data_2ACK
# 
_entry.id   2ACK 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2ACK         
WWPDB D_1000177735 
# 
_pdbx_database_PDB_obs_spr.id               SPRSDE 
_pdbx_database_PDB_obs_spr.date             1998-02-11 
_pdbx_database_PDB_obs_spr.pdb_id           2ACK 
_pdbx_database_PDB_obs_spr.replace_pdb_id   1ACK 
_pdbx_database_PDB_obs_spr.details          ? 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2ACK 
_pdbx_database_status.recvd_initial_deposition_date   1997-10-29 
_pdbx_database_status.deposit_site                    ? 
_pdbx_database_status.process_site                    BNL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Raves, M.L.'   1 
'Sussman, J.L.' 2 
'Harel, M.'     3 
'Silman, I.'    4 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Static Laue diffraction studies on acetylcholinesterase.' 'Acta Crystallogr.,Sect.D' 54  1359 1366 1998 ABCRE6 DK 
0907-4449 0766 ? 10089512 10.1107/S0907444998005277 
1       'Quaternary Ligand Binding to Aromatic Residues in the Active-Site Gorge of Acetylcholinesterase' Proc.Natl.Acad.Sci.USA 
90  9031 ?    1993 PNASA6 US 0027-8424 0040 ? ?        ?                         
2       'Atomic Structure of Acetylcholinesterase from Torpedo Californica: A Prototypic Acetylcholine-Binding Protein' Science 
253 872  ?    1991 SCIEAS US 0036-8075 0038 ? ?        ?                         
3       
;Purification and Crystallization of a Dimeric Form of Acetylcholinesterase from Torpedo Californica Subsequent to Solubilization with Phosphatidylinositol-Specific Phospholipase C
;
J.Mol.Biol.                203 821  ?    1988 JMOBAK UK 0022-2836 0070 ? ?        ?                         
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Ravelli, R.B.'      1  
primary 'Raves, M.L.'        2  
primary 'Ren, Z.'            3  
primary 'Bourgeois, D.'      4  
primary 'Roth, M.'           5  
primary 'Kroon, J.'          6  
primary 'Silman, I.'         7  
primary 'Sussman, J.L.'      8  
1       'Harel, M.'          9  
1       'Schalk, I.'         10 
1       'Ehret-Sabatier, L.' 11 
1       'Bouet, F.'          12 
1       'Goeldner, M.'       13 
1       'Hirth, C.'          14 
1       'Axelsen, P.H.'      15 
1       'Silman, I.'         16 
1       'Sussman, J.L.'      17 
2       'Sussman, J.L.'      18 
2       'Harel, M.'          19 
2       'Frolow, F.'         20 
2       'Oefner, C.'         21 
2       'Goldman, A.'        22 
2       'Toker, L.'          23 
2       'Silman, I.'         24 
3       'Sussman, J.L.'      25 
3       'Harel, M.'          26 
3       'Frolow, F.'         27 
3       'Varon, L.'          28 
3       'Toker, L.'          29 
3       'Futerman, A.H.'     30 
3       'Silman, I.'         31 
# 
_cell.entry_id           2ACK 
_cell.length_a           112.409 
_cell.length_b           112.409 
_cell.length_c           136.550 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         2ACK 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat ACETYLCHOLINESTERASE 60736.516 1   3.1.1.7 ? ? ? 
2 non-polymer syn 'EDROPHONIUM ION'    166.240   1   ?       ? ? ? 
3 water       nat water                18.015    252 ?       ? ? ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_seq_one_letter_code_can   
;DDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWNASTYPNNCQQYVDEQFPGFSG
SEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTEEVVLVSLSYRVGAFGFLALHG
SQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLFRRAILQSGSPNCPWASVSVAE
GRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGEFFPTSLESMLNSGNFKKTQIL
LGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWMDDNNGIKNRDGLDDIVGDHNV
ICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYTAEEEALSRRIMHYWATFAKTG
NPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATAC
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ASP n 
1 2   ASP n 
1 3   HIS n 
1 4   SER n 
1 5   GLU n 
1 6   LEU n 
1 7   LEU n 
1 8   VAL n 
1 9   ASN n 
1 10  THR n 
1 11  LYS n 
1 12  SER n 
1 13  GLY n 
1 14  LYS n 
1 15  VAL n 
1 16  MET n 
1 17  GLY n 
1 18  THR n 
1 19  ARG n 
1 20  VAL n 
1 21  PRO n 
1 22  VAL n 
1 23  LEU n 
1 24  SER n 
1 25  SER n 
1 26  HIS n 
1 27  ILE n 
1 28  SER n 
1 29  ALA n 
1 30  PHE n 
1 31  LEU n 
1 32  GLY n 
1 33  ILE n 
1 34  PRO n 
1 35  PHE n 
1 36  ALA n 
1 37  GLU n 
1 38  PRO n 
1 39  PRO n 
1 40  VAL n 
1 41  GLY n 
1 42  ASN n 
1 43  MET n 
1 44  ARG n 
1 45  PHE n 
1 46  ARG n 
1 47  ARG n 
1 48  PRO n 
1 49  GLU n 
1 50  PRO n 
1 51  LYS n 
1 52  LYS n 
1 53  PRO n 
1 54  TRP n 
1 55  SER n 
1 56  GLY n 
1 57  VAL n 
1 58  TRP n 
1 59  ASN n 
1 60  ALA n 
1 61  SER n 
1 62  THR n 
1 63  TYR n 
1 64  PRO n 
1 65  ASN n 
1 66  ASN n 
1 67  CYS n 
1 68  GLN n 
1 69  GLN n 
1 70  TYR n 
1 71  VAL n 
1 72  ASP n 
1 73  GLU n 
1 74  GLN n 
1 75  PHE n 
1 76  PRO n 
1 77  GLY n 
1 78  PHE n 
1 79  SER n 
1 80  GLY n 
1 81  SER n 
1 82  GLU n 
1 83  MET n 
1 84  TRP n 
1 85  ASN n 
1 86  PRO n 
1 87  ASN n 
1 88  ARG n 
1 89  GLU n 
1 90  MET n 
1 91  SER n 
1 92  GLU n 
1 93  ASP n 
1 94  CYS n 
1 95  LEU n 
1 96  TYR n 
1 97  LEU n 
1 98  ASN n 
1 99  ILE n 
1 100 TRP n 
1 101 VAL n 
1 102 PRO n 
1 103 SER n 
1 104 PRO n 
1 105 ARG n 
1 106 PRO n 
1 107 LYS n 
1 108 SER n 
1 109 THR n 
1 110 THR n 
1 111 VAL n 
1 112 MET n 
1 113 VAL n 
1 114 TRP n 
1 115 ILE n 
1 116 TYR n 
1 117 GLY n 
1 118 GLY n 
1 119 GLY n 
1 120 PHE n 
1 121 TYR n 
1 122 SER n 
1 123 GLY n 
1 124 SER n 
1 125 SER n 
1 126 THR n 
1 127 LEU n 
1 128 ASP n 
1 129 VAL n 
1 130 TYR n 
1 131 ASN n 
1 132 GLY n 
1 133 LYS n 
1 134 TYR n 
1 135 LEU n 
1 136 ALA n 
1 137 TYR n 
1 138 THR n 
1 139 GLU n 
1 140 GLU n 
1 141 VAL n 
1 142 VAL n 
1 143 LEU n 
1 144 VAL n 
1 145 SER n 
1 146 LEU n 
1 147 SER n 
1 148 TYR n 
1 149 ARG n 
1 150 VAL n 
1 151 GLY n 
1 152 ALA n 
1 153 PHE n 
1 154 GLY n 
1 155 PHE n 
1 156 LEU n 
1 157 ALA n 
1 158 LEU n 
1 159 HIS n 
1 160 GLY n 
1 161 SER n 
1 162 GLN n 
1 163 GLU n 
1 164 ALA n 
1 165 PRO n 
1 166 GLY n 
1 167 ASN n 
1 168 VAL n 
1 169 GLY n 
1 170 LEU n 
1 171 LEU n 
1 172 ASP n 
1 173 GLN n 
1 174 ARG n 
1 175 MET n 
1 176 ALA n 
1 177 LEU n 
1 178 GLN n 
1 179 TRP n 
1 180 VAL n 
1 181 HIS n 
1 182 ASP n 
1 183 ASN n 
1 184 ILE n 
1 185 GLN n 
1 186 PHE n 
1 187 PHE n 
1 188 GLY n 
1 189 GLY n 
1 190 ASP n 
1 191 PRO n 
1 192 LYS n 
1 193 THR n 
1 194 VAL n 
1 195 THR n 
1 196 ILE n 
1 197 PHE n 
1 198 GLY n 
1 199 GLU n 
1 200 SER n 
1 201 ALA n 
1 202 GLY n 
1 203 GLY n 
1 204 ALA n 
1 205 SER n 
1 206 VAL n 
1 207 GLY n 
1 208 MET n 
1 209 HIS n 
1 210 ILE n 
1 211 LEU n 
1 212 SER n 
1 213 PRO n 
1 214 GLY n 
1 215 SER n 
1 216 ARG n 
1 217 ASP n 
1 218 LEU n 
1 219 PHE n 
1 220 ARG n 
1 221 ARG n 
1 222 ALA n 
1 223 ILE n 
1 224 LEU n 
1 225 GLN n 
1 226 SER n 
1 227 GLY n 
1 228 SER n 
1 229 PRO n 
1 230 ASN n 
1 231 CYS n 
1 232 PRO n 
1 233 TRP n 
1 234 ALA n 
1 235 SER n 
1 236 VAL n 
1 237 SER n 
1 238 VAL n 
1 239 ALA n 
1 240 GLU n 
1 241 GLY n 
1 242 ARG n 
1 243 ARG n 
1 244 ARG n 
1 245 ALA n 
1 246 VAL n 
1 247 GLU n 
1 248 LEU n 
1 249 GLY n 
1 250 ARG n 
1 251 ASN n 
1 252 LEU n 
1 253 ASN n 
1 254 CYS n 
1 255 ASN n 
1 256 LEU n 
1 257 ASN n 
1 258 SER n 
1 259 ASP n 
1 260 GLU n 
1 261 GLU n 
1 262 LEU n 
1 263 ILE n 
1 264 HIS n 
1 265 CYS n 
1 266 LEU n 
1 267 ARG n 
1 268 GLU n 
1 269 LYS n 
1 270 LYS n 
1 271 PRO n 
1 272 GLN n 
1 273 GLU n 
1 274 LEU n 
1 275 ILE n 
1 276 ASP n 
1 277 VAL n 
1 278 GLU n 
1 279 TRP n 
1 280 ASN n 
1 281 VAL n 
1 282 LEU n 
1 283 PRO n 
1 284 PHE n 
1 285 ASP n 
1 286 SER n 
1 287 ILE n 
1 288 PHE n 
1 289 ARG n 
1 290 PHE n 
1 291 SER n 
1 292 PHE n 
1 293 VAL n 
1 294 PRO n 
1 295 VAL n 
1 296 ILE n 
1 297 ASP n 
1 298 GLY n 
1 299 GLU n 
1 300 PHE n 
1 301 PHE n 
1 302 PRO n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 GLU n 
1 307 SER n 
1 308 MET n 
1 309 LEU n 
1 310 ASN n 
1 311 SER n 
1 312 GLY n 
1 313 ASN n 
1 314 PHE n 
1 315 LYS n 
1 316 LYS n 
1 317 THR n 
1 318 GLN n 
1 319 ILE n 
1 320 LEU n 
1 321 LEU n 
1 322 GLY n 
1 323 VAL n 
1 324 ASN n 
1 325 LYS n 
1 326 ASP n 
1 327 GLU n 
1 328 GLY n 
1 329 SER n 
1 330 PHE n 
1 331 PHE n 
1 332 LEU n 
1 333 LEU n 
1 334 TYR n 
1 335 GLY n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 PHE n 
1 340 SER n 
1 341 LYS n 
1 342 ASP n 
1 343 SER n 
1 344 GLU n 
1 345 SER n 
1 346 LYS n 
1 347 ILE n 
1 348 SER n 
1 349 ARG n 
1 350 GLU n 
1 351 ASP n 
1 352 PHE n 
1 353 MET n 
1 354 SER n 
1 355 GLY n 
1 356 VAL n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 VAL n 
1 361 PRO n 
1 362 HIS n 
1 363 ALA n 
1 364 ASN n 
1 365 ASP n 
1 366 LEU n 
1 367 GLY n 
1 368 LEU n 
1 369 ASP n 
1 370 ALA n 
1 371 VAL n 
1 372 THR n 
1 373 LEU n 
1 374 GLN n 
1 375 TYR n 
1 376 THR n 
1 377 ASP n 
1 378 TRP n 
1 379 MET n 
1 380 ASP n 
1 381 ASP n 
1 382 ASN n 
1 383 ASN n 
1 384 GLY n 
1 385 ILE n 
1 386 LYS n 
1 387 ASN n 
1 388 ARG n 
1 389 ASP n 
1 390 GLY n 
1 391 LEU n 
1 392 ASP n 
1 393 ASP n 
1 394 ILE n 
1 395 VAL n 
1 396 GLY n 
1 397 ASP n 
1 398 HIS n 
1 399 ASN n 
1 400 VAL n 
1 401 ILE n 
1 402 CYS n 
1 403 PRO n 
1 404 LEU n 
1 405 MET n 
1 406 HIS n 
1 407 PHE n 
1 408 VAL n 
1 409 ASN n 
1 410 LYS n 
1 411 TYR n 
1 412 THR n 
1 413 LYS n 
1 414 PHE n 
1 415 GLY n 
1 416 ASN n 
1 417 GLY n 
1 418 THR n 
1 419 TYR n 
1 420 LEU n 
1 421 TYR n 
1 422 PHE n 
1 423 PHE n 
1 424 ASN n 
1 425 HIS n 
1 426 ARG n 
1 427 ALA n 
1 428 SER n 
1 429 ASN n 
1 430 LEU n 
1 431 VAL n 
1 432 TRP n 
1 433 PRO n 
1 434 GLU n 
1 435 TRP n 
1 436 MET n 
1 437 GLY n 
1 438 VAL n 
1 439 ILE n 
1 440 HIS n 
1 441 GLY n 
1 442 TYR n 
1 443 GLU n 
1 444 ILE n 
1 445 GLU n 
1 446 PHE n 
1 447 VAL n 
1 448 PHE n 
1 449 GLY n 
1 450 LEU n 
1 451 PRO n 
1 452 LEU n 
1 453 VAL n 
1 454 LYS n 
1 455 GLU n 
1 456 LEU n 
1 457 ASN n 
1 458 TYR n 
1 459 THR n 
1 460 ALA n 
1 461 GLU n 
1 462 GLU n 
1 463 GLU n 
1 464 ALA n 
1 465 LEU n 
1 466 SER n 
1 467 ARG n 
1 468 ARG n 
1 469 ILE n 
1 470 MET n 
1 471 HIS n 
1 472 TYR n 
1 473 TRP n 
1 474 ALA n 
1 475 THR n 
1 476 PHE n 
1 477 ALA n 
1 478 LYS n 
1 479 THR n 
1 480 GLY n 
1 481 ASN n 
1 482 PRO n 
1 483 ASN n 
1 484 GLU n 
1 485 PRO n 
1 486 HIS n 
1 487 SER n 
1 488 GLN n 
1 489 GLU n 
1 490 SER n 
1 491 LYS n 
1 492 TRP n 
1 493 PRO n 
1 494 LEU n 
1 495 PHE n 
1 496 THR n 
1 497 THR n 
1 498 LYS n 
1 499 GLU n 
1 500 GLN n 
1 501 LYS n 
1 502 PHE n 
1 503 ILE n 
1 504 ASP n 
1 505 LEU n 
1 506 ASN n 
1 507 THR n 
1 508 GLU n 
1 509 PRO n 
1 510 MET n 
1 511 LYS n 
1 512 VAL n 
1 513 HIS n 
1 514 GLN n 
1 515 ARG n 
1 516 LEU n 
1 517 ARG n 
1 518 VAL n 
1 519 GLN n 
1 520 MET n 
1 521 CYS n 
1 522 VAL n 
1 523 PHE n 
1 524 TRP n 
1 525 ASN n 
1 526 GLN n 
1 527 PHE n 
1 528 LEU n 
1 529 PRO n 
1 530 LYS n 
1 531 LEU n 
1 532 LEU n 
1 533 ASN n 
1 534 ALA n 
1 535 THR n 
1 536 ALA n 
1 537 CYS n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           ? 
_entity_src_nat.pdbx_end_seq_num           ? 
_entity_src_nat.common_name                'Pacific electric ray' 
_entity_src_nat.pdbx_organism_scientific   'Torpedo californica' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      7787 
_entity_src_nat.genus                      Torpedo 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 'ELECTRIC ORGAN' 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_TORCA 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_db_accession          P04058 
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_seq_one_letter_code   
;MNLLVTSSLGVLLHLVVLCQADDHSELLVNTKSGKVMGTRVPVLSSHISAFLGIPFAEPPVGNMRFRRPEPKKPWSGVWN
ASTYPNNCQQYVDEQFPGFSGSEMWNPNREMSEDCLYLNIWVPSPRPKSTTVMVWIYGGGFYSGSSTLDVYNGKYLAYTE
EVVLVSLSYRVGAFGFLALHGSQEAPGNVGLLDQRMALQWVHDNIQFFGGDPKTVTIFGESAGGASVGMHILSPGSRDLF
RRAILQSGSPNCPWASVSVAEGRRRAVELGRNLNCNLNSDEELIHCLREKKPQELIDVEWNVLPFDSIFRFSFVPVIDGE
FFPTSLESMLNSGNFKKTQILLGVNKDEGSFFLLYGAPGFSKDSESKISREDFMSGVKLSVPHANDLGLDAVTLQYTDWM
DDNNGIKNRDGLDDIVGDHNVICPLMHFVNKYTKFGNGTYLYFFNHRASNLVWPEWMGVIHGYEIEFVFGLPLVKELNYT
AEEEALSRRIMHYWATFAKTGNPNEPHSQESKWPLFTTKEQKFIDLNTEPMKVHQRLRVQMCVFWNQFLPKLLNATACDG
ELSSSGTSSSKGIIFYVLFSILYLIF
;
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2ACK 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 537 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P04058 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  558 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       537 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE           ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE          ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE        ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'   ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE          ? 'C3 H7 N O2 S'   121.158 
EDR non-polymer         . 'EDROPHONIUM ION' ? 'C10 H16 N O 1'  166.240 
GLN 'L-peptide linking' y GLUTAMINE         ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'   ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE           ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE         ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER             ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE        ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE           ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE            ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE        ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE     ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE           ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE            ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE         ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN        ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE          ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE            ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2ACK 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      3.6 
_exptl_crystal.density_percent_sol   65. 
_exptl_crystal.description           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'PROTEIN WAS CRYSTALLISED FROM 40 % PEG200, 100 MM MES, PH 5.8 AT 4 DEGREES C., temperature 277K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           273 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   MARRESEARCH 
_diffrn_detector.pdbx_collection_date   1993-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.92 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'EMBL/DESY, HAMBURG BEAMLINE X11' 
_diffrn_source.pdbx_synchrotron_site       'EMBL/DESY, Hamburg' 
_diffrn_source.pdbx_synchrotron_beamline   X11 
_diffrn_source.pdbx_wavelength             0.92 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2ACK 
_reflns.observed_criterion_sigma_I   0. 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             33.3 
_reflns.d_resolution_high            2.4 
_reflns.number_obs                   38611 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         97.7 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.089 
_reflns.pdbx_netI_over_sigmaI        14.0 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.1 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.40 
_reflns_shell.d_res_low              2.46 
_reflns_shell.percent_possible_all   99.6 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.42 
_reflns_shell.meanI_over_sigI_obs    2.1 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2ACK 
_refine.ls_number_reflns_obs                     38560 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.0 
_refine.ls_d_res_high                            2.4 
_refine.ls_percent_reflns_obs                    97.7 
_refine.ls_R_factor_obs                          0.213 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.257 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.9 
_refine.ls_number_reflns_R_free                  1890 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.B_iso_mean                               37.3 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 2ACE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4146 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         12 
_refine_hist.number_atoms_solvent             252 
_refine_hist.number_atoms_total               4410 
_refine_hist.d_res_high                       2.4 
_refine_hist.d_res_low                        20.0 
# 
_struct.entry_id                  2ACK 
_struct.title                     'ACETYLCHOLINESTERASE COMPLEXED WITH EDROPHONIUM, MONOCHROMATIC DATA' 
_struct.pdbx_descriptor           ACETYLCHOLINESTERASE 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2ACK 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            'HYDROLASE, CARBOXYLIC ESTERASE' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id                    1 
_struct_biol.details               
;TORPEDO CALIFONICA ACETYLCHOLINESTERASE IS A G2 DIMER IN
SOLUTION (SEE SUSSMAN 1988).  THE ASYMMETRIC UNIT CONTAINS
A MONOMER, WITH THE CRYSTALLOGRAPHIC TWO-FOLD AXIS RELATING
THE TWO MONOMERS IN A DIMER.
;
_struct_biol.pdbx_parent_biol_id   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  H1  SER A 79  ? ASN A 85  ? SER A 79  ASN A 85  1 ? 7  
HELX_P HELX_P2  H2  GLY A 132 ? GLU A 139 ? GLY A 132 GLU A 139 1 ? 8  
HELX_P HELX_P3  H3  VAL A 168 ? ASN A 183 ? VAL A 168 ASN A 183 1 ? 16 
HELX_P HELX_P4  H4  SER A 200 ? LEU A 211 ? SER A 200 LEU A 211 1 ? 12 
HELX_P HELX_P5  H5  VAL A 238 ? LEU A 252 ? VAL A 238 LEU A 252 1 ? 15 
HELX_P HELX_P6  H6  ASP A 259 ? GLU A 268 ? ASP A 259 GLU A 268 1 ? 10 
HELX_P HELX_P7  H7  PRO A 271 ? GLU A 278 ? PRO A 271 GLU A 278 1 ? 8  
HELX_P HELX_P8  H8  LEU A 305 ? SER A 311 ? LEU A 305 SER A 311 1 ? 7  
HELX_P HELX_P9  H9  SER A 329 ? GLY A 335 ? SER A 329 GLY A 335 1 ? 7  
HELX_P HELX_P10 H10 ARG A 349 ? VAL A 360 ? ARG A 349 VAL A 360 1 ? 12 
HELX_P HELX_P11 H11 ASP A 365 ? THR A 376 ? ASP A 365 THR A 376 1 ? 12 
HELX_P HELX_P12 H12 GLY A 384 ? VAL A 400 ? GLY A 384 VAL A 400 1 ? 17 
HELX_P HELX_P13 H13 VAL A 400 ? TYR A 411 ? VAL A 400 TYR A 411 1 ? 12 
HELX_P HELX_P14 H14 GLU A 443 ? PHE A 448 ? GLU A 443 PHE A 448 1 ? 6  
HELX_P HELX_P15 H15 ALA A 460 ? THR A 479 ? ALA A 460 THR A 479 1 ? 20 
HELX_P HELX_P16 H16 VAL A 518 ? ALA A 534 ? VAL A 518 ALA A 534 1 ? 17 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 67  SG ? ? ? 1_555 A CYS 94  SG ? ? A CYS 67  A CYS 94  1_555 ? ? ? ? ? ? ? 2.012 ? 
disulf2 disulf ? ? A CYS 254 SG ? ? ? 1_555 A CYS 265 SG ? ? A CYS 254 A CYS 265 1_555 ? ? ? ? ? ? ? 2.022 ? 
disulf3 disulf ? ? A CYS 402 SG ? ? ? 1_555 A CYS 521 SG ? ? A CYS 402 A CYS 521 1_555 ? ? ? ? ? ? ? 2.021 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           103 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            103 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    104 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     104 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       7.69 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A3  ? 2 ? 
B12 ? 2 ? 
A4  ? 1 ? 
B11 ? 9 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A3  1 2 ? anti-parallel 
B12 1 2 ? anti-parallel 
B11 1 2 ? anti-parallel 
B11 2 3 ? parallel      
B11 3 4 ? parallel      
B11 4 5 ? parallel      
B11 5 6 ? parallel      
B11 6 7 ? parallel      
B11 7 8 ? parallel      
B11 8 9 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A3  1 LEU A 6   ? THR A 10  ? LEU A 6   THR A 10  
A3  2 GLY A 13  ? MET A 16  ? GLY A 13  MET A 16  
B12 1 MET A 16  ? PRO A 21  ? MET A 16  PRO A 21  
B12 2 HIS A 26  ? PRO A 34  ? HIS A 26  PRO A 34  
A4  1 VAL A 57  ? ALA A 60  ? VAL A 57  ALA A 60  
B11 1 TYR A 96  ? PRO A 102 ? TYR A 96  PRO A 102 
B11 2 VAL A 142 ? SER A 147 ? VAL A 142 SER A 147 
B11 3 THR A 109 ? TYR A 116 ? THR A 109 TYR A 116 
B11 4 THR A 193 ? GLU A 199 ? THR A 193 GLU A 199 
B11 5 ARG A 220 ? SER A 226 ? ARG A 220 SER A 226 
B11 6 GLN A 318 ? ASN A 324 ? GLN A 318 ASN A 324 
B11 7 GLY A 417 ? PHE A 423 ? GLY A 417 PHE A 423 
B11 8 PHE A 502 ? LEU A 505 ? PHE A 502 LEU A 505 
B11 9 MET A 510 ? GLN A 514 ? MET A 510 GLN A 514 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
CAT Unknown  ? ? ? ? 3  'CATALYTIC TRIAD.'                   
AC1 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE EDR A 999' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  CAT 3  SER A 200 ? SER A 200 . ? 1_555 ? 
2  CAT 3  HIS A 440 ? HIS A 440 . ? 1_555 ? 
3  CAT 3  GLU A 327 ? GLU A 327 . ? 1_555 ? 
4  AC1 10 TRP A 84  ? TRP A 84  . ? 1_555 ? 
5  AC1 10 GLY A 119 ? GLY A 119 . ? 1_555 ? 
6  AC1 10 TYR A 121 ? TYR A 121 . ? 1_555 ? 
7  AC1 10 GLU A 199 ? GLU A 199 . ? 1_555 ? 
8  AC1 10 SER A 200 ? SER A 200 . ? 1_555 ? 
9  AC1 10 PHE A 331 ? PHE A 331 . ? 1_555 ? 
10 AC1 10 HIS A 440 ? HIS A 440 . ? 1_555 ? 
11 AC1 10 HOH C .   ? HOH A 611 . ? 1_555 ? 
12 AC1 10 HOH C .   ? HOH A 621 . ? 1_555 ? 
13 AC1 10 HOH C .   ? HOH A 627 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2ACK 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2ACK 
_atom_sites.fract_transf_matrix[1][1]   0.008896 
_atom_sites.fract_transf_matrix[1][2]   0.005136 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010272 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007323 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 4   ? -12.316 88.143 34.398 1.00 59.41 ? 4   SER A N   1 
ATOM   2    C CA  . SER A 1 4   ? -11.669 88.399 35.717 1.00 58.93 ? 4   SER A CA  1 
ATOM   3    C C   . SER A 1 4   ? -10.664 87.314 36.092 1.00 57.61 ? 4   SER A C   1 
ATOM   4    O O   . SER A 1 4   ? -10.859 86.115 35.932 1.00 57.65 ? 4   SER A O   1 
ATOM   5    C CB  . SER A 1 4   ? -12.705 88.551 36.831 1.00 62.55 ? 4   SER A CB  1 
ATOM   6    O OG  . SER A 1 4   ? -12.098 88.618 38.116 1.00 64.73 ? 4   SER A OG  1 
ATOM   7    N N   . GLU A 1 5   ? -9.541  87.768 36.632 1.00 56.72 ? 5   GLU A N   1 
ATOM   8    C CA  . GLU A 1 5   ? -8.439  86.938 37.082 1.00 55.20 ? 5   GLU A CA  1 
ATOM   9    C C   . GLU A 1 5   ? -8.795  86.049 38.269 1.00 53.99 ? 5   GLU A C   1 
ATOM   10   O O   . GLU A 1 5   ? -8.052  85.114 38.562 1.00 53.73 ? 5   GLU A O   1 
ATOM   11   C CB  . GLU A 1 5   ? -7.284  87.865 37.452 1.00 56.58 ? 5   GLU A CB  1 
ATOM   12   C CG  . GLU A 1 5   ? -6.025  87.157 37.901 1.00 59.96 ? 5   GLU A CG  1 
ATOM   13   C CD  . GLU A 1 5   ? -4.933  88.151 38.240 1.00 61.85 ? 5   GLU A CD  1 
ATOM   14   O OE1 . GLU A 1 5   ? -5.282  89.250 38.719 1.00 64.25 ? 5   GLU A OE1 1 
ATOM   15   O OE2 . GLU A 1 5   ? -3.748  87.832 38.029 1.00 63.52 ? 5   GLU A OE2 1 
ATOM   16   N N   . LEU A 1 6   ? -9.905  86.324 38.945 1.00 52.54 ? 6   LEU A N   1 
ATOM   17   C CA  . LEU A 1 6   ? -10.328 85.530 40.090 1.00 51.57 ? 6   LEU A CA  1 
ATOM   18   C C   . LEU A 1 6   ? -11.443 84.569 39.701 1.00 50.64 ? 6   LEU A C   1 
ATOM   19   O O   . LEU A 1 6   ? -11.896 83.774 40.523 1.00 50.43 ? 6   LEU A O   1 
ATOM   20   C CB  . LEU A 1 6   ? -10.783 86.414 41.257 1.00 50.32 ? 6   LEU A CB  1 
ATOM   21   C CG  . LEU A 1 6   ? -9.740  87.451 41.701 1.00 50.53 ? 6   LEU A CG  1 
ATOM   22   C CD1 . LEU A 1 6   ? -10.332 88.349 42.771 1.00 51.61 ? 6   LEU A CD1 1 
ATOM   23   C CD2 . LEU A 1 6   ? -8.468  86.774 42.191 1.00 50.09 ? 6   LEU A CD2 1 
ATOM   24   N N   . LEU A 1 7   ? -11.871 84.642 38.442 1.00 49.84 ? 7   LEU A N   1 
ATOM   25   C CA  . LEU A 1 7   ? -12.885 83.681 38.001 1.00 49.38 ? 7   LEU A CA  1 
ATOM   26   C C   . LEU A 1 7   ? -12.154 82.668 37.126 1.00 48.87 ? 7   LEU A C   1 
ATOM   27   O O   . LEU A 1 7   ? -11.432 83.048 36.194 1.00 49.94 ? 7   LEU A O   1 
ATOM   28   C CB  . LEU A 1 7   ? -14.057 84.307 37.273 1.00 51.49 ? 7   LEU A CB  1 
ATOM   29   C CG  . LEU A 1 7   ? -15.224 83.356 36.978 1.00 54.28 ? 7   LEU A CG  1 
ATOM   30   C CD1 . LEU A 1 7   ? -15.809 82.793 38.263 1.00 55.42 ? 7   LEU A CD1 1 
ATOM   31   C CD2 . LEU A 1 7   ? -16.312 84.055 36.174 1.00 56.44 ? 7   LEU A CD2 1 
ATOM   32   N N   . VAL A 1 8   ? -12.269 81.401 37.493 1.00 47.52 ? 8   VAL A N   1 
ATOM   33   C CA  . VAL A 1 8   ? -11.582 80.366 36.725 1.00 46.08 ? 8   VAL A CA  1 
ATOM   34   C C   . VAL A 1 8   ? -12.608 79.304 36.349 1.00 45.60 ? 8   VAL A C   1 
ATOM   35   O O   . VAL A 1 8   ? -13.472 78.918 37.136 1.00 45.74 ? 8   VAL A O   1 
ATOM   36   C CB  . VAL A 1 8   ? -10.400 79.705 37.452 1.00 45.52 ? 8   VAL A CB  1 
ATOM   37   C CG1 . VAL A 1 8   ? -10.038 78.372 36.809 1.00 43.43 ? 8   VAL A CG1 1 
ATOM   38   C CG2 . VAL A 1 8   ? -9.176  80.613 37.473 1.00 44.27 ? 8   VAL A CG2 1 
ATOM   39   N N   . ASN A 1 9   ? -12.498 78.864 35.098 1.00 44.78 ? 9   ASN A N   1 
ATOM   40   C CA  . ASN A 1 9   ? -13.416 77.830 34.628 1.00 43.40 ? 9   ASN A CA  1 
ATOM   41   C C   . ASN A 1 9   ? -12.713 76.494 34.690 1.00 41.34 ? 9   ASN A C   1 
ATOM   42   O O   . ASN A 1 9   ? -11.596 76.425 34.167 1.00 42.56 ? 9   ASN A O   1 
ATOM   43   C CB  . ASN A 1 9   ? -13.877 78.161 33.213 1.00 47.77 ? 9   ASN A CB  1 
ATOM   44   C CG  . ASN A 1 9   ? -15.390 78.056 33.199 1.00 51.95 ? 9   ASN A CG  1 
ATOM   45   O OD1 . ASN A 1 9   ? -15.894 76.957 33.433 1.00 53.16 ? 9   ASN A OD1 1 
ATOM   46   N ND2 . ASN A 1 9   ? -15.982 79.218 32.960 1.00 54.98 ? 9   ASN A ND2 1 
ATOM   47   N N   . THR A 1 10  ? -13.286 75.495 35.325 1.00 39.12 ? 10  THR A N   1 
ATOM   48   C CA  . THR A 1 10  ? -12.597 74.219 35.386 1.00 38.09 ? 10  THR A CA  1 
ATOM   49   C C   . THR A 1 10  ? -13.548 73.141 34.893 1.00 37.32 ? 10  THR A C   1 
ATOM   50   O O   . THR A 1 10  ? -14.737 73.398 34.746 1.00 37.42 ? 10  THR A O   1 
ATOM   51   C CB  . THR A 1 10  ? -12.109 73.816 36.802 1.00 36.73 ? 10  THR A CB  1 
ATOM   52   O OG1 . THR A 1 10  ? -13.250 73.394 37.568 1.00 35.00 ? 10  THR A OG1 1 
ATOM   53   C CG2 . THR A 1 10  ? -11.411 74.959 37.506 1.00 33.43 ? 10  THR A CG2 1 
ATOM   54   N N   . LYS A 1 11  ? -13.037 71.938 34.728 1.00 37.18 ? 11  LYS A N   1 
ATOM   55   C CA  . LYS A 1 11  ? -13.843 70.811 34.295 1.00 37.44 ? 11  LYS A CA  1 
ATOM   56   C C   . LYS A 1 11  ? -14.828 70.393 35.367 1.00 38.63 ? 11  LYS A C   1 
ATOM   57   O O   . LYS A 1 11  ? -15.629 69.479 35.144 1.00 39.53 ? 11  LYS A O   1 
ATOM   58   C CB  . LYS A 1 11  ? -12.900 69.659 33.921 1.00 34.96 ? 11  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 11  ? -11.786 70.169 32.996 1.00 33.78 ? 11  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 11  ? -11.129 69.012 32.278 1.00 31.91 ? 11  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 11  ? -9.808  69.362 31.625 1.00 27.22 ? 11  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 11  ? -8.945  68.139 31.634 1.00 28.49 ? 11  LYS A NZ  1 
ATOM   63   N N   . SER A 1 12  ? -14.774 71.022 36.538 1.00 38.89 ? 12  SER A N   1 
ATOM   64   C CA  . SER A 1 12  ? -15.679 70.654 37.631 1.00 39.03 ? 12  SER A CA  1 
ATOM   65   C C   . SER A 1 12  ? -16.724 71.736 37.830 1.00 38.71 ? 12  SER A C   1 
ATOM   66   O O   . SER A 1 12  ? -17.772 71.507 38.432 1.00 39.87 ? 12  SER A O   1 
ATOM   67   C CB  . SER A 1 12  ? -14.881 70.403 38.912 1.00 38.79 ? 12  SER A CB  1 
ATOM   68   O OG  . SER A 1 12  ? -14.166 69.177 38.822 1.00 39.85 ? 12  SER A OG  1 
ATOM   69   N N   . GLY A 1 13  ? -16.437 72.919 37.306 1.00 38.33 ? 13  GLY A N   1 
ATOM   70   C CA  . GLY A 1 13  ? -17.377 74.032 37.427 1.00 38.46 ? 13  GLY A CA  1 
ATOM   71   C C   . GLY A 1 13  ? -16.568 75.318 37.517 1.00 38.74 ? 13  GLY A C   1 
ATOM   72   O O   . GLY A 1 13  ? -15.337 75.259 37.480 1.00 39.09 ? 13  GLY A O   1 
ATOM   73   N N   . LYS A 1 14  ? -17.266 76.437 37.604 1.00 39.70 ? 14  LYS A N   1 
ATOM   74   C CA  . LYS A 1 14  ? -16.542 77.708 37.705 1.00 41.45 ? 14  LYS A CA  1 
ATOM   75   C C   . LYS A 1 14  ? -16.225 77.933 39.187 1.00 41.43 ? 14  LYS A C   1 
ATOM   76   O O   . LYS A 1 14  ? -16.957 77.499 40.071 1.00 41.70 ? 14  LYS A O   1 
ATOM   77   C CB  . LYS A 1 14  ? -17.310 78.882 37.125 1.00 44.46 ? 14  LYS A CB  1 
ATOM   78   C CG  . LYS A 1 14  ? -17.648 78.752 35.653 1.00 48.12 ? 14  LYS A CG  1 
ATOM   79   C CD  . LYS A 1 14  ? -18.063 80.085 35.047 1.00 51.10 ? 14  LYS A CD  1 
ATOM   80   C CE  . LYS A 1 14  ? -19.359 79.958 34.264 1.00 54.79 ? 14  LYS A CE  1 
ATOM   81   N NZ  . LYS A 1 14  ? -20.092 78.691 34.541 1.00 56.35 ? 14  LYS A NZ  1 
ATOM   82   N N   . VAL A 1 15  ? -15.094 78.559 39.426 1.00 41.60 ? 15  VAL A N   1 
ATOM   83   C CA  . VAL A 1 15  ? -14.585 78.821 40.751 1.00 41.99 ? 15  VAL A CA  1 
ATOM   84   C C   . VAL A 1 15  ? -14.269 80.298 40.893 1.00 42.47 ? 15  VAL A C   1 
ATOM   85   O O   . VAL A 1 15  ? -13.727 80.883 39.953 1.00 42.40 ? 15  VAL A O   1 
ATOM   86   C CB  . VAL A 1 15  ? -13.314 77.994 41.032 1.00 40.62 ? 15  VAL A CB  1 
ATOM   87   C CG1 . VAL A 1 15  ? -12.543 78.544 42.216 1.00 40.90 ? 15  VAL A CG1 1 
ATOM   88   C CG2 . VAL A 1 15  ? -13.689 76.544 41.274 1.00 40.55 ? 15  VAL A CG2 1 
ATOM   89   N N   . MET A 1 16  ? -14.616 80.862 42.049 1.00 43.04 ? 16  MET A N   1 
ATOM   90   C CA  . MET A 1 16  ? -14.288 82.272 42.247 1.00 44.36 ? 16  MET A CA  1 
ATOM   91   C C   . MET A 1 16  ? -13.310 82.388 43.423 1.00 44.24 ? 16  MET A C   1 
ATOM   92   O O   . MET A 1 16  ? -13.629 82.035 44.554 1.00 44.00 ? 16  MET A O   1 
ATOM   93   C CB  . MET A 1 16  ? -15.500 83.162 42.484 1.00 48.99 ? 16  MET A CB  1 
ATOM   94   C CG  . MET A 1 16  ? -15.077 84.573 42.878 1.00 55.96 ? 16  MET A CG  1 
ATOM   95   S SD  . MET A 1 16  ? -15.749 85.850 41.809 1.00 63.92 ? 16  MET A SD  1 
ATOM   96   C CE  . MET A 1 16  ? -14.277 86.345 40.914 1.00 62.39 ? 16  MET A CE  1 
ATOM   97   N N   . GLY A 1 17  ? -12.133 82.878 43.086 1.00 43.87 ? 17  GLY A N   1 
ATOM   98   C CA  . GLY A 1 17  ? -11.066 83.061 44.044 1.00 44.92 ? 17  GLY A CA  1 
ATOM   99   C C   . GLY A 1 17  ? -11.245 84.405 44.749 1.00 45.84 ? 17  GLY A C   1 
ATOM   100  O O   . GLY A 1 17  ? -12.320 84.990 44.740 1.00 45.64 ? 17  GLY A O   1 
ATOM   101  N N   . THR A 1 18  ? -10.150 84.850 45.338 1.00 46.30 ? 18  THR A N   1 
ATOM   102  C CA  . THR A 1 18  ? -10.087 86.096 46.076 1.00 47.34 ? 18  THR A CA  1 
ATOM   103  C C   . THR A 1 18  ? -8.696  86.684 45.918 1.00 47.44 ? 18  THR A C   1 
ATOM   104  O O   . THR A 1 18  ? -7.751  85.927 45.722 1.00 47.05 ? 18  THR A O   1 
ATOM   105  C CB  . THR A 1 18  ? -10.418 85.865 47.559 1.00 48.78 ? 18  THR A CB  1 
ATOM   106  O OG1 . THR A 1 18  ? -10.665 87.118 48.186 1.00 49.50 ? 18  THR A OG1 1 
ATOM   107  C CG2 . THR A 1 18  ? -9.260  85.161 48.256 1.00 48.52 ? 18  THR A CG2 1 
ATOM   108  N N   . ARG A 1 19  ? -8.581  88.000 45.958 1.00 48.45 ? 19  ARG A N   1 
ATOM   109  C CA  . ARG A 1 19  ? -7.263  88.616 45.785 1.00 49.76 ? 19  ARG A CA  1 
ATOM   110  C C   . ARG A 1 19  ? -6.610  88.733 47.152 1.00 49.54 ? 19  ARG A C   1 
ATOM   111  O O   . ARG A 1 19  ? -7.227  89.295 48.060 1.00 50.09 ? 19  ARG A O   1 
ATOM   112  C CB  . ARG A 1 19  ? -7.386  89.966 45.081 1.00 53.82 ? 19  ARG A CB  1 
ATOM   113  C CG  . ARG A 1 19  ? -6.073  90.710 44.884 1.00 59.17 ? 19  ARG A CG  1 
ATOM   114  C CD  . ARG A 1 19  ? -6.094  91.669 43.708 1.00 62.97 ? 19  ARG A CD  1 
ATOM   115  N NE  . ARG A 1 19  ? -4.804  92.281 43.416 1.00 66.66 ? 19  ARG A NE  1 
ATOM   116  C CZ  . ARG A 1 19  ? -3.774  91.756 42.760 1.00 68.18 ? 19  ARG A CZ  1 
ATOM   117  N NH1 . ARG A 1 19  ? -3.822  90.511 42.294 1.00 68.77 ? 19  ARG A NH1 1 
ATOM   118  N NH2 . ARG A 1 19  ? -2.645  92.443 42.592 1.00 67.83 ? 19  ARG A NH2 1 
ATOM   119  N N   . VAL A 1 20  ? -5.400  88.210 47.324 1.00 49.50 ? 20  VAL A N   1 
ATOM   120  C CA  . VAL A 1 20  ? -4.773  88.321 48.641 1.00 48.73 ? 20  VAL A CA  1 
ATOM   121  C C   . VAL A 1 20  ? -3.490  89.137 48.563 1.00 48.13 ? 20  VAL A C   1 
ATOM   122  O O   . VAL A 1 20  ? -2.658  88.994 47.675 1.00 47.39 ? 20  VAL A O   1 
ATOM   123  C CB  . VAL A 1 20  ? -4.459  86.957 49.284 1.00 49.79 ? 20  VAL A CB  1 
ATOM   124  C CG1 . VAL A 1 20  ? -5.699  86.069 49.255 1.00 51.47 ? 20  VAL A CG1 1 
ATOM   125  C CG2 . VAL A 1 20  ? -3.293  86.266 48.595 1.00 49.00 ? 20  VAL A CG2 1 
ATOM   126  N N   . PRO A 1 21  ? -3.343  90.029 49.530 1.00 48.44 ? 21  PRO A N   1 
ATOM   127  C CA  . PRO A 1 21  ? -2.155  90.854 49.651 1.00 48.11 ? 21  PRO A CA  1 
ATOM   128  C C   . PRO A 1 21  ? -1.007  89.956 50.050 1.00 47.99 ? 21  PRO A C   1 
ATOM   129  O O   . PRO A 1 21  ? -1.174  89.008 50.818 1.00 47.20 ? 21  PRO A O   1 
ATOM   130  C CB  . PRO A 1 21  ? -2.510  91.901 50.681 1.00 48.49 ? 21  PRO A CB  1 
ATOM   131  C CG  . PRO A 1 21  ? -3.507  91.207 51.550 1.00 49.00 ? 21  PRO A CG  1 
ATOM   132  C CD  . PRO A 1 21  ? -4.283  90.277 50.653 1.00 48.74 ? 21  PRO A CD  1 
ATOM   133  N N   . VAL A 1 22  ? 0.158   90.229 49.496 1.00 48.22 ? 22  VAL A N   1 
ATOM   134  C CA  . VAL A 1 22  ? 1.361   89.477 49.752 1.00 49.02 ? 22  VAL A CA  1 
ATOM   135  C C   . VAL A 1 22  ? 2.507   90.495 49.726 1.00 49.94 ? 22  VAL A C   1 
ATOM   136  O O   . VAL A 1 22  ? 2.682   91.136 48.694 1.00 49.03 ? 22  VAL A O   1 
ATOM   137  C CB  . VAL A 1 22  ? 1.722   88.372 48.753 1.00 48.16 ? 22  VAL A CB  1 
ATOM   138  C CG1 . VAL A 1 22  ? 2.872   87.548 49.334 1.00 46.49 ? 22  VAL A CG1 1 
ATOM   139  C CG2 . VAL A 1 22  ? 0.543   87.482 48.422 1.00 49.30 ? 22  VAL A CG2 1 
ATOM   140  N N   . LEU A 1 23  ? 3.202   90.589 50.855 1.00 50.93 ? 23  LEU A N   1 
ATOM   141  C CA  . LEU A 1 23  ? 4.285   91.574 50.925 1.00 52.12 ? 23  LEU A CA  1 
ATOM   142  C C   . LEU A 1 23  ? 3.729   92.877 50.367 1.00 52.99 ? 23  LEU A C   1 
ATOM   143  O O   . LEU A 1 23  ? 2.640   93.294 50.802 1.00 52.85 ? 23  LEU A O   1 
ATOM   144  C CB  . LEU A 1 23  ? 5.514   91.017 50.220 1.00 53.51 ? 23  LEU A CB  1 
ATOM   145  C CG  . LEU A 1 23  ? 6.017   89.683 50.796 1.00 54.74 ? 23  LEU A CG  1 
ATOM   146  C CD1 . LEU A 1 23  ? 7.161   89.102 49.987 1.00 54.46 ? 23  LEU A CD1 1 
ATOM   147  C CD2 . LEU A 1 23  ? 6.465   89.850 52.245 1.00 56.13 ? 23  LEU A CD2 1 
ATOM   148  N N   . SER A 1 24  ? 4.393   93.527 49.426 1.00 53.67 ? 24  SER A N   1 
ATOM   149  C CA  . SER A 1 24  ? 3.859   94.786 48.909 1.00 55.33 ? 24  SER A CA  1 
ATOM   150  C C   . SER A 1 24  ? 3.052   94.670 47.628 1.00 55.26 ? 24  SER A C   1 
ATOM   151  O O   . SER A 1 24  ? 3.003   95.617 46.836 1.00 56.16 ? 24  SER A O   1 
ATOM   152  C CB  . SER A 1 24  ? 5.061   95.718 48.664 1.00 58.33 ? 24  SER A CB  1 
ATOM   153  O OG  . SER A 1 24  ? 6.031   94.986 47.922 1.00 61.11 ? 24  SER A OG  1 
ATOM   154  N N   . SER A 1 25  ? 2.451   93.526 47.372 1.00 54.67 ? 25  SER A N   1 
ATOM   155  C CA  . SER A 1 25  ? 1.695   93.250 46.169 1.00 53.46 ? 25  SER A CA  1 
ATOM   156  C C   . SER A 1 25  ? 0.483   92.394 46.508 1.00 52.87 ? 25  SER A C   1 
ATOM   157  O O   . SER A 1 25  ? 0.004   92.398 47.648 1.00 53.01 ? 25  SER A O   1 
ATOM   158  C CB  . SER A 1 25  ? 2.581   92.544 45.138 1.00 54.49 ? 25  SER A CB  1 
ATOM   159  O OG  . SER A 1 25  ? 1.925   92.444 43.883 1.00 55.24 ? 25  SER A OG  1 
ATOM   160  N N   . HIS A 1 26  ? -0.018  91.667 45.518 1.00 51.66 ? 26  HIS A N   1 
ATOM   161  C CA  . HIS A 1 26  ? -1.163  90.798 45.725 1.00 50.97 ? 26  HIS A CA  1 
ATOM   162  C C   . HIS A 1 26  ? -1.046  89.600 44.780 1.00 49.37 ? 26  HIS A C   1 
ATOM   163  O O   . HIS A 1 26  ? -0.216  89.558 43.882 1.00 49.61 ? 26  HIS A O   1 
ATOM   164  C CB  . HIS A 1 26  ? -2.501  91.450 45.462 1.00 56.22 ? 26  HIS A CB  1 
ATOM   165  C CG  . HIS A 1 26  ? -3.066  92.446 46.406 1.00 62.10 ? 26  HIS A CG  1 
ATOM   166  N ND1 . HIS A 1 26  ? -2.582  93.734 46.526 1.00 64.21 ? 26  HIS A ND1 1 
ATOM   167  C CD2 . HIS A 1 26  ? -4.135  92.369 47.244 1.00 64.13 ? 26  HIS A CD2 1 
ATOM   168  C CE1 . HIS A 1 26  ? -3.312  94.391 47.413 1.00 66.06 ? 26  HIS A CE1 1 
ATOM   169  N NE2 . HIS A 1 26  ? -4.262  93.586 47.865 1.00 65.95 ? 26  HIS A NE2 1 
ATOM   170  N N   . ILE A 1 27  ? -1.869  88.595 45.034 1.00 47.66 ? 27  ILE A N   1 
ATOM   171  C CA  . ILE A 1 27  ? -1.920  87.415 44.205 1.00 45.16 ? 27  ILE A CA  1 
ATOM   172  C C   . ILE A 1 27  ? -3.333  86.847 44.365 1.00 43.87 ? 27  ILE A C   1 
ATOM   173  O O   . ILE A 1 27  ? -4.113  87.367 45.166 1.00 43.90 ? 27  ILE A O   1 
ATOM   174  C CB  . ILE A 1 27  ? -0.922  86.313 44.511 1.00 46.95 ? 27  ILE A CB  1 
ATOM   175  C CG1 . ILE A 1 27  ? -1.099  85.791 45.945 1.00 47.54 ? 27  ILE A CG1 1 
ATOM   176  C CG2 . ILE A 1 27  ? 0.513   86.792 44.305 1.00 48.48 ? 27  ILE A CG2 1 
ATOM   177  C CD1 . ILE A 1 27  ? -0.212  84.561 46.127 1.00 49.56 ? 27  ILE A CD1 1 
ATOM   178  N N   . SER A 1 28  ? -3.600  85.834 43.554 1.00 41.81 ? 28  SER A N   1 
ATOM   179  C CA  . SER A 1 28  ? -4.926  85.245 43.604 1.00 40.34 ? 28  SER A CA  1 
ATOM   180  C C   . SER A 1 28  ? -4.886  83.982 44.460 1.00 39.10 ? 28  SER A C   1 
ATOM   181  O O   . SER A 1 28  ? -3.861  83.297 44.489 1.00 38.93 ? 28  SER A O   1 
ATOM   182  C CB  . SER A 1 28  ? -5.448  84.897 42.209 1.00 42.06 ? 28  SER A CB  1 
ATOM   183  O OG  . SER A 1 28  ? -5.264  85.935 41.283 1.00 41.76 ? 28  SER A OG  1 
ATOM   184  N N   . ALA A 1 29  ? -6.007  83.710 45.103 1.00 37.94 ? 29  ALA A N   1 
ATOM   185  C CA  . ALA A 1 29  ? -6.112  82.529 45.937 1.00 37.86 ? 29  ALA A CA  1 
ATOM   186  C C   . ALA A 1 29  ? -7.486  81.901 45.710 1.00 36.92 ? 29  ALA A C   1 
ATOM   187  O O   . ALA A 1 29  ? -8.511  82.576 45.697 1.00 37.05 ? 29  ALA A O   1 
ATOM   188  C CB  . ALA A 1 29  ? -5.913  82.828 47.418 1.00 38.41 ? 29  ALA A CB  1 
ATOM   189  N N   . PHE A 1 30  ? -7.445  80.605 45.500 1.00 35.79 ? 30  PHE A N   1 
