRP C 1 194 ? 67.032  43.138 103.460 1.00 24.14 ? 212  TRP G CE3 1 
ATOM   7221  C  CZ2 . TRP C 1 194 ? 66.808  40.381 102.796 1.00 24.32 ? 212  TRP G CZ2 1 
ATOM   7222  C  CZ3 . TRP C 1 194 ? 66.380  42.245 104.289 1.00 25.36 ? 212  TRP G CZ3 1 
ATOM   7223  C  CH2 . TRP C 1 194 ? 66.276  40.878 103.954 1.00 25.48 ? 212  TRP G CH2 1 
ATOM   7224  N  N   . LYS C 1 195 ? 66.009  46.292 100.664 1.00 18.39 ? 213  LYS G N   1 
ATOM   7225  C  CA  . LYS C 1 195 ? 65.091  47.337 101.099 1.00 18.05 ? 213  LYS G CA  1 
ATOM   7226  C  C   . LYS C 1 195 ? 65.569  47.926 102.410 1.00 17.79 ? 213  LYS G C   1 
ATOM   7227  O  O   . LYS C 1 195 ? 65.844  47.201 103.356 1.00 17.77 ? 213  LYS G O   1 
ATOM   7228  C  CB  . LYS C 1 195 ? 63.675  46.785 101.213 1.00 18.26 ? 213  LYS G CB  1 
ATOM   7229  C  CG  . LYS C 1 195 ? 63.218  46.218 99.898  1.00 18.77 ? 213  LYS G CG  1 
ATOM   7230  C  CD  . LYS C 1 195 ? 61.749  46.033 99.794  1.00 18.75 ? 213  LYS G CD  1 
ATOM   7231  C  CE  . LYS C 1 195 ? 61.447  45.572 98.388  1.00 18.74 ? 213  LYS G CE  1 
ATOM   7232  N  NZ  . LYS C 1 195 ? 60.304  44.635 98.353  1.00 18.01 ? 213  LYS G NZ  1 
ATOM   7233  N  N   . GLY C 1 196 ? 65.670  49.249 102.445 1.00 17.77 ? 214  GLY G N   1 
ATOM   7234  C  CA  . GLY C 1 196 ? 66.327  49.951 103.533 1.00 17.70 ? 214  GLY G CA  1 
ATOM   7235  C  C   . GLY C 1 196 ? 67.777  50.223 103.185 1.00 17.56 ? 214  GLY G C   1 
ATOM   7236  O  O   . GLY C 1 196 ? 68.568  50.634 104.039 1.00 17.87 ? 214  GLY G O   1 
ATOM   7237  N  N   . GLY C 1 197 ? 68.118  49.978 101.922 1.00 17.06 ? 215  GLY G N   1 
ATOM   7238  C  CA  . GLY C 1 197 ? 69.464  50.174 101.421 1.00 16.29 ? 215  GLY G CA  1 
ATOM   7239  C  C   . GLY C 1 197 ? 69.505  51.358 100.487 1.00 15.95 ? 215  GLY G C   1 
ATOM   7240  O  O   . GLY C 1 197 ? 68.645  52.228 100.543 1.00 16.10 ? 215  GLY G O   1 
ATOM   7241  N  N   . THR C 1 198 ? 70.499  51.372 99.609  1.00 15.64 ? 216  THR G N   1 
ATOM   7242  C  CA  . THR C 1 198 ? 70.786  52.525 98.769  1.00 15.38 ? 216  THR G CA  1 
ATOM   7243  C  C   . THR C 1 198 ? 70.763  52.158 97.283  1.00 15.07 ? 216  THR G C   1 
ATOM   7244  O  O   . THR C 1 198 ? 71.333  52.874 96.453  1.00 14.56 ? 216  THR G O   1 
ATOM   7245  C  CB  . THR C 1 198 ? 72.176  53.112 99.126  1.00 15.50 ? 216  THR G CB  1 
ATOM   7246  O  OG1 . THR C 1 198 ? 73.174  52.092 98.972  1.00 16.26 ? 216  THR G OG1 1 
ATOM   7247  C  CG2 . THR C 1 198 ? 72.198  53.595 100.558 1.00 15.65 ? 216  THR G CG2 1 
ATOM   7248  N  N   . GLY C 1 199 ? 70.098  51.050 96.959  1.00 14.85 ? 217  GLY G N   1 
ATOM   7249  C  CA  . GLY C 1 199 ? 70.066  50.515 95.598  1.00 15.15 ? 217  GLY G CA  1 
ATOM   7250  C  C   . GLY C 1 199 ? 69.313  51.358 94.579  1.00 15.33 ? 217  GLY G C   1 
ATOM   7251  O  O   . GLY C 1 199 ? 69.488  51.184 93.373  1.00 15.16 ? 217  GLY G O   1 
ATOM   7252  N  N   . ASP C 1 200 ? 68.477  52.271 95.066  1.00 15.51 ? 218  ASP G N   1 
ATOM   7253  C  CA  . ASP C 1 200 ? 67.763  53.194 94.197  1.00 15.85 ? 218  ASP G CA  1 
ATOM   7254  C  C   . ASP C 1 200 ? 68.524  54.494 94.024  1.00 15.85 ? 218  ASP G C   1 
ATOM   7255  O  O   . ASP C 1 200 ? 68.001  55.443 93.450  1.00 16.14 ? 218  ASP G O   1 
ATOM   7256  C  CB  . ASP C 1 200 ? 66.326  53.445 94.700  1.00 15.92 ? 218  ASP G CB  1 
ATOM   7257  C  CG  . ASP C 1 200 ? 66.274  54.007 96.124  1.00 16.70 ? 218  ASP G CG  1 
ATOM   7258  O  OD1 . ASP C 1 200 ? 67.320  54.094 96.806  1.00 15.60 ? 218  ASP G OD1 1 
ATOM   7259  O  OD2 . ASP C 1 200 ? 65.155  54.359 96.559  1.00 19.07 ? 218  ASP G OD2 1 
ATOM   7260  N  N   . CYS C 1 201 ? 69.758  54.531 94.524  1.00 15.98 ? 219  CYS G N   1 
ATOM   7261  C  CA  . CYS C 1 201 ? 70.650  55.681 94.334  1.00 16.45 ? 219  CYS G CA  1 
ATOM   7262  C  C   . CYS C 1 201 ? 71.896  55.261 93.567  1.00 15.49 ? 219  CYS G C   1 
ATOM   7263  O  O   . CYS C 1 201 ? 72.266  54.090 93.562  1.00 14.95 ? 219  CYS G O   1 
ATOM   7264  C  CB  . CYS C 1 201 ? 71.049  56.309 95.683  1.00 16.51 ? 219  CYS G CB  1 
ATOM   7265  S  SG  . CYS C 1 201 ? 69.660  57.056 96.573  1.00 21.47 ? 219  CYS G SG  1 
ATOM   7266  N  N   . LYS C 1 202 ? 72.539  56.225 92.920  1.00 15.00 ? 220  LYS G N   1 
ATOM   7267  C  CA  . LYS C 1 202 ? 73.773  55.960 92.197  1.00 14.71 ? 220  LYS G CA  1 
ATOM   7268  C  C   . LYS C 1 202 ? 74.976  56.289 93.071  1.00 14.73 ? 220  LYS G C   1 
ATOM   7269  O  O   . LYS C 1 202 ? 75.901  56.984 92.652  1.00 14.99 ? 220  LYS G O   1 
ATOM   7270  C  CB  . LYS C 1 202 ? 73.814  56.758 90.902  1.00 14.92 ? 220  LYS G CB  1 
ATOM   7271  C  CG  . LYS C 1 202 ? 74.068  55.917 89.684  1.00 14.48 ? 220  LYS G CG  1 
ATOM   7272  C  CD  . LYS C 1 202 ? 73.517  56.608 88.469  1.00 14.41 ? 220  LYS G CD  1 
ATOM   7273  C  CE  . LYS C 1 202 ? 74.112  56.037 87.213  1.00 15.34 ? 220  LYS G CE  1 
ATOM   7274  N  NZ  . LYS C 1 202 ? 73.903  54.564 87.197  1.00 15.01 ? 220  LYS G NZ  1 
ATOM   7275  N  N   . MET C 1 203 ? 74.939  55.780 94.295  1.00 14.44 ? 221  MET G N   1 
ATOM   7276  C  CA  . MET C 1 203 ? 76.040  55.883 95.235  1.00 14.22 ? 221  MET G CA  1 
ATOM   7277  C  C   . MET C 1 203 ? 77.050  54.795 94.933  1.00 13.90 ? 221  MET G C   1 
ATOM   7278  O  O   . MET C 1 203 ? 76.672  53.656 94.649  1.00 13.66 ? 221  MET G O   1 
ATOM   7279  C  CB  . MET C 1 203 ? 75.516  55.750 96.659  1.00 14.22 ? 221  MET G CB  1 
ATOM   7280  C  CG  . MET C 1 203 ? 74.845  57.015 97.165  1.00 14.88 ? 221  MET G CG  1 
ATOM   7281  S  SD  . MET C 1 203 ? 73.873  56.735 98.657  1.00 18.19 ? 221  MET G SD  1 
ATOM   7282  C  CE  . MET C 1 203 ? 75.119  56.255 99.858  1.00 14.10 ? 221  MET G CE  1 
ATOM   7283  N  N   . GLY C 1 204 ? 78.331  55.157 94.988  1.00 13.66 ? 222  GLY G N   1 
ATOM   7284  C  CA  . GLY C 1 204 ? 79.425  54.256 94.606  1.00 13.61 ? 222  GLY G CA  1 
ATOM   7285  C  C   . GLY C 1 204 ? 79.447  52.931 95.342  1.00 13.30 ? 222  GLY G C   1 
ATOM   7286  O  O   . GLY C 1 204 ? 79.835  51.917 94.775  1.00 13.31 ? 222  GLY G O   1 
ATOM   7287  N  N   . GLY C 1 205 ? 79.024  52.944 96.604  1.00 13.69 ? 223  GLY G N   1 
ATOM   7288  C  CA  . GLY C 1 205 ? 78.968  51.740 97.438  1.00 13.93 ? 223  GLY G CA  1 
ATOM   7289  C  C   . GLY C 1 205 ? 78.176  50.581 96.862  1.00 14.50 ? 223  GLY G C   1 
ATOM   7290  O  O   . GLY C 1 205 ? 78.424  49.426 97.216  1.00 14.69 ? 223  GLY G O   1 
ATOM   7291  N  N   . ASN C 1 206 ? 77.226  50.884 95.976  1.00 14.73 ? 224  ASN G N   1 
ATOM   7292  C  CA  . ASN C 1 206 ? 76.385  49.860 95.346  1.00 15.32 ? 224  ASN G CA  1 
ATOM   7293  C  C   . ASN C 1 206 ? 77.137  49.004 94.340  1.00 15.35 ? 224  ASN G C   1 
ATOM   7294  O  O   . ASN C 1 206 ? 76.652  47.944 93.956  1.00 15.75 ? 224  ASN G O   1 
ATOM   7295  C  CB  . ASN C 1 206 ? 75.200  50.498 94.601  1.00 15.31 ? 224  ASN G CB  1 
ATOM   7296  C  CG  . ASN C 1 206 ? 74.265  51.260 95.508  1.00 15.55 ? 224  ASN G CG  1 
ATOM   7297  O  OD1 . ASN C 1 206 ? 73.751  52.309 95.128  1.00 16.65 ? 224  ASN G OD1 1 
ATOM   7298  N  ND2 . ASN C 1 206 ? 74.039  50.749 96.701  1.00 16.14 ? 224  ASN G ND2 1 
ATOM   7299  N  N   . TYR C 1 207 ? 78.307  49.474 93.913  1.00 15.45 ? 225  TYR G N   1 
ATOM   7300  C  CA  . TYR C 1 207 ? 78.994  48.919 92.746  1.00 15.92 ? 225  TYR G CA  1 
ATOM   7301  C  C   . TYR C 1 207 ? 80.250  48.126 93.072  1.00 16.57 ? 225  TYR G C   1 
ATOM   7302  O  O   . TYR C 1 207 ? 80.581  47.182 92.358  1.00 16.33 ? 225  TYR G O   1 
ATOM   7303  C  CB  . TYR C 1 207 ? 79.253  50.031 91.706  1.00 15.82 ? 225  TYR G CB  1 
ATOM   7304  C  CG  . TYR C 1 207 ? 77.946  50.683 91.317  1.00 15.45 ? 225  TYR G CG  1 
ATOM   7305  C  CD1 . TYR C 1 207 ? 77.488  51.823 91.978  1.00 15.07 ? 225  TYR G CD1 1 
ATOM   7306  C  CD2 . TYR C 1 207 ? 77.117  50.101 90.359  1.00 14.83 ? 225  TYR G CD2 1 
ATOM   7307  C  CE1 . TYR C 1 207 ? 76.259  52.397 91.657  1.00 14.77 ? 225  TYR G CE1 1 
ATOM   7308  C  CE2 . TYR C 1 207 ? 75.890  50.666 90.032  1.00 14.85 ? 225  TYR G CE2 1 
ATOM   7309  C  CZ  . TYR C 1 207 ? 75.469  51.811 90.686  1.00 15.37 ? 225  TYR G CZ  1 
ATOM   7310  O  OH  . TYR C 1 207 ? 74.254  52.367 90.374  1.00 14.87 ? 225  TYR G OH  1 
ATOM   7311  N  N   . GLY C 1 208 ? 80.936  48.495 94.154  1.00 17.52 ? 226  GLY G N   1 
ATOM   7312  C  CA  . GLY C 1 208 ? 82.163  47.805 94.555  1.00 18.87 ? 226  GLY G CA  1 
ATOM   7313  C  C   . GLY C 1 208 ? 81.884  46.351 94.864  1.00 19.99 ? 226  GLY G C   1 
ATOM   7314  O  O   . GLY C 1 208 ? 82.684  45.466 94.546  1.00 19.31 ? 226  GLY G O   1 
ATOM   7315  N  N   . SER C 1 209 ? 80.720  46.138 95.471  1.00 21.19 ? 227  SER G N   1 
ATOM   7316  C  CA  . SER C 1 209 ? 80.189  44.835 95.848  1.00 22.85 ? 227  SER G CA  1 
ATOM   7317  C  C   . SER C 1 209 ? 79.749  43.981 94.659  1.00 23.83 ? 227  SER G C   1 
ATOM   7318  O  O   . SER C 1 209 ? 79.283  42.854 94.853  1.00 24.26 ? 227  SER G O   1 
ATOM   7319  C  CB  . SER C 1 209 ? 78.989  45.042 96.789  1.00 23.28 ? 227  SER G CB  1 
ATOM   7320  O  OG  . SER C 1 209 ? 78.245  46.210 96.433  1.00 23.02 ? 227  SER G OG  1 
ATOM   7321  N  N   . SER C 1 210 ? 79.891  44.523 93.446  1.00 24.40 ? 228  SER G N   1 
ATOM   7322  C  CA  . SER C 1 210 ? 79.431  43.877 92.213  1.00 25.20 ? 228  SER G CA  1 
ATOM   7323  C  C   . SER C 1 210 ? 80.534  43.132 91.486  1.00 25.26 ? 228  SER G C   1 
ATOM   7324  O  O   . SER C 1 210 ? 80.254  42.147 90.803  1.00 25.55 ? 228  SER G O   1 
ATOM   7325  C  CB  . SER C 1 210 ? 78.848  44.912 91.233  1.00 25.25 ? 228  SER G CB  1 
ATOM   7326  O  OG  . SER C 1 210 ? 77.689  45.532 91.761  1.00 27.60 ? 228  SER G OG  1 
ATOM   7327  N  N   . LEU C 1 211 ? 81.770  43.620 91.616  1.00 24.99 ? 229  LEU G N   1 
ATOM   7328  C  CA  . LEU C 1 211 ? 82.908  43.147 90.820  1.00 25.09 ? 229  LEU G CA  1 
ATOM   7329  C  C   . LEU C 1 211 ? 83.198  41.655 90.947  1.00 25.06 ? 229  LEU G C   1 
ATOM   7330  O  O   . LEU C 1 211 ? 83.551  41.004 89.960  1.00 25.11 ? 229  LEU G O   1 
ATOM   7331  C  CB  . LEU C 1 211 ? 84.169  43.951 91.151  1.00 24.90 ? 229  LEU G CB  1 
ATOM   7332  C  CG  . LEU C 1 211 ? 84.472  45.244 90.390  1.00 25.57 ? 229  LEU G CG  1 
ATOM   7333  C  CD1 . LEU C 1 211 ? 83.300  46.219 90.383  1.00 26.12 ? 229  LEU G CD1 1 
ATOM   7334  C  CD2 . LEU C 1 211 ? 85.706  45.907 90.976  1.00 24.54 ? 229  LEU G CD2 1 
ATOM   7335  N  N   . PHE C 1 212 ? 83.055  41.121 92.158  1.00 25.21 ? 230  PHE G N   1 
ATOM   7336  C  CA  . PHE C 1 212 ? 83.295  39.701 92.406  1.00 25.25 ? 230  PHE G CA  1 
ATOM   7337  C  C   . PHE C 1 212 ? 82.326  38.856 91.582  1.00 25.27 ? 230  PHE G C   1 
ATOM   7338  O  O   . PHE C 1 212 ? 82.744  37.915 90.903  1.00 25.28 ? 230  PHE G O   1 
ATOM   7339  C  CB  . PHE C 1 212 ? 83.164  39.378 93.895  1.00 25.30 ? 230  PHE G CB  1 
ATOM   7340  C  CG  . PHE C 1 212 ? 83.609  37.990 94.259  1.00 25.61 ? 230  PHE G CG  1 
ATOM   7341  C  CD1 . PHE C 1 212 ? 82.712  36.922 94.218  1.00 25.38 ? 230  PHE G CD1 1 
ATOM   7342  C  CD2 . PHE C 1 212 ? 84.926  37.750 94.649  1.00 25.60 ? 230  PHE G CD2 1 
ATOM   7343  C  CE1 . PHE C 1 212 ? 83.120  35.636 94.555  1.00 25.82 ? 230  PHE G CE1 1 
ATOM   7344  C  CE2 . PHE C 1 212 ? 85.348  36.463 94.992  1.00 25.92 ? 230  PHE G CE2 1 
ATOM   7345  C  CZ  . PHE C 1 212 ? 84.442  35.404 94.947  1.00 26.03 ? 230  PHE G CZ  1 
ATOM   7346  N  N   . ALA C 1 213 ? 81.043  39.222 91.638  1.00 25.00 ? 231  ALA G N   1 
ATOM   7347  C  CA  . ALA C 1 213 ? 79.982  38.550 90.888  1.00 25.00 ? 231  ALA G CA  1 
ATOM   7348  C  C   . ALA C 1 213 ? 80.200  38.604 89.368  1.00 24.97 ? 231  ALA G C   1 
ATOM   7349  O  O   . ALA C 1 213 ? 80.004  37.602 88.683  1.00 24.66 ? 231  ALA G O   1 
ATOM   7350  C  CB  . ALA C 1 213 ? 78.622  39.131 91.266  1.00 25.00 ? 231  ALA G CB  1 
ATOM   7351  N  N   . GLN C 1 214 ? 80.610  39.769 88.855  1.00 24.96 ? 232  GLN G N   1 
ATOM   7352  C  CA  . GLN C 1 214 ? 80.960  39.925 87.446  1.00 25.17 ? 232  GLN G CA  1 
ATOM   7353  C  C   . GLN C 1 214 ? 82.128  39.027 87.017  1.00 25.61 ? 232  GLN G C   1 
ATOM   7354  O  O   . GLN C 1 214 ? 82.080  38.424 85.940  1.00 25.27 ? 232  GLN G O   1 
ATOM   7355  C  CB  . GLN C 1 214 ? 81.252  41.389 87.105  1.00 25.06 ? 232  GLN G CB  1 
ATOM   7356  C  CG  . GLN C 1 214 ? 81.733  41.644 85.659  1.00 24.65 ? 232  GLN G CG  1 
ATOM   7357  C  CD  . GLN C 1 214 ? 80.718  41.265 84.571  1.00 24.91 ? 232  GLN G CD  1 
ATOM   7358  O  OE1 . GLN C 1 214 ? 79.537  41.008 84.846  1.00 24.97 ? 232  GLN G OE1 1 
ATOM   7359  N  NE2 . GLN C 1 214 ? 81.179  41.249 83.324  1.00 23.15 ? 232  GLN G NE2 1 
ATOM   7360  N  N   . CYS C 1 215 ? 83.163  38.943 87.855  1.00 26.12 ? 233  CYS G N   1 
ATOM   7361  C  CA  . CYS C 1 215 ? 84.308  38.059 87.592  1.00 26.64 ? 233  CYS G CA  1 
ATOM   7362  C  C   . CYS C 1 215 ? 83.910  36.586 87.530  1.00 26.75 ? 233  CYS G C   1 
ATOM   7363  O  O   . CYS C 1 215 ? 84.379  35.854 86.655  1.00 26.72 ? 233  CYS G O   1 
ATOM   7364  C  CB  . CYS C 1 215 ? 85.420  38.264 88.622  1.00 26.66 ? 233  CYS G CB  1 
ATOM   7365  S  SG  . CYS C 1 215 ? 86.389  39.749 88.343  1.00 28.28 ? 233  CYS G SG  1 
ATOM   7366  N  N   . GLU C 1 216 ? 83.051  36.162 88.458  1.00 27.00 ? 234  GLU G N   1 
ATOM   7367  C  CA  . GLU C 1 216 ? 82.516  34.800 88.475  1.00 27.74 ? 234  GLU G CA  1 
ATOM   7368  C  C   . GLU C 1 216 ? 81.694  34.539 87.218  1.00 28.30 ? 234  GLU G C   1 
ATOM   7369  O  O   . GLU C 1 216 ? 81.699  33.442 86.654  1.00 28.29 ? 234  GLU G O   1 
ATOM   7370  C  CB  . GLU C 1 216 ? 81.644  34.603 89.707  1.00 27.52 ? 234  GLU G CB  1 
ATOM   7371  C  CG  . GLU C 1 216 ? 81.185  33.178 89.920  1.00 27.96 ? 234  GLU G CG  1 
ATOM   7372  C  CD  . GLU C 1 216 ? 80.592  32.974 91.289  1.00 29.14 ? 234  GLU G CD  1 
ATOM   7373  O  OE1 . GLU C 1 216 ? 79.359  32.817 91.383  1.00 28.57 ? 234  GLU G OE1 1 
ATOM   7374  O  OE2 . GLU C 1 216 ? 81.357  32.987 92.278  1.00 30.41 ? 234  GLU G OE2 1 
ATOM   7375  N  N   . ASP C 1 217 ? 80.983  35.582 86.813  1.00 28.90 ? 235  ASP G N   1 
ATOM   7376  C  CA  . ASP C 1 217 ? 80.226  35.645 85.584  1.00 29.45 ? 235  ASP G CA  1 
ATOM   7377  C  C   . ASP C 1 217 ? 81.081  35.300 84.362  1.00 29.11 ? 235  ASP G C   1 
ATOM   7378  O  O   . ASP C 1 217 ? 80.770  34.359 83.629  1.00 28.58 ? 235  ASP G O   1 
ATOM   7379  C  CB  . ASP C 1 217 ? 79.717  37.070 85.458  1.00 30.22 ? 235  ASP G CB  1 
ATOM   7380  C  CG  . ASP C 1 217 ? 78.492  37.172 84.645  1.00 32.68 ? 235  ASP G CG  1 
ATOM   7381  O  OD1 . ASP C 1 217 ? 78.604  37.572 83.469  1.00 36.86 ? 235  ASP G OD1 1 
ATOM   7382  O  OD2 . ASP C 1 217 ? 77.411  36.866 85.186  1.00 36.76 ? 235  ASP G OD2 1 
ATOM   7383  N  N   . VAL C 1 218 ? 82.156  36.062 84.160  1.00 29.13 ? 236  VAL G N   1 
ATOM   7384  C  CA  . VAL C 1 218 ? 83.053  35.874 83.013  1.00 29.50 ? 236  VAL G CA  1 
ATOM   7385  C  C   . VAL C 1 218 ? 83.810  34.532 83.060  1.00 29.46 ? 236  VAL G C   1 
ATOM   7386  O  O   . VAL C 1 218 ? 84.063  33.926 82.015  1.00 29.47 ? 236  VAL G O   1 
ATOM   7387  C  CB  . VAL C 1 218 ? 83.990  37.115 82.772  1.00 29.60 ? 236  VAL G CB  1 
ATOM   7388  C  CG1 . VAL C 1 218 ? 84.649  37.569 84.051  1.00 30.59 ? 236  VAL G CG1 1 
ATOM   7389  C  CG2 . VAL C 1 218 ? 85.050  36.831 81.711  1.00 29.88 ? 236  VAL G CG2 1 
ATOM   7390  N  N   . ASP C 1 219 ? 84.129  34.064 84.268  1.00 29.24 ? 237  ASP G N   1 
ATOM   7391  C  CA  . ASP C 1 219 ? 84.716  32.736 84.462  1.00 29.33 ? 237  ASP G CA  1 
ATOM   7392  C  C   . ASP C 1 219 ? 83.829  31.644 83.863  1.00 29.09 ? 237  ASP G C   1 
ATOM   7393  O  O   . ASP C 1 219 ? 84.324  30.609 83.416  1.00 29.28 ? 237  ASP G O   1 
ATOM   7394  C  CB  . ASP C 1 219 ? 84.946  32.441 85.953  1.00 29.42 ? 237  ASP G CB  1 
ATOM   7395  C  CG  . ASP C 1 219 ? 86.143  33.194 86.540  1.00 30.36 ? 237  ASP G CG  1 
ATOM   7396  O  OD1 . ASP C 1 219 ? 86.268  33.206 87.787  1.00 31.85 ? 237  ASP G OD1 1 
ATOM   7397  O  OD2 . ASP C 1 219 ? 86.955  33.767 85.775  1.00 30.50 ? 237  ASP G OD2 1 
ATOM   7398  N  N   . ASN C 1 220 ? 82.520  31.890 83.853  1.00 28.57 ? 238  ASN G N   1 
ATOM   7399  C  CA  . ASN C 1 220 ? 81.544  30.931 83.338  1.00 28.01 ? 238  ASN G CA  1 
ATOM   7400  C  C   . ASN C 1 220 ? 80.995  31.287 81.951  1.00 27.43 ? 238  ASN G C   1 
ATOM   7401  O  O   . ASN C 1 220 ? 79.927  30.817 81.560  1.00 27.61 ? 238  ASN G O   1 
ATOM   7402  C  CB  . ASN C 1 220 ? 80.409  30.734 84.348  1.00 28.00 ? 238  ASN G CB  1 
ATOM   7403  C  CG  . ASN C 1 220 ? 80.868  30.028 85.607  1.00 28.39 ? 238  ASN G CG  1 
ATOM   7404  O  OD1 . ASN C 1 220 ? 80.741  28.811 85.728  1.00 28.71 ? 238  ASN G OD1 1 
ATOM   7405  N  ND2 . ASN C 1 220 ? 81.416  30.788 86.549  1.00 28.68 ? 238  ASN G ND2 1 
ATOM   7406  N  N   . GLY C 1 221 ? 81.734  32.116 81.217  1.00 26.93 ? 239  GLY G N   1 
ATOM   7407  C  CA  . GLY C 1 221 ? 81.397  32.463 79.834  1.00 26.25 ? 239  GLY G CA  1 
ATOM   7408  C  C   . GLY C 1 221 ? 80.271  33.464 79.650  1.00 25.72 ? 239  GLY G C   1 
ATOM   7409  O  O   . GLY C 1 221 ? 79.789  33.664 78.530  1.00 25.59 ? 239  GLY G O   1 
ATOM   7410  N  N   . CYS C 1 222 ? 79.851  34.092 80.747  1.00 25.10 ? 240  CYS G N   1 
ATOM   7411  C  CA  . CYS C 1 222 ? 78.784  35.092 80.716  1.00 24.30 ? 240  CYS G CA  1 
ATOM   7412  C  C   . CYS C 1 222 ? 79.338  36.510 80.716  1.00 23.58 ? 240  CYS G C   1 
ATOM   7413  O  O   . CYS C 1 222 ? 80.471  36.741 81.128  1.00 23.72 ? 240  CYS G O   1 
ATOM   7414  C  CB  . CYS C 1 222 ? 77.834  34.895 81.896  1.00 24.37 ? 240  CYS G CB  1 
ATOM   7415  S  SG  . CYS C 1 222 ? 76.958  33.335 81.848  1.00 24.76 ? 240  CYS G SG  1 
ATOM   7416  N  N   . GLN C 1 223 ? 78.517  37.459 80.276  1.00 22.85 ? 241  GLN G N   1 
ATOM   7417  C  CA  . GLN C 1 223 ? 78.952  38.838 80.064  1.00 22.06 ? 241  GLN G CA  1 
ATOM   7418  C  C   . GLN C 1 223 ? 78.452  39.805 81.146  1.00 21.50 ? 241  GLN G C   1 
ATOM   7419  O  O   . GLN C 1 223 ? 79.065  40.851 81.379  1.00 21.16 ? 241  GLN G O   1 
ATOM   7420  C  CB  . GLN C 1 223 ? 78.514  39.316 78.673  1.00 22.41 ? 241  GLN G CB  1 
ATOM   7421  C  CG  . GLN C 1 223 ? 79.232  38.638 77.494  1.00 22.47 ? 241  GLN G CG  1 
ATOM   7422  C  CD  . GLN C 1 223 ? 78.819  37.187 77.284  1.00 23.58 ? 241  GLN G CD  1 
ATOM   7423  O  OE1 . GLN C 1 223 ? 77.646  36.889 77.069  1.00 23.79 ? 241  GLN G OE1 1 
ATOM   7424  N  NE2 . GLN C 1 223 ? 79.790  36.277 77.338  1.00 23.11 ? 241  GLN G NE2 1 
ATOM   7425  N  N   . GLN C 1 224 ? 77.337  39.457 81.793  1.00 20.78 ? 242  GLN G N   1 
ATOM   7426  C  CA  . GLN C 1 224 ? 76.748  40.269 82.867  1.00 20.08 ? 242  GLN G CA  1 
ATOM   7427  C  C   . GLN C 1 224 ? 76.085  39.387 83.921  1.00 19.45 ? 242  GLN G C   1 
ATOM   7428  O  O   . GLN C 1 224 ? 75.802  38.216 83.679  1.00 19.46 ? 242  GLN G O   1 
ATOM   7429  C  CB  . GLN C 1 224 ? 75.721  41.279 82.318  1.00 20.22 ? 242  GLN G CB  1 
ATOM   7430  C  CG  . GLN C 1 224 ? 76.290  42.470 81.548  1.00 20.52 ? 242  GLN G CG  1 
ATOM   7431  C  CD  . GLN C 1 224 ? 77.047  43.456 82.426  1.00 21.86 ? 242  GLN G CD  1 
ATOM   7432  O  OE1 . GLN C 1 224 ? 76.461  44.372 83.008  1.00 22.77 ? 242  GLN G OE1 1 
ATOM   7433  N  NE2 . GLN C 1 224 ? 78.361  43.294 82.495  1.00 22.38 ? 242  GLN G NE2 1 
ATOM   7434  N  N   . VAL C 1 225 ? 75.834  39.968 85.087  1.00 18.80 ? 243  VAL G N   1 
ATOM   7435  C  CA  . VAL C 1 225 ? 75.179  39.284 86.189  1.00 18.08 ? 243  VAL G CA  1 
ATOM   7436  C  C   . VAL C 1 225 ? 73.683  39.575 86.150  1.00 17.72 ? 243  VAL G C   1 
ATOM   7437  O  O   . VAL C 1 225 ? 73.275  40.713 85.919  1.00 17.61 ? 243  VAL G O   1 
ATOM   7438  C  CB  . VAL C 1 225 ? 75.764  39.753 87.547  1.00 18.26 ? 243  VAL G CB  1 
ATOM   7439  C  CG1 . VAL C 1 225 ? 74.940  39.235 88.717  1.00 18.34 ? 243  VAL G CG1 1 
ATOM   7440  C  CG2 . VAL C 1 225 ? 77.215  39.311 87.682  1.00 18.25 ? 243  VAL G CG2 1 
ATOM   7441  N  N   . LEU C 1 226 ? 72.870  38.541 86.354  1.00 17.11 ? 244  LEU G N   1 
ATOM   7442  C  CA  . LEU C 1 226 ? 71.445  38.735 86.573  1.00 16.94 ? 244  LEU G CA  1 
ATOM   7443  C  C   . LEU C 1 226 ? 71.209  38.780 88.084  1.00 16.72 ? 244  LEU G C   1 
ATOM   7444  O  O   . LEU C 1 226 ? 71.406  37.781 88.783  1.00 16.28 ? 244  LEU G O   1 
ATOM   7445  C  CB  . LEU C 1 226 ? 70.609  37.634 85.898  1.00 16.92 ? 244  LEU G CB  1 
ATOM   7446  C  CG  . LEU C 1 226 ? 69.084  37.714 86.093  1.00 17.70 ? 244  LEU G CG  1 
ATOM   7447  C  CD1 . LEU C 1 226 ? 68.547  39.057 85.621  1.00 17.38 ? 244  LEU G CD1 1 
ATOM   7448  C  CD2 . LEU C 1 226 ? 68.347  36.564 85.390  1.00 18.03 ? 244  LEU G CD2 1 
ATOM   7449  N  N   . TRP C 1 227 ? 70.815  39.953 88.579  1.00 16.56 ? 245  TRP G N   1 
ATOM   7450  C  CA  . TRP C 1 227 ? 70.632  40.158 90.009  1.00 16.44 ? 245  TRP G CA  1 
ATOM   7451  C  C   . TRP C 1 227 ? 69.283  39.629 90.505  1.00 16.59 ? 245  TRP G C   1 
ATOM   7452  O  O   . TRP C 1 227 ? 68.215  40.128 90.136  1.00 16.64 ? 245  TRP G O   1 
ATOM   7453  C  CB  . TRP C 1 227 ? 70.829  41.628 90.381  1.00 16.21 ? 245  TRP G CB  1 
ATOM   7454  C  CG  . TRP C 1 227 ? 72.228  42.128 90.141  1.00 15.39 ? 245  TRP G CG  1 
ATOM   7455  C  CD1 . TRP C 1 227 ? 72.640  42.951 89.132  1.00 14.95 ? 245  TRP G CD1 1 
ATOM   7456  C  CD2 . TRP C 1 227 ? 73.400  41.821 90.914  1.00 15.48 ? 245  TRP G CD2 1 
ATOM   7457  N  NE1 . TRP C 1 227 ? 73.993  43.185 89.235  1.00 14.94 ? 245  TRP G NE1 1 
ATOM   7458  C  CE2 . TRP C 1 227 ? 74.483  42.503 90.318  1.00 15.30 ? 245  TRP G CE2 1 
ATOM   7459  C  CE3 . TRP C 1 227 ? 73.638  41.040 92.055  1.00 15.17 ? 245  TRP G CE3 1 
ATOM   7460  C  CZ2 . TRP C 1 227 ? 75.788  42.430 90.826  1.00 16.12 ? 245  TRP G CZ2 1 
ATOM   7461  C  CZ3 . TRP C 1 227 ? 74.931  40.974 92.564  1.00 15.64 ? 245  TRP G CZ3 1 
ATOM   7462  C  CH2 . TRP C 1 227 ? 75.990  41.663 91.947  1.00 15.49 ? 245  TRP G CH2 1 
ATOM   7463  N  N   . LEU C 1 228 ? 69.355  38.603 91.344  1.00 16.49 ? 246  LEU G N   1 
ATOM   7464  C  CA  . LEU C 1 228 ? 68.166  37.964 91.900  1.00 16.52 ? 246  LEU G CA  1 
ATOM   7465  C  C   . LEU C 1 228 ? 67.912  38.433 93.325  1.00 16.90 ? 246  LEU G C   1 
ATOM   7466  O  O   . LEU C 1 228 ? 68.858  38.668 94.087  1.00 17.04 ? 246  LEU G O   1 
ATOM   7467  C  CB  . LEU C 1 228 ? 68.325  36.439 91.869  1.00 16.18 ? 246  LEU G CB  1 
ATOM   7468  C  CG  . LEU C 1 228 ? 68.581  35.766 90.517  1.00 15.92 ? 246  LEU G CG  1 
ATOM   7469  C  CD1 . LEU C 1 228 ? 68.758  34.265 90.719  1.00 16.25 ? 246  LEU G CD1 1 
ATOM   7470  C  CD2 . LEU C 1 228 ? 67.460  36.054 89.516  1.00 14.01 ? 246  LEU G CD2 1 
ATOM   7471  N  N   . TYR C 1 229 ? 66.637  38.559 93.687  1.00 17.36 ? 247  TYR G N   1 
ATOM   7472  C  CA  . TYR C 1 229 ? 66.268  39.012 95.027  1.00 17.88 ? 247  TYR G CA  1 
ATOM   7473  C  C   . TYR C 1 229 ? 65.149  38.191 95.665  1.00 18.56 ? 247  TYR G C   1 
ATOM   7474  O  O   . TYR C 1 229 ? 64.161  37.845 95.012  1.00 18.31 ? 247  TYR G O   1 
ATOM   7475  C  CB  . TYR C 1 229 ? 65.880  40.500 95.008  1.00 17.75 ? 247  TYR G CB  1 
ATOM   7476  C  CG  . TYR C 1 229 ? 65.216  40.982 96.287  1.00 17.44 ? 247  TYR G CG  1 
ATOM   7477  C  CD1 . TYR C 1 229 ? 65.973  41.384 97.391  1.00 16.96 ? 247  TYR G CD1 1 
ATOM   7478  C  CD2 . TYR C 1 229 ? 63.828  41.017 96.393  1.00 17.49 ? 247  TYR G CD2 1 
ATOM   7479  C  CE1 . TYR C 1 229 ? 65.355  41.824 98.564  1.00 16.85 ? 247  TYR G CE1 1 
ATOM   7480  C  CE2 . TYR C 1 229 ? 63.204  41.439 97.549  1.00 17.60 ? 247  TYR G CE2 1 
ATOM   7481  C  CZ  . TYR C 1 229 ? 63.964  41.842 98.633  1.00 17.37 ? 247  TYR G CZ  1 
ATOM   7482  O  OH  . TYR C 1 229 ? 63.306  42.263 99.775  1.00 16.50 ? 247  TYR G OH  1 
ATOM   7483  N  N   . GLY C 1 230 ? 65.315  37.902 96.952  1.00 19.14 ? 248  GLY G N   1 
ATOM   7484  C  CA  . GLY C 1 230 ? 64.254  37.322 97.760  1.00 20.45 ? 248  GLY G CA  1 
ATOM   7485  C  C   . GLY C 1 230 ? 64.103  35.820 97.635  1.00 21.28 ? 248  GLY G C   1 
ATOM   7486  O  O   . GLY C 1 230 ? 64.757  35.183 96.801  1.00 21.11 ? 248  GLY G O   1 
ATOM   7487  N  N   . ARG C 1 231 ? 63.230  35.265 98.472  1.00 22.06 ? 249  ARG G N   1 
ATOM   7488  C  CA  . ARG C 1 231 ? 62.936  33.829 98.467  1.00 23.67 ? 249  ARG G CA  1 
ATOM   7489  C  C   . ARG C 1 231 ? 62.306  33.320 97.166  1.00 23.42 ? 249  ARG G C   1 
ATOM   7490  O  O   . ARG C 1 231 ? 62.509  32.169 96.789  1.00 23.49 ? 249  ARG G O   1 
ATOM   7491  C  CB  . ARG C 1 231 ? 62.074  33.436 99.676  1.00 24.11 ? 249  ARG G CB  1 
ATOM   7492  C  CG  . ARG C 1 231 ? 60.886  34.350 99.970  1.00 28.07 ? 249  ARG G CG  1 
ATOM   7493  C  CD  . ARG C 1 231 ? 60.141  33.946 101.268 1.00 34.01 ? 249  ARG G CD  1 
ATOM   7494  N  NE  . ARG C 1 231 ? 60.990  33.989 102.471 1.00 37.71 ? 249  ARG G NE  1 
ATOM   7495  C  CZ  . ARG C 1 231 ? 61.636  32.939 102.985 1.00 40.27 ? 249  ARG G CZ  1 
ATOM   7496  N  NH1 . ARG C 1 231 ? 62.378  33.087 104.082 1.00 41.51 ? 249  ARG G NH1 1 
ATOM   7497  N  NH2 . ARG C 1 231 ? 61.547  31.739 102.412 1.00 41.22 ? 249  ARG G NH2 1 
ATOM   7498  N  N   . ASP C 1 232 ? 61.552  34.180 96.484  1.00 23.48 ? 250  ASP G N   1 
ATOM   7499  C  CA  . ASP C 1 232 ? 60.937  33.816 95.205  1.00 23.65 ? 250  ASP G CA  1 
ATOM   7500  C  C   . ASP C 1 232 ? 61.865  34.011 93.995  1.00 23.08 ? 250  ASP G C   1 
ATOM   7501  O  O   . ASP C 1 232 ? 61.476  33.733 92.862  1.00 23.12 ? 250  ASP G O   1 
ATOM   7502  C  CB  . ASP C 1 232 ? 59.595  34.544 95.012  1.00 24.13 ? 250  ASP G CB  1 
ATOM   7503  C  CG  . ASP C 1 232 ? 59.708  36.069 95.155  1.00 26.38 ? 250  ASP G CG  1 
ATOM   7504  O  OD1 . ASP C 1 232 ? 58.700  36.755 94.849  1.00 28.55 ? 250  ASP G OD1 1 
ATOM   7505  O  OD2 . ASP C 1 232 ? 60.780  36.587 95.575  1.00 27.92 ? 250  ASP G OD2 1 
ATOM   7506  N  N   . HIS C 1 233 ? 63.088  34.480 94.249  1.00 22.59 ? 251  HIS G N   1 
ATOM   7507  C  CA  . HIS C 1 233 ? 64.105  34.729 93.211  1.00 22.01 ? 251  HIS G CA  1 
ATOM   7508  C  C   . HIS C 1 233 ? 63.620  35.691 92.137  1.00 21.71 ? 251  HIS G C   1 
ATOM   7509  O  O   . HIS C 1 233 ? 63.603  35.358 90.945  1.00 21.53 ? 251  HIS G O   1 
ATOM   7510  C  CB  . HIS C 1 233 ? 64.593  33.426 92.566  1.00 21.92 ? 251  HIS G CB  1 
ATOM   7511  C  CG  . HIS C 1 233 ? 65.085  32.411 93.549  1.00 22.53 ? 251  HIS G CG  1 
ATOM   7512  N  ND1 . HIS C 1 233 ? 66.064  32.689 94.479  1.00 23.08 ? 251  HIS G ND1 1 
ATOM   7513  C  CD2 . HIS C 1 233 ? 64.736  31.118 93.745  1.00 22.52 ? 251  HIS G CD2 1 
ATOM   7514  C  CE1 . HIS C 1 233 ? 66.297  31.609 95.204  1.00 22.87 ? 251  HIS G CE1 1 
ATOM   7515  N  NE2 . HIS C 1 233 ? 65.504  30.644 94.780  1.00 23.07 ? 251  HIS G NE2 1 
ATOM   7516  N  N   . GLN C 1 234 ? 63.209  36.884 92.551  1.00 21.28 ? 252  GLN G N   1 
ATOM   7517  C  CA  . GLN C 1 234 ? 62.789  37.854 91.555  1.00 21.11 ? 252  GLN G CA  1 
ATOM   7518  C  C   . GLN C 1 234 ? 63.973  38.439 90.797  1.00 20.51 ? 252  GLN G C   1 
ATOM   7519  O  O   . GLN C 1 234 ? 65.069  38.625 91.344  1.00 19.89 ? 252  GLN G O   1 
ATOM   7520  C  CB  . GLN C 1 234 ? 61.817  38.907 92.098  1.00 21.31 ? 252  GLN G CB  1 
ATOM   7521  C  CG  . GLN C 1 234 ? 62.294  39.758 93.220  1.00 22.97 ? 252  GLN G CG  1 
ATOM   7522  C  CD  . GLN C 1 234 ? 61.137  40.441 93.924  1.00 23.44 ? 252  GLN G CD  1 
ATOM   7523  O  OE1 . GLN C 1 234 ? 60.125  39.816 94.232  1.00 26.30 ? 252  GLN G OE1 1 
ATOM   7524  N  NE2 . GLN C 1 234 ? 61.281  41.725 94.176  1.00 23.29 ? 252  GLN G NE2 1 
ATOM   7525  N  N   . ILE C 1 235 ? 63.733  38.667 89.514  1.00 19.74 ? 253  ILE G N   1 
ATOM   7526  C  CA  . ILE C 1 235 ? 64.716  39.219 88.604  1.00 19.86 ? 253  ILE G CA  1 
ATOM   7527  C  C   . ILE C 1 235 ? 64.636  40.735 88.704  1.00 18.90 ? 253  ILE G C   1 
ATOM   7528  O  O   . ILE C 1 235 ? 63.572  41.317 88.508  1.00 18.92 ? 253  ILE G O   1 
ATOM   7529  C  CB  . ILE C 1 235 ? 64.427  38.748 87.169  1.00 20.01 ? 253  ILE G CB  1 
ATOM   7530  C  CG1 . ILE C 1 235 ? 64.630  37.236 87.072  1.00 20.75 ? 253  ILE G CG1 1 
ATOM   7531  C  CG2 . ILE C 1 235 ? 65.325  39.478 86.172  1.00 21.76 ? 253  ILE G CG2 1 
ATOM   7532  C  CD1 . ILE C 1 235 ? 63.722  36.570 86.035  1.00 24.50 ? 253  ILE G CD1 1 
ATOM   7533  N  N   . THR C 1 236 ? 65.755  41.372 89.026  1.00 18.46 ? 254  THR G N   1 
ATOM   7534  C  CA  . THR C 1 236 ? 65.731  42.803 89.327  1.00 17.82 ? 254  THR G CA  1 
ATOM   7535  C  C   . THR C 1 236 ? 66.444  43.633 88.271  1.00 17.63 ? 254  THR G C   1 
ATOM   7536  O  O   . THR C 1 236 ? 65.819  44.427 87.571  1.00 17.88 ? 254  THR G O   1 
ATOM   7537  C  CB  . THR C 1 236 ? 66.285  43.106 90.742  1.00 17.64 ? 254  THR G CB  1 
ATOM   7538  O  OG1 . THR C 1 236 ? 67.639  42.649 90.841  1.00 17.45 ? 254  THR G OG1 1 
ATOM   7539  C  CG2 . THR C 1 236 ? 65.442  42.403 91.804  1.00 17.30 ? 254  THR G CG2 1 
ATOM   7540  N  N   . GLU C 1 237 ? 67.750  43.440 88.160  1.00 17.24 ? 255  GLU G N   1 
ATOM   7541  C  CA  . GLU C 1 237 ? 68.571  44.214 87.249  1.00 17.14 ? 255  GLU G CA  1 
ATOM   7542  C  C   . GLU C 1 237 ? 69.560  43.310 86.532  1.00 16.80 ? 255  GLU G C   1 
ATOM   7543  O  O   . GLU C 1 237 ? 69.915  42.237 87.028  1.00 16.84 ? 255  GLU G O   1 
ATOM   7544  C  CB  . GLU C 1 237 ? 69.305  45.333 87.996  1.00 17.15 ? 255  GLU G CB  1 
ATOM   7545  C  CG  . GLU C 1 237 ? 68.375  46.311 88.698  1.00 18.40 ? 255  GLU G CG  1 
ATOM   7546  C  CD  . GLU C 1 237 ? 68.744  47.758 88.467  1.00 20.31 ? 255  GLU G CD  1 
ATOM   7547  O  OE1 . GLU C 1 237 ? 68.404  48.604 89.314  1.00 21.16 ? 255  GLU G OE1 1 
ATOM   7548  O  OE2 . GLU C 1 237 ? 69.378  48.058 87.439  1.00 22.88 ? 255  GLU G OE2 1 
ATOM   7549  N  N   . VAL C 1 238 ? 69.975  43.733 85.348  1.00 16.75 ? 256  VAL G N   1 
ATOM   7550  C  CA  . VAL C 1 238 ? 70.979  43.000 84.583  1.00 16.89 ? 256  VAL G CA  1 
ATOM   7551  C  C   . VAL C 1 238 ? 72.255  43.834 84.571  1.00 16.18 ? 256  VAL G C   1 
ATOM   7552  O  O   . VAL C 1 238 ? 72.364  44.823 83.836  1.00 16.01 ? 256  VAL G O   1 
ATOM   7553  C  CB  . VAL C 1 238 ? 70.496  42.634 83.142  1.00 17.16 ? 256  VAL G CB  1 
ATOM   7554  C  CG1 . VAL C 1 238 ? 69.190  41.848 83.185  1.00 18.06 ? 256  VAL G CG1 1 
ATOM   7555  C  CG2 . VAL C 1 238 ? 70.269  43.849 82.335  1.00 17.66 ? 256  VAL G CG2 1 
ATOM   7556  N  N   . GLY C 1 239 ? 73.205  43.442 85.416  1.00 15.59 ? 257  GLY G N   1 
ATOM   7557  C  CA  . GLY C 1 239 ? 74.427  44.225 85.630  1.00 14.85 ? 257  GLY G CA  1 
ATOM   7558  C  C   . GLY C 1 239 ? 74.082  45.619 86.125  1.00 14.42 ? 257  GLY G C   1 
ATOM   7559  O  O   . GLY C 1 239 ? 73.389  45.776 87.135  1.00 14.41 ? 257  GLY G O   1 
ATOM   7560  N  N   . THR C 1 240 ? 74.538  46.625 85.387  1.00 13.82 ? 258  THR G N   1 
ATOM   7561  C  CA  . THR C 1 240 ? 74.255  48.024 85.699  1.00 13.32 ? 258  THR G CA  1 
ATOM   7562  C  C   . THR C 1 240 ? 73.125  48.554 84.814  1.00 13.19 ? 258  THR G C   1 
ATOM   7563  O  O   . THR C 1 240 ? 73.056  49.749 84.512  1.00 13.16 ? 258  THR G O   1 
ATOM   7564  C  CB  . THR C 1 240 ? 75.515  48.893 85.523  1.00 13.28 ? 258  THR G CB  1 
ATOM   7565  O  OG1 . THR C 1 240 ? 76.051  48.691 84.208  1.00 13.25 ? 258  THR G OG1 1 
ATOM   7566  C  CG2 . THR C 1 240 ? 76.582  48.527 86.572  1.00 11.96 ? 258  THR G CG2 1 
ATOM   7567  N  N   . MET C 1 241 ? 72.237  47.652 84.405  1.00 13.09 ? 259  MET G N   1 
ATOM   7568  C  CA  . MET C 1 241 ? 71.111  48.006 83.546  1.00 13.14 ? 259  MET G CA  1 
ATOM   7569  C  C   . MET C 1 241 ? 69.782  47.575 84.157  1.00 12.97 ? 259  MET G C   1 
ATOM   7570  O  O   . MET C 1 241 ? 69.715  46.610 84.922  1.00 12.75 ? 259  MET G O   1 
ATOM   7571  C  CB  . MET C 1 241 ? 71.266  47.354 82.163  1.00 13.15 ? 259  MET G CB  1 
ATOM   7572  C  CG  . MET C 1 241 ? 72.472  47.811 81.348  1.00 13.62 ? 259  MET G CG  1 
ATOM   7573  S  SD  . MET C 1 241 ? 72.804  46.757 79.899  1.00 16.25 ? 259  MET G SD  1 
ATOM   7574  C  CE  . MET C 1 241 ? 73.518  45.293 80.662  1.00 15.17 ? 259  MET G CE  1 
ATOM   7575  N  N   . ASN C 1 242 ? 68.723  48.293 83.803  1.00 12.76 ? 260  ASN G N   1 
ATOM   7576  C  CA  . ASN C 1 242 ? 67.376  47.897 84.165  1.00 12.92 ? 260  ASN G CA  1 
ATOM   7577  C  C   . ASN C 1 242 ? 66.896  46.753 83.283  1.00 13.11 ? 260  ASN G C   1 
ATOM   7578  O  O   . ASN C 1 242 ? 67.371  46.592 82.162  1.00 12.97 ? 260  ASN G O   1 
ATOM   7579  C  CB  . ASN C 1 242 ? 66.425  49.089 84.080  1.00 12.99 ? 260  ASN G CB  1 
ATOM   7580  C  CG  . ASN C 1 242 ? 66.704  50.128 85.147  1.00 12.85 ? 260  ASN G CG  1 
ATOM   7581  O  OD1 . ASN C 1 242 ? 66.684  49.834 86.349  1.00 14.25 ? 260  ASN G OD1 1 
ATOM   7582  N  ND2 . ASN C 1 242 ? 66.967  51.340 84.721  1.00 10.89 ? 260  ASN G ND2 1 
ATOM   7583  N  N   . LEU C 1 243 ? 65.953  45.964 83.798  1.00 13.24 ? 261  LEU G N   1 
ATOM   7584  C  CA  . LEU C 1 243 ? 65.529  44.735 83.129  1.00 13.46 ? 261  LEU G CA  1 
ATOM   7585  C  C   . LEU C 1 243 ? 64.141  44.860 82.495  1.00 13.04 ? 261  LEU G C   1 
ATOM   7586  O  O   . LEU C 1 243 ? 63.170  45.198 83.173  1.00 12.70 ? 261  LEU G O   1 
ATOM   7587  C  CB  . LEU C 1 243 ? 65.562  43.561 84.120  1.00 13.50 ? 261  LEU G CB  1 
ATOM   7588  C  CG  . LEU C 1 243 ? 65.284  42.124 83.640  1.00 15.45 ? 261  LEU G CG  1 
ATOM   7589  C  CD1 . LEU C 1 243 ? 63.787  41.802 83.539  1.00 16.17 ? 261  LEU G CD1 1 
ATOM   7590  C  CD2 . LEU C 1 243 ? 65.986  41.827 82.305  1.00 17.95 ? 261  LEU G CD2 1 
ATOM   7591  N  N   . PHE C 1 244 ? 64.052  44.563 81.201  1.00 12.89 ? 262  PHE G N   1 
ATOM   7592  C  CA  . PHE C 1 244 ? 62.760  44.511 80.509  1.00 13.03 ? 262  PHE G CA  1 
ATOM   7593  C  C   . PHE C 1 244 ? 62.443  43.121 79.969  1.00 13.45 ? 262  PHE G C   1 
ATOM   7594  O  O   . PHE C 1 244 ? 63.318  42.445 79.429  1.00 12.98 ? 262  PHE G O   1 
ATOM   7595  C  CB  . PHE C 1 244 ? 62.696  45.550 79.388  1.00 12.41 ? 262  PHE G CB  1 
ATOM   7596  C  CG  . PHE C 1 244 ? 62.526  46.956 79.883  1.00 11.80 ? 262  PHE G CG  1 
ATOM   7597  C  CD1 . PHE C 1 244 ? 63.636  47.748 80.160  1.00 11.07 ? 262  PHE G CD1 1 
ATOM   7598  C  CD2 . PHE C 1 244 ? 61.256  47.484 80.083  1.00 10.70 ? 262  PHE G CD2 1 
ATOM   7599  C  CE1 . PHE C 1 244 ? 63.486  49.049 80.625  1.00 11.75 ? 262  PHE G CE1 1 
ATOM   7600  C  CE2 . PHE C 1 244 ? 61.088  48.789 80.543  1.00 11.88 ? 262  PHE G CE2 1 
ATOM   7601  C  CZ  . PHE C 1 244 ? 62.206  49.576 80.819  1.00 11.42 ? 262  PHE G CZ  1 
ATOM   7602  N  N   . LEU C 1 245 ? 61.186  42.709 80.131  1.00 14.36 ? 263  LEU G N   1 
ATOM   7603  C  CA  . LEU C 1 245 ? 60.690  41.430 79.619  1.00 15.19 ? 263  LEU G CA  1 
ATOM   7604  C  C   . LEU C 1 245 ? 59.523  41.674 78.666  1.00 15.78 ? 263  LEU G C   1 
ATOM   7605  O  O   . LEU C 1 245 ? 58.490  42.221 79.064  1.00 15.50 ? 263  LEU G O   1 
ATOM   7606  C  CB  . LEU C 1 245 ? 60.217  40.519 80.764  1.00 14.93 ? 263  LEU G CB  1 
ATOM   7607  C  CG  . LEU C 1 245 ? 60.449  38.991 80.738  1.00 15.60 ? 263  LEU G CG  1 
ATOM   7608  C  CD1 . LEU C 1 245 ? 59.414  38.256 81.587  1.00 13.45 ? 263  LEU G CD1 1 
ATOM   7609  C  CD2 . LEU C 1 245 ? 60.512  38.382 79.334  1.00 15.19 ? 263  LEU G CD2 1 
ATOM   7610  N  N   . TYR C 1 246 ? 59.701  41.263 77.413  1.00 16.57 ? 264  TYR G N   1 
ATOM   7611  C  CA  . TYR C 1 246 ? 58.643  41.321 76.407  1.00 17.46 ? 264  TYR G CA  1 
ATOM   7612  C  C   . TYR C 1 246 ? 58.109  39.916 76.200  1.00 18.06 ? 264  TYR G C   1 
ATOM   7613  O  O   . TYR C 1 246 ? 58.830  39.030 75.735  1.00 18.19 ? 264  TYR G O   1 
ATOM   7614  C  CB  . TYR C 1 246 ? 59.181  41.882 75.095  1.00 17.22 ? 264  TYR G CB  1 
ATOM   7615  C  CG  . TYR C 1 246 ? 58.129  42.221 74.062  1.00 17.24 ? 264  TYR G CG  1 
ATOM   7616  C  CD1 . TYR C 1 246 ? 56.892  42.755 74.436  1.00 17.23 ? 264  TYR G CD1 1 
ATOM   7617  C  CD2 . TYR C 1 246 ? 58.387  42.046 72.702  1.00 16.95 ? 264  TYR G CD2 1 
ATOM   7618  C  CE1 . TYR C 1 246 ? 55.937  43.079 73.488  1.00 17.54 ? 264  TYR G CE1 1 
ATOM   7619  C  CE2 . TYR C 1 246 ? 57.441  42.373 71.748  1.00 17.07 ? 264  TYR G CE2 1 
ATOM   7620  C  CZ  . TYR C 1 246 ? 56.222  42.891 72.147  1.00 18.13 ? 264  TYR G CZ  1 
ATOM   7621  O  OH  . TYR C 1 246 ? 55.281  43.221 71.202  1.00 20.15 ? 264  TYR G OH  1 
ATOM   7622  N  N   . TRP C 1 247 ? 56.845  39.717 76.559  1.00 18.67 ? 265  TRP G N   1 
ATOM   7623  C  CA  . TRP C 1 247 ? 56.292  38.376 76.660  1.00 19.51 ? 265  TRP G CA  1 
ATOM   7624  C  C   . TRP C 1 247 ? 54.767  38.376 76.607  1.00 20.35 ? 265  TRP G C   1 
ATOM   7625  O  O   . TRP C 1 247 ? 54.128  39.432 76.631  1.00 20.42 ? 265  TRP G O   1 
ATOM   7626  C  CB  . TRP C 1 247 ? 56.789  37.700 77.953  1.00 19.10 ? 265  TRP G CB  1 
ATOM   7627  C  CG  . TRP C 1 247 ? 56.154  38.206 79.246  1.00 18.52 ? 265  TRP G CG  1 
ATOM   7628  C  CD1 . TRP C 1 247 ? 55.618  39.445 79.482  1.00 17.77 ? 265  TRP G CD1 1 
ATOM   7629  C  CD2 . TRP C 1 247 ? 56.027  37.478 80.477  1.00 17.71 ? 265  TRP G CD2 1 
ATOM   7630  N  NE1 . TRP C 1 247 ? 55.145  39.521 80.771  1.00 17.47 ? 265  TRP G NE1 1 
ATOM   7631  C  CE2 . TRP C 1 247 ? 55.391  38.333 81.407  1.00 17.45 ? 265  TRP G CE2 1 
ATOM   7632  C  CE3 . TRP C 1 247 ? 56.386  36.183 80.883  1.00 17.22 ? 265  TRP G CE3 1 
ATOM   7633  C  CZ2 . TRP C 1 247 ? 55.100  37.934 82.722  1.00 17.87 ? 265  TRP G CZ2 1 
ATOM   7634  C  CZ3 . TRP C 1 247 ? 56.096  35.785 82.188  1.00 16.68 ? 265  TRP G CZ3 1 
ATOM   7635  C  CH2 . TRP C 1 247 ? 55.453  36.659 83.090  1.00 17.45 ? 265  TRP G CH2 1 
ATOM   7636  N  N   . ILE C 1 248 ? 54.199  37.180 76.510  1.00 21.51 ? 266  ILE G N   1 
ATOM   7637  C  CA  . ILE C 1 248 ? 52.787  36.984 76.754  1.00 22.61 ? 266  ILE G CA  1 
ATOM   7638  C  C   . ILE C 1 248 ? 52.673  36.635 78.228  1.00 23.13 ? 266  ILE G C   1 
ATOM   7639  O  O   . ILE C 1 248 ? 53.247  35.640 78.676  1.00 23.24 ? 266  ILE G O   1 
ATOM   7640  C  CB  . ILE C 1 248 ? 52.202  35.856 75.875  1.00 23.01 ? 266  ILE G CB  1 
ATOM   7641  C  CG1 . ILE C 1 248 ? 52.243  36.252 74.396  1.00 23.30 ? 266  ILE G CG1 1 
ATOM   7642  C  CG2 . ILE C 1 248 ? 50.768  35.511 76.314  1.00 23.09 ? 266  ILE G CG2 1 
ATOM   7643  C  CD1 . ILE C 1 248 ? 51.568  35.245 73.478  1.00 25.75 ? 266  ILE G CD1 1 
ATOM   7644  N  N   . ASN C 1 249 ? 51.952  37.465 78.978  1.00 23.84 ? 267  ASN G N   1 
ATOM   7645  C  CA  . ASN C 1 249 ? 51.799  37.263 80.418  1.00 24.94 ? 267  ASN G CA  1 
ATOM   7646  C  C   . ASN C 1 249 ? 50.824  36.135 80.768  1.00 25.63 ? 267  ASN G C   1 
ATOM   7647  O  O   . ASN C 1 249 ? 50.370  35.405 79.881  1.00 25.83 ? 267  ASN G O   1 
ATOM   7648  C  CB  . ASN C 1 249 ? 51.457  38.584 81.141  1.00 24.75 ? 267  ASN G CB  1 
ATOM   7649  C  CG  . ASN C 1 249 ? 50.036  39.071 80.876  1.00 24.62 ? 267  ASN G CG  1 
ATOM   7650  O  OD1 . ASN C 1 249 ? 49.154  38.308 80.476  1.00 24.09 ? 267  ASN G OD1 1 
ATOM   7651  N  ND2 . ASN C 1 249 ? 49.809  40.358 81.116  1.00 24.06 ? 267  ASN G ND2 1 
ATOM   7652  N  N   . GLU C 1 250 ? 50.513  36.000 82.058  1.00 26.48 ? 268  GLU G N   1 
ATOM   7653  C  CA  . GLU C 1 250 ? 49.749  34.861 82.576  1.00 27.20 ? 268  GLU G CA  1 
ATOM   7654  C  C   . GLU C 1 250 ? 48.283  34.883 82.151  1.00 27.65 ? 268  GLU G C   1 
ATOM   7655  O  O   . GLU C 1 250 ? 47.639  33.834 82.094  1.00 27.70 ? 268  GLU G O   1 
ATOM   7656  C  CB  . GLU C 1 250 ? 49.846  34.792 84.106  1.00 27.46 ? 268  GLU G CB  1 
ATOM   7657  C  CG  . GLU C 1 250 ? 51.250  34.550 84.655  1.00 27.27 ? 268  GLU G CG  1 
ATOM   7658  C  CD  . GLU C 1 250 ? 52.034  35.834 84.924  1.00 27.33 ? 268  GLU G CD  1 
ATOM   7659  O  OE1 . GLU C 1 250 ? 53.003  35.773 85.712  1.00 26.68 ? 268  GLU G OE1 1 
ATOM   7660  O  OE2 . GLU C 1 250 ? 51.687  36.898 84.360  1.00 27.12 ? 268  GLU G OE2 1 
ATOM   7661  N  N   . ASP C 1 251 ? 47.774  36.081 81.859  1.00 28.09 ? 269  ASP G N   1 
ATOM   7662  C  CA  . ASP C 1 251 ? 46.392  36.283 81.409  1.00 28.41 ? 269  ASP G CA  1 
ATOM   7663  C  C   . ASP C 1 251 ? 46.250  36.190 79.886  1.00 28.20 ? 269  ASP G C   1 
ATOM   7664  O  O   . ASP C 1 251 ? 45.188  36.480 79.339  1.00 28.39 ? 269  ASP G O   1 
ATOM   7665  C  CB  . ASP C 1 251 ? 45.862  37.639 81.900  1.00 28.82 ? 269  ASP G CB  1 
ATOM   7666  C  CG  . ASP C 1 251 ? 45.751  37.724 83.429  1.00 30.30 ? 269  ASP G CG  1 
ATOM   7667  O  OD1 . ASP C 1 251 ? 45.431  38.825 83.928  1.00 32.49 ? 269  ASP G OD1 1 
ATOM   7668  O  OD2 . ASP C 1 251 ? 45.974  36.713 84.135  1.00 31.11 ? 269  ASP G OD2 1 
ATOM   7669  N  N   . GLY C 1 252 ? 47.327  35.791 79.213  1.00 28.01 ? 270  GLY G N   1 
ATOM   7670  C  CA  . GLY C 1 252 ? 47.350  35.642 77.760  1.00 27.68 ? 270  GLY G CA  1 
ATOM   7671  C  C   . GLY C 1 252 ? 47.507  36.943 76.989  1.00 27.60 ? 270  GLY G C   1 
ATOM   7672  O  O   . GLY C 1 252 ? 47.248  36.985 75.778  1.00 27.68 ? 270  GLY G O   1 
ATOM   7673  N  N   . GLU C 1 253 ? 47.934  37.998 77.688  1.00 26.82 ? 271  GLU G N   1 
ATOM   7674  C  CA  . GLU C 1 253 ? 48.110  39.321 77.094  1.00 26.25 ? 271  GLU G CA  1 
ATOM   7675  C  C   . GLU C 1 253 ? 49.571  39.587 76.750  1.00 25.35 ? 271  GLU G C   1 
ATOM   7676  O  O   . GLU C 1 253 ? 50.475  39.292 77.538  1.00 25.18 ? 271  GLU G O   1 
ATOM   7677  C  CB  . GLU C 1 253 ? 47.642  40.424 78.054  1.00 26.65 ? 271  GLU G CB  1 
ATOM   7678  C  CG  . GLU C 1 253 ? 46.160  40.450 78.404  1.00 28.67 ? 271  GLU G CG  1 
ATOM   7679  C  CD  . GLU C 1 253 ? 45.873  41.373 79.582  1.00 31.60 ? 271  GLU G CD  1 
ATOM   7680  O  OE1 . GLU C 1 253 ? 45.172  42.392 79.382  1.00 33.18 ? 271  GLU G OE1 1 
ATOM   7681  O  OE2 . GLU C 1 253 ? 46.369  41.094 80.704  1.00 32.30 ? 271  GLU G OE2 1 
ATOM   7682  N  N   . GLU C 1 254 ? 49.798  40.176 75.580  1.00 24.28 ? 272  GLU G N   1 
ATOM   7683  C  CA  . GLU C 1 254 ? 51.126  40.660 75.229  1.00 23.23 ? 272  GLU G CA  1 
ATOM   7684  C  C   . GLU C 1 254 ? 51.495  41.836 76.134  1.00 21.99 ? 272  GLU G C   1 
ATOM   7685  O  O   . GLU C 1 254 ? 50.710  42.768 76.305  1.00 21.78 ? 272  GLU G O   1 
ATOM   7686  C  CB  . GLU C 1 254 ? 51.168  41.078 73.766  1.00 23.47 ? 272  GLU G CB  1 
ATOM   7687  C  CG  . GLU C 1 254 ? 52.564  41.239 73.229  1.00 24.90 ? 272  GLU G CG  1 
ATOM   7688  C  CD  . GLU C 1 254 ? 52.557  41.532 71.755  1.00 27.31 ? 272  GLU G CD  1 
