data_2ACE
# 
_entry.id   2ACE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ACE         
WWPDB D_1000177732 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1996-11-08 
_pdbx_database_PDB_obs_spr.pdb_id           2ACE 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1ACE 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ACE 
_pdbx_database_status.recvd_initial_deposition_date   1996-06-23 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Harel, M.'     1 
'Raves, M.L.'   2 
'Silman, I.'    3 
'Sussman, J.L.' 4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Structure of acetylcholinesterase complexed with the nootropic alkaloid, (-)-huperzine A.' Nat.Struct.Biol.       4    57 
63 1997 NSBIEW US 1072-8368 2024 ? 8989325 10.1038/nsb0197-57 
1       
'Residues in Torpedo Californica Acetylcholinesterase Necessary for Processing to a Glycosyl Phosphatidylinositol-Anchored Form' 
Biochim.Biophys.Acta   1292 223  ?  1996 BBACAQ NE 0006-3002 0113 ? ?       ?                  
2       
;Structure and Dynamics of the Active Site Gorge of Acetylcholinesterase: Synergistic Use of Molecular Dynamics Simulation and X-Ray Crystallography
;
'Protein Sci.'         3    188  ?  1994 PRCIEI US 0961-8368 0795 ? ?       ?                  
3       'Quaternary Ligand Binding to Aromatic Residues in the Active-Site Gorge of Acetylcholinesterase' Proc.Natl.Acad.Sci.USA 
90   9031 ?  1993 PNASA6 US 0027-8424 0040 ? ?       ?                  
4       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253  872  ?  1991 SCIEAS US 0036-8075 0038 ? ?       ?                  
5       
;Purification and Crystallization of a Dimeric Form of Acetylcholinesterase from Torpedo Californica Subsequent to Solubilization with Phosphatidylinositol-Specific Phospholipase C
;
J.Mol.Biol.            203  821  ?  1988 JMOBAK UK 0022-2836 0070 ? ?       ?                  
6       'Primary Structure of Torpedo Californica Acetylcholinesterase Deduced from its Cdna Sequence' Nature                 319  
407  ?  1986 NATUAS UK 0028-0836 0006 ? ?       ?                  
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Raves, M.L.'         1  
primary 'Harel, M.'           2  
primary 'Pang, Y.-P.'         3  
primary 'Silman, I.'          4  
primary 'Kozikowski, A.P.'    5  
primary 'Sussman, J.L.'       6  
1       'Bucht, G.'           7  
1       'Hjalmarsson, K.'     8  
2       'Axelsen, P.H.'       9  
2       'Harel, M.'           10 
2       'Silman, I.'          11 
2       'Sussman, J.L.'       12 
3       'Harel, M.'           13 
3       'Schalk, I.'          14 
3       'Ehret-Sabatier, L.'  15 
3       'Bouet, F.'           16 
3       'Goeldner, M.'        17 
3       'Hirth, C.'           18 
3       'Axelsen, P.H.'       19 
3       'Silman, I.'          20 
3       'Sussman, J.L.'       21 
4       'Sussman, J.L.'       22 
4       'Harel, M.'           23 
4       'Frolow, F.'          24 
4       'Oefner, C.'          25 
4       'Goldman, A.'         26 
4       'Toker, L.'           27 
4       'Silman, I.'          28 
5       'Sussman, J.L.'       29 
5       'Harel, M.'           30 
5       'Frolow, F.'          31 
5       'Varon, L.'           32 
5       'Toker, L.'           33 
5       'Futerman, A.H.'      34 
5       'Silman, I.'          35 
6       'Schumacher, M.'      36 
6       'Camp, S.'            37 
6       'Maulet, Y.'          38 
6       'Newton, M.'          39 
6       'Macphee-Quigley, K.' 40 
6       'Taylor, S.S.'        41 
6       'Friedmann, T.'       42 
6       'Taylor, P.'          43 
# 
_cell.entry_id           2ACE 
_cell.length_a           112.410 
_cell.length_b           112.410 
_cell.length_c           136.700 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2ACE 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE 60736.516 1   3.1.1.7 ? ? ? 
2 non-polymer syn ACETYLCHOLINE        146.207   1   ?       ? ? ? 
3 water       nat water                18.015    204 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ELECTROPLAQUE 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               'G2 FORM' 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ACE 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACH non-polymer         . ACETYLCHOLINE   ? 'C7 H16 N O2 1'  146.207 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ACE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.8 
_exptl_crystal.density_percent_sol   68. 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    'PROTEIN WAS CRYSTALLIZED FROM 35% PEG 200, 100 MM MES, PH 5.8, AT 4 DEG., temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           273 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1993-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2ACE 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             25.0 
_reflns.d_resolution_high            2.25 
_reflns.number_obs                   46243 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.095 
_reflns.pdbx_netI_over_sigmaI        7.4 
_reflns.B_iso_Wilson_estimate        33.9 
_reflns.pdbx_redundancy              1.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.25 
_reflns_shell.d_res_low              2.33 
_reflns_shell.percent_possible_all   96.7 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.713 
_reflns_shell.meanI_over_sigI_obs    0.9 
_reflns_shell.pdbx_redundancy        1.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ACE 
_refine.ls_number_reflns_obs                     30035 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             8.00 
_refine.ls_d_res_high                            2.50 
_refine.ls_percent_reflns_obs                    96.6 
_refine.ls_R_factor_obs                          0.199 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.199 
_refine.ls_R_factor_R_free                       0.258 
_refine.ls_R_factor_R_free_error                 0.006 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.2 
_refine.ls_number_reflns_R_free                  1555 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               24.5 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  
;THE NATURAL SUBSTRATE ACETYLCHOLINE, IN AN ALL-TRANS
CONFORMATION, HAS BEEN MANUALLY DOCKED INTO THE ACTIVE
SITE, COVALENTLY BOUND TO SER 200 IN A TETRAHEDRAL
INTERMEDIATE CONFORMATION.  THE ACETYLCHOLINE IS A MODEL,
NOT DERIVED FROM THE EXPERIMENTAL DATA.
;
_refine.pdbx_starting_model                      'PDB ENTRY 1ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        2ACE 
_refine_analyze.Luzzati_coordinate_error_obs    0.25 
_refine_analyze.Luzzati_sigma_a_obs             0.27 
_refine_analyze.Luzzati_d_res_low_obs           8.00 
_refine_analyze.Luzzati_coordinate_error_free   0.33 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4143 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             204 
_refine_hist.number_atoms_total               4357 
_refine_hist.d_res_high                       2.50 
_refine_hist.d_res_low                        8.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
x_bond_d                0.016 ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d      24.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d      1.60  ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
x_mcbond_it             1.41  1.50 ? ? 'X-RAY DIFFRACTION' ? 
x_mcangle_it            2.26  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scbond_it             2.09  2.00 ? ? 'X-RAY DIFFRACTION' ? 
x_scangle_it            3.12  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.d_res_high                       2.50 
_refine_ls_shell.d_res_low                        2.61 
_refine_ls_shell.number_reflns_R_work             3181 
_refine_ls_shell.R_factor_R_work                  0.308 
_refine_ls_shell.percent_reflns_obs               99.3 
_refine_ls_shell.R_factor_R_free                  0.39 
_refine_ls_shell.R_factor_R_free_error            0.025 
_refine_ls_shell.percent_reflns_R_free            5.2 
_refine_ls_shell.number_reflns_R_free             167 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.R_factor_all                     ? 
# 
loop_
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
_pdbx_xplor_file.pdbx_refine_id 
1 PARHCSDX.PRO TOPHCSDX.PRO 'X-RAY DIFFRACTION' 
2 PARAM11.WAT  TOPH11.WAT   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  2ACE 
_struct.title                     'NATIVE ACETYLCHOLINESTERASE (E.C. 3.1.1.7) FROM TORPEDO CALIFORNICA' 
_struct.pdbx_descriptor           'ACETYLCHOLINESTERASE, ACETYLCHOLINE' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ACE 
_struct_keywords.pdbx_keywords   'SERINE HYDROLASE' 
_struct_keywords.text            'SERINE HYDROLASE, NEUROTRANSMITTER CLEAVAGE, CATALYTIC TRIAD, ALPHA/BETA HYDROLASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;TORPEDO CALIFONICA ACETYLCHOLINESTERASE IS A G2 DIMER IN
SOLUTION (SEE SUSSMAN 1988).  THE ASYMMETRIC UNIT CONTAINS
A MONOMER, WITH THE CRYSTALLOGRAPHIC TWO-FOLD AXIS RELATING
THE TWO MONOMERS IN A DIMER.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1A  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  2A  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  3A  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  4A  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  5A  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  6A  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  7A  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  8A  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  9A  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 10A ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 11A ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 12A GLY A 384 ? VAL A 400 ? GLY A 384 VAL A 400 1 ? 17 
HELX_P HELX_P13 13A VAL A 400 ? TYR A 411 ? VAL A 400 TYR A 411 1 ? 12 
HELX_P HELX_P14 14A GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P15 15A ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P16 16A VAL A 518 ? THR A 535 ? VAL A 518 THR A 535 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 67  SG ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.015 ? 
disulf2 disulf ? ? A CYS 254 SG ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.003 ? 
disulf3 disulf ? ? A CYS 402 SG ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.022 ? 
covale1 covale ? ? B ACH .   C5 ? ? ? 1_555 A SER 200 OG ? ? A ACH 998 A SER 200 1_555 ? ? ? ? ? ? ? 1.475 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3  ? 
B ? 11 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1  2  ? anti-parallel 
A 2  3  ? parallel      
B 1  2  ? anti-parallel 
B 2  3  ? anti-parallel 
B 3  4  ? anti-parallel 
B 4  5  ? parallel      
B 5  6  ? parallel      
B 6  7  ? parallel      
B 7  8  ? parallel      
B 8  9  ? parallel      
B 9  10 ? parallel      
B 10 11 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1  LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A 2  GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
A 3  VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B 1  MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B 2  HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
B 3  TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B 4  VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B 5  THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B 6  THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B 7  ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B 8  GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B 9  GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B 10 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B 11 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1  2  O VAL A 8   ? O VAL A 8   N VAL A 15  ? N VAL A 15  
A 2  3  O LYS A 14  ? O LYS A 14  N TRP A 58  ? N TRP A 58  
B 1  2  N THR A 18  ? N THR A 18  O ALA A 29  ? O ALA A 29  
B 2  3  O PHE A 30  ? O PHE A 30  N ILE A 99  ? N ILE A 99  
B 3  4  O TRP A 100 ? O TRP A 100 N LEU A 143 ? N LEU A 143 
B 4  5  O VAL A 142 ? O VAL A 142 N MET A 112 ? N MET A 112 
B 5  6  N VAL A 113 ? N VAL A 113 O THR A 195 ? O THR A 195 
B 6  7  O ILE A 196 ? O ILE A 196 N ILE A 223 ? N ILE A 223 
B 7  8  O LEU A 224 ? O LEU A 224 N GLY A 322 ? N GLY A 322 
B 8  9  O LEU A 321 ? O LEU A 321 N TYR A 421 ? N TYR A 421 
B 9  10 O LEU A 420 ? O LEU A 420 N ILE A 503 ? N ILE A 503 
B 10 11 O PHE A 502 ? O PHE A 502 N HIS A 513 ? N HIS A 513 
# 
_struct_site.id                   CAT 
_struct_site.pdbx_evidence_code   Unknown 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'CATALYTIC TRIAD.' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 CAT 3 SER A 200 ? SER A 200 . ? 1_555 ? 
2 CAT 3 GLU A 327 ? GLU A 327 . ? 1_555 ? 
3 CAT 3 HIS A 440 ? HIS A 440 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ACE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ACE 
_atom_sites.fract_transf_matrix[1][1]   0.008896 
_atom_sites.fract_transf_matrix[1][2]   0.005136 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010272 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007315 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.542 87.338 34.691 1.00   45.63 ? 4   SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -11.865 87.982 35.872 1.00   44.10 ? 4   SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -10.724 87.090 36.350 1.00   42.02 ? 4   SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -10.816 85.853 36.285 1.00   42.64 ? 4   SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -12.860 88.168 37.030 1.00   46.45 ? 4   SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.201 88.584 38.249 1.00   48.60 ? 4   SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.678  87.717 36.883 1.00   39.05 ? 5   GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.509  86.999 37.390 1.00   34.59 ? 5   GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -8.902  86.053 38.509 1.00   31.22 ? 5   GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.170  85.123 38.803 1.00   30.96 ? 5   GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.503  88.002 37.915 1.00   34.35 ? 5   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.194  87.401 38.248 1.00   36.57 ? 5   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -5.141  88.455 38.508 1.00   39.29 ? 5   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.505  89.585 38.949 1.00   41.36 ? 5   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -3.944  88.153 38.258 1.00   40.16 ? 5   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -10.072 86.283 39.104 1.00   27.93 ? 6   LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.549 85.460 40.201 1.00   27.35 ? 6   LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.604 84.461 39.798 1.00   28.45 ? 6   LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -12.010 83.591 40.576 1.00   29.12 ? 6   LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -11.077 86.346 41.317 1.00   26.13 ? 6   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -10.086 87.414 41.763 1.00   24.28 ? 6   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -10.708 88.197 42.864 1.00   24.95 ? 6   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -8.827  86.777 42.251 1.00   23.62 ? 6   LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -12.104 84.590 38.590 1.00   29.38 ? 7   LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -13.101 83.636 38.148 1.00   29.87 ? 7   LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.321 82.664 37.300 1.00   29.80 ? 7   LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.556 83.086 36.413 1.00   31.94 ? 7   LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.147 84.327 37.297 1.00   31.75 ? 7   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.288 83.419 36.871 1.00   34.00 ? 7   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -16.131 83.081 38.088 1.00   35.28 ? 7   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.147 84.139 35.831 1.00   37.55 ? 7   LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.412 81.382 37.605 1.00   26.83 ? 8   VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.703 80.412 36.806 1.00   25.45 ? 8   VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.642 79.299 36.422 1.00   26.73 ? 8   VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.614 79.020 37.118 1.00   26.77 ? 8   VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.494 79.872 37.534 1.00   23.39 ? 8   VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -9.958  78.656 36.837 1.00   22.24 ? 8   VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.431  80.905 37.532 1.00   21.17 ? 8   VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.425 78.724 35.254 1.00   27.26 ? 9   ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.287 77.645 34.834 1.00   27.31 ? 9   ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.494 76.391 34.944 1.00   26.09 ? 9   ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -11.298 76.373 34.634 1.00   27.68 ? 9   ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -13.715 77.830 33.401 1.00   30.54 ? 9   ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.141 78.213 33.290 1.00   31.84 ? 9   ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -16.030 77.346 33.336 1.00   33.60 ? 9   ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.397 79.524 33.177 1.00   33.08 ? 9   ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.143 75.334 35.380 1.00   22.94 ? 10  THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.445 74.096 35.522 1.00   23.00 ? 10  THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.399 73.053 35.023 1.00   22.60 ? 10  THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.579 73.306 34.915 1.00   22.29 ? 10  THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.166 73.829 37.012 1.00   23.26 ? 10  THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.412 73.706 37.714 1.00   22.81 ? 10  THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.382 74.947 37.602 1.00   19.73 ? 10  THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -12.917 71.847 34.804 1.00   22.16 ? 11  LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.795 70.800 34.355 1.00   21.59 ? 11  LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.849 70.432 35.410 1.00   23.48 ? 11  LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.738 69.632 35.124 1.00   26.32 ? 11  LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.960 69.596 33.958 1.00   19.60 ? 11  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.806 70.011 33.068 1.00   17.31 ? 11  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -10.930 68.864 32.651 1.00   15.24 ? 11  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.781  69.398 31.890 1.00   13.26 ? 11  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.725  68.390 31.809 1.00   14.46 ? 11  LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.776 71.008 36.616 1.00   24.15 ? 12  SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.766 70.707 37.682 1.00   23.78 ? 12  SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.857 71.753 37.851 1.00   22.02 ? 12  SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.963 71.455 38.318 1.00   20.83 ? 12  SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -15.071 70.521 39.029 1.00   25.28 ? 12  SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.287 69.337 39.053 1.00   26.22 ? 12  SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.520 72.988 37.520 1.00   21.38 ? 13  GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.458 74.083 37.619 1.00   21.89 ? 13  GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.627 75.339 37.685 1.00   23.88 ? 13  GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.402 75.273 37.614 1.00   24.19 ? 13  GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.262 76.497 37.739 1.00   27.22 ? 14  LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.500 77.746 37.846 1.00   29.06 ? 14  LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.130 77.880 39.328 1.00   29.19 ? 14  LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -16.809 77.314 40.203 1.00   29.22 ? 14  LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.338 78.943 37.362 1.00   30.15 ? 14  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.953 78.706 36.000 1.00   31.92 ? 14  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.914 79.791 35.610 1.00   34.75 ? 14  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.663 79.434 34.316 1.00   36.73 ? 14  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.593 78.255 34.482 1.00   39.24 ? 14  LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.124 78.689 39.614 1.00   28.44 ? 15  VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.622 78.850 40.960 1.00   27.03 ? 15  VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.327 80.316 41.096 1.00   27.80 ? 15  VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.732 80.897 40.204 1.00   28.02 ? 15  VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.330 78.030 41.067 1.00   25.78 ? 15  VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.274 78.777 41.758 1.00   26.64 ? 15  VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.588 76.719 41.730 1.00   25.49 ? 15  VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.679 80.904 42.230 1.00   29.81 ? 16  MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.481 82.334 42.457 1.00   31.26 ? 16  MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.490 82.503 43.593 1.00   31.30 ? 16  MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.786 82.205 44.752 1.00   32.07 ? 16  MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.835 82.975 42.821 1.00   34.00 ? 16  MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.844 84.457 43.156 1.00   36.16 ? 16  MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.753 85.494 41.713 1.00   39.23 ? 16  MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.609 86.772 42.316 1.00   38.52 ? 16  MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.297 82.941 43.260 1.00   31.28 ? 17  GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.290 83.110 44.275 1.00   32.21 ? 17  GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.410 84.442 44.955 1.00   32.53 ? 17  GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.465 85.054 44.976 1.00   34.16 ? 17  GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.315 84.871 45.547 1.00   32.60 ? 18  THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.254 86.131 46.235 1.00   32.94 ? 18  THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -8.814  86.508 46.070 1.00   32.78 ? 18  THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -7.961  85.637 45.840 1.00   32.60 ? 18  THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.507 85.971 47.712 1.00   33.82 ? 18  THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.348 87.247 48.340 1.00   36.62 ? 18  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.491  85.021 48.324 1.00   34.59 ? 18  THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.515  87.786 46.183 1.00   33.67 ? 19  ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.131  88.172 46.014 1.00   34.94 ? 19  ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.609  88.521 47.372 1.00   33.75 ? 19  ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.282  89.189 48.149 1.00   34.61 ? 19  ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -6.993  89.329 45.037 1.00   37.26 ? 19  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -7.326  90.672 45.560 1.00   41.67 ? 19  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.895  91.718 44.524 1.00   46.63 ? 19  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -5.579  91.385 43.958 1.00   51.81 ? 19  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -4.794  92.248 43.298 1.00   55.30 ? 19  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -5.181  93.532 43.127 1.00   56.43 ? 19  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -3.650  91.812 42.729 1.00   56.12 ? 19  ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.466  87.958 47.709 1.00   33.31 ? 20  VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -4.877  88.192 49.011 1.00   32.19 ? 20  VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.681  89.120 48.875 1.00   30.88 ? 20  VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -3.028  89.154 47.823 1.00   30.61 ? 20  VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.435  86.855 49.606 1.00   32.76 ? 20  VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -5.663  85.954 49.780 1.00   32.59 ? 20  VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.435  86.168 48.653 1.00   32.13 ? 20  VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.441  89.966 49.884 1.00   29.59 ? 21  PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.289  90.875 49.789 1.00   28.73 ? 21  PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.058  90.106 50.196 1.00   27.42 ? 21  PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.153  89.246 51.060 1.00   27.29 ? 21  PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.626  91.965 50.808 1.00   29.00 ? 21  PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.453  91.208 51.850 1.00   29.07 ? 21  PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.327  90.311 51.011 1.00   29.02 ? 21  PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? 0.071   90.354 49.542 1.00   27.18 ? 22  VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.324   89.669 49.864 1.00   27.36 ? 22  VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.419   90.698 49.734 1.00   28.56 ? 22  VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.452   91.424 48.740 1.00   30.08 ? 22  VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.733   88.593 48.837 1.00   25.53 ? 22  VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.712   87.644 49.479 1.00   24.02 ? 22  VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 0.546   87.879 48.257 1.00   23.49 ? 22  VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.335   90.708 50.694 1.00   29.02 ? 23  LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.472   91.612 50.705 1.00   30.92 ? 23  LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 4.298   92.866 49.851 1.00   32.74 ? 23  LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 4.961   93.024 48.822 1.00   33.96 ? 23  LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.710   90.865 50.234 1.00   30.74 ? 23  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 5.972   89.527 50.913 1.00   30.71 ? 23  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 6.907   88.670 50.094 1.00   31.74 ? 23  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.550   89.793 52.253 1.00   31.46 ? 23  LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 3.360   93.720 50.216 1.00   33.71 ? 24  SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 3.172   94.950 49.443 1.00   36.41 ? 24  SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 2.825   94.636 47.993 1.00   35.29 ? 24  SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 3.440   95.175 47.062 1.00   37.64 ? 24  SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 4.462   95.790 49.459 1.00   38.08 ? 24  SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 5.423   95.311 48.502 1.00   40.32 ? 24  SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 1.823   93.795 47.803 1.00   33.22 ? 25  SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.406   93.401 46.481 1.00   30.65 ? 25  SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.252   92.451 46.705 1.00   29.93 ? 25  SER A C   1 
ATOM   157  O O   . SER A 1 25  ? -0.296  92.405 47.803 1.00   29.94 ? 25  SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.553   92.696 45.784 1.00   30.65 ? 25  SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 2.162   92.360 44.465 1.00   32.21 ? 25  SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.152  91.690 45.698 1.00   29.70 ? 26  HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.284  90.785 45.906 1.00   29.64 ? 26  HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.221  89.582 44.980 1.00   29.93 ? 26  HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.334  89.491 44.115 1.00   32.07 ? 26  HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.599  91.530 45.664 1.00   29.88 ? 26  HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -2.703  92.838 46.396 1.00   32.04 ? 26  HIS A CG  1 
ATOM   166  N N   . ILE A 1 27  ? -2.126  88.634 45.187 1.00   27.91 ? 27  ILE A N   1 
ATOM   167  C CA  . ILE A 1 27  ? -2.199  87.466 44.333 1.00   25.73 ? 27  ILE A CA  1 
ATOM   168  C C   . ILE A 1 27  ? -3.584  86.908 44.494 1.00   24.93 ? 27  ILE A C   1 
ATOM   169  O O   . ILE A 1 27  ? -4.358  87.398 45.319 1.00   24.21 ? 27  ILE A O   1 
ATOM   170  C CB  . ILE A 1 27  ? -1.223  86.402 44.711 1.00   26.86 ? 27  ILE A CB  1 
ATOM   171  C CG1 . ILE A 1 27  ? -1.458  85.982 46.145 1.00   27.65 ? 27  ILE A CG1 1 
ATOM   172  C CG2 . ILE A 1 27  ? 0.204   86.897 44.525 1.00   28.06 ? 27  ILE A CG2 1 
ATOM   173  C CD1 . ILE A 1 27  ? -0.587  84.832 46.532 1.00   30.42 ? 27  ILE A CD1 1 
ATOM   174  N N   . SER A 1 28  ? -3.917  85.911 43.690 1.00   24.30 ? 28  SER A N   1 
ATOM   175  C CA  . SER A 1 28  ? -5.239  85.317 43.763 1.00   24.25 ? 28  SER A CA  1 
ATOM   176  C C   . SER A 1 28  ? -5.134  84.138 44.684 1.00   23.41 ? 28  SER A C   1 
ATOM   177  O O   . SER A 1 28  ? -4.048  83.590 44.859 1.00   23.47 ? 28  SER A O   1 
ATOM   178  C CB  . SER A 1 28  ? -5.678  84.809 42.392 1.00   24.72 ? 28  SER A CB  1 
ATOM   179  O OG  . SER A 1 28  ? -5.407  85.757 41.379 1.00   29.18 ? 28  SER A OG  1 
ATOM   180  N N   . ALA A 1 29  ? -6.253  83.713 45.240 1.00   21.90 ? 29  ALA A N   1 
ATOM   181  C CA  . ALA A 1 29  ? -6.257  82.569 46.112 1.00   20.23 ? 29  ALA A CA  1 
ATOM   182  C C   . ALA A 1 29  ? -7.590  81.976 45.828 1.00   20.63 ? 29  ALA A C   1 
ATOM   183  O O   . ALA A 1 29  ? -8.591  82.700 45.733 1.00   21.86 ? 29  ALA A O   1 
ATOM   184  C CB  . ALA A 1 29  ? -6.185  83.003 47.560 1.00   18.99 ? 29  ALA A CB  1 
ATOM   185  N N   . PHE A 1 30  ? -7.603  80.687 45.576 1.00   20.13 ? 30  PHE A N   1 
ATOM   186  C CA  . PHE A 1 30  ? -8.847  79.991 45.324 1.00   21.57 ? 30  PHE A CA  1 
ATOM   187  C C   . PHE A 1 30  ? -8.738  79.027 46.481 1.00   22.44 ? 30  PHE A C   1 
ATOM   188  O O   . PHE A 1 30  ? -7.874  78.149 46.469 1.00   25.76 ? 30  PHE A O   1 
ATOM   189  C CB  . PHE A 1 30  ? -8.787  79.317 43.937 1.00   20.52 ? 30  PHE A CB  1 
ATOM   190  C CG  . PHE A 1 30  ? -8.640  80.309 42.805 1.00   19.49 ? 30  PHE A CG  1 
ATOM   191  C CD1 . PHE A 1 30  ? -7.406  80.834 42.488 1.00   16.98 ? 30  PHE A CD1 1 
ATOM   192  C CD2 . PHE A 1 30  ? -9.761  80.803 42.144 1.00   18.80 ? 30  PHE A CD2 1 
ATOM   193  C CE1 . PHE A 1 30  ? -7.289  81.840 41.549 1.00   18.44 ? 30  PHE A CE1 1 
ATOM   194  C CE2 . PHE A 1 30  ? -9.657  81.800 41.211 1.00   18.10 ? 30  PHE A CE2 1 
ATOM   195  C CZ  . PHE A 1 30  ? -8.423  82.326 40.911 1.00   19.88 ? 30  PHE A CZ  1 
ATOM   196  N N   . LEU A 1 31  ? -9.510  79.249 47.538 1.00   21.13 ? 31  LEU A N   1 
ATOM   197  C CA  . LEU A 1 31  ? -9.380  78.413 48.721 1.00   19.06 ? 31  LEU A CA  1 
ATOM   198  C C   . LEU A 1 31  ? -10.599 77.581 48.978 1.00   19.71 ? 31  LEU A C   1 
ATOM   199  O O   . LEU A 1 31  ? -11.713 78.055 48.882 1.00   19.58 ? 31  LEU A O   1 
ATOM   200  C CB  . LEU A 1 31  ? -9.107  79.286 49.931 1.00   16.07 ? 31  LEU A CB  1 
ATOM   201  C CG  . LEU A 1 31  ? -8.051  80.356 49.803 1.00   13.97 ? 31  LEU A CG  1 
ATOM   202  C CD1 . LEU A 1 31  ? -8.361  81.418 50.789 1.00   15.53 ? 31  LEU A CD1 1 
ATOM   203  C CD2 . LEU A 1 31  ? -6.694  79.799 50.006 1.00   14.55 ? 31  LEU A CD2 1 
ATOM   204  N N   . GLY A 1 32  ? -10.375 76.337 49.347 1.00   20.17 ? 32  GLY A N   1 
ATOM   205  C CA  . GLY A 1 32  ? -11.483 75.454 49.616 1.00   21.07 ? 32  GLY A CA  1 
ATOM   206  C C   . GLY A 1 32  ? -12.187 74.843 48.418 1.00   22.32 ? 32  GLY A C   1 
ATOM   207  O O   . GLY A 1 32  ? -13.395 74.565 48.502 1.00   23.36 ? 32  GLY A O   1 
ATOM   208  N N   . ILE A 1 33  ? -11.470 74.586 47.326 1.00   20.06 ? 33  ILE A N   1 
ATOM   209  C CA  . ILE A 1 33  ? -12.113 73.999 46.151 1.00   19.99 ? 33  ILE A CA  1 
ATOM   210  C C   . ILE A 1 33  ? -12.216 72.529 46.472 1.00   19.74 ? 33  ILE A C   1 
ATOM   211  O O   . ILE A 1 33  ? -11.240 71.924 46.852 1.00   21.59 ? 33  ILE A O   1 
ATOM   212  C CB  . ILE A 1 33  ? -11.242 74.173 44.901 1.00   19.01 ? 33  ILE A CB  1 
ATOM   213  C CG1 . ILE A 1 33  ? -11.071 75.655 44.590 1.00   19.56 ? 33  ILE A CG1 1 
ATOM   214  C CG2 . ILE A 1 33  ? -11.860 73.468 43.739 1.00   16.55 ? 33  ILE A CG2 1 
ATOM   215  C CD1 . ILE A 1 33  ? -9.745  75.982 43.922 1.00   20.70 ? 33  ILE A CD1 1 
ATOM   216  N N   . PRO A 1 34  ? -13.381 71.926 46.325 1.00   19.81 ? 34  PRO A N   1 
ATOM   217  C CA  . PRO A 1 34  ? -13.462 70.499 46.646 1.00   21.21 ? 34  PRO A CA  1 
ATOM   218  C C   . PRO A 1 34  ? -12.961 69.563 45.539 1.00   23.20 ? 34  PRO A C   1 
ATOM   219  O O   . PRO A 1 34  ? -13.092 69.865 44.345 1.00   27.08 ? 34  PRO A O   1 
ATOM   220  C CB  . PRO A 1 34  ? -14.943 70.310 46.922 1.00   20.13 ? 34  PRO A CB  1 
ATOM   221  C CG  . PRO A 1 34  ? -15.576 71.255 45.956 1.00   21.28 ? 34  PRO A CG  1 
ATOM   222  C CD  . PRO A 1 34  ? -14.697 72.480 45.987 1.00   21.01 ? 34  PRO A CD  1 
ATOM   223  N N   . PHE A 1 35  ? -12.383 68.428 45.915 1.00   22.65 ? 35  PHE A N   1 
ATOM   224  C CA  . PHE A 1 35  ? -11.895 67.490 44.920 1.00   21.82 ? 35  PHE A CA  1 
ATOM   225  C C   . PHE A 1 35  ? -12.496 66.115 45.074 1.00   22.55 ? 35  PHE A C   1 
ATOM   226  O O   . PHE A 1 35  ? -12.158 65.207 44.297 1.00   25.58 ? 35  PHE A O   1 
ATOM   227  C CB  . PHE A 1 35  ? -10.375 67.391 44.961 1.00   21.78 ? 35  PHE A CB  1 
ATOM   228  C CG  . PHE A 1 35  ? -9.828  66.866 46.267 1.00   22.77 ? 35  PHE A CG  1 
ATOM   229  C CD1 . PHE A 1 35  ? -10.040 65.558 46.655 1.00   23.61 ? 35  PHE A CD1 1 
ATOM   230  C CD2 . PHE A 1 35  ? -9.073  67.677 47.089 1.00   23.08 ? 35  PHE A CD2 1 
ATOM   231  C CE1 . PHE A 1 35  ? -9.513  65.078 47.821 1.00   21.65 ? 35  PHE A CE1 1 
ATOM   232  C CE2 . PHE A 1 35  ? -8.552  67.197 48.245 1.00   21.45 ? 35  PHE A CE2 1 
ATOM   233  C CZ  . PHE A 1 35  ? -8.770  65.901 48.609 1.00   20.26 ? 35  PHE A CZ  1 
ATOM   234  N N   . ALA A 1 36  ? -13.379 65.951 46.060 1.00   20.32 ? 36  ALA A N   1 
ATOM   235  C CA  . ALA A 1 36  ? -14.029 64.667 46.314 1.00   19.00 ? 36  ALA A CA  1 
ATOM   236  C C   . ALA A 1 36  ? -15.394 64.837 46.946 1.00   19.85 ? 36  ALA A C   1 
ATOM   237  O O   . ALA A 1 36  ? -15.733 65.894 47.467 1.00   19.85 ? 36  ALA A O   1 
ATOM   238  C CB  . ALA A 1 36  ? -13.179 63.853 47.216 1.00   17.19 ? 36  ALA A CB  1 
ATOM   239  N N   . GLU A 1 37  ? -16.203 63.797 46.904 1.00   21.79 ? 37  GLU A N   1 
ATOM   240  C CA  . GLU A 1 37  ? -17.505 63.887 47.548 1.00   23.45 ? 37  GLU A CA  1 
ATOM   241  C C   . GLU A 1 37  ? -17.194 63.855 49.038 1.00   23.21 ? 37  GLU A C   1 
ATOM   242  O O   . GLU A 1 37  ? -16.249 63.186 49.441 1.00   22.61 ? 37  GLU A O   1 
ATOM   243  C CB  . GLU A 1 37  ? -18.370 62.689 47.170 1.00   24.28 ? 37  GLU A CB  1 
ATOM   244  C CG  . GLU A 1 37  ? -18.886 62.772 45.747 1.00   28.92 ? 37  GLU A CG  1 
ATOM   245  C CD  . GLU A 1 37  ? -19.719 64.018 45.523 1.00   30.58 ? 37  GLU A CD  1 
ATOM   246  O OE1 . GLU A 1 37  ? -20.816 64.107 46.120 1.00   32.06 ? 37  GLU A OE1 1 
ATOM   247  O OE2 . GLU A 1 37  ? -19.267 64.924 44.779 1.00   30.81 ? 37  GLU A OE2 1 
ATOM   248  N N   . PRO A 1 38  ? -17.912 64.639 49.852 1.00   21.97 ? 38  PRO A N   1 
ATOM   249  C CA  . PRO A 1 38  ? -17.706 64.689 51.296 1.00   21.21 ? 38  PRO A CA  1 
ATOM   250  C C   . PRO A 1 38  ? -17.833 63.280 51.765 1.00   20.79 ? 38  PRO A C   1 
ATOM   251  O O   . PRO A 1 38  ? -18.884 62.681 51.596 1.00   22.53 ? 38  PRO A O   1 
ATOM   252  C CB  . PRO A 1 38  ? -18.894 65.490 51.770 1.00   21.53 ? 38  PRO A CB  1 
ATOM   253  C CG  . PRO A 1 38  ? -19.077 66.470 50.674 1.00   23.58 ? 38  PRO A CG  1 
ATOM   254  C CD  . PRO A 1 38  ? -18.937 65.606 49.439 1.00   23.90 ? 38  PRO A CD  1 
ATOM   255  N N   . PRO A 1 39  ? -16.782 62.737 52.383 1.00   20.05 ? 39  PRO A N   1 
ATOM   256  C CA  . PRO A 1 39  ? -16.677 61.377 52.910 1.00   20.23 ? 39  PRO A CA  1 
ATOM   257  C C   . PRO A 1 39  ? -17.473 61.092 54.186 1.00   21.16 ? 39  PRO A C   1 
ATOM   258  O O   . PRO A 1 39  ? -17.061 60.287 55.025 1.00   20.85 ? 39  PRO A O   1 
ATOM   259  C CB  . PRO A 1 39  ? -15.182 61.249 53.150 1.00   19.97 ? 39  PRO A CB  1 
ATOM   260  C CG  . PRO A 1 39  ? -14.842 62.581 53.626 1.00   19.16 ? 39  PRO A CG  1 
ATOM   261  C CD  . PRO A 1 39  ? -15.571 63.499 52.695 1.00   18.47 ? 39  PRO A CD  1 
ATOM   262  N N   . VAL A 1 40  ? -18.648 61.688 54.284 1.00   21.51 ? 40  VAL A N   1 
ATOM   263  C CA  . VAL A 1 40  ? -19.490 61.537 55.445 1.00   23.07 ? 40  VAL A CA  1 
ATOM   264  C C   . VAL A 1 40  ? -20.397 60.312 55.391 1.00   25.31 ? 40  VAL A C   1 
ATOM   265  O O   . VAL A 1 40  ? -20.351 59.520 54.445 1.00   27.68 ? 40  VAL A O   1 
ATOM   266  C CB  . VAL A 1 40  ? -20.338 62.761 55.586 1.00   22.50 ? 40  VAL A CB  1 
ATOM   267  C CG1 . VAL A 1 40  ? -19.458 63.959 55.823 1.00   20.64 ? 40  VAL A CG1 1 
ATOM   268  C CG2 . VAL A 1 40  ? -21.135 62.957 54.310 1.00   22.14 ? 40  VAL A CG2 1 
ATOM   269  N N   . GLY A 1 41  ? -21.178 60.120 56.447 1.00   25.93 ? 41  GLY A N   1 
ATOM   270  C CA  . GLY A 1 41  ? -22.112 59.006 56.524 1.00   26.55 ? 41  GLY A CA  1 
ATOM   271  C C   . GLY A 1 41  ? -21.553 57.656 56.155 1.00   27.31 ? 41  GLY A C   1 
ATOM   272  O O   . GLY A 1 41  ? -20.445 57.315 56.536 1.00   28.77 ? 41  GLY A O   1 
ATOM   273  N N   . ASN A 1 42  ? -22.292 56.905 55.347 1.00   28.52 ? 42  ASN A N   1 
ATOM   274  C CA  . ASN A 1 42  ? -21.865 55.572 54.941 1.00   27.86 ? 42  ASN A CA  1 
ATOM   275  C C   . ASN A 1 42  ? -20.591 55.570 54.113 1.00   27.95 ? 42  ASN A C   1 
ATOM   276  O O   . ASN A 1 42  ? -20.047 54.503 53.801 1.00   27.65 ? 42  ASN A O   1 
ATOM   277  C CB  . ASN A 1 42  ? -22.983 54.871 54.177 1.00   28.87 ? 42  ASN A CB  1 
ATOM   278  N N   . MET A 1 43  ? -20.110 56.750 53.751 1.00   27.47 ? 43  MET A N   1 
ATOM   279  C CA  . MET A 1 43  ? -18.888 56.813 52.969 1.00   27.24 ? 43  MET A CA  1 
ATOM   280  C C   . MET A 1 43  ? -17.643 56.851 53.852 1.00   26.55 ? 43  MET A C   1 
ATOM   281  O O   . MET A 1 43  ? -16.526 56.779 53.349 1.00   26.67 ? 43  MET A O   1 
ATOM   282  C CB  . MET A 1 43  ? -18.905 58.008 51.998 1.00   30.68 ? 43  MET A CB  1 
ATOM   283  C CG  . MET A 1 43  ? -19.796 57.828 50.725 1.00   33.35 ? 43  MET A CG  1 
ATOM   284  S SD  . MET A 1 43  ? -19.187 58.877 49.340 1.00   36.83 ? 43  MET A SD  1 
ATOM   285  C CE  . MET A 1 43  ? -20.244 60.302 49.469 1.00   35.04 ? 43  MET A CE  1 
ATOM   286  N N   . ARG A 1 44  ? -17.822 56.936 55.166 1.00   24.97 ? 44  ARG A N   1 
ATOM   287  C CA  . ARG A 1 44  ? -16.682 56.974 56.075 1.00   23.62 ? 44  ARG A CA  1 
ATOM   288  C C   . ARG A 1 44  ? -15.867 55.713 55.902 1.00   22.49 ? 44  ARG A C   1 
ATOM   289  O O   . ARG A 1 44  ? -16.410 54.625 55.856 1.00   22.21 ? 44  ARG A O   1 
ATOM   290  C CB  . ARG A 1 44  ? -17.147 57.095 57.536 1.00   25.41 ? 44  ARG A CB  1 
ATOM   291  C CG  . ARG A 1 44  ? -16.005 57.018 58.554 1.00   24.69 ? 44  ARG A CG  1 
ATOM   292  C CD  . ARG A 1 44  ? -16.483 56.919 59.969 1.00   24.31 ? 44  ARG A CD  1 
ATOM   293  N NE  . ARG A 1 44  ? -17.096 58.162 60.417 1.00   24.01 ? 44  ARG A NE  1 
ATOM   294  C CZ  . ARG A 1 44  ? -17.717 58.291 61.586 1.00   24.50 ? 44  ARG A CZ  1 
ATOM   295  N NH1 . ARG A 1 44  ? -17.800 57.258 62.418 1.00   23.35 ? 44  ARG A NH1 1 
ATOM   296  N NH2 . ARG A 1 44  ? -18.290 59.437 61.912 1.00   23.59 ? 44  ARG A NH2 1 
ATOM   297  N N   . PHE A 1 45  ? -14.560 55.885 55.806 1.00   22.66 ? 45  PHE A N   1 
ATOM   298  C CA  . PHE A 1 45  ? -13.608 54.807 55.621 1.00   22.65 ? 45  PHE A CA  1 
ATOM   299  C C   . PHE A 1 45  ? -13.535 54.417 54.149 1.00   23.34 ? 45  PHE A C   1 
ATOM   300  O O   . PHE A 1 45  ? -12.600 53.740 53.729 1.00   24.15 ? 45  PHE A O   1 
ATOM   301  C CB  . PHE A 1 45  ? -13.994 53.582 56.425 1.00   23.23 ? 45  PHE A CB  1 
ATOM   302  C CG  . PHE A 1 45  ? -14.198 53.843 57.878 1.00   24.66 ? 45  PHE A CG  1 
ATOM   303  C CD1 . PHE A 1 45  ? -13.287 54.583 58.603 1.00   26.10 ? 45  PHE A CD1 1 
ATOM   304  C CD2 . PHE A 1 45  ? -15.289 53.302 58.542 1.00   24.86 ? 45  PHE A CD2 1 
ATOM   305  C CE1 . PHE A 1 45  ? -13.458 54.778 59.975 1.00   24.96 ? 45  PHE A CE1 1 
ATOM   306  C CE2 . PHE A 1 45  ? -15.455 53.493 59.900 1.00   24.79 ? 45  PHE A CE2 1 
ATOM   307  C CZ  . PHE A 1 45  ? -14.537 54.232 60.612 1.00   25.28 ? 45  PHE A CZ  1 
ATOM   308  N N   . ARG A 1 46  ? -14.524 54.824 53.361 1.00   24.71 ? 46  ARG A N   1 
ATOM   309  C CA  . ARG A 1 46  ? -14.546 54.487 51.934 1.00   26.35 ? 46  ARG A CA  1 
ATOM   310  C C   . ARG A 1 46  ? -13.552 55.245 51.083 1.00   24.82 ? 46  ARG A C   1 
ATOM   311  O O   . ARG A 1 46  ? -13.102 56.324 51.444 1.00   26.05 ? 46  ARG A O   1 
ATOM   312  C CB  . ARG A 1 46  ? -15.955 54.654 51.341 1.00   27.18 ? 46  ARG A CB  1 
ATOM   313  C CG  . ARG A 1 46  ? -16.831 53.448 51.612 1.00   28.80 ? 46  ARG A CG  1 
ATOM   314  C CD  . ARG A 1 46  ? -18.030 53.376 50.684 1.00   31.97 ? 46  ARG A CD  1 
ATOM   315  N NE  . ARG A 1 46  ? -18.872 52.202 50.987 1.00   35.01 ? 46  ARG A NE  1 
ATOM   316  N N   . ARG A 1 47  ? -13.242 54.710 49.912 1.00   24.18 ? 47  ARG A N   1 
ATOM   317  C CA  . ARG A 1 47  ? -12.312 55.388 49.052 1.00   22.10 ? 47  ARG A CA  1 
ATOM   318  C C   . ARG A 1 47  ? -12.941 56.677 48.619 1.00   21.12 ? 47  ARG A C   1 
ATOM   319  O O   . ARG A 1 47  ? -14.168 56.825 48.619 1.00   20.61 ? 47  ARG A O   1 
ATOM   320  C CB  . ARG A 1 47  ? -11.998 54.533 47.867 1.00   24.53 ? 47  ARG A CB  1 
ATOM   321  C CG  . ARG A 1 47  ? -11.508 53.177 48.282 1.00   31.09 ? 47  ARG A CG  1 
ATOM   322  C CD  . ARG A 1 47  ? -10.699 52.515 47.164 1.00   34.46 ? 47  ARG A CD  1 
ATOM   323  N NE  . ARG A 1 47  ? -10.338 51.146 47.502 1.00   38.88 ? 47  ARG A NE  1 
ATOM   324  C CZ  . ARG A 1 47  ? -9.328  50.489 46.937 1.00   42.95 ? 47  ARG A CZ  1 
ATOM   325  N NH1 . ARG A 1 47  ? -8.580  51.081 45.992 1.00   44.70 ? 47  ARG A NH1 1 
ATOM   326  N NH2 . ARG A 1 47  ? -9.059  49.235 47.321 1.00   43.90 ? 47  ARG A NH2 1 
ATOM   327  N N   . PRO A 1 48  ? -12.111 57.655 48.285 1.00   20.42 ? 48  PRO A N   1 
ATOM   328  C CA  . PRO A 1 48  ? -12.674 58.922 47.859 1.00   21.85 ? 48  PRO A CA  1 
ATOM   329  C C   . PRO A 1 48  ? -13.394 58.792 46.518 1.00   24.92 ? 48  PRO A C   1 
ATOM   330  O O   . PRO A 1 48  ? -13.034 57.976 45.646 1.00   26.48 ? 48  PRO A O   1 
ATOM   331  C CB  . PRO A 1 48  ? -11.470 59.841 47.837 1.00   20.41 ? 48  PRO A CB  1 
ATOM   332  C CG  . PRO A 1 48  ? -10.352 58.940 47.580 1.00   20.77 ? 48  PRO A CG  1 
ATOM   333  C CD  . PRO A 1 48  ? -10.650 57.701 48.339 1.00   20.06 ? 48  PRO A CD  1 
ATOM   334  N N   . GLU A 1 49  ? -14.429 59.609 46.387 1.00   26.78 ? 49  GLU A N   1 
ATOM   335  C CA  . GLU A 1 49  ? -15.332 59.672 45.257 1.00   27.23 ? 49  GLU A CA  1 
ATOM   336  C C   . GLU A 1 49  ? -15.107 61.014 44.610 1.00   26.64 ? 49  GLU A C   1 
ATOM   337  O O   . GLU A 1 49  ? -14.987 62.023 45.300 1.00   26.50 ? 49  GLU A O   1 
ATOM   338  C CB  . GLU A 1 49  ? -16.715 59.636 45.833 1.00   31.33 ? 49  GLU A CB  1 
ATOM   339  C CG  . GLU A 1 49  ? -17.826 59.860 44.891 1.00   38.28 ? 49  GLU A CG  1 
ATOM   340  C CD  . GLU A 1 49  ? -18.869 58.791 45.095 1.00   42.70 ? 49  GLU A CD  1 
ATOM   341  O OE1 . GLU A 1 49  ? -18.411 57.626 45.329 1.00   43.89 ? 49  GLU A OE1 1 
ATOM   342  O OE2 . GLU A 1 49  ? -20.106 59.098 45.020 1.00   44.16 ? 49  GLU A OE2 1 
ATOM   343  N N   . PRO A 1 50  ? -15.068 61.065 43.287 1.00   26.29 ? 50  PRO A N   1 
ATOM   344  C CA  . PRO A 1 50  ? -14.840 62.324 42.579 1.00   26.08 ? 50  PRO A CA  1 
ATOM   345  C C   . PRO A 1 50  ? -15.941 63.314 42.845 1.00   25.90 ? 50  PRO A C   1 
ATOM   346  O O   . PRO A 1 50  ? -17.078 62.939 43.021 1.00   27.48 ? 50  PRO A O   1 
ATOM   347  C CB  . PRO A 1 50  ? -14.811 61.893 41.114 1.00   27.23 ? 50  PRO A CB  1 
ATOM   348  C CG  . PRO A 1 50  ? -14.452 60.408 41.175 1.00   28.45 ? 50  PRO A CG  1 
ATOM   349  C CD  . PRO A 1 50  ? -15.273 59.957 42.344 1.00   27.83 ? 50  PRO A CD  1 
ATOM   350  N N   . LYS A 1 51  ? -15.607 64.586 42.877 1.00   26.30 ? 51  LYS A N   1 
ATOM   351  C CA  . LYS A 1 51  ? -16.601 65.594 43.143 1.00   27.88 ? 51  LYS A CA  1 
ATOM   352  C C   . LYS A 1 51  ? -17.541 65.722 41.963 1.00   29.49 ? 51  LYS A C   1 
ATOM   353  O O   . LYS A 1 51  ? -17.085 66.061 40.869 1.00   31.13 ? 51  LYS A O   1 
ATOM   354  C CB  . LYS A 1 51  ? -15.875 66.918 43.364 1.00   27.38 ? 51  LYS A CB  1 
ATOM   355  C CG  . LYS A 1 51  ? -16.759 68.112 43.644 1.00   27.70 ? 51  LYS A CG  1 
ATOM   356  C CD  . LYS A 1 51  ? -17.675 67.911 44.840 1.00   26.30 ? 51  LYS A CD  1 
ATOM   357  C CE  . LYS A 1 51  ? -18.429 69.205 45.104 1.00   26.85 ? 51  LYS A CE  1 
ATOM   358  N NZ  . LYS A 1 51  ? -19.591 68.980 46.002 1.00   30.22 ? 51  LYS A NZ  1 
ATOM   359  N N   . LYS A 1 52  ? -18.819 65.381 42.134 1.00   30.54 ? 52  LYS A N   1 
ATOM   360  C CA  . LYS A 1 52  ? -19.789 65.551 41.042 1.00   31.56 ? 52  LYS A CA  1 
ATOM   361  C C   . LYS A 1 52  ? -19.605 67.022 40.693 1.00   31.48 ? 52  LYS A C   1 
ATOM   362  O O   . LYS A 1 52  ? -19.508 67.850 41.589 1.00   30.69 ? 52  LYS A O   1 
ATOM   363  C CB  . LYS A 1 52  ? -21.247 65.398 41.514 1.00   33.45 ? 52  LYS A CB  1 
ATOM   364  C CG  . LYS A 1 52  ? -21.601 64.227 42.445 1.00   36.93 ? 52  LYS A CG  1 
ATOM   365  C CD  . LYS A 1 52  ? -21.290 62.832 41.872 1.00   39.95 ? 52  LYS A CD  1 
ATOM   366  C CE  . LYS A 1 52  ? -19.775 62.553 41.834 1.00   42.32 ? 52  LYS A CE  1 
ATOM   367  N NZ  . LYS A 1 52  ? -19.405 61.074 41.820 1.00   44.86 ? 52  LYS A NZ  1 
ATOM   368  N N   . PRO A 1 53  ? -19.533 67.367 39.397 1.00   31.55 ? 53  PRO A N   1 
ATOM   369  C CA  . PRO A 1 53  ? -19.358 68.783 39.078 1.00   31.13 ? 53  PRO A CA  1 
ATOM   370  C C   . PRO A 1 53  ? -20.531 69.535 39.650 1.00   32.24 ? 53  PRO A C   1 
ATOM   371  O O   . PRO A 1 53  ? -21.512 68.921 40.110 1.00   31.74 ? 53  PRO A O   1 
ATOM   372  C CB  . PRO A 1 53  ? -19.399 68.791 37.561 1.00   30.13 ? 53  PRO A CB  1 
ATOM   373  C CG  . PRO A 1 53  ? -18.882 67.447 37.205 1.00   30.13 ? 53  PRO A CG  1 
ATOM   374  C CD  . PRO A 1 53  ? -19.640 66.576 38.160 1.00   31.02 ? 53  PRO A CD  1 
ATOM   375  N N   . TRP A 1 54  ? -20.449 70.858 39.575 1.00   33.08 ? 54  TRP A N   1 
ATOM   376  C CA  . TRP A 1 54  ? -21.493 71.733 40.097 1.00   33.76 ? 54  TRP A CA  1 
ATOM   377  C C   . TRP A 1 54  ? -21.794 72.817 39.048 1.00   35.55 ? 54  TRP A C   1 
ATOM   378  O O   . TRP A 1 54  ? -21.181 72.842 37.970 1.00   37.28 ? 54  TRP A O   1 
ATOM   379  C CB  . TRP A 1 54  ? -21.005 72.384 41.422 1.00   30.08 ? 54  TRP A CB  1 
ATOM   380  C CG  . TRP A 1 54  ? -19.705 73.184 41.347 1.00   24.65 ? 54  TRP A CG  1 
ATOM   381  C CD1 . TRP A 1 54  ? -19.573 74.508 41.025 1.00   24.76 ? 54  TRP A CD1 1 
ATOM   382  C CD2 . TRP A 1 54  ? -18.370 72.700 41.581 1.00   23.00 ? 54  TRP A CD2 1 
ATOM   383  N NE1 . TRP A 1 54  ? -18.231 74.877 41.026 1.00   22.47 ? 54  TRP A NE1 1 
ATOM   384  C CE2 . TRP A 1 54  ? -17.482 73.782 41.367 1.00   22.14 ? 54  TRP A CE2 1 
ATOM   385  C CE3 . TRP A 1 54  ? -17.840 71.460 41.941 1.00   22.64 ? 54  TRP A CE3 1 
ATOM   386  C CZ2 . TRP A 1 54  ? -16.109 73.652 41.504 1.00   20.68 ? 54  TRP A CZ2 1 
ATOM   387  C CZ3 . TRP A 1 54  ? -16.464 71.337 42.072 1.00   21.42 ? 54  TRP A CZ3 1 
ATOM   388  C CH2 . TRP A 1 54  ? -15.620 72.427 41.853 1.00   19.93 ? 54  TRP A CH2 1 
ATOM   389  N N   . SER A 1 55  ? -22.775 73.673 39.310 1.00   37.34 ? 55  SER A N   1 
ATOM   390  C CA  . SER A 1 55  ? -23.037 74.754 38.377 1.00   38.81 ? 55  SER A CA  1 
ATOM   391  C C   . SER A 1 55  ? -23.126 76.027 39.218 1.00   38.67 ? 55  SER A C   1 
ATOM   392  O O   . SER A 1 55  ? -23.627 76.011 40.366 1.00   38.25 ? 55  SER A O   1 
ATOM   393  C CB  . SER A 1 55  ? -24.323 74.532 37.600 1.00   40.24 ? 55  SER A CB  1 
ATOM   394  O OG  . SER A 1 55  ? -25.441 74.634 38.478 1.00   45.64 ? 55  SER A OG  1 
ATOM   395  N N   . GLY A 1 56  ? -22.605 77.119 38.664 1.00   38.13 ? 56  GLY A N   1 
ATOM   396  C CA  . GLY A 1 56  ? -22.631 78.371 39.386 1.00   35.84 ? 56  GLY A CA  1 
ATOM   397  C C   . GLY A 1 56  ? -21.220 78.520 39.842 1.00   33.89 ? 56  GLY A C   1 
ATOM   398  O O   . GLY A 1 56  ? -20.446 77.580 39.727 1.00   34.56 ? 56  GLY A O   1 
ATOM   399  N N   . VAL A 1 57  ? -20.845 79.703 40.288 1.00   31.99 ? 57  VAL A N   1 
ATOM   400  C CA  . VAL A 1 57  ? -19.499 79.873 40.718 1.00   30.98 ? 57  VAL A CA  1 
ATOM   401  C C   . VAL A 1 57  ? -19.356 79.252 42.093 1.00   30.50 ? 57  VAL A C   1 
ATOM   402  O O   . VAL A 1 57  ? -20.253 79.395 42.915 1.00   31.89 ? 57  VAL A O   1 
ATOM   403  C CB  . VAL A 1 57  ? -19.147 81.356 40.793 1.00   31.05 ? 57  VAL A CB  1 
ATOM   404  C CG1 . VAL A 1 57  ? -17.657 81.517 40.738 1.00   32.66 ? 57  VAL A CG1 1 
ATOM   405  C CG2 . VAL A 1 57  ? -19.753 82.095 39.632 1.00   30.56 ? 57  VAL A CG2 1 
ATOM   406  N N   . TRP A 1 58  ? -18.322 78.444 42.301 1.00   29.57 ? 58  TRP A N   1 
ATOM   407  C CA  . TRP A 1 58  ? -18.069 77.885 43.622 1.00   27.70 ? 58  TRP A CA  1 
ATOM   408  C C   . TRP A 1 58  ? -17.273 79.028 44.249 1.00   29.29 ? 58  TRP A C   1 
ATOM   409  O O   . TRP A 1 58  ? -16.382 79.598 43.602 1.00   27.99 ? 58  TRP A O   1 
ATOM   410  C CB  . TRP A 1 58  ? -17.182 76.650 43.569 1.00   26.73 ? 58  TRP A CB  1 
ATOM   411  C CG  . TRP A 1 58  ? -16.935 76.108 44.936 1.00   26.09 ? 58  TRP A CG  1 
ATOM   412  C CD1 . TRP A 1 58  ? -16.002 76.546 45.841 1.00   24.35 ? 58  TRP A CD1 1 
ATOM   413  C CD2 . TRP A 1 58  ? -17.691 75.094 45.601 1.00   24.47 ? 58  TRP A CD2 1 
ATOM   414  N NE1 . TRP A 1 58  ? -16.145 75.872 47.029 1.00   24.25 ? 58  TRP A NE1 1 
ATOM   415  C CE2 . TRP A 1 58  ? -17.176 74.976 46.909 1.00   25.11 ? 58  TRP A CE2 1 
ATOM   416  C CE3 . TRP A 1 58  ? -18.759 74.279 45.218 1.00   24.96 ? 58  TRP A CE3 1 
ATOM   417  C CZ2 . TRP A 1 58  ? -17.693 74.072 47.842 1.00   24.55 ? 58  TRP A CZ2 1 
ATOM   418  C CZ3 . TRP A 1 58  ? -19.278 73.371 46.146 1.00   26.38 ? 58  TRP A CZ3 1 
ATOM   419  C CH2 . TRP A 1 58  ? -18.738 73.280 47.445 1.00   27.31 ? 58  TRP A CH2 1 
ATOM   420  N N   . ASN A 1 59  ? -17.593 79.357 45.501 1.00   30.86 ? 59  ASN A N   1 
ATOM   421  C CA  . ASN A 1 59  ? -16.962 80.461 46.215 1.00   31.49 ? 59  ASN A CA  1 
ATOM   422  C C   . ASN A 1 59  ? -15.742 80.024 46.989 1.00   31.04 ? 59  ASN A C   1 
ATOM   423  O O   . ASN A 1 59  ? -15.841 79.582 48.129 1.00   33.91 ? 59  ASN A O   1 
ATOM   424  C CB  . ASN A 1 59  ? -17.954 81.080 47.183 1.00   33.90 ? 59  ASN A CB  1 
ATOM   425  C CG  . ASN A 1 59  ? -17.419 82.360 47.788 1.00   38.27 ? 59  ASN A CG  1 