ATOM   190  C CA  . PHE A 1 30  ? -8.667  79.831 45.276 1.00 35.79 ? 30  PHE A CA  1 
ATOM   191  C C   . PHE A 1 30  ? -8.627  78.905 46.480 1.00 35.18 ? 30  PHE A C   1 
ATOM   192  O O   . PHE A 1 30  ? -7.869  77.939 46.494 1.00 35.19 ? 30  PHE A O   1 
ATOM   193  C CB  . PHE A 1 30  ? -8.682  79.166 43.903 1.00 35.10 ? 30  PHE A CB  1 
ATOM   194  C CG  . PHE A 1 30  ? -8.713  80.184 42.787 1.00 34.49 ? 30  PHE A CG  1 
ATOM   195  C CD1 . PHE A 1 30  ? -7.543  80.779 42.347 1.00 32.20 ? 30  PHE A CD1 1 
ATOM   196  C CD2 . PHE A 1 30  ? -9.921  80.549 42.206 1.00 33.64 ? 30  PHE A CD2 1 
ATOM   197  C CE1 . PHE A 1 30  ? -7.586  81.723 41.338 1.00 32.63 ? 30  PHE A CE1 1 
ATOM   198  C CE2 . PHE A 1 30  ? -9.950  81.490 41.192 1.00 31.42 ? 30  PHE A CE2 1 
ATOM   199  C CZ  . PHE A 1 30  ? -8.788  82.086 40.764 1.00 29.88 ? 30  PHE A CZ  1 
ATOM   200  N N   . LEU A 1 31  ? -9.391  79.282 47.502 1.00 35.33 ? 31  LEU A N   1 
ATOM   201  C CA  . LEU A 1 31  ? -9.344  78.480 48.723 1.00 34.09 ? 31  LEU A CA  1 
ATOM   202  C C   . LEU A 1 31  ? -10.541 77.588 48.865 1.00 33.61 ? 31  LEU A C   1 
ATOM   203  O O   . LEU A 1 31  ? -11.664 78.007 48.609 1.00 33.37 ? 31  LEU A O   1 
ATOM   204  C CB  . LEU A 1 31  ? -9.216  79.429 49.939 1.00 33.55 ? 31  LEU A CB  1 
ATOM   205  C CG  . LEU A 1 31  ? -8.114  80.484 49.772 1.00 32.04 ? 31  LEU A CG  1 
ATOM   206  C CD1 . LEU A 1 31  ? -8.082  81.460 50.939 1.00 30.79 ? 31  LEU A CD1 1 
ATOM   207  C CD2 . LEU A 1 31  ? -6.767  79.807 49.603 1.00 30.62 ? 31  LEU A CD2 1 
ATOM   208  N N   . GLY A 1 32  ? -10.269 76.356 49.293 1.00 34.12 ? 32  GLY A N   1 
ATOM   209  C CA  . GLY A 1 32  ? -11.354 75.431 49.519 1.00 34.99 ? 32  GLY A CA  1 
ATOM   210  C C   . GLY A 1 32  ? -12.061 74.863 48.312 1.00 35.86 ? 32  GLY A C   1 
ATOM   211  O O   . GLY A 1 32  ? -13.304 74.750 48.334 1.00 36.74 ? 32  GLY A O   1 
ATOM   212  N N   . ILE A 1 33  ? -11.300 74.439 47.301 1.00 35.32 ? 33  ILE A N   1 
ATOM   213  C CA  . ILE A 1 33  ? -11.951 73.811 46.148 1.00 34.92 ? 33  ILE A CA  1 
ATOM   214  C C   . ILE A 1 33  ? -12.180 72.349 46.468 1.00 34.16 ? 33  ILE A C   1 
ATOM   215  O O   . ILE A 1 33  ? -11.242 71.641 46.814 1.00 34.42 ? 33  ILE A O   1 
ATOM   216  C CB  . ILE A 1 33  ? -11.099 73.942 44.872 1.00 35.17 ? 33  ILE A CB  1 
ATOM   217  C CG1 . ILE A 1 33  ? -10.896 75.421 44.534 1.00 34.74 ? 33  ILE A CG1 1 
ATOM   218  C CG2 . ILE A 1 33  ? -11.734 73.186 43.713 1.00 32.85 ? 33  ILE A CG2 1 
ATOM   219  C CD1 . ILE A 1 33  ? -9.613  75.671 43.766 1.00 36.70 ? 33  ILE A CD1 1 
ATOM   220  N N   . PRO A 1 34  ? -13.380 71.833 46.357 1.00 34.64 ? 34  PRO A N   1 
ATOM   221  C CA  . PRO A 1 34  ? -13.650 70.432 46.610 1.00 34.94 ? 34  PRO A CA  1 
ATOM   222  C C   . PRO A 1 34  ? -13.029 69.582 45.515 1.00 36.17 ? 34  PRO A C   1 
ATOM   223  O O   . PRO A 1 34  ? -13.145 69.989 44.344 1.00 36.72 ? 34  PRO A O   1 
ATOM   224  C CB  . PRO A 1 34  ? -15.161 70.359 46.658 1.00 34.78 ? 34  PRO A CB  1 
ATOM   225  C CG  . PRO A 1 34  ? -15.632 71.499 45.815 1.00 34.79 ? 34  PRO A CG  1 
ATOM   226  C CD  . PRO A 1 34  ? -14.590 72.576 45.911 1.00 35.09 ? 34  PRO A CD  1 
ATOM   227  N N   . PHE A 1 35  ? -12.387 68.460 45.828 1.00 35.40 ? 35  PHE A N   1 
ATOM   228  C CA  . PHE A 1 35  ? -11.789 67.629 44.789 1.00 34.80 ? 35  PHE A CA  1 
ATOM   229  C C   . PHE A 1 35  ? -12.341 66.214 44.908 1.00 34.11 ? 35  PHE A C   1 
ATOM   230  O O   . PHE A 1 35  ? -11.910 65.297 44.208 1.00 34.75 ? 35  PHE A O   1 
ATOM   231  C CB  . PHE A 1 35  ? -10.268 67.601 44.850 1.00 36.78 ? 35  PHE A CB  1 
ATOM   232  C CG  . PHE A 1 35  ? -9.689  67.055 46.127 1.00 35.80 ? 35  PHE A CG  1 
ATOM   233  C CD1 . PHE A 1 35  ? -9.701  65.695 46.386 1.00 35.90 ? 35  PHE A CD1 1 
ATOM   234  C CD2 . PHE A 1 35  ? -9.179  67.927 47.080 1.00 34.92 ? 35  PHE A CD2 1 
ATOM   235  C CE1 . PHE A 1 35  ? -9.182  65.206 47.578 1.00 37.33 ? 35  PHE A CE1 1 
ATOM   236  C CE2 . PHE A 1 35  ? -8.638  67.434 48.250 1.00 33.64 ? 35  PHE A CE2 1 
ATOM   237  C CZ  . PHE A 1 35  ? -8.637  66.078 48.500 1.00 33.71 ? 35  PHE A CZ  1 
ATOM   238  N N   . ALA A 1 36  ? -13.328 66.069 45.785 1.00 33.41 ? 36  ALA A N   1 
ATOM   239  C CA  . ALA A 1 36  ? -13.963 64.769 45.972 1.00 32.92 ? 36  ALA A CA  1 
ATOM   240  C C   . ALA A 1 36  ? -15.327 64.922 46.601 1.00 33.38 ? 36  ALA A C   1 
ATOM   241  O O   . ALA A 1 36  ? -15.680 65.990 47.095 1.00 33.61 ? 36  ALA A O   1 
ATOM   242  C CB  . ALA A 1 36  ? -13.098 63.890 46.871 1.00 31.80 ? 36  ALA A CB  1 
ATOM   243  N N   . GLU A 1 37  ? -16.110 63.852 46.626 1.00 34.29 ? 37  GLU A N   1 
ATOM   244  C CA  . GLU A 1 37  ? -17.378 63.929 47.351 1.00 35.02 ? 37  GLU A CA  1 
ATOM   245  C C   . GLU A 1 37  ? -17.065 63.848 48.851 1.00 35.86 ? 37  GLU A C   1 
ATOM   246  O O   . GLU A 1 37  ? -16.180 63.078 49.260 1.00 34.07 ? 37  GLU A O   1 
ATOM   247  C CB  . GLU A 1 37  ? -18.290 62.791 46.939 1.00 36.05 ? 37  GLU A CB  1 
ATOM   248  C CG  . GLU A 1 37  ? -18.835 62.917 45.517 1.00 40.81 ? 37  GLU A CG  1 
ATOM   249  C CD  . GLU A 1 37  ? -19.693 64.163 45.394 1.00 42.16 ? 37  GLU A CD  1 
ATOM   250  O OE1 . GLU A 1 37  ? -20.755 64.186 46.045 1.00 44.59 ? 37  GLU A OE1 1 
ATOM   251  O OE2 . GLU A 1 37  ? -19.322 65.109 44.683 1.00 43.87 ? 37  GLU A OE2 1 
ATOM   252  N N   . PRO A 1 38  ? -17.756 64.603 49.684 1.00 36.29 ? 38  PRO A N   1 
ATOM   253  C CA  . PRO A 1 38  ? -17.560 64.582 51.130 1.00 36.74 ? 38  PRO A CA  1 
ATOM   254  C C   . PRO A 1 38  ? -17.626 63.159 51.631 1.00 36.39 ? 38  PRO A C   1 
ATOM   255  O O   . PRO A 1 38  ? -18.632 62.480 51.416 1.00 36.45 ? 38  PRO A O   1 
ATOM   256  C CB  . PRO A 1 38  ? -18.683 65.441 51.677 1.00 36.45 ? 38  PRO A CB  1 
ATOM   257  C CG  . PRO A 1 38  ? -18.943 66.400 50.555 1.00 37.11 ? 38  PRO A CG  1 
ATOM   258  C CD  . PRO A 1 38  ? -18.836 65.544 49.303 1.00 36.64 ? 38  PRO A CD  1 
ATOM   259  N N   . PRO A 1 39  ? -16.591 62.655 52.276 1.00 36.35 ? 39  PRO A N   1 
ATOM   260  C CA  . PRO A 1 39  ? -16.547 61.290 52.749 1.00 37.29 ? 39  PRO A CA  1 
ATOM   261  C C   . PRO A 1 39  ? -17.286 61.045 54.054 1.00 38.59 ? 39  PRO A C   1 
ATOM   262  O O   . PRO A 1 39  ? -16.776 60.428 54.988 1.00 39.00 ? 39  PRO A O   1 
ATOM   263  C CB  . PRO A 1 39  ? -15.060 61.006 52.875 1.00 36.86 ? 39  PRO A CB  1 
ATOM   264  C CG  . PRO A 1 39  ? -14.392 62.324 52.992 1.00 36.87 ? 39  PRO A CG  1 
ATOM   265  C CD  . PRO A 1 39  ? -15.351 63.397 52.574 1.00 36.61 ? 39  PRO A CD  1 
ATOM   266  N N   . VAL A 1 40  ? -18.520 61.513 54.134 1.00 39.54 ? 40  VAL A N   1 
ATOM   267  C CA  . VAL A 1 40  ? -19.367 61.376 55.297 1.00 40.84 ? 40  VAL A CA  1 
ATOM   268  C C   . VAL A 1 40  ? -20.357 60.234 55.175 1.00 41.43 ? 40  VAL A C   1 
ATOM   269  O O   . VAL A 1 40  ? -20.441 59.510 54.178 1.00 42.17 ? 40  VAL A O   1 
ATOM   270  C CB  . VAL A 1 40  ? -20.125 62.699 55.511 1.00 42.51 ? 40  VAL A CB  1 
ATOM   271  C CG1 . VAL A 1 40  ? -19.136 63.850 55.432 1.00 41.94 ? 40  VAL A CG1 1 
ATOM   272  C CG2 . VAL A 1 40  ? -21.229 62.827 54.481 1.00 43.91 ? 40  VAL A CG2 1 
ATOM   273  N N   . GLY A 1 41  ? -21.112 60.052 56.253 1.00 41.29 ? 41  GLY A N   1 
ATOM   274  C CA  . GLY A 1 41  ? -22.110 59.004 56.355 1.00 40.77 ? 41  GLY A CA  1 
ATOM   275  C C   . GLY A 1 41  ? -21.518 57.642 56.050 1.00 41.18 ? 41  GLY A C   1 
ATOM   276  O O   . GLY A 1 41  ? -20.450 57.271 56.534 1.00 40.98 ? 41  GLY A O   1 
ATOM   277  N N   . ASN A 1 42  ? -22.214 56.874 55.207 1.00 41.47 ? 42  ASN A N   1 
ATOM   278  C CA  . ASN A 1 42  ? -21.706 55.538 54.863 1.00 41.11 ? 42  ASN A CA  1 
ATOM   279  C C   . ASN A 1 42  ? -20.489 55.597 53.953 1.00 40.20 ? 42  ASN A C   1 
ATOM   280  O O   . ASN A 1 42  ? -19.939 54.552 53.604 1.00 39.63 ? 42  ASN A O   1 
ATOM   281  C CB  . ASN A 1 42  ? -22.868 54.729 54.284 1.00 44.04 ? 42  ASN A CB  1 
ATOM   282  C CG  . ASN A 1 42  ? -23.727 54.174 55.424 1.00 44.23 ? 42  ASN A CG  1 
ATOM   283  N N   . MET A 1 43  ? -19.990 56.784 53.634 1.00 40.10 ? 43  MET A N   1 
ATOM   284  C CA  . MET A 1 43  ? -18.783 56.935 52.832 1.00 41.20 ? 43  MET A CA  1 
ATOM   285  C C   . MET A 1 43  ? -17.542 56.904 53.732 1.00 40.56 ? 43  MET A C   1 
ATOM   286  O O   . MET A 1 43  ? -16.404 56.744 53.276 1.00 40.98 ? 43  MET A O   1 
ATOM   287  C CB  . MET A 1 43  ? -18.792 58.234 52.038 1.00 46.24 ? 43  MET A CB  1 
ATOM   288  C CG  . MET A 1 43  ? -19.879 58.393 50.984 1.00 51.30 ? 43  MET A CG  1 
ATOM   289  S SD  . MET A 1 43  ? -19.193 58.885 49.390 1.00 57.95 ? 43  MET A SD  1 
ATOM   290  C CE  . MET A 1 43  ? -19.521 60.637 49.367 1.00 56.92 ? 43  MET A CE  1 
ATOM   291  N N   . ARG A 1 44  ? -17.767 57.064 55.038 1.00 38.96 ? 44  ARG A N   1 
ATOM   292  C CA  . ARG A 1 44  ? -16.666 57.057 55.990 1.00 37.22 ? 44  ARG A CA  1 
ATOM   293  C C   . ARG A 1 44  ? -15.854 55.784 55.824 1.00 35.72 ? 44  ARG A C   1 
ATOM   294  O O   . ARG A 1 44  ? -16.397 54.679 55.801 1.00 35.81 ? 44  ARG A O   1 
ATOM   295  C CB  . ARG A 1 44  ? -17.184 57.211 57.427 1.00 38.62 ? 44  ARG A CB  1 
ATOM   296  C CG  . ARG A 1 44  ? -16.044 57.159 58.446 1.00 39.19 ? 44  ARG A CG  1 
ATOM   297  C CD  . ARG A 1 44  ? -16.584 57.008 59.861 1.00 38.64 ? 44  ARG A CD  1 
ATOM   298  N NE  . ARG A 1 44  ? -17.041 58.307 60.350 1.00 37.56 ? 44  ARG A NE  1 
ATOM   299  C CZ  . ARG A 1 44  ? -17.710 58.433 61.492 1.00 37.10 ? 44  ARG A CZ  1 
ATOM   300  N NH1 . ARG A 1 44  ? -17.956 57.338 62.201 1.00 37.44 ? 44  ARG A NH1 1 
ATOM   301  N NH2 . ARG A 1 44  ? -18.109 59.636 61.875 1.00 35.90 ? 44  ARG A NH2 1 
ATOM   302  N N   . PHE A 1 45  ? -14.542 55.921 55.708 1.00 34.71 ? 45  PHE A N   1 
ATOM   303  C CA  . PHE A 1 45  ? -13.610 54.823 55.525 1.00 34.70 ? 45  PHE A CA  1 
ATOM   304  C C   . PHE A 1 45  ? -13.502 54.374 54.062 1.00 34.24 ? 45  PHE A C   1 
ATOM   305  O O   . PHE A 1 45  ? -12.578 53.625 53.749 1.00 33.13 ? 45  PHE A O   1 
ATOM   306  C CB  . PHE A 1 45  ? -13.955 53.585 56.373 1.00 36.97 ? 45  PHE A CB  1 
ATOM   307  C CG  . PHE A 1 45  ? -14.070 53.855 57.845 1.00 40.20 ? 45  PHE A CG  1 
ATOM   308  C CD1 . PHE A 1 45  ? -13.155 54.657 58.505 1.00 41.05 ? 45  PHE A CD1 1 
ATOM   309  C CD2 . PHE A 1 45  ? -15.142 53.334 58.560 1.00 41.99 ? 45  PHE A CD2 1 
ATOM   310  C CE1 . PHE A 1 45  ? -13.296 54.917 59.859 1.00 43.54 ? 45  PHE A CE1 1 
ATOM   311  C CE2 . PHE A 1 45  ? -15.281 53.562 59.915 1.00 42.27 ? 45  PHE A CE2 1 
ATOM   312  C CZ  . PHE A 1 45  ? -14.356 54.372 60.558 1.00 43.47 ? 45  PHE A CZ  1 
ATOM   313  N N   . ARG A 1 46  ? -14.413 54.810 53.194 1.00 34.68 ? 46  ARG A N   1 
ATOM   314  C CA  . ARG A 1 46  ? -14.398 54.441 51.790 1.00 35.42 ? 46  ARG A CA  1 
ATOM   315  C C   . ARG A 1 46  ? -13.401 55.234 50.952 1.00 33.97 ? 46  ARG A C   1 
ATOM   316  O O   . ARG A 1 46  ? -13.055 56.380 51.241 1.00 33.39 ? 46  ARG A O   1 
ATOM   317  C CB  . ARG A 1 46  ? -15.767 54.667 51.129 1.00 40.06 ? 46  ARG A CB  1 
ATOM   318  C CG  . ARG A 1 46  ? -16.762 53.529 51.314 1.00 43.40 ? 46  ARG A CG  1 
ATOM   319  C CD  . ARG A 1 46  ? -17.939 53.768 50.374 1.00 47.49 ? 46  ARG A CD  1 
ATOM   320  N NE  . ARG A 1 46  ? -18.932 52.698 50.452 1.00 52.10 ? 46  ARG A NE  1 
ATOM   321  N N   . ARG A 1 47  ? -13.022 54.619 49.831 1.00 33.83 ? 47  ARG A N   1 
ATOM   322  C CA  . ARG A 1 47  ? -12.146 55.348 48.888 1.00 31.96 ? 47  ARG A CA  1 
ATOM   323  C C   . ARG A 1 47  ? -12.885 56.610 48.505 1.00 30.16 ? 47  ARG A C   1 
ATOM   324  O O   . ARG A 1 47  ? -14.118 56.656 48.491 1.00 30.44 ? 47  ARG A O   1 
ATOM   325  C CB  . ARG A 1 47  ? -11.801 54.452 47.725 1.00 36.32 ? 47  ARG A CB  1 
ATOM   326  C CG  . ARG A 1 47  ? -11.175 53.116 48.124 1.00 41.99 ? 47  ARG A CG  1 
ATOM   327  C CD  . ARG A 1 47  ? -10.701 52.377 46.881 1.00 45.10 ? 47  ARG A CD  1 
ATOM   328  N NE  . ARG A 1 47  ? -9.962  51.145 47.116 1.00 46.11 ? 47  ARG A NE  1 
ATOM   329  C CZ  . ARG A 1 47  ? -10.552 49.975 47.351 1.00 47.88 ? 47  ARG A CZ  1 
ATOM   330  N NH1 . ARG A 1 47  ? -11.876 49.884 47.389 1.00 47.33 ? 47  ARG A NH1 1 
ATOM   331  N NH2 . ARG A 1 47  ? -9.804  48.893 47.543 1.00 49.08 ? 47  ARG A NH2 1 
ATOM   332  N N   . PRO A 1 48  ? -12.185 57.688 48.228 1.00 30.13 ? 48  PRO A N   1 
ATOM   333  C CA  . PRO A 1 48  ? -12.838 58.928 47.845 1.00 31.09 ? 48  PRO A CA  1 
ATOM   334  C C   . PRO A 1 48  ? -13.506 58.809 46.482 1.00 33.11 ? 48  PRO A C   1 
ATOM   335  O O   . PRO A 1 48  ? -13.132 57.992 45.638 1.00 31.88 ? 48  PRO A O   1 
ATOM   336  C CB  . PRO A 1 48  ? -11.718 59.936 47.862 1.00 30.06 ? 48  PRO A CB  1 
ATOM   337  C CG  . PRO A 1 48  ? -10.502 59.132 47.546 1.00 29.65 ? 48  PRO A CG  1 
ATOM   338  C CD  . PRO A 1 48  ? -10.704 57.783 48.188 1.00 29.55 ? 48  PRO A CD  1 
ATOM   339  N N   . GLU A 1 49  ? -14.514 59.626 46.253 1.00 35.51 ? 49  GLU A N   1 
ATOM   340  C CA  . GLU A 1 49  ? -15.264 59.666 45.009 1.00 37.51 ? 49  GLU A CA  1 
ATOM   341  C C   . GLU A 1 49  ? -14.979 61.037 44.394 1.00 38.30 ? 49  GLU A C   1 
ATOM   342  O O   . GLU A 1 49  ? -14.920 62.015 45.136 1.00 37.40 ? 49  GLU A O   1 
ATOM   343  C CB  . GLU A 1 49  ? -16.753 59.487 45.201 1.00 41.25 ? 49  GLU A CB  1 
ATOM   344  C CG  . GLU A 1 49  ? -17.300 58.071 45.258 1.00 43.74 ? 49  GLU A CG  1 
ATOM   345  C CD  . GLU A 1 49  ? -18.777 58.112 45.644 1.00 45.91 ? 49  GLU A CD  1 
ATOM   346  N N   . PRO A 1 50  ? -14.770 61.073 43.093 1.00 39.76 ? 50  PRO A N   1 
ATOM   347  C CA  . PRO A 1 50  ? -14.528 62.317 42.384 1.00 40.67 ? 50  PRO A CA  1 
ATOM   348  C C   . PRO A 1 50  ? -15.669 63.273 42.677 1.00 41.24 ? 50  PRO A C   1 
ATOM   349  O O   . PRO A 1 50  ? -16.811 62.828 42.816 1.00 41.44 ? 50  PRO A O   1 
ATOM   350  C CB  . PRO A 1 50  ? -14.409 61.957 40.922 1.00 40.58 ? 50  PRO A CB  1 
ATOM   351  C CG  . PRO A 1 50  ? -14.813 60.539 40.808 1.00 40.41 ? 50  PRO A CG  1 
ATOM   352  C CD  . PRO A 1 50  ? -14.859 59.921 42.172 1.00 40.35 ? 50  PRO A CD  1 
ATOM   353  N N   . LYS A 1 51  ? -15.361 64.549 42.800 1.00 42.01 ? 51  LYS A N   1 
ATOM   354  C CA  . LYS A 1 51  ? -16.407 65.512 43.109 1.00 44.33 ? 51  LYS A CA  1 
ATOM   355  C C   . LYS A 1 51  ? -17.351 65.762 41.940 1.00 46.23 ? 51  LYS A C   1 
ATOM   356  O O   . LYS A 1 51  ? -16.929 66.195 40.866 1.00 47.07 ? 51  LYS A O   1 
ATOM   357  C CB  . LYS A 1 51  ? -15.731 66.818 43.548 1.00 40.63 ? 51  LYS A CB  1 
ATOM   358  C CG  . LYS A 1 51  ? -16.679 67.974 43.742 1.00 38.98 ? 51  LYS A CG  1 
ATOM   359  C CD  . LYS A 1 51  ? -17.714 67.729 44.831 1.00 36.70 ? 51  LYS A CD  1 
ATOM   360  C CE  . LYS A 1 51  ? -18.326 69.085 45.181 1.00 38.65 ? 51  LYS A CE  1 
ATOM   361  N NZ  . LYS A 1 51  ? -19.628 68.911 45.872 1.00 42.89 ? 51  LYS A NZ  1 
ATOM   362  N N   . LYS A 1 52  ? -18.643 65.529 42.143 1.00 47.44 ? 52  LYS A N   1 
ATOM   363  C CA  . LYS A 1 52  ? -19.622 65.785 41.095 1.00 49.05 ? 52  LYS A CA  1 
ATOM   364  C C   . LYS A 1 52  ? -19.505 67.239 40.656 1.00 49.38 ? 52  LYS A C   1 
ATOM   365  O O   . LYS A 1 52  ? -19.521 68.150 41.478 1.00 49.50 ? 52  LYS A O   1 
ATOM   366  C CB  . LYS A 1 52  ? -21.038 65.479 41.579 1.00 51.91 ? 52  LYS A CB  1 
ATOM   367  C CG  . LYS A 1 52  ? -21.313 63.982 41.673 1.00 56.76 ? 52  LYS A CG  1 
ATOM   368  C CD  . LYS A 1 52  ? -22.331 63.674 42.759 1.00 60.27 ? 52  LYS A CD  1 
ATOM   369  C CE  . LYS A 1 52  ? -22.470 62.175 42.983 1.00 63.07 ? 52  LYS A CE  1 
ATOM   370  N NZ  . LYS A 1 52  ? -23.509 61.899 44.025 1.00 65.42 ? 52  LYS A NZ  1 
ATOM   371  N N   . PRO A 1 53  ? -19.367 67.455 39.359 1.00 50.22 ? 53  PRO A N   1 
ATOM   372  C CA  . PRO A 1 53  ? -19.281 68.792 38.797 1.00 50.21 ? 53  PRO A CA  1 
ATOM   373  C C   . PRO A 1 53  ? -20.399 69.642 39.364 1.00 50.15 ? 53  PRO A C   1 
ATOM   374  O O   . PRO A 1 53  ? -21.470 69.099 39.659 1.00 49.63 ? 53  PRO A O   1 
ATOM   375  C CB  . PRO A 1 53  ? -19.372 68.599 37.301 1.00 50.11 ? 53  PRO A CB  1 
ATOM   376  C CG  . PRO A 1 53  ? -19.004 67.181 37.068 1.00 50.11 ? 53  PRO A CG  1 
ATOM   377  C CD  . PRO A 1 53  ? -19.390 66.415 38.298 1.00 50.19 ? 53  PRO A CD  1 
ATOM   378  N N   . TRP A 1 54  ? -20.155 70.934 39.533 1.00 50.09 ? 54  TRP A N   1 
ATOM   379  C CA  . TRP A 1 54  ? -21.216 71.762 40.105 1.00 50.64 ? 54  TRP A CA  1 
ATOM   380  C C   . TRP A 1 54  ? -21.652 72.839 39.124 1.00 52.08 ? 54  TRP A C   1 
ATOM   381  O O   . TRP A 1 54  ? -20.995 73.099 38.115 1.00 52.41 ? 54  TRP A O   1 
ATOM   382  C CB  . TRP A 1 54  ? -20.746 72.418 41.412 1.00 42.71 ? 54  TRP A CB  1 
ATOM   383  C CG  . TRP A 1 54  ? -19.528 73.268 41.194 1.00 38.43 ? 54  TRP A CG  1 
ATOM   384  C CD1 . TRP A 1 54  ? -19.485 74.564 40.766 1.00 37.29 ? 54  TRP A CD1 1 
ATOM   385  C CD2 . TRP A 1 54  ? -18.164 72.855 41.362 1.00 35.96 ? 54  TRP A CD2 1 
ATOM   386  N NE1 . TRP A 1 54  ? -18.173 74.993 40.663 1.00 36.45 ? 54  TRP A NE1 1 
ATOM   387  C CE2 . TRP A 1 54  ? -17.352 73.947 41.024 1.00 35.95 ? 54  TRP A CE2 1 
ATOM   388  C CE3 . TRP A 1 54  ? -17.561 71.663 41.773 1.00 35.26 ? 54  TRP A CE3 1 
ATOM   389  C CZ2 . TRP A 1 54  ? -15.963 73.886 41.097 1.00 36.13 ? 54  TRP A CZ2 1 
ATOM   390  C CZ3 . TRP A 1 54  ? -16.185 71.600 41.838 1.00 33.53 ? 54  TRP A CZ3 1 
ATOM   391  C CH2 . TRP A 1 54  ? -15.402 72.711 41.508 1.00 34.80 ? 54  TRP A CH2 1 
ATOM   392  N N   . SER A 1 55  ? -22.776 73.472 39.456 1.00 53.43 ? 55  SER A N   1 
ATOM   393  C CA  . SER A 1 55  ? -23.261 74.541 38.593 1.00 54.74 ? 55  SER A CA  1 
ATOM   394  C C   . SER A 1 55  ? -23.170 75.858 39.377 1.00 54.86 ? 55  SER A C   1 
ATOM   395  O O   . SER A 1 55  ? -23.352 75.898 40.600 1.00 55.18 ? 55  SER A O   1 
ATOM   396  C CB  . SER A 1 55  ? -24.683 74.364 38.081 1.00 58.35 ? 55  SER A CB  1 
ATOM   397  O OG  . SER A 1 55  ? -25.013 75.561 37.369 1.00 62.78 ? 55  SER A OG  1 
ATOM   398  N N   . GLY A 1 56  ? -22.875 76.903 38.611 1.00 54.42 ? 56  GLY A N   1 
ATOM   399  C CA  . GLY A 1 56  ? -22.748 78.226 39.216 1.00 53.24 ? 56  GLY A CA  1 
ATOM   400  C C   . GLY A 1 56  ? -21.292 78.384 39.638 1.00 52.54 ? 56  GLY A C   1 
ATOM   401  O O   . GLY A 1 56  ? -20.482 77.505 39.375 1.00 53.13 ? 56  GLY A O   1 
ATOM   402  N N   . VAL A 1 57  ? -20.987 79.505 40.270 1.00 51.95 ? 57  VAL A N   1 
ATOM   403  C CA  . VAL A 1 57  ? -19.630 79.765 40.710 1.00 50.17 ? 57  VAL A CA  1 
ATOM   404  C C   . VAL A 1 57  ? -19.423 79.248 42.125 1.00 49.59 ? 57  VAL A C   1 
ATOM   405  O O   . VAL A 1 57  ? -20.212 79.497 43.032 1.00 49.12 ? 57  VAL A O   1 
ATOM   406  C CB  . VAL A 1 57  ? -19.313 81.265 40.639 1.00 49.44 ? 57  VAL A CB  1 
ATOM   407  C CG1 . VAL A 1 57  ? -17.853 81.506 40.964 1.00 48.57 ? 57  VAL A CG1 1 
ATOM   408  C CG2 . VAL A 1 57  ? -19.670 81.788 39.255 1.00 49.23 ? 57  VAL A CG2 1 
ATOM   409  N N   . TRP A 1 58  ? -18.330 78.505 42.276 1.00 48.66 ? 58  TRP A N   1 
ATOM   410  C CA  . TRP A 1 58  ? -17.978 77.948 43.568 1.00 47.05 ? 58  TRP A CA  1 
ATOM   411  C C   . TRP A 1 58  ? -17.201 79.062 44.276 1.00 46.39 ? 58  TRP A C   1 
ATOM   412  O O   . TRP A 1 58  ? -16.270 79.565 43.652 1.00 46.04 ? 58  TRP A O   1 
ATOM   413  C CB  . TRP A 1 58  ? -17.133 76.694 43.490 1.00 45.80 ? 58  TRP A CB  1 
ATOM   414  C CG  . TRP A 1 58  ? -16.771 76.200 44.864 1.00 45.47 ? 58  TRP A CG  1 
ATOM   415  C CD1 . TRP A 1 58  ? -15.749 76.618 45.667 1.00 43.47 ? 58  TRP A CD1 1 
ATOM   416  C CD2 . TRP A 1 58  ? -17.491 75.207 45.598 1.00 45.22 ? 58  TRP A CD2 1 
ATOM   417  N NE1 . TRP A 1 58  ? -15.782 75.931 46.847 1.00 43.64 ? 58  TRP A NE1 1 
ATOM   418  C CE2 . TRP A 1 58  ? -16.838 75.063 46.838 1.00 44.26 ? 58  TRP A CE2 1 
ATOM   419  C CE3 . TRP A 1 58  ? -18.615 74.421 45.315 1.00 45.70 ? 58  TRP A CE3 1 
ATOM   420  C CZ2 . TRP A 1 58  ? -17.280 74.162 47.801 1.00 44.03 ? 58  TRP A CZ2 1 
ATOM   421  C CZ3 . TRP A 1 58  ? -19.046 73.519 46.272 1.00 46.02 ? 58  TRP A CZ3 1 
ATOM   422  C CH2 . TRP A 1 58  ? -18.378 73.403 47.503 1.00 45.83 ? 58  TRP A CH2 1 
ATOM   423  N N   . ASN A 1 59  ? -17.636 79.470 45.454 1.00 46.13 ? 59  ASN A N   1 
ATOM   424  C CA  . ASN A 1 59  ? -16.933 80.519 46.200 1.00 45.96 ? 59  ASN A CA  1 
ATOM   425  C C   . ASN A 1 59  ? -15.669 79.929 46.815 1.00 44.88 ? 59  ASN A C   1 
ATOM   426  O O   . ASN A 1 59  ? -15.739 79.070 47.690 1.00 45.11 ? 59  ASN A O   1 
ATOM   427  C CB  . ASN A 1 59  ? -17.842 81.141 47.264 1.00 47.77 ? 59  ASN A CB  1 
ATOM   428  C CG  . ASN A 1 59  ? -17.243 82.429 47.794 1.00 51.76 ? 59  ASN A CG  1 
ATOM   429  O OD1 . ASN A 1 59  ? -16.033 82.627 47.645 1.00 54.71 ? 59  ASN A OD1 1 
ATOM   430  N ND2 . ASN A 1 59  ? -18.031 83.306 48.402 1.00 53.42 ? 59  ASN A ND2 1 
ATOM   431  N N   . ALA A 1 60  ? -14.506 80.323 46.332 1.00 44.22 ? 60  ALA A N   1 
ATOM   432  C CA  . ALA A 1 60  ? -13.248 79.795 46.824 1.00 42.84 ? 60  ALA A CA  1 
ATOM   433  C C   . ALA A 1 60  ? -12.460 80.933 47.467 1.00 42.51 ? 60  ALA A C   1 
ATOM   434  O O   . ALA A 1 60  ? -11.262 81.061 47.255 1.00 42.36 ? 60  ALA A O   1 
ATOM   435  C CB  . ALA A 1 60  ? -12.416 79.176 45.723 1.00 40.11 ? 60  ALA A CB  1 
ATOM   436  N N   . SER A 1 61  ? -13.186 81.736 48.228 1.00 42.10 ? 61  SER A N   1 
ATOM   437  C CA  . SER A 1 61  ? -12.523 82.865 48.873 1.00 43.14 ? 61  SER A CA  1 
ATOM   438  C C   . SER A 1 61  ? -12.126 82.559 50.306 1.00 42.74 ? 61  SER A C   1 
ATOM   439  O O   . SER A 1 61  ? -11.435 83.393 50.898 1.00 43.92 ? 61  SER A O   1 
ATOM   440  C CB  . SER A 1 61  ? -13.445 84.089 48.818 1.00 43.87 ? 61  SER A CB  1 
ATOM   441  O OG  . SER A 1 61  ? -14.725 83.720 49.297 1.00 46.57 ? 61  SER A OG  1 
ATOM   442  N N   . THR A 1 62  ? -12.566 81.448 50.900 1.00 42.33 ? 62  THR A N   1 
ATOM   443  C CA  . THR A 1 62  ? -12.201 81.196 52.291 1.00 41.17 ? 62  THR A CA  1 
ATOM   444  C C   . THR A 1 62  ? -11.780 79.755 52.543 1.00 39.99 ? 62  THR A C   1 
ATOM   445  O O   . THR A 1 62  ? -12.301 78.792 51.980 1.00 40.62 ? 62  THR A O   1 
ATOM   446  C CB  . THR A 1 62  ? -13.346 81.496 53.270 1.00 43.50 ? 62  THR A CB  1 
ATOM   447  O OG1 . THR A 1 62  ? -14.362 80.501 53.089 1.00 45.06 ? 62  THR A OG1 1 
ATOM   448  C CG2 . THR A 1 62  ? -13.938 82.874 53.034 1.00 45.11 ? 62  THR A CG2 1 
ATOM   449  N N   . TYR A 1 63  ? -10.792 79.619 53.427 1.00 37.57 ? 63  TYR A N   1 
ATOM   450  C CA  . TYR A 1 63  ? -10.302 78.301 53.780 1.00 35.17 ? 63  TYR A CA  1 
ATOM   451  C C   . TYR A 1 63  ? -11.426 77.341 54.134 1.00 33.70 ? 63  TYR A C   1 
ATOM   452  O O   . TYR A 1 63  ? -12.464 77.693 54.680 1.00 34.40 ? 63  TYR A O   1 
ATOM   453  C CB  . TYR A 1 63  ? -9.385  78.401 54.986 1.00 35.77 ? 63  TYR A CB  1 
ATOM   454  C CG  . TYR A 1 63  ? -7.937  78.699 54.704 1.00 37.26 ? 63  TYR A CG  1 
ATOM   455  C CD1 . TYR A 1 63  ? -7.265  78.068 53.667 1.00 37.37 ? 63  TYR A CD1 1 
ATOM   456  C CD2 . TYR A 1 63  ? -7.228  79.600 55.495 1.00 36.90 ? 63  TYR A CD2 1 
ATOM   457  C CE1 . TYR A 1 63  ? -5.932  78.337 53.430 1.00 37.26 ? 63  TYR A CE1 1 
ATOM   458  C CE2 . TYR A 1 63  ? -5.888  79.867 55.254 1.00 35.95 ? 63  TYR A CE2 1 
ATOM   459  C CZ  . TYR A 1 63  ? -5.250  79.228 54.222 1.00 36.45 ? 63  TYR A CZ  1 
ATOM   460  O OH  . TYR A 1 63  ? -3.914  79.460 53.969 1.00 37.17 ? 63  TYR A OH  1 
ATOM   461  N N   . PRO A 1 64  ? -11.228 76.071 53.823 1.00 32.06 ? 64  PRO A N   1 
ATOM   462  C CA  . PRO A 1 64  ? -12.142 75.020 54.152 1.00 31.33 ? 64  PRO A CA  1 
ATOM   463  C C   . PRO A 1 64  ? -11.980 74.462 55.565 1.00 32.73 ? 64  PRO A C   1 
ATOM   464  O O   . PRO A 1 64  ? -11.000 74.757 56.255 1.00 31.25 ? 64  PRO A O   1 
ATOM   465  C CB  . PRO A 1 64  ? -11.720 73.933 53.171 1.00 30.74 ? 64  PRO A CB  1 
ATOM   466  C CG  . PRO A 1 64  ? -10.233 74.090 53.129 1.00 29.76 ? 64  PRO A CG  1 
ATOM   467  C CD  . PRO A 1 64  ? -9.986  75.565 53.154 1.00 30.18 ? 64  PRO A CD  1 
ATOM   468  N N   . ASN A 1 65  ? -12.828 73.505 55.929 1.00 33.22 ? 65  ASN A N   1 
ATOM   469  C CA  . ASN A 1 65  ? -12.737 72.790 57.166 1.00 34.62 ? 65  ASN A CA  1 
ATOM   470  C C   . ASN A 1 65  ? -11.512 71.881 57.138 1.00 35.54 ? 65  ASN A C   1 
ATOM   471  O O   . ASN A 1 65  ? -11.020 71.550 56.066 1.00 37.26 ? 65  ASN A O   1 
ATOM   472  C CB  . ASN A 1 65  ? -13.915 71.862 57.446 1.00 35.57 ? 65  ASN A CB  1 
ATOM   473  C CG  . ASN A 1 65  ? -15.241 72.592 57.462 1.00 38.89 ? 65  ASN A CG  1 
ATOM   474  O OD1 . ASN A 1 65  ? -15.302 73.741 57.898 1.00 39.89 ? 65  ASN A OD1 1 
ATOM   475  N ND2 . ASN A 1 65  ? -16.272 71.912 56.969 1.00 40.06 ? 65  ASN A ND2 1 
ATOM   476  N N   . ASN A 1 66  ? -11.078 71.507 58.335 1.00 35.43 ? 66  ASN A N   1 
ATOM   477  C CA  . ASN A 1 66  ? -9.934  70.626 58.480 1.00 33.47 ? 66  ASN A CA  1 
ATOM   478  C C   . ASN A 1 66  ? -10.533 69.254 58.774 1.00 32.27 ? 66  ASN A C   1 
ATOM   479  O O   . ASN A 1 66  ? -11.665 69.197 59.260 1.00 31.75 ? 66  ASN A O   1 
ATOM   480  C CB  . ASN A 1 66  ? -8.993  71.079 59.579 1.00 38.01 ? 66  ASN A CB  1 
ATOM   481  C CG  . ASN A 1 66  ? -8.427  72.460 59.348 1.00 41.01 ? 66  ASN A CG  1 
ATOM   482  O OD1 . ASN A 1 66  ? -7.870  73.081 60.253 1.00 43.20 ? 66  ASN A OD1 1 
ATOM   483  N ND2 . ASN A 1 66  ? -8.582  72.959 58.130 1.00 41.07 ? 66  ASN A ND2 1 
ATOM   484  N N   . CYS A 1 67  ? -9.796  68.203 58.476 1.00 31.46 ? 67  CYS A N   1 
ATOM   485  C CA  . CYS A 1 67  ? -10.313 66.872 58.754 1.00 31.61 ? 67  CYS A CA  1 
ATOM   486  C C   . CYS A 1 67  ? -10.316 66.638 60.261 1.00 33.26 ? 67  CYS A C   1 
ATOM   487  O O   . CYS A 1 67  ? -9.550  67.225 61.033 1.00 32.43 ? 67  CYS A O   1 
ATOM   488  C CB  . CYS A 1 67  ? -9.466  65.848 57.984 1.00 30.95 ? 67  CYS A CB  1 
ATOM   489  S SG  . CYS A 1 67  ? -9.577  66.097 56.158 1.00 29.80 ? 67  CYS A SG  1 
ATOM   490  N N   . GLN A 1 68  ? -11.239 65.793 60.688 1.00 33.59 ? 68  GLN A N   1 
ATOM   491  C CA  . GLN A 1 68  ? -11.372 65.353 62.052 1.00 32.84 ? 68  GLN A CA  1 
ATOM   492  C C   . GLN A 1 68  ? -10.032 64.788 62.499 1.00 33.81 ? 68  GLN A C   1 
ATOM   493  O O   . GLN A 1 68  ? -9.513  63.887 61.836 1.00 34.91 ? 68  GLN A O   1 
ATOM   494  C CB  . GLN A 1 68  ? -12.446 64.283 62.171 1.00 30.70 ? 68  GLN A CB  1 
ATOM   495  C CG  . GLN A 1 68  ? -13.833 64.797 61.861 1.00 33.52 ? 68  GLN A CG  1 
ATOM   496  C CD  . GLN A 1 68  ? -14.416 65.622 62.997 1.00 39.77 ? 68  GLN A CD  1 
ATOM   497  O OE1 . GLN A 1 68  ? -15.604 65.968 62.985 1.00 43.11 ? 68  GLN A OE1 1 
ATOM   498  N NE2 . GLN A 1 68  ? -13.605 65.961 63.992 1.00 36.78 ? 68  GLN A NE2 1 
ATOM   499  N N   . GLN A 1 69  ? -9.492  65.308 63.591 1.00 33.10 ? 69  GLN A N   1 
ATOM   500  C CA  . GLN A 1 69  ? -8.228  64.820 64.084 1.00 33.27 ? 69  GLN A CA  1 
ATOM   501  C C   . GLN A 1 69  ? -7.977  65.126 65.568 1.00 33.66 ? 69  GLN A C   1 
ATOM   502  O O   . GLN A 1 69  ? -8.532  66.036 66.162 1.00 31.53 ? 69  GLN A O   1 
ATOM   503  C CB  . GLN A 1 69  ? -7.063  65.476 63.315 1.00 26.45 ? 69  GLN A CB  1 
ATOM   504  C CG  . GLN A 1 69  ? -7.139  66.989 63.390 1.00 25.16 ? 69  GLN A CG  1 
ATOM   505  C CD  . GLN A 1 69  ? -6.229  67.686 62.401 1.00 30.71 ? 69  GLN A CD  1 
ATOM   506  O OE1 . GLN A 1 69  ? -5.056  67.959 62.671 1.00 26.92 ? 69  GLN A OE1 1 
ATOM   507  N NE2 . GLN A 1 69  ? -6.819  67.972 61.217 1.00 32.11 ? 69  GLN A NE2 1 
ATOM   508  N N   . TYR A 1 70  ? -7.060  64.337 66.107 1.00 34.30 ? 70  TYR A N   1 
ATOM   509  C CA  . TYR A 1 70  ? -6.629  64.491 67.477 1.00 35.20 ? 70  TYR A CA  1 
ATOM   510  C C   . TYR A 1 70  ? -6.065  65.900 67.615 1.00 36.00 ? 70  TYR A C   1 
ATOM   511  O O   . TYR A 1 70  ? -5.290  66.294 66.736 1.00 37.30 ? 70  TYR A O   1 
ATOM   512  C CB  . TYR A 1 70  ? -5.560  63.480 67.819 1.00 36.11 ? 70  TYR A CB  1 
ATOM   513  C CG  . TYR A 1 70  ? -4.883  63.773 69.140 1.00 37.82 ? 70  TYR A CG  1 
ATOM   514  C CD1 . TYR A 1 70  ? -5.538  63.484 70.330 1.00 38.46 ? 70  TYR A CD1 1 
ATOM   515  C CD2 . TYR A 1 70  ? -3.613  64.324 69.175 1.00 38.85 ? 70  TYR A CD2 1 
ATOM   516  C CE1 . TYR A 1 70  ? -4.933  63.739 71.547 1.00 40.20 ? 70  TYR A CE1 1 
ATOM   517  C CE2 . TYR A 1 70  ? -3.006  64.569 70.393 1.00 41.18 ? 70  TYR A CE2 1 
ATOM   518  C CZ  . TYR A 1 70  ? -3.667  64.278 71.570 1.00 41.86 ? 70  TYR A CZ  1 
ATOM   519  O OH  . TYR A 1 70  ? -3.047  64.529 72.771 1.00 44.84 ? 70  TYR A OH  1 
ATOM   520  N N   . VAL A 1 71  ? -6.513  66.657 68.590 1.00 35.63 ? 71  VAL A N   1 
ATOM   521  C CA  . VAL A 1 71  ? -6.063  68.023 68.802 1.00 36.35 ? 71  VAL A CA  1 
ATOM   522  C C   . VAL A 1 71  ? -5.034  68.045 69.923 1.00 37.42 ? 71  VAL A C   1 
ATOM   523  O O   . VAL A 1 71  ? -5.332  67.459 70.975 1.00 38.66 ? 71  VAL A O   1 
ATOM   524  C CB  . VAL A 1 71  ? -7.253  68.930 69.137 1.00 35.22 ? 71  VAL A CB  1 
ATOM   525  C CG1 . VAL A 1 71  ? -6.819  70.320 69.581 1.00 34.70 ? 71  VAL A CG1 1 
ATOM   526  C CG2 . VAL A 1 71  ? -8.171  69.032 67.921 1.00 36.62 ? 71  VAL A CG2 1 
ATOM   527  N N   . ASP A 1 72  ? -3.861  68.609 69.714 1.00 37.38 ? 72  ASP A N   1 
ATOM   528  C CA  . ASP A 1 72  ? -2.809  68.646 70.713 1.00 37.90 ? 72  ASP A CA  1 
ATOM   529  C C   . ASP A 1 72  ? -3.169  69.688 71.783 1.00 38.71 ? 72  ASP A C   1 
ATOM   530  O O   . ASP A 1 72  ? -3.184  70.879 71.514 1.00 37.46 ? 72  ASP A O   1 
ATOM   531  C CB  . ASP A 1 72  ? -1.440  68.965 70.128 1.00 36.96 ? 72  ASP A CB  1 
ATOM   532  C CG  . ASP A 1 72  ? -0.303  69.034 71.124 1.00 37.58 ? 72  ASP A CG  1 
ATOM   533  O OD1 . ASP A 1 72  ? -0.477  68.534 72.250 1.00 37.93 ? 72  ASP A OD1 1 
ATOM   534  O OD2 . ASP A 1 72  ? 0.798   69.534 70.821 1.00 36.20 ? 72  ASP A OD2 1 
ATOM   535  N N   . GLU A 1 73  ? -3.467  69.180 72.981 1.00 39.47 ? 73  GLU A N   1 
ATOM   536  C CA  . GLU A 1 73  ? -3.804  70.083 74.080 1.00 41.64 ? 73  GLU A CA  1 
ATOM   537  C C   . GLU A 1 73  ? -2.761  69.986 75.185 1.00 41.26 ? 73  GLU A C   1 
ATOM   538  O O   . GLU A 1 73  ? -2.984  70.414 76.310 1.00 42.64 ? 73  GLU A O   1 
ATOM   539  C CB  . GLU A 1 73  ? -5.211  69.766 74.591 1.00 45.05 ? 73  GLU A CB  1 
ATOM   540  C CG  . GLU A 1 73  ? -6.260  70.637 73.922 1.00 51.57 ? 73  GLU A CG  1 
ATOM   541  C CD  . GLU A 1 73  ? -7.688  70.215 74.168 1.00 57.11 ? 73  GLU A CD  1 
ATOM   542  O OE1 . GLU A 1 73  ? -7.969  69.399 75.071 1.00 58.71 ? 73  GLU A OE1 1 
ATOM   543  O OE2 . GLU A 1 73  ? -8.572  70.722 73.435 1.00 62.15 ? 73  GLU A OE2 1 
ATOM   544  N N   . GLN A 1 74  ? -1.607  69.422 74.875 1.00 41.02 ? 74  GLN A N   1 
ATOM   545  C CA  . GLN A 1 74  ? -0.531  69.249 75.834 1.00 41.23 ? 74  GLN A CA  1 
ATOM   546  C C   . GLN A 1 74  ? 0.007   70.561 76.376 1.00 41.05 ? 74  GLN A C   1 
ATOM   547  O O   . GLN A 1 74  ? 0.543   70.560 77.489 1.00 42.42 ? 74  GLN A O   1 
ATOM   548  C CB  . GLN A 1 74  ? 0.572   68.417 75.188 1.00 43.40 ? 74  GLN A CB  1 
ATOM   549  C CG  . GLN A 1 74  ? 1.816   68.157 75.986 1.00 49.90 ? 74  GLN A CG  1 
ATOM   550  C CD  . GLN A 1 74  ? 1.634   67.507 77.343 1.00 53.78 ? 74  GLN A CD  1 
ATOM   551  O OE1 . GLN A 1 74  ? 0.608   67.627 78.012 1.00 53.51 ? 74  GLN A OE1 1 
ATOM   552  N NE2 . GLN A 1 74  ? 2.678   66.795 77.775 1.00 56.02 ? 74  GLN A NE2 1 
ATOM   553  N N   . PHE A 1 75  ? -0.081  71.682 75.698 1.00 40.41 ? 75  PHE A N   1 
ATOM   554  C CA  . PHE A 1 75  ? 0.432   72.967 76.118 1.00 38.15 ? 75  PHE A CA  1 
ATOM   555  C C   . PHE A 1 75  ? -0.555  74.072 75.752 1.00 38.42 ? 75  PHE A C   1 
ATOM   556  O O   . PHE A 1 75  ? -0.267  74.924 74.923 1.00 38.47 ? 75  PHE A O   1 
ATOM   557  C CB  . PHE A 1 75  ? 1.798   73.255 75.487 1.00 34.37 ? 75  PHE A CB  1 
ATOM   558  C CG  . PHE A 1 75  ? 2.838   72.220 75.804 1.00 35.98 ? 75  PHE A CG  1 
ATOM   559  C CD1 . PHE A 1 75  ? 3.321   72.071 77.110 1.00 34.24 ? 75  PHE A CD1 1 
ATOM   560  C CD2 . PHE A 1 75  ? 3.336   71.377 74.823 1.00 34.89 ? 75  PHE A CD2 1 
ATOM   561  C CE1 . PHE A 1 75  ? 4.274   71.117 77.404 1.00 32.45 ? 75  PHE A CE1 1 
ATOM   562  C CE2 . PHE A 1 75  ? 4.287   70.417 75.118 1.00 34.81 ? 75  PHE A CE2 1 
ATOM   563  C CZ  . PHE A 1 75  ? 4.764   70.288 76.413 1.00 35.03 ? 75  PHE A CZ  1 
ATOM   564  N N   . PRO A 1 76  ? -1.715  74.060 76.386 1.00 39.03 ? 76  PRO A N   1 
ATOM   565  C CA  . PRO A 1 76  ? -2.773  75.026 76.158 1.00 39.00 ? 76  PRO A CA  1 
ATOM   566  C C   . PRO A 1 76  ? -2.265  76.441 76.024 1.00 39.41 ? 76  PRO A C   1 
ATOM   567  O O   . PRO A 1 76  ? -1.467  76.947 76.814 1.00 39.85 ? 76  PRO A O   1 
ATOM   568  C CB  . PRO A 1 76  ? -3.709  74.839 77.353 1.00 38.49 ? 76  PRO A CB  1 
ATOM   569  C CG  . PRO A 1 76  ? -3.563  73.399 77.705 1.00 37.75 ? 76  PRO A CG  1 
ATOM   570  C CD  . PRO A 1 76  ? -2.125  73.062 77.424 1.00 38.73 ? 76  PRO A CD  1 
ATOM   571  N N   . GLY A 1 77  ? -2.683  77.082 74.937 1.00 39.65 ? 77  GLY A N   1 
ATOM   572  C CA  . GLY A 1 77  ? -2.277  78.448 74.638 1.00 39.05 ? 77  GLY A CA  1 
ATOM   573  C C   . GLY A 1 77  ? -0.830  78.602 74.214 1.00 38.00 ? 77  GLY A C   1 
ATOM   574  O O   . GLY A 1 77  ? -0.423  79.720 73.884 1.00 39.64 ? 77  GLY A O   1 
ATOM   575  N N   . PHE A 1 78  ? -0.019  77.556 74.215 1.00 36.26 ? 78  PHE A N   1 
ATOM   576  C CA  . PHE A 1 78  ? 1.376   77.690 73.807 1.00 34.42 ? 78  PHE A CA  1 
ATOM   577  C C   . PHE A 1 78  ? 1.471   77.640 72.280 1.00 34.42 ? 78  PHE A C   1 
ATOM   578  O O   . PHE A 1 78  ? 1.094   76.622 71.690 1.00 33.04 ? 78  PHE A O   1 
ATOM   579  C CB  . PHE A 1 78  ? 2.184   76.578 74.456 1.00 28.32 ? 78  PHE A CB  1 
ATOM   580  C CG  . PHE A 1 78  ? 3.618   76.555 74.023 1.00 26.27 ? 78  PHE A CG  1 
ATOM   581  C CD1 . PHE A 1 78  ? 4.421   77.663 74.230 1.00 27.29 ? 78  PHE A CD1 1 
ATOM   582  C CD2 . PHE A 1 78  ? 4.158   75.433 73.421 1.00 23.67 ? 78  PHE A CD2 1 
ATOM   583  C CE1 . PHE A 1 78  ? 5.754   77.648 73.839 1.00 25.86 ? 78  PHE A CE1 1 
ATOM   584  C CE2 . PHE A 1 78  ? 5.487   75.403 73.053 1.00 22.76 ? 78  PHE A CE2 1 
ATOM   585  C CZ  . PHE A 1 78  ? 6.277   76.509 73.256 1.00 23.35 ? 78  PHE A CZ  1 
ATOM   586  N N   . SER A 1 79  ? 2.029   78.663 71.655 1.00 34.30 ? 79  SER A N   1 
ATOM   587  C CA  . SER A 1 79  ? 2.041   78.705 70.190 1.00 35.38 ? 79  SER A CA  1 
ATOM   588  C C   . SER A 1 79  ? 2.915   77.611 69.594 1.00 35.30 ? 79  SER A C   1 
ATOM   589  O O   . SER A 1 79  ? 2.566   77.103 68.529 1.00 34.78 ? 79  SER A O   1 
ATOM   590  C CB  . SER A 1 79  ? 2.464   80.088 69.694 1.00 34.95 ? 79  SER A CB  1 
ATOM   591  O OG  . SER A 1 79  ? 3.751   80.382 70.179 1.00 38.98 ? 79  SER A OG  1 
ATOM   592  N N   . GLY A 1 80  ? 3.996   77.219 70.251 1.00 35.19 ? 80  GLY A N   1 
ATOM   593  C CA  . GLY A 1 80  ? 4.849   76.173 69.715 1.00 35.09 ? 80  GLY A CA  1 
ATOM   594  C C   . GLY A 1 80  ? 4.023   74.970 69.277 1.00 36.16 ? 80  GLY A C   1 
ATOM   595  O O   . GLY A 1 80  ? 4.416   74.250 68.341 1.00 35.86 ? 80  GLY A O   1 
ATOM   596  N N   . SER A 1 81  ? 2.913   74.693 69.969 1.00 35.24 ? 81  SER A N   1 
ATOM   597  C CA  . SER A 1 81  ? 2.172   73.490 69.615 1.00 36.40 ? 81  SER A CA  1 
ATOM   598  C C   . SER A 1 81  ? 0.805   73.766 69.022 1.00 36.09 ? 81  SER A C   1 
ATOM   599  O O   . SER A 1 81  ? 0.274   72.948 68.267 1.00 35.44 ? 81  SER A O   1 
ATOM   600  C CB  . SER A 1 81  ? 2.053   72.595 70.871 1.00 38.93 ? 81  SER A CB  1 
ATOM   601  O OG  . SER A 1 81  ? 1.348   73.267 71.902 1.00 39.74 ? 81  SER A OG  1 
ATOM   602  N N   . GLU A 1 82  ? 0.246   74.914 69.358 1.00 36.91 ? 82  GLU A N   1 
ATOM   603  C CA  . GLU A 1 82  ? -1.090  75.254 68.861 1.00 38.10 ? 82  GLU A CA  1 
ATOM   604  C C   . GLU A 1 82  ? -1.068  75.629 67.385 1.00 37.13 ? 82  GLU A C   1 
ATOM   605  O O   . GLU A 1 82  ? -2.073  75.452 66.702 1.00 36.93 ? 82  GLU A O   1 
ATOM   606  C CB  . GLU A 1 82  ? -1.693  76.366 69.730 1.00 42.60 ? 82  GLU A CB  1 
ATOM   607  C CG  . GLU A 1 82  ? -1.601  76.030 71.214 1.00 48.83 ? 82  GLU A CG  1 
ATOM   608  C CD  . GLU A 1 82  ? -2.899  75.735 71.920 1.00 52.21 ? 82  GLU A CD  1 
ATOM   609  O OE1 . GLU A 1 82  ? -3.636  76.700 72.217 1.00 54.72 ? 82  GLU A OE1 1 
ATOM   610  O OE2 . GLU A 1 82  ? -3.210  74.556 72.207 1.00 53.64 ? 82  GLU A OE2 1 
ATOM   611  N N   . MET A 1 83  ? 0.074   76.114 66.913 1.00 36.27 ? 83  MET A N   1 
ATOM   612  C CA  . MET A 1 83  ? 0.240   76.507 65.532 1.00 34.75 ? 83  MET A CA  1 
ATOM   613  C C   . MET A 1 83  ? 0.090   75.301 64.594 1.00 34.53 ? 83  MET A C   1 
ATOM   614  O O   . MET A 1 83  ? -0.152  75.503 63.412 1.00 34.25 ? 83  MET A O   1 
ATOM   615  C CB  . MET A 1 83  ? 1.617   77.130 65.309 1.00 30.31 ? 83  MET A CB  1 
ATOM   616  C CG  . MET A 1 83  ? 2.686   76.048 65.301 1.00 32.46 ? 83  MET A CG  1 
ATOM   617  S SD  . MET A 1 83  ? 4.223   76.603 64.548 1.00 35.29 ? 83  MET A SD  1 
ATOM   618  C CE  . MET A 1 83  ? 3.974   78.367 64.634 1.00 32.38 ? 83  MET A CE  1 
ATOM   619  N N   . TRP A 1 84  ? 0.239   74.098 65.116 1.00 32.71 ? 84  TRP A N   1 
ATOM   620  C CA  . TRP A 1 84  ? 0.087   72.873 64.375 1.00 32.50 ? 84  TRP A CA  1 
ATOM   621  C C   . TRP A 1 84  ? -1.331  72.336 64.459 1.00 32.60 ? 84  TRP A C   1 
ATOM   622  O O   . TRP A 1 84  ? -1.689  71.412 63.720 1.00 33.95 ? 84  TRP A O   1 
ATOM   623  C CB  . TRP A 1 84  ? 1.038   71.788 64.900 1.00 29.73 ? 84  TRP A CB  1 
ATOM   624  C CG  . TRP A 1 84  ? 2.467   72.228 64.777 1.00 32.63 ? 84  TRP A CG  1 
ATOM   625  C CD1 . TRP A 1 84  ? 3.326   72.542 65.770 1.00 33.88 ? 84  TRP A CD1 1 
ATOM   626  C CD2 . TRP A 1 84  ? 3.201   72.433 63.559 1.00 36.11 ? 84  TRP A CD2 1 