ATOM   7689  O  OE1 . GLU C 1 254 ? 52.748  40.573 70.973  1.00 29.24 ? 272  GLU G OE1 1 
ATOM   7690  O  OE2 . GLU C 1 254 ? 52.334  42.706 71.383  1.00 26.93 ? 272  GLU G OE2 1 
ATOM   7691  N  N   . GLU C 1 255 ? 52.695  41.789 76.704  1.00 20.50 ? 273  GLU G N   1 
ATOM   7692  C  CA  . GLU C 1 255 ? 53.064  42.706 77.771  1.00 18.84 ? 273  GLU G CA  1 
ATOM   7693  C  C   . GLU C 1 255 ? 54.546  43.095 77.739  1.00 18.15 ? 273  GLU G C   1 
ATOM   7694  O  O   . GLU C 1 255 ? 55.413  42.249 77.502  1.00 17.89 ? 273  GLU G O   1 
ATOM   7695  C  CB  . GLU C 1 255 ? 52.726  42.047 79.113  1.00 18.64 ? 273  GLU G CB  1 
ATOM   7696  C  CG  . GLU C 1 255 ? 52.937  42.900 80.362  1.00 18.31 ? 273  GLU G CG  1 
ATOM   7697  C  CD  . GLU C 1 255 ? 52.582  42.154 81.632  1.00 17.92 ? 273  GLU G CD  1 
ATOM   7698  O  OE1 . GLU C 1 255 ? 51.527  42.453 82.222  1.00 18.46 ? 273  GLU G OE1 1 
ATOM   7699  O  OE2 . GLU C 1 255 ? 53.348  41.255 82.039  1.00 18.02 ? 273  GLU G OE2 1 
ATOM   7700  N  N   . LEU C 1 256 ? 54.825  44.375 77.975  1.00 16.93 ? 274  LEU G N   1 
ATOM   7701  C  CA  . LEU C 1 256 ? 56.169  44.795 78.360  1.00 16.04 ? 274  LEU G CA  1 
ATOM   7702  C  C   . LEU C 1 256 ? 56.209  44.966 79.877  1.00 15.45 ? 274  LEU G C   1 
ATOM   7703  O  O   . LEU C 1 256 ? 55.494  45.810 80.434  1.00 14.65 ? 274  LEU G O   1 
ATOM   7704  C  CB  . LEU C 1 256 ? 56.595  46.092 77.660  1.00 15.67 ? 274  LEU G CB  1 
ATOM   7705  C  CG  . LEU C 1 256 ? 58.036  46.547 77.966  1.00 15.82 ? 274  LEU G CG  1 
ATOM   7706  C  CD1 . LEU C 1 256 ? 59.055  45.524 77.448  1.00 14.52 ? 274  LEU G CD1 1 
ATOM   7707  C  CD2 . LEU C 1 256 ? 58.319  47.932 77.386  1.00 14.43 ? 274  LEU G CD2 1 
ATOM   7708  N  N   . ALA C 1 257 ? 57.044  44.156 80.528  1.00 14.84 ? 275  ALA G N   1 
ATOM   7709  C  CA  . ALA C 1 257 ? 57.144  44.134 81.989  1.00 14.73 ? 275  ALA G CA  1 
ATOM   7710  C  C   . ALA C 1 257 ? 58.535  44.502 82.486  1.00 14.54 ? 275  ALA G C   1 
ATOM   7711  O  O   . ALA C 1 257 ? 59.541  44.125 81.886  1.00 14.58 ? 275  ALA G O   1 
ATOM   7712  C  CB  . ALA C 1 257 ? 56.737  42.764 82.539  1.00 14.63 ? 275  ALA G CB  1 
ATOM   7713  N  N   . THR C 1 258 ? 58.571  45.230 83.599  1.00 14.19 ? 276  THR G N   1 
ATOM   7714  C  CA  . THR C 1 258 ? 59.815  45.640 84.253  1.00 13.78 ? 276  THR G CA  1 
ATOM   7715  C  C   . THR C 1 258 ? 59.566  45.727 85.771  1.00 13.61 ? 276  THR G C   1 
ATOM   7716  O  O   . THR C 1 258 ? 58.473  46.117 86.192  1.00 13.36 ? 276  THR G O   1 
ATOM   7717  C  CB  . THR C 1 258 ? 60.357  46.991 83.667  1.00 13.56 ? 276  THR G CB  1 
ATOM   7718  O  OG1 . THR C 1 258 ? 61.734  47.170 84.019  1.00 13.71 ? 276  THR G OG1 1 
ATOM   7719  C  CG2 . THR C 1 258 ? 59.540  48.203 84.147  1.00 13.57 ? 276  THR G CG2 1 
ATOM   7720  N  N   . PRO C 1 259 ? 60.559  45.328 86.595  1.00 13.41 ? 277  PRO G N   1 
ATOM   7721  C  CA  . PRO C 1 259 ? 60.415  45.415 88.051  1.00 13.17 ? 277  PRO G CA  1 
ATOM   7722  C  C   . PRO C 1 259 ? 60.085  46.823 88.552  1.00 13.16 ? 277  PRO G C   1 
ATOM   7723  O  O   . PRO C 1 259 ? 60.575  47.806 87.989  1.00 13.19 ? 277  PRO G O   1 
ATOM   7724  C  CB  . PRO C 1 259 ? 61.786  44.948 88.558  1.00 13.31 ? 277  PRO G CB  1 
ATOM   7725  C  CG  . PRO C 1 259 ? 62.257  44.009 87.476  1.00 13.12 ? 277  PRO G CG  1 
ATOM   7726  C  CD  . PRO C 1 259 ? 61.850  44.715 86.220  1.00 13.31 ? 277  PRO G CD  1 
ATOM   7727  N  N   . PRO C 1 260 ? 59.249  46.921 89.605  1.00 13.19 ? 278  PRO G N   1 
ATOM   7728  C  CA  . PRO C 1 260 ? 58.786  48.202 90.137  1.00 13.25 ? 278  PRO G CA  1 
ATOM   7729  C  C   . PRO C 1 260 ? 59.824  48.884 91.027  1.00 13.45 ? 278  PRO G C   1 
ATOM   7730  O  O   . PRO C 1 260 ? 60.742  48.225 91.527  1.00 13.02 ? 278  PRO G O   1 
ATOM   7731  C  CB  . PRO C 1 260 ? 57.557  47.824 90.982  1.00 13.45 ? 278  PRO G CB  1 
ATOM   7732  C  CG  . PRO C 1 260 ? 57.457  46.334 90.954  1.00 13.03 ? 278  PRO G CG  1 
ATOM   7733  C  CD  . PRO C 1 260 ? 58.708  45.783 90.370  1.00 13.21 ? 278  PRO G CD  1 
ATOM   7734  N  N   . LEU C 1 261 ? 59.654  50.191 91.230  1.00 13.35 ? 279  LEU G N   1 
ATOM   7735  C  CA  . LEU C 1 261 ? 60.596  50.989 92.011  1.00 13.49 ? 279  LEU G CA  1 
ATOM   7736  C  C   . LEU C 1 261 ? 60.283  50.930 93.500  1.00 13.69 ? 279  LEU G C   1 
ATOM   7737  O  O   . LEU C 1 261 ? 59.909  51.935 94.111  1.00 13.48 ? 279  LEU G O   1 
ATOM   7738  C  CB  . LEU C 1 261 ? 60.612  52.444 91.520  1.00 13.04 ? 279  LEU G CB  1 
ATOM   7739  C  CG  . LEU C 1 261 ? 60.960  52.687 90.051  1.00 13.61 ? 279  LEU G CG  1 
ATOM   7740  C  CD1 . LEU C 1 261 ? 61.007  54.187 89.742  1.00 13.78 ? 279  LEU G CD1 1 
ATOM   7741  C  CD2 . LEU C 1 261 ? 62.270  51.997 89.652  1.00 12.14 ? 279  LEU G CD2 1 
ATOM   7742  N  N   . ASP C 1 262 ? 60.445  49.741 94.076  1.00 13.98 ? 280  ASP G N   1 
ATOM   7743  C  CA  . ASP C 1 262 ? 60.122  49.510 95.483  1.00 14.28 ? 280  ASP G CA  1 
ATOM   7744  C  C   . ASP C 1 262 ? 61.336  49.606 96.411  1.00 14.27 ? 280  ASP G C   1 
ATOM   7745  O  O   . ASP C 1 262 ? 61.248  49.247 97.585  1.00 14.82 ? 280  ASP G O   1 
ATOM   7746  C  CB  . ASP C 1 262 ? 59.407  48.156 95.662  1.00 13.92 ? 280  ASP G CB  1 
ATOM   7747  C  CG  . ASP C 1 262 ? 60.296  46.955 95.330  1.00 14.72 ? 280  ASP G CG  1 
ATOM   7748  O  OD1 . ASP C 1 262 ? 59.844  45.816 95.586  1.00 14.71 ? 280  ASP G OD1 1 
ATOM   7749  O  OD2 . ASP C 1 262 ? 61.438  47.125 94.831  1.00 15.39 ? 280  ASP G OD2 1 
ATOM   7750  N  N   . GLY C 1 263 ? 62.466  50.067 95.883  1.00 13.99 ? 281  GLY G N   1 
ATOM   7751  C  CA  . GLY C 1 263 ? 63.639  50.338 96.711  1.00 13.61 ? 281  GLY G CA  1 
ATOM   7752  C  C   . GLY C 1 263 ? 64.928  49.663 96.273  1.00 13.61 ? 281  GLY G C   1 
ATOM   7753  O  O   . GLY C 1 263 ? 66.018  50.118 96.627  1.00 13.61 ? 281  GLY G O   1 
ATOM   7754  N  N   . ILE C 1 264 ? 64.810  48.577 95.512  1.00 13.26 ? 282  ILE G N   1 
ATOM   7755  C  CA  . ILE C 1 264 ? 65.974  47.795 95.104  1.00 12.99 ? 282  ILE G CA  1 
ATOM   7756  C  C   . ILE C 1 264 ? 66.321  47.937 93.609  1.00 13.20 ? 282  ILE G C   1 
ATOM   7757  O  O   . ILE C 1 264 ? 67.210  47.254 93.101  1.00 13.54 ? 282  ILE G O   1 
ATOM   7758  C  CB  . ILE C 1 264 ? 65.827  46.299 95.509  1.00 13.04 ? 282  ILE G CB  1 
ATOM   7759  C  CG1 . ILE C 1 264 ? 64.655  45.647 94.765  1.00 12.28 ? 282  ILE G CG1 1 
ATOM   7760  C  CG2 . ILE C 1 264 ? 65.674  46.171 97.041  1.00 12.20 ? 282  ILE G CG2 1 
ATOM   7761  C  CD1 . ILE C 1 264 ? 64.553  44.173 94.959  1.00 11.58 ? 282  ILE G CD1 1 
ATOM   7762  N  N   . ILE C 1 265 ? 65.627  48.839 92.921  1.00 13.15 ? 283  ILE G N   1 
ATOM   7763  C  CA  . ILE C 1 265 ? 65.874  49.103 91.504  1.00 12.92 ? 283  ILE G CA  1 
ATOM   7764  C  C   . ILE C 1 265 ? 66.280  50.559 91.296  1.00 12.51 ? 283  ILE G C   1 
ATOM   7765  O  O   . ILE C 1 265 ? 65.650  51.473 91.838  1.00 12.35 ? 283  ILE G O   1 
ATOM   7766  C  CB  . ILE C 1 265 ? 64.656  48.696 90.603  1.00 13.08 ? 283  ILE G CB  1 
ATOM   7767  C  CG1 . ILE C 1 265 ? 64.678  47.190 90.329  1.00 14.83 ? 283  ILE G CG1 1 
ATOM   7768  C  CG2 . ILE C 1 265 ? 64.735  49.340 89.239  1.00 12.62 ? 283  ILE G CG2 1 
ATOM   7769  C  CD1 . ILE C 1 265 ? 63.797  46.415 91.185  1.00 16.48 ? 283  ILE G CD1 1 
ATOM   7770  N  N   . LEU C 1 266 ? 67.357  50.761 90.539  1.00 11.81 ? 284  LEU G N   1 
ATOM   7771  C  CA  . LEU C 1 266 ? 67.789  52.100 90.167  1.00 11.55 ? 284  LEU G CA  1 
ATOM   7772  C  C   . LEU C 1 266 ? 66.815  52.658 89.120  1.00 11.46 ? 284  LEU G C   1 
ATOM   7773  O  O   . LEU C 1 266 ? 66.582  52.024 88.092  1.00 11.35 ? 284  LEU G O   1 
ATOM   7774  C  CB  . LEU C 1 266 ? 69.239  52.073 89.644  1.00 11.34 ? 284  LEU G CB  1 
ATOM   7775  C  CG  . LEU C 1 266 ? 70.085  53.354 89.498  1.00 11.16 ? 284  LEU G CG  1 
ATOM   7776  C  CD1 . LEU C 1 266 ? 69.677  54.173 88.285  1.00 9.39  ? 284  LEU G CD1 1 
ATOM   7777  C  CD2 . LEU C 1 266 ? 70.059  54.217 90.765  1.00 10.71 ? 284  LEU G CD2 1 
ATOM   7778  N  N   . PRO C 1 267 ? 66.208  53.826 89.395  1.00 11.67 ? 285  PRO G N   1 
ATOM   7779  C  CA  . PRO C 1 267 ? 65.293  54.410 88.410  1.00 11.85 ? 285  PRO G CA  1 
ATOM   7780  C  C   . PRO C 1 267 ? 66.034  54.974 87.192  1.00 11.95 ? 285  PRO G C   1 
ATOM   7781  O  O   . PRO C 1 267 ? 66.328  56.174 87.143  1.00 12.38 ? 285  PRO G O   1 
ATOM   7782  C  CB  . PRO C 1 267 ? 64.592  55.540 89.191  1.00 11.99 ? 285  PRO G CB  1 
ATOM   7783  C  CG  . PRO C 1 267 ? 65.022  55.390 90.632  1.00 12.08 ? 285  PRO G CG  1 
ATOM   7784  C  CD  . PRO C 1 267 ? 66.309  54.647 90.616  1.00 11.85 ? 285  PRO G CD  1 
ATOM   7785  N  N   . GLY C 1 268 ? 66.341  54.112 86.223  1.00 11.58 ? 286  GLY G N   1 
ATOM   7786  C  CA  . GLY C 1 268 ? 67.046  54.538 85.015  1.00 11.24 ? 286  GLY G CA  1 
ATOM   7787  C  C   . GLY C 1 268 ? 66.261  55.553 84.206  1.00 11.06 ? 286  GLY G C   1 
ATOM   7788  O  O   . GLY C 1 268 ? 65.027  55.502 84.179  1.00 10.64 ? 286  GLY G O   1 
ATOM   7789  N  N   . VAL C 1 269 ? 66.957  56.486 83.556  1.00 11.22 ? 287  VAL G N   1 
ATOM   7790  C  CA  . VAL C 1 269 ? 66.254  57.393 82.640  1.00 11.77 ? 287  VAL G CA  1 
ATOM   7791  C  C   . VAL C 1 269 ? 65.869  56.690 81.329  1.00 11.77 ? 287  VAL G C   1 
ATOM   7792  O  O   . VAL C 1 269 ? 64.796  56.959 80.790  1.00 12.08 ? 287  VAL G O   1 
ATOM   7793  C  CB  . VAL C 1 269 ? 66.932  58.809 82.417  1.00 12.14 ? 287  VAL G CB  1 
ATOM   7794  C  CG1 . VAL C 1 269 ? 67.940  59.139 83.497  1.00 11.65 ? 287  VAL G CG1 1 
ATOM   7795  C  CG2 . VAL C 1 269 ? 67.503  58.978 81.014  1.00 12.32 ? 287  VAL G CG2 1 
ATOM   7796  N  N   . THR C 1 270 ? 66.724  55.781 80.850  1.00 11.68 ? 288  THR G N   1 
ATOM   7797  C  CA  . THR C 1 270 ? 66.405  54.950 79.688  1.00 11.70 ? 288  THR G CA  1 
ATOM   7798  C  C   . THR C 1 270 ? 65.154  54.111 79.965  1.00 11.72 ? 288  THR G C   1 
ATOM   7799  O  O   . THR C 1 270 ? 64.263  54.027 79.120  1.00 12.07 ? 288  THR G O   1 
ATOM   7800  C  CB  . THR C 1 270 ? 67.589  54.021 79.264  1.00 11.72 ? 288  THR G CB  1 
ATOM   7801  O  OG1 . THR C 1 270 ? 68.838  54.693 79.461  1.00 11.26 ? 288  THR G OG1 1 
ATOM   7802  C  CG2 . THR C 1 270 ? 67.461  53.642 77.797  1.00 11.28 ? 288  THR G CG2 1 
ATOM   7803  N  N   . ARG C 1 271 ? 65.105  53.507 81.153  1.00 11.79 ? 289  ARG G N   1 
ATOM   7804  C  CA  . ARG C 1 271 ? 63.922  52.815 81.681  1.00 11.68 ? 289  ARG G CA  1 
ATOM   7805  C  C   . ARG C 1 271 ? 62.674  53.704 81.628  1.00 12.12 ? 289  ARG G C   1 
ATOM   7806  O  O   . ARG C 1 271 ? 61.645  53.314 81.068  1.00 11.78 ? 289  ARG G O   1 
ATOM   7807  C  CB  . ARG C 1 271 ? 64.196  52.370 83.122  1.00 11.37 ? 289  ARG G CB  1 
ATOM   7808  C  CG  . ARG C 1 271 ? 63.047  51.647 83.827  1.00 11.44 ? 289  ARG G CG  1 
ATOM   7809  C  CD  . ARG C 1 271 ? 63.333  51.526 85.322  1.00 10.38 ? 289  ARG G CD  1 
ATOM   7810  N  NE  . ARG C 1 271 ? 62.280  50.802 86.034  1.00 10.58 ? 289  ARG G NE  1 
ATOM   7811  C  CZ  . ARG C 1 271 ? 61.129  51.341 86.443  1.00 10.06 ? 289  ARG G CZ  1 
ATOM   7812  N  NH1 . ARG C 1 271 ? 60.871  52.622 86.219  1.00 8.64  ? 289  ARG G NH1 1 
ATOM   7813  N  NH2 . ARG C 1 271 ? 60.235  50.593 87.082  1.00 9.75  ? 289  ARG G NH2 1 
ATOM   7814  N  N   . ARG C 1 272 ? 62.780  54.898 82.211  1.00 12.44 ? 290  ARG G N   1 
ATOM   7815  C  CA  . ARG C 1 272 ? 61.714  55.893 82.166  1.00 13.04 ? 290  ARG G CA  1 
ATOM   7816  C  C   . ARG C 1 272 ? 61.254  56.187 80.723  1.00 13.05 ? 290  ARG G C   1 
ATOM   7817  O  O   . ARG C 1 272 ? 60.057  56.147 80.427  1.00 13.09 ? 290  ARG G O   1 
ATOM   7818  C  CB  . ARG C 1 272 ? 62.147  57.172 82.899  1.00 12.99 ? 290  ARG G CB  1 
ATOM   7819  C  CG  . ARG C 1 272 ? 61.210  58.377 82.721  1.00 13.59 ? 290  ARG G CG  1 
ATOM   7820  C  CD  . ARG C 1 272 ? 60.026  58.370 83.690  1.00 14.68 ? 290  ARG G CD  1 
ATOM   7821  N  NE  . ARG C 1 272 ? 58.986  57.404 83.333  1.00 14.91 ? 290  ARG G NE  1 
ATOM   7822  C  CZ  . ARG C 1 272 ? 58.613  56.375 84.089  1.00 14.95 ? 290  ARG G CZ  1 
ATOM   7823  N  NH1 . ARG C 1 272 ? 57.649  55.565 83.673  1.00 15.57 ? 290  ARG G NH1 1 
ATOM   7824  N  NH2 . ARG C 1 272 ? 59.188  56.155 85.261  1.00 14.58 ? 290  ARG G NH2 1 
ATOM   7825  N  N   . CYS C 1 273 ? 62.208  56.446 79.830  1.00 13.24 ? 291  CYS G N   1 
ATOM   7826  C  CA  . CYS C 1 273 ? 61.910  56.718 78.421  1.00 13.34 ? 291  CYS G CA  1 
ATOM   7827  C  C   . CYS C 1 273 ? 61.203  55.563 77.702  1.00 12.99 ? 291  CYS G C   1 
ATOM   7828  O  O   . CYS C 1 273 ? 60.256  55.798 76.958  1.00 12.72 ? 291  CYS G O   1 
ATOM   7829  C  CB  . CYS C 1 273 ? 63.184  57.102 77.665  1.00 13.29 ? 291  CYS G CB  1 
ATOM   7830  S  SG  . CYS C 1 273 ? 63.882  58.657 78.217  1.00 15.49 ? 291  CYS G SG  1 
ATOM   7831  N  N   . ILE C 1 274 ? 61.675  54.335 77.923  1.00 12.93 ? 292  ILE G N   1 
ATOM   7832  C  CA  . ILE C 1 274 ? 61.077  53.128 77.334  1.00 13.25 ? 292  ILE G CA  1 
ATOM   7833  C  C   . ILE C 1 274 ? 59.614  52.951 77.789  1.00 13.75 ? 292  ILE G C   1 
ATOM   7834  O  O   . ILE C 1 274 ? 58.725  52.733 76.965  1.00 13.88 ? 292  ILE G O   1 
ATOM   7835  C  CB  . ILE C 1 274 ? 61.936  51.857 77.640  1.00 12.95 ? 292  ILE G CB  1 
ATOM   7836  C  CG1 . ILE C 1 274 ? 63.290  51.942 76.918  1.00 13.20 ? 292  ILE G CG1 1 
ATOM   7837  C  CG2 . ILE C 1 274 ? 61.207  50.575 77.246  1.00 11.99 ? 292  ILE G CG2 1 
ATOM   7838  C  CD1 . ILE C 1 274 ? 64.345  50.962 77.419  1.00 10.97 ? 292  ILE G CD1 1 
ATOM   7839  N  N   . LEU C 1 275 ? 59.381  53.064 79.098  1.00 13.89 ? 293  LEU G N   1 
ATOM   7840  C  CA  . LEU C 1 275 ? 58.039  53.044 79.671  1.00 14.12 ? 293  LEU G CA  1 
ATOM   7841  C  C   . LEU C 1 275 ? 57.138  54.118 79.049  1.00 14.57 ? 293  LEU G C   1 
ATOM   7842  O  O   . LEU C 1 275 ? 56.017  53.825 78.628  1.00 14.56 ? 293  LEU G O   1 
ATOM   7843  C  CB  . LEU C 1 275 ? 58.119  53.197 81.195  1.00 13.90 ? 293  LEU G CB  1 
ATOM   7844  C  CG  . LEU C 1 275 ? 57.965  51.978 82.128  1.00 14.82 ? 293  LEU G CG  1 
ATOM   7845  C  CD1 . LEU C 1 275 ? 58.018  50.618 81.414  1.00 14.90 ? 293  LEU G CD1 1 
ATOM   7846  C  CD2 . LEU C 1 275 ? 58.920  52.012 83.329  1.00 12.58 ? 293  LEU G CD2 1 
ATOM   7847  N  N   . ASP C 1 276 ? 57.642  55.350 78.979  1.00 14.92 ? 294  ASP G N   1 
ATOM   7848  C  CA  . ASP C 1 276 ? 56.929  56.458 78.353  1.00 15.33 ? 294  ASP G CA  1 
ATOM   7849  C  C   . ASP C 1 276 ? 56.517  56.140 76.917  1.00 15.72 ? 294  ASP G C   1 
ATOM   7850  O  O   . ASP C 1 276 ? 55.359  56.329 76.547  1.00 15.60 ? 294  ASP G O   1 
ATOM   7851  C  CB  . ASP C 1 276 ? 57.786  57.725 78.364  1.00 15.06 ? 294  ASP G CB  1 
ATOM   7852  C  CG  . ASP C 1 276 ? 57.881  58.357 79.730  1.00 15.71 ? 294  ASP G CG  1 
ATOM   7853  O  OD1 . ASP C 1 276 ? 58.513  59.427 79.817  1.00 16.48 ? 294  ASP G OD1 1 
ATOM   7854  O  OD2 . ASP C 1 276 ? 57.332  57.800 80.715  1.00 16.62 ? 294  ASP G OD2 1 
ATOM   7855  N  N   . LEU C 1 277 ? 57.483  55.676 76.128  1.00 15.83 ? 295  LEU G N   1 
ATOM   7856  C  CA  . LEU C 1 277 ? 57.277  55.263 74.739  1.00 16.27 ? 295  LEU G CA  1 
ATOM   7857  C  C   . LEU C 1 277 ? 56.237  54.158 74.601  1.00 16.44 ? 295  LEU G C   1 
ATOM   7858  O  O   . LEU C 1 277 ? 55.282  54.297 73.837  1.00 16.57 ? 295  LEU G O   1 
ATOM   7859  C  CB  . LEU C 1 277 ? 58.605  54.787 74.138  1.00 15.86 ? 295  LEU G CB  1 
ATOM   7860  C  CG  . LEU C 1 277 ? 59.437  55.670 73.197  1.00 17.00 ? 295  LEU G CG  1 
ATOM   7861  C  CD1 . LEU C 1 277 ? 59.114  57.168 73.260  1.00 17.42 ? 295  LEU G CD1 1 
ATOM   7862  C  CD2 . LEU C 1 277 ? 60.946  55.389 73.377  1.00 15.72 ? 295  LEU G CD2 1 
ATOM   7863  N  N   . ALA C 1 278 ? 56.428  53.067 75.346  1.00 16.54 ? 296  ALA G N   1 
ATOM   7864  C  CA  . ALA C 1 278 ? 55.513  51.923 75.311  1.00 16.52 ? 296  ALA G CA  1 
ATOM   7865  C  C   . ALA C 1 278 ? 54.080  52.278 75.738  1.00 16.68 ? 296  ALA G C   1 
ATOM   7866  O  O   . ALA C 1 278 ? 53.118  51.738 75.185  1.00 16.40 ? 296  ALA G O   1 
ATOM   7867  C  CB  . ALA C 1 278 ? 56.058  50.785 76.151  1.00 16.38 ? 296  ALA G CB  1 
ATOM   7868  N  N   . HIS C 1 279 ? 53.947  53.169 76.722  1.00 17.03 ? 297  HIS G N   1 
ATOM   7869  C  CA  . HIS C 1 279 ? 52.638  53.709 77.124  1.00 17.62 ? 297  HIS G CA  1 
ATOM   7870  C  C   . HIS C 1 279 ? 52.003  54.520 75.994  1.00 18.39 ? 297  HIS G C   1 
ATOM   7871  O  O   . HIS C 1 279 ? 50.825  54.343 75.684  1.00 18.67 ? 297  HIS G O   1 
ATOM   7872  C  CB  . HIS C 1 279 ? 52.742  54.576 78.385  1.00 17.01 ? 297  HIS G CB  1 
ATOM   7873  C  CG  . HIS C 1 279 ? 52.715  53.797 79.666  1.00 16.83 ? 297  HIS G CG  1 
ATOM   7874  N  ND1 . HIS C 1 279 ? 53.686  53.925 80.636  1.00 16.27 ? 297  HIS G ND1 1 
ATOM   7875  C  CD2 . HIS C 1 279 ? 51.836  52.880 80.136  1.00 15.79 ? 297  HIS G CD2 1 
ATOM   7876  C  CE1 . HIS C 1 279 ? 53.407  53.121 81.646  1.00 15.67 ? 297  HIS G CE1 1 
ATOM   7877  N  NE2 . HIS C 1 279 ? 52.288  52.477 81.368  1.00 15.71 ? 297  HIS G NE2 1 
ATOM   7878  N  N   . GLN C 1 280 ? 52.797  55.398 75.387  1.00 19.18 ? 298  GLN G N   1 
ATOM   7879  C  CA  . GLN C 1 280 ? 52.352  56.238 74.277  1.00 20.35 ? 298  GLN G CA  1 
ATOM   7880  C  C   . GLN C 1 280 ? 51.938  55.424 73.036  1.00 20.20 ? 298  GLN G C   1 
ATOM   7881  O  O   . GLN C 1 280 ? 50.944  55.751 72.383  1.00 20.31 ? 298  GLN G O   1 
ATOM   7882  C  CB  . GLN C 1 280 ? 53.420  57.292 73.936  1.00 20.62 ? 298  GLN G CB  1 
ATOM   7883  C  CG  . GLN C 1 280 ? 53.240  58.654 74.655  1.00 23.98 ? 298  GLN G CG  1 
ATOM   7884  C  CD  . GLN C 1 280 ? 53.992  58.806 75.996  1.00 28.40 ? 298  GLN G CD  1 
ATOM   7885  O  OE1 . GLN C 1 280 ? 53.721  58.087 76.964  1.00 31.14 ? 298  GLN G OE1 1 
ATOM   7886  N  NE2 . GLN C 1 280 ? 54.908  59.782 76.062  1.00 27.71 ? 298  GLN G NE2 1 
ATOM   7887  N  N   . TRP C 1 281 ? 52.680  54.359 72.735  1.00 20.04 ? 299  TRP G N   1 
ATOM   7888  C  CA  . TRP C 1 281 ? 52.364  53.477 71.602  1.00 20.11 ? 299  TRP G CA  1 
ATOM   7889  C  C   . TRP C 1 281 ? 50.997  52.784 71.730  1.00 20.25 ? 299  TRP G C   1 
ATOM   7890  O  O   . TRP C 1 281 ? 50.259  52.661 70.744  1.00 20.09 ? 299  TRP G O   1 
ATOM   7891  C  CB  . TRP C 1 281 ? 53.472  52.437 71.394  1.00 20.16 ? 299  TRP G CB  1 
ATOM   7892  C  CG  . TRP C 1 281 ? 54.815  53.029 71.010  1.00 20.51 ? 299  TRP G CG  1 
ATOM   7893  C  CD1 . TRP C 1 281 ? 55.045  54.247 70.432  1.00 20.13 ? 299  TRP G CD1 1 
ATOM   7894  C  CD2 . TRP C 1 281 ? 56.102  52.407 71.156  1.00 20.55 ? 299  TRP G CD2 1 
ATOM   7895  N  NE1 . TRP C 1 281 ? 56.391  54.427 70.224  1.00 20.94 ? 299  TRP G NE1 1 
ATOM   7896  C  CE2 . TRP C 1 281 ? 57.062  53.312 70.653  1.00 20.53 ? 299  TRP G CE2 1 
ATOM   7897  C  CE3 . TRP C 1 281 ? 56.534  51.176 71.665  1.00 20.54 ? 299  TRP G CE3 1 
ATOM   7898  C  CZ2 . TRP C 1 281 ? 58.429  53.026 70.644  1.00 20.26 ? 299  TRP G CZ2 1 
ATOM   7899  C  CZ3 . TRP C 1 281 ? 57.893  50.894 71.659  1.00 21.03 ? 299  TRP G CZ3 1 
ATOM   7900  C  CH2 . TRP C 1 281 ? 58.825  51.816 71.148  1.00 20.44 ? 299  TRP G CH2 1 
ATOM   7901  N  N   . GLY C 1 282 ? 50.671  52.331 72.939  1.00 19.98 ? 300  GLY G N   1 
ATOM   7902  C  CA  . GLY C 1 282 ? 49.373  51.724 73.218  1.00 19.72 ? 300  GLY G CA  1 
ATOM   7903  C  C   . GLY C 1 282 ? 49.084  50.489 72.389  1.00 19.86 ? 300  GLY G C   1 
ATOM   7904  O  O   . GLY C 1 282 ? 47.935  50.245 72.018  1.00 19.88 ? 300  GLY G O   1 
ATOM   7905  N  N   . GLU C 1 283 ? 50.131  49.712 72.110  1.00 19.71 ? 301  GLU G N   1 
ATOM   7906  C  CA  . GLU C 1 283 ? 50.034  48.509 71.285  1.00 19.49 ? 301  GLU G CA  1 
ATOM   7907  C  C   . GLU C 1 283 ? 50.053  47.226 72.115  1.00 19.35 ? 301  GLU G C   1 
ATOM   7908  O  O   . GLU C 1 283 ? 49.619  46.166 71.652  1.00 19.52 ? 301  GLU G O   1 
ATOM   7909  C  CB  . GLU C 1 283 ? 51.171  48.487 70.264  1.00 19.70 ? 301  GLU G CB  1 
ATOM   7910  C  CG  . GLU C 1 283 ? 51.119  49.636 69.265  1.00 19.61 ? 301  GLU G CG  1 
ATOM   7911  C  CD  . GLU C 1 283 ? 52.384  49.759 68.455  1.00 19.87 ? 301  GLU G CD  1 
ATOM   7912  O  OE1 . GLU C 1 283 ? 53.051  48.725 68.226  1.00 18.38 ? 301  GLU G OE1 1 
ATOM   7913  O  OE2 . GLU C 1 283 ? 52.704  50.899 68.046  1.00 20.46 ? 301  GLU G OE2 1 
ATOM   7914  N  N   . PHE C 1 284 ? 50.565  47.328 73.336  1.00 18.81 ? 302  PHE G N   1 
ATOM   7915  C  CA  . PHE C 1 284 ? 50.616  46.197 74.266  1.00 18.17 ? 302  PHE G CA  1 
ATOM   7916  C  C   . PHE C 1 284 ? 50.499  46.698 75.695  1.00 17.92 ? 302  PHE G C   1 
ATOM   7917  O  O   . PHE C 1 284 ? 50.658  47.892 75.953  1.00 17.66 ? 302  PHE G O   1 
ATOM   7918  C  CB  . PHE C 1 284 ? 51.892  45.360 74.081  1.00 17.90 ? 302  PHE G CB  1 
ATOM   7919  C  CG  . PHE C 1 284 ? 53.145  46.177 73.903  1.00 18.35 ? 302  PHE G CG  1 
ATOM   7920  C  CD1 . PHE C 1 284 ? 53.631  46.462 72.624  1.00 18.27 ? 302  PHE G CD1 1 
ATOM   7921  C  CD2 . PHE C 1 284 ? 53.842  46.664 75.008  1.00 18.33 ? 302  PHE G CD2 1 
ATOM   7922  C  CE1 . PHE C 1 284 ? 54.786  47.223 72.448  1.00 17.79 ? 302  PHE G CE1 1 
ATOM   7923  C  CE2 . PHE C 1 284 ? 54.995  47.431 74.845  1.00 18.11 ? 302  PHE G CE2 1 
ATOM   7924  C  CZ  . PHE C 1 284 ? 55.472  47.707 73.563  1.00 18.48 ? 302  PHE G CZ  1 
ATOM   7925  N  N   . LYS C 1 285 ? 50.202  45.785 76.613  1.00 17.75 ? 303  LYS G N   1 
ATOM   7926  C  CA  . LYS C 1 285 ? 50.175  46.101 78.038  1.00 17.92 ? 303  LYS G CA  1 
ATOM   7927  C  C   . LYS C 1 285 ? 51.571  46.476 78.544  1.00 17.58 ? 303  LYS G C   1 
ATOM   7928  O  O   . LYS C 1 285 ? 52.568  45.881 78.147  1.00 17.64 ? 303  LYS G O   1 
ATOM   7929  C  CB  . LYS C 1 285 ? 49.612  44.922 78.844  1.00 17.88 ? 303  LYS G CB  1 
ATOM   7930  C  CG  . LYS C 1 285 ? 49.147  45.313 80.235  1.00 19.19 ? 303  LYS G CG  1 
ATOM   7931  C  CD  . LYS C 1 285 ? 48.687  44.113 81.050  1.00 20.95 ? 303  LYS G CD  1 
ATOM   7932  C  CE  . LYS C 1 285 ? 48.073  44.565 82.365  1.00 22.92 ? 303  LYS G CE  1 
ATOM   7933  N  NZ  . LYS C 1 285 ? 47.718  43.404 83.228  1.00 24.88 ? 303  LYS G NZ  1 
ATOM   7934  N  N   . VAL C 1 286 ? 51.626  47.486 79.404  1.00 17.82 ? 304  VAL G N   1 
ATOM   7935  C  CA  . VAL C 1 286 ? 52.865  47.941 80.013  1.00 17.88 ? 304  VAL G CA  1 
ATOM   7936  C  C   . VAL C 1 286 ? 52.716  47.755 81.522  1.00 18.27 ? 304  VAL G C   1 
ATOM   7937  O  O   . VAL C 1 286 ? 51.833  48.365 82.134  1.00 18.58 ? 304  VAL G O   1 
ATOM   7938  C  CB  . VAL C 1 286 ? 53.149  49.426 79.674  1.00 17.91 ? 304  VAL G CB  1 
ATOM   7939  C  CG1 . VAL C 1 286 ? 54.470  49.871 80.273  1.00 17.41 ? 304  VAL G CG1 1 
ATOM   7940  C  CG2 . VAL C 1 286 ? 53.151  49.647 78.158  1.00 17.85 ? 304  VAL G CG2 1 
ATOM   7941  N  N   . SER C 1 287 ? 53.557  46.904 82.115  1.00 18.19 ? 305  SER G N   1 
ATOM   7942  C  CA  . SER C 1 287 ? 53.424  46.556 83.538  1.00 17.97 ? 305  SER G CA  1 
ATOM   7943  C  C   . SER C 1 287 ? 54.714  46.668 84.332  1.00 17.40 ? 305  SER G C   1 
ATOM   7944  O  O   . SER C 1 287 ? 55.641  45.894 84.118  1.00 17.23 ? 305  SER G O   1 
ATOM   7945  C  CB  . SER C 1 287 ? 52.902  45.124 83.707  1.00 17.78 ? 305  SER G CB  1 
ATOM   7946  O  OG  . SER C 1 287 ? 51.744  44.899 82.937  1.00 19.91 ? 305  SER G OG  1 
ATOM   7947  N  N   . GLU C 1 288 ? 54.761  47.613 85.267  1.00 17.06 ? 306  GLU G N   1 
ATOM   7948  C  CA  . GLU C 1 288 ? 55.742  47.539 86.342  1.00 16.82 ? 306  GLU G CA  1 
ATOM   7949  C  C   . GLU C 1 288 ? 55.220  46.472 87.304  1.00 16.76 ? 306  GLU G C   1 
ATOM   7950  O  O   . GLU C 1 288 ? 54.148  46.614 87.900  1.00 16.78 ? 306  GLU G O   1 
ATOM   7951  C  CB  . GLU C 1 288 ? 55.966  48.896 87.018  1.00 16.84 ? 306  GLU G CB  1 
ATOM   7952  C  CG  . GLU C 1 288 ? 56.497  49.970 86.054  1.00 17.59 ? 306  GLU G CG  1 
ATOM   7953  C  CD  . GLU C 1 288 ? 56.803  51.300 86.729  1.00 19.12 ? 306  GLU G CD  1 
ATOM   7954  O  OE1 . GLU C 1 288 ? 57.725  51.359 87.573  1.00 19.90 ? 306  GLU G OE1 1 
ATOM   7955  O  OE2 . GLU C 1 288 ? 56.141  52.301 86.394  1.00 18.55 ? 306  GLU G OE2 1 
ATOM   7956  N  N   . ARG C 1 289 ? 55.949  45.368 87.391  1.00 16.40 ? 307  ARG G N   1 
ATOM   7957  C  CA  . ARG C 1 289 ? 55.492  44.222 88.157  1.00 16.29 ? 307  ARG G CA  1 
ATOM   7958  C  C   . ARG C 1 289 ? 56.663  43.340 88.518  1.00 16.11 ? 307  ARG G C   1 
ATOM   7959  O  O   . ARG C 1 289 ? 57.708  43.390 87.873  1.00 16.01 ? 307  ARG G O   1 
ATOM   7960  C  CB  . ARG C 1 289 ? 54.468  43.406 87.354  1.00 16.42 ? 307  ARG G CB  1 
ATOM   7961  C  CG  . ARG C 1 289 ? 54.971  42.922 85.995  1.00 16.09 ? 307  ARG G CG  1 
ATOM   7962  C  CD  . ARG C 1 289 ? 54.130  41.772 85.475  1.00 15.87 ? 307  ARG G CD  1 
ATOM   7963  N  NE  . ARG C 1 289 ? 54.435  40.525 86.167  1.00 15.97 ? 307  ARG G NE  1 
ATOM   7964  C  CZ  . ARG C 1 289 ? 53.757  39.393 86.008  1.00 17.48 ? 307  ARG G CZ  1 
ATOM   7965  N  NH1 . ARG C 1 289 ? 52.716  39.352 85.184  1.00 17.68 ? 307  ARG G NH1 1 
ATOM   7966  N  NH2 . ARG C 1 289 ? 54.112  38.300 86.679  1.00 17.13 ? 307  ARG G NH2 1 
ATOM   7967  N  N   . TYR C 1 290 ? 56.468  42.523 89.544  1.00 16.00 ? 308  TYR G N   1 
ATOM   7968  C  CA  . TYR C 1 290 ? 57.469  41.551 89.954  1.00 15.70 ? 308  TYR G CA  1 
ATOM   7969  C  C   . TYR C 1 290 ? 57.548  40.409 88.949  1.00 15.61 ? 308  TYR G C   1 
ATOM   7970  O  O   . TYR C 1 290 ? 56.536  39.951 88.418  1.00 15.29 ? 308  TYR G O   1 
ATOM   7971  C  CB  . TYR C 1 290 ? 57.199  41.069 91.390  1.00 15.45 ? 308  TYR G CB  1 
ATOM   7972  C  CG  . TYR C 1 290 ? 57.141  42.231 92.357  1.00 15.16 ? 308  TYR G CG  1 
ATOM   7973  C  CD1 . TYR C 1 290 ? 55.928  42.669 92.893  1.00 15.30 ? 308  TYR G CD1 1 
ATOM   7974  C  CD2 . TYR C 1 290 ? 58.297  42.926 92.697  1.00 14.83 ? 308  TYR G CD2 1 
ATOM   7975  C  CE1 . TYR C 1 290 ? 55.875  43.761 93.768  1.00 15.18 ? 308  TYR G CE1 1 
ATOM   7976  C  CE2 . TYR C 1 290 ? 58.258  44.022 93.559  1.00 15.41 ? 308  TYR G CE2 1 
ATOM   7977  C  CZ  . TYR C 1 290 ? 57.051  44.434 94.094  1.00 15.53 ? 308  TYR G CZ  1 
ATOM   7978  O  OH  . TYR C 1 290 ? 57.028  45.522 94.941  1.00 15.34 ? 308  TYR G OH  1 
ATOM   7979  N  N   . LEU C 1 291 ? 58.779  39.992 88.683  1.00 15.88 ? 309  LEU G N   1 
ATOM   7980  C  CA  . LEU C 1 291 ? 59.106  38.957 87.721  1.00 16.26 ? 309  LEU G CA  1 
ATOM   7981  C  C   . LEU C 1 291 ? 60.072  38.000 88.411  1.00 16.62 ? 309  LEU G C   1 
ATOM   7982  O  O   . LEU C 1 291 ? 61.121  38.428 88.891  1.00 16.91 ? 309  LEU G O   1 
ATOM   7983  C  CB  . LEU C 1 291 ? 59.786  39.600 86.507  1.00 16.15 ? 309  LEU G CB  1 
ATOM   7984  C  CG  . LEU C 1 291 ? 59.129  39.880 85.142  1.00 17.46 ? 309  LEU G CG  1 
ATOM   7985  C  CD1 . LEU C 1 291 ? 57.593  39.812 85.102  1.00 15.80 ? 309  LEU G CD1 1 
ATOM   7986  C  CD2 . LEU C 1 291 ? 59.664  41.199 84.543  1.00 17.11 ? 309  LEU G CD2 1 
ATOM   7987  N  N   . THR C 1 292 ? 59.718  36.719 88.481  1.00 16.97 ? 310  THR G N   1 
ATOM   7988  C  CA  . THR C 1 292 ? 60.586  35.718 89.110  1.00 17.56 ? 310  THR G CA  1 
ATOM   7989  C  C   . THR C 1 292 ? 61.188  34.760 88.083  1.00 18.14 ? 310  THR G C   1 
ATOM   7990  O  O   . THR C 1 292 ? 60.750  34.719 86.928  1.00 18.47 ? 310  THR G O   1 
ATOM   7991  C  CB  . THR C 1 292 ? 59.844  34.897 90.199  1.00 17.33 ? 310  THR G CB  1 
ATOM   7992  O  OG1 . THR C 1 292 ? 58.911  34.007 89.577  1.00 17.45 ? 310  THR G OG1 1 
ATOM   7993  C  CG2 . THR C 1 292 ? 59.111  35.814 91.175  1.00 16.97 ? 310  THR G CG2 1 
ATOM   7994  N  N   . MET C 1 293 ? 62.193  33.995 88.504  1.00 18.63 ? 311  MET G N   1 
ATOM   7995  C  CA  . MET C 1 293 ? 62.806  32.984 87.636  1.00 19.24 ? 311  MET G CA  1 
ATOM   7996  C  C   . MET C 1 293 ? 61.783  31.934 87.198  1.00 19.62 ? 311  MET G C   1 
ATOM   7997  O  O   . MET C 1 293 ? 61.781  31.510 86.043  1.00 19.40 ? 311  MET G O   1 
ATOM   7998  C  CB  . MET C 1 293 ? 64.004  32.318 88.314  1.00 18.96 ? 311  MET G CB  1 
ATOM   7999  C  CG  . MET C 1 293 ? 65.267  33.177 88.371  1.00 19.19 ? 311  MET G CG  1 
ATOM   8000  S  SD  . MET C 1 293 ? 65.863  33.796 86.777  1.00 20.25 ? 311  MET G SD  1 
ATOM   8001  C  CE  . MET C 1 293 ? 66.315  32.291 85.913  1.00 19.87 ? 311  MET G CE  1 
ATOM   8002  N  N   . ASP C 1 294 ? 60.907  31.542 88.121  1.00 20.32 ? 312  ASP G N   1 
ATOM   8003  C  CA  . ASP C 1 294 ? 59.823  30.610 87.822  1.00 21.10 ? 312  ASP G CA  1 
ATOM   8004  C  C   . ASP C 1 294 ? 58.813  31.175 86.816  1.00 21.18 ? 312  ASP G C   1 
ATOM   8005  O  O   . ASP C 1 294 ? 58.398  30.458 85.911  1.00 20.82 ? 312  ASP G O   1 
ATOM   8006  C  CB  . ASP C 1 294 ? 59.136  30.140 89.105  1.00 21.48 ? 312  ASP G CB  1 
ATOM   8007  C  CG  . ASP C 1 294 ? 59.981  29.144 89.888  1.00 23.73 ? 312  ASP G CG  1 
ATOM   8008  O  OD1 . ASP C 1 294 ? 61.061  28.751 89.390  1.00 26.40 ? 312  ASP G OD1 1 
ATOM   8009  O  OD2 . ASP C 1 294 ? 59.566  28.749 91.003  1.00 26.38 ? 312  ASP G OD2 1 
ATOM   8010  N  N   . ASP C 1 295 ? 58.441  32.451 86.961  1.00 21.43 ? 313  ASP G N   1 
ATOM   8011  C  CA  . ASP C 1 295 ? 57.609  33.139 85.961  1.00 21.72 ? 313  ASP G CA  1 
ATOM   8012  C  C   . ASP C 1 295 ? 58.212  33.003 84.569  1.00 22.16 ? 313  ASP G C   1 
ATOM   8013  O  O   . ASP C 1 295 ? 57.506  32.703 83.607  1.00 21.77 ? 313  ASP G O   1 
ATOM   8014  C  CB  . ASP C 1 295 ? 57.499  34.642 86.250  1.00 21.56 ? 313  ASP G CB  1 
ATOM   8015  C  CG  . ASP C 1 295 ? 56.653  34.965 87.459  1.00 21.52 ? 313  ASP G CG  1 
ATOM   8016  O  OD1 . ASP C 1 295 ? 55.931  34.080 87.966  1.00 21.90 ? 313  ASP G OD1 1 
ATOM   8017  O  OD2 . ASP C 1 295 ? 56.717  36.135 87.899  1.00 20.98 ? 313  ASP G OD2 1 
ATOM   8018  N  N   . LEU C 1 296 ? 59.520  33.253 84.484  1.00 22.83 ? 314  LEU G N   1 
ATOM   8019  C  CA  . LEU C 1 296 ? 60.269  33.261 83.230  1.00 23.74 ? 314  LEU G CA  1 
ATOM   8020  C  C   . LEU C 1 296 ? 60.341  31.843 82.689  1.00 24.40 ? 314  LEU G C   1 
ATOM   8021  O  O   . LEU C 1 296 ? 60.043  31.591 81.523  1.00 24.41 ? 314  LEU G O   1 
ATOM   8022  C  CB  . LEU C 1 296 ? 61.692  33.754 83.488  1.00 23.44 ? 314  LEU G CB  1 
ATOM   8023  C  CG  . LEU C 1 296 ? 62.488  34.630 82.519  1.00 23.88 ? 314  LEU G CG  1 
ATOM   8024  C  CD1 . LEU C 1 296 ? 63.966  34.305 82.685  1.00 23.72 ? 314  LEU G CD1 1 
ATOM   8025  C  CD2 . LEU C 1 296 ? 62.074  34.511 81.064  1.00 23.52 ? 314  LEU G CD2 1 
ATOM   8026  N  N   . THR C 1 297 ? 60.763  30.939 83.570  1.00 25.39 ? 315  THR G N   1 
ATOM   8027  C  CA  . THR C 1 297 ? 60.883  29.511 83.312  1.00 26.48 ? 315  THR G CA  1 
ATOM   8028  C  C   . THR C 1 297 ? 59.602  28.882 82.743  1.00 26.65 ? 315  THR G C   1 
ATOM   8029  O  O   . THR C 1 297 ? 59.663  28.181 81.731  1.00 26.86 ? 315  THR G O   1 
ATOM   8030  C  CB  . THR C 1 297 ? 61.414  28.783 84.589  1.00 26.17 ? 315  THR G CB  1 
ATOM   8031  O  OG1 . THR C 1 297 ? 62.824  28.585 84.452  1.00 27.69 ? 315  THR G OG1 1 
ATOM   8032  C  CG2 . THR C 1 297 ? 60.740  27.444 84.835  1.00 27.67 ? 315  THR G CG2 1 
ATOM   8033  N  N   . THR C 1 298 ? 58.453  29.147 83.360  1.00 27.15 ? 316  THR G N   1 
ATOM   8034  C  CA  . THR C 1 298 ? 57.213  28.534 82.871  1.00 28.02 ? 316  THR G CA  1 
ATOM   8035  C  C   . THR C 1 298 ? 56.665  29.234 81.620  1.00 28.06 ? 316  THR G C   1 
ATOM   8036  O  O   . THR C 1 298 ? 55.956  28.621 80.823  1.00 28.34 ? 316  THR G O   1 
ATOM   8037  C  CB  . THR C 1 298 ? 56.114  28.337 83.970  1.00 28.02 ? 316  THR G CB  1 
ATOM   8038  O  OG1 . THR C 1 298 ? 55.239  29.467 84.024  1.00 29.79 ? 316  THR G OG1 1 
ATOM   8039  C  CG2 . THR C 1 298 ? 56.725  28.069 85.336  1.00 27.67 ? 316  THR G CG2 1 
ATOM   8040  N  N   . ALA C 1 299 ? 57.017  30.507 81.447  1.00 28.22 ? 317  ALA G N   1 
ATOM   8041  C  CA  . ALA C 1 299 ? 56.683  31.246 80.234  1.00 28.30 ? 317  ALA G CA  1 
ATOM   8042  C  C   . ALA C 1 299 ? 57.485  30.740 79.038  1.00 28.50 ? 317  ALA G C   1 
ATOM   8043  O  O   . ALA C 1 299 ? 56.957  30.644 77.927  1.00 28.61 ? 317  ALA G O   1 
ATOM   8044  C  CB  . ALA C 1 299 ? 56.909  32.722 80.433  1.00 28.25 ? 317  ALA G CB  1 
ATOM   8045  N  N   . LEU C 1 300 ? 58.755  30.414 79.272  1.00 28.66 ? 318  LEU G N   1 
ATOM   8046  C  CA  . LEU C 1 300 ? 59.623  29.871 78.230  1.00 28.97 ? 318  LEU G CA  1 
ATOM   8047  C  C   . LEU C 1 300 ? 59.183  28.481 77.783  1.00 29.48 ? 318  LEU G C   1 
ATOM   8048  O  O   . LEU C 1 300 ? 59.211  28.181 76.588  1.00 29.70 ? 318  LEU G O   1 
ATOM   8049  C  CB  . LEU C 1 300 ? 61.083  29.842 78.688  1.00 28.69 ? 318  LEU G CB  1 
ATOM   8050  C  CG  . LEU C 1 300 ? 61.845  31.170 78.698  1.00 27.97 ? 318  LEU G CG  1 
ATOM   8051  C  CD1 . LEU C 1 300 ? 63.062  31.062 79.595  1.00 25.98 ? 318  LEU G CD1 1 
ATOM   8052  C  CD2 . LEU C 1 300 ? 62.241  31.609 77.289  1.00 26.15 ? 318  LEU G CD2 1 
ATOM   8053  N  N   . GLU C 1 301 ? 58.786  27.643 78.744  1.00 30.03 ? 319  GLU G N   1 
ATOM   8054  C  CA  . GLU C 1 301 ? 58.181  26.335 78.462  1.00 30.46 ? 319  GLU G CA  1 
ATOM   8055  C  C   . GLU C 1 301 ? 56.951  26.487 77.554  1.00 30.26 ? 319  GLU G C   1 
ATOM   8056  O  O   . GLU C 1 301 ? 56.782  25.735 76.593  1.00 30.54 ? 319  GLU G O   1 
ATOM   8057  C  CB  . GLU C 1 301 ? 57.791  25.622 79.767  1.00 30.87 ? 319  GLU G CB  1 
ATOM   8058  C  CG  . GLU C 1 301 ? 58.963  25.066 80.583  1.00 32.92 ? 319  GLU G CG  1 
ATOM   8059  C  CD  . GLU C 1 301 ? 58.622  24.812 82.063  1.00 35.56 ? 319  GLU G CD  1 
ATOM   8060  O  OE1 . GLU C 1 301 ? 57.429  24.878 82.446  1.00 36.31 ? 319  GLU G OE1 1 
ATOM   8061  O  OE2 . GLU C 1 301 ? 59.563  24.542 82.848  1.00 36.49 ? 319  GLU G OE2 1 
ATOM   8062  N  N   . GLY C 1 302 ? 56.106  27.473 77.856  1.00 29.90 ? 320  GLY G N   1 
ATOM   8063  C  CA  . GLY C 1 302 ? 54.910  27.752 77.057  1.00 29.36 ? 320  GLY G CA  1 
ATOM   8064  C  C   . GLY C 1 302 ? 55.115  28.658 75.851  1.00 29.05 ? 320  GLY G C   1 
ATOM   8065  O  O   . GLY C 1 302 ? 54.142  29.172 75.297  1.00 29.11 ? 320  GLY G O   1 
ATOM   8066  N  N   . ASN C 1 303 ? 56.374  28.846 75.444  1.00 28.81 ? 321  ASN G N   1 
ATOM   8067  C  CA  . ASN C 1 303 ? 56.754  29.704 74.298  1.00 28.40 ? 321  ASN G CA  1 
ATOM   8068  C  C   . ASN C 1 303 ? 56.181  31.129 74.341  1.00 27.74 ? 321  ASN G C   1 
ATOM   8069  O  O   . ASN C 1 303 ? 55.837  31.708 73.304  1.00 27.68 ? 321  ASN G O   1 
ATOM   8070  C  CB  . ASN C 1 303 ? 56.400  29.030 72.966  1.00 28.75 ? 321  ASN G CB  1 
ATOM   8071  C  CG  . ASN C 1 303 ? 57.128  27.724 72.763  1.00 29.83 ? 321  ASN G CG  1 
ATOM   8072  O  OD1 . ASN C 1 303 ? 58.355  27.691 72.648  1.00 31.76 ? 321  ASN G OD1 1 
ATOM   8073  N  ND2 . ASN C 1 303 ? 56.373  26.631 72.717  1.00 31.27 ? 321  ASN G ND2 1 
ATOM   8074  N  N   . ARG C 1 304 ? 56.094  31.687 75.546  1.00 26.72 ? 322  ARG G N   1 
ATOM   8075  C  CA  . ARG C 1 304 ? 55.430  32.967 75.761  1.00 25.76 ? 322  ARG G CA  1 
ATOM   8076  C  C   . ARG C 1 304 ? 56.388  34.169 75.748  1.00 25.22 ? 322  ARG G C   1 
ATOM   8077  O  O   . ARG C 1 304 ? 55.950  35.311 75.629  1.00 24.80 ? 322  ARG G O   1 
ATOM   8078  C  CB  . ARG C 1 304 ? 54.628  32.921 77.061  1.00 25.74 ? 322  ARG G CB  1 
ATOM   8079  C  CG  . ARG C 1 304 ? 53.280  32.200 76.958  1.00 25.52 ? 322  ARG G CG  1 
ATOM   8080  C  CD  . ARG C 1 304 ? 52.716  31.874 78.347  1.00 25.91 ? 322  ARG G CD  1 
ATOM   8081  N  NE  . ARG C 1 304 ? 52.889  32.992 79.276  1.00 26.17 ? 322  ARG G NE  1 
ATOM   8082  C  CZ  . ARG C 1 304 ? 53.185  32.870 80.567  1.00 25.96 ? 322  ARG G CZ  1 
ATOM   8083  N  NH1 . ARG C 1 304 ? 53.345  31.673 81.113  1.00 24.86 ? 322  ARG G NH1 1 
ATOM   8084  N  NH2 . ARG C 1 304 ? 53.329  33.957 81.314  1.00 26.48 ? 322  ARG G NH2 1 
ATOM   8085  N  N   . VAL C 1 305 ? 57.688  33.903 75.847  1.00 24.70 ? 323  VAL G N   1 
ATOM   8086  C  CA  . VAL C 1 305 ? 58.701  34.964 75.885  1.00 24.24 ? 323  VAL G CA  1 
ATOM   8087  C  C   . VAL C 1 305 ? 59.112  35.363 74.476  1.00 23.90 ? 323  VAL G C   1 
ATOM   8088  O  O   . VAL C 1 305 ? 59.408  34.507 73.641  1.00 23.94 ? 323  VAL G O   1 
ATOM   8089  C  CB  . VAL C 1 305 ? 59.968  34.550 76.698  1.00 24.05 ? 323  VAL G CB  1 
ATOM   8090  C  CG1 . VAL C 1 305 ? 60.987  35.687 76.747  1.00 24.27 ? 323  VAL G CG1 1 
ATOM   8091  C  CG2 . VAL C 1 305 ? 59.595  34.136 78.113  1.00 24.03 ? 323  VAL G CG2 1 
ATOM   8092  N  N   . ARG C 1 306 ? 59.133  36.668 74.226  1.00 23.59 ? 324  ARG G N   1 
ATOM   8093  C  CA  . ARG C 1 306 ? 59.587  37.210 72.953  1.00 23.46 ? 324  ARG G CA  1 
ATOM   8094  C  C   . ARG C 1 306 ? 61.017  37.719 73.082  1.00 22.72 ? 324  ARG G C   1 
ATOM   8095  O  O   . ARG C 1 306 ? 61.925  37.243 72.397  1.00 22.41 ? 324  ARG G O   1 
ATOM   8096  C  CB  . ARG C 1 306 ? 58.668  38.348 72.497  1.00 23.78 ? 324  ARG G CB  1 
ATOM   8097  C  CG  . ARG C 1 306 ? 57.200  37.968 72.343  1.00 26.77 ? 324  ARG G CG  1 
ATOM   8098  C  CD  . ARG C 1 306 ? 56.856  37.586 70.906  1.00 31.88 ? 324  ARG G CD  1 
ATOM   8099  N  NE  . ARG C 1 306 ? 57.116  38.682 69.966  1.00 35.64 ? 324  ARG G NE  1 
ATOM   8100  C  CZ  . ARG C 1 306 ? 56.183  39.451 69.399  1.00 38.13 ? 324  ARG G CZ  1 
ATOM   8101  N  NH1 . ARG C 1 306 ? 54.889  39.262 69.660  1.00 38.12 ? 324  ARG G NH1 1 
ATOM   8102  N  NH2 . ARG C 1 306 ? 56.552  40.417 68.558  1.00 38.93 ? 324  ARG G NH2 1 
ATOM   8103  N  N   . GLU C 1 307 ? 61.209  38.685 73.974  1.00 21.87 ? 325  GLU G N   1 
ATOM   8104  C  CA  . GLU C 1 307 ? 62.487  39.357 74.119  1.00 21.35 ? 325  GLU G CA  1 
ATOM   8105  C  C   . GLU C 1 307 ? 62.795  39.655 75.579  1.00 21.11 ? 325  GLU G C   1 
ATOM   8106  O  O   . GLU C 1 307 ? 61.894  39.877 76.399  1.00 20.92 ? 325  GLU G O   1 
ATOM   8107  C  CB  . GLU C 1 307 ? 62.498  40.682 73.341  1.00 21.27 ? 325  GLU G CB  1 
ATOM   8108  C  CG  . GLU C 1 307 ? 62.248  40.574 71.839  1.00 21.01 ? 325  GLU G CG  1 
ATOM   8109  C  CD  . GLU C 1 307 ? 62.084  41.929 71.185  1.00 21.45 ? 325  GLU G CD  1 
ATOM   8110  O  OE1 . GLU C 1 307 ? 61.183  42.072 70.323  1.00 20.51 ? 325  GLU G OE1 1 
ATOM   8111  O  OE2 . GLU C 1 307 ? 62.849  42.856 71.545  1.00 20.32 ? 325  GLU G OE2 1 
ATOM   8112  N  N   . MET C 1 308 ? 64.084  39.662 75.882  1.00 20.62 ? 326  MET G N   1 
ATOM   8113  C  CA  . MET C 1 308 ? 64.586  40.198 77.130  1.00 20.19 ? 326  MET G CA  1 
ATOM   8114  C  C   . MET C 1 308 ? 65.761  41.116 76.823  1.00 19.60 ? 326  MET G C   1 
ATOM   8115  O  O   . MET C 1 308 ? 66.642  40.774 76.028  1.00 19.52 ? 326  MET G O   1 
ATOM   8116  C  CB  . MET C 1 308 ? 65.018  39.086 78.074  1.00 20.28 ? 326  MET G CB  1 
ATOM   8117  C  CG  . MET C 1 308 ? 65.341  39.590 79.461  1.00 21.62 ? 326  MET G CG  1 
ATOM   8118  S  SD  . MET C 1 308 ? 65.912  38.303 80.572  1.00 25.37 ? 326  MET G SD  1 
ATOM   8119  C  CE  . MET C 1 308 ? 64.554  37.149 80.447  1.00 23.71 ? 326  MET G CE  1 
ATOM   8120  N  N   . PHE C 1 309 ? 65.759  42.289 77.442  1.00 18.80 ? 327  PHE G N   1 
ATOM   8121  C  CA  . PHE C 1 309 ? 66.841  43.240 77.253  1.00 18.36 ? 327  PHE G CA  1 
ATOM   8122  C  C   . PHE C 1 309 ? 67.045  44.111 78.470  1.00 18.23 ? 327  PHE G C   1 
ATOM   8123  O  O   . PHE C 1 309 ? 66.145  44.318 79.285  1.00 17.59 ? 327  PHE G O   1 
ATOM   8124  C  CB  . PHE C 1 309 ? 66.643  44.111 75.997  1.00 17.98 ? 327  PHE G CB  1 
ATOM   8125  C  CG  . PHE C 1 309 ? 65.311  44.814 75.935  1.00 17.63 ? 327  PHE G CG  1 
ATOM   8126  C  CD1 . PHE C 1 309 ? 64.194  44.170 75.400  1.00 17.75 ? 327  PHE G CD1 1 
ATOM   8127  C  CD2 . PHE C 1 309 ? 65.178  46.123 76.384  1.00 16.46 ? 327  PHE G CD2 1 
ATOM   8128  C  CE1 . PHE C 1 309 ? 62.962  44.814 75.329  1.00 17.76 ? 327  PHE G CE1 1 
ATOM   8129  C  CE2 . PHE C 1 309 ? 63.952  46.778 76.320  1.00 17.33 ? 327  PHE G CE2 1 
ATOM   8130  C  CZ  . PHE C 1 309 ? 62.841  46.125 75.792  1.00 17.36 ? 327  PHE G CZ  1 
ATOM   8131  N  N   . SER C 1 310 ? 68.263  44.613 78.573  1.00 18.31 ? 328  SER G N   1 
ATOM   8132  C  CA  . SER C 1 310 ? 68.599  45.585 79.572  1.00 18.44 ? 328  SER G CA  1 
ATOM   8133  C  C   . SER C 1 310 ? 68.629  46.966 78.946  1.00 17.32 ? 328  SER G C   1 
ATOM   8134  O  O   . SER C 1 310 ? 68.742  47.094 77.731  1.00 17.18 ? 328  SER G O   1 
ATOM   8135  C  CB  . SER C 1 310 ? 69.955  45.240 80.125  1.00 19.33 ? 328  SER G CB  1 
ATOM   8136  O  OG  . SER C 1 310 ? 70.844  44.914 79.066  1.00 23.43 ? 328  SER G OG  1 
ATOM   8137  N  N   . SER C 1 311 ? 68.512  47.989 79.783  1.00 16.29 ? 329  SER G N   1 
ATOM   8138  C  CA  . SER C 1 311 ? 68.581  49.380 79.337  1.00 15.19 ? 329  SER G CA  1 
ATOM   8139  C  C   . SER C 1 311 ? 69.507  50.186 80.232  1.00 14.51 ? 329  SER G C   1 
ATOM   8140  O  O   . SER C 1 311 ? 69.496  50.024 81.441  1.00 14.31 ? 329  SER G O   1 
ATOM   8141  C  CB  . SER C 1 311 ? 67.183  50.019 79.316  1.00 15.26 ? 329  SER G CB  1 
ATOM   8142  O  OG  . SER C 1 311 ? 66.639  50.164 80.624  1.00 14.14 ? 329  SER G OG  1 
ATOM   8143  N  N   . GLY C 1 312 ? 70.303  51.054 79.622  1.00 13.87 ? 330  GLY G N   1 
ATOM   8144  C  CA  . GLY C 1 312 ? 71.164  51.977 80.349  1.00 13.79 ? 330  GLY G CA  1 
ATOM   8145  C  C   . GLY C 1 312 ? 71.729  53.012 79.398  1.00 14.08 ? 330  GLY G C   1 
ATOM   8146  O  O   . GLY C 1 312 ? 71.606  52.873 78.183  1.00 13.57 ? 330  GLY G O   1 
ATOM   8147  N  N   . THR C 1 313 ? 72.342  54.053 79.953  1.00 14.38 ? 331  THR G N   1 
ATOM   8148  C  CA  . THR C 1 313 ? 72.926  55.129 79.152  1.00 15.10 ? 331  THR G CA  1 
ATOM   8149  C  C   . THR C 1 313 ? 74.046  54.639 78.220  1.00 15.71 ? 331  THR G C   1 
ATOM   8150  O  O   . THR C 1 313 ? 74.119  55.074 77.079  1.00 15.90 ? 331  THR G O   1 
ATOM   8151  C  CB  . THR C 1 313 ? 73.385  56.314 80.045  1.00 15.11 ? 331  THR G CB  1 
ATOM   8152  O  OG1 . THR C 1 313 ? 72.237  56.890 80.676  1.00 14.97 ? 331  THR G OG1 1 
ATOM   8153  C  CG2 . THR C 1 313 ? 74.096  57.393 79.239  1.00 13.81 ? 331  THR G CG2 1 
ATOM   8154  N  N   . ALA C 1 314 ? 74.881  53.712 78.686  1.00 16.77 ? 332  ALA G N   1 
ATOM   8155  C  CA  . ALA C 1 314 ? 75.975  53.175 77.855  1.00 18.00 ? 332  ALA G CA  1 
ATOM   8156  C  C   . ALA C 1 314 ? 75.559  52.419 76.576  1.00 18.61 ? 332  ALA G C   1 
ATOM   8157  O  O   . ALA C 1 314 ? 76.186  52.592 75.535  1.00 19.34 ? 332  ALA G O   1 
ATOM   8158  C  CB  . ALA C 1 314 ? 76.947  52.330 78.692  1.00 17.78 ? 332  ALA G CB  1 