ATOM   426  O OD1 . ASN A 1 59  ? -16.185 82.601 47.784 1.00   41.69 ? 59  ASN A OD1 1 
ATOM   427  N ND2 . ASN A 1 59  ? -18.317 83.220 48.276 1.00   40.59 ? 59  ASN A ND2 1 
ATOM   428  N N   . ALA A 1 60  ? -14.575 80.199 46.412 1.00   29.09 ? 60  ALA A N   1 
ATOM   429  C CA  . ALA A 1 60  ? -13.380 79.765 47.079 1.00   26.68 ? 60  ALA A CA  1 
ATOM   430  C C   . ALA A 1 60  ? -12.715 80.937 47.729 1.00   26.52 ? 60  ALA A C   1 
ATOM   431  O O   . ALA A 1 60  ? -11.528 81.155 47.508 1.00   25.56 ? 60  ALA A O   1 
ATOM   432  C CB  . ALA A 1 60  ? -12.453 79.153 46.092 1.00   25.30 ? 60  ALA A CB  1 
ATOM   433  N N   . SER A 1 61  ? -13.451 81.711 48.521 1.00   26.74 ? 61  SER A N   1 
ATOM   434  C CA  . SER A 1 61  ? -12.822 82.863 49.160 1.00   27.90 ? 61  SER A CA  1 
ATOM   435  C C   . SER A 1 61  ? -12.309 82.650 50.591 1.00   28.24 ? 61  SER A C   1 
ATOM   436  O O   . SER A 1 61  ? -11.678 83.546 51.176 1.00   29.00 ? 61  SER A O   1 
ATOM   437  C CB  . SER A 1 61  ? -13.752 84.077 49.091 1.00   28.26 ? 61  SER A CB  1 
ATOM   438  O OG  . SER A 1 61  ? -15.059 83.768 49.554 1.00   28.90 ? 61  SER A OG  1 
ATOM   439  N N   . THR A 1 62  ? -12.559 81.473 51.161 1.00   28.53 ? 62  THR A N   1 
ATOM   440  C CA  . THR A 1 62  ? -12.117 81.186 52.526 1.00   28.66 ? 62  THR A CA  1 
ATOM   441  C C   . THR A 1 62  ? -11.771 79.722 52.750 1.00   26.72 ? 62  THR A C   1 
ATOM   442  O O   . THR A 1 62  ? -12.487 78.833 52.265 1.00   27.14 ? 62  THR A O   1 
ATOM   443  C CB  . THR A 1 62  ? -13.225 81.490 53.516 1.00   29.63 ? 62  THR A CB  1 
ATOM   444  O OG1 . THR A 1 62  ? -14.427 80.857 53.053 1.00   29.06 ? 62  THR A OG1 1 
ATOM   445  C CG2 . THR A 1 62  ? -13.440 82.991 53.651 1.00   29.65 ? 62  THR A CG2 1 
ATOM   446  N N   . TYR A 1 63  ? -10.793 79.498 53.629 1.00   24.58 ? 63  TYR A N   1 
ATOM   447  C CA  . TYR A 1 63  ? -10.309 78.173 53.979 1.00   22.01 ? 63  TYR A CA  1 
ATOM   448  C C   . TYR A 1 63  ? -11.409 77.224 54.376 1.00   20.75 ? 63  TYR A C   1 
ATOM   449  O O   . TYR A 1 63  ? -12.369 77.606 54.995 1.00   20.15 ? 63  TYR A O   1 
ATOM   450  C CB  . TYR A 1 63  ? -9.347  78.264 55.136 1.00   20.67 ? 63  TYR A CB  1 
ATOM   451  C CG  . TYR A 1 63  ? -7.957  78.666 54.775 1.00   22.08 ? 63  TYR A CG  1 
ATOM   452  C CD1 . TYR A 1 63  ? -7.269  78.036 53.755 1.00   23.93 ? 63  TYR A CD1 1 
ATOM   453  C CD2 . TYR A 1 63  ? -7.279  79.599 55.534 1.00   22.79 ? 63  TYR A CD2 1 
ATOM   454  C CE1 . TYR A 1 63  ? -5.923  78.321 53.521 1.00   23.97 ? 63  TYR A CE1 1 
ATOM   455  C CE2 . TYR A 1 63  ? -5.951  79.889 55.310 1.00   21.48 ? 63  TYR A CE2 1 
ATOM   456  C CZ  . TYR A 1 63  ? -5.278  79.241 54.320 1.00   23.31 ? 63  TYR A CZ  1 
ATOM   457  O OH  . TYR A 1 63  ? -3.926  79.432 54.213 1.00   25.75 ? 63  TYR A OH  1 
ATOM   458  N N   . PRO A 1 64  ? -11.232 75.951 54.073 1.00   20.67 ? 64  PRO A N   1 
ATOM   459  C CA  . PRO A 1 64  ? -12.185 74.890 54.376 1.00   20.81 ? 64  PRO A CA  1 
ATOM   460  C C   . PRO A 1 64  ? -12.064 74.288 55.781 1.00   21.45 ? 64  PRO A C   1 
ATOM   461  O O   . PRO A 1 64  ? -11.134 74.589 56.521 1.00   22.44 ? 64  PRO A O   1 
ATOM   462  C CB  . PRO A 1 64  ? -11.844 73.855 53.315 1.00   21.14 ? 64  PRO A CB  1 
ATOM   463  C CG  . PRO A 1 64  ? -10.371 74.013 53.149 1.00   18.71 ? 64  PRO A CG  1 
ATOM   464  C CD  . PRO A 1 64  ? -10.152 75.477 53.188 1.00   19.27 ? 64  PRO A CD  1 
ATOM   465  N N   . ASN A 1 65  ? -12.986 73.405 56.141 1.00   19.92 ? 65  ASN A N   1 
ATOM   466  C CA  . ASN A 1 65  ? -12.906 72.770 57.429 1.00   21.11 ? 65  ASN A CA  1 
ATOM   467  C C   . ASN A 1 65  ? -11.660 71.920 57.394 1.00   21.64 ? 65  ASN A C   1 
ATOM   468  O O   . ASN A 1 65  ? -11.081 71.695 56.341 1.00   23.04 ? 65  ASN A O   1 
ATOM   469  C CB  . ASN A 1 65  ? -14.069 71.829 57.662 1.00   23.04 ? 65  ASN A CB  1 
ATOM   470  C CG  . ASN A 1 65  ? -15.394 72.504 57.569 1.00   26.16 ? 65  ASN A CG  1 
ATOM   471  O OD1 . ASN A 1 65  ? -15.603 73.608 58.087 1.00   27.61 ? 65  ASN A OD1 1 
ATOM   472  N ND2 . ASN A 1 65  ? -16.323 71.842 56.900 1.00   28.24 ? 65  ASN A ND2 1 
ATOM   473  N N   . ASN A 1 66  ? -11.276 71.402 58.546 1.00   22.50 ? 66  ASN A N   1 
ATOM   474  C CA  . ASN A 1 66  ? -10.117 70.550 58.657 1.00   20.31 ? 66  ASN A CA  1 
ATOM   475  C C   . ASN A 1 66  ? -10.661 69.203 58.984 1.00   19.92 ? 66  ASN A C   1 
ATOM   476  O O   . ASN A 1 66  ? -11.782 69.088 59.468 1.00   19.70 ? 66  ASN A O   1 
ATOM   477  C CB  . ASN A 1 66  ? -9.228  71.043 59.764 1.00   21.69 ? 66  ASN A CB  1 
ATOM   478  C CG  . ASN A 1 66  ? -8.568  72.324 59.412 1.00   23.88 ? 66  ASN A CG  1 
ATOM   479  O OD1 . ASN A 1 66  ? -7.621  72.742 60.061 1.00   24.80 ? 66  ASN A OD1 1 
ATOM   480  N ND2 . ASN A 1 66  ? -9.014  72.938 58.330 1.00   27.19 ? 66  ASN A ND2 1 
ATOM   481  N N   . CYS A 1 67  ? -9.903  68.174 58.663 1.00   18.93 ? 67  CYS A N   1 
ATOM   482  C CA  . CYS A 1 67  ? -10.357 66.830 58.893 1.00   20.18 ? 67  CYS A CA  1 
ATOM   483  C C   . CYS A 1 67  ? -10.363 66.544 60.373 1.00   21.32 ? 67  CYS A C   1 
ATOM   484  O O   . CYS A 1 67  ? -9.562  67.115 61.123 1.00   21.14 ? 67  CYS A O   1 
ATOM   485  C CB  . CYS A 1 67  ? -9.468  65.846 58.125 1.00   22.13 ? 67  CYS A CB  1 
ATOM   486  S SG  . CYS A 1 67  ? -9.510  66.095 56.305 1.00   20.69 ? 67  CYS A SG  1 
ATOM   487  N N   . GLN A 1 68  ? -11.295 65.700 60.804 1.00   21.34 ? 68  GLN A N   1 
ATOM   488  C CA  . GLN A 1 68  ? -11.402 65.363 62.200 1.00   21.11 ? 68  GLN A CA  1 
ATOM   489  C C   . GLN A 1 68  ? -10.069 64.842 62.605 1.00   21.97 ? 68  GLN A C   1 
ATOM   490  O O   . GLN A 1 68  ? -9.451  64.109 61.844 1.00   23.28 ? 68  GLN A O   1 
ATOM   491  C CB  . GLN A 1 68  ? -12.413 64.274 62.385 1.00   20.74 ? 68  GLN A CB  1 
ATOM   492  C CG  . GLN A 1 68  ? -13.757 64.693 61.981 1.00   24.66 ? 68  GLN A CG  1 
ATOM   493  C CD  . GLN A 1 68  ? -14.526 65.366 63.079 1.00   28.19 ? 68  GLN A CD  1 
ATOM   494  O OE1 . GLN A 1 68  ? -15.756 65.479 63.000 1.00   32.49 ? 68  GLN A OE1 1 
ATOM   495  N NE2 . GLN A 1 68  ? -13.840 65.780 64.133 1.00   29.12 ? 68  GLN A NE2 1 
ATOM   496  N N   . GLN A 1 69  ? -9.632  65.169 63.815 1.00   22.83 ? 69  GLN A N   1 
ATOM   497  C CA  . GLN A 1 69  ? -8.329  64.715 64.265 1.00   21.99 ? 69  GLN A CA  1 
ATOM   498  C C   . GLN A 1 69  ? -8.076  65.042 65.707 1.00   22.43 ? 69  GLN A C   1 
ATOM   499  O O   . GLN A 1 69  ? -8.696  65.937 66.287 1.00   22.35 ? 69  GLN A O   1 
ATOM   500  C CB  . GLN A 1 69  ? -7.252  65.424 63.464 1.00   21.52 ? 69  GLN A CB  1 
ATOM   501  C CG  . GLN A 1 69  ? -7.296  66.936 63.594 1.00   18.11 ? 69  GLN A CG  1 
ATOM   502  C CD  . GLN A 1 69  ? -6.388  67.604 62.610 1.00   19.88 ? 69  GLN A CD  1 
ATOM   503  O OE1 . GLN A 1 69  ? -5.190  67.741 62.847 1.00   18.53 ? 69  GLN A OE1 1 
ATOM   504  N NE2 . GLN A 1 69  ? -6.944  68.016 61.484 1.00   20.44 ? 69  GLN A NE2 1 
ATOM   505  N N   . TYR A 1 70  ? -7.046  64.401 66.221 1.00   21.44 ? 70  TYR A N   1 
ATOM   506  C CA  . TYR A 1 70  ? -6.619  64.586 67.567 1.00   21.19 ? 70  TYR A CA  1 
ATOM   507  C C   . TYR A 1 70  ? -6.006  65.980 67.709 1.00   21.28 ? 70  TYR A C   1 
ATOM   508  O O   . TYR A 1 70  ? -5.053  66.319 67.022 1.00   21.55 ? 70  TYR A O   1 
ATOM   509  C CB  . TYR A 1 70  ? -5.611  63.503 67.873 1.00   22.75 ? 70  TYR A CB  1 
ATOM   510  C CG  . TYR A 1 70  ? -4.993  63.651 69.212 1.00   25.99 ? 70  TYR A CG  1 
ATOM   511  C CD1 . TYR A 1 70  ? -5.707  63.350 70.362 1.00   27.11 ? 70  TYR A CD1 1 
ATOM   512  C CD2 . TYR A 1 70  ? -3.734  64.201 69.339 1.00   25.93 ? 70  TYR A CD2 1 
ATOM   513  C CE1 . TYR A 1 70  ? -5.181  63.617 71.605 1.00   28.30 ? 70  TYR A CE1 1 
ATOM   514  C CE2 . TYR A 1 70  ? -3.204  64.468 70.566 1.00   28.96 ? 70  TYR A CE2 1 
ATOM   515  C CZ  . TYR A 1 70  ? -3.931  64.187 71.695 1.00   29.03 ? 70  TYR A CZ  1 
ATOM   516  O OH  . TYR A 1 70  ? -3.414  64.562 72.918 1.00   34.47 ? 70  TYR A OH  1 
ATOM   517  N N   . VAL A 1 71  ? -6.616  66.824 68.526 1.00   21.68 ? 71  VAL A N   1 
ATOM   518  C CA  . VAL A 1 71  ? -6.108  68.177 68.749 1.00   23.24 ? 71  VAL A CA  1 
ATOM   519  C C   . VAL A 1 71  ? -5.161  68.044 69.929 1.00   25.65 ? 71  VAL A C   1 
ATOM   520  O O   . VAL A 1 71  ? -5.448  67.271 70.844 1.00   29.38 ? 71  VAL A O   1 
ATOM   521  C CB  . VAL A 1 71  ? -7.241  69.115 69.127 1.00   20.99 ? 71  VAL A CB  1 
ATOM   522  C CG1 . VAL A 1 71  ? -6.722  70.508 69.406 1.00   20.50 ? 71  VAL A CG1 1 
ATOM   523  C CG2 . VAL A 1 71  ? -8.245  69.137 68.020 1.00   21.48 ? 71  VAL A CG2 1 
ATOM   524  N N   . ASP A 1 72  ? -4.036  68.756 69.907 1.00   26.23 ? 72  ASP A N   1 
ATOM   525  C CA  . ASP A 1 72  ? -3.026  68.685 70.967 1.00   26.42 ? 72  ASP A CA  1 
ATOM   526  C C   . ASP A 1 72  ? -3.304  69.714 72.036 1.00   28.60 ? 72  ASP A C   1 
ATOM   527  O O   . ASP A 1 72  ? -3.312  70.923 71.765 1.00   28.73 ? 72  ASP A O   1 
ATOM   528  C CB  . ASP A 1 72  ? -1.651  68.974 70.380 1.00   25.81 ? 72  ASP A CB  1 
ATOM   529  C CG  . ASP A 1 72  ? -0.542  68.930 71.393 1.00   23.83 ? 72  ASP A CG  1 
ATOM   530  O OD1 . ASP A 1 72  ? -0.619  68.156 72.350 1.00   25.76 ? 72  ASP A OD1 1 
ATOM   531  O OD2 . ASP A 1 72  ? 0.454   69.638 71.200 1.00   24.42 ? 72  ASP A OD2 1 
ATOM   532  N N   . GLU A 1 73  ? -3.464  69.245 73.272 1.00   29.84 ? 73  GLU A N   1 
ATOM   533  C CA  . GLU A 1 73  ? -3.718  70.146 74.374 1.00   29.15 ? 73  GLU A CA  1 
ATOM   534  C C   . GLU A 1 73  ? -2.621  70.031 75.388 1.00   28.69 ? 73  GLU A C   1 
ATOM   535  O O   . GLU A 1 73  ? -2.755  70.518 76.483 1.00   30.99 ? 73  GLU A O   1 
ATOM   536  C CB  . GLU A 1 73  ? -5.048  69.827 75.026 1.00   30.84 ? 73  GLU A CB  1 
ATOM   537  C CG  . GLU A 1 73  ? -6.140  69.586 74.037 1.00   34.31 ? 73  GLU A CG  1 
ATOM   538  C CD  . GLU A 1 73  ? -7.401  70.309 74.381 1.00   36.97 ? 73  GLU A CD  1 
ATOM   539  O OE1 . GLU A 1 73  ? -7.372  71.572 74.385 1.00   40.97 ? 73  GLU A OE1 1 
ATOM   540  O OE2 . GLU A 1 73  ? -8.423  69.622 74.628 1.00   38.79 ? 73  GLU A OE2 1 
ATOM   541  N N   . GLN A 1 74  ? -1.526  69.382 75.039 1.00   28.10 ? 74  GLN A N   1 
ATOM   542  C CA  . GLN A 1 74  ? -0.426  69.255 75.973 1.00   27.96 ? 74  GLN A CA  1 
ATOM   543  C C   . GLN A 1 74  ? 0.035   70.597 76.583 1.00   27.81 ? 74  GLN A C   1 
ATOM   544  O O   . GLN A 1 74  ? 0.336   70.665 77.790 1.00   28.56 ? 74  GLN A O   1 
ATOM   545  C CB  . GLN A 1 74  ? 0.746   68.570 75.298 1.00   29.80 ? 74  GLN A CB  1 
ATOM   546  C CG  . GLN A 1 74  ? 1.214   67.317 76.007 1.00   34.79 ? 74  GLN A CG  1 
ATOM   547  C CD  . GLN A 1 74  ? 1.835   67.620 77.364 1.00   38.87 ? 74  GLN A CD  1 
ATOM   548  O OE1 . GLN A 1 74  ? 3.058   67.495 77.542 1.00   42.22 ? 74  GLN A OE1 1 
ATOM   549  N NE2 . GLN A 1 74  ? 1.006   68.040 78.324 1.00   40.99 ? 74  GLN A NE2 1 
ATOM   550  N N   . PHE A 1 75  ? 0.054   71.660 75.778 1.00   25.45 ? 75  PHE A N   1 
ATOM   551  C CA  . PHE A 1 75  ? 0.507   72.970 76.224 1.00   22.07 ? 75  PHE A CA  1 
ATOM   552  C C   . PHE A 1 75  ? -0.484  74.024 75.786 1.00   23.38 ? 75  PHE A C   1 
ATOM   553  O O   . PHE A 1 75  ? -0.134  74.978 75.091 1.00   22.42 ? 75  PHE A O   1 
ATOM   554  C CB  . PHE A 1 75  ? 1.872   73.281 75.638 1.00   20.23 ? 75  PHE A CB  1 
ATOM   555  C CG  . PHE A 1 75  ? 2.901   72.267 75.968 1.00   23.31 ? 75  PHE A CG  1 
ATOM   556  C CD1 . PHE A 1 75  ? 3.308   72.071 77.273 1.00   24.47 ? 75  PHE A CD1 1 
ATOM   557  C CD2 . PHE A 1 75  ? 3.449   71.474 74.987 1.00   24.40 ? 75  PHE A CD2 1 
ATOM   558  C CE1 . PHE A 1 75  ? 4.245   71.087 77.591 1.00   24.93 ? 75  PHE A CE1 1 
ATOM   559  C CE2 . PHE A 1 75  ? 4.385   70.494 75.297 1.00   24.46 ? 75  PHE A CE2 1 
ATOM   560  C CZ  . PHE A 1 75  ? 4.780   70.300 76.598 1.00   24.81 ? 75  PHE A CZ  1 
ATOM   561  N N   . PRO A 1 76  ? -1.711  73.939 76.313 1.00   24.70 ? 76  PRO A N   1 
ATOM   562  C CA  . PRO A 1 76  ? -2.789  74.869 75.988 1.00   24.12 ? 76  PRO A CA  1 
ATOM   563  C C   . PRO A 1 76  ? -2.279  76.289 75.951 1.00   25.48 ? 76  PRO A C   1 
ATOM   564  O O   . PRO A 1 76  ? -1.595  76.730 76.877 1.00   26.47 ? 76  PRO A O   1 
ATOM   565  C CB  . PRO A 1 76  ? -3.759  74.668 77.141 1.00   23.66 ? 76  PRO A CB  1 
ATOM   566  C CG  . PRO A 1 76  ? -3.544  73.248 77.535 1.00   22.77 ? 76  PRO A CG  1 
ATOM   567  C CD  . PRO A 1 76  ? -2.044  73.168 77.527 1.00   22.99 ? 76  PRO A CD  1 
ATOM   568  N N   . GLY A 1 77  ? -2.538  76.973 74.845 1.00   25.61 ? 77  GLY A N   1 
ATOM   569  C CA  . GLY A 1 77  ? -2.103  78.351 74.716 1.00   25.35 ? 77  GLY A CA  1 
ATOM   570  C C   . GLY A 1 77  ? -0.665  78.505 74.256 1.00   25.71 ? 77  GLY A C   1 
ATOM   571  O O   . GLY A 1 77  ? -0.271  79.566 73.753 1.00   27.32 ? 77  GLY A O   1 
ATOM   572  N N   . PHE A 1 78  ? 0.155   77.484 74.445 1.00   23.16 ? 78  PHE A N   1 
ATOM   573  C CA  . PHE A 1 78  ? 1.512   77.627 73.996 1.00   20.24 ? 78  PHE A CA  1 
ATOM   574  C C   . PHE A 1 78  ? 1.479   77.675 72.470 1.00   21.48 ? 78  PHE A C   1 
ATOM   575  O O   . PHE A 1 78  ? 1.078   76.716 71.825 1.00   22.58 ? 78  PHE A O   1 
ATOM   576  C CB  . PHE A 1 78  ? 2.354   76.465 74.471 1.00   16.25 ? 78  PHE A CB  1 
ATOM   577  C CG  . PHE A 1 78  ? 3.794   76.620 74.150 1.00   14.10 ? 78  PHE A CG  1 
ATOM   578  C CD1 . PHE A 1 78  ? 4.417   77.844 74.300 1.00   12.82 ? 78  PHE A CD1 1 
ATOM   579  C CD2 . PHE A 1 78  ? 4.520   75.567 73.669 1.00   12.26 ? 78  PHE A CD2 1 
ATOM   580  C CE1 . PHE A 1 78  ? 5.736   78.008 73.969 1.00   12.34 ? 78  PHE A CE1 1 
ATOM   581  C CE2 . PHE A 1 78  ? 5.833   75.732 73.343 1.00   14.01 ? 78  PHE A CE2 1 
ATOM   582  C CZ  . PHE A 1 78  ? 6.437   76.951 73.491 1.00   11.07 ? 78  PHE A CZ  1 
ATOM   583  N N   . SER A 1 79  ? 1.902   78.784 71.885 1.00   21.39 ? 79  SER A N   1 
ATOM   584  C CA  . SER A 1 79  ? 1.909   78.917 70.440 1.00   21.94 ? 79  SER A CA  1 
ATOM   585  C C   . SER A 1 79  ? 2.772   77.859 69.801 1.00   22.10 ? 79  SER A C   1 
ATOM   586  O O   . SER A 1 79  ? 2.367   77.216 68.835 1.00   23.89 ? 79  SER A O   1 
ATOM   587  C CB  . SER A 1 79  ? 2.416   80.285 70.029 1.00   21.85 ? 79  SER A CB  1 
ATOM   588  O OG  . SER A 1 79  ? 3.752   80.439 70.441 1.00   24.77 ? 79  SER A OG  1 
ATOM   589  N N   . GLY A 1 80  ? 3.933   77.614 70.376 1.00   21.81 ? 80  GLY A N   1 
ATOM   590  C CA  . GLY A 1 80  ? 4.817   76.617 69.811 1.00   21.72 ? 80  GLY A CA  1 
ATOM   591  C C   . GLY A 1 80  ? 4.130   75.319 69.442 1.00   23.06 ? 80  GLY A C   1 
ATOM   592  O O   . GLY A 1 80  ? 4.624   74.580 68.605 1.00   24.43 ? 80  GLY A O   1 
ATOM   593  N N   . SER A 1 81  ? 2.987   75.022 70.042 1.00   22.77 ? 81  SER A N   1 
ATOM   594  C CA  . SER A 1 81  ? 2.328   73.774 69.740 1.00   23.11 ? 81  SER A CA  1 
ATOM   595  C C   . SER A 1 81  ? 0.970   73.969 69.128 1.00   22.89 ? 81  SER A C   1 
ATOM   596  O O   . SER A 1 81  ? 0.496   73.123 68.394 1.00   21.75 ? 81  SER A O   1 
ATOM   597  C CB  . SER A 1 81  ? 2.188   72.941 71.007 1.00   23.45 ? 81  SER A CB  1 
ATOM   598  O OG  . SER A 1 81  ? 1.169   73.461 71.828 1.00   22.46 ? 81  SER A OG  1 
ATOM   599  N N   . GLU A 1 82  ? 0.319   75.071 69.456 1.00   24.35 ? 82  GLU A N   1 
ATOM   600  C CA  . GLU A 1 82  ? -1.008  75.308 68.928 1.00   26.27 ? 82  GLU A CA  1 
ATOM   601  C C   . GLU A 1 82  ? -0.913  75.743 67.485 1.00   25.46 ? 82  GLU A C   1 
ATOM   602  O O   . GLU A 1 82  ? -1.880  75.639 66.729 1.00   26.39 ? 82  GLU A O   1 
ATOM   603  C CB  . GLU A 1 82  ? -1.755  76.358 69.764 1.00   27.84 ? 82  GLU A CB  1 
ATOM   604  C CG  . GLU A 1 82  ? -1.672  76.072 71.260 1.00   31.64 ? 82  GLU A CG  1 
ATOM   605  C CD  . GLU A 1 82  ? -3.006  75.916 71.946 1.00   33.90 ? 82  GLU A CD  1 
ATOM   606  O OE1 . GLU A 1 82  ? -3.696  76.953 72.064 1.00   36.99 ? 82  GLU A OE1 1 
ATOM   607  O OE2 . GLU A 1 82  ? -3.343  74.779 72.415 1.00   35.00 ? 82  GLU A OE2 1 
ATOM   608  N N   . MET A 1 83  ? 0.262   76.187 67.072 1.00   24.18 ? 83  MET A N   1 
ATOM   609  C CA  . MET A 1 83  ? 0.403   76.630 65.706 1.00   22.20 ? 83  MET A CA  1 
ATOM   610  C C   . MET A 1 83  ? 0.178   75.476 64.745 1.00   22.08 ? 83  MET A C   1 
ATOM   611  O O   . MET A 1 83  ? 0.067   75.699 63.538 1.00   21.76 ? 83  MET A O   1 
ATOM   612  C CB  . MET A 1 83  ? 1.784   77.212 65.480 1.00   22.57 ? 83  MET A CB  1 
ATOM   613  C CG  . MET A 1 83  ? 2.836   76.178 65.383 1.00   22.60 ? 83  MET A CG  1 
ATOM   614  S SD  . MET A 1 83  ? 4.229   76.849 64.575 1.00   26.51 ? 83  MET A SD  1 
ATOM   615  C CE  . MET A 1 83  ? 4.314   78.492 65.301 1.00   26.27 ? 83  MET A CE  1 
ATOM   616  N N   . TRP A 1 84  ? 0.158   74.259 65.288 1.00   20.58 ? 84  TRP A N   1 
ATOM   617  C CA  . TRP A 1 84  ? -0.045  73.041 64.523 1.00   20.25 ? 84  TRP A CA  1 
ATOM   618  C C   . TRP A 1 84  ? -1.433  72.477 64.689 1.00   21.46 ? 84  TRP A C   1 
ATOM   619  O O   . TRP A 1 84  ? -1.759  71.459 64.088 1.00   23.09 ? 84  TRP A O   1 
ATOM   620  C CB  . TRP A 1 84  ? 0.916   71.956 64.985 1.00   19.94 ? 84  TRP A CB  1 
ATOM   621  C CG  . TRP A 1 84  ? 2.325   72.348 64.904 1.00   21.54 ? 84  TRP A CG  1 
ATOM   622  C CD1 . TRP A 1 84  ? 3.138   72.665 65.943 1.00   21.40 ? 84  TRP A CD1 1 
ATOM   623  C CD2 . TRP A 1 84  ? 3.101   72.529 63.711 1.00   21.28 ? 84  TRP A CD2 1 
ATOM   624  N NE1 . TRP A 1 84  ? 4.370   73.046 65.479 1.00   23.08 ? 84  TRP A NE1 1 
ATOM   625  C CE2 . TRP A 1 84  ? 4.375   72.969 64.108 1.00   22.83 ? 84  TRP A CE2 1 
ATOM   626  C CE3 . TRP A 1 84  ? 2.839   72.371 62.349 1.00   18.70 ? 84  TRP A CE3 1 
ATOM   627  C CZ2 . TRP A 1 84  ? 5.389   73.255 63.185 1.00   20.62 ? 84  TRP A CZ2 1 
ATOM   628  C CZ3 . TRP A 1 84  ? 3.837   72.651 61.446 1.00   16.80 ? 84  TRP A CZ3 1 
ATOM   629  C CH2 . TRP A 1 84  ? 5.093   73.087 61.864 1.00   18.55 ? 84  TRP A CH2 1 
ATOM   630  N N   . ASN A 1 85  ? -2.234  73.074 65.552 1.00   20.53 ? 85  ASN A N   1 
ATOM   631  C CA  . ASN A 1 85  ? -3.568  72.547 65.776 1.00   20.62 ? 85  ASN A CA  1 
ATOM   632  C C   . ASN A 1 85  ? -4.498  73.083 64.724 1.00   19.32 ? 85  ASN A C   1 
ATOM   633  O O   . ASN A 1 85  ? -4.320  74.174 64.215 1.00   18.39 ? 85  ASN A O   1 
ATOM   634  C CB  . ASN A 1 85  ? -4.121  72.956 67.157 1.00   23.48 ? 85  ASN A CB  1 
ATOM   635  C CG  . ASN A 1 85  ? -3.628  72.076 68.315 1.00   24.52 ? 85  ASN A CG  1 
ATOM   636  O OD1 . ASN A 1 85  ? -3.420  70.865 68.180 1.00   22.84 ? 85  ASN A OD1 1 
ATOM   637  N ND2 . ASN A 1 85  ? -3.484  72.696 69.480 1.00   25.55 ? 85  ASN A ND2 1 
ATOM   638  N N   . PRO A 1 86  ? -5.580  72.363 64.475 1.00   18.17 ? 86  PRO A N   1 
ATOM   639  C CA  . PRO A 1 86  ? -6.548  72.777 63.487 1.00   18.76 ? 86  PRO A CA  1 
ATOM   640  C C   . PRO A 1 86  ? -7.038  74.139 63.881 1.00   20.20 ? 86  PRO A C   1 
ATOM   641  O O   . PRO A 1 86  ? -7.439  74.324 65.029 1.00   22.50 ? 86  PRO A O   1 
ATOM   642  C CB  . PRO A 1 86  ? -7.651  71.752 63.683 1.00   17.34 ? 86  PRO A CB  1 
ATOM   643  C CG  . PRO A 1 86  ? -6.897  70.554 64.111 1.00   17.88 ? 86  PRO A CG  1 
ATOM   644  C CD  . PRO A 1 86  ? -6.019  71.126 65.126 1.00   17.46 ? 86  PRO A CD  1 
ATOM   645  N N   . ASN A 1 87  ? -7.010  75.078 62.943 1.00   20.21 ? 87  ASN A N   1 
ATOM   646  C CA  . ASN A 1 87  ? -7.489  76.421 63.192 1.00   19.65 ? 87  ASN A CA  1 
ATOM   647  C C   . ASN A 1 87  ? -8.804  76.681 62.504 1.00   19.39 ? 87  ASN A C   1 
ATOM   648  O O   . ASN A 1 87  ? -9.086  77.811 62.162 1.00   18.01 ? 87  ASN A O   1 
ATOM   649  C CB  . ASN A 1 87  ? -6.466  77.471 62.749 1.00   23.03 ? 87  ASN A CB  1 
ATOM   650  C CG  . ASN A 1 87  ? -6.053  77.318 61.300 1.00   26.70 ? 87  ASN A CG  1 
ATOM   651  O OD1 . ASN A 1 87  ? -6.531  76.433 60.598 1.00   28.46 ? 87  ASN A OD1 1 
ATOM   652  N ND2 . ASN A 1 87  ? -5.122  78.151 60.858 1.00   26.68 ? 87  ASN A ND2 1 
ATOM   653  N N   . ARG A 1 88  ? -9.596  75.636 62.278 1.00   19.18 ? 88  ARG A N   1 
ATOM   654  C CA  . ARG A 1 88  ? -10.901 75.775 61.637 1.00   19.69 ? 88  ARG A CA  1 
ATOM   655  C C   . ARG A 1 88  ? -11.742 74.686 62.230 1.00   20.21 ? 88  ARG A C   1 
ATOM   656  O O   . ARG A 1 88  ? -11.230 73.803 62.891 1.00   20.90 ? 88  ARG A O   1 
ATOM   657  C CB  . ARG A 1 88  ? -10.849 75.514 60.133 1.00   22.52 ? 88  ARG A CB  1 
ATOM   658  C CG  . ARG A 1 88  ? -10.053 76.489 59.301 1.00   24.24 ? 88  ARG A CG  1 
ATOM   659  C CD  . ARG A 1 88  ? -10.879 77.663 58.911 1.00   27.04 ? 88  ARG A CD  1 
ATOM   660  N NE  . ARG A 1 88  ? -10.002 78.821 58.841 1.00   32.46 ? 88  ARG A NE  1 
ATOM   661  C CZ  . ARG A 1 88  ? -10.396 80.059 58.552 1.00   35.28 ? 88  ARG A CZ  1 
ATOM   662  N NH1 . ARG A 1 88  ? -11.679 80.313 58.285 1.00   36.40 ? 88  ARG A NH1 1 
ATOM   663  N NH2 . ARG A 1 88  ? -9.495  81.051 58.570 1.00   36.02 ? 88  ARG A NH2 1 
ATOM   664  N N   . GLU A 1 89  ? -13.043 74.737 61.990 1.00   21.40 ? 89  GLU A N   1 
ATOM   665  C CA  . GLU A 1 89  ? -13.943 73.732 62.524 1.00   22.27 ? 89  GLU A CA  1 
ATOM   666  C C   . GLU A 1 89  ? -13.450 72.461 61.909 1.00   21.03 ? 89  GLU A C   1 
ATOM   667  O O   . GLU A 1 89  ? -12.925 72.488 60.817 1.00   21.93 ? 89  GLU A O   1 
ATOM   668  C CB  . GLU A 1 89  ? -15.376 74.020 62.080 1.00   24.72 ? 89  GLU A CB  1 
ATOM   669  C CG  . GLU A 1 89  ? -16.361 72.845 62.289 1.00   27.89 ? 89  GLU A CG  1 
ATOM   670  N N   . MET A 1 90  ? -13.468 71.377 62.647 1.00   19.79 ? 90  MET A N   1 
ATOM   671  C CA  . MET A 1 90  ? -13.029 70.139 62.071 1.00   19.32 ? 90  MET A CA  1 
ATOM   672  C C   . MET A 1 90  ? -14.305 69.559 61.551 1.00   19.57 ? 90  MET A C   1 
ATOM   673  O O   . MET A 1 90  ? -15.368 69.897 62.046 1.00   19.67 ? 90  MET A O   1 
ATOM   674  C CB  . MET A 1 90  ? -12.451 69.233 63.136 1.00   19.12 ? 90  MET A CB  1 
ATOM   675  C CG  . MET A 1 90  ? -11.132 69.694 63.680 1.00   21.88 ? 90  MET A CG  1 
ATOM   676  S SD  . MET A 1 90  ? -10.534 68.476 64.817 1.00   22.29 ? 90  MET A SD  1 
ATOM   677  C CE  . MET A 1 90  ? -11.505 68.883 66.171 1.00   22.14 ? 90  MET A CE  1 
ATOM   678  N N   . SER A 1 91  ? -14.227 68.717 60.535 1.00   20.87 ? 91  SER A N   1 
ATOM   679  C CA  . SER A 1 91  ? -15.427 68.110 59.986 1.00   21.87 ? 91  SER A CA  1 
ATOM   680  C C   . SER A 1 91  ? -15.029 66.944 59.125 1.00   20.72 ? 91  SER A C   1 
ATOM   681  O O   . SER A 1 91  ? -13.927 66.929 58.591 1.00   19.81 ? 91  SER A O   1 
ATOM   682  C CB  . SER A 1 91  ? -16.165 69.130 59.128 1.00   22.79 ? 91  SER A CB  1 
ATOM   683  O OG  . SER A 1 91  ? -17.365 68.572 58.605 1.00   28.51 ? 91  SER A OG  1 
ATOM   684  N N   . GLU A 1 92  ? -15.897 65.956 58.998 1.00   21.91 ? 92  GLU A N   1 
ATOM   685  C CA  . GLU A 1 92  ? -15.571 64.819 58.144 1.00   23.49 ? 92  GLU A CA  1 
ATOM   686  C C   . GLU A 1 92  ? -15.615 65.295 56.683 1.00   25.48 ? 92  GLU A C   1 
ATOM   687  O O   . GLU A 1 92  ? -15.070 64.633 55.783 1.00   26.91 ? 92  GLU A O   1 
ATOM   688  C CB  . GLU A 1 92  ? -16.525 63.644 58.369 1.00   22.76 ? 92  GLU A CB  1 
ATOM   689  C CG  . GLU A 1 92  ? -16.295 62.913 59.664 1.00   22.88 ? 92  GLU A CG  1 
ATOM   690  C CD  . GLU A 1 92  ? -16.947 61.564 59.659 1.00   24.66 ? 92  GLU A CD  1 
ATOM   691  O OE1 . GLU A 1 92  ? -18.153 61.473 59.923 1.00   25.87 ? 92  GLU A OE1 1 
ATOM   692  O OE2 . GLU A 1 92  ? -16.268 60.573 59.376 1.00   25.56 ? 92  GLU A OE2 1 
ATOM   693  N N   . ASP A 1 93  ? -16.257 66.451 56.456 1.00   24.44 ? 93  ASP A N   1 
ATOM   694  C CA  . ASP A 1 93  ? -16.340 67.073 55.144 1.00   22.60 ? 93  ASP A CA  1 
ATOM   695  C C   . ASP A 1 93  ? -15.138 67.996 55.078 1.00   20.71 ? 93  ASP A C   1 
ATOM   696  O O   . ASP A 1 93  ? -15.258 69.197 55.273 1.00   20.35 ? 93  ASP A O   1 
ATOM   697  C CB  . ASP A 1 93  ? -17.644 67.882 55.021 1.00   26.19 ? 93  ASP A CB  1 
ATOM   698  C CG  . ASP A 1 93  ? -17.775 68.624 53.675 1.00   28.99 ? 93  ASP A CG  1 
ATOM   699  O OD1 . ASP A 1 93  ? -16.806 68.629 52.882 1.00   30.26 ? 93  ASP A OD1 1 
ATOM   700  O OD2 . ASP A 1 93  ? -18.852 69.212 53.396 1.00   31.87 ? 93  ASP A OD2 1 
ATOM   701  N N   . CYS A 1 94  ? -13.975 67.437 54.788 1.00   20.04 ? 94  CYS A N   1 
ATOM   702  C CA  . CYS A 1 94  ? -12.776 68.237 54.723 1.00   19.48 ? 94  CYS A CA  1 
ATOM   703  C C   . CYS A 1 94  ? -11.943 68.071 53.466 1.00   21.31 ? 94  CYS A C   1 
ATOM   704  O O   . CYS A 1 94  ? -10.920 68.753 53.320 1.00   21.33 ? 94  CYS A O   1 
ATOM   705  C CB  . CYS A 1 94  ? -11.897 67.878 55.881 1.00   19.53 ? 94  CYS A CB  1 
ATOM   706  S SG  . CYS A 1 94  ? -11.479 66.125 55.878 1.00   18.82 ? 94  CYS A SG  1 
ATOM   707  N N   . LEU A 1 95  ? -12.343 67.180 52.557 1.00   21.17 ? 95  LEU A N   1 
ATOM   708  C CA  . LEU A 1 95  ? -11.546 66.983 51.351 1.00   19.32 ? 95  LEU A CA  1 
ATOM   709  C C   . LEU A 1 95  ? -11.671 68.182 50.425 1.00   18.69 ? 95  LEU A C   1 
ATOM   710  O O   . LEU A 1 95  ? -12.587 68.239 49.604 1.00   19.46 ? 95  LEU A O   1 
ATOM   711  C CB  . LEU A 1 95  ? -11.945 65.693 50.653 1.00   16.16 ? 95  LEU A CB  1 
ATOM   712  C CG  . LEU A 1 95  ? -11.739 64.491 51.550 1.00   15.06 ? 95  LEU A CG  1 
ATOM   713  C CD1 . LEU A 1 95  ? -11.982 63.226 50.798 1.00   13.26 ? 95  LEU A CD1 1 
ATOM   714  C CD2 . LEU A 1 95  ? -10.356 64.513 52.076 1.00   13.99 ? 95  LEU A CD2 1 
ATOM   715  N N   . TYR A 1 96  ? -10.757 69.139 50.582 1.00   16.44 ? 96  TYR A N   1 
ATOM   716  C CA  . TYR A 1 96  ? -10.725 70.376 49.796 1.00   15.00 ? 96  TYR A CA  1 
ATOM   717  C C   . TYR A 1 96  ? -9.288  70.742 49.505 1.00   15.51 ? 96  TYR A C   1 
ATOM   718  O O   . TYR A 1 96  ? -8.402  70.306 50.211 1.00   17.97 ? 96  TYR A O   1 
ATOM   719  C CB  . TYR A 1 96  ? -11.337 71.520 50.601 1.00   13.89 ? 96  TYR A CB  1 
ATOM   720  C CG  . TYR A 1 96  ? -12.798 71.333 50.887 1.00   13.34 ? 96  TYR A CG  1 
ATOM   721  C CD1 . TYR A 1 96  ? -13.213 70.515 51.893 1.00   13.37 ? 96  TYR A CD1 1 
ATOM   722  C CD2 . TYR A 1 96  ? -13.765 71.936 50.096 1.00   13.82 ? 96  TYR A CD2 1 
ATOM   723  C CE1 . TYR A 1 96  ? -14.550 70.282 52.111 1.00   16.98 ? 96  TYR A CE1 1 
ATOM   724  C CE2 . TYR A 1 96  ? -15.101 71.712 50.301 1.00   13.87 ? 96  TYR A CE2 1 
ATOM   725  C CZ  . TYR A 1 96  ? -15.488 70.880 51.310 1.00   16.39 ? 96  TYR A CZ  1 
ATOM   726  O OH  . TYR A 1 96  ? -16.813 70.611 51.519 1.00   18.06 ? 96  TYR A OH  1 
ATOM   727  N N   . LEU A 1 97  ? -9.048  71.521 48.458 1.00   15.84 ? 97  LEU A N   1 
ATOM   728  C CA  . LEU A 1 97  ? -7.703  71.953 48.125 1.00   15.08 ? 97  LEU A CA  1 
ATOM   729  C C   . LEU A 1 97  ? -7.708  73.460 48.031 1.00   15.20 ? 97  LEU A C   1 
ATOM   730  O O   . LEU A 1 97  ? -8.770  74.057 47.916 1.00   16.60 ? 97  LEU A O   1 
ATOM   731  C CB  . LEU A 1 97  ? -7.212  71.308 46.832 1.00   16.38 ? 97  LEU A CB  1 
ATOM   732  C CG  . LEU A 1 97  ? -7.885  71.427 45.469 1.00   17.59 ? 97  LEU A CG  1 
ATOM   733  C CD1 . LEU A 1 97  ? -7.436  72.674 44.765 1.00   19.47 ? 97  LEU A CD1 1 
ATOM   734  C CD2 . LEU A 1 97  ? -7.445  70.260 44.646 1.00   16.44 ? 97  LEU A CD2 1 
ATOM   735  N N   . ASN A 1 98  ? -6.537  74.068 48.147 1.00   15.64 ? 98  ASN A N   1 
ATOM   736  C CA  . ASN A 1 98  ? -6.380  75.520 48.094 1.00   17.11 ? 98  ASN A CA  1 
ATOM   737  C C   . ASN A 1 98  ? -5.289  75.831 47.063 1.00   17.26 ? 98  ASN A C   1 
ATOM   738  O O   . ASN A 1 98  ? -4.243  75.172 47.063 1.00   17.27 ? 98  ASN A O   1 
ATOM   739  C CB  . ASN A 1 98  ? -5.913  76.078 49.465 1.00   18.52 ? 98  ASN A CB  1 
ATOM   740  C CG  . ASN A 1 98  ? -6.749  75.587 50.630 1.00   17.37 ? 98  ASN A CG  1 
ATOM   741  O OD1 . ASN A 1 98  ? -7.897  75.973 50.780 1.00   19.01 ? 98  ASN A OD1 1 
ATOM   742  N ND2 . ASN A 1 98  ? -6.173  74.731 51.455 1.00   15.67 ? 98  ASN A ND2 1 
ATOM   743  N N   . ILE A 1 99  ? -5.504  76.844 46.224 1.00   17.62 ? 99  ILE A N   1 
ATOM   744  C CA  . ILE A 1 99  ? -4.534  77.232 45.188 1.00   18.31 ? 99  ILE A CA  1 
ATOM   745  C C   . ILE A 1 99  ? -4.158  78.705 45.310 1.00   18.48 ? 99  ILE A C   1 
ATOM   746  O O   . ILE A 1 99  ? -5.025  79.562 45.450 1.00   19.41 ? 99  ILE A O   1 
ATOM   747  C CB  . ILE A 1 99  ? -5.119  77.032 43.742 1.00   17.35 ? 99  ILE A CB  1 
ATOM   748  C CG1 . ILE A 1 99  ? -5.620  75.617 43.543 1.00   17.53 ? 99  ILE A CG1 1 
ATOM   749  C CG2 . ILE A 1 99  ? -4.071  77.281 42.713 1.00   15.39 ? 99  ILE A CG2 1 
ATOM   750  C CD1 . ILE A 1 99  ? -6.683  75.536 42.529 1.00   19.88 ? 99  ILE A CD1 1 
ATOM   751  N N   . TRP A 1 100 ? -2.875  79.001 45.319 1.00   18.38 ? 100 TRP A N   1 
ATOM   752  C CA  . TRP A 1 100 ? -2.454  80.386 45.369 1.00   21.18 ? 100 TRP A CA  1 
ATOM   753  C C   . TRP A 1 100 ? -1.898  80.555 43.968 1.00   22.97 ? 100 TRP A C   1 
ATOM   754  O O   . TRP A 1 100 ? -1.170  79.682 43.516 1.00   25.19 ? 100 TRP A O   1 
ATOM   755  C CB  . TRP A 1 100 ? -1.371  80.605 46.435 1.00   19.80 ? 100 TRP A CB  1 
ATOM   756  C CG  . TRP A 1 100 ? -1.953  80.762 47.788 1.00   19.65 ? 100 TRP A CG  1 
ATOM   757  C CD1 . TRP A 1 100 ? -2.451  81.900 48.333 1.00   19.46 ? 100 TRP A CD1 1 
ATOM   758  C CD2 . TRP A 1 100 ? -2.224  79.717 48.726 1.00   19.21 ? 100 TRP A CD2 1 
ATOM   759  N NE1 . TRP A 1 100 ? -3.043  81.631 49.543 1.00   19.56 ? 100 TRP A NE1 1 
ATOM   760  C CE2 . TRP A 1 100 ? -2.915  80.291 49.804 1.00   20.02 ? 100 TRP A CE2 1 
ATOM   761  C CE3 . TRP A 1 100 ? -1.952  78.348 48.756 1.00   18.74 ? 100 TRP A CE3 1 
ATOM   762  C CZ2 . TRP A 1 100 ? -3.339  79.542 50.895 1.00   19.32 ? 100 TRP A CZ2 1 
ATOM   763  C CZ3 . TRP A 1 100 ? -2.372  77.608 49.840 1.00   18.52 ? 100 TRP A CZ3 1 
ATOM   764  C CH2 . TRP A 1 100 ? -3.058  78.204 50.893 1.00   19.41 ? 100 TRP A CH2 1 
ATOM   765  N N   . VAL A 1 101 ? -2.293  81.611 43.251 1.00   23.37 ? 101 VAL A N   1 
ATOM   766  C CA  . VAL A 1 101 ? -1.833  81.835 41.879 1.00   21.76 ? 101 VAL A CA  1 
ATOM   767  C C   . VAL A 1 101 ? -1.284  83.230 41.697 1.00   21.37 ? 101 VAL A C   1 
ATOM   768  O O   . VAL A 1 101 ? -1.945  84.219 42.020 1.00   21.67 ? 101 VAL A O   1 
ATOM   769  C CB  . VAL A 1 101 ? -2.986  81.713 40.875 1.00   22.60 ? 101 VAL A CB  1 
ATOM   770  C CG1 . VAL A 1 101 ? -2.439  81.770 39.475 1.00   21.61 ? 101 VAL A CG1 1 
ATOM   771  C CG2 . VAL A 1 101 ? -3.802  80.433 41.117 1.00   20.30 ? 101 VAL A CG2 1 
ATOM   772  N N   . PRO A 1 102 ? -0.087  83.346 41.148 1.00   20.19 ? 102 PRO A N   1 
ATOM   773  C CA  . PRO A 1 102 ? 0.459   84.679 40.960 1.00   21.62 ? 102 PRO A CA  1 
ATOM   774  C C   . PRO A 1 102 ? -0.465  85.556 40.130 1.00   25.61 ? 102 PRO A C   1 
ATOM   775  O O   . PRO A 1 102 ? -1.264  85.059 39.334 1.00   26.60 ? 102 PRO A O   1 
ATOM   776  C CB  . PRO A 1 102 ? 1.746   84.400 40.222 1.00   18.37 ? 102 PRO A CB  1 
ATOM   777  C CG  . PRO A 1 102 ? 2.157   83.106 40.797 1.00   18.20 ? 102 PRO A CG  1 
ATOM   778  C CD  . PRO A 1 102 ? 0.894   82.321 40.796 1.00   18.64 ? 102 PRO A CD  1 
ATOM   779  N N   . SER A 1 103 ? -0.407  86.861 40.369 1.00   29.15 ? 103 SER A N   1 
ATOM   780  C CA  . SER A 1 103 ? -1.207  87.807 39.622 1.00   31.01 ? 103 SER A CA  1 
ATOM   781  C C   . SER A 1 103 ? -0.222  88.765 39.011 1.00   33.48 ? 103 SER A C   1 
ATOM   782  O O   . SER A 1 103 ? 0.503   89.431 39.746 1.00   34.82 ? 103 SER A O   1 
ATOM   783  C CB  . SER A 1 103 ? -2.098  88.610 40.526 1.00   30.59 ? 103 SER A CB  1 
ATOM   784  O OG  . SER A 1 103 ? -2.544  89.752 39.806 1.00   32.20 ? 103 SER A OG  1 
ATOM   785  N N   . PRO A 1 104 ? -0.223  88.915 37.663 1.00   35.40 ? 104 PRO A N   1 
ATOM   786  C CA  . PRO A 1 104 ? -1.088  88.248 36.686 1.00   34.28 ? 104 PRO A CA  1 
ATOM   787  C C   . PRO A 1 104 ? -0.926  86.736 36.530 1.00   32.65 ? 104 PRO A C   1 
ATOM   788  O O   . PRO A 1 104 ? 0.177   86.199 36.501 1.00   32.33 ? 104 PRO A O   1 
ATOM   789  C CB  . PRO A 1 104 ? -0.762  88.992 35.384 1.00   35.47 ? 104 PRO A CB  1 
ATOM   790  C CG  . PRO A 1 104 ? 0.672   89.313 35.543 1.00   35.49 ? 104 PRO A CG  1 
ATOM   791  C CD  . PRO A 1 104 ? 0.703   89.838 36.971 1.00   36.63 ? 104 PRO A CD  1 
ATOM   792  N N   . ARG A 1 105 ? -2.074  86.078 36.448 1.00   32.29 ? 105 ARG A N   1 
ATOM   793  C CA  . ARG A 1 105 ? -2.192  84.643 36.277 1.00   32.04 ? 105 ARG A CA  1 
ATOM   794  C C   . ARG A 1 105 ? -1.232  84.277 35.203 1.00   31.99 ? 105 ARG A C   1 
ATOM   795  O O   . ARG A 1 105 ? -1.254  84.886 34.143 1.00   33.51 ? 105 ARG A O   1 
ATOM   796  C CB  . ARG A 1 105 ? -3.596  84.306 35.779 1.00   30.39 ? 105 ARG A CB  1 
ATOM   797  C CG  . ARG A 1 105 ? -3.861  82.823 35.745 1.00   30.97 ? 105 ARG A CG  1 
ATOM   798  C CD  . ARG A 1 105 ? -5.204  82.501 35.136 1.00   30.67 ? 105 ARG A CD  1 
ATOM   799  N NE  . ARG A 1 105 ? -6.309  83.155 35.815 1.00   31.41 ? 105 ARG A NE  1 
ATOM   800  C CZ  . ARG A 1 105 ? -7.581  82.954 35.475 1.00   33.86 ? 105 ARG A CZ  1 
ATOM   801  N NH1 . ARG A 1 105 ? -7.870  82.112 34.479 1.00   34.60 ? 105 ARG A NH1 1 
ATOM   802  N NH2 . ARG A 1 105 ? -8.567  83.629 36.075 1.00   33.38 ? 105 ARG A NH2 1 
ATOM   803  N N   . PRO A 1 106 ? -0.343  83.316 35.465 1.00   31.50 ? 106 PRO A N   1 
ATOM   804  C CA  . PRO A 1 106 ? 0.661   82.852 34.497 1.00   30.91 ? 106 PRO A CA  1 
ATOM   805  C C   . PRO A 1 106 ? -0.099  82.059 33.452 1.00   31.01 ? 106 PRO A C   1 
ATOM   806  O O   . PRO A 1 106 ? -1.303  81.876 33.609 1.00   30.60 ? 106 PRO A O   1 
ATOM   807  C CB  . PRO A 1 106 ? 1.516   81.905 35.327 1.00   29.85 ? 106 PRO A CB  1 
ATOM   808  C CG  . PRO A 1 106 ? 1.252   82.310 36.737 1.00   30.87 ? 106 PRO A CG  1 
ATOM   809  C CD  . PRO A 1 106 ? -0.224  82.578 36.722 1.00   30.37 ? 106 PRO A CD  1 
ATOM   810  N N   . LYS A 1 107 ? 0.571   81.619 32.385 1.00   31.93 ? 107 LYS A N   1 
ATOM   811  C CA  . LYS A 1 107 ? -0.102  80.821 31.351 1.00   33.71 ? 107 LYS A CA  1 
ATOM   812  C C   . LYS A 1 107 ? 0.295   79.379 31.580 1.00   34.00 ? 107 LYS A C   1 
ATOM   813  O O   . LYS A 1 107 ? -0.492  78.457 31.345 1.00   34.28 ? 107 LYS A O   1 
ATOM   814  C CB  . LYS A 1 107 ? 0.328   81.240 29.945 1.00   33.81 ? 107 LYS A CB  1 
ATOM   815  C CG  . LYS A 1 107 ? 0.067   82.696 29.609 1.00   34.51 ? 107 LYS A CG  1 
ATOM   816  C CD  . LYS A 1 107 ? -1.410  83.033 29.624 1.00   37.21 ? 107 LYS A CD  1 
ATOM   817  C CE  . LYS A 1 107 ? -1.564  84.567 29.667 1.00   40.19 ? 107 LYS A CE  1 
ATOM   818  N NZ  . LYS A 1 107 ? -2.994  85.051 29.662 1.00   42.96 ? 107 LYS A NZ  1 
ATOM   819  N N   . SER A 1 108 ? 1.548   79.187 31.987 1.00   33.73 ? 108 SER A N   1 
ATOM   820  C CA  . SER A 1 108 ? 2.035   77.853 32.283 1.00   33.66 ? 108 SER A CA  1 
ATOM   821  C C   . SER A 1 108 ? 3.245   77.807 33.208 1.00   34.14 ? 108 SER A C   1 
ATOM   822  O O   . SER A 1 108 ? 4.372   77.696 32.700 1.00   37.53 ? 108 SER A O   1 
ATOM   823  C CB  . SER A 1 108 ? 2.390   77.106 31.004 1.00   31.88 ? 108 SER A CB  1 
ATOM   824  O OG  . SER A 1 108 ? 1.419   76.113 30.699 1.00   34.82 ? 108 SER A OG  1 
ATOM   825  N N   . THR A 1 109 ? 3.059   77.988 34.523 1.00   32.25 ? 109 THR A N   1 
ATOM   826  C CA  . THR A 1 109 ? 4.185   77.842 35.463 1.00   29.09 ? 109 THR A CA  1 
ATOM   827  C C   . THR A 1 109 ? 4.167   76.524 36.221 1.00   27.63 ? 109 THR A C   1 
ATOM   828  O O   . THR A 1 109 ? 3.162   75.801 36.286 1.00   26.49 ? 109 THR A O   1 
ATOM   829  C CB  . THR A 1 109 ? 4.230   78.852 36.570 1.00   26.89 ? 109 THR A CB  1 
ATOM   830  O OG1 . THR A 1 109 ? 2.975   79.523 36.669 1.00   28.65 ? 109 THR A OG1 1 
ATOM   831  C CG2 . THR A 1 109 ? 5.372   79.791 36.368 1.00   28.52 ? 109 THR A CG2 1 
ATOM   832  N N   . THR A 1 110 ? 5.302   76.265 36.844 1.00   26.64 ? 110 THR A N   1 
ATOM   833  C CA  . THR A 1 110 ? 5.512   75.100 37.665 1.00   25.14 ? 110 THR A CA  1 
ATOM   834  C C   . THR A 1 110 ? 4.506   75.056 38.812 1.00   23.09 ? 110 THR A C   1 
ATOM   835  O O   . THR A 1 110 ? 4.171   76.076 39.415 1.00   21.17 ? 110 THR A O   1 
ATOM   836  C CB  . THR A 1 110 ? 6.892   75.167 38.228 1.00   25.55 ? 110 THR A CB  1 
ATOM   837  O OG1 . THR A 1 110 ? 7.757   75.757 37.243 1.00   26.79 ? 110 THR A OG1 1 
ATOM   838  C CG2 . THR A 1 110 ? 7.378   73.786 38.531 1.00   28.72 ? 110 THR A CG2 1 
ATOM   839  N N   . VAL A 1 111 ? 3.980   73.873 39.070 1.00   22.60 ? 111 VAL A N   1 
ATOM   840  C CA  . VAL A 1 111 ? 3.022   73.690 40.146 1.00   21.84 ? 111 VAL A CA  1 
ATOM   841  C C   . VAL A 1 111 ? 3.693   72.974 41.336 1.00   21.36 ? 111 VAL A C   1 
ATOM   842  O O   . VAL A 1 111 ? 4.465   72.022 41.146 1.00   19.40 ? 111 VAL A O   1 
ATOM   843  C CB  . VAL A 1 111 ? 1.859   72.853 39.663 1.00   20.95 ? 111 VAL A CB  1 
ATOM   844  C CG1 . VAL A 1 111 ? 0.908   72.592 40.797 1.00   20.69 ? 111 VAL A CG1 1 
ATOM   845  C CG2 . VAL A 1 111 ? 1.153   73.572 38.544 1.00   18.25 ? 111 VAL A CG2 1 
ATOM   846  N N   . MET A 1 112 ? 3.438   73.474 42.548 1.00   20.33 ? 112 MET A N   1 
ATOM   847  C CA  . MET A 1 112 ? 3.951   72.892 43.795 1.00   17.72 ? 112 MET A CA  1 
ATOM   848  C C   . MET A 1 112 ? 2.775   72.512 44.684 1.00   16.70 ? 112 MET A C   1 
ATOM   849  O O   . MET A 1 112 ? 2.035   73.376 45.124 1.00   18.32 ? 112 MET A O   1 
ATOM   850  C CB  . MET A 1 112 ? 4.864   73.879 44.498 1.00   16.99 ? 112 MET A CB  1 
ATOM   851  C CG  . MET A 1 112 ? 6.151   74.017 43.773 1.00   17.28 ? 112 MET A CG  1 
ATOM   852  S SD  . MET A 1 112 ? 7.328   74.921 44.662 1.00   20.28 ? 112 MET A SD  1 
ATOM   853  C CE  . MET A 1 112 ? 8.009   73.686 45.624 1.00   19.76 ? 112 MET A CE  1 
ATOM   854  N N   . VAL A 1 113 ? 2.556   71.213 44.863 1.00   15.82 ? 113 VAL A N   1 
ATOM   855  C CA  . VAL A 1 113 ? 1.465   70.687 45.680 1.00   16.21 ? 113 VAL A CA  1 
ATOM   856  C C   . VAL A 1 113 ? 2.027   70.259 47.038 1.00   18.28 ? 113 VAL A C   1 
ATOM   857  O O   . VAL A 1 113 ? 2.895   69.392 47.106 1.00   17.92 ? 113 VAL A O   1 
ATOM   858  C CB  . VAL A 1 113 ? 0.817   69.463 45.008 1.00   13.36 ? 113 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 113 ? -0.371  69.000 45.781 1.00   10.13 ? 113 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 113 ? 0.392   69.803 43.638 1.00   12.43 ? 113 VAL A CG2 1 
ATOM   861  N N   . TRP A 1 114 ? 1.540   70.884 48.108 1.00   20.48 ? 114 TRP A N   1 
ATOM   862  C CA  . TRP A 1 114 ? 1.972   70.610 49.487 1.00   18.29 ? 114 TRP A CA  1 
ATOM   863  C C   . TRP A 1 114 ? 1.097   69.573 50.175 1.00   18.13 ? 114 TRP A C   1 
ATOM   864  O O   . TRP A 1 114 ? -0.116  69.740 50.222 1.00   18.16 ? 114 TRP A O   1 
ATOM   865  C CB  . TRP A 1 114 ? 1.921   71.915 50.301 1.00   18.59 ? 114 TRP A CB  1 
ATOM   866  C CG  . TRP A 1 114 ? 2.187   71.747 51.780 1.00   17.85 ? 114 TRP A CG  1 
ATOM   867  C CD1 . TRP A 1 114 ? 1.264   71.760 52.793 1.00   18.55 ? 114 TRP A CD1 1 
ATOM   868  C CD2 . TRP A 1 114 ? 3.446   71.482 52.394 1.00   15.20 ? 114 TRP A CD2 1 
ATOM   869  N NE1 . TRP A 1 114 ? 1.882   71.503 53.990 1.00   17.34 ? 114 TRP A NE1 1 
ATOM   870  C CE2 . TRP A 1 114 ? 3.219   71.329 53.768 1.00   15.58 ? 114 TRP A CE2 1 
ATOM   871  C CE3 . TRP A 1 114 ? 4.746   71.353 51.912 1.00   13.22 ? 114 TRP A CE3 1 
ATOM   872  C CZ2 . TRP A 1 114 ? 4.235   71.054 54.653 1.00   14.77 ? 114 TRP A CZ2 1 
ATOM   873  C CZ3 . TRP A 1 114 ? 5.750   71.084 52.794 1.00   14.51 ? 114 TRP A CZ3 1 
ATOM   874  C CH2 . TRP A 1 114 ? 5.493   70.936 54.149 1.00   14.62 ? 114 TRP A CH2 1 
ATOM   875  N N   . ILE A 1 115 ? 1.707   68.497 50.675 1.00   18.20 ? 115 ILE A N   1 
ATOM   876  C CA  . ILE A 1 115 ? 0.994   67.454 51.415 1.00   18.26 ? 115 ILE A CA  1 
ATOM   877  C C   . ILE A 1 115 ? 1.446   67.617 52.869 1.00   18.78 ? 115 ILE A C   1 
ATOM   878  O O   . ILE A 1 115 ? 2.622   67.408 53.185 1.00   17.59 ? 115 ILE A O   1 
ATOM   879  C CB  . ILE A 1 115 ? 1.376   66.051 50.939 1.00   16.78 ? 115 ILE A CB  1 
ATOM   880  C CG1 . ILE A 1 115 ? 1.252   65.981 49.404 1.00   16.08 ? 115 ILE A CG1 1 
ATOM   881  C CG2 . ILE A 1 115 ? 0.489   65.052 51.632 1.00   13.55 ? 115 ILE A CG2 1 
ATOM   882  C CD1 . ILE A 1 115 ? 1.685   64.717 48.746 1.00   12.73 ? 115 ILE A CD1 1 
ATOM   883  N N   . TYR A 1 116 ? 0.544   68.060 53.740 1.00   17.75 ? 116 TYR A N   1 
ATOM   884  C CA  . TYR A 1 116 ? 0.899   68.284 55.144 1.00   15.65 ? 116 TYR A CA  1 
ATOM   885  C C   . TYR A 1 116 ? 1.299   67.052 55.909 1.00   17.78 ? 116 TYR A C   1 
ATOM   886  O O   . TYR A 1 116 ? 0.917   65.943 55.549 1.00   19.32 ? 116 TYR A O   1 
ATOM   887  C CB  . TYR A 1 116 ? -0.220  68.998 55.903 1.00   12.06 ? 116 TYR A CB  1 
ATOM   888  C CG  . TYR A 1 116 ? -1.572  68.321 55.921 1.00   7.98  ? 116 TYR A CG  1 
ATOM   889  C CD1 . TYR A 1 116 ? -1.780  67.132 56.580 1.00   8.00  ? 116 TYR A CD1 1 
ATOM   890  C CD2 . TYR A 1 116 ? -2.654  68.902 55.305 1.00   7.49  ? 116 TYR A CD2 1 
ATOM   891  C CE1 . TYR A 1 116 ? -3.035  66.543 56.618 1.00   5.28  ? 116 TYR A CE1 1 
ATOM   892  C CE2 . TYR A 1 116 ? -3.901  68.318 55.342 1.00   6.54  ? 116 TYR A CE2 1 
ATOM   893  C CZ  . TYR A 1 116 ? -4.082  67.149 55.991 1.00   6.46  ? 116 TYR A CZ  1 
ATOM   894  O OH  . TYR A 1 116 ? -5.331  66.586 55.977 1.00   11.89 ? 116 TYR A OH  1 
ATOM   895  N N   . GLY A 1 117 ? 2.080   67.256 56.971 1.00   18.61 ? 117 GLY A N   1 
ATOM   896  C CA  . GLY A 1 117 ? 2.494   66.157 57.827 1.00   15.83 ? 117 GLY A CA  1 
ATOM   897  C C   . GLY A 1 117 ? 1.554   65.989 59.012 1.00   14.18 ? 117 GLY A C   1 
ATOM   898  O O   . GLY A 1 117 ? 0.457   66.545 59.032 1.00   11.17 ? 117 GLY A O   1 
ATOM   899  N N   . GLY A 1 118 ? 1.992   65.197 59.989 1.00   15.54 ? 118 GLY A N   1 
ATOM   900  C CA  . GLY A 1 118 ? 1.207   64.949 61.190 1.00   14.32 ? 118 GLY A CA  1 
ATOM   901  C C   . GLY A 1 118 ? 1.071   63.503 61.640 1.00   14.61 ? 118 GLY A C   1 
ATOM   902  O O   . GLY A 1 118 ? 0.058   63.128 62.192 1.00   16.57 ? 118 GLY A O   1 
ATOM   903  N N   . GLY A 1 119 ? 2.058   62.670 61.372 1.00   14.38 ? 119 GLY A N   1 
ATOM   904  C CA  . GLY A 1 119 ? 1.977   61.283 61.782 1.00   14.68 ? 119 GLY A CA  1 
ATOM   905  C C   . GLY A 1 119 ? 0.781   60.541 61.236 1.00   16.41 ? 119 GLY A C   1 
ATOM   906  O O   . GLY A 1 119 ? 0.437   59.459 61.716 1.00   17.36 ? 119 GLY A O   1 
ATOM   907  N N   . PHE A 1 120 ? 0.144   61.107 60.217 1.00   17.83 ? 120 PHE A N   1 
ATOM   908  C CA  . PHE A 1 120 ? -1.031  60.505 59.614 1.00   16.26 ? 120 PHE A CA  1 
ATOM   909  C C   . PHE A 1 120 ? -2.229  60.548 60.561 1.00   16.56 ? 120 PHE A C   1 
ATOM   910  O O   . PHE A 1 120 ? -3.324  60.147 60.179 1.00   16.84 ? 120 PHE A O   1 
ATOM   911  C CB  . PHE A 1 120 ? -0.760  59.069 59.169 1.00   15.84 ? 120 PHE A CB  1 
ATOM   912  C CG  . PHE A 1 120 ? 0.162   58.946 57.987 1.00   16.55 ? 120 PHE A CG  1 
ATOM   913  C CD1 . PHE A 1 120 ? -0.195  59.449 56.751 1.00   16.46 ? 120 PHE A CD1 1 
ATOM   914  C CD2 . PHE A 1 120 ? 1.353   58.261 58.097 1.00   17.08 ? 120 PHE A CD2 1 
ATOM   915  C CE1 . PHE A 1 120 ? 0.622   59.264 55.649 1.00   16.51 ? 120 PHE A CE1 1 
ATOM   916  C CE2 . PHE A 1 120 ? 2.166   58.078 56.993 1.00   18.14 ? 120 PHE A CE2 1 
ATOM   917  C CZ  . PHE A 1 120 ? 1.789   58.585 55.766 1.00   15.33 ? 120 PHE A CZ  1 
ATOM   918  N N   . TYR A 1 121 ? -2.030  61.004 61.798 1.00   14.88 ? 121 TYR A N   1 
ATOM   919  C CA  . TYR A 1 121 ? -3.149  61.136 62.746 1.00   13.81 ? 121 TYR A CA  1 
ATOM   920  C C   . TYR A 1 121 ? -3.666  62.575 62.787 1.00   13.68 ? 121 TYR A C   1 
ATOM   921  O O   . TYR A 1 121 ? -4.712  62.828 63.374 1.00   13.59 ? 121 TYR A O   1 
ATOM   922  C CB  . TYR A 1 121 ? -2.792  60.675 64.178 1.00   11.87 ? 121 TYR A CB  1 
ATOM   923  C CG  . TYR A 1 121 ? -1.837  61.567 64.922 1.00   8.99  ? 121 TYR A CG  1 
ATOM   924  C CD1 . TYR A 1 121 ? -2.283  62.680 65.626 1.00   10.09 ? 121 TYR A CD1 1 
ATOM   925  C CD2 . TYR A 1 121 ? -0.479  61.326 64.879 1.00   9.44  ? 121 TYR A CD2 1 
ATOM   926  C CE1 . TYR A 1 121 ? -1.383  63.532 66.260 1.00   10.62 ? 121 TYR A CE1 1 
ATOM   927  C CE2 . TYR A 1 121 ? 0.413   62.161 65.499 1.00   11.89 ? 121 TYR A CE2 1 
ATOM   928  C CZ  . TYR A 1 121 ? -0.040  63.258 66.186 1.00   12.22 ? 121 TYR A CZ  1 
ATOM   929  O OH  . TYR A 1 121 ? 0.897   64.071 66.783 1.00   18.45 ? 121 TYR A OH  1 
ATOM   930  N N   . SER A 1 122 ? -2.934  63.514 62.189 1.00   11.65 ? 122 SER A N   1 
ATOM   931  C CA  . SER A 1 122 ? -3.368  64.907 62.187 1.00   13.84 ? 122 SER A CA  1 
ATOM   932  C C   . SER A 1 122 ? -2.859  65.709 60.984 1.00   13.62 ? 122 SER A C   1 
ATOM   933  O O   . SER A 1 122 ? -2.179  65.184 60.117 1.00   12.58 ? 122 SER A O   1 
ATOM   934  C CB  . SER A 1 122 ? -2.926  65.599 63.489 1.00   14.95 ? 122 SER A CB  1 
ATOM   935  O OG  . SER A 1 122 ? -1.510  65.653 63.608 1.00   12.87 ? 122 SER A OG  1 
ATOM   936  N N   . GLY A 1 123 ? -3.219  66.979 60.934 1.00   13.70 ? 123 GLY A N   1 
ATOM   937  C CA  . GLY A 1 123 ? -2.765  67.827 59.860 1.00   14.31 ? 123 GLY A CA  1 
ATOM   938  C C   . GLY A 1 123 ? -3.876  68.732 59.400 1.00   15.93 ? 123 GLY A C   1 
ATOM   939  O O   . GLY A 1 123 ? -5.053  68.395 59.503 1.00   17.42 ? 123 GLY A O   1 
ATOM   940  N N   . SER A 1 124 ? -3.505  69.880 58.868 1.00   16.38 ? 124 SER A N   1 
ATOM   941  C CA  . SER A 1 124 ? -4.458  70.847 58.375 1.00   17.92 ? 124 SER A CA  1 
ATOM   942  C C   . SER A 1 124 ? -3.766  71.581 57.252 1.00   20.01 ? 124 SER A C   1 
ATOM   943  O O   . SER A 1 124 ? -2.595  71.931 57.363 1.00   19.67 ? 124 SER A O   1 
ATOM   944  C CB  . SER A 1 124 ? -4.778  71.853 59.463 1.00   18.94 ? 124 SER A CB  1 
ATOM   945  O OG  . SER A 1 124 ? -5.371  71.193 60.543 1.00   23.17 ? 124 SER A OG  1 
ATOM   946  N N   . SER A 1 125 ? -4.469  71.817 56.159 1.00   20.86 ? 125 SER A N   1 
ATOM   947  C CA  . SER A 1 125 ? -3.845  72.524 55.062 1.00   21.69 ? 125 SER A CA  1 
ATOM   948  C C   . SER A 1 125 ? -4.040  73.998 55.311 1.00   21.73 ? 125 SER A C   1 
ATOM   949  O O   . SER A 1 125 ? -3.624  74.822 54.522 1.00   22.11 ? 125 SER A O   1 
ATOM   950  C CB  . SER A 1 125 ? -4.551  72.160 53.775 1.00   22.03 ? 125 SER A CB  1 
ATOM   951  O OG  . SER A 1 125 ? -5.844  72.724 53.783 1.00   22.01 ? 125 SER A OG  1 
ATOM   952  N N   . THR A 1 126 ? -4.682  74.329 56.420 1.00   21.91 ? 126 THR A N   1 
ATOM   953  C CA  . THR A 1 126 ? -4.989  75.710 56.714 1.00   20.42 ? 126 THR A CA  1 
ATOM   954  C C   . THR A 1 126 ? -4.090  76.388 57.733 1.00   20.83 ? 126 THR A C   1 
ATOM   955  O O   . THR A 1 126 ? -4.254  77.575 58.026 1.00   21.79 ? 126 THR A O   1 
ATOM   956  C CB  . THR A 1 126 ? -6.495  75.820 57.087 1.00   20.06 ? 126 THR A CB  1 
ATOM   957  O OG1 . THR A 1 126 ? -6.843  74.797 58.027 1.00   20.49 ? 126 THR A OG1 1 
ATOM   958  C CG2 . THR A 1 126 ? -7.356  75.542 55.856 1.00   19.82 ? 126 THR A CG2 1 
ATOM   959  N N   . LEU A 1 127 ? -3.084  75.678 58.229 1.00   21.18 ? 127 LEU A N   1 
ATOM   960  C CA  . LEU A 1 127 ? -2.215  76.266 59.234 1.00   21.24 ? 127 LEU A CA  1 
ATOM   961  C C   . LEU A 1 127 ? -1.611  77.512 58.651 1.00   23.40 ? 127 LEU A C   1 
ATOM   962  O O   . LEU A 1 127 ? -1.562  77.667 57.433 1.00   25.87 ? 127 LEU A O   1 
ATOM   963  C CB  . LEU A 1 127 ? -1.100  75.320 59.643 1.00   18.29 ? 127 LEU A CB  1 
ATOM   964  C CG  . LEU A 1 127 ? -1.479  73.921 60.088 1.00   19.18 ? 127 LEU A CG  1 
ATOM   965  C CD1 . LEU A 1 127 ? -0.287  73.296 60.794 1.00   17.02 ? 127 LEU A CD1 1 
ATOM   966  C CD2 . LEU A 1 127 ? -2.713  73.972 60.973 1.00   16.85 ? 127 LEU A CD2 1 
ATOM   967  N N   . ASP A 1 128 ? -1.089  78.377 59.505 1.00   24.09 ? 128 ASP A N   1 
ATOM   968  C CA  . ASP A 1 128 ? -0.511  79.596 59.020 1.00   24.42 ? 128 ASP A CA  1 
ATOM   969  C C   . ASP A 1 128 ? 0.826   79.342 58.376 1.00   23.78 ? 128 ASP A C   1 
ATOM   970  O O   . ASP A 1 128 ? 1.197   80.054 57.455 1.00   24.07 ? 128 ASP A O   1 
ATOM   971  C CB  . ASP A 1 128 ? -0.389  80.612 60.151 1.00   27.75 ? 128 ASP A CB  1 
ATOM   972  C CG  . ASP A 1 128 ? -1.743  81.076 60.663 1.00   31.88 ? 128 ASP A CG  1 
ATOM   973  O OD1 . ASP A 1 128 ? -2.628  81.465 59.849 1.00   33.80 ? 128 ASP A OD1 1 
ATOM   974  O OD2 . ASP A 1 128 ? -1.938  81.050 61.900 1.00   37.49 ? 128 ASP A OD2 1 
ATOM   975  N N   . VAL A 1 129 ? 1.584   78.378 58.887 1.00   23.19 ? 129 VAL A N   1 
ATOM   976  C CA  . VAL A 1 129 ? 2.889   78.098 58.294 1.00   22.69 ? 129 VAL A CA  1 
ATOM   977  C C   . VAL A 1 129 ? 2.796   77.473 56.922 1.00   23.34 ? 129 VAL A C   1 
ATOM   978  O O   . VAL A 1 129 ? 3.816   77.341 56.263 1.00   23.09 ? 129 VAL A O   1 
ATOM   979  C CB  . VAL A 1 129 ? 3.747   77.139 59.123 1.00   20.85 ? 129 VAL A CB  1 
ATOM   980  C CG1 . VAL A 1 129 ? 4.525   77.892 60.118 1.00   19.90 ? 129 VAL A CG1 1 
ATOM   981  C CG2 . VAL A 1 129 ? 2.889   76.075 59.749 1.00   17.67 ? 129 VAL A CG2 1 
ATOM   982  N N   . TYR A 1 130 ? 1.611   76.975 56.551 1.00   23.90 ? 130 TYR A N   1 
ATOM   983  C CA  . TYR A 1 130 ? 1.410   76.348 55.237 1.00   24.26 ? 130 TYR A CA  1 
ATOM   984  C C   . TYR A 1 130 ? 0.817   77.359 54.274 1.00   26.05 ? 130 TYR A C   1 
ATOM   985  O O   . TYR A 1 130 ? 0.312   76.993 53.227 1.00   28.68 ? 130 TYR A O   1 
ATOM   986  C CB  . TYR A 1 130 ? 0.477   75.135 55.321 1.00   17.53 ? 130 TYR A CB  1 
ATOM   987  C CG  . TYR A 1 130 ? 0.978   74.014 56.201 1.00   14.34 ? 130 TYR A CG  1 
ATOM   988  C CD1 . TYR A 1 130 ? 2.332   73.855 56.477 1.00   14.12 ? 130 TYR A CD1 1 
ATOM   989  C CD2 . TYR A 1 130 ? 0.092   73.110 56.765 1.00   14.18 ? 130 TYR A CD2 1 
ATOM   990  C CE1 . TYR A 1 130 ? 2.784   72.828 57.280 1.00   12.06 ? 130 TYR A CE1 1 
ATOM   991  C CE2 . TYR A 1 130 ? 0.537   72.093 57.565 1.00   12.59 ? 130 TYR A CE2 1 
ATOM   992  C CZ  . TYR A 1 130 ? 1.880   71.953 57.812 1.00   12.72 ? 130 TYR A CZ  1 
ATOM   993  O OH  . TYR A 1 130 ? 2.313   70.883 58.541 1.00   15.64 ? 130 TYR A OH  1 
ATOM   994  N N   . ASN A 1 131 ? 0.905   78.635 54.620 1.00   28.17 ? 131 ASN A N   1 
ATOM   995  C CA  . ASN A 1 131 ? 0.350   79.710 53.811 1.00   27.63 ? 131 ASN A CA  1 
ATOM   996  C C   . ASN A 1 131 ? 1.208   79.889 52.574 1.00   27.69 ? 131 ASN A C   1 
ATOM   997  O O   . ASN A 1 131 ? 2.220   80.585 52.615 1.00   27.08 ? 131 ASN A O   1 
ATOM   998  C CB  . ASN A 1 131 ? 0.359   80.952 54.671 1.00   29.02 ? 131 ASN A CB  1 
ATOM   999  C CG  . ASN A 1 131 ? -0.205  82.135 53.988 1.00   31.05 ? 131 ASN A CG  1 
ATOM   1000 O OD1 . ASN A 1 131 ? -1.401  82.238 53.743 1.00   31.08 ? 131 ASN A OD1 1 
ATOM   1001 N ND2 . ASN A 1 131 ? 0.653   83.086 53.720 1.00   35.09 ? 131 ASN A ND2 1 
ATOM   1002 N N   . GLY A 1 132 ? 0.775   79.288 51.465 1.00   28.28 ? 132 GLY A N   1 
ATOM   1003 C CA  . GLY A 1 132 ? 1.523   79.341 50.205 1.00   28.06 ? 132 GLY A CA  1 
ATOM   1004 C C   . GLY A 1 132 ? 1.661   80.607 49.359 1.00   27.77 ? 132 GLY A C   1 
ATOM   1005 O O   . GLY A 1 132 ? 2.222   80.554 48.252 1.00   27.83 ? 132 GLY A O   1 
ATOM   1006 N N   . LYS A 1 133 ? 1.226   81.751 49.866 1.00   26.60 ? 133 LYS A N   1 
ATOM   1007 C CA  . LYS A 1 133 ? 1.294   82.983 49.106 1.00   25.35 ? 133 LYS A CA  1 
ATOM   1008 C C   . LYS A 1 133 ? 2.653   83.606 48.954 1.00   25.28 ? 133 LYS A C   1 
ATOM   1009 O O   . LYS A 1 133 ? 2.897   84.296 47.974 1.00   28.18 ? 133 LYS A O   1 