ATOM   627  N NE1 . TRP A 1 84  ? 4.546   72.916 65.268 1.00 33.88 ? 84  TRP A NE1 1 
ATOM   628  C CE2 . TRP A 1 84  ? 4.505   72.840 63.912 1.00 36.06 ? 84  TRP A CE2 1 
ATOM   629  C CE3 . TRP A 1 84  ? 2.874   72.296 62.208 1.00 34.44 ? 84  TRP A CE3 1 
ATOM   630  C CZ2 . TRP A 1 84  ? 5.513   73.102 62.977 1.00 35.56 ? 84  TRP A CZ2 1 
ATOM   631  C CZ3 . TRP A 1 84  ? 3.867   72.567 61.284 1.00 36.60 ? 84  TRP A CZ3 1 
ATOM   632  C CH2 . TRP A 1 84  ? 5.153   72.968 61.670 1.00 36.84 ? 84  TRP A CH2 1 
ATOM   633  N N   . ASN A 1 85  ? -2.142  72.893 65.338 1.00 31.89 ? 85  ASN A N   1 
ATOM   634  C CA  . ASN A 1 85  ? -3.499  72.413 65.509 1.00 32.03 ? 85  ASN A CA  1 
ATOM   635  C C   . ASN A 1 85  ? -4.455  73.001 64.481 1.00 31.87 ? 85  ASN A C   1 
ATOM   636  O O   . ASN A 1 85  ? -4.234  74.085 63.945 1.00 31.74 ? 85  ASN A O   1 
ATOM   637  C CB  . ASN A 1 85  ? -4.036  72.775 66.904 1.00 34.44 ? 85  ASN A CB  1 
ATOM   638  C CG  . ASN A 1 85  ? -3.616  71.837 68.012 1.00 32.70 ? 85  ASN A CG  1 
ATOM   639  O OD1 . ASN A 1 85  ? -3.516  70.625 67.854 1.00 28.39 ? 85  ASN A OD1 1 
ATOM   640  N ND2 . ASN A 1 85  ? -3.378  72.430 69.185 1.00 36.08 ? 85  ASN A ND2 1 
ATOM   641  N N   . PRO A 1 86  ? -5.556  72.303 64.272 1.00 31.03 ? 86  PRO A N   1 
ATOM   642  C CA  . PRO A 1 86  ? -6.564  72.767 63.350 1.00 31.38 ? 86  PRO A CA  1 
ATOM   643  C C   . PRO A 1 86  ? -6.948  74.196 63.659 1.00 32.17 ? 86  PRO A C   1 
ATOM   644  O O   . PRO A 1 86  ? -7.302  74.460 64.811 1.00 34.14 ? 86  PRO A O   1 
ATOM   645  C CB  . PRO A 1 86  ? -7.728  71.815 63.531 1.00 30.07 ? 86  PRO A CB  1 
ATOM   646  C CG  . PRO A 1 86  ? -7.107  70.592 64.099 1.00 31.35 ? 86  PRO A CG  1 
ATOM   647  C CD  . PRO A 1 86  ? -5.905  71.014 64.897 1.00 30.46 ? 86  PRO A CD  1 
ATOM   648  N N   . ASN A 1 87  ? -6.937  75.104 62.701 1.00 32.99 ? 87  ASN A N   1 
ATOM   649  C CA  . ASN A 1 87  ? -7.339  76.481 62.911 1.00 32.56 ? 87  ASN A CA  1 
ATOM   650  C C   . ASN A 1 87  ? -8.680  76.790 62.264 1.00 33.45 ? 87  ASN A C   1 
ATOM   651  O O   . ASN A 1 87  ? -9.002  77.967 62.092 1.00 33.90 ? 87  ASN A O   1 
ATOM   652  C CB  . ASN A 1 87  ? -6.284  77.445 62.364 1.00 33.81 ? 87  ASN A CB  1 
ATOM   653  C CG  . ASN A 1 87  ? -6.017  77.236 60.879 1.00 36.18 ? 87  ASN A CG  1 
ATOM   654  O OD1 . ASN A 1 87  ? -6.521  76.292 60.264 1.00 36.01 ? 87  ASN A OD1 1 
ATOM   655  N ND2 . ASN A 1 87  ? -5.211  78.123 60.320 1.00 34.00 ? 87  ASN A ND2 1 
ATOM   656  N N   . ARG A 1 88  ? -9.480  75.804 61.895 1.00 33.94 ? 88  ARG A N   1 
ATOM   657  C CA  . ARG A 1 88  ? -10.785 76.005 61.302 1.00 34.64 ? 88  ARG A CA  1 
ATOM   658  C C   . ARG A 1 88  ? -11.714 74.920 61.831 1.00 35.34 ? 88  ARG A C   1 
ATOM   659  O O   . ARG A 1 88  ? -11.182 73.923 62.297 1.00 36.09 ? 88  ARG A O   1 
ATOM   660  C CB  . ARG A 1 88  ? -10.861 75.890 59.773 1.00 35.83 ? 88  ARG A CB  1 
ATOM   661  C CG  . ARG A 1 88  ? -9.602  76.254 59.007 1.00 35.62 ? 88  ARG A CG  1 
ATOM   662  C CD  . ARG A 1 88  ? -9.614  77.786 58.885 1.00 37.40 ? 88  ARG A CD  1 
ATOM   663  N NE  . ARG A 1 88  ? -10.943 78.145 58.413 1.00 42.37 ? 88  ARG A NE  1 
ATOM   664  C CZ  . ARG A 1 88  ? -11.329 79.397 58.184 1.00 47.17 ? 88  ARG A CZ  1 
ATOM   665  N NH1 . ARG A 1 88  ? -10.455 80.372 58.435 1.00 47.69 ? 88  ARG A NH1 1 
ATOM   666  N NH2 . ARG A 1 88  ? -12.559 79.603 57.720 1.00 47.34 ? 88  ARG A NH2 1 
ATOM   667  N N   . GLU A 1 89  ? -13.028 75.052 61.714 1.00 37.39 ? 89  GLU A N   1 
ATOM   668  C CA  . GLU A 1 89  ? -13.889 73.989 62.202 1.00 39.19 ? 89  GLU A CA  1 
ATOM   669  C C   . GLU A 1 89  ? -13.393 72.655 61.647 1.00 38.90 ? 89  GLU A C   1 
ATOM   670  O O   . GLU A 1 89  ? -12.920 72.593 60.517 1.00 39.60 ? 89  GLU A O   1 
ATOM   671  C CB  . GLU A 1 89  ? -15.362 74.152 61.826 1.00 48.14 ? 89  GLU A CB  1 
ATOM   672  C CG  . GLU A 1 89  ? -16.178 72.993 62.409 1.00 57.55 ? 89  GLU A CG  1 
ATOM   673  C CD  . GLU A 1 89  ? -17.587 72.912 61.861 1.00 63.97 ? 89  GLU A CD  1 
ATOM   674  O OE1 . GLU A 1 89  ? -18.014 73.884 61.199 1.00 67.22 ? 89  GLU A OE1 1 
ATOM   675  O OE2 . GLU A 1 89  ? -18.267 71.882 62.084 1.00 66.98 ? 89  GLU A OE2 1 
ATOM   676  N N   . MET A 1 90  ? -13.494 71.613 62.453 1.00 38.55 ? 90  MET A N   1 
ATOM   677  C CA  . MET A 1 90  ? -13.068 70.294 62.014 1.00 38.13 ? 90  MET A CA  1 
ATOM   678  C C   . MET A 1 90  ? -14.301 69.627 61.408 1.00 38.03 ? 90  MET A C   1 
ATOM   679  O O   . MET A 1 90  ? -15.406 69.893 61.891 1.00 38.52 ? 90  MET A O   1 
ATOM   680  C CB  . MET A 1 90  ? -12.489 69.441 63.125 1.00 37.07 ? 90  MET A CB  1 
ATOM   681  C CG  . MET A 1 90  ? -11.017 69.676 63.390 1.00 39.67 ? 90  MET A CG  1 
ATOM   682  S SD  . MET A 1 90  ? -10.328 68.516 64.581 1.00 41.67 ? 90  MET A SD  1 
ATOM   683  C CE  . MET A 1 90  ? -11.507 68.649 65.925 1.00 41.94 ? 90  MET A CE  1 
ATOM   684  N N   . SER A 1 91  ? -14.086 68.822 60.375 1.00 37.15 ? 91  SER A N   1 
ATOM   685  C CA  . SER A 1 91  ? -15.244 68.174 59.763 1.00 36.60 ? 91  SER A CA  1 
ATOM   686  C C   . SER A 1 91  ? -14.847 66.994 58.893 1.00 35.75 ? 91  SER A C   1 
ATOM   687  O O   . SER A 1 91  ? -13.772 66.955 58.308 1.00 35.22 ? 91  SER A O   1 
ATOM   688  C CB  . SER A 1 91  ? -16.055 69.157 58.899 1.00 35.00 ? 91  SER A CB  1 
ATOM   689  O OG  . SER A 1 91  ? -17.267 68.510 58.538 1.00 36.16 ? 91  SER A OG  1 
ATOM   690  N N   . GLU A 1 92  ? -15.765 66.041 58.795 1.00 35.80 ? 92  GLU A N   1 
ATOM   691  C CA  . GLU A 1 92  ? -15.478 64.886 57.930 1.00 35.90 ? 92  GLU A CA  1 
ATOM   692  C C   . GLU A 1 92  ? -15.479 65.400 56.489 1.00 36.02 ? 92  GLU A C   1 
ATOM   693  O O   . GLU A 1 92  ? -14.796 64.863 55.620 1.00 36.58 ? 92  GLU A O   1 
ATOM   694  C CB  . GLU A 1 92  ? -16.454 63.769 58.229 1.00 34.30 ? 92  GLU A CB  1 
ATOM   695  C CG  . GLU A 1 92  ? -15.846 62.832 59.266 1.00 34.83 ? 92  GLU A CG  1 
ATOM   696  C CD  . GLU A 1 92  ? -16.771 61.667 59.544 1.00 36.31 ? 92  GLU A CD  1 
ATOM   697  O OE1 . GLU A 1 92  ? -17.887 61.932 60.041 1.00 37.53 ? 92  GLU A OE1 1 
ATOM   698  O OE2 . GLU A 1 92  ? -16.385 60.521 59.259 1.00 37.35 ? 92  GLU A OE2 1 
ATOM   699  N N   . ASP A 1 93  ? -16.223 66.484 56.254 1.00 34.91 ? 93  ASP A N   1 
ATOM   700  C CA  . ASP A 1 93  ? -16.269 67.115 54.945 1.00 33.47 ? 93  ASP A CA  1 
ATOM   701  C C   . ASP A 1 93  ? -15.042 68.012 54.856 1.00 31.26 ? 93  ASP A C   1 
ATOM   702  O O   . ASP A 1 93  ? -15.103 69.224 55.022 1.00 31.43 ? 93  ASP A O   1 
ATOM   703  C CB  . ASP A 1 93  ? -17.537 67.914 54.707 1.00 36.71 ? 93  ASP A CB  1 
ATOM   704  C CG  . ASP A 1 93  ? -17.571 68.718 53.428 1.00 38.20 ? 93  ASP A CG  1 
ATOM   705  O OD1 . ASP A 1 93  ? -16.621 68.718 52.619 1.00 38.31 ? 93  ASP A OD1 1 
ATOM   706  O OD2 . ASP A 1 93  ? -18.594 69.405 53.199 1.00 41.73 ? 93  ASP A OD2 1 
ATOM   707  N N   . CYS A 1 94  ? -13.900 67.391 54.585 1.00 30.65 ? 94  CYS A N   1 
ATOM   708  C CA  . CYS A 1 94  ? -12.685 68.203 54.514 1.00 30.19 ? 94  CYS A CA  1 
ATOM   709  C C   . CYS A 1 94  ? -11.834 67.962 53.289 1.00 30.01 ? 94  CYS A C   1 
ATOM   710  O O   . CYS A 1 94  ? -10.673 68.407 53.260 1.00 28.20 ? 94  CYS A O   1 
ATOM   711  C CB  . CYS A 1 94  ? -11.917 67.871 55.819 1.00 27.52 ? 94  CYS A CB  1 
ATOM   712  S SG  . CYS A 1 94  ? -11.571 66.093 55.886 1.00 28.59 ? 94  CYS A SG  1 
ATOM   713  N N   . LEU A 1 95  ? -12.391 67.284 52.260 1.00 30.36 ? 95  LEU A N   1 
ATOM   714  C CA  . LEU A 1 95  ? -11.514 67.059 51.077 1.00 29.12 ? 95  LEU A CA  1 
ATOM   715  C C   . LEU A 1 95  ? -11.568 68.258 50.145 1.00 29.00 ? 95  LEU A C   1 
ATOM   716  O O   . LEU A 1 95  ? -12.455 68.363 49.287 1.00 28.94 ? 95  LEU A O   1 
ATOM   717  C CB  . LEU A 1 95  ? -11.890 65.744 50.409 1.00 27.68 ? 95  LEU A CB  1 
ATOM   718  C CG  . LEU A 1 95  ? -11.717 64.511 51.289 1.00 29.01 ? 95  LEU A CG  1 
ATOM   719  C CD1 . LEU A 1 95  ? -12.122 63.235 50.582 1.00 27.84 ? 95  LEU A CD1 1 
ATOM   720  C CD2 . LEU A 1 95  ? -10.270 64.415 51.779 1.00 29.30 ? 95  LEU A CD2 1 
ATOM   721  N N   . TYR A 1 96  ? -10.678 69.226 50.368 1.00 27.72 ? 96  TYR A N   1 
ATOM   722  C CA  . TYR A 1 96  ? -10.608 70.450 49.604 1.00 27.80 ? 96  TYR A CA  1 
ATOM   723  C C   . TYR A 1 96  ? -9.141  70.788 49.337 1.00 28.53 ? 96  TYR A C   1 
ATOM   724  O O   . TYR A 1 96  ? -8.259  70.234 50.001 1.00 29.49 ? 96  TYR A O   1 
ATOM   725  C CB  . TYR A 1 96  ? -11.222 71.696 50.263 1.00 28.62 ? 96  TYR A CB  1 
ATOM   726  C CG  . TYR A 1 96  ? -12.692 71.447 50.523 1.00 28.79 ? 96  TYR A CG  1 
ATOM   727  C CD1 . TYR A 1 96  ? -13.035 70.741 51.669 1.00 28.10 ? 96  TYR A CD1 1 
ATOM   728  C CD2 . TYR A 1 96  ? -13.689 71.880 49.662 1.00 27.18 ? 96  TYR A CD2 1 
ATOM   729  C CE1 . TYR A 1 96  ? -14.357 70.439 51.934 1.00 28.77 ? 96  TYR A CE1 1 
ATOM   730  C CE2 . TYR A 1 96  ? -15.012 71.580 49.925 1.00 27.35 ? 96  TYR A CE2 1 
ATOM   731  C CZ  . TYR A 1 96  ? -15.335 70.869 51.058 1.00 29.51 ? 96  TYR A CZ  1 
ATOM   732  O OH  . TYR A 1 96  ? -16.640 70.570 51.373 1.00 30.63 ? 96  TYR A OH  1 
ATOM   733  N N   . LEU A 1 97  ? -8.929  71.670 48.370 1.00 28.30 ? 97  LEU A N   1 
ATOM   734  C CA  . LEU A 1 97  ? -7.559  72.045 48.010 1.00 28.13 ? 97  LEU A CA  1 
ATOM   735  C C   . LEU A 1 97  ? -7.524  73.556 47.904 1.00 27.44 ? 97  LEU A C   1 
ATOM   736  O O   . LEU A 1 97  ? -8.560  74.213 47.799 1.00 28.36 ? 97  LEU A O   1 
ATOM   737  C CB  . LEU A 1 97  ? -7.127  71.324 46.747 1.00 33.37 ? 97  LEU A CB  1 
ATOM   738  C CG  . LEU A 1 97  ? -7.883  71.543 45.430 1.00 35.07 ? 97  LEU A CG  1 
ATOM   739  C CD1 . LEU A 1 97  ? -7.430  72.825 44.752 1.00 33.05 ? 97  LEU A CD1 1 
ATOM   740  C CD2 . LEU A 1 97  ? -7.683  70.347 44.509 1.00 33.79 ? 97  LEU A CD2 1 
ATOM   741  N N   . ASN A 1 98  ? -6.351  74.132 47.991 1.00 27.17 ? 98  ASN A N   1 
ATOM   742  C CA  . ASN A 1 98  ? -6.179  75.564 47.953 1.00 28.42 ? 98  ASN A CA  1 
ATOM   743  C C   . ASN A 1 98  ? -5.095  75.876 46.938 1.00 28.28 ? 98  ASN A C   1 
ATOM   744  O O   . ASN A 1 98  ? -4.099  75.166 46.882 1.00 29.31 ? 98  ASN A O   1 
ATOM   745  C CB  . ASN A 1 98  ? -5.777  76.173 49.315 1.00 31.58 ? 98  ASN A CB  1 
ATOM   746  C CG  . ASN A 1 98  ? -6.594  75.528 50.427 1.00 32.28 ? 98  ASN A CG  1 
ATOM   747  O OD1 . ASN A 1 98  ? -7.787  75.816 50.533 1.00 34.11 ? 98  ASN A OD1 1 
ATOM   748  N ND2 . ASN A 1 98  ? -5.943  74.650 51.167 1.00 31.53 ? 98  ASN A ND2 1 
ATOM   749  N N   . ILE A 1 99  ? -5.342  76.926 46.177 1.00 29.16 ? 99  ILE A N   1 
ATOM   750  C CA  . ILE A 1 99  ? -4.382  77.306 45.159 1.00 30.48 ? 99  ILE A CA  1 
ATOM   751  C C   . ILE A 1 99  ? -3.962  78.759 45.221 1.00 30.43 ? 99  ILE A C   1 
ATOM   752  O O   . ILE A 1 99  ? -4.812  79.643 45.268 1.00 31.46 ? 99  ILE A O   1 
ATOM   753  C CB  . ILE A 1 99  ? -4.995  77.043 43.757 1.00 30.18 ? 99  ILE A CB  1 
ATOM   754  C CG1 . ILE A 1 99  ? -5.486  75.600 43.627 1.00 29.49 ? 99  ILE A CG1 1 
ATOM   755  C CG2 . ILE A 1 99  ? -3.961  77.400 42.701 1.00 30.44 ? 99  ILE A CG2 1 
ATOM   756  C CD1 . ILE A 1 99  ? -6.421  75.369 42.446 1.00 32.28 ? 99  ILE A CD1 1 
ATOM   757  N N   . TRP A 1 100 ? -2.667  78.986 45.196 1.00 30.78 ? 100 TRP A N   1 
ATOM   758  C CA  . TRP A 1 100 ? -2.176  80.353 45.185 1.00 33.24 ? 100 TRP A CA  1 
ATOM   759  C C   . TRP A 1 100 ? -1.619  80.518 43.760 1.00 34.88 ? 100 TRP A C   1 
ATOM   760  O O   . TRP A 1 100 ? -0.828  79.677 43.331 1.00 34.09 ? 100 TRP A O   1 
ATOM   761  C CB  . TRP A 1 100 ? -1.134  80.679 46.244 1.00 34.69 ? 100 TRP A CB  1 
ATOM   762  C CG  . TRP A 1 100 ? -1.760  80.772 47.610 1.00 36.81 ? 100 TRP A CG  1 
ATOM   763  C CD1 . TRP A 1 100 ? -2.227  81.890 48.242 1.00 36.77 ? 100 TRP A CD1 1 
ATOM   764  C CD2 . TRP A 1 100 ? -2.031  79.668 48.486 1.00 35.61 ? 100 TRP A CD2 1 
ATOM   765  N NE1 . TRP A 1 100 ? -2.755  81.561 49.463 1.00 35.94 ? 100 TRP A NE1 1 
ATOM   766  C CE2 . TRP A 1 100 ? -2.636  80.205 49.645 1.00 36.90 ? 100 TRP A CE2 1 
ATOM   767  C CE3 . TRP A 1 100 ? -1.774  78.299 48.420 1.00 33.70 ? 100 TRP A CE3 1 
ATOM   768  C CZ2 . TRP A 1 100 ? -3.004  79.407 50.728 1.00 35.50 ? 100 TRP A CZ2 1 
ATOM   769  C CZ3 . TRP A 1 100 ? -2.147  77.507 49.491 1.00 37.83 ? 100 TRP A CZ3 1 
ATOM   770  C CH2 . TRP A 1 100 ? -2.753  78.068 50.636 1.00 37.15 ? 100 TRP A CH2 1 
ATOM   771  N N   . VAL A 1 101 ? -2.079  81.563 43.092 1.00 35.43 ? 101 VAL A N   1 
ATOM   772  C CA  . VAL A 1 101 ? -1.655  81.849 41.737 1.00 35.95 ? 101 VAL A CA  1 
ATOM   773  C C   . VAL A 1 101 ? -1.114  83.265 41.576 1.00 35.81 ? 101 VAL A C   1 
ATOM   774  O O   . VAL A 1 101 ? -1.776  84.235 41.933 1.00 34.93 ? 101 VAL A O   1 
ATOM   775  C CB  . VAL A 1 101 ? -2.817  81.715 40.728 1.00 38.00 ? 101 VAL A CB  1 
ATOM   776  C CG1 . VAL A 1 101 ? -2.393  82.255 39.367 1.00 40.26 ? 101 VAL A CG1 1 
ATOM   777  C CG2 . VAL A 1 101 ? -3.287  80.278 40.609 1.00 39.07 ? 101 VAL A CG2 1 
ATOM   778  N N   . PRO A 1 102 ? 0.071   83.360 40.993 1.00 36.21 ? 102 PRO A N   1 
ATOM   779  C CA  . PRO A 1 102 ? 0.678   84.644 40.713 1.00 37.38 ? 102 PRO A CA  1 
ATOM   780  C C   . PRO A 1 102 ? -0.260  85.556 39.930 1.00 38.93 ? 102 PRO A C   1 
ATOM   781  O O   . PRO A 1 102 ? -1.186  85.141 39.227 1.00 37.84 ? 102 PRO A O   1 
ATOM   782  C CB  . PRO A 1 102 ? 1.944   84.318 39.954 1.00 36.85 ? 102 PRO A CB  1 
ATOM   783  C CG  . PRO A 1 102 ? 2.211   82.882 40.219 1.00 36.55 ? 102 PRO A CG  1 
ATOM   784  C CD  . PRO A 1 102 ? 0.888   82.228 40.506 1.00 36.05 ? 102 PRO A CD  1 
ATOM   785  N N   . SER A 1 103 ? -0.051  86.859 40.109 1.00 40.90 ? 103 SER A N   1 
ATOM   786  C CA  . SER A 1 103 ? -0.866  87.877 39.449 1.00 43.13 ? 103 SER A CA  1 
ATOM   787  C C   . SER A 1 103 ? 0.030   88.777 38.633 1.00 44.47 ? 103 SER A C   1 
ATOM   788  O O   . SER A 1 103 ? 0.906   89.185 39.358 1.00 45.20 ? 103 SER A O   1 
ATOM   789  C CB  . SER A 1 103 ? -1.674  88.701 40.442 1.00 45.00 ? 103 SER A CB  1 
ATOM   790  O OG  . SER A 1 103 ? -2.700  89.407 39.757 1.00 45.97 ? 103 SER A OG  1 
ATOM   791  N N   . PRO A 1 104 ? -0.123  88.882 37.338 1.00 45.45 ? 104 PRO A N   1 
ATOM   792  C CA  . PRO A 1 104 ? -1.149  88.366 36.488 1.00 45.30 ? 104 PRO A CA  1 
ATOM   793  C C   . PRO A 1 104 ? -1.050  86.845 36.383 1.00 44.32 ? 104 PRO A C   1 
ATOM   794  O O   . PRO A 1 104 ? 0.050   86.314 36.430 1.00 42.66 ? 104 PRO A O   1 
ATOM   795  C CB  . PRO A 1 104 ? -1.003  89.019 35.115 1.00 45.85 ? 104 PRO A CB  1 
ATOM   796  C CG  . PRO A 1 104 ? 0.471   89.297 35.065 1.00 45.71 ? 104 PRO A CG  1 
ATOM   797  C CD  . PRO A 1 104 ? 0.748   89.710 36.485 1.00 45.75 ? 104 PRO A CD  1 
ATOM   798  N N   . ARG A 1 105 ? -2.187  86.177 36.258 1.00 45.12 ? 105 ARG A N   1 
ATOM   799  C CA  . ARG A 1 105 ? -2.205  84.725 36.150 1.00 46.51 ? 105 ARG A CA  1 
ATOM   800  C C   . ARG A 1 105 ? -1.231  84.257 35.080 1.00 47.60 ? 105 ARG A C   1 
ATOM   801  O O   . ARG A 1 105 ? -1.298  84.733 33.945 1.00 48.68 ? 105 ARG A O   1 
ATOM   802  C CB  . ARG A 1 105 ? -3.600  84.199 35.821 1.00 46.34 ? 105 ARG A CB  1 
ATOM   803  C CG  . ARG A 1 105 ? -3.559  82.697 35.515 1.00 47.46 ? 105 ARG A CG  1 
ATOM   804  C CD  . ARG A 1 105 ? -4.912  82.243 34.976 1.00 46.56 ? 105 ARG A CD  1 
ATOM   805  N NE  . ARG A 1 105 ? -5.998  82.924 35.649 1.00 46.55 ? 105 ARG A NE  1 
ATOM   806  C CZ  . ARG A 1 105 ? -7.268  82.927 35.287 1.00 49.20 ? 105 ARG A CZ  1 
ATOM   807  N NH1 . ARG A 1 105 ? -7.643  82.264 34.202 1.00 50.97 ? 105 ARG A NH1 1 
ATOM   808  N NH2 . ARG A 1 105 ? -8.181  83.591 35.991 1.00 50.07 ? 105 ARG A NH2 1 
ATOM   809  N N   . PRO A 1 106 ? -0.345  83.347 35.436 1.00 48.06 ? 106 PRO A N   1 
ATOM   810  C CA  . PRO A 1 106 ? 0.652   82.805 34.526 1.00 48.26 ? 106 PRO A CA  1 
ATOM   811  C C   . PRO A 1 106 ? 0.017   82.011 33.401 1.00 48.22 ? 106 PRO A C   1 
ATOM   812  O O   . PRO A 1 106 ? -1.202  81.810 33.407 1.00 48.58 ? 106 PRO A O   1 
ATOM   813  C CB  . PRO A 1 106 ? 1.553   81.961 35.413 1.00 48.27 ? 106 PRO A CB  1 
ATOM   814  C CG  . PRO A 1 106 ? 1.244   82.396 36.804 1.00 47.96 ? 106 PRO A CG  1 
ATOM   815  C CD  . PRO A 1 106 ? -0.225  82.747 36.793 1.00 48.05 ? 106 PRO A CD  1 
ATOM   816  N N   . LYS A 1 107 ? 0.781   81.551 32.420 1.00 48.67 ? 107 LYS A N   1 
ATOM   817  C CA  . LYS A 1 107 ? 0.160   80.794 31.327 1.00 49.27 ? 107 LYS A CA  1 
ATOM   818  C C   . LYS A 1 107 ? 0.417   79.303 31.509 1.00 48.82 ? 107 LYS A C   1 
ATOM   819  O O   . LYS A 1 107 ? -0.464  78.465 31.327 1.00 49.61 ? 107 LYS A O   1 
ATOM   820  C CB  . LYS A 1 107 ? 0.670   81.231 29.959 1.00 50.66 ? 107 LYS A CB  1 
ATOM   821  C CG  . LYS A 1 107 ? 0.234   82.611 29.508 1.00 53.01 ? 107 LYS A CG  1 
ATOM   822  C CD  . LYS A 1 107 ? -1.254  82.832 29.710 1.00 56.21 ? 107 LYS A CD  1 
ATOM   823  C CE  . LYS A 1 107 ? -1.521  84.175 30.377 1.00 58.35 ? 107 LYS A CE  1 
ATOM   824  N NZ  . LYS A 1 107 ? -2.646  84.911 29.737 1.00 60.07 ? 107 LYS A NZ  1 
ATOM   825  N N   . SER A 1 108 ? 1.660   78.999 31.863 1.00 47.98 ? 108 SER A N   1 
ATOM   826  C CA  . SER A 1 108 ? 2.030   77.603 32.057 1.00 47.41 ? 108 SER A CA  1 
ATOM   827  C C   . SER A 1 108 ? 3.229   77.538 32.989 1.00 46.12 ? 108 SER A C   1 
ATOM   828  O O   . SER A 1 108 ? 4.356   77.309 32.533 1.00 47.17 ? 108 SER A O   1 
ATOM   829  C CB  . SER A 1 108 ? 2.361   76.918 30.740 1.00 48.43 ? 108 SER A CB  1 
ATOM   830  O OG  . SER A 1 108 ? 1.750   75.641 30.668 1.00 52.44 ? 108 SER A OG  1 
ATOM   831  N N   . THR A 1 109 ? 2.968   77.748 34.281 1.00 44.19 ? 109 THR A N   1 
ATOM   832  C CA  . THR A 1 109 ? 4.155   77.700 35.151 1.00 41.67 ? 109 THR A CA  1 
ATOM   833  C C   . THR A 1 109 ? 4.210   76.492 36.068 1.00 39.60 ? 109 THR A C   1 
ATOM   834  O O   . THR A 1 109 ? 3.293   75.689 36.187 1.00 38.14 ? 109 THR A O   1 
ATOM   835  C CB  . THR A 1 109 ? 4.222   79.027 35.929 1.00 42.23 ? 109 THR A CB  1 
ATOM   836  O OG1 . THR A 1 109 ? 5.589   79.171 36.334 1.00 46.50 ? 109 THR A OG1 1 
ATOM   837  C CG2 . THR A 1 109 ? 3.290   79.016 37.113 1.00 43.35 ? 109 THR A CG2 1 
ATOM   838  N N   . THR A 1 110 ? 5.385   76.354 36.694 1.00 38.60 ? 110 THR A N   1 
ATOM   839  C CA  . THR A 1 110 ? 5.616   75.273 37.638 1.00 36.90 ? 110 THR A CA  1 
ATOM   840  C C   . THR A 1 110 ? 4.563   75.231 38.749 1.00 34.85 ? 110 THR A C   1 
ATOM   841  O O   . THR A 1 110 ? 4.112   76.219 39.317 1.00 32.99 ? 110 THR A O   1 
ATOM   842  C CB  . THR A 1 110 ? 6.989   75.361 38.309 1.00 39.33 ? 110 THR A CB  1 
ATOM   843  O OG1 . THR A 1 110 ? 7.960   75.485 37.268 1.00 42.42 ? 110 THR A OG1 1 
ATOM   844  C CG2 . THR A 1 110 ? 7.236   74.105 39.122 1.00 40.53 ? 110 THR A CG2 1 
ATOM   845  N N   . VAL A 1 111 ? 4.119   73.998 38.963 1.00 33.25 ? 111 VAL A N   1 
ATOM   846  C CA  . VAL A 1 111 ? 3.127   73.745 39.993 1.00 32.28 ? 111 VAL A CA  1 
ATOM   847  C C   . VAL A 1 111 ? 3.804   73.003 41.152 1.00 31.64 ? 111 VAL A C   1 
ATOM   848  O O   . VAL A 1 111 ? 4.585   72.062 40.962 1.00 29.68 ? 111 VAL A O   1 
ATOM   849  C CB  . VAL A 1 111 ? 1.929   72.952 39.465 1.00 32.46 ? 111 VAL A CB  1 
ATOM   850  C CG1 . VAL A 1 111 ? 0.837   72.785 40.504 1.00 32.50 ? 111 VAL A CG1 1 
ATOM   851  C CG2 . VAL A 1 111 ? 1.355   73.649 38.228 1.00 33.45 ? 111 VAL A CG2 1 
ATOM   852  N N   . MET A 1 112 ? 3.460   73.494 42.350 1.00 31.48 ? 112 MET A N   1 
ATOM   853  C CA  . MET A 1 112 ? 3.984   72.895 43.595 1.00 30.01 ? 112 MET A CA  1 
ATOM   854  C C   . MET A 1 112 ? 2.792   72.469 44.435 1.00 29.87 ? 112 MET A C   1 
ATOM   855  O O   . MET A 1 112 ? 1.901   73.274 44.716 1.00 30.24 ? 112 MET A O   1 
ATOM   856  C CB  . MET A 1 112 ? 4.908   73.833 44.335 1.00 28.62 ? 112 MET A CB  1 
ATOM   857  C CG  . MET A 1 112 ? 6.351   73.597 43.900 1.00 31.32 ? 112 MET A CG  1 
ATOM   858  S SD  . MET A 1 112 ? 7.433   74.889 44.524 1.00 35.21 ? 112 MET A SD  1 
ATOM   859  C CE  . MET A 1 112 ? 8.662   73.890 45.353 1.00 34.34 ? 112 MET A CE  1 
ATOM   860  N N   . VAL A 1 113 ? 2.754   71.178 44.751 1.00 29.48 ? 113 VAL A N   1 
ATOM   861  C CA  . VAL A 1 113 ? 1.654   70.623 45.531 1.00 28.96 ? 113 VAL A CA  1 
ATOM   862  C C   . VAL A 1 113 ? 2.183   70.164 46.894 1.00 28.88 ? 113 VAL A C   1 
ATOM   863  O O   . VAL A 1 113 ? 2.995   69.251 47.020 1.00 27.84 ? 113 VAL A O   1 
ATOM   864  C CB  . VAL A 1 113 ? 0.951   69.461 44.824 1.00 28.22 ? 113 VAL A CB  1 
ATOM   865  C CG1 . VAL A 1 113 ? -0.219  68.961 45.670 1.00 29.50 ? 113 VAL A CG1 1 
ATOM   866  C CG2 . VAL A 1 113 ? 0.469   69.885 43.447 1.00 30.30 ? 113 VAL A CG2 1 
ATOM   867  N N   . TRP A 1 114 ? 1.720   70.877 47.910 1.00 28.77 ? 114 TRP A N   1 
ATOM   868  C CA  . TRP A 1 114 ? 2.085   70.638 49.297 1.00 26.84 ? 114 TRP A CA  1 
ATOM   869  C C   . TRP A 1 114 ? 1.196   69.597 49.964 1.00 25.11 ? 114 TRP A C   1 
ATOM   870  O O   . TRP A 1 114 ? -0.022  69.720 49.914 1.00 23.37 ? 114 TRP A O   1 
ATOM   871  C CB  . TRP A 1 114 ? 1.968   71.930 50.117 1.00 28.16 ? 114 TRP A CB  1 
ATOM   872  C CG  . TRP A 1 114 ? 2.189   71.719 51.594 1.00 32.17 ? 114 TRP A CG  1 
ATOM   873  C CD1 . TRP A 1 114 ? 1.259   71.798 52.600 1.00 33.97 ? 114 TRP A CD1 1 
ATOM   874  C CD2 . TRP A 1 114 ? 3.432   71.392 52.228 1.00 29.68 ? 114 TRP A CD2 1 
ATOM   875  N NE1 . TRP A 1 114 ? 1.854   71.551 53.823 1.00 33.97 ? 114 TRP A NE1 1 
ATOM   876  C CE2 . TRP A 1 114 ? 3.183   71.308 53.622 1.00 32.14 ? 114 TRP A CE2 1 
ATOM   877  C CE3 . TRP A 1 114 ? 4.725   71.187 51.750 1.00 25.57 ? 114 TRP A CE3 1 
ATOM   878  C CZ2 . TRP A 1 114 ? 4.185   71.009 54.540 1.00 28.89 ? 114 TRP A CZ2 1 
ATOM   879  C CZ3 . TRP A 1 114 ? 5.720   70.895 52.654 1.00 28.52 ? 114 TRP A CZ3 1 
ATOM   880  C CH2 . TRP A 1 114 ? 5.443   70.806 54.036 1.00 30.21 ? 114 TRP A CH2 1 
ATOM   881  N N   . ILE A 1 115 ? 1.833   68.608 50.562 1.00 25.72 ? 115 ILE A N   1 
ATOM   882  C CA  . ILE A 1 115 ? 1.156   67.551 51.311 1.00 26.14 ? 115 ILE A CA  1 
ATOM   883  C C   . ILE A 1 115 ? 1.586   67.653 52.788 1.00 25.82 ? 115 ILE A C   1 
ATOM   884  O O   . ILE A 1 115 ? 2.728   67.355 53.158 1.00 24.51 ? 115 ILE A O   1 
ATOM   885  C CB  . ILE A 1 115 ? 1.418   66.132 50.808 1.00 25.90 ? 115 ILE A CB  1 
ATOM   886  C CG1 . ILE A 1 115 ? 1.093   66.040 49.307 1.00 26.41 ? 115 ILE A CG1 1 
ATOM   887  C CG2 . ILE A 1 115 ? 0.560   65.165 51.609 1.00 23.88 ? 115 ILE A CG2 1 
ATOM   888  C CD1 . ILE A 1 115 ? 1.537   64.761 48.642 1.00 24.18 ? 115 ILE A CD1 1 
ATOM   889  N N   . TYR A 1 116 ? 0.634   68.083 53.616 1.00 25.26 ? 116 TYR A N   1 
ATOM   890  C CA  . TYR A 1 116 ? 0.972   68.239 55.051 1.00 25.33 ? 116 TYR A CA  1 
ATOM   891  C C   . TYR A 1 116 ? 1.303   66.940 55.765 1.00 25.53 ? 116 TYR A C   1 
ATOM   892  O O   . TYR A 1 116 ? 0.748   65.872 55.524 1.00 25.73 ? 116 TYR A O   1 
ATOM   893  C CB  . TYR A 1 116 ? -0.149  68.968 55.798 1.00 22.41 ? 116 TYR A CB  1 
ATOM   894  C CG  . TYR A 1 116 ? -1.518  68.358 55.812 1.00 19.35 ? 116 TYR A CG  1 
ATOM   895  C CD1 . TYR A 1 116 ? -1.777  67.138 56.415 1.00 19.02 ? 116 TYR A CD1 1 
ATOM   896  C CD2 . TYR A 1 116 ? -2.606  69.017 55.255 1.00 16.90 ? 116 TYR A CD2 1 
ATOM   897  C CE1 . TYR A 1 116 ? -3.037  66.568 56.436 1.00 16.18 ? 116 TYR A CE1 1 
ATOM   898  C CE2 . TYR A 1 116 ? -3.871  68.457 55.297 1.00 15.11 ? 116 TYR A CE2 1 
ATOM   899  C CZ  . TYR A 1 116 ? -4.081  67.245 55.860 1.00 15.70 ? 116 TYR A CZ  1 
ATOM   900  O OH  . TYR A 1 116 ? -5.351  66.679 55.865 1.00 19.04 ? 116 TYR A OH  1 
ATOM   901  N N   . GLY A 1 117 ? 2.289   67.065 56.671 1.00 26.21 ? 117 GLY A N   1 
ATOM   902  C CA  . GLY A 1 117 ? 2.661   65.923 57.517 1.00 26.79 ? 117 GLY A CA  1 
ATOM   903  C C   . GLY A 1 117 ? 1.830   65.981 58.811 1.00 25.64 ? 117 GLY A C   1 
ATOM   904  O O   . GLY A 1 117 ? 0.870   66.740 58.929 1.00 26.00 ? 117 GLY A O   1 
ATOM   905  N N   . GLY A 1 118 ? 2.194   65.181 59.800 1.00 27.64 ? 118 GLY A N   1 
ATOM   906  C CA  . GLY A 1 118 ? 1.522   65.093 61.105 1.00 24.38 ? 118 GLY A CA  1 
ATOM   907  C C   . GLY A 1 118 ? 1.278   63.653 61.517 1.00 24.48 ? 118 GLY A C   1 
ATOM   908  O O   . GLY A 1 118 ? 0.216   63.336 62.072 1.00 25.98 ? 118 GLY A O   1 
ATOM   909  N N   . GLY A 1 119 ? 2.185   62.728 61.250 1.00 24.32 ? 119 GLY A N   1 
ATOM   910  C CA  . GLY A 1 119 ? 2.052   61.337 61.636 1.00 25.72 ? 119 GLY A CA  1 
ATOM   911  C C   . GLY A 1 119 ? 0.851   60.569 61.129 1.00 27.23 ? 119 GLY A C   1 
ATOM   912  O O   . GLY A 1 119 ? 0.532   59.449 61.577 1.00 27.63 ? 119 GLY A O   1 
ATOM   913  N N   . PHE A 1 120 ? 0.150   61.107 60.147 1.00 26.94 ? 120 PHE A N   1 
ATOM   914  C CA  . PHE A 1 120 ? -1.013  60.499 59.512 1.00 26.76 ? 120 PHE A CA  1 
ATOM   915  C C   . PHE A 1 120 ? -2.210  60.569 60.462 1.00 27.05 ? 120 PHE A C   1 
ATOM   916  O O   . PHE A 1 120 ? -3.295  60.100 60.098 1.00 26.59 ? 120 PHE A O   1 
ATOM   917  C CB  . PHE A 1 120 ? -0.772  59.060 59.049 1.00 27.23 ? 120 PHE A CB  1 
ATOM   918  C CG  . PHE A 1 120 ? 0.188   58.880 57.908 1.00 27.18 ? 120 PHE A CG  1 
ATOM   919  C CD1 . PHE A 1 120 ? -0.122  59.322 56.630 1.00 26.34 ? 120 PHE A CD1 1 
ATOM   920  C CD2 . PHE A 1 120 ? 1.415   58.269 58.108 1.00 27.92 ? 120 PHE A CD2 1 
ATOM   921  C CE1 . PHE A 1 120 ? 0.777   59.154 55.590 1.00 28.35 ? 120 PHE A CE1 1 
ATOM   922  C CE2 . PHE A 1 120 ? 2.317   58.098 57.075 1.00 28.23 ? 120 PHE A CE2 1 
ATOM   923  C CZ  . PHE A 1 120 ? 1.998   58.541 55.796 1.00 28.75 ? 120 PHE A CZ  1 
ATOM   924  N N   . TYR A 1 121 ? -2.021  61.199 61.635 1.00 25.70 ? 121 TYR A N   1 
ATOM   925  C CA  . TYR A 1 121 ? -3.152  61.290 62.562 1.00 24.69 ? 121 TYR A CA  1 
ATOM   926  C C   . TYR A 1 121 ? -3.660  62.713 62.651 1.00 23.94 ? 121 TYR A C   1 
ATOM   927  O O   . TYR A 1 121 ? -4.757  62.977 63.120 1.00 24.88 ? 121 TYR A O   1 
ATOM   928  C CB  . TYR A 1 121 ? -2.766  60.787 63.961 1.00 23.61 ? 121 TYR A CB  1 
ATOM   929  C CG  . TYR A 1 121 ? -1.806  61.681 64.714 1.00 17.69 ? 121 TYR A CG  1 
ATOM   930  C CD1 . TYR A 1 121 ? -2.229  62.801 65.402 1.00 18.84 ? 121 TYR A CD1 1 
ATOM   931  C CD2 . TYR A 1 121 ? -0.461  61.376 64.705 1.00 17.91 ? 121 TYR A CD2 1 
ATOM   932  C CE1 . TYR A 1 121 ? -1.320  63.614 66.077 1.00 19.98 ? 121 TYR A CE1 1 
ATOM   933  C CE2 . TYR A 1 121 ? 0.456   62.162 65.364 1.00 20.55 ? 121 TYR A CE2 1 
ATOM   934  C CZ  . TYR A 1 121 ? 0.010   63.275 66.073 1.00 20.31 ? 121 TYR A CZ  1 
ATOM   935  O OH  . TYR A 1 121 ? 0.947   64.036 66.727 1.00 19.61 ? 121 TYR A OH  1 
ATOM   936  N N   . SER A 1 122 ? -2.843  63.658 62.236 1.00 23.67 ? 122 SER A N   1 
ATOM   937  C CA  . SER A 1 122 ? -3.246  65.052 62.293 1.00 24.31 ? 122 SER A CA  1 
ATOM   938  C C   . SER A 1 122 ? -2.745  65.777 61.044 1.00 23.92 ? 122 SER A C   1 
ATOM   939  O O   . SER A 1 122 ? -1.984  65.192 60.277 1.00 24.48 ? 122 SER A O   1 
ATOM   940  C CB  . SER A 1 122 ? -2.693  65.756 63.534 1.00 24.03 ? 122 SER A CB  1 
ATOM   941  O OG  . SER A 1 122 ? -1.273  65.695 63.604 1.00 24.02 ? 122 SER A OG  1 
ATOM   942  N N   . GLY A 1 123 ? -3.092  67.041 60.898 1.00 23.76 ? 123 GLY A N   1 
ATOM   943  C CA  . GLY A 1 123 ? -2.601  67.774 59.727 1.00 25.01 ? 123 GLY A CA  1 
ATOM   944  C C   . GLY A 1 123 ? -3.732  68.632 59.172 1.00 24.28 ? 123 GLY A C   1 
ATOM   945  O O   . GLY A 1 123 ? -4.894  68.263 59.203 1.00 24.31 ? 123 GLY A O   1 
ATOM   946  N N   . SER A 1 124 ? -3.352  69.780 58.666 1.00 24.59 ? 124 SER A N   1 
ATOM   947  C CA  . SER A 1 124 ? -4.281  70.743 58.143 1.00 26.48 ? 124 SER A CA  1 
ATOM   948  C C   . SER A 1 124 ? -3.570  71.531 57.050 1.00 28.22 ? 124 SER A C   1 
ATOM   949  O O   . SER A 1 124 ? -2.364  71.771 57.180 1.00 26.63 ? 124 SER A O   1 
ATOM   950  C CB  . SER A 1 124 ? -4.759  71.693 59.240 1.00 29.24 ? 124 SER A CB  1 
ATOM   951  O OG  . SER A 1 124 ? -5.749  71.041 60.017 1.00 34.62 ? 124 SER A OG  1 
ATOM   952  N N   . SER A 1 125 ? -4.324  71.829 55.996 1.00 29.58 ? 125 SER A N   1 
ATOM   953  C CA  . SER A 1 125 ? -3.744  72.561 54.876 1.00 31.94 ? 125 SER A CA  1 
ATOM   954  C C   . SER A 1 125 ? -3.824  74.056 55.113 1.00 33.12 ? 125 SER A C   1 
ATOM   955  O O   . SER A 1 125 ? -3.180  74.849 54.437 1.00 34.87 ? 125 SER A O   1 
ATOM   956  C CB  . SER A 1 125 ? -4.495  72.241 53.586 1.00 32.72 ? 125 SER A CB  1 
ATOM   957  O OG  . SER A 1 125 ? -5.850  72.639 53.713 1.00 30.66 ? 125 SER A OG  1 
ATOM   958  N N   . THR A 1 126 ? -4.636  74.409 56.098 1.00 33.44 ? 126 THR A N   1 
ATOM   959  C CA  . THR A 1 126 ? -4.938  75.806 56.395 1.00 33.53 ? 126 THR A CA  1 
ATOM   960  C C   . THR A 1 126 ? -4.029  76.452 57.416 1.00 33.53 ? 126 THR A C   1 
ATOM   961  O O   . THR A 1 126 ? -4.192  77.632 57.734 1.00 34.06 ? 126 THR A O   1 
ATOM   962  C CB  . THR A 1 126 ? -6.411  75.835 56.838 1.00 33.30 ? 126 THR A CB  1 
ATOM   963  O OG1 . THR A 1 126 ? -6.605  74.880 57.873 1.00 36.41 ? 126 THR A OG1 1 
ATOM   964  C CG2 . THR A 1 126 ? -7.333  75.419 55.695 1.00 33.94 ? 126 THR A CG2 1 
ATOM   965  N N   . LEU A 1 127 ? -3.028  75.758 57.926 1.00 33.47 ? 127 LEU A N   1 
ATOM   966  C CA  . LEU A 1 127 ? -2.132  76.364 58.889 1.00 33.81 ? 127 LEU A CA  1 
ATOM   967  C C   . LEU A 1 127 ? -1.443  77.594 58.321 1.00 34.92 ? 127 LEU A C   1 
ATOM   968  O O   . LEU A 1 127 ? -1.008  77.644 57.164 1.00 36.03 ? 127 LEU A O   1 
ATOM   969  C CB  . LEU A 1 127 ? -1.054  75.375 59.343 1.00 30.82 ? 127 LEU A CB  1 
ATOM   970  C CG  . LEU A 1 127 ? -1.626  74.084 59.953 1.00 31.94 ? 127 LEU A CG  1 
ATOM   971  C CD1 . LEU A 1 127 ? -0.504  73.202 60.472 1.00 28.41 ? 127 LEU A CD1 1 
ATOM   972  C CD2 . LEU A 1 127 ? -2.641  74.417 61.040 1.00 27.76 ? 127 LEU A CD2 1 
ATOM   973  N N   . ASP A 1 128 ? -1.177  78.526 59.225 1.00 34.75 ? 128 ASP A N   1 
ATOM   974  C CA  . ASP A 1 128 ? -0.423  79.707 58.889 1.00 35.65 ? 128 ASP A CA  1 
ATOM   975  C C   . ASP A 1 128 ? 0.941   79.362 58.313 1.00 35.06 ? 128 ASP A C   1 
ATOM   976  O O   . ASP A 1 128 ? 1.352   80.092 57.405 1.00 35.69 ? 128 ASP A O   1 
ATOM   977  C CB  . ASP A 1 128 ? -0.221  80.602 60.122 1.00 41.70 ? 128 ASP A CB  1 
ATOM   978  C CG  . ASP A 1 128 ? -1.531  81.143 60.659 1.00 48.71 ? 128 ASP A CG  1 
ATOM   979  O OD1 . ASP A 1 128 ? -2.550  81.138 59.933 1.00 50.15 ? 128 ASP A OD1 1 
ATOM   980  O OD2 . ASP A 1 128 ? -1.539  81.580 61.840 1.00 54.00 ? 128 ASP A OD2 1 
ATOM   981  N N   . VAL A 1 129 ? 1.653   78.351 58.813 1.00 34.12 ? 129 VAL A N   1 
ATOM   982  C CA  . VAL A 1 129 ? 2.957   78.070 58.260 1.00 33.93 ? 129 VAL A CA  1 
ATOM   983  C C   . VAL A 1 129 ? 2.893   77.503 56.828 1.00 32.97 ? 129 VAL A C   1 
ATOM   984  O O   . VAL A 1 129 ? 3.963   77.408 56.234 1.00 31.62 ? 129 VAL A O   1 
ATOM   985  C CB  . VAL A 1 129 ? 3.818   76.994 58.980 1.00 33.73 ? 129 VAL A CB  1 
ATOM   986  C CG1 . VAL A 1 129 ? 4.782   77.687 59.907 1.00 37.25 ? 129 VAL A CG1 1 
ATOM   987  C CG2 . VAL A 1 129 ? 2.905   75.978 59.634 1.00 33.09 ? 129 VAL A CG2 1 
ATOM   988  N N   . TYR A 1 130 ? 1.722   77.071 56.415 1.00 32.70 ? 130 TYR A N   1 
ATOM   989  C CA  . TYR A 1 130 ? 1.503   76.489 55.105 1.00 33.85 ? 130 TYR A CA  1 
ATOM   990  C C   . TYR A 1 130 ? 0.908   77.480 54.103 1.00 34.31 ? 130 TYR A C   1 
ATOM   991  O O   . TYR A 1 130 ? 0.313   77.065 53.110 1.00 35.02 ? 130 TYR A O   1 
ATOM   992  C CB  . TYR A 1 130 ? 0.536   75.306 55.226 1.00 31.30 ? 130 TYR A CB  1 
ATOM   993  C CG  . TYR A 1 130 ? 0.996   74.127 56.038 1.00 28.39 ? 130 TYR A CG  1 
ATOM   994  C CD1 . TYR A 1 130 ? 2.330   73.905 56.354 1.00 27.14 ? 130 TYR A CD1 1 
ATOM   995  C CD2 . TYR A 1 130 ? 0.053   73.225 56.525 1.00 26.93 ? 130 TYR A CD2 1 
ATOM   996  C CE1 . TYR A 1 130 ? 2.726   72.807 57.094 1.00 25.29 ? 130 TYR A CE1 1 
ATOM   997  C CE2 . TYR A 1 130 ? 0.438   72.127 57.269 1.00 25.47 ? 130 TYR A CE2 1 
ATOM   998  C CZ  . TYR A 1 130 ? 1.769   71.936 57.552 1.00 25.18 ? 130 TYR A CZ  1 
ATOM   999  O OH  . TYR A 1 130 ? 2.135   70.838 58.277 1.00 27.18 ? 130 TYR A OH  1 
ATOM   1000 N N   . ASN A 1 131 ? 0.959   78.770 54.388 1.00 35.48 ? 131 ASN A N   1 
ATOM   1001 C CA  . ASN A 1 131 ? 0.391   79.793 53.519 1.00 36.46 ? 131 ASN A CA  1 
ATOM   1002 C C   . ASN A 1 131 ? 1.222   79.935 52.248 1.00 36.22 ? 131 ASN A C   1 
ATOM   1003 O O   . ASN A 1 131 ? 2.313   80.499 52.285 1.00 35.15 ? 131 ASN A O   1 
ATOM   1004 C CB  . ASN A 1 131 ? 0.304   81.121 54.267 1.00 39.14 ? 131 ASN A CB  1 
ATOM   1005 C CG  . ASN A 1 131 ? -0.608  82.113 53.573 1.00 41.90 ? 131 ASN A CG  1 
ATOM   1006 O OD1 . ASN A 1 131 ? -0.797  82.137 52.355 1.00 42.20 ? 131 ASN A OD1 1 
ATOM   1007 N ND2 . ASN A 1 131 ? -1.201  82.985 54.380 1.00 43.21 ? 131 ASN A ND2 1 
ATOM   1008 N N   . GLY A 1 132 ? 0.701   79.413 51.129 1.00 36.86 ? 132 GLY A N   1 
ATOM   1009 C CA  . GLY A 1 132 ? 1.442   79.399 49.881 1.00 36.66 ? 132 GLY A CA  1 
ATOM   1010 C C   . GLY A 1 132 ? 1.665   80.728 49.193 1.00 36.90 ? 132 GLY A C   1 
ATOM   1011 O O   . GLY A 1 132 ? 2.431   80.786 48.231 1.00 36.85 ? 132 GLY A O   1 
ATOM   1012 N N   . LYS A 1 133 ? 1.052   81.805 49.650 1.00 37.52 ? 133 LYS A N   1 
ATOM   1013 C CA  . LYS A 1 133 ? 1.197   83.105 49.018 1.00 38.81 ? 133 LYS A CA  1 
ATOM   1014 C C   . LYS A 1 133 ? 2.628   83.592 48.942 1.00 39.80 ? 133 LYS A C   1 
ATOM   1015 O O   . LYS A 1 133 ? 2.939   84.144 47.877 1.00 41.00 ? 133 LYS A O   1 
ATOM   1016 C CB  . LYS A 1 133 ? 0.329   84.145 49.735 1.00 40.42 ? 133 LYS A CB  1 
ATOM   1017 C CG  . LYS A 1 133 ? 0.994   84.893 50.885 1.00 41.12 ? 133 LYS A CG  1 
ATOM   1018 C CD  . LYS A 1 133 ? -0.086  85.397 51.820 1.00 40.15 ? 133 LYS A CD  1 
ATOM   1019 C CE  . LYS A 1 133 ? 0.232   86.722 52.488 1.00 39.82 ? 133 LYS A CE  1 
ATOM   1020 N NZ  . LYS A 1 133 ? -1.006  87.203 53.195 1.00 40.96 ? 133 LYS A NZ  1 
ATOM   1021 N N   . TYR A 1 134 ? 3.487   83.460 49.943 1.00 40.48 ? 134 TYR A N   1 
ATOM   1022 C CA  . TYR A 1 134 ? 4.837   83.994 49.798 1.00 40.27 ? 134 TYR A CA  1 
ATOM   1023 C C   . TYR A 1 134 ? 5.629   83.227 48.754 1.00 40.15 ? 134 TYR A C   1 
ATOM   1024 O O   . TYR A 1 134 ? 6.453   83.823 48.065 1.00 40.02 ? 134 TYR A O   1 
ATOM   1025 C CB  . TYR A 1 134 ? 5.621   83.986 51.125 1.00 40.89 ? 134 TYR A CB  1 
ATOM   1026 C CG  . TYR A 1 134 ? 4.769   84.554 52.239 1.00 42.38 ? 134 TYR A CG  1 
ATOM   1027 C CD1 . TYR A 1 134 ? 4.662   85.931 52.402 1.00 43.31 ? 134 TYR A CD1 1 
ATOM   1028 C CD2 . TYR A 1 134 ? 4.044   83.712 53.075 1.00 42.43 ? 134 TYR A CD2 1 
ATOM   1029 C CE1 . TYR A 1 134 ? 3.856   86.453 53.398 1.00 43.71 ? 134 TYR A CE1 1 
ATOM   1030 C CE2 . TYR A 1 134 ? 3.234   84.233 54.067 1.00 42.72 ? 134 TYR A CE2 1 
ATOM   1031 C CZ  . TYR A 1 134 ? 3.146   85.599 54.214 1.00 43.88 ? 134 TYR A CZ  1 
ATOM   1032 O OH  . TYR A 1 134 ? 2.342   86.131 55.200 1.00 46.58 ? 134 TYR A OH  1 
ATOM   1033 N N   . LEU A 1 135 ? 5.444   81.925 48.710 1.00 40.43 ? 135 LEU A N   1 
ATOM   1034 C CA  . LEU A 1 135 ? 6.170   81.078 47.767 1.00 41.63 ? 135 LEU A CA  1 
ATOM   1035 C C   . LEU A 1 135 ? 5.648   81.288 46.349 1.00 42.54 ? 135 LEU A C   1 
ATOM   1036 O O   . LEU A 1 135 ? 6.399   81.485 45.395 1.00 42.56 ? 135 LEU A O   1 
ATOM   1037 C CB  . LEU A 1 135 ? 6.042   79.620 48.187 1.00 40.22 ? 135 LEU A CB  1 
ATOM   1038 C CG  . LEU A 1 135 ? 7.018   78.620 47.577 1.00 40.50 ? 135 LEU A CG  1 
ATOM   1039 C CD1 . LEU A 1 135 ? 8.425   79.178 47.527 1.00 39.50 ? 135 LEU A CD1 1 
ATOM   1040 C CD2 . LEU A 1 135 ? 6.967   77.319 48.366 1.00 41.11 ? 135 LEU A CD2 1 
ATOM   1041 N N   . ALA A 1 136 ? 4.319   81.259 46.218 1.00 43.36 ? 136 ALA A N   1 
ATOM   1042 C CA  . ALA A 1 136 ? 3.690   81.465 44.921 1.00 44.20 ? 136 ALA A CA  1 
ATOM   1043 C C   . ALA A 1 136 ? 4.207   82.784 44.341 1.00 45.39 ? 136 ALA A C   1 
ATOM   1044 O O   . ALA A 1 136 ? 4.777   82.892 43.251 1.00 45.50 ? 136 ALA A O   1 
ATOM   1045 C CB  . ALA A 1 136 ? 2.181   81.483 45.039 1.00 41.36 ? 136 ALA A CB  1 
ATOM   1046 N N   . TYR A 1 137 ? 4.003   83.813 45.162 1.00 45.40 ? 137 TYR A N   1 
ATOM   1047 C CA  . TYR A 1 137 ? 4.391   85.157 44.804 1.00 45.65 ? 137 TYR A CA  1 
ATOM   1048 C C   . TYR A 1 137 ? 5.872   85.347 44.547 1.00 44.90 ? 137 TYR A C   1 
ATOM   1049 O O   . TYR A 1 137 ? 6.264   85.996 43.579 1.00 46.01 ? 137 TYR A O   1 
ATOM   1050 C CB  . TYR A 1 137 ? 3.982   86.114 45.946 1.00 46.91 ? 137 TYR A CB  1 
ATOM   1051 C CG  . TYR A 1 137 ? 4.510   87.504 45.651 1.00 49.85 ? 137 TYR A CG  1 
ATOM   1052 C CD1 . TYR A 1 137 ? 3.827   88.349 44.784 1.00 50.97 ? 137 TYR A CD1 1 
ATOM   1053 C CD2 . TYR A 1 137 ? 5.702   87.937 46.212 1.00 51.11 ? 137 TYR A CD2 1 
ATOM   1054 C CE1 . TYR A 1 137 ? 4.311   89.613 44.500 1.00 52.05 ? 137 TYR A CE1 1 
ATOM   1055 C CE2 . TYR A 1 137 ? 6.190   89.198 45.931 1.00 52.59 ? 137 TYR A CE2 1 
ATOM   1056 C CZ  . TYR A 1 137 ? 5.493   90.032 45.073 1.00 52.63 ? 137 TYR A CZ  1 
ATOM   1057 O OH  . TYR A 1 137 ? 5.995   91.287 44.805 1.00 52.28 ? 137 TYR A OH  1 
ATOM   1058 N N   . THR A 1 138 ? 6.733   84.834 45.396 1.00 43.99 ? 138 THR A N   1 
ATOM   1059 C CA  . THR A 1 138 ? 8.169   85.038 45.259 1.00 42.85 ? 138 THR A CA  1 
ATOM   1060 C C   . THR A 1 138 ? 8.797   84.248 44.137 1.00 42.84 ? 138 THR A C   1 
ATOM   1061 O O   . THR A 1 138 ? 9.751   84.708 43.503 1.00 42.69 ? 138 THR A O   1 
ATOM   1062 C CB  . THR A 1 138 ? 8.856   84.680 46.607 1.00 40.58 ? 138 THR A CB  1 
ATOM   1063 O OG1 . THR A 1 138 ? 8.326   85.544 47.619 1.00 41.03 ? 138 THR A OG1 1 