ATOM   8159  N  N   . CYS C 1 315 ? 74.517  51.594 76.645  1.00 19.23 ? 333  CYS G N   1 
ATOM   8160  C  CA  . CYS C 1 315 ? 74.140  50.745 75.506  1.00 19.85 ? 333  CYS G CA  1 
ATOM   8161  C  C   . CYS C 1 315 ? 72.814  51.122 74.856  1.00 19.72 ? 333  CYS G C   1 
ATOM   8162  O  O   . CYS C 1 315 ? 72.518  50.679 73.737  1.00 19.49 ? 333  CYS G O   1 
ATOM   8163  C  CB  . CYS C 1 315 ? 74.058  49.284 75.944  1.00 19.84 ? 333  CYS G CB  1 
ATOM   8164  S  SG  . CYS C 1 315 ? 72.644  48.965 77.012  1.00 22.92 ? 333  CYS G SG  1 
ATOM   8165  N  N   . VAL C 1 316 ? 72.029  51.934 75.570  1.00 19.75 ? 334  VAL G N   1 
ATOM   8166  C  CA  . VAL C 1 316 ? 70.611  52.190 75.290  1.00 19.37 ? 334  VAL G CA  1 
ATOM   8167  C  C   . VAL C 1 316 ? 69.818  50.916 75.591  1.00 19.28 ? 334  VAL G C   1 
ATOM   8168  O  O   . VAL C 1 316 ? 69.047  50.864 76.547  1.00 18.85 ? 334  VAL G O   1 
ATOM   8169  C  CB  . VAL C 1 316 ? 70.331  52.699 73.844  1.00 19.52 ? 334  VAL G CB  1 
ATOM   8170  C  CG1 . VAL C 1 316 ? 68.878  53.120 73.693  1.00 18.64 ? 334  VAL G CG1 1 
ATOM   8171  C  CG2 . VAL C 1 316 ? 71.244  53.860 73.479  1.00 19.56 ? 334  VAL G CG2 1 
ATOM   8172  N  N   . VAL C 1 317 ? 70.034  49.890 74.774  1.00 19.22 ? 335  VAL G N   1 
ATOM   8173  C  CA  . VAL C 1 317 ? 69.333  48.620 74.900  1.00 19.47 ? 335  VAL G CA  1 
ATOM   8174  C  C   . VAL C 1 317 ? 70.314  47.471 74.651  1.00 19.29 ? 335  VAL G C   1 
ATOM   8175  O  O   . VAL C 1 317 ? 71.165  47.561 73.770  1.00 19.40 ? 335  VAL G O   1 
ATOM   8176  C  CB  . VAL C 1 317 ? 68.073  48.608 73.966  1.00 19.59 ? 335  VAL G CB  1 
ATOM   8177  C  CG1 . VAL C 1 317 ? 67.910  47.311 73.211  1.00 19.97 ? 335  VAL G CG1 1 
ATOM   8178  C  CG2 . VAL C 1 317 ? 66.815  48.962 74.777  1.00 20.31 ? 335  VAL G CG2 1 
ATOM   8179  N  N   . CYS C 1 318 ? 70.212  46.411 75.447  1.00 19.05 ? 336  CYS G N   1 
ATOM   8180  C  CA  . CYS C 1 318 ? 71.128  45.281 75.333  1.00 19.22 ? 336  CYS G CA  1 
ATOM   8181  C  C   . CYS C 1 318 ? 70.381  43.940 75.386  1.00 18.61 ? 336  CYS G C   1 
ATOM   8182  O  O   . CYS C 1 318 ? 69.972  43.510 76.457  1.00 18.34 ? 336  CYS G O   1 
ATOM   8183  C  CB  . CYS C 1 318 ? 72.196  45.356 76.434  1.00 19.43 ? 336  CYS G CB  1 
ATOM   8184  S  SG  . CYS C 1 318 ? 73.382  43.978 76.465  1.00 22.73 ? 336  CYS G SG  1 
ATOM   8185  N  N   . PRO C 1 319 ? 70.211  43.278 74.223  1.00 18.45 ? 337  PRO G N   1 
ATOM   8186  C  CA  . PRO C 1 319 ? 69.495  41.998 74.151  1.00 18.35 ? 337  PRO G CA  1 
ATOM   8187  C  C   . PRO C 1 319 ? 70.144  40.887 74.971  1.00 18.10 ? 337  PRO G C   1 
ATOM   8188  O  O   . PRO C 1 319 ? 71.373  40.812 75.060  1.00 17.81 ? 337  PRO G O   1 
ATOM   8189  C  CB  . PRO C 1 319 ? 69.540  41.645 72.657  1.00 18.69 ? 337  PRO G CB  1 
ATOM   8190  C  CG  . PRO C 1 319 ? 69.834  42.925 71.966  1.00 18.42 ? 337  PRO G CG  1 
ATOM   8191  C  CD  . PRO C 1 319 ? 70.687  43.708 72.896  1.00 18.23 ? 337  PRO G CD  1 
ATOM   8192  N  N   . VAL C 1 320 ? 69.304  40.046 75.569  1.00 17.91 ? 338  VAL G N   1 
ATOM   8193  C  CA  . VAL C 1 320 ? 69.753  38.909 76.365  1.00 18.07 ? 338  VAL G CA  1 
ATOM   8194  C  C   . VAL C 1 320 ? 69.371  37.610 75.650  1.00 18.48 ? 338  VAL G C   1 
ATOM   8195  O  O   . VAL C 1 320 ? 68.215  37.422 75.279  1.00 18.27 ? 338  VAL G O   1 
ATOM   8196  C  CB  . VAL C 1 320 ? 69.147  38.945 77.791  1.00 17.84 ? 338  VAL G CB  1 
ATOM   8197  C  CG1 . VAL C 1 320 ? 69.409  37.637 78.536  1.00 17.11 ? 338  VAL G CG1 1 
ATOM   8198  C  CG2 . VAL C 1 320 ? 69.687  40.150 78.575  1.00 17.48 ? 338  VAL G CG2 1 
ATOM   8199  N  N   . SER C 1 321 ? 70.343  36.720 75.466  1.00 19.00 ? 339  SER G N   1 
ATOM   8200  C  CA  . SER C 1 321 ? 70.111  35.469 74.739  1.00 19.73 ? 339  SER G CA  1 
ATOM   8201  C  C   . SER C 1 321 ? 70.042  34.236 75.639  1.00 20.14 ? 339  SER G C   1 
ATOM   8202  O  O   . SER C 1 321 ? 69.363  33.259 75.300  1.00 20.48 ? 339  SER G O   1 
ATOM   8203  C  CB  . SER C 1 321 ? 71.178  35.270 73.656  1.00 19.85 ? 339  SER G CB  1 
ATOM   8204  O  OG  . SER C 1 321 ? 72.466  35.121 74.233  1.00 20.89 ? 339  SER G OG  1 
ATOM   8205  N  N   . ASP C 1 322 ? 70.749  34.274 76.770  1.00 20.46 ? 340  ASP G N   1 
ATOM   8206  C  CA  . ASP C 1 322 ? 70.852  33.116 77.667  1.00 20.76 ? 340  ASP G CA  1 
ATOM   8207  C  C   . ASP C 1 322 ? 70.978  33.509 79.138  1.00 21.02 ? 340  ASP G C   1 
ATOM   8208  O  O   . ASP C 1 322 ? 71.509  34.568 79.463  1.00 20.79 ? 340  ASP G O   1 
ATOM   8209  C  CB  . ASP C 1 322 ? 72.051  32.248 77.275  1.00 20.88 ? 340  ASP G CB  1 
ATOM   8210  C  CG  . ASP C 1 322 ? 71.952  31.723 75.854  1.00 21.41 ? 340  ASP G CG  1 
ATOM   8211  O  OD1 . ASP C 1 322 ? 71.324  30.665 75.661  1.00 22.17 ? 340  ASP G OD1 1 
ATOM   8212  O  OD2 . ASP C 1 322 ? 72.491  32.376 74.930  1.00 22.40 ? 340  ASP G OD2 1 
ATOM   8213  N  N   . ILE C 1 323 ? 70.474  32.645 80.018  1.00 21.37 ? 341  ILE G N   1 
ATOM   8214  C  CA  . ILE C 1 323 ? 70.649  32.787 81.463  1.00 21.63 ? 341  ILE G CA  1 
ATOM   8215  C  C   . ILE C 1 323 ? 71.182  31.468 82.024  1.00 22.14 ? 341  ILE G C   1 
ATOM   8216  O  O   . ILE C 1 323 ? 70.588  30.415 81.796  1.00 22.32 ? 341  ILE G O   1 
ATOM   8217  C  CB  . ILE C 1 323 ? 69.327  33.183 82.185  1.00 21.56 ? 341  ILE G CB  1 
ATOM   8218  C  CG1 . ILE C 1 323 ? 68.812  34.530 81.664  1.00 21.28 ? 341  ILE G CG1 1 
ATOM   8219  C  CG2 . ILE C 1 323 ? 69.527  33.246 83.706  1.00 21.14 ? 341  ILE G CG2 1 
ATOM   8220  C  CD1 . ILE C 1 323 ? 67.428  34.900 82.145  1.00 20.85 ? 341  ILE G CD1 1 
ATOM   8221  N  N   . LEU C 1 324 ? 72.311  31.525 82.732  1.00 22.58 ? 342  LEU G N   1 
ATOM   8222  C  CA  . LEU C 1 324 ? 72.835  30.349 83.423  1.00 23.22 ? 342  LEU G CA  1 
ATOM   8223  C  C   . LEU C 1 324 ? 72.380  30.384 84.875  1.00 23.69 ? 342  LEU G C   1 
ATOM   8224  O  O   . LEU C 1 324 ? 72.720  31.301 85.629  1.00 23.59 ? 342  LEU G O   1 
ATOM   8225  C  CB  . LEU C 1 324 ? 74.365  30.233 83.323  1.00 23.01 ? 342  LEU G CB  1 
ATOM   8226  C  CG  . LEU C 1 324 ? 75.162  30.412 82.019  1.00 23.78 ? 342  LEU G CG  1 
ATOM   8227  C  CD1 . LEU C 1 324 ? 76.460  29.585 82.052  1.00 23.87 ? 342  LEU G CD1 1 
ATOM   8228  C  CD2 . LEU C 1 324 ? 74.386  30.115 80.745  1.00 24.37 ? 342  LEU G CD2 1 
ATOM   8229  N  N   . TYR C 1 325 ? 71.603  29.373 85.249  1.00 24.44 ? 343  TYR G N   1 
ATOM   8230  C  CA  . TYR C 1 325 ? 70.908  29.329 86.527  1.00 25.17 ? 343  TYR G CA  1 
ATOM   8231  C  C   . TYR C 1 325 ? 70.810  27.876 86.985  1.00 26.02 ? 343  TYR G C   1 
ATOM   8232  O  O   . TYR C 1 325 ? 70.378  27.006 86.219  1.00 26.27 ? 343  TYR G O   1 
ATOM   8233  C  CB  . TYR C 1 325 ? 69.508  29.936 86.363  1.00 24.96 ? 343  TYR G CB  1 
ATOM   8234  C  CG  . TYR C 1 325 ? 68.673  30.030 87.623  1.00 24.73 ? 343  TYR G CG  1 
ATOM   8235  C  CD1 . TYR C 1 325 ? 67.433  29.400 87.700  1.00 24.55 ? 343  TYR G CD1 1 
ATOM   8236  C  CD2 . TYR C 1 325 ? 69.113  30.762 88.730  1.00 24.81 ? 343  TYR G CD2 1 
ATOM   8237  C  CE1 . TYR C 1 325 ? 66.653  29.484 88.844  1.00 24.71 ? 343  TYR G CE1 1 
ATOM   8238  C  CE2 . TYR C 1 325 ? 68.341  30.850 89.887  1.00 24.79 ? 343  TYR G CE2 1 
ATOM   8239  C  CZ  . TYR C 1 325 ? 67.109  30.208 89.933  1.00 24.84 ? 343  TYR G CZ  1 
ATOM   8240  O  OH  . TYR C 1 325 ? 66.331  30.288 91.064  1.00 24.44 ? 343  TYR G OH  1 
ATOM   8241  N  N   . LYS C 1 326 ? 71.226  27.628 88.227  1.00 26.82 ? 344  LYS G N   1 
ATOM   8242  C  CA  . LYS C 1 326 ? 71.208  26.292 88.847  1.00 27.72 ? 344  LYS G CA  1 
ATOM   8243  C  C   . LYS C 1 326 ? 71.821  25.186 87.972  1.00 27.89 ? 344  LYS G C   1 
ATOM   8244  O  O   . LYS C 1 326 ? 71.309  24.069 87.931  1.00 28.09 ? 344  LYS G O   1 
ATOM   8245  C  CB  . LYS C 1 326 ? 69.783  25.899 89.272  1.00 28.00 ? 344  LYS G CB  1 
ATOM   8246  C  CG  . LYS C 1 326 ? 69.100  26.861 90.236  1.00 28.64 ? 344  LYS G CG  1 
ATOM   8247  C  CD  . LYS C 1 326 ? 67.874  26.230 90.901  1.00 30.98 ? 344  LYS G CD  1 
ATOM   8248  C  CE  . LYS C 1 326 ? 66.749  25.949 89.908  1.00 32.11 ? 344  LYS G CE  1 
ATOM   8249  N  NZ  . LYS C 1 326 ? 65.491  25.498 90.587  1.00 33.67 ? 344  LYS G NZ  1 
ATOM   8250  N  N   . GLY C 1 327 ? 72.908  25.505 87.274  1.00 28.11 ? 345  GLY G N   1 
ATOM   8251  C  CA  . GLY C 1 327 ? 73.607  24.527 86.434  1.00 28.38 ? 345  GLY G CA  1 
ATOM   8252  C  C   . GLY C 1 327 ? 73.034  24.334 85.039  1.00 28.57 ? 345  GLY G C   1 
ATOM   8253  O  O   . GLY C 1 327 ? 73.610  23.619 84.225  1.00 28.63 ? 345  GLY G O   1 
ATOM   8254  N  N   . GLU C 1 328 ? 71.903  24.978 84.768  1.00 28.81 ? 346  GLU G N   1 
ATOM   8255  C  CA  . GLU C 1 328 ? 71.240  24.912 83.468  1.00 29.12 ? 346  GLU G CA  1 
ATOM   8256  C  C   . GLU C 1 328 ? 71.550  26.149 82.609  1.00 28.62 ? 346  GLU G C   1 
ATOM   8257  O  O   . GLU C 1 328 ? 71.766  27.245 83.138  1.00 28.80 ? 346  GLU G O   1 
ATOM   8258  C  CB  . GLU C 1 328 ? 69.725  24.763 83.674  1.00 29.45 ? 346  GLU G CB  1 
ATOM   8259  C  CG  . GLU C 1 328 ? 68.890  24.825 82.389  1.00 32.04 ? 346  GLU G CG  1 
ATOM   8260  C  CD  . GLU C 1 328 ? 67.393  24.658 82.617  1.00 35.08 ? 346  GLU G CD  1 
ATOM   8261  O  OE1 . GLU C 1 328 ? 66.965  24.471 83.782  1.00 36.44 ? 346  GLU G OE1 1 
ATOM   8262  O  OE2 . GLU C 1 328 ? 66.641  24.711 81.614  1.00 36.95 ? 346  GLU G OE2 1 
ATOM   8263  N  N   . THR C 1 329 ? 71.591  25.964 81.289  1.00 27.96 ? 347  THR G N   1 
ATOM   8264  C  CA  . THR C 1 329 ? 71.679  27.088 80.350  1.00 27.24 ? 347  THR G CA  1 
ATOM   8265  C  C   . THR C 1 329 ? 70.301  27.341 79.752  1.00 26.81 ? 347  THR G C   1 
ATOM   8266  O  O   . THR C 1 329 ? 69.818  26.560 78.931  1.00 27.18 ? 347  THR G O   1 
ATOM   8267  C  CB  . THR C 1 329 ? 72.715  26.839 79.235  1.00 27.21 ? 347  THR G CB  1 
ATOM   8268  O  OG1 . THR C 1 329 ? 74.017  26.711 79.814  1.00 27.10 ? 347  THR G OG1 1 
ATOM   8269  C  CG2 . THR C 1 329 ? 72.727  27.986 78.231  1.00 26.78 ? 347  THR G CG2 1 
ATOM   8270  N  N   . ILE C 1 330 ? 69.674  28.433 80.181  1.00 26.15 ? 348  ILE G N   1 
ATOM   8271  C  CA  . ILE C 1 330 ? 68.304  28.763 79.789  1.00 25.28 ? 348  ILE G CA  1 
ATOM   8272  C  C   . ILE C 1 330 ? 68.324  29.729 78.610  1.00 24.98 ? 348  ILE G C   1 
ATOM   8273  O  O   . ILE C 1 330 ? 68.784  30.863 78.736  1.00 25.04 ? 348  ILE G O   1 
ATOM   8274  C  CB  . ILE C 1 330 ? 67.507  29.366 80.973  1.00 25.25 ? 348  ILE G CB  1 
ATOM   8275  C  CG1 . ILE C 1 330 ? 67.458  28.376 82.146  1.00 24.98 ? 348  ILE G CG1 1 
ATOM   8276  C  CG2 . ILE C 1 330 ? 66.093  29.757 80.541  1.00 25.08 ? 348  ILE G CG2 1 
ATOM   8277  C  CD1 . ILE C 1 330 ? 67.098  28.997 83.483  1.00 24.40 ? 348  ILE G CD1 1 
ATOM   8278  N  N   . HIS C 1 331 ? 67.832  29.276 77.461  1.00 24.25 ? 349  HIS G N   1 
ATOM   8279  C  CA  . HIS C 1 331 ? 67.851  30.114 76.274  1.00 23.46 ? 349  HIS G CA  1 
ATOM   8280  C  C   . HIS C 1 331 ? 66.688  31.098 76.257  1.00 23.07 ? 349  HIS G C   1 
ATOM   8281  O  O   . HIS C 1 331 ? 65.561  30.745 76.599  1.00 22.95 ? 349  HIS G O   1 
ATOM   8282  C  CB  . HIS C 1 331 ? 67.880  29.287 74.982  1.00 23.30 ? 349  HIS G CB  1 
ATOM   8283  C  CG  . HIS C 1 331 ? 68.103  30.116 73.756  1.00 22.49 ? 349  HIS G CG  1 
ATOM   8284  N  ND1 . HIS C 1 331 ? 69.336  30.639 73.427  1.00 22.09 ? 349  HIS G ND1 1 
ATOM   8285  C  CD2 . HIS C 1 331 ? 67.244  30.548 72.802  1.00 21.85 ? 349  HIS G CD2 1 
ATOM   8286  C  CE1 . HIS C 1 331 ? 69.230  31.343 72.314  1.00 21.71 ? 349  HIS G CE1 1 
ATOM   8287  N  NE2 . HIS C 1 331 ? 67.970  31.306 71.916  1.00 21.16 ? 349  HIS G NE2 1 
ATOM   8288  N  N   . ILE C 1 332 ? 66.992  32.335 75.868  1.00 22.66 ? 350  ILE G N   1 
ATOM   8289  C  CA  . ILE C 1 332 ? 65.989  33.378 75.671  1.00 22.32 ? 350  ILE G CA  1 
ATOM   8290  C  C   . ILE C 1 332 ? 65.948  33.685 74.172  1.00 22.26 ? 350  ILE G C   1 
ATOM   8291  O  O   . ILE C 1 332 ? 66.985  34.015 73.582  1.00 22.12 ? 350  ILE G O   1 
ATOM   8292  C  CB  . ILE C 1 332 ? 66.306  34.677 76.481  1.00 22.10 ? 350  ILE G CB  1 
ATOM   8293  C  CG1 . ILE C 1 332 ? 66.895  34.367 77.876  1.00 21.86 ? 350  ILE G CG1 1 
ATOM   8294  C  CG2 . ILE C 1 332 ? 65.087  35.592 76.544  1.00 21.89 ? 350  ILE G CG2 1 
ATOM   8295  C  CD1 . ILE C 1 332 ? 65.995  33.599 78.837  1.00 21.77 ? 350  ILE G CD1 1 
ATOM   8296  N  N   . PRO C 1 333 ? 64.754  33.570 73.552  1.00 22.11 ? 351  PRO G N   1 
ATOM   8297  C  CA  . PRO C 1 333 ? 64.592  33.675 72.095  1.00 22.19 ? 351  PRO G CA  1 
ATOM   8298  C  C   . PRO C 1 333 ? 64.597  35.107 71.552  1.00 22.17 ? 351  PRO G C   1 
ATOM   8299  O  O   . PRO C 1 333 ? 63.994  35.372 70.510  1.00 22.13 ? 351  PRO G O   1 
ATOM   8300  C  CB  . PRO C 1 333 ? 63.227  33.027 71.855  1.00 22.22 ? 351  PRO G CB  1 
ATOM   8301  C  CG  . PRO C 1 333 ? 62.465  33.321 73.098  1.00 22.63 ? 351  PRO G CG  1 
ATOM   8302  C  CD  . PRO C 1 333 ? 63.467  33.316 74.228  1.00 21.97 ? 351  PRO G CD  1 
ATOM   8303  N  N   . THR C 1 334 ? 65.283  36.008 72.254  1.00 22.11 ? 352  THR G N   1 
ATOM   8304  C  CA  . THR C 1 334 ? 65.331  37.430 71.910  1.00 21.80 ? 352  THR G CA  1 
ATOM   8305  C  C   . THR C 1 334 ? 65.759  37.657 70.457  1.00 22.27 ? 352  THR G C   1 
ATOM   8306  O  O   . THR C 1 334 ? 65.102  38.394 69.721  1.00 21.91 ? 352  THR G O   1 
ATOM   8307  C  CB  . THR C 1 334 ? 66.286  38.189 72.870  1.00 21.70 ? 352  THR G CB  1 
ATOM   8308  O  OG1 . THR C 1 334 ? 65.907  37.933 74.230  1.00 20.44 ? 352  THR G OG1 1 
ATOM   8309  C  CG2 . THR C 1 334 ? 66.264  39.682 72.613  1.00 20.86 ? 352  THR G CG2 1 
ATOM   8310  N  N   . MET C 1 335 ? 66.851  37.009 70.055  1.00 22.92 ? 353  MET G N   1 
ATOM   8311  C  CA  . MET C 1 335 ? 67.455  37.230 68.737  1.00 23.67 ? 353  MET G CA  1 
ATOM   8312  C  C   . MET C 1 335 ? 66.691  36.569 67.588  1.00 24.15 ? 353  MET G C   1 
ATOM   8313  O  O   . MET C 1 335 ? 66.745  37.044 66.454  1.00 24.45 ? 353  MET G O   1 
ATOM   8314  C  CB  . MET C 1 335 ? 68.930  36.804 68.729  1.00 23.64 ? 353  MET G CB  1 
ATOM   8315  C  CG  . MET C 1 335 ? 69.834  37.611 69.678  1.00 24.13 ? 353  MET G CG  1 
ATOM   8316  S  SD  . MET C 1 335 ? 69.724  39.413 69.511  1.00 26.24 ? 353  MET G SD  1 
ATOM   8317  C  CE  . MET C 1 335 ? 70.572  39.681 67.955  1.00 24.03 ? 353  MET G CE  1 
ATOM   8318  N  N   . GLU C 1 336 ? 65.985  35.479 67.876  1.00 24.80 ? 354  GLU G N   1 
ATOM   8319  C  CA  . GLU C 1 336 ? 65.143  34.844 66.861  1.00 25.66 ? 354  GLU G CA  1 
ATOM   8320  C  C   . GLU C 1 336 ? 63.741  35.463 66.783  1.00 25.53 ? 354  GLU G C   1 
ATOM   8321  O  O   . GLU C 1 336 ? 62.899  35.006 66.015  1.00 26.13 ? 354  GLU G O   1 
ATOM   8322  C  CB  . GLU C 1 336 ? 65.117  33.304 66.975  1.00 25.92 ? 354  GLU G CB  1 
ATOM   8323  C  CG  . GLU C 1 336 ? 65.292  32.719 68.364  1.00 28.36 ? 354  GLU G CG  1 
ATOM   8324  C  CD  . GLU C 1 336 ? 66.743  32.669 68.834  1.00 30.00 ? 354  GLU G CD  1 
ATOM   8325  O  OE1 . GLU C 1 336 ? 67.670  32.722 67.999  1.00 31.75 ? 354  GLU G OE1 1 
ATOM   8326  O  OE2 . GLU C 1 336 ? 66.953  32.581 70.057  1.00 31.08 ? 354  GLU G OE2 1 
ATOM   8327  N  N   . ASN C 1 337 ? 63.513  36.513 67.569  1.00 25.32 ? 355  ASN G N   1 
ATOM   8328  C  CA  . ASN C 1 337 ? 62.307  37.337 67.467  1.00 24.92 ? 355  ASN G CA  1 
ATOM   8329  C  C   . ASN C 1 337 ? 62.640  38.756 66.981  1.00 24.62 ? 355  ASN G C   1 
ATOM   8330  O  O   . ASN C 1 337 ? 61.939  39.718 67.298  1.00 24.93 ? 355  ASN G O   1 
ATOM   8331  C  CB  . ASN C 1 337 ? 61.560  37.377 68.811  1.00 24.71 ? 355  ASN G CB  1 
ATOM   8332  C  CG  . ASN C 1 337 ? 60.799  36.088 69.107  1.00 25.13 ? 355  ASN G CG  1 
ATOM   8333  O  OD1 . ASN C 1 337 ? 59.951  35.659 68.325  1.00 26.27 ? 355  ASN G OD1 1 
ATOM   8334  N  ND2 . ASN C 1 337 ? 61.087  35.477 70.251  1.00 23.96 ? 355  ASN G ND2 1 
ATOM   8335  N  N   . GLY C 1 338 ? 63.714  38.880 66.209  1.00 24.33 ? 356  GLY G N   1 
ATOM   8336  C  CA  . GLY C 1 338 ? 64.143  40.181 65.683  1.00 24.06 ? 356  GLY G CA  1 
ATOM   8337  C  C   . GLY C 1 338 ? 65.535  40.592 66.146  1.00 23.62 ? 356  GLY G C   1 
ATOM   8338  O  O   . GLY C 1 338 ? 66.503  40.393 65.423  1.00 23.98 ? 356  GLY G O   1 
ATOM   8339  N  N   . PRO C 1 339 ? 65.653  41.174 67.357  1.00 23.29 ? 357  PRO G N   1 
ATOM   8340  C  CA  . PRO C 1 339 ? 64.581  41.459 68.309  1.00 22.78 ? 357  PRO G CA  1 
ATOM   8341  C  C   . PRO C 1 339 ? 63.817  42.708 67.892  1.00 22.25 ? 357  PRO G C   1 
ATOM   8342  O  O   . PRO C 1 339 ? 64.394  43.796 67.818  1.00 22.52 ? 357  PRO G O   1 
ATOM   8343  C  CB  . PRO C 1 339 ? 65.330  41.676 69.629  1.00 22.76 ? 357  PRO G CB  1 
ATOM   8344  C  CG  . PRO C 1 339 ? 66.679  42.134 69.242  1.00 22.97 ? 357  PRO G CG  1 
ATOM   8345  C  CD  . PRO C 1 339 ? 66.968  41.628 67.853  1.00 23.21 ? 357  PRO G CD  1 
ATOM   8346  N  N   . LYS C 1 340 ? 62.534  42.534 67.597  1.00 21.63 ? 358  LYS G N   1 
ATOM   8347  C  CA  . LYS C 1 340 ? 61.685  43.605 67.072  1.00 21.06 ? 358  LYS G CA  1 
ATOM   8348  C  C   . LYS C 1 340 ? 61.564  44.816 68.000  1.00 20.21 ? 358  LYS G C   1 
ATOM   8349  O  O   . LYS C 1 340 ? 61.795  45.949 67.571  1.00 20.40 ? 358  LYS G O   1 
ATOM   8350  C  CB  . LYS C 1 340 ? 60.283  43.064 66.757  1.00 21.25 ? 358  LYS G CB  1 
ATOM   8351  C  CG  . LYS C 1 340 ? 60.158  42.350 65.419  1.00 22.53 ? 358  LYS G CG  1 
ATOM   8352  C  CD  . LYS C 1 340 ? 58.706  41.929 65.140  1.00 24.68 ? 358  LYS G CD  1 
ATOM   8353  C  CE  . LYS C 1 340 ? 57.751  43.123 65.028  1.00 25.62 ? 358  LYS G CE  1 
ATOM   8354  N  NZ  . LYS C 1 340 ? 58.103  44.052 63.906  1.00 26.95 ? 358  LYS G NZ  1 
ATOM   8355  N  N   . LEU C 1 341 ? 61.190  44.582 69.259  1.00 19.12 ? 359  LEU G N   1 
ATOM   8356  C  CA  . LEU C 1 341 ? 60.948  45.686 70.193  1.00 18.37 ? 359  LEU G CA  1 
ATOM   8357  C  C   . LEU C 1 341 ? 62.249  46.375 70.599  1.00 18.01 ? 359  LEU G C   1 
ATOM   8358  O  O   . LEU C 1 341 ? 62.313  47.603 70.636  1.00 18.19 ? 359  LEU G O   1 
ATOM   8359  C  CB  . LEU C 1 341 ? 60.166  45.221 71.427  1.00 18.03 ? 359  LEU G CB  1 
ATOM   8360  C  CG  . LEU C 1 341 ? 59.801  46.323 72.434  1.00 18.34 ? 359  LEU G CG  1 
ATOM   8361  C  CD1 . LEU C 1 341 ? 58.880  47.375 71.803  1.00 16.91 ? 359  LEU G CD1 1 
ATOM   8362  C  CD2 . LEU C 1 341 ? 59.192  45.747 73.706  1.00 17.86 ? 359  LEU G CD2 1 
ATOM   8363  N  N   . ALA C 1 342 ? 63.280  45.581 70.884  1.00 17.52 ? 360  ALA G N   1 
ATOM   8364  C  CA  . ALA C 1 342 ? 64.603  46.108 71.212  1.00 17.35 ? 360  ALA G CA  1 
ATOM   8365  C  C   . ALA C 1 342 ? 65.135  47.038 70.118  1.00 17.26 ? 360  ALA G C   1 
ATOM   8366  O  O   . ALA C 1 342 ? 65.630  48.133 70.421  1.00 17.17 ? 360  ALA G O   1 
ATOM   8367  C  CB  . ALA C 1 342 ? 65.591  44.971 71.493  1.00 16.91 ? 360  ALA G CB  1 
ATOM   8368  N  N   . SER C 1 343 ? 65.017  46.602 68.859  1.00 17.07 ? 361  SER G N   1 
ATOM   8369  C  CA  . SER C 1 343 ? 65.430  47.396 67.696  1.00 17.38 ? 361  SER G CA  1 
ATOM   8370  C  C   . SER C 1 343 ? 64.653  48.693 67.571  1.00 16.85 ? 361  SER G C   1 
ATOM   8371  O  O   . SER C 1 343 ? 65.234  49.736 67.284  1.00 16.81 ? 361  SER G O   1 
ATOM   8372  C  CB  . SER C 1 343 ? 65.244  46.602 66.396  1.00 17.50 ? 361  SER G CB  1 
ATOM   8373  O  OG  . SER C 1 343 ? 66.098  45.484 66.374  1.00 19.81 ? 361  SER G OG  1 
ATOM   8374  N  N   . ARG C 1 344 ? 63.337  48.605 67.769  1.00 16.73 ? 362  ARG G N   1 
ATOM   8375  C  CA  . ARG C 1 344 ? 62.434  49.753 67.667  1.00 16.34 ? 362  ARG G CA  1 
ATOM   8376  C  C   . ARG C 1 344 ? 62.799  50.847 68.671  1.00 16.08 ? 362  ARG G C   1 
ATOM   8377  O  O   . ARG C 1 344 ? 62.860  52.025 68.313  1.00 15.73 ? 362  ARG G O   1 
ATOM   8378  C  CB  . ARG C 1 344 ? 60.976  49.307 67.853  1.00 16.18 ? 362  ARG G CB  1 
ATOM   8379  C  CG  . ARG C 1 344 ? 59.942  50.404 67.610  1.00 16.13 ? 362  ARG G CG  1 
ATOM   8380  C  CD  . ARG C 1 344 ? 58.538  49.878 67.840  1.00 16.00 ? 362  ARG G CD  1 
ATOM   8381  N  NE  . ARG C 1 344 ? 57.533  50.937 67.833  1.00 15.36 ? 362  ARG G NE  1 
ATOM   8382  C  CZ  . ARG C 1 344 ? 56.224  50.725 67.967  1.00 15.87 ? 362  ARG G CZ  1 
ATOM   8383  N  NH1 . ARG C 1 344 ? 55.754  49.490 68.116  1.00 15.45 ? 362  ARG G NH1 1 
ATOM   8384  N  NH2 . ARG C 1 344 ? 55.379  51.747 67.946  1.00 15.80 ? 362  ARG G NH2 1 
ATOM   8385  N  N   . ILE C 1 345 ? 63.043  50.433 69.917  1.00 16.24 ? 363  ILE G N   1 
ATOM   8386  C  CA  . ILE C 1 345 ? 63.481  51.317 71.007  1.00 15.88 ? 363  ILE G CA  1 
ATOM   8387  C  C   . ILE C 1 345 ? 64.845  51.956 70.700  1.00 15.81 ? 363  ILE G C   1 
ATOM   8388  O  O   . ILE C 1 345 ? 65.017  53.176 70.801  1.00 15.43 ? 363  ILE G O   1 
ATOM   8389  C  CB  . ILE C 1 345 ? 63.541  50.541 72.365  1.00 15.88 ? 363  ILE G CB  1 
ATOM   8390  C  CG1 . ILE C 1 345 ? 62.137  50.113 72.805  1.00 16.10 ? 363  ILE G CG1 1 
ATOM   8391  C  CG2 . ILE C 1 345 ? 64.197  51.387 73.461  1.00 15.05 ? 363  ILE G CG2 1 
ATOM   8392  C  CD1 . ILE C 1 345 ? 62.120  49.049 73.891  1.00 16.37 ? 363  ILE G CD1 1 
ATOM   8393  N  N   . LEU C 1 346 ? 65.813  51.125 70.324  1.00 16.24 ? 364  LEU G N   1 
ATOM   8394  C  CA  . LEU C 1 346 ? 67.148  51.614 69.956  1.00 16.36 ? 364  LEU G CA  1 
ATOM   8395  C  C   . LEU C 1 346 ? 67.029  52.669 68.851  1.00 16.17 ? 364  LEU G C   1 
ATOM   8396  O  O   . LEU C 1 346 ? 67.596  53.751 68.975  1.00 16.25 ? 364  LEU G O   1 
ATOM   8397  C  CB  . LEU C 1 346 ? 68.049  50.453 69.502  1.00 16.49 ? 364  LEU G CB  1 
ATOM   8398  C  CG  . LEU C 1 346 ? 69.592  50.475 69.614  1.00 17.69 ? 364  LEU G CG  1 
ATOM   8399  C  CD1 . LEU C 1 346 ? 70.191  49.989 68.311  1.00 17.72 ? 364  LEU G CD1 1 
ATOM   8400  C  CD2 . LEU C 1 346 ? 70.218  51.818 70.000  1.00 17.58 ? 364  LEU G CD2 1 
ATOM   8401  N  N   . SER C 1 347 ? 66.276  52.363 67.791  1.00 16.19 ? 365  SER G N   1 
ATOM   8402  C  CA  . SER C 1 347 ? 66.026  53.328 66.704  1.00 16.71 ? 365  SER G CA  1 
ATOM   8403  C  C   . SER C 1 347 ? 65.335  54.603 67.177  1.00 16.59 ? 365  SER G C   1 
ATOM   8404  O  O   . SER C 1 347 ? 65.789  55.695 66.851  1.00 16.38 ? 365  SER G O   1 
ATOM   8405  C  CB  . SER C 1 347 ? 65.215  52.703 65.560  1.00 16.71 ? 365  SER G CB  1 
ATOM   8406  O  OG  . SER C 1 347 ? 65.981  51.741 64.869  1.00 17.88 ? 365  SER G OG  1 
ATOM   8407  N  N   . LYS C 1 348 ? 64.244  54.463 67.934  1.00 16.88 ? 366  LYS G N   1 
ATOM   8408  C  CA  . LYS C 1 348 ? 63.526  55.626 68.484  1.00 17.50 ? 366  LYS G CA  1 
ATOM   8409  C  C   . LYS C 1 348 ? 64.443  56.549 69.257  1.00 17.27 ? 366  LYS G C   1 
ATOM   8410  O  O   . LYS C 1 348 ? 64.539  57.734 68.941  1.00 17.25 ? 366  LYS G O   1 
ATOM   8411  C  CB  . LYS C 1 348 ? 62.378  55.211 69.417  1.00 17.69 ? 366  LYS G CB  1 
ATOM   8412  C  CG  . LYS C 1 348 ? 60.998  55.272 68.807  1.00 20.55 ? 366  LYS G CG  1 
ATOM   8413  C  CD  . LYS C 1 348 ? 60.553  56.688 68.440  1.00 22.29 ? 366  LYS G CD  1 
ATOM   8414  C  CE  . LYS C 1 348 ? 59.806  56.629 67.102  1.00 24.56 ? 366  LYS G CE  1 
ATOM   8415  N  NZ  . LYS C 1 348 ? 58.896  57.783 66.870  1.00 26.51 ? 366  LYS G NZ  1 
ATOM   8416  N  N   . LEU C 1 349 ? 65.107  55.998 70.275  1.00 17.30 ? 367  LEU G N   1 
ATOM   8417  C  CA  . LEU C 1 349 ? 65.950  56.796 71.172  1.00 17.35 ? 367  LEU G CA  1 
ATOM   8418  C  C   . LEU C 1 349 ? 67.156  57.408 70.452  1.00 17.23 ? 367  LEU G C   1 
ATOM   8419  O  O   . LEU C 1 349 ? 67.478  58.567 70.674  1.00 17.40 ? 367  LEU G O   1 
ATOM   8420  C  CB  . LEU C 1 349 ? 66.360  55.983 72.414  1.00 17.40 ? 367  LEU G CB  1 
ATOM   8421  C  CG  . LEU C 1 349 ? 65.232  55.589 73.395  1.00 18.19 ? 367  LEU G CG  1 
ATOM   8422  C  CD1 . LEU C 1 349 ? 65.730  54.665 74.512  1.00 19.07 ? 367  LEU G CD1 1 
ATOM   8423  C  CD2 . LEU C 1 349 ? 64.529  56.800 73.996  1.00 18.03 ? 367  LEU G CD2 1 
ATOM   8424  N  N   . THR C 1 350 ? 67.796  56.630 69.582  1.00 17.41 ? 368  THR G N   1 
ATOM   8425  C  CA  . THR C 1 350 ? 68.884  57.111 68.713  1.00 18.01 ? 368  THR G CA  1 
ATOM   8426  C  C   . THR C 1 350 ? 68.424  58.293 67.846  1.00 17.76 ? 368  THR G C   1 
ATOM   8427  O  O   . THR C 1 350 ? 69.111  59.319 67.770  1.00 17.37 ? 368  THR G O   1 
ATOM   8428  C  CB  . THR C 1 350 ? 69.411  55.958 67.793  1.00 18.23 ? 368  THR G CB  1 
ATOM   8429  O  OG1 . THR C 1 350 ? 69.864  54.874 68.606  1.00 20.27 ? 368  THR G OG1 1 
ATOM   8430  C  CG2 . THR C 1 350 ? 70.565  56.410 66.916  1.00 19.20 ? 368  THR G CG2 1 
ATOM   8431  N  N   . ASP C 1 351 ? 67.255  58.147 67.215  1.00 17.40 ? 369  ASP G N   1 
ATOM   8432  C  CA  . ASP C 1 351 ? 66.692  59.192 66.353  1.00 17.36 ? 369  ASP G CA  1 
ATOM   8433  C  C   . ASP C 1 351 ? 66.426  60.485 67.103  1.00 17.04 ? 369  ASP G C   1 
ATOM   8434  O  O   . ASP C 1 351 ? 66.664  61.564 66.577  1.00 17.10 ? 369  ASP G O   1 
ATOM   8435  C  CB  . ASP C 1 351 ? 65.397  58.714 65.682  1.00 17.68 ? 369  ASP G CB  1 
ATOM   8436  C  CG  . ASP C 1 351 ? 65.646  57.725 64.555  1.00 18.05 ? 369  ASP G CG  1 
ATOM   8437  O  OD1 . ASP C 1 351 ? 64.642  57.228 63.996  1.00 20.01 ? 369  ASP G OD1 1 
ATOM   8438  O  OD2 . ASP C 1 351 ? 66.829  57.442 64.226  1.00 17.50 ? 369  ASP G OD2 1 
ATOM   8439  N  N   . ILE C 1 352 ? 65.928  60.370 68.331  1.00 16.82 ? 370  ILE G N   1 
ATOM   8440  C  CA  . ILE C 1 352 ? 65.719  61.536 69.193  1.00 16.30 ? 370  ILE G CA  1 
ATOM   8441  C  C   . ILE C 1 352 ? 67.065  62.165 69.587  1.00 15.95 ? 370  ILE G C   1 
ATOM   8442  O  O   . ILE C 1 352 ? 67.249  63.381 69.460  1.00 15.40 ? 370  ILE G O   1 
ATOM   8443  C  CB  . ILE C 1 352 ? 64.871  61.187 70.453  1.00 16.17 ? 370  ILE G CB  1 
ATOM   8444  C  CG1 . ILE C 1 352 ? 63.456  60.765 70.036  1.00 16.85 ? 370  ILE G CG1 1 
ATOM   8445  C  CG2 . ILE C 1 352 ? 64.836  62.375 71.434  1.00 15.89 ? 370  ILE G CG2 1 
ATOM   8446  C  CD1 . ILE C 1 352 ? 62.633  60.062 71.123  1.00 17.68 ? 370  ILE G CD1 1 
ATOM   8447  N  N   . GLN C 1 353 ? 68.000  61.325 70.037  1.00 15.71 ? 371  GLN G N   1 
ATOM   8448  C  CA  . GLN C 1 353 ? 69.294  61.794 70.547  1.00 15.69 ? 371  GLN G CA  1 
ATOM   8449  C  C   . GLN C 1 353 ? 70.104  62.544 69.483  1.00 15.80 ? 371  GLN G C   1 
ATOM   8450  O  O   . GLN C 1 353 ? 70.745  63.556 69.782  1.00 15.23 ? 371  GLN G O   1 
ATOM   8451  C  CB  . GLN C 1 353 ? 70.110  60.625 71.113  1.00 15.60 ? 371  GLN G CB  1 
ATOM   8452  C  CG  . GLN C 1 353 ? 69.565  60.014 72.411  1.00 14.77 ? 371  GLN G CG  1 
ATOM   8453  C  CD  . GLN C 1 353 ? 70.117  58.609 72.689  1.00 14.25 ? 371  GLN G CD  1 
ATOM   8454  O  OE1 . GLN C 1 353 ? 70.678  57.956 71.805  1.00 13.19 ? 371  GLN G OE1 1 
ATOM   8455  N  NE2 . GLN C 1 353 ? 69.947  58.142 73.918  1.00 12.52 ? 371  GLN G NE2 1 
ATOM   8456  N  N   . TYR C 1 354 ? 70.056  62.046 68.246  1.00 16.20 ? 372  TYR G N   1 
ATOM   8457  C  CA  . TYR C 1 354 ? 70.812  62.621 67.126  1.00 16.56 ? 372  TYR G CA  1 
ATOM   8458  C  C   . TYR C 1 354 ? 70.008  63.639 66.307  1.00 17.42 ? 372  TYR G C   1 
ATOM   8459  O  O   . TYR C 1 354 ? 70.409  64.024 65.203  1.00 17.35 ? 372  TYR G O   1 
ATOM   8460  C  CB  . TYR C 1 354 ? 71.396  61.511 66.236  1.00 16.22 ? 372  TYR G CB  1 
ATOM   8461  C  CG  . TYR C 1 354 ? 72.521  60.759 66.912  1.00 15.27 ? 372  TYR G CG  1 
ATOM   8462  C  CD1 . TYR C 1 354 ? 72.273  59.561 67.585  1.00 14.10 ? 372  TYR G CD1 1 
ATOM   8463  C  CD2 . TYR C 1 354 ? 73.837  61.257 66.900  1.00 13.52 ? 372  TYR G CD2 1 
ATOM   8464  C  CE1 . TYR C 1 354 ? 73.294  58.860 68.224  1.00 13.60 ? 372  TYR G CE1 1 
ATOM   8465  C  CE2 . TYR C 1 354 ? 74.875  60.562 67.543  1.00 13.15 ? 372  TYR G CE2 1 
ATOM   8466  C  CZ  . TYR C 1 354 ? 74.591  59.362 68.202  1.00 13.55 ? 372  TYR G CZ  1 
ATOM   8467  O  OH  . TYR C 1 354 ? 75.590  58.659 68.846  1.00 12.96 ? 372  TYR G OH  1 
ATOM   8468  N  N   . GLY C 1 355 ? 68.874  64.062 66.861  1.00 18.39 ? 373  GLY G N   1 
ATOM   8469  C  CA  . GLY C 1 355 ? 68.072  65.145 66.297  1.00 20.04 ? 373  GLY G CA  1 
ATOM   8470  C  C   . GLY C 1 355 ? 67.362  64.842 64.989  1.00 21.27 ? 373  GLY G C   1 
ATOM   8471  O  O   . GLY C 1 355 ? 66.896  65.759 64.316  1.00 21.09 ? 373  GLY G O   1 
ATOM   8472  N  N   . ARG C 1 356 ? 67.278  63.562 64.630  1.00 22.39 ? 374  ARG G N   1 
ATOM   8473  C  CA  . ARG C 1 356 ? 66.538  63.141 63.442  1.00 24.23 ? 374  ARG G CA  1 
ATOM   8474  C  C   . ARG C 1 356 ? 65.046  63.324 63.677  1.00 25.29 ? 374  ARG G C   1 
ATOM   8475  O  O   . ARG C 1 356 ? 64.247  63.342 62.738  1.00 25.82 ? 374  ARG G O   1 
ATOM   8476  C  CB  . ARG C 1 356 ? 66.856  61.685 63.087  1.00 24.15 ? 374  ARG G CB  1 
ATOM   8477  C  CG  . ARG C 1 356 ? 68.212  61.497 62.424  1.00 25.58 ? 374  ARG G CG  1 
ATOM   8478  C  CD  . ARG C 1 356 ? 68.410  60.057 61.953  1.00 28.38 ? 374  ARG G CD  1 
ATOM   8479  N  NE  . ARG C 1 356 ? 68.989  59.223 63.003  1.00 31.12 ? 374  ARG G NE  1 
ATOM   8480  C  CZ  . ARG C 1 356 ? 70.250  58.803 63.025  1.00 32.05 ? 374  ARG G CZ  1 
ATOM   8481  N  NH1 . ARG C 1 356 ? 71.082  59.116 62.038  1.00 32.35 ? 374  ARG G NH1 1 
ATOM   8482  N  NH2 . ARG C 1 356 ? 70.678  58.053 64.033  1.00 32.68 ? 374  ARG G NH2 1 
ATOM   8483  N  N   . GLU C 1 357 ? 64.696  63.494 64.947  1.00 26.50 ? 375  GLU G N   1 
ATOM   8484  C  CA  . GLU C 1 357 ? 63.323  63.584 65.405  1.00 27.80 ? 375  GLU G CA  1 
ATOM   8485  C  C   . GLU C 1 357 ? 63.250  64.622 66.528  1.00 28.27 ? 375  GLU G C   1 
ATOM   8486  O  O   . GLU C 1 357 ? 64.099  64.639 67.430  1.00 28.28 ? 375  GLU G O   1 
ATOM   8487  C  CB  . GLU C 1 357 ? 62.888  62.208 65.911  1.00 27.86 ? 375  GLU G CB  1 
ATOM   8488  C  CG  . GLU C 1 357 ? 61.488  62.127 66.443  1.00 29.51 ? 375  GLU G CG  1 
ATOM   8489  C  CD  . GLU C 1 357 ? 61.018  60.694 66.603  1.00 31.62 ? 375  GLU G CD  1 
ATOM   8490  O  OE1 . GLU C 1 357 ? 60.319  60.417 67.604  1.00 32.50 ? 375  GLU G OE1 1 
ATOM   8491  O  OE2 . GLU C 1 357 ? 61.339  59.851 65.729  1.00 31.66 ? 375  GLU G OE2 1 
ATOM   8492  N  N   . GLU C 1 358 ? 62.243  65.491 66.467  1.00 28.90 ? 376  GLU G N   1 
ATOM   8493  C  CA  . GLU C 1 358 ? 62.041  66.507 67.497  1.00 29.39 ? 376  GLU G CA  1 
ATOM   8494  C  C   . GLU C 1 358 ? 61.316  65.917 68.704  1.00 28.96 ? 376  GLU G C   1 
ATOM   8495  O  O   . GLU C 1 358 ? 60.353  65.173 68.555  1.00 29.00 ? 376  GLU G O   1 
ATOM   8496  C  CB  . GLU C 1 358 ? 61.273  67.708 66.936  1.00 29.97 ? 376  GLU G CB  1 
ATOM   8497  C  CG  . GLU C 1 358 ? 62.024  68.455 65.827  1.00 32.43 ? 376  GLU G CG  1 
ATOM   8498  C  CD  . GLU C 1 358 ? 61.202  69.552 65.159  1.00 35.33 ? 376  GLU G CD  1 
ATOM   8499  O  OE1 . GLU C 1 358 ? 59.978  69.360 64.937  1.00 35.37 ? 376  GLU G OE1 1 
ATOM   8500  O  OE2 . GLU C 1 358 ? 61.802  70.607 64.834  1.00 37.11 ? 376  GLU G OE2 1 
ATOM   8501  N  N   . SER C 1 359 ? 61.810  66.240 69.895  1.00 28.89 ? 377  SER G N   1 
ATOM   8502  C  CA  . SER C 1 359 ? 61.216  65.795 71.159  1.00 28.67 ? 377  SER G CA  1 
ATOM   8503  C  C   . SER C 1 359 ? 61.718  66.739 72.244  1.00 28.40 ? 377  SER G C   1 
ATOM   8504  O  O   . SER C 1 359 ? 62.852  67.231 72.169  1.00 28.21 ? 377  SER G O   1 
ATOM   8505  C  CB  . SER C 1 359 ? 61.620  64.343 71.482  1.00 28.94 ? 377  SER G CB  1 
ATOM   8506  O  OG  . SER C 1 359 ? 60.603  63.631 72.188  1.00 29.48 ? 377  SER G OG  1 
ATOM   8507  N  N   . ASP C 1 360 ? 60.877  66.986 73.249  1.00 27.89 ? 378  ASP G N   1 
ATOM   8508  C  CA  . ASP C 1 360 ? 61.262  67.819 74.392  1.00 27.62 ? 378  ASP G CA  1 
ATOM   8509  C  C   . ASP C 1 360 ? 62.345  67.172 75.275  1.00 26.67 ? 378  ASP G C   1 
ATOM   8510  O  O   . ASP C 1 360 ? 62.888  67.822 76.168  1.00 26.44 ? 378  ASP G O   1 
ATOM   8511  C  CB  . ASP C 1 360 ? 60.032  68.217 75.226  1.00 28.02 ? 378  ASP G CB  1 
ATOM   8512  C  CG  . ASP C 1 360 ? 59.324  67.019 75.853  1.00 29.84 ? 378  ASP G CG  1 
ATOM   8513  O  OD1 . ASP C 1 360 ? 58.694  67.207 76.914  1.00 32.42 ? 378  ASP G OD1 1 
ATOM   8514  O  OD2 . ASP C 1 360 ? 59.383  65.894 75.297  1.00 32.33 ? 378  ASP G OD2 1 
ATOM   8515  N  N   . TRP C 1 361 ? 62.659  65.904 75.004  1.00 25.71 ? 379  TRP G N   1 
ATOM   8516  C  CA  . TRP C 1 361 ? 63.701  65.166 75.731  1.00 24.99 ? 379  TRP G CA  1 
ATOM   8517  C  C   . TRP C 1 361 ? 65.133  65.641 75.462  1.00 25.15 ? 379  TRP G C   1 
ATOM   8518  O  O   . TRP C 1 361 ? 66.049  65.263 76.190  1.00 24.84 ? 379  TRP G O   1 
ATOM   8519  C  CB  . TRP C 1 361 ? 63.627  63.668 75.428  1.00 24.56 ? 379  TRP G CB  1 
ATOM   8520  C  CG  . TRP C 1 361 ? 62.439  62.949 76.003  1.00 23.17 ? 379  TRP G CG  1 
ATOM   8521  C  CD1 . TRP C 1 361 ? 61.531  63.435 76.905  1.00 22.18 ? 379  TRP G CD1 1 
ATOM   8522  C  CD2 . TRP C 1 361 ? 62.055  61.594 75.738  1.00 21.01 ? 379  TRP G CD2 1 
ATOM   8523  N  NE1 . TRP C 1 361 ? 60.598  62.472 77.201  1.00 21.49 ? 379  TRP G NE1 1 
ATOM   8524  C  CE2 . TRP C 1 361 ? 60.896  61.331 76.501  1.00 20.81 ? 379  TRP G CE2 1 
ATOM   8525  C  CE3 . TRP C 1 361 ? 62.572  60.579 74.921  1.00 20.13 ? 379  TRP G CE3 1 
ATOM   8526  C  CZ2 . TRP C 1 361 ? 60.243  60.092 76.475  1.00 19.98 ? 379  TRP G CZ2 1 
ATOM   8527  C  CZ3 . TRP C 1 361 ? 61.924  59.349 74.897  1.00 19.84 ? 379  TRP G CZ3 1 
ATOM   8528  C  CH2 . TRP C 1 361 ? 60.771  59.118 75.672  1.00 19.30 ? 379  TRP G CH2 1 
ATOM   8529  N  N   . THR C 1 362 ? 65.329  66.437 74.412  1.00 25.21 ? 380  THR G N   1 
ATOM   8530  C  CA  . THR C 1 362 ? 66.666  66.929 74.076  1.00 25.84 ? 380  THR G CA  1 
ATOM   8531  C  C   . THR C 1 362 ? 66.797  68.439 74.214  1.00 26.46 ? 380  THR G C   1 
ATOM   8532  O  O   . THR C 1 362 ? 65.850  69.177 73.948  1.00 26.42 ? 380  THR G O   1 
ATOM   8533  C  CB  . THR C 1 362 ? 67.135  66.492 72.661  1.00 25.68 ? 380  THR G CB  1 
ATOM   8534  O  OG1 . THR C 1 362 ? 66.161  66.865 71.679  1.00 26.27 ? 380  THR G OG1 1 
ATOM   8535  C  CG2 . THR C 1 362 ? 67.369  64.980 72.601  1.00 24.75 ? 380  THR G CG2 1 
ATOM   8536  N  N   . ILE C 1 363 ? 67.975  68.878 74.658  1.00 27.27 ? 381  ILE G N   1 
ATOM   8537  C  CA  . ILE C 1 363 ? 68.331  70.295 74.695  1.00 28.34 ? 381  ILE G CA  1 
ATOM   8538  C  C   . ILE C 1 363 ? 69.593  70.519 73.858  1.00 28.79 ? 381  ILE G C   1 
ATOM   8539  O  O   . ILE C 1 363 ? 70.602  69.844 74.061  1.00 28.57 ? 381  ILE G O   1 
ATOM   8540  C  CB  . ILE C 1 363 ? 68.605  70.802 76.150  1.00 28.49 ? 381  ILE G CB  1 
ATOM   8541  C  CG1 . ILE C 1 363 ? 67.550  70.298 77.155  1.00 29.49 ? 381  ILE G CG1 1 
ATOM   8542  C  CG2 . ILE C 1 363 ? 68.748  72.320 76.179  1.00 28.43 ? 381  ILE G CG2 1 
ATOM   8543  C  CD1 . ILE C 1 363 ? 66.136  70.839 76.954  1.00 31.07 ? 381  ILE G CD1 1 
ATOM   8544  N  N   . VAL C 1 364 ? 69.526  71.460 72.919  1.00 29.70 ? 382  VAL G N   1 
ATOM   8545  C  CA  . VAL C 1 364 ? 70.694  71.897 72.157  1.00 30.55 ? 382  VAL G CA  1 
ATOM   8546  C  C   . VAL C 1 364 ? 71.533  72.767 73.088  1.00 31.66 ? 382  VAL G C   1 
ATOM   8547  O  O   . VAL C 1 364 ? 70.998  73.683 73.723  1.00 31.77 ? 382  VAL G O   1 
ATOM   8548  C  CB  . VAL C 1 364 ? 70.281  72.714 70.901  1.00 30.59 ? 382  VAL G CB  1 
ATOM   8549  C  CG1 . VAL C 1 364 ? 71.508  73.262 70.160  1.00 30.12 ? 382  VAL G CG1 1 
ATOM   8550  C  CG2 . VAL C 1 364 ? 69.415  71.873 69.961  1.00 30.25 ? 382  VAL G CG2 1 
ATOM   8551  N  N   . LEU C 1 365 ? 72.834  72.491 73.186  1.00 33.03 ? 383  LEU G N   1 
ATOM   8552  C  CA  . LEU C 1 365 ? 73.673  73.249 74.125  1.00 34.59 ? 383  LEU G CA  1 
ATOM   8553  C  C   . LEU C 1 365 ? 73.709  74.751 73.840  1.00 35.45 ? 383  LEU G C   1 
ATOM   8554  O  O   . LEU C 1 365 ? 73.778  75.179 72.678  1.00 35.48 ? 383  LEU G O   1 
ATOM   8555  C  CB  . LEU C 1 365 ? 75.083  72.658 74.293  1.00 34.64 ? 383  LEU G CB  1 
ATOM   8556  C  CG  . LEU C 1 365 ? 76.103  72.362 73.192  1.00 35.64 ? 383  LEU G CG  1 
ATOM   8557  C  CD1 . LEU C 1 365 ? 76.083  73.347 72.029  1.00 37.72 ? 383  LEU G CD1 1 
ATOM   8558  C  CD2 . LEU C 1 365 ? 77.495  72.305 73.813  1.00 35.86 ? 383  LEU G CD2 1 
ATOM   8559  N  N   . SER C 1 366 ? 73.624  75.537 74.914  1.00 36.57 ? 384  SER G N   1 
ATOM   8560  C  CA  . SER C 1 366 ? 73.636  76.999 74.829  1.00 37.61 ? 384  SER G CA  1 
ATOM   8561  C  C   . SER C 1 366 ? 75.062  77.542 74.901  1.00 37.79 ? 384  SER G C   1 
ATOM   8562  O  O   . SER C 1 366 ? 76.027  76.778 74.843  1.00 38.30 ? 384  SER G O   1 
ATOM   8563  C  CB  . SER C 1 366 ? 72.776  77.620 75.939  1.00 37.88 ? 384  SER G CB  1 
ATOM   8564  O  OG  . SER C 1 366 ? 71.406  77.267 75.798  1.00 39.09 ? 384  SER G OG  1 
ATOM   8565  N  N   . VAL D 1 1   ? 103.721 40.204 86.892  1.00 36.72 ? 19   VAL J N   1 
ATOM   8566  C  CA  . VAL D 1 1   ? 104.906 39.319 87.135  1.00 36.60 ? 19   VAL J CA  1 
ATOM   8567  C  C   . VAL D 1 1   ? 105.159 39.039 88.626  1.00 36.10 ? 19   VAL J C   1 
ATOM   8568  O  O   . VAL D 1 1   ? 105.421 37.892 89.010  1.00 36.45 ? 19   VAL J O   1 
ATOM   8569  C  CB  . VAL D 1 1   ? 106.215 39.846 86.444  1.00 36.68 ? 19   VAL J CB  1 
ATOM   8570  C  CG1 . VAL D 1 1   ? 106.165 39.623 84.936  1.00 37.48 ? 19   VAL J CG1 1 
ATOM   8571  C  CG2 . VAL D 1 1   ? 106.477 41.320 86.760  1.00 36.87 ? 19   VAL J CG2 1 
ATOM   8572  N  N   . VAL D 1 2   ? 105.075 40.078 89.456  1.00 35.24 ? 20   VAL J N   1 
ATOM   8573  C  CA  . VAL D 1 2   ? 105.414 39.961 90.888  1.00 34.23 ? 20   VAL J CA  1 
ATOM   8574  C  C   . VAL D 1 2   ? 104.175 39.838 91.801  1.00 33.39 ? 20   VAL J C   1 
ATOM   8575  O  O   . VAL D 1 2   ? 103.342 40.757 91.895  1.00 32.98 ? 20   VAL J O   1 
ATOM   8576  C  CB  . VAL D 1 2   ? 106.424 41.066 91.339  1.00 34.27 ? 20   VAL J CB  1 
ATOM   8577  C  CG1 . VAL D 1 2   ? 106.073 42.417 90.735  1.00 34.63 ? 20   VAL J CG1 1 
ATOM   8578  C  CG2 . VAL D 1 2   ? 106.541 41.147 92.848  1.00 34.27 ? 20   VAL J CG2 1 
ATOM   8579  N  N   . GLY D 1 3   ? 104.078 38.674 92.453  1.00 32.24 ? 21   GLY J N   1 
ATOM   8580  C  CA  . GLY D 1 3   ? 102.906 38.273 93.239  1.00 30.57 ? 21   GLY J CA  1 
ATOM   8581  C  C   . GLY D 1 3   ? 102.720 39.048 94.529  1.00 29.40 ? 21   GLY J C   1 
ATOM   8582  O  O   . GLY D 1 3   ? 101.595 39.167 95.035  1.00 29.46 ? 21   GLY J O   1 
ATOM   8583  N  N   . THR D 1 4   ? 103.821 39.566 95.067  1.00 28.10 ? 22   THR J N   1 
ATOM   8584  C  CA  . THR D 1 4   ? 103.779 40.398 96.268  1.00 26.81 ? 22   THR J CA  1 
ATOM   8585  C  C   . THR D 1 4   ? 104.958 41.362 96.375  1.00 25.97 ? 22   THR J C   1 
ATOM   8586  O  O   . THR D 1 4   ? 106.059 41.085 95.893  1.00 25.80 ? 22   THR J O   1 
ATOM   8587  C  CB  . THR D 1 4   ? 103.667 39.558 97.573  1.00 26.90 ? 22   THR J CB  1 
ATOM   8588  O  OG1 . THR D 1 4   ? 103.593 40.439 98.708  1.00 26.91 ? 22   THR J OG1 1 
ATOM   8589  C  CG2 . THR D 1 4   ? 104.867 38.618 97.735  1.00 26.56 ? 22   THR J CG2 1 
ATOM   8590  N  N   . PHE D 1 5   ? 104.702 42.505 97.002  1.00 24.92 ? 23   PHE J N   1 
ATOM   8591  C  CA  . PHE D 1 5   ? 105.765 43.387 97.459  1.00 24.28 ? 23   PHE J CA  1 
ATOM   8592  C  C   . PHE D 1 5   ? 106.459 42.699 98.631  1.00 24.24 ? 23   PHE J C   1 
ATOM   8593  O  O   . PHE D 1 5   ? 105.874 41.831 99.283  1.00 23.98 ? 23   PHE J O   1 
ATOM   8594  C  CB  . PHE D 1 5   ? 105.216 44.762 97.875  1.00 23.74 ? 23   PHE J CB  1 
ATOM   8595  C  CG  . PHE D 1 5   ? 104.091 44.705 98.891  1.00 22.71 ? 23   PHE J CG  1 
ATOM   8596  C  CD1 . PHE D 1 5   ? 104.350 44.854 100.250 1.00 21.35 ? 23   PHE J CD1 1 
ATOM   8597  C  CD2 . PHE D 1 5   ? 102.768 44.520 98.482  1.00 21.15 ? 23   PHE J CD2 1 
ATOM   8598  C  CE1 . PHE D 1 5   ? 103.311 44.812 101.186 1.00 21.22 ? 23   PHE J CE1 1 
ATOM   8599  C  CE2 . PHE D 1 5   ? 101.727 44.481 99.407  1.00 20.27 ? 23   PHE J CE2 1 
ATOM   8600  C  CZ  . PHE D 1 5   ? 101.998 44.627 100.761 1.00 20.05 ? 23   PHE J CZ  1 
ATOM   8601  N  N   . LYS D 1 6   ? 107.703 43.077 98.886  1.00 24.26 ? 24   LYS J N   1 
ATOM   8602  C  CA  . LYS D 1 6   ? 108.467 42.467 99.966  1.00 24.67 ? 24   LYS J CA  1 
ATOM   8603  C  C   . LYS D 1 6   ? 109.030 43.537 100.880 1.00 24.44 ? 24   LYS J C   1 
ATOM   8604  O  O   . LYS D 1 6   ? 109.487 44.583 100.414 1.00 24.25 ? 24   LYS J O   1 
ATOM   8605  C  CB  . LYS D 1 6   ? 109.587 41.581 99.406  1.00 24.80 ? 24   LYS J CB  1 
ATOM   8606  C  CG  . LYS D 1 6   ? 109.078 40.358 98.656  1.00 26.28 ? 24   LYS J CG  1 
ATOM   8607  C  CD  . LYS D 1 6   ? 110.222 39.528 98.096  1.00 29.35 ? 24   LYS J CD  1 
ATOM   8608  C  CE  . LYS D 1 6   ? 109.725 38.558 97.024  1.00 31.99 ? 24   LYS J CE  1 
ATOM   8609  N  NZ  . LYS D 1 6   ? 108.800 37.507 97.568  1.00 32.85 ? 24   LYS J NZ  1 
ATOM   8610  N  N   . ALA D 1 7   ? 108.975 43.273 102.181 1.00 24.59 ? 25   ALA J N   1 
ATOM   8611  C  CA  . ALA D 1 7   ? 109.528 44.173 103.191 1.00 25.02 ? 25   ALA J CA  1 
ATOM   8612  C  C   . ALA D 1 7   ? 111.030 44.374 102.986 1.00 25.40 ? 25   ALA J C   1 
ATOM   8613  O  O   . ALA D 1 7   ? 111.562 45.438 103.287 1.00 25.37 ? 25   ALA J O   1 
ATOM   8614  C  CB  . ALA D 1 7   ? 109.247 43.641 104.573 1.00 24.75 ? 25   ALA J CB  1 
ATOM   8615  N  N   . LYS D 1 8   ? 111.690 43.338 102.464 1.00 25.94 ? 26   LYS J N   1 
ATOM   8616  C  CA  . LYS D 1 8   ? 113.096 43.376 102.052 1.00 26.52 ? 26   LYS J CA  1 
ATOM   8617  C  C   . LYS D 1 8   ? 113.390 44.547 101.107 1.00 26.19 ? 26   LYS J C   1 
ATOM   8618  O  O   . LYS D 1 8   ? 114.466 45.146 101.165 1.00 26.23 ? 26   LYS J O   1 
ATOM   8619  C  CB  . LYS D 1 8   ? 113.444 42.053 101.349 1.00 27.07 ? 26   LYS J CB  1 
ATOM   8620  C  CG  . LYS D 1 8   ? 114.899 41.644 101.409 1.00 29.10 ? 26   LYS J CG  1 
ATOM   8621  C  CD  . LYS D 1 8   ? 115.197 40.546 100.389 1.00 32.03 ? 26   LYS J CD  1 
ATOM   8622  C  CE  . LYS D 1 8   ? 116.695 40.212 100.335 1.00 34.06 ? 26   LYS J CE  1 
ATOM   8623  N  NZ  . LYS D 1 8   ? 117.073 39.472 99.079  1.00 34.91 ? 26   LYS J NZ  1 
ATOM   8624  N  N   . ASP D 1 9   ? 112.427 44.862 100.241 1.00 25.82 ? 27   ASP J N   1 
ATOM   8625  C  CA  . ASP D 1 9   ? 112.590 45.882 99.198  1.00 25.41 ? 27   ASP J CA  1 
ATOM   8626  C  C   . ASP D 1 9   ? 112.215 47.299 99.631  1.00 25.16 ? 27   ASP J C   1 
ATOM   8627  O  O   . ASP D 1 9   ? 112.293 48.233 98.838  1.00 24.99 ? 27   ASP J O   1 