ATOM   1010 C CB  . LYS A 1 133 ? 0.357   84.024 49.688 1.00   25.93 ? 133 LYS A CB  1 
ATOM   1011 C CG  . LYS A 1 133 ? 0.816   84.626 50.999 1.00   27.68 ? 133 LYS A CG  1 
ATOM   1012 C CD  . LYS A 1 133 ? -0.290  85.501 51.568 1.00   26.26 ? 133 LYS A CD  1 
ATOM   1013 C CE  . LYS A 1 133 ? 0.249   86.501 52.538 1.00   25.21 ? 133 LYS A CE  1 
ATOM   1014 N NZ  . LYS A 1 133 ? -0.884  87.376 52.981 1.00   26.73 ? 133 LYS A NZ  1 
ATOM   1015 N N   . TYR A 1 134 ? 3.549   83.397 49.903 1.00   23.60 ? 134 TYR A N   1 
ATOM   1016 C CA  . TYR A 1 134 ? 4.848   84.020 49.790 1.00   22.59 ? 134 TYR A CA  1 
ATOM   1017 C C   . TYR A 1 134 ? 5.644   83.239 48.808 1.00   21.76 ? 134 TYR A C   1 
ATOM   1018 O O   . TYR A 1 134 ? 6.493   83.799 48.140 1.00   23.79 ? 134 TYR A O   1 
ATOM   1019 C CB  . TYR A 1 134 ? 5.572   84.060 51.134 1.00   23.86 ? 134 TYR A CB  1 
ATOM   1020 C CG  . TYR A 1 134 ? 4.749   84.638 52.259 1.00   25.50 ? 134 TYR A CG  1 
ATOM   1021 C CD1 . TYR A 1 134 ? 3.928   83.822 53.030 1.00   27.29 ? 134 TYR A CD1 1 
ATOM   1022 C CD2 . TYR A 1 134 ? 4.752   85.992 52.524 1.00   24.83 ? 134 TYR A CD2 1 
ATOM   1023 C CE1 . TYR A 1 134 ? 3.123   84.349 54.039 1.00   27.13 ? 134 TYR A CE1 1 
ATOM   1024 C CE2 . TYR A 1 134 ? 3.954   86.526 53.525 1.00   26.60 ? 134 TYR A CE2 1 
ATOM   1025 C CZ  . TYR A 1 134 ? 3.141   85.697 54.277 1.00   28.36 ? 134 TYR A CZ  1 
ATOM   1026 O OH  . TYR A 1 134 ? 2.327   86.217 55.279 1.00   31.42 ? 134 TYR A OH  1 
ATOM   1027 N N   . LEU A 1 135 ? 5.413   81.934 48.735 1.00   21.69 ? 135 LEU A N   1 
ATOM   1028 C CA  . LEU A 1 135 ? 6.150   81.082 47.796 1.00   21.72 ? 135 LEU A CA  1 
ATOM   1029 C C   . LEU A 1 135 ? 5.581   81.342 46.411 1.00   23.64 ? 135 LEU A C   1 
ATOM   1030 O O   . LEU A 1 135 ? 6.327   81.624 45.458 1.00   24.18 ? 135 LEU A O   1 
ATOM   1031 C CB  . LEU A 1 135 ? 5.978   79.621 48.169 1.00   19.60 ? 135 LEU A CB  1 
ATOM   1032 C CG  . LEU A 1 135 ? 6.952   78.599 47.618 1.00   17.48 ? 135 LEU A CG  1 
ATOM   1033 C CD1 . LEU A 1 135 ? 8.338   79.189 47.573 1.00   15.47 ? 135 LEU A CD1 1 
ATOM   1034 C CD2 . LEU A 1 135 ? 6.898   77.368 48.500 1.00   13.28 ? 135 LEU A CD2 1 
ATOM   1035 N N   . ALA A 1 136 ? 4.256   81.312 46.307 1.00   23.10 ? 136 ALA A N   1 
ATOM   1036 C CA  . ALA A 1 136 ? 3.604   81.584 45.037 1.00   24.02 ? 136 ALA A CA  1 
ATOM   1037 C C   . ALA A 1 136 ? 4.129   82.916 44.529 1.00   26.75 ? 136 ALA A C   1 
ATOM   1038 O O   . ALA A 1 136 ? 4.774   83.003 43.470 1.00   27.25 ? 136 ALA A O   1 
ATOM   1039 C CB  . ALA A 1 136 ? 2.113   81.673 45.229 1.00   23.03 ? 136 ALA A CB  1 
ATOM   1040 N N   . TYR A 1 137 ? 3.874   83.955 45.312 1.00   27.42 ? 137 TYR A N   1 
ATOM   1041 C CA  . TYR A 1 137 ? 4.290   85.299 44.962 1.00   27.51 ? 137 TYR A CA  1 
ATOM   1042 C C   . TYR A 1 137 ? 5.769   85.386 44.689 1.00   26.89 ? 137 TYR A C   1 
ATOM   1043 O O   . TYR A 1 137 ? 6.183   85.696 43.587 1.00   29.17 ? 137 TYR A O   1 
ATOM   1044 C CB  . TYR A 1 137 ? 3.918   86.273 46.080 1.00   28.46 ? 137 TYR A CB  1 
ATOM   1045 C CG  . TYR A 1 137 ? 4.443   87.658 45.855 1.00   31.64 ? 137 TYR A CG  1 
ATOM   1046 C CD1 . TYR A 1 137 ? 5.733   88.010 46.243 1.00   32.99 ? 137 TYR A CD1 1 
ATOM   1047 C CD2 . TYR A 1 137 ? 3.675   88.612 45.202 1.00   33.58 ? 137 TYR A CD2 1 
ATOM   1048 C CE1 . TYR A 1 137 ? 6.248   89.276 45.980 1.00   36.06 ? 137 TYR A CE1 1 
ATOM   1049 C CE2 . TYR A 1 137 ? 4.186   89.896 44.925 1.00   35.89 ? 137 TYR A CE2 1 
ATOM   1050 C CZ  . TYR A 1 137 ? 5.472   90.215 45.316 1.00   37.01 ? 137 TYR A CZ  1 
ATOM   1051 O OH  . TYR A 1 137 ? 5.994   91.466 45.000 1.00   40.33 ? 137 TYR A OH  1 
ATOM   1052 N N   . THR A 1 138 ? 6.574   85.099 45.697 1.00   26.29 ? 138 THR A N   1 
ATOM   1053 C CA  . THR A 1 138 ? 8.025   85.187 45.572 1.00   24.14 ? 138 THR A CA  1 
ATOM   1054 C C   . THR A 1 138 ? 8.619   84.389 44.431 1.00   23.62 ? 138 THR A C   1 
ATOM   1055 O O   . THR A 1 138 ? 9.448   84.916 43.707 1.00   24.98 ? 138 THR A O   1 
ATOM   1056 C CB  . THR A 1 138 ? 8.714   84.851 46.926 1.00   21.07 ? 138 THR A CB  1 
ATOM   1057 O OG1 . THR A 1 138 ? 8.289   85.806 47.898 1.00   22.39 ? 138 THR A OG1 1 
ATOM   1058 C CG2 . THR A 1 138 ? 10.188  84.957 46.846 1.00   20.82 ? 138 THR A CG2 1 
ATOM   1059 N N   . GLU A 1 139 ? 8.166   83.155 44.218 1.00   24.48 ? 139 GLU A N   1 
ATOM   1060 C CA  . GLU A 1 139 ? 8.740   82.307 43.167 1.00   24.38 ? 139 GLU A CA  1 
ATOM   1061 C C   . GLU A 1 139 ? 7.892   82.082 41.913 1.00   24.89 ? 139 GLU A C   1 
ATOM   1062 O O   . GLU A 1 139 ? 8.250   81.273 41.058 1.00   25.94 ? 139 GLU A O   1 
ATOM   1063 C CB  . GLU A 1 139 ? 9.155   80.946 43.730 1.00   23.31 ? 139 GLU A CB  1 
ATOM   1064 C CG  . GLU A 1 139 ? 10.215  80.953 44.795 1.00   22.12 ? 139 GLU A CG  1 
ATOM   1065 C CD  . GLU A 1 139 ? 11.508  81.523 44.321 1.00   25.44 ? 139 GLU A CD  1 
ATOM   1066 O OE1 . GLU A 1 139 ? 12.227  80.902 43.519 1.00   27.50 ? 139 GLU A OE1 1 
ATOM   1067 O OE2 . GLU A 1 139 ? 11.845  82.619 44.773 1.00   30.01 ? 139 GLU A OE2 1 
ATOM   1068 N N   . GLU A 1 140 ? 6.751   82.744 41.805 1.00   25.93 ? 140 GLU A N   1 
ATOM   1069 C CA  . GLU A 1 140 ? 5.934   82.592 40.614 1.00   28.00 ? 140 GLU A CA  1 
ATOM   1070 C C   . GLU A 1 140 ? 5.521   81.163 40.373 1.00   26.52 ? 140 GLU A C   1 
ATOM   1071 O O   . GLU A 1 140 ? 5.622   80.669 39.252 1.00   27.06 ? 140 GLU A O   1 
ATOM   1072 C CB  . GLU A 1 140 ? 6.697   83.099 39.377 1.00   30.91 ? 140 GLU A CB  1 
ATOM   1073 C CG  . GLU A 1 140 ? 6.242   84.473 38.853 1.00   37.99 ? 140 GLU A CG  1 
ATOM   1074 C CD  . GLU A 1 140 ? 7.403   85.454 38.729 1.00   42.85 ? 140 GLU A CD  1 
ATOM   1075 O OE1 . GLU A 1 140 ? 8.535   85.030 38.333 1.00   44.78 ? 140 GLU A OE1 1 
ATOM   1076 O OE2 . GLU A 1 140 ? 7.193   86.660 39.040 1.00   45.47 ? 140 GLU A OE2 1 
ATOM   1077 N N   . VAL A 1 141 ? 5.100   80.468 41.412 1.00   23.21 ? 141 VAL A N   1 
ATOM   1078 C CA  . VAL A 1 141 ? 4.663   79.105 41.206 1.00   21.24 ? 141 VAL A CA  1 
ATOM   1079 C C   . VAL A 1 141 ? 3.242   79.040 41.650 1.00   20.48 ? 141 VAL A C   1 
ATOM   1080 O O   . VAL A 1 141 ? 2.785   79.898 42.382 1.00   20.77 ? 141 VAL A O   1 
ATOM   1081 C CB  . VAL A 1 141 ? 5.465   78.091 42.013 1.00   21.38 ? 141 VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 141 ? 6.874   78.013 41.501 1.00   19.82 ? 141 VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 141 ? 5.443   78.439 43.474 1.00   19.95 ? 141 VAL A CG2 1 
ATOM   1084 N N   . VAL A 1 142 ? 2.505   78.084 41.123 1.00   21.49 ? 142 VAL A N   1 
ATOM   1085 C CA  . VAL A 1 142 ? 1.123   77.926 41.534 1.00   22.48 ? 142 VAL A CA  1 
ATOM   1086 C C   . VAL A 1 142 ? 1.239   76.972 42.713 1.00   23.60 ? 142 VAL A C   1 
ATOM   1087 O O   . VAL A 1 142 ? 1.765   75.866 42.574 1.00   23.65 ? 142 VAL A O   1 
ATOM   1088 C CB  . VAL A 1 142 ? 0.263   77.304 40.417 1.00   21.38 ? 142 VAL A CB  1 
ATOM   1089 C CG1 . VAL A 1 142 ? -1.130  76.964 40.940 1.00   18.73 ? 142 VAL A CG1 1 
ATOM   1090 C CG2 . VAL A 1 142 ? 0.172   78.275 39.256 1.00   21.06 ? 142 VAL A CG2 1 
ATOM   1091 N N   . LEU A 1 143 ? 0.828   77.408 43.891 1.00   23.43 ? 143 LEU A N   1 
ATOM   1092 C CA  . LEU A 1 143 ? 0.943   76.535 45.041 1.00   21.43 ? 143 LEU A CA  1 
ATOM   1093 C C   . LEU A 1 143 ? -0.383  75.959 45.388 1.00   19.77 ? 143 LEU A C   1 
ATOM   1094 O O   . LEU A 1 143 ? -1.362  76.683 45.560 1.00   20.53 ? 143 LEU A O   1 
ATOM   1095 C CB  . LEU A 1 143 ? 1.507   77.280 46.246 1.00   21.87 ? 143 LEU A CB  1 
ATOM   1096 C CG  . LEU A 1 143 ? 2.313   76.364 47.157 1.00   22.13 ? 143 LEU A CG  1 
ATOM   1097 C CD1 . LEU A 1 143 ? 3.664   76.941 47.383 1.00   23.90 ? 143 LEU A CD1 1 
ATOM   1098 C CD2 . LEU A 1 143 ? 1.602   76.191 48.458 1.00   24.43 ? 143 LEU A CD2 1 
ATOM   1099 N N   . VAL A 1 144 ? -0.446  74.643 45.400 1.00   18.95 ? 144 VAL A N   1 
ATOM   1100 C CA  . VAL A 1 144 ? -1.668  73.977 45.779 1.00   17.15 ? 144 VAL A CA  1 
ATOM   1101 C C   . VAL A 1 144 ? -1.309  73.286 47.080 1.00   17.02 ? 144 VAL A C   1 
ATOM   1102 O O   . VAL A 1 144 ? -0.157  72.896 47.292 1.00   14.52 ? 144 VAL A O   1 
ATOM   1103 C CB  . VAL A 1 144 ? -2.086  72.886 44.752 1.00   14.64 ? 144 VAL A CB  1 
ATOM   1104 C CG1 . VAL A 1 144 ? -3.416  72.313 45.106 1.00   12.93 ? 144 VAL A CG1 1 
ATOM   1105 C CG2 . VAL A 1 144 ? -2.162  73.450 43.410 1.00   14.57 ? 144 VAL A CG2 1 
ATOM   1106 N N   . SER A 1 145 ? -2.265  73.203 47.979 1.00   16.02 ? 145 SER A N   1 
ATOM   1107 C CA  . SER A 1 145 ? -2.048  72.480 49.208 1.00   17.00 ? 145 SER A CA  1 
ATOM   1108 C C   . SER A 1 145 ? -3.329  71.683 49.311 1.00   16.25 ? 145 SER A C   1 
ATOM   1109 O O   . SER A 1 145 ? -4.413  72.199 49.092 1.00   15.29 ? 145 SER A O   1 
ATOM   1110 C CB  . SER A 1 145 ? -1.794  73.410 50.409 1.00   16.13 ? 145 SER A CB  1 
ATOM   1111 O OG  . SER A 1 145 ? -2.893  74.240 50.720 1.00   18.64 ? 145 SER A OG  1 
ATOM   1112 N N   . LEU A 1 146 ? -3.187  70.379 49.409 1.00   17.65 ? 146 LEU A N   1 
ATOM   1113 C CA  . LEU A 1 146 ? -4.344  69.522 49.497 1.00   19.05 ? 146 LEU A CA  1 
ATOM   1114 C C   . LEU A 1 146 ? -4.565  69.072 50.951 1.00   21.12 ? 146 LEU A C   1 
ATOM   1115 O O   . LEU A 1 146 ? -3.770  69.389 51.843 1.00   21.50 ? 146 LEU A O   1 
ATOM   1116 C CB  . LEU A 1 146 ? -4.127  68.323 48.579 1.00   17.69 ? 146 LEU A CB  1 
ATOM   1117 C CG  . LEU A 1 146 ? -2.864  67.497 48.801 1.00   19.37 ? 146 LEU A CG  1 
ATOM   1118 C CD1 . LEU A 1 146 ? -3.122  66.480 49.897 1.00   20.55 ? 146 LEU A CD1 1 
ATOM   1119 C CD2 . LEU A 1 146 ? -2.514  66.735 47.555 1.00   17.31 ? 146 LEU A CD2 1 
ATOM   1120 N N   . SER A 1 147 ? -5.643  68.344 51.186 1.00   20.45 ? 147 SER A N   1 
ATOM   1121 C CA  . SER A 1 147 ? -5.930  67.827 52.497 1.00   20.21 ? 147 SER A CA  1 
ATOM   1122 C C   . SER A 1 147 ? -6.339  66.381 52.301 1.00   19.94 ? 147 SER A C   1 
ATOM   1123 O O   . SER A 1 147 ? -6.686  65.983 51.202 1.00   20.05 ? 147 SER A O   1 
ATOM   1124 C CB  . SER A 1 147 ? -7.046  68.617 53.136 1.00   20.00 ? 147 SER A CB  1 
ATOM   1125 O OG  . SER A 1 147 ? -8.181  68.553 52.322 1.00   23.75 ? 147 SER A OG  1 
ATOM   1126 N N   . TYR A 1 148 ? -6.201  65.567 53.328 1.00   19.27 ? 148 TYR A N   1 
ATOM   1127 C CA  . TYR A 1 148 ? -6.571  64.175 53.218 1.00   18.84 ? 148 TYR A CA  1 
ATOM   1128 C C   . TYR A 1 148 ? -7.041  63.711 54.554 1.00   19.29 ? 148 TYR A C   1 
ATOM   1129 O O   . TYR A 1 148 ? -6.715  64.307 55.567 1.00   21.28 ? 148 TYR A O   1 
ATOM   1130 C CB  . TYR A 1 148 ? -5.397  63.327 52.762 1.00   16.61 ? 148 TYR A CB  1 
ATOM   1131 C CG  . TYR A 1 148 ? -4.158  63.436 53.601 1.00   14.75 ? 148 TYR A CG  1 
ATOM   1132 C CD1 . TYR A 1 148 ? -3.246  64.439 53.383 1.00   13.62 ? 148 TYR A CD1 1 
ATOM   1133 C CD2 . TYR A 1 148 ? -3.888  62.504 54.595 1.00   14.95 ? 148 TYR A CD2 1 
ATOM   1134 C CE1 . TYR A 1 148 ? -2.099  64.515 54.123 1.00   14.82 ? 148 TYR A CE1 1 
ATOM   1135 C CE2 . TYR A 1 148 ? -2.753  62.572 55.345 1.00   13.86 ? 148 TYR A CE2 1 
ATOM   1136 C CZ  . TYR A 1 148 ? -1.861  63.581 55.108 1.00   15.45 ? 148 TYR A CZ  1 
ATOM   1137 O OH  . TYR A 1 148 ? -0.747  63.686 55.875 1.00   12.65 ? 148 TYR A OH  1 
ATOM   1138 N N   . ARG A 1 149 ? -7.854  62.679 54.564 1.00   19.10 ? 149 ARG A N   1 
ATOM   1139 C CA  . ARG A 1 149 ? -8.350  62.175 55.815 1.00   19.22 ? 149 ARG A CA  1 
ATOM   1140 C C   . ARG A 1 149 ? -7.190  61.578 56.588 1.00   20.57 ? 149 ARG A C   1 
ATOM   1141 O O   . ARG A 1 149 ? -6.369  60.843 56.037 1.00   21.94 ? 149 ARG A O   1 
ATOM   1142 C CB  . ARG A 1 149 ? -9.422  61.133 55.583 1.00   16.11 ? 149 ARG A CB  1 
ATOM   1143 C CG  . ARG A 1 149 ? -10.739 61.707 55.232 1.00   17.40 ? 149 ARG A CG  1 
ATOM   1144 C CD  . ARG A 1 149 ? -11.690 60.595 54.858 1.00   18.80 ? 149 ARG A CD  1 
ATOM   1145 N NE  . ARG A 1 149 ? -11.417 60.130 53.505 1.00   19.18 ? 149 ARG A NE  1 
ATOM   1146 C CZ  . ARG A 1 149 ? -11.928 59.033 52.961 1.00   20.47 ? 149 ARG A CZ  1 
ATOM   1147 N NH1 . ARG A 1 149 ? -12.737 58.248 53.654 1.00   20.01 ? 149 ARG A NH1 1 
ATOM   1148 N NH2 . ARG A 1 149 ? -11.712 58.776 51.679 1.00   21.23 ? 149 ARG A NH2 1 
ATOM   1149 N N   . VAL A 1 150 ? -7.127  61.921 57.868 1.00   20.19 ? 150 VAL A N   1 
ATOM   1150 C CA  . VAL A 1 150 ? -6.099  61.442 58.766 1.00   18.52 ? 150 VAL A CA  1 
ATOM   1151 C C   . VAL A 1 150 ? -6.807  60.585 59.793 1.00   18.36 ? 150 VAL A C   1 
ATOM   1152 O O   . VAL A 1 150 ? -8.031  60.479 59.776 1.00   18.57 ? 150 VAL A O   1 
ATOM   1153 C CB  . VAL A 1 150 ? -5.429  62.608 59.458 1.00   17.96 ? 150 VAL A CB  1 
ATOM   1154 C CG1 . VAL A 1 150 ? -4.426  63.233 58.552 1.00   17.67 ? 150 VAL A CG1 1 
ATOM   1155 C CG2 . VAL A 1 150 ? -6.461  63.642 59.851 1.00   16.31 ? 150 VAL A CG2 1 
ATOM   1156 N N   . GLY A 1 151 ? -6.030  59.892 60.608 1.00   18.17 ? 151 GLY A N   1 
ATOM   1157 C CA  . GLY A 1 151 ? -6.581  59.067 61.660 1.00   17.69 ? 151 GLY A CA  1 
ATOM   1158 C C   . GLY A 1 151 ? -7.344  57.856 61.197 1.00   19.59 ? 151 GLY A C   1 
ATOM   1159 O O   . GLY A 1 151 ? -7.166  57.383 60.094 1.00   22.14 ? 151 GLY A O   1 
ATOM   1160 N N   . ALA A 1 152 ? -8.196  57.325 62.052 1.00   20.84 ? 152 ALA A N   1 
ATOM   1161 C CA  . ALA A 1 152 ? -8.987  56.174 61.693 1.00   20.95 ? 152 ALA A CA  1 
ATOM   1162 C C   . ALA A 1 152 ? -9.700  56.480 60.413 1.00   21.25 ? 152 ALA A C   1 
ATOM   1163 O O   . ALA A 1 152 ? -9.653  55.710 59.491 1.00   22.63 ? 152 ALA A O   1 
ATOM   1164 C CB  . ALA A 1 152 ? -9.998  55.871 62.785 1.00   22.45 ? 152 ALA A CB  1 
ATOM   1165 N N   . PHE A 1 153 ? -10.264 57.672 60.343 1.00   22.10 ? 153 PHE A N   1 
ATOM   1166 C CA  . PHE A 1 153 ? -11.025 58.150 59.195 1.00   22.42 ? 153 PHE A CA  1 
ATOM   1167 C C   . PHE A 1 153 ? -10.339 58.009 57.854 1.00   23.26 ? 153 PHE A C   1 
ATOM   1168 O O   . PHE A 1 153 ? -11.001 57.957 56.813 1.00   22.95 ? 153 PHE A O   1 
ATOM   1169 C CB  . PHE A 1 153 ? -11.365 59.613 59.405 1.00   21.79 ? 153 PHE A CB  1 
ATOM   1170 C CG  . PHE A 1 153 ? -12.033 59.880 60.690 1.00   23.67 ? 153 PHE A CG  1 
ATOM   1171 C CD1 . PHE A 1 153 ? -13.348 59.508 60.886 1.00   23.55 ? 153 PHE A CD1 1 
ATOM   1172 C CD2 . PHE A 1 153 ? -11.343 60.471 61.727 1.00   24.59 ? 153 PHE A CD2 1 
ATOM   1173 C CE1 . PHE A 1 153 ? -13.972 59.718 62.093 1.00   23.91 ? 153 PHE A CE1 1 
ATOM   1174 C CE2 . PHE A 1 153 ? -11.964 60.688 62.951 1.00   23.90 ? 153 PHE A CE2 1 
ATOM   1175 C CZ  . PHE A 1 153 ? -13.284 60.308 63.128 1.00   23.61 ? 153 PHE A CZ  1 
ATOM   1176 N N   . GLY A 1 154 ? -9.013  58.019 57.869 1.00   22.78 ? 154 GLY A N   1 
ATOM   1177 C CA  . GLY A 1 154 ? -8.272  57.910 56.632 1.00   21.28 ? 154 GLY A CA  1 
ATOM   1178 C C   . GLY A 1 154 ? -7.395  56.680 56.574 1.00   21.62 ? 154 GLY A C   1 
ATOM   1179 O O   . GLY A 1 154 ? -6.944  56.298 55.498 1.00   22.57 ? 154 GLY A O   1 
ATOM   1180 N N   . PHE A 1 155 ? -7.147  56.021 57.695 1.00   19.23 ? 155 PHE A N   1 
ATOM   1181 C CA  . PHE A 1 155 ? -6.298  54.877 57.605 1.00   16.29 ? 155 PHE A CA  1 
ATOM   1182 C C   . PHE A 1 155 ? -6.763  53.583 58.246 1.00   16.84 ? 155 PHE A C   1 
ATOM   1183 O O   . PHE A 1 155 ? -6.054  52.574 58.209 1.00   17.14 ? 155 PHE A O   1 
ATOM   1184 C CB  . PHE A 1 155 ? -4.895  55.290 57.991 1.00   15.14 ? 155 PHE A CB  1 
ATOM   1185 C CG  . PHE A 1 155 ? -4.327  56.348 57.086 1.00   15.01 ? 155 PHE A CG  1 
ATOM   1186 C CD1 . PHE A 1 155 ? -3.797  56.009 55.841 1.00   15.75 ? 155 PHE A CD1 1 
ATOM   1187 C CD2 . PHE A 1 155 ? -4.397  57.679 57.424 1.00   13.34 ? 155 PHE A CD2 1 
ATOM   1188 C CE1 . PHE A 1 155 ? -3.362  56.981 54.964 1.00   11.49 ? 155 PHE A CE1 1 
ATOM   1189 C CE2 . PHE A 1 155 ? -3.962  58.652 56.543 1.00   14.10 ? 155 PHE A CE2 1 
ATOM   1190 C CZ  . PHE A 1 155 ? -3.448  58.298 55.315 1.00   13.09 ? 155 PHE A CZ  1 
ATOM   1191 N N   . LEU A 1 156 ? -7.999  53.552 58.717 1.00   16.29 ? 156 LEU A N   1 
ATOM   1192 C CA  . LEU A 1 156 ? -8.488  52.319 59.312 1.00   19.37 ? 156 LEU A CA  1 
ATOM   1193 C C   . LEU A 1 156 ? -8.479  51.310 58.194 1.00   20.96 ? 156 LEU A C   1 
ATOM   1194 O O   . LEU A 1 156 ? -9.115  51.539 57.177 1.00   23.84 ? 156 LEU A O   1 
ATOM   1195 C CB  . LEU A 1 156 ? -9.903  52.486 59.814 1.00   20.60 ? 156 LEU A CB  1 
ATOM   1196 C CG  . LEU A 1 156 ? -10.412 51.245 60.525 1.00   21.52 ? 156 LEU A CG  1 
ATOM   1197 C CD1 . LEU A 1 156 ? -11.006 51.697 61.838 1.00   25.09 ? 156 LEU A CD1 1 
ATOM   1198 C CD2 . LEU A 1 156 ? -11.439 50.542 59.701 1.00   21.46 ? 156 LEU A CD2 1 
ATOM   1199 N N   . ALA A 1 157 ? -7.840  50.169 58.392 1.00   21.22 ? 157 ALA A N   1 
ATOM   1200 C CA  . ALA A 1 157 ? -7.756  49.188 57.339 1.00   19.98 ? 157 ALA A CA  1 
ATOM   1201 C C   . ALA A 1 157 ? -8.254  47.789 57.591 1.00   22.29 ? 157 ALA A C   1 
ATOM   1202 O O   . ALA A 1 157 ? -7.538  46.968 58.159 1.00   24.10 ? 157 ALA A O   1 
ATOM   1203 C CB  . ALA A 1 157 ? -6.352  49.108 56.874 1.00   20.20 ? 157 ALA A CB  1 
ATOM   1204 N N   . LEU A 1 158 ? -9.432  47.466 57.079 1.00   22.93 ? 158 LEU A N   1 
ATOM   1205 C CA  . LEU A 1 158 ? -9.940  46.118 57.212 1.00   23.48 ? 158 LEU A CA  1 
ATOM   1206 C C   . LEU A 1 158 ? -9.746  45.526 55.837 1.00   25.49 ? 158 LEU A C   1 
ATOM   1207 O O   . LEU A 1 158 ? -10.674 45.406 55.040 1.00   26.82 ? 158 LEU A O   1 
ATOM   1208 C CB  . LEU A 1 158 ? -11.407 46.128 57.608 1.00   24.02 ? 158 LEU A CB  1 
ATOM   1209 C CG  . LEU A 1 158 ? -11.632 46.623 59.033 1.00   23.79 ? 158 LEU A CG  1 
ATOM   1210 C CD1 . LEU A 1 158 ? -13.058 46.992 59.221 1.00   22.53 ? 158 LEU A CD1 1 
ATOM   1211 C CD2 . LEU A 1 158 ? -11.216 45.552 59.997 1.00   22.65 ? 158 LEU A CD2 1 
ATOM   1212 N N   . HIS A 1 159 ? -8.506  45.210 55.540 1.00   27.45 ? 159 HIS A N   1 
ATOM   1213 C CA  . HIS A 1 159 ? -8.143  44.658 54.244 1.00   31.82 ? 159 HIS A CA  1 
ATOM   1214 C C   . HIS A 1 159 ? -9.028  43.522 53.798 1.00   32.81 ? 159 HIS A C   1 
ATOM   1215 O O   . HIS A 1 159 ? -9.020  42.456 54.408 1.00   34.97 ? 159 HIS A O   1 
ATOM   1216 C CB  . HIS A 1 159 ? -6.701  44.153 54.282 1.00   33.06 ? 159 HIS A CB  1 
ATOM   1217 C CG  . HIS A 1 159 ? -6.173  43.701 52.953 1.00   37.46 ? 159 HIS A CG  1 
ATOM   1218 N ND1 . HIS A 1 159 ? -5.737  44.588 51.985 1.00   37.58 ? 159 HIS A ND1 1 
ATOM   1219 C CD2 . HIS A 1 159 ? -5.892  42.458 52.482 1.00   36.81 ? 159 HIS A CD2 1 
ATOM   1220 C CE1 . HIS A 1 159 ? -5.199  43.910 50.984 1.00   37.59 ? 159 HIS A CE1 1 
ATOM   1221 N NE2 . HIS A 1 159 ? -5.281  42.616 51.261 1.00   35.94 ? 159 HIS A NE2 1 
ATOM   1222 N N   . GLY A 1 160 ? -9.738  43.696 52.695 1.00   33.64 ? 160 GLY A N   1 
ATOM   1223 C CA  . GLY A 1 160 ? -10.568 42.601 52.230 1.00   33.83 ? 160 GLY A CA  1 
ATOM   1224 C C   . GLY A 1 160 ? -11.979 43.091 52.029 1.00   34.81 ? 160 GLY A C   1 
ATOM   1225 O O   . GLY A 1 160 ? -12.730 42.516 51.225 1.00   35.90 ? 160 GLY A O   1 
ATOM   1226 N N   . SER A 1 161 ? -12.376 44.102 52.798 1.00   33.22 ? 161 SER A N   1 
ATOM   1227 C CA  . SER A 1 161 ? -13.701 44.647 52.640 1.00   32.49 ? 161 SER A CA  1 
ATOM   1228 C C   . SER A 1 161 ? -13.426 45.815 51.733 1.00   32.83 ? 161 SER A C   1 
ATOM   1229 O O   . SER A 1 161 ? -12.274 46.222 51.581 1.00   32.72 ? 161 SER A O   1 
ATOM   1230 C CB  . SER A 1 161 ? -14.242 45.151 53.958 1.00   30.87 ? 161 SER A CB  1 
ATOM   1231 O OG  . SER A 1 161 ? -13.401 46.174 54.431 1.00   30.60 ? 161 SER A OG  1 
ATOM   1232 N N   . GLN A 1 162 ? -14.461 46.333 51.096 1.00   33.34 ? 162 GLN A N   1 
ATOM   1233 C CA  . GLN A 1 162 ? -14.290 47.459 50.206 1.00   33.54 ? 162 GLN A CA  1 
ATOM   1234 C C   . GLN A 1 162 ? -14.827 48.648 50.930 1.00   32.43 ? 162 GLN A C   1 
ATOM   1235 O O   . GLN A 1 162 ? -14.725 49.759 50.438 1.00   33.16 ? 162 GLN A O   1 
ATOM   1236 C CB  . GLN A 1 162 ? -15.070 47.241 48.902 1.00   35.35 ? 162 GLN A CB  1 
ATOM   1237 C CG  . GLN A 1 162 ? -14.352 46.322 47.897 1.00   36.68 ? 162 GLN A CG  1 
ATOM   1238 C CD  . GLN A 1 162 ? -12.973 46.864 47.509 1.00   37.47 ? 162 GLN A CD  1 
ATOM   1239 N N   . GLU A 1 163 ? -15.416 48.388 52.097 1.00   32.42 ? 163 GLU A N   1 
ATOM   1240 C CA  . GLU A 1 163 ? -16.003 49.421 52.961 1.00   31.85 ? 163 GLU A CA  1 
ATOM   1241 C C   . GLU A 1 163 ? -14.942 50.154 53.796 1.00   29.19 ? 163 GLU A C   1 
ATOM   1242 O O   . GLU A 1 163 ? -15.177 51.269 54.247 1.00   29.40 ? 163 GLU A O   1 
ATOM   1243 C CB  . GLU A 1 163 ? -17.049 48.788 53.884 1.00   34.07 ? 163 GLU A CB  1 
ATOM   1244 C CG  . GLU A 1 163 ? -18.273 48.293 53.162 1.00   37.07 ? 163 GLU A CG  1 
ATOM   1245 C CD  . GLU A 1 163 ? -18.949 49.435 52.446 1.00   39.75 ? 163 GLU A CD  1 
ATOM   1246 O OE1 . GLU A 1 163 ? -19.610 50.236 53.133 1.00   41.55 ? 163 GLU A OE1 1 
ATOM   1247 O OE2 . GLU A 1 163 ? -18.778 49.585 51.209 1.00   41.71 ? 163 GLU A OE2 1 
ATOM   1248 N N   . ALA A 1 164 ? -13.815 49.498 54.050 1.00   25.39 ? 164 ALA A N   1 
ATOM   1249 C CA  . ALA A 1 164 ? -12.717 50.097 54.790 1.00   23.81 ? 164 ALA A CA  1 
ATOM   1250 C C   . ALA A 1 164 ? -11.511 49.353 54.307 1.00   22.87 ? 164 ALA A C   1 
ATOM   1251 O O   . ALA A 1 164 ? -11.012 48.444 54.979 1.00   23.42 ? 164 ALA A O   1 
ATOM   1252 C CB  . ALA A 1 164 ? -12.880 49.901 56.272 1.00   22.89 ? 164 ALA A CB  1 
ATOM   1253 N N   . PRO A 1 165 ? -11.045 49.691 53.103 1.00   23.11 ? 165 PRO A N   1 
ATOM   1254 C CA  . PRO A 1 165 ? -9.881  49.040 52.510 1.00   22.33 ? 165 PRO A CA  1 
ATOM   1255 C C   . PRO A 1 165 ? -8.574  49.547 53.099 1.00   22.87 ? 165 PRO A C   1 
ATOM   1256 O O   . PRO A 1 165 ? -7.559  48.848 53.079 1.00   24.53 ? 165 PRO A O   1 
ATOM   1257 C CB  . PRO A 1 165 ? -10.023 49.395 51.040 1.00   20.09 ? 165 PRO A CB  1 
ATOM   1258 C CG  . PRO A 1 165 ? -10.556 50.784 51.102 1.00   21.68 ? 165 PRO A CG  1 
ATOM   1259 C CD  . PRO A 1 165 ? -11.571 50.752 52.223 1.00   21.49 ? 165 PRO A CD  1 
ATOM   1260 N N   . GLY A 1 166 ? -8.607  50.737 53.681 1.00   22.64 ? 166 GLY A N   1 
ATOM   1261 C CA  . GLY A 1 166 ? -7.398  51.294 54.250 1.00   20.99 ? 166 GLY A CA  1 
ATOM   1262 C C   . GLY A 1 166 ? -6.728  52.107 53.169 1.00   21.31 ? 166 GLY A C   1 
ATOM   1263 O O   . GLY A 1 166 ? -7.162  52.065 52.024 1.00   21.44 ? 166 GLY A O   1 
ATOM   1264 N N   . ASN A 1 167 ? -5.744  52.918 53.544 1.00   20.13 ? 167 ASN A N   1 
ATOM   1265 C CA  . ASN A 1 167 ? -5.038  53.750 52.605 1.00   17.04 ? 167 ASN A CA  1 
ATOM   1266 C C   . ASN A 1 167 ? -5.940  54.775 51.947 1.00   17.19 ? 167 ASN A C   1 
ATOM   1267 O O   . ASN A 1 167 ? -5.487  55.567 51.114 1.00   18.62 ? 167 ASN A O   1 
ATOM   1268 C CB  . ASN A 1 167 ? -4.376  52.878 51.559 1.00   15.89 ? 167 ASN A CB  1 
ATOM   1269 C CG  . ASN A 1 167 ? -3.193  52.162 52.102 1.00   16.01 ? 167 ASN A CG  1 
ATOM   1270 O OD1 . ASN A 1 167 ? -2.619  52.590 53.076 1.00   19.54 ? 167 ASN A OD1 1 
ATOM   1271 N ND2 . ASN A 1 167 ? -2.814  51.073 51.488 1.00   16.52 ? 167 ASN A ND2 1 
ATOM   1272 N N   . VAL A 1 168 ? -7.181  54.870 52.396 1.00   15.74 ? 168 VAL A N   1 
ATOM   1273 C CA  . VAL A 1 168 ? -8.075  55.814 51.775 1.00   16.90 ? 168 VAL A CA  1 
ATOM   1274 C C   . VAL A 1 168 ? -7.589  57.233 51.894 1.00   18.31 ? 168 VAL A C   1 
ATOM   1275 O O   . VAL A 1 168 ? -7.901  58.058 51.037 1.00   24.27 ? 168 VAL A O   1 
ATOM   1276 C CB  . VAL A 1 168 ? -9.521  55.675 52.234 1.00   15.73 ? 168 VAL A CB  1 
ATOM   1277 C CG1 . VAL A 1 168 ? -9.907  54.224 52.246 1.00   11.80 ? 168 VAL A CG1 1 
ATOM   1278 C CG2 . VAL A 1 168 ? -9.739  56.347 53.545 1.00   14.96 ? 168 VAL A CG2 1 
ATOM   1279 N N   . GLY A 1 169 ? -6.790  57.525 52.908 1.00   17.23 ? 169 GLY A N   1 
ATOM   1280 C CA  . GLY A 1 169 ? -6.245  58.865 53.060 1.00   13.57 ? 169 GLY A CA  1 
ATOM   1281 C C   . GLY A 1 169 ? -5.163  59.118 52.029 1.00   13.56 ? 169 GLY A C   1 
ATOM   1282 O O   . GLY A 1 169 ? -4.794  60.259 51.769 1.00   11.45 ? 169 GLY A O   1 
ATOM   1283 N N   . LEU A 1 170 ? -4.603  58.043 51.486 1.00   15.12 ? 170 LEU A N   1 
ATOM   1284 C CA  . LEU A 1 170 ? -3.575  58.136 50.440 1.00   16.46 ? 170 LEU A CA  1 
ATOM   1285 C C   . LEU A 1 170 ? -4.270  58.349 49.074 1.00   17.35 ? 170 LEU A C   1 
ATOM   1286 O O   . LEU A 1 170 ? -3.755  59.048 48.194 1.00   16.95 ? 170 LEU A O   1 
ATOM   1287 C CB  . LEU A 1 170 ? -2.710  56.886 50.420 1.00   15.84 ? 170 LEU A CB  1 
ATOM   1288 C CG  . LEU A 1 170 ? -1.586  56.782 51.442 1.00   12.18 ? 170 LEU A CG  1 
ATOM   1289 C CD1 . LEU A 1 170 ? -0.850  55.524 51.215 1.00   9.97  ? 170 LEU A CD1 1 
ATOM   1290 C CD2 . LEU A 1 170 ? -0.670  57.927 51.302 1.00   10.64 ? 170 LEU A CD2 1 
ATOM   1291 N N   . LEU A 1 171 ? -5.476  57.794 48.947 1.00   17.46 ? 171 LEU A N   1 
ATOM   1292 C CA  . LEU A 1 171 ? -6.295  57.958 47.761 1.00   17.38 ? 171 LEU A CA  1 
ATOM   1293 C C   . LEU A 1 171 ? -6.907  59.359 47.771 1.00   19.70 ? 171 LEU A C   1 
ATOM   1294 O O   . LEU A 1 171 ? -7.258  59.893 46.732 1.00   22.17 ? 171 LEU A O   1 
ATOM   1295 C CB  . LEU A 1 171 ? -7.390  56.915 47.726 1.00   15.67 ? 171 LEU A CB  1 
ATOM   1296 C CG  . LEU A 1 171 ? -6.857  55.500 47.633 1.00   13.78 ? 171 LEU A CG  1 
ATOM   1297 C CD1 . LEU A 1 171 ? -7.991  54.562 47.660 1.00   14.20 ? 171 LEU A CD1 1 
ATOM   1298 C CD2 . LEU A 1 171 ? -6.056  55.330 46.387 1.00   13.60 ? 171 LEU A CD2 1 
ATOM   1299 N N   . ASP A 1 172 ? -7.097  59.955 48.936 1.00   19.39 ? 172 ASP A N   1 
ATOM   1300 C CA  . ASP A 1 172 ? -7.613  61.306 48.944 1.00   17.24 ? 172 ASP A CA  1 
ATOM   1301 C C   . ASP A 1 172 ? -6.528  62.170 48.337 1.00   15.63 ? 172 ASP A C   1 
ATOM   1302 O O   . ASP A 1 172 ? -6.824  63.151 47.716 1.00   17.88 ? 172 ASP A O   1 
ATOM   1303 C CB  . ASP A 1 172 ? -7.854  61.831 50.369 1.00   17.58 ? 172 ASP A CB  1 
ATOM   1304 C CG  . ASP A 1 172 ? -9.036  61.209 51.052 1.00   19.29 ? 172 ASP A CG  1 
ATOM   1305 O OD1 . ASP A 1 172 ? -9.759  60.405 50.449 1.00   20.78 ? 172 ASP A OD1 1 
ATOM   1306 O OD2 . ASP A 1 172 ? -9.245  61.534 52.234 1.00   20.94 ? 172 ASP A OD2 1 
ATOM   1307 N N   . GLN A 1 173 ? -5.265  61.862 48.587 1.00   14.86 ? 173 GLN A N   1 
ATOM   1308 C CA  . GLN A 1 173 ? -4.194  62.700 48.063 1.00   14.90 ? 173 GLN A CA  1 
ATOM   1309 C C   . GLN A 1 173 ? -4.078  62.518 46.576 1.00   15.82 ? 173 GLN A C   1 
ATOM   1310 O O   . GLN A 1 173 ? -3.890  63.472 45.852 1.00   16.18 ? 173 GLN A O   1 
ATOM   1311 C CB  . GLN A 1 173 ? -2.852  62.348 48.684 1.00   14.08 ? 173 GLN A CB  1 
ATOM   1312 C CG  . GLN A 1 173 ? -2.745  62.563 50.192 1.00   16.12 ? 173 GLN A CG  1 
ATOM   1313 C CD  . GLN A 1 173 ? -1.435  62.040 50.737 1.00   17.36 ? 173 GLN A CD  1 
ATOM   1314 O OE1 . GLN A 1 173 ? -0.466  61.906 50.009 1.00   20.68 ? 173 GLN A OE1 1 
ATOM   1315 N NE2 . GLN A 1 173 ? -1.400  61.745 52.006 1.00   19.31 ? 173 GLN A NE2 1 
ATOM   1316 N N   . ARG A 1 174 ? -4.182  61.269 46.127 1.00   16.95 ? 174 ARG A N   1 
ATOM   1317 C CA  . ARG A 1 174 ? -4.077  60.916 44.724 1.00   15.50 ? 174 ARG A CA  1 
ATOM   1318 C C   . ARG A 1 174 ? -5.158  61.667 44.020 1.00   16.75 ? 174 ARG A C   1 
ATOM   1319 O O   . ARG A 1 174 ? -4.925  62.376 43.052 1.00   17.36 ? 174 ARG A O   1 
ATOM   1320 C CB  . ARG A 1 174 ? -4.335  59.445 44.560 1.00   14.61 ? 174 ARG A CB  1 
ATOM   1321 C CG  . ARG A 1 174 ? -3.718  58.861 43.348 1.00   14.04 ? 174 ARG A CG  1 
ATOM   1322 C CD  . ARG A 1 174 ? -4.137  57.451 43.212 1.00   11.28 ? 174 ARG A CD  1 
ATOM   1323 N NE  . ARG A 1 174 ? -3.057  56.536 43.529 1.00   10.38 ? 174 ARG A NE  1 
ATOM   1324 C CZ  . ARG A 1 174 ? -3.221  55.222 43.581 1.00   11.82 ? 174 ARG A CZ  1 
ATOM   1325 N NH1 . ARG A 1 174 ? -4.412  54.700 43.351 1.00   7.63  ? 174 ARG A NH1 1 
ATOM   1326 N NH2 . ARG A 1 174 ? -2.192  54.435 43.839 1.00   11.23 ? 174 ARG A NH2 1 
ATOM   1327 N N   . MET A 1 175 ? -6.347  61.576 44.577 1.00   16.66 ? 175 MET A N   1 
ATOM   1328 C CA  . MET A 1 175 ? -7.474  62.249 44.011 1.00   16.51 ? 175 MET A CA  1 
ATOM   1329 C C   . MET A 1 175 ? -7.283  63.722 43.847 1.00   17.58 ? 175 MET A C   1 
ATOM   1330 O O   . MET A 1 175 ? -7.825  64.287 42.920 1.00   21.01 ? 175 MET A O   1 
ATOM   1331 C CB  . MET A 1 175 ? -8.697  62.032 44.841 1.00   17.93 ? 175 MET A CB  1 
ATOM   1332 C CG  . MET A 1 175 ? -9.857  62.673 44.206 1.00   21.81 ? 175 MET A CG  1 
ATOM   1333 S SD  . MET A 1 175 ? -10.991 61.431 43.791 1.00   27.58 ? 175 MET A SD  1 
ATOM   1334 C CE  . MET A 1 175 ? -12.300 62.174 44.568 1.00   24.04 ? 175 MET A CE  1 
ATOM   1335 N N   . ALA A 1 176 ? -6.566  64.372 44.749 1.00   18.81 ? 176 ALA A N   1 
ATOM   1336 C CA  . ALA A 1 176 ? -6.364  65.809 44.635 1.00   18.19 ? 176 ALA A CA  1 
ATOM   1337 C C   . ALA A 1 176 ? -5.266  66.037 43.661 1.00   17.59 ? 176 ALA A C   1 
ATOM   1338 O O   . ALA A 1 176 ? -5.104  67.131 43.158 1.00   18.70 ? 176 ALA A O   1 
ATOM   1339 C CB  . ALA A 1 176 ? -5.994  66.407 45.961 1.00   18.95 ? 176 ALA A CB  1 
ATOM   1340 N N   . LEU A 1 177 ? -4.438  65.024 43.470 1.00   19.09 ? 177 LEU A N   1 
ATOM   1341 C CA  . LEU A 1 177 ? -3.349  65.137 42.518 1.00   20.29 ? 177 LEU A CA  1 
ATOM   1342 C C   . LEU A 1 177 ? -3.994  65.060 41.136 1.00   21.09 ? 177 LEU A C   1 
ATOM   1343 O O   . LEU A 1 177 ? -3.609  65.762 40.202 1.00   19.53 ? 177 LEU A O   1 
ATOM   1344 C CB  . LEU A 1 177 ? -2.321  64.018 42.725 1.00   20.19 ? 177 LEU A CB  1 
ATOM   1345 C CG  . LEU A 1 177 ? -1.257  64.251 43.796 1.00   19.38 ? 177 LEU A CG  1 
ATOM   1346 C CD1 . LEU A 1 177 ? -0.220  63.155 43.754 1.00   17.76 ? 177 LEU A CD1 1 
ATOM   1347 C CD2 . LEU A 1 177 ? -0.615  65.584 43.544 1.00   18.05 ? 177 LEU A CD2 1 
ATOM   1348 N N   . GLN A 1 178 ? -5.028  64.236 41.051 1.00   21.97 ? 178 GLN A N   1 
ATOM   1349 C CA  . GLN A 1 178 ? -5.801  64.049 39.836 1.00   22.54 ? 178 GLN A CA  1 
ATOM   1350 C C   . GLN A 1 178 ? -6.506  65.355 39.501 1.00   21.45 ? 178 GLN A C   1 
ATOM   1351 O O   . GLN A 1 178 ? -6.406  65.817 38.369 1.00   23.26 ? 178 GLN A O   1 
ATOM   1352 C CB  . GLN A 1 178 ? -6.839  62.949 40.028 1.00   23.73 ? 178 GLN A CB  1 
ATOM   1353 C CG  . GLN A 1 178 ? -7.538  62.517 38.761 1.00   26.46 ? 178 GLN A CG  1 
ATOM   1354 C CD  . GLN A 1 178 ? -6.590  61.858 37.790 1.00   28.26 ? 178 GLN A CD  1 
ATOM   1355 O OE1 . GLN A 1 178 ? -6.181  60.716 37.983 1.00   30.45 ? 178 GLN A OE1 1 
ATOM   1356 N NE2 . GLN A 1 178 ? -6.239  62.571 36.734 1.00   29.54 ? 178 GLN A NE2 1 
ATOM   1357 N N   . TRP A 1 179 ? -7.228  65.944 40.452 1.00   18.74 ? 179 TRP A N   1 
ATOM   1358 C CA  . TRP A 1 179 ? -7.903  67.203 40.175 1.00   16.49 ? 179 TRP A CA  1 
ATOM   1359 C C   . TRP A 1 179 ? -6.902  68.231 39.765 1.00   17.32 ? 179 TRP A C   1 
ATOM   1360 O O   . TRP A 1 179 ? -7.220  69.088 38.983 1.00   19.50 ? 179 TRP A O   1 
ATOM   1361 C CB  . TRP A 1 179 ? -8.656  67.722 41.361 1.00   11.23 ? 179 TRP A CB  1 
ATOM   1362 C CG  . TRP A 1 179 ? -9.596  68.816 41.044 1.00   8.48  ? 179 TRP A CG  1 
ATOM   1363 C CD1 . TRP A 1 179 ? -10.925 68.698 40.850 1.00   7.66  ? 179 TRP A CD1 1 
ATOM   1364 C CD2 . TRP A 1 179 ? -9.304  70.216 40.973 1.00   6.28  ? 179 TRP A CD2 1 
ATOM   1365 N NE1 . TRP A 1 179 ? -11.482 69.926 40.672 1.00   9.95  ? 179 TRP A NE1 1 
ATOM   1366 C CE2 . TRP A 1 179 ? -10.504 70.877 40.741 1.00   5.89  ? 179 TRP A CE2 1 
ATOM   1367 C CE3 . TRP A 1 179 ? -8.141  70.972 41.087 1.00   6.09  ? 179 TRP A CE3 1 
ATOM   1368 C CZ2 . TRP A 1 179 ? -10.582 72.251 40.621 1.00   7.56  ? 179 TRP A CZ2 1 
ATOM   1369 C CZ3 . TRP A 1 179 ? -8.224  72.336 40.965 1.00   6.98  ? 179 TRP A CZ3 1 
ATOM   1370 C CH2 . TRP A 1 179 ? -9.428  72.960 40.737 1.00   7.03  ? 179 TRP A CH2 1 
ATOM   1371 N N   . VAL A 1 180 ? -5.693  68.173 40.291 1.00   19.12 ? 180 VAL A N   1 
ATOM   1372 C CA  . VAL A 1 180 ? -4.670  69.145 39.906 1.00   20.67 ? 180 VAL A CA  1 
ATOM   1373 C C   . VAL A 1 180 ? -4.180  68.859 38.457 1.00   21.99 ? 180 VAL A C   1 
ATOM   1374 O O   . VAL A 1 180 ? -3.916  69.771 37.684 1.00   22.23 ? 180 VAL A O   1 
ATOM   1375 C CB  . VAL A 1 180 ? -3.472  69.112 40.906 1.00   19.67 ? 180 VAL A CB  1 
ATOM   1376 C CG1 . VAL A 1 180 ? -2.347  69.975 40.422 1.00   18.40 ? 180 VAL A CG1 1 
ATOM   1377 C CG2 . VAL A 1 180 ? -3.919  69.610 42.249 1.00   18.69 ? 180 VAL A CG2 1 
ATOM   1378 N N   . HIS A 1 181 ? -4.040  67.584 38.117 1.00   22.94 ? 181 HIS A N   1 
ATOM   1379 C CA  . HIS A 1 181 ? -3.593  67.161 36.798 1.00   22.06 ? 181 HIS A CA  1 
ATOM   1380 C C   . HIS A 1 181 ? -4.539  67.696 35.755 1.00   20.97 ? 181 HIS A C   1 
ATOM   1381 O O   . HIS A 1 181 ? -4.148  68.429 34.860 1.00   20.31 ? 181 HIS A O   1 
ATOM   1382 C CB  . HIS A 1 181 ? -3.600  65.645 36.717 1.00   23.47 ? 181 HIS A CB  1 
ATOM   1383 C CG  . HIS A 1 181 ? -2.889  65.127 35.521 1.00   29.31 ? 181 HIS A CG  1 
ATOM   1384 N ND1 . HIS A 1 181 ? -3.547  64.616 34.421 1.00   29.22 ? 181 HIS A ND1 1 
ATOM   1385 C CD2 . HIS A 1 181 ? -1.565  65.100 35.218 1.00   31.16 ? 181 HIS A CD2 1 
ATOM   1386 C CE1 . HIS A 1 181 ? -2.663  64.298 33.490 1.00   30.94 ? 181 HIS A CE1 1 
ATOM   1387 N NE2 . HIS A 1 181 ? -1.454  64.583 33.950 1.00   31.94 ? 181 HIS A NE2 1 
ATOM   1388 N N   . ASP A 1 182 ? -5.803  67.350 35.933 1.00   20.43 ? 182 ASP A N   1 
ATOM   1389 C CA  . ASP A 1 182 ? -6.875  67.744 35.058 1.00   21.17 ? 182 ASP A CA  1 
ATOM   1390 C C   . ASP A 1 182 ? -7.248  69.223 34.989 1.00   21.99 ? 182 ASP A C   1 
ATOM   1391 O O   . ASP A 1 182 ? -7.617  69.692 33.923 1.00   24.78 ? 182 ASP A O   1 
ATOM   1392 C CB  . ASP A 1 182 ? -8.131  66.952 35.413 1.00   21.24 ? 182 ASP A CB  1 
ATOM   1393 C CG  . ASP A 1 182 ? -7.941  65.434 35.266 1.00   24.92 ? 182 ASP A CG  1 
ATOM   1394 O OD1 . ASP A 1 182 ? -7.005  64.997 34.539 1.00   26.64 ? 182 ASP A OD1 1 
ATOM   1395 O OD2 . ASP A 1 182 ? -8.724  64.670 35.881 1.00   25.29 ? 182 ASP A OD2 1 
ATOM   1396 N N   . ASN A 1 183 ? -7.168  69.966 36.086 1.00   21.46 ? 183 ASN A N   1 
ATOM   1397 C CA  . ASN A 1 183 ? -7.586  71.361 36.077 1.00   18.37 ? 183 ASN A CA  1 
ATOM   1398 C C   . ASN A 1 183 ? -6.572  72.441 36.312 1.00   19.44 ? 183 ASN A C   1 
ATOM   1399 O O   . ASN A 1 183 ? -6.861  73.616 36.118 1.00   20.53 ? 183 ASN A O   1 
ATOM   1400 C CB  . ASN A 1 183 ? -8.638  71.564 37.140 1.00   18.46 ? 183 ASN A CB  1 
ATOM   1401 C CG  . ASN A 1 183 ? -9.833  70.715 36.927 1.00   20.51 ? 183 ASN A CG  1 
ATOM   1402 O OD1 . ASN A 1 183 ? -10.813 71.156 36.335 1.00   21.67 ? 183 ASN A OD1 1 
ATOM   1403 N ND2 . ASN A 1 183 ? -9.774  69.487 37.393 1.00   19.90 ? 183 ASN A ND2 1 
ATOM   1404 N N   . ILE A 1 184 ? -5.388  72.095 36.766 1.00   20.88 ? 184 ILE A N   1 
ATOM   1405 C CA  . ILE A 1 184 ? -4.427  73.148 37.080 1.00   21.91 ? 184 ILE A CA  1 
ATOM   1406 C C   . ILE A 1 184 ? -4.050  74.043 35.900 1.00   23.58 ? 184 ILE A C   1 
ATOM   1407 O O   . ILE A 1 184 ? -3.467  75.127 36.089 1.00   24.98 ? 184 ILE A O   1 
ATOM   1408 C CB  . ILE A 1 184 ? -3.182  72.591 37.814 1.00   19.98 ? 184 ILE A CB  1 
ATOM   1409 C CG1 . ILE A 1 184 ? -2.512  73.703 38.604 1.00   18.35 ? 184 ILE A CG1 1 
ATOM   1410 C CG2 . ILE A 1 184 ? -2.228  71.955 36.849 1.00   19.84 ? 184 ILE A CG2 1 
ATOM   1411 C CD1 . ILE A 1 184 ? -3.366  74.216 39.723 1.00   16.27 ? 184 ILE A CD1 1 
ATOM   1412 N N   . GLN A 1 185 ? -4.414  73.611 34.694 1.00   23.74 ? 185 GLN A N   1 
ATOM   1413 C CA  . GLN A 1 185 ? -4.111  74.373 33.478 1.00   23.28 ? 185 GLN A CA  1 
ATOM   1414 C C   . GLN A 1 185 ? -4.961  75.639 33.394 1.00   22.65 ? 185 GLN A C   1 
ATOM   1415 O O   . GLN A 1 185 ? -4.547  76.650 32.829 1.00   20.57 ? 185 GLN A O   1 
ATOM   1416 C CB  . GLN A 1 185 ? -4.310  73.506 32.219 1.00   22.78 ? 185 GLN A CB  1 
ATOM   1417 C CG  . GLN A 1 185 ? -5.710  72.999 32.018 1.00   23.84 ? 185 GLN A CG  1 
ATOM   1418 C CD  . GLN A 1 185 ? -5.814  72.028 30.870 1.00   25.61 ? 185 GLN A CD  1 
ATOM   1419 O OE1 . GLN A 1 185 ? -5.240  70.940 30.906 1.00   26.75 ? 185 GLN A OE1 1 
ATOM   1420 N NE2 . GLN A 1 185 ? -6.556  72.405 29.844 1.00   26.11 ? 185 GLN A NE2 1 
ATOM   1421 N N   . PHE A 1 186 ? -6.118  75.614 34.033 1.00   21.19 ? 186 PHE A N   1 
ATOM   1422 C CA  . PHE A 1 186 ? -6.987  76.765 34.001 1.00   21.73 ? 186 PHE A CA  1 
ATOM   1423 C C   . PHE A 1 186 ? -6.652  77.811 35.016 1.00   22.69 ? 186 PHE A C   1 
ATOM   1424 O O   . PHE A 1 186 ? -7.367  78.814 35.104 1.00   25.29 ? 186 PHE A O   1 
ATOM   1425 C CB  . PHE A 1 186 ? -8.409  76.309 34.203 1.00   23.22 ? 186 PHE A CB  1 
ATOM   1426 C CG  . PHE A 1 186 ? -8.799  75.232 33.259 1.00   26.77 ? 186 PHE A CG  1 
ATOM   1427 C CD1 . PHE A 1 186 ? -8.747  75.461 31.876 1.00   25.58 ? 186 PHE A CD1 1 
ATOM   1428 C CD2 . PHE A 1 186 ? -9.135  73.966 33.728 1.00   27.47 ? 186 PHE A CD2 1 
ATOM   1429 C CE1 . PHE A 1 186 ? -9.025  74.442 30.980 1.00   28.36 ? 186 PHE A CE1 1 
ATOM   1430 C CE2 . PHE A 1 186 ? -9.418  72.921 32.823 1.00   29.45 ? 186 PHE A CE2 1 
ATOM   1431 C CZ  . PHE A 1 186 ? -9.362  73.161 31.448 1.00   28.94 ? 186 PHE A CZ  1 
ATOM   1432 N N   . PHE A 1 187 ? -5.574  77.591 35.780 1.00   22.48 ? 187 PHE A N   1 
ATOM   1433 C CA  . PHE A 1 187 ? -5.130  78.517 36.829 1.00   19.18 ? 187 PHE A CA  1 
ATOM   1434 C C   . PHE A 1 187 ? -3.748  79.061 36.520 1.00   20.33 ? 187 PHE A C   1 
ATOM   1435 O O   . PHE A 1 187 ? -3.224  79.895 37.254 1.00   21.71 ? 187 PHE A O   1 
ATOM   1436 C CB  . PHE A 1 187 ? -5.066  77.814 38.170 1.00   15.90 ? 187 PHE A CB  1 
ATOM   1437 C CG  . PHE A 1 187 ? -6.398  77.363 38.702 1.00   14.99 ? 187 PHE A CG  1 
ATOM   1438 C CD1 . PHE A 1 187 ? -6.879  76.099 38.422 1.00   14.34 ? 187 PHE A CD1 1 
ATOM   1439 C CD2 . PHE A 1 187 ? -7.126  78.171 39.563 1.00   15.08 ? 187 PHE A CD2 1 
ATOM   1440 C CE1 . PHE A 1 187 ? -8.053  75.641 38.991 1.00   14.77 ? 187 PHE A CE1 1 
ATOM   1441 C CE2 . PHE A 1 187 ? -8.303  77.724 40.138 1.00   13.77 ? 187 PHE A CE2 1 
ATOM   1442 C CZ  . PHE A 1 187 ? -8.766  76.465 39.855 1.00   14.36 ? 187 PHE A CZ  1 
ATOM   1443 N N   . GLY A 1 188 ? -3.142  78.572 35.442 1.00   19.60 ? 188 GLY A N   1 
ATOM   1444 C CA  . GLY A 1 188 ? -1.827  79.038 35.059 1.00   15.99 ? 188 GLY A CA  1 
ATOM   1445 C C   . GLY A 1 188 ? -0.778  77.992 35.297 1.00   15.83 ? 188 GLY A C   1 
ATOM   1446 O O   . GLY A 1 188 ? 0.379   78.168 34.942 1.00   15.26 ? 188 GLY A O   1 
ATOM   1447 N N   . GLY A 1 189 ? -1.181  76.857 35.833 1.00   15.12 ? 189 GLY A N   1 
ATOM   1448 C CA  . GLY A 1 189 ? -0.190  75.856 36.123 1.00   16.94 ? 189 GLY A CA  1 
ATOM   1449 C C   . GLY A 1 189 ? -0.033  74.854 35.030 1.00   19.72 ? 189 GLY A C   1 
ATOM   1450 O O   . GLY A 1 189 ? -1.003  74.484 34.388 1.00   22.77 ? 189 GLY A O   1 
ATOM   1451 N N   . ASP A 1 190 ? 1.174   74.338 34.900 1.00   19.36 ? 190 ASP A N   1 
ATOM   1452 C CA  . ASP A 1 190 ? 1.493   73.342 33.903 1.00   19.68 ? 190 ASP A CA  1 
ATOM   1453 C C   . ASP A 1 190 ? 1.395   71.965 34.555 1.00   21.40 ? 190 ASP A C   1 
ATOM   1454 O O   . ASP A 1 190 ? 2.316   71.544 35.240 1.00   22.29 ? 190 ASP A O   1 
ATOM   1455 C CB  . ASP A 1 190 ? 2.902   73.639 33.425 1.00   17.62 ? 190 ASP A CB  1 
ATOM   1456 C CG  . ASP A 1 190 ? 3.485   72.543 32.603 1.00   20.73 ? 190 ASP A CG  1 
ATOM   1457 O OD1 . ASP A 1 190 ? 2.774   71.587 32.234 1.00   17.86 ? 190 ASP A OD1 1 
ATOM   1458 O OD2 . ASP A 1 190 ? 4.702   72.634 32.329 1.00   24.84 ? 190 ASP A OD2 1 
ATOM   1459 N N   . PRO A 1 191 ? 0.360   71.174 34.229 1.00   22.39 ? 191 PRO A N   1 
ATOM   1460 C CA  . PRO A 1 191 ? 0.205   69.843 34.830 1.00   23.02 ? 191 PRO A CA  1 
ATOM   1461 C C   . PRO A 1 191 ? 1.275   68.841 34.489 1.00   23.76 ? 191 PRO A C   1 
ATOM   1462 O O   . PRO A 1 191 ? 1.175   67.681 34.868 1.00   25.47 ? 191 PRO A O   1 
ATOM   1463 C CB  . PRO A 1 191 ? -1.146  69.391 34.310 1.00   22.69 ? 191 PRO A CB  1 
ATOM   1464 C CG  . PRO A 1 191 ? -1.175  69.979 33.000 1.00   23.46 ? 191 PRO A CG  1 
ATOM   1465 C CD  . PRO A 1 191 ? -0.667  71.381 33.205 1.00   22.17 ? 191 PRO A CD  1 
ATOM   1466 N N   . LYS A 1 192 ? 2.274   69.276 33.738 1.00   25.81 ? 192 LYS A N   1 
ATOM   1467 C CA  . LYS A 1 192 ? 3.389   68.417 33.351 1.00   27.63 ? 192 LYS A CA  1 
ATOM   1468 C C   . LYS A 1 192 ? 4.587   68.848 34.172 1.00   26.91 ? 192 LYS A C   1 
ATOM   1469 O O   . LYS A 1 192 ? 5.700   68.388 33.949 1.00   27.93 ? 192 LYS A O   1 
ATOM   1470 C CB  . LYS A 1 192 ? 3.719   68.571 31.864 1.00   29.85 ? 192 LYS A CB  1 
ATOM   1471 C CG  . LYS A 1 192 ? 2.562   68.192 30.933 1.00   35.59 ? 192 LYS A CG  1 
ATOM   1472 C CD  . LYS A 1 192 ? 2.083   66.744 31.162 1.00   37.82 ? 192 LYS A CD  1 
ATOM   1473 C CE  . LYS A 1 192 ? 0.869   66.372 30.255 1.00   39.90 ? 192 LYS A CE  1 
ATOM   1474 N NZ  . LYS A 1 192 ? -0.499  66.856 30.763 1.00   39.89 ? 192 LYS A NZ  1 
ATOM   1475 N N   . THR A 1 193 ? 4.373   69.771 35.102 1.00   26.03 ? 193 THR A N   1 
ATOM   1476 C CA  . THR A 1 193 ? 5.463   70.215 35.944 1.00   24.22 ? 193 THR A CA  1 
ATOM   1477 C C   . THR A 1 193 ? 5.036   70.491 37.368 1.00   22.38 ? 193 THR A C   1 
ATOM   1478 O O   . THR A 1 193 ? 5.240   71.595 37.882 1.00   20.66 ? 193 THR A O   1 
ATOM   1479 C CB  . THR A 1 193 ? 6.151   71.409 35.353 1.00   23.26 ? 193 THR A CB  1 
ATOM   1480 O OG1 . THR A 1 193 ? 6.380   71.144 33.974 1.00   26.62 ? 193 THR A OG1 1 
ATOM   1481 C CG2 . THR A 1 193 ? 7.484   71.589 35.983 1.00   22.80 ? 193 THR A CG2 1 
ATOM   1482 N N   . VAL A 1 194 ? 4.350   69.512 37.962 1.00   20.95 ? 194 VAL A N   1 
ATOM   1483 C CA  . VAL A 1 194 ? 3.938   69.627 39.343 1.00   19.93 ? 194 VAL A CA  1 
ATOM   1484 C C   . VAL A 1 194 ? 4.889   68.793 40.184 1.00   19.55 ? 194 VAL A C   1 
ATOM   1485 O O   . VAL A 1 194 ? 5.225   67.658 39.826 1.00   17.13 ? 194 VAL A O   1 
ATOM   1486 C CB  . VAL A 1 194 ? 2.465   69.230 39.620 1.00   19.01 ? 194 VAL A CB  1 
ATOM   1487 C CG1 . VAL A 1 194 ? 1.635   69.309 38.392 1.00   18.43 ? 194 VAL A CG1 1 
ATOM   1488 C CG2 . VAL A 1 194 ? 2.356   67.911 40.289 1.00   19.47 ? 194 VAL A CG2 1 
ATOM   1489 N N   . THR A 1 195 ? 5.412   69.429 41.227 1.00   18.95 ? 195 THR A N   1 
ATOM   1490 C CA  . THR A 1 195 ? 6.311   68.820 42.189 1.00   18.22 ? 195 THR A CA  1 
ATOM   1491 C C   . THR A 1 195 ? 5.478   68.613 43.421 1.00   17.66 ? 195 THR A C   1 
ATOM   1492 O O   . THR A 1 195 ? 4.898   69.577 43.911 1.00   18.70 ? 195 THR A O   1 
ATOM   1493 C CB  . THR A 1 195 ? 7.319   69.816 42.633 1.00   17.70 ? 195 THR A CB  1 
ATOM   1494 O OG1 . THR A 1 195 ? 8.053   70.267 41.509 1.00   21.00 ? 195 THR A OG1 1 
ATOM   1495 C CG2 . THR A 1 195 ? 8.235   69.215 43.618 1.00   18.93 ? 195 THR A CG2 1 
ATOM   1496 N N   . ILE A 1 196 ? 5.329   67.394 43.904 1.00   15.39 ? 196 ILE A N   1 
ATOM   1497 C CA  . ILE A 1 196 ? 4.579   67.250 45.130 1.00   13.84 ? 196 ILE A CA  1 
ATOM   1498 C C   . ILE A 1 196 ? 5.577   67.325 46.271 1.00   14.73 ? 196 ILE A C   1 
ATOM   1499 O O   . ILE A 1 196 ? 6.669   66.792 46.156 1.00   15.95 ? 196 ILE A O   1 
ATOM   1500 C CB  . ILE A 1 196 ? 3.837   65.939 45.199 1.00   11.94 ? 196 ILE A CB  1 
ATOM   1501 C CG1 . ILE A 1 196 ? 4.742   64.778 44.838 1.00   10.71 ? 196 ILE A CG1 1 
ATOM   1502 C CG2 . ILE A 1 196 ? 2.628   65.999 44.335 1.00   13.66 ? 196 ILE A CG2 1 
ATOM   1503 C CD1 . ILE A 1 196 ? 4.142   63.431 45.154 1.00   9.15  ? 196 ILE A CD1 1 
ATOM   1504 N N   . PHE A 1 197 ? 5.293   68.086 47.318 1.00   16.29 ? 197 PHE A N   1 
ATOM   1505 C CA  . PHE A 1 197 ? 6.221   68.120 48.455 1.00   15.99 ? 197 PHE A CA  1 
ATOM   1506 C C   . PHE A 1 197 ? 5.532   68.015 49.804 1.00   16.13 ? 197 PHE A C   1 
ATOM   1507 O O   . PHE A 1 197 ? 4.384   68.390 49.952 1.00   16.82 ? 197 PHE A O   1 
ATOM   1508 C CB  . PHE A 1 197 ? 7.246   69.272 48.377 1.00   15.61 ? 197 PHE A CB  1 
ATOM   1509 C CG  . PHE A 1 197 ? 6.678   70.656 48.518 1.00   14.78 ? 197 PHE A CG  1 
ATOM   1510 C CD1 . PHE A 1 197 ? 5.487   71.015 47.933 1.00   13.88 ? 197 PHE A CD1 1 
ATOM   1511 C CD2 . PHE A 1 197 ? 7.376   71.610 49.231 1.00   13.46 ? 197 PHE A CD2 1 
ATOM   1512 C CE1 . PHE A 1 197 ? 5.010   72.297 48.065 1.00   12.87 ? 197 PHE A CE1 1 
ATOM   1513 C CE2 . PHE A 1 197 ? 6.891   72.881 49.349 1.00   11.83 ? 197 PHE A CE2 1 
ATOM   1514 C CZ  . PHE A 1 197 ? 5.707   73.219 48.766 1.00   10.96 ? 197 PHE A CZ  1 
ATOM   1515 N N   . GLY A 1 198 ? 6.191   67.410 50.772 1.00   17.81 ? 198 GLY A N   1 
ATOM   1516 C CA  . GLY A 1 198 ? 5.556   67.264 52.061 1.00   18.24 ? 198 GLY A CA  1 
ATOM   1517 C C   . GLY A 1 198 ? 6.549   67.041 53.159 1.00   19.28 ? 198 GLY A C   1 
ATOM   1518 O O   . GLY A 1 198 ? 7.699   66.696 52.895 1.00   18.29 ? 198 GLY A O   1 
ATOM   1519 N N   . GLU A 1 199 ? 6.101   67.191 54.399 1.00   19.92 ? 199 GLU A N   1 
ATOM   1520 C CA  . GLU A 1 199 ? 6.989   67.024 55.534 1.00   18.55 ? 199 GLU A CA  1 
ATOM   1521 C C   . GLU A 1 199 ? 6.451   65.961 56.437 1.00   17.65 ? 199 GLU A C   1 
ATOM   1522 O O   . GLU A 1 199 ? 5.256   65.883 56.664 1.00   17.45 ? 199 GLU A O   1 
ATOM   1523 C CB  . GLU A 1 199 ? 7.083   68.341 56.295 1.00   20.94 ? 199 GLU A CB  1 
ATOM   1524 C CG  . GLU A 1 199 ? 8.131   68.358 57.397 1.00   22.13 ? 199 GLU A CG  1 
ATOM   1525 C CD  . GLU A 1 199 ? 7.567   68.129 58.797 1.00   22.98 ? 199 GLU A CD  1 
ATOM   1526 O OE1 . GLU A 1 199 ? 6.337   68.173 58.997 1.00   22.70 ? 199 GLU A OE1 1 
ATOM   1527 O OE2 . GLU A 1 199 ? 8.370   67.912 59.722 1.00   24.02 ? 199 GLU A OE2 1 
ATOM   1528 N N   . SER A 1 200 ? 7.330   65.105 56.915 1.00   17.14 ? 200 SER A N   1 
ATOM   1529 C CA  . SER A 1 200 ? 6.964   64.038 57.840 1.00   17.54 ? 200 SER A CA  1 
ATOM   1530 C C   . SER A 1 200 ? 5.963   63.080 57.246 1.00   16.00 ? 200 SER A C   1 
ATOM   1531 O O   . SER A 1 200 ? 6.306   62.386 56.321 1.00   20.32 ? 200 SER A O   1 
ATOM   1532 C CB  . SER A 1 200 ? 6.497   64.604 59.191 1.00   17.01 ? 200 SER A CB  1 
ATOM   1533 O OG  . SER A 1 200 ? 6.738   63.690 60.261 1.00   18.77 ? 200 SER A OG  1 
ATOM   1534 N N   . ALA A 1 201 ? 4.759   62.964 57.774 1.00   15.78 ? 201 ALA A N   1 
ATOM   1535 C CA  . ALA A 1 201 ? 3.816   62.021 57.188 1.00   14.46 ? 201 ALA A CA  1 
ATOM   1536 C C   . ALA A 1 201 ? 3.541   62.453 55.729 1.00   16.88 ? 201 ALA A C   1 
ATOM   1537 O O   . ALA A 1 201 ? 3.098   61.658 54.895 1.00   17.53 ? 201 ALA A O   1 
ATOM   1538 C CB  . ALA A 1 201 ? 2.549   61.982 57.998 1.00   10.00 ? 201 ALA A CB  1 
ATOM   1539 N N   . GLY A 1 202 ? 3.820   63.722 55.433 1.00   17.64 ? 202 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 202 ? 3.636   64.259 54.101 1.00   17.45 ? 202 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 202 ? 4.803   63.913 53.199 1.00   18.50 ? 202 GLY A C   1 
ATOM   1542 O O   . GLY A 1 202 ? 4.607   63.655 52.023 1.00   21.45 ? 202 GLY A O   1 
ATOM   1543 N N   . GLY A 1 203 ? 6.018   63.948 53.726 1.00   16.21 ? 203 GLY A N   1 
ATOM   1544 C CA  . GLY A 1 203 ? 7.179   63.595 52.950 1.00   15.37 ? 203 GLY A CA  1 
ATOM   1545 C C   . GLY A 1 203 ? 7.128   62.103 52.761 1.00   16.84 ? 203 GLY A C   1 
ATOM   1546 O O   . GLY A 1 203 ? 7.646   61.572 51.803 1.00   19.67 ? 203 GLY A O   1 
ATOM   1547 N N   . ALA A 1 204 ? 6.487   61.407 53.681 1.00   17.67 ? 204 ALA A N   1 
ATOM   1548 C CA  . ALA A 1 204 ? 6.362   59.960 53.590 1.00   17.10 ? 204 ALA A CA  1 
ATOM   1549 C C   . ALA A 1 204 ? 5.326   59.685 52.524 1.00   17.37 ? 204 ALA A C   1 
ATOM   1550 O O   . ALA A 1 204 ? 5.450   58.725 51.782 1.00   18.90 ? 204 ALA A O   1 
ATOM   1551 C CB  . ALA A 1 204 ? 5.909   59.361 54.941 1.00   16.28 ? 204 ALA A CB  1 
ATOM   1552 N N   . SER A 1 205 ? 4.237   60.451 52.538 1.00   15.74 ? 205 SER A N   1 
ATOM   1553 C CA  . SER A 1 205 ? 3.210   60.313 51.527 1.00   14.92 ? 205 SER A CA  1 
ATOM   1554 C C   . SER A 1 205 ? 3.843   60.510 50.135 1.00   16.25 ? 205 SER A C   1 
ATOM   1555 O O   . SER A 1 205 ? 3.737   59.648 49.269 1.00   16.75 ? 205 SER A O   1 
ATOM   1556 C CB  . SER A 1 205 ? 2.137   61.340 51.775 1.00   13.42 ? 205 SER A CB  1 
ATOM   1557 O OG  . SER A 1 205 ? 1.370   60.945 52.894 1.00   17.67 ? 205 SER A OG  1 
ATOM   1558 N N   . VAL A 1 206 ? 4.562   61.612 49.950 1.00   14.62 ? 206 VAL A N   1 
ATOM   1559 C CA  . VAL A 1 206 ? 5.236   61.892 48.697 1.00   13.60 ? 206 VAL A CA  1 
ATOM   1560 C C   . VAL A 1 206 ? 5.967   60.668 48.197 1.00   14.12 ? 206 VAL A C   1 
ATOM   1561 O O   . VAL A 1 206 ? 5.736   60.210 47.106 1.00   17.78 ? 206 VAL A O   1 
ATOM   1562 C CB  . VAL A 1 206 ? 6.198   63.046 48.844 1.00   12.22 ? 206 VAL A CB  1 
ATOM   1563 C CG1 . VAL A 1 206 ? 7.112   63.115 47.680 1.00   12.70 ? 206 VAL A CG1 1 
ATOM   1564 C CG2 . VAL A 1 206 ? 5.428   64.325 48.964 1.00   11.36 ? 206 VAL A CG2 1 
ATOM   1565 N N   . GLY A 1 207 ? 6.797   60.076 49.019 1.00   15.33 ? 207 GLY A N   1 
ATOM   1566 C CA  . GLY A 1 207 ? 7.508   58.892 48.579 1.00   13.67 ? 207 GLY A CA  1 
ATOM   1567 C C   . GLY A 1 207 ? 6.612   57.716 48.288 1.00   13.09 ? 207 GLY A C   1 
ATOM   1568 O O   . GLY A 1 207 ? 7.020   56.825 47.581 1.00   15.38 ? 207 GLY A O   1 
ATOM   1569 N N   . MET A 1 208 ? 5.403   57.684 48.826 1.00   13.79 ? 208 MET A N   1 
ATOM   1570 C CA  . MET A 1 208 ? 4.520   56.557 48.570 1.00   13.75 ? 208 MET A CA  1 
ATOM   1571 C C   . MET A 1 208 ? 3.846   56.736 47.225 1.00   15.04 ? 208 MET A C   1 
ATOM   1572 O O   . MET A 1 208 ? 3.498   55.770 46.567 1.00   16.52 ? 208 MET A O   1 
ATOM   1573 C CB  . MET A 1 208 ? 3.503   56.405 49.684 1.00   12.78 ? 208 MET A CB  1 
ATOM   1574 C CG  . MET A 1 208 ? 4.136   56.147 51.034 1.00   16.31 ? 208 MET A CG  1 
ATOM   1575 S SD  . MET A 1 208 ? 3.023   56.062 52.454 1.00   16.66 ? 208 MET A SD  1 
ATOM   1576 C CE  . MET A 1 208 ? 4.145   55.304 53.502 1.00   15.03 ? 208 MET A CE  1 
ATOM   1577 N N   . HIS A 1 209 ? 3.648   57.977 46.810 1.00   14.32 ? 209 HIS A N   1 
ATOM   1578 C CA  . HIS A 1 209 ? 3.065   58.248 45.510 1.00   14.49 ? 209 HIS A CA  1 
ATOM   1579 C C   . HIS A 1 209 ? 4.110   57.951 44.458 1.00   17.00 ? 209 HIS A C   1 
ATOM   1580 O O   . HIS A 1 209 ? 3.762   57.616 43.345 1.00   19.39 ? 209 HIS A O   1 
ATOM   1581 C CB  . HIS A 1 209 ? 2.587   59.679 45.419 1.00   12.52 ? 209 HIS A CB  1 
ATOM   1582 C CG  . HIS A 1 209 ? 1.364   59.927 46.231 1.00   13.17 ? 209 HIS A CG  1 
ATOM   1583 N ND1 . HIS A 1 209 ? 0.261   59.108 46.162 1.00   13.09 ? 209 HIS A ND1 1 
ATOM   1584 C CD2 . HIS A 1 209 ? 1.095   60.842 47.189 1.00   12.68 ? 209 HIS A CD2 1 
ATOM   1585 C CE1 . HIS A 1 209 ? -0.635  59.504 47.044 1.00   13.76 ? 209 HIS A CE1 1 
ATOM   1586 N NE2 . HIS A 1 209 ? -0.149  60.555 47.680 1.00   15.02 ? 209 HIS A NE2 1 
ATOM   1587 N N   . ILE A 1 210 ? 5.384   58.010 44.846 1.00   16.22 ? 210 ILE A N   1 
ATOM   1588 C CA  . ILE A 1 210 ? 6.520   57.708 43.987 1.00   15.71 ? 210 ILE A CA  1 
ATOM   1589 C C   . ILE A 1 210 ? 6.610   56.194 43.798 1.00   18.12 ? 210 ILE A C   1 
ATOM   1590 O O   . ILE A 1 210 ? 7.206   55.710 42.835 1.00   19.19 ? 210 ILE A O   1 
ATOM   1591 C CB  . ILE A 1 210 ? 7.850   58.181 44.648 1.00   14.33 ? 210 ILE A CB  1 
ATOM   1592 C CG1 . ILE A 1 210 ? 7.980   59.694 44.600 1.00   11.53 ? 210 ILE A CG1 1 
ATOM   1593 C CG2 . ILE A 1 210 ? 9.051   57.568 43.974 1.00   14.65 ? 210 ILE A CG2 1 