ATOM   1064 C CG2 . THR A 1 138 ? 10.350  84.869 46.571 1.00 40.48 ? 138 THR A CG2 1 
ATOM   1065 N N   . GLU A 1 139 ? 8.340   83.010 43.949 1.00 42.60 ? 139 GLU A N   1 
ATOM   1066 C CA  . GLU A 1 139 ? 8.992   82.170 42.946 1.00 42.64 ? 139 GLU A CA  1 
ATOM   1067 C C   . GLU A 1 139 ? 8.130   81.975 41.711 1.00 42.44 ? 139 GLU A C   1 
ATOM   1068 O O   . GLU A 1 139 ? 8.465   81.144 40.872 1.00 42.82 ? 139 GLU A O   1 
ATOM   1069 C CB  . GLU A 1 139 ? 9.371   80.831 43.591 1.00 41.36 ? 139 GLU A CB  1 
ATOM   1070 C CG  . GLU A 1 139 ? 10.470  80.951 44.616 1.00 40.95 ? 139 GLU A CG  1 
ATOM   1071 C CD  . GLU A 1 139 ? 11.832  81.280 44.073 1.00 41.49 ? 139 GLU A CD  1 
ATOM   1072 O OE1 . GLU A 1 139 ? 12.222  80.826 42.983 1.00 43.18 ? 139 GLU A OE1 1 
ATOM   1073 O OE2 . GLU A 1 139 ? 12.589  81.991 44.763 1.00 42.42 ? 139 GLU A OE2 1 
ATOM   1074 N N   . GLU A 1 140 ? 7.039   82.712 41.586 1.00 42.64 ? 140 GLU A N   1 
ATOM   1075 C CA  . GLU A 1 140 ? 6.177   82.590 40.417 1.00 43.29 ? 140 GLU A CA  1 
ATOM   1076 C C   . GLU A 1 140 ? 5.852   81.132 40.132 1.00 41.69 ? 140 GLU A C   1 
ATOM   1077 O O   . GLU A 1 140 ? 6.056   80.612 39.034 1.00 41.80 ? 140 GLU A O   1 
ATOM   1078 C CB  . GLU A 1 140 ? 6.831   83.227 39.183 1.00 50.48 ? 140 GLU A CB  1 
ATOM   1079 C CG  . GLU A 1 140 ? 6.270   84.572 38.752 1.00 58.44 ? 140 GLU A CG  1 
ATOM   1080 C CD  . GLU A 1 140 ? 7.350   85.632 38.594 1.00 65.36 ? 140 GLU A CD  1 
ATOM   1081 O OE1 . GLU A 1 140 ? 8.505   85.296 38.233 1.00 68.30 ? 140 GLU A OE1 1 
ATOM   1082 O OE2 . GLU A 1 140 ? 7.080   86.835 38.823 1.00 67.70 ? 140 GLU A OE2 1 
ATOM   1083 N N   . VAL A 1 141 ? 5.311   80.473 41.151 1.00 40.12 ? 141 VAL A N   1 
ATOM   1084 C CA  . VAL A 1 141 ? 4.887   79.093 40.990 1.00 37.55 ? 141 VAL A CA  1 
ATOM   1085 C C   . VAL A 1 141 ? 3.412   79.063 41.349 1.00 35.82 ? 141 VAL A C   1 
ATOM   1086 O O   . VAL A 1 141 ? 2.974   79.966 42.044 1.00 35.23 ? 141 VAL A O   1 
ATOM   1087 C CB  . VAL A 1 141 ? 5.653   78.097 41.861 1.00 38.70 ? 141 VAL A CB  1 
ATOM   1088 C CG1 . VAL A 1 141 ? 7.142   78.119 41.554 1.00 37.78 ? 141 VAL A CG1 1 
ATOM   1089 C CG2 . VAL A 1 141 ? 5.416   78.408 43.340 1.00 38.86 ? 141 VAL A CG2 1 
ATOM   1090 N N   . VAL A 1 142 ? 2.697   78.078 40.843 1.00 35.37 ? 142 VAL A N   1 
ATOM   1091 C CA  . VAL A 1 142 ? 1.297   77.923 41.219 1.00 34.54 ? 142 VAL A CA  1 
ATOM   1092 C C   . VAL A 1 142 ? 1.419   77.012 42.459 1.00 33.76 ? 142 VAL A C   1 
ATOM   1093 O O   . VAL A 1 142 ? 2.012   75.929 42.330 1.00 32.76 ? 142 VAL A O   1 
ATOM   1094 C CB  . VAL A 1 142 ? 0.377   77.322 40.176 1.00 36.21 ? 142 VAL A CB  1 
ATOM   1095 C CG1 . VAL A 1 142 ? -0.988  76.988 40.771 1.00 35.88 ? 142 VAL A CG1 1 
ATOM   1096 C CG2 . VAL A 1 142 ? 0.195   78.271 38.988 1.00 38.40 ? 142 VAL A CG2 1 
ATOM   1097 N N   . LEU A 1 143 ? 0.985   77.520 43.615 1.00 32.38 ? 143 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 143 ? 1.137   76.687 44.807 1.00 30.41 ? 143 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 143 ? -0.176  76.041 45.190 1.00 28.33 ? 143 LEU A C   1 
ATOM   1100 O O   . LEU A 1 143 ? -1.178  76.720 45.400 1.00 28.46 ? 143 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 143 ? 1.665   77.460 46.022 1.00 36.00 ? 143 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 143 ? 2.340   76.500 47.029 1.00 38.12 ? 143 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 143 ? 3.702   77.022 47.411 1.00 41.23 ? 143 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 143 ? 1.417   76.325 48.217 1.00 38.78 ? 143 LEU A CD2 1 
ATOM   1105 N N   . VAL A 1 144 ? -0.138  74.716 45.242 1.00 27.13 ? 144 VAL A N   1 
ATOM   1106 C CA  . VAL A 1 144 ? -1.343  73.989 45.619 1.00 27.07 ? 144 VAL A CA  1 
ATOM   1107 C C   . VAL A 1 144 ? -1.144  73.274 46.970 1.00 26.58 ? 144 VAL A C   1 
ATOM   1108 O O   . VAL A 1 144 ? -0.069  72.695 47.199 1.00 25.96 ? 144 VAL A O   1 
ATOM   1109 C CB  . VAL A 1 144 ? -1.761  72.923 44.591 1.00 25.53 ? 144 VAL A CB  1 
ATOM   1110 C CG1 . VAL A 1 144 ? -3.082  72.274 44.992 1.00 24.23 ? 144 VAL A CG1 1 
ATOM   1111 C CG2 . VAL A 1 144 ? -1.889  73.502 43.189 1.00 31.33 ? 144 VAL A CG2 1 
ATOM   1112 N N   . SER A 1 145 ? -2.172  73.312 47.815 1.00 25.25 ? 145 SER A N   1 
ATOM   1113 C CA  . SER A 1 145 ? -2.021  72.602 49.100 1.00 26.02 ? 145 SER A CA  1 
ATOM   1114 C C   . SER A 1 145 ? -3.255  71.698 49.134 1.00 24.96 ? 145 SER A C   1 
ATOM   1115 O O   . SER A 1 145 ? -4.332  72.217 48.875 1.00 23.72 ? 145 SER A O   1 
ATOM   1116 C CB  . SER A 1 145 ? -1.882  73.437 50.363 1.00 23.43 ? 145 SER A CB  1 
ATOM   1117 O OG  . SER A 1 145 ? -3.086  74.082 50.742 1.00 24.24 ? 145 SER A OG  1 
ATOM   1118 N N   . LEU A 1 146 ? -3.044  70.416 49.400 1.00 25.87 ? 146 LEU A N   1 
ATOM   1119 C CA  . LEU A 1 146 ? -4.226  69.552 49.434 1.00 28.21 ? 146 LEU A CA  1 
ATOM   1120 C C   . LEU A 1 146 ? -4.530  69.125 50.875 1.00 29.11 ? 146 LEU A C   1 
ATOM   1121 O O   . LEU A 1 146 ? -3.768  69.383 51.810 1.00 28.85 ? 146 LEU A O   1 
ATOM   1122 C CB  . LEU A 1 146 ? -4.050  68.331 48.509 1.00 25.85 ? 146 LEU A CB  1 
ATOM   1123 C CG  . LEU A 1 146 ? -2.818  67.478 48.795 1.00 28.57 ? 146 LEU A CG  1 
ATOM   1124 C CD1 . LEU A 1 146 ? -2.940  66.766 50.156 1.00 28.26 ? 146 LEU A CD1 1 
ATOM   1125 C CD2 . LEU A 1 146 ? -2.557  66.428 47.723 1.00 25.80 ? 146 LEU A CD2 1 
ATOM   1126 N N   . SER A 1 147 ? -5.633  68.396 51.031 1.00 29.91 ? 147 SER A N   1 
ATOM   1127 C CA  . SER A 1 147 ? -5.974  67.832 52.313 1.00 31.98 ? 147 SER A CA  1 
ATOM   1128 C C   . SER A 1 147 ? -6.314  66.357 52.086 1.00 33.01 ? 147 SER A C   1 
ATOM   1129 O O   . SER A 1 147 ? -6.679  65.942 50.980 1.00 33.60 ? 147 SER A O   1 
ATOM   1130 C CB  . SER A 1 147 ? -7.144  68.509 53.005 1.00 35.48 ? 147 SER A CB  1 
ATOM   1131 O OG  . SER A 1 147 ? -8.266  68.514 52.146 1.00 42.03 ? 147 SER A OG  1 
ATOM   1132 N N   . TYR A 1 148 ? -6.082  65.591 53.144 1.00 31.45 ? 148 TYR A N   1 
ATOM   1133 C CA  . TYR A 1 148 ? -6.420  64.192 53.156 1.00 30.65 ? 148 TYR A CA  1 
ATOM   1134 C C   . TYR A 1 148 ? -6.877  63.808 54.570 1.00 32.31 ? 148 TYR A C   1 
ATOM   1135 O O   . TYR A 1 148 ? -6.541  64.460 55.577 1.00 32.43 ? 148 TYR A O   1 
ATOM   1136 C CB  . TYR A 1 148 ? -5.274  63.299 52.721 1.00 28.86 ? 148 TYR A CB  1 
ATOM   1137 C CG  . TYR A 1 148 ? -3.999  63.471 53.495 1.00 25.18 ? 148 TYR A CG  1 
ATOM   1138 C CD1 . TYR A 1 148 ? -3.192  64.573 53.316 1.00 23.92 ? 148 TYR A CD1 1 
ATOM   1139 C CD2 . TYR A 1 148 ? -3.638  62.518 54.447 1.00 23.97 ? 148 TYR A CD2 1 
ATOM   1140 C CE1 . TYR A 1 148 ? -2.014  64.700 54.033 1.00 24.24 ? 148 TYR A CE1 1 
ATOM   1141 C CE2 . TYR A 1 148 ? -2.490  62.658 55.201 1.00 22.29 ? 148 TYR A CE2 1 
ATOM   1142 C CZ  . TYR A 1 148 ? -1.701  63.760 55.004 1.00 23.43 ? 148 TYR A CZ  1 
ATOM   1143 O OH  . TYR A 1 148 ? -0.532  63.887 55.705 1.00 23.18 ? 148 TYR A OH  1 
ATOM   1144 N N   . ARG A 1 149 ? -7.727  62.796 54.539 1.00 31.75 ? 149 ARG A N   1 
ATOM   1145 C CA  . ARG A 1 149 ? -8.263  62.222 55.752 1.00 32.07 ? 149 ARG A CA  1 
ATOM   1146 C C   . ARG A 1 149 ? -7.118  61.632 56.579 1.00 32.96 ? 149 ARG A C   1 
ATOM   1147 O O   . ARG A 1 149 ? -6.272  60.902 56.062 1.00 33.37 ? 149 ARG A O   1 
ATOM   1148 C CB  . ARG A 1 149 ? -9.277  61.135 55.443 1.00 28.80 ? 149 ARG A CB  1 
ATOM   1149 C CG  . ARG A 1 149 ? -10.680 61.654 55.178 1.00 28.48 ? 149 ARG A CG  1 
ATOM   1150 C CD  . ARG A 1 149 ? -11.527 60.490 54.685 1.00 31.92 ? 149 ARG A CD  1 
ATOM   1151 N NE  . ARG A 1 149 ? -11.147 60.068 53.331 1.00 30.55 ? 149 ARG A NE  1 
ATOM   1152 C CZ  . ARG A 1 149 ? -11.779 59.058 52.741 1.00 32.15 ? 149 ARG A CZ  1 
ATOM   1153 N NH1 . ARG A 1 149 ? -12.709 58.408 53.433 1.00 30.45 ? 149 ARG A NH1 1 
ATOM   1154 N NH2 . ARG A 1 149 ? -11.504 58.697 51.485 1.00 33.47 ? 149 ARG A NH2 1 
ATOM   1155 N N   . VAL A 1 150 ? -7.132  61.976 57.862 1.00 32.68 ? 150 VAL A N   1 
ATOM   1156 C CA  . VAL A 1 150 ? -6.094  61.472 58.760 1.00 32.99 ? 150 VAL A CA  1 
ATOM   1157 C C   . VAL A 1 150 ? -6.776  60.586 59.794 1.00 33.25 ? 150 VAL A C   1 
ATOM   1158 O O   . VAL A 1 150 ? -8.005  60.516 59.831 1.00 33.92 ? 150 VAL A O   1 
ATOM   1159 C CB  . VAL A 1 150 ? -5.299  62.590 59.439 1.00 29.76 ? 150 VAL A CB  1 
ATOM   1160 C CG1 . VAL A 1 150 ? -4.513  63.390 58.410 1.00 27.85 ? 150 VAL A CG1 1 
ATOM   1161 C CG2 . VAL A 1 150 ? -6.197  63.542 60.227 1.00 24.92 ? 150 VAL A CG2 1 
ATOM   1162 N N   . GLY A 1 151 ? -5.970  59.945 60.611 1.00 33.76 ? 151 GLY A N   1 
ATOM   1163 C CA  . GLY A 1 151 ? -6.461  59.089 61.675 1.00 32.92 ? 151 GLY A CA  1 
ATOM   1164 C C   . GLY A 1 151 ? -7.193  57.892 61.090 1.00 33.40 ? 151 GLY A C   1 
ATOM   1165 O O   . GLY A 1 151 ? -6.907  57.438 59.988 1.00 33.71 ? 151 GLY A O   1 
ATOM   1166 N N   . ALA A 1 152 ? -8.117  57.359 61.875 1.00 32.59 ? 152 ALA A N   1 
ATOM   1167 C CA  . ALA A 1 152 ? -8.917  56.230 61.488 1.00 32.14 ? 152 ALA A CA  1 
ATOM   1168 C C   . ALA A 1 152 ? -9.723  56.540 60.225 1.00 31.23 ? 152 ALA A C   1 
ATOM   1169 O O   . ALA A 1 152 ? -9.975  55.657 59.431 1.00 30.55 ? 152 ALA A O   1 
ATOM   1170 C CB  . ALA A 1 152 ? -9.866  55.869 62.625 1.00 32.76 ? 152 ALA A CB  1 
ATOM   1171 N N   . PHE A 1 153 ? -10.161 57.768 60.076 1.00 31.22 ? 153 PHE A N   1 
ATOM   1172 C CA  . PHE A 1 153 ? -10.952 58.219 58.958 1.00 32.39 ? 153 PHE A CA  1 
ATOM   1173 C C   . PHE A 1 153 ? -10.243 58.065 57.608 1.00 32.82 ? 153 PHE A C   1 
ATOM   1174 O O   . PHE A 1 153 ? -10.942 57.872 56.610 1.00 31.81 ? 153 PHE A O   1 
ATOM   1175 C CB  . PHE A 1 153 ? -11.307 59.698 59.123 1.00 32.79 ? 153 PHE A CB  1 
ATOM   1176 C CG  . PHE A 1 153 ? -12.003 59.946 60.430 1.00 37.29 ? 153 PHE A CG  1 
ATOM   1177 C CD1 . PHE A 1 153 ? -13.354 59.700 60.565 1.00 38.02 ? 153 PHE A CD1 1 
ATOM   1178 C CD2 . PHE A 1 153 ? -11.277 60.383 61.534 1.00 37.39 ? 153 PHE A CD2 1 
ATOM   1179 C CE1 . PHE A 1 153 ? -13.986 59.922 61.774 1.00 39.33 ? 153 PHE A CE1 1 
ATOM   1180 C CE2 . PHE A 1 153 ? -11.904 60.602 62.739 1.00 36.86 ? 153 PHE A CE2 1 
ATOM   1181 C CZ  . PHE A 1 153 ? -13.258 60.383 62.853 1.00 38.31 ? 153 PHE A CZ  1 
ATOM   1182 N N   . GLY A 1 154 ? -8.910  58.166 57.620 1.00 31.65 ? 154 GLY A N   1 
ATOM   1183 C CA  . GLY A 1 154 ? -8.210  58.044 56.357 1.00 30.90 ? 154 GLY A CA  1 
ATOM   1184 C C   . GLY A 1 154 ? -7.394  56.776 56.298 1.00 30.90 ? 154 GLY A C   1 
ATOM   1185 O O   . GLY A 1 154 ? -7.017  56.335 55.210 1.00 30.79 ? 154 GLY A O   1 
ATOM   1186 N N   . PHE A 1 155 ? -7.090  56.184 57.463 1.00 30.86 ? 155 PHE A N   1 
ATOM   1187 C CA  . PHE A 1 155 ? -6.236  54.994 57.430 1.00 28.63 ? 155 PHE A CA  1 
ATOM   1188 C C   . PHE A 1 155 ? -6.763  53.780 58.146 1.00 29.57 ? 155 PHE A C   1 
ATOM   1189 O O   . PHE A 1 155 ? -6.030  52.801 58.347 1.00 28.39 ? 155 PHE A O   1 
ATOM   1190 C CB  . PHE A 1 155 ? -4.863  55.450 57.962 1.00 24.45 ? 155 PHE A CB  1 
ATOM   1191 C CG  . PHE A 1 155 ? -4.254  56.460 57.027 1.00 26.82 ? 155 PHE A CG  1 
ATOM   1192 C CD1 . PHE A 1 155 ? -3.711  56.041 55.809 1.00 30.38 ? 155 PHE A CD1 1 
ATOM   1193 C CD2 . PHE A 1 155 ? -4.363  57.809 57.257 1.00 26.25 ? 155 PHE A CD2 1 
ATOM   1194 C CE1 . PHE A 1 155 ? -3.234  56.944 54.881 1.00 26.76 ? 155 PHE A CE1 1 
ATOM   1195 C CE2 . PHE A 1 155 ? -3.882  58.728 56.347 1.00 28.99 ? 155 PHE A CE2 1 
ATOM   1196 C CZ  . PHE A 1 155 ? -3.320  58.289 55.154 1.00 28.30 ? 155 PHE A CZ  1 
ATOM   1197 N N   . LEU A 1 156 ? -8.055  53.760 58.490 1.00 30.15 ? 156 LEU A N   1 
ATOM   1198 C CA  . LEU A 1 156 ? -8.501  52.519 59.129 1.00 31.96 ? 156 LEU A CA  1 
ATOM   1199 C C   . LEU A 1 156 ? -8.410  51.425 58.082 1.00 33.69 ? 156 LEU A C   1 
ATOM   1200 O O   . LEU A 1 156 ? -8.998  51.617 57.008 1.00 34.93 ? 156 LEU A O   1 
ATOM   1201 C CB  . LEU A 1 156 ? -9.916  52.627 59.660 1.00 33.38 ? 156 LEU A CB  1 
ATOM   1202 C CG  . LEU A 1 156 ? -10.422 51.309 60.271 1.00 32.56 ? 156 LEU A CG  1 
ATOM   1203 C CD1 . LEU A 1 156 ? -10.318 51.433 61.780 1.00 34.43 ? 156 LEU A CD1 1 
ATOM   1204 C CD2 . LEU A 1 156 ? -11.823 51.014 59.790 1.00 33.12 ? 156 LEU A CD2 1 
ATOM   1205 N N   . ALA A 1 157 ? -7.779  50.289 58.331 1.00 34.74 ? 157 ALA A N   1 
ATOM   1206 C CA  . ALA A 1 157 ? -7.702  49.285 57.296 1.00 34.88 ? 157 ALA A CA  1 
ATOM   1207 C C   . ALA A 1 157 ? -8.172  47.882 57.618 1.00 37.11 ? 157 ALA A C   1 
ATOM   1208 O O   . ALA A 1 157 ? -7.474  47.094 58.257 1.00 36.58 ? 157 ALA A O   1 
ATOM   1209 C CB  . ALA A 1 157 ? -6.213  49.218 56.897 1.00 32.88 ? 157 ALA A CB  1 
ATOM   1210 N N   . LEU A 1 158 ? -9.310  47.501 57.035 1.00 37.98 ? 158 LEU A N   1 
ATOM   1211 C CA  . LEU A 1 158 ? -9.832  46.142 57.139 1.00 40.04 ? 158 LEU A CA  1 
ATOM   1212 C C   . LEU A 1 158 ? -9.599  45.453 55.797 1.00 41.51 ? 158 LEU A C   1 
ATOM   1213 O O   . LEU A 1 158 ? -10.488 45.200 54.984 1.00 41.71 ? 158 LEU A O   1 
ATOM   1214 C CB  . LEU A 1 158 ? -11.303 46.152 57.561 1.00 39.34 ? 158 LEU A CB  1 
ATOM   1215 C CG  . LEU A 1 158 ? -11.491 46.518 59.051 1.00 39.23 ? 158 LEU A CG  1 
ATOM   1216 C CD1 . LEU A 1 158 ? -12.950 46.764 59.387 1.00 37.12 ? 158 LEU A CD1 1 
ATOM   1217 C CD2 . LEU A 1 158 ? -10.891 45.417 59.911 1.00 36.80 ? 158 LEU A CD2 1 
ATOM   1218 N N   . HIS A 1 159 ? -8.328  45.164 55.526 1.00 43.10 ? 159 HIS A N   1 
ATOM   1219 C CA  . HIS A 1 159 ? -7.940  44.538 54.280 1.00 45.29 ? 159 HIS A CA  1 
ATOM   1220 C C   . HIS A 1 159 ? -8.892  43.420 53.863 1.00 46.71 ? 159 HIS A C   1 
ATOM   1221 O O   . HIS A 1 159 ? -9.102  42.487 54.631 1.00 47.10 ? 159 HIS A O   1 
ATOM   1222 C CB  . HIS A 1 159 ? -6.546  43.906 54.314 1.00 48.71 ? 159 HIS A CB  1 
ATOM   1223 C CG  . HIS A 1 159 ? -6.102  43.603 52.907 1.00 52.63 ? 159 HIS A CG  1 
ATOM   1224 N ND1 . HIS A 1 159 ? -6.059  44.580 51.929 1.00 52.65 ? 159 HIS A ND1 1 
ATOM   1225 C CD2 . HIS A 1 159 ? -5.696  42.444 52.332 1.00 53.46 ? 159 HIS A CD2 1 
ATOM   1226 C CE1 . HIS A 1 159 ? -5.619  44.029 50.817 1.00 53.36 ? 159 HIS A CE1 1 
ATOM   1227 N NE2 . HIS A 1 159 ? -5.398  42.742 51.026 1.00 53.34 ? 159 HIS A NE2 1 
ATOM   1228 N N   . GLY A 1 160 ? -9.347  43.507 52.607 1.00 47.36 ? 160 GLY A N   1 
ATOM   1229 C CA  . GLY A 1 160 ? -10.241 42.488 52.070 1.00 47.61 ? 160 GLY A CA  1 
ATOM   1230 C C   . GLY A 1 160 ? -11.659 43.032 51.966 1.00 47.87 ? 160 GLY A C   1 
ATOM   1231 O O   . GLY A 1 160 ? -12.468 42.624 51.138 1.00 48.79 ? 160 GLY A O   1 
ATOM   1232 N N   . SER A 1 161 ? -11.972 43.979 52.839 1.00 48.07 ? 161 SER A N   1 
ATOM   1233 C CA  . SER A 1 161 ? -13.305 44.578 52.831 1.00 47.15 ? 161 SER A CA  1 
ATOM   1234 C C   . SER A 1 161 ? -13.205 45.766 51.894 1.00 47.01 ? 161 SER A C   1 
ATOM   1235 O O   . SER A 1 161 ? -12.086 46.267 51.718 1.00 48.08 ? 161 SER A O   1 
ATOM   1236 C CB  . SER A 1 161 ? -13.729 44.937 54.240 1.00 46.93 ? 161 SER A CB  1 
ATOM   1237 O OG  . SER A 1 161 ? -13.927 46.327 54.383 1.00 48.84 ? 161 SER A OG  1 
ATOM   1238 N N   . GLN A 1 162 ? -14.289 46.201 51.290 1.00 46.47 ? 162 GLN A N   1 
ATOM   1239 C CA  . GLN A 1 162 ? -14.219 47.330 50.372 1.00 46.18 ? 162 GLN A CA  1 
ATOM   1240 C C   . GLN A 1 162 ? -14.794 48.553 51.069 1.00 45.50 ? 162 GLN A C   1 
ATOM   1241 O O   . GLN A 1 162 ? -14.696 49.675 50.589 1.00 45.20 ? 162 GLN A O   1 
ATOM   1242 C CB  . GLN A 1 162 ? -14.972 47.056 49.073 1.00 50.12 ? 162 GLN A CB  1 
ATOM   1243 C CG  . GLN A 1 162 ? -14.633 45.759 48.362 1.00 52.07 ? 162 GLN A CG  1 
ATOM   1244 C CD  . GLN A 1 162 ? -13.340 45.814 47.572 1.00 52.65 ? 162 GLN A CD  1 
ATOM   1245 N N   . GLU A 1 163 ? -15.387 48.293 52.233 1.00 44.78 ? 163 GLU A N   1 
ATOM   1246 C CA  . GLU A 1 163 ? -15.987 49.379 53.004 1.00 44.23 ? 163 GLU A CA  1 
ATOM   1247 C C   . GLU A 1 163 ? -14.931 50.189 53.740 1.00 42.38 ? 163 GLU A C   1 
ATOM   1248 O O   . GLU A 1 163 ? -15.134 51.362 54.008 1.00 41.86 ? 163 GLU A O   1 
ATOM   1249 C CB  . GLU A 1 163 ? -17.023 48.793 53.969 1.00 49.72 ? 163 GLU A CB  1 
ATOM   1250 C CG  . GLU A 1 163 ? -18.276 48.290 53.267 1.00 53.62 ? 163 GLU A CG  1 
ATOM   1251 C CD  . GLU A 1 163 ? -18.873 49.299 52.303 1.00 56.93 ? 163 GLU A CD  1 
ATOM   1252 O OE1 . GLU A 1 163 ? -19.083 50.473 52.670 1.00 55.78 ? 163 GLU A OE1 1 
ATOM   1253 O OE2 . GLU A 1 163 ? -19.151 48.909 51.139 1.00 60.74 ? 163 GLU A OE2 1 
ATOM   1254 N N   . ALA A 1 164 ? -13.811 49.565 54.051 1.00 41.49 ? 164 ALA A N   1 
ATOM   1255 C CA  . ALA A 1 164 ? -12.696 50.181 54.752 1.00 40.97 ? 164 ALA A CA  1 
ATOM   1256 C C   . ALA A 1 164 ? -11.438 49.433 54.329 1.00 39.88 ? 164 ALA A C   1 
ATOM   1257 O O   . ALA A 1 164 ? -10.876 48.647 55.085 1.00 40.34 ? 164 ALA A O   1 
ATOM   1258 C CB  . ALA A 1 164 ? -12.853 50.124 56.258 1.00 43.10 ? 164 ALA A CB  1 
ATOM   1259 N N   . PRO A 1 165 ? -11.021 49.682 53.094 1.00 39.16 ? 165 PRO A N   1 
ATOM   1260 C CA  . PRO A 1 165 ? -9.863  49.035 52.529 1.00 37.97 ? 165 PRO A CA  1 
ATOM   1261 C C   . PRO A 1 165 ? -8.520  49.448 53.070 1.00 37.45 ? 165 PRO A C   1 
ATOM   1262 O O   . PRO A 1 165 ? -7.579  48.664 52.991 1.00 37.07 ? 165 PRO A O   1 
ATOM   1263 C CB  . PRO A 1 165 ? -9.954  49.391 51.039 1.00 38.24 ? 165 PRO A CB  1 
ATOM   1264 C CG  . PRO A 1 165 ? -10.704 50.674 51.012 1.00 38.40 ? 165 PRO A CG  1 
ATOM   1265 C CD  . PRO A 1 165 ? -11.686 50.618 52.144 1.00 38.61 ? 165 PRO A CD  1 
ATOM   1266 N N   . GLY A 1 166 ? -8.426  50.670 53.591 1.00 36.85 ? 166 GLY A N   1 
ATOM   1267 C CA  . GLY A 1 166 ? -7.121  51.130 54.085 1.00 35.64 ? 166 GLY A CA  1 
ATOM   1268 C C   . GLY A 1 166 ? -6.578  52.069 52.998 1.00 35.00 ? 166 GLY A C   1 
ATOM   1269 O O   . GLY A 1 166 ? -7.174  52.170 51.924 1.00 34.63 ? 166 GLY A O   1 
ATOM   1270 N N   . ASN A 1 167 ? -5.579  52.858 53.332 1.00 33.96 ? 167 ASN A N   1 
ATOM   1271 C CA  . ASN A 1 167 ? -4.957  53.823 52.453 1.00 32.67 ? 167 ASN A CA  1 
ATOM   1272 C C   . ASN A 1 167 ? -5.856  54.873 51.839 1.00 31.94 ? 167 ASN A C   1 
ATOM   1273 O O   . ASN A 1 167 ? -5.362  55.699 51.045 1.00 32.42 ? 167 ASN A O   1 
ATOM   1274 C CB  . ASN A 1 167 ? -4.278  52.988 51.335 1.00 33.54 ? 167 ASN A CB  1 
ATOM   1275 C CG  . ASN A 1 167 ? -3.134  52.229 51.983 1.00 33.76 ? 167 ASN A CG  1 
ATOM   1276 O OD1 . ASN A 1 167 ? -2.654  52.684 53.024 1.00 36.01 ? 167 ASN A OD1 1 
ATOM   1277 N ND2 . ASN A 1 167 ? -2.670  51.124 51.441 1.00 33.10 ? 167 ASN A ND2 1 
ATOM   1278 N N   . VAL A 1 168 ? -7.139  54.950 52.174 1.00 30.92 ? 168 VAL A N   1 
ATOM   1279 C CA  . VAL A 1 168 ? -8.002  55.960 51.544 1.00 29.89 ? 168 VAL A CA  1 
ATOM   1280 C C   . VAL A 1 168 ? -7.504  57.380 51.721 1.00 29.96 ? 168 VAL A C   1 
ATOM   1281 O O   . VAL A 1 168 ? -7.817  58.183 50.823 1.00 30.51 ? 168 VAL A O   1 
ATOM   1282 C CB  . VAL A 1 168 ? -9.473  55.817 52.000 1.00 29.08 ? 168 VAL A CB  1 
ATOM   1283 C CG1 . VAL A 1 168 ? -9.847  54.338 51.855 1.00 26.06 ? 168 VAL A CG1 1 
ATOM   1284 C CG2 . VAL A 1 168 ? -9.725  56.356 53.396 1.00 27.44 ? 168 VAL A CG2 1 
ATOM   1285 N N   . GLY A 1 169 ? -6.721  57.695 52.748 1.00 29.09 ? 169 GLY A N   1 
ATOM   1286 C CA  . GLY A 1 169 ? -6.139  59.028 52.907 1.00 27.26 ? 169 GLY A CA  1 
ATOM   1287 C C   . GLY A 1 169 ? -5.066  59.258 51.826 1.00 26.51 ? 169 GLY A C   1 
ATOM   1288 O O   . GLY A 1 169 ? -4.808  60.379 51.396 1.00 25.63 ? 169 GLY A O   1 
ATOM   1289 N N   . LEU A 1 170 ? -4.409  58.183 51.411 1.00 26.17 ? 170 LEU A N   1 
ATOM   1290 C CA  . LEU A 1 170 ? -3.440  58.222 50.328 1.00 27.19 ? 170 LEU A CA  1 
ATOM   1291 C C   . LEU A 1 170 ? -4.252  58.404 49.016 1.00 27.69 ? 170 LEU A C   1 
ATOM   1292 O O   . LEU A 1 170 ? -3.894  59.251 48.203 1.00 26.90 ? 170 LEU A O   1 
ATOM   1293 C CB  . LEU A 1 170 ? -2.572  56.993 50.266 1.00 25.36 ? 170 LEU A CB  1 
ATOM   1294 C CG  . LEU A 1 170 ? -1.467  56.796 51.301 1.00 22.61 ? 170 LEU A CG  1 
ATOM   1295 C CD1 . LEU A 1 170 ? -0.825  55.423 51.173 1.00 19.86 ? 170 LEU A CD1 1 
ATOM   1296 C CD2 . LEU A 1 170 ? -0.389  57.855 51.161 1.00 19.24 ? 170 LEU A CD2 1 
ATOM   1297 N N   . LEU A 1 171 ? -5.395  57.737 48.896 1.00 27.86 ? 171 LEU A N   1 
ATOM   1298 C CA  . LEU A 1 171 ? -6.246  57.914 47.714 1.00 29.27 ? 171 LEU A CA  1 
ATOM   1299 C C   . LEU A 1 171 ? -6.772  59.337 47.685 1.00 30.37 ? 171 LEU A C   1 
ATOM   1300 O O   . LEU A 1 171 ? -6.865  59.940 46.616 1.00 31.73 ? 171 LEU A O   1 
ATOM   1301 C CB  . LEU A 1 171 ? -7.402  56.913 47.649 1.00 27.26 ? 171 LEU A CB  1 
ATOM   1302 C CG  . LEU A 1 171 ? -6.953  55.458 47.454 1.00 27.81 ? 171 LEU A CG  1 
ATOM   1303 C CD1 . LEU A 1 171 ? -8.107  54.472 47.470 1.00 27.17 ? 171 LEU A CD1 1 
ATOM   1304 C CD2 . LEU A 1 171 ? -6.172  55.322 46.148 1.00 27.93 ? 171 LEU A CD2 1 
ATOM   1305 N N   . ASP A 1 172 ? -7.054  59.934 48.854 1.00 31.58 ? 172 ASP A N   1 
ATOM   1306 C CA  . ASP A 1 172 ? -7.497  61.322 48.879 1.00 29.45 ? 172 ASP A CA  1 
ATOM   1307 C C   . ASP A 1 172 ? -6.432  62.195 48.223 1.00 28.38 ? 172 ASP A C   1 
ATOM   1308 O O   . ASP A 1 172 ? -6.751  63.136 47.512 1.00 28.18 ? 172 ASP A O   1 
ATOM   1309 C CB  . ASP A 1 172 ? -7.743  61.867 50.289 1.00 30.23 ? 172 ASP A CB  1 
ATOM   1310 C CG  . ASP A 1 172 ? -8.896  61.182 50.980 1.00 33.15 ? 172 ASP A CG  1 
ATOM   1311 O OD1 . ASP A 1 172 ? -9.552  60.339 50.329 1.00 33.00 ? 172 ASP A OD1 1 
ATOM   1312 O OD2 . ASP A 1 172 ? -9.126  61.430 52.185 1.00 33.40 ? 172 ASP A OD2 1 
ATOM   1313 N N   . GLN A 1 173 ? -5.164  61.925 48.516 1.00 27.50 ? 173 GLN A N   1 
ATOM   1314 C CA  . GLN A 1 173 ? -4.108  62.747 47.944 1.00 27.95 ? 173 GLN A CA  1 
ATOM   1315 C C   . GLN A 1 173 ? -4.082  62.539 46.421 1.00 28.48 ? 173 GLN A C   1 
ATOM   1316 O O   . GLN A 1 173 ? -3.983  63.474 45.644 1.00 27.60 ? 173 GLN A O   1 
ATOM   1317 C CB  . GLN A 1 173 ? -2.755  62.423 48.568 1.00 26.75 ? 173 GLN A CB  1 
ATOM   1318 C CG  . GLN A 1 173 ? -2.686  62.685 50.067 1.00 27.23 ? 173 GLN A CG  1 
ATOM   1319 C CD  . GLN A 1 173 ? -1.478  62.065 50.727 1.00 26.88 ? 173 GLN A CD  1 
ATOM   1320 O OE1 . GLN A 1 173 ? -0.484  61.691 50.106 1.00 22.10 ? 173 GLN A OE1 1 
ATOM   1321 N NE2 . GLN A 1 173 ? -1.530  61.936 52.060 1.00 30.01 ? 173 GLN A NE2 1 
ATOM   1322 N N   . ARG A 1 174 ? -4.169  61.277 46.024 1.00 28.26 ? 174 ARG A N   1 
ATOM   1323 C CA  . ARG A 1 174 ? -4.156  60.882 44.640 1.00 30.03 ? 174 ARG A CA  1 
ATOM   1324 C C   . ARG A 1 174 ? -5.250  61.649 43.871 1.00 30.23 ? 174 ARG A C   1 
ATOM   1325 O O   . ARG A 1 174 ? -4.943  62.256 42.857 1.00 29.16 ? 174 ARG A O   1 
ATOM   1326 C CB  . ARG A 1 174 ? -4.340  59.372 44.491 1.00 27.50 ? 174 ARG A CB  1 
ATOM   1327 C CG  . ARG A 1 174 ? -3.925  58.985 43.065 1.00 26.24 ? 174 ARG A CG  1 
ATOM   1328 C CD  . ARG A 1 174 ? -4.199  57.506 42.844 1.00 19.70 ? 174 ARG A CD  1 
ATOM   1329 N NE  . ARG A 1 174 ? -2.987  56.803 43.298 1.00 19.22 ? 174 ARG A NE  1 
ATOM   1330 C CZ  . ARG A 1 174 ? -3.073  55.475 43.426 1.00 19.95 ? 174 ARG A CZ  1 
ATOM   1331 N NH1 . ARG A 1 174 ? -4.236  54.905 43.131 1.00 18.08 ? 174 ARG A NH1 1 
ATOM   1332 N NH2 . ARG A 1 174 ? -1.996  54.803 43.805 1.00 20.91 ? 174 ARG A NH2 1 
ATOM   1333 N N   . MET A 1 175 ? -6.448  61.631 44.420 1.00 30.21 ? 175 MET A N   1 
ATOM   1334 C CA  . MET A 1 175 ? -7.601  62.296 43.866 1.00 31.54 ? 175 MET A CA  1 
ATOM   1335 C C   . MET A 1 175 ? -7.330  63.774 43.668 1.00 32.03 ? 175 MET A C   1 
ATOM   1336 O O   . MET A 1 175 ? -7.714  64.364 42.659 1.00 33.26 ? 175 MET A O   1 
ATOM   1337 C CB  . MET A 1 175 ? -8.820  62.133 44.775 1.00 35.47 ? 175 MET A CB  1 
ATOM   1338 C CG  . MET A 1 175 ? -10.152 62.556 44.170 1.00 42.53 ? 175 MET A CG  1 
ATOM   1339 S SD  . MET A 1 175 ? -10.730 61.439 42.871 1.00 49.32 ? 175 MET A SD  1 
ATOM   1340 C CE  . MET A 1 175 ? -11.408 60.104 43.849 1.00 46.64 ? 175 MET A CE  1 
ATOM   1341 N N   . ALA A 1 176 ? -6.685  64.402 44.652 1.00 31.55 ? 176 ALA A N   1 
ATOM   1342 C CA  . ALA A 1 176 ? -6.445  65.830 44.497 1.00 30.48 ? 176 ALA A CA  1 
ATOM   1343 C C   . ALA A 1 176 ? -5.381  66.032 43.421 1.00 29.32 ? 176 ALA A C   1 
ATOM   1344 O O   . ALA A 1 176 ? -5.379  67.051 42.753 1.00 28.20 ? 176 ALA A O   1 
ATOM   1345 C CB  . ALA A 1 176 ? -6.031  66.469 45.814 1.00 27.37 ? 176 ALA A CB  1 
ATOM   1346 N N   . LEU A 1 177 ? -4.477  65.065 43.327 1.00 29.12 ? 177 LEU A N   1 
ATOM   1347 C CA  . LEU A 1 177 ? -3.392  65.124 42.360 1.00 29.84 ? 177 LEU A CA  1 
ATOM   1348 C C   . LEU A 1 177 ? -3.993  64.990 40.945 1.00 30.21 ? 177 LEU A C   1 
ATOM   1349 O O   . LEU A 1 177 ? -3.651  65.713 40.033 1.00 28.57 ? 177 LEU A O   1 
ATOM   1350 C CB  . LEU A 1 177 ? -2.348  64.060 42.629 1.00 30.43 ? 177 LEU A CB  1 
ATOM   1351 C CG  . LEU A 1 177 ? -1.276  64.314 43.692 1.00 31.93 ? 177 LEU A CG  1 
ATOM   1352 C CD1 . LEU A 1 177 ? -0.364  63.095 43.816 1.00 29.43 ? 177 LEU A CD1 1 
ATOM   1353 C CD2 . LEU A 1 177 ? -0.461  65.565 43.401 1.00 32.29 ? 177 LEU A CD2 1 
ATOM   1354 N N   . GLN A 1 178 ? -4.977  64.114 40.846 1.00 31.06 ? 178 GLN A N   1 
ATOM   1355 C CA  . GLN A 1 178 ? -5.770  63.857 39.672 1.00 32.23 ? 178 GLN A CA  1 
ATOM   1356 C C   . GLN A 1 178 ? -6.476  65.145 39.240 1.00 32.51 ? 178 GLN A C   1 
ATOM   1357 O O   . GLN A 1 178 ? -6.516  65.490 38.058 1.00 32.28 ? 178 GLN A O   1 
ATOM   1358 C CB  . GLN A 1 178 ? -6.808  62.767 39.913 1.00 32.65 ? 178 GLN A CB  1 
ATOM   1359 C CG  . GLN A 1 178 ? -7.648  62.398 38.692 1.00 35.26 ? 178 GLN A CG  1 
ATOM   1360 C CD  . GLN A 1 178 ? -6.770  61.908 37.550 1.00 37.89 ? 178 GLN A CD  1 
ATOM   1361 O OE1 . GLN A 1 178 ? -6.124  60.869 37.660 1.00 37.47 ? 178 GLN A OE1 1 
ATOM   1362 N NE2 . GLN A 1 178 ? -6.718  62.650 36.443 1.00 38.95 ? 178 GLN A NE2 1 
ATOM   1363 N N   . TRP A 1 179 ? -6.999  65.856 40.237 1.00 31.25 ? 179 TRP A N   1 
ATOM   1364 C CA  . TRP A 1 179 ? -7.711  67.090 39.916 1.00 30.62 ? 179 TRP A CA  1 
ATOM   1365 C C   . TRP A 1 179 ? -6.770  68.201 39.484 1.00 31.90 ? 179 TRP A C   1 
ATOM   1366 O O   . TRP A 1 179 ? -7.179  69.071 38.711 1.00 31.97 ? 179 TRP A O   1 
ATOM   1367 C CB  . TRP A 1 179 ? -8.539  67.488 41.117 1.00 24.37 ? 179 TRP A CB  1 
ATOM   1368 C CG  . TRP A 1 179 ? -9.532  68.564 40.864 1.00 20.62 ? 179 TRP A CG  1 
ATOM   1369 C CD1 . TRP A 1 179 ? -10.868 68.390 40.615 1.00 21.45 ? 179 TRP A CD1 1 
ATOM   1370 C CD2 . TRP A 1 179 ? -9.289  69.969 40.852 1.00 19.61 ? 179 TRP A CD2 1 
ATOM   1371 N NE1 . TRP A 1 179 ? -11.464 69.610 40.439 1.00 23.34 ? 179 TRP A NE1 1 
ATOM   1372 C CE2 . TRP A 1 179 ? -10.509 70.596 40.568 1.00 21.41 ? 179 TRP A CE2 1 
ATOM   1373 C CE3 . TRP A 1 179 ? -8.148  70.751 41.033 1.00 22.53 ? 179 TRP A CE3 1 
ATOM   1374 C CZ2 . TRP A 1 179 ? -10.638 71.977 40.452 1.00 22.89 ? 179 TRP A CZ2 1 
ATOM   1375 C CZ3 . TRP A 1 179 ? -8.271  72.125 40.915 1.00 22.91 ? 179 TRP A CZ3 1 
ATOM   1376 C CH2 . TRP A 1 179 ? -9.502  72.721 40.632 1.00 23.74 ? 179 TRP A CH2 1 
ATOM   1377 N N   . VAL A 1 180 ? -5.540  68.180 39.953 1.00 32.32 ? 180 VAL A N   1 
ATOM   1378 C CA  . VAL A 1 180 ? -4.553  69.195 39.602 1.00 32.95 ? 180 VAL A CA  1 
ATOM   1379 C C   . VAL A 1 180 ? -4.096  68.943 38.175 1.00 33.50 ? 180 VAL A C   1 
ATOM   1380 O O   . VAL A 1 180 ? -3.922  69.809 37.337 1.00 34.32 ? 180 VAL A O   1 
ATOM   1381 C CB  . VAL A 1 180 ? -3.366  69.147 40.582 1.00 31.08 ? 180 VAL A CB  1 
ATOM   1382 C CG1 . VAL A 1 180 ? -2.157  69.935 40.106 1.00 24.89 ? 180 VAL A CG1 1 
ATOM   1383 C CG2 . VAL A 1 180 ? -3.861  69.656 41.934 1.00 31.72 ? 180 VAL A CG2 1 
ATOM   1384 N N   . HIS A 1 181 ? -3.835  67.669 37.928 1.00 33.16 ? 181 HIS A N   1 
ATOM   1385 C CA  . HIS A 1 181 ? -3.480  67.140 36.647 1.00 33.06 ? 181 HIS A CA  1 
ATOM   1386 C C   . HIS A 1 181 ? -4.444  67.641 35.560 1.00 32.52 ? 181 HIS A C   1 
ATOM   1387 O O   . HIS A 1 181 ? -3.989  68.238 34.594 1.00 31.97 ? 181 HIS A O   1 
ATOM   1388 C CB  . HIS A 1 181 ? -3.529  65.611 36.688 1.00 35.55 ? 181 HIS A CB  1 
ATOM   1389 C CG  . HIS A 1 181 ? -2.919  65.099 35.408 1.00 40.46 ? 181 HIS A CG  1 
ATOM   1390 N ND1 . HIS A 1 181 ? -3.687  64.579 34.385 1.00 42.33 ? 181 HIS A ND1 1 
ATOM   1391 C CD2 . HIS A 1 181 ? -1.626  65.064 35.017 1.00 40.58 ? 181 HIS A CD2 1 
ATOM   1392 C CE1 . HIS A 1 181 ? -2.873  64.220 33.410 1.00 43.10 ? 181 HIS A CE1 1 
ATOM   1393 N NE2 . HIS A 1 181 ? -1.629  64.498 33.764 1.00 43.37 ? 181 HIS A NE2 1 
ATOM   1394 N N   . ASP A 1 182 ? -5.727  67.430 35.777 1.00 30.90 ? 182 ASP A N   1 
ATOM   1395 C CA  . ASP A 1 182 ? -6.821  67.792 34.942 1.00 30.74 ? 182 ASP A CA  1 
ATOM   1396 C C   . ASP A 1 182 ? -7.280  69.241 34.977 1.00 32.42 ? 182 ASP A C   1 
ATOM   1397 O O   . ASP A 1 182 ? -7.965  69.616 33.999 1.00 33.53 ? 182 ASP A O   1 
ATOM   1398 C CB  . ASP A 1 182 ? -8.079  66.984 35.351 1.00 24.58 ? 182 ASP A CB  1 
ATOM   1399 C CG  . ASP A 1 182 ? -7.821  65.505 35.206 1.00 28.16 ? 182 ASP A CG  1 
ATOM   1400 O OD1 . ASP A 1 182 ? -6.794  65.120 34.595 1.00 31.54 ? 182 ASP A OD1 1 
ATOM   1401 O OD2 . ASP A 1 182 ? -8.611  64.687 35.713 1.00 32.26 ? 182 ASP A OD2 1 
ATOM   1402 N N   . ASN A 1 183 ? -6.983  70.057 35.990 1.00 31.47 ? 183 ASN A N   1 
ATOM   1403 C CA  . ASN A 1 183 ? -7.547  71.402 35.959 1.00 31.15 ? 183 ASN A CA  1 
ATOM   1404 C C   . ASN A 1 183 ? -6.562  72.513 36.211 1.00 31.20 ? 183 ASN A C   1 
ATOM   1405 O O   . ASN A 1 183 ? -6.920  73.681 36.053 1.00 31.90 ? 183 ASN A O   1 
ATOM   1406 C CB  . ASN A 1 183 ? -8.647  71.517 37.025 1.00 34.00 ? 183 ASN A CB  1 
ATOM   1407 C CG  . ASN A 1 183 ? -9.863  70.664 36.730 1.00 37.33 ? 183 ASN A CG  1 
ATOM   1408 O OD1 . ASN A 1 183 ? -10.727 71.050 35.933 1.00 37.35 ? 183 ASN A OD1 1 
ATOM   1409 N ND2 . ASN A 1 183 ? -9.919  69.504 37.383 1.00 36.89 ? 183 ASN A ND2 1 
ATOM   1410 N N   . ILE A 1 184 ? -5.343  72.179 36.600 1.00 31.71 ? 184 ILE A N   1 
ATOM   1411 C CA  . ILE A 1 184 ? -4.380  73.231 36.916 1.00 31.99 ? 184 ILE A CA  1 
ATOM   1412 C C   . ILE A 1 184 ? -4.007  74.099 35.731 1.00 33.11 ? 184 ILE A C   1 
ATOM   1413 O O   . ILE A 1 184 ? -3.567  75.243 35.968 1.00 33.95 ? 184 ILE A O   1 
ATOM   1414 C CB  . ILE A 1 184 ? -3.137  72.599 37.568 1.00 31.52 ? 184 ILE A CB  1 
ATOM   1415 C CG1 . ILE A 1 184 ? -2.393  73.682 38.371 1.00 30.42 ? 184 ILE A CG1 1 
ATOM   1416 C CG2 . ILE A 1 184 ? -2.211  71.955 36.558 1.00 30.02 ? 184 ILE A CG2 1 
ATOM   1417 C CD1 . ILE A 1 184 ? -3.219  74.226 39.504 1.00 28.75 ? 184 ILE A CD1 1 
ATOM   1418 N N   . GLN A 1 185 ? -4.120  73.607 34.497 1.00 33.33 ? 185 GLN A N   1 
ATOM   1419 C CA  . GLN A 1 185 ? -3.855  74.437 33.309 1.00 32.42 ? 185 GLN A CA  1 
ATOM   1420 C C   . GLN A 1 185 ? -4.769  75.660 33.299 1.00 31.30 ? 185 GLN A C   1 
ATOM   1421 O O   . GLN A 1 185 ? -4.348  76.722 32.861 1.00 30.28 ? 185 GLN A O   1 
ATOM   1422 C CB  . GLN A 1 185 ? -4.043  73.660 32.000 1.00 32.52 ? 185 GLN A CB  1 
ATOM   1423 C CG  . GLN A 1 185 ? -5.488  73.370 31.665 1.00 33.65 ? 185 GLN A CG  1 
ATOM   1424 C CD  . GLN A 1 185 ? -5.672  72.249 30.663 1.00 36.67 ? 185 GLN A CD  1 
ATOM   1425 O OE1 . GLN A 1 185 ? -5.333  71.114 30.974 1.00 36.36 ? 185 GLN A OE1 1 
ATOM   1426 N NE2 . GLN A 1 185 ? -6.185  72.552 29.459 1.00 37.21 ? 185 GLN A NE2 1 
ATOM   1427 N N   . PHE A 1 186 ? -5.995  75.543 33.822 1.00 31.04 ? 186 PHE A N   1 
ATOM   1428 C CA  . PHE A 1 186 ? -6.877  76.702 33.841 1.00 32.52 ? 186 PHE A CA  1 
ATOM   1429 C C   . PHE A 1 186 ? -6.459  77.763 34.852 1.00 33.50 ? 186 PHE A C   1 
ATOM   1430 O O   . PHE A 1 186 ? -7.050  78.850 34.848 1.00 34.15 ? 186 PHE A O   1 
ATOM   1431 C CB  . PHE A 1 186 ? -8.320  76.300 34.155 1.00 34.25 ? 186 PHE A CB  1 
ATOM   1432 C CG  . PHE A 1 186 ? -8.779  75.194 33.252 1.00 38.14 ? 186 PHE A CG  1 
ATOM   1433 C CD1 . PHE A 1 186 ? -8.850  75.413 31.877 1.00 40.68 ? 186 PHE A CD1 1 
ATOM   1434 C CD2 . PHE A 1 186 ? -9.055  73.936 33.751 1.00 38.47 ? 186 PHE A CD2 1 
ATOM   1435 C CE1 . PHE A 1 186 ? -9.238  74.390 31.028 1.00 40.71 ? 186 PHE A CE1 1 
ATOM   1436 C CE2 . PHE A 1 186 ? -9.446  72.918 32.902 1.00 41.28 ? 186 PHE A CE2 1 
ATOM   1437 C CZ  . PHE A 1 186 ? -9.546  73.142 31.534 1.00 40.38 ? 186 PHE A CZ  1 
ATOM   1438 N N   . PHE A 1 187 ? -5.484  77.465 35.707 1.00 33.42 ? 187 PHE A N   1 
ATOM   1439 C CA  . PHE A 1 187 ? -5.038  78.428 36.702 1.00 32.70 ? 187 PHE A CA  1 
ATOM   1440 C C   . PHE A 1 187 ? -3.665  78.975 36.334 1.00 32.52 ? 187 PHE A C   1 
ATOM   1441 O O   . PHE A 1 187 ? -3.087  79.745 37.103 1.00 32.64 ? 187 PHE A O   1 
ATOM   1442 C CB  . PHE A 1 187 ? -4.965  77.800 38.094 1.00 31.19 ? 187 PHE A CB  1 
ATOM   1443 C CG  . PHE A 1 187 ? -6.310  77.389 38.634 1.00 28.12 ? 187 PHE A CG  1 
ATOM   1444 C CD1 . PHE A 1 187 ? -6.792  76.120 38.414 1.00 25.06 ? 187 PHE A CD1 1 
ATOM   1445 C CD2 . PHE A 1 187 ? -7.052  78.269 39.404 1.00 27.38 ? 187 PHE A CD2 1 
ATOM   1446 C CE1 . PHE A 1 187 ? -8.009  75.736 38.938 1.00 25.72 ? 187 PHE A CE1 1 
ATOM   1447 C CE2 . PHE A 1 187 ? -8.265  77.887 39.931 1.00 25.88 ? 187 PHE A CE2 1 
ATOM   1448 C CZ  . PHE A 1 187 ? -8.753  76.622 39.678 1.00 24.92 ? 187 PHE A CZ  1 
ATOM   1449 N N   . GLY A 1 188 ? -3.146  78.537 35.184 1.00 30.96 ? 188 GLY A N   1 
ATOM   1450 C CA  . GLY A 1 188 ? -1.844  79.033 34.744 1.00 28.60 ? 188 GLY A CA  1 
ATOM   1451 C C   . GLY A 1 188 ? -0.747  78.038 35.042 1.00 28.08 ? 188 GLY A C   1 
ATOM   1452 O O   . GLY A 1 188 ? 0.449   78.273 34.864 1.00 26.78 ? 188 GLY A O   1 
ATOM   1453 N N   . GLY A 1 189 ? -1.184  76.858 35.514 1.00 28.73 ? 189 GLY A N   1 
ATOM   1454 C CA  . GLY A 1 189 ? -0.160  75.887 35.846 1.00 29.49 ? 189 GLY A CA  1 
ATOM   1455 C C   . GLY A 1 189 ? 0.013   74.810 34.805 1.00 29.87 ? 189 GLY A C   1 
ATOM   1456 O O   . GLY A 1 189 ? -0.923  74.379 34.146 1.00 32.57 ? 189 GLY A O   1 
ATOM   1457 N N   . ASP A 1 190 ? 1.230   74.335 34.709 1.00 29.52 ? 190 ASP A N   1 
ATOM   1458 C CA  . ASP A 1 190 ? 1.600   73.277 33.799 1.00 30.11 ? 190 ASP A CA  1 
ATOM   1459 C C   . ASP A 1 190 ? 1.523   71.923 34.485 1.00 31.32 ? 190 ASP A C   1 
ATOM   1460 O O   . ASP A 1 190 ? 2.423   71.438 35.185 1.00 31.28 ? 190 ASP A O   1 
ATOM   1461 C CB  . ASP A 1 190 ? 2.984   73.669 33.260 1.00 24.90 ? 190 ASP A CB  1 
ATOM   1462 C CG  . ASP A 1 190 ? 3.561   72.530 32.463 1.00 26.58 ? 190 ASP A CG  1 
ATOM   1463 O OD1 . ASP A 1 190 ? 2.791   71.595 32.177 1.00 28.15 ? 190 ASP A OD1 1 
ATOM   1464 O OD2 . ASP A 1 190 ? 4.773   72.532 32.188 1.00 31.29 ? 190 ASP A OD2 1 
ATOM   1465 N N   . PRO A 1 191 ? 0.474   71.162 34.193 1.00 31.94 ? 191 PRO A N   1 
ATOM   1466 C CA  . PRO A 1 191 ? 0.248   69.834 34.706 1.00 32.28 ? 191 PRO A CA  1 
ATOM   1467 C C   . PRO A 1 191 ? 1.342   68.848 34.395 1.00 33.19 ? 191 PRO A C   1 
ATOM   1468 O O   . PRO A 1 191 ? 1.247   67.675 34.766 1.00 34.73 ? 191 PRO A O   1 
ATOM   1469 C CB  . PRO A 1 191 ? -1.057  69.373 34.059 1.00 32.41 ? 191 PRO A CB  1 
ATOM   1470 C CG  . PRO A 1 191 ? -1.172  70.240 32.835 1.00 32.61 ? 191 PRO A CG  1 
ATOM   1471 C CD  . PRO A 1 191 ? -0.631  71.577 33.277 1.00 32.97 ? 191 PRO A CD  1 
ATOM   1472 N N   . LYS A 1 192 ? 2.385   69.241 33.691 1.00 34.19 ? 192 LYS A N   1 
ATOM   1473 C CA  . LYS A 1 192 ? 3.466   68.312 33.338 1.00 33.96 ? 192 LYS A CA  1 
ATOM   1474 C C   . LYS A 1 192 ? 4.705   68.675 34.141 1.00 32.47 ? 192 LYS A C   1 
ATOM   1475 O O   . LYS A 1 192 ? 5.739   68.028 34.062 1.00 31.83 ? 192 LYS A O   1 
ATOM   1476 C CB  . LYS A 1 192 ? 3.717   68.332 31.826 1.00 37.48 ? 192 LYS A CB  1 
ATOM   1477 C CG  . LYS A 1 192 ? 2.442   68.048 31.050 1.00 42.82 ? 192 LYS A CG  1 
ATOM   1478 C CD  . LYS A 1 192 ? 1.904   66.645 31.275 1.00 45.66 ? 192 LYS A CD  1 
ATOM   1479 C CE  . LYS A 1 192 ? 0.842   66.277 30.259 1.00 48.36 ? 192 LYS A CE  1 
ATOM   1480 N NZ  . LYS A 1 192 ? -0.465  66.955 30.471 1.00 50.60 ? 192 LYS A NZ  1 
ATOM   1481 N N   . THR A 1 193 ? 4.538   69.760 34.903 1.00 32.02 ? 193 THR A N   1 
ATOM   1482 C CA  . THR A 1 193 ? 5.655   70.185 35.765 1.00 32.49 ? 193 THR A CA  1 
ATOM   1483 C C   . THR A 1 193 ? 5.103   70.457 37.176 1.00 30.94 ? 193 THR A C   1 
ATOM   1484 O O   . THR A 1 193 ? 5.135   71.537 37.736 1.00 29.89 ? 193 THR A O   1 
ATOM   1485 C CB  . THR A 1 193 ? 6.415   71.343 35.149 1.00 33.98 ? 193 THR A CB  1 
ATOM   1486 O OG1 . THR A 1 193 ? 6.662   70.937 33.790 1.00 39.21 ? 193 THR A OG1 1 
ATOM   1487 C CG2 . THR A 1 193 ? 7.738   71.554 35.852 1.00 32.08 ? 193 THR A CG2 1 
ATOM   1488 N N   . VAL A 1 194 ? 4.474   69.399 37.668 1.00 30.02 ? 194 VAL A N   1 
ATOM   1489 C CA  . VAL A 1 194 ? 3.904   69.368 38.998 1.00 29.96 ? 194 VAL A CA  1 
ATOM   1490 C C   . VAL A 1 194 ? 4.884   68.693 39.960 1.00 28.81 ? 194 VAL A C   1 
ATOM   1491 O O   . VAL A 1 194 ? 5.272   67.539 39.797 1.00 28.13 ? 194 VAL A O   1 
ATOM   1492 C CB  . VAL A 1 194 ? 2.582   68.600 39.082 1.00 29.95 ? 194 VAL A CB  1 
ATOM   1493 C CG1 . VAL A 1 194 ? 2.215   68.411 40.546 1.00 29.39 ? 194 VAL A CG1 1 
ATOM   1494 C CG2 . VAL A 1 194 ? 1.500   69.334 38.295 1.00 29.12 ? 194 VAL A CG2 1 
ATOM   1495 N N   . THR A 1 195 ? 5.325   69.475 40.929 1.00 29.34 ? 195 THR A N   1 
ATOM   1496 C CA  . THR A 1 195 ? 6.216   68.925 41.953 1.00 28.71 ? 195 THR A CA  1 
ATOM   1497 C C   . THR A 1 195 ? 5.383   68.671 43.215 1.00 28.66 ? 195 THR A C   1 
ATOM   1498 O O   . THR A 1 195 ? 4.644   69.558 43.673 1.00 29.14 ? 195 THR A O   1 
ATOM   1499 C CB  . THR A 1 195 ? 7.388   69.845 42.267 1.00 27.66 ? 195 THR A CB  1 