ATOM   8628  C  CB  . ASP D 1 9   ? 111.776 45.492 97.961  1.00 25.49 ? 27   ASP J CB  1 
ATOM   8629  C  CG  . ASP D 1 9   ? 112.295 44.228 97.289  1.00 26.10 ? 27   ASP J CG  1 
ATOM   8630  O  OD1 . ASP D 1 9   ? 111.487 43.528 96.646  1.00 26.14 ? 27   ASP J OD1 1 
ATOM   8631  O  OD2 . ASP D 1 9   ? 113.510 43.935 97.401  1.00 26.90 ? 27   ASP J OD2 1 
ATOM   8632  N  N   . LEU D 1 10  ? 111.813 47.446 100.890 1.00 24.95 ? 28   LEU J N   1 
ATOM   8633  C  CA  . LEU D 1 10  ? 111.323 48.708 101.438 1.00 24.83 ? 28   LEU J CA  1 
ATOM   8634  C  C   . LEU D 1 10  ? 112.260 49.875 101.116 1.00 24.87 ? 28   LEU J C   1 
ATOM   8635  O  O   . LEU D 1 10  ? 113.476 49.793 101.337 1.00 25.04 ? 28   LEU J O   1 
ATOM   8636  C  CB  . LEU D 1 10  ? 111.153 48.555 102.950 1.00 24.98 ? 28   LEU J CB  1 
ATOM   8637  C  CG  . LEU D 1 10  ? 110.005 49.115 103.809 1.00 25.44 ? 28   LEU J CG  1 
ATOM   8638  C  CD1 . LEU D 1 10  ? 108.689 49.319 103.089 1.00 24.29 ? 28   LEU J CD1 1 
ATOM   8639  C  CD2 . LEU D 1 10  ? 109.816 48.188 104.996 1.00 24.73 ? 28   LEU J CD2 1 
ATOM   8640  N  N   . ILE D 1 11  ? 111.686 50.945 100.568 1.00 24.37 ? 29   ILE J N   1 
ATOM   8641  C  CA  . ILE D 1 11  ? 112.421 52.168 100.272 1.00 24.10 ? 29   ILE J CA  1 
ATOM   8642  C  C   . ILE D 1 11  ? 111.902 53.270 101.192 1.00 24.12 ? 29   ILE J C   1 
ATOM   8643  O  O   . ILE D 1 11  ? 110.756 53.708 101.077 1.00 24.06 ? 29   ILE J O   1 
ATOM   8644  C  CB  . ILE D 1 11  ? 112.276 52.594 98.774  1.00 23.99 ? 29   ILE J CB  1 
ATOM   8645  C  CG1 . ILE D 1 11  ? 112.782 51.492 97.838  1.00 23.51 ? 29   ILE J CG1 1 
ATOM   8646  C  CG2 . ILE D 1 11  ? 113.015 53.909 98.505  1.00 23.93 ? 29   ILE J CG2 1 
ATOM   8647  C  CD1 . ILE D 1 11  ? 112.460 51.718 96.363  1.00 23.83 ? 29   ILE J CD1 1 
ATOM   8648  N  N   . VAL D 1 12  ? 112.745 53.714 102.114 1.00 24.34 ? 30   VAL J N   1 
ATOM   8649  C  CA  . VAL D 1 12  ? 112.302 54.687 103.111 1.00 24.47 ? 30   VAL J CA  1 
ATOM   8650  C  C   . VAL D 1 12  ? 112.903 56.071 102.902 1.00 24.52 ? 30   VAL J C   1 
ATOM   8651  O  O   . VAL D 1 12  ? 114.126 56.237 102.757 1.00 24.68 ? 30   VAL J O   1 
ATOM   8652  C  CB  . VAL D 1 12  ? 112.387 54.134 104.587 1.00 24.74 ? 30   VAL J CB  1 
ATOM   8653  C  CG1 . VAL D 1 12  ? 113.172 52.835 104.648 1.00 24.16 ? 30   VAL J CG1 1 
ATOM   8654  C  CG2 . VAL D 1 12  ? 112.917 55.167 105.574 1.00 24.78 ? 30   VAL J CG2 1 
ATOM   8655  N  N   . THR D 1 13  ? 111.999 57.045 102.854 1.00 24.26 ? 31   THR J N   1 
ATOM   8656  C  CA  . THR D 1 13  ? 112.298 58.446 102.606 1.00 24.18 ? 31   THR J CA  1 
ATOM   8657  C  C   . THR D 1 13  ? 111.867 59.252 103.835 1.00 23.82 ? 31   THR J C   1 
ATOM   8658  O  O   . THR D 1 13  ? 110.713 59.665 103.931 1.00 23.62 ? 31   THR J O   1 
ATOM   8659  C  CB  . THR D 1 13  ? 111.528 58.943 101.351 1.00 24.37 ? 31   THR J CB  1 
ATOM   8660  O  OG1 . THR D 1 13  ? 111.908 58.159 100.216 1.00 24.45 ? 31   THR J OG1 1 
ATOM   8661  C  CG2 . THR D 1 13  ? 111.798 60.421 101.067 1.00 24.70 ? 31   THR J CG2 1 
ATOM   8662  N  N   . PRO D 1 14  ? 112.784 59.450 104.799 1.00 23.76 ? 32   PRO J N   1 
ATOM   8663  C  CA  . PRO D 1 14  ? 112.474 60.246 105.988 1.00 23.54 ? 32   PRO J CA  1 
ATOM   8664  C  C   . PRO D 1 14  ? 112.024 61.679 105.690 1.00 23.34 ? 32   PRO J C   1 
ATOM   8665  O  O   . PRO D 1 14  ? 112.515 62.316 104.751 1.00 23.33 ? 32   PRO J O   1 
ATOM   8666  C  CB  . PRO D 1 14  ? 113.802 60.254 106.754 1.00 23.59 ? 32   PRO J CB  1 
ATOM   8667  C  CG  . PRO D 1 14  ? 114.484 59.010 106.320 1.00 23.40 ? 32   PRO J CG  1 
ATOM   8668  C  CD  . PRO D 1 14  ? 114.151 58.899 104.862 1.00 23.77 ? 32   PRO J CD  1 
ATOM   8669  N  N   . ALA D 1 15  ? 111.077 62.161 106.488 1.00 23.06 ? 33   ALA J N   1 
ATOM   8670  C  CA  . ALA D 1 15  ? 110.707 63.568 106.504 1.00 23.02 ? 33   ALA J CA  1 
ATOM   8671  C  C   . ALA D 1 15  ? 111.900 64.392 106.991 1.00 23.06 ? 33   ALA J C   1 
ATOM   8672  O  O   . ALA D 1 15  ? 112.632 63.969 107.893 1.00 23.20 ? 33   ALA J O   1 
ATOM   8673  C  CB  . ALA D 1 15  ? 109.511 63.781 107.411 1.00 22.77 ? 33   ALA J CB  1 
ATOM   8674  N  N   . THR D 1 16  ? 112.105 65.559 106.392 1.00 22.91 ? 34   THR J N   1 
ATOM   8675  C  CA  . THR D 1 16  ? 113.230 66.407 106.789 1.00 22.94 ? 34   THR J CA  1 
ATOM   8676  C  C   . THR D 1 16  ? 112.816 67.380 107.885 1.00 22.52 ? 34   THR J C   1 
ATOM   8677  O  O   . THR D 1 16  ? 113.665 67.928 108.581 1.00 22.58 ? 34   THR J O   1 
ATOM   8678  C  CB  . THR D 1 16  ? 113.877 67.149 105.586 1.00 22.97 ? 34   THR J CB  1 
ATOM   8679  O  OG1 . THR D 1 16  ? 112.853 67.664 104.725 1.00 23.49 ? 34   THR J OG1 1 
ATOM   8680  C  CG2 . THR D 1 16  ? 114.779 66.197 104.798 1.00 22.61 ? 34   THR J CG2 1 
ATOM   8681  N  N   . ILE D 1 17  ? 111.506 67.577 108.027 1.00 22.07 ? 35   ILE J N   1 
ATOM   8682  C  CA  . ILE D 1 17  ? 110.935 68.349 109.123 1.00 21.59 ? 35   ILE J CA  1 
ATOM   8683  C  C   . ILE D 1 17  ? 109.977 67.443 109.894 1.00 21.27 ? 35   ILE J C   1 
ATOM   8684  O  O   . ILE D 1 17  ? 109.104 66.805 109.300 1.00 21.72 ? 35   ILE J O   1 
ATOM   8685  C  CB  . ILE D 1 17  ? 110.195 69.625 108.619 1.00 21.61 ? 35   ILE J CB  1 
ATOM   8686  C  CG1 . ILE D 1 17  ? 111.125 70.517 107.778 1.00 22.45 ? 35   ILE J CG1 1 
ATOM   8687  C  CG2 . ILE D 1 17  ? 109.616 70.422 109.779 1.00 21.57 ? 35   ILE J CG2 1 
ATOM   8688  C  CD1 . ILE D 1 17  ? 112.383 70.985 108.489 1.00 22.25 ? 35   ILE J CD1 1 
ATOM   8689  N  N   . LEU D 1 18  ? 110.138 67.379 111.211 1.00 20.59 ? 36   LEU J N   1 
ATOM   8690  C  CA  . LEU D 1 18  ? 109.278 66.518 112.024 1.00 20.16 ? 36   LEU J CA  1 
ATOM   8691  C  C   . LEU D 1 18  ? 108.242 67.329 112.789 1.00 20.14 ? 36   LEU J C   1 
ATOM   8692  O  O   . LEU D 1 18  ? 108.526 68.433 113.257 1.00 20.06 ? 36   LEU J O   1 
ATOM   8693  C  CB  . LEU D 1 18  ? 110.101 65.625 112.962 1.00 19.76 ? 36   LEU J CB  1 
ATOM   8694  C  CG  . LEU D 1 18  ? 111.117 64.663 112.320 1.00 18.94 ? 36   LEU J CG  1 
ATOM   8695  C  CD1 . LEU D 1 18  ? 111.954 63.981 113.388 1.00 17.86 ? 36   LEU J CD1 1 
ATOM   8696  C  CD2 . LEU D 1 18  ? 110.464 63.625 111.417 1.00 16.91 ? 36   LEU J CD2 1 
ATOM   8697  N  N   . LYS D 1 19  ? 107.035 66.779 112.887 1.00 20.27 ? 37   LYS J N   1 
ATOM   8698  C  CA  . LYS D 1 19  ? 105.918 67.445 113.563 1.00 20.40 ? 37   LYS J CA  1 
ATOM   8699  C  C   . LYS D 1 19  ? 105.940 67.211 115.068 1.00 20.70 ? 37   LYS J C   1 
ATOM   8700  O  O   . LYS D 1 19  ? 106.398 66.170 115.544 1.00 20.62 ? 37   LYS J O   1 
ATOM   8701  C  CB  . LYS D 1 19  ? 104.579 66.973 112.988 1.00 20.15 ? 37   LYS J CB  1 
ATOM   8702  C  CG  . LYS D 1 19  ? 104.329 67.380 111.530 1.00 20.31 ? 37   LYS J CG  1 
ATOM   8703  C  CD  . LYS D 1 19  ? 102.989 66.862 110.999 1.00 20.32 ? 37   LYS J CD  1 
ATOM   8704  C  CE  . LYS D 1 19  ? 102.989 65.336 110.864 1.00 21.31 ? 37   LYS J CE  1 
ATOM   8705  N  NZ  . LYS D 1 19  ? 101.945 64.828 109.914 1.00 21.59 ? 37   LYS J NZ  1 
ATOM   8706  N  N   . GLU D 1 20  ? 105.428 68.182 115.816 1.00 21.39 ? 38   GLU J N   1 
ATOM   8707  C  CA  . GLU D 1 20  ? 105.243 68.014 117.254 1.00 22.01 ? 38   GLU J CA  1 
ATOM   8708  C  C   . GLU D 1 20  ? 104.099 67.030 117.537 1.00 21.93 ? 38   GLU J C   1 
ATOM   8709  O  O   . GLU D 1 20  ? 103.080 67.024 116.839 1.00 21.56 ? 38   GLU J O   1 
ATOM   8710  C  CB  . GLU D 1 20  ? 105.010 69.368 117.935 1.00 22.14 ? 38   GLU J CB  1 
ATOM   8711  C  CG  . GLU D 1 20  ? 106.227 70.310 117.859 1.00 23.95 ? 38   GLU J CG  1 
ATOM   8712  C  CD  . GLU D 1 20  ? 105.989 71.669 118.518 1.00 26.03 ? 38   GLU J CD  1 
ATOM   8713  O  OE1 . GLU D 1 20  ? 105.202 71.739 119.490 1.00 27.61 ? 38   GLU J OE1 1 
ATOM   8714  O  OE2 . GLU D 1 20  ? 106.599 72.667 118.071 1.00 25.92 ? 38   GLU J OE2 1 
ATOM   8715  N  N   . LYS D 1 21  ? 104.302 66.179 118.540 1.00 22.26 ? 39   LYS J N   1 
ATOM   8716  C  CA  . LYS D 1 21  ? 103.312 65.183 118.954 1.00 22.66 ? 39   LYS J CA  1 
ATOM   8717  C  C   . LYS D 1 21  ? 102.174 65.874 119.718 1.00 23.07 ? 39   LYS J C   1 
ATOM   8718  O  O   . LYS D 1 21  ? 102.400 66.902 120.372 1.00 23.20 ? 39   LYS J O   1 
ATOM   8719  C  CB  . LYS D 1 21  ? 103.960 64.109 119.846 1.00 22.80 ? 39   LYS J CB  1 
ATOM   8720  C  CG  . LYS D 1 21  ? 105.362 63.620 119.418 1.00 22.88 ? 39   LYS J CG  1 
ATOM   8721  C  CD  . LYS D 1 21  ? 105.320 62.858 118.110 1.00 22.80 ? 39   LYS J CD  1 
ATOM   8722  C  CE  . LYS D 1 21  ? 106.526 61.968 117.904 1.00 22.97 ? 39   LYS J CE  1 
ATOM   8723  N  NZ  . LYS D 1 21  ? 107.759 62.697 117.513 1.00 23.76 ? 39   LYS J NZ  1 
ATOM   8724  N  N   . PRO D 1 22  ? 100.948 65.322 119.641 1.00 23.28 ? 40   PRO J N   1 
ATOM   8725  C  CA  . PRO D 1 22  ? 99.841  65.923 120.376 1.00 23.73 ? 40   PRO J CA  1 
ATOM   8726  C  C   . PRO D 1 22  ? 99.793  65.460 121.832 1.00 24.26 ? 40   PRO J C   1 
ATOM   8727  O  O   . PRO D 1 22  ? 100.447 64.485 122.201 1.00 24.07 ? 40   PRO J O   1 
ATOM   8728  C  CB  . PRO D 1 22  ? 98.613  65.411 119.619 1.00 23.59 ? 40   PRO J CB  1 
ATOM   8729  C  CG  . PRO D 1 22  ? 99.025  64.080 119.133 1.00 23.32 ? 40   PRO J CG  1 
ATOM   8730  C  CD  . PRO D 1 22  ? 100.512 64.135 118.882 1.00 23.30 ? 40   PRO J CD  1 
ATOM   8731  N  N   . ASP D 1 23  ? 99.024  66.173 122.646 1.00 25.33 ? 41   ASP J N   1 
ATOM   8732  C  CA  . ASP D 1 23  ? 98.762  65.786 124.028 1.00 26.35 ? 41   ASP J CA  1 
ATOM   8733  C  C   . ASP D 1 23  ? 97.929  64.499 124.021 1.00 26.85 ? 41   ASP J C   1 
ATOM   8734  O  O   . ASP D 1 23  ? 96.832  64.492 123.457 1.00 26.88 ? 41   ASP J O   1 
ATOM   8735  C  CB  . ASP D 1 23  ? 97.993  66.909 124.727 1.00 26.46 ? 41   ASP J CB  1 
ATOM   8736  C  CG  . ASP D 1 23  ? 98.072  66.835 126.244 1.00 27.35 ? 41   ASP J CG  1 
ATOM   8737  O  OD1 . ASP D 1 23  ? 98.266  65.736 126.806 1.00 26.87 ? 41   ASP J OD1 1 
ATOM   8738  O  OD2 . ASP D 1 23  ? 97.919  67.900 126.882 1.00 29.17 ? 41   ASP J OD2 1 
ATOM   8739  N  N   . PRO D 1 24  ? 98.450  63.402 124.621 1.00 27.46 ? 42   PRO J N   1 
ATOM   8740  C  CA  . PRO D 1 24  ? 97.688  62.145 124.667 1.00 28.11 ? 42   PRO J CA  1 
ATOM   8741  C  C   . PRO D 1 24  ? 96.355  62.253 125.419 1.00 28.88 ? 42   PRO J C   1 
ATOM   8742  O  O   . PRO D 1 24  ? 95.462  61.425 125.207 1.00 28.81 ? 42   PRO J O   1 
ATOM   8743  C  CB  . PRO D 1 24  ? 98.631  61.174 125.389 1.00 27.98 ? 42   PRO J CB  1 
ATOM   8744  C  CG  . PRO D 1 24  ? 99.601  62.030 126.114 1.00 27.88 ? 42   PRO J CG  1 
ATOM   8745  C  CD  . PRO D 1 24  ? 99.769  63.259 125.264 1.00 27.53 ? 42   PRO J CD  1 
ATOM   8746  N  N   . ASN D 1 25  ? 96.226  63.269 126.277 1.00 29.57 ? 43   ASN J N   1 
ATOM   8747  C  CA  . ASN D 1 25  ? 95.002  63.478 127.056 1.00 30.36 ? 43   ASN J CA  1 
ATOM   8748  C  C   . ASN D 1 25  ? 93.959  64.311 126.306 1.00 30.24 ? 43   ASN J C   1 
ATOM   8749  O  O   . ASN D 1 25  ? 92.827  64.464 126.774 1.00 30.40 ? 43   ASN J O   1 
ATOM   8750  C  CB  . ASN D 1 25  ? 95.311  64.102 128.431 1.00 30.60 ? 43   ASN J CB  1 
ATOM   8751  C  CG  . ASN D 1 25  ? 96.429  63.378 129.178 1.00 32.48 ? 43   ASN J CG  1 
ATOM   8752  O  OD1 . ASN D 1 25  ? 96.499  62.139 129.202 1.00 33.98 ? 43   ASN J OD1 1 
ATOM   8753  N  ND2 . ASN D 1 25  ? 97.314  64.158 129.803 1.00 33.54 ? 43   ASN J ND2 1 
ATOM   8754  N  N   . ASN D 1 26  ? 94.342  64.833 125.142 1.00 30.10 ? 44   ASN J N   1 
ATOM   8755  C  CA  . ASN D 1 26  ? 93.448  65.628 124.296 1.00 30.21 ? 44   ASN J CA  1 
ATOM   8756  C  C   . ASN D 1 26  ? 93.394  65.138 122.840 1.00 29.60 ? 44   ASN J C   1 
ATOM   8757  O  O   . ASN D 1 26  ? 93.503  65.935 121.901 1.00 29.92 ? 44   ASN J O   1 
ATOM   8758  C  CB  . ASN D 1 26  ? 93.857  67.110 124.319 1.00 30.68 ? 44   ASN J CB  1 
ATOM   8759  C  CG  . ASN D 1 26  ? 93.925  67.688 125.724 1.00 32.50 ? 44   ASN J CG  1 
ATOM   8760  O  OD1 . ASN D 1 26  ? 93.073  67.404 126.582 1.00 34.29 ? 44   ASN J OD1 1 
ATOM   8761  N  ND2 . ASN D 1 26  ? 94.944  68.517 125.966 1.00 33.44 ? 44   ASN J ND2 1 
ATOM   8762  N  N   . LEU D 1 27  ? 93.225  63.833 122.654 1.00 28.72 ? 45   LEU J N   1 
ATOM   8763  C  CA  . LEU D 1 27  ? 93.169  63.243 121.317 1.00 27.49 ? 45   LEU J CA  1 
ATOM   8764  C  C   . LEU D 1 27  ? 91.731  62.990 120.857 1.00 26.60 ? 45   LEU J C   1 
ATOM   8765  O  O   . LEU D 1 27  ? 90.941  62.381 121.582 1.00 26.59 ? 45   LEU J O   1 
ATOM   8766  C  CB  . LEU D 1 27  ? 93.965  61.933 121.275 1.00 27.74 ? 45   LEU J CB  1 
ATOM   8767  C  CG  . LEU D 1 27  ? 95.486  61.959 121.460 1.00 27.89 ? 45   LEU J CG  1 
ATOM   8768  C  CD1 . LEU D 1 27  ? 95.984  60.594 121.908 1.00 29.28 ? 45   LEU J CD1 1 
ATOM   8769  C  CD2 . LEU D 1 27  ? 96.181  62.373 120.191 1.00 27.22 ? 45   LEU J CD2 1 
ATOM   8770  N  N   . VAL D 1 28  ? 91.401  63.481 119.663 1.00 25.24 ? 46   VAL J N   1 
ATOM   8771  C  CA  . VAL D 1 28  ? 90.144  63.154 118.980 1.00 23.99 ? 46   VAL J CA  1 
ATOM   8772  C  C   . VAL D 1 28  ? 90.469  62.122 117.897 1.00 23.10 ? 46   VAL J C   1 
ATOM   8773  O  O   . VAL D 1 28  ? 91.371  62.341 117.081 1.00 22.64 ? 46   VAL J O   1 
ATOM   8774  C  CB  . VAL D 1 28  ? 89.486  64.407 118.347 1.00 24.09 ? 46   VAL J CB  1 
ATOM   8775  C  CG1 . VAL D 1 28  ? 88.214  64.043 117.592 1.00 23.83 ? 46   VAL J CG1 1 
ATOM   8776  C  CG2 . VAL D 1 28  ? 89.178  65.447 119.415 1.00 24.98 ? 46   VAL J CG2 1 
ATOM   8777  N  N   . PHE D 1 29  ? 89.747  60.997 117.911 1.00 22.01 ? 47   PHE J N   1 
ATOM   8778  C  CA  . PHE D 1 29  ? 90.029  59.861 117.026 1.00 20.79 ? 47   PHE J CA  1 
ATOM   8779  C  C   . PHE D 1 29  ? 90.137  60.251 115.552 1.00 20.12 ? 47   PHE J C   1 
ATOM   8780  O  O   . PHE D 1 29  ? 89.242  60.894 115.013 1.00 20.23 ? 47   PHE J O   1 
ATOM   8781  C  CB  . PHE D 1 29  ? 88.974  58.748 117.175 1.00 20.57 ? 47   PHE J CB  1 
ATOM   8782  C  CG  . PHE D 1 29  ? 89.112  57.656 116.141 1.00 20.38 ? 47   PHE J CG  1 
ATOM   8783  C  CD1 . PHE D 1 29  ? 89.950  56.566 116.366 1.00 19.87 ? 47   PHE J CD1 1 
ATOM   8784  C  CD2 . PHE D 1 29  ? 88.442  57.744 114.919 1.00 20.09 ? 47   PHE J CD2 1 
ATOM   8785  C  CE1 . PHE D 1 29  ? 90.106  55.574 115.399 1.00 20.11 ? 47   PHE J CE1 1 
ATOM   8786  C  CE2 . PHE D 1 29  ? 88.596  56.760 113.946 1.00 19.73 ? 47   PHE J CE2 1 
ATOM   8787  C  CZ  . PHE D 1 29  ? 89.430  55.678 114.185 1.00 19.43 ? 47   PHE J CZ  1 
ATOM   8788  N  N   . GLY D 1 30  ? 91.236  59.846 114.917 1.00 19.27 ? 48   GLY J N   1 
ATOM   8789  C  CA  . GLY D 1 30  ? 91.367  59.883 113.460 1.00 18.09 ? 48   GLY J CA  1 
ATOM   8790  C  C   . GLY D 1 30  ? 91.566  61.253 112.842 1.00 17.48 ? 48   GLY J C   1 
ATOM   8791  O  O   . GLY D 1 30  ? 91.363  61.414 111.643 1.00 17.38 ? 48   GLY J O   1 
ATOM   8792  N  N   . THR D 1 31  ? 91.974  62.232 113.651 1.00 16.76 ? 49   THR J N   1 
ATOM   8793  C  CA  . THR D 1 31  ? 92.133  63.609 113.184 1.00 16.13 ? 49   THR J CA  1 
ATOM   8794  C  C   . THR D 1 31  ? 93.594  64.078 113.091 1.00 16.03 ? 49   THR J C   1 
ATOM   8795  O  O   . THR D 1 31  ? 93.906  64.979 112.312 1.00 15.85 ? 49   THR J O   1 
ATOM   8796  C  CB  . THR D 1 31  ? 91.322  64.613 114.046 1.00 16.21 ? 49   THR J CB  1 
ATOM   8797  O  OG1 . THR D 1 31  ? 91.877  64.682 115.362 1.00 16.30 ? 49   THR J OG1 1 
ATOM   8798  C  CG2 . THR D 1 31  ? 89.847  64.207 114.134 1.00 15.65 ? 49   THR J CG2 1 
ATOM   8799  N  N   . VAL D 1 32  ? 94.485  63.507 113.897 1.00 15.70 ? 50   VAL J N   1 
ATOM   8800  C  CA  . VAL D 1 32  ? 95.901  63.853 113.759 1.00 15.32 ? 50   VAL J CA  1 
ATOM   8801  C  C   . VAL D 1 32  ? 96.695  62.670 113.222 1.00 15.06 ? 50   VAL J C   1 
ATOM   8802  O  O   . VAL D 1 32  ? 96.484  61.530 113.630 1.00 14.97 ? 50   VAL J O   1 
ATOM   8803  C  CB  . VAL D 1 32  ? 96.549  64.537 115.033 1.00 15.59 ? 50   VAL J CB  1 
ATOM   8804  C  CG1 . VAL D 1 32  ? 95.532  65.376 115.817 1.00 14.36 ? 50   VAL J CG1 1 
ATOM   8805  C  CG2 . VAL D 1 32  ? 97.255  63.560 115.927 1.00 15.97 ? 50   VAL J CG2 1 
ATOM   8806  N  N   . PHE D 1 33  ? 97.571  62.949 112.263 1.00 14.74 ? 51   PHE J N   1 
ATOM   8807  C  CA  . PHE D 1 33  ? 98.345  61.900 111.610 1.00 14.46 ? 51   PHE J CA  1 
ATOM   8808  C  C   . PHE D 1 33  ? 99.831  62.100 111.859 1.00 14.44 ? 51   PHE J C   1 
ATOM   8809  O  O   . PHE D 1 33  ? 100.292 63.226 112.086 1.00 14.36 ? 51   PHE J O   1 
ATOM   8810  C  CB  . PHE D 1 33  ? 98.034  61.851 110.108 1.00 14.54 ? 51   PHE J CB  1 
ATOM   8811  C  CG  . PHE D 1 33  ? 96.581  61.594 109.797 1.00 14.83 ? 51   PHE J CG  1 
ATOM   8812  C  CD1 . PHE D 1 33  ? 95.692  62.655 109.629 1.00 14.19 ? 51   PHE J CD1 1 
ATOM   8813  C  CD2 . PHE D 1 33  ? 96.096  60.288 109.698 1.00 14.80 ? 51   PHE J CD2 1 
ATOM   8814  C  CE1 . PHE D 1 33  ? 94.343  62.423 109.352 1.00 14.19 ? 51   PHE J CE1 1 
ATOM   8815  C  CE2 . PHE D 1 33  ? 94.749  60.044 109.424 1.00 14.17 ? 51   PHE J CE2 1 
ATOM   8816  C  CZ  . PHE D 1 33  ? 93.871  61.113 109.249 1.00 14.39 ? 51   PHE J CZ  1 
ATOM   8817  N  N   . THR D 1 34  ? 100.573 60.998 111.812 1.00 14.29 ? 52   THR J N   1 
ATOM   8818  C  CA  . THR D 1 34  ? 102.004 60.992 112.105 1.00 14.11 ? 52   THR J CA  1 
ATOM   8819  C  C   . THR D 1 34  ? 102.825 61.534 110.933 1.00 14.26 ? 52   THR J C   1 
ATOM   8820  O  O   . THR D 1 34  ? 102.269 62.087 109.982 1.00 14.58 ? 52   THR J O   1 
ATOM   8821  C  CB  . THR D 1 34  ? 102.477 59.582 112.519 1.00 14.15 ? 52   THR J CB  1 
ATOM   8822  O  OG1 . THR D 1 34  ? 102.417 58.707 111.391 1.00 13.84 ? 52   THR J OG1 1 
ATOM   8823  C  CG2 . THR D 1 34  ? 101.586 59.027 113.617 1.00 13.20 ? 52   THR J CG2 1 
ATOM   8824  N  N   . ASP D 1 35  ? 104.145 61.406 111.021 1.00 14.26 ? 53   ASP J N   1 
ATOM   8825  C  CA  . ASP D 1 35  ? 105.059 61.979 110.031 1.00 14.40 ? 53   ASP J CA  1 
ATOM   8826  C  C   . ASP D 1 35  ? 105.072 61.215 108.710 1.00 14.76 ? 53   ASP J C   1 
ATOM   8827  O  O   . ASP D 1 35  ? 105.198 61.821 107.643 1.00 14.84 ? 53   ASP J O   1 
ATOM   8828  C  CB  . ASP D 1 35  ? 106.487 62.016 110.592 1.00 14.35 ? 53   ASP J CB  1 
ATOM   8829  C  CG  . ASP D 1 35  ? 106.661 63.035 111.711 1.00 14.12 ? 53   ASP J CG  1 
ATOM   8830  O  OD1 . ASP D 1 35  ? 106.348 64.231 111.503 1.00 12.68 ? 53   ASP J OD1 1 
ATOM   8831  O  OD2 . ASP D 1 35  ? 107.131 62.633 112.796 1.00 13.83 ? 53   ASP J OD2 1 
ATOM   8832  N  N   . HIS D 1 36  ? 104.940 59.890 108.794 1.00 15.01 ? 54   HIS J N   1 
ATOM   8833  C  CA  . HIS D 1 36  ? 105.161 59.003 107.657 1.00 15.59 ? 54   HIS J CA  1 
ATOM   8834  C  C   . HIS D 1 36  ? 103.964 58.108 107.325 1.00 15.66 ? 54   HIS J C   1 
ATOM   8835  O  O   . HIS D 1 36  ? 103.055 57.909 108.149 1.00 16.04 ? 54   HIS J O   1 
ATOM   8836  C  CB  . HIS D 1 36  ? 106.422 58.143 107.880 1.00 15.71 ? 54   HIS J CB  1 
ATOM   8837  C  CG  . HIS D 1 36  ? 107.670 58.945 108.096 1.00 16.39 ? 54   HIS J CG  1 
ATOM   8838  N  ND1 . HIS D 1 36  ? 108.124 59.292 109.351 1.00 16.20 ? 54   HIS J ND1 1 
ATOM   8839  C  CD2 . HIS D 1 36  ? 108.557 59.470 107.218 1.00 16.93 ? 54   HIS J CD2 1 
ATOM   8840  C  CE1 . HIS D 1 36  ? 109.234 60.000 109.237 1.00 16.17 ? 54   HIS J CE1 1 
ATOM   8841  N  NE2 . HIS D 1 36  ? 109.517 60.124 107.953 1.00 16.54 ? 54   HIS J NE2 1 
ATOM   8842  N  N   . MET D 1 37  ? 103.989 57.570 106.108 1.00 15.48 ? 55   MET J N   1 
ATOM   8843  C  CA  . MET D 1 37  ? 102.972 56.659 105.612 1.00 15.42 ? 55   MET J CA  1 
ATOM   8844  C  C   . MET D 1 37  ? 103.640 55.564 104.783 1.00 15.49 ? 55   MET J C   1 
ATOM   8845  O  O   . MET D 1 37  ? 104.729 55.769 104.250 1.00 15.60 ? 55   MET J O   1 
ATOM   8846  C  CB  . MET D 1 37  ? 101.933 57.419 104.766 1.00 15.63 ? 55   MET J CB  1 
ATOM   8847  C  CG  . MET D 1 37  ? 102.425 57.942 103.398 1.00 15.46 ? 55   MET J CG  1 
ATOM   8848  S  SD  . MET D 1 37  ? 101.246 59.006 102.502 1.00 16.39 ? 55   MET J SD  1 
ATOM   8849  C  CE  . MET D 1 37  ? 99.841  57.911 102.282 1.00 17.22 ? 55   MET J CE  1 
ATOM   8850  N  N   . LEU D 1 38  ? 102.987 54.410 104.676 1.00 15.34 ? 56   LEU J N   1 
ATOM   8851  C  CA  . LEU D 1 38  ? 103.406 53.373 103.734 1.00 15.29 ? 56   LEU J CA  1 
ATOM   8852  C  C   . LEU D 1 38  ? 102.578 53.491 102.456 1.00 15.40 ? 56   LEU J C   1 
ATOM   8853  O  O   . LEU D 1 38  ? 101.380 53.762 102.523 1.00 15.48 ? 56   LEU J O   1 
ATOM   8854  C  CB  . LEU D 1 38  ? 103.238 51.975 104.342 1.00 14.96 ? 56   LEU J CB  1 
ATOM   8855  C  CG  . LEU D 1 38  ? 103.623 50.724 103.530 1.00 14.80 ? 56   LEU J CG  1 
ATOM   8856  C  CD1 . LEU D 1 38  ? 105.132 50.481 103.475 1.00 14.30 ? 56   LEU J CD1 1 
ATOM   8857  C  CD2 . LEU D 1 38  ? 102.936 49.503 104.102 1.00 16.33 ? 56   LEU J CD2 1 
ATOM   8858  N  N   . THR D 1 39  ? 103.220 53.298 101.303 1.00 15.29 ? 57   THR J N   1 
ATOM   8859  C  CA  . THR D 1 39  ? 102.518 53.232 100.016 1.00 15.15 ? 57   THR J CA  1 
ATOM   8860  C  C   . THR D 1 39  ? 103.084 52.096 99.170  1.00 15.34 ? 57   THR J C   1 
ATOM   8861  O  O   . THR D 1 39  ? 104.301 51.897 99.128  1.00 15.10 ? 57   THR J O   1 
ATOM   8862  C  CB  . THR D 1 39  ? 102.592 54.571 99.201  1.00 15.53 ? 57   THR J CB  1 
ATOM   8863  O  OG1 . THR D 1 39  ? 103.960 54.943 98.970  1.00 15.10 ? 57   THR J OG1 1 
ATOM   8864  C  CG2 . THR D 1 39  ? 101.858 55.716 99.914  1.00 14.07 ? 57   THR J CG2 1 
ATOM   8865  N  N   . VAL D 1 40  ? 102.198 51.335 98.527  1.00 15.31 ? 58   VAL J N   1 
ATOM   8866  C  CA  . VAL D 1 40  ? 102.603 50.321 97.547  1.00 15.27 ? 58   VAL J CA  1 
ATOM   8867  C  C   . VAL D 1 40  ? 101.721 50.371 96.283  1.00 15.53 ? 58   VAL J C   1 
ATOM   8868  O  O   . VAL D 1 40  ? 100.499 50.216 96.358  1.00 15.12 ? 58   VAL J O   1 
ATOM   8869  C  CB  . VAL D 1 40  ? 102.601 48.868 98.114  1.00 15.55 ? 58   VAL J CB  1 
ATOM   8870  C  CG1 . VAL D 1 40  ? 103.591 48.003 97.322  1.00 14.52 ? 58   VAL J CG1 1 
ATOM   8871  C  CG2 . VAL D 1 40  ? 102.950 48.832 99.596  1.00 15.11 ? 58   VAL J CG2 1 
ATOM   8872  N  N   . GLU D 1 41  ? 102.357 50.581 95.130  1.00 15.47 ? 59   GLU J N   1 
ATOM   8873  C  CA  . GLU D 1 41  ? 101.663 50.577 93.838  1.00 15.64 ? 59   GLU J CA  1 
ATOM   8874  C  C   . GLU D 1 41  ? 101.553 49.175 93.256  1.00 15.48 ? 59   GLU J C   1 
ATOM   8875  O  O   . GLU D 1 41  ? 102.444 48.351 93.440  1.00 15.30 ? 59   GLU J O   1 
ATOM   8876  C  CB  . GLU D 1 41  ? 102.394 51.466 92.827  1.00 15.72 ? 59   GLU J CB  1 
ATOM   8877  C  CG  . GLU D 1 41  ? 102.514 52.926 93.223  1.00 16.86 ? 59   GLU J CG  1 
ATOM   8878  C  CD  . GLU D 1 41  ? 101.216 53.697 93.065  1.00 18.97 ? 59   GLU J CD  1 
ATOM   8879  O  OE1 . GLU D 1 41  ? 101.180 54.887 93.455  1.00 20.03 ? 59   GLU J OE1 1 
ATOM   8880  O  OE2 . GLU D 1 41  ? 100.232 53.123 92.547  1.00 18.99 ? 59   GLU J OE2 1 
ATOM   8881  N  N   . TRP D 1 42  ? 100.459 48.929 92.539  1.00 15.49 ? 60   TRP J N   1 
ATOM   8882  C  CA  . TRP D 1 42  ? 100.258 47.694 91.795  1.00 15.61 ? 60   TRP J CA  1 
ATOM   8883  C  C   . TRP D 1 42  ? 99.667  47.983 90.409  1.00 15.96 ? 60   TRP J C   1 
ATOM   8884  O  O   . TRP D 1 42  ? 98.866  48.901 90.240  1.00 16.12 ? 60   TRP J O   1 
ATOM   8885  C  CB  . TRP D 1 42  ? 99.341  46.743 92.575  1.00 15.29 ? 60   TRP J CB  1 
ATOM   8886  C  CG  . TRP D 1 42  ? 99.021  45.443 91.869  1.00 15.03 ? 60   TRP J CG  1 
ATOM   8887  C  CD1 . TRP D 1 42  ? 99.705  44.267 91.973  1.00 14.31 ? 60   TRP J CD1 1 
ATOM   8888  C  CD2 . TRP D 1 42  ? 97.932  45.194 90.963  1.00 14.48 ? 60   TRP J CD2 1 
ATOM   8889  N  NE1 . TRP D 1 42  ? 99.117  43.304 91.189  1.00 14.39 ? 60   TRP J NE1 1 
ATOM   8890  C  CE2 . TRP D 1 42  ? 98.027  43.842 90.559  1.00 14.47 ? 60   TRP J CE2 1 
ATOM   8891  C  CE3 . TRP D 1 42  ? 96.882  45.978 90.461  1.00 14.39 ? 60   TRP J CE3 1 
ATOM   8892  C  CZ2 . TRP D 1 42  ? 97.113  43.253 89.671  1.00 14.43 ? 60   TRP J CZ2 1 
ATOM   8893  C  CZ3 . TRP D 1 42  ? 95.972  45.389 89.573  1.00 14.80 ? 60   TRP J CZ3 1 
ATOM   8894  C  CH2 . TRP D 1 42  ? 96.096  44.042 89.192  1.00 13.61 ? 60   TRP J CH2 1 
ATOM   8895  N  N   . SER D 1 43  ? 100.081 47.200 89.422  1.00 16.15 ? 61   SER J N   1 
ATOM   8896  C  CA  . SER D 1 43  ? 99.444  47.209 88.113  1.00 17.02 ? 61   SER J CA  1 
ATOM   8897  C  C   . SER D 1 43  ? 99.338  45.765 87.646  1.00 17.49 ? 61   SER J C   1 
ATOM   8898  O  O   . SER D 1 43  ? 100.126 44.927 88.068  1.00 17.14 ? 61   SER J O   1 
ATOM   8899  C  CB  . SER D 1 43  ? 100.241 48.062 87.118  1.00 16.77 ? 61   SER J CB  1 
ATOM   8900  O  OG  . SER D 1 43  ? 101.478 47.445 86.797  1.00 16.63 ? 61   SER J OG  1 
ATOM   8901  N  N   . SER D 1 44  ? 98.356  45.463 86.801  1.00 18.79 ? 62   SER J N   1 
ATOM   8902  C  CA  . SER D 1 44  ? 98.243  44.112 86.235  1.00 20.17 ? 62   SER J CA  1 
ATOM   8903  C  C   . SER D 1 44  ? 99.424  43.755 85.313  1.00 20.86 ? 62   SER J C   1 
ATOM   8904  O  O   . SER D 1 44  ? 99.792  42.589 85.191  1.00 20.99 ? 62   SER J O   1 
ATOM   8905  C  CB  . SER D 1 44  ? 96.911  43.922 85.511  1.00 20.00 ? 62   SER J CB  1 
ATOM   8906  O  OG  . SER D 1 44  ? 96.792  44.830 84.433  1.00 21.89 ? 62   SER J OG  1 
ATOM   8907  N  N   . GLU D 1 45  ? 100.024 44.769 84.697  1.00 22.00 ? 63   GLU J N   1 
ATOM   8908  C  CA  . GLU D 1 45  ? 101.132 44.573 83.761  1.00 23.42 ? 63   GLU J CA  1 
ATOM   8909  C  C   . GLU D 1 45  ? 102.432 44.171 84.469  1.00 23.43 ? 63   GLU J C   1 
ATOM   8910  O  O   . GLU D 1 45  ? 103.087 43.199 84.078  1.00 23.86 ? 63   GLU J O   1 
ATOM   8911  C  CB  . GLU D 1 45  ? 101.337 45.841 82.918  1.00 23.71 ? 63   GLU J CB  1 
ATOM   8912  C  CG  . GLU D 1 45  ? 102.324 45.691 81.766  1.00 27.23 ? 63   GLU J CG  1 
ATOM   8913  C  CD  . GLU D 1 45  ? 102.187 46.789 80.719  1.00 30.69 ? 63   GLU J CD  1 
ATOM   8914  O  OE1 . GLU D 1 45  ? 103.089 47.647 80.630  1.00 33.19 ? 63   GLU J OE1 1 
ATOM   8915  O  OE2 . GLU D 1 45  ? 101.177 46.800 79.978  1.00 32.89 ? 63   GLU J OE2 1 
ATOM   8916  N  N   . PHE D 1 46  ? 102.787 44.912 85.517  1.00 23.33 ? 64   PHE J N   1 
ATOM   8917  C  CA  . PHE D 1 46  ? 104.055 44.723 86.216  1.00 23.21 ? 64   PHE J CA  1 
ATOM   8918  C  C   . PHE D 1 46  ? 103.918 44.134 87.622  1.00 22.71 ? 64   PHE J C   1 
ATOM   8919  O  O   . PHE D 1 46  ? 104.924 43.824 88.255  1.00 22.93 ? 64   PHE J O   1 
ATOM   8920  C  CB  . PHE D 1 46  ? 104.822 46.048 86.280  1.00 23.51 ? 64   PHE J CB  1 
ATOM   8921  C  CG  . PHE D 1 46  ? 105.085 46.661 84.933  1.00 24.84 ? 64   PHE J CG  1 
ATOM   8922  C  CD1 . PHE D 1 46  ? 106.019 46.094 84.064  1.00 26.13 ? 64   PHE J CD1 1 
ATOM   8923  C  CD2 . PHE D 1 46  ? 104.404 47.806 84.533  1.00 26.09 ? 64   PHE J CD2 1 
ATOM   8924  C  CE1 . PHE D 1 46  ? 106.268 46.656 82.814  1.00 27.17 ? 64   PHE J CE1 1 
ATOM   8925  C  CE2 . PHE D 1 46  ? 104.648 48.383 83.283  1.00 27.12 ? 64   PHE J CE2 1 
ATOM   8926  C  CZ  . PHE D 1 46  ? 105.581 47.805 82.421  1.00 27.14 ? 64   PHE J CZ  1 
ATOM   8927  N  N   . GLY D 1 47  ? 102.683 43.981 88.103  1.00 21.86 ? 65   GLY J N   1 
ATOM   8928  C  CA  . GLY D 1 47  ? 102.437 43.464 89.452  1.00 20.74 ? 65   GLY J CA  1 
ATOM   8929  C  C   . GLY D 1 47  ? 102.756 44.491 90.525  1.00 19.98 ? 65   GLY J C   1 
ATOM   8930  O  O   . GLY D 1 47  ? 102.633 45.695 90.303  1.00 19.98 ? 65   GLY J O   1 
ATOM   8931  N  N   . TRP D 1 48  ? 103.174 44.005 91.687  1.00 19.44 ? 66   TRP J N   1 
ATOM   8932  C  CA  . TRP D 1 48  ? 103.494 44.852 92.830  1.00 19.10 ? 66   TRP J CA  1 
ATOM   8933  C  C   . TRP D 1 48  ? 104.833 45.559 92.664  1.00 19.49 ? 66   TRP J C   1 
ATOM   8934  O  O   . TRP D 1 48  ? 105.856 44.933 92.366  1.00 19.39 ? 66   TRP J O   1 
ATOM   8935  C  CB  . TRP D 1 48  ? 103.507 44.038 94.133  1.00 18.69 ? 66   TRP J CB  1 
ATOM   8936  C  CG  . TRP D 1 48  ? 102.146 43.654 94.646  1.00 17.58 ? 66   TRP J CG  1 
ATOM   8937  C  CD1 . TRP D 1 48  ? 101.568 42.424 94.589  1.00 17.07 ? 66   TRP J CD1 1 
ATOM   8938  C  CD2 . TRP D 1 48  ? 101.202 44.511 95.309  1.00 16.77 ? 66   TRP J CD2 1 
ATOM   8939  N  NE1 . TRP D 1 48  ? 100.318 42.455 95.165  1.00 17.30 ? 66   TRP J NE1 1 
ATOM   8940  C  CE2 . TRP D 1 48  ? 100.066 43.726 95.612  1.00 16.53 ? 66   TRP J CE2 1 
ATOM   8941  C  CE3 . TRP D 1 48  ? 101.197 45.871 95.656  1.00 16.16 ? 66   TRP J CE3 1 
ATOM   8942  C  CZ2 . TRP D 1 48  ? 98.939  44.250 96.262  1.00 16.03 ? 66   TRP J CZ2 1 
ATOM   8943  C  CZ3 . TRP D 1 48  ? 100.070 46.395 96.304  1.00 15.64 ? 66   TRP J CZ3 1 
ATOM   8944  C  CH2 . TRP D 1 48  ? 98.962  45.581 96.600  1.00 15.40 ? 66   TRP J CH2 1 
ATOM   8945  N  N   . GLU D 1 49  ? 104.807 46.869 92.871  1.00 19.62 ? 67   GLU J N   1 
ATOM   8946  C  CA  . GLU D 1 49  ? 106.002 47.686 92.926  1.00 20.17 ? 67   GLU J CA  1 
ATOM   8947  C  C   . GLU D 1 49  ? 106.665 47.511 94.299  1.00 19.87 ? 67   GLU J C   1 
ATOM   8948  O  O   . GLU D 1 49  ? 106.107 46.857 95.193  1.00 19.86 ? 67   GLU J O   1 
ATOM   8949  C  CB  . GLU D 1 49  ? 105.602 49.146 92.701  1.00 20.67 ? 67   GLU J CB  1 
ATOM   8950  C  CG  . GLU D 1 49  ? 106.592 49.982 91.930  1.00 23.89 ? 67   GLU J CG  1 
ATOM   8951  C  CD  . GLU D 1 49  ? 106.622 49.687 90.436  1.00 26.92 ? 67   GLU J CD  1 
ATOM   8952  O  OE1 . GLU D 1 49  ? 105.718 48.985 89.927  1.00 28.44 ? 67   GLU J OE1 1 
ATOM   8953  O  OE2 . GLU D 1 49  ? 107.560 50.178 89.767  1.00 28.22 ? 67   GLU J OE2 1 
ATOM   8954  N  N   . LYS D 1 50  ? 107.858 48.076 94.467  1.00 19.42 ? 68   LYS J N   1 
ATOM   8955  C  CA  . LYS D 1 50  ? 108.527 48.073 95.768  1.00 19.00 ? 68   LYS J CA  1 
ATOM   8956  C  C   . LYS D 1 50  ? 107.771 48.976 96.742  1.00 18.36 ? 68   LYS J C   1 
ATOM   8957  O  O   . LYS D 1 50  ? 107.284 50.043 96.346  1.00 18.05 ? 68   LYS J O   1 
ATOM   8958  C  CB  . LYS D 1 50  ? 109.978 48.551 95.653  1.00 18.94 ? 68   LYS J CB  1 
ATOM   8959  C  CG  . LYS D 1 50  ? 110.934 47.581 94.976  1.00 20.20 ? 68   LYS J CG  1 
ATOM   8960  C  CD  . LYS D 1 50  ? 112.387 48.060 95.145  1.00 21.48 ? 68   LYS J CD  1 
ATOM   8961  C  CE  . LYS D 1 50  ? 113.290 47.524 94.048  1.00 23.11 ? 68   LYS J CE  1 
ATOM   8962  N  NZ  . LYS D 1 50  ? 113.283 46.038 93.989  1.00 23.49 ? 68   LYS J NZ  1 
ATOM   8963  N  N   . PRO D 1 51  ? 107.677 48.556 98.018  1.00 17.90 ? 69   PRO J N   1 
ATOM   8964  C  CA  . PRO D 1 51  ? 106.956 49.362 99.006  1.00 17.81 ? 69   PRO J CA  1 
ATOM   8965  C  C   . PRO D 1 51  ? 107.771 50.566 99.489  1.00 17.84 ? 69   PRO J C   1 
ATOM   8966  O  O   . PRO D 1 51  ? 109.006 50.488 99.599  1.00 17.87 ? 69   PRO J O   1 
ATOM   8967  C  CB  . PRO D 1 51  ? 106.691 48.378 100.152 1.00 17.66 ? 69   PRO J CB  1 
ATOM   8968  C  CG  . PRO D 1 51  ? 107.720 47.306 100.004 1.00 17.90 ? 69   PRO J CG  1 
ATOM   8969  C  CD  . PRO D 1 51  ? 108.236 47.317 98.595  1.00 17.83 ? 69   PRO J CD  1 
ATOM   8970  N  N   . HIS D 1 52  ? 107.074 51.668 99.753  1.00 17.37 ? 70   HIS J N   1 
ATOM   8971  C  CA  . HIS D 1 52  ? 107.699 52.900 100.199 1.00 17.44 ? 70   HIS J CA  1 
ATOM   8972  C  C   . HIS D 1 52  ? 107.163 53.342 101.556 1.00 17.49 ? 70   HIS J C   1 
ATOM   8973  O  O   . HIS D 1 52  ? 105.948 53.361 101.779 1.00 17.72 ? 70   HIS J O   1 
ATOM   8974  C  CB  . HIS D 1 52  ? 107.458 54.022 99.188  1.00 17.24 ? 70   HIS J CB  1 
ATOM   8975  C  CG  . HIS D 1 52  ? 108.220 53.872 97.908  1.00 18.07 ? 70   HIS J CG  1 
ATOM   8976  N  ND1 . HIS D 1 52  ? 109.230 54.736 97.540  1.00 17.68 ? 70   HIS J ND1 1 
ATOM   8977  C  CD2 . HIS D 1 52  ? 108.108 52.974 96.899  1.00 18.03 ? 70   HIS J CD2 1 
ATOM   8978  C  CE1 . HIS D 1 52  ? 109.717 54.366 96.368  1.00 18.03 ? 70   HIS J CE1 1 
ATOM   8979  N  NE2 . HIS D 1 52  ? 109.052 53.301 95.957  1.00 18.14 ? 70   HIS J NE2 1 
ATOM   8980  N  N   . ILE D 1 53  ? 108.076 53.675 102.465 1.00 17.09 ? 71   ILE J N   1 
ATOM   8981  C  CA  . ILE D 1 53  ? 107.732 54.473 103.632 1.00 16.77 ? 71   ILE J CA  1 
ATOM   8982  C  C   . ILE D 1 53  ? 108.225 55.883 103.344 1.00 16.59 ? 71   ILE J C   1 
ATOM   8983  O  O   . ILE D 1 53  ? 109.395 56.087 103.041 1.00 16.68 ? 71   ILE J O   1 
ATOM   8984  C  CB  . ILE D 1 53  ? 108.332 53.922 104.957 1.00 16.71 ? 71   ILE J CB  1 
ATOM   8985  C  CG1 . ILE D 1 53  ? 107.765 52.530 105.266 1.00 16.58 ? 71   ILE J CG1 1 
ATOM   8986  C  CG2 . ILE D 1 53  ? 108.018 54.865 106.103 1.00 16.35 ? 71   ILE J CG2 1 
ATOM   8987  C  CD1 . ILE D 1 53  ? 108.440 51.786 106.408 1.00 16.10 ? 71   ILE J CD1 1 
ATOM   8988  N  N   . LYS D 1 54  ? 107.327 56.855 103.422 1.00 16.49 ? 72   LYS J N   1 
ATOM   8989  C  CA  . LYS D 1 54  ? 107.658 58.216 103.038 1.00 16.30 ? 72   LYS J CA  1 
ATOM   8990  C  C   . LYS D 1 54  ? 106.825 59.221 103.842 1.00 16.56 ? 72   LYS J C   1 
ATOM   8991  O  O   . LYS D 1 54  ? 105.895 58.818 104.548 1.00 16.65 ? 72   LYS J O   1 
ATOM   8992  C  CB  . LYS D 1 54  ? 107.466 58.386 101.520 1.00 16.46 ? 72   LYS J CB  1 
ATOM   8993  C  CG  . LYS D 1 54  ? 106.062 58.069 100.986 1.00 16.44 ? 72   LYS J CG  1 
ATOM   8994  C  CD  . LYS D 1 54  ? 106.040 58.170 99.467  1.00 16.71 ? 72   LYS J CD  1 
ATOM   8995  C  CE  . LYS D 1 54  ? 104.621 58.277 98.931  1.00 17.69 ? 72   LYS J CE  1 
ATOM   8996  N  NZ  . LYS D 1 54  ? 104.605 58.225 97.430  1.00 17.42 ? 72   LYS J NZ  1 
ATOM   8997  N  N   . PRO D 1 55  ? 107.154 60.529 103.755 1.00 16.63 ? 73   PRO J N   1 
ATOM   8998  C  CA  . PRO D 1 55  ? 106.367 61.503 104.506 1.00 16.77 ? 73   PRO J CA  1 
ATOM   8999  C  C   . PRO D 1 55  ? 104.894 61.451 104.118 1.00 16.94 ? 73   PRO J C   1 
ATOM   9000  O  O   . PRO D 1 55  ? 104.561 61.243 102.945 1.00 17.15 ? 73   PRO J O   1 
ATOM   9001  C  CB  . PRO D 1 55  ? 106.967 62.854 104.083 1.00 16.81 ? 73   PRO J CB  1 
ATOM   9002  C  CG  . PRO D 1 55  ? 108.366 62.527 103.655 1.00 17.26 ? 73   PRO J CG  1 
ATOM   9003  C  CD  . PRO D 1 55  ? 108.235 61.178 102.989 1.00 16.75 ? 73   PRO J CD  1 
ATOM   9004  N  N   . LEU D 1 56  ? 104.029 61.608 105.115 1.00 16.81 ? 74   LEU J N   1 
ATOM   9005  C  CA  . LEU D 1 56  ? 102.608 61.730 104.895 1.00 16.58 ? 74   LEU J CA  1 
ATOM   9006  C  C   . LEU D 1 56  ? 102.376 62.848 103.887 1.00 16.63 ? 74   LEU J C   1 
ATOM   9007  O  O   . LEU D 1 56  ? 102.937 63.936 104.014 1.00 16.48 ? 74   LEU J O   1 
ATOM   9008  C  CB  . LEU D 1 56  ? 101.903 62.045 106.213 1.00 16.60 ? 74   LEU J CB  1 
ATOM   9009  C  CG  . LEU D 1 56  ? 100.402 62.328 106.133 1.00 16.80 ? 74   LEU J CG  1 
ATOM   9010  C  CD1 . LEU D 1 56  ? 99.603  61.024 106.051 1.00 16.20 ? 74   LEU J CD1 1 
ATOM   9011  C  CD2 . LEU D 1 56  ? 99.986  63.154 107.326 1.00 17.06 ? 74   LEU J CD2 1 
ATOM   9012  N  N   . GLN D 1 57  ? 101.563 62.559 102.876 1.00 16.37 ? 75   GLN J N   1 
ATOM   9013  C  CA  . GLN D 1 57  ? 101.290 63.504 101.798 1.00 16.44 ? 75   GLN J CA  1 
ATOM   9014  C  C   . GLN D 1 57  ? 99.967  63.145 101.131 1.00 15.92 ? 75   GLN J C   1 
ATOM   9015  O  O   . GLN D 1 57  ? 99.469  62.035 101.293 1.00 15.60 ? 75   GLN J O   1 
ATOM   9016  C  CB  . GLN D 1 57  ? 102.438 63.494 100.773 1.00 16.60 ? 75   GLN J CB  1 
ATOM   9017  C  CG  . GLN D 1 57  ? 102.787 62.112 100.204 1.00 18.83 ? 75   GLN J CG  1 
ATOM   9018  C  CD  . GLN D 1 57  ? 104.170 62.062 99.548  1.00 22.68 ? 75   GLN J CD  1 
ATOM   9019  O  OE1 . GLN D 1 57  ? 105.213 62.018 100.230 1.00 22.98 ? 75   GLN J OE1 1 
ATOM   9020  N  NE2 . GLN D 1 57  ? 104.182 62.046 98.216  1.00 23.66 ? 75   GLN J NE2 1 
ATOM   9021  N  N   . ASN D 1 58  ? 99.394  64.095 100.398 1.00 15.80 ? 76   ASN J N   1 
ATOM   9022  C  CA  . ASN D 1 58  ? 98.222  63.832 99.571  1.00 15.47 ? 76   ASN J CA  1 
ATOM   9023  C  C   . ASN D 1 58  ? 98.486  62.757 98.531  1.00 15.26 ? 76   ASN J C   1 
ATOM   9024  O  O   . ASN D 1 58  ? 99.619  62.566 98.090  1.00 15.07 ? 76   ASN J O   1 
ATOM   9025  C  CB  . ASN D 1 58  ? 97.754  65.107 98.875  1.00 15.47 ? 76   ASN J CB  1 
ATOM   9026  C  CG  . ASN D 1 58  ? 96.987  66.026 99.795  1.00 15.80 ? 76   ASN J CG  1 
ATOM   9027  O  OD1 . ASN D 1 58  ? 96.856  65.770 100.993 1.00 16.40 ? 76   ASN J OD1 1 
ATOM   9028  N  ND2 . ASN D 1 58  ? 96.470  67.107 99.238  1.00 16.49 ? 76   ASN J ND2 1 
ATOM   9029  N  N   . LEU D 1 59  ? 97.431  62.043 98.160  1.00 15.07 ? 77   LEU J N   1 
ATOM   9030  C  CA  . LEU D 1 59  ? 97.504  61.082 97.076  1.00 15.05 ? 77   LEU J CA  1 
ATOM   9031  C  C   . LEU D 1 59  ? 97.164  61.784 95.769  1.00 15.28 ? 77   LEU J C   1 
ATOM   9032  O  O   . LEU D 1 59  ? 96.216  62.565 95.704  1.00 15.77 ? 77   LEU J O   1 
ATOM   9033  C  CB  . LEU D 1 59  ? 96.566  59.898 97.332  1.00 14.87 ? 77   LEU J CB  1 
ATOM   9034  C  CG  . LEU D 1 59  ? 96.671  59.200 98.697  1.00 13.60 ? 77   LEU J CG  1 
ATOM   9035  C  CD1 . LEU D 1 59  ? 95.588  58.148 98.838  1.00 12.91 ? 77   LEU J CD1 1 
ATOM   9036  C  CD2 . LEU D 1 59  ? 98.053  58.587 98.913  1.00 12.69 ? 77   LEU J CD2 1 
ATOM   9037  N  N   . SER D 1 60  ? 97.970  61.526 94.742  1.00 15.44 ? 78   SER J N   1 
ATOM   9038  C  CA  . SER D 1 60  ? 97.719  62.030 93.403  1.00 14.99 ? 78   SER J CA  1 
ATOM   9039  C  C   . SER D 1 60  ? 97.004  60.930 92.635  1.00 14.78 ? 78   SER J C   1 
ATOM   9040  O  O   . SER D 1 60  ? 97.603  59.917 92.265  1.00 14.54 ? 78   SER J O   1 
ATOM   9041  C  CB  . SER D 1 60  ? 99.031  62.405 92.707  1.00 15.19 ? 78   SER J CB  1 
ATOM   9042  O  OG  . SER D 1 60  ? 98.780  63.045 91.468  1.00 15.66 ? 78   SER J OG  1 
ATOM   9043  N  N   . LEU D 1 61  ? 95.711  61.131 92.412  1.00 14.38 ? 79   LEU J N   1 
ATOM   9044  C  CA  . LEU D 1 61  ? 94.872  60.099 91.827  1.00 14.15 ? 79   LEU J CA  1 
ATOM   9045  C  C   . LEU D 1 61  ? 94.204  60.597 90.555  1.00 13.76 ? 79   LEU J C   1 
ATOM   9046  O  O   . LEU D 1 61  ? 93.612  61.678 90.538  1.00 13.33 ? 79   LEU J O   1 
ATOM   9047  C  CB  . LEU D 1 61  ? 93.808  59.660 92.844  1.00 14.12 ? 79   LEU J CB  1 
ATOM   9048  C  CG  . LEU D 1 61  ? 94.040  58.531 93.865  1.00 14.35 ? 79   LEU J CG  1 
ATOM   9049  C  CD1 . LEU D 1 61  ? 95.485  58.160 94.143  1.00 13.33 ? 79   LEU J CD1 1 
ATOM   9050  C  CD2 . LEU D 1 61  ? 93.302  58.806 95.170  1.00 14.98 ? 79   LEU J CD2 1 
ATOM   9051  N  N   . HIS D 1 62  ? 94.309  59.805 89.489  1.00 13.35 ? 80   HIS J N   1 
ATOM   9052  C  CA  . HIS D 1 62  ? 93.516  60.044 88.290  1.00 13.13 ? 80   HIS J CA  1 
ATOM   9053  C  C   . HIS D 1 62  ? 92.051  60.179 88.714  1.00 12.81 ? 80   HIS J C   1 
ATOM   9054  O  O   . HIS D 1 62  ? 91.571  59.385 89.521  1.00 12.62 ? 80   HIS J O   1 
ATOM   9055  C  CB  . HIS D 1 62  ? 93.680  58.897 87.288  1.00 13.19 ? 80   HIS J CB  1 
ATOM   9056  C  CG  . HIS D 1 62  ? 93.139  59.213 85.929  1.00 13.18 ? 80   HIS J CG  1 
ATOM   9057  N  ND1 . HIS D 1 62  ? 91.791  59.211 85.647  1.00 13.48 ? 80   HIS J ND1 1 
ATOM   9058  C  CD2 . HIS D 1 62  ? 93.765  59.561 84.779  1.00 13.15 ? 80   HIS J CD2 1 
ATOM   9059  C  CE1 . HIS D 1 62  ? 91.607  59.547 84.383  1.00 14.48 ? 80   HIS J CE1 1 
ATOM   9060  N  NE2 . HIS D 1 62  ? 92.791  59.762 83.833  1.00 14.93 ? 80   HIS J NE2 1 
ATOM   9061  N  N   . PRO D 1 63  ? 91.345  61.199 88.198  1.00 12.86 ? 81   PRO J N   1 
ATOM   9062  C  CA  . PRO D 1 63  ? 89.956  61.425 88.630  1.00 12.74 ? 81   PRO J CA  1 
ATOM   9063  C  C   . PRO D 1 63  ? 88.979  60.290 88.256  1.00 12.88 ? 81   PRO J C   1 
ATOM   9064  O  O   . PRO D 1 63  ? 87.866  60.238 88.786  1.00 13.16 ? 81   PRO J O   1 
ATOM   9065  C  CB  . PRO D 1 63  ? 89.580  62.747 87.944  1.00 12.70 ? 81   PRO J CB  1 
ATOM   9066  C  CG  . PRO D 1 63  ? 90.534  62.890 86.803  1.00 12.74 ? 81   PRO J CG  1 
ATOM   9067  C  CD  . PRO D 1 63  ? 91.798  62.207 87.214  1.00 12.90 ? 81   PRO J CD  1 
ATOM   9068  N  N   . GLY D 1 64  ? 89.413  59.383 87.380  1.00 12.67 ? 82   GLY J N   1 
ATOM   9069  C  CA  . GLY D 1 64  ? 88.641  58.202 87.005  1.00 12.37 ? 82   GLY J CA  1 
ATOM   9070  C  C   . GLY D 1 64  ? 88.835  57.004 87.922  1.00 12.52 ? 82   GLY J C   1 
ATOM   9071  O  O   . GLY D 1 64  ? 88.195  55.961 87.728  1.00 12.52 ? 82   GLY J O   1 
ATOM   9072  N  N   . SER D 1 65  ? 89.713  57.147 88.919  1.00 12.14 ? 83   SER J N   1 
ATOM   9073  C  CA  . SER D 1 65  ? 90.020  56.069 89.875  1.00 12.18 ? 83   SER J CA  1 
ATOM   9074  C  C   . SER D 1 65  ? 88.772  55.372 90.423  1.00 12.07 ? 83   SER J C   1 
ATOM   9075  O  O   . SER D 1 65  ? 87.880  56.018 90.994  1.00 12.24 ? 83   SER J O   1 
ATOM   9076  C  CB  . SER D 1 65  ? 90.865  56.610 91.030  1.00 12.27 ? 83   SER J CB  1 
ATOM   9077  O  OG  . SER D 1 65  ? 92.142  57.013 90.562  1.00 12.32 ? 83   SER J OG  1 
ATOM   9078  N  N   . SER D 1 66  ? 88.713  54.055 90.251  1.00 11.60 ? 84   SER J N   1 
ATOM   9079  C  CA  . SER D 1 66  ? 87.499  53.297 90.554  1.00 11.58 ? 84   SER J CA  1 
ATOM   9080  C  C   . SER D 1 66  ? 87.079  53.335 92.028  1.00 11.48 ? 84   SER J C   1 
ATOM   9081  O  O   . SER D 1 66  ? 85.898  53.118 92.340  1.00 11.21 ? 84   SER J O   1 
ATOM   9082  C  CB  . SER D 1 66  ? 87.611  51.851 90.054  1.00 11.48 ? 84   SER J CB  1 
ATOM   9083  O  OG  . SER D 1 66  ? 88.764  51.211 90.574  1.00 12.85 ? 84   SER J OG  1 
ATOM   9084  N  N   . ALA D 1 67  ? 88.034  53.611 92.923  1.00 11.07 ? 85   ALA J N   1 
ATOM   9085  C  CA  . ALA D 1 67  ? 87.725  53.831 94.341  1.00 10.74 ? 85   ALA J CA  1 
ATOM   9086  C  C   . ALA D 1 67  ? 86.779  55.016 94.546  1.00 10.57 ? 85   ALA J C   1 
ATOM   9087  O  O   . ALA D 1 67  ? 86.059  55.058 95.543  1.00 10.29 ? 85   ALA J O   1 
ATOM   9088  C  CB  . ALA D 1 67  ? 89.001  54.054 95.141  1.00 10.93 ? 85   ALA J CB  1 
ATOM   9089  N  N   . LEU D 1 68  ? 86.809  55.974 93.612  1.00 10.28 ? 86   LEU J N   1 
ATOM   9090  C  CA  . LEU D 1 68  ? 85.989  57.192 93.682  1.00 10.22 ? 86   LEU J CA  1 
ATOM   9091  C  C   . LEU D 1 68  ? 84.637  57.074 92.974  1.00 10.09 ? 86   LEU J C   1 
ATOM   9092  O  O   . LEU D 1 68  ? 83.721  57.862 93.232  1.00 9.97  ? 86   LEU J O   1 
ATOM   9093  C  CB  . LEU D 1 68  ? 86.749  58.400 93.113  1.00 10.30 ? 86   LEU J CB  1 
ATOM   9094  C  CG  . LEU D 1 68  ? 88.165  58.743 93.589  1.00 10.21 ? 86   LEU J CG  1 
ATOM   9095  C  CD1 . LEU D 1 68  ? 88.687  59.910 92.759  1.00 10.16 ? 86   LEU J CD1 1 
ATOM   9096  C  CD2 . LEU D 1 68  ? 88.208  59.085 95.073  1.00 10.04 ? 86   LEU J CD2 1 