ATOM   1594 C CD1 . ILE A 1 210 ? 9.347   60.159 44.990 1.00   8.96  ? 210 ILE A CD1 1 
ATOM   1595 N N   . LEU A 1 211 ? 6.036   55.441 44.731 1.00   19.08 ? 211 LEU A N   1 
ATOM   1596 C CA  . LEU A 1 211 ? 6.090   53.990 44.679 1.00   18.80 ? 211 LEU A CA  1 
ATOM   1597 C C   . LEU A 1 211 ? 4.823   53.390 44.144 1.00   19.59 ? 211 LEU A C   1 
ATOM   1598 O O   . LEU A 1 211 ? 4.837   52.427 43.375 1.00   21.79 ? 211 LEU A O   1 
ATOM   1599 C CB  . LEU A 1 211 ? 6.303   53.420 46.077 1.00   20.37 ? 211 LEU A CB  1 
ATOM   1600 C CG  . LEU A 1 211 ? 7.629   53.581 46.813 1.00   21.36 ? 211 LEU A CG  1 
ATOM   1601 C CD1 . LEU A 1 211 ? 7.429   53.129 48.264 1.00   22.62 ? 211 LEU A CD1 1 
ATOM   1602 C CD2 . LEU A 1 211 ? 8.712   52.758 46.164 1.00   20.94 ? 211 LEU A CD2 1 
ATOM   1603 N N   . SER A 1 212 ? 3.702   53.892 44.615 1.00   18.07 ? 212 SER A N   1 
ATOM   1604 C CA  . SER A 1 212 ? 2.455   53.335 44.169 1.00   18.90 ? 212 SER A CA  1 
ATOM   1605 C C   . SER A 1 212 ? 2.237   53.562 42.677 1.00   20.25 ? 212 SER A C   1 
ATOM   1606 O O   . SER A 1 212 ? 2.222   54.703 42.219 1.00   21.66 ? 212 SER A O   1 
ATOM   1607 C CB  . SER A 1 212 ? 1.325   53.941 44.951 1.00   15.76 ? 212 SER A CB  1 
ATOM   1608 O OG  . SER A 1 212 ? 0.114   53.346 44.572 1.00   16.87 ? 212 SER A OG  1 
ATOM   1609 N N   . PRO A 1 213 ? 2.082   52.478 41.893 1.00   20.07 ? 213 PRO A N   1 
ATOM   1610 C CA  . PRO A 1 213 ? 1.856   52.527 40.451 1.00   18.86 ? 213 PRO A CA  1 
ATOM   1611 C C   . PRO A 1 213 ? 0.807   53.552 40.021 1.00   17.45 ? 213 PRO A C   1 
ATOM   1612 O O   . PRO A 1 213 ? 1.067   54.380 39.161 1.00   16.63 ? 213 PRO A O   1 
ATOM   1613 C CB  . PRO A 1 213 ? 1.398   51.113 40.160 1.00   18.99 ? 213 PRO A CB  1 
ATOM   1614 C CG  . PRO A 1 213 ? 2.283   50.332 41.029 1.00   21.16 ? 213 PRO A CG  1 
ATOM   1615 C CD  . PRO A 1 213 ? 2.229   51.081 42.332 1.00   19.91 ? 213 PRO A CD  1 
ATOM   1616 N N   . GLY A 1 214 ? -0.355  53.530 40.654 1.00   16.53 ? 214 GLY A N   1 
ATOM   1617 C CA  . GLY A 1 214 ? -1.412  54.451 40.299 1.00   14.07 ? 214 GLY A CA  1 
ATOM   1618 C C   . GLY A 1 214 ? -1.224  55.917 40.597 1.00   16.54 ? 214 GLY A C   1 
ATOM   1619 O O   . GLY A 1 214 ? -2.165  56.665 40.435 1.00   18.48 ? 214 GLY A O   1 
ATOM   1620 N N   . SER A 1 215 ? -0.055  56.351 41.048 1.00   16.86 ? 215 SER A N   1 
ATOM   1621 C CA  . SER A 1 215 ? 0.152   57.773 41.344 1.00   16.54 ? 215 SER A CA  1 
ATOM   1622 C C   . SER A 1 215 ? 1.298   58.350 40.584 1.00   17.82 ? 215 SER A C   1 
ATOM   1623 O O   . SER A 1 215 ? 1.315   59.542 40.337 1.00   17.71 ? 215 SER A O   1 
ATOM   1624 C CB  . SER A 1 215 ? 0.479   58.014 42.816 1.00   17.96 ? 215 SER A CB  1 
ATOM   1625 O OG  . SER A 1 215 ? -0.654  57.865 43.632 1.00   20.20 ? 215 SER A OG  1 
ATOM   1626 N N   . ARG A 1 216 ? 2.290   57.516 40.274 1.00   18.65 ? 216 ARG A N   1 
ATOM   1627 C CA  . ARG A 1 216 ? 3.493   57.974 39.579 1.00   19.72 ? 216 ARG A CA  1 
ATOM   1628 C C   . ARG A 1 216 ? 3.238   58.966 38.445 1.00   19.10 ? 216 ARG A C   1 
ATOM   1629 O O   . ARG A 1 216 ? 3.907   59.987 38.368 1.00   20.68 ? 216 ARG A O   1 
ATOM   1630 C CB  . ARG A 1 216 ? 4.352   56.792 39.069 1.00   18.25 ? 216 ARG A CB  1 
ATOM   1631 C CG  . ARG A 1 216 ? 4.123   55.490 39.786 1.00   19.09 ? 216 ARG A CG  1 
ATOM   1632 C CD  . ARG A 1 216 ? 5.408   54.790 40.215 1.00   21.85 ? 216 ARG A CD  1 
ATOM   1633 N NE  . ARG A 1 216 ? 5.739   53.651 39.373 1.00   23.01 ? 216 ARG A NE  1 
ATOM   1634 C CZ  . ARG A 1 216 ? 5.993   52.414 39.793 1.00   23.68 ? 216 ARG A CZ  1 
ATOM   1635 N NH1 . ARG A 1 216 ? 5.951   52.085 41.067 1.00   20.93 ? 216 ARG A NH1 1 
ATOM   1636 N NH2 . ARG A 1 216 ? 6.375   51.499 38.910 1.00   27.39 ? 216 ARG A NH2 1 
ATOM   1637 N N   . ASP A 1 217 ? 2.202   58.734 37.645 1.00   19.46 ? 217 ASP A N   1 
ATOM   1638 C CA  . ASP A 1 217 ? 1.917   59.580 36.483 1.00   18.96 ? 217 ASP A CA  1 
ATOM   1639 C C   . ASP A 1 217 ? 1.362   60.954 36.751 1.00   19.48 ? 217 ASP A C   1 
ATOM   1640 O O   . ASP A 1 217 ? 1.456   61.817 35.871 1.00   22.38 ? 217 ASP A O   1 
ATOM   1641 C CB  . ASP A 1 217 ? 0.968   58.874 35.517 1.00   16.54 ? 217 ASP A CB  1 
ATOM   1642 C CG  . ASP A 1 217 ? 1.485   57.517 35.049 1.00   16.57 ? 217 ASP A CG  1 
ATOM   1643 O OD1 . ASP A 1 217 ? 2.671   57.165 35.260 1.00   18.94 ? 217 ASP A OD1 1 
ATOM   1644 O OD2 . ASP A 1 217 ? 0.682   56.791 34.451 1.00   13.88 ? 217 ASP A OD2 1 
ATOM   1645 N N   . LEU A 1 218 ? 0.828   61.170 37.958 1.00   18.53 ? 218 LEU A N   1 
ATOM   1646 C CA  . LEU A 1 218 ? 0.194   62.434 38.360 1.00   15.22 ? 218 LEU A CA  1 
ATOM   1647 C C   . LEU A 1 218 ? 1.101   63.569 38.819 1.00   14.25 ? 218 LEU A C   1 
ATOM   1648 O O   . LEU A 1 218 ? 0.618   64.612 39.262 1.00   12.57 ? 218 LEU A O   1 
ATOM   1649 C CB  . LEU A 1 218 ? -0.868  62.175 39.439 1.00   16.59 ? 218 LEU A CB  1 
ATOM   1650 C CG  . LEU A 1 218 ? -2.048  61.261 39.094 1.00   18.63 ? 218 LEU A CG  1 
ATOM   1651 C CD1 . LEU A 1 218 ? -2.942  61.031 40.287 1.00   16.84 ? 218 LEU A CD1 1 
ATOM   1652 C CD2 . LEU A 1 218 ? -2.848  61.888 37.976 1.00   17.29 ? 218 LEU A CD2 1 
ATOM   1653 N N   . PHE A 1 219 ? 2.406   63.373 38.744 1.00   12.79 ? 219 PHE A N   1 
ATOM   1654 C CA  . PHE A 1 219 ? 3.311   64.434 39.135 1.00   12.48 ? 219 PHE A CA  1 
ATOM   1655 C C   . PHE A 1 219 ? 4.664   64.186 38.479 1.00   14.45 ? 219 PHE A C   1 
ATOM   1656 O O   . PHE A 1 219 ? 4.929   63.079 38.033 1.00   15.85 ? 219 PHE A O   1 
ATOM   1657 C CB  . PHE A 1 219 ? 3.394   64.550 40.668 1.00   12.09 ? 219 PHE A CB  1 
ATOM   1658 C CG  . PHE A 1 219 ? 3.910   63.323 41.344 1.00   8.86  ? 219 PHE A CG  1 
ATOM   1659 C CD1 . PHE A 1 219 ? 3.073   62.267 41.595 1.00   7.39  ? 219 PHE A CD1 1 
ATOM   1660 C CD2 . PHE A 1 219 ? 5.259   63.201 41.631 1.00   7.39  ? 219 PHE A CD2 1 
ATOM   1661 C CE1 . PHE A 1 219 ? 3.576   61.115 42.105 1.00   11.06 ? 219 PHE A CE1 1 
ATOM   1662 C CE2 . PHE A 1 219 ? 5.766   62.050 42.141 1.00   7.83  ? 219 PHE A CE2 1 
ATOM   1663 C CZ  . PHE A 1 219 ? 4.932   61.003 42.378 1.00   8.38  ? 219 PHE A CZ  1 
ATOM   1664 N N   . ARG A 1 220 ? 5.525   65.199 38.472 1.00   14.66 ? 220 ARG A N   1 
ATOM   1665 C CA  . ARG A 1 220 ? 6.832   65.148 37.829 1.00   15.11 ? 220 ARG A CA  1 
ATOM   1666 C C   . ARG A 1 220 ? 8.021   64.920 38.743 1.00   17.25 ? 220 ARG A C   1 
ATOM   1667 O O   . ARG A 1 220 ? 8.829   64.027 38.529 1.00   18.59 ? 220 ARG A O   1 
ATOM   1668 C CB  . ARG A 1 220 ? 7.025   66.477 37.115 1.00   16.00 ? 220 ARG A CB  1 
ATOM   1669 C CG  . ARG A 1 220 ? 8.322   66.704 36.432 1.00   17.63 ? 220 ARG A CG  1 
ATOM   1670 C CD  . ARG A 1 220 ? 8.406   65.930 35.157 1.00   22.65 ? 220 ARG A CD  1 
ATOM   1671 N NE  . ARG A 1 220 ? 9.498   66.406 34.299 1.00   26.65 ? 220 ARG A NE  1 
ATOM   1672 C CZ  . ARG A 1 220 ? 9.360   67.314 33.334 1.00   24.75 ? 220 ARG A CZ  1 
ATOM   1673 N NH1 . ARG A 1 220 ? 8.189   67.878 33.102 1.00   22.51 ? 220 ARG A NH1 1 
ATOM   1674 N NH2 . ARG A 1 220 ? 10.371  67.553 32.515 1.00   24.30 ? 220 ARG A NH2 1 
ATOM   1675 N N   . ARG A 1 221 ? 8.172   65.802 39.711 1.00   18.01 ? 221 ARG A N   1 
ATOM   1676 C CA  . ARG A 1 221 ? 9.269   65.767 40.662 1.00   17.19 ? 221 ARG A CA  1 
ATOM   1677 C C   . ARG A 1 221 ? 8.724   65.695 42.060 1.00   16.30 ? 221 ARG A C   1 
ATOM   1678 O O   . ARG A 1 221 ? 7.562   66.014 42.270 1.00   16.06 ? 221 ARG A O   1 
ATOM   1679 C CB  . ARG A 1 221 ? 10.064  67.048 40.512 1.00   16.50 ? 221 ARG A CB  1 
ATOM   1680 C CG  . ARG A 1 221 ? 11.046  66.933 39.440 1.00   18.45 ? 221 ARG A CG  1 
ATOM   1681 C CD  . ARG A 1 221 ? 11.923  68.123 39.386 1.00   22.24 ? 221 ARG A CD  1 
ATOM   1682 N NE  . ARG A 1 221 ? 11.361  69.147 38.526 1.00   27.26 ? 221 ARG A NE  1 
ATOM   1683 C CZ  . ARG A 1 221 ? 11.366  69.098 37.200 1.00   25.54 ? 221 ARG A CZ  1 
ATOM   1684 N NH1 . ARG A 1 221 ? 11.912  68.073 36.573 1.00   24.48 ? 221 ARG A NH1 1 
ATOM   1685 N NH2 . ARG A 1 221 ? 10.804  70.081 36.511 1.00   26.93 ? 221 ARG A NH2 1 
ATOM   1686 N N   . ALA A 1 222 ? 9.584   65.382 43.026 1.00   16.59 ? 222 ALA A N   1 
ATOM   1687 C CA  . ALA A 1 222 ? 9.176   65.277 44.430 1.00   15.10 ? 222 ALA A CA  1 
ATOM   1688 C C   . ALA A 1 222 ? 10.183  65.836 45.407 1.00   15.74 ? 222 ALA A C   1 
ATOM   1689 O O   . ALA A 1 222 ? 11.381  65.685 45.238 1.00   16.26 ? 222 ALA A O   1 
ATOM   1690 C CB  . ALA A 1 222 ? 8.892   63.825 44.786 1.00   10.57 ? 222 ALA A CB  1 
ATOM   1691 N N   . ILE A 1 223 ? 9.688   66.496 46.441 1.00   17.25 ? 223 ILE A N   1 
ATOM   1692 C CA  . ILE A 1 223 ? 10.539  67.013 47.510 1.00   16.41 ? 223 ILE A CA  1 
ATOM   1693 C C   . ILE A 1 223 ? 10.025  66.344 48.778 1.00   16.85 ? 223 ILE A C   1 
ATOM   1694 O O   . ILE A 1 223 ? 8.837   66.446 49.089 1.00   16.45 ? 223 ILE A O   1 
ATOM   1695 C CB  . ILE A 1 223 ? 10.404  68.509 47.681 1.00   16.23 ? 223 ILE A CB  1 
ATOM   1696 C CG1 . ILE A 1 223 ? 10.948  69.228 46.450 1.00   16.07 ? 223 ILE A CG1 1 
ATOM   1697 C CG2 . ILE A 1 223 ? 11.142  68.944 48.942 1.00   15.62 ? 223 ILE A CG2 1 
ATOM   1698 C CD1 . ILE A 1 223 ? 10.736  70.694 46.462 1.00   13.79 ? 223 ILE A CD1 1 
ATOM   1699 N N   . LEU A 1 224 ? 10.885  65.602 49.463 1.00   16.03 ? 224 LEU A N   1 
ATOM   1700 C CA  . LEU A 1 224 ? 10.497  64.922 50.705 1.00   14.81 ? 224 LEU A CA  1 
ATOM   1701 C C   . LEU A 1 224 ? 11.215  65.557 51.900 1.00   15.04 ? 224 LEU A C   1 
ATOM   1702 O O   . LEU A 1 224 ? 12.440  65.565 51.949 1.00   15.30 ? 224 LEU A O   1 
ATOM   1703 C CB  . LEU A 1 224 ? 10.836  63.417 50.642 1.00   12.16 ? 224 LEU A CB  1 
ATOM   1704 C CG  . LEU A 1 224 ? 10.211  62.494 49.589 1.00   12.17 ? 224 LEU A CG  1 
ATOM   1705 C CD1 . LEU A 1 224 ? 10.984  62.614 48.295 1.00   9.77  ? 224 LEU A CD1 1 
ATOM   1706 C CD2 . LEU A 1 224 ? 10.258  61.077 50.055 1.00   10.67 ? 224 LEU A CD2 1 
ATOM   1707 N N   . GLN A 1 225 ? 10.468  66.112 52.849 1.00   15.97 ? 225 GLN A N   1 
ATOM   1708 C CA  . GLN A 1 225 ? 11.065  66.742 54.044 1.00   15.90 ? 225 GLN A CA  1 
ATOM   1709 C C   . GLN A 1 225 ? 10.835  65.949 55.336 1.00   15.04 ? 225 GLN A C   1 
ATOM   1710 O O   . GLN A 1 225 ? 9.702   65.771 55.756 1.00   16.11 ? 225 GLN A O   1 
ATOM   1711 C CB  . GLN A 1 225 ? 10.517  68.150 54.230 1.00   16.24 ? 225 GLN A CB  1 
ATOM   1712 C CG  . GLN A 1 225 ? 10.913  69.111 53.152 1.00   18.50 ? 225 GLN A CG  1 
ATOM   1713 C CD  . GLN A 1 225 ? 9.926   70.240 52.983 1.00   19.51 ? 225 GLN A CD  1 
ATOM   1714 O OE1 . GLN A 1 225 ? 9.577   70.608 51.869 1.00   22.81 ? 225 GLN A OE1 1 
ATOM   1715 N NE2 . GLN A 1 225 ? 9.482   70.810 54.083 1.00   20.16 ? 225 GLN A NE2 1 
ATOM   1716 N N   . SER A 1 226 ? 11.908  65.443 55.924 1.00   13.89 ? 226 SER A N   1 
ATOM   1717 C CA  . SER A 1 226 ? 11.862  64.702 57.174 1.00   15.05 ? 226 SER A CA  1 
ATOM   1718 C C   . SER A 1 226 ? 10.976  63.502 57.136 1.00   16.63 ? 226 SER A C   1 
ATOM   1719 O O   . SER A 1 226 ? 10.297  63.193 58.113 1.00   19.71 ? 226 SER A O   1 
ATOM   1720 C CB  . SER A 1 226 ? 11.440  65.603 58.352 1.00   14.13 ? 226 SER A CB  1 
ATOM   1721 O OG  . SER A 1 226 ? 12.366  66.650 58.599 1.00   12.91 ? 226 SER A OG  1 
ATOM   1722 N N   . GLY A 1 227 ? 10.991  62.790 56.028 1.00   16.72 ? 227 GLY A N   1 
ATOM   1723 C CA  . GLY A 1 227 ? 10.169  61.610 55.953 1.00   15.18 ? 227 GLY A CA  1 
ATOM   1724 C C   . GLY A 1 227 ? 10.394  60.853 54.678 1.00   16.45 ? 227 GLY A C   1 
ATOM   1725 O O   . GLY A 1 227 ? 10.827  61.418 53.686 1.00   17.47 ? 227 GLY A O   1 
ATOM   1726 N N   . SER A 1 228 ? 10.155  59.560 54.721 1.00   13.97 ? 228 SER A N   1 
ATOM   1727 C CA  . SER A 1 228 ? 10.305  58.752 53.556 1.00   14.23 ? 228 SER A CA  1 
ATOM   1728 C C   . SER A 1 228 ? 9.323   57.643 53.779 1.00   14.47 ? 228 SER A C   1 
ATOM   1729 O O   . SER A 1 228 ? 8.990   57.360 54.907 1.00   13.74 ? 228 SER A O   1 
ATOM   1730 C CB  . SER A 1 228 ? 11.723  58.270 53.428 1.00   13.50 ? 228 SER A CB  1 
ATOM   1731 O OG  . SER A 1 228 ? 12.043  57.487 54.517 1.00   16.36 ? 228 SER A OG  1 
ATOM   1732 N N   . PRO A 1 229 ? 8.826   57.014 52.705 1.00   14.56 ? 229 PRO A N   1 
ATOM   1733 C CA  . PRO A 1 229 ? 7.849   55.930 52.762 1.00   13.50 ? 229 PRO A CA  1 
ATOM   1734 C C   . PRO A 1 229 ? 8.217   54.797 53.663 1.00   13.34 ? 229 PRO A C   1 
ATOM   1735 O O   . PRO A 1 229 ? 7.344   54.110 54.153 1.00   12.28 ? 229 PRO A O   1 
ATOM   1736 C CB  . PRO A 1 229 ? 7.811   55.449 51.317 1.00   15.95 ? 229 PRO A CB  1 
ATOM   1737 C CG  . PRO A 1 229 ? 9.245   55.700 50.845 1.00   14.59 ? 229 PRO A CG  1 
ATOM   1738 C CD  . PRO A 1 229 ? 9.427   57.085 51.357 1.00   14.19 ? 229 PRO A CD  1 
ATOM   1739 N N   . ASN A 1 230 ? 9.519   54.573 53.822 1.00   14.01 ? 230 ASN A N   1 
ATOM   1740 C CA  . ASN A 1 230 ? 10.040  53.485 54.646 1.00   15.16 ? 230 ASN A CA  1 
ATOM   1741 C C   . ASN A 1 230 ? 10.286  53.780 56.142 1.00   16.04 ? 230 ASN A C   1 
ATOM   1742 O O   . ASN A 1 230 ? 10.889  52.972 56.848 1.00   17.85 ? 230 ASN A O   1 
ATOM   1743 C CB  . ASN A 1 230 ? 11.309  52.912 54.013 1.00   13.59 ? 230 ASN A CB  1 
ATOM   1744 C CG  . ASN A 1 230 ? 12.434  53.880 54.024 1.00   13.15 ? 230 ASN A CG  1 
ATOM   1745 O OD1 . ASN A 1 230 ? 12.259  55.023 53.679 1.00   15.93 ? 230 ASN A OD1 1 
ATOM   1746 N ND2 . ASN A 1 230 ? 13.604  53.438 54.443 1.00   16.19 ? 230 ASN A ND2 1 
ATOM   1747 N N   . CYS A 1 231 ? 9.864   54.934 56.633 1.00   16.43 ? 231 CYS A N   1 
ATOM   1748 C CA  . CYS A 1 231 ? 10.052  55.242 58.040 1.00   15.23 ? 231 CYS A CA  1 
ATOM   1749 C C   . CYS A 1 231 ? 9.248   54.183 58.815 1.00   16.31 ? 231 CYS A C   1 
ATOM   1750 O O   . CYS A 1 231 ? 8.145   53.814 58.406 1.00   17.79 ? 231 CYS A O   1 
ATOM   1751 C CB  . CYS A 1 231 ? 9.579   56.663 58.307 1.00   12.67 ? 231 CYS A CB  1 
ATOM   1752 S SG  . CYS A 1 231 ? 10.734  57.929 57.743 1.00   14.59 ? 231 CYS A SG  1 
ATOM   1753 N N   . PRO A 1 232 ? 9.787   53.666 59.925 1.00   15.04 ? 232 PRO A N   1 
ATOM   1754 C CA  . PRO A 1 232 ? 9.120   52.639 60.727 1.00   14.13 ? 232 PRO A CA  1 
ATOM   1755 C C   . PRO A 1 232 ? 7.741   52.948 61.245 1.00   14.48 ? 232 PRO A C   1 
ATOM   1756 O O   . PRO A 1 232 ? 6.980   52.049 61.568 1.00   15.77 ? 232 PRO A O   1 
ATOM   1757 C CB  . PRO A 1 232 ? 10.119  52.375 61.846 1.00   13.38 ? 232 PRO A CB  1 
ATOM   1758 C CG  . PRO A 1 232 ? 10.820  53.639 61.979 1.00   14.13 ? 232 PRO A CG  1 
ATOM   1759 C CD  . PRO A 1 232 ? 11.038  54.084 60.570 1.00   15.19 ? 232 PRO A CD  1 
ATOM   1760 N N   . TRP A 1 233 ? 7.419   54.221 61.334 1.00   14.50 ? 233 TRP A N   1 
ATOM   1761 C CA  . TRP A 1 233 ? 6.112   54.643 61.787 1.00   15.43 ? 233 TRP A CA  1 
ATOM   1762 C C   . TRP A 1 233 ? 5.171   54.900 60.615 1.00   18.18 ? 233 TRP A C   1 
ATOM   1763 O O   . TRP A 1 233 ? 3.993   55.168 60.821 1.00   20.57 ? 233 TRP A O   1 
ATOM   1764 C CB  . TRP A 1 233 ? 6.256   55.938 62.566 1.00   14.14 ? 233 TRP A CB  1 
ATOM   1765 C CG  . TRP A 1 233 ? 7.087   56.970 61.871 1.00   12.57 ? 233 TRP A CG  1 
ATOM   1766 C CD1 . TRP A 1 233 ? 8.424   57.178 62.010 1.00   12.46 ? 233 TRP A CD1 1 
ATOM   1767 C CD2 . TRP A 1 233 ? 6.632   57.919 60.921 1.00   13.42 ? 233 TRP A CD2 1 
ATOM   1768 N NE1 . TRP A 1 233 ? 8.832   58.201 61.199 1.00   10.91 ? 233 TRP A NE1 1 
ATOM   1769 C CE2 . TRP A 1 233 ? 7.749   58.671 60.514 1.00   12.26 ? 233 TRP A CE2 1 
ATOM   1770 C CE3 . TRP A 1 233 ? 5.384   58.200 60.358 1.00   13.50 ? 233 TRP A CE3 1 
ATOM   1771 C CZ2 . TRP A 1 233 ? 7.663   59.676 59.573 1.00   13.79 ? 233 TRP A CZ2 1 
ATOM   1772 C CZ3 . TRP A 1 233 ? 5.298   59.196 59.422 1.00   14.98 ? 233 TRP A CZ3 1 
ATOM   1773 C CH2 . TRP A 1 233 ? 6.433   59.926 59.034 1.00   15.41 ? 233 TRP A CH2 1 
ATOM   1774 N N   . ALA A 1 234 ? 5.699   54.835 59.389 1.00   17.55 ? 234 ALA A N   1 
ATOM   1775 C CA  . ALA A 1 234 ? 4.930   55.127 58.193 1.00   15.26 ? 234 ALA A CA  1 
ATOM   1776 C C   . ALA A 1 234 ? 3.977   54.094 57.668 1.00   14.86 ? 234 ALA A C   1 
ATOM   1777 O O   . ALA A 1 234 ? 3.091   54.448 56.938 1.00   14.37 ? 234 ALA A O   1 
ATOM   1778 C CB  . ALA A 1 234 ? 5.816   55.564 57.122 1.00   15.48 ? 234 ALA A CB  1 
ATOM   1779 N N   . SER A 1 235 ? 4.140   52.825 57.997 1.00   14.11 ? 235 SER A N   1 
ATOM   1780 C CA  . SER A 1 235 ? 3.182   51.865 57.498 1.00   14.50 ? 235 SER A CA  1 
ATOM   1781 C C   . SER A 1 235 ? 3.081   50.650 58.403 1.00   16.05 ? 235 SER A C   1 
ATOM   1782 O O   . SER A 1 235 ? 3.926   50.466 59.261 1.00   16.81 ? 235 SER A O   1 
ATOM   1783 C CB  . SER A 1 235 ? 3.597   51.427 56.113 1.00   13.94 ? 235 SER A CB  1 
ATOM   1784 O OG  . SER A 1 235 ? 4.788   50.674 56.186 1.00   15.81 ? 235 SER A OG  1 
ATOM   1785 N N   . VAL A 1 236 ? 2.049   49.831 58.208 1.00   16.47 ? 236 VAL A N   1 
ATOM   1786 C CA  . VAL A 1 236 ? 1.860   48.595 58.965 1.00   17.79 ? 236 VAL A CA  1 
ATOM   1787 C C   . VAL A 1 236 ? 1.423   47.464 58.039 1.00   19.15 ? 236 VAL A C   1 
ATOM   1788 O O   . VAL A 1 236 ? 0.968   47.717 56.928 1.00   21.39 ? 236 VAL A O   1 
ATOM   1789 C CB  . VAL A 1 236 ? 0.800   48.716 60.085 1.00   17.41 ? 236 VAL A CB  1 
ATOM   1790 C CG1 . VAL A 1 236 ? 1.306   49.613 61.188 1.00   18.70 ? 236 VAL A CG1 1 
ATOM   1791 C CG2 . VAL A 1 236 ? -0.527  49.201 59.552 1.00   14.89 ? 236 VAL A CG2 1 
ATOM   1792 N N   . SER A 1 237 ? 1.601   46.221 58.470 1.00   18.58 ? 237 SER A N   1 
ATOM   1793 C CA  . SER A 1 237 ? 1.186   45.076 57.679 1.00   18.78 ? 237 SER A CA  1 
ATOM   1794 C C   . SER A 1 237 ? -0.325  45.098 57.665 1.00   19.57 ? 237 SER A C   1 
ATOM   1795 O O   . SER A 1 237 ? -0.923  45.817 58.459 1.00   18.72 ? 237 SER A O   1 
ATOM   1796 C CB  . SER A 1 237 ? 1.642   43.807 58.357 1.00   19.78 ? 237 SER A CB  1 
ATOM   1797 O OG  . SER A 1 237 ? 1.101   43.756 59.666 1.00   23.87 ? 237 SER A OG  1 
ATOM   1798 N N   . VAL A 1 238 ? -0.954  44.306 56.800 1.00   19.63 ? 238 VAL A N   1 
ATOM   1799 C CA  . VAL A 1 238 ? -2.406  44.297 56.754 1.00   20.34 ? 238 VAL A CA  1 
ATOM   1800 C C   . VAL A 1 238 ? -2.932  43.668 58.010 1.00   20.06 ? 238 VAL A C   1 
ATOM   1801 O O   . VAL A 1 238 ? -3.954  44.077 58.523 1.00   20.87 ? 238 VAL A O   1 
ATOM   1802 C CB  . VAL A 1 238 ? -2.956  43.543 55.542 1.00   22.04 ? 238 VAL A CB  1 
ATOM   1803 C CG1 . VAL A 1 238 ? -2.513  44.226 54.246 1.00   23.52 ? 238 VAL A CG1 1 
ATOM   1804 C CG2 . VAL A 1 238 ? -2.475  42.122 55.557 1.00   24.12 ? 238 VAL A CG2 1 
ATOM   1805 N N   . ALA A 1 239 ? -2.214  42.687 58.532 1.00   20.50 ? 239 ALA A N   1 
ATOM   1806 C CA  . ALA A 1 239 ? -2.637  42.021 59.761 1.00   20.73 ? 239 ALA A CA  1 
ATOM   1807 C C   . ALA A 1 239 ? -2.623  43.006 60.907 1.00   21.55 ? 239 ALA A C   1 
ATOM   1808 O O   . ALA A 1 239 ? -3.583  43.104 61.659 1.00   22.47 ? 239 ALA A O   1 
ATOM   1809 C CB  . ALA A 1 239 ? -1.728  40.873 60.077 1.00   21.44 ? 239 ALA A CB  1 
ATOM   1810 N N   . GLU A 1 240 ? -1.540  43.759 61.023 1.00   20.87 ? 240 GLU A N   1 
ATOM   1811 C CA  . GLU A 1 240 ? -1.431  44.739 62.073 1.00   20.16 ? 240 GLU A CA  1 
ATOM   1812 C C   . GLU A 1 240 ? -2.542  45.747 61.949 1.00   19.99 ? 240 GLU A C   1 
ATOM   1813 O O   . GLU A 1 240 ? -3.220  46.029 62.925 1.00   21.36 ? 240 GLU A O   1 
ATOM   1814 C CB  . GLU A 1 240 ? -0.080  45.425 62.017 1.00   20.89 ? 240 GLU A CB  1 
ATOM   1815 C CG  . GLU A 1 240 ? 0.129   46.463 63.111 1.00   25.33 ? 240 GLU A CG  1 
ATOM   1816 C CD  . GLU A 1 240 ? -0.162  45.943 64.501 1.00   23.76 ? 240 GLU A CD  1 
ATOM   1817 O OE1 . GLU A 1 240 ? 0.182   44.809 64.812 1.00   25.58 ? 240 GLU A OE1 1 
ATOM   1818 O OE2 . GLU A 1 240 ? -0.750  46.671 65.291 1.00   23.51 ? 240 GLU A OE2 1 
ATOM   1819 N N   . GLY A 1 241 ? -2.770  46.255 60.746 1.00   19.91 ? 241 GLY A N   1 
ATOM   1820 C CA  . GLY A 1 241 ? -3.820  47.237 60.539 1.00   18.25 ? 241 GLY A CA  1 
ATOM   1821 C C   . GLY A 1 241 ? -5.179  46.695 60.891 1.00   17.87 ? 241 GLY A C   1 
ATOM   1822 O O   . GLY A 1 241 ? -6.061  47.423 61.321 1.00   15.81 ? 241 GLY A O   1 
ATOM   1823 N N   . ARG A 1 242 ? -5.358  45.401 60.686 1.00   19.84 ? 242 ARG A N   1 
ATOM   1824 C CA  . ARG A 1 242 ? -6.622  44.746 61.009 1.00   21.05 ? 242 ARG A CA  1 
ATOM   1825 C C   . ARG A 1 242 ? -6.765  44.665 62.530 1.00   21.15 ? 242 ARG A C   1 
ATOM   1826 O O   . ARG A 1 242 ? -7.829  44.979 63.077 1.00   20.17 ? 242 ARG A O   1 
ATOM   1827 C CB  . ARG A 1 242 ? -6.638  43.342 60.413 1.00   23.64 ? 242 ARG A CB  1 
ATOM   1828 C CG  . ARG A 1 242 ? -7.948  42.595 60.630 1.00   28.17 ? 242 ARG A CG  1 
ATOM   1829 C CD  . ARG A 1 242 ? -8.062  41.398 59.683 1.00   30.32 ? 242 ARG A CD  1 
ATOM   1830 N NE  . ARG A 1 242 ? -8.684  41.710 58.391 1.00   30.25 ? 242 ARG A NE  1 
ATOM   1831 C CZ  . ARG A 1 242 ? -9.997  41.872 58.213 1.00   30.60 ? 242 ARG A CZ  1 
ATOM   1832 N NH1 . ARG A 1 242 ? -10.830 41.822 59.235 1.00   29.86 ? 242 ARG A NH1 1 
ATOM   1833 N NH2 . ARG A 1 242 ? -10.486 42.139 57.010 1.00   31.43 ? 242 ARG A NH2 1 
ATOM   1834 N N   . ARG A 1 243 ? -5.673  44.268 63.200 1.00   20.82 ? 243 ARG A N   1 
ATOM   1835 C CA  . ARG A 1 243 ? -5.616  44.141 64.647 1.00   20.48 ? 243 ARG A CA  1 
ATOM   1836 C C   . ARG A 1 243 ? -6.029  45.429 65.283 1.00   19.46 ? 243 ARG A C   1 
ATOM   1837 O O   . ARG A 1 243 ? -7.001  45.470 66.009 1.00   22.06 ? 243 ARG A O   1 
ATOM   1838 C CB  . ARG A 1 243 ? -4.219  43.801 65.081 1.00   21.23 ? 243 ARG A CB  1 
ATOM   1839 C CG  . ARG A 1 243 ? -4.096  43.504 66.533 1.00   22.78 ? 243 ARG A CG  1 
ATOM   1840 C CD  . ARG A 1 243 ? -2.791  44.089 67.086 1.00   26.18 ? 243 ARG A CD  1 
ATOM   1841 N NE  . ARG A 1 243 ? -3.134  44.755 68.334 1.00   31.64 ? 243 ARG A NE  1 
ATOM   1842 C CZ  . ARG A 1 243 ? -2.734  45.960 68.716 1.00   33.33 ? 243 ARG A CZ  1 
ATOM   1843 N NH1 . ARG A 1 243 ? -1.915  46.695 67.967 1.00   32.65 ? 243 ARG A NH1 1 
ATOM   1844 N NH2 . ARG A 1 243 ? -3.280  46.490 69.814 1.00   38.00 ? 243 ARG A NH2 1 
ATOM   1845 N N   . ARG A 1 244 ? -5.349  46.505 64.944 1.00   18.78 ? 244 ARG A N   1 
ATOM   1846 C CA  . ARG A 1 244 ? -5.683  47.820 65.472 1.00   17.80 ? 244 ARG A CA  1 
ATOM   1847 C C   . ARG A 1 244 ? -7.089  48.256 65.107 1.00   20.33 ? 244 ARG A C   1 
ATOM   1848 O O   . ARG A 1 244 ? -7.679  49.069 65.817 1.00   24.05 ? 244 ARG A O   1 
ATOM   1849 C CB  . ARG A 1 244 ? -4.705  48.881 64.976 1.00   13.46 ? 244 ARG A CB  1 
ATOM   1850 C CG  . ARG A 1 244 ? -3.248  48.484 65.050 1.00   8.88  ? 244 ARG A CG  1 
ATOM   1851 C CD  . ARG A 1 244 ? -2.367  49.659 64.739 1.00   8.23  ? 244 ARG A CD  1 
ATOM   1852 N NE  . ARG A 1 244 ? -0.974  49.324 64.891 1.00   6.73  ? 244 ARG A NE  1 
ATOM   1853 C CZ  . ARG A 1 244 ? 0.016   50.147 64.629 1.00   9.16  ? 244 ARG A CZ  1 
ATOM   1854 N NH1 . ARG A 1 244 ? -0.227  51.362 64.209 1.00   8.09  ? 244 ARG A NH1 1 
ATOM   1855 N NH2 . ARG A 1 244 ? 1.250   49.742 64.791 1.00   8.23  ? 244 ARG A NH2 1 
ATOM   1856 N N   . ALA A 1 245 ? -7.603  47.792 63.968 1.00   22.51 ? 245 ALA A N   1 
ATOM   1857 C CA  . ALA A 1 245 ? -8.954  48.146 63.510 1.00   23.67 ? 245 ALA A CA  1 
ATOM   1858 C C   . ALA A 1 245 ? -9.938  47.485 64.438 1.00   24.35 ? 245 ALA A C   1 
ATOM   1859 O O   . ALA A 1 245 ? -10.924 48.093 64.849 1.00   23.05 ? 245 ALA A O   1 
ATOM   1860 C CB  . ALA A 1 245 ? -9.185  47.632 62.115 1.00   24.48 ? 245 ALA A CB  1 
ATOM   1861 N N   . VAL A 1 246 ? -9.688  46.211 64.727 1.00   25.10 ? 246 VAL A N   1 
ATOM   1862 C CA  . VAL A 1 246 ? -10.546 45.458 65.616 1.00   26.70 ? 246 VAL A CA  1 
ATOM   1863 C C   . VAL A 1 246 ? -10.481 46.063 66.990 1.00   27.19 ? 246 VAL A C   1 
ATOM   1864 O O   . VAL A 1 246 ? -11.514 46.384 67.576 1.00   28.10 ? 246 VAL A O   1 
ATOM   1865 C CB  . VAL A 1 246 ? -10.095 44.034 65.735 1.00   27.60 ? 246 VAL A CB  1 
ATOM   1866 C CG1 . VAL A 1 246 ? -10.881 43.356 66.834 1.00   26.97 ? 246 VAL A CG1 1 
ATOM   1867 C CG2 . VAL A 1 246 ? -10.322 43.326 64.396 1.00   28.14 ? 246 VAL A CG2 1 
ATOM   1868 N N   . GLU A 1 247 ? -9.257  46.243 67.487 1.00   26.33 ? 247 GLU A N   1 
ATOM   1869 C CA  . GLU A 1 247 ? -9.014  46.812 68.801 1.00   25.55 ? 247 GLU A CA  1 
ATOM   1870 C C   . GLU A 1 247 ? -9.729  48.120 68.971 1.00   25.17 ? 247 GLU A C   1 
ATOM   1871 O O   . GLU A 1 247 ? -10.295 48.380 70.021 1.00   26.25 ? 247 GLU A O   1 
ATOM   1872 C CB  . GLU A 1 247 ? -7.540  47.017 68.998 1.00   27.64 ? 247 GLU A CB  1 
ATOM   1873 C CG  . GLU A 1 247 ? -7.053  46.619 70.341 1.00   34.16 ? 247 GLU A CG  1 
ATOM   1874 C CD  . GLU A 1 247 ? -7.609  45.272 70.801 1.00   39.18 ? 247 GLU A CD  1 
ATOM   1875 O OE1 . GLU A 1 247 ? -7.763  44.356 69.949 1.00   40.88 ? 247 GLU A OE1 1 
ATOM   1876 O OE2 . GLU A 1 247 ? -7.891  45.113 72.032 1.00   42.37 ? 247 GLU A OE2 1 
ATOM   1877 N N   . LEU A 1 248 ? -9.751  48.950 67.940 1.00   24.55 ? 248 LEU A N   1 
ATOM   1878 C CA  . LEU A 1 248 ? -10.451 50.213 68.074 1.00   23.68 ? 248 LEU A CA  1 
ATOM   1879 C C   . LEU A 1 248 ? -11.884 49.840 68.315 1.00   23.33 ? 248 LEU A C   1 
ATOM   1880 O O   . LEU A 1 248 ? -12.523 50.411 69.172 1.00   25.29 ? 248 LEU A O   1 
ATOM   1881 C CB  . LEU A 1 248 ? -10.353 51.068 66.822 1.00   22.29 ? 248 LEU A CB  1 
ATOM   1882 C CG  . LEU A 1 248 ? -11.004 52.434 67.032 1.00   21.73 ? 248 LEU A CG  1 
ATOM   1883 C CD1 . LEU A 1 248 ? -9.998  53.364 67.621 1.00   22.35 ? 248 LEU A CD1 1 
ATOM   1884 C CD2 . LEU A 1 248 ? -11.496 52.997 65.720 1.00   23.89 ? 248 LEU A CD2 1 
ATOM   1885 N N   . GLY A 1 249 ? -12.372 48.823 67.620 1.00   23.57 ? 249 GLY A N   1 
ATOM   1886 C CA  . GLY A 1 249 ? -13.757 48.401 67.808 1.00   24.06 ? 249 GLY A CA  1 
ATOM   1887 C C   . GLY A 1 249 ? -14.038 47.991 69.244 1.00   25.08 ? 249 GLY A C   1 
ATOM   1888 O O   . GLY A 1 249 ? -15.076 48.334 69.827 1.00   24.68 ? 249 GLY A O   1 
ATOM   1889 N N   . ARG A 1 250 ? -13.106 47.252 69.822 1.00   25.92 ? 250 ARG A N   1 
ATOM   1890 C CA  . ARG A 1 250 ? -13.237 46.804 71.196 1.00   27.56 ? 250 ARG A CA  1 
ATOM   1891 C C   . ARG A 1 250 ? -13.437 48.046 72.106 1.00   27.73 ? 250 ARG A C   1 
ATOM   1892 O O   . ARG A 1 250 ? -14.445 48.165 72.790 1.00   28.85 ? 250 ARG A O   1 
ATOM   1893 C CB  . ARG A 1 250 ? -11.981 46.015 71.572 1.00   28.15 ? 250 ARG A CB  1 
ATOM   1894 C CG  . ARG A 1 250 ? -12.229 44.741 72.351 1.00   30.48 ? 250 ARG A CG  1 
ATOM   1895 C CD  . ARG A 1 250 ? -11.000 43.836 72.350 1.00   32.41 ? 250 ARG A CD  1 
ATOM   1896 N NE  . ARG A 1 250 ? -10.787 43.190 71.047 1.00   34.35 ? 250 ARG A NE  1 
ATOM   1897 N N   . ASN A 1 251 ? -12.539 49.021 72.024 1.00   27.05 ? 251 ASN A N   1 
ATOM   1898 C CA  . ASN A 1 251 ? -12.644 50.243 72.825 1.00   27.01 ? 251 ASN A CA  1 
ATOM   1899 C C   . ASN A 1 251 ? -13.966 50.995 72.657 1.00   28.49 ? 251 ASN A C   1 
ATOM   1900 O O   . ASN A 1 251 ? -14.205 51.987 73.358 1.00   29.72 ? 251 ASN A O   1 
ATOM   1901 C CB  . ASN A 1 251 ? -11.535 51.211 72.441 1.00   25.08 ? 251 ASN A CB  1 
ATOM   1902 C CG  . ASN A 1 251 ? -10.191 50.799 72.956 1.00   25.04 ? 251 ASN A CG  1 
ATOM   1903 O OD1 . ASN A 1 251 ? -9.640  51.465 73.830 1.00   28.17 ? 251 ASN A OD1 1 
ATOM   1904 N ND2 . ASN A 1 251 ? -9.630  49.737 72.406 1.00   22.49 ? 251 ASN A ND2 1 
ATOM   1905 N N   . LEU A 1 252 ? -14.772 50.620 71.664 1.00   29.39 ? 252 LEU A N   1 
ATOM   1906 C CA  . LEU A 1 252 ? -16.049 51.312 71.433 1.00   29.96 ? 252 LEU A CA  1 
ATOM   1907 C C   . LEU A 1 252 ? -17.219 50.349 71.580 1.00   29.94 ? 252 LEU A C   1 
ATOM   1908 O O   . LEU A 1 252 ? -18.369 50.688 71.354 1.00   29.88 ? 252 LEU A O   1 
ATOM   1909 C CB  . LEU A 1 252 ? -16.062 52.020 70.076 1.00   29.29 ? 252 LEU A CB  1 
ATOM   1910 C CG  . LEU A 1 252 ? -14.991 53.106 69.928 1.00   29.61 ? 252 LEU A CG  1 
ATOM   1911 C CD1 . LEU A 1 252 ? -14.822 53.498 68.461 1.00   30.39 ? 252 LEU A CD1 1 
ATOM   1912 C CD2 . LEU A 1 252 ? -15.333 54.329 70.758 1.00   29.69 ? 252 LEU A CD2 1 
ATOM   1913 N N   . ASN A 1 253 ? -16.913 49.138 72.005 1.00   31.24 ? 253 ASN A N   1 
ATOM   1914 C CA  . ASN A 1 253 ? -17.947 48.160 72.257 1.00   33.36 ? 253 ASN A CA  1 
ATOM   1915 C C   . ASN A 1 253 ? -18.758 47.927 71.032 1.00   33.67 ? 253 ASN A C   1 
ATOM   1916 O O   . ASN A 1 253 ? -19.982 48.103 71.033 1.00   34.81 ? 253 ASN A O   1 
ATOM   1917 C CB  . ASN A 1 253 ? -18.825 48.656 73.398 1.00   34.48 ? 253 ASN A CB  1 
ATOM   1918 C CG  . ASN A 1 253 ? -18.011 48.940 74.646 1.00   35.74 ? 253 ASN A CG  1 
ATOM   1919 O OD1 . ASN A 1 253 ? -17.106 48.161 74.991 1.00   37.32 ? 253 ASN A OD1 1 
ATOM   1920 N ND2 . ASN A 1 253 ? -18.253 50.089 75.280 1.00   34.77 ? 253 ASN A ND2 1 
ATOM   1921 N N   . CYS A 1 254 ? -18.046 47.608 69.959 1.00   34.95 ? 254 CYS A N   1 
ATOM   1922 C CA  . CYS A 1 254 ? -18.665 47.318 68.678 1.00   34.08 ? 254 CYS A CA  1 
ATOM   1923 C C   . CYS A 1 254 ? -18.758 45.824 68.597 1.00   34.48 ? 254 CYS A C   1 
ATOM   1924 O O   . CYS A 1 254 ? -17.860 45.114 69.077 1.00   33.76 ? 254 CYS A O   1 
ATOM   1925 C CB  . CYS A 1 254 ? -17.752 47.711 67.534 1.00   32.99 ? 254 CYS A CB  1 
ATOM   1926 S SG  . CYS A 1 254 ? -17.633 49.467 67.259 1.00   30.55 ? 254 CYS A SG  1 
ATOM   1927 N N   . ASN A 1 255 ? -19.776 45.362 67.871 1.00   35.67 ? 255 ASN A N   1 
ATOM   1928 C CA  . ASN A 1 255 ? -19.961 43.937 67.634 1.00   34.53 ? 255 ASN A CA  1 
ATOM   1929 C C   . ASN A 1 255 ? -18.709 43.663 66.857 1.00   33.17 ? 255 ASN A C   1 
ATOM   1930 O O   . ASN A 1 255 ? -18.367 44.455 65.972 1.00   32.65 ? 255 ASN A O   1 
ATOM   1931 C CB  . ASN A 1 255 ? -21.145 43.718 66.715 1.00   36.99 ? 255 ASN A CB  1 
ATOM   1932 C CG  . ASN A 1 255 ? -21.442 42.257 66.515 1.00   38.97 ? 255 ASN A CG  1 
ATOM   1933 O OD1 . ASN A 1 255 ? -20.651 41.514 65.890 1.00   39.71 ? 255 ASN A OD1 1 
ATOM   1934 N ND2 . ASN A 1 255 ? -22.568 41.808 67.073 1.00   41.49 ? 255 ASN A ND2 1 
ATOM   1935 N N   . LEU A 1 256 ? -17.959 42.649 67.247 1.00   31.96 ? 256 LEU A N   1 
ATOM   1936 C CA  . LEU A 1 256 ? -16.730 42.344 66.537 1.00   31.53 ? 256 LEU A CA  1 
ATOM   1937 C C   . LEU A 1 256 ? -16.825 41.010 65.845 1.00   32.90 ? 256 LEU A C   1 
ATOM   1938 O O   . LEU A 1 256 ? -15.796 40.372 65.575 1.00   34.95 ? 256 LEU A O   1 
ATOM   1939 C CB  . LEU A 1 256 ? -15.566 42.275 67.498 1.00   29.56 ? 256 LEU A CB  1 
ATOM   1940 C CG  . LEU A 1 256 ? -15.017 43.540 68.099 1.00   28.37 ? 256 LEU A CG  1 
ATOM   1941 C CD1 . LEU A 1 256 ? -13.759 43.150 68.860 1.00   28.22 ? 256 LEU A CD1 1 
ATOM   1942 C CD2 . LEU A 1 256 ? -14.686 44.507 66.988 1.00   29.22 ? 256 LEU A CD2 1 
ATOM   1943 N N   . ASN A 1 257 ? -18.040 40.567 65.559 1.00   33.34 ? 257 ASN A N   1 
ATOM   1944 C CA  . ASN A 1 257 ? -18.205 39.274 64.924 1.00   34.26 ? 257 ASN A CA  1 
ATOM   1945 C C   . ASN A 1 257 ? -17.872 39.283 63.450 1.00   34.43 ? 257 ASN A C   1 
ATOM   1946 O O   . ASN A 1 257 ? -17.604 38.217 62.886 1.00   35.92 ? 257 ASN A O   1 
ATOM   1947 C CB  . ASN A 1 257 ? -19.626 38.760 65.125 1.00   35.50 ? 257 ASN A CB  1 
ATOM   1948 N N   . SER A 1 258 ? -17.849 40.465 62.822 1.00   34.36 ? 258 SER A N   1 
ATOM   1949 C CA  . SER A 1 258 ? -17.569 40.548 61.383 1.00   32.59 ? 258 SER A CA  1 
ATOM   1950 C C   . SER A 1 258 ? -17.148 41.940 60.976 1.00   32.58 ? 258 SER A C   1 
ATOM   1951 O O   . SER A 1 258 ? -17.619 42.914 61.571 1.00   32.37 ? 258 SER A O   1 
ATOM   1952 C CB  . SER A 1 258 ? -18.851 40.264 60.626 1.00   32.89 ? 258 SER A CB  1 
ATOM   1953 O OG  . SER A 1 258 ? -19.769 41.332 60.877 1.00   32.20 ? 258 SER A OG  1 
ATOM   1954 N N   . ASP A 1 259 ? -16.400 42.053 59.871 1.00   32.68 ? 259 ASP A N   1 
ATOM   1955 C CA  . ASP A 1 259 ? -15.976 43.371 59.392 1.00   32.84 ? 259 ASP A CA  1 
ATOM   1956 C C   . ASP A 1 259 ? -17.189 44.252 59.182 1.00   32.86 ? 259 ASP A C   1 
ATOM   1957 O O   . ASP A 1 259 ? -17.152 45.424 59.495 1.00   34.08 ? 259 ASP A O   1 
ATOM   1958 C CB  . ASP A 1 259 ? -15.203 43.311 58.069 1.00   31.69 ? 259 ASP A CB  1 
ATOM   1959 C CG  . ASP A 1 259 ? -13.825 42.690 58.209 1.00   33.07 ? 259 ASP A CG  1 
ATOM   1960 O OD1 . ASP A 1 259 ? -13.437 42.276 59.328 1.00   34.49 ? 259 ASP A OD1 1 
ATOM   1961 O OD2 . ASP A 1 259 ? -13.118 42.578 57.182 1.00   33.12 ? 259 ASP A OD2 1 
ATOM   1962 N N   . GLU A 1 260 ? -18.286 43.688 58.709 1.00   33.50 ? 260 GLU A N   1 
ATOM   1963 C CA  . GLU A 1 260 ? -19.479 44.500 58.439 1.00   34.23 ? 260 GLU A CA  1 
ATOM   1964 C C   . GLU A 1 260 ? -20.079 45.061 59.704 1.00   33.59 ? 260 GLU A C   1 
ATOM   1965 O O   . GLU A 1 260 ? -20.442 46.241 59.753 1.00   33.49 ? 260 GLU A O   1 
ATOM   1966 C CB  . GLU A 1 260 ? -20.538 43.703 57.662 1.00   36.53 ? 260 GLU A CB  1 
ATOM   1967 C CG  . GLU A 1 260 ? -19.988 42.994 56.402 1.00   39.24 ? 260 GLU A CG  1 
ATOM   1968 C CD  . GLU A 1 260 ? -19.133 41.739 56.714 1.00   38.20 ? 260 GLU A CD  1 
ATOM   1969 N N   . GLU A 1 261 ? -20.218 44.216 60.722 1.00   33.70 ? 261 GLU A N   1 
ATOM   1970 C CA  . GLU A 1 261 ? -20.767 44.679 61.997 1.00   33.71 ? 261 GLU A CA  1 
ATOM   1971 C C   . GLU A 1 261 ? -19.773 45.697 62.558 1.00   32.47 ? 261 GLU A C   1 
ATOM   1972 O O   . GLU A 1 261 ? -20.157 46.802 62.980 1.00   31.70 ? 261 GLU A O   1 
ATOM   1973 C CB  . GLU A 1 261 ? -20.919 43.512 62.959 1.00   37.35 ? 261 GLU A CB  1 
ATOM   1974 C CG  . GLU A 1 261 ? -21.872 42.431 62.465 1.00   41.66 ? 261 GLU A CG  1 
ATOM   1975 C CD  . GLU A 1 261 ? -23.326 42.732 62.779 1.00   45.50 ? 261 GLU A CD  1 
ATOM   1976 O OE1 . GLU A 1 261 ? -23.750 43.924 62.665 1.00   46.49 ? 261 GLU A OE1 1 
ATOM   1977 O OE2 . GLU A 1 261 ? -24.052 41.754 63.146 1.00   48.08 ? 261 GLU A OE2 1 
ATOM   1978 N N   . LEU A 1 262 ? -18.489 45.366 62.448 1.00   30.54 ? 262 LEU A N   1 
ATOM   1979 C CA  . LEU A 1 262 ? -17.423 46.239 62.924 1.00   29.11 ? 262 LEU A CA  1 
ATOM   1980 C C   . LEU A 1 262 ? -17.474 47.586 62.225 1.00   28.78 ? 262 LEU A C   1 
ATOM   1981 O O   . LEU A 1 262 ? -17.684 48.610 62.867 1.00   28.76 ? 262 LEU A O   1 
ATOM   1982 C CB  . LEU A 1 262 ? -16.065 45.559 62.728 1.00   28.46 ? 262 LEU A CB  1 
ATOM   1983 C CG  . LEU A 1 262 ? -14.765 46.283 63.090 1.00   28.53 ? 262 LEU A CG  1 
ATOM   1984 C CD1 . LEU A 1 262 ? -14.906 47.137 64.305 1.00   28.23 ? 262 LEU A CD1 1 
ATOM   1985 C CD2 . LEU A 1 262 ? -13.708 45.235 63.315 1.00   28.81 ? 262 LEU A CD2 1 
ATOM   1986 N N   . ILE A 1 263 ? -17.421 47.587 60.900 1.00   30.02 ? 263 ILE A N   1 
ATOM   1987 C CA  . ILE A 1 263 ? -17.441 48.844 60.153 1.00   30.92 ? 263 ILE A CA  1 
ATOM   1988 C C   . ILE A 1 263 ? -18.725 49.568 60.425 1.00   30.96 ? 263 ILE A C   1 
ATOM   1989 O O   . ILE A 1 263 ? -18.732 50.776 60.631 1.00   30.49 ? 263 ILE A O   1 
ATOM   1990 C CB  . ILE A 1 263 ? -17.339 48.649 58.631 1.00   30.49 ? 263 ILE A CB  1 
ATOM   1991 C CG1 . ILE A 1 263 ? -15.988 48.046 58.272 1.00   30.10 ? 263 ILE A CG1 1 
ATOM   1992 C CG2 . ILE A 1 263 ? -17.519 49.977 57.914 1.00   28.19 ? 263 ILE A CG2 1 
ATOM   1993 C CD1 . ILE A 1 263 ? -15.979 47.437 56.900 1.00   30.88 ? 263 ILE A CD1 1 
ATOM   1994 N N   . HIS A 1 264 ? -19.830 48.848 60.464 1.00   32.59 ? 264 HIS A N   1 
ATOM   1995 C CA  . HIS A 1 264 ? -21.062 49.569 60.699 1.00   34.48 ? 264 HIS A CA  1 
ATOM   1996 C C   . HIS A 1 264 ? -21.050 50.231 62.063 1.00   32.74 ? 264 HIS A C   1 
ATOM   1997 O O   . HIS A 1 264 ? -21.480 51.373 62.195 1.00   32.74 ? 264 HIS A O   1 
ATOM   1998 C CB  . HIS A 1 264 ? -22.299 48.679 60.532 1.00   39.21 ? 264 HIS A CB  1 
ATOM   1999 C CG  . HIS A 1 264 ? -23.573 49.341 60.968 1.00   44.77 ? 264 HIS A CG  1 
ATOM   2000 N ND1 . HIS A 1 264 ? -24.632 48.637 61.507 1.00   46.91 ? 264 HIS A ND1 1 
ATOM   2001 C CD2 . HIS A 1 264 ? -23.930 50.654 61.020 1.00   47.14 ? 264 HIS A CD2 1 
ATOM   2002 C CE1 . HIS A 1 264 ? -25.581 49.487 61.887 1.00   47.76 ? 264 HIS A CE1 1 
ATOM   2003 N NE2 . HIS A 1 264 ? -25.176 50.718 61.600 1.00   47.43 ? 264 HIS A NE2 1 
ATOM   2004 N N   . CYS A 1 265 ? -20.514 49.555 63.074 1.00   31.34 ? 265 CYS A N   1 
ATOM   2005 C CA  . CYS A 1 265 ? -20.522 50.139 64.413 1.00   29.03 ? 265 CYS A CA  1 
ATOM   2006 C C   . CYS A 1 265 ? -19.684 51.386 64.395 1.00   27.31 ? 265 CYS A C   1 
ATOM   2007 O O   . CYS A 1 265 ? -20.143 52.467 64.788 1.00   26.69 ? 265 CYS A O   1 
ATOM   2008 C CB  . CYS A 1 265 ? -19.985 49.140 65.432 1.00   30.83 ? 265 CYS A CB  1 
ATOM   2009 S SG  . CYS A 1 265 ? -19.581 49.880 67.046 1.00   31.33 ? 265 CYS A SG  1 
ATOM   2010 N N   . LEU A 1 266 ? -18.497 51.266 63.811 1.00   25.70 ? 266 LEU A N   1 
ATOM   2011 C CA  . LEU A 1 266 ? -17.587 52.395 63.736 1.00   23.63 ? 266 LEU A CA  1 
ATOM   2012 C C   . LEU A 1 266 ? -18.193 53.547 62.948 1.00   24.30 ? 266 LEU A C   1 
ATOM   2013 O O   . LEU A 1 266 ? -17.829 54.697 63.154 1.00   26.63 ? 266 LEU A O   1 
ATOM   2014 C CB  . LEU A 1 266 ? -16.239 51.971 63.160 1.00   21.81 ? 266 LEU A CB  1 
ATOM   2015 C CG  . LEU A 1 266 ? -15.401 50.943 63.927 1.00   20.04 ? 266 LEU A CG  1 
ATOM   2016 C CD1 . LEU A 1 266 ? -14.070 50.831 63.291 1.00   20.53 ? 266 LEU A CD1 1 
ATOM   2017 C CD2 . LEU A 1 266 ? -15.203 51.356 65.360 1.00   20.74 ? 266 LEU A CD2 1 
ATOM   2018 N N   . ARG A 1 267 ? -19.181 53.281 62.111 1.00   24.86 ? 267 ARG A N   1 
ATOM   2019 C CA  . ARG A 1 267 ? -19.778 54.380 61.356 1.00   25.69 ? 267 ARG A CA  1 
ATOM   2020 C C   . ARG A 1 267 ? -20.882 55.127 62.100 1.00   27.33 ? 267 ARG A C   1 
ATOM   2021 O O   . ARG A 1 267 ? -21.278 56.231 61.702 1.00   27.74 ? 267 ARG A O   1 
ATOM   2022 C CB  . ARG A 1 267 ? -20.285 53.902 60.006 1.00   24.78 ? 267 ARG A CB  1 
ATOM   2023 C CG  . ARG A 1 267 ? -19.181 53.557 59.027 1.00   24.30 ? 267 ARG A CG  1 
ATOM   2024 C CD  . ARG A 1 267 ? -19.769 53.318 57.670 1.00   24.80 ? 267 ARG A CD  1 
ATOM   2025 N NE  . ARG A 1 267 ? -18.742 53.213 56.639 1.00   28.77 ? 267 ARG A NE  1 
ATOM   2026 C CZ  . ARG A 1 267 ? -18.818 52.363 55.620 1.00   28.27 ? 267 ARG A CZ  1 
ATOM   2027 N NH1 . ARG A 1 267 ? -19.876 51.575 55.530 1.00   28.09 ? 267 ARG A NH1 1 
ATOM   2028 N NH2 . ARG A 1 267 ? -17.836 52.264 54.728 1.00   26.19 ? 267 ARG A NH2 1 
ATOM   2029 N N   . GLU A 1 268 ? -21.451 54.505 63.131 1.00   28.90 ? 268 GLU A N   1 
ATOM   2030 C CA  . GLU A 1 268 ? -22.488 55.184 63.910 1.00   29.20 ? 268 GLU A CA  1 
ATOM   2031 C C   . GLU A 1 268 ? -21.779 56.115 64.890 1.00   28.51 ? 268 GLU A C   1 
ATOM   2032 O O   . GLU A 1 268 ? -22.313 57.126 65.322 1.00   29.46 ? 268 GLU A O   1 
ATOM   2033 C CB  . GLU A 1 268 ? -23.312 54.168 64.694 1.00   31.99 ? 268 GLU A CB  1 
ATOM   2034 C CG  . GLU A 1 268 ? -24.162 53.244 63.834 1.00   34.08 ? 268 GLU A CG  1 
ATOM   2035 C CD  . GLU A 1 268 ? -25.172 54.021 63.004 1.00   36.11 ? 268 GLU A CD  1 
ATOM   2036 N N   . LYS A 1 269 ? -20.553 55.763 65.229 1.00   26.83 ? 269 LYS A N   1 
ATOM   2037 C CA  . LYS A 1 269 ? -19.789 56.538 66.157 1.00   25.98 ? 269 LYS A CA  1 
ATOM   2038 C C   . LYS A 1 269 ? -19.546 57.951 65.691 1.00   26.05 ? 269 LYS A C   1 
ATOM   2039 O O   . LYS A 1 269 ? -19.236 58.179 64.537 1.00   27.51 ? 269 LYS A O   1 
ATOM   2040 C CB  . LYS A 1 269 ? -18.455 55.849 66.375 1.00   27.81 ? 269 LYS A CB  1 
ATOM   2041 C CG  . LYS A 1 269 ? -18.577 54.466 66.986 1.00   29.66 ? 269 LYS A CG  1 
ATOM   2042 C CD  . LYS A 1 269 ? -19.490 54.524 68.200 1.00   31.59 ? 269 LYS A CD  1 
ATOM   2043 C CE  . LYS A 1 269 ? -19.813 53.156 68.750 1.00   31.87 ? 269 LYS A CE  1 
ATOM   2044 N NZ  . LYS A 1 269 ? -20.867 53.382 69.762 1.00   35.39 ? 269 LYS A NZ  1 
ATOM   2045 N N   . LYS A 1 270 ? -19.661 58.910 66.598 1.00   25.40 ? 270 LYS A N   1 
ATOM   2046 C CA  . LYS A 1 270 ? -19.399 60.290 66.256 1.00   23.66 ? 270 LYS A CA  1 
ATOM   2047 C C   . LYS A 1 270 ? -17.883 60.393 66.090 1.00   22.30 ? 270 LYS A C   1 
ATOM   2048 O O   . LYS A 1 270 ? -17.133 59.624 66.687 1.00   22.20 ? 270 LYS A O   1 
ATOM   2049 C CB  . LYS A 1 270 ? -19.897 61.206 67.366 1.00   25.77 ? 270 LYS A CB  1 
ATOM   2050 C CG  . LYS A 1 270 ? -21.395 61.120 67.590 1.00   27.14 ? 270 LYS A CG  1 
ATOM   2051 C CD  . LYS A 1 270 ? -21.827 62.064 68.702 1.00   30.94 ? 270 LYS A CD  1 
ATOM   2052 N N   . PRO A 1 271 ? -17.408 61.384 65.332 1.00   20.23 ? 271 PRO A N   1 
ATOM   2053 C CA  . PRO A 1 271 ? -15.980 61.522 65.122 1.00   20.69 ? 271 PRO A CA  1 
ATOM   2054 C C   . PRO A 1 271 ? -15.123 61.459 66.364 1.00   22.67 ? 271 PRO A C   1 
ATOM   2055 O O   . PRO A 1 271 ? -14.196 60.651 66.440 1.00   23.49 ? 271 PRO A O   1 
ATOM   2056 C CB  . PRO A 1 271 ? -15.875 62.883 64.447 1.00   19.91 ? 271 PRO A CB  1 
ATOM   2057 C CG  . PRO A 1 271 ? -17.146 62.995 63.706 1.00   17.32 ? 271 PRO A CG  1 
ATOM   2058 C CD  . PRO A 1 271 ? -18.133 62.488 64.683 1.00   19.88 ? 271 PRO A CD  1 
ATOM   2059 N N   . GLN A 1 272 ? -15.411 62.306 67.342 1.00   24.69 ? 272 GLN A N   1 
ATOM   2060 C CA  . GLN A 1 272 ? -14.590 62.333 68.544 1.00   25.42 ? 272 GLN A CA  1 
ATOM   2061 C C   . GLN A 1 272 ? -14.579 61.046 69.357 1.00   25.22 ? 272 GLN A C   1 
ATOM   2062 O O   . GLN A 1 272 ? -13.695 60.871 70.198 1.00   26.20 ? 272 GLN A O   1 
ATOM   2063 C CB  . GLN A 1 272 ? -14.963 63.501 69.434 1.00   26.88 ? 272 GLN A CB  1 
ATOM   2064 C CG  . GLN A 1 272 ? -13.981 63.719 70.567 1.00   30.11 ? 272 GLN A CG  1 
ATOM   2065 C CD  . GLN A 1 272 ? -12.676 64.342 70.118 1.00   33.10 ? 272 GLN A CD  1 
ATOM   2066 O OE1 . GLN A 1 272 ? -12.648 65.201 69.207 1.00   35.98 ? 272 GLN A OE1 1 
ATOM   2067 N NE2 . GLN A 1 272 ? -11.571 63.933 70.757 1.00   32.78 ? 272 GLN A NE2 1 
ATOM   2068 N N   . GLU A 1 273 ? -15.513 60.131 69.122 1.00   23.77 ? 273 GLU A N   1 
ATOM   2069 C CA  . GLU A 1 273 ? -15.479 58.888 69.881 1.00   24.20 ? 273 GLU A CA  1 
ATOM   2070 C C   . GLU A 1 273 ? -14.357 58.057 69.358 1.00   23.95 ? 273 GLU A C   1 
ATOM   2071 O O   . GLU A 1 273 ? -13.741 57.321 70.107 1.00   25.81 ? 273 GLU A O   1 
ATOM   2072 C CB  . GLU A 1 273 ? -16.783 58.098 69.774 1.00   26.16 ? 273 GLU A CB  1 
ATOM   2073 C CG  . GLU A 1 273 ? -18.006 58.881 70.245 1.00   29.37 ? 273 GLU A CG  1 
ATOM   2074 C CD  . GLU A 1 273 ? -19.189 57.993 70.448 1.00   30.99 ? 273 GLU A CD  1 
ATOM   2075 O OE1 . GLU A 1 273 ? -19.066 57.049 71.269 1.00   34.71 ? 273 GLU A OE1 1 
ATOM   2076 O OE2 . GLU A 1 273 ? -20.224 58.219 69.778 1.00   30.98 ? 273 GLU A OE2 1 
ATOM   2077 N N   . LEU A 1 274 ? -14.112 58.133 68.053 1.00   24.31 ? 274 LEU A N   1 
ATOM   2078 C CA  . LEU A 1 274 ? -13.025 57.375 67.466 1.00   22.95 ? 274 LEU A CA  1 
ATOM   2079 C C   . LEU A 1 274 ? -11.730 58.014 67.886 1.00   21.76 ? 274 LEU A C   1 
ATOM   2080 O O   . LEU A 1 274 ? -10.767 57.343 68.267 1.00   21.26 ? 274 LEU A O   1 
ATOM   2081 C CB  . LEU A 1 274 ? -13.136 57.324 65.938 1.00   24.82 ? 274 LEU A CB  1 
ATOM   2082 C CG  . LEU A 1 274 ? -14.002 56.172 65.404 1.00   24.92 ? 274 LEU A CG  1 
ATOM   2083 C CD1 . LEU A 1 274 ? -15.412 56.567 65.396 1.00   24.48 ? 274 LEU A CD1 1 
ATOM   2084 C CD2 . LEU A 1 274 ? -13.595 55.830 64.022 1.00   26.20 ? 274 LEU A CD2 1 
ATOM   2085 N N   . ILE A 1 275 ? -11.708 59.330 67.874 1.00   21.12 ? 275 ILE A N   1 
ATOM   2086 C CA  . ILE A 1 275 ? -10.494 60.021 68.266 1.00   22.14 ? 275 ILE A CA  1 
ATOM   2087 C C   . ILE A 1 275 ? -10.083 59.767 69.716 1.00   23.17 ? 275 ILE A C   1 
ATOM   2088 O O   . ILE A 1 275 ? -8.911  59.557 69.998 1.00   21.66 ? 275 ILE A O   1 
ATOM   2089 C CB  . ILE A 1 275 ? -10.626 61.496 68.058 1.00   22.26 ? 275 ILE A CB  1 
ATOM   2090 C CG1 . ILE A 1 275 ? -10.880 61.776 66.585 1.00   21.68 ? 275 ILE A CG1 1 
ATOM   2091 C CG2 . ILE A 1 275 ? -9.367  62.182 68.549 1.00   23.15 ? 275 ILE A CG2 1 
ATOM   2092 C CD1 . ILE A 1 275 ? -11.269 63.202 66.323 1.00   24.03 ? 275 ILE A CD1 1 
ATOM   2093 N N   . ASP A 1 276 ? -11.052 59.808 70.630 1.00   23.72 ? 276 ASP A N   1 
ATOM   2094 C CA  . ASP A 1 276 ? -10.813 59.571 72.055 1.00   21.91 ? 276 ASP A CA  1 
ATOM   2095 C C   . ASP A 1 276 ? -10.098 58.268 72.375 1.00   21.94 ? 276 ASP A C   1 
ATOM   2096 O O   . ASP A 1 276 ? -9.256  58.245 73.255 1.00   24.10 ? 276 ASP A O   1 
ATOM   2097 C CB  . ASP A 1 276 ? -12.119 59.667 72.833 1.00   19.91 ? 276 ASP A CB  1 
ATOM   2098 C CG  . ASP A 1 276 ? -12.592 61.083 72.973 1.00   20.97 ? 276 ASP A CG  1 
ATOM   2099 O OD1 . ASP A 1 276 ? -11.781 62.002 72.782 1.00   22.41 ? 276 ASP A OD1 1 
ATOM   2100 O OD2 . ASP A 1 276 ? -13.778 61.305 73.276 1.00   24.95 ? 276 ASP A OD2 1 
ATOM   2101 N N   . VAL A 1 277 ? -10.407 57.189 71.669 1.00   21.35 ? 277 VAL A N   1 
ATOM   2102 C CA  . VAL A 1 277 ? -9.733  55.904 71.912 1.00   19.74 ? 277 VAL A CA  1 
ATOM   2103 C C   . VAL A 1 277 ? -8.616  55.565 70.911 1.00   19.99 ? 277 VAL A C   1 
ATOM   2104 O O   . VAL A 1 277 ? -7.900  54.602 71.092 1.00   20.45 ? 277 VAL A O   1 
ATOM   2105 C CB  . VAL A 1 277 ? -10.738 54.764 71.912 1.00   20.25 ? 277 VAL A CB  1 
ATOM   2106 C CG1 . VAL A 1 277 ? -11.666 54.903 73.098 1.00   20.34 ? 277 VAL A CG1 1 
ATOM   2107 C CG2 . VAL A 1 277 ? -11.560 54.807 70.651 1.00   20.36 ? 277 VAL A CG2 1 
ATOM   2108 N N   . GLU A 1 278 ? -8.422  56.404 69.899 1.00   19.75 ? 278 GLU A N   1 
ATOM   2109 C CA  . GLU A 1 278 ? -7.406  56.202 68.865 1.00   18.97 ? 278 GLU A CA  1 
ATOM   2110 C C   . GLU A 1 278 ? -6.052  55.697 69.320 1.00   19.52 ? 278 GLU A C   1 
ATOM   2111 O O   . GLU A 1 278 ? -5.441  54.854 68.664 1.00   21.03 ? 278 GLU A O   1 
ATOM   2112 C CB  . GLU A 1 278 ? -7.188  57.509 68.091 1.00   19.61 ? 278 GLU A CB  1 
ATOM   2113 C CG  . GLU A 1 278 ? -6.162  57.382 66.987 1.00   20.90 ? 278 GLU A CG  1 
ATOM   2114 C CD  . GLU A 1 278 ? -5.880  58.663 66.219 1.00   21.46 ? 278 GLU A CD  1 
ATOM   2115 O OE1 . GLU A 1 278 ? -6.787  59.499 66.038 1.00   19.07 ? 278 GLU A OE1 1 
ATOM   2116 O OE2 . GLU A 1 278 ? -4.723  58.809 65.768 1.00   22.64 ? 278 GLU A OE2 1 
ATOM   2117 N N   . TRP A 1 279 ? -5.542  56.242 70.414 1.00   19.23 ? 279 TRP A N   1 
ATOM   2118 C CA  . TRP A 1 279 ? -4.226  55.843 70.893 1.00   16.89 ? 279 TRP A CA  1 
ATOM   2119 C C   . TRP A 1 279 ? -4.185  54.586 71.698 1.00   17.84 ? 279 TRP A C   1 
ATOM   2120 O O   . TRP A 1 279 ? -3.123  54.051 71.934 1.00   18.26 ? 279 TRP A O   1 
ATOM   2121 C CB  . TRP A 1 279 ? -3.617  56.945 71.699 1.00   16.21 ? 279 TRP A CB  1 
ATOM   2122 C CG  . TRP A 1 279 ? -3.403  58.138 70.908 1.00   16.71 ? 279 TRP A CG  1 
ATOM   2123 C CD1 . TRP A 1 279 ? -4.258  59.181 70.760 1.00   17.12 ? 279 TRP A CD1 1 
ATOM   2124 C CD2 . TRP A 1 279 ? -2.242  58.449 70.152 1.00   15.42 ? 279 TRP A CD2 1 
ATOM   2125 N NE1 . TRP A 1 279 ? -3.693  60.134 69.953 1.00   17.09 ? 279 TRP A NE1 1 
ATOM   2126 C CE2 . TRP A 1 279 ? -2.453  59.707 69.568 1.00   17.31 ? 279 TRP A CE2 1 
ATOM   2127 C CE3 . TRP A 1 279 ? -1.040  57.788 69.919 1.00   17.56 ? 279 TRP A CE3 1 
ATOM   2128 C CZ2 . TRP A 1 279 ? -1.506  60.325 68.763 1.00   19.32 ? 279 TRP A CZ2 1 
ATOM   2129 C CZ3 . TRP A 1 279 ? -0.092  58.397 69.121 1.00   19.95 ? 279 TRP A CZ3 1 
ATOM   2130 C CH2 . TRP A 1 279 ? -0.331  59.659 68.550 1.00   20.05 ? 279 TRP A CH2 1 
ATOM   2131 N N   . ASN A 1 280 ? -5.343  54.085 72.088 1.00   17.92 ? 280 ASN A N   1 
ATOM   2132 C CA  . ASN A 1 280 ? -5.396  52.870 72.881 1.00   18.97 ? 280 ASN A CA  1 
ATOM   2133 C C   . ASN A 1 280 ? -5.093  51.599 72.098 1.00   19.71 ? 280 ASN A C   1 
ATOM   2134 O O   . ASN A 1 280 ? -5.056  50.525 72.664 1.00   22.81 ? 280 ASN A O   1 
ATOM   2135 C CB  . ASN A 1 280 ? -6.782  52.739 73.536 1.00   19.03 ? 280 ASN A CB  1 
ATOM   2136 C CG  . ASN A 1 280 ? -7.104  53.892 74.470 1.00   20.21 ? 280 ASN A CG  1 
ATOM   2137 O OD1 . ASN A 1 280 ? -6.243  54.725 74.755 1.00   23.77 ? 280 ASN A OD1 1 
ATOM   2138 N ND2 . ASN A 1 280 ? -8.342  53.967 74.924 1.00   17.66 ? 280 ASN A ND2 1 
ATOM   2139 N N   . VAL A 1 281 ? -4.850  51.710 70.802 1.00   20.83 ? 281 VAL A N   1 
ATOM   2140 C CA  . VAL A 1 281 ? -4.634  50.544 69.945 1.00   18.34 ? 281 VAL A CA  1 
ATOM   2141 C C   . VAL A 1 281 ? -3.213  50.189 69.579 1.00   17.08 ? 281 VAL A C   1 
ATOM   2142 O O   . VAL A 1 281 ? -2.983  49.127 69.035 1.00   17.49 ? 281 VAL A O   1 
ATOM   2143 C CB  . VAL A 1 281 ? -5.415  50.706 68.642 1.00   19.13 ? 281 VAL A CB  1 
ATOM   2144 C CG1 . VAL A 1 281 ? -6.819  51.182 68.931 1.00   17.98 ? 281 VAL A CG1 1 
ATOM   2145 C CG2 . VAL A 1 281 ? -4.719  51.715 67.743 1.00   20.87 ? 281 VAL A CG2 1 
ATOM   2146 N N   . LEU A 1 282 ? -2.261  51.081 69.793 1.00   18.07 ? 282 LEU A N   1 
ATOM   2147 C CA  . LEU A 1 282 ? -0.881  50.738 69.464 1.00   20.71 ? 282 LEU A CA  1 
ATOM   2148 C C   . LEU A 1 282 ? -0.565  49.456 70.174 1.00   21.80 ? 282 LEU A C   1 
ATOM   2149 O O   . LEU A 1 282 ? -1.176  49.145 71.184 1.00   23.77 ? 282 LEU A O   1 
ATOM   2150 C CB  . LEU A 1 282 ? 0.069   51.791 69.959 1.00   21.02 ? 282 LEU A CB  1 
ATOM   2151 C CG  . LEU A 1 282 ? -0.231  53.121 69.318 1.00   22.58 ? 282 LEU A CG  1 
ATOM   2152 C CD1 . LEU A 1 282 ? 0.709   54.174 69.865 1.00   25.29 ? 282 LEU A CD1 1 
ATOM   2153 C CD2 . LEU A 1 282 ? -0.040  52.964 67.853 1.00   22.25 ? 282 LEU A CD2 1 
ATOM   2154 N N   . PRO A 1 283 ? 0.390   48.678 69.664 1.00   23.11 ? 283 PRO A N   1 
ATOM   2155 C CA  . PRO A 1 283 ? 0.672   47.435 70.373 1.00   23.01 ? 283 PRO A CA  1 
ATOM   2156 C C   . PRO A 1 283 ? 1.809   47.592 71.352 1.00   23.40 ? 283 PRO A C   1 
ATOM   2157 O O   . PRO A 1 283 ? 2.244   46.611 71.929 1.00   24.87 ? 283 PRO A O   1 
ATOM   2158 C CB  . PRO A 1 283 ? 1.095   46.519 69.240 1.00   20.92 ? 283 PRO A CB  1 
ATOM   2159 C CG  . PRO A 1 283 ? 1.942   47.425 68.444 1.00   20.58 ? 283 PRO A CG  1 
ATOM   2160 C CD  . PRO A 1 283 ? 1.169   48.743 68.419 1.00   21.69 ? 283 PRO A CD  1 
ATOM   2161 N N   . PHE A 1 284 ? 2.340   48.796 71.512 1.00   23.64 ? 284 PHE A N   1 
ATOM   2162 C CA  . PHE A 1 284 ? 3.461   48.958 72.415 1.00   23.62 ? 284 PHE A CA  1 
ATOM   2163 C C   . PHE A 1 284 ? 3.454   50.274 73.157 1.00   24.38 ? 284 PHE A C   1 
ATOM   2164 O O   . PHE A 1 284 ? 2.722   51.201 72.794 1.00   25.23 ? 284 PHE A O   1 
ATOM   2165 C CB  . PHE A 1 284 ? 4.748   48.951 71.621 1.00   23.96 ? 284 PHE A CB  1 
ATOM   2166 C CG  . PHE A 1 284 ? 5.014   47.701 70.911 1.00   25.38 ? 284 PHE A CG  1 
ATOM   2167 C CD1 . PHE A 1 284 ? 5.035   46.497 71.590 1.00   28.96 ? 284 PHE A CD1 1 
ATOM   2168 C CD2 . PHE A 1 284 ? 5.305   47.720 69.561 1.00   27.33 ? 284 PHE A CD2 1 
ATOM   2169 C CE1 . PHE A 1 284 ? 5.355   45.290 70.926 1.00   29.86 ? 284 PHE A CE1 1 
ATOM   2170 C CE2 . PHE A 1 284 ? 5.624   46.545 68.887 1.00   28.52 ? 284 PHE A CE2 1 
ATOM   2171 C CZ  . PHE A 1 284 ? 5.650   45.319 69.570 1.00   28.95 ? 284 PHE A CZ  1 
ATOM   2172 N N   . ASP A 1 285 ? 4.296   50.358 74.185 1.00   23.12 ? 285 ASP A N   1 
ATOM   2173 C CA  . ASP A 1 285 ? 4.465   51.595 74.922 1.00   22.19 ? 285 ASP A CA  1 
ATOM   2174 C C   . ASP A 1 285 ? 5.565   52.092 74.027 1.00   22.09 ? 285 ASP A C   1 
ATOM   2175 O O   . ASP A 1 285 ? 6.648   51.499 73.990 1.00   20.30 ? 285 ASP A O   1 
ATOM   2176 C CB  . ASP A 1 285 ? 5.026   51.319 76.303 1.00   24.68 ? 285 ASP A CB  1 
ATOM   2177 C CG  . ASP A 1 285 ? 5.116   52.565 77.175 1.00   23.94 ? 285 ASP A CG  1 