ATOM   1500 O OG1 . THR A 1 195 ? 8.412   69.635 41.299 1.00 28.59 ? 195 THR A OG1 1 
ATOM   1501 C CG2 . THR A 1 195 ? 7.965   69.544 43.656 1.00 30.23 ? 195 THR A CG2 1 
ATOM   1502 N N   . ILE A 1 196 ? 5.425   67.464 43.743 1.00 27.73 ? 196 ILE A N   1 
ATOM   1503 C CA  . ILE A 1 196 ? 4.716   67.179 44.990 1.00 26.88 ? 196 ILE A CA  1 
ATOM   1504 C C   . ILE A 1 196 ? 5.782   67.257 46.113 1.00 26.33 ? 196 ILE A C   1 
ATOM   1505 O O   . ILE A 1 196 ? 6.901   66.759 46.018 1.00 24.04 ? 196 ILE A O   1 
ATOM   1506 C CB  . ILE A 1 196 ? 3.995   65.844 45.064 1.00 27.29 ? 196 ILE A CB  1 
ATOM   1507 C CG1 . ILE A 1 196 ? 4.985   64.713 44.759 1.00 26.37 ? 196 ILE A CG1 1 
ATOM   1508 C CG2 . ILE A 1 196 ? 2.807   65.819 44.120 1.00 29.43 ? 196 ILE A CG2 1 
ATOM   1509 C CD1 . ILE A 1 196 ? 4.331   63.347 44.789 1.00 27.36 ? 196 ILE A CD1 1 
ATOM   1510 N N   . PHE A 1 197 ? 5.420   67.949 47.179 1.00 26.19 ? 197 PHE A N   1 
ATOM   1511 C CA  . PHE A 1 197 ? 6.342   68.105 48.317 1.00 26.86 ? 197 PHE A CA  1 
ATOM   1512 C C   . PHE A 1 197 ? 5.556   68.062 49.632 1.00 26.74 ? 197 PHE A C   1 
ATOM   1513 O O   . PHE A 1 197 ? 4.425   68.510 49.759 1.00 26.33 ? 197 PHE A O   1 
ATOM   1514 C CB  . PHE A 1 197 ? 7.180   69.350 48.179 1.00 24.22 ? 197 PHE A CB  1 
ATOM   1515 C CG  . PHE A 1 197 ? 6.588   70.691 48.418 1.00 22.90 ? 197 PHE A CG  1 
ATOM   1516 C CD1 . PHE A 1 197 ? 5.420   71.088 47.794 1.00 26.48 ? 197 PHE A CD1 1 
ATOM   1517 C CD2 . PHE A 1 197 ? 7.256   71.606 49.219 1.00 20.08 ? 197 PHE A CD2 1 
ATOM   1518 C CE1 . PHE A 1 197 ? 4.896   72.351 48.000 1.00 25.68 ? 197 PHE A CE1 1 
ATOM   1519 C CE2 . PHE A 1 197 ? 6.735   72.862 49.432 1.00 21.65 ? 197 PHE A CE2 1 
ATOM   1520 C CZ  . PHE A 1 197 ? 5.547   73.233 48.840 1.00 24.30 ? 197 PHE A CZ  1 
ATOM   1521 N N   . GLY A 1 198 ? 6.197   67.471 50.637 1.00 27.29 ? 198 GLY A N   1 
ATOM   1522 C CA  . GLY A 1 198 ? 5.571   67.353 51.948 1.00 27.23 ? 198 GLY A CA  1 
ATOM   1523 C C   . GLY A 1 198 ? 6.616   67.067 53.018 1.00 26.73 ? 198 GLY A C   1 
ATOM   1524 O O   . GLY A 1 198 ? 7.746   66.678 52.750 1.00 26.76 ? 198 GLY A O   1 
ATOM   1525 N N   . GLU A 1 199 ? 6.157   67.264 54.245 1.00 26.78 ? 199 GLU A N   1 
ATOM   1526 C CA  . GLU A 1 199 ? 7.006   67.046 55.418 1.00 24.50 ? 199 GLU A CA  1 
ATOM   1527 C C   . GLU A 1 199 ? 6.455   65.931 56.280 1.00 22.64 ? 199 GLU A C   1 
ATOM   1528 O O   . GLU A 1 199 ? 5.264   65.648 56.411 1.00 20.72 ? 199 GLU A O   1 
ATOM   1529 C CB  . GLU A 1 199 ? 7.136   68.358 56.199 1.00 25.69 ? 199 GLU A CB  1 
ATOM   1530 C CG  . GLU A 1 199 ? 8.223   68.340 57.257 1.00 27.32 ? 199 GLU A CG  1 
ATOM   1531 C CD  . GLU A 1 199 ? 7.713   67.958 58.658 1.00 29.93 ? 199 GLU A CD  1 
ATOM   1532 O OE1 . GLU A 1 199 ? 6.502   67.751 58.903 1.00 25.44 ? 199 GLU A OE1 1 
ATOM   1533 O OE2 . GLU A 1 199 ? 8.596   67.846 59.543 1.00 30.50 ? 199 GLU A OE2 1 
ATOM   1534 N N   . SER A 1 200 ? 7.416   65.260 56.872 1.00 22.85 ? 200 SER A N   1 
ATOM   1535 C CA  . SER A 1 200 ? 7.126   64.155 57.801 1.00 23.92 ? 200 SER A CA  1 
ATOM   1536 C C   . SER A 1 200 ? 6.151   63.207 57.141 1.00 22.97 ? 200 SER A C   1 
ATOM   1537 O O   . SER A 1 200 ? 6.644   62.515 56.244 1.00 25.46 ? 200 SER A O   1 
ATOM   1538 C CB  . SER A 1 200 ? 6.656   64.619 59.193 1.00 19.61 ? 200 SER A CB  1 
ATOM   1539 O OG  . SER A 1 200 ? 5.341   65.124 59.300 1.00 20.35 ? 200 SER A OG  1 
ATOM   1540 N N   . ALA A 1 201 ? 4.918   63.045 57.565 1.00 23.30 ? 201 ALA A N   1 
ATOM   1541 C CA  . ALA A 1 201 ? 4.027   62.069 56.957 1.00 22.37 ? 201 ALA A CA  1 
ATOM   1542 C C   . ALA A 1 201 ? 3.695   62.443 55.489 1.00 23.72 ? 201 ALA A C   1 
ATOM   1543 O O   . ALA A 1 201 ? 3.195   61.634 54.733 1.00 22.97 ? 201 ALA A O   1 
ATOM   1544 C CB  . ALA A 1 201 ? 2.745   61.956 57.758 1.00 14.17 ? 201 ALA A CB  1 
ATOM   1545 N N   . GLY A 1 202 ? 3.836   63.699 55.140 1.00 23.80 ? 202 GLY A N   1 
ATOM   1546 C CA  . GLY A 1 202 ? 3.646   64.347 53.873 1.00 25.04 ? 202 GLY A CA  1 
ATOM   1547 C C   . GLY A 1 202 ? 4.824   63.885 52.994 1.00 27.07 ? 202 GLY A C   1 
ATOM   1548 O O   . GLY A 1 202 ? 4.622   63.482 51.855 1.00 26.02 ? 202 GLY A O   1 
ATOM   1549 N N   . GLY A 1 203 ? 6.013   63.933 53.590 1.00 26.64 ? 203 GLY A N   1 
ATOM   1550 C CA  . GLY A 1 203 ? 7.206   63.475 52.898 1.00 28.21 ? 203 GLY A CA  1 
ATOM   1551 C C   . GLY A 1 203 ? 7.089   61.975 52.646 1.00 29.39 ? 203 GLY A C   1 
ATOM   1552 O O   . GLY A 1 203 ? 7.478   61.436 51.596 1.00 32.70 ? 203 GLY A O   1 
ATOM   1553 N N   . ALA A 1 204 ? 6.532   61.222 53.591 1.00 28.67 ? 204 ALA A N   1 
ATOM   1554 C CA  . ALA A 1 204 ? 6.409   59.789 53.407 1.00 26.66 ? 204 ALA A CA  1 
ATOM   1555 C C   . ALA A 1 204 ? 5.364   59.539 52.308 1.00 25.50 ? 204 ALA A C   1 
ATOM   1556 O O   . ALA A 1 204 ? 5.489   58.603 51.537 1.00 24.16 ? 204 ALA A O   1 
ATOM   1557 C CB  . ALA A 1 204 ? 6.016   59.048 54.687 1.00 22.11 ? 204 ALA A CB  1 
ATOM   1558 N N   . SER A 1 205 ? 4.337   60.374 52.328 1.00 24.28 ? 205 SER A N   1 
ATOM   1559 C CA  . SER A 1 205 ? 3.247   60.295 51.370 1.00 24.52 ? 205 SER A CA  1 
ATOM   1560 C C   . SER A 1 205 ? 3.783   60.472 49.941 1.00 25.13 ? 205 SER A C   1 
ATOM   1561 O O   . SER A 1 205 ? 3.590   59.643 49.044 1.00 25.19 ? 205 SER A O   1 
ATOM   1562 C CB  . SER A 1 205 ? 2.233   61.355 51.762 1.00 24.05 ? 205 SER A CB  1 
ATOM   1563 O OG  . SER A 1 205 ? 1.347   60.826 52.747 1.00 24.46 ? 205 SER A OG  1 
ATOM   1564 N N   . VAL A 1 206 ? 4.609   61.491 49.766 1.00 23.86 ? 206 VAL A N   1 
ATOM   1565 C CA  . VAL A 1 206 ? 5.298   61.782 48.527 1.00 25.20 ? 206 VAL A CA  1 
ATOM   1566 C C   . VAL A 1 206 ? 6.020   60.538 48.036 1.00 25.89 ? 206 VAL A C   1 
ATOM   1567 O O   . VAL A 1 206 ? 5.719   60.055 46.937 1.00 26.91 ? 206 VAL A O   1 
ATOM   1568 C CB  . VAL A 1 206 ? 6.230   62.983 48.705 1.00 21.96 ? 206 VAL A CB  1 
ATOM   1569 C CG1 . VAL A 1 206 ? 7.290   63.062 47.638 1.00 19.39 ? 206 VAL A CG1 1 
ATOM   1570 C CG2 . VAL A 1 206 ? 5.364   64.246 48.710 1.00 20.81 ? 206 VAL A CG2 1 
ATOM   1571 N N   . GLY A 1 207 ? 6.901   59.972 48.832 1.00 26.02 ? 207 GLY A N   1 
ATOM   1572 C CA  . GLY A 1 207 ? 7.650   58.781 48.488 1.00 24.90 ? 207 GLY A CA  1 
ATOM   1573 C C   . GLY A 1 207 ? 6.713   57.624 48.164 1.00 26.52 ? 207 GLY A C   1 
ATOM   1574 O O   . GLY A 1 207 ? 7.062   56.739 47.382 1.00 26.36 ? 207 GLY A O   1 
ATOM   1575 N N   . MET A 1 208 ? 5.528   57.616 48.761 1.00 26.00 ? 208 MET A N   1 
ATOM   1576 C CA  . MET A 1 208 ? 4.602   56.518 48.519 1.00 27.19 ? 208 MET A CA  1 
ATOM   1577 C C   . MET A 1 208 ? 3.949   56.668 47.142 1.00 26.67 ? 208 MET A C   1 
ATOM   1578 O O   . MET A 1 208 ? 3.591   55.691 46.508 1.00 27.23 ? 208 MET A O   1 
ATOM   1579 C CB  . MET A 1 208 ? 3.544   56.443 49.624 1.00 25.20 ? 208 MET A CB  1 
ATOM   1580 C CG  . MET A 1 208 ? 4.157   56.023 50.959 1.00 31.00 ? 208 MET A CG  1 
ATOM   1581 S SD  . MET A 1 208 ? 3.000   56.087 52.360 1.00 28.24 ? 208 MET A SD  1 
ATOM   1582 C CE  . MET A 1 208 ? 3.913   54.987 53.458 1.00 29.27 ? 208 MET A CE  1 
ATOM   1583 N N   . HIS A 1 209 ? 3.740   57.893 46.719 1.00 26.47 ? 209 HIS A N   1 
ATOM   1584 C CA  . HIS A 1 209 ? 3.158   58.227 45.441 1.00 26.66 ? 209 HIS A CA  1 
ATOM   1585 C C   . HIS A 1 209 ? 4.172   57.888 44.338 1.00 27.89 ? 209 HIS A C   1 
ATOM   1586 O O   . HIS A 1 209 ? 3.772   57.519 43.250 1.00 28.95 ? 209 HIS A O   1 
ATOM   1587 C CB  . HIS A 1 209 ? 2.763   59.687 45.375 1.00 20.86 ? 209 HIS A CB  1 
ATOM   1588 C CG  . HIS A 1 209 ? 1.469   59.904 46.099 1.00 20.36 ? 209 HIS A CG  1 
ATOM   1589 N ND1 . HIS A 1 209 ? 0.390   59.087 45.932 1.00 21.24 ? 209 HIS A ND1 1 
ATOM   1590 C CD2 . HIS A 1 209 ? 1.105   60.842 47.016 1.00 22.87 ? 209 HIS A CD2 1 
ATOM   1591 C CE1 . HIS A 1 209 ? -0.627  59.525 46.649 1.00 22.71 ? 209 HIS A CE1 1 
ATOM   1592 N NE2 . HIS A 1 209 ? -0.208  60.586 47.321 1.00 22.99 ? 209 HIS A NE2 1 
ATOM   1593 N N   . ILE A 1 210 ? 5.444   57.970 44.655 1.00 28.13 ? 210 ILE A N   1 
ATOM   1594 C CA  . ILE A 1 210 ? 6.557   57.642 43.811 1.00 27.52 ? 210 ILE A CA  1 
ATOM   1595 C C   . ILE A 1 210 ? 6.629   56.141 43.584 1.00 28.94 ? 210 ILE A C   1 
ATOM   1596 O O   . ILE A 1 210 ? 7.106   55.647 42.554 1.00 29.79 ? 210 ILE A O   1 
ATOM   1597 C CB  . ILE A 1 210 ? 7.871   58.053 44.483 1.00 24.35 ? 210 ILE A CB  1 
ATOM   1598 C CG1 . ILE A 1 210 ? 7.989   59.580 44.468 1.00 22.01 ? 210 ILE A CG1 1 
ATOM   1599 C CG2 . ILE A 1 210 ? 9.079   57.406 43.832 1.00 24.21 ? 210 ILE A CG2 1 
ATOM   1600 C CD1 . ILE A 1 210 ? 9.393   60.020 44.800 1.00 23.51 ? 210 ILE A CD1 1 
ATOM   1601 N N   . LEU A 1 211 ? 6.141   55.415 44.595 1.00 28.47 ? 211 LEU A N   1 
ATOM   1602 C CA  . LEU A 1 211 ? 6.166   53.965 44.545 1.00 28.10 ? 211 LEU A CA  1 
ATOM   1603 C C   . LEU A 1 211 ? 4.858   53.404 44.014 1.00 27.25 ? 211 LEU A C   1 
ATOM   1604 O O   . LEU A 1 211 ? 4.883   52.432 43.253 1.00 29.23 ? 211 LEU A O   1 
ATOM   1605 C CB  . LEU A 1 211 ? 6.449   53.385 45.928 1.00 28.98 ? 211 LEU A CB  1 
ATOM   1606 C CG  . LEU A 1 211 ? 7.850   53.475 46.510 1.00 30.38 ? 211 LEU A CG  1 
ATOM   1607 C CD1 . LEU A 1 211 ? 7.746   53.406 48.040 1.00 31.08 ? 211 LEU A CD1 1 
ATOM   1608 C CD2 . LEU A 1 211 ? 8.770   52.373 46.016 1.00 29.60 ? 211 LEU A CD2 1 
ATOM   1609 N N   . SER A 1 212 ? 3.714   53.948 44.380 1.00 26.65 ? 212 SER A N   1 
ATOM   1610 C CA  . SER A 1 212 ? 2.440   53.444 43.904 1.00 26.37 ? 212 SER A CA  1 
ATOM   1611 C C   . SER A 1 212 ? 2.251   53.646 42.392 1.00 27.84 ? 212 SER A C   1 
ATOM   1612 O O   . SER A 1 212 ? 2.133   54.792 41.960 1.00 26.37 ? 212 SER A O   1 
ATOM   1613 C CB  . SER A 1 212 ? 1.294   54.161 44.596 1.00 19.97 ? 212 SER A CB  1 
ATOM   1614 O OG  . SER A 1 212 ? 0.092   53.426 44.403 1.00 20.19 ? 212 SER A OG  1 
ATOM   1615 N N   . PRO A 1 213 ? 2.152   52.569 41.637 1.00 28.72 ? 213 PRO A N   1 
ATOM   1616 C CA  . PRO A 1 213 ? 1.927   52.638 40.197 1.00 29.34 ? 213 PRO A CA  1 
ATOM   1617 C C   . PRO A 1 213 ? 0.802   53.603 39.866 1.00 28.02 ? 213 PRO A C   1 
ATOM   1618 O O   . PRO A 1 213 ? 0.987   54.506 39.057 1.00 27.26 ? 213 PRO A O   1 
ATOM   1619 C CB  . PRO A 1 213 ? 1.656   51.200 39.774 1.00 29.59 ? 213 PRO A CB  1 
ATOM   1620 C CG  . PRO A 1 213 ? 2.349   50.376 40.815 1.00 30.30 ? 213 PRO A CG  1 
ATOM   1621 C CD  . PRO A 1 213 ? 2.251   51.164 42.106 1.00 29.80 ? 213 PRO A CD  1 
ATOM   1622 N N   . GLY A 1 214 ? -0.344  53.495 40.515 1.00 27.04 ? 214 GLY A N   1 
ATOM   1623 C CA  . GLY A 1 214 ? -1.481  54.353 40.289 1.00 25.45 ? 214 GLY A CA  1 
ATOM   1624 C C   . GLY A 1 214 ? -1.281  55.820 40.564 1.00 25.53 ? 214 GLY A C   1 
ATOM   1625 O O   . GLY A 1 214 ? -2.250  56.577 40.407 1.00 25.41 ? 214 GLY A O   1 
ATOM   1626 N N   . SER A 1 215 ? -0.112  56.280 40.988 1.00 24.54 ? 215 SER A N   1 
ATOM   1627 C CA  . SER A 1 215 ? 0.110   57.664 41.287 1.00 24.77 ? 215 SER A CA  1 
ATOM   1628 C C   . SER A 1 215 ? 1.231   58.280 40.494 1.00 24.05 ? 215 SER A C   1 
ATOM   1629 O O   . SER A 1 215 ? 1.212   59.491 40.297 1.00 24.83 ? 215 SER A O   1 
ATOM   1630 C CB  . SER A 1 215 ? 0.539   57.890 42.801 1.00 25.27 ? 215 SER A CB  1 
ATOM   1631 O OG  . SER A 1 215 ? -0.574  57.650 43.654 1.00 23.14 ? 215 SER A OG  1 
ATOM   1632 N N   . ARG A 1 216 ? 2.228   57.483 40.136 1.00 24.43 ? 216 ARG A N   1 
ATOM   1633 C CA  . ARG A 1 216 ? 3.384   58.027 39.439 1.00 26.37 ? 216 ARG A CA  1 
ATOM   1634 C C   . ARG A 1 216 ? 3.058   58.924 38.245 1.00 26.41 ? 216 ARG A C   1 
ATOM   1635 O O   . ARG A 1 216 ? 3.890   59.813 38.021 1.00 27.29 ? 216 ARG A O   1 
ATOM   1636 C CB  . ARG A 1 216 ? 4.323   56.944 38.881 1.00 25.56 ? 216 ARG A CB  1 
ATOM   1637 C CG  . ARG A 1 216 ? 4.149   55.554 39.436 1.00 25.44 ? 216 ARG A CG  1 
ATOM   1638 C CD  . ARG A 1 216 ? 5.403   54.717 39.214 1.00 24.93 ? 216 ARG A CD  1 
ATOM   1639 N NE  . ARG A 1 216 ? 5.509   53.590 40.126 1.00 25.35 ? 216 ARG A NE  1 
ATOM   1640 C CZ  . ARG A 1 216 ? 5.966   52.384 39.853 1.00 28.17 ? 216 ARG A CZ  1 
ATOM   1641 N NH1 . ARG A 1 216 ? 6.302   52.117 38.586 1.00 27.78 ? 216 ARG A NH1 1 
ATOM   1642 N NH2 . ARG A 1 216 ? 6.074   51.425 40.778 1.00 24.37 ? 216 ARG A NH2 1 
ATOM   1643 N N   . ASP A 1 217 ? 1.963   58.739 37.523 1.00 26.25 ? 217 ASP A N   1 
ATOM   1644 C CA  . ASP A 1 217 ? 1.820   59.609 36.333 1.00 28.23 ? 217 ASP A CA  1 
ATOM   1645 C C   . ASP A 1 217 ? 1.246   60.965 36.684 1.00 28.56 ? 217 ASP A C   1 
ATOM   1646 O O   . ASP A 1 217 ? 1.294   61.843 35.820 1.00 29.86 ? 217 ASP A O   1 
ATOM   1647 C CB  . ASP A 1 217 ? 0.962   58.947 35.246 1.00 23.56 ? 217 ASP A CB  1 
ATOM   1648 C CG  . ASP A 1 217 ? 1.367   57.530 34.909 1.00 21.76 ? 217 ASP A CG  1 
ATOM   1649 O OD1 . ASP A 1 217 ? 2.518   57.084 35.122 1.00 21.64 ? 217 ASP A OD1 1 
ATOM   1650 O OD2 . ASP A 1 217 ? 0.486   56.790 34.421 1.00 24.35 ? 217 ASP A OD2 1 
ATOM   1651 N N   . LEU A 1 218 ? 0.741   61.150 37.905 1.00 28.33 ? 218 LEU A N   1 
ATOM   1652 C CA  . LEU A 1 218 ? 0.121   62.418 38.284 1.00 25.44 ? 218 LEU A CA  1 
ATOM   1653 C C   . LEU A 1 218 ? 1.077   63.523 38.649 1.00 24.37 ? 218 LEU A C   1 
ATOM   1654 O O   . LEU A 1 218 ? 0.630   64.647 38.940 1.00 24.68 ? 218 LEU A O   1 
ATOM   1655 C CB  . LEU A 1 218 ? -0.842  62.107 39.446 1.00 28.95 ? 218 LEU A CB  1 
ATOM   1656 C CG  . LEU A 1 218 ? -1.939  61.101 39.036 1.00 32.70 ? 218 LEU A CG  1 
ATOM   1657 C CD1 . LEU A 1 218 ? -2.935  60.896 40.175 1.00 31.97 ? 218 LEU A CD1 1 
ATOM   1658 C CD2 . LEU A 1 218 ? -2.660  61.545 37.766 1.00 30.27 ? 218 LEU A CD2 1 
ATOM   1659 N N   . PHE A 1 219 ? 2.389   63.306 38.615 1.00 22.53 ? 219 PHE A N   1 
ATOM   1660 C CA  . PHE A 1 219 ? 3.257   64.432 38.985 1.00 21.41 ? 219 PHE A CA  1 
ATOM   1661 C C   . PHE A 1 219 ? 4.592   64.137 38.377 1.00 20.76 ? 219 PHE A C   1 
ATOM   1662 O O   . PHE A 1 219 ? 4.800   62.991 38.000 1.00 21.62 ? 219 PHE A O   1 
ATOM   1663 C CB  . PHE A 1 219 ? 3.308   64.586 40.534 1.00 24.48 ? 219 PHE A CB  1 
ATOM   1664 C CG  . PHE A 1 219 ? 3.977   63.374 41.139 1.00 15.79 ? 219 PHE A CG  1 
ATOM   1665 C CD1 . PHE A 1 219 ? 3.243   62.231 41.350 1.00 18.24 ? 219 PHE A CD1 1 
ATOM   1666 C CD2 . PHE A 1 219 ? 5.312   63.375 41.417 1.00 17.63 ? 219 PHE A CD2 1 
ATOM   1667 C CE1 . PHE A 1 219 ? 3.852   61.101 41.866 1.00 21.18 ? 219 PHE A CE1 1 
ATOM   1668 C CE2 . PHE A 1 219 ? 5.955   62.242 41.902 1.00 19.45 ? 219 PHE A CE2 1 
ATOM   1669 C CZ  . PHE A 1 219 ? 5.208   61.114 42.137 1.00 20.81 ? 219 PHE A CZ  1 
ATOM   1670 N N   . ARG A 1 220 ? 5.508   65.058 38.333 1.00 22.54 ? 220 ARG A N   1 
ATOM   1671 C CA  . ARG A 1 220 ? 6.805   64.951 37.725 1.00 24.09 ? 220 ARG A CA  1 
ATOM   1672 C C   . ARG A 1 220 ? 8.037   64.807 38.587 1.00 26.96 ? 220 ARG A C   1 
ATOM   1673 O O   . ARG A 1 220 ? 8.993   64.055 38.334 1.00 26.80 ? 220 ARG A O   1 
ATOM   1674 C CB  . ARG A 1 220 ? 6.883   66.330 37.026 1.00 24.41 ? 220 ARG A CB  1 
ATOM   1675 C CG  . ARG A 1 220 ? 8.199   66.743 36.412 1.00 28.18 ? 220 ARG A CG  1 
ATOM   1676 C CD  . ARG A 1 220 ? 8.202   66.261 34.979 1.00 33.59 ? 220 ARG A CD  1 
ATOM   1677 N NE  . ARG A 1 220 ? 9.389   66.571 34.194 1.00 36.55 ? 220 ARG A NE  1 
ATOM   1678 C CZ  . ARG A 1 220 ? 9.341   67.388 33.139 1.00 35.32 ? 220 ARG A CZ  1 
ATOM   1679 N NH1 . ARG A 1 220 ? 8.201   67.970 32.793 1.00 36.20 ? 220 ARG A NH1 1 
ATOM   1680 N NH2 . ARG A 1 220 ? 10.449  67.604 32.454 1.00 35.04 ? 220 ARG A NH2 1 
ATOM   1681 N N   . ARG A 1 221 ? 8.033   65.613 39.656 1.00 27.10 ? 221 ARG A N   1 
ATOM   1682 C CA  . ARG A 1 221 ? 9.131   65.682 40.610 1.00 28.01 ? 221 ARG A CA  1 
ATOM   1683 C C   . ARG A 1 221 ? 8.678   65.631 42.065 1.00 27.17 ? 221 ARG A C   1 
ATOM   1684 O O   . ARG A 1 221 ? 7.546   65.988 42.393 1.00 26.19 ? 221 ARG A O   1 
ATOM   1685 C CB  . ARG A 1 221 ? 9.888   66.994 40.323 1.00 29.67 ? 221 ARG A CB  1 
ATOM   1686 C CG  . ARG A 1 221 ? 11.051  66.730 39.397 1.00 35.50 ? 221 ARG A CG  1 
ATOM   1687 C CD  . ARG A 1 221 ? 11.946  67.950 39.258 1.00 38.25 ? 221 ARG A CD  1 
ATOM   1688 N NE  . ARG A 1 221 ? 11.411  68.890 38.309 1.00 42.19 ? 221 ARG A NE  1 
ATOM   1689 C CZ  . ARG A 1 221 ? 11.428  68.916 36.991 1.00 39.95 ? 221 ARG A CZ  1 
ATOM   1690 N NH1 . ARG A 1 221 ? 12.001  67.985 36.269 1.00 37.15 ? 221 ARG A NH1 1 
ATOM   1691 N NH2 . ARG A 1 221 ? 10.814  69.950 36.424 1.00 42.12 ? 221 ARG A NH2 1 
ATOM   1692 N N   . ALA A 1 222 ? 9.581   65.185 42.941 1.00 27.20 ? 222 ALA A N   1 
ATOM   1693 C CA  . ALA A 1 222 ? 9.222   65.097 44.358 1.00 27.24 ? 222 ALA A CA  1 
ATOM   1694 C C   . ALA A 1 222 ? 10.268  65.640 45.320 1.00 27.57 ? 222 ALA A C   1 
ATOM   1695 O O   . ALA A 1 222 ? 11.480  65.499 45.181 1.00 27.78 ? 222 ALA A O   1 
ATOM   1696 C CB  . ALA A 1 222 ? 8.930   63.636 44.710 1.00 24.15 ? 222 ALA A CB  1 
ATOM   1697 N N   . ILE A 1 223 ? 9.709   66.285 46.344 1.00 27.78 ? 223 ILE A N   1 
ATOM   1698 C CA  . ILE A 1 223 ? 10.454  66.868 47.446 1.00 26.95 ? 223 ILE A CA  1 
ATOM   1699 C C   . ILE A 1 223 ? 9.950   66.209 48.754 1.00 27.19 ? 223 ILE A C   1 
ATOM   1700 O O   . ILE A 1 223 ? 8.763   66.313 49.083 1.00 26.27 ? 223 ILE A O   1 
ATOM   1701 C CB  . ILE A 1 223 ? 10.313  68.370 47.578 1.00 26.63 ? 223 ILE A CB  1 
ATOM   1702 C CG1 . ILE A 1 223 ? 10.847  69.121 46.347 1.00 23.21 ? 223 ILE A CG1 1 
ATOM   1703 C CG2 . ILE A 1 223 ? 11.062  68.865 48.830 1.00 24.73 ? 223 ILE A CG2 1 
ATOM   1704 C CD1 . ILE A 1 223 ? 10.486  70.595 46.444 1.00 22.33 ? 223 ILE A CD1 1 
ATOM   1705 N N   . LEU A 1 224 ? 10.852  65.546 49.446 1.00 25.56 ? 224 LEU A N   1 
ATOM   1706 C CA  . LEU A 1 224 ? 10.575  64.852 50.691 1.00 26.35 ? 224 LEU A CA  1 
ATOM   1707 C C   . LEU A 1 224 ? 11.303  65.502 51.888 1.00 25.45 ? 224 LEU A C   1 
ATOM   1708 O O   . LEU A 1 224 ? 12.540  65.518 51.943 1.00 24.41 ? 224 LEU A O   1 
ATOM   1709 C CB  . LEU A 1 224 ? 11.010  63.399 50.637 1.00 26.22 ? 224 LEU A CB  1 
ATOM   1710 C CG  . LEU A 1 224 ? 10.294  62.413 49.725 1.00 28.38 ? 224 LEU A CG  1 
ATOM   1711 C CD1 . LEU A 1 224 ? 10.800  62.585 48.285 1.00 29.06 ? 224 LEU A CD1 1 
ATOM   1712 C CD2 . LEU A 1 224 ? 10.506  60.999 50.234 1.00 25.72 ? 224 LEU A CD2 1 
ATOM   1713 N N   . GLN A 1 225 ? 10.523  66.028 52.814 1.00 24.47 ? 225 GLN A N   1 
ATOM   1714 C CA  . GLN A 1 225 ? 11.085  66.702 54.001 1.00 25.04 ? 225 GLN A CA  1 
ATOM   1715 C C   . GLN A 1 225 ? 10.899  65.908 55.296 1.00 23.91 ? 225 GLN A C   1 
ATOM   1716 O O   . GLN A 1 225 ? 9.753   65.708 55.724 1.00 23.65 ? 225 GLN A O   1 
ATOM   1717 C CB  . GLN A 1 225 ? 10.423  68.075 54.123 1.00 25.57 ? 225 GLN A CB  1 
ATOM   1718 C CG  . GLN A 1 225 ? 10.957  69.115 53.164 1.00 28.27 ? 225 GLN A CG  1 
ATOM   1719 C CD  . GLN A 1 225 ? 10.016  70.268 52.931 1.00 29.97 ? 225 GLN A CD  1 
ATOM   1720 O OE1 . GLN A 1 225 ? 9.734   70.658 51.799 1.00 30.28 ? 225 GLN A OE1 1 
ATOM   1721 N NE2 . GLN A 1 225 ? 9.487   70.856 54.001 1.00 30.77 ? 225 GLN A NE2 1 
ATOM   1722 N N   . SER A 1 226 ? 11.981  65.422 55.879 1.00 22.90 ? 226 SER A N   1 
ATOM   1723 C CA  . SER A 1 226 ? 11.948  64.682 57.130 1.00 23.68 ? 226 SER A CA  1 
ATOM   1724 C C   . SER A 1 226 ? 10.900  63.593 57.095 1.00 25.45 ? 226 SER A C   1 
ATOM   1725 O O   . SER A 1 226 ? 10.022  63.570 57.987 1.00 26.65 ? 226 SER A O   1 
ATOM   1726 C CB  . SER A 1 226 ? 11.608  65.572 58.351 1.00 20.99 ? 226 SER A CB  1 
ATOM   1727 O OG  . SER A 1 226 ? 12.391  66.754 58.417 1.00 18.15 ? 226 SER A OG  1 
ATOM   1728 N N   . GLY A 1 227 ? 10.973  62.755 56.076 1.00 25.66 ? 227 GLY A N   1 
ATOM   1729 C CA  . GLY A 1 227 ? 9.988   61.694 55.887 1.00 24.43 ? 227 GLY A CA  1 
ATOM   1730 C C   . GLY A 1 227 ? 10.352  60.959 54.597 1.00 26.30 ? 227 GLY A C   1 
ATOM   1731 O O   . GLY A 1 227 ? 10.781  61.517 53.584 1.00 25.93 ? 227 GLY A O   1 
ATOM   1732 N N   . SER A 1 228 ? 10.161  59.657 54.651 1.00 26.18 ? 228 SER A N   1 
ATOM   1733 C CA  . SER A 1 228 ? 10.457  58.778 53.538 1.00 26.05 ? 228 SER A CA  1 
ATOM   1734 C C   . SER A 1 228 ? 9.455   57.661 53.727 1.00 27.66 ? 228 SER A C   1 
ATOM   1735 O O   . SER A 1 228 ? 8.947   57.502 54.828 1.00 29.37 ? 228 SER A O   1 
ATOM   1736 C CB  . SER A 1 228 ? 11.921  58.408 53.558 1.00 25.96 ? 228 SER A CB  1 
ATOM   1737 O OG  . SER A 1 228 ? 12.131  57.193 54.206 1.00 29.67 ? 228 SER A OG  1 
ATOM   1738 N N   . PRO A 1 229 ? 9.033   56.997 52.668 1.00 27.68 ? 229 PRO A N   1 
ATOM   1739 C CA  . PRO A 1 229 ? 8.000   56.003 52.738 1.00 26.54 ? 229 PRO A CA  1 
ATOM   1740 C C   . PRO A 1 229 ? 8.349   54.792 53.558 1.00 25.56 ? 229 PRO A C   1 
ATOM   1741 O O   . PRO A 1 229 ? 7.456   54.086 54.018 1.00 25.02 ? 229 PRO A O   1 
ATOM   1742 C CB  . PRO A 1 229 ? 7.784   55.625 51.255 1.00 27.14 ? 229 PRO A CB  1 
ATOM   1743 C CG  . PRO A 1 229 ? 9.122   55.891 50.640 1.00 27.06 ? 229 PRO A CG  1 
ATOM   1744 C CD  . PRO A 1 229 ? 9.598   57.175 51.290 1.00 27.16 ? 229 PRO A CD  1 
ATOM   1745 N N   . ASN A 1 230 ? 9.635   54.508 53.713 1.00 25.31 ? 230 ASN A N   1 
ATOM   1746 C CA  . ASN A 1 230 ? 10.077  53.359 54.478 1.00 26.30 ? 230 ASN A CA  1 
ATOM   1747 C C   . ASN A 1 230 ? 10.319  53.692 55.961 1.00 26.79 ? 230 ASN A C   1 
ATOM   1748 O O   . ASN A 1 230 ? 10.971  52.890 56.622 1.00 27.03 ? 230 ASN A O   1 
ATOM   1749 C CB  . ASN A 1 230 ? 11.368  52.766 53.868 1.00 23.11 ? 230 ASN A CB  1 
ATOM   1750 C CG  . ASN A 1 230 ? 12.447  53.818 53.910 1.00 25.58 ? 230 ASN A CG  1 
ATOM   1751 O OD1 . ASN A 1 230 ? 12.192  54.983 53.597 1.00 27.10 ? 230 ASN A OD1 1 
ATOM   1752 N ND2 . ASN A 1 230 ? 13.662  53.498 54.321 1.00 28.77 ? 230 ASN A ND2 1 
ATOM   1753 N N   . CYS A 1 231 ? 9.867   54.820 56.495 1.00 26.75 ? 231 CYS A N   1 
ATOM   1754 C CA  . CYS A 1 231 ? 10.047  55.132 57.912 1.00 26.71 ? 231 CYS A CA  1 
ATOM   1755 C C   . CYS A 1 231 ? 9.296   54.098 58.746 1.00 26.09 ? 231 CYS A C   1 
ATOM   1756 O O   . CYS A 1 231 ? 8.216   53.648 58.349 1.00 27.64 ? 231 CYS A O   1 
ATOM   1757 C CB  . CYS A 1 231 ? 9.546   56.536 58.232 1.00 20.07 ? 231 CYS A CB  1 
ATOM   1758 S SG  . CYS A 1 231 ? 10.693  57.810 57.730 1.00 23.76 ? 231 CYS A SG  1 
ATOM   1759 N N   . PRO A 1 232 ? 9.831   53.698 59.879 1.00 26.46 ? 232 PRO A N   1 
ATOM   1760 C CA  . PRO A 1 232 ? 9.251   52.653 60.733 1.00 26.11 ? 232 PRO A CA  1 
ATOM   1761 C C   . PRO A 1 232 ? 7.835   52.942 61.163 1.00 25.18 ? 232 PRO A C   1 
ATOM   1762 O O   . PRO A 1 232 ? 7.039   52.056 61.444 1.00 24.92 ? 232 PRO A O   1 
ATOM   1763 C CB  . PRO A 1 232 ? 10.238  52.514 61.890 1.00 25.84 ? 232 PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 232 ? 10.999  53.791 61.880 1.00 26.47 ? 232 PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 232 ? 11.129  54.183 60.416 1.00 26.35 ? 232 PRO A CD  1 
ATOM   1766 N N   . TRP A 1 233 ? 7.449   54.204 61.211 1.00 25.18 ? 233 TRP A N   1 
ATOM   1767 C CA  . TRP A 1 233 ? 6.109   54.605 61.539 1.00 25.55 ? 233 TRP A CA  1 
ATOM   1768 C C   . TRP A 1 233 ? 5.207   54.920 60.350 1.00 27.43 ? 233 TRP A C   1 
ATOM   1769 O O   . TRP A 1 233 ? 4.008   55.173 60.555 1.00 28.97 ? 233 TRP A O   1 
ATOM   1770 C CB  . TRP A 1 233 ? 6.253   55.909 62.342 1.00 23.08 ? 233 TRP A CB  1 
ATOM   1771 C CG  . TRP A 1 233 ? 7.147   56.901 61.668 1.00 21.20 ? 233 TRP A CG  1 
ATOM   1772 C CD1 . TRP A 1 233 ? 8.481   57.081 61.801 1.00 23.90 ? 233 TRP A CD1 1 
ATOM   1773 C CD2 . TRP A 1 233 ? 6.722   57.862 60.683 1.00 23.54 ? 233 TRP A CD2 1 
ATOM   1774 N NE1 . TRP A 1 233 ? 8.925   58.106 60.986 1.00 22.13 ? 233 TRP A NE1 1 
ATOM   1775 C CE2 . TRP A 1 233 ? 7.847   58.600 60.302 1.00 22.43 ? 233 TRP A CE2 1 
ATOM   1776 C CE3 . TRP A 1 233 ? 5.465   58.146 60.101 1.00 22.35 ? 233 TRP A CE3 1 
ATOM   1777 C CZ2 . TRP A 1 233 ? 7.777   59.621 59.349 1.00 25.20 ? 233 TRP A CZ2 1 
ATOM   1778 C CZ3 . TRP A 1 233 ? 5.410   59.184 59.210 1.00 21.89 ? 233 TRP A CZ3 1 
ATOM   1779 C CH2 . TRP A 1 233 ? 6.552   59.899 58.817 1.00 21.92 ? 233 TRP A CH2 1 
ATOM   1780 N N   . ALA A 1 234 ? 5.704   54.950 59.118 1.00 26.52 ? 234 ALA A N   1 
ATOM   1781 C CA  . ALA A 1 234 ? 4.853   55.308 57.970 1.00 25.54 ? 234 ALA A CA  1 
ATOM   1782 C C   . ALA A 1 234 ? 3.922   54.235 57.474 1.00 25.03 ? 234 ALA A C   1 
ATOM   1783 O O   . ALA A 1 234 ? 2.972   54.612 56.803 1.00 25.98 ? 234 ALA A O   1 
ATOM   1784 C CB  . ALA A 1 234 ? 5.762   55.764 56.828 1.00 22.80 ? 234 ALA A CB  1 
ATOM   1785 N N   . SER A 1 235 ? 4.075   52.963 57.782 1.00 25.49 ? 235 SER A N   1 
ATOM   1786 C CA  . SER A 1 235 ? 3.130   51.965 57.343 1.00 25.34 ? 235 SER A CA  1 
ATOM   1787 C C   . SER A 1 235 ? 3.116   50.771 58.299 1.00 26.61 ? 235 SER A C   1 
ATOM   1788 O O   . SER A 1 235 ? 4.119   50.566 58.969 1.00 26.33 ? 235 SER A O   1 
ATOM   1789 C CB  . SER A 1 235 ? 3.504   51.429 55.956 1.00 22.73 ? 235 SER A CB  1 
ATOM   1790 O OG  . SER A 1 235 ? 4.724   50.684 56.077 1.00 17.02 ? 235 SER A OG  1 
ATOM   1791 N N   . VAL A 1 236 ? 2.086   49.960 58.244 1.00 27.49 ? 236 VAL A N   1 
ATOM   1792 C CA  . VAL A 1 236 ? 1.951   48.710 58.943 1.00 29.32 ? 236 VAL A CA  1 
ATOM   1793 C C   . VAL A 1 236 ? 1.490   47.610 57.965 1.00 30.20 ? 236 VAL A C   1 
ATOM   1794 O O   . VAL A 1 236 ? 0.929   47.909 56.909 1.00 29.95 ? 236 VAL A O   1 
ATOM   1795 C CB  . VAL A 1 236 ? 0.916   48.691 60.083 1.00 29.32 ? 236 VAL A CB  1 
ATOM   1796 C CG1 . VAL A 1 236 ? 1.376   49.532 61.279 1.00 30.67 ? 236 VAL A CG1 1 
ATOM   1797 C CG2 . VAL A 1 236 ? -0.434  49.182 59.597 1.00 27.16 ? 236 VAL A CG2 1 
ATOM   1798 N N   . SER A 1 237 ? 1.665   46.358 58.355 1.00 30.23 ? 237 SER A N   1 
ATOM   1799 C CA  . SER A 1 237 ? 1.212   45.219 57.594 1.00 30.38 ? 237 SER A CA  1 
ATOM   1800 C C   . SER A 1 237 ? -0.307  45.216 57.534 1.00 31.47 ? 237 SER A C   1 
ATOM   1801 O O   . SER A 1 237 ? -0.919  45.952 58.325 1.00 31.43 ? 237 SER A O   1 
ATOM   1802 C CB  . SER A 1 237 ? 1.691   43.921 58.244 1.00 31.00 ? 237 SER A CB  1 
ATOM   1803 O OG  . SER A 1 237 ? 0.861   43.682 59.380 1.00 35.08 ? 237 SER A OG  1 
ATOM   1804 N N   . VAL A 1 238 ? -0.911  44.407 56.650 1.00 31.21 ? 238 VAL A N   1 
ATOM   1805 C CA  . VAL A 1 238 ? -2.384  44.432 56.657 1.00 31.48 ? 238 VAL A CA  1 
ATOM   1806 C C   . VAL A 1 238 ? -2.882  43.705 57.902 1.00 31.12 ? 238 VAL A C   1 
ATOM   1807 O O   . VAL A 1 238 ? -3.970  43.978 58.401 1.00 30.28 ? 238 VAL A O   1 
ATOM   1808 C CB  . VAL A 1 238 ? -3.015  43.856 55.378 1.00 34.29 ? 238 VAL A CB  1 
ATOM   1809 C CG1 . VAL A 1 238 ? -2.126  44.161 54.172 1.00 37.93 ? 238 VAL A CG1 1 
ATOM   1810 C CG2 . VAL A 1 238 ? -3.259  42.361 55.463 1.00 32.16 ? 238 VAL A CG2 1 
ATOM   1811 N N   . ALA A 1 239 ? -2.087  42.761 58.405 1.00 31.44 ? 239 ALA A N   1 
ATOM   1812 C CA  . ALA A 1 239 ? -2.507  42.038 59.613 1.00 32.89 ? 239 ALA A CA  1 
ATOM   1813 C C   . ALA A 1 239 ? -2.569  43.027 60.790 1.00 33.12 ? 239 ALA A C   1 
ATOM   1814 O O   . ALA A 1 239 ? -3.578  43.131 61.493 1.00 33.66 ? 239 ALA A O   1 
ATOM   1815 C CB  . ALA A 1 239 ? -1.579  40.877 59.869 1.00 32.14 ? 239 ALA A CB  1 
ATOM   1816 N N   . GLU A 1 240 ? -1.540  43.855 60.923 1.00 32.63 ? 240 GLU A N   1 
ATOM   1817 C CA  . GLU A 1 240 ? -1.469  44.852 61.984 1.00 32.14 ? 240 GLU A CA  1 
ATOM   1818 C C   . GLU A 1 240 ? -2.553  45.887 61.816 1.00 32.57 ? 240 GLU A C   1 
ATOM   1819 O O   . GLU A 1 240 ? -3.178  46.336 62.783 1.00 32.55 ? 240 GLU A O   1 
ATOM   1820 C CB  . GLU A 1 240 ? -0.082  45.498 61.999 1.00 31.24 ? 240 GLU A CB  1 
ATOM   1821 C CG  . GLU A 1 240 ? 0.104   46.517 63.097 1.00 36.16 ? 240 GLU A CG  1 
ATOM   1822 C CD  . GLU A 1 240 ? -0.237  46.036 64.507 1.00 36.40 ? 240 GLU A CD  1 
ATOM   1823 O OE1 . GLU A 1 240 ? -0.363  44.813 64.715 1.00 33.65 ? 240 GLU A OE1 1 
ATOM   1824 O OE2 . GLU A 1 240 ? -0.433  46.917 65.377 1.00 34.09 ? 240 GLU A OE2 1 
ATOM   1825 N N   . GLY A 1 241 ? -2.792  46.269 60.542 1.00 31.99 ? 241 GLY A N   1 
ATOM   1826 C CA  . GLY A 1 241 ? -3.834  47.266 60.280 1.00 29.92 ? 241 GLY A CA  1 
ATOM   1827 C C   . GLY A 1 241 ? -5.179  46.711 60.741 1.00 29.63 ? 241 GLY A C   1 
ATOM   1828 O O   . GLY A 1 241 ? -6.037  47.411 61.276 1.00 29.05 ? 241 GLY A O   1 
ATOM   1829 N N   . ARG A 1 242 ? -5.361  45.423 60.497 1.00 29.35 ? 242 ARG A N   1 
ATOM   1830 C CA  . ARG A 1 242 ? -6.590  44.752 60.891 1.00 31.53 ? 242 ARG A CA  1 
ATOM   1831 C C   . ARG A 1 242 ? -6.702  44.684 62.424 1.00 31.63 ? 242 ARG A C   1 
ATOM   1832 O O   . ARG A 1 242 ? -7.745  45.025 62.980 1.00 31.01 ? 242 ARG A O   1 
ATOM   1833 C CB  . ARG A 1 242 ? -6.651  43.351 60.277 1.00 34.40 ? 242 ARG A CB  1 
ATOM   1834 C CG  . ARG A 1 242 ? -7.898  42.578 60.669 1.00 39.12 ? 242 ARG A CG  1 
ATOM   1835 C CD  . ARG A 1 242 ? -8.083  41.331 59.798 1.00 43.14 ? 242 ARG A CD  1 
ATOM   1836 N NE  . ARG A 1 242 ? -8.663  41.697 58.501 1.00 45.25 ? 242 ARG A NE  1 
ATOM   1837 C CZ  . ARG A 1 242 ? -9.950  41.942 58.310 1.00 47.29 ? 242 ARG A CZ  1 
ATOM   1838 N NH1 . ARG A 1 242 ? -10.808 41.845 59.318 1.00 48.29 ? 242 ARG A NH1 1 
ATOM   1839 N NH2 . ARG A 1 242 ? -10.411 42.276 57.109 1.00 48.08 ? 242 ARG A NH2 1 
ATOM   1840 N N   . ARG A 1 243 ? -5.623  44.252 63.081 1.00 31.48 ? 243 ARG A N   1 
ATOM   1841 C CA  . ARG A 1 243 ? -5.625  44.151 64.530 1.00 32.80 ? 243 ARG A CA  1 
ATOM   1842 C C   . ARG A 1 243 ? -5.985  45.482 65.191 1.00 32.56 ? 243 ARG A C   1 
ATOM   1843 O O   . ARG A 1 243 ? -6.889  45.482 66.033 1.00 32.24 ? 243 ARG A O   1 
ATOM   1844 C CB  . ARG A 1 243 ? -4.283  43.657 65.078 1.00 36.07 ? 243 ARG A CB  1 
ATOM   1845 C CG  . ARG A 1 243 ? -4.281  43.633 66.613 1.00 36.85 ? 243 ARG A CG  1 
ATOM   1846 C CD  . ARG A 1 243 ? -2.867  43.440 67.144 1.00 36.06 ? 243 ARG A CD  1 
ATOM   1847 N NE  . ARG A 1 243 ? -2.114  44.682 67.242 1.00 35.66 ? 243 ARG A NE  1 
ATOM   1848 C CZ  . ARG A 1 243 ? -2.492  45.767 67.905 1.00 37.08 ? 243 ARG A CZ  1 
ATOM   1849 N NH1 . ARG A 1 243 ? -3.642  45.763 68.568 1.00 37.26 ? 243 ARG A NH1 1 
ATOM   1850 N NH2 . ARG A 1 243 ? -1.730  46.862 67.903 1.00 36.64 ? 243 ARG A NH2 1 
ATOM   1851 N N   . ARG A 1 244 ? -5.374  46.576 64.745 1.00 32.30 ? 244 ARG A N   1 
ATOM   1852 C CA  . ARG A 1 244 ? -5.689  47.882 65.314 1.00 31.80 ? 244 ARG A CA  1 
ATOM   1853 C C   . ARG A 1 244 ? -7.111  48.316 65.006 1.00 33.46 ? 244 ARG A C   1 
ATOM   1854 O O   . ARG A 1 244 ? -7.676  49.111 65.788 1.00 33.37 ? 244 ARG A O   1 
ATOM   1855 C CB  . ARG A 1 244 ? -4.696  48.952 64.829 1.00 26.00 ? 244 ARG A CB  1 
ATOM   1856 C CG  . ARG A 1 244 ? -3.235  48.508 64.993 1.00 21.52 ? 244 ARG A CG  1 
ATOM   1857 C CD  . ARG A 1 244 ? -2.311  49.704 64.804 1.00 19.73 ? 244 ARG A CD  1 
ATOM   1858 N NE  . ARG A 1 244 ? -0.911  49.297 64.900 1.00 17.78 ? 244 ARG A NE  1 
ATOM   1859 C CZ  . ARG A 1 244 ? 0.067   50.151 64.624 1.00 16.26 ? 244 ARG A CZ  1 
ATOM   1860 N NH1 . ARG A 1 244 ? -0.217  51.394 64.265 1.00 17.74 ? 244 ARG A NH1 1 
ATOM   1861 N NH2 . ARG A 1 244 ? 1.315   49.757 64.701 1.00 13.81 ? 244 ARG A NH2 1 
ATOM   1862 N N   . ALA A 1 245 ? -7.690  47.832 63.904 1.00 34.04 ? 245 ALA A N   1 
ATOM   1863 C CA  . ALA A 1 245 ? -9.063  48.226 63.581 1.00 35.04 ? 245 ALA A CA  1 
ATOM   1864 C C   . ALA A 1 245 ? -10.038 47.559 64.554 1.00 35.44 ? 245 ALA A C   1 
ATOM   1865 O O   . ALA A 1 245 ? -10.999 48.152 65.019 1.00 34.43 ? 245 ALA A O   1 
ATOM   1866 C CB  . ALA A 1 245 ? -9.450  47.836 62.169 1.00 37.28 ? 245 ALA A CB  1 
ATOM   1867 N N   . VAL A 1 246 ? -9.782  46.280 64.818 1.00 36.40 ? 246 VAL A N   1 
ATOM   1868 C CA  . VAL A 1 246 ? -10.611 45.508 65.733 1.00 38.54 ? 246 VAL A CA  1 
ATOM   1869 C C   . VAL A 1 246 ? -10.498 46.122 67.133 1.00 39.38 ? 246 VAL A C   1 
ATOM   1870 O O   . VAL A 1 246 ? -11.496 46.438 67.768 1.00 38.93 ? 246 VAL A O   1 
ATOM   1871 C CB  . VAL A 1 246 ? -10.196 44.035 65.746 1.00 40.80 ? 246 VAL A CB  1 
ATOM   1872 C CG1 . VAL A 1 246 ? -11.022 43.263 66.762 1.00 39.90 ? 246 VAL A CG1 1 
ATOM   1873 C CG2 . VAL A 1 246 ? -10.350 43.436 64.353 1.00 41.98 ? 246 VAL A CG2 1 
ATOM   1874 N N   . GLU A 1 247 ? -9.243  46.344 67.543 1.00 39.04 ? 247 GLU A N   1 
ATOM   1875 C CA  . GLU A 1 247 ? -8.957  46.956 68.822 1.00 39.91 ? 247 GLU A CA  1 
ATOM   1876 C C   . GLU A 1 247 ? -9.712  48.273 68.936 1.00 40.24 ? 247 GLU A C   1 
ATOM   1877 O O   . GLU A 1 247 ? -10.262 48.600 69.999 1.00 40.62 ? 247 GLU A O   1 
ATOM   1878 C CB  . GLU A 1 247 ? -7.462  47.188 69.010 1.00 42.79 ? 247 GLU A CB  1 
ATOM   1879 C CG  . GLU A 1 247 ? -6.799  46.065 69.799 1.00 48.37 ? 247 GLU A CG  1 
ATOM   1880 C CD  . GLU A 1 247 ? -7.589  45.750 71.065 1.00 52.38 ? 247 GLU A CD  1 
ATOM   1881 O OE1 . GLU A 1 247 ? -7.617  46.589 71.995 1.00 54.15 ? 247 GLU A OE1 1 
ATOM   1882 O OE2 . GLU A 1 247 ? -8.217  44.673 71.098 1.00 53.55 ? 247 GLU A OE2 1 
ATOM   1883 N N   . LEU A 1 248 ? -9.761  49.015 67.826 1.00 39.38 ? 248 LEU A N   1 
ATOM   1884 C CA  . LEU A 1 248 ? -10.476 50.288 67.890 1.00 38.42 ? 248 LEU A CA  1 
ATOM   1885 C C   . LEU A 1 248 ? -11.942 49.992 68.171 1.00 38.39 ? 248 LEU A C   1 
ATOM   1886 O O   . LEU A 1 248 ? -12.559 50.708 68.945 1.00 38.35 ? 248 LEU A O   1 
ATOM   1887 C CB  . LEU A 1 248 ? -10.328 51.117 66.623 1.00 36.29 ? 248 LEU A CB  1 
ATOM   1888 C CG  . LEU A 1 248 ? -11.050 52.467 66.605 1.00 36.02 ? 248 LEU A CG  1 
ATOM   1889 C CD1 . LEU A 1 248 ? -10.428 53.443 67.598 1.00 35.18 ? 248 LEU A CD1 1 
ATOM   1890 C CD2 . LEU A 1 248 ? -11.039 53.070 65.204 1.00 35.54 ? 248 LEU A CD2 1 
ATOM   1891 N N   . GLY A 1 249 ? -12.455 48.939 67.546 1.00 38.58 ? 249 GLY A N   1 
ATOM   1892 C CA  . GLY A 1 249 ? -13.855 48.567 67.695 1.00 39.38 ? 249 GLY A CA  1 
ATOM   1893 C C   . GLY A 1 249 ? -14.120 48.083 69.121 1.00 40.06 ? 249 GLY A C   1 
ATOM   1894 O O   . GLY A 1 249 ? -15.152 48.367 69.711 1.00 39.12 ? 249 GLY A O   1 
ATOM   1895 N N   . ARG A 1 250 ? -13.142 47.348 69.629 1.00 40.78 ? 250 ARG A N   1 
ATOM   1896 C CA  . ARG A 1 250 ? -13.182 46.802 70.971 1.00 42.49 ? 250 ARG A CA  1 
ATOM   1897 C C   . ARG A 1 250 ? -13.341 47.942 71.981 1.00 43.60 ? 250 ARG A C   1 
ATOM   1898 O O   . ARG A 1 250 ? -14.174 47.928 72.888 1.00 44.14 ? 250 ARG A O   1 
ATOM   1899 C CB  . ARG A 1 250 ? -11.912 45.996 71.199 1.00 43.55 ? 250 ARG A CB  1 
ATOM   1900 C CG  . ARG A 1 250 ? -12.053 44.899 72.245 1.00 43.83 ? 250 ARG A CG  1 
ATOM   1901 C CD  . ARG A 1 250 ? -10.769 44.096 72.371 1.00 43.12 ? 250 ARG A CD  1 
ATOM   1902 N NE  . ARG A 1 250 ? -10.737 42.975 71.426 1.00 44.71 ? 250 ARG A NE  1 
ATOM   1903 N N   . ASN A 1 251 ? -12.610 49.029 71.757 1.00 43.64 ? 251 ASN A N   1 
ATOM   1904 C CA  . ASN A 1 251 ? -12.627 50.223 72.566 1.00 42.86 ? 251 ASN A CA  1 
ATOM   1905 C C   . ASN A 1 251 ? -13.935 50.984 72.436 1.00 43.40 ? 251 ASN A C   1 
ATOM   1906 O O   . ASN A 1 251 ? -14.209 51.877 73.245 1.00 43.35 ? 251 ASN A O   1 
ATOM   1907 C CB  . ASN A 1 251 ? -11.493 51.165 72.164 1.00 41.04 ? 251 ASN A CB  1 
ATOM   1908 C CG  . ASN A 1 251 ? -10.157 50.939 72.818 1.00 39.66 ? 251 ASN A CG  1 
ATOM   1909 O OD1 . ASN A 1 251 ? -9.777  51.678 73.734 1.00 41.34 ? 251 ASN A OD1 1 
ATOM   1910 N ND2 . ASN A 1 251 ? -9.384  49.955 72.389 1.00 38.43 ? 251 ASN A ND2 1 
ATOM   1911 N N   . LEU A 1 252 ? -14.738 50.661 71.423 1.00 44.31 ? 252 LEU A N   1 
ATOM   1912 C CA  . LEU A 1 252 ? -16.009 51.395 71.279 1.00 44.39 ? 252 LEU A CA  1 
ATOM   1913 C C   . LEU A 1 252 ? -17.173 50.440 71.440 1.00 44.82 ? 252 LEU A C   1 
ATOM   1914 O O   . LEU A 1 252 ? -18.315 50.726 71.110 1.00 45.24 ? 252 LEU A O   1 
ATOM   1915 C CB  . LEU A 1 252 ? -16.032 52.134 69.946 1.00 43.50 ? 252 LEU A CB  1 
ATOM   1916 C CG  . LEU A 1 252 ? -14.922 53.192 69.861 1.00 43.43 ? 252 LEU A CG  1 
ATOM   1917 C CD1 . LEU A 1 252 ? -14.765 53.709 68.442 1.00 42.13 ? 252 LEU A CD1 1 
ATOM   1918 C CD2 . LEU A 1 252 ? -15.229 54.305 70.852 1.00 41.40 ? 252 LEU A CD2 1 
ATOM   1919 N N   . ASN A 1 253 ? -16.842 49.275 71.985 1.00 45.49 ? 253 ASN A N   1 
ATOM   1920 C CA  . ASN A 1 253 ? -17.855 48.261 72.247 1.00 47.52 ? 253 ASN A CA  1 
ATOM   1921 C C   . ASN A 1 253 ? -18.636 47.929 70.988 1.00 47.85 ? 253 ASN A C   1 
ATOM   1922 O O   . ASN A 1 253 ? -19.865 47.883 70.989 1.00 48.45 ? 253 ASN A O   1 
ATOM   1923 C CB  . ASN A 1 253 ? -18.790 48.756 73.361 1.00 50.21 ? 253 ASN A CB  1 
ATOM   1924 C CG  . ASN A 1 253 ? -17.971 49.159 74.581 1.00 53.52 ? 253 ASN A CG  1 
ATOM   1925 O OD1 . ASN A 1 253 ? -17.357 48.304 75.219 1.00 55.00 ? 253 ASN A OD1 1 
ATOM   1926 N ND2 . ASN A 1 253 ? -17.916 50.460 74.851 1.00 54.75 ? 253 ASN A ND2 1 
ATOM   1927 N N   . CYS A 1 254 ? -17.895 47.705 69.912 1.00 47.86 ? 254 CYS A N   1 
ATOM   1928 C CA  . CYS A 1 254 ? -18.493 47.363 68.642 1.00 47.69 ? 254 CYS A CA  1 
ATOM   1929 C C   . CYS A 1 254 ? -18.671 45.857 68.528 1.00 47.66 ? 254 CYS A C   1 
ATOM   1930 O O   . CYS A 1 254 ? -17.876 45.107 69.087 1.00 47.43 ? 254 CYS A O   1 
ATOM   1931 C CB  . CYS A 1 254 ? -17.612 47.797 67.464 1.00 47.01 ? 254 CYS A CB  1 
ATOM   1932 S SG  . CYS A 1 254 ? -17.703 49.577 67.169 1.00 45.90 ? 254 CYS A SG  1 
ATOM   1933 N N   . ASN A 1 255 ? -19.687 45.470 67.766 1.00 48.53 ? 255 ASN A N   1 
ATOM   1934 C CA  . ASN A 1 255 ? -19.853 44.043 67.494 1.00 48.58 ? 255 ASN A CA  1 
ATOM   1935 C C   . ASN A 1 255 ? -18.596 43.698 66.707 1.00 48.60 ? 255 ASN A C   1 
ATOM   1936 O O   . ASN A 1 255 ? -18.318 44.455 65.764 1.00 48.48 ? 255 ASN A O   1 