ATOM   9097  N  N   . HIS D 1 69  ? 84.513  56.093 92.084  1.00 9.88  ? 87   HIS J N   1 
ATOM   9098  C  CA  . HIS D 1 69  ? 83.279  55.907 91.322  1.00 9.24  ? 87   HIS J CA  1 
ATOM   9099  C  C   . HIS D 1 69  ? 82.484  54.699 91.788  1.00 9.10  ? 87   HIS J C   1 
ATOM   9100  O  O   . HIS D 1 69  ? 81.275  54.795 91.983  1.00 8.70  ? 87   HIS J O   1 
ATOM   9101  C  CB  . HIS D 1 69  ? 83.572  55.833 89.816  1.00 8.84  ? 87   HIS J CB  1 
ATOM   9102  C  CG  . HIS D 1 69  ? 84.239  57.062 89.279  1.00 8.54  ? 87   HIS J CG  1 
ATOM   9103  N  ND1 . HIS D 1 69  ? 83.558  58.037 88.583  1.00 7.63  ? 87   HIS J ND1 1 
ATOM   9104  C  CD2 . HIS D 1 69  ? 85.519  57.491 89.371  1.00 9.07  ? 87   HIS J CD2 1 
ATOM   9105  C  CE1 . HIS D 1 69  ? 84.393  59.005 88.253  1.00 8.72  ? 87   HIS J CE1 1 
ATOM   9106  N  NE2 . HIS D 1 69  ? 85.591  58.699 88.721  1.00 9.39  ? 87   HIS J NE2 1 
ATOM   9107  N  N   . TYR D 1 70  ? 83.172  53.573 91.971  1.00 9.12  ? 88   TYR J N   1 
ATOM   9108  C  CA  . TYR D 1 70  ? 82.519  52.287 92.257  1.00 9.12  ? 88   TYR J CA  1 
ATOM   9109  C  C   . TYR D 1 70  ? 82.933  51.670 93.597  1.00 9.38  ? 88   TYR J C   1 
ATOM   9110  O  O   . TYR D 1 70  ? 82.793  50.459 93.795  1.00 9.36  ? 88   TYR J O   1 
ATOM   9111  C  CB  . TYR D 1 70  ? 82.771  51.295 91.102  1.00 8.77  ? 88   TYR J CB  1 
ATOM   9112  C  CG  . TYR D 1 70  ? 82.489  51.894 89.728  1.00 9.63  ? 88   TYR J CG  1 
ATOM   9113  C  CD1 . TYR D 1 70  ? 81.255  52.508 89.449  1.00 9.13  ? 88   TYR J CD1 1 
ATOM   9114  C  CD2 . TYR D 1 70  ? 83.454  51.858 88.719  1.00 8.88  ? 88   TYR J CD2 1 
ATOM   9115  C  CE1 . TYR D 1 70  ? 80.995  53.067 88.210  1.00 9.30  ? 88   TYR J CE1 1 
ATOM   9116  C  CE2 . TYR D 1 70  ? 83.202  52.404 87.470  1.00 9.18  ? 88   TYR J CE2 1 
ATOM   9117  C  CZ  . TYR D 1 70  ? 81.973  53.012 87.224  1.00 9.13  ? 88   TYR J CZ  1 
ATOM   9118  O  OH  . TYR D 1 70  ? 81.715  53.556 85.995  1.00 7.85  ? 88   TYR J OH  1 
ATOM   9119  N  N   . ALA D 1 71  ? 83.451  52.500 94.504  1.00 9.15  ? 89   ALA J N   1 
ATOM   9120  C  CA  . ALA D 1 71  ? 83.805  52.071 95.862  1.00 9.51  ? 89   ALA J CA  1 
ATOM   9121  C  C   . ALA D 1 71  ? 84.701  50.837 95.889  1.00 9.52  ? 89   ALA J C   1 
ATOM   9122  O  O   . ALA D 1 71  ? 84.506  49.931 96.698  1.00 9.26  ? 89   ALA J O   1 
ATOM   9123  C  CB  . ALA D 1 71  ? 82.535  51.841 96.715  1.00 9.17  ? 89   ALA J CB  1 
ATOM   9124  N  N   . VAL D 1 72  ? 85.677  50.816 94.989  1.00 10.09 ? 90   VAL J N   1 
ATOM   9125  C  CA  . VAL D 1 72  ? 86.644  49.728 94.906  1.00 10.22 ? 90   VAL J CA  1 
ATOM   9126  C  C   . VAL D 1 72  ? 87.717  50.032 95.950  1.00 10.61 ? 90   VAL J C   1 
ATOM   9127  O  O   . VAL D 1 72  ? 88.720  50.695 95.672  1.00 10.88 ? 90   VAL J O   1 
ATOM   9128  C  CB  . VAL D 1 72  ? 87.200  49.577 93.456  1.00 10.22 ? 90   VAL J CB  1 
ATOM   9129  C  CG1 . VAL D 1 72  ? 88.218  48.445 93.366  1.00 10.19 ? 90   VAL J CG1 1 
ATOM   9130  C  CG2 . VAL D 1 72  ? 86.042  49.323 92.468  1.00 8.54  ? 90   VAL J CG2 1 
ATOM   9131  N  N   . GLU D 1 73  ? 87.464  49.565 97.171  1.00 10.79 ? 91   GLU J N   1 
ATOM   9132  C  CA  . GLU D 1 73  ? 88.255  49.953 98.332  1.00 11.00 ? 91   GLU J CA  1 
ATOM   9133  C  C   . GLU D 1 73  ? 87.941  49.090 99.548  1.00 11.16 ? 91   GLU J C   1 
ATOM   9134  O  O   . GLU D 1 73  ? 86.837  48.546 99.681  1.00 10.76 ? 91   GLU J O   1 
ATOM   9135  C  CB  . GLU D 1 73  ? 87.993  51.424 98.682  1.00 10.83 ? 91   GLU J CB  1 
ATOM   9136  C  CG  . GLU D 1 73  ? 86.543  51.702 99.061  1.00 10.57 ? 91   GLU J CG  1 
ATOM   9137  C  CD  . GLU D 1 73  ? 86.247  53.172 99.207  1.00 11.00 ? 91   GLU J CD  1 
ATOM   9138  O  OE1 . GLU D 1 73  ? 85.644  53.549 100.224 1.00 11.42 ? 91   GLU J OE1 1 
ATOM   9139  O  OE2 . GLU D 1 73  ? 86.628  53.953 98.315  1.00 11.42 ? 91   GLU J OE2 1 
ATOM   9140  N  N   . LEU D 1 74  ? 88.927  48.971 100.430 1.00 11.30 ? 92   LEU J N   1 
ATOM   9141  C  CA  . LEU D 1 74  ? 88.730  48.341 101.733 1.00 11.46 ? 92   LEU J CA  1 
ATOM   9142  C  C   . LEU D 1 74  ? 89.727  48.899 102.747 1.00 11.37 ? 92   LEU J C   1 
ATOM   9143  O  O   . LEU D 1 74  ? 90.706  49.558 102.376 1.00 11.31 ? 92   LEU J O   1 
ATOM   9144  C  CB  . LEU D 1 74  ? 88.777  46.798 101.653 1.00 11.55 ? 92   LEU J CB  1 
ATOM   9145  C  CG  . LEU D 1 74  ? 89.993  45.888 101.334 1.00 12.96 ? 92   LEU J CG  1 
ATOM   9146  C  CD1 . LEU D 1 74  ? 90.284  45.754 99.846  1.00 13.16 ? 92   LEU J CD1 1 
ATOM   9147  C  CD2 . LEU D 1 74  ? 91.271  46.200 102.121 1.00 11.09 ? 92   LEU J CD2 1 
ATOM   9148  N  N   . PHE D 1 75  ? 89.470  48.645 104.024 1.00 11.15 ? 93   PHE J N   1 
ATOM   9149  C  CA  . PHE D 1 75  ? 90.346  49.135 105.074 1.00 11.31 ? 93   PHE J CA  1 
ATOM   9150  C  C   . PHE D 1 75  ? 90.483  48.144 106.219 1.00 11.39 ? 93   PHE J C   1 
ATOM   9151  O  O   . PHE D 1 75  ? 89.754  47.154 106.296 1.00 11.17 ? 93   PHE J O   1 
ATOM   9152  C  CB  . PHE D 1 75  ? 89.887  50.523 105.599 1.00 11.08 ? 93   PHE J CB  1 
ATOM   9153  C  CG  . PHE D 1 75  ? 88.557  50.506 106.320 1.00 11.00 ? 93   PHE J CG  1 
ATOM   9154  C  CD1 . PHE D 1 75  ? 87.360  50.544 105.602 1.00 10.40 ? 93   PHE J CD1 1 
ATOM   9155  C  CD2 . PHE D 1 75  ? 88.502  50.465 107.714 1.00 8.71  ? 93   PHE J CD2 1 
ATOM   9156  C  CE1 . PHE D 1 75  ? 86.140  50.529 106.259 1.00 10.48 ? 93   PHE J CE1 1 
ATOM   9157  C  CE2 . PHE D 1 75  ? 87.286  50.448 108.383 1.00 8.87  ? 93   PHE J CE2 1 
ATOM   9158  C  CZ  . PHE D 1 75  ? 86.097  50.483 107.658 1.00 9.42  ? 93   PHE J CZ  1 
ATOM   9159  N  N   . GLU D 1 76  ? 91.446  48.423 107.090 1.00 11.55 ? 94   GLU J N   1 
ATOM   9160  C  CA  . GLU D 1 76  ? 91.565  47.741 108.364 1.00 11.91 ? 94   GLU J CA  1 
ATOM   9161  C  C   . GLU D 1 76  ? 91.775  48.751 109.477 1.00 11.78 ? 94   GLU J C   1 
ATOM   9162  O  O   . GLU D 1 76  ? 91.973  49.942 109.235 1.00 11.64 ? 94   GLU J O   1 
ATOM   9163  C  CB  . GLU D 1 76  ? 92.707  46.716 108.359 1.00 11.69 ? 94   GLU J CB  1 
ATOM   9164  C  CG  . GLU D 1 76  ? 92.286  45.328 107.910 1.00 12.08 ? 94   GLU J CG  1 
ATOM   9165  C  CD  . GLU D 1 76  ? 91.263  44.686 108.836 1.00 12.91 ? 94   GLU J CD  1 
ATOM   9166  O  OE1 . GLU D 1 76  ? 90.492  43.823 108.359 1.00 14.22 ? 94   GLU J OE1 1 
ATOM   9167  O  OE2 . GLU D 1 76  ? 91.230  45.041 110.033 1.00 11.71 ? 94   GLU J OE2 1 
ATOM   9168  N  N   . GLY D 1 77  ? 91.708  48.253 110.699 1.00 11.80 ? 95   GLY J N   1 
ATOM   9169  C  CA  . GLY D 1 77  ? 91.951  49.060 111.873 1.00 11.99 ? 95   GLY J CA  1 
ATOM   9170  C  C   . GLY D 1 77  ? 92.518  48.175 112.950 1.00 11.88 ? 95   GLY J C   1 
ATOM   9171  O  O   . GLY D 1 77  ? 91.878  47.220 113.381 1.00 12.36 ? 95   GLY J O   1 
ATOM   9172  N  N   . LEU D 1 78  ? 93.735  48.495 113.360 1.00 12.18 ? 96   LEU J N   1 
ATOM   9173  C  CA  . LEU D 1 78  ? 94.408  47.839 114.473 1.00 12.49 ? 96   LEU J CA  1 
ATOM   9174  C  C   . LEU D 1 78  ? 95.294  48.853 115.188 1.00 12.39 ? 96   LEU J C   1 
ATOM   9175  O  O   . LEU D 1 78  ? 95.408  49.997 114.750 1.00 12.04 ? 96   LEU J O   1 
ATOM   9176  C  CB  . LEU D 1 78  ? 95.178  46.579 114.027 1.00 12.64 ? 96   LEU J CB  1 
ATOM   9177  C  CG  . LEU D 1 78  ? 96.108  46.339 112.814 1.00 14.06 ? 96   LEU J CG  1 
ATOM   9178  C  CD1 . LEU D 1 78  ? 96.034  47.381 111.687 1.00 14.59 ? 96   LEU J CD1 1 
ATOM   9179  C  CD2 . LEU D 1 78  ? 97.559  46.096 113.245 1.00 14.32 ? 96   LEU J CD2 1 
ATOM   9180  N  N   . LYS D 1 79  ? 95.899  48.446 116.299 1.00 12.55 ? 97   LYS J N   1 
ATOM   9181  C  CA  . LYS D 1 79  ? 96.593  49.396 117.164 1.00 12.69 ? 97   LYS J CA  1 
ATOM   9182  C  C   . LYS D 1 79  ? 97.957  48.926 117.655 1.00 12.53 ? 97   LYS J C   1 
ATOM   9183  O  O   . LYS D 1 79  ? 98.209  47.726 117.772 1.00 12.38 ? 97   LYS J O   1 
ATOM   9184  C  CB  . LYS D 1 79  ? 95.717  49.750 118.370 1.00 12.40 ? 97   LYS J CB  1 
ATOM   9185  C  CG  . LYS D 1 79  ? 94.449  50.522 118.039 1.00 13.13 ? 97   LYS J CG  1 
ATOM   9186  C  CD  . LYS D 1 79  ? 93.624  50.752 119.292 1.00 14.53 ? 97   LYS J CD  1 
ATOM   9187  C  CE  . LYS D 1 79  ? 92.679  51.914 119.111 1.00 16.30 ? 97   LYS J CE  1 
ATOM   9188  N  NZ  . LYS D 1 79  ? 91.907  52.161 120.374 1.00 19.75 ? 97   LYS J NZ  1 
ATOM   9189  N  N   . ALA D 1 80  ? 98.823  49.899 117.931 1.00 12.71 ? 98   ALA J N   1 
ATOM   9190  C  CA  . ALA D 1 80  ? 100.086 49.679 118.640 1.00 13.07 ? 98   ALA J CA  1 
ATOM   9191  C  C   . ALA D 1 80  ? 99.978  50.260 120.043 1.00 13.15 ? 98   ALA J C   1 
ATOM   9192  O  O   . ALA D 1 80  ? 99.429  51.353 120.225 1.00 12.86 ? 98   ALA J O   1 
ATOM   9193  C  CB  . ALA D 1 80  ? 101.246 50.329 117.888 1.00 12.90 ? 98   ALA J CB  1 
ATOM   9194  N  N   . PHE D 1 81  ? 100.510 49.537 121.026 1.00 13.44 ? 99   PHE J N   1 
ATOM   9195  C  CA  . PHE D 1 81  ? 100.401 49.941 122.431 1.00 13.87 ? 99   PHE J CA  1 
ATOM   9196  C  C   . PHE D 1 81  ? 101.783 50.045 123.076 1.00 14.26 ? 99   PHE J C   1 
ATOM   9197  O  O   . PHE D 1 81  ? 102.570 49.107 122.992 1.00 14.20 ? 99   PHE J O   1 
ATOM   9198  C  CB  . PHE D 1 81  ? 99.548  48.933 123.222 1.00 13.30 ? 99   PHE J CB  1 
ATOM   9199  C  CG  . PHE D 1 81  ? 98.168  48.703 122.653 1.00 13.04 ? 99   PHE J CG  1 
ATOM   9200  C  CD1 . PHE D 1 81  ? 97.962  47.753 121.646 1.00 11.40 ? 99   PHE J CD1 1 
ATOM   9201  C  CD2 . PHE D 1 81  ? 97.065  49.418 123.148 1.00 11.61 ? 99   PHE J CD2 1 
ATOM   9202  C  CE1 . PHE D 1 81  ? 96.682  47.540 121.124 1.00 11.87 ? 99   PHE J CE1 1 
ATOM   9203  C  CE2 . PHE D 1 81  ? 95.783  49.215 122.641 1.00 11.26 ? 99   PHE J CE2 1 
ATOM   9204  C  CZ  . PHE D 1 81  ? 95.586  48.278 121.618 1.00 11.36 ? 99   PHE J CZ  1 
ATOM   9205  N  N   . ARG D 1 82  ? 102.075 51.176 123.719 1.00 15.03 ? 100  ARG J N   1 
ATOM   9206  C  CA  . ARG D 1 82  ? 103.301 51.301 124.520 1.00 15.88 ? 100  ARG J CA  1 
ATOM   9207  C  C   . ARG D 1 82  ? 103.071 50.717 125.913 1.00 16.12 ? 100  ARG J C   1 
ATOM   9208  O  O   . ARG D 1 82  ? 102.310 51.267 126.710 1.00 16.32 ? 100  ARG J O   1 
ATOM   9209  C  CB  . ARG D 1 82  ? 103.789 52.752 124.614 1.00 16.09 ? 100  ARG J CB  1 
ATOM   9210  C  CG  . ARG D 1 82  ? 104.972 52.932 125.574 1.00 16.90 ? 100  ARG J CG  1 
ATOM   9211  C  CD  . ARG D 1 82  ? 105.604 54.282 125.454 1.00 18.80 ? 100  ARG J CD  1 
ATOM   9212  N  NE  . ARG D 1 82  ? 106.432 54.369 124.250 1.00 23.52 ? 100  ARG J NE  1 
ATOM   9213  C  CZ  . ARG D 1 82  ? 106.171 55.195 123.252 1.00 23.74 ? 100  ARG J CZ  1 
ATOM   9214  N  NH1 . ARG D 1 82  ? 105.130 55.996 123.355 1.00 26.89 ? 100  ARG J NH1 1 
ATOM   9215  N  NH2 . ARG D 1 82  ? 106.937 55.242 122.174 1.00 23.38 ? 100  ARG J NH2 1 
ATOM   9216  N  N   . GLY D 1 83  ? 103.738 49.603 126.194 1.00 16.53 ? 101  GLY J N   1 
ATOM   9217  C  CA  . GLY D 1 83  ? 103.467 48.828 127.399 1.00 17.41 ? 101  GLY J CA  1 
ATOM   9218  C  C   . GLY D 1 83  ? 103.922 49.461 128.698 1.00 17.92 ? 101  GLY J C   1 
ATOM   9219  O  O   . GLY D 1 83  ? 104.601 50.492 128.681 1.00 17.51 ? 101  GLY J O   1 
ATOM   9220  N  N   . VAL D 1 84  ? 103.553 48.828 129.819 1.00 18.39 ? 102  VAL J N   1 
ATOM   9221  C  CA  . VAL D 1 84  ? 104.011 49.249 131.152 1.00 18.94 ? 102  VAL J CA  1 
ATOM   9222  C  C   . VAL D 1 84  ? 105.533 49.133 131.283 1.00 19.25 ? 102  VAL J C   1 
ATOM   9223  O  O   . VAL D 1 84  ? 106.148 49.801 132.113 1.00 18.99 ? 102  VAL J O   1 
ATOM   9224  C  CB  . VAL D 1 84  ? 103.328 48.449 132.305 1.00 19.20 ? 102  VAL J CB  1 
ATOM   9225  C  CG1 . VAL D 1 84  ? 101.871 48.853 132.450 1.00 19.41 ? 102  VAL J CG1 1 
ATOM   9226  C  CG2 . VAL D 1 84  ? 103.467 46.925 132.100 1.00 19.00 ? 102  VAL J CG2 1 
ATOM   9227  N  N   . ASP D 1 85  ? 106.114 48.273 130.449 1.00 19.54 ? 103  ASP J N   1 
ATOM   9228  C  CA  . ASP D 1 85  ? 107.550 48.055 130.392 1.00 19.64 ? 103  ASP J CA  1 
ATOM   9229  C  C   . ASP D 1 85  ? 108.183 48.845 129.240 1.00 19.73 ? 103  ASP J C   1 
ATOM   9230  O  O   . ASP D 1 85  ? 109.315 48.577 128.849 1.00 19.85 ? 103  ASP J O   1 
ATOM   9231  C  CB  . ASP D 1 85  ? 107.831 46.562 130.224 1.00 19.48 ? 103  ASP J CB  1 
ATOM   9232  C  CG  . ASP D 1 85  ? 107.184 45.971 128.962 1.00 20.21 ? 103  ASP J CG  1 
ATOM   9233  O  OD1 . ASP D 1 85  ? 107.451 44.787 128.665 1.00 19.96 ? 103  ASP J OD1 1 
ATOM   9234  O  OD2 . ASP D 1 85  ? 106.420 46.679 128.267 1.00 19.01 ? 103  ASP J OD2 1 
ATOM   9235  N  N   . ASN D 1 86  ? 107.434 49.811 128.706 1.00 20.01 ? 104  ASN J N   1 
ATOM   9236  C  CA  . ASN D 1 86  ? 107.863 50.644 127.575 1.00 20.22 ? 104  ASN J CA  1 
ATOM   9237  C  C   . ASN D 1 86  ? 108.189 49.883 126.273 1.00 20.21 ? 104  ASN J C   1 
ATOM   9238  O  O   . ASN D 1 86  ? 108.888 50.400 125.396 1.00 20.38 ? 104  ASN J O   1 
ATOM   9239  C  CB  . ASN D 1 86  ? 109.027 51.567 127.971 1.00 20.37 ? 104  ASN J CB  1 
ATOM   9240  C  CG  . ASN D 1 86  ? 109.218 52.710 126.993 1.00 21.13 ? 104  ASN J CG  1 
ATOM   9241  O  OD1 . ASN D 1 86  ? 108.268 53.420 126.663 1.00 21.40 ? 104  ASN J OD1 1 
ATOM   9242  N  ND2 . ASN D 1 86  ? 110.445 52.885 126.511 1.00 21.69 ? 104  ASN J ND2 1 
ATOM   9243  N  N   . LYS D 1 87  ? 107.686 48.657 126.150 1.00 19.81 ? 105  LYS J N   1 
ATOM   9244  C  CA  . LYS D 1 87  ? 107.772 47.935 124.888 1.00 19.45 ? 105  LYS J CA  1 
ATOM   9245  C  C   . LYS D 1 87  ? 106.498 48.175 124.089 1.00 18.71 ? 105  LYS J C   1 
ATOM   9246  O  O   . LYS D 1 87  ? 105.390 48.135 124.633 1.00 18.56 ? 105  LYS J O   1 
ATOM   9247  C  CB  . LYS D 1 87  ? 108.003 46.439 125.111 1.00 19.37 ? 105  LYS J CB  1 
ATOM   9248  C  CG  . LYS D 1 87  ? 109.411 46.092 125.561 1.00 21.41 ? 105  LYS J CG  1 
ATOM   9249  C  CD  . LYS D 1 87  ? 109.562 44.599 125.838 1.00 24.39 ? 105  LYS J CD  1 
ATOM   9250  C  CE  . LYS D 1 87  ? 110.861 44.311 126.595 1.00 27.13 ? 105  LYS J CE  1 
ATOM   9251  N  NZ  . LYS D 1 87  ? 110.887 42.901 127.098 1.00 28.85 ? 105  LYS J NZ  1 
ATOM   9252  N  N   . ILE D 1 88  ? 106.668 48.454 122.803 1.00 18.19 ? 106  ILE J N   1 
ATOM   9253  C  CA  . ILE D 1 88  ? 105.539 48.632 121.897 1.00 17.53 ? 106  ILE J CA  1 
ATOM   9254  C  C   . ILE D 1 88  ? 105.086 47.270 121.388 1.00 17.08 ? 106  ILE J C   1 
ATOM   9255  O  O   . ILE D 1 88  ? 105.906 46.447 120.978 1.00 16.60 ? 106  ILE J O   1 
ATOM   9256  C  CB  . ILE D 1 88  ? 105.871 49.608 120.741 1.00 17.65 ? 106  ILE J CB  1 
ATOM   9257  C  CG1 . ILE D 1 88  ? 106.149 51.004 121.315 1.00 18.02 ? 106  ILE J CG1 1 
ATOM   9258  C  CG2 . ILE D 1 88  ? 104.734 49.649 119.704 1.00 17.20 ? 106  ILE J CG2 1 
ATOM   9259  C  CD1 . ILE D 1 88  ? 106.859 51.943 120.372 1.00 18.66 ? 106  ILE J CD1 1 
ATOM   9260  N  N   . ARG D 1 89  ? 103.774 47.048 121.447 1.00 16.64 ? 107  ARG J N   1 
ATOM   9261  C  CA  . ARG D 1 89  ? 103.163 45.789 121.061 1.00 16.69 ? 107  ARG J CA  1 
ATOM   9262  C  C   . ARG D 1 89  ? 102.036 45.973 120.047 1.00 16.44 ? 107  ARG J C   1 
ATOM   9263  O  O   . ARG D 1 89  ? 101.304 46.957 120.087 1.00 15.95 ? 107  ARG J O   1 
ATOM   9264  C  CB  . ARG D 1 89  ? 102.630 45.052 122.299 1.00 16.85 ? 107  ARG J CB  1 
ATOM   9265  C  CG  . ARG D 1 89  ? 103.550 43.952 122.810 1.00 17.70 ? 107  ARG J CG  1 
ATOM   9266  C  CD  . ARG D 1 89  ? 103.202 43.514 124.227 1.00 17.85 ? 107  ARG J CD  1 
ATOM   9267  N  NE  . ARG D 1 89  ? 103.556 44.577 125.146 1.00 20.83 ? 107  ARG J NE  1 
ATOM   9268  C  CZ  . ARG D 1 89  ? 104.560 44.551 126.014 1.00 17.59 ? 107  ARG J CZ  1 
ATOM   9269  N  NH1 . ARG D 1 89  ? 105.328 43.485 126.155 1.00 18.21 ? 107  ARG J NH1 1 
ATOM   9270  N  NH2 . ARG D 1 89  ? 104.771 45.612 126.756 1.00 16.30 ? 107  ARG J NH2 1 
ATOM   9271  N  N   . LEU D 1 90  ? 101.925 45.019 119.128 1.00 16.32 ? 108  LEU J N   1 
ATOM   9272  C  CA  . LEU D 1 90  ? 100.739 44.886 118.299 1.00 16.23 ? 108  LEU J CA  1 
ATOM   9273  C  C   . LEU D 1 90  ? 99.846  43.821 118.904 1.00 16.27 ? 108  LEU J C   1 
ATOM   9274  O  O   . LEU D 1 90  ? 100.328 42.911 119.586 1.00 16.24 ? 108  LEU J O   1 
ATOM   9275  C  CB  . LEU D 1 90  ? 101.104 44.533 116.857 1.00 16.12 ? 108  LEU J CB  1 
ATOM   9276  C  CG  . LEU D 1 90  ? 101.917 45.557 116.059 1.00 15.93 ? 108  LEU J CG  1 
ATOM   9277  C  CD1 . LEU D 1 90  ? 102.059 45.110 114.615 1.00 15.06 ? 108  LEU J CD1 1 
ATOM   9278  C  CD2 . LEU D 1 90  ? 101.289 46.941 116.140 1.00 15.43 ? 108  LEU J CD2 1 
ATOM   9279  N  N   . PHE D 1 91  ? 98.546  43.946 118.661 1.00 16.33 ? 109  PHE J N   1 
ATOM   9280  C  CA  . PHE D 1 91  ? 97.548  43.050 119.234 1.00 16.44 ? 109  PHE J CA  1 
ATOM   9281  C  C   . PHE D 1 91  ? 96.817  42.290 118.124 1.00 17.04 ? 109  PHE J C   1 
ATOM   9282  O  O   . PHE D 1 91  ? 96.080  42.890 117.320 1.00 17.15 ? 109  PHE J O   1 
ATOM   9283  C  CB  . PHE D 1 91  ? 96.560  43.848 120.101 1.00 16.23 ? 109  PHE J CB  1 
ATOM   9284  C  CG  . PHE D 1 91  ? 95.526  43.004 120.786 1.00 15.83 ? 109  PHE J CG  1 
ATOM   9285  C  CD1 . PHE D 1 91  ? 95.804  42.393 122.007 1.00 15.91 ? 109  PHE J CD1 1 
ATOM   9286  C  CD2 . PHE D 1 91  ? 94.267  42.821 120.215 1.00 16.31 ? 109  PHE J CD2 1 
ATOM   9287  C  CE1 . PHE D 1 91  ? 94.846  41.604 122.649 1.00 15.92 ? 109  PHE J CE1 1 
ATOM   9288  C  CE2 . PHE D 1 91  ? 93.305  42.031 120.845 1.00 15.88 ? 109  PHE J CE2 1 
ATOM   9289  C  CZ  . PHE D 1 91  ? 93.595  41.426 122.069 1.00 16.48 ? 109  PHE J CZ  1 
ATOM   9290  N  N   . GLN D 1 92  ? 97.048  40.975 118.081 1.00 17.32 ? 110  GLN J N   1 
ATOM   9291  C  CA  . GLN D 1 92  ? 96.425  40.068 117.107 1.00 17.66 ? 110  GLN J CA  1 
ATOM   9292  C  C   . GLN D 1 92  ? 96.510  40.540 115.642 1.00 17.53 ? 110  GLN J C   1 
ATOM   9293  O  O   . GLN D 1 92  ? 95.547  40.372 114.890 1.00 17.42 ? 110  GLN J O   1 
ATOM   9294  C  CB  . GLN D 1 92  ? 94.964  39.793 117.498 1.00 17.88 ? 110  GLN J CB  1 
ATOM   9295  C  CG  . GLN D 1 92  ? 94.790  39.093 118.858 1.00 18.92 ? 110  GLN J CG  1 
ATOM   9296  C  CD  . GLN D 1 92  ? 94.654  37.587 118.743 1.00 20.73 ? 110  GLN J CD  1 
ATOM   9297  O  OE1 . GLN D 1 92  ? 93.598  37.034 119.037 1.00 22.80 ? 110  GLN J OE1 1 
ATOM   9298  N  NE2 . GLN D 1 92  ? 95.715  36.918 118.302 1.00 21.38 ? 110  GLN J NE2 1 
ATOM   9299  N  N   . PRO D 1 93  ? 97.676  41.084 115.220 1.00 17.49 ? 111  PRO J N   1 
ATOM   9300  C  CA  . PRO D 1 93  ? 97.715  41.754 113.916 1.00 17.61 ? 111  PRO J CA  1 
ATOM   9301  C  C   . PRO D 1 93  ? 97.550  40.806 112.723 1.00 17.98 ? 111  PRO J C   1 
ATOM   9302  O  O   . PRO D 1 93  ? 97.124  41.245 111.649 1.00 17.58 ? 111  PRO J O   1 
ATOM   9303  C  CB  . PRO D 1 93  ? 99.095  42.421 113.901 1.00 17.39 ? 111  PRO J CB  1 
ATOM   9304  C  CG  . PRO D 1 93  ? 99.926  41.583 114.809 1.00 17.35 ? 111  PRO J CG  1 
ATOM   9305  C  CD  . PRO D 1 93  ? 99.000  41.081 115.877 1.00 17.17 ? 111  PRO J CD  1 
ATOM   9306  N  N   . ASN D 1 94  ? 97.873  39.524 112.915 1.00 18.36 ? 112  ASN J N   1 
ATOM   9307  C  CA  . ASN D 1 94  ? 97.695  38.512 111.867 1.00 18.88 ? 112  ASN J CA  1 
ATOM   9308  C  C   . ASN D 1 94  ? 96.233  38.285 111.499 1.00 18.33 ? 112  ASN J C   1 
ATOM   9309  O  O   . ASN D 1 94  ? 95.930  37.976 110.351 1.00 18.75 ? 112  ASN J O   1 
ATOM   9310  C  CB  . ASN D 1 94  ? 98.356  37.182 112.251 1.00 19.47 ? 112  ASN J CB  1 
ATOM   9311  C  CG  . ASN D 1 94  ? 99.877  37.244 112.193 1.00 21.90 ? 112  ASN J CG  1 
ATOM   9312  O  OD1 . ASN D 1 94  ? 100.555 37.069 113.211 1.00 24.88 ? 112  ASN J OD1 1 
ATOM   9313  N  ND2 . ASN D 1 94  ? 100.421 37.494 111.000 1.00 24.00 ? 112  ASN J ND2 1 
ATOM   9314  N  N   . LEU D 1 95  ? 95.331  38.441 112.466 1.00 17.67 ? 113  LEU J N   1 
ATOM   9315  C  CA  . LEU D 1 95  ? 93.893  38.370 112.190 1.00 17.01 ? 113  LEU J CA  1 
ATOM   9316  C  C   . LEU D 1 95  ? 93.427  39.529 111.301 1.00 16.49 ? 113  LEU J C   1 
ATOM   9317  O  O   . LEU D 1 95  ? 92.530  39.358 110.478 1.00 16.26 ? 113  LEU J O   1 
ATOM   9318  C  CB  . LEU D 1 95  ? 93.073  38.333 113.487 1.00 17.15 ? 113  LEU J CB  1 
ATOM   9319  C  CG  . LEU D 1 95  ? 93.219  37.165 114.473 1.00 17.64 ? 113  LEU J CG  1 
ATOM   9320  C  CD1 . LEU D 1 95  ? 92.140  37.251 115.543 1.00 17.90 ? 113  LEU J CD1 1 
ATOM   9321  C  CD2 . LEU D 1 95  ? 93.149  35.814 113.781 1.00 18.92 ? 113  LEU J CD2 1 
ATOM   9322  N  N   . ASN D 1 96  ? 94.039  40.703 111.472 1.00 15.91 ? 114  ASN J N   1 
ATOM   9323  C  CA  . ASN D 1 96  ? 93.757  41.856 110.609 1.00 15.62 ? 114  ASN J CA  1 
ATOM   9324  C  C   . ASN D 1 96  ? 94.289  41.658 109.193 1.00 15.58 ? 114  ASN J C   1 
ATOM   9325  O  O   . ASN D 1 96  ? 93.646  42.051 108.229 1.00 15.60 ? 114  ASN J O   1 
ATOM   9326  C  CB  . ASN D 1 96  ? 94.332  43.142 111.205 1.00 15.37 ? 114  ASN J CB  1 
ATOM   9327  C  CG  . ASN D 1 96  ? 93.647  43.544 112.487 1.00 14.96 ? 114  ASN J CG  1 
ATOM   9328  O  OD1 . ASN D 1 96  ? 92.612  44.215 112.471 1.00 14.59 ? 114  ASN J OD1 1 
ATOM   9329  N  ND2 . ASN D 1 96  ? 94.224  43.148 113.609 1.00 13.30 ? 114  ASN J ND2 1 
ATOM   9330  N  N   . MET D 1 97  ? 95.469  41.052 109.079 1.00 15.82 ? 115  MET J N   1 
ATOM   9331  C  CA  . MET D 1 97  ? 96.041  40.697 107.784 1.00 16.18 ? 115  MET J CA  1 
ATOM   9332  C  C   . MET D 1 97  ? 95.176  39.654 107.061 1.00 16.47 ? 115  MET J C   1 
ATOM   9333  O  O   . MET D 1 97  ? 94.959  39.754 105.847 1.00 16.13 ? 115  MET J O   1 
ATOM   9334  C  CB  . MET D 1 97  ? 97.479  40.183 107.950 1.00 16.28 ? 115  MET J CB  1 
ATOM   9335  C  CG  . MET D 1 97  ? 98.459  41.180 108.554 1.00 16.02 ? 115  MET J CG  1 
ATOM   9336  S  SD  . MET D 1 97  ? 98.686  42.701 107.590 1.00 18.07 ? 115  MET J SD  1 
ATOM   9337  C  CE  . MET D 1 97  ? 97.552  43.849 108.387 1.00 17.34 ? 115  MET J CE  1 
ATOM   9338  N  N   . ASP D 1 98  ? 94.693  38.664 107.819 1.00 16.72 ? 116  ASP J N   1 
ATOM   9339  C  CA  . ASP D 1 98  ? 93.789  37.630 107.320 1.00 17.17 ? 116  ASP J CA  1 
ATOM   9340  C  C   . ASP D 1 98  ? 92.510  38.249 106.748 1.00 16.65 ? 116  ASP J C   1 
ATOM   9341  O  O   . ASP D 1 98  ? 92.076  37.910 105.649 1.00 16.16 ? 116  ASP J O   1 
ATOM   9342  C  CB  . ASP D 1 98  ? 93.391  36.670 108.456 1.00 17.97 ? 116  ASP J CB  1 
ATOM   9343  C  CG  . ASP D 1 98  ? 94.501  35.700 108.854 1.00 21.28 ? 116  ASP J CG  1 
ATOM   9344  O  OD1 . ASP D 1 98  ? 95.629  35.770 108.300 1.00 25.48 ? 116  ASP J OD1 1 
ATOM   9345  O  OD2 . ASP D 1 98  ? 94.234  34.851 109.741 1.00 24.61 ? 116  ASP J OD2 1 
ATOM   9346  N  N   . ARG D 1 99  ? 91.910  39.149 107.526 1.00 16.18 ? 117  ARG J N   1 
ATOM   9347  C  CA  . ARG D 1 99  ? 90.656  39.791 107.166 1.00 15.81 ? 117  ARG J CA  1 
ATOM   9348  C  C   . ARG D 1 99  ? 90.843  40.734 105.975 1.00 15.25 ? 117  ARG J C   1 
ATOM   9349  O  O   . ARG D 1 99  ? 89.990  40.785 105.082 1.00 15.25 ? 117  ARG J O   1 
ATOM   9350  C  CB  . ARG D 1 99  ? 90.084  40.522 108.380 1.00 15.68 ? 117  ARG J CB  1 
ATOM   9351  C  CG  . ARG D 1 99  ? 88.645  41.006 108.239 1.00 16.50 ? 117  ARG J CG  1 
ATOM   9352  C  CD  . ARG D 1 99  ? 88.086  41.452 109.598 1.00 15.83 ? 117  ARG J CD  1 
ATOM   9353  N  NE  . ARG D 1 99  ? 88.699  42.691 110.080 1.00 15.57 ? 117  ARG J NE  1 
ATOM   9354  C  CZ  . ARG D 1 99  ? 88.546  43.190 111.308 1.00 14.86 ? 117  ARG J CZ  1 
ATOM   9355  N  NH1 . ARG D 1 99  ? 87.802  42.562 112.209 1.00 13.89 ? 117  ARG J NH1 1 
ATOM   9356  N  NH2 . ARG D 1 99  ? 89.147  44.324 111.639 1.00 14.01 ? 117  ARG J NH2 1 
ATOM   9357  N  N   . MET D 1 100 ? 91.961  41.457 105.953 1.00 14.60 ? 118  MET J N   1 
ATOM   9358  C  CA  . MET D 1 100 ? 92.254  42.380 104.853 1.00 14.30 ? 118  MET J CA  1 
ATOM   9359  C  C   . MET D 1 100 ? 92.430  41.633 103.525 1.00 14.27 ? 118  MET J C   1 
ATOM   9360  O  O   . MET D 1 100 ? 91.912  42.054 102.489 1.00 13.60 ? 118  MET J O   1 
ATOM   9361  C  CB  . MET D 1 100 ? 93.499  43.212 105.156 1.00 14.17 ? 118  MET J CB  1 
ATOM   9362  C  CG  . MET D 1 100 ? 93.686  44.383 104.215 1.00 13.87 ? 118  MET J CG  1 
ATOM   9363  S  SD  . MET D 1 100 ? 95.144  45.327 104.629 1.00 15.61 ? 118  MET J SD  1 
ATOM   9364  C  CE  . MET D 1 100 ? 95.064  46.666 103.432 1.00 11.06 ? 118  MET J CE  1 
ATOM   9365  N  N   . TYR D 1 101 ? 93.168  40.528 103.578 1.00 14.77 ? 119  TYR J N   1 
ATOM   9366  C  CA  . TYR D 1 101 ? 93.363  39.641 102.427 1.00 15.38 ? 119  TYR J CA  1 
ATOM   9367  C  C   . TYR D 1 101 ? 92.021  39.117 101.908 1.00 15.69 ? 119  TYR J C   1 
ATOM   9368  O  O   . TYR D 1 101 ? 91.769  39.130 100.709 1.00 15.88 ? 119  TYR J O   1 
ATOM   9369  C  CB  . TYR D 1 101 ? 94.272  38.473 102.821 1.00 15.27 ? 119  TYR J CB  1 
ATOM   9370  C  CG  . TYR D 1 101 ? 94.706  37.597 101.671 1.00 15.20 ? 119  TYR J CG  1 
ATOM   9371  C  CD1 . TYR D 1 101 ? 95.947  37.773 101.076 1.00 14.66 ? 119  TYR J CD1 1 
ATOM   9372  C  CD2 . TYR D 1 101 ? 93.869  36.591 101.175 1.00 14.88 ? 119  TYR J CD2 1 
ATOM   9373  C  CE1 . TYR D 1 101 ? 96.353  36.967 100.022 1.00 15.69 ? 119  TYR J CE1 1 
ATOM   9374  C  CE2 . TYR D 1 101 ? 94.259  35.797 100.114 1.00 14.89 ? 119  TYR J CE2 1 
ATOM   9375  C  CZ  . TYR D 1 101 ? 95.509  35.982 99.552  1.00 15.50 ? 119  TYR J CZ  1 
ATOM   9376  O  OH  . TYR D 1 101 ? 95.908  35.201 98.500  1.00 17.12 ? 119  TYR J OH  1 
ATOM   9377  N  N   . ARG D 1 102 ? 91.160  38.678 102.822 1.00 16.36 ? 120  ARG J N   1 
ATOM   9378  C  CA  . ARG D 1 102 ? 89.835  38.168 102.466 1.00 17.08 ? 120  ARG J CA  1 
ATOM   9379  C  C   . ARG D 1 102 ? 88.924  39.238 101.850 1.00 16.79 ? 120  ARG J C   1 
ATOM   9380  O  O   . ARG D 1 102 ? 88.186  38.958 100.906 1.00 16.69 ? 120  ARG J O   1 
ATOM   9381  C  CB  . ARG D 1 102 ? 89.164  37.532 103.683 1.00 17.60 ? 120  ARG J CB  1 
ATOM   9382  C  CG  . ARG D 1 102 ? 89.694  36.148 104.015 1.00 20.22 ? 120  ARG J CG  1 
ATOM   9383  C  CD  . ARG D 1 102 ? 89.108  35.605 105.308 1.00 24.83 ? 120  ARG J CD  1 
ATOM   9384  N  NE  . ARG D 1 102 ? 88.996  34.143 105.257 1.00 30.07 ? 120  ARG J NE  1 
ATOM   9385  C  CZ  . ARG D 1 102 ? 89.906  33.289 105.722 1.00 31.25 ? 120  ARG J CZ  1 
ATOM   9386  N  NH1 . ARG D 1 102 ? 89.694  31.983 105.617 1.00 31.40 ? 120  ARG J NH1 1 
ATOM   9387  N  NH2 . ARG D 1 102 ? 91.020  33.732 106.297 1.00 32.85 ? 120  ARG J NH2 1 
ATOM   9388  N  N   . SER D 1 103 ? 88.977  40.454 102.390 1.00 16.37 ? 121  SER J N   1 
ATOM   9389  C  CA  . SER D 1 103 ? 88.255  41.582 101.808 1.00 16.32 ? 121  SER J CA  1 
ATOM   9390  C  C   . SER D 1 103 ? 88.796  41.935 100.423 1.00 15.83 ? 121  SER J C   1 
ATOM   9391  O  O   . SER D 1 103 ? 88.030  42.324 99.553  1.00 15.75 ? 121  SER J O   1 
ATOM   9392  C  CB  . SER D 1 103 ? 88.310  42.805 102.726 1.00 16.21 ? 121  SER J CB  1 
ATOM   9393  O  OG  . SER D 1 103 ? 87.724  42.520 103.983 1.00 18.70 ? 121  SER J OG  1 
ATOM   9394  N  N   . ALA D 1 104 ? 90.106  41.793 100.221 1.00 15.45 ? 122  ALA J N   1 
ATOM   9395  C  CA  . ALA D 1 104 ? 90.719  42.114 98.924  1.00 15.60 ? 122  ALA J CA  1 
ATOM   9396  C  C   . ALA D 1 104 ? 90.206  41.198 97.811  1.00 15.57 ? 122  ALA J C   1 
ATOM   9397  O  O   . ALA D 1 104 ? 89.898  41.666 96.709  1.00 15.92 ? 122  ALA J O   1 
ATOM   9398  C  CB  . ALA D 1 104 ? 92.244  42.068 99.006  1.00 15.23 ? 122  ALA J CB  1 
ATOM   9399  N  N   . VAL D 1 105 ? 90.109  39.904 98.118  1.00 15.18 ? 123  VAL J N   1 
ATOM   9400  C  CA  . VAL D 1 105 ? 89.565  38.899 97.207  1.00 15.31 ? 123  VAL J CA  1 
ATOM   9401  C  C   . VAL D 1 105 ? 88.106  39.237 96.888  1.00 15.31 ? 123  VAL J C   1 
ATOM   9402  O  O   . VAL D 1 105 ? 87.692  39.230 95.729  1.00 15.27 ? 123  VAL J O   1 
ATOM   9403  C  CB  . VAL D 1 105 ? 89.682  37.461 97.816  1.00 15.33 ? 123  VAL J CB  1 
ATOM   9404  C  CG1 . VAL D 1 105 ? 88.968  36.412 96.942  1.00 15.95 ? 123  VAL J CG1 1 
ATOM   9405  C  CG2 . VAL D 1 105 ? 91.150  37.071 98.023  1.00 14.99 ? 123  VAL J CG2 1 
ATOM   9406  N  N   . ARG D 1 106 ? 87.344  39.560 97.928  1.00 15.18 ? 124  ARG J N   1 
ATOM   9407  C  CA  . ARG D 1 106 ? 85.955  39.950 97.778  1.00 15.61 ? 124  ARG J CA  1 
ATOM   9408  C  C   . ARG D 1 106 ? 85.794  41.216 96.911  1.00 15.09 ? 124  ARG J C   1 
ATOM   9409  O  O   . ARG D 1 106 ? 84.848  41.310 96.120  1.00 14.97 ? 124  ARG J O   1 
ATOM   9410  C  CB  . ARG D 1 106 ? 85.326  40.135 99.156  1.00 16.18 ? 124  ARG J CB  1 
ATOM   9411  C  CG  . ARG D 1 106 ? 83.819  40.092 99.159  1.00 19.87 ? 124  ARG J CG  1 
ATOM   9412  C  CD  . ARG D 1 106 ? 83.238  38.681 99.226  1.00 24.74 ? 124  ARG J CD  1 
ATOM   9413  N  NE  . ARG D 1 106 ? 81.932  38.751 99.878  1.00 29.66 ? 124  ARG J NE  1 
ATOM   9414  C  CZ  . ARG D 1 106 ? 81.709  38.461 101.157 1.00 31.54 ? 124  ARG J CZ  1 
ATOM   9415  N  NH1 . ARG D 1 106 ? 82.692  38.028 101.942 1.00 32.13 ? 124  ARG J NH1 1 
ATOM   9416  N  NH2 . ARG D 1 106 ? 80.484  38.585 101.649 1.00 33.78 ? 124  ARG J NH2 1 
ATOM   9417  N  N   . ALA D 1 107 ? 86.736  42.153 97.040  1.00 14.38 ? 125  ALA J N   1 
ATOM   9418  C  CA  . ALA D 1 107 ? 86.744  43.407 96.268  1.00 14.37 ? 125  ALA J CA  1 
ATOM   9419  C  C   . ALA D 1 107 ? 87.303  43.265 94.847  1.00 14.18 ? 125  ALA J C   1 
ATOM   9420  O  O   . ALA D 1 107 ? 87.086  44.143 93.996  1.00 14.13 ? 125  ALA J O   1 
ATOM   9421  C  CB  . ALA D 1 107 ? 87.532  44.496 97.036  1.00 13.94 ? 125  ALA J CB  1 
ATOM   9422  N  N   . THR D 1 108 ? 88.014  42.157 94.610  1.00 14.23 ? 126  THR J N   1 
ATOM   9423  C  CA  . THR D 1 108 ? 88.797  41.878 93.379  1.00 14.21 ? 126  THR J CA  1 
ATOM   9424  C  C   . THR D 1 108 ? 90.039  42.770 93.280  1.00 13.84 ? 126  THR J C   1 
ATOM   9425  O  O   . THR D 1 108 ? 90.568  43.020 92.189  1.00 13.69 ? 126  THR J O   1 
ATOM   9426  C  CB  . THR D 1 108 ? 87.966  41.921 92.048  1.00 14.20 ? 126  THR J CB  1 
ATOM   9427  O  OG1 . THR D 1 108 ? 87.743  43.283 91.653  1.00 15.29 ? 126  THR J OG1 1 
ATOM   9428  C  CG2 . THR D 1 108 ? 86.639  41.200 92.203  1.00 14.33 ? 126  THR J CG2 1 
ATOM   9429  N  N   . LEU D 1 109 ? 90.493  43.249 94.432  1.00 13.53 ? 127  LEU J N   1 
ATOM   9430  C  CA  . LEU D 1 109 ? 91.756  43.974 94.523  1.00 13.19 ? 127  LEU J CA  1 
ATOM   9431  C  C   . LEU D 1 109 ? 92.901  42.962 94.566  1.00 13.34 ? 127  LEU J C   1 
ATOM   9432  O  O   . LEU D 1 109 ? 92.685  41.808 94.953  1.00 13.29 ? 127  LEU J O   1 
ATOM   9433  C  CB  . LEU D 1 109 ? 91.759  44.908 95.743  1.00 12.83 ? 127  LEU J CB  1 
ATOM   9434  C  CG  . LEU D 1 109 ? 91.034  46.238 95.484  1.00 11.94 ? 127  LEU J CG  1 
ATOM   9435  C  CD1 . LEU D 1 109 ? 90.594  46.921 96.764  1.00 10.75 ? 127  LEU J CD1 1 
ATOM   9436  C  CD2 . LEU D 1 109 ? 91.898  47.170 94.659  1.00 13.18 ? 127  LEU J CD2 1 
ATOM   9437  N  N   . PRO D 1 110 ? 94.109  43.370 94.129  1.00 13.67 ? 128  PRO J N   1 
ATOM   9438  C  CA  . PRO D 1 110 ? 95.187  42.388 94.026  1.00 13.99 ? 128  PRO J CA  1 
ATOM   9439  C  C   . PRO D 1 110 ? 95.566  41.742 95.352  1.00 14.40 ? 128  PRO J C   1 
ATOM   9440  O  O   . PRO D 1 110 ? 95.597  42.386 96.398  1.00 14.52 ? 128  PRO J O   1 
ATOM   9441  C  CB  . PRO D 1 110 ? 96.368  43.194 93.473  1.00 13.89 ? 128  PRO J CB  1 
ATOM   9442  C  CG  . PRO D 1 110 ? 96.040  44.615 93.744  1.00 13.81 ? 128  PRO J CG  1 
ATOM   9443  C  CD  . PRO D 1 110 ? 94.543  44.709 93.680  1.00 13.67 ? 128  PRO J CD  1 
ATOM   9444  N  N   . VAL D 1 111 ? 95.863  40.461 95.270  1.00 14.74 ? 129  VAL J N   1 
ATOM   9445  C  CA  . VAL D 1 111 ? 96.292  39.663 96.398  1.00 15.44 ? 129  VAL J CA  1 
ATOM   9446  C  C   . VAL D 1 111 ? 97.753  39.989 96.775  1.00 15.38 ? 129  VAL J C   1 
ATOM   9447  O  O   . VAL D 1 111 ? 98.544  40.386 95.923  1.00 15.30 ? 129  VAL J O   1 
ATOM   9448  C  CB  . VAL D 1 111 ? 96.010  38.179 96.046  1.00 15.77 ? 129  VAL J CB  1 
ATOM   9449  C  CG1 . VAL D 1 111 ? 97.189  37.280 96.293  1.00 17.16 ? 129  VAL J CG1 1 
ATOM   9450  C  CG2 . VAL D 1 111 ? 94.724  37.710 96.731  1.00 15.85 ? 129  VAL J CG2 1 
ATOM   9451  N  N   . PHE D 1 112 ? 98.086  39.869 98.059  1.00 15.79 ? 130  PHE J N   1 
ATOM   9452  C  CA  . PHE D 1 112 ? 99.426  40.193 98.574  1.00 16.27 ? 130  PHE J CA  1 
ATOM   9453  C  C   . PHE D 1 112 ? 99.840  39.190 99.660  1.00 16.82 ? 130  PHE J C   1 
ATOM   9454  O  O   . PHE D 1 112 ? 99.001  38.449 100.178 1.00 16.63 ? 130  PHE J O   1 
ATOM   9455  C  CB  . PHE D 1 112 ? 99.448  41.621 99.150  1.00 16.30 ? 130  PHE J CB  1 
ATOM   9456  C  CG  . PHE D 1 112 ? 98.464  41.830 100.274 1.00 16.14 ? 130  PHE J CG  1 
ATOM   9457  C  CD1 . PHE D 1 112 ? 98.825  41.563 101.596 1.00 15.37 ? 130  PHE J CD1 1 
ATOM   9458  C  CD2 . PHE D 1 112 ? 97.166  42.267 100.009 1.00 15.90 ? 130  PHE J CD2 1 
ATOM   9459  C  CE1 . PHE D 1 112 ? 97.912  41.732 102.633 1.00 15.26 ? 130  PHE J CE1 1 
ATOM   9460  C  CE2 . PHE D 1 112 ? 96.244  42.441 101.042 1.00 15.28 ? 130  PHE J CE2 1 
ATOM   9461  C  CZ  . PHE D 1 112 ? 96.622  42.174 102.357 1.00 16.01 ? 130  PHE J CZ  1 
ATOM   9462  N  N   . ASP D 1 113 ? 101.127 39.171 100.006 1.00 17.39 ? 131  ASP J N   1 
ATOM   9463  C  CA  . ASP D 1 113 ? 101.614 38.316 101.091 1.00 18.12 ? 131  ASP J CA  1 
ATOM   9464  C  C   . ASP D 1 113 ? 101.377 39.007 102.435 1.00 17.94 ? 131  ASP J C   1 
ATOM   9465  O  O   . ASP D 1 113 ? 101.882 40.106 102.676 1.00 17.42 ? 131  ASP J O   1 
ATOM   9466  C  CB  . ASP D 1 113 ? 103.097 37.984 100.900 1.00 18.65 ? 131  ASP J CB  1 
ATOM   9467  C  CG  . ASP D 1 113 ? 103.591 36.923 101.864 1.00 20.77 ? 131  ASP J CG  1 
ATOM   9468  O  OD1 . ASP D 1 113 ? 103.625 37.184 103.088 1.00 22.52 ? 131  ASP J OD1 1 
ATOM   9469  O  OD2 . ASP D 1 113 ? 103.956 35.824 101.393 1.00 23.61 ? 131  ASP J OD2 1 
ATOM   9470  N  N   . LYS D 1 114 ? 100.607 38.345 103.294 1.00 18.15 ? 132  LYS J N   1 
ATOM   9471  C  CA  . LYS D 1 114 ? 100.168 38.900 104.579 1.00 18.73 ? 132  LYS J CA  1 
ATOM   9472  C  C   . LYS D 1 114 ? 101.305 39.193 105.558 1.00 18.78 ? 132  LYS J C   1 
ATOM   9473  O  O   . LYS D 1 114 ? 101.266 40.188 106.276 1.00 18.44 ? 132  LYS J O   1 
ATOM   9474  C  CB  . LYS D 1 114 ? 99.127  37.981 105.228 1.00 18.66 ? 132  LYS J CB  1 
ATOM   9475  C  CG  . LYS D 1 114 ? 97.765  38.053 104.558 1.00 19.58 ? 132  LYS J CG  1 
ATOM   9476  C  CD  . LYS D 1 114 ? 96.799  37.024 105.118 1.00 21.21 ? 132  LYS J CD  1 
ATOM   9477  C  CE  . LYS D 1 114 ? 96.898  35.693 104.386 1.00 23.31 ? 132  LYS J CE  1 
ATOM   9478  N  NZ  . LYS D 1 114 ? 95.902  34.707 104.915 1.00 25.55 ? 132  LYS J NZ  1 
ATOM   9479  N  N   . GLU D 1 115 ? 102.319 38.330 105.572 1.00 19.38 ? 133  GLU J N   1 
ATOM   9480  C  CA  . GLU D 1 115 ? 103.478 38.516 106.444 1.00 19.64 ? 133  GLU J CA  1 
ATOM   9481  C  C   . GLU D 1 115 ? 104.372 39.654 105.959 1.00 19.02 ? 133  GLU J C   1 
ATOM   9482  O  O   . GLU D 1 115 ? 104.972 40.368 106.769 1.00 19.03 ? 133  GLU J O   1 
ATOM   9483  C  CB  . GLU D 1 115 ? 104.264 37.203 106.595 1.00 20.32 ? 133  GLU J CB  1 
ATOM   9484  C  CG  . GLU D 1 115 ? 103.601 36.180 107.539 1.00 23.15 ? 133  GLU J CG  1 
ATOM   9485  C  CD  . GLU D 1 115 ? 103.576 36.635 109.007 1.00 27.57 ? 133  GLU J CD  1 
ATOM   9486  O  OE1 . GLU D 1 115 ? 104.645 36.989 109.567 1.00 29.64 ? 133  GLU J OE1 1 
ATOM   9487  O  OE2 . GLU D 1 115 ? 102.481 36.624 109.613 1.00 30.01 ? 133  GLU J OE2 1 
ATOM   9488  N  N   . GLU D 1 116 ? 104.439 39.839 104.643 1.00 18.62 ? 134  GLU J N   1 
ATOM   9489  C  CA  . GLU D 1 116 ? 105.169 40.971 104.064 1.00 18.21 ? 134  GLU J CA  1 
ATOM   9490  C  C   . GLU D 1 116 ? 104.530 42.310 104.431 1.00 17.66 ? 134  GLU J C   1 
ATOM   9491  O  O   . GLU D 1 116 ? 105.240 43.265 104.779 1.00 17.22 ? 134  GLU J O   1 
ATOM   9492  C  CB  . GLU D 1 116 ? 105.294 40.845 102.541 1.00 18.44 ? 134  GLU J CB  1 
ATOM   9493  C  CG  . GLU D 1 116 ? 106.155 39.673 102.057 1.00 20.13 ? 134  GLU J CG  1 
ATOM   9494  C  CD  . GLU D 1 116 ? 107.619 39.736 102.513 1.00 22.52 ? 134  GLU J CD  1 
ATOM   9495  O  OE1 . GLU D 1 116 ? 108.120 40.828 102.854 1.00 23.36 ? 134  GLU J OE1 1 
ATOM   9496  O  OE2 . GLU D 1 116 ? 108.277 38.679 102.514 1.00 23.84 ? 134  GLU J OE2 1 
ATOM   9497  N  N   . LEU D 1 117 ? 103.199 42.382 104.359 1.00 16.94 ? 135  LEU J N   1 
ATOM   9498  C  CA  . LEU D 1 117 ? 102.494 43.616 104.727 1.00 16.56 ? 135  LEU J CA  1 
ATOM   9499  C  C   . LEU D 1 117 ? 102.658 43.920 106.213 1.00 16.44 ? 135  LEU J C   1 
ATOM   9500  O  O   . LEU D 1 117 ? 102.898 45.072 106.596 1.00 16.36 ? 135  LEU J O   1 
ATOM   9501  C  CB  . LEU D 1 117 ? 101.005 43.569 104.346 1.00 16.18 ? 135  LEU J CB  1 
ATOM   9502  C  CG  . LEU D 1 117 ? 100.185 44.795 104.796 1.00 15.32 ? 135  LEU J CG  1 
ATOM   9503  C  CD1 . LEU D 1 117 ? 100.738 46.094 104.214 1.00 14.12 ? 135  LEU J CD1 1 
ATOM   9504  C  CD2 . LEU D 1 117 ? 98.714  44.636 104.454 1.00 14.63 ? 135  LEU J CD2 1 
ATOM   9505  N  N   . LEU D 1 118 ? 102.527 42.883 107.039 1.00 16.47 ? 136  LEU J N   1 
ATOM   9506  C  CA  . LEU D 1 118 ? 102.738 43.019 108.470 1.00 16.71 ? 136  LEU J CA  1 
ATOM   9507  C  C   . LEU D 1 118 ? 104.130 43.569 108.783 1.00 16.84 ? 136  LEU J C   1 
ATOM   9508  O  O   . LEU D 1 118 ? 104.257 44.502 109.571 1.00 16.82 ? 136  LEU J O   1 
ATOM   9509  C  CB  . LEU D 1 118 ? 102.491 41.697 109.206 1.00 16.60 ? 136  LEU J CB  1 
ATOM   9510  C  CG  . LEU D 1 118 ? 102.647 41.741 110.735 1.00 16.82 ? 136  LEU J CG  1 
ATOM   9511  C  CD1 . LEU D 1 118 ? 101.758 42.805 111.388 1.00 16.73 ? 136  LEU J CD1 1 
ATOM   9512  C  CD2 . LEU D 1 118 ? 102.382 40.379 111.347 1.00 17.08 ? 136  LEU J CD2 1 
ATOM   9513  N  N   . GLU D 1 119 ? 105.164 43.016 108.151 1.00 17.22 ? 137  GLU J N   1 
ATOM   9514  C  CA  . GLU D 1 119 ? 106.526 43.514 108.367 1.00 17.56 ? 137  GLU J CA  1 
ATOM   9515  C  C   . GLU D 1 119 ? 106.687 44.965 107.921 1.00 17.34 ? 137  GLU J C   1 
ATOM   9516  O  O   . GLU D 1 119 ? 107.344 45.746 108.602 1.00 17.84 ? 137  GLU J O   1 
ATOM   9517  C  CB  . GLU D 1 119 ? 107.572 42.603 107.712 1.00 17.82 ? 137  GLU J CB  1 
ATOM   9518  C  CG  . GLU D 1 119 ? 109.042 43.003 107.975 1.00 19.94 ? 137  GLU J CG  1 
ATOM   9519  C  CD  . GLU D 1 119 ? 109.407 43.114 109.456 1.00 22.58 ? 137  GLU J CD  1 
ATOM   9520  O  OE1 . GLU D 1 119 ? 110.267 43.953 109.788 1.00 24.69 ? 137  GLU J OE1 1 
ATOM   9521  O  OE2 . GLU D 1 119 ? 108.845 42.374 110.290 1.00 24.29 ? 137  GLU J OE2 1 
ATOM   9522  N  N   . CYS D 1 120 ? 106.072 45.323 106.795 1.00 16.80 ? 138  CYS J N   1 
ATOM   9523  C  CA  . CYS D 1 120 ? 106.059 46.711 106.320 1.00 16.89 ? 138  CYS J CA  1 
ATOM   9524  C  C   . CYS D 1 120 ? 105.364 47.667 107.297 1.00 16.33 ? 138  CYS J C   1 
ATOM   9525  O  O   . CYS D 1 120 ? 105.820 48.785 107.486 1.00 16.19 ? 138  CYS J O   1 
ATOM   9526  C  CB  . CYS D 1 120 ? 105.381 46.814 104.951 1.00 17.08 ? 138  CYS J CB  1 
ATOM   9527  S  SG  . CYS D 1 120 ? 106.368 46.218 103.581 1.00 17.96 ? 138  CYS J SG  1 
ATOM   9528  N  N   . ILE D 1 121 ? 104.254 47.224 107.890 1.00 16.11 ? 139  ILE J N   1 
ATOM   9529  C  CA  . ILE D 1 121 ? 103.536 48.003 108.900 1.00 15.93 ? 139  ILE J CA  1 
ATOM   9530  C  C   . ILE D 1 121 ? 104.412 48.163 110.155 1.00 16.14 ? 139  ILE J C   1 
ATOM   9531  O  O   . ILE D 1 121 ? 104.542 49.262 110.688 1.00 16.06 ? 139  ILE J O   1 
ATOM   9532  C  CB  . ILE D 1 121 ? 102.130 47.379 109.222 1.00 15.98 ? 139  ILE J CB  1 
ATOM   9533  C  CG1 . ILE D 1 121 ? 101.162 47.607 108.049 1.00 15.73 ? 139  ILE J CG1 1 
ATOM   9534  C  CG2 . ILE D 1 121 ? 101.548 47.936 110.541 1.00 15.30 ? 139  ILE J CG2 1 
ATOM   9535  C  CD1 . ILE D 1 121 ? 99.820  46.851 108.160 1.00 15.91 ? 139  ILE J CD1 1 
ATOM   9536  N  N   . GLN D 1 122 ? 105.031 47.070 110.598 1.00 16.33 ? 140  GLN J N   1 
ATOM   9537  C  CA  . GLN D 1 122 ? 105.956 47.099 111.739 1.00 16.68 ? 140  GLN J CA  1 
ATOM   9538  C  C   . GLN D 1 122 ? 107.091 48.090 111.538 1.00 16.31 ? 140  GLN J C   1 
ATOM   9539  O  O   . GLN D 1 122 ? 107.430 48.843 112.454 1.00 16.23 ? 140  GLN J O   1 
ATOM   9540  C  CB  . GLN D 1 122 ? 106.523 45.706 112.026 1.00 16.98 ? 140  GLN J CB  1 
ATOM   9541  C  CG  . GLN D 1 122 ? 105.461 44.688 112.403 1.00 18.84 ? 140  GLN J CG  1 
ATOM   9542  C  CD  . GLN D 1 122 ? 105.855 43.835 113.581 1.00 21.79 ? 140  GLN J CD  1 
ATOM   9543  O  OE1 . GLN D 1 122 ? 105.693 42.614 113.562 1.00 23.89 ? 140  GLN J OE1 1 
ATOM   9544  N  NE2 . GLN D 1 122 ? 106.365 44.473 114.622 1.00 22.68 ? 140  GLN J NE2 1 
ATOM   9545  N  N   . GLN D 1 123 ? 107.663 48.103 110.336 1.00 16.07 ? 141  GLN J N   1 
ATOM   9546  C  CA  . GLN D 1 123 ? 108.706 49.073 109.991 1.00 15.95 ? 141  GLN J CA  1 
ATOM   9547  C  C   . GLN D 1 123 ? 108.226 50.525 110.023 1.00 15.58 ? 141  GLN J C   1 
ATOM   9548  O  O   . GLN D 1 123 ? 108.963 51.413 110.456 1.00 15.63 ? 141  GLN J O   1 
ATOM   9549  C  CB  . GLN D 1 123 ? 109.329 48.742 108.631 1.00 16.12 ? 141  GLN J CB  1 
ATOM   9550  C  CG  . GLN D 1 123 ? 110.256 47.526 108.652 1.00 17.55 ? 141  GLN J CG  1 
ATOM   9551  C  CD  . GLN D 1 123 ? 111.312 47.592 109.754 1.00 18.83 ? 141  GLN J CD  1 
ATOM   9552  O  OE1 . GLN D 1 123 ? 111.999 48.600 109.917 1.00 20.46 ? 141  GLN J OE1 1 
ATOM   9553  N  NE2 . GLN D 1 123 ? 111.446 46.508 110.508 1.00 19.84 ? 141  GLN J NE2 1 
ATOM   9554  N  N   . LEU D 1 124 ? 106.993 50.762 109.564 1.00 15.19 ? 142  LEU J N   1 
ATOM   9555  C  CA  . LEU D 1 124 ? 106.395 52.097 109.607 1.00 14.59 ? 142  LEU J CA  1 
ATOM   9556  C  C   . LEU D 1 124 ? 106.152 52.573 111.040 1.00 14.50 ? 142  LEU J C   1 
ATOM   9557  O  O   . LEU D 1 124 ? 106.443 53.723 111.379 1.00 14.11 ? 142  LEU J O   1 
ATOM   9558  C  CB  . LEU D 1 124 ? 105.084 52.130 108.810 1.00 14.55 ? 142  LEU J CB  1 
ATOM   9559  C  CG  . LEU D 1 124 ? 104.205 53.386 108.929 1.00 14.55 ? 142  LEU J CG  1 
ATOM   9560  C  CD1 . LEU D 1 124 ? 104.843 54.600 108.242 1.00 14.09 ? 142  LEU J CD1 1 
ATOM   9561  C  CD2 . LEU D 1 124 ? 102.799 53.128 108.378 1.00 13.82 ? 142  LEU J CD2 1 
ATOM   9562  N  N   . VAL D 1 125 ? 105.593 51.691 111.865 1.00 14.64 ? 143  VAL J N   1 
ATOM   9563  C  CA  . VAL D 1 125 ? 105.346 51.991 113.273 1.00 14.76 ? 143  VAL J CA  1 
ATOM   9564  C  C   . VAL D 1 125 ? 106.674 52.178 114.012 1.00 15.21 ? 143  VAL J C   1 
ATOM   9565  O  O   . VAL D 1 125 ? 106.800 53.087 114.823 1.00 15.16 ? 143  VAL J O   1 