ATOM   2178 O OD1 . ASP A 1 285 ? 4.641   53.655 76.774 1.00   25.26 ? 285 ASP A OD1 1 
ATOM   2179 O OD2 . ASP A 1 285 ? 5.648   52.425 78.290 1.00   25.20 ? 285 ASP A OD2 1 
ATOM   2180 N N   . SER A 1 286 ? 5.291   53.149 73.278 1.00   21.98 ? 286 SER A N   1 
ATOM   2181 C CA  . SER A 1 286 ? 6.268   53.630 72.324 1.00   22.20 ? 286 SER A CA  1 
ATOM   2182 C C   . SER A 1 286 ? 6.204   55.119 72.056 1.00   22.03 ? 286 SER A C   1 
ATOM   2183 O O   . SER A 1 286 ? 5.214   55.773 72.347 1.00   22.53 ? 286 SER A O   1 
ATOM   2184 C CB  . SER A 1 286 ? 5.990   52.922 71.023 1.00   22.91 ? 286 SER A CB  1 
ATOM   2185 O OG  . SER A 1 286 ? 4.640   53.178 70.654 1.00   23.72 ? 286 SER A OG  1 
ATOM   2186 N N   . ILE A 1 287 ? 7.258   55.627 71.437 1.00   22.12 ? 287 ILE A N   1 
ATOM   2187 C CA  . ILE A 1 287 ? 7.356   57.025 71.088 1.00   21.41 ? 287 ILE A CA  1 
ATOM   2188 C C   . ILE A 1 287 ? 7.511   57.005 69.572 1.00   21.24 ? 287 ILE A C   1 
ATOM   2189 O O   . ILE A 1 287 ? 8.149   56.098 69.036 1.00   21.33 ? 287 ILE A O   1 
ATOM   2190 C CB  . ILE A 1 287 ? 8.569   57.638 71.846 1.00   23.58 ? 287 ILE A CB  1 
ATOM   2191 C CG1 . ILE A 1 287 ? 8.063   58.734 72.759 1.00   26.75 ? 287 ILE A CG1 1 
ATOM   2192 C CG2 . ILE A 1 287 ? 9.637   58.215 70.932 1.00   23.57 ? 287 ILE A CG2 1 
ATOM   2193 C CD1 . ILE A 1 287 ? 6.752   58.367 73.397 1.00   28.78 ? 287 ILE A CD1 1 
ATOM   2194 N N   . PHE A 1 288 ? 6.837   57.912 68.871 1.00   19.21 ? 288 PHE A N   1 
ATOM   2195 C CA  . PHE A 1 288 ? 6.932   58.000 67.410 1.00   16.85 ? 288 PHE A CA  1 
ATOM   2196 C C   . PHE A 1 288 ? 6.270   56.844 66.680 1.00   16.47 ? 288 PHE A C   1 
ATOM   2197 O O   . PHE A 1 288 ? 6.828   56.298 65.745 1.00   17.61 ? 288 PHE A O   1 
ATOM   2198 C CB  . PHE A 1 288 ? 8.388   58.119 66.956 1.00   18.10 ? 288 PHE A CB  1 
ATOM   2199 C CG  . PHE A 1 288 ? 8.610   59.088 65.815 1.00   19.49 ? 288 PHE A CG  1 
ATOM   2200 C CD1 . PHE A 1 288 ? 7.684   59.225 64.789 1.00   18.95 ? 288 PHE A CD1 1 
ATOM   2201 C CD2 . PHE A 1 288 ? 9.748   59.899 65.788 1.00   18.58 ? 288 PHE A CD2 1 
ATOM   2202 C CE1 . PHE A 1 288 ? 7.891   60.159 63.771 1.00   17.80 ? 288 PHE A CE1 1 
ATOM   2203 C CE2 . PHE A 1 288 ? 9.948   60.824 64.769 1.00   17.16 ? 288 PHE A CE2 1 
ATOM   2204 C CZ  . PHE A 1 288 ? 9.022   60.951 63.771 1.00   16.24 ? 288 PHE A CZ  1 
ATOM   2205 N N   . ARG A 1 289 ? 5.089   56.451 67.127 1.00   13.53 ? 289 ARG A N   1 
ATOM   2206 C CA  . ARG A 1 289 ? 4.331   55.424 66.468 1.00   11.20 ? 289 ARG A CA  1 
ATOM   2207 C C   . ARG A 1 289 ? 2.927   55.971 66.540 1.00   13.50 ? 289 ARG A C   1 
ATOM   2208 O O   . ARG A 1 289 ? 2.560   56.611 67.523 1.00   13.69 ? 289 ARG A O   1 
ATOM   2209 C CB  . ARG A 1 289 ? 4.424   54.094 67.172 1.00   9.10  ? 289 ARG A CB  1 
ATOM   2210 C CG  . ARG A 1 289 ? 5.782   53.453 67.111 1.00   14.13 ? 289 ARG A CG  1 
ATOM   2211 C CD  . ARG A 1 289 ? 6.300   53.284 65.684 1.00   16.39 ? 289 ARG A CD  1 
ATOM   2212 N NE  . ARG A 1 289 ? 7.507   52.466 65.637 1.00   15.20 ? 289 ARG A NE  1 
ATOM   2213 C CZ  . ARG A 1 289 ? 8.737   52.950 65.578 1.00   14.47 ? 289 ARG A CZ  1 
ATOM   2214 N NH1 . ARG A 1 289 ? 8.936   54.246 65.555 1.00   14.54 ? 289 ARG A NH1 1 
ATOM   2215 N NH2 . ARG A 1 289 ? 9.767   52.131 65.536 1.00   14.41 ? 289 ARG A NH2 1 
ATOM   2216 N N   . PHE A 1 290 ? 2.192   55.859 65.442 1.00   14.79 ? 290 PHE A N   1 
ATOM   2217 C CA  . PHE A 1 290 ? 0.846   56.359 65.399 1.00   13.43 ? 290 PHE A CA  1 
ATOM   2218 C C   . PHE A 1 290 ? 0.004   55.176 65.045 1.00   13.49 ? 290 PHE A C   1 
ATOM   2219 O O   . PHE A 1 290 ? 0.522   54.191 64.560 1.00   10.84 ? 290 PHE A O   1 
ATOM   2220 C CB  . PHE A 1 290 ? 0.793   57.495 64.434 1.00   13.44 ? 290 PHE A CB  1 
ATOM   2221 C CG  . PHE A 1 290 ? 1.959   58.425 64.572 1.00   13.01 ? 290 PHE A CG  1 
ATOM   2222 C CD1 . PHE A 1 290 ? 1.976   59.382 65.547 1.00   12.30 ? 290 PHE A CD1 1 
ATOM   2223 C CD2 . PHE A 1 290 ? 3.046   58.321 63.731 1.00   12.62 ? 290 PHE A CD2 1 
ATOM   2224 C CE1 . PHE A 1 290 ? 3.051   60.224 65.685 1.00   14.76 ? 290 PHE A CE1 1 
ATOM   2225 C CE2 . PHE A 1 290 ? 4.144   59.171 63.861 1.00   15.01 ? 290 PHE A CE2 1 
ATOM   2226 C CZ  . PHE A 1 290 ? 4.145   60.123 64.839 1.00   14.16 ? 290 PHE A CZ  1 
ATOM   2227 N N   . SER A 1 291 ? -1.268  55.227 65.400 1.00   14.14 ? 291 SER A N   1 
ATOM   2228 C CA  . SER A 1 291 ? -2.141  54.081 65.230 1.00   16.58 ? 291 SER A CA  1 
ATOM   2229 C C   . SER A 1 291 ? -2.575  53.696 63.857 1.00   16.50 ? 291 SER A C   1 
ATOM   2230 O O   . SER A 1 291 ? -2.397  52.563 63.454 1.00   15.80 ? 291 SER A O   1 
ATOM   2231 C CB  . SER A 1 291 ? -3.375  54.230 66.097 1.00   18.31 ? 291 SER A CB  1 
ATOM   2232 O OG  . SER A 1 291 ? -3.018  54.802 67.324 1.00   21.04 ? 291 SER A OG  1 
ATOM   2233 N N   . PHE A 1 292 ? -3.223  54.623 63.172 1.00   16.82 ? 292 PHE A N   1 
ATOM   2234 C CA  . PHE A 1 292 ? -3.703  54.350 61.843 1.00   15.23 ? 292 PHE A CA  1 
ATOM   2235 C C   . PHE A 1 292 ? -2.788  54.973 60.809 1.00   15.39 ? 292 PHE A C   1 
ATOM   2236 O O   . PHE A 1 292 ? -2.596  56.178 60.761 1.00   14.38 ? 292 PHE A O   1 
ATOM   2237 C CB  . PHE A 1 292 ? -5.127  54.827 61.742 1.00   14.84 ? 292 PHE A CB  1 
ATOM   2238 C CG  . PHE A 1 292 ? -6.001  54.237 62.791 1.00   17.45 ? 292 PHE A CG  1 
ATOM   2239 C CD1 . PHE A 1 292 ? -6.318  52.894 62.761 1.00   16.50 ? 292 PHE A CD1 1 
ATOM   2240 C CD2 . PHE A 1 292 ? -6.417  54.993 63.872 1.00   15.71 ? 292 PHE A CD2 1 
ATOM   2241 C CE1 . PHE A 1 292 ? -7.023  52.323 63.800 1.00   17.16 ? 292 PHE A CE1 1 
ATOM   2242 C CE2 . PHE A 1 292 ? -7.116  54.421 64.896 1.00   14.84 ? 292 PHE A CE2 1 
ATOM   2243 C CZ  . PHE A 1 292 ? -7.417  53.090 64.864 1.00   16.07 ? 292 PHE A CZ  1 
ATOM   2244 N N   . VAL A 1 293 ? -2.122  54.102 60.070 1.00   15.21 ? 293 VAL A N   1 
ATOM   2245 C CA  . VAL A 1 293 ? -1.196  54.504 59.049 1.00   14.52 ? 293 VAL A CA  1 
ATOM   2246 C C   . VAL A 1 293 ? -1.412  53.655 57.793 1.00   17.87 ? 293 VAL A C   1 
ATOM   2247 O O   . VAL A 1 293 ? -2.181  52.683 57.803 1.00   19.01 ? 293 VAL A O   1 
ATOM   2248 C CB  . VAL A 1 293 ? 0.229   54.340 59.539 1.00   12.43 ? 293 VAL A CB  1 
ATOM   2249 C CG1 . VAL A 1 293 ? 0.579   55.447 60.492 1.00   7.41  ? 293 VAL A CG1 1 
ATOM   2250 C CG2 . VAL A 1 293 ? 0.406   52.991 60.147 1.00   9.04  ? 293 VAL A CG2 1 
ATOM   2251 N N   . PRO A 1 294 ? -0.791  54.046 56.674 1.00   18.23 ? 294 PRO A N   1 
ATOM   2252 C CA  . PRO A 1 294 ? -0.965  53.270 55.457 1.00   17.15 ? 294 PRO A CA  1 
ATOM   2253 C C   . PRO A 1 294 ? -0.652  51.819 55.703 1.00   17.35 ? 294 PRO A C   1 
ATOM   2254 O O   . PRO A 1 294 ? 0.220   51.512 56.499 1.00   18.71 ? 294 PRO A O   1 
ATOM   2255 C CB  . PRO A 1 294 ? 0.084   53.886 54.538 1.00   17.13 ? 294 PRO A CB  1 
ATOM   2256 C CG  . PRO A 1 294 ? 0.043   55.304 54.916 1.00   16.68 ? 294 PRO A CG  1 
ATOM   2257 C CD  . PRO A 1 294 ? 0.023   55.244 56.410 1.00   16.91 ? 294 PRO A CD  1 
ATOM   2258 N N   . VAL A 1 295 ? -1.371  50.913 55.053 1.00   18.30 ? 295 VAL A N   1 
ATOM   2259 C CA  . VAL A 1 295 ? -1.067  49.504 55.201 1.00   18.49 ? 295 VAL A CA  1 
ATOM   2260 C C   . VAL A 1 295 ? -0.466  49.038 53.901 1.00   19.79 ? 295 VAL A C   1 
ATOM   2261 O O   . VAL A 1 295 ? -0.803  49.559 52.835 1.00   22.34 ? 295 VAL A O   1 
ATOM   2262 C CB  . VAL A 1 295 ? -2.316  48.674 55.437 1.00   19.39 ? 295 VAL A CB  1 
ATOM   2263 C CG1 . VAL A 1 295 ? -2.950  49.056 56.745 1.00   21.74 ? 295 VAL A CG1 1 
ATOM   2264 C CG2 . VAL A 1 295 ? -3.313  48.880 54.320 1.00   19.31 ? 295 VAL A CG2 1 
ATOM   2265 N N   . ILE A 1 296 ? 0.482   48.121 53.972 1.00   18.75 ? 296 ILE A N   1 
ATOM   2266 C CA  . ILE A 1 296 ? 1.056   47.575 52.763 1.00   17.78 ? 296 ILE A CA  1 
ATOM   2267 C C   . ILE A 1 296 ? -0.004  46.575 52.299 1.00   19.38 ? 296 ILE A C   1 
ATOM   2268 O O   . ILE A 1 296 ? 0.034   45.422 52.684 1.00   19.83 ? 296 ILE A O   1 
ATOM   2269 C CB  . ILE A 1 296 ? 2.367   46.862 53.052 1.00   16.13 ? 296 ILE A CB  1 
ATOM   2270 C CG1 . ILE A 1 296 ? 3.327   47.821 53.746 1.00   14.60 ? 296 ILE A CG1 1 
ATOM   2271 C CG2 . ILE A 1 296 ? 2.988   46.365 51.774 1.00   14.53 ? 296 ILE A CG2 1 
ATOM   2272 C CD1 . ILE A 1 296 ? 3.343   49.198 53.165 1.00   12.57 ? 296 ILE A CD1 1 
ATOM   2273 N N   . ASP A 1 297 ? -0.992  47.048 51.542 1.00   19.92 ? 297 ASP A N   1 
ATOM   2274 C CA  . ASP A 1 297 ? -2.095  46.214 51.078 1.00   21.80 ? 297 ASP A CA  1 
ATOM   2275 C C   . ASP A 1 297 ? -1.965  45.344 49.846 1.00   24.12 ? 297 ASP A C   1 
ATOM   2276 O O   . ASP A 1 297 ? -2.784  44.452 49.665 1.00   25.54 ? 297 ASP A O   1 
ATOM   2277 C CB  . ASP A 1 297 ? -3.340  47.065 50.875 1.00   22.25 ? 297 ASP A CB  1 
ATOM   2278 C CG  . ASP A 1 297 ? -3.136  48.151 49.854 1.00   22.36 ? 297 ASP A CG  1 
ATOM   2279 O OD1 . ASP A 1 297 ? -2.003  48.279 49.365 1.00   19.49 ? 297 ASP A OD1 1 
ATOM   2280 O OD2 . ASP A 1 297 ? -4.095  48.896 49.559 1.00   22.42 ? 297 ASP A OD2 1 
ATOM   2281 N N   . GLY A 1 298 ? -0.994  45.599 48.980 1.00   25.18 ? 298 GLY A N   1 
ATOM   2282 C CA  . GLY A 1 298 ? -0.888  44.813 47.758 1.00   25.41 ? 298 GLY A CA  1 
ATOM   2283 C C   . GLY A 1 298 ? -1.667  45.472 46.610 1.00   27.39 ? 298 GLY A C   1 
ATOM   2284 O O   . GLY A 1 298 ? -1.787  44.919 45.517 1.00   28.12 ? 298 GLY A O   1 
ATOM   2285 N N   . GLU A 1 299 ? -2.229  46.646 46.860 1.00   26.75 ? 299 GLU A N   1 
ATOM   2286 C CA  . GLU A 1 299 ? -2.998  47.372 45.855 1.00   26.75 ? 299 GLU A CA  1 
ATOM   2287 C C   . GLU A 1 299 ? -2.320  48.710 45.683 1.00   24.58 ? 299 GLU A C   1 
ATOM   2288 O O   . GLU A 1 299 ? -1.698  48.956 44.659 1.00   27.07 ? 299 GLU A O   1 
ATOM   2289 C CB  . GLU A 1 299 ? -4.455  47.526 46.310 1.00   30.90 ? 299 GLU A CB  1 
ATOM   2290 C CG  . GLU A 1 299 ? -5.190  46.172 46.398 1.00   39.71 ? 299 GLU A CG  1 
ATOM   2291 C CD  . GLU A 1 299 ? -6.488  46.179 47.264 1.00   44.93 ? 299 GLU A CD  1 
ATOM   2292 O OE1 . GLU A 1 299 ? -7.407  47.035 47.041 1.00   45.37 ? 299 GLU A OE1 1 
ATOM   2293 O OE2 . GLU A 1 299 ? -6.594  45.265 48.149 1.00   46.90 ? 299 GLU A OE2 1 
ATOM   2294 N N   . PHE A 1 300 ? -2.384  49.573 46.693 1.00   22.13 ? 300 PHE A N   1 
ATOM   2295 C CA  . PHE A 1 300 ? -1.716  50.869 46.602 1.00   17.98 ? 300 PHE A CA  1 
ATOM   2296 C C   . PHE A 1 300 ? -0.221  50.547 46.507 1.00   17.71 ? 300 PHE A C   1 
ATOM   2297 O O   . PHE A 1 300 ? 0.505   51.139 45.710 1.00   18.06 ? 300 PHE A O   1 
ATOM   2298 C CB  . PHE A 1 300 ? -2.053  51.713 47.836 1.00   14.60 ? 300 PHE A CB  1 
ATOM   2299 C CG  . PHE A 1 300 ? -1.752  53.179 47.697 1.00   11.40 ? 300 PHE A CG  1 
ATOM   2300 C CD1 . PHE A 1 300 ? -0.473  53.670 47.912 1.00   10.81 ? 300 PHE A CD1 1 
ATOM   2301 C CD2 . PHE A 1 300 ? -2.751  54.069 47.394 1.00   9.25  ? 300 PHE A CD2 1 
ATOM   2302 C CE1 . PHE A 1 300 ? -0.202  55.019 47.827 1.00   9.04  ? 300 PHE A CE1 1 
ATOM   2303 C CE2 . PHE A 1 300 ? -2.485  55.420 47.306 1.00   9.99  ? 300 PHE A CE2 1 
ATOM   2304 C CZ  . PHE A 1 300 ? -1.206  55.895 47.523 1.00   9.32  ? 300 PHE A CZ  1 
ATOM   2305 N N   . PHE A 1 301 ? 0.219   49.545 47.266 1.00   18.46 ? 301 PHE A N   1 
ATOM   2306 C CA  . PHE A 1 301 ? 1.623   49.128 47.274 1.00   18.70 ? 301 PHE A CA  1 
ATOM   2307 C C   . PHE A 1 301 ? 1.573   47.693 46.799 1.00   21.56 ? 301 PHE A C   1 
ATOM   2308 O O   . PHE A 1 301 ? 0.876   46.876 47.378 1.00   22.53 ? 301 PHE A O   1 
ATOM   2309 C CB  . PHE A 1 301 ? 2.219   49.156 48.699 1.00   17.30 ? 301 PHE A CB  1 
ATOM   2310 C CG  . PHE A 1 301 ? 2.247   50.528 49.344 1.00   13.02 ? 301 PHE A CG  1 
ATOM   2311 C CD1 . PHE A 1 301 ? 3.172   51.468 48.959 1.00   11.58 ? 301 PHE A CD1 1 
ATOM   2312 C CD2 . PHE A 1 301 ? 1.317   50.873 50.318 1.00   12.36 ? 301 PHE A CD2 1 
ATOM   2313 C CE1 . PHE A 1 301 ? 3.175   52.712 49.513 1.00   12.81 ? 301 PHE A CE1 1 
ATOM   2314 C CE2 . PHE A 1 301 ? 1.307   52.118 50.880 1.00   9.71  ? 301 PHE A CE2 1 
ATOM   2315 C CZ  . PHE A 1 301 ? 2.230   53.042 50.482 1.00   12.71 ? 301 PHE A CZ  1 
ATOM   2316 N N   . PRO A 1 302 ? 2.250   47.376 45.699 1.00   23.96 ? 302 PRO A N   1 
ATOM   2317 C CA  . PRO A 1 302 ? 2.252   46.013 45.160 1.00   24.55 ? 302 PRO A CA  1 
ATOM   2318 C C   . PRO A 1 302 ? 2.893   44.940 46.036 1.00   25.79 ? 302 PRO A C   1 
ATOM   2319 O O   . PRO A 1 302 ? 2.433   43.788 46.059 1.00   27.17 ? 302 PRO A O   1 
ATOM   2320 C CB  . PRO A 1 302 ? 2.983   46.185 43.835 1.00   24.83 ? 302 PRO A CB  1 
ATOM   2321 C CG  . PRO A 1 302 ? 2.560   47.553 43.406 1.00   25.02 ? 302 PRO A CG  1 
ATOM   2322 C CD  . PRO A 1 302 ? 2.736   48.336 44.693 1.00   24.34 ? 302 PRO A CD  1 
ATOM   2323 N N   . THR A 1 303 ? 4.012   45.281 46.668 1.00   26.29 ? 303 THR A N   1 
ATOM   2324 C CA  . THR A 1 303 ? 4.718   44.370 47.555 1.00   24.65 ? 303 THR A CA  1 
ATOM   2325 C C   . THR A 1 303 ? 5.388   45.231 48.608 1.00   24.61 ? 303 THR A C   1 
ATOM   2326 O O   . THR A 1 303 ? 5.156   46.430 48.693 1.00   21.45 ? 303 THR A O   1 
ATOM   2327 C CB  . THR A 1 303 ? 5.779   43.593 46.829 1.00   25.12 ? 303 THR A CB  1 
ATOM   2328 O OG1 . THR A 1 303 ? 6.659   44.497 46.171 1.00   25.70 ? 303 THR A OG1 1 
ATOM   2329 C CG2 . THR A 1 303 ? 5.166   42.737 45.786 1.00   28.90 ? 303 THR A CG2 1 
ATOM   2330 N N   . SER A 1 304 ? 6.252   44.615 49.390 1.00   25.51 ? 304 SER A N   1 
ATOM   2331 C CA  . SER A 1 304 ? 6.904   45.317 50.464 1.00   26.29 ? 304 SER A CA  1 
ATOM   2332 C C   . SER A 1 304 ? 7.661   46.498 49.946 1.00   25.74 ? 304 SER A C   1 
ATOM   2333 O O   . SER A 1 304 ? 8.460   46.347 49.032 1.00   27.55 ? 304 SER A O   1 
ATOM   2334 C CB  . SER A 1 304 ? 7.872   44.372 51.162 1.00   28.39 ? 304 SER A CB  1 
ATOM   2335 O OG  . SER A 1 304 ? 8.905   43.959 50.269 1.00   31.23 ? 304 SER A OG  1 
ATOM   2336 N N   . LEU A 1 305 ? 7.486   47.656 50.564 1.00   24.18 ? 305 LEU A N   1 
ATOM   2337 C CA  . LEU A 1 305 ? 8.223   48.812 50.113 1.00   23.68 ? 305 LEU A CA  1 
ATOM   2338 C C   . LEU A 1 305 ? 9.670   48.466 49.893 1.00   24.93 ? 305 LEU A C   1 
ATOM   2339 O O   . LEU A 1 305 ? 10.292  49.008 48.994 1.00   26.65 ? 305 LEU A O   1 
ATOM   2340 C CB  . LEU A 1 305 ? 8.190   49.907 51.145 1.00   20.92 ? 305 LEU A CB  1 
ATOM   2341 C CG  . LEU A 1 305 ? 6.780   50.327 51.443 1.00   20.57 ? 305 LEU A CG  1 
ATOM   2342 C CD1 . LEU A 1 305 ? 6.877   51.429 52.463 1.00   22.28 ? 305 LEU A CD1 1 
ATOM   2343 C CD2 . LEU A 1 305 ? 6.123   50.788 50.179 1.00   20.35 ? 305 LEU A CD2 1 
ATOM   2344 N N   . GLU A 1 306 ? 10.221  47.540 50.673 1.00   25.47 ? 306 GLU A N   1 
ATOM   2345 C CA  . GLU A 1 306 ? 11.640  47.240 50.499 1.00   26.13 ? 306 GLU A CA  1 
ATOM   2346 C C   . GLU A 1 306 ? 11.959  46.495 49.233 1.00   25.25 ? 306 GLU A C   1 
ATOM   2347 O O   . GLU A 1 306 ? 13.019  46.726 48.661 1.00   26.17 ? 306 GLU A O   1 
ATOM   2348 C CB  . GLU A 1 306 ? 12.234  46.511 51.709 1.00   28.15 ? 306 GLU A CB  1 
ATOM   2349 C CG  . GLU A 1 306 ? 13.651  45.952 51.486 1.00   29.60 ? 306 GLU A CG  1 
ATOM   2350 C CD  . GLU A 1 306 ? 14.742  47.021 51.433 1.00   33.05 ? 306 GLU A CD  1 
ATOM   2351 O OE1 . GLU A 1 306 ? 14.494  48.172 51.900 1.00   32.95 ? 306 GLU A OE1 1 
ATOM   2352 O OE2 . GLU A 1 306 ? 15.868  46.684 50.954 1.00   34.70 ? 306 GLU A OE2 1 
ATOM   2353 N N   . SER A 1 307 ? 11.109  45.568 48.798 1.00   23.97 ? 307 SER A N   1 
ATOM   2354 C CA  . SER A 1 307 ? 11.439  44.871 47.554 1.00   23.85 ? 307 SER A CA  1 
ATOM   2355 C C   . SER A 1 307 ? 11.249  45.869 46.426 1.00   23.42 ? 307 SER A C   1 
ATOM   2356 O O   . SER A 1 307 ? 12.035  45.880 45.478 1.00   23.90 ? 307 SER A O   1 
ATOM   2357 C CB  . SER A 1 307 ? 10.628  43.607 47.344 1.00   22.10 ? 307 SER A CB  1 
ATOM   2358 O OG  . SER A 1 307 ? 9.262   43.906 47.338 1.00   27.59 ? 307 SER A OG  1 
ATOM   2359 N N   . MET A 1 308 ? 10.261  46.761 46.564 1.00   22.52 ? 308 MET A N   1 
ATOM   2360 C CA  . MET A 1 308 ? 10.055  47.816 45.579 1.00   20.98 ? 308 MET A CA  1 
ATOM   2361 C C   . MET A 1 308 ? 11.293  48.676 45.557 1.00   22.14 ? 308 MET A C   1 
ATOM   2362 O O   . MET A 1 308 ? 11.796  49.012 44.509 1.00   25.03 ? 308 MET A O   1 
ATOM   2363 C CB  . MET A 1 308 ? 8.857   48.671 45.921 1.00   18.50 ? 308 MET A CB  1 
ATOM   2364 C CG  . MET A 1 308 ? 7.573   47.990 45.605 1.00   18.98 ? 308 MET A CG  1 
ATOM   2365 S SD  . MET A 1 308 ? 6.198   49.051 45.859 1.00   21.56 ? 308 MET A SD  1 
ATOM   2366 C CE  . MET A 1 308 ? 6.087   49.890 44.333 1.00   24.70 ? 308 MET A CE  1 
ATOM   2367 N N   . LEU A 1 309 ? 11.854  48.991 46.711 1.00   24.26 ? 309 LEU A N   1 
ATOM   2368 C CA  . LEU A 1 309 ? 13.060  49.798 46.698 1.00   24.02 ? 309 LEU A CA  1 
ATOM   2369 C C   . LEU A 1 309 ? 14.184  49.020 46.056 1.00   23.96 ? 309 LEU A C   1 
ATOM   2370 O O   . LEU A 1 309 ? 14.920  49.533 45.234 1.00   23.34 ? 309 LEU A O   1 
ATOM   2371 C CB  . LEU A 1 309 ? 13.431  50.250 48.107 1.00   24.93 ? 309 LEU A CB  1 
ATOM   2372 C CG  . LEU A 1 309 ? 12.587  51.428 48.620 1.00   26.19 ? 309 LEU A CG  1 
ATOM   2373 C CD1 . LEU A 1 309 ? 13.039  51.801 50.002 1.00   26.22 ? 309 LEU A CD1 1 
ATOM   2374 C CD2 . LEU A 1 309 ? 12.736  52.624 47.696 1.00   25.63 ? 309 LEU A CD2 1 
ATOM   2375 N N   . ASN A 1 310 ? 14.256  47.742 46.357 1.00   24.87 ? 310 ASN A N   1 
ATOM   2376 C CA  . ASN A 1 310 ? 15.325  46.945 45.808 1.00   27.29 ? 310 ASN A CA  1 
ATOM   2377 C C   . ASN A 1 310 ? 15.267  46.724 44.312 1.00   27.07 ? 310 ASN A C   1 
ATOM   2378 O O   . ASN A 1 310 ? 16.303  46.668 43.662 1.00   27.69 ? 310 ASN A O   1 
ATOM   2379 C CB  . ASN A 1 310 ? 15.409  45.592 46.512 1.00   31.51 ? 310 ASN A CB  1 
ATOM   2380 C CG  . ASN A 1 310 ? 16.111  45.671 47.881 1.00   36.83 ? 310 ASN A CG  1 
ATOM   2381 O OD1 . ASN A 1 310 ? 16.829  46.653 48.186 1.00   38.22 ? 310 ASN A OD1 1 
ATOM   2382 N ND2 . ASN A 1 310 ? 15.917  44.621 48.719 1.00   38.37 ? 310 ASN A ND2 1 
ATOM   2383 N N   . SER A 1 311 ? 14.073  46.627 43.746 1.00   25.56 ? 311 SER A N   1 
ATOM   2384 C CA  . SER A 1 311 ? 13.975  46.346 42.324 1.00   23.93 ? 311 SER A CA  1 
ATOM   2385 C C   . SER A 1 311 ? 13.709  47.505 41.396 1.00   23.47 ? 311 SER A C   1 
ATOM   2386 O O   . SER A 1 311 ? 13.368  47.290 40.237 1.00   25.20 ? 311 SER A O   1 
ATOM   2387 C CB  . SER A 1 311 ? 12.947  45.252 42.082 1.00   23.42 ? 311 SER A CB  1 
ATOM   2388 O OG  . SER A 1 311 ? 11.644  45.718 42.369 1.00   24.64 ? 311 SER A OG  1 
ATOM   2389 N N   . GLY A 1 312 ? 13.900  48.724 41.874 1.00   21.69 ? 312 GLY A N   1 
ATOM   2390 C CA  . GLY A 1 312 ? 13.670  49.888 41.048 1.00   17.99 ? 312 GLY A CA  1 
ATOM   2391 C C   . GLY A 1 312 ? 12.210  50.110 40.745 1.00   17.49 ? 312 GLY A C   1 
ATOM   2392 O O   . GLY A 1 312 ? 11.868  51.006 40.001 1.00   17.74 ? 312 GLY A O   1 
ATOM   2393 N N   . ASN A 1 313 ? 11.337  49.336 41.350 1.00   16.30 ? 313 ASN A N   1 
ATOM   2394 C CA  . ASN A 1 313 ? 9.914   49.474 41.085 1.00   15.79 ? 313 ASN A CA  1 
ATOM   2395 C C   . ASN A 1 313 ? 9.362   50.778 41.635 1.00   17.17 ? 313 ASN A C   1 
ATOM   2396 O O   . ASN A 1 313 ? 8.631   50.787 42.605 1.00   19.64 ? 313 ASN A O   1 
ATOM   2397 C CB  . ASN A 1 313 ? 9.177   48.270 41.676 1.00   16.35 ? 313 ASN A CB  1 
ATOM   2398 C CG  . ASN A 1 313 ? 7.716   48.213 41.289 1.00   17.63 ? 313 ASN A CG  1 
ATOM   2399 O OD1 . ASN A 1 313 ? 7.149   49.169 40.733 1.00   20.98 ? 313 ASN A OD1 1 
ATOM   2400 N ND2 . ASN A 1 313 ? 7.085   47.082 41.582 1.00   18.25 ? 313 ASN A ND2 1 
ATOM   2401 N N   . PHE A 1 314 ? 9.754   51.895 41.045 1.00   18.46 ? 314 PHE A N   1 
ATOM   2402 C CA  . PHE A 1 314 ? 9.261   53.206 41.475 1.00   19.44 ? 314 PHE A CA  1 
ATOM   2403 C C   . PHE A 1 314 ? 9.449   54.278 40.397 1.00   19.32 ? 314 PHE A C   1 
ATOM   2404 O O   . PHE A 1 314 ? 10.207  54.104 39.454 1.00   20.19 ? 314 PHE A O   1 
ATOM   2405 C CB  . PHE A 1 314 ? 9.906   53.655 42.793 1.00   16.59 ? 314 PHE A CB  1 
ATOM   2406 C CG  . PHE A 1 314 ? 11.410  53.620 42.784 1.00   16.17 ? 314 PHE A CG  1 
ATOM   2407 C CD1 . PHE A 1 314 ? 12.137  54.586 42.122 1.00   14.76 ? 314 PHE A CD1 1 
ATOM   2408 C CD2 . PHE A 1 314 ? 12.090  52.613 43.437 1.00   14.97 ? 314 PHE A CD2 1 
ATOM   2409 C CE1 . PHE A 1 314 ? 13.484  54.553 42.106 1.00   13.27 ? 314 PHE A CE1 1 
ATOM   2410 C CE2 . PHE A 1 314 ? 13.453  52.579 43.421 1.00   14.39 ? 314 PHE A CE2 1 
ATOM   2411 C CZ  . PHE A 1 314 ? 14.149  53.559 42.749 1.00   14.57 ? 314 PHE A CZ  1 
ATOM   2412 N N   . LYS A 1 315 ? 8.772   55.399 40.543 1.00   18.48 ? 315 LYS A N   1 
ATOM   2413 C CA  . LYS A 1 315 ? 8.882   56.443 39.564 1.00   17.89 ? 315 LYS A CA  1 
ATOM   2414 C C   . LYS A 1 315 ? 10.285  57.005 39.542 1.00   20.47 ? 315 LYS A C   1 
ATOM   2415 O O   . LYS A 1 315 ? 10.773  57.480 40.571 1.00   23.59 ? 315 LYS A O   1 
ATOM   2416 C CB  . LYS A 1 315 ? 7.888   57.541 39.888 1.00   16.40 ? 315 LYS A CB  1 
ATOM   2417 C CG  . LYS A 1 315 ? 7.895   58.681 38.930 1.00   14.53 ? 315 LYS A CG  1 
ATOM   2418 C CD  . LYS A 1 315 ? 6.946   59.726 39.382 1.00   15.73 ? 315 LYS A CD  1 
ATOM   2419 C CE  . LYS A 1 315 ? 7.021   60.918 38.480 1.00   16.16 ? 315 LYS A CE  1 
ATOM   2420 N NZ  . LYS A 1 315 ? 6.299   60.656 37.205 1.00   17.24 ? 315 LYS A NZ  1 
ATOM   2421 N N   . LYS A 1 316 ? 10.977  56.908 38.412 1.00   20.36 ? 316 LYS A N   1 
ATOM   2422 C CA  . LYS A 1 316 ? 12.294  57.494 38.337 1.00   19.82 ? 316 LYS A CA  1 
ATOM   2423 C C   . LYS A 1 316 ? 12.139  58.948 37.930 1.00   20.77 ? 316 LYS A C   1 
ATOM   2424 O O   . LYS A 1 316 ? 11.466  59.255 36.949 1.00   25.04 ? 316 LYS A O   1 
ATOM   2425 C CB  . LYS A 1 316 ? 13.152  56.809 37.308 1.00   21.62 ? 316 LYS A CB  1 
ATOM   2426 C CG  . LYS A 1 316 ? 13.679  55.470 37.711 1.00   23.61 ? 316 LYS A CG  1 
ATOM   2427 C CD  . LYS A 1 316 ? 12.667  54.410 37.454 1.00   25.81 ? 316 LYS A CD  1 
ATOM   2428 C CE  . LYS A 1 316 ? 13.325  53.063 37.500 1.00   27.06 ? 316 LYS A CE  1 
ATOM   2429 N NZ  . LYS A 1 316 ? 12.322  52.025 37.152 1.00   31.40 ? 316 LYS A NZ  1 
ATOM   2430 N N   . THR A 1 317 ? 12.745  59.850 38.693 1.00   19.96 ? 317 THR A N   1 
ATOM   2431 C CA  . THR A 1 317 ? 12.700  61.269 38.411 1.00   16.15 ? 317 THR A CA  1 
ATOM   2432 C C   . THR A 1 317 ? 13.691  61.888 39.340 1.00   15.73 ? 317 THR A C   1 
ATOM   2433 O O   . THR A 1 317 ? 14.587  61.202 39.809 1.00   15.11 ? 317 THR A O   1 
ATOM   2434 C CB  . THR A 1 317 ? 11.326  61.866 38.639 1.00   15.89 ? 317 THR A CB  1 
ATOM   2435 O OG1 . THR A 1 317 ? 11.387  63.282 38.400 1.00   18.62 ? 317 THR A OG1 1 
ATOM   2436 C CG2 . THR A 1 317 ? 10.853  61.629 40.061 1.00   16.77 ? 317 THR A CG2 1 
ATOM   2437 N N   . GLN A 1 318 ? 13.602  63.192 39.529 1.00   16.90 ? 318 GLN A N   1 
ATOM   2438 C CA  . GLN A 1 318 ? 14.513  63.885 40.419 1.00   18.54 ? 318 GLN A CA  1 
ATOM   2439 C C   . GLN A 1 318 ? 13.770  64.081 41.725 1.00   18.77 ? 318 GLN A C   1 
ATOM   2440 O O   . GLN A 1 318 ? 12.556  64.274 41.733 1.00   18.25 ? 318 GLN A O   1 
ATOM   2441 C CB  . GLN A 1 318 ? 14.904  65.259 39.849 1.00   19.64 ? 318 GLN A CB  1 
ATOM   2442 C CG  . GLN A 1 318 ? 15.402  65.289 38.404 1.00   21.76 ? 318 GLN A CG  1 
ATOM   2443 C CD  . GLN A 1 318 ? 14.267  65.180 37.380 1.00   22.32 ? 318 GLN A CD  1 
ATOM   2444 O OE1 . GLN A 1 318 ? 13.355  65.992 37.349 1.00   21.54 ? 318 GLN A OE1 1 
ATOM   2445 N NE2 . GLN A 1 318 ? 14.339  64.173 36.533 1.00   26.91 ? 318 GLN A NE2 1 
ATOM   2446 N N   . ILE A 1 319 ? 14.480  63.984 42.836 1.00   19.08 ? 319 ILE A N   1 
ATOM   2447 C CA  . ILE A 1 319 ? 13.862  64.189 44.146 1.00   18.76 ? 319 ILE A CA  1 
ATOM   2448 C C   . ILE A 1 319 ? 14.802  65.032 44.982 1.00   17.12 ? 319 ILE A C   1 
ATOM   2449 O O   . ILE A 1 319 ? 16.018  64.925 44.853 1.00   17.65 ? 319 ILE A O   1 
ATOM   2450 C CB  . ILE A 1 319 ? 13.646  62.884 44.917 1.00   18.26 ? 319 ILE A CB  1 
ATOM   2451 C CG1 . ILE A 1 319 ? 14.975  62.177 45.074 1.00   18.38 ? 319 ILE A CG1 1 
ATOM   2452 C CG2 . ILE A 1 319 ? 12.621  61.995 44.249 1.00   18.66 ? 319 ILE A CG2 1 
ATOM   2453 C CD1 . ILE A 1 319 ? 14.942  61.153 46.129 1.00   20.67 ? 319 ILE A CD1 1 
ATOM   2454 N N   . LEU A 1 320 ? 14.238  65.884 45.821 1.00   16.19 ? 320 LEU A N   1 
ATOM   2455 C CA  . LEU A 1 320 ? 15.020  66.730 46.710 1.00   14.98 ? 320 LEU A CA  1 
ATOM   2456 C C   . LEU A 1 320 ? 14.518  66.395 48.114 1.00   15.43 ? 320 LEU A C   1 
ATOM   2457 O O   . LEU A 1 320 ? 13.329  66.528 48.418 1.00   13.10 ? 320 LEU A O   1 
ATOM   2458 C CB  . LEU A 1 320 ? 14.795  68.185 46.366 1.00   13.08 ? 320 LEU A CB  1 
ATOM   2459 C CG  . LEU A 1 320 ? 15.699  69.137 47.102 1.00   14.31 ? 320 LEU A CG  1 
ATOM   2460 C CD1 . LEU A 1 320 ? 15.852  70.436 46.354 1.00   11.38 ? 320 LEU A CD1 1 
ATOM   2461 C CD2 . LEU A 1 320 ? 15.104  69.355 48.472 1.00   16.45 ? 320 LEU A CD2 1 
ATOM   2462 N N   . LEU A 1 321 ? 15.415  65.927 48.964 1.00   16.84 ? 321 LEU A N   1 
ATOM   2463 C CA  . LEU A 1 321 ? 15.003  65.544 50.300 1.00   19.01 ? 321 LEU A CA  1 
ATOM   2464 C C   . LEU A 1 321 ? 16.000  65.849 51.406 1.00   20.59 ? 321 LEU A C   1 
ATOM   2465 O O   . LEU A 1 321 ? 17.187  66.119 51.149 1.00   21.26 ? 321 LEU A O   1 
ATOM   2466 C CB  . LEU A 1 321 ? 14.660  64.070 50.319 1.00   14.87 ? 321 LEU A CB  1 
ATOM   2467 C CG  . LEU A 1 321 ? 15.756  63.043 50.168 1.00   14.31 ? 321 LEU A CG  1 
ATOM   2468 C CD1 . LEU A 1 321 ? 15.068  61.705 50.220 1.00   13.27 ? 321 LEU A CD1 1 
ATOM   2469 C CD2 . LEU A 1 321 ? 16.489  63.195 48.863 1.00   15.13 ? 321 LEU A CD2 1 
ATOM   2470 N N   . GLY A 1 322 ? 15.538  65.782 52.647 1.00   20.20 ? 322 GLY A N   1 
ATOM   2471 C CA  . GLY A 1 322 ? 16.454  66.054 53.719 1.00   19.50 ? 322 GLY A CA  1 
ATOM   2472 C C   . GLY A 1 322 ? 15.839  65.905 55.069 1.00   20.40 ? 322 GLY A C   1 
ATOM   2473 O O   . GLY A 1 322 ? 14.656  65.603 55.201 1.00   19.06 ? 322 GLY A O   1 
ATOM   2474 N N   . VAL A 1 323 ? 16.646  66.169 56.080 1.00   19.30 ? 323 VAL A N   1 
ATOM   2475 C CA  . VAL A 1 323 ? 16.204  66.034 57.431 1.00   18.21 ? 323 VAL A CA  1 
ATOM   2476 C C   . VAL A 1 323 ? 16.735  67.207 58.252 1.00   19.98 ? 323 VAL A C   1 
ATOM   2477 O O   . VAL A 1 323 ? 17.568  67.963 57.760 1.00   20.41 ? 323 VAL A O   1 
ATOM   2478 C CB  . VAL A 1 323 ? 16.712  64.700 57.975 1.00   16.78 ? 323 VAL A CB  1 
ATOM   2479 C CG1 . VAL A 1 323 ? 16.093  63.563 57.222 1.00   13.78 ? 323 VAL A CG1 1 
ATOM   2480 C CG2 . VAL A 1 323 ? 18.185  64.602 57.821 1.00   18.31 ? 323 VAL A CG2 1 
ATOM   2481 N N   . ASN A 1 324 ? 16.129  67.448 59.420 1.00   19.97 ? 324 ASN A N   1 
ATOM   2482 C CA  . ASN A 1 324 ? 16.552  68.491 60.366 1.00   19.49 ? 324 ASN A CA  1 
ATOM   2483 C C   . ASN A 1 324 ? 17.485  67.836 61.350 1.00   20.16 ? 324 ASN A C   1 
ATOM   2484 O O   . ASN A 1 324 ? 17.436  66.627 61.545 1.00   20.51 ? 324 ASN A O   1 
ATOM   2485 C CB  . ASN A 1 324 ? 15.385  69.039 61.172 1.00   19.59 ? 324 ASN A CB  1 
ATOM   2486 C CG  . ASN A 1 324 ? 14.457  69.890 60.352 1.00   20.65 ? 324 ASN A CG  1 
ATOM   2487 O OD1 . ASN A 1 324 ? 14.670  70.091 59.162 1.00   23.26 ? 324 ASN A OD1 1 
ATOM   2488 N ND2 . ASN A 1 324 ? 13.398  70.367 60.973 1.00   21.03 ? 324 ASN A ND2 1 
ATOM   2489 N N   . LYS A 1 325 ? 18.283  68.643 62.028 1.00   20.47 ? 325 LYS A N   1 
ATOM   2490 C CA  . LYS A 1 325 ? 19.228  68.122 63.003 1.00   21.17 ? 325 LYS A CA  1 
ATOM   2491 C C   . LYS A 1 325 ? 18.635  67.406 64.205 1.00   21.22 ? 325 LYS A C   1 
ATOM   2492 O O   . LYS A 1 325 ? 19.135  66.346 64.579 1.00   22.37 ? 325 LYS A O   1 
ATOM   2493 C CB  . LYS A 1 325 ? 20.175  69.210 63.515 1.00   20.89 ? 325 LYS A CB  1 
ATOM   2494 C CG  . LYS A 1 325 ? 21.277  68.606 64.353 1.00   22.94 ? 325 LYS A CG  1 
ATOM   2495 C CD  . LYS A 1 325 ? 22.501  69.481 64.503 1.00   26.15 ? 325 LYS A CD  1 
ATOM   2496 C CE  . LYS A 1 325 ? 22.427  70.270 65.741 1.00   27.36 ? 325 LYS A CE  1 
ATOM   2497 N NZ  . LYS A 1 325 ? 21.243  71.139 65.647 1.00   30.98 ? 325 LYS A NZ  1 
ATOM   2498 N N   . ASP A 1 326 ? 17.583  67.953 64.811 1.00   20.40 ? 326 ASP A N   1 
ATOM   2499 C CA  . ASP A 1 326 ? 17.016  67.339 66.007 1.00   18.66 ? 326 ASP A CA  1 
ATOM   2500 C C   . ASP A 1 326 ? 15.586  66.954 65.782 1.00   19.35 ? 326 ASP A C   1 
ATOM   2501 O O   . ASP A 1 326 ? 14.667  67.628 66.240 1.00   20.25 ? 326 ASP A O   1 
ATOM   2502 C CB  . ASP A 1 326 ? 17.139  68.300 67.192 1.00   16.04 ? 326 ASP A CB  1 
ATOM   2503 C CG  . ASP A 1 326 ? 18.547  68.827 67.366 1.00   16.29 ? 326 ASP A CG  1 
ATOM   2504 O OD1 . ASP A 1 326 ? 19.491  68.044 67.606 1.00   16.57 ? 326 ASP A OD1 1 
ATOM   2505 O OD2 . ASP A 1 326 ? 18.727  70.044 67.255 1.00   17.19 ? 326 ASP A OD2 1 
ATOM   2506 N N   . GLU A 1 327 ? 15.409  65.825 65.118 1.00   20.12 ? 327 GLU A N   1 
ATOM   2507 C CA  . GLU A 1 327 ? 14.094  65.303 64.771 1.00   19.07 ? 327 GLU A CA  1 
ATOM   2508 C C   . GLU A 1 327 ? 13.384  64.684 65.949 1.00   19.38 ? 327 GLU A C   1 
ATOM   2509 O O   . GLU A 1 327 ? 12.156  64.707 66.020 1.00   21.27 ? 327 GLU A O   1 
ATOM   2510 C CB  . GLU A 1 327 ? 14.223  64.211 63.700 1.00   20.66 ? 327 GLU A CB  1 
ATOM   2511 C CG  . GLU A 1 327 ? 14.823  64.633 62.369 1.00   20.74 ? 327 GLU A CG  1 
ATOM   2512 C CD  . GLU A 1 327 ? 13.855  65.409 61.517 1.00   21.10 ? 327 GLU A CD  1 
ATOM   2513 O OE1 . GLU A 1 327 ? 12.694  65.594 61.911 1.00   21.83 ? 327 GLU A OE1 1 
ATOM   2514 O OE2 . GLU A 1 327 ? 14.244  65.839 60.434 1.00   22.61 ? 327 GLU A OE2 1 
ATOM   2515 N N   . GLY A 1 328 ? 14.141  64.080 66.850 1.00   17.82 ? 328 GLY A N   1 
ATOM   2516 C CA  . GLY A 1 328 ? 13.508  63.420 67.985 1.00   18.22 ? 328 GLY A CA  1 
ATOM   2517 C C   . GLY A 1 328 ? 13.048  64.234 69.181 1.00   17.07 ? 328 GLY A C   1 
ATOM   2518 O O   . GLY A 1 328 ? 12.047  63.903 69.801 1.00   17.01 ? 328 GLY A O   1 
ATOM   2519 N N   . SER A 1 329 ? 13.738  65.328 69.467 1.00   17.29 ? 329 SER A N   1 
ATOM   2520 C CA  . SER A 1 329 ? 13.418  66.147 70.595 1.00   17.75 ? 329 SER A CA  1 
ATOM   2521 C C   . SER A 1 329 ? 11.939  66.273 70.806 1.00   18.50 ? 329 SER A C   1 
ATOM   2522 O O   . SER A 1 329 ? 11.426  65.842 71.818 1.00   20.86 ? 329 SER A O   1 
ATOM   2523 C CB  . SER A 1 329 ? 14.059  67.496 70.450 1.00   17.77 ? 329 SER A CB  1 
ATOM   2524 O OG  . SER A 1 329 ? 13.408  68.227 69.451 1.00   19.80 ? 329 SER A OG  1 
ATOM   2525 N N   . PHE A 1 330 ? 11.213  66.669 69.790 1.00   19.92 ? 330 PHE A N   1 
ATOM   2526 C CA  . PHE A 1 330 ? 9.761   66.832 69.936 1.00   19.74 ? 330 PHE A CA  1 
ATOM   2527 C C   . PHE A 1 330 ? 8.983   65.645 70.516 1.00   19.71 ? 330 PHE A C   1 
ATOM   2528 O O   . PHE A 1 330 ? 8.039   65.830 71.285 1.00   20.56 ? 330 PHE A O   1 
ATOM   2529 C CB  . PHE A 1 330 ? 9.134   67.229 68.599 1.00   19.78 ? 330 PHE A CB  1 
ATOM   2530 C CG  . PHE A 1 330 ? 7.778   67.812 68.732 1.00   23.92 ? 330 PHE A CG  1 
ATOM   2531 C CD1 . PHE A 1 330 ? 6.648   66.984 68.796 1.00   26.20 ? 330 PHE A CD1 1 
ATOM   2532 C CD2 . PHE A 1 330 ? 7.616   69.196 68.829 1.00   26.12 ? 330 PHE A CD2 1 
ATOM   2533 C CE1 . PHE A 1 330 ? 5.364   67.523 68.958 1.00   25.72 ? 330 PHE A CE1 1 
ATOM   2534 C CE2 . PHE A 1 330 ? 6.336   69.760 68.995 1.00   26.86 ? 330 PHE A CE2 1 
ATOM   2535 C CZ  . PHE A 1 330 ? 5.209   68.919 69.060 1.00   27.54 ? 330 PHE A CZ  1 
ATOM   2536 N N   . PHE A 1 331 ? 9.366   64.427 70.164 1.00   18.52 ? 331 PHE A N   1 
ATOM   2537 C CA  . PHE A 1 331 ? 8.641   63.248 70.627 1.00   16.62 ? 331 PHE A CA  1 
ATOM   2538 C C   . PHE A 1 331 ? 9.074   62.797 71.992 1.00   16.62 ? 331 PHE A C   1 
ATOM   2539 O O   . PHE A 1 331 ? 8.367   62.043 72.640 1.00   15.69 ? 331 PHE A O   1 
ATOM   2540 C CB  . PHE A 1 331 ? 8.818   62.120 69.619 1.00   16.12 ? 331 PHE A CB  1 
ATOM   2541 C CG  . PHE A 1 331 ? 8.413   62.512 68.258 1.00   16.42 ? 331 PHE A CG  1 
ATOM   2542 C CD1 . PHE A 1 331 ? 9.277   63.263 67.467 1.00   16.24 ? 331 PHE A CD1 1 
ATOM   2543 C CD2 . PHE A 1 331 ? 7.115   62.288 67.825 1.00   15.83 ? 331 PHE A CD2 1 
ATOM   2544 C CE1 . PHE A 1 331 ? 8.855   63.805 66.276 1.00   16.13 ? 331 PHE A CE1 1 
ATOM   2545 C CE2 . PHE A 1 331 ? 6.671   62.822 66.630 1.00   16.36 ? 331 PHE A CE2 1 
ATOM   2546 C CZ  . PHE A 1 331 ? 7.541   63.589 65.850 1.00   16.44 ? 331 PHE A CZ  1 
ATOM   2547 N N   . LEU A 1 332 ? 10.297  63.157 72.371 1.00   16.90 ? 332 LEU A N   1 
ATOM   2548 C CA  . LEU A 1 332 ? 10.813  62.810 73.684 1.00   16.36 ? 332 LEU A CA  1 
ATOM   2549 C C   . LEU A 1 332 ? 10.038  63.736 74.621 1.00   16.82 ? 332 LEU A C   1 
ATOM   2550 O O   . LEU A 1 332 ? 9.278   63.264 75.464 1.00   17.35 ? 332 LEU A O   1 
ATOM   2551 C CB  . LEU A 1 332 ? 12.316  63.063 73.759 1.00   12.44 ? 332 LEU A CB  1 
ATOM   2552 C CG  . LEU A 1 332 ? 13.179  62.069 73.017 1.00   8.55  ? 332 LEU A CG  1 
ATOM   2553 C CD1 . LEU A 1 332 ? 14.573  62.516 73.069 1.00   10.13 ? 332 LEU A CD1 1 
ATOM   2554 C CD2 . LEU A 1 332 ? 13.046  60.705 73.612 1.00   8.48  ? 332 LEU A CD2 1 
ATOM   2555 N N   . LEU A 1 333 ? 10.086  65.036 74.341 1.00   16.90 ? 333 LEU A N   1 
ATOM   2556 C CA  . LEU A 1 333 ? 9.365   66.024 75.135 1.00   19.31 ? 333 LEU A CA  1 
ATOM   2557 C C   . LEU A 1 333 ? 7.947   65.585 75.477 1.00   20.29 ? 333 LEU A C   1 
ATOM   2558 O O   . LEU A 1 333 ? 7.472   65.844 76.576 1.00   23.78 ? 333 LEU A O   1 
ATOM   2559 C CB  . LEU A 1 333 ? 9.274   67.370 74.413 1.00   17.26 ? 333 LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 333 ? 8.342   68.347 75.146 1.00   19.19 ? 333 LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 333 ? 8.915   68.588 76.479 1.00   16.59 ? 333 LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 333 ? 8.168   69.683 74.440 1.00   18.77 ? 333 LEU A CD2 1 
ATOM   2563 N N   . TYR A 1 334 ? 7.289   64.898 74.556 1.00   20.22 ? 334 TYR A N   1 
ATOM   2564 C CA  . TYR A 1 334 ? 5.909   64.477 74.750 1.00   18.01 ? 334 TYR A CA  1 
ATOM   2565 C C   . TYR A 1 334 ? 5.668   63.083 75.297 1.00   17.87 ? 334 TYR A C   1 
ATOM   2566 O O   . TYR A 1 334 ? 4.592   62.805 75.803 1.00   20.80 ? 334 TYR A O   1 
ATOM   2567 C CB  . TYR A 1 334 ? 5.158   64.561 73.415 1.00   16.65 ? 334 TYR A CB  1 
ATOM   2568 C CG  . TYR A 1 334 ? 4.589   65.904 73.060 1.00   13.69 ? 334 TYR A CG  1 
ATOM   2569 C CD1 . TYR A 1 334 ? 5.405   66.988 72.811 1.00   11.82 ? 334 TYR A CD1 1 
ATOM   2570 C CD2 . TYR A 1 334 ? 3.217   66.082 72.996 1.00   13.00 ? 334 TYR A CD2 1 
ATOM   2571 C CE1 . TYR A 1 334 ? 4.864   68.208 72.521 1.00   10.93 ? 334 TYR A CE1 1 
ATOM   2572 C CE2 . TYR A 1 334 ? 2.674   67.296 72.701 1.00   12.88 ? 334 TYR A CE2 1 
ATOM   2573 C CZ  . TYR A 1 334 ? 3.500   68.348 72.470 1.00   12.00 ? 334 TYR A CZ  1 
ATOM   2574 O OH  . TYR A 1 334 ? 2.929   69.556 72.213 1.00   16.54 ? 334 TYR A OH  1 
ATOM   2575 N N   . GLY A 1 335 ? 6.604   62.174 75.149 1.00   16.61 ? 335 GLY A N   1 
ATOM   2576 C CA  . GLY A 1 335 ? 6.297   60.854 75.628 1.00   17.54 ? 335 GLY A CA  1 
ATOM   2577 C C   . GLY A 1 335 ? 7.424   60.135 76.314 1.00   19.43 ? 335 GLY A C   1 
ATOM   2578 O O   . GLY A 1 335 ? 7.317   58.928 76.536 1.00   22.60 ? 335 GLY A O   1 
ATOM   2579 N N   . ALA A 1 336 ? 8.527   60.812 76.571 1.00   17.71 ? 336 ALA A N   1 
ATOM   2580 C CA  . ALA A 1 336 ? 9.616   60.167 77.283 1.00   20.24 ? 336 ALA A CA  1 
ATOM   2581 C C   . ALA A 1 336 ? 9.687   60.821 78.671 1.00   21.24 ? 336 ALA A C   1 
ATOM   2582 O O   . ALA A 1 336 ? 9.476   62.032 78.799 1.00   21.40 ? 336 ALA A O   1 
ATOM   2583 C CB  . ALA A 1 336 ? 10.922  60.363 76.550 1.00   17.96 ? 336 ALA A CB  1 
ATOM   2584 N N   . PRO A 1 337 ? 9.919   60.032 79.730 1.00   20.02 ? 337 PRO A N   1 
ATOM   2585 C CA  . PRO A 1 337 ? 10.009  60.571 81.090 1.00   20.27 ? 337 PRO A CA  1 
ATOM   2586 C C   . PRO A 1 337 ? 11.349  61.268 81.293 1.00   20.31 ? 337 PRO A C   1 
ATOM   2587 O O   . PRO A 1 337 ? 12.374  60.784 80.827 1.00   20.49 ? 337 PRO A O   1 
ATOM   2588 C CB  . PRO A 1 337 ? 9.939   59.322 81.942 1.00   22.04 ? 337 PRO A CB  1 
ATOM   2589 C CG  . PRO A 1 337 ? 10.676  58.328 81.098 1.00   22.20 ? 337 PRO A CG  1 
ATOM   2590 C CD  . PRO A 1 337 ? 10.073  58.573 79.735 1.00   19.65 ? 337 PRO A CD  1 
ATOM   2591 N N   . GLY A 1 338 ? 11.345  62.403 81.982 1.00   18.96 ? 338 GLY A N   1 
ATOM   2592 C CA  . GLY A 1 338 ? 12.583  63.108 82.213 1.00   17.56 ? 338 GLY A CA  1 
ATOM   2593 C C   . GLY A 1 338 ? 12.644  64.417 81.460 1.00   19.22 ? 338 GLY A C   1 
ATOM   2594 O O   . GLY A 1 338 ? 13.341  65.349 81.869 1.00   21.04 ? 338 GLY A O   1 
ATOM   2595 N N   . PHE A 1 339 ? 11.856  64.519 80.395 1.00   17.50 ? 339 PHE A N   1 
ATOM   2596 C CA  . PHE A 1 339 ? 11.862  65.701 79.555 1.00   15.99 ? 339 PHE A CA  1 
ATOM   2597 C C   . PHE A 1 339 ? 10.715  66.558 79.940 1.00   16.48 ? 339 PHE A C   1 
ATOM   2598 O O   . PHE A 1 339 ? 9.635   66.046 80.184 1.00   18.40 ? 339 PHE A O   1 
ATOM   2599 C CB  . PHE A 1 339 ? 11.705  65.311 78.084 1.00   14.69 ? 339 PHE A CB  1 
ATOM   2600 C CG  . PHE A 1 339 ? 12.794  64.408 77.555 1.00   11.77 ? 339 PHE A CG  1 
ATOM   2601 C CD1 . PHE A 1 339 ? 12.681  63.032 77.653 1.00   11.18 ? 339 PHE A CD1 1 
ATOM   2602 C CD2 . PHE A 1 339 ? 13.902  64.935 76.927 1.00   10.49 ? 339 PHE A CD2 1 
ATOM   2603 C CE1 . PHE A 1 339 ? 13.652  62.197 77.134 1.00   10.29 ? 339 PHE A CE1 1 
ATOM   2604 C CE2 . PHE A 1 339 ? 14.874  64.111 76.407 1.00   10.16 ? 339 PHE A CE2 1 
ATOM   2605 C CZ  . PHE A 1 339 ? 14.744  62.736 76.514 1.00   10.90 ? 339 PHE A CZ  1 
ATOM   2606 N N   . SER A 1 340 ? 10.930  67.865 79.962 1.00   17.79 ? 340 SER A N   1 
ATOM   2607 C CA  . SER A 1 340 ? 9.868   68.794 80.315 1.00   20.11 ? 340 SER A CA  1 
ATOM   2608 C C   . SER A 1 340 ? 10.083  69.997 79.428 1.00   20.54 ? 340 SER A C   1 
ATOM   2609 O O   . SER A 1 340 ? 11.223  70.325 79.106 1.00   21.42 ? 340 SER A O   1 
ATOM   2610 C CB  . SER A 1 340 ? 10.003  69.233 81.781 1.00   21.75 ? 340 SER A CB  1 
ATOM   2611 O OG  . SER A 1 340 ? 10.053  68.109 82.645 1.00   25.50 ? 340 SER A OG  1 
ATOM   2612 N N   . LYS A 1 341 ? 9.021   70.718 79.111 1.00   19.42 ? 341 LYS A N   1 
ATOM   2613 C CA  . LYS A 1 341 ? 9.168   71.859 78.244 1.00   19.28 ? 341 LYS A CA  1 
ATOM   2614 C C   . LYS A 1 341 ? 9.947   72.944 78.910 1.00   20.34 ? 341 LYS A C   1 
ATOM   2615 O O   . LYS A 1 341 ? 10.643  73.695 78.232 1.00   23.54 ? 341 LYS A O   1 
ATOM   2616 C CB  . LYS A 1 341 ? 7.818   72.412 77.818 1.00   16.67 ? 341 LYS A CB  1 
ATOM   2617 C CG  . LYS A 1 341 ? 7.946   73.621 76.930 1.00   15.16 ? 341 LYS A CG  1 
ATOM   2618 C CD  . LYS A 1 341 ? 6.597   74.179 76.535 1.00   15.09 ? 341 LYS A CD  1 
ATOM   2619 C CE  . LYS A 1 341 ? 5.929   74.955 77.650 1.00   15.87 ? 341 LYS A CE  1 
ATOM   2620 N NZ  . LYS A 1 341 ? 6.636   76.230 77.986 1.00   15.89 ? 341 LYS A NZ  1 
ATOM   2621 N N   . ASP A 1 342 ? 9.870   73.015 80.235 1.00   21.20 ? 342 ASP A N   1 
ATOM   2622 C CA  . ASP A 1 342 ? 10.540  74.080 80.970 1.00   19.79 ? 342 ASP A CA  1 
ATOM   2623 C C   . ASP A 1 342 ? 11.844  73.838 81.698 1.00   19.34 ? 342 ASP A C   1 
ATOM   2624 O O   . ASP A 1 342 ? 12.287  74.716 82.426 1.00   20.26 ? 342 ASP A O   1 
ATOM   2625 C CB  . ASP A 1 342 ? 9.552   74.728 81.904 1.00   20.70 ? 342 ASP A CB  1 
ATOM   2626 C CG  . ASP A 1 342 ? 8.326   75.235 81.185 1.00   23.64 ? 342 ASP A CG  1 
ATOM   2627 O OD1 . ASP A 1 342 ? 8.468   75.697 80.044 1.00   24.85 ? 342 ASP A OD1 1 
ATOM   2628 O OD2 . ASP A 1 342 ? 7.215   75.170 81.751 1.00   23.46 ? 342 ASP A OD2 1 
ATOM   2629 N N   . SER A 1 343 ? 12.445  72.665 81.549 1.00   19.67 ? 343 SER A N   1 
ATOM   2630 C CA  . SER A 1 343 ? 13.734  72.388 82.182 1.00   20.82 ? 343 SER A CA  1 
ATOM   2631 C C   . SER A 1 343 ? 14.741  72.019 81.109 1.00   21.58 ? 343 SER A C   1 
ATOM   2632 O O   . SER A 1 343 ? 14.358  71.764 79.987 1.00   22.82 ? 343 SER A O   1 
ATOM   2633 C CB  . SER A 1 343 ? 13.636  71.227 83.151 1.00   20.83 ? 343 SER A CB  1 
ATOM   2634 O OG  . SER A 1 343 ? 13.284  70.028 82.499 1.00   21.65 ? 343 SER A OG  1 
ATOM   2635 N N   . GLU A 1 344 ? 16.023  71.944 81.448 1.00   23.33 ? 344 GLU A N   1 
ATOM   2636 C CA  . GLU A 1 344 ? 17.043  71.575 80.464 1.00   22.94 ? 344 GLU A CA  1 
ATOM   2637 C C   . GLU A 1 344 ? 16.897  70.083 80.157 1.00   23.56 ? 344 GLU A C   1 
ATOM   2638 O O   . GLU A 1 344 ? 17.709  69.501 79.438 1.00   24.89 ? 344 GLU A O   1 
ATOM   2639 C CB  . GLU A 1 344 ? 18.458  71.817 81.013 1.00   23.87 ? 344 GLU A CB  1 
ATOM   2640 C CG  . GLU A 1 344 ? 18.796  73.254 81.426 1.00   26.49 ? 344 GLU A CG  1 
ATOM   2641 C CD  . GLU A 1 344 ? 20.153  73.345 82.131 1.00   27.20 ? 344 GLU A CD  1 
ATOM   2642 N N   . SER A 1 345 ? 15.927  69.438 80.778 1.00   21.26 ? 345 SER A N   1 
ATOM   2643 C CA  . SER A 1 345 ? 15.714  68.038 80.556 1.00   21.24 ? 345 SER A CA  1 
ATOM   2644 C C   . SER A 1 345 ? 16.972  67.187 80.591 1.00   23.04 ? 345 SER A C   1 
ATOM   2645 O O   . SER A 1 345 ? 17.146  66.312 79.740 1.00   24.30 ? 345 SER A O   1 
ATOM   2646 C CB  . SER A 1 345 ? 14.947  67.825 79.260 1.00   20.43 ? 345 SER A CB  1 
ATOM   2647 O OG  . SER A 1 345 ? 13.638  68.383 79.371 1.00   22.65 ? 345 SER A OG  1 
ATOM   2648 N N   . LYS A 1 346 ? 17.862  67.429 81.555 1.00   23.56 ? 346 LYS A N   1 
ATOM   2649 C CA  . LYS A 1 346 ? 19.059  66.582 81.669 1.00   24.98 ? 346 LYS A CA  1 
ATOM   2650 C C   . LYS A 1 346 ? 18.469  65.212 82.013 1.00   25.10 ? 346 LYS A C   1 
ATOM   2651 O O   . LYS A 1 346 ? 17.483  65.150 82.740 1.00   25.41 ? 346 LYS A O   1 
ATOM   2652 C CB  . LYS A 1 346 ? 19.979  67.081 82.773 1.00   26.30 ? 346 LYS A CB  1 
ATOM   2653 C CG  . LYS A 1 346 ? 20.638  68.433 82.475 1.00   28.43 ? 346 LYS A CG  1 
ATOM   2654 C CD  . LYS A 1 346 ? 21.439  68.923 83.685 1.00   33.15 ? 346 LYS A CD  1 
ATOM   2655 C CE  . LYS A 1 346 ? 22.044  70.329 83.480 1.00   36.26 ? 346 LYS A CE  1 
ATOM   2656 N NZ  . LYS A 1 346 ? 23.010  70.700 84.579 1.00   37.95 ? 346 LYS A NZ  1 
ATOM   2657 N N   . ILE A 1 347 ? 19.040  64.123 81.505 1.00   25.81 ? 347 ILE A N   1 
ATOM   2658 C CA  . ILE A 1 347 ? 18.457  62.789 81.719 1.00   27.03 ? 347 ILE A CA  1 
ATOM   2659 C C   . ILE A 1 347 ? 19.403  61.811 82.420 1.00   28.62 ? 347 ILE A C   1 
ATOM   2660 O O   . ILE A 1 347 ? 20.591  61.712 82.118 1.00   29.09 ? 347 ILE A O   1 
ATOM   2661 C CB  . ILE A 1 347 ? 17.968  62.182 80.323 1.00   27.20 ? 347 ILE A CB  1 
ATOM   2662 C CG1 . ILE A 1 347 ? 16.929  63.090 79.657 1.00   24.80 ? 347 ILE A CG1 1 
ATOM   2663 C CG2 . ILE A 1 347 ? 17.391  60.811 80.463 1.00   25.90 ? 347 ILE A CG2 1 
ATOM   2664 C CD1 . ILE A 1 347 ? 15.639  63.125 80.349 1.00   22.87 ? 347 ILE A CD1 1 
ATOM   2665 N N   . SER A 1 348 ? 18.873  61.096 83.391 1.00   30.64 ? 348 SER A N   1 
ATOM   2666 C CA  . SER A 1 348 ? 19.664  60.133 84.148 1.00   32.75 ? 348 SER A CA  1 
ATOM   2667 C C   . SER A 1 348 ? 19.715  58.858 83.342 1.00   33.63 ? 348 SER A C   1 
ATOM   2668 O O   . SER A 1 348 ? 18.814  58.630 82.532 1.00   34.77 ? 348 SER A O   1 
ATOM   2669 C CB  . SER A 1 348 ? 18.906  59.791 85.417 1.00   32.39 ? 348 SER A CB  1 
ATOM   2670 O OG  . SER A 1 348 ? 17.881  58.850 85.114 1.00   31.36 ? 348 SER A OG  1 
ATOM   2671 N N   . ARG A 1 349 ? 20.677  57.978 83.618 1.00   33.61 ? 349 ARG A N   1 
ATOM   2672 C CA  . ARG A 1 349 ? 20.723  56.704 82.899 1.00   34.00 ? 349 ARG A CA  1 
ATOM   2673 C C   . ARG A 1 349 ? 19.411  55.976 83.109 1.00   33.17 ? 349 ARG A C   1 
ATOM   2674 O O   . ARG A 1 349 ? 18.913  55.331 82.213 1.00   33.84 ? 349 ARG A O   1 
ATOM   2675 C CB  . ARG A 1 349 ? 21.821  55.805 83.425 1.00   36.31 ? 349 ARG A CB  1 
ATOM   2676 C CG  . ARG A 1 349 ? 23.203  56.338 83.147 1.00   40.73 ? 349 ARG A CG  1 
ATOM   2677 C CD  . ARG A 1 349 ? 23.360  56.632 81.655 1.00   42.10 ? 349 ARG A CD  1 
ATOM   2678 N NE  . ARG A 1 349 ? 23.250  55.419 80.843 1.00   43.11 ? 349 ARG A NE  1 
ATOM   2679 C CZ  . ARG A 1 349 ? 23.815  55.307 79.649 1.00   42.60 ? 349 ARG A CZ  1 
ATOM   2680 N NH1 . ARG A 1 349 ? 24.522  56.330 79.174 1.00   43.70 ? 349 ARG A NH1 1 
ATOM   2681 N NH2 . ARG A 1 349 ? 23.616  54.227 78.902 1.00   41.91 ? 349 ARG A NH2 1 
ATOM   2682 N N   . GLU A 1 350 ? 18.820  56.092 84.280 1.00   32.39 ? 350 GLU A N   1 
ATOM   2683 C CA  . GLU A 1 350 ? 17.586  55.367 84.478 1.00   32.88 ? 350 GLU A CA  1 
ATOM   2684 C C   . GLU A 1 350 ? 16.555  55.833 83.473 1.00   31.95 ? 350 GLU A C   1 
ATOM   2685 O O   . GLU A 1 350 ? 15.802  55.022 82.941 1.00   33.38 ? 350 GLU A O   1 
ATOM   2686 C CB  . GLU A 1 350 ? 17.065  55.514 85.918 1.00   35.14 ? 350 GLU A CB  1 
ATOM   2687 C CG  . GLU A 1 350 ? 15.941  54.508 86.315 1.00   37.53 ? 350 GLU A CG  1 
ATOM   2688 C CD  . GLU A 1 350 ? 14.571  54.889 85.755 1.00   38.27 ? 350 GLU A CD  1 
ATOM   2689 N N   . ASP A 1 351 ? 16.496  57.128 83.208 1.00   30.12 ? 351 ASP A N   1 
ATOM   2690 C CA  . ASP A 1 351 ? 15.506  57.619 82.263 1.00   28.84 ? 351 ASP A CA  1 
ATOM   2691 C C   . ASP A 1 351 ? 15.992  57.478 80.821 1.00   29.23 ? 351 ASP A C   1 
ATOM   2692 O O   . ASP A 1 351 ? 15.200  57.324 79.876 1.00   28.57 ? 351 ASP A O   1 
ATOM   2693 C CB  . ASP A 1 351 ? 15.115  59.038 82.601 1.00   28.64 ? 351 ASP A CB  1 
ATOM   2694 C CG  . ASP A 1 351 ? 14.135  59.105 83.759 1.00   27.50 ? 351 ASP A CG  1 
ATOM   2695 O OD1 . ASP A 1 351 ? 13.611  58.049 84.189 1.00   26.13 ? 351 ASP A OD1 1 
ATOM   2696 O OD2 . ASP A 1 351 ? 13.883  60.236 84.222 1.00   28.59 ? 351 ASP A OD2 1 
ATOM   2697 N N   . PHE A 1 352 ? 17.305  57.424 80.665 1.00   27.08 ? 352 PHE A N   1 
ATOM   2698 C CA  . PHE A 1 352 ? 17.864  57.222 79.367 1.00   24.91 ? 352 PHE A CA  1 
ATOM   2699 C C   . PHE A 1 352 ? 17.367  55.851 78.994 1.00   26.06 ? 352 PHE A C   1 
ATOM   2700 O O   . PHE A 1 352 ? 16.548  55.720 78.098 1.00   27.92 ? 352 PHE A O   1 
ATOM   2701 C CB  . PHE A 1 352 ? 19.350  57.183 79.448 1.00   21.97 ? 352 PHE A CB  1 
ATOM   2702 C CG  . PHE A 1 352 ? 19.987  56.861 78.172 1.00   23.00 ? 352 PHE A CG  1 
ATOM   2703 C CD1 . PHE A 1 352 ? 20.281  57.864 77.266 1.00   24.69 ? 352 PHE A CD1 1 
ATOM   2704 C CD2 . PHE A 1 352 ? 20.356  55.571 77.885 1.00   23.94 ? 352 PHE A CD2 1 
ATOM   2705 C CE1 . PHE A 1 352 ? 20.949  57.585 76.085 1.00   25.44 ? 352 PHE A CE1 1 
ATOM   2706 C CE2 . PHE A 1 352 ? 21.023  55.279 76.713 1.00   26.96 ? 352 PHE A CE2 1 
ATOM   2707 C CZ  . PHE A 1 352 ? 21.323  56.292 75.805 1.00   25.67 ? 352 PHE A CZ  1 
ATOM   2708 N N   . MET A 1 353 ? 17.824  54.836 79.721 1.00   27.09 ? 353 MET A N   1 
ATOM   2709 C CA  . MET A 1 353 ? 17.435  53.447 79.502 1.00   27.10 ? 353 MET A CA  1 
ATOM   2710 C C   . MET A 1 353 ? 15.945  53.251 79.279 1.00   27.19 ? 353 MET A C   1 
ATOM   2711 O O   . MET A 1 353 ? 15.555  52.222 78.731 1.00   28.85 ? 353 MET A O   1 
ATOM   2712 C CB  . MET A 1 353 ? 17.864  52.572 80.687 1.00   31.17 ? 353 MET A CB  1 
ATOM   2713 C CG  . MET A 1 353 ? 19.334  52.074 80.714 1.00   35.45 ? 353 MET A CG  1 
ATOM   2714 S SD  . MET A 1 353 ? 19.744  51.187 82.316 1.00   39.58 ? 353 MET A SD  1 
ATOM   2715 C CE  . MET A 1 353 ? 18.061  50.636 82.924 1.00   36.49 ? 353 MET A CE  1 
ATOM   2716 N N   . SER A 1 354 ? 15.104  54.179 79.741 1.00   25.39 ? 354 SER A N   1 
ATOM   2717 C CA  . SER A 1 354 ? 13.654  54.055 79.521 1.00   25.64 ? 354 SER A CA  1 
ATOM   2718 C C   . SER A 1 354 ? 13.276  54.671 78.185 1.00   24.29 ? 354 SER A C   1 
ATOM   2719 O O   . SER A 1 354 ? 12.306  54.247 77.551 1.00   24.43 ? 354 SER A O   1 
ATOM   2720 C CB  . SER A 1 354 ? 12.864  54.761 80.617 1.00   24.86 ? 354 SER A CB  1 
ATOM   2721 O OG  . SER A 1 354 ? 13.037  54.081 81.851 1.00   31.86 ? 354 SER A OG  1 
ATOM   2722 N N   . GLY A 1 355 ? 13.981  55.740 77.827 1.00   22.76 ? 355 GLY A N   1 
ATOM   2723 C CA  . GLY A 1 355 ? 13.776  56.413 76.569 1.00   20.81 ? 355 GLY A CA  1 
ATOM   2724 C C   . GLY A 1 355 ? 14.142  55.498 75.419 1.00   21.48 ? 355 GLY A C   1 
ATOM   2725 O O   . GLY A 1 355 ? 13.381  55.409 74.455 1.00   21.19 ? 355 GLY A O   1 
ATOM   2726 N N   . VAL A 1 356 ? 15.262  54.778 75.503 1.00   20.81 ? 356 VAL A N   1 
ATOM   2727 C CA  . VAL A 1 356 ? 15.615  53.886 74.399 1.00   20.60 ? 356 VAL A CA  1 
ATOM   2728 C C   . VAL A 1 356 ? 14.629  52.765 74.206 1.00   22.00 ? 356 VAL A C   1 
ATOM   2729 O O   . VAL A 1 356 ? 14.442  52.313 73.086 1.00   24.64 ? 356 VAL A O   1 
ATOM   2730 C CB  . VAL A 1 356 ? 17.006  53.288 74.485 1.00   19.04 ? 356 VAL A CB  1 
ATOM   2731 C CG1 . VAL A 1 356 ? 17.965  54.268 75.075 1.00   18.97 ? 356 VAL A CG1 1 
ATOM   2732 C CG2 . VAL A 1 356 ? 16.993  52.007 75.200 1.00   21.66 ? 356 VAL A CG2 1 
ATOM   2733 N N   . LYS A 1 357 ? 13.973  52.341 75.280 1.00   22.52 ? 357 LYS A N   1 
ATOM   2734 C CA  . LYS A 1 357 ? 12.988  51.266 75.227 1.00   21.49 ? 357 LYS A CA  1 
ATOM   2735 C C   . LYS A 1 357 ? 11.745  51.752 74.506 1.00   21.45 ? 357 LYS A C   1 
ATOM   2736 O O   . LYS A 1 357 ? 11.034  50.988 73.845 1.00   20.51 ? 357 LYS A O   1 
ATOM   2737 C CB  . LYS A 1 357 ? 12.599  50.854 76.637 1.00   23.30 ? 357 LYS A CB  1 
ATOM   2738 C CG  . LYS A 1 357 ? 11.479  49.807 76.704 1.00   27.29 ? 357 LYS A CG  1 
ATOM   2739 C CD  . LYS A 1 357 ? 12.013  48.383 76.943 1.00   29.87 ? 357 LYS A CD  1 
ATOM   2740 C CE  . LYS A 1 357 ? 10.939  47.281 76.695 1.00   30.20 ? 357 LYS A CE  1 
ATOM   2741 N N   . LEU A 1 358 ? 11.437  53.018 74.708 1.00   21.47 ? 358 LEU A N   1 
ATOM   2742 C CA  . LEU A 1 358 ? 10.272  53.614 74.082 1.00   20.96 ? 358 LEU A CA  1 
ATOM   2743 C C   . LEU A 1 358 ? 10.532  53.913 72.619 1.00   20.84 ? 358 LEU A C   1 
ATOM   2744 O O   . LEU A 1 358 ? 9.613   53.874 71.820 1.00   20.96 ? 358 LEU A O   1 
ATOM   2745 C CB  . LEU A 1 358 ? 9.901   54.916 74.798 1.00   20.44 ? 358 LEU A CB  1 
ATOM   2746 C CG  . LEU A 1 358 ? 8.813   54.861 75.852 1.00   19.42 ? 358 LEU A CG  1 
ATOM   2747 C CD1 . LEU A 1 358 ? 9.228   53.920 76.916 1.00   21.99 ? 358 LEU A CD1 1 
ATOM   2748 C CD2 . LEU A 1 358 ? 8.607   56.221 76.437 1.00   21.53 ? 358 LEU A CD2 1 
ATOM   2749 N N   . SER A 1 359 ? 11.773  54.268 72.298 1.00   20.71 ? 359 SER A N   1 
ATOM   2750 C CA  . SER A 1 359 ? 12.184  54.630 70.961 1.00   19.90 ? 359 SER A CA  1 
ATOM   2751 C C   . SER A 1 359 ? 12.290  53.475 70.002 1.00   21.81 ? 359 SER A C   1 
ATOM   2752 O O   . SER A 1 359 ? 12.022  53.638 68.807 1.00   24.81 ? 359 SER A O   1 
ATOM   2753 C CB  . SER A 1 359 ? 13.506  55.349 71.022 1.00   19.47 ? 359 SER A CB  1 
ATOM   2754 O OG  . SER A 1 359 ? 13.411  56.457 71.893 1.00   19.55 ? 359 SER A OG  1 
ATOM   2755 N N   . VAL A 1 360 ? 12.694  52.312 70.501 1.00   22.07 ? 360 VAL A N   1 
ATOM   2756 C CA  . VAL A 1 360 ? 12.834  51.111 69.683 1.00   21.46 ? 360 VAL A CA  1 
ATOM   2757 C C   . VAL A 1 360 ? 11.976  50.003 70.288 1.00   23.51 ? 360 VAL A C   1 
ATOM   2758 O O   . VAL A 1 360 ? 12.465  48.913 70.547 1.00   25.35 ? 360 VAL A O   1 
ATOM   2759 C CB  . VAL A 1 360 ? 14.281  50.646 69.687 1.00   19.70 ? 360 VAL A CB  1 
ATOM   2760 C CG1 . VAL A 1 360 ? 14.513  49.650 68.586 1.00   20.03 ? 360 VAL A CG1 1 
ATOM   2761 C CG2 . VAL A 1 360 ? 15.182  51.816 69.545 1.00   20.00 ? 360 VAL A CG2 1 