ATOM   1937 C CB  . ASN A 1 255 ? -21.114 43.764 66.717 1.00 51.52 ? 255 ASN A CB  1 
ATOM   1938 C CG  . ASN A 1 255 ? -21.343 42.309 66.382 1.00 53.71 ? 255 ASN A CG  1 
ATOM   1939 O OD1 . ASN A 1 255 ? -20.432 41.580 65.996 1.00 54.80 ? 255 ASN A OD1 1 
ATOM   1940 N ND2 . ASN A 1 255 ? -22.589 41.875 66.531 1.00 55.36 ? 255 ASN A ND2 1 
ATOM   1941 N N   . LEU A 1 256 ? -17.855 42.668 67.060 1.00 48.79 ? 256 LEU A N   1 
ATOM   1942 C CA  . LEU A 1 256 ? -16.655 42.347 66.298 1.00 49.57 ? 256 LEU A CA  1 
ATOM   1943 C C   . LEU A 1 256 ? -16.847 41.048 65.518 1.00 50.47 ? 256 LEU A C   1 
ATOM   1944 O O   . LEU A 1 256 ? -15.872 40.432 65.082 1.00 50.97 ? 256 LEU A O   1 
ATOM   1945 C CB  . LEU A 1 256 ? -15.434 42.210 67.196 1.00 48.79 ? 256 LEU A CB  1 
ATOM   1946 C CG  . LEU A 1 256 ? -15.068 43.393 68.095 1.00 49.98 ? 256 LEU A CG  1 
ATOM   1947 C CD1 . LEU A 1 256 ? -13.802 43.067 68.883 1.00 47.89 ? 256 LEU A CD1 1 
ATOM   1948 C CD2 . LEU A 1 256 ? -14.915 44.668 67.275 1.00 49.10 ? 256 LEU A CD2 1 
ATOM   1949 N N   . ASN A 1 257 ? -18.091 40.627 65.350 1.00 50.83 ? 257 ASN A N   1 
ATOM   1950 C CA  . ASN A 1 257 ? -18.379 39.378 64.651 1.00 51.90 ? 257 ASN A CA  1 
ATOM   1951 C C   . ASN A 1 257 ? -17.968 39.408 63.189 1.00 51.46 ? 257 ASN A C   1 
ATOM   1952 O O   . ASN A 1 257 ? -17.561 38.373 62.656 1.00 52.09 ? 257 ASN A O   1 
ATOM   1953 C CB  . ASN A 1 257 ? -19.875 39.038 64.791 1.00 54.52 ? 257 ASN A CB  1 
ATOM   1954 N N   . SER A 1 258 ? -18.041 40.560 62.533 1.00 51.54 ? 258 SER A N   1 
ATOM   1955 C CA  . SER A 1 258 ? -17.630 40.631 61.131 1.00 50.68 ? 258 SER A CA  1 
ATOM   1956 C C   . SER A 1 258 ? -17.128 42.012 60.760 1.00 50.44 ? 258 SER A C   1 
ATOM   1957 O O   . SER A 1 258 ? -17.447 42.984 61.448 1.00 50.47 ? 258 SER A O   1 
ATOM   1958 C CB  . SER A 1 258 ? -18.827 40.229 60.260 1.00 49.01 ? 258 SER A CB  1 
ATOM   1959 O OG  . SER A 1 258 ? -19.878 41.177 60.403 1.00 48.87 ? 258 SER A OG  1 
ATOM   1960 N N   . ASP A 1 259 ? -16.412 42.129 59.646 1.00 50.30 ? 259 ASP A N   1 
ATOM   1961 C CA  . ASP A 1 259 ? -15.958 43.445 59.200 1.00 50.62 ? 259 ASP A CA  1 
ATOM   1962 C C   . ASP A 1 259 ? -17.143 44.396 59.080 1.00 50.70 ? 259 ASP A C   1 
ATOM   1963 O O   . ASP A 1 259 ? -17.151 45.537 59.528 1.00 50.82 ? 259 ASP A O   1 
ATOM   1964 C CB  . ASP A 1 259 ? -15.232 43.364 57.859 1.00 50.04 ? 259 ASP A CB  1 
ATOM   1965 C CG  . ASP A 1 259 ? -13.869 42.718 57.956 1.00 50.73 ? 259 ASP A CG  1 
ATOM   1966 O OD1 . ASP A 1 259 ? -13.473 42.294 59.060 1.00 50.08 ? 259 ASP A OD1 1 
ATOM   1967 O OD2 . ASP A 1 259 ? -13.171 42.628 56.921 1.00 52.48 ? 259 ASP A OD2 1 
ATOM   1968 N N   . GLU A 1 260 ? -18.188 43.901 58.442 1.00 51.16 ? 260 GLU A N   1 
ATOM   1969 C CA  . GLU A 1 260 ? -19.437 44.588 58.179 1.00 51.81 ? 260 GLU A CA  1 
ATOM   1970 C C   . GLU A 1 260 ? -20.050 45.130 59.461 1.00 50.93 ? 260 GLU A C   1 
ATOM   1971 O O   . GLU A 1 260 ? -20.458 46.292 59.509 1.00 51.57 ? 260 GLU A O   1 
ATOM   1972 C CB  . GLU A 1 260 ? -20.423 43.643 57.484 1.00 57.44 ? 260 GLU A CB  1 
ATOM   1973 C CG  . GLU A 1 260 ? -19.858 42.924 56.270 1.00 64.62 ? 260 GLU A CG  1 
ATOM   1974 C CD  . GLU A 1 260 ? -18.682 42.013 56.566 1.00 69.47 ? 260 GLU A CD  1 
ATOM   1975 O OE1 . GLU A 1 260 ? -18.705 41.336 57.616 1.00 71.13 ? 260 GLU A OE1 1 
ATOM   1976 O OE2 . GLU A 1 260 ? -17.710 41.956 55.774 1.00 72.06 ? 260 GLU A OE2 1 
ATOM   1977 N N   . GLU A 1 261 ? -20.117 44.289 60.492 1.00 49.77 ? 261 GLU A N   1 
ATOM   1978 C CA  . GLU A 1 261 ? -20.664 44.757 61.761 1.00 49.27 ? 261 GLU A CA  1 
ATOM   1979 C C   . GLU A 1 261 ? -19.712 45.789 62.369 1.00 47.52 ? 261 GLU A C   1 
ATOM   1980 O O   . GLU A 1 261 ? -20.138 46.857 62.810 1.00 46.43 ? 261 GLU A O   1 
ATOM   1981 C CB  . GLU A 1 261 ? -20.899 43.599 62.724 1.00 56.48 ? 261 GLU A CB  1 
ATOM   1982 C CG  . GLU A 1 261 ? -21.877 42.548 62.221 1.00 62.19 ? 261 GLU A CG  1 
ATOM   1983 C CD  . GLU A 1 261 ? -23.210 42.589 62.941 1.00 67.19 ? 261 GLU A CD  1 
ATOM   1984 O OE1 . GLU A 1 261 ? -23.682 43.693 63.299 1.00 69.23 ? 261 GLU A OE1 1 
ATOM   1985 O OE2 . GLU A 1 261 ? -23.798 41.502 63.154 1.00 69.37 ? 261 GLU A OE2 1 
ATOM   1986 N N   . LEU A 1 262 ? -18.426 45.446 62.365 1.00 46.38 ? 262 LEU A N   1 
ATOM   1987 C CA  . LEU A 1 262 ? -17.382 46.311 62.897 1.00 45.88 ? 262 LEU A CA  1 
ATOM   1988 C C   . LEU A 1 262 ? -17.424 47.678 62.228 1.00 45.97 ? 262 LEU A C   1 
ATOM   1989 O O   . LEU A 1 262 ? -17.567 48.707 62.895 1.00 46.06 ? 262 LEU A O   1 
ATOM   1990 C CB  . LEU A 1 262 ? -15.999 45.665 62.738 1.00 44.97 ? 262 LEU A CB  1 
ATOM   1991 C CG  . LEU A 1 262 ? -14.813 46.566 63.123 1.00 45.17 ? 262 LEU A CG  1 
ATOM   1992 C CD1 . LEU A 1 262 ? -15.006 47.127 64.526 1.00 43.53 ? 262 LEU A CD1 1 
ATOM   1993 C CD2 . LEU A 1 262 ? -13.485 45.834 63.018 1.00 43.19 ? 262 LEU A CD2 1 
ATOM   1994 N N   . ILE A 1 263 ? -17.362 47.700 60.897 1.00 46.28 ? 263 ILE A N   1 
ATOM   1995 C CA  . ILE A 1 263 ? -17.413 48.962 60.157 1.00 45.90 ? 263 ILE A CA  1 
ATOM   1996 C C   . ILE A 1 263 ? -18.734 49.673 60.398 1.00 45.23 ? 263 ILE A C   1 
ATOM   1997 O O   . ILE A 1 263 ? -18.764 50.894 60.590 1.00 45.39 ? 263 ILE A O   1 
ATOM   1998 C CB  . ILE A 1 263 ? -17.225 48.780 58.639 1.00 46.13 ? 263 ILE A CB  1 
ATOM   1999 C CG1 . ILE A 1 263 ? -15.821 48.256 58.344 1.00 46.27 ? 263 ILE A CG1 1 
ATOM   2000 C CG2 . ILE A 1 263 ? -17.471 50.084 57.891 1.00 46.37 ? 263 ILE A CG2 1 
ATOM   2001 C CD1 . ILE A 1 263 ? -15.751 47.408 57.093 1.00 46.66 ? 263 ILE A CD1 1 
ATOM   2002 N N   . HIS A 1 264 ? -19.828 48.910 60.384 1.00 45.19 ? 264 HIS A N   1 
ATOM   2003 C CA  . HIS A 1 264 ? -21.124 49.558 60.603 1.00 46.30 ? 264 HIS A CA  1 
ATOM   2004 C C   . HIS A 1 264 ? -21.134 50.289 61.943 1.00 45.00 ? 264 HIS A C   1 
ATOM   2005 O O   . HIS A 1 264 ? -21.653 51.389 62.047 1.00 45.68 ? 264 HIS A O   1 
ATOM   2006 C CB  . HIS A 1 264 ? -22.311 48.587 60.549 1.00 51.23 ? 264 HIS A CB  1 
ATOM   2007 C CG  . HIS A 1 264 ? -23.586 49.321 60.875 1.00 57.35 ? 264 HIS A CG  1 
ATOM   2008 N ND1 . HIS A 1 264 ? -24.524 48.859 61.770 1.00 60.27 ? 264 HIS A ND1 1 
ATOM   2009 C CD2 . HIS A 1 264 ? -24.049 50.516 60.421 1.00 59.95 ? 264 HIS A CD2 1 
ATOM   2010 C CE1 . HIS A 1 264 ? -25.520 49.727 61.849 1.00 61.26 ? 264 HIS A CE1 1 
ATOM   2011 N NE2 . HIS A 1 264 ? -25.259 50.743 61.042 1.00 61.65 ? 264 HIS A NE2 1 
ATOM   2012 N N   . CYS A 1 265 ? -20.576 49.660 62.968 1.00 44.98 ? 265 CYS A N   1 
ATOM   2013 C CA  . CYS A 1 265 ? -20.515 50.257 64.301 1.00 43.83 ? 265 CYS A CA  1 
ATOM   2014 C C   . CYS A 1 265 ? -19.655 51.512 64.246 1.00 42.54 ? 265 CYS A C   1 
ATOM   2015 O O   . CYS A 1 265 ? -20.061 52.594 64.683 1.00 42.18 ? 265 CYS A O   1 
ATOM   2016 C CB  . CYS A 1 265 ? -20.010 49.206 65.289 1.00 45.96 ? 265 CYS A CB  1 
ATOM   2017 S SG  . CYS A 1 265 ? -19.694 49.861 66.959 1.00 47.01 ? 265 CYS A SG  1 
ATOM   2018 N N   . LEU A 1 266 ? -18.473 51.388 63.630 1.00 41.68 ? 266 LEU A N   1 
ATOM   2019 C CA  . LEU A 1 266 ? -17.599 52.558 63.518 1.00 40.55 ? 266 LEU A CA  1 
ATOM   2020 C C   . LEU A 1 266 ? -18.215 53.688 62.718 1.00 40.87 ? 266 LEU A C   1 
ATOM   2021 O O   . LEU A 1 266 ? -17.815 54.841 62.927 1.00 41.22 ? 266 LEU A O   1 
ATOM   2022 C CB  . LEU A 1 266 ? -16.262 52.160 62.900 1.00 39.08 ? 266 LEU A CB  1 
ATOM   2023 C CG  . LEU A 1 266 ? -15.449 51.118 63.669 1.00 38.71 ? 266 LEU A CG  1 
ATOM   2024 C CD1 . LEU A 1 266 ? -14.129 50.874 62.963 1.00 38.83 ? 266 LEU A CD1 1 
ATOM   2025 C CD2 . LEU A 1 266 ? -15.233 51.559 65.109 1.00 39.01 ? 266 LEU A CD2 1 
ATOM   2026 N N   . ARG A 1 267 ? -19.166 53.439 61.820 1.00 41.19 ? 267 ARG A N   1 
ATOM   2027 C CA  . ARG A 1 267 ? -19.715 54.574 61.066 1.00 41.82 ? 267 ARG A CA  1 
ATOM   2028 C C   . ARG A 1 267 ? -20.788 55.265 61.890 1.00 41.80 ? 267 ARG A C   1 
ATOM   2029 O O   . ARG A 1 267 ? -21.111 56.429 61.636 1.00 41.74 ? 267 ARG A O   1 
ATOM   2030 C CB  . ARG A 1 267 ? -20.273 54.164 59.706 1.00 42.82 ? 267 ARG A CB  1 
ATOM   2031 C CG  . ARG A 1 267 ? -19.269 53.499 58.781 1.00 43.37 ? 267 ARG A CG  1 
ATOM   2032 C CD  . ARG A 1 267 ? -19.833 53.360 57.380 1.00 44.48 ? 267 ARG A CD  1 
ATOM   2033 N NE  . ARG A 1 267 ? -18.781 53.263 56.382 1.00 47.72 ? 267 ARG A NE  1 
ATOM   2034 C CZ  . ARG A 1 267 ? -18.746 52.378 55.384 1.00 47.29 ? 267 ARG A CZ  1 
ATOM   2035 N NH1 . ARG A 1 267 ? -19.728 51.499 55.250 1.00 46.71 ? 267 ARG A NH1 1 
ATOM   2036 N NH2 . ARG A 1 267 ? -17.712 52.379 54.553 1.00 46.32 ? 267 ARG A NH2 1 
ATOM   2037 N N   . GLU A 1 268 ? -21.331 54.541 62.871 1.00 42.67 ? 268 GLU A N   1 
ATOM   2038 C CA  . GLU A 1 268 ? -22.358 55.169 63.715 1.00 43.28 ? 268 GLU A CA  1 
ATOM   2039 C C   . GLU A 1 268 ? -21.684 56.090 64.731 1.00 42.76 ? 268 GLU A C   1 
ATOM   2040 O O   . GLU A 1 268 ? -22.263 57.099 65.126 1.00 43.06 ? 268 GLU A O   1 
ATOM   2041 C CB  . GLU A 1 268 ? -23.237 54.152 64.423 1.00 46.60 ? 268 GLU A CB  1 
ATOM   2042 C CG  . GLU A 1 268 ? -24.506 53.715 63.734 1.00 49.09 ? 268 GLU A CG  1 
ATOM   2043 C CD  . GLU A 1 268 ? -24.973 54.607 62.597 1.00 51.20 ? 268 GLU A CD  1 
ATOM   2044 N N   . LYS A 1 269 ? -20.464 55.758 65.140 1.00 42.61 ? 269 LYS A N   1 
ATOM   2045 C CA  . LYS A 1 269 ? -19.778 56.594 66.121 1.00 42.81 ? 269 LYS A CA  1 
ATOM   2046 C C   . LYS A 1 269 ? -19.571 58.020 65.654 1.00 42.55 ? 269 LYS A C   1 
ATOM   2047 O O   . LYS A 1 269 ? -19.419 58.280 64.464 1.00 43.90 ? 269 LYS A O   1 
ATOM   2048 C CB  . LYS A 1 269 ? -18.432 55.946 66.475 1.00 45.53 ? 269 LYS A CB  1 
ATOM   2049 C CG  . LYS A 1 269 ? -18.589 54.554 67.071 1.00 47.77 ? 269 LYS A CG  1 
ATOM   2050 C CD  . LYS A 1 269 ? -19.631 54.556 68.199 1.00 49.52 ? 269 LYS A CD  1 
ATOM   2051 C CE  . LYS A 1 269 ? -19.512 53.287 69.029 1.00 51.05 ? 269 LYS A CE  1 
ATOM   2052 N NZ  . LYS A 1 269 ? -20.821 52.885 69.619 1.00 53.62 ? 269 LYS A NZ  1 
ATOM   2053 N N   . LYS A 1 270 ? -19.572 58.968 66.592 1.00 41.59 ? 270 LYS A N   1 
ATOM   2054 C CA  . LYS A 1 270 ? -19.299 60.358 66.248 1.00 40.19 ? 270 LYS A CA  1 
ATOM   2055 C C   . LYS A 1 270 ? -17.789 60.456 66.069 1.00 39.02 ? 270 LYS A C   1 
ATOM   2056 O O   . LYS A 1 270 ? -17.067 59.682 66.698 1.00 39.36 ? 270 LYS A O   1 
ATOM   2057 C CB  . LYS A 1 270 ? -19.797 61.335 67.295 1.00 43.22 ? 270 LYS A CB  1 
ATOM   2058 C CG  . LYS A 1 270 ? -21.303 61.283 67.500 1.00 46.13 ? 270 LYS A CG  1 
ATOM   2059 C CD  . LYS A 1 270 ? -21.800 62.579 68.131 1.00 48.44 ? 270 LYS A CD  1 
ATOM   2060 N N   . PRO A 1 271 ? -17.323 61.362 65.228 1.00 37.49 ? 271 PRO A N   1 
ATOM   2061 C CA  . PRO A 1 271 ? -15.904 61.483 64.983 1.00 36.69 ? 271 PRO A CA  1 
ATOM   2062 C C   . PRO A 1 271 ? -15.033 61.497 66.226 1.00 36.35 ? 271 PRO A C   1 
ATOM   2063 O O   . PRO A 1 271 ? -14.049 60.757 66.297 1.00 35.20 ? 271 PRO A O   1 
ATOM   2064 C CB  . PRO A 1 271 ? -15.779 62.778 64.177 1.00 36.70 ? 271 PRO A CB  1 
ATOM   2065 C CG  . PRO A 1 271 ? -17.142 63.212 63.797 1.00 36.08 ? 271 PRO A CG  1 
ATOM   2066 C CD  . PRO A 1 271 ? -18.135 62.300 64.432 1.00 36.08 ? 271 PRO A CD  1 
ATOM   2067 N N   . GLN A 1 272 ? -15.350 62.330 67.214 1.00 36.65 ? 272 GLN A N   1 
ATOM   2068 C CA  . GLN A 1 272 ? -14.539 62.418 68.428 1.00 36.86 ? 272 GLN A CA  1 
ATOM   2069 C C   . GLN A 1 272 ? -14.449 61.114 69.203 1.00 36.07 ? 272 GLN A C   1 
ATOM   2070 O O   . GLN A 1 272 ? -13.417 60.838 69.814 1.00 35.45 ? 272 GLN A O   1 
ATOM   2071 C CB  . GLN A 1 272 ? -15.062 63.516 69.364 1.00 41.21 ? 272 GLN A CB  1 
ATOM   2072 C CG  . GLN A 1 272 ? -14.078 63.718 70.514 1.00 45.28 ? 272 GLN A CG  1 
ATOM   2073 C CD  . GLN A 1 272 ? -12.775 64.326 70.027 1.00 47.01 ? 272 GLN A CD  1 
ATOM   2074 O OE1 . GLN A 1 272 ? -12.756 65.141 69.103 1.00 46.64 ? 272 GLN A OE1 1 
ATOM   2075 N NE2 . GLN A 1 272 ? -11.693 63.911 70.683 1.00 47.85 ? 272 GLN A NE2 1 
ATOM   2076 N N   . GLU A 1 273 ? -15.470 60.280 69.120 1.00 35.85 ? 273 GLU A N   1 
ATOM   2077 C CA  . GLU A 1 273 ? -15.429 58.987 69.788 1.00 36.46 ? 273 GLU A CA  1 
ATOM   2078 C C   . GLU A 1 273 ? -14.287 58.142 69.253 1.00 36.26 ? 273 GLU A C   1 
ATOM   2079 O O   . GLU A 1 273 ? -13.620 57.431 70.024 1.00 37.27 ? 273 GLU A O   1 
ATOM   2080 C CB  . GLU A 1 273 ? -16.742 58.244 69.602 1.00 40.59 ? 273 GLU A CB  1 
ATOM   2081 C CG  . GLU A 1 273 ? -17.981 59.136 69.680 1.00 44.71 ? 273 GLU A CG  1 
ATOM   2082 C CD  . GLU A 1 273 ? -19.183 58.237 69.922 1.00 49.21 ? 273 GLU A CD  1 
ATOM   2083 O OE1 . GLU A 1 273 ? -19.058 57.375 70.821 1.00 54.02 ? 273 GLU A OE1 1 
ATOM   2084 O OE2 . GLU A 1 273 ? -20.201 58.369 69.228 1.00 50.95 ? 273 GLU A OE2 1 
ATOM   2085 N N   . LEU A 1 274 ? -14.060 58.210 67.935 1.00 35.19 ? 274 LEU A N   1 
ATOM   2086 C CA  . LEU A 1 274 ? -12.965 57.415 67.369 1.00 33.67 ? 274 LEU A CA  1 
ATOM   2087 C C   . LEU A 1 274 ? -11.640 58.060 67.788 1.00 31.20 ? 274 LEU A C   1 
ATOM   2088 O O   . LEU A 1 274 ? -10.669 57.375 68.073 1.00 30.27 ? 274 LEU A O   1 
ATOM   2089 C CB  . LEU A 1 274 ? -12.977 57.300 65.857 1.00 36.11 ? 274 LEU A CB  1 
ATOM   2090 C CG  . LEU A 1 274 ? -14.161 56.761 65.084 1.00 36.95 ? 274 LEU A CG  1 
ATOM   2091 C CD1 . LEU A 1 274 ? -13.661 55.856 63.961 1.00 36.92 ? 274 LEU A CD1 1 
ATOM   2092 C CD2 . LEU A 1 274 ? -15.129 55.986 65.953 1.00 35.99 ? 274 LEU A CD2 1 
ATOM   2093 N N   . ILE A 1 275 ? -11.640 59.383 67.768 1.00 30.41 ? 275 ILE A N   1 
ATOM   2094 C CA  . ILE A 1 275 ? -10.416 60.100 68.149 1.00 32.42 ? 275 ILE A CA  1 
ATOM   2095 C C   . ILE A 1 275 ? -10.097 59.901 69.636 1.00 32.69 ? 275 ILE A C   1 
ATOM   2096 O O   . ILE A 1 275 ? -8.921  59.714 69.957 1.00 32.20 ? 275 ILE A O   1 
ATOM   2097 C CB  . ILE A 1 275 ? -10.524 61.580 67.754 1.00 32.88 ? 275 ILE A CB  1 
ATOM   2098 C CG1 . ILE A 1 275 ? -10.552 61.705 66.222 1.00 33.63 ? 275 ILE A CG1 1 
ATOM   2099 C CG2 . ILE A 1 275 ? -9.374  62.389 68.330 1.00 32.10 ? 275 ILE A CG2 1 
ATOM   2100 C CD1 . ILE A 1 275 ? -11.006 63.056 65.702 1.00 32.71 ? 275 ILE A CD1 1 
ATOM   2101 N N   . ASP A 1 276 ? -11.072 59.880 70.539 1.00 32.63 ? 276 ASP A N   1 
ATOM   2102 C CA  . ASP A 1 276 ? -10.841 59.674 71.953 1.00 33.05 ? 276 ASP A CA  1 
ATOM   2103 C C   . ASP A 1 276 ? -10.075 58.391 72.266 1.00 33.22 ? 276 ASP A C   1 
ATOM   2104 O O   . ASP A 1 276 ? -9.235  58.397 73.163 1.00 32.30 ? 276 ASP A O   1 
ATOM   2105 C CB  . ASP A 1 276 ? -12.157 59.582 72.736 1.00 34.18 ? 276 ASP A CB  1 
ATOM   2106 C CG  . ASP A 1 276 ? -12.837 60.924 72.837 1.00 36.02 ? 276 ASP A CG  1 
ATOM   2107 O OD1 . ASP A 1 276 ? -12.120 61.934 72.753 1.00 35.40 ? 276 ASP A OD1 1 
ATOM   2108 O OD2 . ASP A 1 276 ? -14.082 60.944 72.961 1.00 41.19 ? 276 ASP A OD2 1 
ATOM   2109 N N   . VAL A 1 277 ? -10.354 57.311 71.535 1.00 33.30 ? 277 VAL A N   1 
ATOM   2110 C CA  . VAL A 1 277 ? -9.652  56.055 71.804 1.00 32.80 ? 277 VAL A CA  1 
ATOM   2111 C C   . VAL A 1 277 ? -8.603  55.688 70.775 1.00 32.54 ? 277 VAL A C   1 
ATOM   2112 O O   . VAL A 1 277 ? -8.045  54.585 70.814 1.00 32.27 ? 277 VAL A O   1 
ATOM   2113 C CB  . VAL A 1 277 ? -10.698 54.924 71.891 1.00 35.97 ? 277 VAL A CB  1 
ATOM   2114 C CG1 . VAL A 1 277 ? -11.604 55.065 73.114 1.00 34.03 ? 277 VAL A CG1 1 
ATOM   2115 C CG2 . VAL A 1 277 ? -11.558 54.889 70.631 1.00 36.13 ? 277 VAL A CG2 1 
ATOM   2116 N N   . GLU A 1 278 ? -8.256  56.573 69.848 1.00 32.70 ? 278 GLU A N   1 
ATOM   2117 C CA  . GLU A 1 278 ? -7.285  56.270 68.786 1.00 32.19 ? 278 GLU A CA  1 
ATOM   2118 C C   . GLU A 1 278 ? -5.933  55.791 69.244 1.00 31.61 ? 278 GLU A C   1 
ATOM   2119 O O   . GLU A 1 278 ? -5.366  54.824 68.719 1.00 31.09 ? 278 GLU A O   1 
ATOM   2120 C CB  . GLU A 1 278 ? -7.120  57.539 67.924 1.00 35.29 ? 278 GLU A CB  1 
ATOM   2121 C CG  . GLU A 1 278 ? -6.024  57.492 66.895 1.00 36.13 ? 278 GLU A CG  1 
ATOM   2122 C CD  . GLU A 1 278 ? -5.825  58.765 66.099 1.00 37.23 ? 278 GLU A CD  1 
ATOM   2123 O OE1 . GLU A 1 278 ? -6.753  59.564 65.872 1.00 34.72 ? 278 GLU A OE1 1 
ATOM   2124 O OE2 . GLU A 1 278 ? -4.655  58.960 65.680 1.00 39.31 ? 278 GLU A OE2 1 
ATOM   2125 N N   . TRP A 1 279 ? -5.352  56.448 70.254 1.00 32.05 ? 279 TRP A N   1 
ATOM   2126 C CA  . TRP A 1 279 ? -4.038  56.016 70.731 1.00 31.04 ? 279 TRP A CA  1 
ATOM   2127 C C   . TRP A 1 279 ? -4.071  54.741 71.545 1.00 31.31 ? 279 TRP A C   1 
ATOM   2128 O O   . TRP A 1 279 ? -2.984  54.222 71.812 1.00 32.37 ? 279 TRP A O   1 
ATOM   2129 C CB  . TRP A 1 279 ? -3.441  57.159 71.535 1.00 31.03 ? 279 TRP A CB  1 
ATOM   2130 C CG  . TRP A 1 279 ? -3.307  58.422 70.735 1.00 30.53 ? 279 TRP A CG  1 
ATOM   2131 C CD1 . TRP A 1 279 ? -4.199  59.445 70.654 1.00 31.48 ? 279 TRP A CD1 1 
ATOM   2132 C CD2 . TRP A 1 279 ? -2.201  58.773 69.900 1.00 28.50 ? 279 TRP A CD2 1 
ATOM   2133 N NE1 . TRP A 1 279 ? -3.711  60.423 69.820 1.00 30.84 ? 279 TRP A NE1 1 
ATOM   2134 C CE2 . TRP A 1 279 ? -2.482  60.028 69.352 1.00 30.44 ? 279 TRP A CE2 1 
ATOM   2135 C CE3 . TRP A 1 279 ? -0.995  58.144 69.581 1.00 30.76 ? 279 TRP A CE3 1 
ATOM   2136 C CZ2 . TRP A 1 279 ? -1.604  60.684 68.477 1.00 32.14 ? 279 TRP A CZ2 1 
ATOM   2137 C CZ3 . TRP A 1 279 ? -0.117  58.801 68.725 1.00 32.35 ? 279 TRP A CZ3 1 
ATOM   2138 C CH2 . TRP A 1 279 ? -0.429  60.054 68.178 1.00 30.17 ? 279 TRP A CH2 1 
ATOM   2139 N N   . ASN A 1 280 ? -5.219  54.181 71.908 1.00 31.73 ? 280 ASN A N   1 
ATOM   2140 C CA  . ASN A 1 280 ? -5.217  52.960 72.708 1.00 33.11 ? 280 ASN A CA  1 
ATOM   2141 C C   . ASN A 1 280 ? -4.943  51.696 71.919 1.00 33.92 ? 280 ASN A C   1 
ATOM   2142 O O   . ASN A 1 280 ? -4.889  50.614 72.526 1.00 33.94 ? 280 ASN A O   1 
ATOM   2143 C CB  . ASN A 1 280 ? -6.563  52.758 73.435 1.00 31.53 ? 280 ASN A CB  1 
ATOM   2144 C CG  . ASN A 1 280 ? -6.952  53.911 74.336 1.00 33.83 ? 280 ASN A CG  1 
ATOM   2145 O OD1 . ASN A 1 280 ? -6.128  54.745 74.749 1.00 35.69 ? 280 ASN A OD1 1 
ATOM   2146 N ND2 . ASN A 1 280 ? -8.237  53.977 74.661 1.00 31.83 ? 280 ASN A ND2 1 
ATOM   2147 N N   . VAL A 1 281 ? -4.787  51.791 70.603 1.00 34.67 ? 281 VAL A N   1 
ATOM   2148 C CA  . VAL A 1 281 ? -4.596  50.543 69.838 1.00 34.21 ? 281 VAL A CA  1 
ATOM   2149 C C   . VAL A 1 281 ? -3.144  50.331 69.480 1.00 33.87 ? 281 VAL A C   1 
ATOM   2150 O O   . VAL A 1 281 ? -2.848  49.295 68.877 1.00 34.86 ? 281 VAL A O   1 
ATOM   2151 C CB  . VAL A 1 281 ? -5.473  50.521 68.573 1.00 33.66 ? 281 VAL A CB  1 
ATOM   2152 C CG1 . VAL A 1 281 ? -6.903  50.910 68.899 1.00 31.81 ? 281 VAL A CG1 1 
ATOM   2153 C CG2 . VAL A 1 281 ? -4.880  51.458 67.522 1.00 34.92 ? 281 VAL A CG2 1 
ATOM   2154 N N   . LEU A 1 282 ? -2.252  51.263 69.807 1.00 34.29 ? 282 LEU A N   1 
ATOM   2155 C CA  . LEU A 1 282 ? -0.844  50.969 69.491 1.00 35.31 ? 282 LEU A CA  1 
ATOM   2156 C C   . LEU A 1 282 ? -0.506  49.656 70.171 1.00 36.31 ? 282 LEU A C   1 
ATOM   2157 O O   . LEU A 1 282 ? -1.016  49.391 71.262 1.00 38.08 ? 282 LEU A O   1 
ATOM   2158 C CB  . LEU A 1 282 ? 0.103   52.057 69.948 1.00 35.39 ? 282 LEU A CB  1 
ATOM   2159 C CG  . LEU A 1 282 ? -0.150  53.418 69.275 1.00 38.25 ? 282 LEU A CG  1 
ATOM   2160 C CD1 . LEU A 1 282 ? 0.648   54.507 69.955 1.00 36.74 ? 282 LEU A CD1 1 
ATOM   2161 C CD2 . LEU A 1 282 ? 0.181   53.315 67.790 1.00 38.46 ? 282 LEU A CD2 1 
ATOM   2162 N N   . PRO A 1 283 ? 0.315   48.814 69.577 1.00 37.10 ? 283 PRO A N   1 
ATOM   2163 C CA  . PRO A 1 283 ? 0.673   47.544 70.167 1.00 37.05 ? 283 PRO A CA  1 
ATOM   2164 C C   . PRO A 1 283 ? 1.751   47.633 71.225 1.00 37.30 ? 283 PRO A C   1 
ATOM   2165 O O   . PRO A 1 283 ? 1.978   46.675 71.969 1.00 38.15 ? 283 PRO A O   1 
ATOM   2166 C CB  . PRO A 1 283 ? 1.164   46.739 68.968 1.00 36.93 ? 283 PRO A CB  1 
ATOM   2167 C CG  . PRO A 1 283 ? 1.739   47.761 68.058 1.00 36.12 ? 283 PRO A CG  1 
ATOM   2168 C CD  . PRO A 1 283 ? 0.967   49.026 68.261 1.00 36.41 ? 283 PRO A CD  1 
ATOM   2169 N N   . PHE A 1 284 ? 2.505   48.734 71.243 1.00 36.91 ? 284 PHE A N   1 
ATOM   2170 C CA  . PHE A 1 284 ? 3.596   48.877 72.177 1.00 36.00 ? 284 PHE A CA  1 
ATOM   2171 C C   . PHE A 1 284 ? 3.576   50.244 72.855 1.00 34.73 ? 284 PHE A C   1 
ATOM   2172 O O   . PHE A 1 284 ? 2.941   51.166 72.370 1.00 33.98 ? 284 PHE A O   1 
ATOM   2173 C CB  . PHE A 1 284 ? 4.986   48.803 71.538 1.00 39.76 ? 284 PHE A CB  1 
ATOM   2174 C CG  . PHE A 1 284 ? 5.227   47.624 70.657 1.00 43.75 ? 284 PHE A CG  1 
ATOM   2175 C CD1 . PHE A 1 284 ? 5.176   46.338 71.166 1.00 45.70 ? 284 PHE A CD1 1 
ATOM   2176 C CD2 . PHE A 1 284 ? 5.517   47.806 69.309 1.00 45.23 ? 284 PHE A CD2 1 
ATOM   2177 C CE1 . PHE A 1 284 ? 5.400   45.240 70.345 1.00 47.86 ? 284 PHE A CE1 1 
ATOM   2178 C CE2 . PHE A 1 284 ? 5.752   46.717 68.487 1.00 45.22 ? 284 PHE A CE2 1 
ATOM   2179 C CZ  . PHE A 1 284 ? 5.683   45.433 69.000 1.00 46.54 ? 284 PHE A CZ  1 
ATOM   2180 N N   . ASP A 1 285 ? 4.339   50.279 73.945 1.00 33.50 ? 285 ASP A N   1 
ATOM   2181 C CA  . ASP A 1 285 ? 4.514   51.538 74.677 1.00 31.49 ? 285 ASP A CA  1 
ATOM   2182 C C   . ASP A 1 285 ? 5.609   52.173 73.838 1.00 29.78 ? 285 ASP A C   1 
ATOM   2183 O O   . ASP A 1 285 ? 6.694   51.602 73.741 1.00 29.77 ? 285 ASP A O   1 
ATOM   2184 C CB  . ASP A 1 285 ? 4.857   51.288 76.120 1.00 35.60 ? 285 ASP A CB  1 
ATOM   2185 C CG  . ASP A 1 285 ? 5.063   52.533 76.953 1.00 36.54 ? 285 ASP A CG  1 
ATOM   2186 O OD1 . ASP A 1 285 ? 4.645   53.617 76.517 1.00 33.78 ? 285 ASP A OD1 1 
ATOM   2187 O OD2 . ASP A 1 285 ? 5.644   52.382 78.054 1.00 42.01 ? 285 ASP A OD2 1 
ATOM   2188 N N   . SER A 1 286 ? 5.365   53.304 73.203 1.00 29.37 ? 286 SER A N   1 
ATOM   2189 C CA  . SER A 1 286 ? 6.409   53.823 72.341 1.00 28.43 ? 286 SER A CA  1 
ATOM   2190 C C   . SER A 1 286 ? 6.262   55.260 71.954 1.00 27.91 ? 286 SER A C   1 
ATOM   2191 O O   . SER A 1 286 ? 5.214   55.830 72.237 1.00 28.67 ? 286 SER A O   1 
ATOM   2192 C CB  . SER A 1 286 ? 6.283   52.988 71.033 1.00 28.77 ? 286 SER A CB  1 
ATOM   2193 O OG  . SER A 1 286 ? 4.939   53.143 70.551 1.00 27.73 ? 286 SER A OG  1 
ATOM   2194 N N   . ILE A 1 287 ? 7.297   55.805 71.343 1.00 27.72 ? 287 ILE A N   1 
ATOM   2195 C CA  . ILE A 1 287 ? 7.166   57.194 70.892 1.00 28.82 ? 287 ILE A CA  1 
ATOM   2196 C C   . ILE A 1 287 ? 7.344   57.139 69.362 1.00 29.31 ? 287 ILE A C   1 
ATOM   2197 O O   . ILE A 1 287 ? 7.910   56.169 68.821 1.00 28.58 ? 287 ILE A O   1 
ATOM   2198 C CB  . ILE A 1 287 ? 8.127   58.159 71.565 1.00 27.39 ? 287 ILE A CB  1 
ATOM   2199 C CG1 . ILE A 1 287 ? 9.554   57.654 71.437 1.00 23.13 ? 287 ILE A CG1 1 
ATOM   2200 C CG2 . ILE A 1 287 ? 7.747   58.340 73.036 1.00 33.27 ? 287 ILE A CG2 1 
ATOM   2201 C CD1 . ILE A 1 287 ? 10.566  58.769 71.523 1.00 24.12 ? 287 ILE A CD1 1 
ATOM   2202 N N   . PHE A 1 288 ? 6.866   58.159 68.669 1.00 29.07 ? 288 PHE A N   1 
ATOM   2203 C CA  . PHE A 1 288 ? 6.987   58.175 67.212 1.00 28.32 ? 288 PHE A CA  1 
ATOM   2204 C C   . PHE A 1 288 ? 6.336   56.961 66.567 1.00 28.30 ? 288 PHE A C   1 
ATOM   2205 O O   . PHE A 1 288 ? 6.953   56.322 65.711 1.00 29.29 ? 288 PHE A O   1 
ATOM   2206 C CB  . PHE A 1 288 ? 8.452   58.211 66.788 1.00 27.54 ? 288 PHE A CB  1 
ATOM   2207 C CG  . PHE A 1 288 ? 8.750   59.214 65.713 1.00 27.93 ? 288 PHE A CG  1 
ATOM   2208 C CD1 . PHE A 1 288 ? 7.919   59.301 64.587 1.00 25.00 ? 288 PHE A CD1 1 
ATOM   2209 C CD2 . PHE A 1 288 ? 9.876   60.019 65.807 1.00 24.07 ? 288 PHE A CD2 1 
ATOM   2210 C CE1 . PHE A 1 288 ? 8.227   60.212 63.599 1.00 23.71 ? 288 PHE A CE1 1 
ATOM   2211 C CE2 . PHE A 1 288 ? 10.176  60.909 64.785 1.00 25.63 ? 288 PHE A CE2 1 
ATOM   2212 C CZ  . PHE A 1 288 ? 9.320   61.042 63.709 1.00 23.81 ? 288 PHE A CZ  1 
ATOM   2213 N N   . ARG A 1 289 ? 5.136   56.604 66.991 1.00 27.33 ? 289 ARG A N   1 
ATOM   2214 C CA  . ARG A 1 289 ? 4.383   55.492 66.423 1.00 26.45 ? 289 ARG A CA  1 
ATOM   2215 C C   . ARG A 1 289 ? 2.958   56.050 66.377 1.00 27.67 ? 289 ARG A C   1 
ATOM   2216 O O   . ARG A 1 289 ? 2.511   56.711 67.306 1.00 27.96 ? 289 ARG A O   1 
ATOM   2217 C CB  . ARG A 1 289 ? 4.473   54.175 67.135 1.00 23.83 ? 289 ARG A CB  1 
ATOM   2218 C CG  . ARG A 1 289 ? 5.841   53.511 67.115 1.00 25.20 ? 289 ARG A CG  1 
ATOM   2219 C CD  . ARG A 1 289 ? 6.251   53.102 65.701 1.00 29.51 ? 289 ARG A CD  1 
ATOM   2220 N NE  . ARG A 1 289 ? 7.547   52.429 65.636 1.00 28.17 ? 289 ARG A NE  1 
ATOM   2221 C CZ  . ARG A 1 289 ? 8.708   53.070 65.549 1.00 26.78 ? 289 ARG A CZ  1 
ATOM   2222 N NH1 . ARG A 1 289 ? 8.748   54.397 65.512 1.00 26.14 ? 289 ARG A NH1 1 
ATOM   2223 N NH2 . ARG A 1 289 ? 9.824   52.370 65.486 1.00 26.37 ? 289 ARG A NH2 1 
ATOM   2224 N N   . PHE A 1 290 ? 2.273   55.852 65.246 1.00 27.70 ? 290 PHE A N   1 
ATOM   2225 C CA  . PHE A 1 290 ? 0.912   56.412 65.160 1.00 27.28 ? 290 PHE A CA  1 
ATOM   2226 C C   . PHE A 1 290 ? 0.029   55.230 64.874 1.00 26.97 ? 290 PHE A C   1 
ATOM   2227 O O   . PHE A 1 290 ? 0.523   54.216 64.406 1.00 27.88 ? 290 PHE A O   1 
ATOM   2228 C CB  . PHE A 1 290 ? 0.884   57.556 64.166 1.00 25.65 ? 290 PHE A CB  1 
ATOM   2229 C CG  . PHE A 1 290 ? 2.115   58.416 64.302 1.00 25.80 ? 290 PHE A CG  1 
ATOM   2230 C CD1 . PHE A 1 290 ? 2.221   59.314 65.365 1.00 27.28 ? 290 PHE A CD1 1 
ATOM   2231 C CD2 . PHE A 1 290 ? 3.149   58.355 63.394 1.00 25.99 ? 290 PHE A CD2 1 
ATOM   2232 C CE1 . PHE A 1 290 ? 3.338   60.106 65.512 1.00 24.89 ? 290 PHE A CE1 1 
ATOM   2233 C CE2 . PHE A 1 290 ? 4.261   59.172 63.507 1.00 26.64 ? 290 PHE A CE2 1 
ATOM   2234 C CZ  . PHE A 1 290 ? 4.367   60.046 64.583 1.00 26.85 ? 290 PHE A CZ  1 
ATOM   2235 N N   . SER A 1 291 ? -1.219  55.370 65.241 1.00 27.92 ? 291 SER A N   1 
ATOM   2236 C CA  . SER A 1 291 ? -2.124  54.244 65.111 1.00 29.59 ? 291 SER A CA  1 
ATOM   2237 C C   . SER A 1 291 ? -2.575  53.902 63.700 1.00 29.27 ? 291 SER A C   1 
ATOM   2238 O O   . SER A 1 291 ? -2.443  52.744 63.319 1.00 29.28 ? 291 SER A O   1 
ATOM   2239 C CB  . SER A 1 291 ? -3.356  54.556 65.997 1.00 32.25 ? 291 SER A CB  1 
ATOM   2240 O OG  . SER A 1 291 ? -2.914  54.619 67.348 1.00 38.41 ? 291 SER A OG  1 
ATOM   2241 N N   . PHE A 1 292 ? -3.183  54.854 63.006 1.00 29.57 ? 292 PHE A N   1 
ATOM   2242 C CA  . PHE A 1 292 ? -3.718  54.557 61.677 1.00 28.94 ? 292 PHE A CA  1 
ATOM   2243 C C   . PHE A 1 292 ? -2.854  55.186 60.592 1.00 27.96 ? 292 PHE A C   1 
ATOM   2244 O O   . PHE A 1 292 ? -2.905  56.382 60.377 1.00 26.86 ? 292 PHE A O   1 
ATOM   2245 C CB  . PHE A 1 292 ? -5.162  55.046 61.522 1.00 29.02 ? 292 PHE A CB  1 
ATOM   2246 C CG  . PHE A 1 292 ? -5.981  54.277 62.529 1.00 30.26 ? 292 PHE A CG  1 
ATOM   2247 C CD1 . PHE A 1 292 ? -6.313  52.957 62.281 1.00 29.44 ? 292 PHE A CD1 1 
ATOM   2248 C CD2 . PHE A 1 292 ? -6.266  54.876 63.756 1.00 29.48 ? 292 PHE A CD2 1 
ATOM   2249 C CE1 . PHE A 1 292 ? -6.989  52.243 63.264 1.00 30.36 ? 292 PHE A CE1 1 
ATOM   2250 C CE2 . PHE A 1 292 ? -6.962  54.158 64.711 1.00 29.17 ? 292 PHE A CE2 1 
ATOM   2251 C CZ  . PHE A 1 292 ? -7.316  52.847 64.460 1.00 29.18 ? 292 PHE A CZ  1 
ATOM   2252 N N   . VAL A 1 293 ? -2.099  54.293 59.978 1.00 27.38 ? 293 VAL A N   1 
ATOM   2253 C CA  . VAL A 1 293 ? -1.201  54.624 58.915 1.00 28.03 ? 293 VAL A CA  1 
ATOM   2254 C C   . VAL A 1 293 ? -1.393  53.731 57.684 1.00 28.61 ? 293 VAL A C   1 
ATOM   2255 O O   . VAL A 1 293 ? -2.036  52.691 57.696 1.00 27.48 ? 293 VAL A O   1 
ATOM   2256 C CB  . VAL A 1 293 ? 0.255   54.464 59.411 1.00 24.55 ? 293 VAL A CB  1 
ATOM   2257 C CG1 . VAL A 1 293 ? 0.579   55.499 60.468 1.00 27.44 ? 293 VAL A CG1 1 
ATOM   2258 C CG2 . VAL A 1 293 ? 0.410   53.035 59.880 1.00 20.65 ? 293 VAL A CG2 1 
ATOM   2259 N N   . PRO A 1 294 ? -0.744  54.114 56.591 1.00 29.24 ? 294 PRO A N   1 
ATOM   2260 C CA  . PRO A 1 294 ? -0.807  53.348 55.361 1.00 29.43 ? 294 PRO A CA  1 
ATOM   2261 C C   . PRO A 1 294 ? -0.495  51.889 55.585 1.00 30.10 ? 294 PRO A C   1 
ATOM   2262 O O   . PRO A 1 294 ? 0.390   51.545 56.375 1.00 31.00 ? 294 PRO A O   1 
ATOM   2263 C CB  . PRO A 1 294 ? 0.211   54.044 54.466 1.00 29.10 ? 294 PRO A CB  1 
ATOM   2264 C CG  . PRO A 1 294 ? 0.101   55.474 54.918 1.00 29.08 ? 294 PRO A CG  1 
ATOM   2265 C CD  . PRO A 1 294 ? 0.049   55.360 56.431 1.00 28.53 ? 294 PRO A CD  1 
ATOM   2266 N N   . VAL A 1 295 ? -1.233  51.006 54.916 1.00 29.76 ? 295 VAL A N   1 
ATOM   2267 C CA  . VAL A 1 295 ? -0.960  49.595 55.002 1.00 30.27 ? 295 VAL A CA  1 
ATOM   2268 C C   . VAL A 1 295 ? -0.394  49.111 53.664 1.00 30.84 ? 295 VAL A C   1 
ATOM   2269 O O   . VAL A 1 295 ? -0.794  49.582 52.601 1.00 31.37 ? 295 VAL A O   1 
ATOM   2270 C CB  . VAL A 1 295 ? -2.167  48.686 55.273 1.00 32.41 ? 295 VAL A CB  1 
ATOM   2271 C CG1 . VAL A 1 295 ? -2.546  48.757 56.754 1.00 34.71 ? 295 VAL A CG1 1 
ATOM   2272 C CG2 . VAL A 1 295 ? -3.339  49.054 54.374 1.00 32.43 ? 295 VAL A CG2 1 
ATOM   2273 N N   . ILE A 1 296 ? 0.521   48.176 53.766 1.00 30.88 ? 296 ILE A N   1 
ATOM   2274 C CA  . ILE A 1 296 ? 1.148   47.550 52.616 1.00 30.92 ? 296 ILE A CA  1 
ATOM   2275 C C   . ILE A 1 296 ? 0.115   46.539 52.123 1.00 31.27 ? 296 ILE A C   1 
ATOM   2276 O O   . ILE A 1 296 ? 0.135   45.378 52.526 1.00 30.79 ? 296 ILE A O   1 
ATOM   2277 C CB  . ILE A 1 296 ? 2.470   46.892 52.990 1.00 30.42 ? 296 ILE A CB  1 
ATOM   2278 C CG1 . ILE A 1 296 ? 3.441   47.911 53.605 1.00 27.57 ? 296 ILE A CG1 1 
ATOM   2279 C CG2 . ILE A 1 296 ? 3.100   46.231 51.770 1.00 30.11 ? 296 ILE A CG2 1 
ATOM   2280 C CD1 . ILE A 1 296 ? 3.415   49.282 52.966 1.00 26.18 ? 296 ILE A CD1 1 
ATOM   2281 N N   . ASP A 1 297 ? -0.875  46.992 51.366 1.00 31.48 ? 297 ASP A N   1 
ATOM   2282 C CA  . ASP A 1 297 ? -1.987  46.183 50.941 1.00 33.30 ? 297 ASP A CA  1 
ATOM   2283 C C   . ASP A 1 297 ? -1.873  45.346 49.672 1.00 35.03 ? 297 ASP A C   1 
ATOM   2284 O O   . ASP A 1 297 ? -2.830  44.568 49.464 1.00 35.62 ? 297 ASP A O   1 
ATOM   2285 C CB  . ASP A 1 297 ? -3.178  47.124 50.676 1.00 32.05 ? 297 ASP A CB  1 
ATOM   2286 C CG  . ASP A 1 297 ? -2.864  48.191 49.649 1.00 32.04 ? 297 ASP A CG  1 
ATOM   2287 O OD1 . ASP A 1 297 ? -1.695  48.397 49.271 1.00 31.14 ? 297 ASP A OD1 1 
ATOM   2288 O OD2 . ASP A 1 297 ? -3.821  48.869 49.220 1.00 35.69 ? 297 ASP A OD2 1 
ATOM   2289 N N   . GLY A 1 298 ? -0.878  45.493 48.814 1.00 34.49 ? 298 GLY A N   1 
ATOM   2290 C CA  . GLY A 1 298 ? -0.928  44.701 47.584 1.00 35.78 ? 298 GLY A CA  1 
ATOM   2291 C C   . GLY A 1 298 ? -1.652  45.454 46.458 1.00 36.24 ? 298 GLY A C   1 
ATOM   2292 O O   . GLY A 1 298 ? -1.617  45.006 45.309 1.00 37.21 ? 298 GLY A O   1 
ATOM   2293 N N   . GLU A 1 299 ? -2.288  46.574 46.727 1.00 35.06 ? 299 GLU A N   1 
ATOM   2294 C CA  . GLU A 1 299 ? -2.991  47.376 45.757 1.00 34.93 ? 299 GLU A CA  1 
ATOM   2295 C C   . GLU A 1 299 ? -2.211  48.662 45.486 1.00 34.55 ? 299 GLU A C   1 
ATOM   2296 O O   . GLU A 1 299 ? -1.446  48.830 44.537 1.00 35.37 ? 299 GLU A O   1 
ATOM   2297 C CB  . GLU A 1 299 ? -4.378  47.786 46.231 1.00 36.69 ? 299 GLU A CB  1 
ATOM   2298 C CG  . GLU A 1 299 ? -5.441  46.709 46.120 1.00 41.78 ? 299 GLU A CG  1 
ATOM   2299 N N   . PHE A 1 300 ? -2.423  49.594 46.412 1.00 33.45 ? 300 PHE A N   1 
ATOM   2300 C CA  . PHE A 1 300 ? -1.718  50.864 46.369 1.00 32.08 ? 300 PHE A CA  1 
ATOM   2301 C C   . PHE A 1 300 ? -0.232  50.576 46.313 1.00 32.58 ? 300 PHE A C   1 
ATOM   2302 O O   . PHE A 1 300 ? 0.502   51.210 45.563 1.00 33.15 ? 300 PHE A O   1 
ATOM   2303 C CB  . PHE A 1 300 ? -2.157  51.692 47.573 1.00 28.04 ? 300 PHE A CB  1 
ATOM   2304 C CG  . PHE A 1 300 ? -1.655  53.107 47.479 1.00 23.18 ? 300 PHE A CG  1 
ATOM   2305 C CD1 . PHE A 1 300 ? -0.325  53.375 47.699 1.00 20.52 ? 300 PHE A CD1 1 
ATOM   2306 C CD2 . PHE A 1 300 ? -2.519  54.136 47.150 1.00 21.28 ? 300 PHE A CD2 1 
ATOM   2307 C CE1 . PHE A 1 300 ? 0.174   54.656 47.602 1.00 18.59 ? 300 PHE A CE1 1 
ATOM   2308 C CE2 . PHE A 1 300 ? -2.030  55.428 47.052 1.00 19.70 ? 300 PHE A CE2 1 
ATOM   2309 C CZ  . PHE A 1 300 ? -0.698  55.685 47.292 1.00 19.64 ? 300 PHE A CZ  1 
ATOM   2310 N N   . PHE A 1 301 ? 0.236   49.619 47.103 1.00 33.29 ? 301 PHE A N   1 
ATOM   2311 C CA  . PHE A 1 301 ? 1.634   49.217 47.147 1.00 33.91 ? 301 PHE A CA  1 
ATOM   2312 C C   . PHE A 1 301 ? 1.649   47.764 46.675 1.00 35.63 ? 301 PHE A C   1 
ATOM   2313 O O   . PHE A 1 301 ? 1.048   46.919 47.324 1.00 35.46 ? 301 PHE A O   1 
ATOM   2314 C CB  . PHE A 1 301 ? 2.296   49.306 48.518 1.00 31.48 ? 301 PHE A CB  1 
ATOM   2315 C CG  . PHE A 1 301 ? 2.258   50.667 49.165 1.00 28.49 ? 301 PHE A CG  1 
ATOM   2316 C CD1 . PHE A 1 301 ? 3.188   51.631 48.824 1.00 27.56 ? 301 PHE A CD1 1 
ATOM   2317 C CD2 . PHE A 1 301 ? 1.306   50.967 50.113 1.00 26.46 ? 301 PHE A CD2 1 
ATOM   2318 C CE1 . PHE A 1 301 ? 3.145   52.885 49.393 1.00 30.24 ? 301 PHE A CE1 1 
ATOM   2319 C CE2 . PHE A 1 301 ? 1.246   52.230 50.673 1.00 27.44 ? 301 PHE A CE2 1 
ATOM   2320 C CZ  . PHE A 1 301 ? 2.157   53.193 50.315 1.00 28.87 ? 301 PHE A CZ  1 
ATOM   2321 N N   . PRO A 1 302 ? 2.176   47.511 45.493 1.00 36.48 ? 302 PRO A N   1 
ATOM   2322 C CA  . PRO A 1 302 ? 2.127   46.177 44.920 1.00 36.79 ? 302 PRO A CA  1 
ATOM   2323 C C   . PRO A 1 302 ? 2.812   45.148 45.798 1.00 36.15 ? 302 PRO A C   1 
ATOM   2324 O O   . PRO A 1 302 ? 2.266   44.071 46.036 1.00 36.12 ? 302 PRO A O   1 
ATOM   2325 C CB  . PRO A 1 302 ? 2.749   46.325 43.538 1.00 36.29 ? 302 PRO A CB  1 
ATOM   2326 C CG  . PRO A 1 302 ? 3.431   47.643 43.533 1.00 37.25 ? 302 PRO A CG  1 
ATOM   2327 C CD  . PRO A 1 302 ? 2.794   48.505 44.589 1.00 36.81 ? 302 PRO A CD  1 
ATOM   2328 N N   . THR A 1 303 ? 4.034   45.386 46.242 1.00 36.03 ? 303 THR A N   1 
ATOM   2329 C CA  . THR A 1 303 ? 4.737   44.465 47.121 1.00 36.38 ? 303 THR A CA  1 
ATOM   2330 C C   . THR A 1 303 ? 5.345   45.257 48.283 1.00 36.48 ? 303 THR A C   1 
ATOM   2331 O O   . THR A 1 303 ? 5.080   46.444 48.468 1.00 35.89 ? 303 THR A O   1 
ATOM   2332 C CB  . THR A 1 303 ? 5.827   43.659 46.409 1.00 38.35 ? 303 THR A CB  1 
ATOM   2333 O OG1 . THR A 1 303 ? 6.879   44.502 45.921 1.00 36.74 ? 303 THR A OG1 1 
ATOM   2334 C CG2 . THR A 1 303 ? 5.243   42.923 45.211 1.00 41.90 ? 303 THR A CG2 1 
ATOM   2335 N N   . SER A 1 304 ? 6.195   44.591 49.057 1.00 36.75 ? 304 SER A N   1 
ATOM   2336 C CA  . SER A 1 304 ? 6.845   45.251 50.187 1.00 36.67 ? 304 SER A CA  1 
ATOM   2337 C C   . SER A 1 304 ? 7.573   46.491 49.690 1.00 36.71 ? 304 SER A C   1 
ATOM   2338 O O   . SER A 1 304 ? 8.108   46.469 48.566 1.00 37.09 ? 304 SER A O   1 
ATOM   2339 C CB  . SER A 1 304 ? 7.789   44.274 50.871 1.00 38.70 ? 304 SER A CB  1 
ATOM   2340 O OG  . SER A 1 304 ? 8.982   44.060 50.130 1.00 41.12 ? 304 SER A OG  1 
ATOM   2341 N N   . LEU A 1 305 ? 7.629   47.557 50.487 1.00 35.37 ? 305 LEU A N   1 
ATOM   2342 C CA  . LEU A 1 305 ? 8.336   48.736 50.003 1.00 34.72 ? 305 LEU A CA  1 
ATOM   2343 C C   . LEU A 1 305 ? 9.784   48.432 49.679 1.00 34.90 ? 305 LEU A C   1 
ATOM   2344 O O   . LEU A 1 305 ? 10.348  48.968 48.718 1.00 35.18 ? 305 LEU A O   1 
ATOM   2345 C CB  . LEU A 1 305 ? 8.336   49.865 51.024 1.00 32.92 ? 305 LEU A CB  1 
ATOM   2346 C CG  . LEU A 1 305 ? 6.959   50.237 51.564 1.00 34.21 ? 305 LEU A CG  1 
ATOM   2347 C CD1 . LEU A 1 305 ? 7.095   51.431 52.507 1.00 35.18 ? 305 LEU A CD1 1 
ATOM   2348 C CD2 . LEU A 1 305 ? 5.992   50.516 50.428 1.00 33.26 ? 305 LEU A CD2 1 
ATOM   2349 N N   . GLU A 1 306 ? 10.378  47.584 50.506 1.00 34.15 ? 306 GLU A N   1 
ATOM   2350 C CA  . GLU A 1 306 ? 11.779  47.245 50.293 1.00 34.50 ? 306 GLU A CA  1 
ATOM   2351 C C   . GLU A 1 306 ? 11.989  46.463 49.004 1.00 34.75 ? 306 GLU A C   1 
ATOM   2352 O O   . GLU A 1 306 ? 13.037  46.643 48.382 1.00 34.33 ? 306 GLU A O   1 
ATOM   2353 C CB  . GLU A 1 306 ? 12.282  46.458 51.511 1.00 33.99 ? 306 GLU A CB  1 
ATOM   2354 C CG  . GLU A 1 306 ? 13.724  46.013 51.433 1.00 36.47 ? 306 GLU A CG  1 
ATOM   2355 C CD  . GLU A 1 306 ? 14.721  47.144 51.514 1.00 41.16 ? 306 GLU A CD  1 
ATOM   2356 O OE1 . GLU A 1 306 ? 14.336  48.276 51.885 1.00 44.74 ? 306 GLU A OE1 1 
ATOM   2357 O OE2 . GLU A 1 306 ? 15.914  46.909 51.215 1.00 44.10 ? 306 GLU A OE2 1 
ATOM   2358 N N   . SER A 1 307 ? 11.082  45.541 48.646 1.00 34.89 ? 307 SER A N   1 
ATOM   2359 C CA  . SER A 1 307 ? 11.380  44.820 47.386 1.00 36.71 ? 307 SER A CA  1 
ATOM   2360 C C   . SER A 1 307 ? 11.167  45.830 46.242 1.00 36.51 ? 307 SER A C   1 
ATOM   2361 O O   . SER A 1 307 ? 11.967  45.794 45.310 1.00 36.37 ? 307 SER A O   1 
ATOM   2362 C CB  . SER A 1 307 ? 10.603  43.531 47.257 1.00 36.38 ? 307 SER A CB  1 
ATOM   2363 O OG  . SER A 1 307 ? 9.280   43.811 46.878 1.00 42.33 ? 307 SER A OG  1 
ATOM   2364 N N   . MET A 1 308 ? 10.188  46.726 46.340 1.00 35.93 ? 308 MET A N   1 
ATOM   2365 C CA  . MET A 1 308 ? 9.985   47.729 45.306 1.00 36.24 ? 308 MET A CA  1 
ATOM   2366 C C   . MET A 1 308 ? 11.222  48.607 45.187 1.00 37.25 ? 308 MET A C   1 
ATOM   2367 O O   . MET A 1 308 ? 11.663  48.914 44.078 1.00 37.74 ? 308 MET A O   1 
ATOM   2368 C CB  . MET A 1 308 ? 8.774   48.636 45.559 1.00 33.15 ? 308 MET A CB  1 
ATOM   2369 C CG  . MET A 1 308 ? 7.466   47.863 45.533 1.00 32.50 ? 308 MET A CG  1 
ATOM   2370 S SD  . MET A 1 308 ? 6.019   48.889 45.805 1.00 35.51 ? 308 MET A SD  1 
ATOM   2371 C CE  . MET A 1 308 ? 6.038   49.890 44.305 1.00 37.42 ? 308 MET A CE  1 
ATOM   2372 N N   . LEU A 1 309 ? 11.819  48.960 46.330 1.00 37.92 ? 309 LEU A N   1 
ATOM   2373 C CA  . LEU A 1 309 ? 13.013  49.796 46.323 1.00 38.15 ? 309 LEU A CA  1 