ATOM   9566  C  CB  . VAL D 1 125 ? 104.460 50.901 113.950 1.00 14.66 ? 143  VAL J CB  1 
ATOM   9567  C  CG1 . VAL D 1 125 ? 104.349 51.130 115.460 1.00 14.77 ? 143  VAL J CG1 1 
ATOM   9568  C  CG2 . VAL D 1 125 ? 103.072 50.887 113.326 1.00 13.67 ? 143  VAL J CG2 1 
ATOM   9569  N  N   . LYS D 1 126 ? 107.668 51.342 113.705 1.00 15.77 ? 144  LYS J N   1 
ATOM   9570  C  CA  . LYS D 1 126 ? 109.011 51.488 114.290 1.00 16.25 ? 144  LYS J CA  1 
ATOM   9571  C  C   . LYS D 1 126 ? 109.594 52.866 113.967 1.00 15.99 ? 144  LYS J C   1 
ATOM   9572  O  O   . LYS D 1 126 ? 110.156 53.531 114.844 1.00 16.30 ? 144  LYS J O   1 
ATOM   9573  C  CB  . LYS D 1 126 ? 109.942 50.365 113.807 1.00 16.68 ? 144  LYS J CB  1 
ATOM   9574  C  CG  . LYS D 1 126 ? 111.364 50.373 114.394 1.00 19.32 ? 144  LYS J CG  1 
ATOM   9575  C  CD  . LYS D 1 126 ? 112.260 49.326 113.688 1.00 21.56 ? 144  LYS J CD  1 
ATOM   9576  C  CE  . LYS D 1 126 ? 113.674 49.269 114.290 1.00 24.04 ? 144  LYS J CE  1 
ATOM   9577  N  NZ  . LYS D 1 126 ? 114.663 48.621 113.336 1.00 24.75 ? 144  LYS J NZ  1 
ATOM   9578  N  N   . LEU D 1 127 ? 109.442 53.305 112.718 1.00 15.57 ? 145  LEU J N   1 
ATOM   9579  C  CA  . LEU D 1 127 ? 109.966 54.606 112.303 1.00 15.00 ? 145  LEU J CA  1 
ATOM   9580  C  C   . LEU D 1 127 ? 109.241 55.775 112.977 1.00 14.70 ? 145  LEU J C   1 
ATOM   9581  O  O   . LEU D 1 127 ? 109.854 56.788 113.315 1.00 14.48 ? 145  LEU J O   1 
ATOM   9582  C  CB  . LEU D 1 127 ? 109.921 54.756 110.778 1.00 15.17 ? 145  LEU J CB  1 
ATOM   9583  C  CG  . LEU D 1 127 ? 110.460 56.075 110.211 1.00 15.06 ? 145  LEU J CG  1 
ATOM   9584  C  CD1 . LEU D 1 127 ? 111.961 56.209 110.466 1.00 15.19 ? 145  LEU J CD1 1 
ATOM   9585  C  CD2 . LEU D 1 127 ? 110.154 56.198 108.724 1.00 15.30 ? 145  LEU J CD2 1 
ATOM   9586  N  N   . ASP D 1 128 ? 107.934 55.627 113.167 1.00 14.52 ? 146  ASP J N   1 
ATOM   9587  C  CA  . ASP D 1 128 ? 107.130 56.645 113.838 1.00 14.27 ? 146  ASP J CA  1 
ATOM   9588  C  C   . ASP D 1 128 ? 106.780 56.260 115.279 1.00 14.09 ? 146  ASP J C   1 
ATOM   9589  O  O   . ASP D 1 128 ? 105.796 56.742 115.829 1.00 14.20 ? 146  ASP J O   1 
ATOM   9590  C  CB  . ASP D 1 128 ? 105.851 56.912 113.031 1.00 14.42 ? 146  ASP J CB  1 
ATOM   9591  C  CG  . ASP D 1 128 ? 106.061 57.922 111.917 1.00 14.41 ? 146  ASP J CG  1 
ATOM   9592  O  OD1 . ASP D 1 128 ? 107.178 58.483 111.812 1.00 14.91 ? 146  ASP J OD1 1 
ATOM   9593  O  OD2 . ASP D 1 128 ? 105.102 58.160 111.151 1.00 14.03 ? 146  ASP J OD2 1 
ATOM   9594  N  N   . GLN D 1 129 ? 107.602 55.413 115.891 1.00 13.93 ? 147  GLN J N   1 
ATOM   9595  C  CA  . GLN D 1 129 ? 107.295 54.829 117.200 1.00 13.91 ? 147  GLN J CA  1 
ATOM   9596  C  C   . GLN D 1 129 ? 107.094 55.825 118.345 1.00 13.74 ? 147  GLN J C   1 
ATOM   9597  O  O   . GLN D 1 129 ? 106.323 55.562 119.259 1.00 14.13 ? 147  GLN J O   1 
ATOM   9598  C  CB  . GLN D 1 129 ? 108.309 53.730 117.571 1.00 13.81 ? 147  GLN J CB  1 
ATOM   9599  C  CG  . GLN D 1 129 ? 109.683 54.218 118.034 1.00 14.32 ? 147  GLN J CG  1 
ATOM   9600  C  CD  . GLN D 1 129 ? 110.591 53.058 118.410 1.00 15.92 ? 147  GLN J CD  1 
ATOM   9601  O  OE1 . GLN D 1 129 ? 111.304 52.507 117.556 1.00 16.36 ? 147  GLN J OE1 1 
ATOM   9602  N  NE2 . GLN D 1 129 ? 110.555 52.663 119.685 1.00 12.69 ? 147  GLN J NE2 1 
ATOM   9603  N  N   . GLU D 1 130 ? 107.761 56.975 118.281 1.00 13.64 ? 148  GLU J N   1 
ATOM   9604  C  CA  . GLU D 1 130 ? 107.554 58.039 119.272 1.00 13.34 ? 148  GLU J CA  1 
ATOM   9605  C  C   . GLU D 1 130 ? 106.133 58.631 119.253 1.00 13.16 ? 148  GLU J C   1 
ATOM   9606  O  O   . GLU D 1 130 ? 105.750 59.350 120.181 1.00 12.80 ? 148  GLU J O   1 
ATOM   9607  C  CB  . GLU D 1 130 ? 108.600 59.153 119.114 1.00 13.45 ? 148  GLU J CB  1 
ATOM   9608  C  CG  . GLU D 1 130 ? 110.035 58.732 119.442 1.00 13.83 ? 148  GLU J CG  1 
ATOM   9609  C  CD  . GLU D 1 130 ? 110.132 57.932 120.732 1.00 14.96 ? 148  GLU J CD  1 
ATOM   9610  O  OE1 . GLU D 1 130 ? 109.585 58.374 121.768 1.00 14.58 ? 148  GLU J OE1 1 
ATOM   9611  O  OE2 . GLU D 1 130 ? 110.751 56.851 120.704 1.00 16.23 ? 148  GLU J OE2 1 
ATOM   9612  N  N   . TRP D 1 131 ? 105.377 58.331 118.191 1.00 12.90 ? 149  TRP J N   1 
ATOM   9613  C  CA  . TRP D 1 131 ? 103.965 58.713 118.073 1.00 12.72 ? 149  TRP J CA  1 
ATOM   9614  C  C   . TRP D 1 131 ? 103.030 57.783 118.855 1.00 12.68 ? 149  TRP J C   1 
ATOM   9615  O  O   . TRP D 1 131 ? 101.874 58.137 119.090 1.00 12.77 ? 149  TRP J O   1 
ATOM   9616  C  CB  . TRP D 1 131 ? 103.516 58.770 116.607 1.00 12.45 ? 149  TRP J CB  1 
ATOM   9617  C  CG  . TRP D 1 131 ? 104.067 59.933 115.809 1.00 12.44 ? 149  TRP J CG  1 
ATOM   9618  C  CD1 . TRP D 1 131 ? 105.230 59.957 115.086 1.00 12.10 ? 149  TRP J CD1 1 
ATOM   9619  C  CD2 . TRP D 1 131 ? 103.458 61.220 115.630 1.00 12.77 ? 149  TRP J CD2 1 
ATOM   9620  N  NE1 . TRP D 1 131 ? 105.386 61.185 114.475 1.00 12.12 ? 149  TRP J NE1 1 
ATOM   9621  C  CE2 . TRP D 1 131 ? 104.316 61.979 114.797 1.00 12.39 ? 149  TRP J CE2 1 
ATOM   9622  C  CE3 . TRP D 1 131 ? 102.268 61.807 116.091 1.00 12.93 ? 149  TRP J CE3 1 
ATOM   9623  C  CZ2 . TRP D 1 131 ? 104.027 63.292 114.423 1.00 12.40 ? 149  TRP J CZ2 1 
ATOM   9624  C  CZ3 . TRP D 1 131 ? 101.983 63.113 115.721 1.00 11.97 ? 149  TRP J CZ3 1 
ATOM   9625  C  CH2 . TRP D 1 131 ? 102.859 63.841 114.893 1.00 12.97 ? 149  TRP J CH2 1 
ATOM   9626  N  N   . VAL D 1 132 ? 103.515 56.595 119.228 1.00 12.72 ? 150  VAL J N   1 
ATOM   9627  C  CA  . VAL D 1 132 ? 102.771 55.694 120.115 1.00 12.67 ? 150  VAL J CA  1 
ATOM   9628  C  C   . VAL D 1 132 ? 102.737 56.383 121.483 1.00 13.31 ? 150  VAL J C   1 
ATOM   9629  O  O   . VAL D 1 132 ? 103.784 56.564 122.098 1.00 12.80 ? 150  VAL J O   1 
ATOM   9630  C  CB  . VAL D 1 132 ? 103.419 54.279 120.219 1.00 13.01 ? 150  VAL J CB  1 
ATOM   9631  C  CG1 . VAL D 1 132 ? 102.529 53.333 121.011 1.00 11.99 ? 150  VAL J CG1 1 
ATOM   9632  C  CG2 . VAL D 1 132 ? 103.691 53.686 118.833 1.00 11.87 ? 150  VAL J CG2 1 
ATOM   9633  N  N   . PRO D 1 133 ? 101.542 56.820 121.941 1.00 13.52 ? 151  PRO J N   1 
ATOM   9634  C  CA  . PRO D 1 133 ? 101.503 57.699 123.119 1.00 13.96 ? 151  PRO J CA  1 
ATOM   9635  C  C   . PRO D 1 133 ? 102.118 57.130 124.405 1.00 14.34 ? 151  PRO J C   1 
ATOM   9636  O  O   . PRO D 1 133 ? 102.031 55.917 124.672 1.00 14.21 ? 151  PRO J O   1 
ATOM   9637  C  CB  . PRO D 1 133 ? 100.004 57.986 123.301 1.00 14.18 ? 151  PRO J CB  1 
ATOM   9638  C  CG  . PRO D 1 133 ? 99.405  57.740 121.946 1.00 13.68 ? 151  PRO J CG  1 
ATOM   9639  C  CD  . PRO D 1 133 ? 100.194 56.574 121.406 1.00 13.54 ? 151  PRO J CD  1 
ATOM   9640  N  N   . TYR D 1 134 ? 102.752 58.018 125.171 1.00 14.46 ? 152  TYR J N   1 
ATOM   9641  C  CA  . TYR D 1 134 ? 103.252 57.702 126.500 1.00 14.87 ? 152  TYR J CA  1 
ATOM   9642  C  C   . TYR D 1 134 ? 102.098 57.864 127.497 1.00 15.59 ? 152  TYR J C   1 
ATOM   9643  O  O   . TYR D 1 134 ? 102.006 58.852 128.234 1.00 15.44 ? 152  TYR J O   1 
ATOM   9644  C  CB  . TYR D 1 134 ? 104.465 58.583 126.852 1.00 14.77 ? 152  TYR J CB  1 
ATOM   9645  C  CG  . TYR D 1 134 ? 105.723 58.224 126.083 1.00 13.10 ? 152  TYR J CG  1 
ATOM   9646  C  CD1 . TYR D 1 134 ? 105.962 58.755 124.818 1.00 11.49 ? 152  TYR J CD1 1 
ATOM   9647  C  CD2 . TYR D 1 134 ? 106.674 57.350 126.626 1.00 12.76 ? 152  TYR J CD2 1 
ATOM   9648  C  CE1 . TYR D 1 134 ? 107.110 58.425 124.096 1.00 12.01 ? 152  TYR J CE1 1 
ATOM   9649  C  CE2 . TYR D 1 134 ? 107.831 57.013 125.914 1.00 12.11 ? 152  TYR J CE2 1 
ATOM   9650  C  CZ  . TYR D 1 134 ? 108.038 57.559 124.649 1.00 12.04 ? 152  TYR J CZ  1 
ATOM   9651  O  OH  . TYR D 1 134 ? 109.171 57.240 123.936 1.00 13.44 ? 152  TYR J OH  1 
ATOM   9652  N  N   . SER D 1 135 ? 101.211 56.872 127.478 1.00 16.48 ? 153  SER J N   1 
ATOM   9653  C  CA  . SER D 1 135 ? 99.962  56.869 128.233 1.00 17.53 ? 153  SER J CA  1 
ATOM   9654  C  C   . SER D 1 135 ? 99.424  55.447 128.218 1.00 18.04 ? 153  SER J C   1 
ATOM   9655  O  O   . SER D 1 135 ? 99.465  54.778 127.186 1.00 18.69 ? 153  SER J O   1 
ATOM   9656  C  CB  . SER D 1 135 ? 98.942  57.811 127.583 1.00 17.47 ? 153  SER J CB  1 
ATOM   9657  O  OG  . SER D 1 135 ? 97.662  57.683 128.187 1.00 18.90 ? 153  SER J OG  1 
ATOM   9658  N  N   . THR D 1 136 ? 98.918  54.985 129.355 1.00 18.41 ? 154  THR J N   1 
ATOM   9659  C  CA  . THR D 1 136 ? 98.317  53.661 129.434 1.00 18.76 ? 154  THR J CA  1 
ATOM   9660  C  C   . THR D 1 136 ? 96.835  53.678 129.068 1.00 18.61 ? 154  THR J C   1 
ATOM   9661  O  O   . THR D 1 136 ? 96.152  52.661 129.185 1.00 18.55 ? 154  THR J O   1 
ATOM   9662  C  CB  . THR D 1 136 ? 98.480  53.051 130.833 1.00 19.12 ? 154  THR J CB  1 
ATOM   9663  O  OG1 . THR D 1 136 ? 98.311  54.083 131.813 1.00 19.70 ? 154  THR J OG1 1 
ATOM   9664  C  CG2 . THR D 1 136 ? 99.868  52.402 130.978 1.00 19.45 ? 154  THR J CG2 1 
ATOM   9665  N  N   . SER D 1 137 ? 96.340  54.830 128.624 1.00 18.67 ? 155  SER J N   1 
ATOM   9666  C  CA  . SER D 1 137 ? 94.964  54.925 128.147 1.00 18.94 ? 155  SER J CA  1 
ATOM   9667  C  C   . SER D 1 137 ? 94.881  55.391 126.683 1.00 18.48 ? 155  SER J C   1 
ATOM   9668  O  O   . SER D 1 137 ? 93.792  55.492 126.115 1.00 19.23 ? 155  SER J O   1 
ATOM   9669  C  CB  . SER D 1 137 ? 94.144  55.825 129.070 1.00 19.00 ? 155  SER J CB  1 
ATOM   9670  O  OG  . SER D 1 137 ? 94.535  57.182 128.924 1.00 21.81 ? 155  SER J OG  1 
ATOM   9671  N  N   . ALA D 1 138 ? 96.033  55.660 126.077 1.00 17.68 ? 156  ALA J N   1 
ATOM   9672  C  CA  . ALA D 1 138 ? 96.106  56.046 124.666 1.00 16.75 ? 156  ALA J CA  1 
ATOM   9673  C  C   . ALA D 1 138 ? 96.959  55.068 123.839 1.00 16.08 ? 156  ALA J C   1 
ATOM   9674  O  O   . ALA D 1 138 ? 97.775  54.319 124.387 1.00 15.92 ? 156  ALA J O   1 
ATOM   9675  C  CB  . ALA D 1 138 ? 96.619  57.470 124.535 1.00 16.62 ? 156  ALA J CB  1 
ATOM   9676  N  N   . SER D 1 139 ? 96.751  55.065 122.524 1.00 15.19 ? 157  SER J N   1 
ATOM   9677  C  CA  . SER D 1 139 ? 97.439  54.126 121.633 1.00 14.42 ? 157  SER J CA  1 
ATOM   9678  C  C   . SER D 1 139 ? 97.632  54.718 120.235 1.00 13.93 ? 157  SER J C   1 
ATOM   9679  O  O   . SER D 1 139 ? 97.200  55.841 119.963 1.00 13.75 ? 157  SER J O   1 
ATOM   9680  C  CB  . SER D 1 139 ? 96.672  52.798 121.561 1.00 14.23 ? 157  SER J CB  1 
ATOM   9681  O  OG  . SER D 1 139 ? 95.433  52.968 120.902 1.00 14.12 ? 157  SER J OG  1 
ATOM   9682  N  N   . LEU D 1 140 ? 98.305  53.974 119.360 1.00 13.27 ? 158  LEU J N   1 
ATOM   9683  C  CA  . LEU D 1 140 ? 98.476  54.406 117.973 1.00 12.53 ? 158  LEU J CA  1 
ATOM   9684  C  C   . LEU D 1 140 ? 97.582  53.585 117.053 1.00 12.00 ? 158  LEU J C   1 
ATOM   9685  O  O   . LEU D 1 140 ? 97.767  52.374 116.903 1.00 11.74 ? 158  LEU J O   1 
ATOM   9686  C  CB  . LEU D 1 140 ? 99.945  54.327 117.526 1.00 12.34 ? 158  LEU J CB  1 
ATOM   9687  C  CG  . LEU D 1 140 ? 100.307 54.904 116.140 1.00 12.47 ? 158  LEU J CG  1 
ATOM   9688  C  CD1 . LEU D 1 140 ? 100.018 56.393 116.061 1.00 11.53 ? 158  LEU J CD1 1 
ATOM   9689  C  CD2 . LEU D 1 140 ? 101.778 54.646 115.780 1.00 11.72 ? 158  LEU J CD2 1 
ATOM   9690  N  N   . TYR D 1 141 ? 96.608  54.254 116.445 1.00 11.67 ? 159  TYR J N   1 
ATOM   9691  C  CA  . TYR D 1 141 ? 95.708  53.598 115.501 1.00 11.39 ? 159  TYR J CA  1 
ATOM   9692  C  C   . TYR D 1 141 ? 96.390  53.450 114.144 1.00 11.10 ? 159  TYR J C   1 
ATOM   9693  O  O   . TYR D 1 141 ? 96.992  54.401 113.631 1.00 10.65 ? 159  TYR J O   1 
ATOM   9694  C  CB  . TYR D 1 141 ? 94.388  54.369 115.377 1.00 11.12 ? 159  TYR J CB  1 
ATOM   9695  C  CG  . TYR D 1 141 ? 93.334  53.691 114.532 1.00 11.80 ? 159  TYR J CG  1 
ATOM   9696  C  CD1 . TYR D 1 141 ? 92.605  52.606 115.023 1.00 11.08 ? 159  TYR J CD1 1 
ATOM   9697  C  CD2 . TYR D 1 141 ? 93.061  54.141 113.233 1.00 12.24 ? 159  TYR J CD2 1 
ATOM   9698  C  CE1 . TYR D 1 141 ? 91.634  51.980 114.237 1.00 11.58 ? 159  TYR J CE1 1 
ATOM   9699  C  CE2 . TYR D 1 141 ? 92.095  53.528 112.449 1.00 10.72 ? 159  TYR J CE2 1 
ATOM   9700  C  CZ  . TYR D 1 141 ? 91.384  52.454 112.954 1.00 11.31 ? 159  TYR J CZ  1 
ATOM   9701  O  OH  . TYR D 1 141 ? 90.422  51.858 112.171 1.00 10.95 ? 159  TYR J OH  1 
ATOM   9702  N  N   . ILE D 1 142 ? 96.284  52.242 113.592 1.00 11.00 ? 160  ILE J N   1 
ATOM   9703  C  CA  . ILE D 1 142 ? 96.885  51.863 112.318 1.00 10.75 ? 160  ILE J CA  1 
ATOM   9704  C  C   . ILE D 1 142 ? 95.762  51.638 111.302 1.00 10.80 ? 160  ILE J C   1 
ATOM   9705  O  O   . ILE D 1 142 ? 94.865  50.819 111.534 1.00 10.43 ? 160  ILE J O   1 
ATOM   9706  C  CB  . ILE D 1 142 ? 97.734  50.561 112.456 1.00 10.86 ? 160  ILE J CB  1 
ATOM   9707  C  CG1 . ILE D 1 142 ? 98.734  50.685 113.620 1.00 10.86 ? 160  ILE J CG1 1 
ATOM   9708  C  CG2 . ILE D 1 142 ? 98.439  50.202 111.120 1.00 9.69  ? 160  ILE J CG2 1 
ATOM   9709  C  CD1 . ILE D 1 142 ? 99.451  49.393 113.970 1.00 9.31  ? 160  ILE J CD1 1 
ATOM   9710  N  N   . ARG D 1 143 ? 95.809  52.390 110.197 1.00 10.64 ? 161  ARG J N   1 
ATOM   9711  C  CA  . ARG D 1 143 ? 94.770  52.346 109.159 1.00 10.40 ? 161  ARG J CA  1 
ATOM   9712  C  C   . ARG D 1 143 ? 95.340  51.893 107.806 1.00 10.25 ? 161  ARG J C   1 
ATOM   9713  O  O   . ARG D 1 143 ? 95.700  52.719 106.970 1.00 10.43 ? 161  ARG J O   1 
ATOM   9714  C  CB  . ARG D 1 143 ? 94.060  53.715 109.054 1.00 10.58 ? 161  ARG J CB  1 
ATOM   9715  C  CG  . ARG D 1 143 ? 93.053  53.928 107.864 1.00 9.39  ? 161  ARG J CG  1 
ATOM   9716  C  CD  . ARG D 1 143 ? 92.012  52.809 107.694 1.00 8.27  ? 161  ARG J CD  1 
ATOM   9717  N  NE  . ARG D 1 143 ? 91.111  52.702 108.844 1.00 8.64  ? 161  ARG J NE  1 
ATOM   9718  C  CZ  . ARG D 1 143 ? 89.945  53.340 108.959 1.00 8.35  ? 161  ARG J CZ  1 
ATOM   9719  N  NH1 . ARG D 1 143 ? 89.513  54.134 107.986 1.00 6.89  ? 161  ARG J NH1 1 
ATOM   9720  N  NH2 . ARG D 1 143 ? 89.206  53.180 110.051 1.00 7.15  ? 161  ARG J NH2 1 
ATOM   9721  N  N   . PRO D 1 144 ? 95.437  50.570 107.595 1.00 10.37 ? 162  PRO J N   1 
ATOM   9722  C  CA  . PRO D 1 144 ? 95.789  50.109 106.261 1.00 10.33 ? 162  PRO J CA  1 
ATOM   9723  C  C   . PRO D 1 144 ? 94.593  50.272 105.331 1.00 10.53 ? 162  PRO J C   1 
ATOM   9724  O  O   . PRO D 1 144 ? 93.460  49.935 105.690 1.00 10.15 ? 162  PRO J O   1 
ATOM   9725  C  CB  . PRO D 1 144 ? 96.122  48.625 106.464 1.00 10.18 ? 162  PRO J CB  1 
ATOM   9726  C  CG  . PRO D 1 144 ? 96.123  48.398 107.963 1.00 10.16 ? 162  PRO J CG  1 
ATOM   9727  C  CD  . PRO D 1 144 ? 95.239  49.447 108.528 1.00 9.87  ? 162  PRO J CD  1 
ATOM   9728  N  N   . ALA D 1 145 ? 94.858  50.806 104.146 1.00 10.85 ? 163  ALA J N   1 
ATOM   9729  C  CA  . ALA D 1 145 ? 93.814  51.128 103.195 1.00 10.84 ? 163  ALA J CA  1 
ATOM   9730  C  C   . ALA D 1 145 ? 94.228  50.669 101.795 1.00 10.86 ? 163  ALA J C   1 
ATOM   9731  O  O   . ALA D 1 145 ? 95.401  50.735 101.429 1.00 10.33 ? 163  ALA J O   1 
ATOM   9732  C  CB  . ALA D 1 145 ? 93.503  52.632 103.243 1.00 10.96 ? 163  ALA J CB  1 
ATOM   9733  N  N   . PHE D 1 146 ? 93.255  50.182 101.028 1.00 11.22 ? 164  PHE J N   1 
ATOM   9734  C  CA  . PHE D 1 146 ? 93.530  49.502 99.761  1.00 11.10 ? 164  PHE J CA  1 
ATOM   9735  C  C   . PHE D 1 146 ? 92.496  49.986 98.749  1.00 11.34 ? 164  PHE J C   1 
ATOM   9736  O  O   . PHE D 1 146 ? 91.306  49.684 98.878  1.00 11.46 ? 164  PHE J O   1 
ATOM   9737  C  CB  . PHE D 1 146 ? 93.422  47.982 99.983  1.00 10.62 ? 164  PHE J CB  1 
ATOM   9738  C  CG  . PHE D 1 146 ? 94.157  47.128 98.964  1.00 10.28 ? 164  PHE J CG  1 
ATOM   9739  C  CD1 . PHE D 1 146 ? 94.810  47.687 97.864  1.00 8.37  ? 164  PHE J CD1 1 
ATOM   9740  C  CD2 . PHE D 1 146 ? 94.168  45.740 99.112  1.00 9.45  ? 164  PHE J CD2 1 
ATOM   9741  C  CE1 . PHE D 1 146 ? 95.473  46.877 96.936  1.00 9.45  ? 164  PHE J CE1 1 
ATOM   9742  C  CE2 . PHE D 1 146 ? 94.832  44.921 98.193  1.00 9.17  ? 164  PHE J CE2 1 
ATOM   9743  C  CZ  . PHE D 1 146 ? 95.480  45.487 97.102  1.00 8.32  ? 164  PHE J CZ  1 
ATOM   9744  N  N   . ILE D 1 147 ? 92.946  50.753 97.757  1.00 11.46 ? 165  ILE J N   1 
ATOM   9745  C  CA  . ILE D 1 147 ? 92.035  51.404 96.799  1.00 11.33 ? 165  ILE J CA  1 
ATOM   9746  C  C   . ILE D 1 147 ? 92.299  51.030 95.331  1.00 11.86 ? 165  ILE J C   1 
ATOM   9747  O  O   . ILE D 1 147 ? 93.447  50.821 94.924  1.00 11.82 ? 165  ILE J O   1 
ATOM   9748  C  CB  . ILE D 1 147 ? 92.049  52.962 96.944  1.00 11.03 ? 165  ILE J CB  1 
ATOM   9749  C  CG1 . ILE D 1 147 ? 93.457  53.532 96.687  1.00 10.55 ? 165  ILE J CG1 1 
ATOM   9750  C  CG2 . ILE D 1 147 ? 91.489  53.394 98.324  1.00 10.26 ? 165  ILE J CG2 1 
ATOM   9751  C  CD1 . ILE D 1 147 ? 93.515  55.042 96.515  1.00 11.04 ? 165  ILE J CD1 1 
ATOM   9752  N  N   . GLY D 1 148 ? 91.228  50.953 94.543  1.00 12.11 ? 166  GLY J N   1 
ATOM   9753  C  CA  . GLY D 1 148 ? 91.362  50.790 93.096  1.00 12.96 ? 166  GLY J CA  1 
ATOM   9754  C  C   . GLY D 1 148 ? 91.697  52.137 92.481  1.00 13.26 ? 166  GLY J C   1 
ATOM   9755  O  O   . GLY D 1 148 ? 91.042  53.131 92.779  1.00 13.19 ? 166  GLY J O   1 
ATOM   9756  N  N   . THR D 1 149 ? 92.726  52.175 91.637  1.00 13.95 ? 167  THR J N   1 
ATOM   9757  C  CA  . THR D 1 149 ? 93.157  53.428 91.001  1.00 14.68 ? 167  THR J CA  1 
ATOM   9758  C  C   . THR D 1 149 ? 93.067  53.345 89.472  1.00 15.65 ? 167  THR J C   1 
ATOM   9759  O  O   . THR D 1 149 ? 93.624  54.171 88.757  1.00 15.65 ? 167  THR J O   1 
ATOM   9760  C  CB  . THR D 1 149 ? 94.573  53.830 91.440  1.00 14.54 ? 167  THR J CB  1 
ATOM   9761  O  OG1 . THR D 1 149 ? 95.462  52.732 91.227  1.00 14.54 ? 167  THR J OG1 1 
ATOM   9762  C  CG2 . THR D 1 149 ? 94.598  54.210 92.928  1.00 13.99 ? 167  THR J CG2 1 
ATOM   9763  N  N   . GLU D 1 150 ? 92.359  52.319 89.004  1.00 17.01 ? 168  GLU J N   1 
ATOM   9764  C  CA  . GLU D 1 150 ? 91.963  52.137 87.609  1.00 18.32 ? 168  GLU J CA  1 
ATOM   9765  C  C   . GLU D 1 150 ? 91.398  53.437 87.000  1.00 18.29 ? 168  GLU J C   1 
ATOM   9766  O  O   . GLU D 1 150 ? 90.356  53.909 87.443  1.00 18.48 ? 168  GLU J O   1 
ATOM   9767  C  CB  . GLU D 1 150 ? 90.902  51.022 87.558  1.00 18.51 ? 168  GLU J CB  1 
ATOM   9768  C  CG  . GLU D 1 150 ? 90.281  50.768 86.193  1.00 20.95 ? 168  GLU J CG  1 
ATOM   9769  C  CD  . GLU D 1 150 ? 91.277  50.190 85.217  1.00 23.98 ? 168  GLU J CD  1 
ATOM   9770  O  OE1 . GLU D 1 150 ? 91.339  50.660 84.060  1.00 25.98 ? 168  GLU J OE1 1 
ATOM   9771  O  OE2 . GLU D 1 150 ? 92.012  49.271 85.620  1.00 25.22 ? 168  GLU J OE2 1 
ATOM   9772  N  N   . PRO D 1 151 ? 92.087  54.018 85.992  1.00 18.48 ? 169  PRO J N   1 
ATOM   9773  C  CA  . PRO D 1 151 ? 91.627  55.277 85.379  1.00 18.83 ? 169  PRO J CA  1 
ATOM   9774  C  C   . PRO D 1 151 ? 90.402  55.192 84.442  1.00 19.19 ? 169  PRO J C   1 
ATOM   9775  O  O   . PRO D 1 151 ? 89.738  56.209 84.222  1.00 20.04 ? 169  PRO J O   1 
ATOM   9776  C  CB  . PRO D 1 151 ? 92.862  55.781 84.617  1.00 18.84 ? 169  PRO J CB  1 
ATOM   9777  C  CG  . PRO D 1 151 ? 93.706  54.599 84.387  1.00 18.26 ? 169  PRO J CG  1 
ATOM   9778  C  CD  . PRO D 1 151 ? 93.347  53.537 85.393  1.00 18.63 ? 169  PRO J CD  1 
ATOM   9779  N  N   . SER D 1 152 ? 90.086  54.013 83.908  1.00 19.23 ? 170  SER J N   1 
ATOM   9780  C  CA  . SER D 1 152 ? 88.934  53.884 83.006  1.00 19.34 ? 170  SER J CA  1 
ATOM   9781  C  C   . SER D 1 152 ? 87.599  53.760 83.742  1.00 19.12 ? 170  SER J C   1 
ATOM   9782  O  O   . SER D 1 152 ? 87.551  53.306 84.878  1.00 19.63 ? 170  SER J O   1 
ATOM   9783  C  CB  . SER D 1 152 ? 89.129  52.752 81.990  1.00 19.36 ? 170  SER J CB  1 
ATOM   9784  O  OG  . SER D 1 152 ? 89.339  51.512 82.627  1.00 20.47 ? 170  SER J OG  1 
ATOM   9785  N  N   . LEU D 1 153 ? 86.519  54.164 83.079  1.00 18.97 ? 171  LEU J N   1 
ATOM   9786  C  CA  . LEU D 1 153 ? 85.195  54.260 83.711  1.00 18.94 ? 171  LEU J CA  1 
ATOM   9787  C  C   . LEU D 1 153 ? 84.327  52.995 83.632  1.00 18.98 ? 171  LEU J C   1 
ATOM   9788  O  O   . LEU D 1 153 ? 83.263  52.943 84.231  1.00 19.19 ? 171  LEU J O   1 
ATOM   9789  C  CB  . LEU D 1 153 ? 84.420  55.480 83.168  1.00 18.67 ? 171  LEU J CB  1 
ATOM   9790  C  CG  . LEU D 1 153 ? 85.034  56.882 83.322  1.00 18.64 ? 171  LEU J CG  1 
ATOM   9791  C  CD1 . LEU D 1 153 ? 84.176  57.935 82.626  1.00 18.33 ? 171  LEU J CD1 1 
ATOM   9792  C  CD2 . LEU D 1 153 ? 85.270  57.268 84.791  1.00 17.53 ? 171  LEU J CD2 1 
ATOM   9793  N  N   . GLY D 1 154 ? 84.773  51.976 82.903  1.00 19.20 ? 172  GLY J N   1 
ATOM   9794  C  CA  . GLY D 1 154 ? 84.072  50.687 82.896  1.00 19.34 ? 172  GLY J CA  1 
ATOM   9795  C  C   . GLY D 1 154 ? 84.093  50.043 84.273  1.00 19.52 ? 172  GLY J C   1 
ATOM   9796  O  O   . GLY D 1 154 ? 85.072  50.183 85.008  1.00 19.14 ? 172  GLY J O   1 
ATOM   9797  N  N   . VAL D 1 155 ? 83.002  49.361 84.629  1.00 19.57 ? 173  VAL J N   1 
ATOM   9798  C  CA  . VAL D 1 155 ? 82.878  48.712 85.932  1.00 19.48 ? 173  VAL J CA  1 
ATOM   9799  C  C   . VAL D 1 155 ? 83.526  47.335 85.839  1.00 19.85 ? 173  VAL J C   1 
ATOM   9800  O  O   . VAL D 1 155 ? 82.928  46.397 85.309  1.00 20.51 ? 173  VAL J O   1 
ATOM   9801  C  CB  . VAL D 1 155 ? 81.396  48.571 86.391  1.00 19.63 ? 173  VAL J CB  1 
ATOM   9802  C  CG1 . VAL D 1 155 ? 81.326  48.179 87.867  1.00 18.99 ? 173  VAL J CG1 1 
ATOM   9803  C  CG2 . VAL D 1 155 ? 80.628  49.854 86.148  1.00 18.10 ? 173  VAL J CG2 1 
ATOM   9804  N  N   . LYS D 1 156 ? 84.748  47.224 86.353  1.00 19.40 ? 174  LYS J N   1 
ATOM   9805  C  CA  . LYS D 1 156 ? 85.574  46.044 86.126  1.00 19.47 ? 174  LYS J CA  1 
ATOM   9806  C  C   . LYS D 1 156 ? 86.631  45.881 87.216  1.00 19.05 ? 174  LYS J C   1 
ATOM   9807  O  O   . LYS D 1 156 ? 86.960  46.836 87.925  1.00 18.90 ? 174  LYS J O   1 
ATOM   9808  C  CB  . LYS D 1 156 ? 86.267  46.143 84.756  1.00 19.60 ? 174  LYS J CB  1 
ATOM   9809  C  CG  . LYS D 1 156 ? 87.485  47.080 84.761  1.00 21.33 ? 174  LYS J CG  1 
ATOM   9810  C  CD  . LYS D 1 156 ? 88.050  47.364 83.367  1.00 24.37 ? 174  LYS J CD  1 
ATOM   9811  C  CE  . LYS D 1 156 ? 87.540  48.692 82.822  1.00 24.68 ? 174  LYS J CE  1 
ATOM   9812  N  NZ  . LYS D 1 156 ? 87.646  49.766 83.856  1.00 24.67 ? 174  LYS J NZ  1 
ATOM   9813  N  N   . LYS D 1 157 ? 87.160  44.664 87.332  1.00 18.82 ? 175  LYS J N   1 
ATOM   9814  C  CA  . LYS D 1 157 ? 88.324  44.381 88.164  1.00 18.55 ? 175  LYS J CA  1 
ATOM   9815  C  C   . LYS D 1 157 ? 89.424  45.388 87.819  1.00 18.07 ? 175  LYS J C   1 
ATOM   9816  O  O   . LYS D 1 157 ? 89.778  45.535 86.642  1.00 17.99 ? 175  LYS J O   1 
ATOM   9817  C  CB  . LYS D 1 157 ? 88.813  42.952 87.912  1.00 18.44 ? 175  LYS J CB  1 
ATOM   9818  C  CG  . LYS D 1 157 ? 89.897  42.475 88.856  1.00 19.65 ? 175  LYS J CG  1 
ATOM   9819  C  CD  . LYS D 1 157 ? 90.406  41.091 88.448  1.00 21.99 ? 175  LYS J CD  1 
ATOM   9820  C  CE  . LYS D 1 157 ? 91.073  40.372 89.601  1.00 24.29 ? 175  LYS J CE  1 
ATOM   9821  N  NZ  . LYS D 1 157 ? 91.319  38.932 89.254  1.00 26.20 ? 175  LYS J NZ  1 
ATOM   9822  N  N   . PRO D 1 158 ? 89.951  46.098 88.836  1.00 17.46 ? 176  PRO J N   1 
ATOM   9823  C  CA  . PRO D 1 158 ? 90.971  47.117 88.592  1.00 17.04 ? 176  PRO J CA  1 
ATOM   9824  C  C   . PRO D 1 158 ? 92.287  46.535 88.067  1.00 16.86 ? 176  PRO J C   1 
ATOM   9825  O  O   . PRO D 1 158 ? 92.677  45.438 88.457  1.00 16.70 ? 176  PRO J O   1 
ATOM   9826  C  CB  . PRO D 1 158 ? 91.171  47.759 89.975  1.00 17.21 ? 176  PRO J CB  1 
ATOM   9827  C  CG  . PRO D 1 158 ? 90.716  46.724 90.952  1.00 16.83 ? 176  PRO J CG  1 
ATOM   9828  C  CD  . PRO D 1 158 ? 89.601  45.991 90.266  1.00 17.55 ? 176  PRO J CD  1 
ATOM   9829  N  N   . THR D 1 159 ? 92.941  47.277 87.174  1.00 16.63 ? 177  THR J N   1 
ATOM   9830  C  CA  . THR D 1 159 ? 94.247  46.908 86.618  1.00 16.54 ? 177  THR J CA  1 
ATOM   9831  C  C   . THR D 1 159 ? 95.319  47.797 87.241  1.00 16.56 ? 177  THR J C   1 
ATOM   9832  O  O   . THR D 1 159 ? 96.493  47.713 86.892  1.00 16.43 ? 177  THR J O   1 
ATOM   9833  C  CB  . THR D 1 159 ? 94.293  47.066 85.073  1.00 16.13 ? 177  THR J CB  1 
ATOM   9834  O  OG1 . THR D 1 159 ? 94.103  48.442 84.725  1.00 16.30 ? 177  THR J OG1 1 
ATOM   9835  C  CG2 . THR D 1 159 ? 93.222  46.233 84.402  1.00 16.55 ? 177  THR J CG2 1 
ATOM   9836  N  N   . LYS D 1 160 ? 94.888  48.662 88.156  1.00 16.76 ? 178  LYS J N   1 
ATOM   9837  C  CA  . LYS D 1 160 ? 95.775  49.552 88.880  1.00 17.07 ? 178  LYS J CA  1 
ATOM   9838  C  C   . LYS D 1 160 ? 95.225  49.737 90.299  1.00 16.58 ? 178  LYS J C   1 
ATOM   9839  O  O   . LYS D 1 160 ? 94.025  49.950 90.485  1.00 16.65 ? 178  LYS J O   1 
ATOM   9840  C  CB  . LYS D 1 160 ? 95.923  50.886 88.129  1.00 17.61 ? 178  LYS J CB  1 
ATOM   9841  C  CG  . LYS D 1 160 ? 96.980  51.803 88.705  1.00 20.32 ? 178  LYS J CG  1 
ATOM   9842  C  CD  . LYS D 1 160 ? 97.307  53.001 87.805  1.00 23.68 ? 178  LYS J CD  1 
ATOM   9843  C  CE  . LYS D 1 160 ? 98.112  54.046 88.592  1.00 24.68 ? 178  LYS J CE  1 
ATOM   9844  N  NZ  . LYS D 1 160 ? 99.374  54.442 87.878  1.00 27.03 ? 178  LYS J NZ  1 
ATOM   9845  N  N   . ALA D 1 161 ? 96.098  49.614 91.295  1.00 16.01 ? 179  ALA J N   1 
ATOM   9846  C  CA  . ALA D 1 161 ? 95.690  49.737 92.696  1.00 15.76 ? 179  ALA J CA  1 
ATOM   9847  C  C   . ALA D 1 161 ? 96.768  50.360 93.575  1.00 15.34 ? 179  ALA J C   1 
ATOM   9848  O  O   . ALA D 1 161 ? 97.943  50.385 93.217  1.00 15.24 ? 179  ALA J O   1 
ATOM   9849  C  CB  . ALA D 1 161 ? 95.250  48.376 93.263  1.00 15.62 ? 179  ALA J CB  1 
ATOM   9850  N  N   . LEU D 1 162 ? 96.347  50.867 94.731  1.00 15.10 ? 180  LEU J N   1 
ATOM   9851  C  CA  . LEU D 1 162 ? 97.254  51.439 95.713  1.00 14.70 ? 180  LEU J CA  1 
ATOM   9852  C  C   . LEU D 1 162 ? 96.907  50.890 97.090  1.00 14.18 ? 180  LEU J C   1 
ATOM   9853  O  O   . LEU D 1 162 ? 95.773  51.031 97.545  1.00 14.01 ? 180  LEU J O   1 
ATOM   9854  C  CB  . LEU D 1 162 ? 97.109  52.965 95.730  1.00 14.85 ? 180  LEU J CB  1 
ATOM   9855  C  CG  . LEU D 1 162 ? 98.196  53.934 96.206  1.00 15.48 ? 180  LEU J CG  1 
ATOM   9856  C  CD1 . LEU D 1 162 ? 97.551  55.074 96.972  1.00 16.09 ? 180  LEU J CD1 1 
ATOM   9857  C  CD2 . LEU D 1 162 ? 99.332  53.321 97.022  1.00 15.63 ? 180  LEU J CD2 1 
ATOM   9858  N  N   . LEU D 1 163 ? 97.886  50.270 97.749  1.00 13.63 ? 181  LEU J N   1 
ATOM   9859  C  CA  . LEU D 1 163 ? 97.756  49.907 99.160  1.00 12.78 ? 181  LEU J CA  1 
ATOM   9860  C  C   . LEU D 1 163 ? 98.533  50.951 99.955  1.00 12.53 ? 181  LEU J C   1 
ATOM   9861  O  O   . LEU D 1 163 ? 99.680  51.233 99.640  1.00 12.50 ? 181  LEU J O   1 
ATOM   9862  C  CB  . LEU D 1 163 ? 98.301  48.498 99.425  1.00 12.61 ? 181  LEU J CB  1 
ATOM   9863  C  CG  . LEU D 1 163 ? 97.870  47.781 100.713 1.00 12.52 ? 181  LEU J CG  1 
ATOM   9864  C  CD1 . LEU D 1 163 ? 97.983  46.270 100.548 1.00 12.73 ? 181  LEU J CD1 1 
ATOM   9865  C  CD2 . LEU D 1 163 ? 98.678  48.249 101.928 1.00 12.64 ? 181  LEU J CD2 1 
ATOM   9866  N  N   . PHE D 1 164 ? 97.901  51.548 100.960 1.00 11.93 ? 182  PHE J N   1 
ATOM   9867  C  CA  . PHE D 1 164 ? 98.592  52.512 101.807 1.00 11.58 ? 182  PHE J CA  1 
ATOM   9868  C  C   . PHE D 1 164 ? 98.249  52.344 103.283 1.00 11.59 ? 182  PHE J C   1 
ATOM   9869  O  O   . PHE D 1 164 ? 97.233  51.731 103.617 1.00 11.45 ? 182  PHE J O   1 
ATOM   9870  C  CB  . PHE D 1 164 ? 98.429  53.973 101.307 1.00 11.16 ? 182  PHE J CB  1 
ATOM   9871  C  CG  . PHE D 1 164 ? 97.021  54.507 101.344 1.00 10.59 ? 182  PHE J CG  1 
ATOM   9872  C  CD1 . PHE D 1 164 ? 96.164  54.333 100.255 1.00 10.39 ? 182  PHE J CD1 1 
ATOM   9873  C  CD2 . PHE D 1 164 ? 96.561  55.222 102.451 1.00 10.30 ? 182  PHE J CD2 1 
ATOM   9874  C  CE1 . PHE D 1 164 ? 94.859  54.843 100.276 1.00 10.30 ? 182  PHE J CE1 1 
ATOM   9875  C  CE2 . PHE D 1 164 ? 95.262  55.724 102.491 1.00 10.38 ? 182  PHE J CE2 1 
ATOM   9876  C  CZ  . PHE D 1 164 ? 94.409  55.544 101.391 1.00 10.57 ? 182  PHE J CZ  1 
ATOM   9877  N  N   . VAL D 1 165 ? 99.125  52.847 104.157 1.00 11.39 ? 183  VAL J N   1 
ATOM   9878  C  CA  . VAL D 1 165 ? 98.900  52.758 105.605 1.00 11.35 ? 183  VAL J CA  1 
ATOM   9879  C  C   . VAL D 1 165 ? 99.126  54.092 106.311 1.00 11.82 ? 183  VAL J C   1 
ATOM   9880  O  O   . VAL D 1 165 ? 100.183 54.730 106.149 1.00 11.89 ? 183  VAL J O   1 
ATOM   9881  C  CB  . VAL D 1 165 ? 99.761  51.660 106.296 1.00 11.22 ? 183  VAL J CB  1 
ATOM   9882  C  CG1 . VAL D 1 165 ? 99.382  51.544 107.775 1.00 10.70 ? 183  VAL J CG1 1 
ATOM   9883  C  CG2 . VAL D 1 165 ? 99.605  50.300 105.599 1.00 10.38 ? 183  VAL J CG2 1 
ATOM   9884  N  N   . LEU D 1 166 ? 98.128  54.481 107.107 1.00 11.53 ? 184  LEU J N   1 
ATOM   9885  C  CA  . LEU D 1 166 ? 98.155  55.705 107.907 1.00 12.05 ? 184  LEU J CA  1 
ATOM   9886  C  C   . LEU D 1 166 ? 98.283  55.388 109.396 1.00 11.80 ? 184  LEU J C   1 
ATOM   9887  O  O   . LEU D 1 166 ? 97.820  54.346 109.855 1.00 11.64 ? 184  LEU J O   1 
ATOM   9888  C  CB  . LEU D 1 166 ? 96.858  56.496 107.686 1.00 12.09 ? 184  LEU J CB  1 
ATOM   9889  C  CG  . LEU D 1 166 ? 96.765  57.581 106.611 1.00 13.42 ? 184  LEU J CG  1 
ATOM   9890  C  CD1 . LEU D 1 166 ? 97.571  57.277 105.361 1.00 12.91 ? 184  LEU J CD1 1 
ATOM   9891  C  CD2 . LEU D 1 166 ? 95.293  57.879 106.268 1.00 12.30 ? 184  LEU J CD2 1 
ATOM   9892  N  N   . LEU D 1 167 ? 98.897  56.301 110.144 1.00 11.80 ? 185  LEU J N   1 
ATOM   9893  C  CA  . LEU D 1 167 ? 98.978  56.182 111.597 1.00 11.83 ? 185  LEU J CA  1 
ATOM   9894  C  C   . LEU D 1 167 ? 98.361  57.406 112.259 1.00 12.09 ? 185  LEU J C   1 
ATOM   9895  O  O   . LEU D 1 167 ? 98.554  58.535 111.797 1.00 11.94 ? 185  LEU J O   1 
ATOM   9896  C  CB  . LEU D 1 167 ? 100.432 56.013 112.059 1.00 11.82 ? 185  LEU J CB  1 
ATOM   9897  C  CG  . LEU D 1 167 ? 101.303 54.906 111.448 1.00 11.22 ? 185  LEU J CG  1 
ATOM   9898  C  CD1 . LEU D 1 167 ? 102.728 55.033 111.977 1.00 10.19 ? 185  LEU J CD1 1 
ATOM   9899  C  CD2 . LEU D 1 167 ? 100.729 53.505 111.718 1.00 8.86  ? 185  LEU J CD2 1 
ATOM   9900  N  N   . SER D 1 168 ? 97.628  57.177 113.345 1.00 12.30 ? 186  SER J N   1 
ATOM   9901  C  CA  . SER D 1 168 ? 96.915  58.246 114.034 1.00 12.50 ? 186  SER J CA  1 
ATOM   9902  C  C   . SER D 1 168 ? 96.805  57.961 115.534 1.00 12.87 ? 186  SER J C   1 
ATOM   9903  O  O   . SER D 1 168 ? 96.216  56.958 115.926 1.00 12.68 ? 186  SER J O   1 
ATOM   9904  C  CB  . SER D 1 168 ? 95.517  58.427 113.422 1.00 12.51 ? 186  SER J CB  1 
ATOM   9905  O  OG  . SER D 1 168 ? 94.807  59.469 114.078 1.00 12.60 ? 186  SER J OG  1 
ATOM   9906  N  N   . PRO D 1 169 ? 97.382  58.839 116.381 1.00 13.76 ? 187  PRO J N   1 
ATOM   9907  C  CA  . PRO D 1 169 ? 97.224  58.675 117.833 1.00 14.25 ? 187  PRO J CA  1 
ATOM   9908  C  C   . PRO D 1 169 ? 95.764  58.780 118.265 1.00 14.92 ? 187  PRO J C   1 
ATOM   9909  O  O   . PRO D 1 169 ? 95.033  59.667 117.804 1.00 14.85 ? 187  PRO J O   1 
ATOM   9910  C  CB  . PRO D 1 169 ? 98.023  59.842 118.423 1.00 14.38 ? 187  PRO J CB  1 
ATOM   9911  C  CG  . PRO D 1 169 ? 98.868  60.359 117.318 1.00 14.42 ? 187  PRO J CG  1 
ATOM   9912  C  CD  . PRO D 1 169 ? 98.205  60.013 116.035 1.00 13.46 ? 187  PRO J CD  1 
ATOM   9913  N  N   . VAL D 1 170 ? 95.344  57.867 119.133 1.00 15.63 ? 188  VAL J N   1 
ATOM   9914  C  CA  . VAL D 1 170 ? 93.973  57.867 119.643 1.00 16.68 ? 188  VAL J CA  1 
ATOM   9915  C  C   . VAL D 1 170 ? 93.991  57.789 121.165 1.00 17.44 ? 188  VAL J C   1 
ATOM   9916  O  O   . VAL D 1 170 ? 94.898  57.199 121.757 1.00 17.03 ? 188  VAL J O   1 
ATOM   9917  C  CB  . VAL D 1 170 ? 93.098  56.725 119.011 1.00 16.71 ? 188  VAL J CB  1 
ATOM   9918  C  CG1 . VAL D 1 170 ? 93.732  55.359 119.209 1.00 15.99 ? 188  VAL J CG1 1 
ATOM   9919  C  CG2 . VAL D 1 170 ? 91.666  56.746 119.560 1.00 17.30 ? 188  VAL J CG2 1 
ATOM   9920  N  N   . GLY D 1 171 ? 92.991  58.402 121.788 1.00 18.65 ? 189  GLY J N   1 
ATOM   9921  C  CA  . GLY D 1 171 ? 92.911  58.459 123.242 1.00 20.42 ? 189  GLY J CA  1 
ATOM   9922  C  C   . GLY D 1 171 ? 91.850  57.551 123.826 1.00 21.65 ? 189  GLY J C   1 
ATOM   9923  O  O   . GLY D 1 171 ? 91.242  56.752 123.107 1.00 21.40 ? 189  GLY J O   1 
ATOM   9924  N  N   . PRO D 1 172 ? 91.617  57.674 125.146 1.00 22.97 ? 190  PRO J N   1 
ATOM   9925  C  CA  . PRO D 1 172 ? 90.587  56.877 125.827 1.00 23.63 ? 190  PRO J CA  1 
ATOM   9926  C  C   . PRO D 1 172 ? 89.167  57.342 125.486 1.00 24.37 ? 190  PRO J C   1 
ATOM   9927  O  O   . PRO D 1 172 ? 88.938  58.529 125.219 1.00 24.20 ? 190  PRO J O   1 
ATOM   9928  C  CB  . PRO D 1 172 ? 90.890  57.105 127.312 1.00 23.61 ? 190  PRO J CB  1 
ATOM   9929  C  CG  . PRO D 1 172 ? 91.598  58.422 127.374 1.00 23.47 ? 190  PRO J CG  1 
ATOM   9930  C  CD  . PRO D 1 172 ? 92.322  58.595 126.062 1.00 23.10 ? 190  PRO J CD  1 
ATOM   9931  N  N   . TYR D 1 173 ? 88.225  56.404 125.480 1.00 25.42 ? 191  TYR J N   1 
ATOM   9932  C  CA  . TYR D 1 173 ? 86.819  56.749 125.291 1.00 26.32 ? 191  TYR J CA  1 
ATOM   9933  C  C   . TYR D 1 173 ? 86.111  56.923 126.628 1.00 26.51 ? 191  TYR J C   1 
ATOM   9934  O  O   . TYR D 1 173 ? 85.072  57.589 126.702 1.00 26.81 ? 191  TYR J O   1 
ATOM   9935  C  CB  . TYR D 1 173 ? 86.112  55.729 124.397 1.00 26.59 ? 191  TYR J CB  1 
ATOM   9936  C  CG  . TYR D 1 173 ? 86.451  55.896 122.933 1.00 27.52 ? 191  TYR J CG  1 
ATOM   9937  C  CD1 . TYR D 1 173 ? 87.673  55.450 122.423 1.00 28.40 ? 191  TYR J CD1 1 
ATOM   9938  C  CD2 . TYR D 1 173 ? 85.556  56.511 122.057 1.00 29.15 ? 191  TYR J CD2 1 
ATOM   9939  C  CE1 . TYR D 1 173 ? 87.996  55.608 121.080 1.00 28.44 ? 191  TYR J CE1 1 
ATOM   9940  C  CE2 . TYR D 1 173 ? 85.870  56.671 120.707 1.00 29.82 ? 191  TYR J CE2 1 
ATOM   9941  C  CZ  . TYR D 1 173 ? 87.094  56.215 120.233 1.00 28.89 ? 191  TYR J CZ  1 
ATOM   9942  O  OH  . TYR D 1 173 ? 87.411  56.361 118.912 1.00 29.72 ? 191  TYR J OH  1 
ATOM   9943  N  N   . PHE D 1 174 ? 86.675  56.325 127.678 1.00 26.66 ? 192  PHE J N   1 
ATOM   9944  C  CA  . PHE D 1 174 ? 86.235  56.606 129.043 1.00 26.77 ? 192  PHE J CA  1 
ATOM   9945  C  C   . PHE D 1 174 ? 86.798  57.950 129.505 1.00 26.62 ? 192  PHE J C   1 
ATOM   9946  O  O   . PHE D 1 174 ? 87.764  58.459 128.927 1.00 26.49 ? 192  PHE J O   1 
ATOM   9947  C  CB  . PHE D 1 174 ? 86.593  55.469 130.016 1.00 26.83 ? 192  PHE J CB  1 
ATOM   9948  C  CG  . PHE D 1 174 ? 88.041  55.075 130.002 1.00 27.72 ? 192  PHE J CG  1 
ATOM   9949  C  CD1 . PHE D 1 174 ? 88.995  55.822 130.704 1.00 28.44 ? 192  PHE J CD1 1 
ATOM   9950  C  CD2 . PHE D 1 174 ? 88.454  53.935 129.312 1.00 28.29 ? 192  PHE J CD2 1 
ATOM   9951  C  CE1 . PHE D 1 174 ? 90.346  55.452 130.700 1.00 28.48 ? 192  PHE J CE1 1 
ATOM   9952  C  CE2 . PHE D 1 174 ? 89.801  53.550 129.301 1.00 28.67 ? 192  PHE J CE2 1 
ATOM   9953  C  CZ  . PHE D 1 174 ? 90.749  54.310 129.998 1.00 29.19 ? 192  PHE J CZ  1 
ATOM   9954  N  N   . SER D 1 175 ? 86.186  58.510 130.549 1.00 26.43 ? 193  SER J N   1 
ATOM   9955  C  CA  . SER D 1 175 ? 86.397  59.900 130.939 1.00 26.19 ? 193  SER J CA  1 
ATOM   9956  C  C   . SER D 1 175 ? 86.069  60.101 132.422 1.00 25.74 ? 193  SER J C   1 
ATOM   9957  O  O   . SER D 1 175 ? 85.126  59.489 132.939 1.00 25.73 ? 193  SER J O   1 
ATOM   9958  C  CB  . SER D 1 175 ? 85.488  60.786 130.089 1.00 26.02 ? 193  SER J CB  1 
ATOM   9959  O  OG  . SER D 1 175 ? 85.986  62.102 129.992 1.00 28.31 ? 193  SER J OG  1 
ATOM   9960  N  N   . SER D 1 176 ? 86.837  60.961 133.100 1.00 25.13 ? 194  SER J N   1 
ATOM   9961  C  CA  . SER D 1 176 ? 86.630  61.257 134.535 1.00 24.43 ? 194  SER J CA  1 
ATOM   9962  C  C   . SER D 1 176 ? 86.424  60.004 135.409 1.00 23.69 ? 194  SER J C   1 
ATOM   9963  O  O   . SER D 1 176 ? 85.580  59.990 136.314 1.00 23.30 ? 194  SER J O   1 
ATOM   9964  C  CB  . SER D 1 176 ? 85.454  62.226 134.722 1.00 24.54 ? 194  SER J CB  1 
ATOM   9965  O  OG  . SER D 1 176 ? 85.624  63.391 133.939 1.00 25.80 ? 194  SER J OG  1 
ATOM   9966  N  N   . GLY D 1 177 ? 87.187  58.953 135.113 1.00 22.98 ? 195  GLY J N   1 
ATOM   9967  C  CA  . GLY D 1 177 ? 87.148  57.707 135.875 1.00 22.03 ? 195  GLY J CA  1 
ATOM   9968  C  C   . GLY D 1 177 ? 86.230  56.625 135.336 1.00 21.30 ? 195  GLY J C   1 
ATOM   9969  O  O   . GLY D 1 177 ? 86.445  55.443 135.599 1.00 20.98 ? 195  GLY J O   1 
ATOM   9970  N  N   . THR D 1 178 ? 85.211  57.022 134.575 1.00 20.71 ? 196  THR J N   1 
ATOM   9971  C  CA  . THR D 1 178 ? 84.155  56.089 134.178 1.00 20.43 ? 196  THR J CA  1 
ATOM   9972  C  C   . THR D 1 178 ? 83.944  56.009 132.666 1.00 20.08 ? 196  THR J C   1 
ATOM   9973  O  O   . THR D 1 178 ? 84.349  56.911 131.930 1.00 20.24 ? 196  THR J O   1 
ATOM   9974  C  CB  . THR D 1 178 ? 82.800  56.467 134.836 1.00 20.59 ? 196  THR J CB  1 
ATOM   9975  O  OG1 . THR D 1 178 ? 82.411  57.782 134.408 1.00 21.12 ? 196  THR J OG1 1 
ATOM   9976  C  CG2 . THR D 1 178 ? 82.895  56.443 136.359 1.00 19.86 ? 196  THR J CG2 1 
ATOM   9977  N  N   . PHE D 1 179 ? 83.300  54.928 132.216 1.00 19.20 ? 197  PHE J N   1 
ATOM   9978  C  CA  . PHE D 1 179 ? 82.803  54.820 130.844 1.00 18.60 ? 197  PHE J CA  1 
ATOM   9979  C  C   . PHE D 1 179 ? 81.884  55.999 130.497 1.00 18.65 ? 197  PHE J C   1 
ATOM   9980  O  O   . PHE D 1 179 ? 81.242  56.584 131.385 1.00 18.36 ? 197  PHE J O   1 
ATOM   9981  C  CB  . PHE D 1 179 ? 82.003  53.519 130.654 1.00 18.16 ? 197  PHE J CB  1 
ATOM   9982  C  CG  . PHE D 1 179 ? 82.847  52.279 130.417 1.00 16.89 ? 197  PHE J CG  1 
ATOM   9983  C  CD1 . PHE D 1 179 ? 82.797  51.212 131.311 1.00 15.35 ? 197  PHE J CD1 1 
ATOM   9984  C  CD2 . PHE D 1 179 ? 83.658  52.165 129.291 1.00 15.82 ? 197  PHE J CD2 1 
ATOM   9985  C  CE1 . PHE D 1 179 ? 83.552  50.054 131.099 1.00 15.75 ? 197  PHE J CE1 1 
ATOM   9986  C  CE2 . PHE D 1 179 ? 84.425  51.007 129.067 1.00 15.14 ? 197  PHE J CE2 1 
ATOM   9987  C  CZ  . PHE D 1 179 ? 84.369  49.954 129.971 1.00 14.99 ? 197  PHE J CZ  1 
ATOM   9988  N  N   . ASN D 1 180 ? 81.843  56.350 129.211 1.00 18.30 ? 198  ASN J N   1 
ATOM   9989  C  CA  . ASN D 1 180 ? 80.818  57.245 128.675 1.00 18.66 ? 198  ASN J CA  1 
ATOM   9990  C  C   . ASN D 1 180 ? 79.811  56.454 127.830 1.00 18.34 ? 198  ASN J C   1 
ATOM   9991  O  O   . ASN D 1 180 ? 80.055  56.209 126.644 1.00 18.15 ? 198  ASN J O   1 
ATOM   9992  C  CB  . ASN D 1 180 ? 81.435  58.362 127.832 1.00 18.60 ? 198  ASN J CB  1 
ATOM   9993  C  CG  . ASN D 1 180 ? 82.278  59.304 128.645 1.00 20.06 ? 198  ASN J CG  1 
ATOM   9994  O  OD1 . ASN D 1 180 ? 83.476  59.434 128.404 1.00 20.88 ? 198  ASN J OD1 1 
ATOM   9995  N  ND2 . ASN D 1 180 ? 81.661  59.970 129.625 1.00 21.46 ? 198  ASN J ND2 1 
ATOM   9996  N  N   . PRO D 1 181 ? 78.676  56.056 128.440 1.00 18.09 ? 199  PRO J N   1 
ATOM   9997  C  CA  . PRO D 1 181 ? 77.683  55.231 127.746 1.00 17.89 ? 199  PRO J CA  1 
ATOM   9998  C  C   . PRO D 1 181 ? 77.061  55.933 126.532 1.00 17.67 ? 199  PRO J C   1 
ATOM   9999  O  O   . PRO D 1 181 ? 77.046  57.162 126.463 1.00 17.34 ? 199  PRO J O   1 
ATOM   10000 C  CB  . PRO D 1 181 ? 76.615  54.980 128.823 1.00 17.90 ? 199  PRO J CB  1 
ATOM   10001 C  CG  . PRO D 1 181 ? 76.784  56.085 129.804 1.00 17.89 ? 199  PRO J CG  1 
ATOM   10002 C  CD  . PRO D 1 181 ? 78.259  56.374 129.819 1.00 17.83 ? 199  PRO J CD  1 
ATOM   10003 N  N   . VAL D 1 182 ? 76.561  55.149 125.583 1.00 17.32 ? 200  VAL J N   1 
ATOM   10004 C  CA  . VAL D 1 182 ? 75.916  55.711 124.403 1.00 16.88 ? 200  VAL J CA  1 
ATOM   10005 C  C   . VAL D 1 182 ? 74.415  55.449 124.381 1.00 16.90 ? 200  VAL J C   1 
ATOM   10006 O  O   . VAL D 1 182 ? 73.936  54.428 124.885 1.00 16.32 ? 200  VAL J O   1 
ATOM   10007 C  CB  . VAL D 1 182 ? 76.553  55.204 123.074 1.00 17.04 ? 200  VAL J CB  1 
ATOM   10008 C  CG1 . VAL D 1 182 ? 77.958  55.791 122.886 1.00 16.05 ? 200  VAL J CG1 1 
ATOM   10009 C  CG2 . VAL D 1 182 ? 76.564  53.666 123.010 1.00 16.95 ? 200  VAL J CG2 1 
ATOM   10010 N  N   . SER D 1 183 ? 73.683  56.390 123.794 1.00 16.89 ? 201  SER J N   1 
ATOM   10011 C  CA  . SER D 1 183 ? 72.308  56.146 123.403 1.00 17.36 ? 201  SER J CA  1 
ATOM   10012 C  C   . SER D 1 183 ? 72.297  55.720 121.949 1.00 16.97 ? 201  SER J C   1 
ATOM   10013 O  O   . SER D 1 183 ? 73.026  56.284 121.124 1.00 16.38 ? 201  SER J O   1 
ATOM   10014 C  CB  . SER D 1 183 ? 71.449  57.391 123.603 1.00 17.16 ? 201  SER J CB  1 
ATOM   10015 O  OG  . SER D 1 183 ? 71.401  57.709 124.981 1.00 19.85 ? 201  SER J OG  1 
ATOM   10016 N  N   . LEU D 1 184 ? 71.467  54.722 121.655 1.00 17.09 ? 202  LEU J N   1 
ATOM   10017 C  CA  . LEU D 1 184 ? 71.343  54.164 120.314 1.00 17.37 ? 202  LEU J CA  1 
ATOM   10018 C  C   . LEU D 1 184 ? 70.003  54.502 119.683 1.00 17.92 ? 202  LEU J C   1 
ATOM   10019 O  O   . LEU D 1 184 ? 68.969  54.503 120.356 1.00 18.13 ? 202  LEU J O   1 
ATOM   10020 C  CB  . LEU D 1 184 ? 71.524  52.645 120.341 1.00 17.20 ? 202  LEU J CB  1 
ATOM   10021 C  CG  . LEU D 1 184 ? 72.752  52.048 121.022 1.00 16.36 ? 202  LEU J CG  1 
ATOM   10022 C  CD1 . LEU D 1 184 ? 72.771  50.550 120.814 1.00 15.20 ? 202  LEU J CD1 1 
ATOM   10023 C  CD2 . LEU D 1 184 ? 74.034  52.694 120.515 1.00 16.32 ? 202  LEU J CD2 1 
ATOM   10024 N  N   . TRP D 1 185 ? 70.044  54.798 118.388 1.00 18.46 ? 203  TRP J N   1 
ATOM   10025 C  CA  . TRP D 1 185 ? 68.859  55.079 117.586 1.00 18.95 ? 203  TRP J CA  1 
ATOM   10026 C  C   . TRP D 1 185 ? 68.523  53.825 116.783 1.00 19.04 ? 203  TRP J C   1 
ATOM   10027 O  O   . TRP D 1 185 ? 69.323  53.376 115.963 1.00 19.21 ? 203  TRP J O   1 
ATOM   10028 C  CB  . TRP D 1 185 ? 69.137  56.285 116.677 1.00 19.32 ? 203  TRP J CB  1 
ATOM   10029 C  CG  . TRP D 1 185 ? 68.055  56.650 115.702 1.00 20.86 ? 203  TRP J CG  1 
ATOM   10030 C  CD1 . TRP D 1 185 ? 68.072  56.444 114.353 1.00 21.66 ? 203  TRP J CD1 1 
ATOM   10031 C  CD2 . TRP D 1 185 ? 66.811  57.305 115.991 1.00 22.44 ? 203  TRP J CD2 1 
ATOM   10032 N  NE1 . TRP D 1 185 ? 66.915  56.913 113.785 1.00 22.39 ? 203  TRP J NE1 1 
ATOM   10033 C  CE2 . TRP D 1 185 ? 66.123  57.450 114.765 1.00 22.54 ? 203  TRP J CE2 1 
ATOM   10034 C  CE3 . TRP D 1 185 ? 66.208  57.778 117.167 1.00 23.70 ? 203  TRP J CE3 1 