ATOM   2762 N N   . PRO A 1 361 ? 10.650  50.203 70.334 1.00   26.45 ? 361 PRO A N   1 
ATOM   2763 C CA  . PRO A 1 361 ? 9.677   49.254 70.904 1.00   26.65 ? 361 PRO A CA  1 
ATOM   2764 C C   . PRO A 1 361 ? 9.769   47.823 70.506 1.00   28.35 ? 361 PRO A C   1 
ATOM   2765 O O   . PRO A 1 361 ? 9.441   46.928 71.284 1.00   31.21 ? 361 PRO A O   1 
ATOM   2766 C CB  . PRO A 1 361 ? 8.335   49.833 70.482 1.00   25.95 ? 361 PRO A CB  1 
ATOM   2767 C CG  . PRO A 1 361 ? 8.654   50.580 69.227 1.00   26.98 ? 361 PRO A CG  1 
ATOM   2768 C CD  . PRO A 1 361 ? 9.953   51.260 69.582 1.00   26.36 ? 361 PRO A CD  1 
ATOM   2769 N N   . HIS A 1 362 ? 10.219  47.587 69.291 1.00   29.67 ? 362 HIS A N   1 
ATOM   2770 C CA  . HIS A 1 362 ? 10.315  46.226 68.770 1.00   30.56 ? 362 HIS A CA  1 
ATOM   2771 C C   . HIS A 1 362 ? 11.610  45.486 69.123 1.00   29.66 ? 362 HIS A C   1 
ATOM   2772 O O   . HIS A 1 362 ? 11.755  44.306 68.819 1.00   31.01 ? 362 HIS A O   1 
ATOM   2773 C CB  . HIS A 1 362 ? 10.161  46.280 67.236 1.00   32.22 ? 362 HIS A CB  1 
ATOM   2774 C CG  . HIS A 1 362 ? 11.102  47.243 66.586 1.00   31.76 ? 362 HIS A CG  1 
ATOM   2775 N ND1 . HIS A 1 362 ? 10.899  48.609 66.623 1.00   32.14 ? 362 HIS A ND1 1 
ATOM   2776 C CD2 . HIS A 1 362 ? 12.316  47.055 66.013 1.00   31.18 ? 362 HIS A CD2 1 
ATOM   2777 C CE1 . HIS A 1 362 ? 11.958  49.221 66.118 1.00   32.18 ? 362 HIS A CE1 1 
ATOM   2778 N NE2 . HIS A 1 362 ? 12.832  48.301 65.740 1.00   32.44 ? 362 HIS A NE2 1 
ATOM   2779 N N   . ALA A 1 363 ? 12.569  46.165 69.729 1.00   28.97 ? 363 ALA A N   1 
ATOM   2780 C CA  . ALA A 1 363 ? 13.821  45.495 70.035 1.00   28.55 ? 363 ALA A CA  1 
ATOM   2781 C C   . ALA A 1 363 ? 13.743  44.596 71.250 1.00   28.93 ? 363 ALA A C   1 
ATOM   2782 O O   . ALA A 1 363 ? 13.026  44.861 72.210 1.00   30.92 ? 363 ALA A O   1 
ATOM   2783 C CB  . ALA A 1 363 ? 14.911  46.503 70.211 1.00   27.63 ? 363 ALA A CB  1 
ATOM   2784 N N   . ASN A 1 364 ? 14.449  43.489 71.183 1.00   28.02 ? 364 ASN A N   1 
ATOM   2785 C CA  . ASN A 1 364 ? 14.502  42.568 72.293 1.00   26.42 ? 364 ASN A CA  1 
ATOM   2786 C C   . ASN A 1 364 ? 15.589  43.195 73.149 1.00   26.06 ? 364 ASN A C   1 
ATOM   2787 O O   . ASN A 1 364 ? 16.211  44.173 72.748 1.00   25.64 ? 364 ASN A O   1 
ATOM   2788 C CB  . ASN A 1 364 ? 14.956  41.205 71.779 1.00   26.46 ? 364 ASN A CB  1 
ATOM   2789 C CG  . ASN A 1 364 ? 16.236  41.298 71.004 1.00   26.42 ? 364 ASN A CG  1 
ATOM   2790 O OD1 . ASN A 1 364 ? 16.836  42.368 70.933 1.00   27.08 ? 364 ASN A OD1 1 
ATOM   2791 N ND2 . ASN A 1 364 ? 16.683  40.191 70.440 1.00   26.01 ? 364 ASN A ND2 1 
ATOM   2792 N N   . ASP A 1 365 ? 15.919  42.573 74.265 1.00   26.54 ? 365 ASP A N   1 
ATOM   2793 C CA  . ASP A 1 365 ? 16.926  43.131 75.149 1.00   25.49 ? 365 ASP A CA  1 
ATOM   2794 C C   . ASP A 1 365 ? 18.299  43.286 74.520 1.00   24.38 ? 365 ASP A C   1 
ATOM   2795 O O   . ASP A 1 365 ? 18.972  44.283 74.730 1.00   25.27 ? 365 ASP A O   1 
ATOM   2796 C CB  . ASP A 1 365 ? 16.989  42.312 76.437 1.00   28.42 ? 365 ASP A CB  1 
ATOM   2797 C CG  . ASP A 1 365 ? 15.738  42.497 77.315 1.00   29.99 ? 365 ASP A CG  1 
ATOM   2798 N N   . LEU A 1 366 ? 18.744  42.307 73.759 1.00   23.30 ? 366 LEU A N   1 
ATOM   2799 C CA  . LEU A 1 366 ? 20.042  42.423 73.131 1.00   22.06 ? 366 LEU A CA  1 
ATOM   2800 C C   . LEU A 1 366 ? 20.007  43.626 72.204 1.00   22.42 ? 366 LEU A C   1 
ATOM   2801 O O   . LEU A 1 366 ? 20.987  44.373 72.078 1.00   22.48 ? 366 LEU A O   1 
ATOM   2802 C CB  . LEU A 1 366 ? 20.337  41.161 72.361 1.00   23.30 ? 366 LEU A CB  1 
ATOM   2803 C CG  . LEU A 1 366 ? 21.665  41.194 71.637 1.00   25.91 ? 366 LEU A CG  1 
ATOM   2804 C CD1 . LEU A 1 366 ? 22.783  41.589 72.593 1.00   24.43 ? 366 LEU A CD1 1 
ATOM   2805 C CD2 . LEU A 1 366 ? 21.902  39.847 71.030 1.00   25.21 ? 366 LEU A CD2 1 
ATOM   2806 N N   . GLY A 1 367 ? 18.840  43.868 71.621 1.00   21.70 ? 367 GLY A N   1 
ATOM   2807 C CA  . GLY A 1 367 ? 18.675  45.004 70.736 1.00   19.74 ? 367 GLY A CA  1 
ATOM   2808 C C   . GLY A 1 367 ? 18.828  46.294 71.503 1.00   19.19 ? 367 GLY A C   1 
ATOM   2809 O O   . GLY A 1 367 ? 19.645  47.134 71.144 1.00   20.19 ? 367 GLY A O   1 
ATOM   2810 N N   . LEU A 1 368 ? 18.080  46.447 72.589 1.00   18.63 ? 368 LEU A N   1 
ATOM   2811 C CA  . LEU A 1 368 ? 18.161  47.661 73.389 1.00   17.49 ? 368 LEU A CA  1 
ATOM   2812 C C   . LEU A 1 368 ? 19.555  47.803 73.947 1.00   17.77 ? 368 LEU A C   1 
ATOM   2813 O O   . LEU A 1 368 ? 19.952  48.883 74.358 1.00   19.19 ? 368 LEU A O   1 
ATOM   2814 C CB  . LEU A 1 368 ? 17.153  47.653 74.529 1.00   18.15 ? 368 LEU A CB  1 
ATOM   2815 C CG  . LEU A 1 368 ? 15.679  47.483 74.194 1.00   18.17 ? 368 LEU A CG  1 
ATOM   2816 C CD1 . LEU A 1 368 ? 14.968  47.178 75.448 1.00   19.22 ? 368 LEU A CD1 1 
ATOM   2817 C CD2 . LEU A 1 368 ? 15.076  48.698 73.543 1.00   18.73 ? 368 LEU A CD2 1 
ATOM   2818 N N   . ASP A 1 369 ? 20.302  46.708 73.985 1.00   18.22 ? 369 ASP A N   1 
ATOM   2819 C CA  . ASP A 1 369 ? 21.669  46.758 74.477 1.00   19.02 ? 369 ASP A CA  1 
ATOM   2820 C C   . ASP A 1 369 ? 22.543  47.280 73.380 1.00   18.76 ? 369 ASP A C   1 
ATOM   2821 O O   . ASP A 1 369 ? 23.502  48.007 73.637 1.00   20.34 ? 369 ASP A O   1 
ATOM   2822 C CB  . ASP A 1 369 ? 22.172  45.385 74.914 1.00   24.36 ? 369 ASP A CB  1 
ATOM   2823 C CG  . ASP A 1 369 ? 21.812  45.037 76.369 1.00   27.21 ? 369 ASP A CG  1 
ATOM   2824 O OD1 . ASP A 1 369 ? 21.341  45.908 77.138 1.00   29.95 ? 369 ASP A OD1 1 
ATOM   2825 O OD2 . ASP A 1 369 ? 22.056  43.875 76.763 1.00   30.28 ? 369 ASP A OD2 1 
ATOM   2826 N N   . ALA A 1 370 ? 22.241  46.914 72.144 1.00   18.53 ? 370 ALA A N   1 
ATOM   2827 C CA  . ALA A 1 370 ? 23.050  47.428 71.049 1.00   16.77 ? 370 ALA A CA  1 
ATOM   2828 C C   . ALA A 1 370 ? 22.808  48.920 70.937 1.00   15.78 ? 370 ALA A C   1 
ATOM   2829 O O   . ALA A 1 370 ? 23.757  49.674 70.901 1.00   17.47 ? 370 ALA A O   1 
ATOM   2830 C CB  . ALA A 1 370 ? 22.743  46.730 69.768 1.00   15.63 ? 370 ALA A CB  1 
ATOM   2831 N N   . VAL A 1 371 ? 21.563  49.378 70.998 1.00   14.33 ? 371 VAL A N   1 
ATOM   2832 C CA  . VAL A 1 371 ? 21.320  50.815 70.880 1.00   13.32 ? 371 VAL A CA  1 
ATOM   2833 C C   . VAL A 1 371 ? 22.070  51.565 71.963 1.00   15.28 ? 371 VAL A C   1 
ATOM   2834 O O   . VAL A 1 371 ? 22.861  52.451 71.670 1.00   18.04 ? 371 VAL A O   1 
ATOM   2835 C CB  . VAL A 1 371 ? 19.827  51.157 70.937 1.00   13.22 ? 371 VAL A CB  1 
ATOM   2836 C CG1 . VAL A 1 371 ? 19.612  52.649 70.885 1.00   10.29 ? 371 VAL A CG1 1 
ATOM   2837 C CG2 . VAL A 1 371 ? 19.117  50.506 69.815 1.00   10.60 ? 371 VAL A CG2 1 
ATOM   2838 N N   . THR A 1 372 ? 21.861  51.192 73.218 1.00   16.62 ? 372 THR A N   1 
ATOM   2839 C CA  . THR A 1 372 ? 22.555  51.830 74.335 1.00   17.00 ? 372 THR A CA  1 
ATOM   2840 C C   . THR A 1 372 ? 24.085  51.854 74.187 1.00   16.11 ? 372 THR A C   1 
ATOM   2841 O O   . THR A 1 372 ? 24.706  52.856 74.458 1.00   16.67 ? 372 THR A O   1 
ATOM   2842 C CB  . THR A 1 372 ? 22.221  51.141 75.629 1.00   18.08 ? 372 THR A CB  1 
ATOM   2843 O OG1 . THR A 1 372 ? 20.802  50.982 75.709 1.00   20.59 ? 372 THR A OG1 1 
ATOM   2844 C CG2 . THR A 1 372 ? 22.697  51.982 76.807 1.00   17.89 ? 372 THR A CG2 1 
ATOM   2845 N N   . LEU A 1 373 ? 24.695  50.760 73.753 1.00   15.66 ? 373 LEU A N   1 
ATOM   2846 C CA  . LEU A 1 373 ? 26.157  50.744 73.577 1.00   17.80 ? 373 LEU A CA  1 
ATOM   2847 C C   . LEU A 1 373 ? 26.627  51.753 72.556 1.00   19.25 ? 373 LEU A C   1 
ATOM   2848 O O   . LEU A 1 373 ? 27.712  52.296 72.662 1.00   20.37 ? 373 LEU A O   1 
ATOM   2849 C CB  . LEU A 1 373 ? 26.644  49.367 73.104 1.00   17.78 ? 373 LEU A CB  1 
ATOM   2850 C CG  . LEU A 1 373 ? 28.148  49.264 72.850 1.00   19.26 ? 373 LEU A CG  1 
ATOM   2851 C CD1 . LEU A 1 373 ? 28.859  49.209 74.186 1.00   20.30 ? 373 LEU A CD1 1 
ATOM   2852 C CD2 . LEU A 1 373 ? 28.498  48.040 72.035 1.00   18.65 ? 373 LEU A CD2 1 
ATOM   2853 N N   . GLN A 1 374 ? 25.814  51.965 71.535 1.00   22.07 ? 374 GLN A N   1 
ATOM   2854 C CA  . GLN A 1 374 ? 26.140  52.854 70.443 1.00   22.16 ? 374 GLN A CA  1 
ATOM   2855 C C   . GLN A 1 374 ? 25.927  54.319 70.789 1.00   22.44 ? 374 GLN A C   1 
ATOM   2856 O O   . GLN A 1 374 ? 26.700  55.179 70.384 1.00   22.62 ? 374 GLN A O   1 
ATOM   2857 C CB  . GLN A 1 374 ? 25.267  52.453 69.265 1.00   24.87 ? 374 GLN A CB  1 
ATOM   2858 C CG  . GLN A 1 374 ? 25.682  52.969 67.911 1.00   27.35 ? 374 GLN A CG  1 
ATOM   2859 C CD  . GLN A 1 374 ? 26.863  52.214 67.335 1.00   28.79 ? 374 GLN A CD  1 
ATOM   2860 O OE1 . GLN A 1 374 ? 27.412  52.616 66.290 1.00   30.58 ? 374 GLN A OE1 1 
ATOM   2861 N NE2 . GLN A 1 374 ? 27.260  51.108 67.992 1.00   26.06 ? 374 GLN A NE2 1 
ATOM   2862 N N   . TYR A 1 375 ? 24.873  54.605 71.544 1.00   23.19 ? 375 TYR A N   1 
ATOM   2863 C CA  . TYR A 1 375 ? 24.553  55.977 71.909 1.00   22.80 ? 375 TYR A CA  1 
ATOM   2864 C C   . TYR A 1 375 ? 24.994  56.466 73.286 1.00   22.20 ? 375 TYR A C   1 
ATOM   2865 O O   . TYR A 1 375 ? 24.625  57.559 73.725 1.00   23.14 ? 375 TYR A O   1 
ATOM   2866 C CB  . TYR A 1 375 ? 23.067  56.207 71.686 1.00   22.69 ? 375 TYR A CB  1 
ATOM   2867 C CG  . TYR A 1 375 ? 22.753  56.265 70.196 1.00   24.01 ? 375 TYR A CG  1 
ATOM   2868 C CD1 . TYR A 1 375 ? 22.889  57.456 69.483 1.00   22.61 ? 375 TYR A CD1 1 
ATOM   2869 C CD2 . TYR A 1 375 ? 22.346  55.123 69.493 1.00   23.00 ? 375 TYR A CD2 1 
ATOM   2870 C CE1 . TYR A 1 375 ? 22.626  57.503 68.136 1.00   20.52 ? 375 TYR A CE1 1 
ATOM   2871 C CE2 . TYR A 1 375 ? 22.089  55.174 68.156 1.00   19.53 ? 375 TYR A CE2 1 
ATOM   2872 C CZ  . TYR A 1 375 ? 22.229  56.365 67.493 1.00   20.53 ? 375 TYR A CZ  1 
ATOM   2873 O OH  . TYR A 1 375 ? 21.941  56.444 66.165 1.00   24.19 ? 375 TYR A OH  1 
ATOM   2874 N N   . THR A 1 376 ? 25.868  55.708 73.924 1.00   21.09 ? 376 THR A N   1 
ATOM   2875 C CA  . THR A 1 376 ? 26.343  56.064 75.227 1.00   21.21 ? 376 THR A CA  1 
ATOM   2876 C C   . THR A 1 376 ? 27.824  56.390 75.261 1.00   21.19 ? 376 THR A C   1 
ATOM   2877 O O   . THR A 1 376 ? 28.658  55.713 74.660 1.00   21.58 ? 376 THR A O   1 
ATOM   2878 C CB  . THR A 1 376 ? 26.064  54.942 76.200 1.00   20.21 ? 376 THR A CB  1 
ATOM   2879 O OG1 . THR A 1 376 ? 24.651  54.742 76.308 1.00   21.92 ? 376 THR A OG1 1 
ATOM   2880 C CG2 . THR A 1 376 ? 26.611  55.280 77.547 1.00   21.03 ? 376 THR A CG2 1 
ATOM   2881 N N   . ASP A 1 377 ? 28.146  57.440 75.990 1.00   21.77 ? 377 ASP A N   1 
ATOM   2882 C CA  . ASP A 1 377 ? 29.512  57.849 76.158 1.00   23.91 ? 377 ASP A CA  1 
ATOM   2883 C C   . ASP A 1 377 ? 29.958  57.136 77.430 1.00   26.39 ? 377 ASP A C   1 
ATOM   2884 O O   . ASP A 1 377 ? 29.815  57.688 78.517 1.00   28.70 ? 377 ASP A O   1 
ATOM   2885 C CB  . ASP A 1 377 ? 29.553  59.354 76.371 1.00   22.64 ? 377 ASP A CB  1 
ATOM   2886 C CG  . ASP A 1 377 ? 30.959  59.895 76.438 1.00   25.00 ? 377 ASP A CG  1 
ATOM   2887 O OD1 . ASP A 1 377 ? 31.913  59.105 76.647 1.00   24.00 ? 377 ASP A OD1 1 
ATOM   2888 O OD2 . ASP A 1 377 ? 31.114  61.129 76.275 1.00   26.17 ? 377 ASP A OD2 1 
ATOM   2889 N N   . TRP A 1 378 ? 30.471  55.913 77.315 1.00   27.71 ? 378 TRP A N   1 
ATOM   2890 C CA  . TRP A 1 378 ? 30.917  55.143 78.479 1.00   27.81 ? 378 TRP A CA  1 
ATOM   2891 C C   . TRP A 1 378 ? 31.953  55.805 79.322 1.00   28.59 ? 378 TRP A C   1 
ATOM   2892 O O   . TRP A 1 378 ? 32.238  55.352 80.425 1.00   30.43 ? 378 TRP A O   1 
ATOM   2893 C CB  . TRP A 1 378 ? 31.455  53.798 78.060 1.00   27.34 ? 378 TRP A CB  1 
ATOM   2894 C CG  . TRP A 1 378 ? 30.408  53.032 77.499 1.00   29.70 ? 378 TRP A CG  1 
ATOM   2895 C CD1 . TRP A 1 378 ? 30.258  52.691 76.194 1.00   32.34 ? 378 TRP A CD1 1 
ATOM   2896 C CD2 . TRP A 1 378 ? 29.238  52.597 78.171 1.00   30.30 ? 378 TRP A CD2 1 
ATOM   2897 N NE1 . TRP A 1 378 ? 29.045  52.078 76.003 1.00   32.84 ? 378 TRP A NE1 1 
ATOM   2898 C CE2 . TRP A 1 378 ? 28.399  52.007 77.208 1.00   32.01 ? 378 TRP A CE2 1 
ATOM   2899 C CE3 . TRP A 1 378 ? 28.809  52.655 79.498 1.00   30.74 ? 378 TRP A CE3 1 
ATOM   2900 C CZ2 . TRP A 1 378 ? 27.155  51.476 77.529 1.00   33.09 ? 378 TRP A CZ2 1 
ATOM   2901 C CZ3 . TRP A 1 378 ? 27.576  52.130 79.824 1.00   32.20 ? 378 TRP A CZ3 1 
ATOM   2902 C CH2 . TRP A 1 378 ? 26.759  51.547 78.845 1.00   34.13 ? 378 TRP A CH2 1 
ATOM   2903 N N   . MET A 1 379 ? 32.553  56.861 78.817 1.00   29.05 ? 379 MET A N   1 
ATOM   2904 C CA  . MET A 1 379 ? 33.565  57.539 79.605 1.00   31.01 ? 379 MET A CA  1 
ATOM   2905 C C   . MET A 1 379 ? 32.946  58.725 80.331 1.00   30.14 ? 379 MET A C   1 
ATOM   2906 O O   . MET A 1 379 ? 33.648  59.495 80.968 1.00   31.75 ? 379 MET A O   1 
ATOM   2907 C CB  . MET A 1 379 ? 34.699  57.990 78.679 1.00   33.35 ? 379 MET A CB  1 
ATOM   2908 C CG  . MET A 1 379 ? 35.860  58.730 79.333 1.00   38.66 ? 379 MET A CG  1 
ATOM   2909 S SD  . MET A 1 379 ? 37.259  58.697 78.163 1.00   43.93 ? 379 MET A SD  1 
ATOM   2910 C CE  . MET A 1 379 ? 37.843  56.898 78.437 1.00   38.61 ? 379 MET A CE  1 
ATOM   2911 N N   . ASP A 1 380 ? 31.623  58.827 80.315 1.00   29.52 ? 380 ASP A N   1 
ATOM   2912 C CA  . ASP A 1 380 ? 30.941  59.958 80.928 1.00   28.95 ? 380 ASP A CA  1 
ATOM   2913 C C   . ASP A 1 380 ? 29.472  59.589 80.864 1.00   29.18 ? 380 ASP A C   1 
ATOM   2914 O O   . ASP A 1 380 ? 28.633  60.393 80.482 1.00   28.35 ? 380 ASP A O   1 
ATOM   2915 C CB  . ASP A 1 380 ? 31.246  61.201 80.090 1.00   29.60 ? 380 ASP A CB  1 
ATOM   2916 C CG  . ASP A 1 380 ? 30.714  62.485 80.689 1.00   31.25 ? 380 ASP A CG  1 
ATOM   2917 O OD1 . ASP A 1 380 ? 29.710  62.460 81.404 1.00   34.66 ? 380 ASP A OD1 1 
ATOM   2918 O OD2 . ASP A 1 380 ? 31.273  63.559 80.401 1.00   34.23 ? 380 ASP A OD2 1 
ATOM   2919 N N   . ASP A 1 381 ? 29.167  58.383 81.334 1.00   30.72 ? 381 ASP A N   1 
ATOM   2920 C CA  . ASP A 1 381 ? 27.811  57.857 81.291 1.00   32.59 ? 381 ASP A CA  1 
ATOM   2921 C C   . ASP A 1 381 ? 26.770  58.438 82.200 1.00   33.63 ? 381 ASP A C   1 
ATOM   2922 O O   . ASP A 1 381 ? 25.596  58.069 82.099 1.00   34.46 ? 381 ASP A O   1 
ATOM   2923 C CB  . ASP A 1 381 ? 27.791  56.329 81.408 1.00   33.83 ? 381 ASP A CB  1 
ATOM   2924 C CG  . ASP A 1 381 ? 28.458  55.820 82.676 1.00   35.67 ? 381 ASP A CG  1 
ATOM   2925 O OD1 . ASP A 1 381 ? 29.601  56.259 83.014 1.00   34.46 ? 381 ASP A OD1 1 
ATOM   2926 O OD2 . ASP A 1 381 ? 27.848  54.919 83.312 1.00   37.72 ? 381 ASP A OD2 1 
ATOM   2927 N N   . ASN A 1 382 ? 27.138  59.344 83.091 1.00   35.23 ? 382 ASN A N   1 
ATOM   2928 C CA  . ASN A 1 382 ? 26.094  59.904 83.950 1.00   35.86 ? 382 ASN A CA  1 
ATOM   2929 C C   . ASN A 1 382 ? 25.892  61.373 83.704 1.00   35.75 ? 382 ASN A C   1 
ATOM   2930 O O   . ASN A 1 382 ? 25.470  62.114 84.601 1.00   38.27 ? 382 ASN A O   1 
ATOM   2931 C CB  . ASN A 1 382 ? 26.320  59.585 85.428 1.00   36.95 ? 382 ASN A CB  1 
ATOM   2932 C CG  . ASN A 1 382 ? 25.531  58.346 85.868 1.00   39.84 ? 382 ASN A CG  1 
ATOM   2933 O OD1 . ASN A 1 382 ? 24.270  58.356 85.898 1.00   42.39 ? 382 ASN A OD1 1 
ATOM   2934 N ND2 . ASN A 1 382 ? 26.247  57.252 86.151 1.00   41.17 ? 382 ASN A ND2 1 
ATOM   2935 N N   . ASN A 1 383 ? 26.236  61.798 82.484 1.00   33.69 ? 383 ASN A N   1 
ATOM   2936 C CA  . ASN A 1 383 ? 26.078  63.182 82.045 1.00   29.81 ? 383 ASN A CA  1 
ATOM   2937 C C   . ASN A 1 383 ? 24.624  63.256 81.643 1.00   29.18 ? 383 ASN A C   1 
ATOM   2938 O O   . ASN A 1 383 ? 24.109  62.360 80.980 1.00   32.00 ? 383 ASN A O   1 
ATOM   2939 C CB  . ASN A 1 383 ? 26.949  63.442 80.834 1.00   28.69 ? 383 ASN A CB  1 
ATOM   2940 C CG  . ASN A 1 383 ? 27.069  64.910 80.515 1.00   28.52 ? 383 ASN A CG  1 
ATOM   2941 O OD1 . ASN A 1 383 ? 28.171  65.443 80.431 1.00   27.56 ? 383 ASN A OD1 1 
ATOM   2942 N ND2 . ASN A 1 383 ? 25.933  65.573 80.319 1.00   27.97 ? 383 ASN A ND2 1 
ATOM   2943 N N   . GLY A 1 384 ? 23.945  64.313 82.024 1.00   27.50 ? 384 GLY A N   1 
ATOM   2944 C CA  . GLY A 1 384 ? 22.534  64.398 81.696 1.00   24.45 ? 384 GLY A CA  1 
ATOM   2945 C C   . GLY A 1 384 ? 22.347  64.987 80.341 1.00   21.98 ? 384 GLY A C   1 
ATOM   2946 O O   . GLY A 1 384 ? 21.400  64.667 79.666 1.00   20.77 ? 384 GLY A O   1 
ATOM   2947 N N   . ILE A 1 385 ? 23.216  65.919 79.997 1.00   20.90 ? 385 ILE A N   1 
ATOM   2948 C CA  . ILE A 1 385 ? 23.188  66.560 78.713 1.00   21.00 ? 385 ILE A CA  1 
ATOM   2949 C C   . ILE A 1 385 ? 23.447  65.477 77.688 1.00   22.08 ? 385 ILE A C   1 
ATOM   2950 O O   . ILE A 1 385 ? 22.652  65.258 76.807 1.00   24.48 ? 385 ILE A O   1 
ATOM   2951 C CB  . ILE A 1 385 ? 24.275  67.591 78.640 1.00   21.86 ? 385 ILE A CB  1 
ATOM   2952 C CG1 . ILE A 1 385 ? 24.065  68.603 79.750 1.00   22.74 ? 385 ILE A CG1 1 
ATOM   2953 C CG2 . ILE A 1 385 ? 24.246  68.314 77.335 1.00   22.91 ? 385 ILE A CG2 1 
ATOM   2954 C CD1 . ILE A 1 385 ? 22.697  69.183 79.728 1.00   22.74 ? 385 ILE A CD1 1 
ATOM   2955 N N   . LYS A 1 386 ? 24.502  64.711 77.853 1.00   23.27 ? 386 LYS A N   1 
ATOM   2956 C CA  . LYS A 1 386 ? 24.792  63.656 76.893 1.00   23.09 ? 386 LYS A CA  1 
ATOM   2957 C C   . LYS A 1 386 ? 23.721  62.582 76.792 1.00   23.59 ? 386 LYS A C   1 
ATOM   2958 O O   . LYS A 1 386 ? 23.520  61.993 75.716 1.00   26.63 ? 386 LYS A O   1 
ATOM   2959 C CB  . LYS A 1 386 ? 26.145  63.008 77.186 1.00   22.08 ? 386 LYS A CB  1 
ATOM   2960 C CG  . LYS A 1 386 ? 27.289  63.975 77.083 1.00   20.73 ? 386 LYS A CG  1 
ATOM   2961 C CD  . LYS A 1 386 ? 28.609  63.257 77.035 1.00   22.34 ? 386 LYS A CD  1 
ATOM   2962 C CE  . LYS A 1 386 ? 29.753  64.257 77.085 1.00   21.30 ? 386 LYS A CE  1 
ATOM   2963 N NZ  . LYS A 1 386 ? 31.057  63.579 77.428 1.00   25.04 ? 386 LYS A NZ  1 
ATOM   2964 N N   . ASN A 1 387 ? 23.035  62.293 77.886 1.00   23.46 ? 387 ASN A N   1 
ATOM   2965 C CA  . ASN A 1 387 ? 22.015  61.258 77.818 1.00   22.53 ? 387 ASN A CA  1 
ATOM   2966 C C   . ASN A 1 387 ? 20.802  61.783 77.108 1.00   21.35 ? 387 ASN A C   1 
ATOM   2967 O O   . ASN A 1 387 ? 20.109  61.029 76.449 1.00   21.25 ? 387 ASN A O   1 
ATOM   2968 C CB  . ASN A 1 387 ? 21.624  60.753 79.206 1.00   23.72 ? 387 ASN A CB  1 
ATOM   2969 C CG  . ASN A 1 387 ? 22.753  60.038 79.918 1.00   27.37 ? 387 ASN A CG  1 
ATOM   2970 O OD1 . ASN A 1 387 ? 23.697  59.531 79.292 1.00   30.81 ? 387 ASN A OD1 1 
ATOM   2971 N ND2 . ASN A 1 387 ? 22.675  60.000 81.237 1.00   29.21 ? 387 ASN A ND2 1 
ATOM   2972 N N   . ARG A 1 388 ? 20.529  63.074 77.274 1.00   20.55 ? 388 ARG A N   1 
ATOM   2973 C CA  . ARG A 1 388 ? 19.385  63.749 76.650 1.00   19.13 ? 388 ARG A CA  1 
ATOM   2974 C C   . ARG A 1 388 ? 19.596  63.786 75.133 1.00   20.05 ? 388 ARG A C   1 
ATOM   2975 O O   . ARG A 1 388 ? 18.798  63.249 74.357 1.00   19.36 ? 388 ARG A O   1 
ATOM   2976 C CB  . ARG A 1 388 ? 19.284  65.175 77.200 1.00   17.46 ? 388 ARG A CB  1 
ATOM   2977 C CG  . ARG A 1 388 ? 18.138  65.995 76.674 1.00   18.23 ? 388 ARG A CG  1 
ATOM   2978 C CD  . ARG A 1 388 ? 18.671  67.228 76.003 1.00   18.59 ? 388 ARG A CD  1 
ATOM   2979 N NE  . ARG A 1 388 ? 18.920  68.319 76.923 1.00   20.90 ? 388 ARG A NE  1 
ATOM   2980 C CZ  . ARG A 1 388 ? 19.920  69.197 76.816 1.00   21.46 ? 388 ARG A CZ  1 
ATOM   2981 N NH1 . ARG A 1 388 ? 20.802  69.127 75.830 1.00   18.02 ? 388 ARG A NH1 1 
ATOM   2982 N NH2 . ARG A 1 388 ? 20.017  70.181 77.704 1.00   24.25 ? 388 ARG A NH2 1 
ATOM   2983 N N   . ASP A 1 389 ? 20.712  64.389 74.726 1.00   20.04 ? 389 ASP A N   1 
ATOM   2984 C CA  . ASP A 1 389 ? 21.080  64.508 73.330 1.00   18.30 ? 389 ASP A CA  1 
ATOM   2985 C C   . ASP A 1 389 ? 21.207  63.141 72.711 1.00   19.44 ? 389 ASP A C   1 
ATOM   2986 O O   . ASP A 1 389 ? 20.769  62.937 71.593 1.00   19.88 ? 389 ASP A O   1 
ATOM   2987 C CB  . ASP A 1 389 ? 22.386  65.266 73.204 1.00   16.51 ? 389 ASP A CB  1 
ATOM   2988 C CG  . ASP A 1 389 ? 22.262  66.698 73.643 1.00   15.15 ? 389 ASP A CG  1 
ATOM   2989 O OD1 . ASP A 1 389 ? 21.122  67.200 73.714 1.00   15.47 ? 389 ASP A OD1 1 
ATOM   2990 O OD2 . ASP A 1 389 ? 23.298  67.326 73.904 1.00   15.89 ? 389 ASP A OD2 1 
ATOM   2991 N N   . GLY A 1 390 ? 21.793  62.198 73.432 1.00   18.77 ? 390 GLY A N   1 
ATOM   2992 C CA  . GLY A 1 390 ? 21.925  60.863 72.896 1.00   19.20 ? 390 GLY A CA  1 
ATOM   2993 C C   . GLY A 1 390 ? 20.568  60.256 72.605 1.00   20.97 ? 390 GLY A C   1 
ATOM   2994 O O   . GLY A 1 390 ? 20.376  59.575 71.607 1.00   23.87 ? 390 GLY A O   1 
ATOM   2995 N N   . LEU A 1 391 ? 19.597  60.532 73.451 1.00   21.14 ? 391 LEU A N   1 
ATOM   2996 C CA  . LEU A 1 391 ? 18.267  59.981 73.270 1.00   21.35 ? 391 LEU A CA  1 
ATOM   2997 C C   . LEU A 1 391 ? 17.627  60.701 72.101 1.00   21.97 ? 391 LEU A C   1 
ATOM   2998 O O   . LEU A 1 391 ? 16.815  60.152 71.355 1.00   21.28 ? 391 LEU A O   1 
ATOM   2999 C CB  . LEU A 1 391 ? 17.456  60.234 74.540 1.00   21.87 ? 391 LEU A CB  1 
ATOM   3000 C CG  . LEU A 1 391 ? 16.347  59.250 74.909 1.00   24.76 ? 391 LEU A CG  1 
ATOM   3001 C CD1 . LEU A 1 391 ? 16.796  57.836 74.692 1.00   24.41 ? 391 LEU A CD1 1 
ATOM   3002 C CD2 . LEU A 1 391 ? 15.954  59.458 76.361 1.00   25.79 ? 391 LEU A CD2 1 
ATOM   3003 N N   . ASP A 1 392 ? 17.997  61.954 71.940 1.00   23.03 ? 392 ASP A N   1 
ATOM   3004 C CA  . ASP A 1 392 ? 17.441  62.760 70.873 1.00   23.26 ? 392 ASP A CA  1 
ATOM   3005 C C   . ASP A 1 392 ? 17.893  62.191 69.511 1.00   23.03 ? 392 ASP A C   1 
ATOM   3006 O O   . ASP A 1 392 ? 17.097  62.071 68.579 1.00   23.23 ? 392 ASP A O   1 
ATOM   3007 C CB  . ASP A 1 392 ? 17.895  64.199 71.075 1.00   25.97 ? 392 ASP A CB  1 
ATOM   3008 C CG  . ASP A 1 392 ? 17.032  65.185 70.348 1.00   29.22 ? 392 ASP A CG  1 
ATOM   3009 O OD1 . ASP A 1 392 ? 16.462  64.796 69.309 1.00   32.93 ? 392 ASP A OD1 1 
ATOM   3010 O OD2 . ASP A 1 392 ? 16.909  66.344 70.809 1.00   30.51 ? 392 ASP A OD2 1 
ATOM   3011 N N   . ASP A 1 393 ? 19.163  61.795 69.416 1.00   21.65 ? 393 ASP A N   1 
ATOM   3012 C CA  . ASP A 1 393 ? 19.711  61.229 68.202 1.00   18.51 ? 393 ASP A CA  1 
ATOM   3013 C C   . ASP A 1 393 ? 19.123  59.858 67.942 1.00   19.19 ? 393 ASP A C   1 
ATOM   3014 O O   . ASP A 1 393 ? 19.014  59.461 66.807 1.00   22.29 ? 393 ASP A O   1 
ATOM   3015 C CB  . ASP A 1 393 ? 21.220  61.121 68.301 1.00   18.39 ? 393 ASP A CB  1 
ATOM   3016 C CG  . ASP A 1 393 ? 21.920  62.446 68.137 1.00   21.07 ? 393 ASP A CG  1 
ATOM   3017 O OD1 . ASP A 1 393 ? 21.272  63.445 67.797 1.00   24.23 ? 393 ASP A OD1 1 
ATOM   3018 O OD2 . ASP A 1 393 ? 23.155  62.505 68.309 1.00   25.24 ? 393 ASP A OD2 1 
ATOM   3019 N N   . ILE A 1 394 ? 18.785  59.105 68.978 1.00   18.93 ? 394 ILE A N   1 
ATOM   3020 C CA  . ILE A 1 394 ? 18.205  57.773 68.801 1.00   16.97 ? 394 ILE A CA  1 
ATOM   3021 C C   . ILE A 1 394 ? 16.836  57.917 68.165 1.00   18.32 ? 394 ILE A C   1 
ATOM   3022 O O   . ILE A 1 394 ? 16.529  57.281 67.178 1.00   19.91 ? 394 ILE A O   1 
ATOM   3023 C CB  . ILE A 1 394 ? 18.053  57.017 70.162 1.00   15.52 ? 394 ILE A CB  1 
ATOM   3024 C CG1 . ILE A 1 394 ? 19.414  56.544 70.690 1.00   15.99 ? 394 ILE A CG1 1 
ATOM   3025 C CG2 . ILE A 1 394 ? 17.137  55.820 70.015 1.00   14.69 ? 394 ILE A CG2 1 
ATOM   3026 C CD1 . ILE A 1 394 ? 19.399  56.064 72.123 1.00   11.27 ? 394 ILE A CD1 1 
ATOM   3027 N N   . VAL A 1 395 ? 15.996  58.758 68.738 1.00   19.18 ? 395 VAL A N   1 
ATOM   3028 C CA  . VAL A 1 395 ? 14.665  58.945 68.212 1.00   18.40 ? 395 VAL A CA  1 
ATOM   3029 C C   . VAL A 1 395 ? 14.693  59.403 66.762 1.00   18.15 ? 395 VAL A C   1 
ATOM   3030 O O   . VAL A 1 395 ? 13.980  58.851 65.941 1.00   17.43 ? 395 VAL A O   1 
ATOM   3031 C CB  . VAL A 1 395 ? 13.895  59.919 69.103 1.00   18.21 ? 395 VAL A CB  1 
ATOM   3032 C CG1 . VAL A 1 395 ? 12.484  60.126 68.607 1.00   16.32 ? 395 VAL A CG1 1 
ATOM   3033 C CG2 . VAL A 1 395 ? 13.860  59.342 70.495 1.00   19.06 ? 395 VAL A CG2 1 
ATOM   3034 N N   . GLY A 1 396 ? 15.554  60.365 66.452 1.00   17.00 ? 396 GLY A N   1 
ATOM   3035 C CA  . GLY A 1 396 ? 15.672  60.888 65.107 1.00   16.72 ? 396 GLY A CA  1 
ATOM   3036 C C   . GLY A 1 396 ? 16.341  59.966 64.095 1.00   18.15 ? 396 GLY A C   1 
ATOM   3037 O O   . GLY A 1 396 ? 15.816  59.782 62.991 1.00   19.89 ? 396 GLY A O   1 
ATOM   3038 N N   . ASP A 1 397 ? 17.499  59.409 64.443 1.00   16.16 ? 397 ASP A N   1 
ATOM   3039 C CA  . ASP A 1 397 ? 18.218  58.513 63.574 1.00   13.76 ? 397 ASP A CA  1 
ATOM   3040 C C   . ASP A 1 397 ? 17.337  57.341 63.230 1.00   15.53 ? 397 ASP A C   1 
ATOM   3041 O O   . ASP A 1 397 ? 17.203  56.990 62.069 1.00   17.66 ? 397 ASP A O   1 
ATOM   3042 C CB  . ASP A 1 397 ? 19.474  57.983 64.254 1.00   14.23 ? 397 ASP A CB  1 
ATOM   3043 C CG  . ASP A 1 397 ? 20.593  58.991 64.311 1.00   17.40 ? 397 ASP A CG  1 
ATOM   3044 O OD1 . ASP A 1 397 ? 20.483  60.097 63.717 1.00   17.96 ? 397 ASP A OD1 1 
ATOM   3045 O OD2 . ASP A 1 397 ? 21.612  58.663 64.952 1.00   18.56 ? 397 ASP A OD2 1 
ATOM   3046 N N   . HIS A 1 398 ? 16.730  56.727 64.229 1.00   15.39 ? 398 HIS A N   1 
ATOM   3047 C CA  . HIS A 1 398 ? 15.897  55.579 63.989 1.00   14.56 ? 398 HIS A CA  1 
ATOM   3048 C C   . HIS A 1 398 ? 14.648  55.855 63.209 1.00   16.21 ? 398 HIS A C   1 
ATOM   3049 O O   . HIS A 1 398 ? 14.272  55.034 62.378 1.00   19.18 ? 398 HIS A O   1 
ATOM   3050 C CB  . HIS A 1 398 ? 15.490  54.901 65.292 1.00   13.94 ? 398 HIS A CB  1 
ATOM   3051 C CG  . HIS A 1 398 ? 14.416  53.868 65.122 1.00   12.62 ? 398 HIS A CG  1 
ATOM   3052 N ND1 . HIS A 1 398 ? 14.621  52.686 64.452 1.00   11.69 ? 398 HIS A ND1 1 
ATOM   3053 C CD2 . HIS A 1 398 ? 13.127  53.845 65.530 1.00   11.86 ? 398 HIS A CD2 1 
ATOM   3054 C CE1 . HIS A 1 398 ? 13.510  51.976 64.454 1.00   10.75 ? 398 HIS A CE1 1 
ATOM   3055 N NE2 . HIS A 1 398 ? 12.588  52.656 65.104 1.00   10.92 ? 398 HIS A NE2 1 
ATOM   3056 N N   . ASN A 1 399 ? 13.968  56.954 63.507 1.00   15.55 ? 399 ASN A N   1 
ATOM   3057 C CA  . ASN A 1 399 ? 12.708  57.260 62.852 1.00   15.27 ? 399 ASN A CA  1 
ATOM   3058 C C   . ASN A 1 399 ? 12.672  58.142 61.627 1.00   17.43 ? 399 ASN A C   1 
ATOM   3059 O O   . ASN A 1 399 ? 11.657  58.163 60.932 1.00   18.53 ? 399 ASN A O   1 
ATOM   3060 C CB  . ASN A 1 399 ? 11.739  57.868 63.842 1.00   14.98 ? 399 ASN A CB  1 
ATOM   3061 C CG  . ASN A 1 399 ? 11.317  56.907 64.894 1.00   17.05 ? 399 ASN A CG  1 
ATOM   3062 O OD1 . ASN A 1 399 ? 10.577  55.963 64.636 1.00   15.11 ? 399 ASN A OD1 1 
ATOM   3063 N ND2 . ASN A 1 399 ? 11.785  57.139 66.107 1.00   18.67 ? 399 ASN A ND2 1 
ATOM   3064 N N   . VAL A 1 400 ? 13.710  58.932 61.398 1.00   17.78 ? 400 VAL A N   1 
ATOM   3065 C CA  . VAL A 1 400 ? 13.704  59.818 60.259 1.00   17.38 ? 400 VAL A CA  1 
ATOM   3066 C C   . VAL A 1 400 ? 14.974  59.797 59.458 1.00   19.03 ? 400 VAL A C   1 
ATOM   3067 O O   . VAL A 1 400 ? 14.969  59.464 58.285 1.00   21.34 ? 400 VAL A O   1 
ATOM   3068 C CB  . VAL A 1 400 ? 13.496  61.262 60.688 1.00   16.10 ? 400 VAL A CB  1 
ATOM   3069 C CG1 . VAL A 1 400 ? 13.601  62.161 59.491 1.00   13.88 ? 400 VAL A CG1 1 
ATOM   3070 C CG2 . VAL A 1 400 ? 12.176  61.423 61.447 1.00   13.16 ? 400 VAL A CG2 1 
ATOM   3071 N N   . ILE A 1 401 ? 16.077  60.148 60.091 1.00   19.44 ? 401 ILE A N   1 
ATOM   3072 C CA  . ILE A 1 401 ? 17.336  60.231 59.385 1.00   18.03 ? 401 ILE A CA  1 
ATOM   3073 C C   . ILE A 1 401 ? 17.766  58.924 58.766 1.00   19.80 ? 401 ILE A C   1 
ATOM   3074 O O   . ILE A 1 401 ? 18.021  58.888 57.574 1.00   21.92 ? 401 ILE A O   1 
ATOM   3075 C CB  . ILE A 1 401 ? 18.452  60.902 60.244 1.00   16.41 ? 401 ILE A CB  1 
ATOM   3076 C CG1 . ILE A 1 401 ? 17.991  62.294 60.681 1.00   12.95 ? 401 ILE A CG1 1 
ATOM   3077 C CG2 . ILE A 1 401 ? 19.759  61.047 59.460 1.00   14.19 ? 401 ILE A CG2 1 
ATOM   3078 C CD1 . ILE A 1 401 ? 19.046  63.101 61.360 1.00   13.65 ? 401 ILE A CD1 1 
ATOM   3079 N N   . CYS A 1 402 ? 17.717  57.811 59.472 1.00   19.94 ? 402 CYS A N   1 
ATOM   3080 C CA  . CYS A 1 402 ? 18.202  56.623 58.795 1.00   20.09 ? 402 CYS A CA  1 
ATOM   3081 C C   . CYS A 1 402 ? 17.300  55.946 57.810 1.00   19.38 ? 402 CYS A C   1 
ATOM   3082 O O   . CYS A 1 402 ? 17.779  55.210 56.949 1.00   19.33 ? 402 CYS A O   1 
ATOM   3083 C CB  . CYS A 1 402 ? 18.836  55.629 59.734 1.00   19.09 ? 402 CYS A CB  1 
ATOM   3084 S SG  . CYS A 1 402 ? 20.254  56.334 60.606 1.00   20.31 ? 402 CYS A SG  1 
ATOM   3085 N N   . PRO A 1 403 ? 15.983  56.067 57.984 1.00   18.75 ? 403 PRO A N   1 
ATOM   3086 C CA  . PRO A 1 403 ? 15.168  55.403 56.982 1.00   18.65 ? 403 PRO A CA  1 
ATOM   3087 C C   . PRO A 1 403 ? 15.260  56.256 55.722 1.00   19.24 ? 403 PRO A C   1 
ATOM   3088 O O   . PRO A 1 403 ? 15.265  55.717 54.616 1.00   21.40 ? 403 PRO A O   1 
ATOM   3089 C CB  . PRO A 1 403 ? 13.791  55.442 57.600 1.00   17.00 ? 403 PRO A CB  1 
ATOM   3090 C CG  . PRO A 1 403 ? 14.092  55.308 58.981 1.00   16.61 ? 403 PRO A CG  1 
ATOM   3091 C CD  . PRO A 1 403 ? 15.173  56.318 59.170 1.00   18.52 ? 403 PRO A CD  1 
ATOM   3092 N N   . LEU A 1 404 ? 15.378  57.571 55.886 1.00   17.31 ? 404 LEU A N   1 
ATOM   3093 C CA  . LEU A 1 404 ? 15.490  58.447 54.738 1.00   18.72 ? 404 LEU A CA  1 
ATOM   3094 C C   . LEU A 1 404 ? 16.791  58.147 54.040 1.00   20.02 ? 404 LEU A C   1 
ATOM   3095 O O   . LEU A 1 404 ? 16.821  58.127 52.822 1.00   21.84 ? 404 LEU A O   1 
ATOM   3096 C CB  . LEU A 1 404 ? 15.430  59.944 55.107 1.00   15.65 ? 404 LEU A CB  1 
ATOM   3097 C CG  . LEU A 1 404 ? 15.573  60.989 53.969 1.00   14.79 ? 404 LEU A CG  1 
ATOM   3098 C CD1 . LEU A 1 404 ? 14.544  62.095 54.090 1.00   11.30 ? 404 LEU A CD1 1 
ATOM   3099 C CD2 . LEU A 1 404 ? 16.952  61.586 53.944 1.00   11.50 ? 404 LEU A CD2 1 
ATOM   3100 N N   . MET A 1 405 ? 17.873  57.911 54.777 1.00   19.82 ? 405 MET A N   1 
ATOM   3101 C CA  . MET A 1 405 ? 19.141  57.635 54.112 1.00   16.64 ? 405 MET A CA  1 
ATOM   3102 C C   . MET A 1 405 ? 19.084  56.341 53.349 1.00   16.64 ? 405 MET A C   1 
ATOM   3103 O O   . MET A 1 405 ? 19.737  56.190 52.345 1.00   17.55 ? 405 MET A O   1 
ATOM   3104 C CB  . MET A 1 405 ? 20.301  57.622 55.075 1.00   15.43 ? 405 MET A CB  1 
ATOM   3105 C CG  . MET A 1 405 ? 20.607  58.957 55.630 1.00   15.80 ? 405 MET A CG  1 
ATOM   3106 S SD  . MET A 1 405 ? 20.788  60.146 54.341 1.00   19.07 ? 405 MET A SD  1 
ATOM   3107 C CE  . MET A 1 405 ? 22.324  59.633 53.726 1.00   16.75 ? 405 MET A CE  1 
ATOM   3108 N N   . HIS A 1 406 ? 18.256  55.415 53.789 1.00   17.56 ? 406 HIS A N   1 
ATOM   3109 C CA  . HIS A 1 406 ? 18.133  54.147 53.110 1.00   16.07 ? 406 HIS A CA  1 
ATOM   3110 C C   . HIS A 1 406 ? 17.429  54.406 51.770 1.00   18.68 ? 406 HIS A C   1 
ATOM   3111 O O   . HIS A 1 406 ? 17.865  53.926 50.738 1.00   19.17 ? 406 HIS A O   1 
ATOM   3112 C CB  . HIS A 1 406 ? 17.304  53.203 53.956 1.00   14.53 ? 406 HIS A CB  1 
ATOM   3113 C CG  . HIS A 1 406 ? 17.218  51.819 53.407 1.00   13.70 ? 406 HIS A CG  1 
ATOM   3114 N ND1 . HIS A 1 406 ? 18.326  51.024 53.232 1.00   13.79 ? 406 HIS A ND1 1 
ATOM   3115 C CD2 . HIS A 1 406 ? 16.158  51.084 52.999 1.00   12.46 ? 406 HIS A CD2 1 
ATOM   3116 C CE1 . HIS A 1 406 ? 17.955  49.859 52.736 1.00   13.81 ? 406 HIS A CE1 1 
ATOM   3117 N NE2 . HIS A 1 406 ? 16.644  49.870 52.584 1.00   14.32 ? 406 HIS A NE2 1 
ATOM   3118 N N   . PHE A 1 407 ? 16.343  55.172 51.800 1.00   19.37 ? 407 PHE A N   1 
ATOM   3119 C CA  . PHE A 1 407 ? 15.568  55.501 50.613 1.00   19.83 ? 407 PHE A CA  1 
ATOM   3120 C C   . PHE A 1 407 ? 16.458  56.227 49.626 1.00   22.10 ? 407 PHE A C   1 
ATOM   3121 O O   . PHE A 1 407 ? 16.618  55.798 48.500 1.00   24.92 ? 407 PHE A O   1 
ATOM   3122 C CB  . PHE A 1 407 ? 14.396  56.393 51.012 1.00   17.60 ? 407 PHE A CB  1 
ATOM   3123 C CG  . PHE A 1 407 ? 13.518  56.822 49.875 1.00   17.06 ? 407 PHE A CG  1 
ATOM   3124 C CD1 . PHE A 1 407 ? 12.643  55.940 49.284 1.00   16.06 ? 407 PHE A CD1 1 
ATOM   3125 C CD2 . PHE A 1 407 ? 13.534  58.138 49.433 1.00   16.41 ? 407 PHE A CD2 1 
ATOM   3126 C CE1 . PHE A 1 407 ? 11.812  56.364 48.288 1.00   14.35 ? 407 PHE A CE1 1 
ATOM   3127 C CE2 . PHE A 1 407 ? 12.696  58.550 48.434 1.00   14.45 ? 407 PHE A CE2 1 
ATOM   3128 C CZ  . PHE A 1 407 ? 11.841  57.664 47.867 1.00   11.81 ? 407 PHE A CZ  1 
ATOM   3129 N N   . VAL A 1 408 ? 17.127  57.275 50.073 1.00   22.40 ? 408 VAL A N   1 
ATOM   3130 C CA  . VAL A 1 408 ? 17.955  58.027 49.180 1.00   22.20 ? 408 VAL A CA  1 
ATOM   3131 C C   . VAL A 1 408 ? 19.009  57.174 48.536 1.00   22.95 ? 408 VAL A C   1 
ATOM   3132 O O   . VAL A 1 408 ? 19.311  57.380 47.383 1.00   24.62 ? 408 VAL A O   1 
ATOM   3133 C CB  . VAL A 1 408 ? 18.596  59.197 49.870 1.00   22.20 ? 408 VAL A CB  1 
ATOM   3134 C CG1 . VAL A 1 408 ? 19.936  58.832 50.395 1.00   22.37 ? 408 VAL A CG1 1 
ATOM   3135 C CG2 . VAL A 1 408 ? 18.729  60.304 48.914 1.00   24.85 ? 408 VAL A CG2 1 
ATOM   3136 N N   . ASN A 1 409 ? 19.558  56.202 49.249 1.00   23.02 ? 409 ASN A N   1 
ATOM   3137 C CA  . ASN A 1 409 ? 20.599  55.374 48.651 1.00   23.28 ? 409 ASN A CA  1 
ATOM   3138 C C   . ASN A 1 409 ? 20.044  54.330 47.706 1.00   23.33 ? 409 ASN A C   1 
ATOM   3139 O O   . ASN A 1 409 ? 20.721  53.894 46.792 1.00   25.45 ? 409 ASN A O   1 
ATOM   3140 C CB  . ASN A 1 409 ? 21.473  54.713 49.717 1.00   24.88 ? 409 ASN A CB  1 
ATOM   3141 C CG  . ASN A 1 409 ? 22.418  55.712 50.407 1.00   28.41 ? 409 ASN A CG  1 
ATOM   3142 O OD1 . ASN A 1 409 ? 23.366  56.226 49.805 1.00   30.30 ? 409 ASN A OD1 1 
ATOM   3143 N ND2 . ASN A 1 409 ? 22.173  55.970 51.677 1.00   30.18 ? 409 ASN A ND2 1 
ATOM   3144 N N   . LYS A 1 410 ? 18.822  53.901 47.945 1.00   23.78 ? 410 LYS A N   1 
ATOM   3145 C CA  . LYS A 1 410 ? 18.185  52.902 47.104 1.00   23.53 ? 410 LYS A CA  1 
ATOM   3146 C C   . LYS A 1 410 ? 17.622  53.595 45.855 1.00   24.12 ? 410 LYS A C   1 
ATOM   3147 O O   . LYS A 1 410 ? 17.832  53.169 44.728 1.00   24.95 ? 410 LYS A O   1 
ATOM   3148 C CB  . LYS A 1 410 ? 17.057  52.241 47.880 1.00   24.69 ? 410 LYS A CB  1 
ATOM   3149 C CG  . LYS A 1 410 ? 17.525  51.503 49.156 1.00   26.48 ? 410 LYS A CG  1 
ATOM   3150 C CD  . LYS A 1 410 ? 17.525  49.977 49.004 1.00   25.50 ? 410 LYS A CD  1 
ATOM   3151 C CE  . LYS A 1 410 ? 18.876  49.461 48.627 1.00   24.60 ? 410 LYS A CE  1 
ATOM   3152 N NZ  . LYS A 1 410 ? 18.759  48.024 48.322 1.00   27.53 ? 410 LYS A NZ  1 
ATOM   3153 N N   . TYR A 1 411 ? 16.918  54.687 46.067 1.00   22.61 ? 411 TYR A N   1 
ATOM   3154 C CA  . TYR A 1 411 ? 16.356  55.437 44.989 1.00   22.36 ? 411 TYR A CA  1 
ATOM   3155 C C   . TYR A 1 411 ? 17.453  55.882 44.037 1.00   23.26 ? 411 TYR A C   1 
ATOM   3156 O O   . TYR A 1 411 ? 17.399  55.622 42.848 1.00   23.24 ? 411 TYR A O   1 
ATOM   3157 C CB  . TYR A 1 411 ? 15.632  56.664 45.537 1.00   20.00 ? 411 TYR A CB  1 
ATOM   3158 C CG  . TYR A 1 411 ? 14.800  57.383 44.511 1.00   17.34 ? 411 TYR A CG  1 
ATOM   3159 C CD1 . TYR A 1 411 ? 13.490  57.030 44.295 1.00   15.51 ? 411 TYR A CD1 1 
ATOM   3160 C CD2 . TYR A 1 411 ? 15.342  58.394 43.735 1.00   19.18 ? 411 TYR A CD2 1 
ATOM   3161 C CE1 . TYR A 1 411 ? 12.750  57.655 43.341 1.00   17.93 ? 411 TYR A CE1 1 
ATOM   3162 C CE2 . TYR A 1 411 ? 14.601  59.028 42.769 1.00   16.48 ? 411 TYR A CE2 1 
ATOM   3163 C CZ  . TYR A 1 411 ? 13.316  58.647 42.588 1.00   17.12 ? 411 TYR A CZ  1 
ATOM   3164 O OH  . TYR A 1 411 ? 12.577  59.277 41.648 1.00   20.31 ? 411 TYR A OH  1 
ATOM   3165 N N   . THR A 1 412 ? 18.472  56.526 44.566 1.00   23.82 ? 412 THR A N   1 
ATOM   3166 C CA  . THR A 1 412 ? 19.526  57.030 43.727 1.00   23.91 ? 412 THR A CA  1 
ATOM   3167 C C   . THR A 1 412 ? 20.085  56.017 42.749 1.00   23.93 ? 412 THR A C   1 
ATOM   3168 O O   . THR A 1 412 ? 20.408  56.353 41.626 1.00   24.48 ? 412 THR A O   1 
ATOM   3169 C CB  . THR A 1 412 ? 20.572  57.704 44.591 1.00   23.26 ? 412 THR A CB  1 
ATOM   3170 O OG1 . THR A 1 412 ? 20.040  58.964 45.011 1.00   23.28 ? 412 THR A OG1 1 
ATOM   3171 C CG2 . THR A 1 412 ? 21.855  57.940 43.864 1.00   22.63 ? 412 THR A CG2 1 
ATOM   3172 N N   . LYS A 1 413 ? 20.103  54.761 43.136 1.00   24.78 ? 413 LYS A N   1 
ATOM   3173 C CA  . LYS A 1 413 ? 20.611  53.741 42.243 1.00   26.89 ? 413 LYS A CA  1 
ATOM   3174 C C   . LYS A 1 413 ? 19.817  53.837 40.921 1.00   27.56 ? 413 LYS A C   1 
ATOM   3175 O O   . LYS A 1 413 ? 20.416  53.871 39.855 1.00   29.19 ? 413 LYS A O   1 
ATOM   3176 C CB  . LYS A 1 413 ? 20.473  52.355 42.901 1.00   27.84 ? 413 LYS A CB  1 
ATOM   3177 C CG  . LYS A 1 413 ? 21.279  51.229 42.239 1.00   29.14 ? 413 LYS A CG  1 
ATOM   3178 N N   . PHE A 1 414 ? 18.500  54.025 40.999 1.00   26.16 ? 414 PHE A N   1 
ATOM   3179 C CA  . PHE A 1 414 ? 17.641  54.128 39.816 1.00   25.46 ? 414 PHE A CA  1 
ATOM   3180 C C   . PHE A 1 414 ? 17.049  55.513 39.510 1.00   26.60 ? 414 PHE A C   1 
ATOM   3181 O O   . PHE A 1 414 ? 16.300  55.659 38.556 1.00   28.09 ? 414 PHE A O   1 
ATOM   3182 C CB  . PHE A 1 414 ? 16.429  53.222 39.979 1.00   24.11 ? 414 PHE A CB  1 
ATOM   3183 C CG  . PHE A 1 414 ? 16.758  51.799 40.128 1.00   23.85 ? 414 PHE A CG  1 
ATOM   3184 C CD1 . PHE A 1 414 ? 17.044  51.032 39.043 1.00   24.33 ? 414 PHE A CD1 1 
ATOM   3185 C CD2 . PHE A 1 414 ? 16.780  51.215 41.360 1.00   25.55 ? 414 PHE A CD2 1 
ATOM   3186 C CE1 . PHE A 1 414 ? 17.353  49.687 39.181 1.00   25.92 ? 414 PHE A CE1 1 
ATOM   3187 C CE2 . PHE A 1 414 ? 17.086  49.878 41.512 1.00   26.16 ? 414 PHE A CE2 1 
ATOM   3188 C CZ  . PHE A 1 414 ? 17.374  49.115 40.415 1.00   25.82 ? 414 PHE A CZ  1 
ATOM   3189 N N   . GLY A 1 415 ? 17.302  56.518 40.319 1.00   27.19 ? 415 GLY A N   1 
ATOM   3190 C CA  . GLY A 1 415 ? 16.661  57.797 40.059 1.00   26.87 ? 415 GLY A CA  1 
ATOM   3191 C C   . GLY A 1 415 ? 17.343  58.680 39.047 1.00   26.84 ? 415 GLY A C   1 
ATOM   3192 O O   . GLY A 1 415 ? 18.396  58.330 38.521 1.00   27.85 ? 415 GLY A O   1 
ATOM   3193 N N   . ASN A 1 416 ? 16.819  59.875 38.840 1.00   25.65 ? 416 ASN A N   1 
ATOM   3194 C CA  . ASN A 1 416 ? 17.427  60.742 37.857 1.00   28.19 ? 416 ASN A CA  1 
ATOM   3195 C C   . ASN A 1 416 ? 17.891  62.048 38.510 1.00   29.03 ? 416 ASN A C   1 
ATOM   3196 O O   . ASN A 1 416 ? 17.726  63.132 37.951 1.00   31.22 ? 416 ASN A O   1 
ATOM   3197 C CB  . ASN A 1 416 ? 16.426  60.957 36.688 1.00   29.88 ? 416 ASN A CB  1 
ATOM   3198 C CG  . ASN A 1 416 ? 17.018  61.729 35.504 1.00   30.11 ? 416 ASN A CG  1 
ATOM   3199 O OD1 . ASN A 1 416 ? 16.504  62.798 35.147 1.00   31.03 ? 416 ASN A OD1 1 
ATOM   3200 N ND2 . ASN A 1 416 ? 18.080  61.193 34.884 1.00   29.20 ? 416 ASN A ND2 1 
ATOM   3201 N N   . GLY A 1 417 ? 18.497  61.959 39.691 1.00   28.13 ? 417 GLY A N   1 
ATOM   3202 C CA  . GLY A 1 417 ? 18.965  63.172 40.338 1.00   26.93 ? 417 GLY A CA  1 
ATOM   3203 C C   . GLY A 1 417 ? 18.434  63.280 41.743 1.00   25.58 ? 417 GLY A C   1 
ATOM   3204 O O   . GLY A 1 417 ? 17.239  63.461 41.951 1.00   24.92 ? 417 GLY A O   1 
ATOM   3205 N N   . THR A 1 418 ? 19.322  63.165 42.717 1.00   24.53 ? 418 THR A N   1 
ATOM   3206 C CA  . THR A 1 418 ? 18.926  63.236 44.104 1.00   22.52 ? 418 THR A CA  1 
ATOM   3207 C C   . THR A 1 418 ? 19.670  64.397 44.725 1.00   21.76 ? 418 THR A C   1 
ATOM   3208 O O   . THR A 1 418 ? 20.859  64.535 44.468 1.00   22.08 ? 418 THR A O   1 
ATOM   3209 C CB  . THR A 1 418 ? 19.348  61.957 44.784 1.00   22.92 ? 418 THR A CB  1 
ATOM   3210 O OG1 . THR A 1 418 ? 18.597  60.869 44.242 1.00   21.59 ? 418 THR A OG1 1 
ATOM   3211 C CG2 . THR A 1 418 ? 19.129  62.046 46.289 1.00   24.33 ? 418 THR A CG2 1 
ATOM   3212 N N   . TYR A 1 419 ? 18.983  65.260 45.472 1.00   21.13 ? 419 TYR A N   1 
ATOM   3213 C CA  . TYR A 1 419 ? 19.629  66.399 46.143 1.00   21.69 ? 419 TYR A CA  1 
ATOM   3214 C C   . TYR A 1 419 ? 19.300  66.295 47.623 1.00   20.07 ? 419 TYR A C   1 
ATOM   3215 O O   . TYR A 1 419 ? 18.135  66.233 47.987 1.00   18.51 ? 419 TYR A O   1 
ATOM   3216 C CB  . TYR A 1 419 ? 19.141  67.731 45.580 1.00   23.73 ? 419 TYR A CB  1 
ATOM   3217 C CG  . TYR A 1 419 ? 19.595  67.959 44.154 1.00   26.07 ? 419 TYR A CG  1 
ATOM   3218 C CD1 . TYR A 1 419 ? 18.882  67.429 43.087 1.00   27.20 ? 419 TYR A CD1 1 
ATOM   3219 C CD2 . TYR A 1 419 ? 20.764  68.648 43.874 1.00   26.01 ? 419 TYR A CD2 1 
ATOM   3220 C CE1 . TYR A 1 419 ? 19.328  67.567 41.795 1.00   26.59 ? 419 TYR A CE1 1 
ATOM   3221 C CE2 . TYR A 1 419 ? 21.210  68.790 42.584 1.00   26.75 ? 419 TYR A CE2 1 
ATOM   3222 C CZ  . TYR A 1 419 ? 20.487  68.238 41.554 1.00   27.51 ? 419 TYR A CZ  1 
ATOM   3223 O OH  . TYR A 1 419 ? 20.954  68.292 40.263 1.00   30.17 ? 419 TYR A OH  1 
ATOM   3224 N N   . LEU A 1 420 ? 20.316  66.288 48.476 1.00   19.58 ? 420 LEU A N   1 
ATOM   3225 C CA  . LEU A 1 420 ? 20.088  66.101 49.909 1.00   18.53 ? 420 LEU A CA  1 
ATOM   3226 C C   . LEU A 1 420 ? 20.551  67.210 50.815 1.00   17.59 ? 420 LEU A C   1 
ATOM   3227 O O   . LEU A 1 420 ? 21.686  67.627 50.734 1.00   19.48 ? 420 LEU A O   1 
ATOM   3228 C CB  . LEU A 1 420 ? 20.780  64.818 50.328 1.00   18.05 ? 420 LEU A CB  1 
ATOM   3229 C CG  . LEU A 1 420 ? 20.620  64.311 51.748 1.00   18.56 ? 420 LEU A CG  1 
ATOM   3230 C CD1 . LEU A 1 420 ? 19.154  63.937 52.011 1.00   17.38 ? 420 LEU A CD1 1 
ATOM   3231 C CD2 . LEU A 1 420 ? 21.536  63.125 51.919 1.00   15.75 ? 420 LEU A CD2 1 
ATOM   3232 N N   . TYR A 1 421 ? 19.697  67.681 51.707 1.00   17.82 ? 421 TYR A N   1 
ATOM   3233 C CA  . TYR A 1 421 ? 20.121  68.739 52.633 1.00   18.50 ? 421 TYR A CA  1 
ATOM   3234 C C   . TYR A 1 421 ? 20.041  68.294 54.085 1.00   19.30 ? 421 TYR A C   1 
ATOM   3235 O O   . TYR A 1 421 ? 19.412  67.286 54.415 1.00   18.14 ? 421 TYR A O   1 
ATOM   3236 C CB  . TYR A 1 421 ? 19.271  69.999 52.463 1.00   16.81 ? 421 TYR A CB  1 
ATOM   3237 C CG  . TYR A 1 421 ? 17.842  69.819 52.873 1.00   17.94 ? 421 TYR A CG  1 
ATOM   3238 C CD1 . TYR A 1 421 ? 16.906  69.317 51.994 1.00   19.93 ? 421 TYR A CD1 1 
ATOM   3239 C CD2 . TYR A 1 421 ? 17.424  70.115 54.152 1.00   20.57 ? 421 TYR A CD2 1 
ATOM   3240 C CE1 . TYR A 1 421 ? 15.577  69.106 52.387 1.00   20.02 ? 421 TYR A CE1 1 
ATOM   3241 C CE2 . TYR A 1 421 ? 16.093  69.907 54.556 1.00   19.81 ? 421 TYR A CE2 1 
ATOM   3242 C CZ  . TYR A 1 421 ? 15.183  69.399 53.668 1.00   18.52 ? 421 TYR A CZ  1 
ATOM   3243 O OH  . TYR A 1 421 ? 13.893  69.151 54.067 1.00   16.75 ? 421 TYR A OH  1 
ATOM   3244 N N   . PHE A 1 422 ? 20.724  69.026 54.950 1.00   19.91 ? 422 PHE A N   1 
ATOM   3245 C CA  . PHE A 1 422 ? 20.666  68.761 56.374 1.00   18.65 ? 422 PHE A CA  1 
ATOM   3246 C C   . PHE A 1 422 ? 20.366  70.109 56.914 1.00   17.32 ? 422 PHE A C   1 
ATOM   3247 O O   . PHE A 1 422 ? 21.210  70.994 56.865 1.00   17.89 ? 422 PHE A O   1 
ATOM   3248 C CB  . PHE A 1 422 ? 21.993  68.285 56.928 1.00   19.92 ? 422 PHE A CB  1 
ATOM   3249 C CG  . PHE A 1 422 ? 21.955  67.940 58.409 1.00   19.33 ? 422 PHE A CG  1 
ATOM   3250 C CD1 . PHE A 1 422 ? 21.263  66.834 58.856 1.00   19.54 ? 422 PHE A CD1 1 
ATOM   3251 C CD2 . PHE A 1 422 ? 22.640  68.706 59.325 1.00   18.78 ? 422 PHE A CD2 1 
ATOM   3252 C CE1 . PHE A 1 422 ? 21.254  66.494 60.187 1.00   19.83 ? 422 PHE A CE1 1 
ATOM   3253 C CE2 . PHE A 1 422 ? 22.636  68.377 60.641 1.00   20.62 ? 422 PHE A CE2 1 
ATOM   3254 C CZ  . PHE A 1 422 ? 21.938  67.260 61.083 1.00   19.49 ? 422 PHE A CZ  1 
ATOM   3255 N N   . PHE A 1 423 ? 19.140  70.300 57.356 1.00   16.55 ? 423 PHE A N   1 
ATOM   3256 C CA  . PHE A 1 423 ? 18.746  71.583 57.890 1.00   17.97 ? 423 PHE A CA  1 
ATOM   3257 C C   . PHE A 1 423 ? 19.214  71.677 59.351 1.00   19.99 ? 423 PHE A C   1 
ATOM   3258 O O   . PHE A 1 423 ? 18.889  70.821 60.191 1.00   19.67 ? 423 PHE A O   1 
ATOM   3259 C CB  . PHE A 1 423 ? 17.223  71.727 57.777 1.00   16.43 ? 423 PHE A CB  1 
ATOM   3260 C CG  . PHE A 1 423 ? 16.716  73.062 58.171 1.00   16.47 ? 423 PHE A CG  1 
ATOM   3261 C CD1 . PHE A 1 423 ? 16.889  74.152 57.346 1.00   16.00 ? 423 PHE A CD1 1 
ATOM   3262 C CD2 . PHE A 1 423 ? 16.081  73.243 59.387 1.00   17.34 ? 423 PHE A CD2 1 
ATOM   3263 C CE1 . PHE A 1 423 ? 16.440  75.407 57.727 1.00   16.15 ? 423 PHE A CE1 1 
ATOM   3264 C CE2 . PHE A 1 423 ? 15.630  74.499 59.772 1.00   14.89 ? 423 PHE A CE2 1 
ATOM   3265 C CZ  . PHE A 1 423 ? 15.814  75.576 58.936 1.00   14.23 ? 423 PHE A CZ  1 
ATOM   3266 N N   . ASN A 1 424 ? 20.014  72.682 59.660 1.00   20.03 ? 424 ASN A N   1 
ATOM   3267 C CA  . ASN A 1 424 ? 20.452  72.822 61.028 1.00   19.48 ? 424 ASN A CA  1 
ATOM   3268 C C   . ASN A 1 424 ? 20.452  74.241 61.529 1.00   19.26 ? 424 ASN A C   1 
ATOM   3269 O O   . ASN A 1 424 ? 21.429  74.698 62.077 1.00   20.20 ? 424 ASN A O   1 
ATOM   3270 C CB  . ASN A 1 424 ? 21.807  72.168 61.228 1.00   19.77 ? 424 ASN A CB  1 
ATOM   3271 C CG  . ASN A 1 424 ? 22.857  72.773 60.380 1.00   22.35 ? 424 ASN A CG  1 
ATOM   3272 O OD1 . ASN A 1 424 ? 22.578  73.650 59.567 1.00   25.02 ? 424 ASN A OD1 1 
ATOM   3273 N ND2 . ASN A 1 424 ? 24.085  72.318 60.545 1.00   25.19 ? 424 ASN A ND2 1 
ATOM   3274 N N   . HIS A 1 425 ? 19.319  74.920 61.398 1.00   19.41 ? 425 HIS A N   1 
ATOM   3275 C CA  . HIS A 1 425 ? 19.186  76.285 61.866 1.00   20.07 ? 425 HIS A CA  1 
ATOM   3276 C C   . HIS A 1 425 ? 18.015  76.384 62.817 1.00   23.56 ? 425 HIS A C   1 
ATOM   3277 O O   . HIS A 1 425 ? 16.880  76.063 62.438 1.00   25.11 ? 425 HIS A O   1 
ATOM   3278 C CB  . HIS A 1 425 ? 18.898  77.265 60.720 1.00   19.58 ? 425 HIS A CB  1 
ATOM   3279 C CG  . HIS A 1 425 ? 18.826  78.700 61.167 1.00   18.11 ? 425 HIS A CG  1 
ATOM   3280 N ND1 . HIS A 1 425 ? 19.950  79.420 61.500 1.00   18.25 ? 425 HIS A ND1 1 
ATOM   3281 C CD2 . HIS A 1 425 ? 17.776  79.521 61.409 1.00   16.28 ? 425 HIS A CD2 1 
ATOM   3282 C CE1 . HIS A 1 425 ? 19.602  80.618 61.931 1.00   17.29 ? 425 HIS A CE1 1 
ATOM   3283 N NE2 . HIS A 1 425 ? 18.287  80.705 61.887 1.00   16.61 ? 425 HIS A NE2 1 
ATOM   3284 N N   . ARG A 1 426 ? 18.265  76.940 64.004 1.00   23.96 ? 426 ARG A N   1 
ATOM   3285 C CA  . ARG A 1 426 ? 17.214  77.122 64.982 1.00   23.64 ? 426 ARG A CA  1 
ATOM   3286 C C   . ARG A 1 426 ? 16.690  78.522 64.774 1.00   22.13 ? 426 ARG A C   1 
ATOM   3287 O O   . ARG A 1 426 ? 17.431  79.473 64.915 1.00   21.78 ? 426 ARG A O   1 
ATOM   3288 C CB  . ARG A 1 426 ? 17.783  76.994 66.393 1.00   26.76 ? 426 ARG A CB  1 
ATOM   3289 C CG  . ARG A 1 426 ? 16.694  76.642 67.375 1.00   28.56 ? 426 ARG A CG  1 
ATOM   3290 C CD  . ARG A 1 426 ? 17.061  76.843 68.823 1.00   30.43 ? 426 ARG A CD  1 
ATOM   3291 N NE  . ARG A 1 426 ? 16.274  75.876 69.572 1.00   33.59 ? 426 ARG A NE  1 
ATOM   3292 C CZ  . ARG A 1 426 ? 15.355  76.176 70.475 1.00   33.06 ? 426 ARG A CZ  1 
ATOM   3293 N NH1 . ARG A 1 426 ? 15.087  77.442 70.789 1.00   32.18 ? 426 ARG A NH1 1 
ATOM   3294 N NH2 . ARG A 1 426 ? 14.674  75.188 71.030 1.00   34.40 ? 426 ARG A NH2 1 
ATOM   3295 N N   . ALA A 1 427 ? 15.426  78.669 64.424 1.00   22.02 ? 427 ALA A N   1 
ATOM   3296 C CA  . ALA A 1 427 ? 14.888  79.999 64.178 1.00   23.81 ? 427 ALA A CA  1 
ATOM   3297 C C   . ALA A 1 427 ? 15.205  80.863 65.356 1.00   26.79 ? 427 ALA A C   1 
ATOM   3298 O O   . ALA A 1 427 ? 15.111  80.409 66.480 1.00   29.14 ? 427 ALA A O   1 
ATOM   3299 C CB  . ALA A 1 427 ? 13.388  79.941 63.986 1.00   24.17 ? 427 ALA A CB  1 
ATOM   3300 N N   . SER A 1 428 ? 15.468  82.143 65.127 1.00   29.25 ? 428 SER A N   1 
ATOM   3301 C CA  . SER A 1 428 ? 15.799  83.037 66.223 1.00   28.92 ? 428 SER A CA  1 
ATOM   3302 C C   . SER A 1 428 ? 14.628  83.204 67.186 1.00   28.77 ? 428 SER A C   1 
ATOM   3303 O O   . SER A 1 428 ? 14.819  83.422 68.382 1.00   29.71 ? 428 SER A O   1 
ATOM   3304 C CB  . SER A 1 428 ? 16.150  84.405 65.680 1.00   28.47 ? 428 SER A CB  1 
ATOM   3305 O OG  . SER A 1 428 ? 14.960  85.128 65.391 1.00   28.17 ? 428 SER A OG  1 
ATOM   3306 N N   . ASN A 1 429 ? 13.418  83.159 66.652 1.00   28.00 ? 429 ASN A N   1 
ATOM   3307 C CA  . ASN A 1 429 ? 12.226  83.374 67.466 1.00   27.42 ? 429 ASN A CA  1 
ATOM   3308 C C   . ASN A 1 429 ? 11.493  82.125 67.911 1.00   26.13 ? 429 ASN A C   1 
ATOM   3309 O O   . ASN A 1 429 ? 10.289  82.189 68.170 1.00   27.24 ? 429 ASN A O   1 
ATOM   3310 C CB  . ASN A 1 429 ? 11.248  84.276 66.698 1.00   27.84 ? 429 ASN A CB  1 
ATOM   3311 C CG  . ASN A 1 429 ? 10.978  83.769 65.283 1.00   29.19 ? 429 ASN A CG  1 
ATOM   3312 O OD1 . ASN A 1 429 ? 11.545  82.758 64.853 1.00   28.09 ? 429 ASN A OD1 1 
ATOM   3313 N ND2 . ASN A 1 429 ? 10.117  84.473 64.549 1.00   30.23 ? 429 ASN A ND2 1 
ATOM   3314 N N   . LEU A 1 430 ? 12.187  81.001 68.008 1.00   24.80 ? 430 LEU A N   1 
ATOM   3315 C CA  . LEU A 1 430 ? 11.530  79.763 68.401 1.00   24.19 ? 430 LEU A CA  1 
ATOM   3316 C C   . LEU A 1 430 ? 11.132  79.844 69.866 1.00   24.31 ? 430 LEU A C   1 
ATOM   3317 O O   . LEU A 1 430 ? 11.910  80.323 70.672 1.00   23.65 ? 430 LEU A O   1 
ATOM   3318 C CB  . LEU A 1 430 ? 12.478  78.583 68.150 1.00   25.07 ? 430 LEU A CB  1 
ATOM   3319 C CG  . LEU A 1 430 ? 11.916  77.428 67.305 1.00   26.63 ? 430 LEU A CG  1 
ATOM   3320 C CD1 . LEU A 1 430 ? 12.987  76.433 66.945 1.00   28.60 ? 430 LEU A CD1 1 
ATOM   3321 C CD2 . LEU A 1 430 ? 10.841  76.720 68.065 1.00   27.10 ? 430 LEU A CD2 1 
ATOM   3322 N N   . VAL A 1 431 ? 9.903   79.453 70.207 1.00   24.52 ? 431 VAL A N   1 
ATOM   3323 C CA  . VAL A 1 431 ? 9.466   79.488 71.612 1.00   25.26 ? 431 VAL A CA  1 
ATOM   3324 C C   . VAL A 1 431 ? 9.570   78.133 72.277 1.00   25.82 ? 431 VAL A C   1 
ATOM   3325 O O   . VAL A 1 431 ? 8.852   77.878 73.224 1.00   27.76 ? 431 VAL A O   1 
ATOM   3326 C CB  . VAL A 1 431 ? 8.004   79.939 71.813 1.00   25.73 ? 431 VAL A CB  1 
ATOM   3327 C CG1 . VAL A 1 431 ? 7.854   81.425 71.608 1.00   26.07 ? 431 VAL A CG1 1 
ATOM   3328 C CG2 . VAL A 1 431 ? 7.089   79.169 70.899 1.00   25.52 ? 431 VAL A CG2 1 
ATOM   3329 N N   . TRP A 1 432 ? 10.437  77.260 71.778 1.00   24.08 ? 432 TRP A N   1 
ATOM   3330 C CA  . TRP A 1 432 ? 10.602  75.936 72.357 1.00   22.12 ? 432 TRP A CA  1 
ATOM   3331 C C   . TRP A 1 432 ? 11.950  75.963 73.059 1.00   21.51 ? 432 TRP A C   1 
ATOM   3332 O O   . TRP A 1 432 ? 12.854  76.714 72.672 1.00   23.67 ? 432 TRP A O   1 
ATOM   3333 C CB  . TRP A 1 432 ? 10.576  74.830 71.269 1.00   21.27 ? 432 TRP A CB  1 
ATOM   3334 C CG  . TRP A 1 432 ? 9.203   74.479 70.690 1.00   20.63 ? 432 TRP A CG  1 
ATOM   3335 C CD1 . TRP A 1 432 ? 8.707   74.875 69.496 1.00   19.57 ? 432 TRP A CD1 1 
ATOM   3336 C CD2 . TRP A 1 432 ? 8.182   73.664 71.284 1.00   21.72 ? 432 TRP A CD2 1 
ATOM   3337 N NE1 . TRP A 1 432 ? 7.449   74.371 69.300 1.00   17.47 ? 432 TRP A NE1 1 
ATOM   3338 C CE2 . TRP A 1 432 ? 7.104   73.618 70.383 1.00   20.22 ? 432 TRP A CE2 1 
ATOM   3339 C CE3 . TRP A 1 432 ? 8.069   72.972 72.494 1.00   24.24 ? 432 TRP A CE3 1 
ATOM   3340 C CZ2 . TRP A 1 432 ? 5.929   72.906 70.649 1.00   21.87 ? 432 TRP A CZ2 1 
ATOM   3341 C CZ3 . TRP A 1 432 ? 6.879   72.260 72.760 1.00   22.49 ? 432 TRP A CZ3 1 
ATOM   3342 C CH2 . TRP A 1 432 ? 5.839   72.237 71.841 1.00   21.49 ? 432 TRP A CH2 1 
ATOM   3343 N N   . PRO A 1 433 ? 12.114  75.153 74.105 1.00   20.13 ? 433 PRO A N   1 
ATOM   3344 C CA  . PRO A 1 433 ? 13.393  75.167 74.792 1.00   20.01 ? 433 PRO A CA  1 
ATOM   3345 C C   . PRO A 1 433 ? 14.591  74.830 73.944 1.00   21.67 ? 433 PRO A C   1 
ATOM   3346 O O   . PRO A 1 433 ? 14.573  73.903 73.155 1.00   24.95 ? 433 PRO A O   1 