ATOM   2374 C C   . LEU A 1 309 ? 14.224  49.061 45.762 1.00 38.87 ? 309 LEU A C   1 
ATOM   2375 O O   . LEU A 1 309 ? 15.071  49.687 45.115 1.00 39.28 ? 309 LEU A O   1 
ATOM   2376 C CB  . LEU A 1 309 ? 13.364  50.303 47.720 1.00 39.18 ? 309 LEU A CB  1 
ATOM   2377 C CG  . LEU A 1 309 ? 12.518  51.450 48.280 1.00 40.88 ? 309 LEU A CG  1 
ATOM   2378 C CD1 . LEU A 1 309 ? 12.979  51.781 49.690 1.00 40.66 ? 309 LEU A CD1 1 
ATOM   2379 C CD2 . LEU A 1 309 ? 12.587  52.675 47.381 1.00 40.43 ? 309 LEU A CD2 1 
ATOM   2380 N N   . ASN A 1 310 ? 14.324  47.765 46.016 1.00 39.06 ? 310 ASN A N   1 
ATOM   2381 C CA  . ASN A 1 310 ? 15.458  46.994 45.541 1.00 40.54 ? 310 ASN A CA  1 
ATOM   2382 C C   . ASN A 1 310 ? 15.400  46.731 44.037 1.00 40.37 ? 310 ASN A C   1 
ATOM   2383 O O   . ASN A 1 310 ? 16.438  46.722 43.384 1.00 40.73 ? 310 ASN A O   1 
ATOM   2384 C CB  . ASN A 1 310 ? 15.561  45.634 46.242 1.00 45.88 ? 310 ASN A CB  1 
ATOM   2385 C CG  . ASN A 1 310 ? 16.153  45.717 47.633 1.00 51.30 ? 310 ASN A CG  1 
ATOM   2386 O OD1 . ASN A 1 310 ? 16.858  46.667 47.989 1.00 53.48 ? 310 ASN A OD1 1 
ATOM   2387 N ND2 . ASN A 1 310 ? 15.847  44.718 48.459 1.00 53.67 ? 310 ASN A ND2 1 
ATOM   2388 N N   . SER A 1 311 ? 14.198  46.503 43.528 1.00 40.04 ? 311 SER A N   1 
ATOM   2389 C CA  . SER A 1 311 ? 14.015  46.196 42.121 1.00 38.88 ? 311 SER A CA  1 
ATOM   2390 C C   . SER A 1 311 ? 13.829  47.405 41.221 1.00 38.16 ? 311 SER A C   1 
ATOM   2391 O O   . SER A 1 311 ? 13.707  47.220 40.010 1.00 38.80 ? 311 SER A O   1 
ATOM   2392 C CB  . SER A 1 311 ? 12.798  45.265 42.010 1.00 39.03 ? 311 SER A CB  1 
ATOM   2393 O OG  . SER A 1 311 ? 11.638  45.956 42.430 1.00 42.74 ? 311 SER A OG  1 
ATOM   2394 N N   . GLY A 1 312 ? 13.855  48.630 41.722 1.00 37.15 ? 312 GLY A N   1 
ATOM   2395 C CA  . GLY A 1 312 ? 13.660  49.811 40.899 1.00 34.41 ? 312 GLY A CA  1 
ATOM   2396 C C   . GLY A 1 312 ? 12.186  50.007 40.585 1.00 33.95 ? 312 GLY A C   1 
ATOM   2397 O O   . GLY A 1 312 ? 11.797  50.879 39.808 1.00 33.99 ? 312 GLY A O   1 
ATOM   2398 N N   . ASN A 1 313 ? 11.301  49.231 41.187 1.00 33.18 ? 313 ASN A N   1 
ATOM   2399 C CA  . ASN A 1 313 ? 9.878   49.384 40.956 1.00 33.37 ? 313 ASN A CA  1 
ATOM   2400 C C   . ASN A 1 313 ? 9.320   50.680 41.535 1.00 33.88 ? 313 ASN A C   1 
ATOM   2401 O O   . ASN A 1 313 ? 8.585   50.691 42.530 1.00 34.17 ? 313 ASN A O   1 
ATOM   2402 C CB  . ASN A 1 313 ? 9.125   48.180 41.542 1.00 32.47 ? 313 ASN A CB  1 
ATOM   2403 C CG  . ASN A 1 313 ? 7.677   48.214 41.094 1.00 33.12 ? 313 ASN A CG  1 
ATOM   2404 O OD1 . ASN A 1 313 ? 7.240   49.182 40.457 1.00 34.18 ? 313 ASN A OD1 1 
ATOM   2405 N ND2 . ASN A 1 313 ? 6.938   47.185 41.458 1.00 33.22 ? 313 ASN A ND2 1 
ATOM   2406 N N   . PHE A 1 314 ? 9.637   51.802 40.892 1.00 33.50 ? 314 PHE A N   1 
ATOM   2407 C CA  . PHE A 1 314 ? 9.146   53.104 41.300 1.00 33.66 ? 314 PHE A CA  1 
ATOM   2408 C C   . PHE A 1 314 ? 9.398   54.152 40.219 1.00 34.03 ? 314 PHE A C   1 
ATOM   2409 O O   . PHE A 1 314 ? 10.221  53.957 39.346 1.00 33.90 ? 314 PHE A O   1 
ATOM   2410 C CB  . PHE A 1 314 ? 9.783   53.531 42.640 1.00 27.79 ? 314 PHE A CB  1 
ATOM   2411 C CG  . PHE A 1 314 ? 11.283  53.521 42.634 1.00 23.62 ? 314 PHE A CG  1 
ATOM   2412 C CD1 . PHE A 1 314 ? 12.001  54.535 42.032 1.00 23.33 ? 314 PHE A CD1 1 
ATOM   2413 C CD2 . PHE A 1 314 ? 11.980  52.486 43.229 1.00 21.58 ? 314 PHE A CD2 1 
ATOM   2414 C CE1 . PHE A 1 314 ? 13.382  54.537 42.023 1.00 23.15 ? 314 PHE A CE1 1 
ATOM   2415 C CE2 . PHE A 1 314 ? 13.355  52.470 43.241 1.00 20.31 ? 314 PHE A CE2 1 
ATOM   2416 C CZ  . PHE A 1 314 ? 14.059  53.500 42.641 1.00 23.58 ? 314 PHE A CZ  1 
ATOM   2417 N N   . LYS A 1 315 ? 8.717   55.286 40.274 1.00 34.56 ? 315 LYS A N   1 
ATOM   2418 C CA  . LYS A 1 315 ? 8.911   56.326 39.272 1.00 34.87 ? 315 LYS A CA  1 
ATOM   2419 C C   . LYS A 1 315 ? 10.306  56.928 39.349 1.00 35.89 ? 315 LYS A C   1 
ATOM   2420 O O   . LYS A 1 315 ? 10.781  57.351 40.404 1.00 36.54 ? 315 LYS A O   1 
ATOM   2421 C CB  . LYS A 1 315 ? 7.829   57.389 39.444 1.00 30.89 ? 315 LYS A CB  1 
ATOM   2422 C CG  . LYS A 1 315 ? 8.198   58.738 38.873 1.00 29.64 ? 315 LYS A CG  1 
ATOM   2423 C CD  . LYS A 1 315 ? 7.113   59.749 39.198 1.00 29.31 ? 315 LYS A CD  1 
ATOM   2424 C CE  . LYS A 1 315 ? 7.083   60.835 38.139 1.00 31.84 ? 315 LYS A CE  1 
ATOM   2425 N NZ  . LYS A 1 315 ? 5.852   60.713 37.301 1.00 28.20 ? 315 LYS A NZ  1 
ATOM   2426 N N   . LYS A 1 316 ? 10.998  56.935 38.208 1.00 36.28 ? 316 LYS A N   1 
ATOM   2427 C CA  . LYS A 1 316 ? 12.344  57.480 38.131 1.00 35.87 ? 316 LYS A CA  1 
ATOM   2428 C C   . LYS A 1 316 ? 12.238  58.949 37.752 1.00 35.23 ? 316 LYS A C   1 
ATOM   2429 O O   . LYS A 1 316 ? 11.645  59.309 36.748 1.00 37.69 ? 316 LYS A O   1 
ATOM   2430 C CB  . LYS A 1 316 ? 13.235  56.759 37.140 1.00 39.54 ? 316 LYS A CB  1 
ATOM   2431 C CG  . LYS A 1 316 ? 13.707  55.387 37.609 1.00 41.40 ? 316 LYS A CG  1 
ATOM   2432 C CD  . LYS A 1 316 ? 12.681  54.360 37.181 1.00 44.39 ? 316 LYS A CD  1 
ATOM   2433 C CE  . LYS A 1 316 ? 13.088  52.946 37.562 1.00 46.56 ? 316 LYS A CE  1 
ATOM   2434 N NZ  . LYS A 1 316 ? 11.962  52.016 37.235 1.00 49.39 ? 316 LYS A NZ  1 
ATOM   2435 N N   . THR A 1 317 ? 12.749  59.821 38.603 1.00 33.93 ? 317 THR A N   1 
ATOM   2436 C CA  . THR A 1 317 ? 12.663  61.246 38.353 1.00 30.38 ? 317 THR A CA  1 
ATOM   2437 C C   . THR A 1 317 ? 13.716  61.888 39.245 1.00 29.59 ? 317 THR A C   1 
ATOM   2438 O O   . THR A 1 317 ? 14.660  61.211 39.656 1.00 27.90 ? 317 THR A O   1 
ATOM   2439 C CB  . THR A 1 317 ? 11.257  61.797 38.570 1.00 29.55 ? 317 THR A CB  1 
ATOM   2440 O OG1 . THR A 1 317 ? 11.292  63.203 38.274 1.00 28.71 ? 317 THR A OG1 1 
ATOM   2441 C CG2 . THR A 1 317 ? 10.750  61.617 39.997 1.00 30.91 ? 317 THR A CG2 1 
ATOM   2442 N N   . GLN A 1 318 ? 13.569  63.175 39.449 1.00 29.43 ? 318 GLN A N   1 
ATOM   2443 C CA  . GLN A 1 318 ? 14.508  63.884 40.295 1.00 30.62 ? 318 GLN A CA  1 
ATOM   2444 C C   . GLN A 1 318 ? 13.808  64.026 41.666 1.00 30.74 ? 318 GLN A C   1 
ATOM   2445 O O   . GLN A 1 318 ? 12.600  64.225 41.751 1.00 29.65 ? 318 GLN A O   1 
ATOM   2446 C CB  . GLN A 1 318 ? 14.926  65.250 39.792 1.00 32.55 ? 318 GLN A CB  1 
ATOM   2447 C CG  . GLN A 1 318 ? 15.411  65.390 38.358 1.00 36.67 ? 318 GLN A CG  1 
ATOM   2448 C CD  . GLN A 1 318 ? 14.253  65.255 37.374 1.00 37.35 ? 318 GLN A CD  1 
ATOM   2449 O OE1 . GLN A 1 318 ? 13.232  65.941 37.453 1.00 35.91 ? 318 GLN A OE1 1 
ATOM   2450 N NE2 . GLN A 1 318 ? 14.419  64.318 36.448 1.00 39.38 ? 318 GLN A NE2 1 
ATOM   2451 N N   . ILE A 1 319 ? 14.609  63.907 42.718 1.00 31.33 ? 319 ILE A N   1 
ATOM   2452 C CA  . ILE A 1 319 ? 14.050  64.060 44.066 1.00 30.79 ? 319 ILE A CA  1 
ATOM   2453 C C   . ILE A 1 319 ? 15.015  64.949 44.866 1.00 29.66 ? 319 ILE A C   1 
ATOM   2454 O O   . ILE A 1 319 ? 16.229  64.887 44.734 1.00 28.72 ? 319 ILE A O   1 
ATOM   2455 C CB  . ILE A 1 319 ? 13.800  62.810 44.903 1.00 28.93 ? 319 ILE A CB  1 
ATOM   2456 C CG1 . ILE A 1 319 ? 15.093  61.987 45.010 1.00 29.55 ? 319 ILE A CG1 1 
ATOM   2457 C CG2 . ILE A 1 319 ? 12.682  61.936 44.357 1.00 31.49 ? 319 ILE A CG2 1 
ATOM   2458 C CD1 . ILE A 1 319 ? 14.848  60.705 45.798 1.00 28.73 ? 319 ILE A CD1 1 
ATOM   2459 N N   . LEU A 1 320 ? 14.362  65.772 45.669 1.00 29.29 ? 320 LEU A N   1 
ATOM   2460 C CA  . LEU A 1 320 ? 15.059  66.675 46.588 1.00 29.99 ? 320 LEU A CA  1 
ATOM   2461 C C   . LEU A 1 320 ? 14.526  66.285 47.983 1.00 30.75 ? 320 LEU A C   1 
ATOM   2462 O O   . LEU A 1 320 ? 13.323  66.220 48.278 1.00 29.53 ? 320 LEU A O   1 
ATOM   2463 C CB  . LEU A 1 320 ? 14.864  68.108 46.150 1.00 29.35 ? 320 LEU A CB  1 
ATOM   2464 C CG  . LEU A 1 320 ? 15.647  69.161 46.950 1.00 32.75 ? 320 LEU A CG  1 
ATOM   2465 C CD1 . LEU A 1 320 ? 15.725  70.480 46.198 1.00 30.93 ? 320 LEU A CD1 1 
ATOM   2466 C CD2 . LEU A 1 320 ? 15.007  69.350 48.327 1.00 28.97 ? 320 LEU A CD2 1 
ATOM   2467 N N   . LEU A 1 321 ? 15.432  65.903 48.885 1.00 31.19 ? 321 LEU A N   1 
ATOM   2468 C CA  . LEU A 1 321 ? 15.031  65.477 50.216 1.00 31.41 ? 321 LEU A CA  1 
ATOM   2469 C C   . LEU A 1 321 ? 16.117  65.773 51.263 1.00 32.34 ? 321 LEU A C   1 
ATOM   2470 O O   . LEU A 1 321 ? 17.284  66.056 51.016 1.00 31.88 ? 321 LEU A O   1 
ATOM   2471 C CB  . LEU A 1 321 ? 14.650  64.004 50.341 1.00 26.15 ? 321 LEU A CB  1 
ATOM   2472 C CG  . LEU A 1 321 ? 15.397  62.932 49.584 1.00 26.46 ? 321 LEU A CG  1 
ATOM   2473 C CD1 . LEU A 1 321 ? 16.898  63.125 49.701 1.00 28.96 ? 321 LEU A CD1 1 
ATOM   2474 C CD2 . LEU A 1 321 ? 14.998  61.549 50.073 1.00 23.38 ? 321 LEU A CD2 1 
ATOM   2475 N N   . GLY A 1 322 ? 15.595  65.740 52.504 1.00 31.80 ? 322 GLY A N   1 
ATOM   2476 C CA  . GLY A 1 322 ? 16.465  66.020 53.631 1.00 32.20 ? 322 GLY A CA  1 
ATOM   2477 C C   . GLY A 1 322 ? 15.793  65.884 54.983 1.00 31.37 ? 322 GLY A C   1 
ATOM   2478 O O   . GLY A 1 322 ? 14.631  65.541 55.141 1.00 30.85 ? 322 GLY A O   1 
ATOM   2479 N N   . VAL A 1 323 ? 16.645  66.164 55.968 1.00 31.34 ? 323 VAL A N   1 
ATOM   2480 C CA  . VAL A 1 323 ? 16.297  66.067 57.372 1.00 30.06 ? 323 VAL A CA  1 
ATOM   2481 C C   . VAL A 1 323 ? 16.740  67.284 58.163 1.00 29.96 ? 323 VAL A C   1 
ATOM   2482 O O   . VAL A 1 323 ? 17.547  68.110 57.725 1.00 30.78 ? 323 VAL A O   1 
ATOM   2483 C CB  . VAL A 1 323 ? 16.931  64.800 57.964 1.00 26.71 ? 323 VAL A CB  1 
ATOM   2484 C CG1 . VAL A 1 323 ? 16.334  63.573 57.290 1.00 26.48 ? 323 VAL A CG1 1 
ATOM   2485 C CG2 . VAL A 1 323 ? 18.445  64.801 57.820 1.00 28.37 ? 323 VAL A CG2 1 
ATOM   2486 N N   . ASN A 1 324 ? 16.098  67.421 59.311 1.00 28.91 ? 324 ASN A N   1 
ATOM   2487 C CA  . ASN A 1 324 ? 16.463  68.446 60.296 1.00 28.58 ? 324 ASN A CA  1 
ATOM   2488 C C   . ASN A 1 324 ? 17.449  67.853 61.294 1.00 27.43 ? 324 ASN A C   1 
ATOM   2489 O O   . ASN A 1 324 ? 17.527  66.645 61.509 1.00 26.19 ? 324 ASN A O   1 
ATOM   2490 C CB  . ASN A 1 324 ? 15.215  69.001 60.975 1.00 29.06 ? 324 ASN A CB  1 
ATOM   2491 C CG  . ASN A 1 324 ? 14.450  69.785 59.901 1.00 30.85 ? 324 ASN A CG  1 
ATOM   2492 O OD1 . ASN A 1 324 ? 14.960  69.843 58.782 1.00 31.60 ? 324 ASN A OD1 1 
ATOM   2493 N ND2 . ASN A 1 324 ? 13.311  70.357 60.218 1.00 31.11 ? 324 ASN A ND2 1 
ATOM   2494 N N   . LYS A 1 325 ? 18.274  68.709 61.874 1.00 27.74 ? 325 LYS A N   1 
ATOM   2495 C CA  . LYS A 1 325 ? 19.259  68.245 62.825 1.00 28.14 ? 325 LYS A CA  1 
ATOM   2496 C C   . LYS A 1 325 ? 18.652  67.537 64.047 1.00 26.95 ? 325 LYS A C   1 
ATOM   2497 O O   . LYS A 1 325 ? 19.233  66.513 64.425 1.00 25.63 ? 325 LYS A O   1 
ATOM   2498 C CB  . LYS A 1 325 ? 20.165  69.389 63.338 1.00 32.92 ? 325 LYS A CB  1 
ATOM   2499 C CG  . LYS A 1 325 ? 20.942  68.788 64.514 1.00 37.37 ? 325 LYS A CG  1 
ATOM   2500 C CD  . LYS A 1 325 ? 22.438  68.962 64.454 1.00 40.44 ? 325 LYS A CD  1 
ATOM   2501 C CE  . LYS A 1 325 ? 22.816  70.189 65.288 1.00 42.18 ? 325 LYS A CE  1 
ATOM   2502 N NZ  . LYS A 1 325 ? 21.824  71.268 64.954 1.00 43.66 ? 325 LYS A NZ  1 
ATOM   2503 N N   . ASP A 1 326 ? 17.560  68.002 64.635 1.00 26.60 ? 326 ASP A N   1 
ATOM   2504 C CA  . ASP A 1 326 ? 17.025  67.312 65.811 1.00 27.47 ? 326 ASP A CA  1 
ATOM   2505 C C   . ASP A 1 326 ? 15.590  66.847 65.669 1.00 28.70 ? 326 ASP A C   1 
ATOM   2506 O O   . ASP A 1 326 ? 14.679  67.379 66.318 1.00 28.50 ? 326 ASP A O   1 
ATOM   2507 C CB  . ASP A 1 326 ? 17.102  68.219 67.061 1.00 21.41 ? 326 ASP A CB  1 
ATOM   2508 C CG  . ASP A 1 326 ? 18.474  68.839 67.176 1.00 20.03 ? 326 ASP A CG  1 
ATOM   2509 O OD1 . ASP A 1 326 ? 19.440  68.120 67.443 1.00 19.88 ? 326 ASP A OD1 1 
ATOM   2510 O OD2 . ASP A 1 326 ? 18.625  70.055 66.953 1.00 23.58 ? 326 ASP A OD2 1 
ATOM   2511 N N   . GLU A 1 327 ? 15.433  65.848 64.815 1.00 29.39 ? 327 GLU A N   1 
ATOM   2512 C CA  . GLU A 1 327 ? 14.168  65.246 64.509 1.00 29.50 ? 327 GLU A CA  1 
ATOM   2513 C C   . GLU A 1 327 ? 13.525  64.552 65.699 1.00 30.56 ? 327 GLU A C   1 
ATOM   2514 O O   . GLU A 1 327 ? 12.293  64.499 65.759 1.00 31.86 ? 327 GLU A O   1 
ATOM   2515 C CB  . GLU A 1 327 ? 14.339  64.169 63.414 1.00 31.99 ? 327 GLU A CB  1 
ATOM   2516 C CG  . GLU A 1 327 ? 14.857  64.651 62.076 1.00 33.41 ? 327 GLU A CG  1 
ATOM   2517 C CD  . GLU A 1 327 ? 13.823  65.385 61.252 1.00 32.17 ? 327 GLU A CD  1 
ATOM   2518 O OE1 . GLU A 1 327 ? 12.652  65.549 61.659 1.00 29.78 ? 327 GLU A OE1 1 
ATOM   2519 O OE2 . GLU A 1 327 ? 14.217  65.816 60.151 1.00 34.86 ? 327 GLU A OE2 1 
ATOM   2520 N N   . GLY A 1 328 ? 14.317  63.981 66.609 1.00 30.01 ? 328 GLY A N   1 
ATOM   2521 C CA  . GLY A 1 328 ? 13.728  63.275 67.731 1.00 29.58 ? 328 GLY A CA  1 
ATOM   2522 C C   . GLY A 1 328 ? 13.209  64.105 68.897 1.00 28.11 ? 328 GLY A C   1 
ATOM   2523 O O   . GLY A 1 328 ? 12.260  63.706 69.565 1.00 28.21 ? 328 GLY A O   1 
ATOM   2524 N N   . SER A 1 329 ? 13.776  65.258 69.130 1.00 27.87 ? 329 SER A N   1 
ATOM   2525 C CA  . SER A 1 329 ? 13.481  66.132 70.250 1.00 27.58 ? 329 SER A CA  1 
ATOM   2526 C C   . SER A 1 329 ? 11.997  66.261 70.510 1.00 28.25 ? 329 SER A C   1 
ATOM   2527 O O   . SER A 1 329 ? 11.524  65.975 71.629 1.00 27.23 ? 329 SER A O   1 
ATOM   2528 C CB  . SER A 1 329 ? 14.176  67.454 69.953 1.00 27.71 ? 329 SER A CB  1 
ATOM   2529 O OG  . SER A 1 329 ? 13.271  68.385 69.433 1.00 28.84 ? 329 SER A OG  1 
ATOM   2530 N N   . PHE A 1 330 ? 11.203  66.640 69.523 1.00 28.23 ? 330 PHE A N   1 
ATOM   2531 C CA  . PHE A 1 330 ? 9.766   66.800 69.706 1.00 27.38 ? 330 PHE A CA  1 
ATOM   2532 C C   . PHE A 1 330 ? 9.050   65.603 70.312 1.00 28.51 ? 330 PHE A C   1 
ATOM   2533 O O   . PHE A 1 330 ? 8.116   65.770 71.111 1.00 27.81 ? 330 PHE A O   1 
ATOM   2534 C CB  . PHE A 1 330 ? 9.144   67.120 68.354 1.00 27.41 ? 330 PHE A CB  1 
ATOM   2535 C CG  . PHE A 1 330 ? 7.671   67.382 68.360 1.00 26.44 ? 330 PHE A CG  1 
ATOM   2536 C CD1 . PHE A 1 330 ? 7.193   68.661 68.597 1.00 27.05 ? 330 PHE A CD1 1 
ATOM   2537 C CD2 . PHE A 1 330 ? 6.782   66.360 68.096 1.00 24.96 ? 330 PHE A CD2 1 
ATOM   2538 C CE1 . PHE A 1 330 ? 5.832   68.904 68.581 1.00 28.77 ? 330 PHE A CE1 1 
ATOM   2539 C CE2 . PHE A 1 330 ? 5.421   66.596 68.070 1.00 25.57 ? 330 PHE A CE2 1 
ATOM   2540 C CZ  . PHE A 1 330 ? 4.951   67.867 68.329 1.00 28.11 ? 330 PHE A CZ  1 
ATOM   2541 N N   . PHE A 1 331 ? 9.387   64.398 69.870 1.00 28.51 ? 331 PHE A N   1 
ATOM   2542 C CA  . PHE A 1 331 ? 8.728   63.198 70.354 1.00 28.79 ? 331 PHE A CA  1 
ATOM   2543 C C   . PHE A 1 331 ? 9.125   62.810 71.782 1.00 29.09 ? 331 PHE A C   1 
ATOM   2544 O O   . PHE A 1 331 ? 8.327   62.189 72.467 1.00 27.88 ? 331 PHE A O   1 
ATOM   2545 C CB  . PHE A 1 331 ? 9.033   62.027 69.380 1.00 26.84 ? 331 PHE A CB  1 
ATOM   2546 C CG  . PHE A 1 331 ? 8.458   62.437 68.039 1.00 28.27 ? 331 PHE A CG  1 
ATOM   2547 C CD1 . PHE A 1 331 ? 7.130   62.196 67.764 1.00 24.93 ? 331 PHE A CD1 1 
ATOM   2548 C CD2 . PHE A 1 331 ? 9.258   63.137 67.132 1.00 26.49 ? 331 PHE A CD2 1 
ATOM   2549 C CE1 . PHE A 1 331 ? 6.585   62.637 66.578 1.00 28.18 ? 331 PHE A CE1 1 
ATOM   2550 C CE2 . PHE A 1 331 ? 8.694   63.577 65.948 1.00 27.10 ? 331 PHE A CE2 1 
ATOM   2551 C CZ  . PHE A 1 331 ? 7.372   63.321 65.667 1.00 27.65 ? 331 PHE A CZ  1 
ATOM   2552 N N   . LEU A 1 332 ? 10.355  63.078 72.175 1.00 28.83 ? 332 LEU A N   1 
ATOM   2553 C CA  . LEU A 1 332 ? 10.869  62.792 73.498 1.00 31.10 ? 332 LEU A CA  1 
ATOM   2554 C C   . LEU A 1 332 ? 10.081  63.644 74.517 1.00 31.11 ? 332 LEU A C   1 
ATOM   2555 O O   . LEU A 1 332 ? 9.482   63.104 75.439 1.00 30.35 ? 332 LEU A O   1 
ATOM   2556 C CB  . LEU A 1 332 ? 12.366  63.062 73.572 1.00 28.38 ? 332 LEU A CB  1 
ATOM   2557 C CG  . LEU A 1 332 ? 13.194  61.990 72.862 1.00 27.54 ? 332 LEU A CG  1 
ATOM   2558 C CD1 . LEU A 1 332 ? 14.599  62.525 72.707 1.00 28.87 ? 332 LEU A CD1 1 
ATOM   2559 C CD2 . LEU A 1 332 ? 13.096  60.671 73.616 1.00 24.63 ? 332 LEU A CD2 1 
ATOM   2560 N N   . LEU A 1 333 ? 9.992   64.921 74.200 1.00 30.66 ? 333 LEU A N   1 
ATOM   2561 C CA  . LEU A 1 333 ? 9.252   65.896 74.938 1.00 32.89 ? 333 LEU A CA  1 
ATOM   2562 C C   . LEU A 1 333 ? 7.828   65.424 75.225 1.00 34.69 ? 333 LEU A C   1 
ATOM   2563 O O   . LEU A 1 333 ? 7.382   65.565 76.367 1.00 35.79 ? 333 LEU A O   1 
ATOM   2564 C CB  . LEU A 1 333 ? 9.138   67.238 74.203 1.00 31.31 ? 333 LEU A CB  1 
ATOM   2565 C CG  . LEU A 1 333 ? 8.216   68.233 74.910 1.00 35.80 ? 333 LEU A CG  1 
ATOM   2566 C CD1 . LEU A 1 333 ? 8.724   68.565 76.317 1.00 34.19 ? 333 LEU A CD1 1 
ATOM   2567 C CD2 . LEU A 1 333 ? 8.072   69.503 74.096 1.00 34.84 ? 333 LEU A CD2 1 
ATOM   2568 N N   . TYR A 1 334 ? 7.126   64.907 74.216 1.00 34.24 ? 334 TYR A N   1 
ATOM   2569 C CA  . TYR A 1 334 ? 5.767   64.485 74.484 1.00 33.60 ? 334 TYR A CA  1 
ATOM   2570 C C   . TYR A 1 334 ? 5.682   63.080 75.047 1.00 33.39 ? 334 TYR A C   1 
ATOM   2571 O O   . TYR A 1 334 ? 4.621   62.828 75.638 1.00 35.01 ? 334 TYR A O   1 
ATOM   2572 C CB  . TYR A 1 334 ? 4.891   64.500 73.223 1.00 31.67 ? 334 TYR A CB  1 
ATOM   2573 C CG  . TYR A 1 334 ? 4.373   65.859 72.825 1.00 28.50 ? 334 TYR A CG  1 
ATOM   2574 C CD1 . TYR A 1 334 ? 5.268   66.815 72.387 1.00 28.60 ? 334 TYR A CD1 1 
ATOM   2575 C CD2 . TYR A 1 334 ? 3.030   66.193 72.872 1.00 26.70 ? 334 TYR A CD2 1 
ATOM   2576 C CE1 . TYR A 1 334 ? 4.845   68.076 72.009 1.00 26.66 ? 334 TYR A CE1 1 
ATOM   2577 C CE2 . TYR A 1 334 ? 2.597   67.453 72.490 1.00 27.15 ? 334 TYR A CE2 1 
ATOM   2578 C CZ  . TYR A 1 334 ? 3.521   68.383 72.061 1.00 27.25 ? 334 TYR A CZ  1 
ATOM   2579 O OH  . TYR A 1 334 ? 3.123   69.651 71.673 1.00 30.08 ? 334 TYR A OH  1 
ATOM   2580 N N   . GLY A 1 335 ? 6.639   62.182 74.899 1.00 32.88 ? 335 GLY A N   1 
ATOM   2581 C CA  . GLY A 1 335 ? 6.377   60.855 75.447 1.00 32.68 ? 335 GLY A CA  1 
ATOM   2582 C C   . GLY A 1 335 ? 7.485   60.202 76.237 1.00 33.54 ? 335 GLY A C   1 
ATOM   2583 O O   . GLY A 1 335 ? 7.289   59.061 76.673 1.00 33.17 ? 335 GLY A O   1 
ATOM   2584 N N   . ALA A 1 336 ? 8.644   60.838 76.384 1.00 32.78 ? 336 ALA A N   1 
ATOM   2585 C CA  . ALA A 1 336 ? 9.700   60.186 77.150 1.00 33.42 ? 336 ALA A CA  1 
ATOM   2586 C C   . ALA A 1 336 ? 9.763   60.814 78.558 1.00 34.03 ? 336 ALA A C   1 
ATOM   2587 O O   . ALA A 1 336 ? 9.571   62.016 78.739 1.00 32.21 ? 336 ALA A O   1 
ATOM   2588 C CB  . ALA A 1 336 ? 11.060  60.283 76.485 1.00 31.00 ? 336 ALA A CB  1 
ATOM   2589 N N   . PRO A 1 337 ? 10.026  59.975 79.542 1.00 34.17 ? 337 PRO A N   1 
ATOM   2590 C CA  . PRO A 1 337 ? 10.161  60.416 80.920 1.00 34.75 ? 337 PRO A CA  1 
ATOM   2591 C C   . PRO A 1 337 ? 11.423  61.222 81.139 1.00 34.10 ? 337 PRO A C   1 
ATOM   2592 O O   . PRO A 1 337 ? 12.481  60.850 80.629 1.00 34.13 ? 337 PRO A O   1 
ATOM   2593 C CB  . PRO A 1 337 ? 10.177  59.120 81.720 1.00 34.64 ? 337 PRO A CB  1 
ATOM   2594 C CG  . PRO A 1 337 ? 10.894  58.188 80.773 1.00 36.05 ? 337 PRO A CG  1 
ATOM   2595 C CD  . PRO A 1 337 ? 10.280  58.518 79.415 1.00 34.68 ? 337 PRO A CD  1 
ATOM   2596 N N   . GLY A 1 338 ? 11.317  62.325 81.884 1.00 33.34 ? 338 GLY A N   1 
ATOM   2597 C CA  . GLY A 1 338 ? 12.499  63.126 82.167 1.00 32.33 ? 338 GLY A CA  1 
ATOM   2598 C C   . GLY A 1 338 ? 12.557  64.396 81.328 1.00 32.49 ? 338 GLY A C   1 
ATOM   2599 O O   . GLY A 1 338 ? 13.333  65.302 81.639 1.00 33.07 ? 338 GLY A O   1 
ATOM   2600 N N   . PHE A 1 339 ? 11.744  64.461 80.277 1.00 30.74 ? 339 PHE A N   1 
ATOM   2601 C CA  . PHE A 1 339 ? 11.773  65.608 79.394 1.00 29.12 ? 339 PHE A CA  1 
ATOM   2602 C C   . PHE A 1 339 ? 10.621  66.506 79.770 1.00 27.63 ? 339 PHE A C   1 
ATOM   2603 O O   . PHE A 1 339 ? 9.560   65.929 80.001 1.00 27.84 ? 339 PHE A O   1 
ATOM   2604 C CB  . PHE A 1 339 ? 11.609  65.264 77.888 1.00 24.70 ? 339 PHE A CB  1 
ATOM   2605 C CG  . PHE A 1 339 ? 12.752  64.452 77.356 1.00 18.64 ? 339 PHE A CG  1 
ATOM   2606 C CD1 . PHE A 1 339 ? 12.768  63.089 77.480 1.00 20.72 ? 339 PHE A CD1 1 
ATOM   2607 C CD2 . PHE A 1 339 ? 13.820  65.078 76.739 1.00 21.28 ? 339 PHE A CD2 1 
ATOM   2608 C CE1 . PHE A 1 339 ? 13.816  62.327 76.984 1.00 21.27 ? 339 PHE A CE1 1 
ATOM   2609 C CE2 . PHE A 1 339 ? 14.882  64.335 76.248 1.00 18.37 ? 339 PHE A CE2 1 
ATOM   2610 C CZ  . PHE A 1 339 ? 14.876  62.972 76.379 1.00 18.39 ? 339 PHE A CZ  1 
ATOM   2611 N N   . SER A 1 340 ? 10.840  67.795 79.779 1.00 27.40 ? 340 SER A N   1 
ATOM   2612 C CA  . SER A 1 340 ? 9.681   68.638 80.126 1.00 29.34 ? 340 SER A CA  1 
ATOM   2613 C C   . SER A 1 340 ? 9.956   69.908 79.354 1.00 29.48 ? 340 SER A C   1 
ATOM   2614 O O   . SER A 1 340 ? 11.134  70.160 79.109 1.00 30.16 ? 340 SER A O   1 
ATOM   2615 C CB  . SER A 1 340 ? 9.553   68.816 81.636 1.00 31.73 ? 340 SER A CB  1 
ATOM   2616 O OG  . SER A 1 340 ? 10.821  69.250 82.125 1.00 32.89 ? 340 SER A OG  1 
ATOM   2617 N N   . LYS A 1 341 ? 8.936   70.640 78.983 1.00 31.09 ? 341 LYS A N   1 
ATOM   2618 C CA  . LYS A 1 341 ? 9.168   71.837 78.197 1.00 32.74 ? 341 LYS A CA  1 
ATOM   2619 C C   . LYS A 1 341 ? 10.033  72.871 78.870 1.00 33.71 ? 341 LYS A C   1 
ATOM   2620 O O   . LYS A 1 341 ? 10.812  73.557 78.178 1.00 34.84 ? 341 LYS A O   1 
ATOM   2621 C CB  . LYS A 1 341 ? 7.800   72.453 77.836 1.00 32.79 ? 341 LYS A CB  1 
ATOM   2622 C CG  . LYS A 1 341 ? 7.952   73.475 76.711 1.00 32.10 ? 341 LYS A CG  1 
ATOM   2623 C CD  . LYS A 1 341 ? 6.642   74.058 76.240 1.00 32.00 ? 341 LYS A CD  1 
ATOM   2624 C CE  . LYS A 1 341 ? 5.816   74.737 77.313 1.00 32.24 ? 341 LYS A CE  1 
ATOM   2625 N NZ  . LYS A 1 341 ? 6.529   75.885 77.942 1.00 34.84 ? 341 LYS A NZ  1 
ATOM   2626 N N   . ASP A 1 342 ? 9.794   73.104 80.157 1.00 34.49 ? 342 ASP A N   1 
ATOM   2627 C CA  . ASP A 1 342 ? 10.464  74.233 80.816 1.00 34.64 ? 342 ASP A CA  1 
ATOM   2628 C C   . ASP A 1 342 ? 11.765  73.911 81.505 1.00 34.73 ? 342 ASP A C   1 
ATOM   2629 O O   . ASP A 1 342 ? 12.311  74.838 82.096 1.00 36.00 ? 342 ASP A O   1 
ATOM   2630 C CB  . ASP A 1 342 ? 9.448   74.843 81.788 1.00 37.14 ? 342 ASP A CB  1 
ATOM   2631 C CG  . ASP A 1 342 ? 8.244   75.309 80.986 1.00 38.83 ? 342 ASP A CG  1 
ATOM   2632 O OD1 . ASP A 1 342 ? 8.431   75.470 79.763 1.00 40.96 ? 342 ASP A OD1 1 
ATOM   2633 O OD2 . ASP A 1 342 ? 7.157   75.506 81.556 1.00 40.11 ? 342 ASP A OD2 1 
ATOM   2634 N N   . SER A 1 343 ? 12.291  72.711 81.445 1.00 35.41 ? 343 SER A N   1 
ATOM   2635 C CA  . SER A 1 343 ? 13.583  72.407 82.044 1.00 36.52 ? 343 SER A CA  1 
ATOM   2636 C C   . SER A 1 343 ? 14.583  72.108 80.913 1.00 37.49 ? 343 SER A C   1 
ATOM   2637 O O   . SER A 1 343 ? 14.213  72.139 79.741 1.00 37.64 ? 343 SER A O   1 
ATOM   2638 C CB  . SER A 1 343 ? 13.529  71.226 82.989 1.00 35.67 ? 343 SER A CB  1 
ATOM   2639 O OG  . SER A 1 343 ? 13.238  70.037 82.296 1.00 38.10 ? 343 SER A OG  1 
ATOM   2640 N N   . GLU A 1 344 ? 15.827  71.821 81.246 1.00 37.36 ? 344 GLU A N   1 
ATOM   2641 C CA  . GLU A 1 344 ? 16.881  71.523 80.299 1.00 37.52 ? 344 GLU A CA  1 
ATOM   2642 C C   . GLU A 1 344 ? 16.835  70.042 79.930 1.00 37.16 ? 344 GLU A C   1 
ATOM   2643 O O   . GLU A 1 344 ? 17.553  69.574 79.057 1.00 37.11 ? 344 GLU A O   1 
ATOM   2644 C CB  . GLU A 1 344 ? 18.262  71.873 80.844 1.00 39.90 ? 344 GLU A CB  1 
ATOM   2645 C CG  . GLU A 1 344 ? 18.708  73.301 80.542 1.00 43.50 ? 344 GLU A CG  1 
ATOM   2646 C CD  . GLU A 1 344 ? 20.057  73.587 81.210 1.00 46.69 ? 344 GLU A CD  1 
ATOM   2647 N N   . SER A 1 345 ? 15.965  69.337 80.631 1.00 36.45 ? 345 SER A N   1 
ATOM   2648 C CA  . SER A 1 345 ? 15.721  67.933 80.401 1.00 36.58 ? 345 SER A CA  1 
ATOM   2649 C C   . SER A 1 345 ? 16.981  67.091 80.466 1.00 37.43 ? 345 SER A C   1 
ATOM   2650 O O   . SER A 1 345 ? 17.205  66.234 79.602 1.00 37.79 ? 345 SER A O   1 
ATOM   2651 C CB  . SER A 1 345 ? 15.020  67.745 79.046 1.00 35.49 ? 345 SER A CB  1 
ATOM   2652 O OG  . SER A 1 345 ? 13.663  68.144 79.191 1.00 36.64 ? 345 SER A OG  1 
ATOM   2653 N N   . LYS A 1 346 ? 17.774  67.330 81.512 1.00 37.83 ? 346 LYS A N   1 
ATOM   2654 C CA  . LYS A 1 346 ? 18.997  66.522 81.676 1.00 38.12 ? 346 LYS A CA  1 
ATOM   2655 C C   . LYS A 1 346 ? 18.430  65.143 81.990 1.00 37.46 ? 346 LYS A C   1 
ATOM   2656 O O   . LYS A 1 346 ? 17.430  64.998 82.680 1.00 38.49 ? 346 LYS A O   1 
ATOM   2657 C CB  . LYS A 1 346 ? 19.953  67.060 82.700 1.00 43.98 ? 346 LYS A CB  1 
ATOM   2658 C CG  . LYS A 1 346 ? 20.585  68.396 82.315 1.00 49.37 ? 346 LYS A CG  1 
ATOM   2659 C CD  . LYS A 1 346 ? 21.339  68.959 83.520 1.00 54.42 ? 346 LYS A CD  1 
ATOM   2660 C CE  . LYS A 1 346 ? 21.626  70.443 83.340 1.00 58.29 ? 346 LYS A CE  1 
ATOM   2661 N NZ  . LYS A 1 346 ? 22.942  70.831 83.930 1.00 60.46 ? 346 LYS A NZ  1 
ATOM   2662 N N   . ILE A 1 347 ? 18.952  64.110 81.368 1.00 37.99 ? 347 ILE A N   1 
ATOM   2663 C CA  . ILE A 1 347 ? 18.360  62.782 81.468 1.00 37.70 ? 347 ILE A CA  1 
ATOM   2664 C C   . ILE A 1 347 ? 19.270  61.844 82.221 1.00 38.48 ? 347 ILE A C   1 
ATOM   2665 O O   . ILE A 1 347 ? 20.475  61.728 82.034 1.00 37.99 ? 347 ILE A O   1 
ATOM   2666 C CB  . ILE A 1 347 ? 18.039  62.347 80.011 1.00 35.55 ? 347 ILE A CB  1 
ATOM   2667 C CG1 . ILE A 1 347 ? 16.986  63.331 79.441 1.00 35.28 ? 347 ILE A CG1 1 
ATOM   2668 C CG2 . ILE A 1 347 ? 17.526  60.943 79.836 1.00 31.14 ? 347 ILE A CG2 1 
ATOM   2669 C CD1 . ILE A 1 347 ? 15.603  63.043 79.972 1.00 34.24 ? 347 ILE A CD1 1 
ATOM   2670 N N   . SER A 1 348 ? 18.647  61.131 83.146 1.00 40.07 ? 348 SER A N   1 
ATOM   2671 C CA  . SER A 1 348 ? 19.352  60.170 83.973 1.00 42.55 ? 348 SER A CA  1 
ATOM   2672 C C   . SER A 1 348 ? 19.583  58.915 83.148 1.00 43.70 ? 348 SER A C   1 
ATOM   2673 O O   . SER A 1 348 ? 18.909  58.746 82.128 1.00 44.43 ? 348 SER A O   1 
ATOM   2674 C CB  . SER A 1 348 ? 18.531  59.848 85.216 1.00 43.06 ? 348 SER A CB  1 
ATOM   2675 O OG  . SER A 1 348 ? 17.769  58.674 84.991 1.00 42.98 ? 348 SER A OG  1 
ATOM   2676 N N   . ARG A 1 349 ? 20.468  58.057 83.604 1.00 44.29 ? 349 ARG A N   1 
ATOM   2677 C CA  . ARG A 1 349 ? 20.752  56.807 82.919 1.00 45.44 ? 349 ARG A CA  1 
ATOM   2678 C C   . ARG A 1 349 ? 19.543  55.888 83.026 1.00 45.82 ? 349 ARG A C   1 
ATOM   2679 O O   . ARG A 1 349 ? 19.302  55.003 82.203 1.00 46.55 ? 349 ARG A O   1 
ATOM   2680 C CB  . ARG A 1 349 ? 21.994  56.155 83.503 1.00 47.19 ? 349 ARG A CB  1 
ATOM   2681 C CG  . ARG A 1 349 ? 22.512  54.975 82.696 1.00 50.95 ? 349 ARG A CG  1 
ATOM   2682 C CD  . ARG A 1 349 ? 23.870  55.295 82.091 1.00 52.85 ? 349 ARG A CD  1 
ATOM   2683 N NE  . ARG A 1 349 ? 23.752  56.092 80.871 1.00 54.53 ? 349 ARG A NE  1 
ATOM   2684 C CZ  . ARG A 1 349 ? 23.627  55.563 79.652 1.00 54.12 ? 349 ARG A CZ  1 
ATOM   2685 N NH1 . ARG A 1 349 ? 23.576  54.253 79.462 1.00 51.60 ? 349 ARG A NH1 1 
ATOM   2686 N NH2 . ARG A 1 349 ? 23.549  56.379 78.607 1.00 56.25 ? 349 ARG A NH2 1 
ATOM   2687 N N   . GLU A 1 350 ? 18.762  56.120 84.076 1.00 45.80 ? 350 GLU A N   1 
ATOM   2688 C CA  . GLU A 1 350 ? 17.550  55.328 84.279 1.00 45.33 ? 350 GLU A CA  1 
ATOM   2689 C C   . GLU A 1 350 ? 16.529  55.783 83.244 1.00 44.26 ? 350 GLU A C   1 
ATOM   2690 O O   . GLU A 1 350 ? 15.884  54.980 82.576 1.00 44.79 ? 350 GLU A O   1 
ATOM   2691 C CB  . GLU A 1 350 ? 17.066  55.477 85.707 1.00 49.55 ? 350 GLU A CB  1 
ATOM   2692 C CG  . GLU A 1 350 ? 15.870  54.634 86.111 1.00 53.15 ? 350 GLU A CG  1 
ATOM   2693 C CD  . GLU A 1 350 ? 16.110  53.908 87.427 1.00 53.40 ? 350 GLU A CD  1 
ATOM   2694 N N   . ASP A 1 351 ? 16.393  57.094 83.088 1.00 43.01 ? 351 ASP A N   1 
ATOM   2695 C CA  . ASP A 1 351 ? 15.439  57.647 82.130 1.00 41.55 ? 351 ASP A CA  1 
ATOM   2696 C C   . ASP A 1 351 ? 15.853  57.384 80.681 1.00 41.42 ? 351 ASP A C   1 
ATOM   2697 O O   . ASP A 1 351 ? 15.036  57.173 79.798 1.00 40.48 ? 351 ASP A O   1 
ATOM   2698 C CB  . ASP A 1 351 ? 15.295  59.140 82.401 1.00 37.39 ? 351 ASP A CB  1 
ATOM   2699 C CG  . ASP A 1 351 ? 14.259  59.379 83.488 1.00 32.26 ? 351 ASP A CG  1 
ATOM   2700 O OD1 . ASP A 1 351 ? 13.487  58.457 83.785 1.00 30.51 ? 351 ASP A OD1 1 
ATOM   2701 O OD2 . ASP A 1 351 ? 14.181  60.528 83.941 1.00 31.80 ? 351 ASP A OD2 1 
ATOM   2702 N N   . PHE A 1 352 ? 17.154  57.373 80.437 1.00 41.02 ? 352 PHE A N   1 
ATOM   2703 C CA  . PHE A 1 352 ? 17.728  57.119 79.135 1.00 40.28 ? 352 PHE A CA  1 
ATOM   2704 C C   . PHE A 1 352 ? 17.343  55.720 78.672 1.00 40.90 ? 352 PHE A C   1 
ATOM   2705 O O   . PHE A 1 352 ? 16.768  55.554 77.602 1.00 40.57 ? 352 PHE A O   1 
ATOM   2706 C CB  . PHE A 1 352 ? 19.237  57.253 79.184 1.00 36.68 ? 352 PHE A CB  1 
ATOM   2707 C CG  . PHE A 1 352 ? 19.936  56.849 77.923 1.00 37.08 ? 352 PHE A CG  1 
ATOM   2708 C CD1 . PHE A 1 352 ? 20.185  57.785 76.932 1.00 37.67 ? 352 PHE A CD1 1 
ATOM   2709 C CD2 . PHE A 1 352 ? 20.370  55.551 77.737 1.00 36.78 ? 352 PHE A CD2 1 
ATOM   2710 C CE1 . PHE A 1 352 ? 20.839  57.423 75.773 1.00 37.09 ? 352 PHE A CE1 1 
ATOM   2711 C CE2 . PHE A 1 352 ? 21.042  55.185 76.591 1.00 38.13 ? 352 PHE A CE2 1 
ATOM   2712 C CZ  . PHE A 1 352 ? 21.265  56.124 75.600 1.00 36.93 ? 352 PHE A CZ  1 
ATOM   2713 N N   . MET A 1 353 ? 17.620  54.755 79.535 1.00 41.53 ? 353 MET A N   1 
ATOM   2714 C CA  . MET A 1 353 ? 17.335  53.352 79.301 1.00 42.00 ? 353 MET A CA  1 
ATOM   2715 C C   . MET A 1 353 ? 15.845  53.158 79.028 1.00 41.35 ? 353 MET A C   1 
ATOM   2716 O O   . MET A 1 353 ? 15.483  52.356 78.156 1.00 42.52 ? 353 MET A O   1 
ATOM   2717 C CB  . MET A 1 353 ? 17.752  52.483 80.476 1.00 46.96 ? 353 MET A CB  1 
ATOM   2718 C CG  . MET A 1 353 ? 19.246  52.317 80.671 1.00 54.15 ? 353 MET A CG  1 
ATOM   2719 S SD  . MET A 1 353 ? 19.682  51.456 82.205 1.00 58.65 ? 353 MET A SD  1 
ATOM   2720 C CE  . MET A 1 353 ? 18.292  50.361 82.430 1.00 56.82 ? 353 MET A CE  1 
ATOM   2721 N N   . SER A 1 354 ? 15.002  53.887 79.755 1.00 39.41 ? 354 SER A N   1 
ATOM   2722 C CA  . SER A 1 354 ? 13.570  53.720 79.479 1.00 38.45 ? 354 SER A CA  1 
ATOM   2723 C C   . SER A 1 354 ? 13.204  54.468 78.184 1.00 36.67 ? 354 SER A C   1 
ATOM   2724 O O   . SER A 1 354 ? 12.249  54.101 77.514 1.00 36.28 ? 354 SER A O   1 
ATOM   2725 C CB  . SER A 1 354 ? 12.725  54.155 80.676 1.00 35.68 ? 354 SER A CB  1 
ATOM   2726 O OG  . SER A 1 354 ? 12.813  55.564 80.802 1.00 40.47 ? 354 SER A OG  1 
ATOM   2727 N N   . GLY A 1 355 ? 13.935  55.512 77.852 1.00 35.18 ? 355 GLY A N   1 
ATOM   2728 C CA  . GLY A 1 355 ? 13.808  56.292 76.641 1.00 34.81 ? 355 GLY A CA  1 
ATOM   2729 C C   . GLY A 1 355 ? 14.126  55.413 75.424 1.00 33.79 ? 355 GLY A C   1 
ATOM   2730 O O   . GLY A 1 355 ? 13.328  55.358 74.497 1.00 32.75 ? 355 GLY A O   1 
ATOM   2731 N N   . VAL A 1 356 ? 15.262  54.712 75.449 1.00 34.14 ? 356 VAL A N   1 
ATOM   2732 C CA  . VAL A 1 356 ? 15.597  53.870 74.314 1.00 35.00 ? 356 VAL A CA  1 
ATOM   2733 C C   . VAL A 1 356 ? 14.547  52.778 74.131 1.00 36.28 ? 356 VAL A C   1 
ATOM   2734 O O   . VAL A 1 356 ? 14.200  52.486 72.981 1.00 37.65 ? 356 VAL A O   1 
ATOM   2735 C CB  . VAL A 1 356 ? 17.005  53.223 74.330 1.00 32.35 ? 356 VAL A CB  1 
ATOM   2736 C CG1 . VAL A 1 356 ? 18.002  54.107 75.064 1.00 27.42 ? 356 VAL A CG1 1 
ATOM   2737 C CG2 . VAL A 1 356 ? 16.957  51.822 74.874 1.00 29.54 ? 356 VAL A CG2 1 
ATOM   2738 N N   . LYS A 1 357 ? 14.004  52.247 75.201 1.00 36.72 ? 357 LYS A N   1 
ATOM   2739 C CA  . LYS A 1 357 ? 12.950  51.241 75.120 1.00 37.02 ? 357 LYS A CA  1 
ATOM   2740 C C   . LYS A 1 357 ? 11.721  51.794 74.409 1.00 35.73 ? 357 LYS A C   1 
ATOM   2741 O O   . LYS A 1 357 ? 11.110  51.072 73.606 1.00 35.95 ? 357 LYS A O   1 
ATOM   2742 C CB  . LYS A 1 357 ? 12.621  50.739 76.526 1.00 42.18 ? 357 LYS A CB  1 
ATOM   2743 C CG  . LYS A 1 357 ? 11.477  49.762 76.633 1.00 46.36 ? 357 LYS A CG  1 
ATOM   2744 C CD  . LYS A 1 357 ? 11.885  48.349 76.272 1.00 51.73 ? 357 LYS A CD  1 
ATOM   2745 C CE  . LYS A 1 357 ? 10.710  47.377 76.358 1.00 54.19 ? 357 LYS A CE  1 
ATOM   2746 N NZ  . LYS A 1 357 ? 10.944  46.201 75.462 1.00 57.08 ? 357 LYS A NZ  1 
ATOM   2747 N N   . LEU A 1 358 ? 11.343  53.034 74.651 1.00 34.94 ? 358 LEU A N   1 
ATOM   2748 C CA  . LEU A 1 358 ? 10.191  53.629 73.995 1.00 35.39 ? 358 LEU A CA  1 
ATOM   2749 C C   . LEU A 1 358 ? 10.438  53.916 72.509 1.00 35.85 ? 358 LEU A C   1 
ATOM   2750 O O   . LEU A 1 358 ? 9.541   53.931 71.673 1.00 35.00 ? 358 LEU A O   1 
ATOM   2751 C CB  . LEU A 1 358 ? 9.824   54.943 74.689 1.00 35.68 ? 358 LEU A CB  1 
ATOM   2752 C CG  . LEU A 1 358 ? 9.362   54.840 76.144 1.00 36.38 ? 358 LEU A CG  1 
ATOM   2753 C CD1 . LEU A 1 358 ? 9.046   56.195 76.757 1.00 32.77 ? 358 LEU A CD1 1 
ATOM   2754 C CD2 . LEU A 1 358 ? 8.127   53.946 76.228 1.00 36.07 ? 358 LEU A CD2 1 
ATOM   2755 N N   . SER A 1 359 ? 11.694  54.192 72.175 1.00 35.46 ? 359 SER A N   1 
ATOM   2756 C CA  . SER A 1 359 ? 12.179  54.567 70.875 1.00 34.33 ? 359 SER A CA  1 
ATOM   2757 C C   . SER A 1 359 ? 12.259  53.437 69.874 1.00 34.64 ? 359 SER A C   1 
ATOM   2758 O O   . SER A 1 359 ? 11.890  53.579 68.704 1.00 35.08 ? 359 SER A O   1 
ATOM   2759 C CB  . SER A 1 359 ? 13.585  55.164 71.084 1.00 33.85 ? 359 SER A CB  1 
ATOM   2760 O OG  . SER A 1 359 ? 13.376  56.435 71.678 1.00 35.38 ? 359 SER A OG  1 
ATOM   2761 N N   . VAL A 1 360 ? 12.678  52.278 70.321 1.00 33.71 ? 360 VAL A N   1 
ATOM   2762 C CA  . VAL A 1 360 ? 12.816  51.068 69.565 1.00 33.63 ? 360 VAL A CA  1 
ATOM   2763 C C   . VAL A 1 360 ? 11.926  50.002 70.159 1.00 34.83 ? 360 VAL A C   1 
ATOM   2764 O O   . VAL A 1 360 ? 12.454  49.016 70.658 1.00 35.15 ? 360 VAL A O   1 
ATOM   2765 C CB  . VAL A 1 360 ? 14.261  50.543 69.624 1.00 31.62 ? 360 VAL A CB  1 
ATOM   2766 C CG1 . VAL A 1 360 ? 14.498  49.592 68.469 1.00 32.32 ? 360 VAL A CG1 1 
ATOM   2767 C CG2 . VAL A 1 360 ? 15.233  51.707 69.627 1.00 30.19 ? 360 VAL A CG2 1 
ATOM   2768 N N   . PRO A 1 361 ? 10.626  50.180 70.097 1.00 36.30 ? 361 PRO A N   1 
ATOM   2769 C CA  . PRO A 1 361 ? 9.675   49.262 70.694 1.00 37.57 ? 361 PRO A CA  1 
ATOM   2770 C C   . PRO A 1 361 ? 9.758   47.827 70.255 1.00 39.81 ? 361 PRO A C   1 
ATOM   2771 O O   . PRO A 1 361 ? 9.331   46.948 71.026 1.00 41.06 ? 361 PRO A O   1 
ATOM   2772 C CB  . PRO A 1 361 ? 8.310   49.849 70.346 1.00 37.46 ? 361 PRO A CB  1 
ATOM   2773 C CG  . PRO A 1 361 ? 8.569   50.784 69.207 1.00 37.15 ? 361 PRO A CG  1 
ATOM   2774 C CD  . PRO A 1 361 ? 9.937   51.347 69.485 1.00 36.52 ? 361 PRO A CD  1 
ATOM   2775 N N   . HIS A 1 362 ? 10.256  47.560 69.051 1.00 40.99 ? 362 HIS A N   1 
ATOM   2776 C CA  . HIS A 1 362 ? 10.268  46.160 68.617 1.00 43.01 ? 362 HIS A CA  1 
ATOM   2777 C C   . HIS A 1 362 ? 11.534  45.417 68.987 1.00 42.87 ? 362 HIS A C   1 
ATOM   2778 O O   . HIS A 1 362 ? 11.633  44.218 68.728 1.00 43.94 ? 362 HIS A O   1 
ATOM   2779 C CB  . HIS A 1 362 ? 10.051  46.143 67.083 1.00 47.32 ? 362 HIS A CB  1 
ATOM   2780 C CG  . HIS A 1 362 ? 11.028  47.079 66.421 1.00 47.76 ? 362 HIS A CG  1 
ATOM   2781 N ND1 . HIS A 1 362 ? 10.869  48.450 66.457 1.00 48.55 ? 362 HIS A ND1 1 
ATOM   2782 C CD2 . HIS A 1 362 ? 12.180  46.823 65.761 1.00 47.59 ? 362 HIS A CD2 1 
ATOM   2783 C CE1 . HIS A 1 362 ? 11.887  49.006 65.828 1.00 49.31 ? 362 HIS A CE1 1 
ATOM   2784 N NE2 . HIS A 1 362 ? 12.697  48.045 65.392 1.00 48.98 ? 362 HIS A NE2 1 
ATOM   2785 N N   . ALA A 1 363 ? 12.539  46.063 69.573 1.00 42.93 ? 363 ALA A N   1 
ATOM   2786 C CA  . ALA A 1 363 ? 13.774  45.367 69.888 1.00 41.62 ? 363 ALA A CA  1 
ATOM   2787 C C   . ALA A 1 363 ? 13.725  44.470 71.116 1.00 41.76 ? 363 ALA A C   1 
ATOM   2788 O O   . ALA A 1 363 ? 13.004  44.695 72.080 1.00 42.31 ? 363 ALA A O   1 
ATOM   2789 C CB  . ALA A 1 363 ? 14.869  46.411 70.111 1.00 39.95 ? 363 ALA A CB  1 
ATOM   2790 N N   . ASN A 1 364 ? 14.546  43.424 71.071 1.00 40.95 ? 364 ASN A N   1 
ATOM   2791 C CA  . ASN A 1 364 ? 14.641  42.526 72.215 1.00 40.41 ? 364 ASN A CA  1 
ATOM   2792 C C   . ASN A 1 364 ? 15.681  43.195 73.125 1.00 39.94 ? 364 ASN A C   1 
ATOM   2793 O O   . ASN A 1 364 ? 16.217  44.258 72.768 1.00 39.09 ? 364 ASN A O   1 
ATOM   2794 C CB  . ASN A 1 364 ? 15.011  41.120 71.791 1.00 39.54 ? 364 ASN A CB  1 
ATOM   2795 C CG  . ASN A 1 364 ? 16.217  41.168 70.865 1.00 40.15 ? 364 ASN A CG  1 
ATOM   2796 O OD1 . ASN A 1 364 ? 16.928  42.175 70.816 1.00 40.65 ? 364 ASN A OD1 1 
ATOM   2797 N ND2 . ASN A 1 364 ? 16.442  40.078 70.165 1.00 40.68 ? 364 ASN A ND2 1 
ATOM   2798 N N   . ASP A 1 365 ? 16.011  42.589 74.253 1.00 39.37 ? 365 ASP A N   1 
ATOM   2799 C CA  . ASP A 1 365 ? 16.951  43.241 75.177 1.00 39.65 ? 365 ASP A CA  1 
ATOM   2800 C C   . ASP A 1 365 ? 18.302  43.427 74.520 1.00 37.80 ? 365 ASP A C   1 
ATOM   2801 O O   . ASP A 1 365 ? 18.929  44.483 74.654 1.00 38.33 ? 365 ASP A O   1 
ATOM   2802 C CB  . ASP A 1 365 ? 17.008  42.444 76.482 1.00 48.70 ? 365 ASP A CB  1 
ATOM   2803 C CG  . ASP A 1 365 ? 15.750  42.672 77.309 1.00 55.69 ? 365 ASP A CG  1 
ATOM   2804 O OD1 . ASP A 1 365 ? 14.954  43.602 77.040 1.00 57.09 ? 365 ASP A OD1 1 
ATOM   2805 O OD2 . ASP A 1 365 ? 15.537  41.895 78.269 1.00 61.56 ? 365 ASP A OD2 1 
ATOM   2806 N N   . LEU A 1 366 ? 18.745  42.424 73.776 1.00 36.62 ? 366 LEU A N   1 
ATOM   2807 C CA  . LEU A 1 366 ? 20.005  42.531 73.043 1.00 34.77 ? 366 LEU A CA  1 
ATOM   2808 C C   . LEU A 1 366 ? 19.972  43.729 72.102 1.00 33.58 ? 366 LEU A C   1 
ATOM   2809 O O   . LEU A 1 366 ? 20.904  44.533 72.016 1.00 32.69 ? 366 LEU A O   1 
ATOM   2810 C CB  . LEU A 1 366 ? 20.227  41.224 72.308 1.00 37.28 ? 366 LEU A CB  1 