ATOM   10035 C  CZ2 . TRP D 1 185 ? 64.857  58.049 114.677 1.00 23.98 ? 203  TRP J CZ2 1 
ATOM   10036 C  CZ3 . TRP D 1 185 ? 64.946  58.374 117.084 1.00 24.19 ? 203  TRP J CZ3 1 
ATOM   10037 C  CH2 . TRP D 1 185 ? 64.287  58.508 115.843 1.00 24.25 ? 203  TRP J CH2 1 
ATOM   10038 N  N   . ALA D 1 186 ? 67.363  53.236 117.069 1.00 18.97 ? 204  ALA J N   1 
ATOM   10039 C  CA  . ALA D 1 186 ? 66.887  52.032 116.383 1.00 19.05 ? 204  ALA J CA  1 
ATOM   10040 C  C   . ALA D 1 186 ? 65.659  52.323 115.507 1.00 19.49 ? 204  ALA J C   1 
ATOM   10041 O  O   . ALA D 1 186 ? 64.522  52.417 115.988 1.00 19.24 ? 204  ALA J O   1 
ATOM   10042 C  CB  . ALA D 1 186 ? 66.589  50.921 117.378 1.00 18.25 ? 204  ALA J CB  1 
ATOM   10043 N  N   . ASN D 1 187 ? 65.923  52.470 114.214 1.00 20.10 ? 205  ASN J N   1 
ATOM   10044 C  CA  . ASN D 1 187 ? 64.903  52.643 113.193 1.00 20.58 ? 205  ASN J CA  1 
ATOM   10045 C  C   . ASN D 1 187 ? 65.041  51.487 112.190 1.00 20.99 ? 205  ASN J C   1 
ATOM   10046 O  O   . ASN D 1 187 ? 66.036  51.418 111.464 1.00 21.09 ? 205  ASN J O   1 
ATOM   10047 C  CB  . ASN D 1 187 ? 65.105  54.004 112.509 1.00 20.37 ? 205  ASN J CB  1 
ATOM   10048 C  CG  . ASN D 1 187 ? 64.077  54.292 111.426 1.00 21.04 ? 205  ASN J CG  1 
ATOM   10049 O  OD1 . ASN D 1 187 ? 63.182  53.485 111.148 1.00 22.43 ? 205  ASN J OD1 1 
ATOM   10050 N  ND2 . ASN D 1 187 ? 64.209  55.459 110.798 1.00 21.48 ? 205  ASN J ND2 1 
ATOM   10051 N  N   . PRO D 1 188 ? 64.056  50.564 112.155 1.00 21.42 ? 206  PRO J N   1 
ATOM   10052 C  CA  . PRO D 1 188 ? 64.153  49.393 111.274 1.00 21.77 ? 206  PRO J CA  1 
ATOM   10053 C  C   . PRO D 1 188 ? 64.037  49.699 109.767 1.00 22.28 ? 206  PRO J C   1 
ATOM   10054 O  O   . PRO D 1 188 ? 64.147  48.777 108.953 1.00 22.29 ? 206  PRO J O   1 
ATOM   10055 C  CB  . PRO D 1 188 ? 62.991  48.514 111.738 1.00 21.77 ? 206  PRO J CB  1 
ATOM   10056 C  CG  . PRO D 1 188 ? 62.001  49.470 112.278 1.00 21.42 ? 206  PRO J CG  1 
ATOM   10057 C  CD  . PRO D 1 188 ? 62.802  50.554 112.931 1.00 21.42 ? 206  PRO J CD  1 
ATOM   10058 N  N   . LYS D 1 189 ? 63.835  50.969 109.409 1.00 22.68 ? 207  LYS J N   1 
ATOM   10059 C  CA  . LYS D 1 189 ? 63.778  51.398 108.002 1.00 23.65 ? 207  LYS J CA  1 
ATOM   10060 C  C   . LYS D 1 189 ? 65.114  51.267 107.264 1.00 23.55 ? 207  LYS J C   1 
ATOM   10061 O  O   . LYS D 1 189 ? 65.134  51.181 106.034 1.00 23.43 ? 207  LYS J O   1 
ATOM   10062 C  CB  . LYS D 1 189 ? 63.273  52.843 107.880 1.00 23.78 ? 207  LYS J CB  1 
ATOM   10063 C  CG  . LYS D 1 189 ? 61.754  52.973 107.893 1.00 26.36 ? 207  LYS J CG  1 
ATOM   10064 C  CD  . LYS D 1 189 ? 61.304  54.408 107.564 1.00 29.79 ? 207  LYS J CD  1 
ATOM   10065 C  CE  . LYS D 1 189 ? 59.813  54.630 107.864 1.00 30.74 ? 207  LYS J CE  1 
ATOM   10066 N  NZ  . LYS D 1 189 ? 59.391  56.063 107.664 1.00 30.49 ? 207  LYS J NZ  1 
ATOM   10067 N  N   . TYR D 1 190 ? 66.215  51.286 108.017 1.00 23.58 ? 208  TYR J N   1 
ATOM   10068 C  CA  . TYR D 1 190 ? 67.561  51.137 107.456 1.00 23.51 ? 208  TYR J CA  1 
ATOM   10069 C  C   . TYR D 1 190 ? 68.124  49.760 107.762 1.00 22.98 ? 208  TYR J C   1 
ATOM   10070 O  O   . TYR D 1 190 ? 67.849  49.181 108.820 1.00 22.97 ? 208  TYR J O   1 
ATOM   10071 C  CB  . TYR D 1 190 ? 68.520  52.201 108.002 1.00 23.88 ? 208  TYR J CB  1 
ATOM   10072 C  CG  . TYR D 1 190 ? 67.984  53.612 107.981 1.00 25.70 ? 208  TYR J CG  1 
ATOM   10073 C  CD1 . TYR D 1 190 ? 67.870  54.323 106.786 1.00 27.94 ? 208  TYR J CD1 1 
ATOM   10074 C  CD2 . TYR D 1 190 ? 67.606  54.242 109.163 1.00 27.57 ? 208  TYR J CD2 1 
ATOM   10075 C  CE1 . TYR D 1 190 ? 67.371  55.632 106.773 1.00 29.40 ? 208  TYR J CE1 1 
ATOM   10076 C  CE2 . TYR D 1 190 ? 67.118  55.538 109.163 1.00 29.10 ? 208  TYR J CE2 1 
ATOM   10077 C  CZ  . TYR D 1 190 ? 67.002  56.229 107.969 1.00 30.09 ? 208  TYR J CZ  1 
ATOM   10078 O  OH  . TYR D 1 190 ? 66.505  57.518 107.984 1.00 31.14 ? 208  TYR J OH  1 
ATOM   10079 N  N   . VAL D 1 191 ? 68.908  49.243 106.823 1.00 22.19 ? 209  VAL J N   1 
ATOM   10080 C  CA  . VAL D 1 191 ? 69.590  47.967 106.985 1.00 21.77 ? 209  VAL J CA  1 
ATOM   10081 C  C   . VAL D 1 191 ? 71.078  48.205 106.746 1.00 20.97 ? 209  VAL J C   1 
ATOM   10082 O  O   . VAL D 1 191 ? 71.448  48.849 105.771 1.00 21.01 ? 209  VAL J O   1 
ATOM   10083 C  CB  . VAL D 1 191 ? 68.993  46.874 106.034 1.00 21.95 ? 209  VAL J CB  1 
ATOM   10084 C  CG1 . VAL D 1 191 ? 69.138  47.253 104.559 1.00 22.86 ? 209  VAL J CG1 1 
ATOM   10085 C  CG2 . VAL D 1 191 ? 69.623  45.539 106.275 1.00 22.30 ? 209  VAL J CG2 1 
ATOM   10086 N  N   . ARG D 1 192 ? 71.928  47.718 107.648 1.00 20.18 ? 210  ARG J N   1 
ATOM   10087 C  CA  . ARG D 1 192 ? 73.377  47.917 107.508 1.00 19.17 ? 210  ARG J CA  1 
ATOM   10088 C  C   . ARG D 1 192 ? 73.940  47.014 106.420 1.00 18.78 ? 210  ARG J C   1 
ATOM   10089 O  O   . ARG D 1 192 ? 74.791  47.425 105.626 1.00 18.67 ? 210  ARG J O   1 
ATOM   10090 C  CB  . ARG D 1 192 ? 74.109  47.651 108.830 1.00 19.03 ? 210  ARG J CB  1 
ATOM   10091 C  CG  . ARG D 1 192 ? 75.559  48.132 108.834 1.00 18.05 ? 210  ARG J CG  1 
ATOM   10092 C  CD  . ARG D 1 192 ? 76.368  47.565 110.002 1.00 16.78 ? 210  ARG J CD  1 
ATOM   10093 N  NE  . ARG D 1 192 ? 76.718  46.153 109.828 1.00 16.29 ? 210  ARG J NE  1 
ATOM   10094 C  CZ  . ARG D 1 192 ? 77.731  45.702 109.087 1.00 15.81 ? 210  ARG J CZ  1 
ATOM   10095 N  NH1 . ARG D 1 192 ? 78.518  46.543 108.423 1.00 16.63 ? 210  ARG J NH1 1 
ATOM   10096 N  NH2 . ARG D 1 192 ? 77.959  44.402 109.004 1.00 15.42 ? 210  ARG J NH2 1 
ATOM   10097 N  N   . ALA D 1 193 ? 73.438  45.783 106.398 1.00 18.26 ? 211  ALA J N   1 
ATOM   10098 C  CA  . ALA D 1 193 ? 73.967  44.716 105.572 1.00 17.91 ? 211  ALA J CA  1 
ATOM   10099 C  C   . ALA D 1 193 ? 72.897  43.646 105.451 1.00 17.83 ? 211  ALA J C   1 
ATOM   10100 O  O   . ALA D 1 193 ? 72.030  43.539 106.322 1.00 18.05 ? 211  ALA J O   1 
ATOM   10101 C  CB  . ALA D 1 193 ? 75.212  44.135 106.214 1.00 17.65 ? 211  ALA J CB  1 
ATOM   10102 N  N   . TRP D 1 194 ? 72.969  42.849 104.386 1.00 17.60 ? 212  TRP J N   1 
ATOM   10103 C  CA  . TRP D 1 194 ? 71.971  41.811 104.109 1.00 17.65 ? 212  TRP J CA  1 
ATOM   10104 C  C   . TRP D 1 194 ? 72.641  40.497 103.718 1.00 17.71 ? 212  TRP J C   1 
ATOM   10105 O  O   . TRP D 1 194 ? 73.797  40.491 103.305 1.00 17.89 ? 212  TRP J O   1 
ATOM   10106 C  CB  . TRP D 1 194 ? 71.004  42.271 103.003 1.00 17.59 ? 212  TRP J CB  1 
ATOM   10107 C  CG  . TRP D 1 194 ? 71.709  42.780 101.779 1.00 17.71 ? 212  TRP J CG  1 
ATOM   10108 C  CD1 . TRP D 1 194 ? 72.027  42.065 100.659 1.00 18.13 ? 212  TRP J CD1 1 
ATOM   10109 C  CD2 . TRP D 1 194 ? 72.219  44.108 101.565 1.00 18.26 ? 212  TRP J CD2 1 
ATOM   10110 N  NE1 . TRP D 1 194 ? 72.691  42.866 99.756  1.00 18.52 ? 212  TRP J NE1 1 
ATOM   10111 C  CE2 . TRP D 1 194 ? 72.822  44.123 100.286 1.00 17.68 ? 212  TRP J CE2 1 
ATOM   10112 C  CE3 . TRP D 1 194 ? 72.209  45.290 102.326 1.00 18.25 ? 212  TRP J CE3 1 
ATOM   10113 C  CZ2 . TRP D 1 194 ? 73.414  45.267 99.752  1.00 18.48 ? 212  TRP J CZ2 1 
ATOM   10114 C  CZ3 . TRP D 1 194 ? 72.804  46.424 101.803 1.00 17.77 ? 212  TRP J CZ3 1 
ATOM   10115 C  CH2 . TRP D 1 194 ? 73.402  46.406 100.526 1.00 19.14 ? 212  TRP J CH2 1 
ATOM   10116 N  N   . LYS D 1 195 ? 71.921  39.386 103.873 1.00 18.06 ? 213  LYS J N   1 
ATOM   10117 C  CA  . LYS D 1 195 ? 72.375  38.091 103.363 1.00 18.27 ? 213  LYS J CA  1 
ATOM   10118 C  C   . LYS D 1 195 ? 72.566  38.219 101.856 1.00 17.89 ? 213  LYS J C   1 
ATOM   10119 O  O   . LYS D 1 195 ? 71.696  38.746 101.154 1.00 17.72 ? 213  LYS J O   1 
ATOM   10120 C  CB  . LYS D 1 195 ? 71.344  36.997 103.657 1.00 18.67 ? 213  LYS J CB  1 
ATOM   10121 C  CG  . LYS D 1 195 ? 70.864  36.933 105.104 1.00 20.83 ? 213  LYS J CG  1 
ATOM   10122 C  CD  . LYS D 1 195 ? 71.493  35.782 105.885 1.00 23.45 ? 213  LYS J CD  1 
ATOM   10123 C  CE  . LYS D 1 195 ? 70.895  35.714 107.283 1.00 24.62 ? 213  LYS J CE  1 
ATOM   10124 N  NZ  . LYS D 1 195 ? 70.602  34.304 107.689 1.00 26.42 ? 213  LYS J NZ  1 
ATOM   10125 N  N   . GLY D 1 196 ? 73.713  37.758 101.370 1.00 17.51 ? 214  GLY J N   1 
ATOM   10126 C  CA  . GLY D 1 196 ? 74.088  37.936 99.970  1.00 16.87 ? 214  GLY J CA  1 
ATOM   10127 C  C   . GLY D 1 196 ? 74.922  39.184 99.720  1.00 16.58 ? 214  GLY J C   1 
ATOM   10128 O  O   . GLY D 1 196 ? 75.449  39.370 98.623  1.00 16.19 ? 214  GLY J O   1 
ATOM   10129 N  N   . GLY D 1 197 ? 75.036  40.034 100.742 1.00 16.49 ? 215  GLY J N   1 
ATOM   10130 C  CA  . GLY D 1 197 ? 75.799  41.278 100.664 1.00 16.22 ? 215  GLY J CA  1 
ATOM   10131 C  C   . GLY D 1 197 ? 77.251  41.135 101.102 1.00 16.36 ? 215  GLY J C   1 
ATOM   10132 O  O   . GLY D 1 197 ? 77.828  40.048 101.032 1.00 15.93 ? 215  GLY J O   1 
ATOM   10133 N  N   . THR D 1 198 ? 77.829  42.243 101.560 1.00 16.50 ? 216  THR J N   1 
ATOM   10134 C  CA  . THR D 1 198 ? 79.252  42.318 101.883 1.00 16.85 ? 216  THR J CA  1 
ATOM   10135 C  C   . THR D 1 198 ? 79.523  42.780 103.324 1.00 16.92 ? 216  THR J C   1 
ATOM   10136 O  O   . THR D 1 198 ? 80.642  43.210 103.647 1.00 16.98 ? 216  THR J O   1 
ATOM   10137 C  CB  . THR D 1 198 ? 79.996  43.261 100.890 1.00 17.18 ? 216  THR J CB  1 
ATOM   10138 O  OG1 . THR D 1 198 ? 79.349  44.542 100.857 1.00 16.50 ? 216  THR J OG1 1 
ATOM   10139 C  CG2 . THR D 1 198 ? 80.036  42.658 99.481  1.00 17.63 ? 216  THR J CG2 1 
ATOM   10140 N  N   . GLY D 1 199 ? 78.510  42.666 104.186 1.00 16.84 ? 217  GLY J N   1 
ATOM   10141 C  CA  . GLY D 1 199 ? 78.601  43.104 105.578 1.00 16.76 ? 217  GLY J CA  1 
ATOM   10142 C  C   . GLY D 1 199 ? 79.646  42.412 106.436 1.00 17.15 ? 217  GLY J C   1 
ATOM   10143 O  O   . GLY D 1 199 ? 80.060  42.950 107.461 1.00 16.94 ? 217  GLY J O   1 
ATOM   10144 N  N   . ASP D 1 200 ? 80.077  41.222 106.026 1.00 17.68 ? 218  ASP J N   1 
ATOM   10145 C  CA  . ASP D 1 200 ? 81.108  40.484 106.764 1.00 18.42 ? 218  ASP J CA  1 
ATOM   10146 C  C   . ASP D 1 200 ? 82.530  40.824 106.305 1.00 18.76 ? 218  ASP J C   1 
ATOM   10147 O  O   . ASP D 1 200 ? 83.492  40.153 106.678 1.00 18.83 ? 218  ASP J O   1 
ATOM   10148 C  CB  . ASP D 1 200 ? 80.841  38.967 106.727 1.00 18.61 ? 218  ASP J CB  1 
ATOM   10149 C  CG  . ASP D 1 200 ? 80.749  38.401 105.304 1.00 19.52 ? 218  ASP J CG  1 
ATOM   10150 O  OD1 . ASP D 1 200 ? 80.608  39.175 104.329 1.00 20.19 ? 218  ASP J OD1 1 
ATOM   10151 O  OD2 . ASP D 1 200 ? 80.808  37.160 105.167 1.00 19.91 ? 218  ASP J OD2 1 
ATOM   10152 N  N   . CYS D 1 201 ? 82.643  41.880 105.499 1.00 19.46 ? 219  CYS J N   1 
ATOM   10153 C  CA  . CYS D 1 201 ? 83.926  42.405 105.040 1.00 20.27 ? 219  CYS J CA  1 
ATOM   10154 C  C   . CYS D 1 201 ? 84.022  43.886 105.352 1.00 19.80 ? 219  CYS J C   1 
ATOM   10155 O  O   . CYS D 1 201 ? 83.012  44.580 105.474 1.00 19.81 ? 219  CYS J O   1 
ATOM   10156 C  CB  . CYS D 1 201 ? 84.105  42.222 103.531 1.00 20.35 ? 219  CYS J CB  1 
ATOM   10157 S  SG  . CYS D 1 201 ? 84.084  40.537 102.954 1.00 24.83 ? 219  CYS J SG  1 
ATOM   10158 N  N   . LYS D 1 202 ? 85.254  44.363 105.448 1.00 19.68 ? 220  LYS J N   1 
ATOM   10159 C  CA  . LYS D 1 202 ? 85.526  45.749 105.757 1.00 19.48 ? 220  LYS J CA  1 
ATOM   10160 C  C   . LYS D 1 202 ? 85.752  46.548 104.468 1.00 19.29 ? 220  LYS J C   1 
ATOM   10161 O  O   . LYS D 1 202 ? 86.739  47.274 104.322 1.00 19.27 ? 220  LYS J O   1 
ATOM   10162 C  CB  . LYS D 1 202 ? 86.734  45.809 106.680 1.00 19.64 ? 220  LYS J CB  1 
ATOM   10163 C  CG  . LYS D 1 202 ? 86.485  46.548 107.952 1.00 19.91 ? 220  LYS J CG  1 
ATOM   10164 C  CD  . LYS D 1 202 ? 87.501  46.118 108.986 1.00 21.30 ? 220  LYS J CD  1 
ATOM   10165 C  CE  . LYS D 1 202 ? 87.660  47.162 110.034 1.00 22.07 ? 220  LYS J CE  1 
ATOM   10166 N  NZ  . LYS D 1 202 ? 86.342  47.431 110.679 1.00 22.77 ? 220  LYS J NZ  1 
ATOM   10167 N  N   . MET D 1 203 ? 84.823  46.394 103.531 1.00 19.06 ? 221  MET J N   1 
ATOM   10168 C  CA  . MET D 1 203 ? 84.851  47.122 102.276 1.00 18.97 ? 221  MET J CA  1 
ATOM   10169 C  C   . MET D 1 203 ? 84.121  48.443 102.467 1.00 18.54 ? 221  MET J C   1 
ATOM   10170 O  O   . MET D 1 203 ? 83.102  48.497 103.166 1.00 18.32 ? 221  MET J O   1 
ATOM   10171 C  CB  . MET D 1 203 ? 84.204  46.295 101.164 1.00 19.56 ? 221  MET J CB  1 
ATOM   10172 C  CG  . MET D 1 203 ? 85.101  45.164 100.611 1.00 20.79 ? 221  MET J CG  1 
ATOM   10173 S  SD  . MET D 1 203 ? 84.178  44.067 99.505  1.00 26.02 ? 221  MET J SD  1 
ATOM   10174 C  CE  . MET D 1 203 ? 83.346  43.066 100.704 1.00 27.69 ? 221  MET J CE  1 
ATOM   10175 N  N   . GLY D 1 204 ? 84.653  49.500 101.853 1.00 17.72 ? 222  GLY J N   1 
ATOM   10176 C  CA  . GLY D 1 204 ? 84.161  50.864 102.053 1.00 17.41 ? 222  GLY J CA  1 
ATOM   10177 C  C   . GLY D 1 204 ? 82.679  51.068 101.812 1.00 17.14 ? 222  GLY J C   1 
ATOM   10178 O  O   . GLY D 1 204 ? 82.041  51.843 102.515 1.00 16.75 ? 222  GLY J O   1 
ATOM   10179 N  N   . GLY D 1 205 ? 82.136  50.356 100.821 1.00 17.34 ? 223  GLY J N   1 
ATOM   10180 C  CA  . GLY D 1 205 ? 80.723  50.452 100.443 1.00 17.12 ? 223  GLY J CA  1 
ATOM   10181 C  C   . GLY D 1 205 ? 79.723  50.229 101.569 1.00 17.22 ? 223  GLY J C   1 
ATOM   10182 O  O   . GLY D 1 205 ? 78.626  50.792 101.540 1.00 16.98 ? 223  GLY J O   1 
ATOM   10183 N  N   . ASN D 1 206 ? 80.103  49.419 102.560 1.00 16.87 ? 224  ASN J N   1 
ATOM   10184 C  CA  . ASN D 1 206 ? 79.257  49.147 103.732 1.00 16.91 ? 224  ASN J CA  1 
ATOM   10185 C  C   . ASN D 1 206 ? 79.011  50.378 104.603 1.00 16.96 ? 224  ASN J C   1 
ATOM   10186 O  O   . ASN D 1 206 ? 78.028  50.435 105.347 1.00 17.39 ? 224  ASN J O   1 
ATOM   10187 C  CB  . ASN D 1 206 ? 79.874  48.048 104.610 1.00 16.82 ? 224  ASN J CB  1 
ATOM   10188 C  CG  . ASN D 1 206 ? 80.089  46.730 103.867 1.00 17.46 ? 224  ASN J CG  1 
ATOM   10189 O  OD1 . ASN D 1 206 ? 81.064  46.024 104.121 1.00 18.90 ? 224  ASN J OD1 1 
ATOM   10190 N  ND2 . ASN D 1 206 ? 79.183  46.395 102.954 1.00 17.63 ? 224  ASN J ND2 1 
ATOM   10191 N  N   . TYR D 1 207 ? 79.907  51.358 104.521 1.00 16.52 ? 225  TYR J N   1 
ATOM   10192 C  CA  . TYR D 1 207 ? 79.909  52.460 105.481 1.00 16.25 ? 225  TYR J CA  1 
ATOM   10193 C  C   . TYR D 1 207 ? 79.307  53.753 104.940 1.00 16.22 ? 225  TYR J C   1 
ATOM   10194 O  O   . TYR D 1 207 ? 78.684  54.498 105.691 1.00 16.40 ? 225  TYR J O   1 
ATOM   10195 C  CB  . TYR D 1 207 ? 81.315  52.644 106.078 1.00 15.91 ? 225  TYR J CB  1 
ATOM   10196 C  CG  . TYR D 1 207 ? 81.822  51.341 106.671 1.00 16.44 ? 225  TYR J CG  1 
ATOM   10197 C  CD1 . TYR D 1 207 ? 82.520  50.413 105.883 1.00 15.52 ? 225  TYR J CD1 1 
ATOM   10198 C  CD2 . TYR D 1 207 ? 81.549  51.004 108.001 1.00 15.51 ? 225  TYR J CD2 1 
ATOM   10199 C  CE1 . TYR D 1 207 ? 82.949  49.194 106.413 1.00 15.25 ? 225  TYR J CE1 1 
ATOM   10200 C  CE2 . TYR D 1 207 ? 81.978  49.789 108.538 1.00 15.14 ? 225  TYR J CE2 1 
ATOM   10201 C  CZ  . TYR D 1 207 ? 82.676  48.893 107.739 1.00 15.61 ? 225  TYR J CZ  1 
ATOM   10202 O  OH  . TYR D 1 207 ? 83.090  47.692 108.265 1.00 15.18 ? 225  TYR J OH  1 
ATOM   10203 N  N   . GLY D 1 208 ? 79.470  54.000 103.643 1.00 16.38 ? 226  GLY J N   1 
ATOM   10204 C  CA  . GLY D 1 208 ? 78.892  55.174 102.984 1.00 16.84 ? 226  GLY J CA  1 
ATOM   10205 C  C   . GLY D 1 208 ? 77.384  55.249 103.098 1.00 17.29 ? 226  GLY J C   1 
ATOM   10206 O  O   . GLY D 1 208 ? 76.823  56.337 103.232 1.00 17.57 ? 226  GLY J O   1 
ATOM   10207 N  N   . SER D 1 209 ? 76.738  54.085 103.067 1.00 17.37 ? 227  SER J N   1 
ATOM   10208 C  CA  . SER D 1 209 ? 75.284  53.981 103.151 1.00 18.15 ? 227  SER J CA  1 
ATOM   10209 C  C   . SER D 1 209 ? 74.722  54.135 104.566 1.00 17.97 ? 227  SER J C   1 
ATOM   10210 O  O   . SER D 1 209 ? 73.509  54.229 104.736 1.00 18.22 ? 227  SER J O   1 
ATOM   10211 C  CB  . SER D 1 209 ? 74.829  52.640 102.572 1.00 18.41 ? 227  SER J CB  1 
ATOM   10212 O  OG  . SER D 1 209 ? 75.589  51.575 103.122 1.00 19.90 ? 227  SER J OG  1 
ATOM   10213 N  N   . SER D 1 210 ? 75.599  54.174 105.569 1.00 17.73 ? 228  SER J N   1 
ATOM   10214 C  CA  . SER D 1 210 ? 75.181  54.197 106.970 1.00 17.62 ? 228  SER J CA  1 
ATOM   10215 C  C   . SER D 1 210 ? 75.158  55.610 107.552 1.00 17.53 ? 228  SER J C   1 
ATOM   10216 O  O   . SER D 1 210 ? 74.573  55.836 108.618 1.00 17.56 ? 228  SER J O   1 
ATOM   10217 C  CB  . SER D 1 210 ? 76.086  53.284 107.814 1.00 17.44 ? 228  SER J CB  1 
ATOM   10218 O  OG  . SER D 1 210 ? 77.270  53.958 108.211 1.00 18.34 ? 228  SER J OG  1 
ATOM   10219 N  N   . LEU D 1 211 ? 75.785  56.549 106.843 1.00 17.29 ? 229  LEU J N   1 
ATOM   10220 C  CA  . LEU D 1 211 ? 75.901  57.939 107.289 1.00 17.52 ? 229  LEU J CA  1 
ATOM   10221 C  C   . LEU D 1 211 ? 74.567  58.643 107.524 1.00 17.64 ? 229  LEU J C   1 
ATOM   10222 O  O   . LEU D 1 211 ? 74.448  59.434 108.467 1.00 17.76 ? 229  LEU J O   1 
ATOM   10223 C  CB  . LEU D 1 211 ? 76.744  58.765 106.304 1.00 17.58 ? 229  LEU J CB  1 
ATOM   10224 C  CG  . LEU D 1 211 ? 78.231  58.461 106.129 1.00 17.43 ? 229  LEU J CG  1 
ATOM   10225 C  CD1 . LEU D 1 211 ? 78.904  59.579 105.353 1.00 17.72 ? 229  LEU J CD1 1 
ATOM   10226 C  CD2 . LEU D 1 211 ? 78.901  58.290 107.474 1.00 19.64 ? 229  LEU J CD2 1 
ATOM   10227 N  N   . PHE D 1 212 ? 73.587  58.369 106.660 1.00 17.70 ? 230  PHE J N   1 
ATOM   10228 C  CA  . PHE D 1 212 ? 72.259  58.980 106.746 1.00 17.76 ? 230  PHE J CA  1 
ATOM   10229 C  C   . PHE D 1 212 ? 71.572  58.605 108.048 1.00 18.10 ? 230  PHE J C   1 
ATOM   10230 O  O   . PHE D 1 212 ? 71.046  59.471 108.741 1.00 17.78 ? 230  PHE J O   1 
ATOM   10231 C  CB  . PHE D 1 212 ? 71.368  58.588 105.551 1.00 17.42 ? 230  PHE J CB  1 
ATOM   10232 C  CG  . PHE D 1 212 ? 70.113  59.423 105.433 1.00 17.60 ? 230  PHE J CG  1 
ATOM   10233 C  CD1 . PHE D 1 212 ? 68.947  59.055 106.104 1.00 18.19 ? 230  PHE J CD1 1 
ATOM   10234 C  CD2 . PHE D 1 212 ? 70.108  60.589 104.671 1.00 16.90 ? 230  PHE J CD2 1 
ATOM   10235 C  CE1 . PHE D 1 212 ? 67.791  59.832 106.012 1.00 18.94 ? 230  PHE J CE1 1 
ATOM   10236 C  CE2 . PHE D 1 212 ? 68.964  61.374 104.561 1.00 17.48 ? 230  PHE J CE2 1 
ATOM   10237 C  CZ  . PHE D 1 212 ? 67.798  61.000 105.232 1.00 18.81 ? 230  PHE J CZ  1 
ATOM   10238 N  N   . ALA D 1 213 ? 71.584  57.313 108.372 1.00 18.65 ? 231  ALA J N   1 
ATOM   10239 C  CA  . ALA D 1 213 ? 71.015  56.828 109.629 1.00 19.39 ? 231  ALA J CA  1 
ATOM   10240 C  C   . ALA D 1 213 ? 71.756  57.403 110.840 1.00 20.02 ? 231  ALA J C   1 
ATOM   10241 O  O   . ALA D 1 213 ? 71.131  57.707 111.861 1.00 20.13 ? 231  ALA J O   1 
ATOM   10242 C  CB  . ALA D 1 213 ? 71.006  55.303 109.661 1.00 18.97 ? 231  ALA J CB  1 
ATOM   10243 N  N   . GLN D 1 214 ? 73.076  57.571 110.712 1.00 20.48 ? 232  GLN J N   1 
ATOM   10244 C  CA  . GLN D 1 214 ? 73.896  58.163 111.773 1.00 21.52 ? 232  GLN J CA  1 
ATOM   10245 C  C   . GLN D 1 214 ? 73.582  59.641 112.027 1.00 21.95 ? 232  GLN J C   1 
ATOM   10246 O  O   . GLN D 1 214 ? 73.600  60.089 113.177 1.00 22.03 ? 232  GLN J O   1 
ATOM   10247 C  CB  . GLN D 1 214 ? 75.395  57.950 111.499 1.00 21.42 ? 232  GLN J CB  1 
ATOM   10248 C  CG  . GLN D 1 214 ? 76.357  58.683 112.445 1.00 22.51 ? 232  GLN J CG  1 
ATOM   10249 C  CD  . GLN D 1 214 ? 76.246  58.241 113.907 1.00 24.35 ? 232  GLN J CD  1 
ATOM   10250 O  OE1 . GLN D 1 214 ? 75.803  57.133 114.205 1.00 25.24 ? 232  GLN J OE1 1 
ATOM   10251 N  NE2 . GLN D 1 214 ? 76.656  59.116 114.823 1.00 24.86 ? 232  GLN J NE2 1 
ATOM   10252 N  N   . CYS D 1 215 ? 73.304  60.390 110.960 1.00 22.78 ? 233  CYS J N   1 
ATOM   10253 C  CA  . CYS D 1 215 ? 72.893  61.790 111.084 1.00 23.53 ? 233  CYS J CA  1 
ATOM   10254 C  C   . CYS D 1 215 ? 71.538  61.923 111.769 1.00 23.97 ? 233  CYS J C   1 
ATOM   10255 O  O   . CYS D 1 215 ? 71.362  62.759 112.658 1.00 24.20 ? 233  CYS J O   1 
ATOM   10256 C  CB  . CYS D 1 215 ? 72.866  62.478 109.720 1.00 23.74 ? 233  CYS J CB  1 
ATOM   10257 S  SG  . CYS D 1 215 ? 74.503  62.865 109.077 1.00 25.05 ? 233  CYS J SG  1 
ATOM   10258 N  N   . GLU D 1 216 ? 70.589  61.094 111.350 1.00 24.56 ? 234  GLU J N   1 
ATOM   10259 C  CA  . GLU D 1 216 ? 69.273  61.023 111.973 1.00 25.31 ? 234  GLU J CA  1 
ATOM   10260 C  C   . GLU D 1 216 ? 69.392  60.626 113.453 1.00 25.64 ? 234  GLU J C   1 
ATOM   10261 O  O   . GLU D 1 216 ? 68.709  61.184 114.314 1.00 25.51 ? 234  GLU J O   1 
ATOM   10262 C  CB  . GLU D 1 216 ? 68.401  60.033 111.202 1.00 25.48 ? 234  GLU J CB  1 
ATOM   10263 C  CG  . GLU D 1 216 ? 67.023  59.801 111.786 1.00 26.68 ? 234  GLU J CG  1 
ATOM   10264 C  CD  . GLU D 1 216 ? 66.155  58.982 110.863 1.00 28.47 ? 234  GLU J CD  1 
ATOM   10265 O  OE1 . GLU D 1 216 ? 65.880  57.809 111.196 1.00 29.57 ? 234  GLU J OE1 1 
ATOM   10266 O  OE2 . GLU D 1 216 ? 65.769  59.506 109.794 1.00 29.08 ? 234  GLU J OE2 1 
ATOM   10267 N  N   . ASP D 1 217 ? 70.262  59.657 113.723 1.00 25.92 ? 235  ASP J N   1 
ATOM   10268 C  CA  . ASP D 1 217 ? 70.655  59.275 115.074 1.00 26.49 ? 235  ASP J CA  1 
ATOM   10269 C  C   . ASP D 1 217 ? 71.072  60.488 115.932 1.00 26.31 ? 235  ASP J C   1 
ATOM   10270 O  O   . ASP D 1 217 ? 70.529  60.705 117.019 1.00 25.78 ? 235  ASP J O   1 
ATOM   10271 C  CB  . ASP D 1 217 ? 71.771  58.234 114.977 1.00 26.89 ? 235  ASP J CB  1 
ATOM   10272 C  CG  . ASP D 1 217 ? 72.706  58.255 116.157 1.00 30.57 ? 235  ASP J CG  1 
ATOM   10273 O  OD1 . ASP D 1 217 ? 73.803  58.866 116.056 1.00 34.62 ? 235  ASP J OD1 1 
ATOM   10274 O  OD2 . ASP D 1 217 ? 72.350  57.658 117.191 1.00 34.83 ? 235  ASP J OD2 1 
ATOM   10275 N  N   . VAL D 1 218 ? 72.021  61.270 115.425 1.00 26.38 ? 236  VAL J N   1 
ATOM   10276 C  CA  . VAL D 1 218 ? 72.519  62.466 116.106 1.00 26.92 ? 236  VAL J CA  1 
ATOM   10277 C  C   . VAL D 1 218 ? 71.422  63.531 116.283 1.00 27.23 ? 236  VAL J C   1 
ATOM   10278 O  O   . VAL D 1 218 ? 71.338  64.165 117.344 1.00 27.44 ? 236  VAL J O   1 
ATOM   10279 C  CB  . VAL D 1 218 ? 73.768  63.055 115.382 1.00 26.87 ? 236  VAL J CB  1 
ATOM   10280 C  CG1 . VAL D 1 218 ? 74.145  64.428 115.936 1.00 27.61 ? 236  VAL J CG1 1 
ATOM   10281 C  CG2 . VAL D 1 218 ? 74.952  62.114 115.507 1.00 27.41 ? 236  VAL J CG2 1 
ATOM   10282 N  N   . ASP D 1 219 ? 70.581  63.710 115.260 1.00 27.31 ? 237  ASP J N   1 
ATOM   10283 C  CA  . ASP D 1 219 ? 69.469  64.678 115.316 1.00 27.62 ? 237  ASP J CA  1 
ATOM   10284 C  C   . ASP D 1 219 ? 68.490  64.370 116.445 1.00 27.30 ? 237  ASP J C   1 
ATOM   10285 O  O   . ASP D 1 219 ? 67.753  65.251 116.903 1.00 27.20 ? 237  ASP J O   1 
ATOM   10286 C  CB  . ASP D 1 219 ? 68.707  64.733 113.985 1.00 27.74 ? 237  ASP J CB  1 
ATOM   10287 C  CG  . ASP D 1 219 ? 69.414  65.571 112.932 1.00 29.48 ? 237  ASP J CG  1 
ATOM   10288 O  OD1 . ASP D 1 219 ? 68.920  65.616 111.782 1.00 31.24 ? 237  ASP J OD1 1 
ATOM   10289 O  OD2 . ASP D 1 219 ? 70.461  66.185 113.245 1.00 30.65 ? 237  ASP J OD2 1 
ATOM   10290 N  N   . ASN D 1 220 ? 68.483  63.112 116.878 1.00 26.79 ? 238  ASN J N   1 
ATOM   10291 C  CA  . ASN D 1 220 ? 67.611  62.673 117.953 1.00 26.24 ? 238  ASN J CA  1 
ATOM   10292 C  C   . ASN D 1 220 ? 68.366  62.425 119.257 1.00 25.64 ? 238  ASN J C   1 
ATOM   10293 O  O   . ASN D 1 220 ? 67.869  61.732 120.143 1.00 25.85 ? 238  ASN J O   1 
ATOM   10294 C  CB  . ASN D 1 220 ? 66.813  61.441 117.519 1.00 26.22 ? 238  ASN J CB  1 
ATOM   10295 C  CG  . ASN D 1 220 ? 65.798  61.762 116.434 1.00 26.72 ? 238  ASN J CG  1 
ATOM   10296 O  OD1 . ASN D 1 220 ? 66.069  61.596 115.243 1.00 27.40 ? 238  ASN J OD1 1 
ATOM   10297 N  ND2 . ASN D 1 220 ? 64.628  62.236 116.841 1.00 25.86 ? 238  ASN J ND2 1 
ATOM   10298 N  N   . GLY D 1 221 ? 69.566  62.995 119.357 1.00 25.17 ? 239  GLY J N   1 
ATOM   10299 C  CA  . GLY D 1 221 ? 70.372  62.962 120.588 1.00 24.56 ? 239  GLY J CA  1 
ATOM   10300 C  C   . GLY D 1 221 ? 71.000  61.621 120.933 1.00 24.11 ? 239  GLY J C   1 
ATOM   10301 O  O   . GLY D 1 221 ? 71.317  61.353 122.093 1.00 24.24 ? 239  GLY J O   1 
ATOM   10302 N  N   . CYS D 1 222 ? 71.180  60.779 119.921 1.00 23.40 ? 240  CYS J N   1 
ATOM   10303 C  CA  . CYS D 1 222 ? 71.837  59.490 120.085 1.00 22.67 ? 240  CYS J CA  1 
ATOM   10304 C  C   . CYS D 1 222 ? 73.222  59.575 119.477 1.00 22.20 ? 240  CYS J C   1 
ATOM   10305 O  O   . CYS D 1 222 ? 73.468  60.411 118.611 1.00 22.26 ? 240  CYS J O   1 
ATOM   10306 C  CB  . CYS D 1 222 ? 71.031  58.384 119.408 1.00 22.50 ? 240  CYS J CB  1 
ATOM   10307 S  SG  . CYS D 1 222 ? 69.424  58.103 120.137 1.00 22.68 ? 240  CYS J SG  1 
ATOM   10308 N  N   . GLN D 1 223 ? 74.121  58.710 119.937 1.00 21.36 ? 241  GLN J N   1 
ATOM   10309 C  CA  . GLN D 1 223 ? 75.512  58.725 119.501 1.00 20.76 ? 241  GLN J CA  1 
ATOM   10310 C  C   . GLN D 1 223 ? 75.786  57.711 118.384 1.00 20.32 ? 241  GLN J C   1 
ATOM   10311 O  O   . GLN D 1 223 ? 76.645  57.935 117.533 1.00 20.46 ? 241  GLN J O   1 
ATOM   10312 C  CB  . GLN D 1 223 ? 76.446  58.472 120.695 1.00 20.86 ? 241  GLN J CB  1 
ATOM   10313 C  CG  . GLN D 1 223 ? 76.500  59.611 121.733 1.00 20.47 ? 241  GLN J CG  1 
ATOM   10314 C  CD  . GLN D 1 223 ? 75.266  59.684 122.621 1.00 21.53 ? 241  GLN J CD  1 
ATOM   10315 O  OE1 . GLN D 1 223 ? 74.795  58.673 123.139 1.00 21.09 ? 241  GLN J OE1 1 
ATOM   10316 N  NE2 . GLN D 1 223 ? 74.738  60.891 122.802 1.00 21.89 ? 241  GLN J NE2 1 
ATOM   10317 N  N   . GLN D 1 224 ? 75.067  56.589 118.405 1.00 19.44 ? 242  GLN J N   1 
ATOM   10318 C  CA  . GLN D 1 224 ? 75.270  55.520 117.433 1.00 18.66 ? 242  GLN J CA  1 
ATOM   10319 C  C   . GLN D 1 224 ? 73.934  54.911 116.993 1.00 17.80 ? 242  GLN J C   1 
ATOM   10320 O  O   . GLN D 1 224 ? 72.892  55.133 117.621 1.00 17.23 ? 242  GLN J O   1 
ATOM   10321 C  CB  . GLN D 1 224 ? 76.210  54.434 117.988 1.00 18.82 ? 242  GLN J CB  1 
ATOM   10322 C  CG  . GLN D 1 224 ? 77.683  54.852 118.142 1.00 20.02 ? 242  GLN J CG  1 
ATOM   10323 C  CD  . GLN D 1 224 ? 78.425  54.992 116.818 1.00 21.82 ? 242  GLN J CD  1 
ATOM   10324 O  OE1 . GLN D 1 224 ? 78.907  54.009 116.257 1.00 24.50 ? 242  GLN J OE1 1 
ATOM   10325 N  NE2 . GLN D 1 224 ? 78.542  56.224 116.327 1.00 23.45 ? 242  GLN J NE2 1 
ATOM   10326 N  N   . VAL D 1 225 ? 73.982  54.160 115.897 1.00 16.83 ? 243  VAL J N   1 
ATOM   10327 C  CA  . VAL D 1 225 ? 72.813  53.486 115.351 1.00 15.81 ? 243  VAL J CA  1 
ATOM   10328 C  C   . VAL D 1 225 ? 72.795  52.034 115.834 1.00 15.56 ? 243  VAL J C   1 
ATOM   10329 O  O   . VAL D 1 225 ? 73.831  51.363 115.838 1.00 15.10 ? 243  VAL J O   1 
ATOM   10330 C  CB  . VAL D 1 225 ? 72.815  53.525 113.795 1.00 15.86 ? 243  VAL J CB  1 
ATOM   10331 C  CG1 . VAL D 1 225 ? 71.591  52.818 113.225 1.00 15.15 ? 243  VAL J CG1 1 
ATOM   10332 C  CG2 . VAL D 1 225 ? 72.884  54.956 113.293 1.00 15.41 ? 243  VAL J CG2 1 
ATOM   10333 N  N   . LEU D 1 226 ? 71.628  51.568 116.274 1.00 14.92 ? 244  LEU J N   1 
ATOM   10334 C  CA  . LEU D 1 226 ? 71.429  50.145 116.519 1.00 14.65 ? 244  LEU J CA  1 
ATOM   10335 C  C   . LEU D 1 226 ? 70.880  49.535 115.224 1.00 14.18 ? 244  LEU J C   1 
ATOM   10336 O  O   . LEU D 1 226 ? 69.789  49.900 114.779 1.00 13.95 ? 244  LEU J O   1 
ATOM   10337 C  CB  . LEU D 1 226 ? 70.480  49.902 117.715 1.00 14.59 ? 244  LEU J CB  1 
ATOM   10338 C  CG  . LEU D 1 226 ? 70.084  48.439 117.991 1.00 14.88 ? 244  LEU J CG  1 
ATOM   10339 C  CD1 . LEU D 1 226 ? 71.320  47.574 118.246 1.00 14.49 ? 244  LEU J CD1 1 
ATOM   10340 C  CD2 . LEU D 1 226 ? 69.089  48.309 119.155 1.00 14.33 ? 244  LEU J CD2 1 
ATOM   10341 N  N   . TRP D 1 227 ? 71.655  48.635 114.618 1.00 13.86 ? 245  TRP J N   1 
ATOM   10342 C  CA  . TRP D 1 227 ? 71.330  48.068 113.311 1.00 14.15 ? 245  TRP J CA  1 
ATOM   10343 C  C   . TRP D 1 227 ? 70.385  46.879 113.415 1.00 14.63 ? 245  TRP J C   1 
ATOM   10344 O  O   . TRP D 1 227 ? 70.735  45.843 113.974 1.00 14.78 ? 245  TRP J O   1 
ATOM   10345 C  CB  . TRP D 1 227 ? 72.601  47.692 112.529 1.00 13.49 ? 245  TRP J CB  1 
ATOM   10346 C  CG  . TRP D 1 227 ? 73.435  48.896 112.193 1.00 13.08 ? 245  TRP J CG  1 
ATOM   10347 C  CD1 . TRP D 1 227 ? 74.614  49.274 112.783 1.00 12.06 ? 245  TRP J CD1 1 
ATOM   10348 C  CD2 . TRP D 1 227 ? 73.135  49.904 111.215 1.00 11.76 ? 245  TRP J CD2 1 
ATOM   10349 N  NE1 . TRP D 1 227 ? 75.065  50.445 112.223 1.00 11.28 ? 245  TRP J NE1 1 
ATOM   10350 C  CE2 . TRP D 1 227 ? 74.179  50.852 111.259 1.00 11.00 ? 245  TRP J CE2 1 
ATOM   10351 C  CE3 . TRP D 1 227 ? 72.083  50.094 110.300 1.00 11.26 ? 245  TRP J CE3 1 
ATOM   10352 C  CZ2 . TRP D 1 227 ? 74.208  51.977 110.421 1.00 11.06 ? 245  TRP J CZ2 1 
ATOM   10353 C  CZ3 . TRP D 1 227 ? 72.113  51.214 109.471 1.00 11.52 ? 245  TRP J CZ3 1 
ATOM   10354 C  CH2 . TRP D 1 227 ? 73.172  52.139 109.537 1.00 11.16 ? 245  TRP J CH2 1 
ATOM   10355 N  N   . LEU D 1 228 ? 69.191  47.046 112.854 1.00 15.21 ? 246  LEU J N   1 
ATOM   10356 C  CA  . LEU D 1 228 ? 68.144  46.027 112.905 1.00 15.92 ? 246  LEU J CA  1 
ATOM   10357 C  C   . LEU D 1 228 ? 68.023  45.307 111.571 1.00 16.17 ? 246  LEU J C   1 
ATOM   10358 O  O   . LEU D 1 228 ? 68.303  45.885 110.525 1.00 16.67 ? 246  LEU J O   1 
ATOM   10359 C  CB  . LEU D 1 228 ? 66.801  46.658 113.300 1.00 15.56 ? 246  LEU J CB  1 
ATOM   10360 C  CG  . LEU D 1 228 ? 66.755  47.431 114.620 1.00 15.36 ? 246  LEU J CG  1 
ATOM   10361 C  CD1 . LEU D 1 228 ? 65.398  48.093 114.784 1.00 15.38 ? 246  LEU J CD1 1 
ATOM   10362 C  CD2 . LEU D 1 228 ? 67.061  46.529 115.814 1.00 15.04 ? 246  LEU J CD2 1 
ATOM   10363 N  N   . TYR D 1 229 ? 67.606  44.048 111.614 1.00 16.95 ? 247  TYR J N   1 
ATOM   10364 C  CA  . TYR D 1 229 ? 67.512  43.228 110.409 1.00 17.68 ? 247  TYR J CA  1 
ATOM   10365 C  C   . TYR D 1 229 ? 66.397  42.203 110.466 1.00 18.35 ? 247  TYR J C   1 
ATOM   10366 O  O   . TYR D 1 229 ? 66.218  41.513 111.474 1.00 18.01 ? 247  TYR J O   1 
ATOM   10367 C  CB  . TYR D 1 229 ? 68.827  42.492 110.157 1.00 17.74 ? 247  TYR J CB  1 
ATOM   10368 C  CG  . TYR D 1 229 ? 68.880  41.753 108.837 1.00 18.48 ? 247  TYR J CG  1 
ATOM   10369 C  CD1 . TYR D 1 229 ? 69.095  42.444 107.646 1.00 18.48 ? 247  TYR J CD1 1 
ATOM   10370 C  CD2 . TYR D 1 229 ? 68.729  40.367 108.777 1.00 19.81 ? 247  TYR J CD2 1 
ATOM   10371 C  CE1 . TYR D 1 229 ? 69.158  41.788 106.441 1.00 19.71 ? 247  TYR J CE1 1 
ATOM   10372 C  CE2 . TYR D 1 229 ? 68.790  39.691 107.556 1.00 19.15 ? 247  TYR J CE2 1 
ATOM   10373 C  CZ  . TYR D 1 229 ? 69.007  40.414 106.397 1.00 20.21 ? 247  TYR J CZ  1 
ATOM   10374 O  OH  . TYR D 1 229 ? 69.076  39.778 105.173 1.00 23.25 ? 247  TYR J OH  1 
ATOM   10375 N  N   . GLY D 1 230 ? 65.684  42.081 109.352 1.00 19.51 ? 248  GLY J N   1 
ATOM   10376 C  CA  . GLY D 1 230 ? 64.636  41.081 109.199 1.00 20.96 ? 248  GLY J CA  1 
ATOM   10377 C  C   . GLY D 1 230 ? 63.313  41.515 109.796 1.00 22.14 ? 248  GLY J C   1 
ATOM   10378 O  O   . GLY D 1 230 ? 63.229  42.555 110.463 1.00 21.94 ? 248  GLY J O   1 
ATOM   10379 N  N   . ARG D 1 231 ? 62.283  40.704 109.559 1.00 23.21 ? 249  ARG J N   1 
ATOM   10380 C  CA  . ARG D 1 231 ? 60.930  40.987 110.038 1.00 24.89 ? 249  ARG J CA  1 
ATOM   10381 C  C   . ARG D 1 231 ? 60.859  40.874 111.558 1.00 24.79 ? 249  ARG J C   1 
ATOM   10382 O  O   . ARG D 1 231 ? 60.062  41.554 112.191 1.00 25.00 ? 249  ARG J O   1 
ATOM   10383 C  CB  . ARG D 1 231 ? 59.910  40.055 109.367 1.00 25.27 ? 249  ARG J CB  1 
ATOM   10384 C  CG  . ARG D 1 231 ? 60.052  40.006 107.847 1.00 28.79 ? 249  ARG J CG  1 
ATOM   10385 C  CD  . ARG D 1 231 ? 58.811  39.485 107.128 1.00 33.96 ? 249  ARG J CD  1 
ATOM   10386 N  NE  . ARG D 1 231 ? 59.113  39.232 105.714 1.00 38.54 ? 249  ARG J NE  1 
ATOM   10387 C  CZ  . ARG D 1 231 ? 58.218  38.889 104.787 1.00 40.74 ? 249  ARG J CZ  1 
ATOM   10388 N  NH1 . ARG D 1 231 ? 58.612  38.683 103.533 1.00 41.59 ? 249  ARG J NH1 1 
ATOM   10389 N  NH2 . ARG D 1 231 ? 56.931  38.753 105.103 1.00 41.24 ? 249  ARG J NH2 1 
ATOM   10390 N  N   . ASP D 1 232 ? 61.723  40.026 112.116 1.00 25.24 ? 250  ASP J N   1 
ATOM   10391 C  CA  . ASP D 1 232 ? 61.872  39.814 113.563 1.00 25.79 ? 250  ASP J CA  1 
ATOM   10392 C  C   . ASP D 1 232 ? 62.599  40.946 114.299 1.00 25.20 ? 250  ASP J C   1 
ATOM   10393 O  O   . ASP D 1 232 ? 62.626  40.962 115.533 1.00 25.29 ? 250  ASP J O   1 
ATOM   10394 C  CB  . ASP D 1 232 ? 62.633  38.503 113.815 1.00 26.31 ? 250  ASP J CB  1 
ATOM   10395 C  CG  . ASP D 1 232 ? 61.751  37.277 113.686 1.00 29.10 ? 250  ASP J CG  1 
ATOM   10396 O  OD1 . ASP D 1 232 ? 60.506  37.433 113.633 1.00 31.39 ? 250  ASP J OD1 1 
ATOM   10397 O  OD2 . ASP D 1 232 ? 62.307  36.148 113.650 1.00 33.10 ? 250  ASP J OD2 1 
ATOM   10398 N  N   . HIS D 1 233 ? 63.192  41.872 113.540 1.00 24.40 ? 251  HIS J N   1 
ATOM   10399 C  CA  . HIS D 1 233 ? 63.997  42.974 114.083 1.00 23.56 ? 251  HIS J CA  1 
ATOM   10400 C  C   . HIS D 1 233 ? 65.132  42.474 114.971 1.00 22.72 ? 251  HIS J C   1 
ATOM   10401 O  O   . HIS D 1 233 ? 65.223  42.821 116.148 1.00 22.37 ? 251  HIS J O   1 
ATOM   10402 C  CB  . HIS D 1 233 ? 63.134  44.019 114.807 1.00 23.74 ? 251  HIS J CB  1 
ATOM   10403 C  CG  . HIS D 1 233 ? 61.949  44.477 114.017 1.00 24.56 ? 251  HIS J CG  1 
ATOM   10404 N  ND1 . HIS D 1 233 ? 60.651  44.272 114.438 1.00 25.28 ? 251  HIS J ND1 1 
ATOM   10405 C  CD2 . HIS D 1 233 ? 61.861  45.111 112.824 1.00 24.58 ? 251  HIS J CD2 1 
ATOM   10406 C  CE1 . HIS D 1 233 ? 59.816  44.775 113.546 1.00 25.29 ? 251  HIS J CE1 1 
ATOM   10407 N  NE2 . HIS D 1 233 ? 60.525  45.288 112.556 1.00 25.28 ? 251  HIS J NE2 1 
ATOM   10408 N  N   . GLN D 1 234 ? 65.984  41.641 114.377 1.00 21.85 ? 252  GLN J N   1 
ATOM   10409 C  CA  . GLN D 1 234 ? 67.201  41.151 115.005 1.00 21.19 ? 252  GLN J CA  1 
ATOM   10410 C  C   . GLN D 1 234 ? 68.105  42.335 115.319 1.00 20.47 ? 252  GLN J C   1 
ATOM   10411 O  O   . GLN D 1 234 ? 68.270  43.220 114.487 1.00 20.66 ? 252  GLN J O   1 
ATOM   10412 C  CB  . GLN D 1 234 ? 67.935  40.189 114.062 1.00 21.09 ? 252  GLN J CB  1 
ATOM   10413 C  CG  . GLN D 1 234 ? 67.225  38.860 113.827 1.00 22.24 ? 252  GLN J CG  1 
ATOM   10414 C  CD  . GLN D 1 234 ? 67.977  37.920 112.883 1.00 24.02 ? 252  GLN J CD  1 
ATOM   10415 O  OE1 . GLN D 1 234 ? 67.558  36.782 112.680 1.00 26.03 ? 252  GLN J OE1 1 
ATOM   10416 N  NE2 . GLN D 1 234 ? 69.090  38.386 112.311 1.00 22.74 ? 252  GLN J NE2 1 
ATOM   10417 N  N   . ILE D 1 235 ? 68.663  42.364 116.524 1.00 19.74 ? 253  ILE J N   1 
ATOM   10418 C  CA  . ILE D 1 235 ? 69.685  43.351 116.859 1.00 19.17 ? 253  ILE J CA  1 
ATOM   10419 C  C   . ILE D 1 235 ? 71.023  42.770 116.418 1.00 18.79 ? 253  ILE J C   1 
ATOM   10420 O  O   . ILE D 1 235 ? 71.386  41.661 116.807 1.00 18.91 ? 253  ILE J O   1 
ATOM   10421 C  CB  . ILE D 1 235 ? 69.657  43.780 118.360 1.00 19.07 ? 253  ILE J CB  1 
ATOM   10422 C  CG1 . ILE D 1 235 ? 69.979  42.614 119.298 1.00 19.04 ? 253  ILE J CG1 1 
ATOM   10423 C  CG2 . ILE D 1 235 ? 68.306  44.407 118.701 1.00 18.83 ? 253  ILE J CG2 1 
ATOM   10424 C  CD1 . ILE D 1 235 ? 69.864  42.944 120.798 1.00 19.21 ? 253  ILE J CD1 1 
ATOM   10425 N  N   . THR D 1 236 ? 71.727  43.490 115.557 1.00 18.48 ? 254  THR J N   1 
ATOM   10426 C  CA  . THR D 1 236 ? 72.878  42.908 114.868 1.00 18.20 ? 254  THR J CA  1 
ATOM   10427 C  C   . THR D 1 236 ? 74.212  43.528 115.292 1.00 18.27 ? 254  THR J C   1 
ATOM   10428 O  O   . THR D 1 236 ? 75.102  42.821 115.763 1.00 18.19 ? 254  THR J O   1 
ATOM   10429 C  CB  . THR D 1 236 ? 72.719  42.955 113.318 1.00 18.26 ? 254  THR J CB  1 
ATOM   10430 O  OG1 . THR D 1 236 ? 72.903  44.294 112.842 1.00 17.08 ? 254  THR J OG1 1 
ATOM   10431 C  CG2 . THR D 1 236 ? 71.345  42.432 112.888 1.00 18.33 ? 254  THR J CG2 1 
ATOM   10432 N  N   . GLU D 1 237 ? 74.342  44.841 115.108 1.00 18.12 ? 255  GLU J N   1 
ATOM   10433 C  CA  . GLU D 1 237 ? 75.567  45.573 115.439 1.00 18.13 ? 255  GLU J CA  1 
ATOM   10434 C  C   . GLU D 1 237 ? 75.230  46.947 115.998 1.00 17.67 ? 255  GLU J C   1 
ATOM   10435 O  O   . GLU D 1 237 ? 74.132  47.458 115.779 1.00 17.31 ? 255  GLU J O   1 
ATOM   10436 C  CB  . GLU D 1 237 ? 76.479  45.707 114.207 1.00 18.15 ? 255  GLU J CB  1 
ATOM   10437 C  CG  . GLU D 1 237 ? 76.953  44.363 113.648 1.00 19.84 ? 255  GLU J CG  1 
ATOM   10438 C  CD  . GLU D 1 237 ? 78.323  44.422 113.034 1.00 21.70 ? 255  GLU J CD  1 
ATOM   10439 O  OE1 . GLU D 1 237 ? 79.164  45.202 113.524 1.00 25.08 ? 255  GLU J OE1 1 
ATOM   10440 O  OE2 . GLU D 1 237 ? 78.573  43.682 112.067 1.00 22.26 ? 255  GLU J OE2 1 
ATOM   10441 N  N   . VAL D 1 238 ? 76.175  47.529 116.734 1.00 17.51 ? 256  VAL J N   1 
ATOM   10442 C  CA  . VAL D 1 238 ? 76.021  48.876 117.286 1.00 17.51 ? 256  VAL J CA  1 
ATOM   10443 C  C   . VAL D 1 238 ? 76.994  49.827 116.590 1.00 17.01 ? 256  VAL J C   1 
ATOM   10444 O  O   . VAL D 1 238 ? 78.196  49.820 116.879 1.00 17.02 ? 256  VAL J O   1 
ATOM   10445 C  CB  . VAL D 1 238 ? 76.280  48.910 118.820 1.00 17.61 ? 256  VAL J CB  1 
ATOM   10446 C  CG1 . VAL D 1 238 ? 76.185  50.336 119.350 1.00 18.12 ? 256  VAL J CG1 1 
ATOM   10447 C  CG2 . VAL D 1 238 ? 75.311  48.021 119.562 1.00 18.66 ? 256  VAL J CG2 1 
ATOM   10448 N  N   . GLY D 1 239 ? 76.473  50.636 115.675 1.00 16.71 ? 257  GLY J N   1 
ATOM   10449 C  CA  . GLY D 1 239 ? 77.303  51.515 114.858 1.00 16.41 ? 257  GLY J CA  1 
ATOM   10450 C  C   . GLY D 1 239 ? 78.310  50.684 114.087 1.00 16.43 ? 257  GLY J C   1 
ATOM   10451 O  O   . GLY D 1 239 ? 77.929  49.815 113.291 1.00 16.49 ? 257  GLY J O   1 
ATOM   10452 N  N   . THR D 1 240 ? 79.593  50.924 114.356 1.00 15.93 ? 258  THR J N   1 
ATOM   10453 C  CA  . THR D 1 240 ? 80.680  50.156 113.747 1.00 15.50 ? 258  THR J CA  1 
ATOM   10454 C  C   . THR D 1 240 ? 81.290  49.147 114.742 1.00 15.09 ? 258  THR J C   1 
ATOM   10455 O  O   . THR D 1 240 ? 82.470  48.809 114.654 1.00 15.08 ? 258  THR J O   1 
ATOM   10456 C  CB  . THR D 1 240 ? 81.796  51.096 113.213 1.00 15.77 ? 258  THR J CB  1 
ATOM   10457 O  OG1 . THR D 1 240 ? 82.297  51.907 114.286 1.00 15.71 ? 258  THR J OG1 1 
ATOM   10458 C  CG2 . THR D 1 240 ? 81.275  51.994 112.092 1.00 15.49 ? 258  THR J CG2 1 
ATOM   10459 N  N   . MET D 1 241 ? 80.473  48.672 115.679 1.00 14.65 ? 259  MET J N   1 
ATOM   10460 C  CA  . MET D 1 241 ? 80.905  47.753 116.735 1.00 14.28 ? 259  MET J CA  1 
ATOM   10461 C  C   . MET D 1 241 ? 80.043  46.491 116.770 1.00 13.98 ? 259  MET J C   1 
ATOM   10462 O  O   . MET D 1 241 ? 78.865  46.528 116.399 1.00 13.77 ? 259  MET J O   1 
ATOM   10463 C  CB  . MET D 1 241 ? 80.816  48.431 118.102 1.00 14.16 ? 259  MET J CB  1 
ATOM   10464 C  CG  . MET D 1 241 ? 81.846  49.517 118.360 1.00 14.93 ? 259  MET J CG  1 
ATOM   10465 S  SD  . MET D 1 241 ? 81.506  50.463 119.876 1.00 16.04 ? 259  MET J SD  1 
ATOM   10466 C  CE  . MET D 1 241 ? 80.153  51.510 119.342 1.00 15.91 ? 259  MET J CE  1 
ATOM   10467 N  N   . ASN D 1 242 ? 80.628  45.382 117.221 1.00 13.28 ? 260  ASN J N   1 
ATOM   10468 C  CA  . ASN D 1 242 ? 79.855  44.165 117.468 1.00 13.50 ? 260  ASN J CA  1 
ATOM   10469 C  C   . ASN D 1 242 ? 78.977  44.277 118.716 1.00 13.71 ? 260  ASN J C   1 
ATOM   10470 O  O   . ASN D 1 242 ? 79.311  45.013 119.647 1.00 13.63 ? 260  ASN J O   1 
ATOM   10471 C  CB  . ASN D 1 242 ? 80.767  42.943 117.540 1.00 13.17 ? 260  ASN J CB  1 
ATOM   10472 C  CG  . ASN D 1 242 ? 81.303  42.546 116.175 1.00 12.69 ? 260  ASN J CG  1 
ATOM   10473 O  OD1 . ASN D 1 242 ? 80.539  42.336 115.226 1.00 12.98 ? 260  ASN J OD1 1 
ATOM   10474 N  ND2 . ASN D 1 242 ? 82.610  42.455 116.064 1.00 10.78 ? 260  ASN J ND2 1 
ATOM   10475 N  N   . LEU D 1 243 ? 77.856  43.555 118.727 1.00 13.46 ? 261  LEU J N   1 
ATOM   10476 C  CA  . LEU D 1 243 ? 76.881  43.683 119.810 1.00 13.39 ? 261  LEU J CA  1 
ATOM   10477 C  C   . LEU D 1 243 ? 76.966  42.533 120.820 1.00 13.13 ? 261  LEU J C   1 
ATOM   10478 O  O   . LEU D 1 243 ? 76.907  41.365 120.444 1.00 12.31 ? 261  LEU J O   1 
ATOM   10479 C  CB  . LEU D 1 243 ? 75.458  43.802 119.236 1.00 13.67 ? 261  LEU J CB  1 
ATOM   10480 C  CG  . LEU D 1 243 ? 74.244  44.096 120.141 1.00 14.47 ? 261  LEU J CG  1 
ATOM   10481 C  CD1 . LEU D 1 243 ? 73.775  42.872 120.959 1.00 14.47 ? 261  LEU J CD1 1 
ATOM   10482 C  CD2 . LEU D 1 243 ? 74.536  45.260 121.058 1.00 17.14 ? 261  LEU J CD2 1 
ATOM   10483 N  N   . PHE D 1 244 ? 77.094  42.882 122.102 1.00 12.95 ? 262  PHE J N   1 
ATOM   10484 C  CA  . PHE D 1 244 ? 77.052  41.908 123.190 1.00 12.82 ? 262  PHE J CA  1 
ATOM   10485 C  C   . PHE D 1 244 ? 75.930  42.217 124.180 1.00 13.07 ? 262  PHE J C   1 
ATOM   10486 O  O   . PHE D 1 244 ? 75.724  43.369 124.563 1.00 12.83 ? 262  PHE J O   1 
ATOM   10487 C  CB  . PHE D 1 244 ? 78.400  41.843 123.927 1.00 12.59 ? 262  PHE J CB  1 
ATOM   10488 C  CG  . PHE D 1 244 ? 79.465  41.081 123.190 1.00 11.69 ? 262  PHE J CG  1 
ATOM   10489 C  CD1 . PHE D 1 244 ? 80.319  41.734 122.309 1.00 10.69 ? 262  PHE J CD1 1 
ATOM   10490 C  CD2 . PHE D 1 244 ? 79.618  39.706 123.383 1.00 11.29 ? 262  PHE J CD2 1 
ATOM   10491 C  CE1 . PHE D 1 244 ? 81.300  41.038 121.621 1.00 9.98  ? 262  PHE J CE1 1 
ATOM   10492 C  CE2 . PHE D 1 244 ? 80.600  39.000 122.703 1.00 10.22 ? 262  PHE J CE2 1 
ATOM   10493 C  CZ  . PHE D 1 244 ? 81.444  39.669 121.813 1.00 10.40 ? 262  PHE J CZ  1 
ATOM   10494 N  N   . LEU D 1 245 ? 75.218  41.175 124.593 1.00 13.54 ? 263  LEU J N   1 
ATOM   10495 C  CA  . LEU D 1 245 ? 74.130  41.296 125.556 1.00 14.57 ? 263  LEU J CA  1 
ATOM   10496 C  C   . LEU D 1 245 ? 74.397  40.340 126.716 1.00 14.93 ? 263  LEU J C   1 
ATOM   10497 O  O   . LEU D 1 245 ? 74.491  39.127 126.526 1.00 14.98 ? 263  LEU J O   1 
ATOM   10498 C  CB  . LEU D 1 245 ? 72.786  40.936 124.911 1.00 14.19 ? 263  LEU J CB  1 
ATOM   10499 C  CG  . LEU D 1 245 ? 71.453  41.623 125.278 1.00 15.69 ? 263  LEU J CG  1 
ATOM   10500 C  CD1 . LEU D 1 245 ? 70.382  40.571 125.367 1.00 15.58 ? 263  LEU J CD1 1 
ATOM   10501 C  CD2 . LEU D 1 245 ? 71.436  42.466 126.547 1.00 15.08 ? 263  LEU J CD2 1 
ATOM   10502 N  N   . TYR D 1 246 ? 74.516  40.901 127.912 1.00 15.53 ? 264  TYR J N   1 
ATOM   10503 C  CA  . TYR D 1 246 ? 74.760  40.119 129.116 1.00 16.08 ? 264  TYR J CA  1 
ATOM   10504 C  C   . TYR D 1 246 ? 73.462  40.129 129.909 1.00 16.61 ? 264  TYR J C   1 