ATOM   3347 C CB  . PRO A 1 433 ? 13.184  74.163 75.925 1.00   19.48 ? 433 PRO A CB  1 
ATOM   3348 C CG  . PRO A 1 433 ? 12.052  73.340 75.483 1.00   18.41 ? 433 PRO A CG  1 
ATOM   3349 C CD  . PRO A 1 433 ? 11.148  74.334 74.847 1.00   17.93 ? 433 PRO A CD  1 
ATOM   3350 N N   . GLU A 1 434 ? 15.672  75.543 74.188 1.00   23.94 ? 434 GLU A N   1 
ATOM   3351 C CA  . GLU A 1 434 ? 16.918  75.356 73.488 1.00   25.65 ? 434 GLU A CA  1 
ATOM   3352 C C   . GLU A 1 434 ? 17.341  73.905 73.338 1.00   26.13 ? 434 GLU A C   1 
ATOM   3353 O O   . GLU A 1 434 ? 17.979  73.535 72.328 1.00   27.98 ? 434 GLU A O   1 
ATOM   3354 C CB  . GLU A 1 434 ? 18.019  76.087 74.247 1.00   29.94 ? 434 GLU A CB  1 
ATOM   3355 C CG  . GLU A 1 434 ? 19.049  76.832 73.369 1.00   38.75 ? 434 GLU A CG  1 
ATOM   3356 C CD  . GLU A 1 434 ? 18.503  78.170 72.831 1.00   44.34 ? 434 GLU A CD  1 
ATOM   3357 O OE1 . GLU A 1 434 ? 17.284  78.479 73.063 1.00   46.91 ? 434 GLU A OE1 1 
ATOM   3358 O OE2 . GLU A 1 434 ? 19.295  78.916 72.174 1.00   47.17 ? 434 GLU A OE2 1 
ATOM   3359 N N   . TRP A 1 435 ? 17.018  73.081 74.332 1.00   24.47 ? 435 TRP A N   1 
ATOM   3360 C CA  . TRP A 1 435 ? 17.452  71.678 74.323 1.00   22.98 ? 435 TRP A CA  1 
ATOM   3361 C C   . TRP A 1 435 ? 16.859  70.907 73.175 1.00   22.56 ? 435 TRP A C   1 
ATOM   3362 O O   . TRP A 1 435 ? 17.339  69.835 72.801 1.00   21.79 ? 435 TRP A O   1 
ATOM   3363 C CB  . TRP A 1 435 ? 17.145  70.959 75.674 1.00   20.93 ? 435 TRP A CB  1 
ATOM   3364 C CG  . TRP A 1 435 ? 15.679  70.641 75.980 1.00   19.93 ? 435 TRP A CG  1 
ATOM   3365 C CD1 . TRP A 1 435 ? 14.829  71.389 76.740 1.00   20.35 ? 435 TRP A CD1 1 
ATOM   3366 C CD2 . TRP A 1 435 ? 14.920  69.480 75.560 1.00   18.05 ? 435 TRP A CD2 1 
ATOM   3367 N NE1 . TRP A 1 435 ? 13.594  70.768 76.826 1.00   17.50 ? 435 TRP A NE1 1 
ATOM   3368 C CE2 . TRP A 1 435 ? 13.625  69.603 76.112 1.00   15.98 ? 435 TRP A CE2 1 
ATOM   3369 C CE3 . TRP A 1 435 ? 15.203  68.360 74.769 1.00   17.69 ? 435 TRP A CE3 1 
ATOM   3370 C CZ2 . TRP A 1 435 ? 12.628  68.659 75.894 1.00   16.40 ? 435 TRP A CZ2 1 
ATOM   3371 C CZ3 . TRP A 1 435 ? 14.208  67.421 74.554 1.00   14.71 ? 435 TRP A CZ3 1 
ATOM   3372 C CH2 . TRP A 1 435 ? 12.937  67.576 75.112 1.00   16.69 ? 435 TRP A CH2 1 
ATOM   3373 N N   . MET A 1 436 ? 15.784  71.446 72.636 1.00   22.32 ? 436 MET A N   1 
ATOM   3374 C CA  . MET A 1 436 ? 15.105  70.786 71.566 1.00   21.28 ? 436 MET A CA  1 
ATOM   3375 C C   . MET A 1 436 ? 15.764  70.991 70.230 1.00   22.60 ? 436 MET A C   1 
ATOM   3376 O O   . MET A 1 436 ? 15.454  70.270 69.308 1.00   24.70 ? 436 MET A O   1 
ATOM   3377 C CB  . MET A 1 436 ? 13.651  71.187 71.564 1.00   19.26 ? 436 MET A CB  1 
ATOM   3378 C CG  . MET A 1 436 ? 12.890  70.473 72.598 1.00   15.36 ? 436 MET A CG  1 
ATOM   3379 S SD  . MET A 1 436 ? 11.263  71.061 72.543 1.00   19.83 ? 436 MET A SD  1 
ATOM   3380 C CE  . MET A 1 436 ? 10.531  69.929 71.443 1.00   20.37 ? 436 MET A CE  1 
ATOM   3381 N N   . GLY A 1 437 ? 16.684  71.948 70.141 1.00   21.91 ? 437 GLY A N   1 
ATOM   3382 C CA  . GLY A 1 437 ? 17.416  72.201 68.903 1.00   21.80 ? 437 GLY A CA  1 
ATOM   3383 C C   . GLY A 1 437 ? 16.667  72.629 67.647 1.00   22.09 ? 437 GLY A C   1 
ATOM   3384 O O   . GLY A 1 437 ? 15.832  73.526 67.678 1.00   22.08 ? 437 GLY A O   1 
ATOM   3385 N N   . VAL A 1 438 ? 17.079  72.085 66.508 1.00   22.04 ? 438 VAL A N   1 
ATOM   3386 C CA  . VAL A 1 438 ? 16.444  72.370 65.225 1.00   20.36 ? 438 VAL A CA  1 
ATOM   3387 C C   . VAL A 1 438 ? 15.377  71.300 65.144 1.00   20.51 ? 438 VAL A C   1 
ATOM   3388 O O   . VAL A 1 438 ? 15.644  70.168 64.729 1.00   20.62 ? 438 VAL A O   1 
ATOM   3389 C CB  . VAL A 1 438 ? 17.418  72.182 64.073 1.00   18.22 ? 438 VAL A CB  1 
ATOM   3390 C CG1 . VAL A 1 438 ? 16.788  72.666 62.813 1.00   17.89 ? 438 VAL A CG1 1 
ATOM   3391 C CG2 . VAL A 1 438 ? 18.704  72.933 64.351 1.00   14.98 ? 438 VAL A CG2 1 
ATOM   3392 N N   . ILE A 1 439 ? 14.182  71.663 65.584 1.00   20.35 ? 439 ILE A N   1 
ATOM   3393 C CA  . ILE A 1 439 ? 13.039  70.770 65.679 1.00   19.01 ? 439 ILE A CA  1 
ATOM   3394 C C   . ILE A 1 439 ? 12.315  70.359 64.404 1.00   20.15 ? 439 ILE A C   1 
ATOM   3395 O O   . ILE A 1 439 ? 12.169  71.130 63.443 1.00   19.63 ? 439 ILE A O   1 
ATOM   3396 C CB  . ILE A 1 439 ? 11.982  71.400 66.605 1.00   18.45 ? 439 ILE A CB  1 
ATOM   3397 C CG1 . ILE A 1 439 ? 12.622  71.899 67.888 1.00   18.39 ? 439 ILE A CG1 1 
ATOM   3398 C CG2 . ILE A 1 439 ? 10.912  70.417 66.945 1.00   19.05 ? 439 ILE A CG2 1 
ATOM   3399 C CD1 . ILE A 1 439 ? 11.701  72.754 68.664 1.00   18.65 ? 439 ILE A CD1 1 
ATOM   3400 N N   . HIS A 1 440 ? 11.741  69.165 64.489 1.00   18.72 ? 440 HIS A N   1 
ATOM   3401 C CA  . HIS A 1 440 ? 10.954  68.553 63.448 1.00   17.80 ? 440 HIS A CA  1 
ATOM   3402 C C   . HIS A 1 440 ? 9.942   69.613 63.132 1.00   19.74 ? 440 HIS A C   1 
ATOM   3403 O O   . HIS A 1 440 ? 9.441   70.249 64.052 1.00   20.29 ? 440 HIS A O   1 
ATOM   3404 C CB  . HIS A 1 440 ? 10.218  67.386 64.049 1.00   16.60 ? 440 HIS A CB  1 
ATOM   3405 C CG  . HIS A 1 440 ? 9.517   66.513 63.068 1.00   15.20 ? 440 HIS A CG  1 
ATOM   3406 N ND1 . HIS A 1 440 ? 10.192  65.749 62.142 1.00   14.37 ? 440 HIS A ND1 1 
ATOM   3407 C CD2 . HIS A 1 440 ? 8.221   66.131 62.990 1.00   13.73 ? 440 HIS A CD2 1 
ATOM   3408 C CE1 . HIS A 1 440 ? 9.354   64.909 61.562 1.00   13.86 ? 440 HIS A CE1 1 
ATOM   3409 N NE2 . HIS A 1 440 ? 8.151   65.122 62.057 1.00   15.73 ? 440 HIS A NE2 1 
ATOM   3410 N N   . GLY A 1 441 ? 9.744   69.873 61.835 1.00   19.78 ? 441 GLY A N   1 
ATOM   3411 C CA  . GLY A 1 441 ? 8.758   70.838 61.388 1.00   19.31 ? 441 GLY A CA  1 
ATOM   3412 C C   . GLY A 1 441 ? 9.202   72.270 61.369 1.00   20.46 ? 441 GLY A C   1 
ATOM   3413 O O   . GLY A 1 441 ? 8.461   73.160 60.948 1.00   21.64 ? 441 GLY A O   1 
ATOM   3414 N N   . TYR A 1 442 ? 10.433  72.524 61.754 1.00   20.46 ? 442 TYR A N   1 
ATOM   3415 C CA  . TYR A 1 442 ? 10.838  73.892 61.765 1.00   19.15 ? 442 TYR A CA  1 
ATOM   3416 C C   . TYR A 1 442 ? 11.567  74.413 60.564 1.00   19.65 ? 442 TYR A C   1 
ATOM   3417 O O   . TYR A 1 442 ? 12.107  75.512 60.599 1.00   18.93 ? 442 TYR A O   1 
ATOM   3418 C CB  . TYR A 1 442 ? 11.453  74.248 63.114 1.00   19.41 ? 442 TYR A CB  1 
ATOM   3419 C CG  . TYR A 1 442 ? 10.340  74.397 64.130 1.00   15.98 ? 442 TYR A CG  1 
ATOM   3420 C CD1 . TYR A 1 442 ? 9.721   73.281 64.676 1.00   17.60 ? 442 TYR A CD1 1 
ATOM   3421 C CD2 . TYR A 1 442 ? 9.815   75.633 64.418 1.00   14.26 ? 442 TYR A CD2 1 
ATOM   3422 C CE1 . TYR A 1 442 ? 8.612   73.396 65.462 1.00   15.10 ? 442 TYR A CE1 1 
ATOM   3423 C CE2 . TYR A 1 442 ? 8.707   75.756 65.196 1.00   15.47 ? 442 TYR A CE2 1 
ATOM   3424 C CZ  . TYR A 1 442 ? 8.112   74.634 65.713 1.00   15.76 ? 442 TYR A CZ  1 
ATOM   3425 O OH  . TYR A 1 442 ? 6.990   74.767 66.472 1.00   17.63 ? 442 TYR A OH  1 
ATOM   3426 N N   . GLU A 1 443 ? 11.603  73.608 59.500 1.00   20.20 ? 443 GLU A N   1 
ATOM   3427 C CA  . GLU A 1 443 ? 12.191  74.064 58.243 1.00   19.10 ? 443 GLU A CA  1 
ATOM   3428 C C   . GLU A 1 443 ? 11.007  74.553 57.450 1.00   18.48 ? 443 GLU A C   1 
ATOM   3429 O O   . GLU A 1 443 ? 11.135  75.447 56.653 1.00   20.47 ? 443 GLU A O   1 
ATOM   3430 C CB  . GLU A 1 443 ? 12.889  72.967 57.451 1.00   17.74 ? 443 GLU A CB  1 
ATOM   3431 C CG  . GLU A 1 443 ? 11.980  72.089 56.646 1.00   17.10 ? 443 GLU A CG  1 
ATOM   3432 C CD  . GLU A 1 443 ? 11.210  71.128 57.501 1.00   16.88 ? 443 GLU A CD  1 
ATOM   3433 O OE1 . GLU A 1 443 ? 11.515  71.019 58.692 1.00   19.78 ? 443 GLU A OE1 1 
ATOM   3434 O OE2 . GLU A 1 443 ? 10.311  70.462 56.990 1.00   14.98 ? 443 GLU A OE2 1 
ATOM   3435 N N   . ILE A 1 444 ? 9.842   73.974 57.706 1.00   19.34 ? 444 ILE A N   1 
ATOM   3436 C CA  . ILE A 1 444 ? 8.611   74.341 57.019 1.00   18.86 ? 444 ILE A CA  1 
ATOM   3437 C C   . ILE A 1 444 ? 8.458   75.834 56.905 1.00   21.23 ? 444 ILE A C   1 
ATOM   3438 O O   . ILE A 1 444 ? 8.265   76.350 55.822 1.00   25.22 ? 444 ILE A O   1 
ATOM   3439 C CB  . ILE A 1 444 ? 7.355   73.816 57.736 1.00   15.39 ? 444 ILE A CB  1 
ATOM   3440 C CG1 . ILE A 1 444 ? 7.335   72.303 57.760 1.00   11.07 ? 444 ILE A CG1 1 
ATOM   3441 C CG2 . ILE A 1 444 ? 6.121   74.290 57.019 1.00   17.71 ? 444 ILE A CG2 1 
ATOM   3442 C CD1 . ILE A 1 444 ? 6.060   71.774 58.194 1.00   9.50  ? 444 ILE A CD1 1 
ATOM   3443 N N   . GLU A 1 445 ? 8.597   76.545 58.008 1.00   22.50 ? 445 GLU A N   1 
ATOM   3444 C CA  . GLU A 1 445 ? 8.416   77.977 57.990 1.00   20.70 ? 445 GLU A CA  1 
ATOM   3445 C C   . GLU A 1 445 ? 9.390   78.720 57.144 1.00   20.24 ? 445 GLU A C   1 
ATOM   3446 O O   . GLU A 1 445 ? 9.139   79.845 56.776 1.00   21.34 ? 445 GLU A O   1 
ATOM   3447 C CB  . GLU A 1 445 ? 8.412   78.528 59.401 1.00   22.74 ? 445 GLU A CB  1 
ATOM   3448 C CG  . GLU A 1 445 ? 9.610   78.140 60.236 1.00   24.67 ? 445 GLU A CG  1 
ATOM   3449 C CD  . GLU A 1 445 ? 9.431   78.588 61.674 1.00   27.44 ? 445 GLU A CD  1 
ATOM   3450 O OE1 . GLU A 1 445 ? 8.490   78.061 62.317 1.00   25.05 ? 445 GLU A OE1 1 
ATOM   3451 O OE2 . GLU A 1 445 ? 10.175  79.496 62.126 1.00   23.83 ? 445 GLU A OE2 1 
ATOM   3452 N N   . PHE A 1 446 ? 10.527  78.133 56.854 1.00   20.38 ? 446 PHE A N   1 
ATOM   3453 C CA  . PHE A 1 446 ? 11.490  78.814 56.001 1.00   22.29 ? 446 PHE A CA  1 
ATOM   3454 C C   . PHE A 1 446 ? 11.131  78.541 54.562 1.00   22.61 ? 446 PHE A C   1 
ATOM   3455 O O   . PHE A 1 446 ? 11.172  79.428 53.717 1.00   24.94 ? 446 PHE A O   1 
ATOM   3456 C CB  . PHE A 1 446 ? 12.900  78.354 56.305 1.00   22.42 ? 446 PHE A CB  1 
ATOM   3457 C CG  . PHE A 1 446 ? 13.439  78.953 57.544 1.00   23.78 ? 446 PHE A CG  1 
ATOM   3458 C CD1 . PHE A 1 446 ? 13.057  78.465 58.780 1.00   24.09 ? 446 PHE A CD1 1 
ATOM   3459 C CD2 . PHE A 1 446 ? 14.235  80.079 57.484 1.00   23.28 ? 446 PHE A CD2 1 
ATOM   3460 C CE1 . PHE A 1 446 ? 13.451  79.101 59.936 1.00   24.31 ? 446 PHE A CE1 1 
ATOM   3461 C CE2 . PHE A 1 446 ? 14.635  80.719 58.629 1.00   24.32 ? 446 PHE A CE2 1 
ATOM   3462 C CZ  . PHE A 1 446 ? 14.240  80.231 59.859 1.00   24.80 ? 446 PHE A CZ  1 
ATOM   3463 N N   . VAL A 1 447 ? 10.659  77.328 54.319 1.00   21.52 ? 447 VAL A N   1 
ATOM   3464 C CA  . VAL A 1 447 ? 10.258  76.901 53.001 1.00   18.97 ? 447 VAL A CA  1 
ATOM   3465 C C   . VAL A 1 447 ? 9.045   77.678 52.530 1.00   18.80 ? 447 VAL A C   1 
ATOM   3466 O O   . VAL A 1 447 ? 8.856   77.854 51.356 1.00   20.95 ? 447 VAL A O   1 
ATOM   3467 C CB  . VAL A 1 447 ? 9.964   75.401 53.027 1.00   17.65 ? 447 VAL A CB  1 
ATOM   3468 C CG1 . VAL A 1 447 ? 9.203   74.979 51.810 1.00   14.40 ? 447 VAL A CG1 1 
ATOM   3469 C CG2 . VAL A 1 447 ? 11.261  74.618 53.197 1.00   14.78 ? 447 VAL A CG2 1 
ATOM   3470 N N   . PHE A 1 448 ? 8.207   78.143 53.429 1.00   17.18 ? 448 PHE A N   1 
ATOM   3471 C CA  . PHE A 1 448 ? 7.045   78.876 52.972 1.00   17.81 ? 448 PHE A CA  1 
ATOM   3472 C C   . PHE A 1 448 ? 7.187   80.363 53.069 1.00   18.11 ? 448 PHE A C   1 
ATOM   3473 O O   . PHE A 1 448 ? 6.213   81.073 52.918 1.00   18.99 ? 448 PHE A O   1 
ATOM   3474 C CB  . PHE A 1 448 ? 5.785   78.430 53.684 1.00   16.99 ? 448 PHE A CB  1 
ATOM   3475 C CG  . PHE A 1 448 ? 5.218   77.161 53.152 1.00   17.11 ? 448 PHE A CG  1 
ATOM   3476 C CD1 . PHE A 1 448 ? 5.765   75.944 53.502 1.00   15.94 ? 448 PHE A CD1 1 
ATOM   3477 C CD2 . PHE A 1 448 ? 4.121   77.178 52.311 1.00   16.37 ? 448 PHE A CD2 1 
ATOM   3478 C CE1 . PHE A 1 448 ? 5.231   74.775 53.025 1.00   15.54 ? 448 PHE A CE1 1 
ATOM   3479 C CE2 . PHE A 1 448 ? 3.587   76.007 51.836 1.00   16.08 ? 448 PHE A CE2 1 
ATOM   3480 C CZ  . PHE A 1 448 ? 4.146   74.809 52.195 1.00   16.36 ? 448 PHE A CZ  1 
ATOM   3481 N N   . GLY A 1 449 ? 8.392   80.826 53.375 1.00   19.81 ? 449 GLY A N   1 
ATOM   3482 C CA  . GLY A 1 449 ? 8.675   82.251 53.434 1.00   19.99 ? 449 GLY A CA  1 
ATOM   3483 C C   . GLY A 1 449 ? 8.150   83.140 54.547 1.00   22.41 ? 449 GLY A C   1 
ATOM   3484 O O   . GLY A 1 449 ? 8.067   84.361 54.367 1.00   23.58 ? 449 GLY A O   1 
ATOM   3485 N N   . LEU A 1 450 ? 7.823   82.576 55.707 1.00   24.47 ? 450 LEU A N   1 
ATOM   3486 C CA  . LEU A 1 450 ? 7.350   83.402 56.818 1.00   23.70 ? 450 LEU A CA  1 
ATOM   3487 C C   . LEU A 1 450 ? 8.479   84.337 57.213 1.00   22.52 ? 450 LEU A C   1 
ATOM   3488 O O   . LEU A 1 450 ? 8.236   85.476 57.540 1.00   24.65 ? 450 LEU A O   1 
ATOM   3489 C CB  . LEU A 1 450 ? 6.902   82.558 58.010 1.00   23.92 ? 450 LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 450 ? 5.516   81.918 57.906 1.00   23.52 ? 450 LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 450 ? 4.456   82.959 58.043 1.00   26.04 ? 450 LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 450 ? 5.341   81.204 56.590 1.00   25.56 ? 450 LEU A CD2 1 
ATOM   3493 N N   . PRO A 1 451 ? 9.732   83.890 57.157 1.00   20.18 ? 451 PRO A N   1 
ATOM   3494 C CA  . PRO A 1 451 ? 10.777  84.834 57.535 1.00   20.98 ? 451 PRO A CA  1 
ATOM   3495 C C   . PRO A 1 451 ? 10.801  86.133 56.755 1.00   23.38 ? 451 PRO A C   1 
ATOM   3496 O O   . PRO A 1 451 ? 11.674  86.965 56.974 1.00   24.26 ? 451 PRO A O   1 
ATOM   3497 C CB  . PRO A 1 451 ? 12.038  84.035 57.296 1.00   18.32 ? 451 PRO A CB  1 
ATOM   3498 C CG  . PRO A 1 451 ? 11.645  82.684 57.762 1.00   18.01 ? 451 PRO A CG  1 
ATOM   3499 C CD  . PRO A 1 451 ? 10.264  82.521 57.152 1.00   19.18 ? 451 PRO A CD  1 
ATOM   3500 N N   . LEU A 1 452 ? 9.875   86.318 55.822 1.00   27.21 ? 452 LEU A N   1 
ATOM   3501 C CA  . LEU A 1 452 ? 9.859   87.540 55.027 1.00   29.94 ? 452 LEU A CA  1 
ATOM   3502 C C   . LEU A 1 452 ? 8.958   88.542 55.672 1.00   30.99 ? 452 LEU A C   1 
ATOM   3503 O O   . LEU A 1 452 ? 9.160   89.740 55.505 1.00   32.54 ? 452 LEU A O   1 
ATOM   3504 C CB  . LEU A 1 452 ? 9.363   87.295 53.602 1.00   30.30 ? 452 LEU A CB  1 
ATOM   3505 C CG  . LEU A 1 452 ? 9.995   86.178 52.777 1.00   31.49 ? 452 LEU A CG  1 
ATOM   3506 C CD1 . LEU A 1 452 ? 9.875   86.575 51.300 1.00   31.49 ? 452 LEU A CD1 1 
ATOM   3507 C CD2 . LEU A 1 452 ? 11.458  85.999 53.145 1.00   30.17 ? 452 LEU A CD2 1 
ATOM   3508 N N   . VAL A 1 453 ? 7.907   88.067 56.325 1.00   32.00 ? 453 VAL A N   1 
ATOM   3509 C CA  . VAL A 1 453 ? 6.997   88.972 57.001 1.00   33.85 ? 453 VAL A CA  1 
ATOM   3510 C C   . VAL A 1 453 ? 7.664   89.472 58.309 1.00   36.27 ? 453 VAL A C   1 
ATOM   3511 O O   . VAL A 1 453 ? 7.777   88.756 59.305 1.00   36.75 ? 453 VAL A O   1 
ATOM   3512 C CB  . VAL A 1 453 ? 5.613   88.310 57.209 1.00   33.67 ? 453 VAL A CB  1 
ATOM   3513 C CG1 . VAL A 1 453 ? 5.713   86.798 57.077 1.00   33.02 ? 453 VAL A CG1 1 
ATOM   3514 C CG2 . VAL A 1 453 ? 4.984   88.718 58.540 1.00   31.83 ? 453 VAL A CG2 1 
ATOM   3515 N N   . LYS A 1 454 ? 8.163   90.704 58.272 1.00   38.55 ? 454 LYS A N   1 
ATOM   3516 C CA  . LYS A 1 454 ? 8.859   91.338 59.408 1.00   40.33 ? 454 LYS A CA  1 
ATOM   3517 C C   . LYS A 1 454 ? 8.097   91.334 60.735 1.00   39.72 ? 454 LYS A C   1 
ATOM   3518 O O   . LYS A 1 454 ? 8.693   91.234 61.817 1.00   40.72 ? 454 LYS A O   1 
ATOM   3519 C CB  . LYS A 1 454 ? 9.228   92.788 59.054 1.00   43.42 ? 454 LYS A CB  1 
ATOM   3520 C CG  . LYS A 1 454 ? 9.933   92.965 57.652 1.00   48.80 ? 454 LYS A CG  1 
ATOM   3521 C CD  . LYS A 1 454 ? 11.061  91.907 57.418 1.00   50.72 ? 454 LYS A CD  1 
ATOM   3522 C CE  . LYS A 1 454 ? 11.626  91.960 55.993 1.00   51.31 ? 454 LYS A CE  1 
ATOM   3523 N NZ  . LYS A 1 454 ? 12.469  93.195 55.809 1.00   51.68 ? 454 LYS A NZ  1 
ATOM   3524 N N   . GLU A 1 455 ? 6.780   91.410 60.685 1.00   38.18 ? 455 GLU A N   1 
ATOM   3525 C CA  . GLU A 1 455 ? 6.050   91.428 61.927 1.00   36.86 ? 455 GLU A CA  1 
ATOM   3526 C C   . GLU A 1 455 ? 6.229   90.107 62.640 1.00   35.77 ? 455 GLU A C   1 
ATOM   3527 O O   . GLU A 1 455 ? 5.526   89.842 63.615 1.00   37.34 ? 455 GLU A O   1 
ATOM   3528 C CB  . GLU A 1 455 ? 4.563   91.697 61.678 1.00   39.99 ? 455 GLU A CB  1 
ATOM   3529 C CG  . GLU A 1 455 ? 4.275   92.976 60.854 1.00   44.41 ? 455 GLU A CG  1 
ATOM   3530 C CD  . GLU A 1 455 ? 4.134   92.700 59.341 1.00   48.39 ? 455 GLU A CD  1 
ATOM   3531 O OE1 . GLU A 1 455 ? 3.365   91.754 58.963 1.00   49.21 ? 455 GLU A OE1 1 
ATOM   3532 O OE2 . GLU A 1 455 ? 4.792   93.429 58.530 1.00   50.32 ? 455 GLU A OE2 1 
ATOM   3533 N N   . LEU A 1 456 ? 7.101   89.243 62.120 1.00   34.38 ? 456 LEU A N   1 
ATOM   3534 C CA  . LEU A 1 456 ? 7.339   87.945 62.734 1.00   33.02 ? 456 LEU A CA  1 
ATOM   3535 C C   . LEU A 1 456 ? 8.670   87.886 63.466 1.00   33.37 ? 456 LEU A C   1 
ATOM   3536 O O   . LEU A 1 456 ? 9.028   86.865 64.082 1.00   33.22 ? 456 LEU A O   1 
ATOM   3537 C CB  . LEU A 1 456 ? 7.263   86.835 61.693 1.00   32.70 ? 456 LEU A CB  1 
ATOM   3538 C CG  . LEU A 1 456 ? 5.908   86.690 61.013 1.00   31.64 ? 456 LEU A CG  1 
ATOM   3539 C CD1 . LEU A 1 456 ? 5.897   85.391 60.217 1.00   30.44 ? 456 LEU A CD1 1 
ATOM   3540 C CD2 . LEU A 1 456 ? 4.803   86.688 62.054 1.00   31.18 ? 456 LEU A CD2 1 
ATOM   3541 N N   . ASN A 1 457 ? 9.453   88.942 63.323 1.00   33.90 ? 457 ASN A N   1 
ATOM   3542 C CA  . ASN A 1 457 ? 10.708  89.028 64.045 1.00   34.73 ? 457 ASN A CA  1 
ATOM   3543 C C   . ASN A 1 457 ? 11.786  88.028 63.674 1.00   32.30 ? 457 ASN A C   1 
ATOM   3544 O O   . ASN A 1 457 ? 12.463  87.515 64.566 1.00   33.84 ? 457 ASN A O   1 
ATOM   3545 C CB  . ASN A 1 457 ? 10.470  88.898 65.571 1.00   39.12 ? 457 ASN A CB  1 
ATOM   3546 C CG  . ASN A 1 457 ? 9.399   89.871 66.113 1.00   43.79 ? 457 ASN A CG  1 
ATOM   3547 O OD1 . ASN A 1 457 ? 8.617   89.517 67.033 1.00   46.37 ? 457 ASN A OD1 1 
ATOM   3548 N ND2 . ASN A 1 457 ? 9.358   91.100 65.562 1.00   44.74 ? 457 ASN A ND2 1 
ATOM   3549 N N   . TYR A 1 458 ? 11.941  87.668 62.414 1.00   28.74 ? 458 TYR A N   1 
ATOM   3550 C CA  . TYR A 1 458 ? 13.054  86.773 62.141 1.00   25.91 ? 458 TYR A CA  1 
ATOM   3551 C C   . TYR A 1 458 ? 14.165  87.756 61.874 1.00   26.56 ? 458 TYR A C   1 
ATOM   3552 O O   . TYR A 1 458 ? 13.913  88.960 61.798 1.00   26.97 ? 458 TYR A O   1 
ATOM   3553 C CB  . TYR A 1 458 ? 12.821  85.864 60.944 1.00   21.95 ? 458 TYR A CB  1 
ATOM   3554 C CG  . TYR A 1 458 ? 11.817  84.761 61.169 1.00   18.52 ? 458 TYR A CG  1 
ATOM   3555 C CD1 . TYR A 1 458 ? 10.463  84.987 60.978 1.00   17.96 ? 458 TYR A CD1 1 
ATOM   3556 C CD2 . TYR A 1 458 ? 12.223  83.482 61.513 1.00   18.04 ? 458 TYR A CD2 1 
ATOM   3557 C CE1 . TYR A 1 458 ? 9.534   83.971 61.114 1.00   16.76 ? 458 TYR A CE1 1 
ATOM   3558 C CE2 . TYR A 1 458 ? 11.301  82.453 61.653 1.00   16.80 ? 458 TYR A CE2 1 
ATOM   3559 C CZ  . TYR A 1 458 ? 9.955   82.711 61.448 1.00   17.68 ? 458 TYR A CZ  1 
ATOM   3560 O OH  . TYR A 1 458 ? 9.017   81.708 61.544 1.00   18.48 ? 458 TYR A OH  1 
ATOM   3561 N N   . THR A 1 459 ? 15.390  87.258 61.751 1.00   28.50 ? 459 THR A N   1 
ATOM   3562 C CA  . THR A 1 459 ? 16.552  88.104 61.514 1.00   29.32 ? 459 THR A CA  1 
ATOM   3563 C C   . THR A 1 459 ? 16.883  88.227 60.021 1.00   31.88 ? 459 THR A C   1 
ATOM   3564 O O   . THR A 1 459 ? 16.513  87.365 59.214 1.00   34.21 ? 459 THR A O   1 
ATOM   3565 C CB  . THR A 1 459 ? 17.754  87.554 62.274 1.00   27.87 ? 459 THR A CB  1 
ATOM   3566 O OG1 . THR A 1 459 ? 18.191  86.325 61.684 1.00   27.66 ? 459 THR A OG1 1 
ATOM   3567 C CG2 . THR A 1 459 ? 17.342  87.238 63.683 1.00   26.46 ? 459 THR A CG2 1 
ATOM   3568 N N   . ALA A 1 460 ? 17.606  89.282 59.653 1.00   33.36 ? 460 ALA A N   1 
ATOM   3569 C CA  . ALA A 1 460 ? 17.965  89.528 58.257 1.00   32.29 ? 460 ALA A CA  1 
ATOM   3570 C C   . ALA A 1 460 ? 18.522  88.278 57.579 1.00   32.95 ? 460 ALA A C   1 
ATOM   3571 O O   . ALA A 1 460 ? 18.075  87.878 56.485 1.00   33.19 ? 460 ALA A O   1 
ATOM   3572 C CB  . ALA A 1 460 ? 18.997  90.626 58.196 1.00   30.96 ? 460 ALA A CB  1 
ATOM   3573 N N   . GLU A 1 461 ? 19.451  87.617 58.261 1.00   32.43 ? 461 GLU A N   1 
ATOM   3574 C CA  . GLU A 1 461 ? 20.083  86.453 57.672 1.00   33.27 ? 461 GLU A CA  1 
ATOM   3575 C C   . GLU A 1 461 ? 19.106  85.314 57.561 1.00   32.16 ? 461 GLU A C   1 
ATOM   3576 O O   . GLU A 1 461 ? 19.299  84.408 56.750 1.00   32.76 ? 461 GLU A O   1 
ATOM   3577 C CB  . GLU A 1 461 ? 21.326  86.030 58.452 1.00   35.03 ? 461 GLU A CB  1 
ATOM   3578 C CG  . GLU A 1 461 ? 21.339  86.517 59.904 1.00   40.71 ? 461 GLU A CG  1 
ATOM   3579 C CD  . GLU A 1 461 ? 21.757  87.974 59.998 1.00   42.75 ? 461 GLU A CD  1 
ATOM   3580 O OE1 . GLU A 1 461 ? 22.976  88.242 59.792 1.00   45.26 ? 461 GLU A OE1 1 
ATOM   3581 O OE2 . GLU A 1 461 ? 20.876  88.843 60.242 1.00   43.82 ? 461 GLU A OE2 1 
ATOM   3582 N N   . GLU A 1 462 ? 18.069  85.335 58.378 1.00   29.54 ? 462 GLU A N   1 
ATOM   3583 C CA  . GLU A 1 462 ? 17.093  84.280 58.311 1.00   29.22 ? 462 GLU A CA  1 
ATOM   3584 C C   . GLU A 1 462 ? 16.217  84.563 57.142 1.00   30.31 ? 462 GLU A C   1 
ATOM   3585 O O   . GLU A 1 462 ? 15.724  83.633 56.508 1.00   30.92 ? 462 GLU A O   1 
ATOM   3586 C CB  . GLU A 1 462 ? 16.265  84.217 59.575 1.00   28.22 ? 462 GLU A CB  1 
ATOM   3587 C CG  . GLU A 1 462 ? 17.026  83.571 60.710 1.00   28.90 ? 462 GLU A CG  1 
ATOM   3588 C CD  . GLU A 1 462 ? 16.191  83.366 61.941 1.00   27.60 ? 462 GLU A CD  1 
ATOM   3589 O OE1 . GLU A 1 462 ? 15.541  84.319 62.432 1.00   26.82 ? 462 GLU A OE1 1 
ATOM   3590 O OE2 . GLU A 1 462 ? 16.195  82.227 62.415 1.00   28.00 ? 462 GLU A OE2 1 
ATOM   3591 N N   . GLU A 1 463 ? 16.014  85.848 56.845 1.00   31.06 ? 463 GLU A N   1 
ATOM   3592 C CA  . GLU A 1 463 ? 15.195  86.221 55.705 1.00   29.99 ? 463 GLU A CA  1 
ATOM   3593 C C   . GLU A 1 463 ? 15.971  85.718 54.530 1.00   29.23 ? 463 GLU A C   1 
ATOM   3594 O O   . GLU A 1 463 ? 15.412  85.097 53.634 1.00   28.59 ? 463 GLU A O   1 
ATOM   3595 C CB  . GLU A 1 463 ? 15.042  87.728 55.549 1.00   32.58 ? 463 GLU A CB  1 
ATOM   3596 C CG  . GLU A 1 463 ? 13.835  88.081 54.682 1.00   37.08 ? 463 GLU A CG  1 
ATOM   3597 C CD  . GLU A 1 463 ? 13.894  89.467 54.088 1.00   39.67 ? 463 GLU A CD  1 
ATOM   3598 O OE1 . GLU A 1 463 ? 14.002  90.460 54.850 1.00   42.30 ? 463 GLU A OE1 1 
ATOM   3599 O OE2 . GLU A 1 463 ? 13.835  89.568 52.838 1.00   42.60 ? 463 GLU A OE2 1 
ATOM   3600 N N   . ALA A 1 464 ? 17.274  85.972 54.555 1.00   27.92 ? 464 ALA A N   1 
ATOM   3601 C CA  . ALA A 1 464 ? 18.146  85.535 53.483 1.00   27.11 ? 464 ALA A CA  1 
ATOM   3602 C C   . ALA A 1 464 ? 17.864  84.082 53.291 1.00   26.37 ? 464 ALA A C   1 
ATOM   3603 O O   . ALA A 1 464 ? 17.267  83.700 52.312 1.00   29.68 ? 464 ALA A O   1 
ATOM   3604 C CB  . ALA A 1 464 ? 19.602  85.715 53.865 1.00   27.74 ? 464 ALA A CB  1 
ATOM   3605 N N   . LEU A 1 465 ? 18.162  83.291 54.306 1.00   24.77 ? 465 LEU A N   1 
ATOM   3606 C CA  . LEU A 1 465 ? 17.964  81.853 54.236 1.00   22.69 ? 465 LEU A CA  1 
ATOM   3607 C C   . LEU A 1 465 ? 16.605  81.418 53.717 1.00   21.55 ? 465 LEU A C   1 
ATOM   3608 O O   . LEU A 1 465 ? 16.503  80.406 53.033 1.00   21.27 ? 465 LEU A O   1 
ATOM   3609 C CB  . LEU A 1 465 ? 18.220  81.231 55.596 1.00   22.24 ? 465 LEU A CB  1 
ATOM   3610 C CG  . LEU A 1 465 ? 18.020  79.736 55.691 1.00   21.78 ? 465 LEU A CG  1 
ATOM   3611 C CD1 . LEU A 1 465 ? 18.949  79.035 54.743 1.00   20.65 ? 465 LEU A CD1 1 
ATOM   3612 C CD2 . LEU A 1 465 ? 18.255  79.312 57.117 1.00   22.47 ? 465 LEU A CD2 1 
ATOM   3613 N N   . SER A 1 466 ? 15.554  82.148 54.037 1.00   20.94 ? 466 SER A N   1 
ATOM   3614 C CA  . SER A 1 466 ? 14.269  81.708 53.553 1.00   22.26 ? 466 SER A CA  1 
ATOM   3615 C C   . SER A 1 466 ? 14.310  81.783 52.045 1.00   23.88 ? 466 SER A C   1 
ATOM   3616 O O   . SER A 1 466 ? 14.162  80.773 51.354 1.00   26.43 ? 466 SER A O   1 
ATOM   3617 C CB  . SER A 1 466 ? 13.145  82.587 54.061 1.00   21.46 ? 466 SER A CB  1 
ATOM   3618 O OG  . SER A 1 466 ? 11.894  81.953 53.836 1.00   22.91 ? 466 SER A OG  1 
ATOM   3619 N N   . ARG A 1 467 ? 14.560  82.981 51.535 1.00   23.94 ? 467 ARG A N   1 
ATOM   3620 C CA  . ARG A 1 467 ? 14.610  83.219 50.109 1.00   23.62 ? 467 ARG A CA  1 
ATOM   3621 C C   . ARG A 1 467 ? 15.439  82.178 49.381 1.00   23.39 ? 467 ARG A C   1 
ATOM   3622 O O   . ARG A 1 467 ? 15.006  81.688 48.356 1.00   24.18 ? 467 ARG A O   1 
ATOM   3623 C CB  . ARG A 1 467 ? 15.084  84.636 49.844 1.00   23.42 ? 467 ARG A CB  1 
ATOM   3624 C CG  . ARG A 1 467 ? 14.027  85.683 50.225 1.00   21.54 ? 467 ARG A CG  1 
ATOM   3625 C CD  . ARG A 1 467 ? 14.565  87.090 50.037 1.00   24.94 ? 467 ARG A CD  1 
ATOM   3626 N NE  . ARG A 1 467 ? 13.555  88.127 50.278 1.00   26.70 ? 467 ARG A NE  1 
ATOM   3627 C CZ  . ARG A 1 467 ? 12.524  88.356 49.477 1.00   26.89 ? 467 ARG A CZ  1 
ATOM   3628 N NH1 . ARG A 1 467 ? 12.374  87.617 48.386 1.00   31.69 ? 467 ARG A NH1 1 
ATOM   3629 N NH2 . ARG A 1 467 ? 11.637  89.299 49.765 1.00   27.54 ? 467 ARG A NH2 1 
ATOM   3630 N N   . ARG A 1 468 ? 16.573  81.771 49.940 1.00   23.78 ? 468 ARG A N   1 
ATOM   3631 C CA  . ARG A 1 468 ? 17.395  80.737 49.311 1.00   24.48 ? 468 ARG A CA  1 
ATOM   3632 C C   . ARG A 1 468 ? 16.645  79.457 49.286 1.00   25.65 ? 468 ARG A C   1 
ATOM   3633 O O   . ARG A 1 468 ? 16.724  78.731 48.308 1.00   29.24 ? 468 ARG A O   1 
ATOM   3634 C CB  . ARG A 1 468 ? 18.662  80.438 50.081 1.00   23.32 ? 468 ARG A CB  1 
ATOM   3635 C CG  . ARG A 1 468 ? 19.774  81.364 49.791 1.00   29.25 ? 468 ARG A CG  1 
ATOM   3636 C CD  . ARG A 1 468 ? 20.928  81.104 50.729 1.00   32.26 ? 468 ARG A CD  1 
ATOM   3637 N NE  . ARG A 1 468 ? 21.331  79.703 50.741 1.00   35.31 ? 468 ARG A NE  1 
ATOM   3638 C CZ  . ARG A 1 468 ? 21.886  79.119 51.801 1.00   37.79 ? 468 ARG A CZ  1 
ATOM   3639 N NH1 . ARG A 1 468 ? 22.054  79.843 52.918 1.00   38.07 ? 468 ARG A NH1 1 
ATOM   3640 N NH2 . ARG A 1 468 ? 22.396  77.875 51.711 1.00   37.36 ? 468 ARG A NH2 1 
ATOM   3641 N N   . ILE A 1 469 ? 15.984  79.114 50.386 1.00   25.29 ? 469 ILE A N   1 
ATOM   3642 C CA  . ILE A 1 469 ? 15.260  77.861 50.421 1.00   23.46 ? 469 ILE A CA  1 
ATOM   3643 C C   . ILE A 1 469 ? 14.084  77.894 49.462 1.00   23.74 ? 469 ILE A C   1 
ATOM   3644 O O   . ILE A 1 469 ? 13.877  76.938 48.722 1.00   24.50 ? 469 ILE A O   1 
ATOM   3645 C CB  . ILE A 1 469 ? 14.850  77.439 51.857 1.00   23.14 ? 469 ILE A CB  1 
ATOM   3646 C CG1 . ILE A 1 469 ? 16.102  77.158 52.700 1.00   23.05 ? 469 ILE A CG1 1 
ATOM   3647 C CG2 . ILE A 1 469 ? 14.076  76.144 51.825 1.00   19.24 ? 469 ILE A CG2 1 
ATOM   3648 C CD1 . ILE A 1 469 ? 15.789  76.658 54.081 1.00   22.27 ? 469 ILE A CD1 1 
ATOM   3649 N N   . MET A 1 470 ? 13.348  78.994 49.402 1.00   23.53 ? 470 MET A N   1 
ATOM   3650 C CA  . MET A 1 470 ? 12.228  79.055 48.469 1.00   23.71 ? 470 MET A CA  1 
ATOM   3651 C C   . MET A 1 470 ? 12.748  78.946 47.042 1.00   25.36 ? 470 MET A C   1 
ATOM   3652 O O   . MET A 1 470 ? 12.103  78.338 46.178 1.00   25.28 ? 470 MET A O   1 
ATOM   3653 C CB  . MET A 1 470 ? 11.451  80.351 48.618 1.00   21.98 ? 470 MET A CB  1 
ATOM   3654 C CG  . MET A 1 470 ? 10.866  80.512 49.980 1.00   22.21 ? 470 MET A CG  1 
ATOM   3655 S SD  . MET A 1 470 ? 9.662   81.788 50.023 1.00   21.13 ? 470 MET A SD  1 
ATOM   3656 C CE  . MET A 1 470 ? 10.662  83.148 49.683 1.00   23.14 ? 470 MET A CE  1 
ATOM   3657 N N   . HIS A 1 471 ? 13.930  79.500 46.786 1.00   26.29 ? 471 HIS A N   1 
ATOM   3658 C CA  . HIS A 1 471 ? 14.481  79.432 45.440 1.00   27.13 ? 471 HIS A CA  1 
ATOM   3659 C C   . HIS A 1 471 ? 14.930  78.023 45.136 1.00   27.55 ? 471 HIS A C   1 
ATOM   3660 O O   . HIS A 1 471 ? 14.614  77.509 44.084 1.00   29.86 ? 471 HIS A O   1 
ATOM   3661 C CB  . HIS A 1 471 ? 15.625  80.406 45.243 1.00   29.09 ? 471 HIS A CB  1 
ATOM   3662 C CG  . HIS A 1 471 ? 15.804  80.828 43.814 1.00   30.88 ? 471 HIS A CG  1 
ATOM   3663 N ND1 . HIS A 1 471 ? 14.805  81.455 43.095 1.00   30.51 ? 471 HIS A ND1 1 
ATOM   3664 C CD2 . HIS A 1 471 ? 16.852  80.685 42.962 1.00   29.06 ? 471 HIS A CD2 1 
ATOM   3665 C CE1 . HIS A 1 471 ? 15.229  81.670 41.861 1.00   32.12 ? 471 HIS A CE1 1 
ATOM   3666 N NE2 . HIS A 1 471 ? 16.466  81.210 41.754 1.00   30.65 ? 471 HIS A NE2 1 
ATOM   3667 N N   . TYR A 1 472 ? 15.654  77.386 46.047 1.00   26.96 ? 472 TYR A N   1 
ATOM   3668 C CA  . TYR A 1 472 ? 16.084  76.006 45.851 1.00   25.14 ? 472 TYR A CA  1 
ATOM   3669 C C   . TYR A 1 472 ? 14.858  75.144 45.532 1.00   24.53 ? 472 TYR A C   1 
ATOM   3670 O O   . TYR A 1 472 ? 14.853  74.366 44.574 1.00   25.03 ? 472 TYR A O   1 
ATOM   3671 C CB  . TYR A 1 472 ? 16.746  75.472 47.135 1.00   27.89 ? 472 TYR A CB  1 
ATOM   3672 C CG  . TYR A 1 472 ? 18.183  75.903 47.323 1.00   29.22 ? 472 TYR A CG  1 
ATOM   3673 C CD1 . TYR A 1 472 ? 19.001  76.120 46.221 1.00   28.97 ? 472 TYR A CD1 1 
ATOM   3674 C CD2 . TYR A 1 472 ? 18.737  76.033 48.584 1.00   28.43 ? 472 TYR A CD2 1 
ATOM   3675 C CE1 . TYR A 1 472 ? 20.318  76.440 46.354 1.00   28.38 ? 472 TYR A CE1 1 
ATOM   3676 C CE2 . TYR A 1 472 ? 20.074  76.357 48.732 1.00   30.27 ? 472 TYR A CE2 1 
ATOM   3677 C CZ  . TYR A 1 472 ? 20.859  76.554 47.598 1.00   30.74 ? 472 TYR A CZ  1 
ATOM   3678 O OH  . TYR A 1 472 ? 22.212  76.839 47.688 1.00   34.61 ? 472 TYR A OH  1 
ATOM   3679 N N   . TRP A 1 473 ? 13.820  75.285 46.345 1.00   21.94 ? 473 TRP A N   1 
ATOM   3680 C CA  . TRP A 1 473 ? 12.609  74.514 46.167 1.00   20.79 ? 473 TRP A CA  1 
ATOM   3681 C C   . TRP A 1 473 ? 11.892  74.807 44.846 1.00   20.58 ? 473 TRP A C   1 
ATOM   3682 O O   . TRP A 1 473 ? 11.518  73.877 44.148 1.00   20.97 ? 473 TRP A O   1 
ATOM   3683 C CB  . TRP A 1 473 ? 11.648  74.717 47.358 1.00   18.55 ? 473 TRP A CB  1 
ATOM   3684 C CG  . TRP A 1 473 ? 11.799  73.726 48.523 1.00   16.83 ? 473 TRP A CG  1 
ATOM   3685 C CD1 . TRP A 1 473 ? 10.794  73.071 49.168 1.00   16.07 ? 473 TRP A CD1 1 
ATOM   3686 C CD2 . TRP A 1 473 ? 13.003  73.379 49.213 1.00   14.57 ? 473 TRP A CD2 1 
ATOM   3687 N NE1 . TRP A 1 473 ? 11.295  72.351 50.218 1.00   17.19 ? 473 TRP A NE1 1 
ATOM   3688 C CE2 . TRP A 1 473 ? 12.649  72.532 50.269 1.00   14.31 ? 473 TRP A CE2 1 
ATOM   3689 C CE3 . TRP A 1 473 ? 14.344  73.713 49.041 1.00   15.83 ? 473 TRP A CE3 1 
ATOM   3690 C CZ2 . TRP A 1 473 ? 13.574  72.024 51.147 1.00   14.29 ? 473 TRP A CZ2 1 
ATOM   3691 C CZ3 . TRP A 1 473 ? 15.262  73.206 49.908 1.00   17.21 ? 473 TRP A CZ3 1 
ATOM   3692 C CH2 . TRP A 1 473 ? 14.875  72.369 50.954 1.00   16.07 ? 473 TRP A CH2 1 
ATOM   3693 N N   . ALA A 1 474 ? 11.667  76.085 44.540 1.00   19.54 ? 474 ALA A N   1 
ATOM   3694 C CA  . ALA A 1 474 ? 10.981  76.501 43.323 1.00   16.84 ? 474 ALA A CA  1 
ATOM   3695 C C   . ALA A 1 474 ? 11.843  76.147 42.146 1.00   17.14 ? 474 ALA A C   1 
ATOM   3696 O O   . ALA A 1 474 ? 11.409  75.414 41.272 1.00   18.35 ? 474 ALA A O   1 
ATOM   3697 C CB  . ALA A 1 474 ? 10.746  77.930 43.348 1.00   15.16 ? 474 ALA A CB  1 
ATOM   3698 N N   . THR A 1 475 ? 13.090  76.596 42.146 1.00   15.90 ? 475 THR A N   1 
ATOM   3699 C CA  . THR A 1 475 ? 14.012  76.275 41.067 1.00   16.13 ? 475 THR A CA  1 
ATOM   3700 C C   . THR A 1 475 ? 14.180  74.764 40.866 1.00   18.87 ? 475 THR A C   1 
ATOM   3701 O O   . THR A 1 475 ? 14.585  74.331 39.793 1.00   22.95 ? 475 THR A O   1 
ATOM   3702 C CB  . THR A 1 475 ? 15.383  76.912 41.280 1.00   14.43 ? 475 THR A CB  1 
ATOM   3703 O OG1 . THR A 1 475 ? 15.245  78.333 41.277 1.00   15.89 ? 475 THR A OG1 1 
ATOM   3704 C CG2 . THR A 1 475 ? 16.317  76.537 40.186 1.00   11.57 ? 475 THR A CG2 1 
ATOM   3705 N N   . PHE A 1 476 ? 13.935  73.948 41.881 1.00   18.32 ? 476 PHE A N   1 
ATOM   3706 C CA  . PHE A 1 476 ? 14.054  72.503 41.692 1.00   16.19 ? 476 PHE A CA  1 
ATOM   3707 C C   . PHE A 1 476 ? 12.771  72.048 41.001 1.00   19.49 ? 476 PHE A C   1 
ATOM   3708 O O   . PHE A 1 476 ? 12.799  71.218 40.087 1.00   20.47 ? 476 PHE A O   1 
ATOM   3709 C CB  . PHE A 1 476 ? 14.203  71.770 43.039 1.00   12.59 ? 476 PHE A CB  1 
ATOM   3710 C CG  . PHE A 1 476 ? 14.050  70.268 42.949 1.00   7.24  ? 476 PHE A CG  1 
ATOM   3711 C CD1 . PHE A 1 476 ? 15.095  69.484 42.520 1.00   4.72  ? 476 PHE A CD1 1 
ATOM   3712 C CD2 . PHE A 1 476 ? 12.835  69.664 43.240 1.00   3.73  ? 476 PHE A CD2 1 
ATOM   3713 C CE1 . PHE A 1 476 ? 14.941  68.124 42.368 1.00   7.47  ? 476 PHE A CE1 1 
ATOM   3714 C CE2 . PHE A 1 476 ? 12.656  68.310 43.097 1.00   4.99  ? 476 PHE A CE2 1 
ATOM   3715 C CZ  . PHE A 1 476 ? 13.703  67.528 42.657 1.00   7.26  ? 476 PHE A CZ  1 
ATOM   3716 N N   . ALA A 1 477 ? 11.644  72.585 41.453 1.00   19.35 ? 477 ALA A N   1 
ATOM   3717 C CA  . ALA A 1 477 ? 10.356  72.226 40.909 1.00   21.35 ? 477 ALA A CA  1 
ATOM   3718 C C   . ALA A 1 477 ? 10.309  72.413 39.402 1.00   23.29 ? 477 ALA A C   1 
ATOM   3719 O O   . ALA A 1 477 ? 9.862   71.524 38.687 1.00   24.72 ? 477 ALA A O   1 
ATOM   3720 C CB  . ALA A 1 477 ? 9.275   73.058 41.552 1.00   19.01 ? 477 ALA A CB  1 
ATOM   3721 N N   . LYS A 1 478 ? 10.762  73.582 38.938 1.00   25.93 ? 478 LYS A N   1 
ATOM   3722 C CA  . LYS A 1 478 ? 10.745  73.958 37.524 1.00   27.06 ? 478 LYS A CA  1 
ATOM   3723 C C   . LYS A 1 478 ? 11.729  73.220 36.641 1.00   26.32 ? 478 LYS A C   1 
ATOM   3724 O O   . LYS A 1 478 ? 11.431  72.958 35.482 1.00   29.24 ? 478 LYS A O   1 
ATOM   3725 C CB  . LYS A 1 478 ? 11.086  75.440 37.329 1.00   27.94 ? 478 LYS A CB  1 
ATOM   3726 C CG  . LYS A 1 478 ? 10.395  76.477 38.207 1.00   30.74 ? 478 LYS A CG  1 
ATOM   3727 C CD  . LYS A 1 478 ? 10.965  77.893 37.880 1.00   33.12 ? 478 LYS A CD  1 
ATOM   3728 C CE  . LYS A 1 478 ? 10.709  78.937 38.986 1.00   33.78 ? 478 LYS A CE  1 
ATOM   3729 N NZ  . LYS A 1 478 ? 11.905  79.089 39.914 1.00   32.72 ? 478 LYS A NZ  1 
ATOM   3730 N N   . THR A 1 479 ? 12.892  72.880 37.175 1.00   23.95 ? 479 THR A N   1 
ATOM   3731 C CA  . THR A 1 479 ? 13.929  72.274 36.365 1.00   21.40 ? 479 THR A CA  1 
ATOM   3732 C C   . THR A 1 479 ? 14.505  70.945 36.771 1.00   21.30 ? 479 THR A C   1 
ATOM   3733 O O   . THR A 1 479 ? 15.298  70.376 36.033 1.00   22.25 ? 479 THR A O   1 
ATOM   3734 C CB  . THR A 1 479 ? 15.114  73.199 36.337 1.00   22.37 ? 479 THR A CB  1 
ATOM   3735 O OG1 . THR A 1 479 ? 15.811  73.056 37.573 1.00   23.42 ? 479 THR A OG1 1 
ATOM   3736 C CG2 . THR A 1 479 ? 14.659  74.656 36.217 1.00   19.86 ? 479 THR A CG2 1 
ATOM   3737 N N   . GLY A 1 480 ? 14.199  70.472 37.961 1.00   20.25 ? 480 GLY A N   1 
ATOM   3738 C CA  . GLY A 1 480 ? 14.780  69.218 38.389 1.00   18.37 ? 480 GLY A CA  1 
ATOM   3739 C C   . GLY A 1 480 ? 16.158  69.413 38.994 1.00   18.18 ? 480 GLY A C   1 
ATOM   3740 O O   . GLY A 1 480 ? 16.851  68.441 39.298 1.00   17.92 ? 480 GLY A O   1 
ATOM   3741 N N   . ASN A 1 481 ? 16.544  70.674 39.191 1.00   19.00 ? 481 ASN A N   1 
ATOM   3742 C CA  . ASN A 1 481 ? 17.833  71.036 39.788 1.00   20.17 ? 481 ASN A CA  1 
ATOM   3743 C C   . ASN A 1 481 ? 17.660  72.283 40.677 1.00   21.63 ? 481 ASN A C   1 
ATOM   3744 O O   . ASN A 1 481 ? 17.018  73.246 40.274 1.00   22.34 ? 481 ASN A O   1 
ATOM   3745 C CB  . ASN A 1 481 ? 18.833  71.312 38.689 1.00   20.22 ? 481 ASN A CB  1 
ATOM   3746 C CG  . ASN A 1 481 ? 20.163  71.706 39.218 1.00   20.91 ? 481 ASN A CG  1 
ATOM   3747 O OD1 . ASN A 1 481 ? 20.286  72.608 40.049 1.00   24.41 ? 481 ASN A OD1 1 
ATOM   3748 N ND2 . ASN A 1 481 ? 21.186  71.029 38.756 1.00   22.29 ? 481 ASN A ND2 1 
ATOM   3749 N N   . PRO A 1 482 ? 18.194  72.267 41.917 1.00   23.51 ? 482 PRO A N   1 
ATOM   3750 C CA  . PRO A 1 482 ? 18.045  73.425 42.800 1.00   23.27 ? 482 PRO A CA  1 
ATOM   3751 C C   . PRO A 1 482 ? 18.833  74.672 42.451 1.00   24.82 ? 482 PRO A C   1 
ATOM   3752 O O   . PRO A 1 482 ? 18.457  75.778 42.830 1.00   25.79 ? 482 PRO A O   1 
ATOM   3753 C CB  . PRO A 1 482 ? 18.464  72.857 44.145 1.00   21.22 ? 482 PRO A CB  1 
ATOM   3754 C CG  . PRO A 1 482 ? 19.459  71.867 43.786 1.00   20.63 ? 482 PRO A CG  1 
ATOM   3755 C CD  . PRO A 1 482 ? 18.798  71.154 42.669 1.00   21.86 ? 482 PRO A CD  1 
ATOM   3756 N N   . ASN A 1 483 ? 19.958  74.505 41.783 1.00   28.37 ? 483 ASN A N   1 
ATOM   3757 C CA  . ASN A 1 483 ? 20.811  75.637 41.415 1.00   31.35 ? 483 ASN A CA  1 
ATOM   3758 C C   . ASN A 1 483 ? 20.360  76.248 40.111 1.00   33.86 ? 483 ASN A C   1 
ATOM   3759 O O   . ASN A 1 483 ? 19.868  75.521 39.260 1.00   36.19 ? 483 ASN A O   1 
ATOM   3760 C CB  . ASN A 1 483 ? 22.199  75.117 41.194 1.00   30.59 ? 483 ASN A CB  1 
ATOM   3761 C CG  . ASN A 1 483 ? 22.621  74.186 42.269 1.00   31.45 ? 483 ASN A CG  1 
ATOM   3762 O OD1 . ASN A 1 483 ? 22.834  74.608 43.408 1.00   33.94 ? 483 ASN A OD1 1 
ATOM   3763 N ND2 . ASN A 1 483 ? 22.728  72.900 41.941 1.00   29.06 ? 483 ASN A ND2 1 
ATOM   3764 N N   . GLU A 1 484 ? 20.548  77.557 39.916 1.00   36.85 ? 484 GLU A N   1 
ATOM   3765 C CA  . GLU A 1 484 ? 20.167  78.192 38.636 1.00   40.18 ? 484 GLU A CA  1 
ATOM   3766 C C   . GLU A 1 484 ? 20.813  77.461 37.421 1.00   42.49 ? 484 GLU A C   1 
ATOM   3767 O O   . GLU A 1 484 ? 20.997  78.069 36.310 1.00   44.23 ? 484 GLU A O   1 
ATOM   3768 C CB  . GLU A 1 484 ? 20.615  79.652 38.621 1.00   40.74 ? 484 GLU A CB  1 
ATOM   3769 C CG  . GLU A 1 484 ? 20.050  80.499 39.729 1.00   41.66 ? 484 GLU A CG  1 
ATOM   3770 C CD  . GLU A 1 484 ? 18.647  80.934 39.435 1.00   42.13 ? 484 GLU A CD  1 
ATOM   3771 O OE1 . GLU A 1 484 ? 17.892  80.131 38.861 1.00   42.54 ? 484 GLU A OE1 1 
ATOM   3772 O OE2 . GLU A 1 484 ? 18.282  82.084 39.789 1.00   45.69 ? 484 GLU A OE2 1 
ATOM   3773 N N   . SER A 1 490 ? 28.569  77.786 44.461 1.00   43.89 ? 490 SER A N   1 
ATOM   3774 C CA  . SER A 1 490 ? 27.354  77.874 45.315 1.00   42.93 ? 490 SER A CA  1 
ATOM   3775 C C   . SER A 1 490 ? 26.523  76.669 44.961 1.00   40.56 ? 490 SER A C   1 
ATOM   3776 O O   . SER A 1 490 ? 25.330  76.612 45.257 1.00   42.34 ? 490 SER A O   1 
ATOM   3777 C CB  . SER A 1 490 ? 26.565  79.144 44.950 1.00   45.30 ? 490 SER A CB  1 
ATOM   3778 O OG  . SER A 1 490 ? 27.044  79.727 43.724 1.00   46.56 ? 490 SER A OG  1 
ATOM   3779 N N   . LYS A 1 491 ? 27.146  75.693 44.328 1.00   36.48 ? 491 LYS A N   1 
ATOM   3780 C CA  . LYS A 1 491 ? 26.393  74.544 43.910 1.00   33.97 ? 491 LYS A CA  1 
ATOM   3781 C C   . LYS A 1 491 ? 26.034  73.528 44.979 1.00   31.87 ? 491 LYS A C   1 
ATOM   3782 O O   . LYS A 1 491 ? 26.878  73.076 45.773 1.00   32.62 ? 491 LYS A O   1 
ATOM   3783 C CB  . LYS A 1 491 ? 27.120  73.865 42.755 1.00   35.82 ? 491 LYS A CB  1 
ATOM   3784 C CG  . LYS A 1 491 ? 27.300  74.811 41.545 1.00   38.70 ? 491 LYS A CG  1 
ATOM   3785 N N   . TRP A 1 492 ? 24.774  73.134 44.962 1.00   26.48 ? 492 TRP A N   1 
ATOM   3786 C CA  . TRP A 1 492 ? 24.309  72.133 45.862 1.00   22.74 ? 492 TRP A CA  1 
ATOM   3787 C C   . TRP A 1 492 ? 24.615  70.864 45.061 1.00   22.09 ? 492 TRP A C   1 
ATOM   3788 O O   . TRP A 1 492 ? 23.978  70.597 44.061 1.00   22.86 ? 492 TRP A O   1 
ATOM   3789 C CB  . TRP A 1 492 ? 22.820  72.366 46.063 1.00   20.18 ? 492 TRP A CB  1 
ATOM   3790 C CG  . TRP A 1 492 ? 22.096  71.326 46.823 1.00   18.33 ? 492 TRP A CG  1 
ATOM   3791 C CD1 . TRP A 1 492 ? 22.465  70.027 47.007 1.00   17.52 ? 492 TRP A CD1 1 
ATOM   3792 C CD2 . TRP A 1 492 ? 20.809  71.467 47.415 1.00   17.92 ? 492 TRP A CD2 1 
ATOM   3793 N NE1 . TRP A 1 492 ? 21.473  69.341 47.662 1.00   18.50 ? 492 TRP A NE1 1 
ATOM   3794 C CE2 . TRP A 1 492 ? 20.444  70.205 47.929 1.00   17.96 ? 492 TRP A CE2 1 
ATOM   3795 C CE3 . TRP A 1 492 ? 19.925  72.536 47.565 1.00   17.07 ? 492 TRP A CE3 1 
ATOM   3796 C CZ2 . TRP A 1 492 ? 19.235  69.988 48.582 1.00   17.49 ? 492 TRP A CZ2 1 
ATOM   3797 C CZ3 . TRP A 1 492 ? 18.721  72.316 48.217 1.00   18.00 ? 492 TRP A CZ3 1 
ATOM   3798 C CH2 . TRP A 1 492 ? 18.388  71.055 48.717 1.00   15.40 ? 492 TRP A CH2 1 
ATOM   3799 N N   . PRO A 1 493 ? 25.648  70.114 45.439 1.00   22.18 ? 493 PRO A N   1 
ATOM   3800 C CA  . PRO A 1 493 ? 26.034  68.887 44.752 1.00   22.30 ? 493 PRO A CA  1 
ATOM   3801 C C   . PRO A 1 493 ? 24.898  67.923 44.563 1.00   24.96 ? 493 PRO A C   1 
ATOM   3802 O O   . PRO A 1 493 ? 23.953  67.896 45.327 1.00   27.46 ? 493 PRO A O   1 
ATOM   3803 C CB  . PRO A 1 493 ? 27.045  68.270 45.703 1.00   20.53 ? 493 PRO A CB  1 
ATOM   3804 C CG  . PRO A 1 493 ? 27.715  69.406 46.231 1.00   23.64 ? 493 PRO A CG  1 
ATOM   3805 C CD  . PRO A 1 493 ? 26.574  70.376 46.544 1.00   23.96 ? 493 PRO A CD  1 
ATOM   3806 N N   . LEU A 1 494 ? 25.039  67.066 43.573 1.00   25.76 ? 494 LEU A N   1 
ATOM   3807 C CA  . LEU A 1 494 ? 24.048  66.064 43.293 1.00   24.86 ? 494 LEU A CA  1 
ATOM   3808 C C   . LEU A 1 494 ? 24.511  64.960 44.231 1.00   25.36 ? 494 LEU A C   1 
ATOM   3809 O O   . LEU A 1 494 ? 25.705  64.787 44.447 1.00   26.68 ? 494 LEU A O   1 
ATOM   3810 C CB  . LEU A 1 494 ? 24.210  65.651 41.839 1.00   24.26 ? 494 LEU A CB  1 
ATOM   3811 C CG  . LEU A 1 494 ? 23.198  64.787 41.128 1.00   24.31 ? 494 LEU A CG  1 
ATOM   3812 C CD1 . LEU A 1 494 ? 21.906  65.515 40.882 1.00   22.41 ? 494 LEU A CD1 1 
ATOM   3813 C CD2 . LEU A 1 494 ? 23.821  64.438 39.828 1.00   25.17 ? 494 LEU A CD2 1 
ATOM   3814 N N   . PHE A 1 495 ? 23.589  64.220 44.803 1.00   24.17 ? 495 PHE A N   1 
ATOM   3815 C CA  . PHE A 1 495 ? 23.964  63.178 45.717 1.00   22.99 ? 495 PHE A CA  1 
ATOM   3816 C C   . PHE A 1 495 ? 24.165  61.949 44.880 1.00   25.24 ? 495 PHE A C   1 
ATOM   3817 O O   . PHE A 1 495 ? 23.310  61.626 44.072 1.00   27.80 ? 495 PHE A O   1 
ATOM   3818 C CB  . PHE A 1 495 ? 22.826  62.967 46.750 1.00   21.35 ? 495 PHE A CB  1 
ATOM   3819 C CG  . PHE A 1 495 ? 22.949  61.708 47.561 1.00   19.68 ? 495 PHE A CG  1 
ATOM   3820 C CD1 . PHE A 1 495 ? 22.588  60.482 47.031 1.00   20.55 ? 495 PHE A CD1 1 
ATOM   3821 C CD2 . PHE A 1 495 ? 23.498  61.730 48.810 1.00   18.47 ? 495 PHE A CD2 1 
ATOM   3822 C CE1 . PHE A 1 495 ? 22.786  59.308 47.727 1.00   20.01 ? 495 PHE A CE1 1 
ATOM   3823 C CE2 . PHE A 1 495 ? 23.691  60.559 49.498 1.00   19.02 ? 495 PHE A CE2 1 
ATOM   3824 C CZ  . PHE A 1 495 ? 23.334  59.346 48.948 1.00   16.72 ? 495 PHE A CZ  1 
ATOM   3825 N N   . THR A 1 496 ? 25.283  61.255 45.065 1.00   26.70 ? 496 THR A N   1 
ATOM   3826 C CA  . THR A 1 496 ? 25.547  60.015 44.362 1.00   26.39 ? 496 THR A CA  1 
ATOM   3827 C C   . THR A 1 496 ? 25.901  58.945 45.402 1.00   28.09 ? 496 THR A C   1 
ATOM   3828 O O   . THR A 1 496 ? 26.422  59.247 46.480 1.00   27.18 ? 496 THR A O   1 
ATOM   3829 C CB  . THR A 1 496 ? 26.674  60.177 43.385 1.00   26.94 ? 496 THR A CB  1 
ATOM   3830 O OG1 . THR A 1 496 ? 27.818  60.716 44.058 1.00   28.99 ? 496 THR A OG1 1 
ATOM   3831 C CG2 . THR A 1 496 ? 26.269  61.148 42.316 1.00   27.61 ? 496 THR A CG2 1 
ATOM   3832 N N   . THR A 1 497 ? 25.597  57.690 45.103 1.00   29.49 ? 497 THR A N   1 
ATOM   3833 C CA  . THR A 1 497 ? 25.881  56.637 46.042 1.00   31.91 ? 497 THR A CA  1 
ATOM   3834 C C   . THR A 1 497 ? 27.366  56.605 46.306 1.00   32.85 ? 497 THR A C   1 
ATOM   3835 O O   . THR A 1 497 ? 27.815  56.311 47.406 1.00   35.13 ? 497 THR A O   1 
ATOM   3836 C CB  . THR A 1 497 ? 25.469  55.296 45.470 1.00   32.64 ? 497 THR A CB  1 
ATOM   3837 O OG1 . THR A 1 497 ? 26.039  55.165 44.172 1.00   32.82 ? 497 THR A OG1 1 
ATOM   3838 C CG2 . THR A 1 497 ? 23.960  55.206 45.357 1.00   31.17 ? 497 THR A CG2 1 
ATOM   3839 N N   . LYS A 1 498 ? 28.152  56.930 45.300 1.00   34.21 ? 498 LYS A N   1 
ATOM   3840 C CA  . LYS A 1 498 ? 29.593  56.885 45.500 1.00   35.36 ? 498 LYS A CA  1 
ATOM   3841 C C   . LYS A 1 498 ? 30.161  57.943 46.445 1.00   35.06 ? 498 LYS A C   1 
ATOM   3842 O O   . LYS A 1 498 ? 30.927  57.607 47.352 1.00   37.01 ? 498 LYS A O   1 
ATOM   3843 C CB  . LYS A 1 498 ? 30.330  56.922 44.148 1.00   35.98 ? 498 LYS A CB  1 
ATOM   3844 N N   . GLU A 1 499 ? 29.801  59.206 46.223 1.00   33.47 ? 499 GLU A N   1 
ATOM   3845 C CA  . GLU A 1 499 ? 30.317  60.328 47.009 1.00   32.40 ? 499 GLU A CA  1 
ATOM   3846 C C   . GLU A 1 499 ? 29.412  60.700 48.158 1.00   30.83 ? 499 GLU A C   1 
ATOM   3847 O O   . GLU A 1 499 ? 29.859  61.263 49.154 1.00   30.89 ? 499 GLU A O   1 
ATOM   3848 C CB  . GLU A 1 499 ? 30.494  61.561 46.119 1.00   35.00 ? 499 GLU A CB  1 
ATOM   3849 C CG  . GLU A 1 499 ? 31.607  61.456 45.066 1.00   37.54 ? 499 GLU A CG  1 
ATOM   3850 C CD  . GLU A 1 499 ? 33.001  61.493 45.686 1.00   40.94 ? 499 GLU A CD  1 
ATOM   3851 N N   . GLN A 1 500 ? 28.119  60.521 47.965 1.00   29.13 ? 500 GLN A N   1 
ATOM   3852 C CA  . GLN A 1 500 ? 27.155  60.809 49.022 1.00   28.16 ? 500 GLN A CA  1 
ATOM   3853 C C   . GLN A 1 500 ? 27.105  62.251 49.495 1.00   26.08 ? 500 GLN A C   1 
ATOM   3854 O O   . GLN A 1 500 ? 26.804  62.479 50.648 1.00   26.93 ? 500 GLN A O   1 
ATOM   3855 C CB  . GLN A 1 500 ? 27.465  59.957 50.239 1.00   28.06 ? 500 GLN A CB  1 
ATOM   3856 C CG  . GLN A 1 500 ? 27.639  58.510 49.961 1.00   31.69 ? 500 GLN A CG  1 
ATOM   3857 C CD  . GLN A 1 500 ? 26.460  57.724 50.415 1.00   35.19 ? 500 GLN A CD  1 
ATOM   3858 O OE1 . GLN A 1 500 ? 25.820  58.041 51.455 1.00   38.78 ? 500 GLN A OE1 1 
ATOM   3859 N NE2 . GLN A 1 500 ? 26.136  56.686 49.664 1.00   35.65 ? 500 GLN A NE2 1 
ATOM   3860 N N   . LYS A 1 501 ? 27.365  63.223 48.645 1.00   24.51 ? 501 LYS A N   1 
ATOM   3861 C CA  . LYS A 1 501 ? 27.335  64.605 49.098 1.00   23.61 ? 501 LYS A CA  1 
ATOM   3862 C C   . LYS A 1 501 ? 25.953  65.132 49.451 1.00   23.33 ? 501 LYS A C   1 
ATOM   3863 O O   . LYS A 1 501 ? 24.942  64.682 48.920 1.00   23.08 ? 501 LYS A O   1 
ATOM   3864 C CB  . LYS A 1 501 ? 27.940  65.532 48.041 1.00   24.74 ? 501 LYS A CB  1 
ATOM   3865 C CG  . LYS A 1 501 ? 29.392  65.249 47.676 1.00   25.96 ? 501 LYS A CG  1 
ATOM   3866 C CD  . LYS A 1 501 ? 29.894  66.397 46.853 1.00   30.13 ? 501 LYS A CD  1 
ATOM   3867 C CE  . LYS A 1 501 ? 31.383  66.312 46.603 1.00   34.91 ? 501 LYS A CE  1 
ATOM   3868 N NZ  . LYS A 1 501 ? 31.703  65.283 45.567 1.00   39.83 ? 501 LYS A NZ  1 
ATOM   3869 N N   . PHE A 1 502 ? 25.926  66.109 50.345 1.00   21.76 ? 502 PHE A N   1 
ATOM   3870 C CA  . PHE A 1 502 ? 24.707  66.772 50.755 1.00   21.27 ? 502 PHE A CA  1 
ATOM   3871 C C   . PHE A 1 502 ? 25.196  68.104 51.235 1.00   21.73 ? 502 PHE A C   1 
ATOM   3872 O O   . PHE A 1 502 ? 26.410  68.287 51.355 1.00   21.53 ? 502 PHE A O   1 
ATOM   3873 C CB  . PHE A 1 502 ? 24.007  66.016 51.894 1.00   22.12 ? 502 PHE A CB  1 
ATOM   3874 C CG  . PHE A 1 502 ? 24.740  66.044 53.212 1.00   20.33 ? 502 PHE A CG  1 
ATOM   3875 C CD1 . PHE A 1 502 ? 24.504  67.047 54.133 1.00   20.72 ? 502 PHE A CD1 1 
ATOM   3876 C CD2 . PHE A 1 502 ? 25.623  65.042 53.546 1.00   19.16 ? 502 PHE A CD2 1 
ATOM   3877 C CE1 . PHE A 1 502 ? 25.130  67.047 55.357 1.00   18.54 ? 502 PHE A CE1 1 
ATOM   3878 C CE2 . PHE A 1 502 ? 26.251  65.047 54.782 1.00   18.59 ? 502 PHE A CE2 1 
ATOM   3879 C CZ  . PHE A 1 502 ? 25.998  66.052 55.683 1.00   17.01 ? 502 PHE A CZ  1 
ATOM   3880 N N   . ILE A 1 503 ? 24.276  69.008 51.560 1.00   22.45 ? 503 ILE A N   1 
ATOM   3881 C CA  . ILE A 1 503 ? 24.641  70.344 52.054 1.00   24.22 ? 503 ILE A CA  1 
ATOM   3882 C C   . ILE A 1 503 ? 23.895  70.747 53.321 1.00   24.21 ? 503 ILE A C   1 
ATOM   3883 O O   . ILE A 1 503 ? 22.786  70.268 53.580 1.00   23.45 ? 503 ILE A O   1 
ATOM   3884 C CB  . ILE A 1 503 ? 24.276  71.449 51.061 1.00   23.45 ? 503 ILE A CB  1 
ATOM   3885 C CG1 . ILE A 1 503 ? 22.800  71.356 50.718 1.00   22.65 ? 503 ILE A CG1 1 
ATOM   3886 C CG2 . ILE A 1 503 ? 25.115  71.354 49.810 1.00   26.64 ? 503 ILE A CG2 1 
ATOM   3887 C CD1 . ILE A 1 503 ? 22.219  72.647 50.223 1.00   22.29 ? 503 ILE A CD1 1 
ATOM   3888 N N   . ASP A 1 504 ? 24.498  71.667 54.074 1.00   25.88 ? 504 ASP A N   1 
ATOM   3889 C CA  . ASP A 1 504 ? 23.895  72.212 55.272 1.00   25.33 ? 504 ASP A CA  1 
ATOM   3890 C C   . ASP A 1 504 ? 22.996  73.285 54.731 1.00   26.01 ? 504 ASP A C   1 
ATOM   3891 O O   . ASP A 1 504 ? 23.350  73.982 53.784 1.00   25.93 ? 504 ASP A O   1 
ATOM   3892 C CB  . ASP A 1 504 ? 24.889  72.980 56.100 1.00   27.16 ? 504 ASP A CB  1 
ATOM   3893 C CG  . ASP A 1 504 ? 26.114  72.227 56.378 1.00   31.73 ? 504 ASP A CG  1 
ATOM   3894 O OD1 . ASP A 1 504 ? 25.999  71.092 56.887 1.00   32.46 ? 504 ASP A OD1 1 
ATOM   3895 O OD2 . ASP A 1 504 ? 27.206  72.797 56.118 1.00   35.59 ? 504 ASP A OD2 1 
ATOM   3896 N N   . LEU A 1 505 ? 21.943  73.572 55.467 1.00   26.72 ? 505 LEU A N   1 
ATOM   3897 C CA  . LEU A 1 505 ? 21.018  74.590 55.051 1.00   26.82 ? 505 LEU A CA  1 
ATOM   3898 C C   . LEU A 1 505 ? 20.807  75.486 56.274 1.00   27.86 ? 505 LEU A C   1 
ATOM   3899 O O   . LEU A 1 505 ? 19.881  75.272 57.051 1.00   29.55 ? 505 LEU A O   1 
ATOM   3900 C CB  . LEU A 1 505 ? 19.725  73.910 54.634 1.00   23.82 ? 505 LEU A CB  1 
ATOM   3901 C CG  . LEU A 1 505 ? 18.876  74.480 53.529 1.00   23.12 ? 505 LEU A CG  1 
ATOM   3902 C CD1 . LEU A 1 505 ? 19.702  74.681 52.278 1.00   20.90 ? 505 LEU A CD1 1 
ATOM   3903 C CD2 . LEU A 1 505 ? 17.773  73.478 53.305 1.00   21.99 ? 505 LEU A CD2 1 
ATOM   3904 N N   . ASN A 1 506 ? 21.683  76.465 56.473 1.00   28.23 ? 506 ASN A N   1 
ATOM   3905 C CA  . ASN A 1 506 ? 21.546  77.371 57.602 1.00   29.10 ? 506 ASN A CA  1 
ATOM   3906 C C   . ASN A 1 506 ? 22.094  78.707 57.163 1.00   30.45 ? 506 ASN A C   1 
ATOM   3907 O O   . ASN A 1 506 ? 22.813  78.775 56.175 1.00   32.15 ? 506 ASN A O   1 
ATOM   3908 C CB  . ASN A 1 506 ? 22.362  76.863 58.759 1.00   28.38 ? 506 ASN A CB  1 
ATOM   3909 C CG  . ASN A 1 506 ? 23.776  76.687 58.389 1.00   27.70 ? 506 ASN A CG  1 
ATOM   3910 O OD1 . ASN A 1 506 ? 24.304  77.467 57.600 1.00   27.86 ? 506 ASN A OD1 1 
ATOM   3911 N ND2 . ASN A 1 506 ? 24.414  75.649 58.916 1.00   28.34 ? 506 ASN A ND2 1 
ATOM   3912 N N   . THR A 1 507 ? 21.906  79.730 57.980 1.00   30.95 ? 507 THR A N   1 
ATOM   3913 C CA  . THR A 1 507 ? 22.326  81.076 57.639 1.00   31.83 ? 507 THR A CA  1 
ATOM   3914 C C   . THR A 1 507 ? 23.818  81.317 57.431 1.00   33.49 ? 507 THR A C   1 
ATOM   3915 O O   . THR A 1 507 ? 24.241  82.457 57.233 1.00   33.71 ? 507 THR A O   1 
ATOM   3916 C CB  . THR A 1 507 ? 21.817  82.021 58.678 1.00   31.27 ? 507 THR A CB  1 
ATOM   3917 O OG1 . THR A 1 507 ? 22.318  81.597 59.946 1.00   34.60 ? 507 THR A OG1 1 
ATOM   3918 C CG2 . THR A 1 507 ? 20.289  81.964 58.749 1.00   31.34 ? 507 THR A CG2 1 
ATOM   3919 N N   . GLU A 1 508 ? 24.633  80.277 57.535 1.00   35.12 ? 508 GLU A N   1 
ATOM   3920 C CA  . GLU A 1 508 ? 26.060  80.454 57.316 1.00   36.69 ? 508 GLU A CA  1 
ATOM   3921 C C   . GLU A 1 508 ? 26.331  80.117 55.853 1.00   39.24 ? 508 GLU A C   1 
ATOM   3922 O O   . GLU A 1 508 ? 25.434  79.632 55.123 1.00   39.64 ? 508 GLU A O   1 
ATOM   3923 C CB  . GLU A 1 508 ? 26.871  79.526 58.229 1.00   37.34 ? 508 GLU A CB  1 
ATOM   3924 C CG  . GLU A 1 508 ? 26.861  79.927 59.729 1.00   37.38 ? 508 GLU A CG  1 
ATOM   3925 N N   . PRO A 1 509 ? 27.558  80.379 55.378 1.00   41.57 ? 509 PRO A N   1 
ATOM   3926 C CA  . PRO A 1 509 ? 27.843  80.066 53.974 1.00   42.46 ? 509 PRO A CA  1 
ATOM   3927 C C   . PRO A 1 509 ? 27.742  78.559 53.854 1.00   42.35 ? 509 PRO A C   1 
ATOM   3928 O O   . PRO A 1 509 ? 28.488  77.836 54.541 1.00   41.62 ? 509 PRO A O   1 
ATOM   3929 C CB  . PRO A 1 509 ? 29.300  80.528 53.811 1.00   43.01 ? 509 PRO A CB  1 
ATOM   3930 C CG  . PRO A 1 509 ? 29.425  81.634 54.831 1.00   43.57 ? 509 PRO A CG  1 