ATOM   10505 O  O   . TYR D 1 246 ? 72.994  41.186 130.359 1.00 16.48 ? 264  TYR J O   1 
ATOM   10506 C  CB  . TYR D 1 246 ? 75.923  40.726 129.908 1.00 15.70 ? 264  TYR J CB  1 
ATOM   10507 C  CG  . TYR D 1 246 ? 76.281  40.033 131.204 1.00 16.33 ? 264  TYR J CG  1 
ATOM   10508 C  CD1 . TYR D 1 246 ? 76.325  38.641 131.292 1.00 16.37 ? 264  TYR J CD1 1 
ATOM   10509 C  CD2 . TYR D 1 246 ? 76.627  40.778 132.338 1.00 16.41 ? 264  TYR J CD2 1 
ATOM   10510 C  CE1 . TYR D 1 246 ? 76.670  38.009 132.478 1.00 17.13 ? 264  TYR J CE1 1 
ATOM   10511 C  CE2 . TYR D 1 246 ? 76.984  40.155 133.532 1.00 16.40 ? 264  TYR J CE2 1 
ATOM   10512 C  CZ  . TYR D 1 246 ? 76.999  38.771 133.594 1.00 17.41 ? 264  TYR J CZ  1 
ATOM   10513 O  OH  . TYR D 1 246 ? 77.337  38.135 134.770 1.00 17.61 ? 264  TYR J OH  1 
ATOM   10514 N  N   . TRP D 1 247 ? 72.866  38.953 130.056 1.00 17.00 ? 265  TRP J N   1 
ATOM   10515 C  CA  . TRP D 1 247 ? 71.505  38.880 130.566 1.00 17.99 ? 265  TRP J CA  1 
ATOM   10516 C  C   . TRP D 1 247 ? 71.186  37.534 131.201 1.00 18.82 ? 265  TRP J C   1 
ATOM   10517 O  O   . TRP D 1 247 ? 72.014  36.605 131.170 1.00 19.18 ? 265  TRP J O   1 
ATOM   10518 C  CB  . TRP D 1 247 ? 70.505  39.218 129.437 1.00 17.50 ? 265  TRP J CB  1 
ATOM   10519 C  CG  . TRP D 1 247 ? 70.355  38.166 128.349 1.00 17.52 ? 265  TRP J CG  1 
ATOM   10520 C  CD1 . TRP D 1 247 ? 71.243  37.174 128.018 1.00 17.65 ? 265  TRP J CD1 1 
ATOM   10521 C  CD2 . TRP D 1 247 ? 69.253  38.030 127.439 1.00 17.63 ? 265  TRP J CD2 1 
ATOM   10522 N  NE1 . TRP D 1 247 ? 70.752  36.421 126.979 1.00 17.48 ? 265  TRP J NE1 1 
ATOM   10523 C  CE2 . TRP D 1 247 ? 69.537  36.929 126.597 1.00 17.57 ? 265  TRP J CE2 1 
ATOM   10524 C  CE3 . TRP D 1 247 ? 68.053  38.733 127.253 1.00 17.46 ? 265  TRP J CE3 1 
ATOM   10525 C  CZ2 . TRP D 1 247 ? 68.662  36.511 125.585 1.00 16.72 ? 265  TRP J CZ2 1 
ATOM   10526 C  CZ3 . TRP D 1 247 ? 67.186  38.319 126.245 1.00 18.04 ? 265  TRP J CZ3 1 
ATOM   10527 C  CH2 . TRP D 1 247 ? 67.496  37.214 125.425 1.00 17.34 ? 265  TRP J CH2 1 
ATOM   10528 N  N   . ILE D 1 248 ? 70.000  37.449 131.802 1.00 19.57 ? 266  ILE J N   1 
ATOM   10529 C  CA  . ILE D 1 248 ? 69.407  36.163 132.143 1.00 20.61 ? 266  ILE J CA  1 
ATOM   10530 C  C   . ILE D 1 248 ? 68.536  35.785 130.946 1.00 21.22 ? 266  ILE J C   1 
ATOM   10531 O  O   . ILE D 1 248 ? 67.592  36.513 130.602 1.00 21.22 ? 266  ILE J O   1 
ATOM   10532 C  CB  . ILE D 1 248 ? 68.549  36.220 133.441 1.00 20.57 ? 266  ILE J CB  1 
ATOM   10533 C  CG1 . ILE D 1 248 ? 69.345  36.782 134.640 1.00 20.78 ? 266  ILE J CG1 1 
ATOM   10534 C  CG2 . ILE D 1 248 ? 67.939  34.856 133.748 1.00 20.81 ? 266  ILE J CG2 1 
ATOM   10535 C  CD1 . ILE D 1 248 ? 70.577  35.967 135.071 1.00 20.74 ? 266  ILE J CD1 1 
ATOM   10536 N  N   . ASN D 1 249 ? 68.876  34.674 130.298 1.00 22.13 ? 267  ASN J N   1 
ATOM   10537 C  CA  . ASN D 1 249 ? 68.170  34.236 129.091 1.00 23.62 ? 267  ASN J CA  1 
ATOM   10538 C  C   . ASN D 1 249 ? 66.793  33.616 129.384 1.00 24.60 ? 267  ASN J C   1 
ATOM   10539 O  O   . ASN D 1 249 ? 66.357  33.586 130.537 1.00 24.62 ? 267  ASN J O   1 
ATOM   10540 C  CB  . ASN D 1 249 ? 69.054  33.317 128.217 1.00 23.28 ? 267  ASN J CB  1 
ATOM   10541 C  CG  . ASN D 1 249 ? 69.170  31.899 128.756 1.00 23.94 ? 267  ASN J CG  1 
ATOM   10542 O  OD1 . ASN D 1 249 ? 68.427  31.485 129.645 1.00 24.59 ? 267  ASN J OD1 1 
ATOM   10543 N  ND2 . ASN D 1 249 ? 70.108  31.139 128.204 1.00 24.34 ? 267  ASN J ND2 1 
ATOM   10544 N  N   . GLU D 1 250 ? 66.132  33.120 128.333 1.00 25.79 ? 268  GLU J N   1 
ATOM   10545 C  CA  . GLU D 1 250 ? 64.778  32.554 128.421 1.00 26.68 ? 268  GLU J CA  1 
ATOM   10546 C  C   . GLU D 1 250 ? 64.666  31.306 129.306 1.00 27.11 ? 268  GLU J C   1 
ATOM   10547 O  O   . GLU D 1 250 ? 63.587  31.003 129.818 1.00 27.40 ? 268  GLU J O   1 
ATOM   10548 C  CB  . GLU D 1 250 ? 64.239  32.230 127.023 1.00 26.83 ? 268  GLU J CB  1 
ATOM   10549 C  CG  . GLU D 1 250 ? 64.131  33.427 126.082 1.00 27.16 ? 268  GLU J CG  1 
ATOM   10550 C  CD  . GLU D 1 250 ? 65.385  33.640 125.234 1.00 27.42 ? 268  GLU J CD  1 
ATOM   10551 O  OE1 . GLU D 1 250 ? 65.296  34.410 124.252 1.00 27.34 ? 268  GLU J OE1 1 
ATOM   10552 O  OE2 . GLU D 1 250 ? 66.446  33.045 125.538 1.00 26.03 ? 268  GLU J OE2 1 
ATOM   10553 N  N   . ASP D 1 251 ? 65.776  30.589 129.466 1.00 27.59 ? 269  ASP J N   1 
ATOM   10554 C  CA  . ASP D 1 251 ? 65.837  29.397 130.311 1.00 27.92 ? 269  ASP J CA  1 
ATOM   10555 C  C   . ASP D 1 251 ? 66.196  29.729 131.763 1.00 27.83 ? 269  ASP J C   1 
ATOM   10556 O  O   . ASP D 1 251 ? 66.391  28.826 132.584 1.00 27.94 ? 269  ASP J O   1 
ATOM   10557 C  CB  . ASP D 1 251 ? 66.866  28.406 129.753 1.00 28.43 ? 269  ASP J CB  1 
ATOM   10558 C  CG  . ASP D 1 251 ? 66.501  27.879 128.371 1.00 29.43 ? 269  ASP J CG  1 
ATOM   10559 O  OD1 . ASP D 1 251 ? 67.425  27.683 127.555 1.00 31.74 ? 269  ASP J OD1 1 
ATOM   10560 O  OD2 . ASP D 1 251 ? 65.304  27.647 128.099 1.00 31.02 ? 269  ASP J OD2 1 
ATOM   10561 N  N   . GLY D 1 252 ? 66.278  31.019 132.079 1.00 27.56 ? 270  GLY J N   1 
ATOM   10562 C  CA  . GLY D 1 252 ? 66.711  31.463 133.403 1.00 27.15 ? 270  GLY J CA  1 
ATOM   10563 C  C   . GLY D 1 252 ? 68.204  31.309 133.655 1.00 26.84 ? 270  GLY J C   1 
ATOM   10564 O  O   . GLY D 1 252 ? 68.642  31.303 134.805 1.00 26.80 ? 270  GLY J O   1 
ATOM   10565 N  N   . GLU D 1 253 ? 68.985  31.186 132.582 1.00 26.56 ? 271  GLU J N   1 
ATOM   10566 C  CA  . GLU D 1 253 ? 70.442  31.039 132.682 1.00 26.36 ? 271  GLU J CA  1 
ATOM   10567 C  C   . GLU D 1 253 ? 71.162  32.357 132.405 1.00 25.48 ? 271  GLU J C   1 
ATOM   10568 O  O   . GLU D 1 253 ? 70.843  33.059 131.441 1.00 25.30 ? 271  GLU J O   1 
ATOM   10569 C  CB  . GLU D 1 253 ? 70.962  30.003 131.684 1.00 26.83 ? 271  GLU J CB  1 
ATOM   10570 C  CG  . GLU D 1 253 ? 70.364  28.605 131.782 1.00 29.15 ? 271  GLU J CG  1 
ATOM   10571 C  CD  . GLU D 1 253 ? 70.724  27.760 130.572 1.00 31.92 ? 271  GLU J CD  1 
ATOM   10572 O  OE1 . GLU D 1 253 ? 71.534  26.821 130.725 1.00 33.31 ? 271  GLU J OE1 1 
ATOM   10573 O  OE2 . GLU D 1 253 ? 70.221  28.052 129.458 1.00 33.52 ? 271  GLU J OE2 1 
ATOM   10574 N  N   . GLU D 1 254 ? 72.138  32.668 133.255 1.00 24.41 ? 272  GLU J N   1 
ATOM   10575 C  CA  . GLU D 1 254 ? 73.065  33.776 133.061 1.00 23.42 ? 272  GLU J CA  1 
ATOM   10576 C  C   . GLU D 1 254 ? 73.850  33.563 131.763 1.00 22.16 ? 272  GLU J C   1 
ATOM   10577 O  O   . GLU D 1 254 ? 74.489  32.527 131.583 1.00 22.30 ? 272  GLU J O   1 
ATOM   10578 C  CB  . GLU D 1 254 ? 74.027  33.848 134.248 1.00 23.59 ? 272  GLU J CB  1 
ATOM   10579 C  CG  . GLU D 1 254 ? 74.760  35.169 134.394 1.00 24.62 ? 272  GLU J CG  1 
ATOM   10580 C  CD  . GLU D 1 254 ? 75.888  35.107 135.410 1.00 26.08 ? 272  GLU J CD  1 
ATOM   10581 O  OE1 . GLU D 1 254 ? 75.874  34.211 136.281 1.00 27.53 ? 272  GLU J OE1 1 
ATOM   10582 O  OE2 . GLU D 1 254 ? 76.798  35.955 135.335 1.00 26.54 ? 272  GLU J OE2 1 
ATOM   10583 N  N   . GLU D 1 255 ? 73.803  34.546 130.868 1.00 20.76 ? 273  GLU J N   1 
ATOM   10584 C  CA  . GLU D 1 255 ? 74.308  34.361 129.507 1.00 19.32 ? 273  GLU J CA  1 
ATOM   10585 C  C   . GLU D 1 255 ? 74.965  35.615 128.922 1.00 18.36 ? 273  GLU J C   1 
ATOM   10586 O  O   . GLU D 1 255 ? 74.437  36.715 129.046 1.00 18.23 ? 273  GLU J O   1 
ATOM   10587 C  CB  . GLU D 1 255 ? 73.160  33.902 128.596 1.00 19.09 ? 273  GLU J CB  1 
ATOM   10588 C  CG  . GLU D 1 255 ? 73.577  33.537 127.178 1.00 18.84 ? 273  GLU J CG  1 
ATOM   10589 C  CD  . GLU D 1 255 ? 72.405  33.136 126.303 1.00 18.17 ? 273  GLU J CD  1 
ATOM   10590 O  OE1 . GLU D 1 255 ? 72.325  31.953 125.946 1.00 18.03 ? 273  GLU J OE1 1 
ATOM   10591 O  OE2 . GLU D 1 255 ? 71.566  33.994 125.970 1.00 17.32 ? 273  GLU J OE2 1 
ATOM   10592 N  N   . LEU D 1 256 ? 76.122  35.436 128.292 1.00 17.23 ? 274  LEU J N   1 
ATOM   10593 C  CA  . LEU D 1 256 ? 76.669  36.459 127.410 1.00 16.41 ? 274  LEU J CA  1 
ATOM   10594 C  C   . LEU D 1 256 ? 76.346  36.045 125.982 1.00 15.83 ? 274  LEU J C   1 
ATOM   10595 O  O   . LEU D 1 256 ? 76.807  35.008 125.517 1.00 15.60 ? 274  LEU J O   1 
ATOM   10596 C  CB  . LEU D 1 256 ? 78.184  36.630 127.603 1.00 16.11 ? 274  LEU J CB  1 
ATOM   10597 C  CG  . LEU D 1 256 ? 78.874  37.676 126.715 1.00 15.58 ? 274  LEU J CG  1 
ATOM   10598 C  CD1 . LEU D 1 256 ? 78.457  39.106 127.098 1.00 14.78 ? 274  LEU J CD1 1 
ATOM   10599 C  CD2 . LEU D 1 256 ? 80.394  37.523 126.730 1.00 13.44 ? 274  LEU J CD2 1 
ATOM   10600 N  N   . ALA D 1 257 ? 75.537  36.854 125.305 1.00 15.48 ? 275  ALA J N   1 
ATOM   10601 C  CA  . ALA D 1 257 ? 75.091  36.550 123.946 1.00 15.56 ? 275  ALA J CA  1 
ATOM   10602 C  C   . ALA D 1 257 ? 75.538  37.601 122.925 1.00 15.45 ? 275  ALA J C   1 
ATOM   10603 O  O   . ALA D 1 257 ? 75.638  38.795 123.243 1.00 14.81 ? 275  ALA J O   1 
ATOM   10604 C  CB  . ALA D 1 257 ? 73.569  36.375 123.908 1.00 15.42 ? 275  ALA J CB  1 
ATOM   10605 N  N   . THR D 1 258 ? 75.805  37.130 121.707 1.00 15.36 ? 276  THR J N   1 
ATOM   10606 C  CA  . THR D 1 258 ? 76.160  37.983 120.564 1.00 15.57 ? 276  THR J CA  1 
ATOM   10607 C  C   . THR D 1 258 ? 75.598  37.358 119.261 1.00 15.86 ? 276  THR J C   1 
ATOM   10608 O  O   . THR D 1 258 ? 75.500  36.139 119.162 1.00 16.13 ? 276  THR J O   1 
ATOM   10609 C  CB  . THR D 1 258 ? 77.706  38.231 120.495 1.00 15.48 ? 276  THR J CB  1 
ATOM   10610 O  OG1 . THR D 1 258 ? 77.992  39.321 119.609 1.00 14.89 ? 276  THR J OG1 1 
ATOM   10611 C  CG2 . THR D 1 258 ? 78.482  36.977 120.061 1.00 15.35 ? 276  THR J CG2 1 
ATOM   10612 N  N   . PRO D 1 259 ? 75.183  38.189 118.282 1.00 16.11 ? 277  PRO J N   1 
ATOM   10613 C  CA  . PRO D 1 259 ? 74.698  37.634 117.007 1.00 16.19 ? 277  PRO J CA  1 
ATOM   10614 C  C   . PRO D 1 259 ? 75.722  36.742 116.297 1.00 16.45 ? 277  PRO J C   1 
ATOM   10615 O  O   . PRO D 1 259 ? 76.930  37.040 116.325 1.00 16.58 ? 277  PRO J O   1 
ATOM   10616 C  CB  . PRO D 1 259 ? 74.412  38.883 116.174 1.00 16.07 ? 277  PRO J CB  1 
ATOM   10617 C  CG  . PRO D 1 259 ? 74.122  39.930 117.181 1.00 15.92 ? 277  PRO J CG  1 
ATOM   10618 C  CD  . PRO D 1 259 ? 75.088  39.659 118.292 1.00 15.83 ? 277  PRO J CD  1 
ATOM   10619 N  N   . PRO D 1 260 ? 75.251  35.651 115.658 1.00 16.40 ? 278  PRO J N   1 
ATOM   10620 C  CA  . PRO D 1 260 ? 76.186  34.727 115.022 1.00 16.06 ? 278  PRO J CA  1 
ATOM   10621 C  C   . PRO D 1 260 ? 76.724  35.271 113.704 1.00 15.88 ? 278  PRO J C   1 
ATOM   10622 O  O   . PRO D 1 260 ? 76.143  36.196 113.123 1.00 15.09 ? 278  PRO J O   1 
ATOM   10623 C  CB  . PRO D 1 260 ? 75.340  33.473 114.787 1.00 16.00 ? 278  PRO J CB  1 
ATOM   10624 C  CG  . PRO D 1 260 ? 73.955  33.963 114.674 1.00 16.05 ? 278  PRO J CG  1 
ATOM   10625 C  CD  . PRO D 1 260 ? 73.846  35.234 115.474 1.00 16.47 ? 278  PRO J CD  1 
ATOM   10626 N  N   . LEU D 1 261 ? 77.836  34.693 113.255 1.00 16.06 ? 279  LEU J N   1 
ATOM   10627 C  CA  . LEU D 1 261 ? 78.471  35.083 111.998 1.00 16.37 ? 279  LEU J CA  1 
ATOM   10628 C  C   . LEU D 1 261 ? 77.786  34.426 110.788 1.00 16.75 ? 279  LEU J C   1 
ATOM   10629 O  O   . LEU D 1 261 ? 78.329  33.514 110.156 1.00 16.77 ? 279  LEU J O   1 
ATOM   10630 C  CB  . LEU D 1 261 ? 79.978  34.779 112.038 1.00 16.03 ? 279  LEU J CB  1 
ATOM   10631 C  CG  . LEU D 1 261 ? 80.817  35.531 113.089 1.00 15.83 ? 279  LEU J CG  1 
ATOM   10632 C  CD1 . LEU D 1 261 ? 82.274  35.095 113.031 1.00 15.96 ? 279  LEU J CD1 1 
ATOM   10633 C  CD2 . LEU D 1 261 ? 80.719  37.049 112.945 1.00 13.08 ? 279  LEU J CD2 1 
ATOM   10634 N  N   . ASP D 1 262 ? 76.590  34.917 110.477 1.00 17.18 ? 280  ASP J N   1 
ATOM   10635 C  CA  . ASP D 1 262 ? 75.764  34.373 109.401 1.00 17.67 ? 280  ASP J CA  1 
ATOM   10636 C  C   . ASP D 1 262 ? 75.834  35.177 108.087 1.00 17.55 ? 280  ASP J C   1 
ATOM   10637 O  O   . ASP D 1 262 ? 75.014  34.972 107.182 1.00 17.88 ? 280  ASP J O   1 
ATOM   10638 C  CB  . ASP D 1 262 ? 74.311  34.246 109.879 1.00 17.78 ? 280  ASP J CB  1 
ATOM   10639 C  CG  . ASP D 1 262 ? 73.637  35.598 110.105 1.00 19.09 ? 280  ASP J CG  1 
ATOM   10640 O  OD1 . ASP D 1 262 ? 72.402  35.613 110.292 1.00 19.90 ? 280  ASP J OD1 1 
ATOM   10641 O  OD2 . ASP D 1 262 ? 74.324  36.646 110.104 1.00 20.34 ? 280  ASP J OD2 1 
ATOM   10642 N  N   . GLY D 1 263 ? 76.800  36.091 107.989 1.00 17.14 ? 281  GLY J N   1 
ATOM   10643 C  CA  . GLY D 1 263 ? 76.993  36.875 106.769 1.00 16.46 ? 281  GLY J CA  1 
ATOM   10644 C  C   . GLY D 1 263 ? 76.667  38.362 106.850 1.00 16.24 ? 281  GLY J C   1 
ATOM   10645 O  O   . GLY D 1 263 ? 77.105  39.134 105.990 1.00 16.28 ? 281  GLY J O   1 
ATOM   10646 N  N   . ILE D 1 264 ? 75.904  38.773 107.868 1.00 15.49 ? 282  ILE J N   1 
ATOM   10647 C  CA  . ILE D 1 264 ? 75.559  40.198 108.047 1.00 15.12 ? 282  ILE J CA  1 
ATOM   10648 C  C   . ILE D 1 264 ? 76.337  40.876 109.185 1.00 14.52 ? 282  ILE J C   1 
ATOM   10649 O  O   . ILE D 1 264 ? 76.156  42.064 109.448 1.00 14.72 ? 282  ILE J O   1 
ATOM   10650 C  CB  . ILE D 1 264 ? 74.035  40.420 108.251 1.00 14.97 ? 282  ILE J CB  1 
ATOM   10651 C  CG1 . ILE D 1 264 ? 73.575  39.876 109.622 1.00 15.62 ? 282  ILE J CG1 1 
ATOM   10652 C  CG2 . ILE D 1 264 ? 73.249  39.809 107.092 1.00 15.43 ? 282  ILE J CG2 1 
ATOM   10653 C  CD1 . ILE D 1 264 ? 72.134  40.220 109.995 1.00 14.39 ? 282  ILE J CD1 1 
ATOM   10654 N  N   . ILE D 1 265 ? 77.203  40.106 109.838 1.00 13.91 ? 283  ILE J N   1 
ATOM   10655 C  CA  . ILE D 1 265 ? 77.976  40.558 110.998 1.00 13.06 ? 283  ILE J CA  1 
ATOM   10656 C  C   . ILE D 1 265 ? 79.441  40.630 110.615 1.00 12.92 ? 283  ILE J C   1 
ATOM   10657 O  O   . ILE D 1 265 ? 79.989  39.662 110.093 1.00 12.83 ? 283  ILE J O   1 
ATOM   10658 C  CB  . ILE D 1 265 ? 77.822  39.580 112.219 1.00 12.82 ? 283  ILE J CB  1 
ATOM   10659 C  CG1 . ILE D 1 265 ? 76.350  39.418 112.624 1.00 12.40 ? 283  ILE J CG1 1 
ATOM   10660 C  CG2 . ILE D 1 265 ? 78.681  40.023 113.421 1.00 11.88 ? 283  ILE J CG2 1 
ATOM   10661 C  CD1 . ILE D 1 265 ? 75.635  40.724 113.022 1.00 12.09 ? 283  ILE J CD1 1 
ATOM   10662 N  N   . LEU D 1 266 ? 80.073  41.776 110.862 1.00 12.70 ? 284  LEU J N   1 
ATOM   10663 C  CA  . LEU D 1 266 ? 81.516  41.870 110.706 1.00 12.45 ? 284  LEU J CA  1 
ATOM   10664 C  C   . LEU D 1 266 ? 82.188  41.042 111.809 1.00 12.51 ? 284  LEU J C   1 
ATOM   10665 O  O   . LEU D 1 266 ? 81.910  41.239 112.994 1.00 12.08 ? 284  LEU J O   1 
ATOM   10666 C  CB  . LEU D 1 266 ? 81.979  43.334 110.724 1.00 12.34 ? 284  LEU J CB  1 
ATOM   10667 C  CG  . LEU D 1 266 ? 83.368  43.743 110.194 1.00 12.21 ? 284  LEU J CG  1 
ATOM   10668 C  CD1 . LEU D 1 266 ? 84.519  43.329 111.142 1.00 10.15 ? 284  LEU J CD1 1 
ATOM   10669 C  CD2 . LEU D 1 266 ? 83.628  43.246 108.764 1.00 12.62 ? 284  LEU J CD2 1 
ATOM   10670 N  N   . PRO D 1 267 ? 83.046  40.083 111.419 1.00 12.82 ? 285  PRO J N   1 
ATOM   10671 C  CA  . PRO D 1 267 ? 83.778  39.269 112.394 1.00 12.78 ? 285  PRO J CA  1 
ATOM   10672 C  C   . PRO D 1 267 ? 84.889  40.060 113.106 1.00 12.64 ? 285  PRO J C   1 
ATOM   10673 O  O   . PRO D 1 267 ? 86.055  40.014 112.693 1.00 12.48 ? 285  PRO J O   1 
ATOM   10674 C  CB  . PRO D 1 267 ? 84.371  38.131 111.543 1.00 12.90 ? 285  PRO J CB  1 
ATOM   10675 C  CG  . PRO D 1 267 ? 83.739  38.256 110.182 1.00 13.46 ? 285  PRO J CG  1 
ATOM   10676 C  CD  . PRO D 1 267 ? 83.368  39.692 110.035 1.00 13.18 ? 285  PRO J CD  1 
ATOM   10677 N  N   . GLY D 1 268 ? 84.524  40.776 114.168 1.00 12.42 ? 286  GLY J N   1 
ATOM   10678 C  CA  . GLY D 1 268 ? 85.490  41.561 114.932 1.00 12.51 ? 286  GLY J CA  1 
ATOM   10679 C  C   . GLY D 1 268 ? 86.565  40.734 115.628 1.00 12.53 ? 286  GLY J C   1 
ATOM   10680 O  O   . GLY D 1 268 ? 86.307  39.616 116.073 1.00 12.73 ? 286  GLY J O   1 
ATOM   10681 N  N   . VAL D 1 269 ? 87.776  41.284 115.695 1.00 12.61 ? 287  VAL J N   1 
ATOM   10682 C  CA  . VAL D 1 269 ? 88.864  40.735 116.509 1.00 12.49 ? 287  VAL J CA  1 
ATOM   10683 C  C   . VAL D 1 269 ? 88.502  40.831 117.996 1.00 12.81 ? 287  VAL J C   1 
ATOM   10684 O  O   . VAL D 1 269 ? 88.655  39.862 118.737 1.00 12.86 ? 287  VAL J O   1 
ATOM   10685 C  CB  . VAL D 1 269 ? 90.212  41.457 116.230 1.00 12.54 ? 287  VAL J CB  1 
ATOM   10686 C  CG1 . VAL D 1 269 ? 91.319  40.987 117.183 1.00 11.68 ? 287  VAL J CG1 1 
ATOM   10687 C  CG2 . VAL D 1 269 ? 90.643  41.235 114.786 1.00 11.91 ? 287  VAL J CG2 1 
ATOM   10688 N  N   . THR D 1 270 ? 88.005  41.996 118.414 1.00 12.95 ? 288  THR J N   1 
ATOM   10689 C  CA  . THR D 1 270 ? 87.585  42.216 119.798 1.00 12.94 ? 288  THR J CA  1 
ATOM   10690 C  C   . THR D 1 270 ? 86.487  41.218 120.179 1.00 13.19 ? 288  THR J C   1 
ATOM   10691 O  O   . THR D 1 270 ? 86.575  40.563 121.212 1.00 13.47 ? 288  THR J O   1 
ATOM   10692 C  CB  . THR D 1 270 ? 87.092  43.670 120.025 1.00 12.74 ? 288  THR J CB  1 
ATOM   10693 O  OG1 . THR D 1 270 ? 87.938  44.579 119.315 1.00 12.62 ? 288  THR J OG1 1 
ATOM   10694 C  CG2 . THR D 1 270 ? 87.109  44.027 121.506 1.00 12.47 ? 288  THR J CG2 1 
ATOM   10695 N  N   . ARG D 1 271 ? 85.468  41.115 119.327 1.00 13.29 ? 289  ARG J N   1 
ATOM   10696 C  CA  . ARG D 1 271 ? 84.402  40.120 119.446 1.00 13.54 ? 289  ARG J CA  1 
ATOM   10697 C  C   . ARG D 1 271 ? 84.922  38.689 119.681 1.00 14.09 ? 289  ARG J C   1 
ATOM   10698 O  O   . ARG D 1 271 ? 84.458  38.013 120.592 1.00 14.08 ? 289  ARG J O   1 
ATOM   10699 C  CB  . ARG D 1 271 ? 83.511  40.164 118.195 1.00 13.05 ? 289  ARG J CB  1 
ATOM   10700 C  CG  . ARG D 1 271 ? 82.344  39.183 118.187 1.00 12.09 ? 289  ARG J CG  1 
ATOM   10701 C  CD  . ARG D 1 271 ? 81.778  39.022 116.771 1.00 11.98 ? 289  ARG J CD  1 
ATOM   10702 N  NE  . ARG D 1 271 ? 80.668  38.073 116.740 1.00 11.25 ? 289  ARG J NE  1 
ATOM   10703 C  CZ  . ARG D 1 271 ? 80.811  36.754 116.620 1.00 11.19 ? 289  ARG J CZ  1 
ATOM   10704 N  NH1 . ARG D 1 271 ? 82.022  36.217 116.494 1.00 8.89  ? 289  ARG J NH1 1 
ATOM   10705 N  NH2 . ARG D 1 271 ? 79.740  35.974 116.626 1.00 9.58  ? 289  ARG J NH2 1 
ATOM   10706 N  N   . ARG D 1 272 ? 85.870  38.234 118.859 1.00 14.76 ? 290  ARG J N   1 
ATOM   10707 C  CA  . ARG D 1 272 ? 86.461  36.891 119.022 1.00 15.40 ? 290  ARG J CA  1 
ATOM   10708 C  C   . ARG D 1 272 ? 87.250  36.740 120.334 1.00 15.09 ? 290  ARG J C   1 
ATOM   10709 O  O   . ARG D 1 272 ? 87.151  35.711 121.014 1.00 14.89 ? 290  ARG J O   1 
ATOM   10710 C  CB  . ARG D 1 272 ? 87.326  36.518 117.804 1.00 15.74 ? 290  ARG J CB  1 
ATOM   10711 C  CG  . ARG D 1 272 ? 87.975  35.117 117.840 1.00 18.31 ? 290  ARG J CG  1 
ATOM   10712 C  CD  . ARG D 1 272 ? 86.982  33.998 118.232 1.00 22.61 ? 290  ARG J CD  1 
ATOM   10713 N  NE  . ARG D 1 272 ? 85.776  33.998 117.400 1.00 25.66 ? 290  ARG J NE  1 
ATOM   10714 C  CZ  . ARG D 1 272 ? 84.683  33.289 117.665 1.00 27.85 ? 290  ARG J CZ  1 
ATOM   10715 N  NH1 . ARG D 1 272 ? 84.647  32.523 118.754 1.00 28.41 ? 290  ARG J NH1 1 
ATOM   10716 N  NH2 . ARG D 1 272 ? 83.625  33.349 116.846 1.00 28.43 ? 290  ARG J NH2 1 
ATOM   10717 N  N   . CYS D 1 273 ? 88.008  37.775 120.690 1.00 14.91 ? 291  CYS J N   1 
ATOM   10718 C  CA  . CYS D 1 273 ? 88.761  37.797 121.948 1.00 14.88 ? 291  CYS J CA  1 
ATOM   10719 C  C   . CYS D 1 273 ? 87.859  37.684 123.175 1.00 14.67 ? 291  CYS J C   1 
ATOM   10720 O  O   . CYS D 1 273 ? 88.172  36.940 124.102 1.00 14.75 ? 291  CYS J O   1 
ATOM   10721 C  CB  . CYS D 1 273 ? 89.610  39.065 122.039 1.00 14.83 ? 291  CYS J CB  1 
ATOM   10722 S  SG  . CYS D 1 273 ? 90.981  39.084 120.885 1.00 15.89 ? 291  CYS J SG  1 
ATOM   10723 N  N   . ILE D 1 274 ? 86.754  38.431 123.168 1.00 14.59 ? 292  ILE J N   1 
ATOM   10724 C  CA  . ILE D 1 274 ? 85.765  38.436 124.259 1.00 14.77 ? 292  ILE J CA  1 
ATOM   10725 C  C   . ILE D 1 274 ? 85.093  37.072 124.409 1.00 15.15 ? 292  ILE J C   1 
ATOM   10726 O  O   . ILE D 1 274 ? 84.927  36.574 125.523 1.00 15.61 ? 292  ILE J O   1 
ATOM   10727 C  CB  . ILE D 1 274 ? 84.684  39.551 124.056 1.00 14.27 ? 292  ILE J CB  1 
ATOM   10728 C  CG1 . ILE D 1 274 ? 85.288  40.938 124.291 1.00 14.38 ? 292  ILE J CG1 1 
ATOM   10729 C  CG2 . ILE D 1 274 ? 83.480  39.344 124.975 1.00 13.86 ? 292  ILE J CG2 1 
ATOM   10730 C  CD1 . ILE D 1 274 ? 84.396  42.099 123.841 1.00 12.75 ? 292  ILE J CD1 1 
ATOM   10731 N  N   . LEU D 1 275 ? 84.694  36.489 123.283 1.00 15.62 ? 293  LEU J N   1 
ATOM   10732 C  CA  . LEU D 1 275 ? 84.143  35.136 123.239 1.00 16.23 ? 293  LEU J CA  1 
ATOM   10733 C  C   . LEU D 1 275 ? 85.130  34.102 123.795 1.00 16.66 ? 293  LEU J C   1 
ATOM   10734 O  O   . LEU D 1 275 ? 84.748  33.260 124.611 1.00 16.78 ? 293  LEU J O   1 
ATOM   10735 C  CB  . LEU D 1 275 ? 83.753  34.786 121.796 1.00 16.18 ? 293  LEU J CB  1 
ATOM   10736 C  CG  . LEU D 1 275 ? 82.288  34.756 121.321 1.00 16.94 ? 293  LEU J CG  1 
ATOM   10737 C  CD1 . LEU D 1 275 ? 81.272  35.411 122.255 1.00 16.30 ? 293  LEU J CD1 1 
ATOM   10738 C  CD2 . LEU D 1 275 ? 82.157  35.262 119.883 1.00 15.74 ? 293  LEU J CD2 1 
ATOM   10739 N  N   . ASP D 1 276 ? 86.389  34.172 123.352 1.00 16.99 ? 294  ASP J N   1 
ATOM   10740 C  CA  . ASP D 1 276 ? 87.459  33.319 123.879 1.00 17.92 ? 294  ASP J CA  1 
ATOM   10741 C  C   . ASP D 1 276 ? 87.585  33.470 125.399 1.00 18.16 ? 294  ASP J C   1 
ATOM   10742 O  O   . ASP D 1 276 ? 87.519  32.482 126.122 1.00 18.34 ? 294  ASP J O   1 
ATOM   10743 C  CB  . ASP D 1 276 ? 88.808  33.609 123.190 1.00 17.85 ? 294  ASP J CB  1 
ATOM   10744 C  CG  . ASP D 1 276 ? 88.836  33.167 121.726 1.00 19.17 ? 294  ASP J CG  1 
ATOM   10745 O  OD1 . ASP D 1 276 ? 89.824  33.484 121.019 1.00 20.19 ? 294  ASP J OD1 1 
ATOM   10746 O  OD2 . ASP D 1 276 ? 87.876  32.502 121.272 1.00 20.27 ? 294  ASP J OD2 1 
ATOM   10747 N  N   . LEU D 1 277 ? 87.747  34.707 125.864 1.00 18.58 ? 295  LEU J N   1 
ATOM   10748 C  CA  . LEU D 1 277 ? 87.814  35.033 127.296 1.00 18.89 ? 295  LEU J CA  1 
ATOM   10749 C  C   . LEU D 1 277 ? 86.664  34.446 128.104 1.00 19.25 ? 295  LEU J C   1 
ATOM   10750 O  O   . LEU D 1 277 ? 86.886  33.797 129.131 1.00 18.94 ? 295  LEU J O   1 
ATOM   10751 C  CB  . LEU D 1 277 ? 87.838  36.554 127.484 1.00 18.70 ? 295  LEU J CB  1 
ATOM   10752 C  CG  . LEU D 1 277 ? 89.142  37.307 127.768 1.00 19.18 ? 295  LEU J CG  1 
ATOM   10753 C  CD1 . LEU D 1 277 ? 90.428  36.521 127.456 1.00 19.97 ? 295  LEU J CD1 1 
ATOM   10754 C  CD2 . LEU D 1 277 ? 89.129  38.652 127.067 1.00 17.84 ? 295  LEU J CD2 1 
ATOM   10755 N  N   . ALA D 1 278 ? 85.443  34.668 127.619 1.00 19.86 ? 296  ALA J N   1 
ATOM   10756 C  CA  . ALA D 1 278 ? 84.232  34.259 128.321 1.00 20.53 ? 296  ALA J CA  1 
ATOM   10757 C  C   . ALA D 1 278 ? 84.100  32.741 128.398 1.00 21.19 ? 296  ALA J C   1 
ATOM   10758 O  O   . ALA D 1 278 ? 83.708  32.211 129.442 1.00 21.55 ? 296  ALA J O   1 
ATOM   10759 C  CB  . ALA D 1 278 ? 82.996  34.890 127.686 1.00 20.04 ? 296  ALA J CB  1 
ATOM   10760 N  N   . HIS D 1 279 ? 84.440  32.051 127.307 1.00 21.66 ? 297  HIS J N   1 
ATOM   10761 C  CA  . HIS D 1 279 ? 84.479  30.590 127.302 1.00 22.38 ? 297  HIS J CA  1 
ATOM   10762 C  C   . HIS D 1 279 ? 85.459  30.062 128.345 1.00 22.55 ? 297  HIS J C   1 
ATOM   10763 O  O   . HIS D 1 279 ? 85.137  29.138 129.088 1.00 22.89 ? 297  HIS J O   1 
ATOM   10764 C  CB  . HIS D 1 279 ? 84.860  30.036 125.927 1.00 22.12 ? 297  HIS J CB  1 
ATOM   10765 C  CG  . HIS D 1 279 ? 83.731  30.007 124.946 1.00 23.52 ? 297  HIS J CG  1 
ATOM   10766 N  ND1 . HIS D 1 279 ? 83.842  30.525 123.672 1.00 24.15 ? 297  HIS J ND1 1 
ATOM   10767 C  CD2 . HIS D 1 279 ? 82.471  29.520 125.047 1.00 23.35 ? 297  HIS J CD2 1 
ATOM   10768 C  CE1 . HIS D 1 279 ? 82.696  30.363 123.034 1.00 24.08 ? 297  HIS J CE1 1 
ATOM   10769 N  NE2 . HIS D 1 279 ? 81.848  29.757 123.846 1.00 24.38 ? 297  HIS J NE2 1 
ATOM   10770 N  N   . GLN D 1 280 ? 86.650  30.655 128.393 1.00 22.83 ? 298  GLN J N   1 
ATOM   10771 C  CA  . GLN D 1 280 ? 87.709  30.183 129.286 1.00 23.27 ? 298  GLN J CA  1 
ATOM   10772 C  C   . GLN D 1 280 ? 87.380  30.396 130.765 1.00 22.63 ? 298  GLN J C   1 
ATOM   10773 O  O   . GLN D 1 280 ? 87.694  29.545 131.591 1.00 22.77 ? 298  GLN J O   1 
ATOM   10774 C  CB  . GLN D 1 280 ? 89.065  30.813 128.940 1.00 23.66 ? 298  GLN J CB  1 
ATOM   10775 C  CG  . GLN D 1 280 ? 89.393  30.950 127.437 1.00 26.67 ? 298  GLN J CG  1 
ATOM   10776 C  CD  . GLN D 1 280 ? 89.056  29.722 126.584 1.00 30.45 ? 298  GLN J CD  1 
ATOM   10777 O  OE1 . GLN D 1 280 ? 89.304  28.579 126.978 1.00 32.60 ? 298  GLN J OE1 1 
ATOM   10778 N  NE2 . GLN D 1 280 ? 88.496  29.965 125.396 1.00 30.91 ? 298  GLN J NE2 1 
ATOM   10779 N  N   . TRP D 1 281 ? 86.749  31.524 131.088 1.00 22.06 ? 299  TRP J N   1 
ATOM   10780 C  CA  . TRP D 1 281 ? 86.307  31.808 132.457 1.00 21.44 ? 299  TRP J CA  1 
ATOM   10781 C  C   . TRP D 1 281 ? 85.363  30.735 132.982 1.00 21.16 ? 299  TRP J C   1 
ATOM   10782 O  O   . TRP D 1 281 ? 85.538  30.256 134.101 1.00 20.75 ? 299  TRP J O   1 
ATOM   10783 C  CB  . TRP D 1 281 ? 85.641  33.184 132.565 1.00 21.27 ? 299  TRP J CB  1 
ATOM   10784 C  CG  . TRP D 1 281 ? 86.582  34.342 132.371 1.00 21.53 ? 299  TRP J CG  1 
ATOM   10785 C  CD1 . TRP D 1 281 ? 87.923  34.365 132.638 1.00 21.51 ? 299  TRP J CD1 1 
ATOM   10786 C  CD2 . TRP D 1 281 ? 86.245  35.654 131.895 1.00 21.32 ? 299  TRP J CD2 1 
ATOM   10787 N  NE1 . TRP D 1 281 ? 88.443  35.603 132.343 1.00 22.15 ? 299  TRP J NE1 1 
ATOM   10788 C  CE2 . TRP D 1 281 ? 87.437  36.413 131.886 1.00 21.46 ? 299  TRP J CE2 1 
ATOM   10789 C  CE3 . TRP D 1 281 ? 85.055  36.259 131.468 1.00 20.84 ? 299  TRP J CE3 1 
ATOM   10790 C  CZ2 . TRP D 1 281 ? 87.473  37.748 131.468 1.00 21.58 ? 299  TRP J CZ2 1 
ATOM   10791 C  CZ3 . TRP D 1 281 ? 85.093  37.578 131.048 1.00 20.48 ? 299  TRP J CZ3 1 
ATOM   10792 C  CH2 . TRP D 1 281 ? 86.293  38.310 131.053 1.00 21.08 ? 299  TRP J CH2 1 
ATOM   10793 N  N   . GLY D 1 282 ? 84.375  30.364 132.165 1.00 20.88 ? 300  GLY J N   1 
ATOM   10794 C  CA  . GLY D 1 282 ? 83.458  29.277 132.491 1.00 20.65 ? 300  GLY J CA  1 
ATOM   10795 C  C   . GLY D 1 282 ? 82.500  29.597 133.620 1.00 20.56 ? 300  GLY J C   1 
ATOM   10796 O  O   . GLY D 1 282 ? 82.105  28.713 134.380 1.00 20.81 ? 300  GLY J O   1 
ATOM   10797 N  N   . GLU D 1 283 ? 82.108  30.862 133.714 1.00 20.43 ? 301  GLU J N   1 
ATOM   10798 C  CA  . GLU D 1 283 ? 81.249  31.330 134.803 1.00 20.21 ? 301  GLU J CA  1 
ATOM   10799 C  C   . GLU D 1 283 ? 79.787  31.474 134.388 1.00 20.25 ? 301  GLU J C   1 
ATOM   10800 O  O   . GLU D 1 283 ? 78.886  31.463 135.229 1.00 20.61 ? 301  GLU J O   1 
ATOM   10801 C  CB  . GLU D 1 283 ? 81.783  32.653 135.350 1.00 19.99 ? 301  GLU J CB  1 
ATOM   10802 C  CG  . GLU D 1 283 ? 83.189  32.527 135.925 1.00 19.04 ? 301  GLU J CG  1 
ATOM   10803 C  CD  . GLU D 1 283 ? 83.787  33.846 136.336 1.00 18.09 ? 301  GLU J CD  1 
ATOM   10804 O  OE1 . GLU D 1 283 ? 85.016  33.889 136.508 1.00 18.80 ? 301  GLU J OE1 1 
ATOM   10805 O  OE2 . GLU D 1 283 ? 83.041  34.837 136.487 1.00 17.76 ? 301  GLU J OE2 1 
ATOM   10806 N  N   . PHE D 1 284 ? 79.560  31.613 133.089 1.00 19.71 ? 302  PHE J N   1 
ATOM   10807 C  CA  . PHE D 1 284 ? 78.214  31.755 132.547 1.00 19.53 ? 302  PHE J CA  1 
ATOM   10808 C  C   . PHE D 1 284 ? 78.184  31.163 131.140 1.00 19.61 ? 302  PHE J C   1 
ATOM   10809 O  O   . PHE D 1 284 ? 79.230  30.775 130.599 1.00 19.27 ? 302  PHE J O   1 
ATOM   10810 C  CB  . PHE D 1 284 ? 77.746  33.225 132.552 1.00 19.11 ? 302  PHE J CB  1 
ATOM   10811 C  CG  . PHE D 1 284 ? 78.813  34.216 132.150 1.00 19.06 ? 302  PHE J CG  1 
ATOM   10812 C  CD1 . PHE D 1 284 ? 79.522  34.927 133.120 1.00 18.58 ? 302  PHE J CD1 1 
ATOM   10813 C  CD2 . PHE D 1 284 ? 79.108  34.444 130.804 1.00 18.66 ? 302  PHE J CD2 1 
ATOM   10814 C  CE1 . PHE D 1 284 ? 80.519  35.851 132.754 1.00 18.59 ? 302  PHE J CE1 1 
ATOM   10815 C  CE2 . PHE D 1 284 ? 80.101  35.366 130.429 1.00 18.98 ? 302  PHE J CE2 1 
ATOM   10816 C  CZ  . PHE D 1 284 ? 80.808  36.065 131.407 1.00 17.67 ? 302  PHE J CZ  1 
ATOM   10817 N  N   . LYS D 1 285 ? 76.985  31.089 130.565 1.00 19.72 ? 303  LYS J N   1 
ATOM   10818 C  CA  . LYS D 1 285 ? 76.802  30.583 129.211 1.00 19.94 ? 303  LYS J CA  1 
ATOM   10819 C  C   . LYS D 1 285 ? 77.244  31.631 128.200 1.00 19.89 ? 303  LYS J C   1 
ATOM   10820 O  O   . LYS D 1 285 ? 76.943  32.810 128.346 1.00 19.88 ? 303  LYS J O   1 
ATOM   10821 C  CB  . LYS D 1 285 ? 75.337  30.207 128.979 1.00 20.24 ? 303  LYS J CB  1 
ATOM   10822 C  CG  . LYS D 1 285 ? 75.087  29.378 127.732 1.00 20.91 ? 303  LYS J CG  1 
ATOM   10823 C  CD  . LYS D 1 285 ? 73.616  29.112 127.551 1.00 22.11 ? 303  LYS J CD  1 
ATOM   10824 C  CE  . LYS D 1 285 ? 73.380  28.067 126.476 1.00 23.60 ? 303  LYS J CE  1 
ATOM   10825 N  NZ  . LYS D 1 285 ? 71.928  27.974 126.140 1.00 25.15 ? 303  LYS J NZ  1 
ATOM   10826 N  N   . VAL D 1 286 ? 77.979  31.186 127.188 1.00 20.08 ? 304  VAL J N   1 
ATOM   10827 C  CA  . VAL D 1 286 ? 78.383  32.034 126.081 1.00 20.21 ? 304  VAL J CA  1 
ATOM   10828 C  C   . VAL D 1 286 ? 77.680  31.520 124.828 1.00 20.62 ? 304  VAL J C   1 
ATOM   10829 O  O   . VAL D 1 286 ? 77.861  30.361 124.437 1.00 20.78 ? 304  VAL J O   1 
ATOM   10830 C  CB  . VAL D 1 286 ? 79.914  32.005 125.885 1.00 20.44 ? 304  VAL J CB  1 
ATOM   10831 C  CG1 . VAL D 1 286 ? 80.336  32.943 124.761 1.00 20.00 ? 304  VAL J CG1 1 
ATOM   10832 C  CG2 . VAL D 1 286 ? 80.633  32.362 127.194 1.00 20.06 ? 304  VAL J CG2 1 
ATOM   10833 N  N   . SER D 1 287 ? 76.870  32.376 124.211 1.00 20.72 ? 305  SER J N   1 
ATOM   10834 C  CA  . SER D 1 287 ? 76.083  31.981 123.042 1.00 20.96 ? 305  SER J CA  1 
ATOM   10835 C  C   . SER D 1 287 ? 76.253  32.926 121.861 1.00 20.94 ? 305  SER J C   1 
ATOM   10836 O  O   . SER D 1 287 ? 76.098  34.143 122.002 1.00 20.87 ? 305  SER J O   1 
ATOM   10837 C  CB  . SER D 1 287 ? 74.597  31.907 123.392 1.00 20.94 ? 305  SER J CB  1 
ATOM   10838 O  OG  . SER D 1 287 ? 74.353  31.021 124.465 1.00 22.30 ? 305  SER J OG  1 
ATOM   10839 N  N   . GLU D 1 288 ? 76.579  32.359 120.700 1.00 20.98 ? 306  GLU J N   1 
ATOM   10840 C  CA  . GLU D 1 288 ? 76.427  33.073 119.432 1.00 21.08 ? 306  GLU J CA  1 
ATOM   10841 C  C   . GLU D 1 288 ? 75.028  32.739 118.934 1.00 21.19 ? 306  GLU J C   1 
ATOM   10842 O  O   . GLU D 1 288 ? 74.706  31.589 118.627 1.00 21.29 ? 306  GLU J O   1 
ATOM   10843 C  CB  . GLU D 1 288 ? 77.502  32.682 118.432 1.00 20.90 ? 306  GLU J CB  1 
ATOM   10844 C  CG  . GLU D 1 288 ? 78.899  32.959 118.939 1.00 21.21 ? 306  GLU J CG  1 
ATOM   10845 C  CD  . GLU D 1 288 ? 79.955  32.506 117.973 1.00 21.71 ? 306  GLU J CD  1 
ATOM   10846 O  OE1 . GLU D 1 288 ? 80.024  33.072 116.861 1.00 22.82 ? 306  GLU J OE1 1 
ATOM   10847 O  OE2 . GLU D 1 288 ? 80.722  31.587 118.326 1.00 23.11 ? 306  GLU J OE2 1 
ATOM   10848 N  N   . ARG D 1 289 ? 74.196  33.763 118.861 1.00 21.22 ? 307  ARG J N   1 
ATOM   10849 C  CA  . ARG D 1 289 ? 72.783  33.557 119.017 1.00 21.53 ? 307  ARG J CA  1 
ATOM   10850 C  C   . ARG D 1 289 ? 72.021  34.753 118.483 1.00 21.14 ? 307  ARG J C   1 
ATOM   10851 O  O   . ARG D 1 289 ? 72.463  35.886 118.649 1.00 20.86 ? 307  ARG J O   1 
ATOM   10852 C  CB  . ARG D 1 289 ? 72.543  33.413 120.519 1.00 22.08 ? 307  ARG J CB  1 
ATOM   10853 C  CG  . ARG D 1 289 ? 71.177  33.036 120.925 1.00 23.59 ? 307  ARG J CG  1 
ATOM   10854 C  CD  . ARG D 1 289 ? 70.877  33.693 122.241 1.00 23.41 ? 307  ARG J CD  1 
ATOM   10855 N  NE  . ARG D 1 289 ? 69.538  34.247 122.179 1.00 24.57 ? 307  ARG J NE  1 
ATOM   10856 C  CZ  . ARG D 1 289 ? 68.542  33.918 122.987 1.00 25.25 ? 307  ARG J CZ  1 
ATOM   10857 N  NH1 . ARG D 1 289 ? 68.733  33.044 123.968 1.00 25.56 ? 307  ARG J NH1 1 
ATOM   10858 N  NH2 . ARG D 1 289 ? 67.358  34.486 122.814 1.00 24.89 ? 307  ARG J NH2 1 
ATOM   10859 N  N   . TYR D 1 290 ? 70.881  34.498 117.839 1.00 20.78 ? 308  TYR J N   1 
ATOM   10860 C  CA  . TYR D 1 290 ? 70.002  35.574 117.392 1.00 20.46 ? 308  TYR J CA  1 
ATOM   10861 C  C   . TYR D 1 290 ? 69.335  36.252 118.579 1.00 20.12 ? 308  TYR J C   1 
ATOM   10862 O  O   . TYR D 1 290 ? 68.959  35.604 119.551 1.00 19.86 ? 308  TYR J O   1 
ATOM   10863 C  CB  . TYR D 1 290 ? 68.961  35.080 116.375 1.00 20.42 ? 308  TYR J CB  1 
ATOM   10864 C  CG  . TYR D 1 290 ? 69.579  34.679 115.058 1.00 20.78 ? 308  TYR J CG  1 
ATOM   10865 C  CD1 . TYR D 1 290 ? 69.437  33.379 114.559 1.00 20.59 ? 308  TYR J CD1 1 
ATOM   10866 C  CD2 . TYR D 1 290 ? 70.335  35.594 114.318 1.00 21.02 ? 308  TYR J CD2 1 
ATOM   10867 C  CE1 . TYR D 1 290 ? 70.024  33.011 113.357 1.00 21.23 ? 308  TYR J CE1 1 
ATOM   10868 C  CE2 . TYR D 1 290 ? 70.925  35.232 113.118 1.00 20.90 ? 308  TYR J CE2 1 
ATOM   10869 C  CZ  . TYR D 1 290 ? 70.768  33.946 112.645 1.00 20.75 ? 308  TYR J CZ  1 
ATOM   10870 O  OH  . TYR D 1 290 ? 71.352  33.600 111.457 1.00 22.07 ? 308  TYR J OH  1 
ATOM   10871 N  N   . LEU D 1 291 ? 69.207  37.567 118.474 1.00 19.93 ? 309  LEU J N   1 
ATOM   10872 C  CA  . LEU D 1 291 ? 68.708  38.414 119.540 1.00 19.91 ? 309  LEU J CA  1 
ATOM   10873 C  C   . LEU D 1 291 ? 67.826  39.443 118.853 1.00 20.19 ? 309  LEU J C   1 
ATOM   10874 O  O   . LEU D 1 291 ? 68.287  40.148 117.949 1.00 20.40 ? 309  LEU J O   1 
ATOM   10875 C  CB  . LEU D 1 291 ? 69.884  39.125 120.225 1.00 19.61 ? 309  LEU J CB  1 
ATOM   10876 C  CG  . LEU D 1 291 ? 70.633  38.720 121.505 1.00 19.48 ? 309  LEU J CG  1 
ATOM   10877 C  CD1 . LEU D 1 291 ? 70.327  37.326 122.043 1.00 17.92 ? 309  LEU J CD1 1 
ATOM   10878 C  CD2 . LEU D 1 291 ? 72.122  38.897 121.301 1.00 18.70 ? 309  LEU J CD2 1 
ATOM   10879 N  N   . THR D 1 292 ? 66.563  39.522 119.262 1.00 20.30 ? 310  THR J N   1 
ATOM   10880 C  CA  . THR D 1 292 ? 65.617  40.461 118.657 1.00 20.39 ? 310  THR J CA  1 
ATOM   10881 C  C   . THR D 1 292 ? 65.233  41.563 119.640 1.00 21.01 ? 310  THR J C   1 
ATOM   10882 O  O   . THR D 1 292 ? 65.527  41.460 120.834 1.00 20.85 ? 310  THR J O   1 
ATOM   10883 C  CB  . THR D 1 292 ? 64.343  39.742 118.149 1.00 20.29 ? 310  THR J CB  1 
ATOM   10884 O  OG1 . THR D 1 292 ? 63.623  39.194 119.256 1.00 19.76 ? 310  THR J OG1 1 
ATOM   10885 C  CG2 . THR D 1 292 ? 64.698  38.622 117.164 1.00 19.93 ? 310  THR J CG2 1 
ATOM   10886 N  N   . MET D 1 293 ? 64.585  42.615 119.133 1.00 21.61 ? 311  MET J N   1 
ATOM   10887 C  CA  . MET D 1 293 ? 64.068  43.697 119.976 1.00 22.67 ? 311  MET J CA  1 
ATOM   10888 C  C   . MET D 1 293 ? 63.049  43.199 121.004 1.00 23.04 ? 311  MET J C   1 
ATOM   10889 O  O   . MET D 1 293 ? 63.040  43.666 122.146 1.00 23.10 ? 311  MET J O   1 
ATOM   10890 C  CB  . MET D 1 293 ? 63.434  44.813 119.133 1.00 22.60 ? 311  MET J CB  1 
ATOM   10891 C  CG  . MET D 1 293 ? 64.418  45.743 118.436 1.00 23.27 ? 311  MET J CG  1 
ATOM   10892 S  SD  . MET D 1 293 ? 65.637  46.536 119.509 1.00 24.75 ? 311  MET J SD  1 
ATOM   10893 C  CE  . MET D 1 293 ? 64.632  47.496 120.637 1.00 24.20 ? 311  MET J CE  1 
ATOM   10894 N  N   . ASP D 1 294 ? 62.193  42.262 120.589 1.00 23.66 ? 312  ASP J N   1 
ATOM   10895 C  CA  . ASP D 1 294 ? 61.188  41.674 121.481 1.00 24.06 ? 312  ASP J CA  1 
ATOM   10896 C  C   . ASP D 1 294 ? 61.843  40.854 122.591 1.00 23.65 ? 312  ASP J C   1 
ATOM   10897 O  O   . ASP D 1 294 ? 61.424  40.929 123.742 1.00 23.67 ? 312  ASP J O   1 
ATOM   10898 C  CB  . ASP D 1 294 ? 60.168  40.827 120.699 1.00 24.65 ? 312  ASP J CB  1 
ATOM   10899 C  CG  . ASP D 1 294 ? 59.191  41.676 119.881 1.00 26.50 ? 312  ASP J CG  1 
ATOM   10900 O  OD1 . ASP D 1 294 ? 58.487  41.098 119.023 1.00 29.20 ? 312  ASP J OD1 1 
ATOM   10901 O  OD2 . ASP D 1 294 ? 59.111  42.910 120.090 1.00 28.66 ? 312  ASP J OD2 1 
ATOM   10902 N  N   . ASP D 1 295 ? 62.871  40.079 122.239 1.00 23.36 ? 313  ASP J N   1 
ATOM   10903 C  CA  . ASP D 1 295 ? 63.693  39.370 123.224 1.00 22.77 ? 313  ASP J CA  1 
ATOM   10904 C  C   . ASP D 1 295 ? 64.210  40.342 124.284 1.00 22.40 ? 313  ASP J C   1 
ATOM   10905 O  O   . ASP D 1 295 ? 64.166  40.049 125.477 1.00 22.19 ? 313  ASP J O   1 
ATOM   10906 C  CB  . ASP D 1 295 ? 64.886  38.690 122.547 1.00 22.87 ? 313  ASP J CB  1 
ATOM   10907 C  CG  . ASP D 1 295 ? 64.485  37.517 121.671 1.00 23.87 ? 313  ASP J CG  1 
ATOM   10908 O  OD1 . ASP D 1 295 ? 63.303  37.101 121.698 1.00 25.11 ? 313  ASP J OD1 1 
ATOM   10909 O  OD2 . ASP D 1 295 ? 65.369  36.999 120.954 1.00 24.52 ? 313  ASP J OD2 1 
ATOM   10910 N  N   . LEU D 1 296 ? 64.689  41.496 123.821 1.00 22.06 ? 314  LEU J N   1 
ATOM   10911 C  CA  . LEU D 1 296 ? 65.300  42.521 124.660 1.00 22.26 ? 314  LEU J CA  1 
ATOM   10912 C  C   . LEU D 1 296 ? 64.281  43.181 125.587 1.00 22.33 ? 314  LEU J C   1 
ATOM   10913 O  O   . LEU D 1 296 ? 64.522  43.304 126.784 1.00 22.07 ? 314  LEU J O   1 
ATOM   10914 C  CB  . LEU D 1 296 ? 65.952  43.595 123.776 1.00 22.00 ? 314  LEU J CB  1 
ATOM   10915 C  CG  . LEU D 1 296 ? 67.308  44.246 124.094 1.00 22.53 ? 314  LEU J CG  1 
ATOM   10916 C  CD1 . LEU D 1 296 ? 67.331  45.655 123.506 1.00 21.81 ? 314  LEU J CD1 1 
ATOM   10917 C  CD2 . LEU D 1 296 ? 67.689  44.284 125.587 1.00 21.57 ? 314  LEU J CD2 1 
ATOM   10918 N  N   . THR D 1 297 ? 63.154  43.614 125.020 1.00 22.72 ? 315  THR J N   1 
ATOM   10919 C  CA  . THR D 1 297 ? 62.115  44.322 125.772 1.00 23.15 ? 315  THR J CA  1 
ATOM   10920 C  C   . THR D 1 297 ? 61.376  43.409 126.756 1.00 23.63 ? 315  THR J C   1 
ATOM   10921 O  O   . THR D 1 297 ? 60.969  43.852 127.826 1.00 23.86 ? 315  THR J O   1 
ATOM   10922 C  CB  . THR D 1 297 ? 61.099  45.019 124.844 1.00 23.00 ? 315  THR J CB  1 
ATOM   10923 O  OG1 . THR D 1 297 ? 60.522  44.054 123.957 1.00 23.29 ? 315  THR J OG1 1 
ATOM   10924 C  CG2 . THR D 1 297 ? 61.768  46.118 124.031 1.00 22.59 ? 315  THR J CG2 1 
ATOM   10925 N  N   . THR D 1 298 ? 61.213  42.138 126.388 1.00 24.02 ? 316  THR J N   1 
ATOM   10926 C  CA  . THR D 1 298 ? 60.636  41.139 127.281 1.00 24.31 ? 316  THR J CA  1 
ATOM   10927 C  C   . THR D 1 298 ? 61.571  40.926 128.471 1.00 24.51 ? 316  THR J C   1 
ATOM   10928 O  O   . THR D 1 298 ? 61.118  40.814 129.615 1.00 24.84 ? 316  THR J O   1 
ATOM   10929 C  CB  . THR D 1 298 ? 60.372  39.801 126.547 1.00 24.19 ? 316  THR J CB  1 
ATOM   10930 O  OG1 . THR D 1 298 ? 59.462  40.030 125.469 1.00 25.41 ? 316  THR J OG1 1 
ATOM   10931 C  CG2 . THR D 1 298 ? 59.756  38.764 127.479 1.00 24.62 ? 316  THR J CG2 1 
ATOM   10932 N  N   . ALA D 1 299 ? 62.873  40.889 128.199 1.00 24.23 ? 317  ALA J N   1 
ATOM   10933 C  CA  . ALA D 1 299 ? 63.865  40.690 129.245 1.00 24.21 ? 317  ALA J CA  1 
ATOM   10934 C  C   . ALA D 1 299 ? 63.966  41.877 130.193 1.00 24.42 ? 317  ALA J C   1 
ATOM   10935 O  O   . ALA D 1 299 ? 64.156  41.690 131.391 1.00 24.07 ? 317  ALA J O   1 
ATOM   10936 C  CB  . ALA D 1 299 ? 65.212  40.360 128.645 1.00 24.13 ? 317  ALA J CB  1 
ATOM   10937 N  N   . LEU D 1 300 ? 63.831  43.091 129.654 1.00 24.81 ? 318  LEU J N   1 
ATOM   10938 C  CA  . LEU D 1 300 ? 63.899  44.321 130.451 1.00 25.33 ? 318  LEU J CA  1 
ATOM   10939 C  C   . LEU D 1 300 ? 62.676  44.475 131.356 1.00 25.97 ? 318  LEU J C   1 
ATOM   10940 O  O   . LEU D 1 300 ? 62.780  44.977 132.480 1.00 25.70 ? 318  LEU J O   1 
ATOM   10941 C  CB  . LEU D 1 300 ? 64.024  45.547 129.540 1.00 25.11 ? 318  LEU J CB  1 
ATOM   10942 C  CG  . LEU D 1 300 ? 65.353  45.769 128.815 1.00 24.77 ? 318  LEU J CG  1 
ATOM   10943 C  CD1 . LEU D 1 300 ? 65.123  46.532 127.520 1.00 25.16 ? 318  LEU J CD1 1 
ATOM   10944 C  CD2 . LEU D 1 300 ? 66.351  46.490 129.703 1.00 23.14 ? 318  LEU J CD2 1 
ATOM   10945 N  N   . GLU D 1 301 ? 61.527  44.047 130.834 1.00 26.47 ? 319  GLU J N   1 
ATOM   10946 C  CA  . GLU D 1 301 ? 60.251  44.041 131.537 1.00 27.28 ? 319  GLU J CA  1 
ATOM   10947 C  C   . GLU D 1 301 ? 60.336  43.156 132.785 1.00 26.84 ? 319  GLU J C   1 
ATOM   10948 O  O   . GLU D 1 301 ? 59.763  43.478 133.831 1.00 27.03 ? 319  GLU J O   1 
ATOM   10949 C  CB  . GLU D 1 301 ? 59.165  43.534 130.574 1.00 27.72 ? 319  GLU J CB  1 
ATOM   10950 C  CG  . GLU D 1 301 ? 57.733  43.506 131.099 1.00 30.61 ? 319  GLU J CG  1 
ATOM   10951 C  CD  . GLU D 1 301 ? 56.718  43.030 130.044 1.00 34.88 ? 319  GLU J CD  1 
ATOM   10952 O  OE1 . GLU D 1 301 ? 57.132  42.617 128.925 1.00 35.42 ? 319  GLU J OE1 1 
ATOM   10953 O  OE2 . GLU D 1 301 ? 55.496  43.075 130.339 1.00 36.43 ? 319  GLU J OE2 1 
ATOM   10954 N  N   . GLY D 1 302 ? 61.066  42.050 132.665 1.00 26.32 ? 320  GLY J N   1 
ATOM   10955 C  CA  . GLY D 1 302 ? 61.229  41.100 133.760 1.00 25.78 ? 320  GLY J CA  1 
ATOM   10956 C  C   . GLY D 1 302 ? 62.562  41.214 134.472 1.00 25.17 ? 320  GLY J C   1 
ATOM   10957 O  O   . GLY D 1 302 ? 63.011  40.253 135.098 1.00 25.06 ? 320  GLY J O   1 
ATOM   10958 N  N   . ASN D 1 303 ? 63.183  42.391 134.368 1.00 24.84 ? 321  ASN J N   1 
ATOM   10959 C  CA  . ASN D 1 303 ? 64.488  42.701 134.990 1.00 24.57 ? 321  ASN J CA  1 
ATOM   10960 C  C   . ASN D 1 303 ? 65.602  41.665 134.750 1.00 23.74 ? 321  ASN J C   1 
ATOM   10961 O  O   . ASN D 1 303 ? 66.391  41.360 135.651 1.00 23.52 ? 321  ASN J O   1 
ATOM   10962 C  CB  . ASN D 1 303 ? 64.317  42.971 136.493 1.00 25.01 ? 321  ASN J CB  1 
ATOM   10963 C  CG  . ASN D 1 303 ? 63.364  44.118 136.779 1.00 26.55 ? 321  ASN J CG  1 
ATOM   10964 O  OD1 . ASN D 1 303 ? 63.570  45.253 136.328 1.00 28.33 ? 321  ASN J OD1 1 
ATOM   10965 N  ND2 . ASN D 1 303 ? 62.317  43.830 137.544 1.00 27.72 ? 321  ASN J ND2 1 
ATOM   10966 N  N   . ARG D 1 304 ? 65.665  41.133 133.533 1.00 22.76 ? 322  ARG J N   1 
ATOM   10967 C  CA  . ARG D 1 304 ? 66.616  40.067 133.210 1.00 21.97 ? 322  ARG J CA  1 
ATOM   10968 C  C   . ARG D 1 304 ? 67.881  40.576 132.520 1.00 21.10 ? 322  ARG J C   1 
ATOM   10969 O  O   . ARG D 1 304 ? 68.857  39.843 132.399 1.00 20.85 ? 322  ARG J O   1 
ATOM   10970 C  CB  . ARG D 1 304 ? 65.939  38.990 132.355 1.00 22.10 ? 322  ARG J CB  1 
ATOM   10971 C  CG  . ARG D 1 304 ? 64.955  38.087 133.117 1.00 23.02 ? 322  ARG J CG  1 
ATOM   10972 C  CD  . ARG D 1 304 ? 64.017  37.375 132.151 1.00 24.37 ? 322  ARG J CD  1 
ATOM   10973 N  NE  . ARG D 1 304 ? 64.758  36.877 130.993 1.00 25.