ATOM   3931 C CD  . PRO A 1 509 ? 28.719  81.015 56.022 1.00   42.86 ? 509 PRO A CD  1 
ATOM   3932 N N   . MET A 1 510 ? 26.825  78.085 53.009 1.00   42.48 ? 510 MET A N   1 
ATOM   3933 C CA  . MET A 1 510 ? 26.627  76.641 52.836 1.00   42.83 ? 510 MET A CA  1 
ATOM   3934 C C   . MET A 1 510 ? 27.949  75.915 52.709 1.00   40.80 ? 510 MET A C   1 
ATOM   3935 O O   . MET A 1 510 ? 28.963  76.511 52.330 1.00   41.60 ? 510 MET A O   1 
ATOM   3936 C CB  . MET A 1 510 ? 25.765  76.310 51.606 1.00   46.08 ? 510 MET A CB  1 
ATOM   3937 C CG  . MET A 1 510 ? 26.568  76.051 50.303 1.00   49.63 ? 510 MET A CG  1 
ATOM   3938 S SD  . MET A 1 510 ? 25.524  75.220 49.031 1.00   52.07 ? 510 MET A SD  1 
ATOM   3939 C CE  . MET A 1 510 ? 23.789  75.648 49.732 1.00   49.46 ? 510 MET A CE  1 
ATOM   3940 N N   . LYS A 1 511 ? 27.918  74.621 52.996 1.00   37.43 ? 511 LYS A N   1 
ATOM   3941 C CA  . LYS A 1 511 ? 29.100  73.806 52.923 1.00   34.31 ? 511 LYS A CA  1 
ATOM   3942 C C   . LYS A 1 511 ? 28.611  72.432 52.517 1.00   31.94 ? 511 LYS A C   1 
ATOM   3943 O O   . LYS A 1 511 ? 27.461  72.057 52.785 1.00   31.63 ? 511 LYS A O   1 
ATOM   3944 C CB  . LYS A 1 511 ? 29.799  73.785 54.279 1.00   34.90 ? 511 LYS A CB  1 
ATOM   3945 C CG  . LYS A 1 511 ? 31.056  72.925 54.302 1.00   37.05 ? 511 LYS A CG  1 
ATOM   3946 N N   . VAL A 1 512 ? 29.466  71.686 51.841 1.00   29.70 ? 512 VAL A N   1 
ATOM   3947 C CA  . VAL A 1 512 ? 29.085  70.374 51.365 1.00   28.15 ? 512 VAL A CA  1 
ATOM   3948 C C   . VAL A 1 512 ? 29.742  69.338 52.250 1.00   28.15 ? 512 VAL A C   1 
ATOM   3949 O O   . VAL A 1 512 ? 30.875  69.528 52.672 1.00   29.63 ? 512 VAL A O   1 
ATOM   3950 C CB  . VAL A 1 512 ? 29.566  70.199 49.895 1.00   25.79 ? 512 VAL A CB  1 
ATOM   3951 C CG1 . VAL A 1 512 ? 29.329  68.780 49.383 1.00   21.97 ? 512 VAL A CG1 1 
ATOM   3952 C CG2 . VAL A 1 512 ? 28.869  71.203 49.017 1.00   22.92 ? 512 VAL A CG2 1 
ATOM   3953 N N   . HIS A 1 513 ? 29.045  68.249 52.539 1.00   26.31 ? 513 HIS A N   1 
ATOM   3954 C CA  . HIS A 1 513 ? 29.600  67.190 53.355 1.00   25.59 ? 513 HIS A CA  1 
ATOM   3955 C C   . HIS A 1 513 ? 29.247  65.887 52.667 1.00   26.83 ? 513 HIS A C   1 
ATOM   3956 O O   . HIS A 1 513 ? 28.505  65.878 51.694 1.00   29.25 ? 513 HIS A O   1 
ATOM   3957 C CB  . HIS A 1 513 ? 28.950  67.172 54.726 1.00   24.41 ? 513 HIS A CB  1 
ATOM   3958 C CG  . HIS A 1 513 ? 28.962  68.482 55.421 1.00   22.84 ? 513 HIS A CG  1 
ATOM   3959 N ND1 . HIS A 1 513 ? 30.113  69.038 55.931 1.00   24.81 ? 513 HIS A ND1 1 
ATOM   3960 C CD2 . HIS A 1 513 ? 27.963  69.345 55.711 1.00   22.94 ? 513 HIS A CD2 1 
ATOM   3961 C CE1 . HIS A 1 513 ? 29.821  70.192 56.509 1.00   24.56 ? 513 HIS A CE1 1 
ATOM   3962 N NE2 . HIS A 1 513 ? 28.522  70.401 56.389 1.00   22.49 ? 513 HIS A NE2 1 
ATOM   3963 N N   . GLN A 1 514 ? 29.673  64.773 53.232 1.00   26.92 ? 514 GLN A N   1 
ATOM   3964 C CA  . GLN A 1 514 ? 29.359  63.499 52.633 1.00   27.64 ? 514 GLN A CA  1 
ATOM   3965 C C   . GLN A 1 514 ? 28.929  62.523 53.694 1.00   26.49 ? 514 GLN A C   1 
ATOM   3966 O O   . GLN A 1 514 ? 29.183  62.722 54.876 1.00   27.83 ? 514 GLN A O   1 
ATOM   3967 C CB  . GLN A 1 514 ? 30.600  62.950 51.967 1.00   29.34 ? 514 GLN A CB  1 
ATOM   3968 C CG  . GLN A 1 514 ? 31.170  63.911 50.945 1.00   34.74 ? 514 GLN A CG  1 
ATOM   3969 C CD  . GLN A 1 514 ? 32.413  63.378 50.284 1.00   35.62 ? 514 GLN A CD  1 
ATOM   3970 O OE1 . GLN A 1 514 ? 33.466  64.011 50.332 1.00   39.08 ? 514 GLN A OE1 1 
ATOM   3971 N NE2 . GLN A 1 514 ? 32.309  62.199 49.676 1.00   36.15 ? 514 GLN A NE2 1 
ATOM   3972 N N   . ARG A 1 515 ? 28.159  61.535 53.294 1.00   25.45 ? 515 ARG A N   1 
ATOM   3973 C CA  . ARG A 1 515 ? 27.797  60.510 54.229 1.00   25.18 ? 515 ARG A CA  1 
ATOM   3974 C C   . ARG A 1 515 ? 27.089  61.000 55.506 1.00   25.53 ? 515 ARG A C   1 
ATOM   3975 O O   . ARG A 1 515 ? 27.626  60.897 56.612 1.00   24.70 ? 515 ARG A O   1 
ATOM   3976 C CB  . ARG A 1 515 ? 29.088  59.769 54.554 1.00   23.44 ? 515 ARG A CB  1 
ATOM   3977 C CG  . ARG A 1 515 ? 29.685  59.112 53.329 1.00   23.15 ? 515 ARG A CG  1 
ATOM   3978 C CD  . ARG A 1 515 ? 30.898  58.294 53.649 1.00   24.78 ? 515 ARG A CD  1 
ATOM   3979 N NE  . ARG A 1 515 ? 31.248  57.372 52.572 1.00   26.12 ? 515 ARG A NE  1 
ATOM   3980 N N   . LEU A 1 516 ? 25.866  61.491 55.348 1.00   25.54 ? 516 LEU A N   1 
ATOM   3981 C CA  . LEU A 1 516 ? 25.063  61.972 56.468 1.00   24.35 ? 516 LEU A CA  1 
ATOM   3982 C C   . LEU A 1 516 ? 24.877  60.807 57.434 1.00   25.30 ? 516 LEU A C   1 
ATOM   3983 O O   . LEU A 1 516 ? 24.391  59.748 57.035 1.00   26.41 ? 516 LEU A O   1 
ATOM   3984 C CB  . LEU A 1 516 ? 23.710  62.440 55.953 1.00   22.75 ? 516 LEU A CB  1 
ATOM   3985 C CG  . LEU A 1 516 ? 22.695  63.061 56.893 1.00   22.56 ? 516 LEU A CG  1 
ATOM   3986 C CD1 . LEU A 1 516 ? 23.368  64.000 57.825 1.00   22.64 ? 516 LEU A CD1 1 
ATOM   3987 C CD2 . LEU A 1 516 ? 21.648  63.815 56.077 1.00   23.31 ? 516 LEU A CD2 1 
ATOM   3988 N N   . ARG A 1 517 ? 25.393  60.968 58.654 1.00   23.88 ? 517 ARG A N   1 
ATOM   3989 C CA  . ARG A 1 517 ? 25.299  59.970 59.717 1.00   21.44 ? 517 ARG A CA  1 
ATOM   3990 C C   . ARG A 1 517 ? 25.492  58.542 59.281 1.00   21.69 ? 517 ARG A C   1 
ATOM   3991 O O   . ARG A 1 517 ? 24.635  57.692 59.544 1.00   23.89 ? 517 ARG A O   1 
ATOM   3992 C CB  . ARG A 1 517 ? 23.988  60.143 60.493 1.00   20.98 ? 517 ARG A CB  1 
ATOM   3993 C CG  . ARG A 1 517 ? 23.920  61.550 61.115 1.00   24.85 ? 517 ARG A CG  1 
ATOM   3994 C CD  . ARG A 1 517 ? 22.739  61.793 61.953 1.00   26.44 ? 517 ARG A CD  1 
ATOM   3995 N NE  . ARG A 1 517 ? 22.867  61.025 63.165 1.00   29.89 ? 517 ARG A NE  1 
ATOM   3996 C CZ  . ARG A 1 517 ? 23.544  61.441 64.232 1.00   31.80 ? 517 ARG A CZ  1 
ATOM   3997 N NH1 . ARG A 1 517 ? 24.144  62.636 64.209 1.00   32.53 ? 517 ARG A NH1 1 
ATOM   3998 N NH2 . ARG A 1 517 ? 23.642  60.660 65.308 1.00   30.37 ? 517 ARG A NH2 1 
ATOM   3999 N N   . VAL A 1 518 ? 26.658  58.238 58.714 1.00   20.75 ? 518 VAL A N   1 
ATOM   4000 C CA  . VAL A 1 518 ? 26.908  56.876 58.240 1.00   20.56 ? 518 VAL A CA  1 
ATOM   4001 C C   . VAL A 1 518 ? 27.061  55.892 59.356 1.00   21.75 ? 518 VAL A C   1 
ATOM   4002 O O   . VAL A 1 518 ? 26.473  54.820 59.313 1.00   24.03 ? 518 VAL A O   1 
ATOM   4003 C CB  . VAL A 1 518 ? 28.189  56.723 57.447 1.00   20.34 ? 518 VAL A CB  1 
ATOM   4004 C CG1 . VAL A 1 518 ? 27.956  55.786 56.302 1.00   17.64 ? 518 VAL A CG1 1 
ATOM   4005 C CG2 . VAL A 1 518 ? 28.735  58.041 57.047 1.00   19.75 ? 518 VAL A CG2 1 
ATOM   4006 N N   . GLN A 1 519 ? 27.932  56.223 60.307 1.00   22.39 ? 519 GLN A N   1 
ATOM   4007 C CA  . GLN A 1 519 ? 28.216  55.368 61.462 1.00   21.98 ? 519 GLN A CA  1 
ATOM   4008 C C   . GLN A 1 519 ? 26.908  54.851 61.976 1.00   20.03 ? 519 GLN A C   1 
ATOM   4009 O O   . GLN A 1 519 ? 26.591  53.682 61.803 1.00   20.04 ? 519 GLN A O   1 
ATOM   4010 C CB  . GLN A 1 519 ? 28.915  56.168 62.560 1.00   25.18 ? 519 GLN A CB  1 
ATOM   4011 C CG  . GLN A 1 519 ? 29.797  55.336 63.467 1.00   29.48 ? 519 GLN A CG  1 
ATOM   4012 C CD  . GLN A 1 519 ? 31.044  54.858 62.741 1.00   34.66 ? 519 GLN A CD  1 
ATOM   4013 O OE1 . GLN A 1 519 ? 31.744  55.656 62.074 1.00   35.55 ? 519 GLN A OE1 1 
ATOM   4014 N NE2 . GLN A 1 519 ? 31.322  53.552 62.831 1.00   35.13 ? 519 GLN A NE2 1 
ATOM   4015 N N   . MET A 1 520 ? 26.081  55.772 62.437 1.00   18.02 ? 520 MET A N   1 
ATOM   4016 C CA  . MET A 1 520 ? 24.789  55.425 62.971 1.00   19.23 ? 520 MET A CA  1 
ATOM   4017 C C   . MET A 1 520 ? 23.880  54.690 62.004 1.00   20.23 ? 520 MET A C   1 
ATOM   4018 O O   . MET A 1 520 ? 23.370  53.620 62.338 1.00   21.93 ? 520 MET A O   1 
ATOM   4019 C CB  . MET A 1 520 ? 24.106  56.658 63.546 1.00   18.81 ? 520 MET A CB  1 
ATOM   4020 C CG  . MET A 1 520 ? 24.891  57.298 64.679 1.00   24.74 ? 520 MET A CG  1 
ATOM   4021 S SD  . MET A 1 520 ? 25.151  56.126 66.102 1.00   30.34 ? 520 MET A SD  1 
ATOM   4022 C CE  . MET A 1 520 ? 26.855  55.550 65.832 1.00   24.30 ? 520 MET A CE  1 
ATOM   4023 N N   . CYS A 1 521 ? 23.702  55.198 60.787 1.00   19.88 ? 521 CYS A N   1 
ATOM   4024 C CA  . CYS A 1 521 ? 22.803  54.520 59.871 1.00   17.92 ? 521 CYS A CA  1 
ATOM   4025 C C   . CYS A 1 521 ? 23.242  53.129 59.443 1.00   17.33 ? 521 CYS A C   1 
ATOM   4026 O O   . CYS A 1 521 ? 22.413  52.299 59.093 1.00   16.29 ? 521 CYS A O   1 
ATOM   4027 C CB  . CYS A 1 521 ? 22.434  55.413 58.710 1.00   19.45 ? 521 CYS A CB  1 
ATOM   4028 S SG  . CYS A 1 521 ? 21.658  56.952 59.288 1.00   19.77 ? 521 CYS A SG  1 
ATOM   4029 N N   . VAL A 1 522 ? 24.526  52.823 59.510 1.00   17.19 ? 522 VAL A N   1 
ATOM   4030 C CA  . VAL A 1 522 ? 24.903  51.464 59.178 1.00   17.86 ? 522 VAL A CA  1 
ATOM   4031 C C   . VAL A 1 522 ? 24.334  50.630 60.321 1.00   19.23 ? 522 VAL A C   1 
ATOM   4032 O O   . VAL A 1 522 ? 23.840  49.526 60.093 1.00   21.81 ? 522 VAL A O   1 
ATOM   4033 C CB  . VAL A 1 522 ? 26.413  51.242 59.124 1.00   18.71 ? 522 VAL A CB  1 
ATOM   4034 C CG1 . VAL A 1 522 ? 26.700  49.762 59.089 1.00   19.66 ? 522 VAL A CG1 1 
ATOM   4035 C CG2 . VAL A 1 522 ? 27.005  51.892 57.885 1.00   18.44 ? 522 VAL A CG2 1 
ATOM   4036 N N   . PHE A 1 523 ? 24.391  51.171 61.543 1.00   18.27 ? 523 PHE A N   1 
ATOM   4037 C CA  . PHE A 1 523 ? 23.877  50.515 62.729 1.00   15.25 ? 523 PHE A CA  1 
ATOM   4038 C C   . PHE A 1 523 ? 22.400  50.227 62.594 1.00   14.66 ? 523 PHE A C   1 
ATOM   4039 O O   . PHE A 1 523 ? 21.964  49.099 62.749 1.00   14.40 ? 523 PHE A O   1 
ATOM   4040 C CB  . PHE A 1 523 ? 24.131  51.375 63.981 1.00   15.15 ? 523 PHE A CB  1 
ATOM   4041 C CG  . PHE A 1 523 ? 23.362  50.924 65.187 1.00   11.39 ? 523 PHE A CG  1 
ATOM   4042 C CD1 . PHE A 1 523 ? 23.665  49.733 65.814 1.00   12.81 ? 523 PHE A CD1 1 
ATOM   4043 C CD2 . PHE A 1 523 ? 22.256  51.616 65.608 1.00   11.04 ? 523 PHE A CD2 1 
ATOM   4044 C CE1 . PHE A 1 523 ? 22.872  49.242 66.817 1.00   10.16 ? 523 PHE A CE1 1 
ATOM   4045 C CE2 . PHE A 1 523 ? 21.468  51.117 66.609 1.00   12.42 ? 523 PHE A CE2 1 
ATOM   4046 C CZ  . PHE A 1 523 ? 21.779  49.929 67.207 1.00   10.78 ? 523 PHE A CZ  1 
ATOM   4047 N N   . TRP A 1 524 ? 21.614  51.252 62.336 1.00   15.57 ? 524 TRP A N   1 
ATOM   4048 C CA  . TRP A 1 524 ? 20.168  51.067 62.205 1.00   17.71 ? 524 TRP A CA  1 
ATOM   4049 C C   . TRP A 1 524 ? 19.709  50.383 60.931 1.00   19.48 ? 524 TRP A C   1 
ATOM   4050 O O   . TRP A 1 524 ? 18.776  49.580 60.961 1.00   23.08 ? 524 TRP A O   1 
ATOM   4051 C CB  . TRP A 1 524 ? 19.443  52.396 62.302 1.00   16.87 ? 524 TRP A CB  1 
ATOM   4052 C CG  . TRP A 1 524 ? 19.530  53.059 63.632 1.00   16.85 ? 524 TRP A CG  1 
ATOM   4053 C CD1 . TRP A 1 524 ? 20.301  54.117 63.952 1.00   15.69 ? 524 TRP A CD1 1 
ATOM   4054 C CD2 . TRP A 1 524 ? 18.748  52.759 64.795 1.00   16.61 ? 524 TRP A CD2 1 
ATOM   4055 N NE1 . TRP A 1 524 ? 20.045  54.514 65.237 1.00   18.97 ? 524 TRP A NE1 1 
ATOM   4056 C CE2 . TRP A 1 524 ? 19.091  53.691 65.776 1.00   18.65 ? 524 TRP A CE2 1 
ATOM   4057 C CE3 . TRP A 1 524 ? 17.781  51.792 65.092 1.00   18.22 ? 524 TRP A CE3 1 
ATOM   4058 C CZ2 . TRP A 1 524 ? 18.499  53.695 67.048 1.00   18.28 ? 524 TRP A CZ2 1 
ATOM   4059 C CZ3 . TRP A 1 524 ? 17.194  51.796 66.350 1.00   16.12 ? 524 TRP A CZ3 1 
ATOM   4060 C CH2 . TRP A 1 524 ? 17.555  52.740 67.308 1.00   16.75 ? 524 TRP A CH2 1 
ATOM   4061 N N   . ASN A 1 525 ? 20.326  50.702 59.803 1.00   18.65 ? 525 ASN A N   1 
ATOM   4062 C CA  . ASN A 1 525 ? 19.900  50.109 58.545 1.00   17.67 ? 525 ASN A CA  1 
ATOM   4063 C C   . ASN A 1 525 ? 20.487  48.765 58.241 1.00   17.02 ? 525 ASN A C   1 
ATOM   4064 O O   . ASN A 1 525 ? 19.851  47.947 57.629 1.00   17.14 ? 525 ASN A O   1 
ATOM   4065 C CB  . ASN A 1 525 ? 20.166  51.063 57.413 1.00   14.46 ? 525 ASN A CB  1 
ATOM   4066 C CG  . ASN A 1 525 ? 19.397  52.318 57.554 1.00   13.59 ? 525 ASN A CG  1 
ATOM   4067 O OD1 . ASN A 1 525 ? 18.316  52.318 58.102 1.00   16.75 ? 525 ASN A OD1 1 
ATOM   4068 N ND2 . ASN A 1 525 ? 19.936  53.403 57.058 1.00   13.44 ? 525 ASN A ND2 1 
ATOM   4069 N N   . GLN A 1 526 ? 21.686  48.508 58.711 1.00   18.63 ? 526 GLN A N   1 
ATOM   4070 C CA  . GLN A 1 526 ? 22.303  47.226 58.450 1.00   20.93 ? 526 GLN A CA  1 
ATOM   4071 C C   . GLN A 1 526 ? 22.474  46.328 59.669 1.00   21.70 ? 526 GLN A C   1 
ATOM   4072 O O   . GLN A 1 526 ? 21.983  45.206 59.671 1.00   23.61 ? 526 GLN A O   1 
ATOM   4073 C CB  . GLN A 1 526 ? 23.655  47.418 57.764 1.00   23.57 ? 526 GLN A CB  1 
ATOM   4074 C CG  . GLN A 1 526 ? 23.589  48.109 56.394 1.00   26.35 ? 526 GLN A CG  1 
ATOM   4075 C CD  . GLN A 1 526 ? 24.975  48.448 55.859 1.00   28.13 ? 526 GLN A CD  1 
ATOM   4076 N N   . PHE A 1 527 ? 23.142  46.803 60.720 1.00   22.23 ? 527 PHE A N   1 
ATOM   4077 C CA  . PHE A 1 527 ? 23.378  45.956 61.904 1.00   20.90 ? 527 PHE A CA  1 
ATOM   4078 C C   . PHE A 1 527 ? 22.188  45.603 62.753 1.00   19.50 ? 527 PHE A C   1 
ATOM   4079 O O   . PHE A 1 527 ? 21.928  44.430 62.984 1.00   18.26 ? 527 PHE A O   1 
ATOM   4080 C CB  . PHE A 1 527 ? 24.441  46.535 62.824 1.00   21.86 ? 527 PHE A CB  1 
ATOM   4081 C CG  . PHE A 1 527 ? 24.803  45.625 63.965 1.00   21.50 ? 527 PHE A CG  1 
ATOM   4082 C CD1 . PHE A 1 527 ? 25.527  44.476 63.736 1.00   20.91 ? 527 PHE A CD1 1 
ATOM   4083 C CD2 . PHE A 1 527 ? 24.418  45.923 65.260 1.00   20.96 ? 527 PHE A CD2 1 
ATOM   4084 C CE1 . PHE A 1 527 ? 25.867  43.632 64.772 1.00   21.26 ? 527 PHE A CE1 1 
ATOM   4085 C CE2 . PHE A 1 527 ? 24.749  45.094 66.295 1.00   21.01 ? 527 PHE A CE2 1 
ATOM   4086 C CZ  . PHE A 1 527 ? 25.480  43.938 66.054 1.00   20.87 ? 527 PHE A CZ  1 
ATOM   4087 N N   . LEU A 1 528 ? 21.462  46.601 63.226 1.00   18.32 ? 528 LEU A N   1 
ATOM   4088 C CA  . LEU A 1 528 ? 20.336  46.310 64.078 1.00   19.12 ? 528 LEU A CA  1 
ATOM   4089 C C   . LEU A 1 528 ? 19.392  45.259 63.514 1.00   19.88 ? 528 LEU A C   1 
ATOM   4090 O O   . LEU A 1 528 ? 19.270  44.196 64.107 1.00   23.78 ? 528 LEU A O   1 
ATOM   4091 C CB  . LEU A 1 528 ? 19.612  47.575 64.526 1.00   20.30 ? 528 LEU A CB  1 
ATOM   4092 C CG  . LEU A 1 528 ? 18.561  47.397 65.635 1.00   20.25 ? 528 LEU A CG  1 
ATOM   4093 C CD1 . LEU A 1 528 ? 19.144  46.671 66.823 1.00   21.65 ? 528 LEU A CD1 1 
ATOM   4094 C CD2 . LEU A 1 528 ? 18.050  48.743 66.052 1.00   19.28 ? 528 LEU A CD2 1 
ATOM   4095 N N   . PRO A 1 529 ? 18.792  45.479 62.332 1.00   19.29 ? 529 PRO A N   1 
ATOM   4096 C CA  . PRO A 1 529 ? 17.877  44.489 61.764 1.00   18.17 ? 529 PRO A CA  1 
ATOM   4097 C C   . PRO A 1 529 ? 18.512  43.121 61.641 1.00   18.27 ? 529 PRO A C   1 
ATOM   4098 O O   . PRO A 1 529 ? 17.845  42.108 61.734 1.00   20.90 ? 529 PRO A O   1 
ATOM   4099 C CB  . PRO A 1 529 ? 17.587  45.062 60.389 1.00   16.25 ? 529 PRO A CB  1 
ATOM   4100 C CG  . PRO A 1 529 ? 17.679  46.498 60.590 1.00   18.21 ? 529 PRO A CG  1 
ATOM   4101 C CD  . PRO A 1 529 ? 18.914  46.627 61.419 1.00   18.87 ? 529 PRO A CD  1 
ATOM   4102 N N   . LYS A 1 530 ? 19.805  43.078 61.423 1.00   19.84 ? 530 LYS A N   1 
ATOM   4103 C CA  . LYS A 1 530 ? 20.450  41.796 61.306 1.00   22.97 ? 530 LYS A CA  1 
ATOM   4104 C C   . LYS A 1 530 ? 20.470  41.172 62.683 1.00   23.56 ? 530 LYS A C   1 
ATOM   4105 O O   . LYS A 1 530 ? 20.172  39.997 62.864 1.00   23.30 ? 530 LYS A O   1 
ATOM   4106 C CB  . LYS A 1 530 ? 21.870  41.947 60.772 1.00   25.92 ? 530 LYS A CB  1 
ATOM   4107 C CG  . LYS A 1 530 ? 22.456  40.613 60.386 1.00   30.34 ? 530 LYS A CG  1 
ATOM   4108 C CD  . LYS A 1 530 ? 23.834  40.709 59.715 1.00   35.37 ? 530 LYS A CD  1 
ATOM   4109 C CE  . LYS A 1 530 ? 24.269  39.266 59.283 1.00   38.49 ? 530 LYS A CE  1 
ATOM   4110 N NZ  . LYS A 1 530 ? 25.681  39.124 58.756 1.00   40.12 ? 530 LYS A NZ  1 
ATOM   4111 N N   . LEU A 1 531 ? 20.772  41.987 63.676 1.00   25.29 ? 531 LEU A N   1 
ATOM   4112 C CA  . LEU A 1 531 ? 20.821  41.526 65.057 1.00   25.53 ? 531 LEU A CA  1 
ATOM   4113 C C   . LEU A 1 531 ? 19.475  40.973 65.459 1.00   24.74 ? 531 LEU A C   1 
ATOM   4114 O O   . LEU A 1 531 ? 19.356  39.797 65.817 1.00   23.97 ? 531 LEU A O   1 
ATOM   4115 C CB  . LEU A 1 531 ? 21.194  42.700 65.976 1.00   26.79 ? 531 LEU A CB  1 
ATOM   4116 C CG  . LEU A 1 531 ? 21.189  42.485 67.484 1.00   25.85 ? 531 LEU A CG  1 
ATOM   4117 C CD1 . LEU A 1 531 ? 21.854  41.199 67.780 1.00   26.90 ? 531 LEU A CD1 1 
ATOM   4118 C CD2 . LEU A 1 531 ? 21.955  43.576 68.142 1.00   26.53 ? 531 LEU A CD2 1 
ATOM   4119 N N   . LEU A 1 532 ? 18.451  41.812 65.340 1.00   24.97 ? 532 LEU A N   1 
ATOM   4120 C CA  . LEU A 1 532 ? 17.101  41.429 65.737 1.00   24.68 ? 532 LEU A CA  1 
ATOM   4121 C C   . LEU A 1 532 ? 16.547  40.275 64.962 1.00   27.55 ? 532 LEU A C   1 
ATOM   4122 O O   . LEU A 1 532 ? 15.462  39.816 65.285 1.00   21.51 ? 532 LEU A O   1 
ATOM   4123 C CB  . LEU A 1 532 ? 16.112  42.582 65.607 1.00   22.96 ? 532 LEU A CB  1 
ATOM   4124 C CG  . LEU A 1 532 ? 16.228  43.882 66.380 1.00   23.00 ? 532 LEU A CG  1 
ATOM   4125 C CD1 . LEU A 1 532 ? 15.032  44.754 66.042 1.00   21.10 ? 532 LEU A CD1 1 
ATOM   4126 C CD2 . LEU A 1 532 ? 16.255  43.593 67.825 1.00   19.61 ? 532 LEU A CD2 1 
ATOM   4127 N N   . ASN A 1 533 ? 17.145  39.942 63.826 1.00   30.44 ? 533 ASN A N   1 
ATOM   4128 C CA  . ASN A 1 533 ? 16.637  38.805 63.064 1.00   32.24 ? 533 ASN A CA  1 
ATOM   4129 C C   . ASN A 1 533 ? 17.328  37.560 63.590 1.00   32.39 ? 533 ASN A C   1 
ATOM   4130 O O   . ASN A 1 533 ? 16.724  36.508 63.691 1.00   32.83 ? 533 ASN A O   1 
ATOM   4131 C CB  . ASN A 1 533 ? 16.902  38.969 61.559 1.00   32.97 ? 533 ASN A CB  1 
ATOM   4132 N N   . ALA A 1 534 ? 18.607  37.675 63.904 1.00   33.11 ? 534 ALA A N   1 
ATOM   4133 C CA  . ALA A 1 534 ? 19.325  36.535 64.419 1.00   35.69 ? 534 ALA A CA  1 
ATOM   4134 C C   . ALA A 1 534 ? 18.674  36.082 65.705 1.00   37.86 ? 534 ALA A C   1 
ATOM   4135 O O   . ALA A 1 534 ? 18.205  34.956 65.812 1.00   40.42 ? 534 ALA A O   1 
ATOM   4136 C CB  . ALA A 1 534 ? 20.769  36.889 64.684 1.00   34.36 ? 534 ALA A CB  1 
ATOM   4137 N N   . THR A 1 535 ? 18.592  36.979 66.672 1.00   40.25 ? 535 THR A N   1 
ATOM   4138 C CA  . THR A 1 535 ? 18.040  36.618 67.972 1.00   40.80 ? 535 THR A CA  1 
ATOM   4139 C C   . THR A 1 535 ? 16.539  36.349 67.891 1.00   41.51 ? 535 THR A C   1 
ATOM   4140 O O   . THR A 1 535 ? 15.832  37.297 67.469 1.00   43.96 ? 535 THR A O   1 
ATOM   4141 C CB  . THR A 1 535 ? 18.354  37.723 69.003 1.00   39.97 ? 535 THR A CB  1 
ATOM   4142 O OG1 . THR A 1 535 ? 17.663  38.913 68.639 1.00   40.19 ? 535 THR A OG1 1 
ATOM   4143 C CG2 . THR A 1 535 ? 19.843  38.067 68.954 1.00   39.84 ? 535 THR A CG2 1 
HETATM 4144 N N1  . ACH B 2 .   ? 4.905   68.061 63.935 0.0000 0.00  ? 998 ACH A N1  1 
HETATM 4145 C C2  . ACH B 2 .   ? 5.498   66.718 63.565 0.0000 0.00  ? 998 ACH A C2  1 
HETATM 4146 C C3  . ACH B 2 .   ? 5.190   66.026 62.222 0.0000 0.00  ? 998 ACH A C3  1 
HETATM 4147 O O4  . ACH B 2 .   ? 5.604   64.649 62.291 0.0000 0.00  ? 998 ACH A O4  1 
HETATM 4148 C C5  . ACH B 2 .   ? 5.643   63.664 61.249 0.0000 0.00  ? 998 ACH A C5  1 
HETATM 4149 O O7  . ACH B 2 .   ? 4.451   63.645 60.536 0.0000 0.00  ? 998 ACH A O7  1 
HETATM 4150 C C6  . ACH B 2 .   ? 5.831   62.330 61.978 0.0000 0.00  ? 998 ACH A C6  1 
HETATM 4151 C C8  . ACH B 2 .   ? 5.356   68.407 65.328 0.0000 0.00  ? 998 ACH A C8  1 
HETATM 4152 C C9  . ACH B 2 .   ? 5.386   69.159 63.039 0.0000 0.00  ? 998 ACH A C9  1 
HETATM 4153 C C10 . ACH B 2 .   ? 3.399   68.007 63.905 0.0000 0.00  ? 998 ACH A C10 1 
HETATM 4154 O O   . HOH C 3 .   ? -6.392  49.806 60.925 1.00   14.42 ? 601 HOH A O   1 
HETATM 4155 O O   . HOH C 3 .   ? 10.576  55.848 68.221 1.00   10.07 ? 602 HOH A O   1 
HETATM 4156 O O   . HOH C 3 .   ? 0.233   67.584 63.976 1.00   27.16 ? 603 HOH A O   1 
HETATM 4157 O O   . HOH C 3 .   ? -13.349 58.233 56.373 1.00   10.38 ? 604 HOH A O   1 
HETATM 4158 O O   . HOH C 3 .   ? -5.400  81.068 32.091 1.00   37.42 ? 605 HOH A O   1 
HETATM 4159 O O   . HOH C 3 .   ? -9.574  62.497 59.199 1.00   14.14 ? 606 HOH A O   1 
HETATM 4160 O O   . HOH C 3 .   ? -13.411 62.530 56.666 1.00   24.79 ? 607 HOH A O   1 
HETATM 4161 O O   . HOH C 3 .   ? 0.361   69.609 59.530 1.00   12.40 ? 608 HOH A O   1 
HETATM 4162 O O   . HOH C 3 .   ? -7.193  70.573 56.020 1.00   15.11 ? 609 HOH A O   1 
HETATM 4163 O O   . HOH C 3 .   ? 2.684   54.081 63.361 1.00   18.35 ? 610 HOH A O   1 
HETATM 4164 O O   . HOH C 3 .   ? -8.930  58.684 64.387 1.00   17.52 ? 611 HOH A O   1 
HETATM 4165 O O   . HOH C 3 .   ? -1.763  58.256 62.198 1.00   17.08 ? 612 HOH A O   1 
HETATM 4166 O O   . HOH C 3 .   ? -1.562  70.101 52.607 1.00   16.84 ? 613 HOH A O   1 
HETATM 4167 O O   . HOH C 3 .   ? -3.704  51.086 59.690 1.00   21.60 ? 614 HOH A O   1 
HETATM 4168 O O   . HOH C 3 .   ? 3.884   69.138 57.717 1.00   12.05 ? 615 HOH A O   1 
HETATM 4169 O O   . HOH C 3 .   ? 14.256  51.411 56.427 1.00   29.72 ? 616 HOH A O   1 
HETATM 4170 O O   . HOH C 3 .   ? 23.229  66.491 47.910 1.00   21.35 ? 617 HOH A O   1 
HETATM 4171 O O   . HOH C 3 .   ? -1.808  68.459 66.870 1.00   23.65 ? 618 HOH A O   1 
HETATM 4172 O O   . HOH C 3 .   ? -15.421 68.259 49.228 1.00   21.95 ? 619 HOH A O   1 
HETATM 4173 O O   . HOH C 3 .   ? 5.126   56.269 35.685 1.00   23.08 ? 620 HOH A O   1 
HETATM 4174 O O   . HOH C 3 .   ? 9.106   51.482 36.963 1.00   33.39 ? 621 HOH A O   1 
HETATM 4175 O O   . HOH C 3 .   ? 6.595   52.373 56.284 1.00   23.88 ? 622 HOH A O   1 
HETATM 4176 O O   . HOH C 3 .   ? 12.057  67.383 66.917 1.00   16.16 ? 623 HOH A O   1 
HETATM 4177 O O   . HOH C 3 .   ? 13.660  68.750 56.899 1.00   23.31 ? 624 HOH A O   1 
HETATM 4178 O O   . HOH C 3 .   ? 6.227   61.172 71.783 1.00   20.39 ? 625 HOH A O   1 
HETATM 4179 O O   . HOH C 3 .   ? -4.434  52.451 55.964 1.00   17.45 ? 626 HOH A O   1 
HETATM 4180 O O   . HOH C 3 .   ? 12.880  83.453 47.247 1.00   18.46 ? 627 HOH A O   1 
HETATM 4181 O O   . HOH C 3 .   ? 1.129   65.057 70.052 1.00   45.70 ? 628 HOH A O   1 
HETATM 4182 O O   . HOH C 3 .   ? 15.300  52.666 61.579 1.00   30.68 ? 629 HOH A O   1 
HETATM 4183 O O   . HOH C 3 .   ? 8.937   55.950 35.664 1.00   30.86 ? 630 HOH A O   1 
HETATM 4184 O O   . HOH C 3 .   ? 7.178   46.898 53.688 1.00   23.03 ? 631 HOH A O   1 
HETATM 4185 O O   . HOH C 3 .   ? 4.036   56.219 77.731 1.00   21.30 ? 632 HOH A O   1 
HETATM 4186 O O   . HOH C 3 .   ? 2.898   66.606 65.077 1.00   27.38 ? 633 HOH A O   1 
HETATM 4187 O O   . HOH C 3 .   ? 2.199   54.764 36.450 1.00   23.88 ? 634 HOH A O   1 
HETATM 4188 O O   . HOH C 3 .   ? 4.213   80.600 51.165 1.00   25.92 ? 635 HOH A O   1 
HETATM 4189 O O   . HOH C 3 .   ? 21.076  51.647 53.144 1.00   40.79 ? 636 HOH A O   1 
HETATM 4190 O O   . HOH C 3 .   ? 7.843   63.937 78.635 1.00   21.50 ? 637 HOH A O   1 
HETATM 4191 O O   . HOH C 3 .   ? -1.100  51.330 42.294 1.00   25.57 ? 638 HOH A O   1 
HETATM 4192 O O   . HOH C 3 .   ? -3.182  46.657 72.451 1.00   32.18 ? 639 HOH A O   1 
HETATM 4193 O O   . HOH C 3 .   ? -7.178  68.432 57.564 1.00   19.65 ? 640 HOH A O   1 
HETATM 4194 O O   . HOH C 3 .   ? 25.193  61.094 52.564 1.00   22.45 ? 641 HOH A O   1 
HETATM 4195 O O   . HOH C 3 .   ? 4.912   59.857 69.933 1.00   15.69 ? 642 HOH A O   1 
HETATM 4196 O O   . HOH C 3 .   ? 15.656  62.601 84.343 1.00   41.18 ? 643 HOH A O   1 
HETATM 4197 O O   . HOH C 3 .   ? -1.583  64.628 29.716 1.00   45.48 ? 644 HOH A O   1 
HETATM 4198 O O   . HOH C 3 .   ? 11.662  64.132 35.399 1.00   32.69 ? 645 HOH A O   1 
HETATM 4199 O O   . HOH C 3 .   ? 13.962  85.743 46.842 1.00   20.37 ? 646 HOH A O   1 
HETATM 4200 O O   . HOH C 3 .   ? -6.664  61.908 64.738 1.00   19.80 ? 647 HOH A O   1 
HETATM 4201 O O   . HOH C 3 .   ? 6.128   48.379 55.572 1.00   46.77 ? 648 HOH A O   1 
HETATM 4202 O O   . HOH C 3 .   ? -7.790  71.725 52.556 1.00   24.23 ? 649 HOH A O   1 
HETATM 4203 O O   . HOH C 3 .   ? 26.278  59.149 77.299 1.00   32.68 ? 650 HOH A O   1 
HETATM 4204 O O   . HOH C 3 .   ? 20.309  62.277 33.603 1.00   43.24 ? 651 HOH A O   1 
HETATM 4205 O O   . HOH C 3 .   ? 21.267  62.012 36.617 1.00   28.62 ? 652 HOH A O   1 
HETATM 4206 O O   . HOH C 3 .   ? 21.643  66.736 70.012 1.00   38.51 ? 653 HOH A O   1 
HETATM 4207 O O   . HOH C 3 .   ? 21.495  65.370 63.745 1.00   31.13 ? 654 HOH A O   1 
HETATM 4208 O O   . HOH C 3 .   ? 14.987  65.097 83.741 1.00   33.28 ? 655 HOH A O   1 
HETATM 4209 O O   . HOH C 3 .   ? -17.923 69.292 49.060 1.00   29.40 ? 656 HOH A O   1 
HETATM 4210 O O   . HOH C 3 .   ? 18.560  67.527 72.584 1.00   28.14 ? 657 HOH A O   1 
HETATM 4211 O O   . HOH C 3 .   ? -8.730  64.290 29.981 1.00   34.43 ? 658 HOH A O   1 
HETATM 4212 O O   . HOH C 3 .   ? -20.311 60.272 59.117 1.00   26.93 ? 659 HOH A O   1 
HETATM 4213 O O   . HOH C 3 .   ? 23.818  77.461 54.182 1.00   34.31 ? 660 HOH A O   1 
HETATM 4214 O O   . HOH C 3 .   ? 10.254  80.469 64.923 1.00   26.62 ? 661 HOH A O   1 
HETATM 4215 O O   . HOH C 3 .   ? -4.428  56.520 39.065 1.00   30.45 ? 662 HOH A O   1 
HETATM 4216 O O   . HOH C 3 .   ? -15.321 74.828 50.359 1.00   44.43 ? 663 HOH A O   1 
HETATM 4217 O O   . HOH C 3 .   ? 19.449  63.292 64.871 1.00   28.82 ? 664 HOH A O   1 
HETATM 4218 O O   . HOH C 3 .   ? 12.475  67.566 83.079 1.00   29.68 ? 665 HOH A O   1 
HETATM 4219 O O   . HOH C 3 .   ? 27.343  63.047 45.518 1.00   31.50 ? 666 HOH A O   1 
HETATM 4220 O O   . HOH C 3 .   ? -9.967  65.824 69.331 1.00   31.09 ? 667 HOH A O   1 
HETATM 4221 O O   . HOH C 3 .   ? -10.721 82.519 55.359 1.00   42.67 ? 668 HOH A O   1 
HETATM 4222 O O   . HOH C 3 .   ? -21.772 69.387 43.408 1.00   43.17 ? 669 HOH A O   1 
HETATM 4223 O O   . HOH C 3 .   ? -15.548 61.035 48.379 1.00   23.40 ? 670 HOH A O   1 
HETATM 4224 O O   . HOH C 3 .   ? 24.687  66.031 84.391 1.00   53.40 ? 671 HOH A O   1 
HETATM 4225 O O   . HOH C 3 .   ? 0.911   83.884 56.657 1.00   40.59 ? 672 HOH A O   1 
HETATM 4226 O O   . HOH C 3 .   ? 17.095  63.587 66.618 1.00   34.72 ? 673 HOH A O   1 
HETATM 4227 O O   . HOH C 3 .   ? 11.742  47.651 73.703 1.00   34.41 ? 674 HOH A O   1 
HETATM 4228 O O   . HOH C 3 .   ? -6.077  44.989 57.419 1.00   31.59 ? 675 HOH A O   1 
HETATM 4229 O O   . HOH C 3 .   ? -4.680  70.851 33.850 1.00   27.78 ? 676 HOH A O   1 
HETATM 4230 O O   . HOH C 3 .   ? -17.670 84.773 50.326 1.00   35.09 ? 677 HOH A O   1 
HETATM 4231 O O   . HOH C 3 .   ? 4.558   68.563 61.924 1.00   27.55 ? 678 HOH A O   1 
HETATM 4232 O O   . HOH C 3 .   ? 4.710   68.554 64.715 1.00   33.76 ? 679 HOH A O   1 
HETATM 4233 O O   . HOH C 3 .   ? -0.785  63.696 58.786 1.00   15.58 ? 680 HOH A O   1 
HETATM 4234 O O   . HOH C 3 .   ? 10.830  68.491 59.150 1.00   14.99 ? 681 HOH A O   1 
HETATM 4235 O O   . HOH C 3 .   ? 4.490   63.918 61.103 1.00   24.20 ? 682 HOH A O   1 
HETATM 4236 O O   . HOH C 3 .   ? 26.890  63.422 59.569 1.00   37.33 ? 683 HOH A O   1 
HETATM 4237 O O   . HOH C 3 .   ? -12.105 63.353 58.955 1.00   26.21 ? 684 HOH A O   1 
HETATM 4238 O O   . HOH C 3 .   ? 3.107   51.622 64.219 1.00   23.93 ? 685 HOH A O   1 
HETATM 4239 O O   . HOH C 3 .   ? -3.724  57.549 63.538 1.00   30.42 ? 686 HOH A O   1 
HETATM 4240 O O   . HOH C 3 .   ? -8.792  61.053 63.693 1.00   22.22 ? 687 HOH A O   1 
HETATM 4241 O O   . HOH C 3 .   ? -14.891 60.218 56.774 1.00   25.75 ? 688 HOH A O   1 
HETATM 4242 O O   . HOH C 3 .   ? -9.486  70.486 54.462 1.00   22.53 ? 689 HOH A O   1 
HETATM 4243 O O   . HOH C 3 .   ? 6.593   58.182 35.212 1.00   40.66 ? 690 HOH A O   1 
HETATM 4244 O O   . HOH C 3 .   ? 20.877  71.481 71.095 1.00   46.61 ? 691 HOH A O   1 
HETATM 4245 O O   . HOH C 3 .   ? 13.524  64.106 86.281 1.00   47.88 ? 692 HOH A O   1 
HETATM 4246 O O   . HOH C 3 .   ? 18.149  59.856 41.570 1.00   24.54 ? 693 HOH A O   1 
HETATM 4247 O O   . HOH C 3 .   ? 7.870   75.732 60.789 1.00   23.05 ? 694 HOH A O   1 
HETATM 4248 O O   . HOH C 3 .   ? 17.609  50.659 44.541 1.00   14.03 ? 695 HOH A O   1 
HETATM 4249 O O   . HOH C 3 .   ? 1.000   70.688 68.275 1.00   23.34 ? 696 HOH A O   1 
HETATM 4250 O O   . HOH C 3 .   ? -3.998  83.606 51.888 1.00   27.26 ? 697 HOH A O   1 
HETATM 4251 O O   . HOH C 3 .   ? -10.026 52.500 54.989 1.00   23.37 ? 698 HOH A O   1 
HETATM 4252 O O   . HOH C 3 .   ? -7.598  69.610 29.284 1.00   35.84 ? 699 HOH A O   1 
HETATM 4253 O O   . HOH C 3 .   ? 15.412  77.386 76.594 1.00   39.00 ? 700 HOH A O   1 
HETATM 4254 O O   . HOH C 3 .   ? 25.859  65.200 61.529 1.00   38.46 ? 701 HOH A O   1 
HETATM 4255 O O   . HOH C 3 .   ? 28.531  59.176 61.357 1.00   36.20 ? 702 HOH A O   1 
HETATM 4256 O O   . HOH C 3 .   ? -14.781 66.951 39.592 1.00   44.64 ? 703 HOH A O   1 
HETATM 4257 O O   . HOH C 3 .   ? -2.252  57.875 66.427 1.00   22.18 ? 704 HOH A O   1 
HETATM 4258 O O   . HOH C 3 .   ? 12.023  55.845 83.801 1.00   31.63 ? 705 HOH A O   1 
HETATM 4259 O O   . HOH C 3 .   ? 0.852   77.416 61.708 1.00   23.38 ? 706 HOH A O   1 
HETATM 4260 O O   . HOH C 3 .   ? -2.522  76.499 64.230 1.00   33.28 ? 707 HOH A O   1 
HETATM 4261 O O   . HOH C 3 .   ? 16.290  68.328 84.443 1.00   39.76 ? 708 HOH A O   1 
HETATM 4262 O O   . HOH C 3 .   ? -3.728  85.757 39.376 1.00   22.62 ? 709 HOH A O   1 
HETATM 4263 O O   . HOH C 3 .   ? -1.923  75.595 52.522 1.00   23.51 ? 710 HOH A O   1 
HETATM 4264 O O   . HOH C 3 .   ? 22.822  77.209 43.582 1.00   27.54 ? 711 HOH A O   1 
HETATM 4265 O O   . HOH C 3 .   ? 3.196   82.904 32.576 1.00   35.77 ? 712 HOH A O   1 
HETATM 4266 O O   . HOH C 3 .   ? -16.283 55.446 47.944 1.00   39.11 ? 713 HOH A O   1 
HETATM 4267 O O   . HOH C 3 .   ? 8.320   49.493 65.451 1.00   54.34 ? 714 HOH A O   1 
HETATM 4268 O O   . HOH C 3 .   ? 18.233  89.956 54.220 1.00   35.55 ? 715 HOH A O   1 
HETATM 4269 O O   . HOH C 3 .   ? 5.318   54.698 80.217 1.00   33.77 ? 716 HOH A O   1 
HETATM 4270 O O   . HOH C 3 .   ? 24.255  57.106 55.167 1.00   40.48 ? 717 HOH A O   1 
HETATM 4271 O O   . HOH C 3 .   ? -6.781  65.670 31.789 1.00   42.97 ? 718 HOH A O   1 
HETATM 4272 O O   . HOH C 3 .   ? -0.785  65.193 72.585 1.00   35.27 ? 719 HOH A O   1 
HETATM 4273 O O   . HOH C 3 .   ? 2.070   41.760 61.762 1.00   38.42 ? 720 HOH A O   1 
HETATM 4274 O O   . HOH C 3 .   ? 9.924   46.311 53.777 1.00   38.05 ? 721 HOH A O   1 
HETATM 4275 O O   . HOH C 3 .   ? 20.167  84.341 62.552 1.00   38.53 ? 722 HOH A O   1 
HETATM 4276 O O   . HOH C 3 .   ? -24.925 45.329 60.483 1.00   40.88 ? 723 HOH A O   1 
HETATM 4277 O O   . HOH C 3 .   ? -20.762 57.946 59.825 1.00   25.40 ? 724 HOH A O   1 
HETATM 4278 O O   . HOH C 3 .   ? -3.581  69.999 62.372 1.00   21.35 ? 725 HOH A O   1 
HETATM 4279 O O   . HOH C 3 .   ? 3.109   46.316 61.257 1.00   32.23 ? 726 HOH A O   1 
HETATM 4280 O O   . HOH C 3 .   ? -0.385  69.677 62.191 1.00   21.70 ? 727 HOH A O   1 
HETATM 4281 O O   . HOH C 3 .   ? -6.762  56.009 40.585 1.00   32.63 ? 728 HOH A O   1 
HETATM 4282 O O   . HOH C 3 .   ? 7.770   53.559 35.796 1.00   34.65 ? 729 HOH A O   1 
HETATM 4283 O O   . HOH C 3 .   ? -15.324 66.966 51.544 1.00   29.62 ? 730 HOH A O   1 
HETATM 4284 O O   . HOH C 3 .   ? -9.758  56.394 44.406 1.00   29.99 ? 731 HOH A O   1 
HETATM 4285 O O   . HOH C 3 .   ? 29.192  50.563 68.350 0.50   17.77 ? 732 HOH A O   1 
HETATM 4286 O O   . HOH C 3 .   ? 26.753  67.568 59.691 1.00   43.65 ? 733 HOH A O   1 
HETATM 4287 O O   . HOH C 3 .   ? 14.418  76.341 63.197 1.00   30.40 ? 734 HOH A O   1 
HETATM 4288 O O   . HOH C 3 .   ? -3.236  66.927 27.353 1.00   23.74 ? 735 HOH A O   1 
HETATM 4289 O O   . HOH C 3 .   ? -19.587 78.473 47.276 1.00   34.41 ? 736 HOH A O   1 
HETATM 4290 O O   . HOH C 3 .   ? -2.854  77.477 31.235 1.00   35.31 ? 737 HOH A O   1 
HETATM 4291 O O   . HOH C 3 .   ? -8.122  58.303 44.490 1.00   25.51 ? 738 HOH A O   1 
HETATM 4292 O O   . HOH C 3 .   ? -3.332  52.030 43.342 1.00   27.73 ? 739 HOH A O   1 
HETATM 4293 O O   . HOH C 3 .   ? 7.699   49.523 37.089 1.00   41.79 ? 740 HOH A O   1 
HETATM 4294 O O   . HOH C 3 .   ? -2.565  74.795 81.105 1.00   40.07 ? 741 HOH A O   1 
HETATM 4295 O O   . HOH C 3 .   ? 3.964   64.285 64.869 1.00   36.54 ? 742 HOH A O   1 
HETATM 4296 O O   . HOH C 3 .   ? 11.778  50.561 58.802 1.00   40.30 ? 743 HOH A O   1 
HETATM 4297 O O   . HOH C 3 .   ? 14.856  49.147 63.003 1.00   47.83 ? 744 HOH A O   1 
HETATM 4298 O O   . HOH C 3 .   ? 8.305   49.792 74.609 1.00   27.55 ? 745 HOH A O   1 
HETATM 4299 O O   . HOH C 3 .   ? 30.545  52.319 69.611 1.00   51.08 ? 746 HOH A O   1 
HETATM 4300 O O   . HOH C 3 .   ? 12.653  58.658 87.346 1.00   34.90 ? 747 HOH A O   1 
HETATM 4301 O O   . HOH C 3 .   ? -20.065 69.764 51.020 1.00   52.05 ? 748 HOH A O   1 
HETATM 4302 O O   . HOH C 3 .   ? 0.130   66.312 67.778 1.00   36.92 ? 749 HOH A O   1 
HETATM 4303 O O   . HOH C 3 .   ? 28.823  55.972 85.746 1.00   52.84 ? 750 HOH A O   1 
HETATM 4304 O O   . HOH C 3 .   ? -3.393  86.321 53.487 1.00   39.66 ? 751 HOH A O   1 
HETATM 4305 O O   . HOH C 3 .   ? 13.542  49.924 54.211 1.00   40.21 ? 752 HOH A O   1 
HETATM 4306 O O   . HOH C 3 .   ? 24.882  63.054 70.421 1.00   55.48 ? 753 HOH A O   1 
HETATM 4307 O O   . HOH C 3 .   ? 22.499  79.246 61.236 1.00   35.74 ? 754 HOH A O   1 
HETATM 4308 O O   . HOH C 3 .   ? 3.284   57.433 70.058 1.00   29.53 ? 755 HOH A O   1 
HETATM 4309 O O   . HOH C 3 .   ? 9.338   88.367 48.013 1.00   36.72 ? 756 HOH A O   1 
HETATM 4310 O O   . HOH C 3 .   ? 7.869   75.716 34.319 1.00   46.17 ? 757 HOH A O   1 
HETATM 4311 O O   . HOH C 3 .   ? 4.670   50.925 61.844 1.00   34.42 ? 758 HOH A O   1 
HETATM 4312 O O   . HOH C 3 .   ? -8.570  73.213 67.286 1.00   44.72 ? 759 HOH A O   1 
HETATM 4313 O O   . HOH C 3 .   ? 15.248  52.182 83.388 1.00   35.69 ? 760 HOH A O   1 
HETATM 4314 O O   . HOH C 3 .   ? -10.459 83.352 34.007 1.00   36.86 ? 761 HOH A O   1 
HETATM 4315 O O   . HOH C 3 .   ? -8.053  47.630 72.754 1.00   37.45 ? 762 HOH A O   1 
HETATM 4316 O O   . HOH C 3 .   ? -6.294  58.648 39.960 1.00   33.55 ? 763 HOH A O   1 
HETATM 4317 O O   . HOH C 3 .   ? 20.638  69.046 70.654 1.00   32.98 ? 764 HOH A O   1 
HETATM 4318 O O   . HOH C 3 .   ? -7.907  79.876 32.221 1.00   31.09 ? 765 HOH A O   1 
HETATM 4319 O O   . HOH C 3 .   ? 8.901   45.197 42.794 1.00   39.03 ? 766 HOH A O   1 
HETATM 4320 O O   . HOH C 3 .   ? 2.750   63.156 69.372 1.00   31.64 ? 767 HOH A O   1 
HETATM 4321 O O   . HOH C 3 .   ? -21.646 48.136 57.118 1.00   38.88 ? 768 HOH A O   1 
HETATM 4322 O O   . HOH C 3 .   ? 4.579   65.183 79.586 1.00   41.00 ? 769 HOH A O   1 
HETATM 4323 O O   . HOH C 3 .   ? 5.655   78.894 78.706 1.00   46.96 ? 770 HOH A O   1 
HETATM 4324 O O   . HOH C 3 .   ? 11.294  77.718 83.838 1.00   50.50 ? 771 HOH A O   1 
HETATM 4325 O O   . HOH C 3 .   ? -10.476 62.970 35.260 1.00   39.76 ? 772 HOH A O   1 
HETATM 4326 O O   . HOH C 3 .   ? 7.172   62.634 34.943 1.00   49.67 ? 773 HOH A O   1 
HETATM 4327 O O   . HOH C 3 .   ? 24.094  65.790 63.813 1.00   35.48 ? 774 HOH A O   1 
HETATM 4328 O O   . HOH C 3 .   ? 25.808  66.524 73.995 1.00   32.67 ? 775 HOH A O   1 
HETATM 4329 O O   . HOH C 3 .   ? -10.988 73.515 65.874 1.00   30.16 ? 776 HOH A O   1 
HETATM 4330 O O   . HOH C 3 .   ? -17.611 65.515 61.081 1.00   36.58 ? 777 HOH A O   1 
HETATM 4331 O O   . HOH C 3 .   ? -4.104  66.438 31.024 1.00   46.81 ? 778 HOH A O   1 
HETATM 4332 O O   . HOH C 3 .   ? -8.149  62.564 34.035 1.00   47.42 ? 779 HOH A O   1 
HETATM 4333 O O   . HOH C 3 .   ? -1.080  72.519 73.084 1.00   31.36 ? 780 HOH A O   1 
HETATM 4334 O O   . HOH C 3 .   ? 12.551  49.812 61.402 1.00   53.57 ? 781 HOH A O   1 
HETATM 4335 O O   . HOH C 3 .   ? -20.827 71.985 35.105 1.00   33.50 ? 782 HOH A O   1 
HETATM 4336 O O   . HOH C 3 .   ? -1.919  57.078 37.579 1.00   29.24 ? 783 HOH A O   1 
HETATM 4337 O O   . HOH C 3 .   ? 22.856  65.249 66.076 1.00   50.97 ? 784 HOH A O   1 
HETATM 4338 O O   . HOH C 3 .   ? 10.606  46.729 38.358 1.00   46.41 ? 785 HOH A O   1 
HETATM 4339 O O   . HOH C 3 .   ? 7.892   54.390 80.730 1.00   48.63 ? 786 HOH A O   1 
HETATM 4340 O O   . HOH C 3 .   ? -3.378  69.111 28.950 1.00   38.16 ? 787 HOH A O   1 
HETATM 4341 O O   . HOH C 3 .   ? -22.392 50.693 57.481 1.00   38.30 ? 788 HOH A O   1 
HETATM 4342 O O   . HOH C 3 .   ? -5.187  40.696 63.053 1.00   39.77 ? 789 HOH A O   1 
HETATM 4343 O O   . HOH C 3 .   ? -5.314  74.568 70.092 1.00   42.00 ? 790 HOH A O   1 
HETATM 4344 O O   . HOH C 3 .   ? 10.929  76.281 77.657 1.00   47.46 ? 791 HOH A O   1 
HETATM 4345 O O   . HOH C 3 .   ? 25.037  60.646 68.203 1.00   40.95 ? 792 HOH A O   1 
HETATM 4346 O O   . HOH C 3 .   ? 14.955  78.871 38.127 1.00   57.49 ? 793 HOH A O   1 
HETATM 4347 O O   . HOH C 3 .   ? -1.733  77.859 62.195 1.00   30.70 ? 794 HOH A O   1 
HETATM 4348 O O   . HOH C 3 .   ? -1.050  66.629 39.821 1.00   28.04 ? 795 HOH A O   1 
HETATM 4349 O O   . HOH C 3 .   ? -21.720 62.548 50.960 1.00   34.35 ? 796 HOH A O   1 
HETATM 4350 O O   . HOH C 3 .   ? -10.122 80.591 33.290 1.00   44.97 ? 797 HOH A O   1 
HETATM 4351 O O   . HOH C 3 .   ? 3.903   60.468 72.853 1.00   42.29 ? 798 HOH A O   1 
HETATM 4352 O O   . HOH C 3 .   ? 0.936   93.908 51.825 1.00   45.73 ? 799 HOH A O   1 
HETATM 4353 O O   . HOH C 3 .   ? 15.336  91.685 51.472 1.00   44.81 ? 800 HOH A O   1 
HETATM 4354 O O   . HOH C 3 .   ? 1.036   43.518 54.729 1.00   33.11 ? 801 HOH A O   1 
HETATM 4355 O O   . HOH C 3 .   ? 6.855   89.979 68.758 1.00   55.66 ? 802 HOH A O   1 
HETATM 4356 O O   . HOH C 3 .   ? -4.696  80.626 62.456 1.00   42.40 ? 803 HOH A O   1 
HETATM 4357 O O   . HOH C 3 .   ? -8.426  67.425 72.738 1.00   46.06 ? 804 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 ?   ?   ?   A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2770  ? 
1 MORE         1     ? 
1 'SSA (A^2)'  35600 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 136.7000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    A 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     732 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   C 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1996-11-08 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-06-22 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' .   ? 1 
SCALEPACK 'data scaling'   .   ? 2 
X-PLOR    'model building' 3.1 ? 3 
X-PLOR    refinement       3.1 ? 4 
X-PLOR    phasing          3.1 ? 5 
# 
_pdbx_entry_details.entry_id             2ACE 
_pdbx_entry_details.compound_details     
;THERE IS RECENT EVIDENCE (SEE BUCHT 1996) THAT THE GPI
ANCHOR IS ATTACHED TO EITHER SER 543 OR SER 544, NOT TO
CYS 537.
;
_pdbx_entry_details.source_details       ? 
_pdbx_entry_details.nonpolymer_details   ? 
_pdbx_entry_details.sequence_details     ? 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1  1 O7  A ACH 998 ? ? O A HOH 682 ? ? 0.63 
2  1 C8  A ACH 998 ? ? O A HOH 679 ? ? 0.90 
3  1 N1  A ACH 998 ? ? O A HOH 679 ? ? 0.94 
4  1 C5  A ACH 998 ? ? O A HOH 682 ? ? 1.19 
5  1 C9  A ACH 998 ? ? O A HOH 678 ? ? 1.51 
6  1 C10 A ACH 998 ? ? O A HOH 679 ? ? 1.64 
7  1 O4  A ACH 998 ? ? O A HOH 682 ? ? 1.79 
8  1 C10 A ACH 998 ? ? O A HOH 633 ? ? 1.89 
9  1 C9  A ACH 998 ? ? O A HOH 679 ? ? 1.91 
10 1 N1  A ACH 998 ? ? O A HOH 678 ? ? 2.10 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             N 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_1              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CA 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_2              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             C 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ASP 
_pdbx_validate_rmsd_angle.auth_seq_id_3              285 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                93.71 
_pdbx_validate_rmsd_angle.angle_target_value         111.00 
_pdbx_validate_rmsd_angle.angle_deviation            -17.29 
_pdbx_validate_rmsd_angle.angle_standard_deviation   2.70 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 21.26   64.91   
2  1 SER A 25  ? ? -179.91 -165.07 
3  1 PRO A 39  ? ? -72.99  36.58   
4  1 PHE A 45  ? ? 81.89   -16.67  
5  1 PRO A 53  ? ? -59.83  172.82  
6  1 ALA A 60  ? ? -100.03 51.60   
7  1 SER A 108 ? ? -157.93 77.53   
8  1 PHE A 120 ? ? 69.11   -5.33   
9  1 LEU A 158 ? ? -104.79 75.01   
10 1 ALA A 164 ? ? -154.26 76.82   
11 1 PRO A 191 ? ? -65.03  3.06    
12 1 THR A 193 ? ? -143.00 51.11   
13 1 SER A 200 ? ? 60.93   -116.36 
14 1 PHE A 288 ? ? 70.31   43.06   
15 1 GLU A 299 ? ? -121.36 -68.79  
16 1 ASN A 313 ? ? -68.95  68.89   
17 1 THR A 317 ? ? -170.01 -163.08 
18 1 ASP A 326 ? ? -119.76 79.74   
19 1 ASP A 380 ? ? -172.16 50.76   
20 1 VAL A 400 ? ? -133.33 -60.51  
21 1 PRO A 451 ? ? -56.58  1.07    
22 1 GLU A 455 ? ? -65.41  7.10    
23 1 THR A 507 ? ? -62.55  1.96    
24 1 MET A 510 ? ? -44.88  158.30  
# 
_pdbx_validate_planes.id              1 
_pdbx_validate_planes.PDB_model_num   1 
_pdbx_validate_planes.auth_comp_id    TYR 
_pdbx_validate_planes.auth_asym_id    A 
_pdbx_validate_planes.auth_seq_id     63 
_pdbx_validate_planes.PDB_ins_code    ? 
_pdbx_validate_planes.label_alt_id    ? 
_pdbx_validate_planes.rmsd            0.070 
_pdbx_validate_planes.type            'SIDE CHAIN' 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A HIS 26  ? ND1 ? A HIS 26  ND1 
2  1 Y 1 A HIS 26  ? CD2 ? A HIS 26  CD2 
3  1 Y 1 A HIS 26  ? CE1 ? A HIS 26  CE1 
4  1 Y 1 A HIS 26  ? NE2 ? A HIS 26  NE2 
5  1 Y 1 A ASN 42  ? CG  ? A ASN 42  CG  
6  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
7  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
8  1 Y 1 A ARG 46  ? CZ  ? A ARG 46  CZ  
9  1 Y 1 A ARG 46  ? NH1 ? A ARG 46  NH1 
10 1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
11 1 Y 1 A GLU 89  ? CD  ? A GLU 89  CD  
12 1 Y 1 A GLU 89  ? OE1 ? A GLU 89  OE1 
13 1 Y 1 A GLU 89  ? OE2 ? A GLU 89  OE2 
14 1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 
15 1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 
16 1 Y 1 A ARG 250 ? CZ  ? A ARG 250 CZ  
17 1 Y 1 A ARG 250 ? NH1 ? A ARG 250 NH1 
18 1 Y 1 A ARG 250 ? NH2 ? A ARG 250 NH2 
19 1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
20 1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
21 1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
22 1 Y 1 A GLU 260 ? OE1 ? A GLU 260 OE1 
23 1 Y 1 A GLU 260 ? OE2 ? A GLU 260 OE2 
24 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
25 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
26 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
27 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
28 1 Y 1 A GLU 344 ? OE1 ? A GLU 344 OE1 
29 1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
30 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
31 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
32 1 Y 1 A LYS 357 ? NZ  ? A LYS 357 NZ  
33 1 Y 1 A ASP 365 ? OD1 ? A ASP 365 OD1 
34 1 Y 1 A ASP 365 ? OD2 ? A ASP 365 OD2 
35 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
36 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
37 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
38 1 Y 1 A LYS 491 ? CD  ? A LYS 491 CD  
39 1 Y 1 A LYS 491 ? CE  ? A LYS 491 CE  
40 1 Y 1 A LYS 491 ? NZ  ? A LYS 491 NZ  
41 1 Y 1 A LYS 498 ? CG  ? A LYS 498 CG  
42 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
43 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
44 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
45 1 Y 1 A GLU 499 ? OE1 ? A GLU 499 OE1 
46 1 Y 1 A GLU 499 ? OE2 ? A GLU 499 OE2 
47 1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
48 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
49 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
50 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
51 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
52 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
53 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
54 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
55 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
56 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
57 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
58 1 Y 1 A ASN 533 ? CG  ? A ASN 533 CG  
59 1 Y 1 A ASN 533 ? OD1 ? A ASN 533 OD1 
60 1 Y 1 A ASN 533 ? ND2 ? A ASN 533 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A PRO 485 ? A PRO 485 
5  1 Y 1 A HIS 486 ? A HIS 486 
6  1 Y 1 A SER 487 ? A SER 487 
7  1 Y 1 A GLN 488 ? A GLN 488 
8  1 Y 1 A GLU 489 ? A GLU 489 
9  1 Y 1 A ALA 536 ? A ALA 536 
10 1 Y 1 A CYS 537 ? A CYS 537 
11 1 N 0 A ACH 998 ? B ACH ?   
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 ACETYLCHOLINE ACH 
3 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ACH 1   998 998 ACH ACH A . 
C 3 HOH 1   601 601 HOH HOH A . 
C 3 HOH 2   602 602 HOH HOH A . 
C 3 HOH 3   603 603 HOH HOH A . 
C 3 HOH 4   604 604 HOH HOH A . 
C 3 HOH 5   605 605 HOH HOH A . 
C 3 HOH 6   606 606 HOH HOH A . 
C 3 HOH 7   607 607 HOH HOH A . 
C 3 HOH 8   608 608 HOH HOH A . 
C 3 HOH 9   609 609 HOH HOH A . 
C 3 HOH 10  610 610 HOH HOH A . 
C 3 HOH 11  611 611 HOH HOH A . 
C 3 HOH 12  612 612 HOH HOH A . 
C 3 HOH 13  613 613 HOH HOH A . 
C 3 HOH 14  614 614 HOH HOH A . 
C 3 HOH 15  615 615 HOH HOH A . 
C 3 HOH 16  616 616 HOH HOH A . 
C 3 HOH 17  617 617 HOH HOH A . 
C 3 HOH 18  618 618 HOH HOH A . 
C 3 HOH 19  619 619 HOH HOH A . 
C 3 HOH 20  620 620 HOH HOH A . 
C 3 HOH 21  621 621 HOH HOH A . 
C 3 HOH 22  622 622 HOH HOH A . 
C 3 HOH 23  623 623 HOH HOH A . 
C 3 HOH 24  624 624 HOH HOH A . 
C 3 HOH 25  625 625 HOH HOH A . 
C 3 HOH 26  626 626 HOH HOH A . 
C 3 HOH 27  627 627 HOH HOH A . 
C 3 HOH 28  628 628 HOH HOH A . 
C 3 HOH 29  629 629 HOH HOH A . 
C 3 HOH 30  630 630 HOH HOH A . 
C 3 HOH 31  631 631 HOH HOH A . 
C 3 HOH 32  632 632 HOH HOH A . 
C 3 HOH 33  633 633 HOH HOH A . 
C 3 HOH 34  634 634 HOH HOH A . 
C 3 HOH 35  635 635 HOH HOH A . 
C 3 HOH 36  636 636 HOH HOH A . 
C 3 HOH 37  637 637 HOH HOH A . 
C 3 HOH 38  638 638 HOH HOH A . 
C 3 HOH 39  639 639 HOH HOH A . 
C 3 HOH 40  640 640 HOH HOH A . 
C 3 HOH 41  641 641 HOH HOH A . 
C 3 HOH 42  642 642 HOH HOH A . 
C 3 HOH 43  643 643 HOH HOH A . 
C 3 HOH 44  644 644 HOH HOH A . 
C 3 HOH 45  645 645 HOH HOH A . 
C 3 HOH 46  646 646 HOH HOH A . 
C 3 HOH 47  647 647 HOH HOH A . 
C 3 HOH 48  648 648 HOH HOH A . 
C 3 HOH 49  649 649 HOH HOH A . 
C 3 HOH 50  650 650 HOH HOH A . 
C 3 HOH 51  651 651 HOH HOH A . 
C 3 HOH 52  652 652 HOH HOH A . 
C 3 HOH 53  653 653 HOH HOH A . 
C 3 HOH 54  654 654 HOH HOH A . 
C 3 HOH 55  655 655 HOH HOH A . 
C 3 HOH 56  656 656 HOH HOH A . 
C 3 HOH 57  657 657 HOH HOH A . 
C 3 HOH 58  658 658 HOH HOH A . 
C 3 HOH 59  659 659 HOH HOH A . 
C 3 HOH 60  660 660 HOH HOH A . 
C 3 HOH 61  661 661 HOH HOH A . 
C 3 HOH 62  662 662 HOH HOH A . 
C 3 HOH 63  663 663 HOH HOH A . 
C 3 HOH 64  664 664 HOH HOH A . 
C 3 HOH 65  665 665 HOH HOH A . 
C 3 HOH 66  666 666 HOH HOH A . 
C 3 HOH 67  667 667 HOH HOH A . 
C 3 HOH 68  668 668 HOH HOH A . 
C 3 HOH 69  669 669 HOH HOH A . 
C 3 HOH 70  670 670 HOH HOH A . 
C 3 HOH 71  671 671 HOH HOH A . 
C 3 HOH 72  672 672 HOH HOH A . 
C 3 HOH 73  673 673 HOH HOH A . 
C 3 HOH 74  674 674 HOH HOH A . 
C 3 HOH 75  675 675 HOH HOH A . 
C 3 HOH 76  676 676 HOH HOH A . 
C 3 HOH 77  677 677 HOH HOH A . 
C 3 HOH 78  678 678 HOH HOH A . 
C 3 HOH 79  679 679 HOH HOH A . 
C 3 HOH 80  680 680 HOH HOH A . 
C 3 HOH 81  681 681 HOH HOH A . 
C 3 HOH 82  682 682 HOH HOH A . 
C 3 HOH 83  683 683 HOH HOH A . 
C 3 HOH 84  684 684 HOH HOH A . 
C 3 HOH 85  685 685 HOH HOH A . 
C 3 HOH 86  686 686 HOH HOH A . 
C 3 HOH 87  687 687 HOH HOH A . 
C 3 HOH 88  688 688 HOH HOH A . 
C 3 HOH 89  689 689 HOH HOH A . 
C 3 HOH 90  690 690 HOH HOH A . 
C 3 HOH 91  691 691 HOH HOH A . 
C 3 HOH 92  692 692 HOH HOH A . 
C 3 HOH 93  693 693 HOH HOH A . 
C 3 HOH 94  694 694 HOH HOH A . 
C 3 HOH 95  695 695 HOH HOH A . 
C 3 HOH 96  696 696 HOH HOH A . 
C 3 HOH 97  697 697 HOH HOH A . 
C 3 HOH 98  698 698 HOH HOH A . 
C 3 HOH 99  699 699 HOH HOH A . 
C 3 HOH 100 700 700 HOH HOH A . 
C 3 HOH 101 701 701 HOH HOH A . 
C 3 HOH 102 702 702 HOH HOH A . 
C 3 HOH 103 703 703 HOH HOH A . 
C 3 HOH 104 704 704 HOH HOH A . 
C 3 HOH 105 705 705 HOH HOH A . 
C 3 HOH 106 706 706 HOH HOH A . 
C 3 HOH 107 707 707 HOH HOH A . 
C 3 HOH 108 708 708 HOH HOH A . 
C 3 HOH 109 709 709 HOH HOH A . 
C 3 HOH 110 710 710 HOH HOH A . 
C 3 HOH 111 711 711 HOH HOH A . 
C 3 HOH 112 712 712 HOH HOH A . 
C 3 HOH 113 713 713 HOH HOH A . 
C 3 HOH 114 714 714 HOH HOH A . 
C 3 HOH 115 715 715 HOH HOH A . 
C 3 HOH 116 716 716 HOH HOH A . 
C 3 HOH 117 717 717 HOH HOH A . 
C 3 HOH 118 718 718 HOH HOH A . 
C 3 HOH 119 719 719 HOH HOH A . 
C 3 HOH 120 720 720 HOH HOH A . 
C 3 HOH 121 721 721 HOH HOH A . 
C 3 HOH 122 722 722 HOH HOH A . 
C 3 HOH 123 723 723 HOH HOH A . 
C 3 HOH 124 724 724 HOH HOH A . 
C 3 HOH 125 725 725 HOH HOH A . 
C 3 HOH 126 726 726 HOH HOH A . 
C 3 HOH 127 727 727 HOH HOH A . 
C 3 HOH 128 728 728 HOH HOH A . 
C 3 HOH 129 729 729 HOH HOH A . 
C 3 HOH 130 730 730 HOH HOH A . 
C 3 HOH 131 731 731 HOH HOH A . 
C 3 HOH 132 732 732 HOH HOH A . 
C 3 HOH 133 733 733 HOH HOH A . 
C 3 HOH 134 734 734 HOH HOH A . 
C 3 HOH 135 735 735 HOH HOH A . 
C 3 HOH 136 736 736 HOH HOH A . 
C 3 HOH 137 737 737 HOH HOH A . 
C 3 HOH 138 738 738 HOH HOH A . 
C 3 HOH 139 739 739 HOH HOH A . 
C 3 HOH 140 740 740 HOH HOH A . 
C 3 HOH 141 741 741 HOH HOH A . 
C 3 HOH 142 742 742 HOH HOH A . 
C 3 HOH 143 743 743 HOH HOH A . 
C 3 HOH 144 744 744 HOH HOH A . 
C 3 HOH 145 745 745 HOH HOH A . 
C 3 HOH 146 746 746 HOH HOH A . 
C 3 HOH 147 747 747 HOH HOH A . 
C 3 HOH 148 748 748 HOH HOH A . 
C 3 HOH 149 749 749 HOH HOH A . 
C 3 HOH 150 750 750 HOH HOH A . 
C 3 HOH 151 751 751 HOH HOH A . 
C 3 HOH 152 752 752 HOH HOH A . 
C 3 HOH 153 753 753 HOH HOH A . 
C 3 HOH 154 754 754 HOH HOH A . 
C 3 HOH 155 755 755 HOH HOH A . 
C 3 HOH 156 756 756 HOH HOH A . 
C 3 HOH 157 757 757 HOH HOH A . 
C 3 HOH 158 758 758 HOH HOH A . 
C 3 HOH 159 759 759 HOH HOH A . 
C 3 HOH 160 760 760 HOH HOH A . 
C 3 HOH 161 761 761 HOH HOH A . 
C 3 HOH 162 762 762 HOH HOH A . 
C 3 HOH 163 763 763 HOH HOH A . 
C 3 HOH 164 764 764 HOH HOH A . 
C 3 HOH 165 765 765 HOH HOH A . 
C 3 HOH 166 766 766 HOH HOH A . 
C 3 HOH 167 767 767 HOH HOH A . 
C 3 HOH 168 768 768 HOH HOH A . 
C 3 HOH 169 769 769 HOH HOH A . 
C 3 HOH 170 770 770 HOH HOH A . 
C 3 HOH 171 771 771 HOH HOH A . 
C 3 HOH 172 772 772 HOH HOH A . 
C 3 HOH 173 773 773 HOH HOH A . 
C 3 HOH 174 774 774 HOH HOH A . 
C 3 HOH 175 775 775 HOH HOH A . 
C 3 HOH 176 776 776 HOH HOH A . 
C 3 HOH 177 777 777 HOH HOH A . 
C 3 HOH 178 778 778 HOH HOH A . 
C 3 HOH 179 779 779 HOH HOH A . 
C 3 HOH 180 780 780 HOH HOH A . 
C 3 HOH 181 781 781 HOH HOH A . 
C 3 HOH 182 782 782 HOH HOH A . 
C 3 HOH 183 783 783 HOH HOH A . 
C 3 HOH 184 784 784 HOH HOH A . 
C 3 HOH 185 785 785 HOH HOH A . 
C 3 HOH 186 786 786 HOH HOH A . 
C 3 HOH 187 787 787 HOH HOH A . 
C 3 HOH 188 788 788 HOH HOH A . 
C 3 HOH 189 789 789 HOH HOH A . 
C 3 HOH 190 790 790 HOH HOH A . 
C 3 HOH 191 791 791 HOH HOH A . 
C 3 HOH 192 792 792 HOH HOH A . 
C 3 HOH 193 793 793 HOH HOH A . 
C 3 HOH 194 794 794 HOH HOH A . 
C 3 HOH 195 795 795 HOH HOH A . 
C 3 HOH 196 796 796 HOH HOH A . 
C 3 HOH 197 797 797 HOH HOH A . 
C 3 HOH 198 798 798 HOH HOH A . 
C 3 HOH 199 799 799 HOH HOH A . 
C 3 HOH 200 800 800 HOH HOH A . 
C 3 HOH 201 801 801 HOH HOH A . 
C 3 HOH 202 802 802 HOH HOH A . 
C 3 HOH 203 803 803 HOH HOH A . 
C 3 HOH 204 804 804 HOH HOH A . 
#