ATOM   2811 C CG  . LEU A 1 366 ? 21.627  40.972 71.748 1.00 41.00 ? 366 LEU A CG  1 
ATOM   2812 C CD1 . LEU A 1 366 ? 22.700  41.285 72.777 1.00 41.75 ? 366 LEU A CD1 1 
ATOM   2813 C CD2 . LEU A 1 366 ? 21.717  39.535 71.272 1.00 42.09 ? 366 LEU A CD2 1 
ATOM   2814 N N   . GLY A 1 367 ? 18.842  43.902 71.407 1.00 32.81 ? 367 GLY A N   1 
ATOM   2815 C CA  . GLY A 1 367 ? 18.709  45.052 70.503 1.00 31.63 ? 367 GLY A CA  1 
ATOM   2816 C C   . GLY A 1 367 ? 18.868  46.345 71.293 1.00 30.63 ? 367 GLY A C   1 
ATOM   2817 O O   . GLY A 1 367 ? 19.633  47.247 70.961 1.00 29.97 ? 367 GLY A O   1 
ATOM   2818 N N   . LEU A 1 368 ? 18.142  46.416 72.409 1.00 31.09 ? 368 LEU A N   1 
ATOM   2819 C CA  . LEU A 1 368 ? 18.215  47.592 73.285 1.00 30.70 ? 368 LEU A CA  1 
ATOM   2820 C C   . LEU A 1 368 ? 19.650  47.804 73.731 1.00 30.93 ? 368 LEU A C   1 
ATOM   2821 O O   . LEU A 1 368 ? 20.132  48.946 73.723 1.00 31.03 ? 368 LEU A O   1 
ATOM   2822 C CB  . LEU A 1 368 ? 17.264  47.420 74.455 1.00 34.30 ? 368 LEU A CB  1 
ATOM   2823 C CG  . LEU A 1 368 ? 15.775  47.335 74.084 1.00 35.10 ? 368 LEU A CG  1 
ATOM   2824 C CD1 . LEU A 1 368 ? 14.944  47.117 75.338 1.00 33.64 ? 368 LEU A CD1 1 
ATOM   2825 C CD2 . LEU A 1 368 ? 15.331  48.576 73.325 1.00 32.97 ? 368 LEU A CD2 1 
ATOM   2826 N N   . ASP A 1 369 ? 20.345  46.704 74.054 1.00 30.31 ? 369 ASP A N   1 
ATOM   2827 C CA  . ASP A 1 369 ? 21.740  46.828 74.446 1.00 30.85 ? 369 ASP A CA  1 
ATOM   2828 C C   . ASP A 1 369 ? 22.577  47.357 73.291 1.00 30.42 ? 369 ASP A C   1 
ATOM   2829 O O   . ASP A 1 369 ? 23.501  48.149 73.518 1.00 30.78 ? 369 ASP A O   1 
ATOM   2830 C CB  . ASP A 1 369 ? 22.375  45.510 74.896 1.00 35.89 ? 369 ASP A CB  1 
ATOM   2831 C CG  . ASP A 1 369 ? 21.930  45.085 76.284 1.00 40.27 ? 369 ASP A CG  1 
ATOM   2832 O OD1 . ASP A 1 369 ? 21.381  45.900 77.060 1.00 41.24 ? 369 ASP A OD1 1 
ATOM   2833 O OD2 . ASP A 1 369 ? 22.152  43.901 76.608 1.00 44.02 ? 369 ASP A OD2 1 
ATOM   2834 N N   . ALA A 1 370 ? 22.275  46.864 72.080 1.00 30.22 ? 370 ALA A N   1 
ATOM   2835 C CA  . ALA A 1 370 ? 23.082  47.358 70.946 1.00 28.65 ? 370 ALA A CA  1 
ATOM   2836 C C   . ALA A 1 370 ? 22.862  48.856 70.799 1.00 26.93 ? 370 ALA A C   1 
ATOM   2837 O O   . ALA A 1 370 ? 23.835  49.583 70.615 1.00 26.03 ? 370 ALA A O   1 
ATOM   2838 C CB  . ALA A 1 370 ? 22.747  46.586 69.689 1.00 32.46 ? 370 ALA A CB  1 
ATOM   2839 N N   . VAL A 1 371 ? 21.629  49.324 70.923 1.00 26.44 ? 371 VAL A N   1 
ATOM   2840 C CA  . VAL A 1 371 ? 21.356  50.747 70.766 1.00 27.17 ? 371 VAL A CA  1 
ATOM   2841 C C   . VAL A 1 371 ? 22.076  51.575 71.810 1.00 28.20 ? 371 VAL A C   1 
ATOM   2842 O O   . VAL A 1 371 ? 22.760  52.562 71.509 1.00 27.97 ? 371 VAL A O   1 
ATOM   2843 C CB  . VAL A 1 371 ? 19.842  51.039 70.850 1.00 28.60 ? 371 VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 371 ? 19.576  52.529 70.764 1.00 28.33 ? 371 VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 371 ? 19.092  50.290 69.764 1.00 28.09 ? 371 VAL A CG2 1 
ATOM   2846 N N   . THR A 1 372 ? 21.921  51.107 73.064 1.00 28.41 ? 372 THR A N   1 
ATOM   2847 C CA  . THR A 1 372 ? 22.545  51.766 74.207 1.00 27.12 ? 372 THR A CA  1 
ATOM   2848 C C   . THR A 1 372 ? 24.046  51.836 74.038 1.00 25.83 ? 372 THR A C   1 
ATOM   2849 O O   . THR A 1 372 ? 24.680  52.861 74.237 1.00 24.22 ? 372 THR A O   1 
ATOM   2850 C CB  . THR A 1 372 ? 22.220  51.042 75.541 1.00 29.31 ? 372 THR A CB  1 
ATOM   2851 O OG1 . THR A 1 372 ? 20.807  51.074 75.747 1.00 30.64 ? 372 THR A OG1 1 
ATOM   2852 C CG2 . THR A 1 372 ? 22.888  51.709 76.728 1.00 25.36 ? 372 THR A CG2 1 
ATOM   2853 N N   . LEU A 1 373 ? 24.648  50.716 73.663 1.00 27.48 ? 373 LEU A N   1 
ATOM   2854 C CA  . LEU A 1 373 ? 26.113  50.733 73.471 1.00 30.26 ? 373 LEU A CA  1 
ATOM   2855 C C   . LEU A 1 373 ? 26.518  51.774 72.446 1.00 32.44 ? 373 LEU A C   1 
ATOM   2856 O O   . LEU A 1 373 ? 27.440  52.575 72.578 1.00 33.52 ? 373 LEU A O   1 
ATOM   2857 C CB  . LEU A 1 373 ? 26.580  49.336 73.065 1.00 31.38 ? 373 LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 373 ? 28.012  49.257 72.526 1.00 35.69 ? 373 LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 373 ? 29.017  49.472 73.648 1.00 38.25 ? 373 LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 373 ? 28.272  47.936 71.819 1.00 35.62 ? 373 LEU A CD2 1 
ATOM   2861 N N   . GLN A 1 374 ? 25.779  51.815 71.330 1.00 33.93 ? 374 GLN A N   1 
ATOM   2862 C CA  . GLN A 1 374 ? 26.049  52.709 70.221 1.00 34.09 ? 374 GLN A CA  1 
ATOM   2863 C C   . GLN A 1 374 ? 25.880  54.170 70.565 1.00 34.30 ? 374 GLN A C   1 
ATOM   2864 O O   . GLN A 1 374 ? 26.596  55.013 70.022 1.00 34.11 ? 374 GLN A O   1 
ATOM   2865 C CB  . GLN A 1 374 ? 25.073  52.317 69.096 1.00 38.29 ? 374 GLN A CB  1 
ATOM   2866 C CG  . GLN A 1 374 ? 25.514  52.610 67.697 1.00 41.37 ? 374 GLN A CG  1 
ATOM   2867 C CD  . GLN A 1 374 ? 26.831  51.968 67.314 1.00 44.79 ? 374 GLN A CD  1 
ATOM   2868 O OE1 . GLN A 1 374 ? 27.473  52.499 66.399 1.00 46.19 ? 374 GLN A OE1 1 
ATOM   2869 N NE2 . GLN A 1 374 ? 27.218  50.890 67.989 1.00 45.39 ? 374 GLN A NE2 1 
ATOM   2870 N N   . TYR A 1 375 ? 24.888  54.498 71.406 1.00 33.94 ? 375 TYR A N   1 
ATOM   2871 C CA  . TYR A 1 375 ? 24.666  55.914 71.690 1.00 34.46 ? 375 TYR A CA  1 
ATOM   2872 C C   . TYR A 1 375 ? 25.148  56.401 73.048 1.00 34.82 ? 375 TYR A C   1 
ATOM   2873 O O   . TYR A 1 375 ? 24.922  57.551 73.427 1.00 34.17 ? 375 TYR A O   1 
ATOM   2874 C CB  . TYR A 1 375 ? 23.157  56.194 71.572 1.00 34.54 ? 375 TYR A CB  1 
ATOM   2875 C CG  . TYR A 1 375 ? 22.778  56.298 70.105 1.00 35.96 ? 375 TYR A CG  1 
ATOM   2876 C CD1 . TYR A 1 375 ? 22.906  57.486 69.399 1.00 35.73 ? 375 TYR A CD1 1 
ATOM   2877 C CD2 . TYR A 1 375 ? 22.392  55.149 69.422 1.00 35.45 ? 375 TYR A CD2 1 
ATOM   2878 C CE1 . TYR A 1 375 ? 22.559  57.558 68.066 1.00 34.95 ? 375 TYR A CE1 1 
ATOM   2879 C CE2 . TYR A 1 375 ? 22.023  55.219 68.105 1.00 35.78 ? 375 TYR A CE2 1 
ATOM   2880 C CZ  . TYR A 1 375 ? 22.119  56.417 67.433 1.00 35.28 ? 375 TYR A CZ  1 
ATOM   2881 O OH  . TYR A 1 375 ? 21.760  56.436 66.112 1.00 35.64 ? 375 TYR A OH  1 
ATOM   2882 N N   . THR A 1 376 ? 25.837  55.543 73.784 1.00 35.02 ? 376 THR A N   1 
ATOM   2883 C CA  . THR A 1 376 ? 26.297  55.942 75.099 1.00 35.64 ? 376 THR A CA  1 
ATOM   2884 C C   . THR A 1 376 ? 27.766  56.302 75.116 1.00 35.48 ? 376 THR A C   1 
ATOM   2885 O O   . THR A 1 376 ? 28.600  55.543 74.619 1.00 36.27 ? 376 THR A O   1 
ATOM   2886 C CB  . THR A 1 376 ? 26.099  54.807 76.133 1.00 36.05 ? 376 THR A CB  1 
ATOM   2887 O OG1 . THR A 1 376 ? 24.709  54.636 76.445 1.00 36.81 ? 376 THR A OG1 1 
ATOM   2888 C CG2 . THR A 1 376 ? 26.874  55.154 77.385 1.00 36.17 ? 376 THR A CG2 1 
ATOM   2889 N N   . ASP A 1 377 ? 28.060  57.435 75.705 1.00 35.42 ? 377 ASP A N   1 
ATOM   2890 C CA  . ASP A 1 377 ? 29.457  57.823 75.894 1.00 37.20 ? 377 ASP A CA  1 
ATOM   2891 C C   . ASP A 1 377 ? 29.889  57.081 77.163 1.00 39.05 ? 377 ASP A C   1 
ATOM   2892 O O   . ASP A 1 377 ? 29.585  57.601 78.250 1.00 38.99 ? 377 ASP A O   1 
ATOM   2893 C CB  . ASP A 1 377 ? 29.533  59.320 76.015 1.00 34.99 ? 377 ASP A CB  1 
ATOM   2894 C CG  . ASP A 1 377 ? 30.928  59.808 76.348 1.00 35.42 ? 377 ASP A CG  1 
ATOM   2895 O OD1 . ASP A 1 377 ? 31.816  58.964 76.572 1.00 33.60 ? 377 ASP A OD1 1 
ATOM   2896 O OD2 . ASP A 1 377 ? 31.084  61.047 76.374 1.00 38.14 ? 377 ASP A OD2 1 
ATOM   2897 N N   . TRP A 1 378 ? 30.477  55.894 77.128 1.00 40.11 ? 378 TRP A N   1 
ATOM   2898 C CA  . TRP A 1 378 ? 30.811  55.181 78.359 1.00 42.72 ? 378 TRP A CA  1 
ATOM   2899 C C   . TRP A 1 378 ? 31.888  55.857 79.193 1.00 43.82 ? 378 TRP A C   1 
ATOM   2900 O O   . TRP A 1 378 ? 32.098  55.438 80.336 1.00 44.50 ? 378 TRP A O   1 
ATOM   2901 C CB  . TRP A 1 378 ? 31.216  53.723 78.073 1.00 42.99 ? 378 TRP A CB  1 
ATOM   2902 C CG  . TRP A 1 378 ? 30.040  52.991 77.493 1.00 46.55 ? 378 TRP A CG  1 
ATOM   2903 C CD1 . TRP A 1 378 ? 29.878  52.667 76.184 1.00 46.56 ? 378 TRP A CD1 1 
ATOM   2904 C CD2 . TRP A 1 378 ? 28.837  52.562 78.136 1.00 47.58 ? 378 TRP A CD2 1 
ATOM   2905 N NE1 . TRP A 1 378 ? 28.669  52.077 75.950 1.00 47.64 ? 378 TRP A NE1 1 
ATOM   2906 C CE2 . TRP A 1 378 ? 28.015  51.975 77.148 1.00 47.95 ? 378 TRP A CE2 1 
ATOM   2907 C CE3 . TRP A 1 378 ? 28.378  52.611 79.450 1.00 48.38 ? 378 TRP A CE3 1 
ATOM   2908 C CZ2 . TRP A 1 378 ? 26.768  51.415 77.423 1.00 49.71 ? 378 TRP A CZ2 1 
ATOM   2909 C CZ3 . TRP A 1 378 ? 27.137  52.064 79.729 1.00 50.68 ? 378 TRP A CZ3 1 
ATOM   2910 C CH2 . TRP A 1 378 ? 26.345  51.480 78.727 1.00 51.45 ? 378 TRP A CH2 1 
ATOM   2911 N N   . MET A 1 379 ? 32.517  56.911 78.722 1.00 45.19 ? 379 MET A N   1 
ATOM   2912 C CA  . MET A 1 379 ? 33.488  57.651 79.510 1.00 47.57 ? 379 MET A CA  1 
ATOM   2913 C C   . MET A 1 379 ? 32.814  58.710 80.376 1.00 47.67 ? 379 MET A C   1 
ATOM   2914 O O   . MET A 1 379 ? 33.432  59.357 81.211 1.00 48.39 ? 379 MET A O   1 
ATOM   2915 C CB  . MET A 1 379 ? 34.489  58.337 78.590 1.00 53.69 ? 379 MET A CB  1 
ATOM   2916 C CG  . MET A 1 379 ? 35.870  58.556 79.182 1.00 61.77 ? 379 MET A CG  1 
ATOM   2917 S SD  . MET A 1 379 ? 37.152  58.293 77.932 1.00 68.65 ? 379 MET A SD  1 
ATOM   2918 C CE  . MET A 1 379 ? 37.762  56.678 78.427 1.00 65.99 ? 379 MET A CE  1 
ATOM   2919 N N   . ASP A 1 380 ? 31.521  58.903 80.179 1.00 47.80 ? 380 ASP A N   1 
ATOM   2920 C CA  . ASP A 1 380 ? 30.714  59.888 80.883 1.00 47.30 ? 380 ASP A CA  1 
ATOM   2921 C C   . ASP A 1 380 ? 29.249  59.505 80.806 1.00 46.87 ? 380 ASP A C   1 
ATOM   2922 O O   . ASP A 1 380 ? 28.400  60.318 80.455 1.00 46.72 ? 380 ASP A O   1 
ATOM   2923 C CB  . ASP A 1 380 ? 31.007  61.234 80.228 1.00 48.06 ? 380 ASP A CB  1 
ATOM   2924 C CG  . ASP A 1 380 ? 30.525  62.458 80.956 1.00 50.90 ? 380 ASP A CG  1 
ATOM   2925 O OD1 . ASP A 1 380 ? 30.023  62.328 82.095 1.00 52.86 ? 380 ASP A OD1 1 
ATOM   2926 O OD2 . ASP A 1 380 ? 30.644  63.568 80.389 1.00 51.88 ? 380 ASP A OD2 1 
ATOM   2927 N N   . ASP A 1 381 ? 28.933  58.256 81.133 1.00 47.16 ? 381 ASP A N   1 
ATOM   2928 C CA  . ASP A 1 381 ? 27.577  57.723 81.039 1.00 47.35 ? 381 ASP A CA  1 
ATOM   2929 C C   . ASP A 1 381 ? 26.569  58.338 81.991 1.00 47.11 ? 381 ASP A C   1 
ATOM   2930 O O   . ASP A 1 381 ? 25.382  57.987 81.864 1.00 47.93 ? 381 ASP A O   1 
ATOM   2931 C CB  . ASP A 1 381 ? 27.599  56.196 81.228 1.00 49.71 ? 381 ASP A CB  1 
ATOM   2932 C CG  . ASP A 1 381 ? 28.001  55.764 82.622 1.00 53.63 ? 381 ASP A CG  1 
ATOM   2933 O OD1 . ASP A 1 381 ? 29.115  56.115 83.076 1.00 54.66 ? 381 ASP A OD1 1 
ATOM   2934 O OD2 . ASP A 1 381 ? 27.192  55.049 83.254 1.00 55.41 ? 381 ASP A OD2 1 
ATOM   2935 N N   . ASN A 1 382 ? 26.952  59.246 82.878 1.00 46.57 ? 382 ASN A N   1 
ATOM   2936 C CA  . ASN A 1 382 ? 25.949  59.862 83.748 1.00 46.11 ? 382 ASN A CA  1 
ATOM   2937 C C   . ASN A 1 382 ? 25.677  61.299 83.325 1.00 45.16 ? 382 ASN A C   1 
ATOM   2938 O O   . ASN A 1 382 ? 24.892  61.982 83.983 1.00 46.54 ? 382 ASN A O   1 
ATOM   2939 C CB  . ASN A 1 382 ? 26.357  59.812 85.227 1.00 47.40 ? 382 ASN A CB  1 
ATOM   2940 C CG  . ASN A 1 382 ? 25.972  58.428 85.730 1.00 49.12 ? 382 ASN A CG  1 
ATOM   2941 O OD1 . ASN A 1 382 ? 26.846  57.628 86.051 1.00 52.64 ? 382 ASN A OD1 1 
ATOM   2942 N ND2 . ASN A 1 382 ? 24.675  58.155 85.746 1.00 48.91 ? 382 ASN A ND2 1 
ATOM   2943 N N   . ASN A 1 383 ? 26.323  61.744 82.256 1.00 43.33 ? 383 ASN A N   1 
ATOM   2944 C CA  . ASN A 1 383 ? 26.101  63.096 81.752 1.00 41.75 ? 383 ASN A CA  1 
ATOM   2945 C C   . ASN A 1 383 ? 24.641  63.202 81.332 1.00 41.40 ? 383 ASN A C   1 
ATOM   2946 O O   . ASN A 1 383 ? 24.167  62.412 80.510 1.00 42.02 ? 383 ASN A O   1 
ATOM   2947 C CB  . ASN A 1 383 ? 27.052  63.401 80.605 1.00 40.22 ? 383 ASN A CB  1 
ATOM   2948 C CG  . ASN A 1 383 ? 27.072  64.881 80.286 1.00 39.08 ? 383 ASN A CG  1 
ATOM   2949 O OD1 . ASN A 1 383 ? 26.021  65.493 80.126 1.00 37.68 ? 383 ASN A OD1 1 
ATOM   2950 N ND2 . ASN A 1 383 ? 28.277  65.422 80.205 1.00 39.81 ? 383 ASN A ND2 1 
ATOM   2951 N N   . GLY A 1 384 ? 23.907  64.143 81.895 1.00 40.23 ? 384 GLY A N   1 
ATOM   2952 C CA  . GLY A 1 384 ? 22.502  64.336 81.612 1.00 38.96 ? 384 GLY A CA  1 
ATOM   2953 C C   . GLY A 1 384 ? 22.240  64.977 80.257 1.00 38.18 ? 384 GLY A C   1 
ATOM   2954 O O   . GLY A 1 384 ? 21.197  64.711 79.674 1.00 36.44 ? 384 GLY A O   1 
ATOM   2955 N N   . ILE A 1 385 ? 23.149  65.845 79.839 1.00 38.05 ? 385 ILE A N   1 
ATOM   2956 C CA  . ILE A 1 385 ? 23.059  66.519 78.559 1.00 38.45 ? 385 ILE A CA  1 
ATOM   2957 C C   . ILE A 1 385 ? 23.316  65.490 77.450 1.00 38.88 ? 385 ILE A C   1 
ATOM   2958 O O   . ILE A 1 385 ? 22.575  65.391 76.475 1.00 39.24 ? 385 ILE A O   1 
ATOM   2959 C CB  . ILE A 1 385 ? 24.061  67.662 78.434 1.00 40.50 ? 385 ILE A CB  1 
ATOM   2960 C CG1 . ILE A 1 385 ? 23.817  68.717 79.520 1.00 40.48 ? 385 ILE A CG1 1 
ATOM   2961 C CG2 . ILE A 1 385 ? 23.988  68.290 77.042 1.00 39.55 ? 385 ILE A CG2 1 
ATOM   2962 C CD1 . ILE A 1 385 ? 22.555  69.522 79.306 1.00 40.26 ? 385 ILE A CD1 1 
ATOM   2963 N N   . LYS A 1 386 ? 24.376  64.716 77.649 1.00 37.87 ? 386 LYS A N   1 
ATOM   2964 C CA  . LYS A 1 386 ? 24.762  63.681 76.709 1.00 38.26 ? 386 LYS A CA  1 
ATOM   2965 C C   . LYS A 1 386 ? 23.686  62.610 76.583 1.00 37.95 ? 386 LYS A C   1 
ATOM   2966 O O   . LYS A 1 386 ? 23.468  62.139 75.465 1.00 39.02 ? 386 LYS A O   1 
ATOM   2967 C CB  . LYS A 1 386 ? 26.091  63.036 77.121 1.00 37.33 ? 386 LYS A CB  1 
ATOM   2968 C CG  . LYS A 1 386 ? 27.233  64.047 77.014 1.00 38.11 ? 386 LYS A CG  1 
ATOM   2969 C CD  . LYS A 1 386 ? 28.559  63.334 77.242 1.00 40.21 ? 386 LYS A CD  1 
ATOM   2970 C CE  . LYS A 1 386 ? 29.741  64.206 76.850 1.00 41.01 ? 386 LYS A CE  1 
ATOM   2971 N NZ  . LYS A 1 386 ? 31.024  63.505 77.190 1.00 43.94 ? 386 LYS A NZ  1 
ATOM   2972 N N   . ASN A 1 387 ? 23.020  62.244 77.673 1.00 36.95 ? 387 ASN A N   1 
ATOM   2973 C CA  . ASN A 1 387 ? 21.963  61.254 77.601 1.00 34.97 ? 387 ASN A CA  1 
ATOM   2974 C C   . ASN A 1 387 ? 20.745  61.818 76.864 1.00 33.40 ? 387 ASN A C   1 
ATOM   2975 O O   . ASN A 1 387 ? 20.003  61.119 76.183 1.00 31.84 ? 387 ASN A O   1 
ATOM   2976 C CB  . ASN A 1 387 ? 21.528  60.802 78.992 1.00 38.41 ? 387 ASN A CB  1 
ATOM   2977 C CG  . ASN A 1 387 ? 22.573  59.985 79.713 1.00 43.61 ? 387 ASN A CG  1 
ATOM   2978 O OD1 . ASN A 1 387 ? 23.431  59.365 79.088 1.00 45.75 ? 387 ASN A OD1 1 
ATOM   2979 N ND2 . ASN A 1 387 ? 22.514  59.979 81.041 1.00 45.50 ? 387 ASN A ND2 1 
ATOM   2980 N N   . ARG A 1 388 ? 20.525  63.109 77.080 1.00 31.71 ? 388 ARG A N   1 
ATOM   2981 C CA  . ARG A 1 388 ? 19.401  63.807 76.475 1.00 30.60 ? 388 ARG A CA  1 
ATOM   2982 C C   . ARG A 1 388 ? 19.584  63.800 74.941 1.00 30.90 ? 388 ARG A C   1 
ATOM   2983 O O   . ARG A 1 388 ? 18.803  63.234 74.206 1.00 28.81 ? 388 ARG A O   1 
ATOM   2984 C CB  . ARG A 1 388 ? 19.325  65.211 77.009 1.00 26.18 ? 388 ARG A CB  1 
ATOM   2985 C CG  . ARG A 1 388 ? 18.125  66.066 76.624 1.00 27.02 ? 388 ARG A CG  1 
ATOM   2986 C CD  . ARG A 1 388 ? 18.713  67.202 75.819 1.00 30.24 ? 388 ARG A CD  1 
ATOM   2987 N NE  . ARG A 1 388 ? 18.980  68.408 76.492 1.00 32.61 ? 388 ARG A NE  1 
ATOM   2988 C CZ  . ARG A 1 388 ? 19.938  69.297 76.544 1.00 31.84 ? 388 ARG A CZ  1 
ATOM   2989 N NH1 . ARG A 1 388 ? 21.069  69.244 75.879 1.00 28.99 ? 388 ARG A NH1 1 
ATOM   2990 N NH2 . ARG A 1 388 ? 19.692  70.327 77.364 1.00 35.32 ? 388 ARG A NH2 1 
ATOM   2991 N N   . ASP A 1 389 ? 20.703  64.374 74.540 1.00 30.60 ? 389 ASP A N   1 
ATOM   2992 C CA  . ASP A 1 389 ? 21.141  64.503 73.175 1.00 30.99 ? 389 ASP A CA  1 
ATOM   2993 C C   . ASP A 1 389 ? 21.274  63.145 72.498 1.00 32.04 ? 389 ASP A C   1 
ATOM   2994 O O   . ASP A 1 389 ? 20.788  62.975 71.376 1.00 32.20 ? 389 ASP A O   1 
ATOM   2995 C CB  . ASP A 1 389 ? 22.463  65.275 73.190 1.00 24.43 ? 389 ASP A CB  1 
ATOM   2996 C CG  . ASP A 1 389 ? 22.175  66.706 73.560 1.00 25.11 ? 389 ASP A CG  1 
ATOM   2997 O OD1 . ASP A 1 389 ? 20.987  67.088 73.665 1.00 26.82 ? 389 ASP A OD1 1 
ATOM   2998 O OD2 . ASP A 1 389 ? 23.136  67.481 73.728 1.00 28.02 ? 389 ASP A OD2 1 
ATOM   2999 N N   . GLY A 1 390 ? 21.841  62.173 73.191 1.00 31.39 ? 390 GLY A N   1 
ATOM   3000 C CA  . GLY A 1 390 ? 21.980  60.842 72.607 1.00 31.92 ? 390 GLY A CA  1 
ATOM   3001 C C   . GLY A 1 390 ? 20.621  60.247 72.283 1.00 32.00 ? 390 GLY A C   1 
ATOM   3002 O O   . GLY A 1 390 ? 20.422  59.479 71.339 1.00 33.64 ? 390 GLY A O   1 
ATOM   3003 N N   . LEU A 1 391 ? 19.635  60.569 73.095 1.00 30.91 ? 391 LEU A N   1 
ATOM   3004 C CA  . LEU A 1 391 ? 18.292  60.047 72.947 1.00 29.31 ? 391 LEU A CA  1 
ATOM   3005 C C   . LEU A 1 391 ? 17.594  60.724 71.765 1.00 28.22 ? 391 LEU A C   1 
ATOM   3006 O O   . LEU A 1 391 ? 16.699  60.163 71.160 1.00 27.24 ? 391 LEU A O   1 
ATOM   3007 C CB  . LEU A 1 391 ? 17.503  60.281 74.231 1.00 26.87 ? 391 LEU A CB  1 
ATOM   3008 C CG  . LEU A 1 391 ? 16.549  59.221 74.748 1.00 31.24 ? 391 LEU A CG  1 
ATOM   3009 C CD1 . LEU A 1 391 ? 16.931  57.812 74.331 1.00 31.13 ? 391 LEU A CD1 1 
ATOM   3010 C CD2 . LEU A 1 391 ? 16.471  59.268 76.288 1.00 32.27 ? 391 LEU A CD2 1 
ATOM   3011 N N   . ASP A 1 392 ? 17.898  61.998 71.607 1.00 27.19 ? 392 ASP A N   1 
ATOM   3012 C CA  . ASP A 1 392 ? 17.395  62.852 70.560 1.00 28.89 ? 392 ASP A CA  1 
ATOM   3013 C C   . ASP A 1 392 ? 17.835  62.203 69.233 1.00 27.91 ? 392 ASP A C   1 
ATOM   3014 O O   . ASP A 1 392 ? 17.014  61.954 68.379 1.00 28.03 ? 392 ASP A O   1 
ATOM   3015 C CB  . ASP A 1 392 ? 17.932  64.254 70.724 1.00 33.95 ? 392 ASP A CB  1 
ATOM   3016 C CG  . ASP A 1 392 ? 17.264  65.333 69.910 1.00 41.03 ? 392 ASP A CG  1 
ATOM   3017 O OD1 . ASP A 1 392 ? 16.322  65.082 69.137 1.00 42.77 ? 392 ASP A OD1 1 
ATOM   3018 O OD2 . ASP A 1 392 ? 17.680  66.512 70.044 1.00 47.82 ? 392 ASP A OD2 1 
ATOM   3019 N N   . ASP A 1 393 ? 19.111  61.890 69.130 1.00 27.08 ? 393 ASP A N   1 
ATOM   3020 C CA  . ASP A 1 393 ? 19.709  61.260 67.988 1.00 28.38 ? 393 ASP A CA  1 
ATOM   3021 C C   . ASP A 1 393 ? 19.123  59.876 67.773 1.00 28.76 ? 393 ASP A C   1 
ATOM   3022 O O   . ASP A 1 393 ? 18.921  59.532 66.626 1.00 28.96 ? 393 ASP A O   1 
ATOM   3023 C CB  . ASP A 1 393 ? 21.217  61.073 68.135 1.00 26.76 ? 393 ASP A CB  1 
ATOM   3024 C CG  . ASP A 1 393 ? 21.889  62.419 68.048 1.00 27.49 ? 393 ASP A CG  1 
ATOM   3025 O OD1 . ASP A 1 393 ? 21.171  63.390 67.757 1.00 31.09 ? 393 ASP A OD1 1 
ATOM   3026 O OD2 . ASP A 1 393 ? 23.109  62.490 68.260 1.00 32.03 ? 393 ASP A OD2 1 
ATOM   3027 N N   . ILE A 1 394 ? 18.914  59.142 68.865 1.00 28.63 ? 394 ILE A N   1 
ATOM   3028 C CA  . ILE A 1 394 ? 18.350  57.810 68.678 1.00 28.20 ? 394 ILE A CA  1 
ATOM   3029 C C   . ILE A 1 394 ? 16.992  57.908 67.982 1.00 28.31 ? 394 ILE A C   1 
ATOM   3030 O O   . ILE A 1 394 ? 16.742  57.187 67.015 1.00 27.93 ? 394 ILE A O   1 
ATOM   3031 C CB  . ILE A 1 394 ? 18.174  57.018 69.984 1.00 26.84 ? 394 ILE A CB  1 
ATOM   3032 C CG1 . ILE A 1 394 ? 19.545  56.511 70.471 1.00 30.09 ? 394 ILE A CG1 1 
ATOM   3033 C CG2 . ILE A 1 394 ? 17.212  55.845 69.840 1.00 19.82 ? 394 ILE A CG2 1 
ATOM   3034 C CD1 . ILE A 1 394 ? 19.560  56.200 71.961 1.00 29.79 ? 394 ILE A CD1 1 
ATOM   3035 N N   . VAL A 1 395 ? 16.138  58.777 68.499 1.00 27.40 ? 395 VAL A N   1 
ATOM   3036 C CA  . VAL A 1 395 ? 14.805  58.911 67.922 1.00 27.87 ? 395 VAL A CA  1 
ATOM   3037 C C   . VAL A 1 395 ? 14.823  59.430 66.475 1.00 26.92 ? 395 VAL A C   1 
ATOM   3038 O O   . VAL A 1 395 ? 14.043  58.935 65.665 1.00 24.75 ? 395 VAL A O   1 
ATOM   3039 C CB  . VAL A 1 395 ? 13.916  59.798 68.818 1.00 25.90 ? 395 VAL A CB  1 
ATOM   3040 C CG1 . VAL A 1 395 ? 12.501  59.939 68.277 1.00 20.74 ? 395 VAL A CG1 1 
ATOM   3041 C CG2 . VAL A 1 395 ? 13.866  59.193 70.219 1.00 27.19 ? 395 VAL A CG2 1 
ATOM   3042 N N   . GLY A 1 396 ? 15.659  60.401 66.190 1.00 27.05 ? 396 GLY A N   1 
ATOM   3043 C CA  . GLY A 1 396 ? 15.793  61.017 64.880 1.00 27.75 ? 396 GLY A CA  1 
ATOM   3044 C C   . GLY A 1 396 ? 16.437  60.050 63.874 1.00 27.65 ? 396 GLY A C   1 
ATOM   3045 O O   . GLY A 1 396 ? 15.907  59.833 62.787 1.00 27.99 ? 396 GLY A O   1 
ATOM   3046 N N   . ASP A 1 397 ? 17.557  59.457 64.245 1.00 26.97 ? 397 ASP A N   1 
ATOM   3047 C CA  . ASP A 1 397 ? 18.280  58.524 63.436 1.00 26.57 ? 397 ASP A CA  1 
ATOM   3048 C C   . ASP A 1 397 ? 17.399  57.346 63.038 1.00 28.08 ? 397 ASP A C   1 
ATOM   3049 O O   . ASP A 1 397 ? 17.391  56.939 61.876 1.00 28.85 ? 397 ASP A O   1 
ATOM   3050 C CB  . ASP A 1 397 ? 19.500  57.942 64.141 1.00 24.94 ? 397 ASP A CB  1 
ATOM   3051 C CG  . ASP A 1 397 ? 20.612  58.942 64.321 1.00 26.12 ? 397 ASP A CG  1 
ATOM   3052 O OD1 . ASP A 1 397 ? 20.484  60.113 63.903 1.00 25.81 ? 397 ASP A OD1 1 
ATOM   3053 O OD2 . ASP A 1 397 ? 21.625  58.538 64.916 1.00 27.50 ? 397 ASP A OD2 1 
ATOM   3054 N N   . HIS A 1 398 ? 16.667  56.782 63.988 1.00 27.64 ? 398 HIS A N   1 
ATOM   3055 C CA  . HIS A 1 398 ? 15.894  55.597 63.683 1.00 26.41 ? 398 HIS A CA  1 
ATOM   3056 C C   . HIS A 1 398 ? 14.577  55.814 62.954 1.00 26.73 ? 398 HIS A C   1 
ATOM   3057 O O   . HIS A 1 398 ? 14.155  54.919 62.214 1.00 27.31 ? 398 HIS A O   1 
ATOM   3058 C CB  . HIS A 1 398 ? 15.550  54.897 64.999 1.00 21.88 ? 398 HIS A CB  1 
ATOM   3059 C CG  . HIS A 1 398 ? 14.446  53.901 64.900 1.00 17.75 ? 398 HIS A CG  1 
ATOM   3060 N ND1 . HIS A 1 398 ? 14.607  52.693 64.258 1.00 19.63 ? 398 HIS A ND1 1 
ATOM   3061 C CD2 . HIS A 1 398 ? 13.181  53.921 65.368 1.00 18.25 ? 398 HIS A CD2 1 
ATOM   3062 C CE1 . HIS A 1 398 ? 13.467  52.000 64.334 1.00 18.26 ? 398 HIS A CE1 1 
ATOM   3063 N NE2 . HIS A 1 398 ? 12.589  52.725 65.002 1.00 18.82 ? 398 HIS A NE2 1 
ATOM   3064 N N   . ASN A 1 399 ? 13.914  56.919 63.210 1.00 25.66 ? 399 ASN A N   1 
ATOM   3065 C CA  . ASN A 1 399 ? 12.640  57.209 62.644 1.00 25.01 ? 399 ASN A CA  1 
ATOM   3066 C C   . ASN A 1 399 ? 12.638  58.074 61.376 1.00 25.95 ? 399 ASN A C   1 
ATOM   3067 O O   . ASN A 1 399 ? 11.604  58.095 60.719 1.00 23.70 ? 399 ASN A O   1 
ATOM   3068 C CB  . ASN A 1 399 ? 11.786  57.974 63.688 1.00 22.54 ? 399 ASN A CB  1 
ATOM   3069 C CG  . ASN A 1 399 ? 11.285  56.995 64.739 1.00 27.06 ? 399 ASN A CG  1 
ATOM   3070 O OD1 . ASN A 1 399 ? 10.450  56.143 64.432 1.00 26.78 ? 399 ASN A OD1 1 
ATOM   3071 N ND2 . ASN A 1 399 ? 11.863  57.069 65.942 1.00 25.36 ? 399 ASN A ND2 1 
ATOM   3072 N N   . VAL A 1 400 ? 13.672  58.869 61.187 1.00 25.83 ? 400 VAL A N   1 
ATOM   3073 C CA  . VAL A 1 400 ? 13.674  59.811 60.088 1.00 26.45 ? 400 VAL A CA  1 
ATOM   3074 C C   . VAL A 1 400 ? 14.951  59.726 59.262 1.00 27.93 ? 400 VAL A C   1 
ATOM   3075 O O   . VAL A 1 400 ? 14.963  59.234 58.130 1.00 27.97 ? 400 VAL A O   1 
ATOM   3076 C CB  . VAL A 1 400 ? 13.491  61.231 60.641 1.00 22.15 ? 400 VAL A CB  1 
ATOM   3077 C CG1 . VAL A 1 400 ? 13.690  62.252 59.532 1.00 19.56 ? 400 VAL A CG1 1 
ATOM   3078 C CG2 . VAL A 1 400 ? 12.123  61.411 61.324 1.00 17.64 ? 400 VAL A CG2 1 
ATOM   3079 N N   . ILE A 1 401 ? 16.069  60.122 59.836 1.00 28.82 ? 401 ILE A N   1 
ATOM   3080 C CA  . ILE A 1 401 ? 17.329  60.151 59.117 1.00 29.54 ? 401 ILE A CA  1 
ATOM   3081 C C   . ILE A 1 401 ? 17.782  58.835 58.514 1.00 31.10 ? 401 ILE A C   1 
ATOM   3082 O O   . ILE A 1 401 ? 18.129  58.890 57.325 1.00 31.85 ? 401 ILE A O   1 
ATOM   3083 C CB  . ILE A 1 401 ? 18.438  60.717 60.022 1.00 25.65 ? 401 ILE A CB  1 
ATOM   3084 C CG1 . ILE A 1 401 ? 17.973  62.075 60.555 1.00 27.09 ? 401 ILE A CG1 1 
ATOM   3085 C CG2 . ILE A 1 401 ? 19.740  60.842 59.251 1.00 24.56 ? 401 ILE A CG2 1 
ATOM   3086 C CD1 . ILE A 1 401 ? 19.103  62.876 61.185 1.00 28.07 ? 401 ILE A CD1 1 
ATOM   3087 N N   . CYS A 1 402 ? 17.821  57.712 59.197 1.00 31.71 ? 402 CYS A N   1 
ATOM   3088 C CA  . CYS A 1 402 ? 18.381  56.521 58.565 1.00 31.85 ? 402 CYS A CA  1 
ATOM   3089 C C   . CYS A 1 402 ? 17.442  55.871 57.580 1.00 32.12 ? 402 CYS A C   1 
ATOM   3090 O O   . CYS A 1 402 ? 17.918  55.325 56.594 1.00 31.83 ? 402 CYS A O   1 
ATOM   3091 C CB  . CYS A 1 402 ? 18.875  55.537 59.656 1.00 30.52 ? 402 CYS A CB  1 
ATOM   3092 S SG  . CYS A 1 402 ? 20.263  56.303 60.492 1.00 32.31 ? 402 CYS A SG  1 
ATOM   3093 N N   . PRO A 1 403 ? 16.161  55.853 57.842 1.00 32.99 ? 403 PRO A N   1 
ATOM   3094 C CA  . PRO A 1 403 ? 15.201  55.321 56.887 1.00 33.23 ? 403 PRO A CA  1 
ATOM   3095 C C   . PRO A 1 403 ? 15.311  56.197 55.638 1.00 33.85 ? 403 PRO A C   1 
ATOM   3096 O O   . PRO A 1 403 ? 15.404  55.654 54.536 1.00 35.46 ? 403 PRO A O   1 
ATOM   3097 C CB  . PRO A 1 403 ? 13.869  55.394 57.560 1.00 32.70 ? 403 PRO A CB  1 
ATOM   3098 C CG  . PRO A 1 403 ? 14.211  55.598 59.010 1.00 32.81 ? 403 PRO A CG  1 
ATOM   3099 C CD  . PRO A 1 403 ? 15.470  56.428 59.013 1.00 32.51 ? 403 PRO A CD  1 
ATOM   3100 N N   . LEU A 1 404 ? 15.424  57.511 55.792 1.00 32.80 ? 404 LEU A N   1 
ATOM   3101 C CA  . LEU A 1 404 ? 15.543  58.408 54.664 1.00 32.98 ? 404 LEU A CA  1 
ATOM   3102 C C   . LEU A 1 404 ? 16.839  58.145 53.883 1.00 33.97 ? 404 LEU A C   1 
ATOM   3103 O O   . LEU A 1 404 ? 16.813  58.196 52.645 1.00 33.71 ? 404 LEU A O   1 
ATOM   3104 C CB  . LEU A 1 404 ? 15.536  59.892 55.026 1.00 27.71 ? 404 LEU A CB  1 
ATOM   3105 C CG  . LEU A 1 404 ? 15.600  60.892 53.868 1.00 25.08 ? 404 LEU A CG  1 
ATOM   3106 C CD1 . LEU A 1 404 ? 14.526  61.961 53.978 1.00 23.01 ? 404 LEU A CD1 1 
ATOM   3107 C CD2 . LEU A 1 404 ? 16.952  61.583 53.776 1.00 24.03 ? 404 LEU A CD2 1 
ATOM   3108 N N   . MET A 1 405 ? 17.913  57.891 54.616 1.00 33.46 ? 405 MET A N   1 
ATOM   3109 C CA  . MET A 1 405 ? 19.199  57.642 53.984 1.00 33.12 ? 405 MET A CA  1 
ATOM   3110 C C   . MET A 1 405 ? 19.166  56.325 53.221 1.00 32.85 ? 405 MET A C   1 
ATOM   3111 O O   . MET A 1 405 ? 19.789  56.167 52.177 1.00 32.72 ? 405 MET A O   1 
ATOM   3112 C CB  . MET A 1 405 ? 20.338  57.639 55.007 1.00 34.53 ? 405 MET A CB  1 
ATOM   3113 C CG  . MET A 1 405 ? 20.566  59.046 55.542 1.00 35.09 ? 405 MET A CG  1 
ATOM   3114 S SD  . MET A 1 405 ? 20.953  60.177 54.185 1.00 37.24 ? 405 MET A SD  1 
ATOM   3115 C CE  . MET A 1 405 ? 22.428  59.365 53.558 1.00 32.19 ? 405 MET A CE  1 
ATOM   3116 N N   . HIS A 1 406 ? 18.422  55.364 53.750 1.00 31.98 ? 406 HIS A N   1 
ATOM   3117 C CA  . HIS A 1 406 ? 18.303  54.095 53.056 1.00 31.24 ? 406 HIS A CA  1 
ATOM   3118 C C   . HIS A 1 406 ? 17.518  54.312 51.744 1.00 32.27 ? 406 HIS A C   1 
ATOM   3119 O O   . HIS A 1 406 ? 17.870  53.725 50.737 1.00 32.09 ? 406 HIS A O   1 
ATOM   3120 C CB  . HIS A 1 406 ? 17.604  53.083 53.910 1.00 23.01 ? 406 HIS A CB  1 
ATOM   3121 C CG  . HIS A 1 406 ? 17.237  51.762 53.319 1.00 19.70 ? 406 HIS A CG  1 
ATOM   3122 N ND1 . HIS A 1 406 ? 18.189  50.826 52.982 1.00 17.92 ? 406 HIS A ND1 1 
ATOM   3123 C CD2 . HIS A 1 406 ? 16.029  51.195 53.068 1.00 17.53 ? 406 HIS A CD2 1 
ATOM   3124 C CE1 . HIS A 1 406 ? 17.595  49.731 52.530 1.00 17.88 ? 406 HIS A CE1 1 
ATOM   3125 N NE2 . HIS A 1 406 ? 16.287  49.923 52.581 1.00 20.79 ? 406 HIS A NE2 1 
ATOM   3126 N N   . PHE A 1 407 ? 16.481  55.121 51.808 1.00 32.23 ? 407 PHE A N   1 
ATOM   3127 C CA  . PHE A 1 407 ? 15.623  55.446 50.707 1.00 34.11 ? 407 PHE A CA  1 
ATOM   3128 C C   . PHE A 1 407 ? 16.422  56.125 49.582 1.00 34.92 ? 407 PHE A C   1 
ATOM   3129 O O   . PHE A 1 407 ? 16.345  55.631 48.471 1.00 34.30 ? 407 PHE A O   1 
ATOM   3130 C CB  . PHE A 1 407 ? 14.487  56.393 51.090 1.00 32.38 ? 407 PHE A CB  1 
ATOM   3131 C CG  . PHE A 1 407 ? 13.591  56.771 49.950 1.00 30.37 ? 407 PHE A CG  1 
ATOM   3132 C CD1 . PHE A 1 407 ? 12.666  55.876 49.454 1.00 31.56 ? 407 PHE A CD1 1 
ATOM   3133 C CD2 . PHE A 1 407 ? 13.651  58.032 49.385 1.00 32.26 ? 407 PHE A CD2 1 
ATOM   3134 C CE1 . PHE A 1 407 ? 11.819  56.233 48.413 1.00 29.10 ? 407 PHE A CE1 1 
ATOM   3135 C CE2 . PHE A 1 407 ? 12.827  58.385 48.329 1.00 31.27 ? 407 PHE A CE2 1 
ATOM   3136 C CZ  . PHE A 1 407 ? 11.895  57.484 47.859 1.00 28.15 ? 407 PHE A CZ  1 
ATOM   3137 N N   . VAL A 1 408 ? 17.175  57.153 49.933 1.00 35.43 ? 408 VAL A N   1 
ATOM   3138 C CA  . VAL A 1 408 ? 17.939  57.881 48.941 1.00 37.10 ? 408 VAL A CA  1 
ATOM   3139 C C   . VAL A 1 408 ? 18.991  56.958 48.325 1.00 37.58 ? 408 VAL A C   1 
ATOM   3140 O O   . VAL A 1 408 ? 19.211  57.099 47.125 1.00 37.99 ? 408 VAL A O   1 
ATOM   3141 C CB  . VAL A 1 408 ? 18.650  59.146 49.451 1.00 37.01 ? 408 VAL A CB  1 
ATOM   3142 C CG1 . VAL A 1 408 ? 17.817  59.836 50.512 1.00 39.85 ? 408 VAL A CG1 1 
ATOM   3143 C CG2 . VAL A 1 408 ? 20.020  58.830 50.012 1.00 39.33 ? 408 VAL A CG2 1 
ATOM   3144 N N   . ASN A 1 409 ? 19.596  56.083 49.109 1.00 37.65 ? 409 ASN A N   1 
ATOM   3145 C CA  . ASN A 1 409 ? 20.600  55.207 48.516 1.00 38.49 ? 409 ASN A CA  1 
ATOM   3146 C C   . ASN A 1 409 ? 19.914  54.200 47.593 1.00 37.90 ? 409 ASN A C   1 
ATOM   3147 O O   . ASN A 1 409 ? 20.491  53.814 46.576 1.00 38.41 ? 409 ASN A O   1 
ATOM   3148 C CB  . ASN A 1 409 ? 21.442  54.515 49.585 1.00 43.13 ? 409 ASN A CB  1 
ATOM   3149 C CG  . ASN A 1 409 ? 22.480  55.465 50.158 1.00 49.73 ? 409 ASN A CG  1 
ATOM   3150 O OD1 . ASN A 1 409 ? 23.345  55.977 49.438 1.00 53.72 ? 409 ASN A OD1 1 
ATOM   3151 N ND2 . ASN A 1 409 ? 22.426  55.755 51.456 1.00 50.89 ? 409 ASN A ND2 1 
ATOM   3152 N N   . LYS A 1 410 ? 18.712  53.742 47.900 1.00 36.78 ? 410 LYS A N   1 
ATOM   3153 C CA  . LYS A 1 410 ? 18.070  52.790 47.009 1.00 36.98 ? 410 LYS A CA  1 
ATOM   3154 C C   . LYS A 1 410 ? 17.537  53.534 45.772 1.00 36.65 ? 410 LYS A C   1 
ATOM   3155 O O   . LYS A 1 410 ? 17.705  53.044 44.661 1.00 36.63 ? 410 LYS A O   1 
ATOM   3156 C CB  . LYS A 1 410 ? 16.959  52.009 47.699 1.00 37.62 ? 410 LYS A CB  1 
ATOM   3157 C CG  . LYS A 1 410 ? 17.536  51.063 48.742 1.00 41.55 ? 410 LYS A CG  1 
ATOM   3158 C CD  . LYS A 1 410 ? 17.689  49.656 48.186 1.00 43.48 ? 410 LYS A CD  1 
ATOM   3159 C CE  . LYS A 1 410 ? 18.892  48.962 48.811 1.00 44.37 ? 410 LYS A CE  1 
ATOM   3160 N NZ  . LYS A 1 410 ? 19.232  47.717 48.066 1.00 45.65 ? 410 LYS A NZ  1 
ATOM   3161 N N   . TYR A 1 411 ? 16.952  54.691 45.980 1.00 35.19 ? 411 TYR A N   1 
ATOM   3162 C CA  . TYR A 1 411 ? 16.380  55.501 44.952 1.00 35.73 ? 411 TYR A CA  1 
ATOM   3163 C C   . TYR A 1 411 ? 17.423  55.947 43.913 1.00 36.55 ? 411 TYR A C   1 
ATOM   3164 O O   . TYR A 1 411 ? 17.243  55.754 42.717 1.00 35.67 ? 411 TYR A O   1 
ATOM   3165 C CB  . TYR A 1 411 ? 15.672  56.741 45.536 1.00 33.97 ? 411 TYR A CB  1 
ATOM   3166 C CG  . TYR A 1 411 ? 14.818  57.372 44.445 1.00 32.08 ? 411 TYR A CG  1 
ATOM   3167 C CD1 . TYR A 1 411 ? 13.542  56.904 44.194 1.00 31.90 ? 411 TYR A CD1 1 
ATOM   3168 C CD2 . TYR A 1 411 ? 15.319  58.370 43.635 1.00 31.92 ? 411 TYR A CD2 1 
ATOM   3169 C CE1 . TYR A 1 411 ? 12.773  57.448 43.189 1.00 32.28 ? 411 TYR A CE1 1 
ATOM   3170 C CE2 . TYR A 1 411 ? 14.559  58.942 42.626 1.00 31.07 ? 411 TYR A CE2 1 
ATOM   3171 C CZ  . TYR A 1 411 ? 13.299  58.451 42.397 1.00 32.43 ? 411 TYR A CZ  1 
ATOM   3172 O OH  . TYR A 1 411 ? 12.517  58.979 41.394 1.00 34.26 ? 411 TYR A OH  1 
ATOM   3173 N N   . THR A 1 412 ? 18.522  56.495 44.372 1.00 36.34 ? 412 THR A N   1 
ATOM   3174 C CA  . THR A 1 412 ? 19.578  57.044 43.549 1.00 36.58 ? 412 THR A CA  1 
ATOM   3175 C C   . THR A 1 412 ? 20.219  56.027 42.630 1.00 37.20 ? 412 THR A C   1 
ATOM   3176 O O   . THR A 1 412 ? 20.880  56.415 41.668 1.00 37.47 ? 412 THR A O   1 
ATOM   3177 C CB  . THR A 1 412 ? 20.586  57.714 44.507 1.00 34.21 ? 412 THR A CB  1 
ATOM   3178 O OG1 . THR A 1 412 ? 19.901  58.906 44.944 1.00 37.02 ? 412 THR A OG1 1 
ATOM   3179 C CG2 . THR A 1 412 ? 21.895  58.095 43.876 1.00 30.95 ? 412 THR A CG2 1 
ATOM   3180 N N   . LYS A 1 413 ? 20.022  54.749 42.861 1.00 37.71 ? 413 LYS A N   1 
ATOM   3181 C CA  . LYS A 1 413 ? 20.559  53.726 41.963 1.00 38.44 ? 413 LYS A CA  1 
ATOM   3182 C C   . LYS A 1 413 ? 19.796  53.791 40.640 1.00 39.01 ? 413 LYS A C   1 
ATOM   3183 O O   . LYS A 1 413 ? 20.379  53.631 39.565 1.00 39.73 ? 413 LYS A O   1 
ATOM   3184 C CB  . LYS A 1 413 ? 20.452  52.374 42.641 1.00 39.23 ? 413 LYS A CB  1 
ATOM   3185 C CG  . LYS A 1 413 ? 21.020  51.167 41.943 1.00 40.53 ? 413 LYS A CG  1 
ATOM   3186 N N   . PHE A 1 414 ? 18.490  54.041 40.675 1.00 38.17 ? 414 PHE A N   1 
ATOM   3187 C CA  . PHE A 1 414 ? 17.640  54.120 39.518 1.00 37.58 ? 414 PHE A CA  1 
ATOM   3188 C C   . PHE A 1 414 ? 17.072  55.465 39.123 1.00 37.08 ? 414 PHE A C   1 
ATOM   3189 O O   . PHE A 1 414 ? 16.486  55.568 38.030 1.00 39.24 ? 414 PHE A O   1 
ATOM   3190 C CB  . PHE A 1 414 ? 16.369  53.264 39.780 1.00 39.39 ? 414 PHE A CB  1 
ATOM   3191 C CG  . PHE A 1 414 ? 16.739  51.820 39.944 1.00 43.73 ? 414 PHE A CG  1 
ATOM   3192 C CD1 . PHE A 1 414 ? 17.088  51.068 38.834 1.00 44.84 ? 414 PHE A CD1 1 
ATOM   3193 C CD2 . PHE A 1 414 ? 16.758  51.230 41.195 1.00 43.68 ? 414 PHE A CD2 1 
ATOM   3194 C CE1 . PHE A 1 414 ? 17.453  49.738 38.976 1.00 46.42 ? 414 PHE A CE1 1 
ATOM   3195 C CE2 . PHE A 1 414 ? 17.112  49.903 41.331 1.00 45.25 ? 414 PHE A CE2 1 
ATOM   3196 C CZ  . PHE A 1 414 ? 17.462  49.155 40.230 1.00 45.95 ? 414 PHE A CZ  1 
ATOM   3197 N N   . GLY A 1 415 ? 17.133  56.479 39.952 1.00 35.87 ? 415 GLY A N   1 
ATOM   3198 C CA  . GLY A 1 415 ? 16.527  57.764 39.695 1.00 33.99 ? 415 GLY A CA  1 
ATOM   3199 C C   . GLY A 1 415 ? 17.312  58.690 38.788 1.00 32.49 ? 415 GLY A C   1 
ATOM   3200 O O   . GLY A 1 415 ? 18.411  58.410 38.359 1.00 31.93 ? 415 GLY A O   1 
ATOM   3201 N N   . ASN A 1 416 ? 16.731  59.845 38.527 1.00 32.34 ? 416 ASN A N   1 
ATOM   3202 C CA  . ASN A 1 416 ? 17.336  60.820 37.652 1.00 33.67 ? 416 ASN A CA  1 
ATOM   3203 C C   . ASN A 1 416 ? 17.921  62.016 38.343 1.00 33.96 ? 416 ASN A C   1 
ATOM   3204 O O   . ASN A 1 416 ? 18.051  63.068 37.720 1.00 34.15 ? 416 ASN A O   1 
ATOM   3205 C CB  . ASN A 1 416 ? 16.230  61.293 36.665 1.00 36.25 ? 416 ASN A CB  1 
ATOM   3206 C CG  . ASN A 1 416 ? 16.895  61.870 35.421 1.00 37.06 ? 416 ASN A CG  1 
ATOM   3207 O OD1 . ASN A 1 416 ? 16.600  62.997 35.042 1.00 37.84 ? 416 ASN A OD1 1 
ATOM   3208 N ND2 . ASN A 1 416 ? 17.804  61.108 34.838 1.00 36.65 ? 416 ASN A ND2 1 
ATOM   3209 N N   . GLY A 1 417 ? 18.279  61.876 39.623 1.00 34.68 ? 417 GLY A N   1 
ATOM   3210 C CA  . GLY A 1 417 ? 18.818  63.062 40.296 1.00 33.53 ? 417 GLY A CA  1 
ATOM   3211 C C   . GLY A 1 417 ? 18.225  63.159 41.709 1.00 33.31 ? 417 GLY A C   1 
ATOM   3212 O O   . GLY A 1 417 ? 17.032  63.278 41.922 1.00 31.62 ? 417 GLY A O   1 
ATOM   3213 N N   . THR A 1 418 ? 19.168  63.091 42.636 1.00 33.26 ? 418 THR A N   1 
ATOM   3214 C CA  . THR A 1 418 ? 18.927  63.157 44.051 1.00 33.29 ? 418 THR A CA  1 
ATOM   3215 C C   . THR A 1 418 ? 19.658  64.363 44.620 1.00 33.45 ? 418 THR A C   1 
ATOM   3216 O O   . THR A 1 418 ? 20.854  64.530 44.355 1.00 32.96 ? 418 THR A O   1 
ATOM   3217 C CB  . THR A 1 418 ? 19.403  61.882 44.764 1.00 33.26 ? 418 THR A CB  1 
ATOM   3218 O OG1 . THR A 1 418 ? 18.642  60.762 44.305 1.00 29.04 ? 418 THR A OG1 1 
ATOM   3219 C CG2 . THR A 1 418 ? 19.227  62.024 46.276 1.00 33.34 ? 418 THR A CG2 1 
ATOM   3220 N N   . TYR A 1 419 ? 18.927  65.189 45.350 1.00 33.15 ? 419 TYR A N   1 
ATOM   3221 C CA  . TYR A 1 419 ? 19.576  66.345 45.995 1.00 33.83 ? 419 TYR A CA  1 
ATOM   3222 C C   . TYR A 1 419 ? 19.262  66.217 47.492 1.00 33.61 ? 419 TYR A C   1 
ATOM   3223 O O   . TYR A 1 419 ? 18.088  66.124 47.857 1.00 33.02 ? 419 TYR A O   1 
ATOM   3224 C CB  . TYR A 1 419 ? 19.133  67.652 45.378 1.00 34.72 ? 419 TYR A CB  1 
ATOM   3225 C CG  . TYR A 1 419 ? 19.615  67.836 43.952 1.00 38.46 ? 419 TYR A CG  1 
ATOM   3226 C CD1 . TYR A 1 419 ? 18.853  67.379 42.874 1.00 39.35 ? 419 TYR A CD1 1 
ATOM   3227 C CD2 . TYR A 1 419 ? 20.825  68.464 43.682 1.00 39.50 ? 419 TYR A CD2 1 
ATOM   3228 C CE1 . TYR A 1 419 ? 19.292  67.528 41.576 1.00 39.25 ? 419 TYR A CE1 1 
ATOM   3229 C CE2 . TYR A 1 419 ? 21.268  68.614 42.383 1.00 40.62 ? 419 TYR A CE2 1 
ATOM   3230 C CZ  . TYR A 1 419 ? 20.486  68.165 41.335 1.00 40.80 ? 419 TYR A CZ  1 
ATOM   3231 O OH  . TYR A 1 419 ? 20.936  68.325 40.046 1.00 42.37 ? 419 TYR A OH  1 
ATOM   3232 N N   . LEU A 1 420 ? 20.289  66.156 48.327 1.00 33.60 ? 420 LEU A N   1 
ATOM   3233 C CA  . LEU A 1 420 ? 20.130  65.963 49.767 1.00 31.06 ? 420 LEU A CA  1 
ATOM   3234 C C   . LEU A 1 420 ? 20.561  67.119 50.647 1.00 30.34 ? 420 LEU A C   1 
ATOM   3235 O O   . LEU A 1 420 ? 21.694  67.586 50.601 1.00 30.18 ? 420 LEU A O   1 
ATOM   3236 C CB  . LEU A 1 420 ? 20.958  64.749 50.182 1.00 30.21 ? 420 LEU A CB  1 
ATOM   3237 C CG  . LEU A 1 420 ? 20.800  64.194 51.603 1.00 30.16 ? 420 LEU A CG  1 
ATOM   3238 C CD1 . LEU A 1 420 ? 19.361  63.809 51.916 1.00 27.89 ? 420 LEU A CD1 1 
ATOM   3239 C CD2 . LEU A 1 420 ? 21.717  62.996 51.772 1.00 27.09 ? 420 LEU A CD2 1 
ATOM   3240 N N   . TYR A 1 421 ? 19.629  67.582 51.473 1.00 29.24 ? 421 TYR A N   1 
ATOM   3241 C CA  . TYR A 1 421 ? 19.945  68.657 52.400 1.00 29.96 ? 421 TYR A CA  1 
ATOM   3242 C C   . TYR A 1 421 ? 19.871  68.179 53.872 1.00 29.85 ? 421 TYR A C   1 
ATOM   3243 O O   . TYR A 1 421 ? 19.238  67.203 54.277 1.00 28.33 ? 421 TYR A O   1 
ATOM   3244 C CB  . TYR A 1 421 ? 19.031  69.865 52.220 1.00 28.50 ? 421 TYR A CB  1 
ATOM   3245 C CG  . TYR A 1 421 ? 17.640  69.635 52.752 1.00 29.69 ? 421 TYR A CG  1 
ATOM   3246 C CD1 . TYR A 1 421 ? 17.292  69.781 54.100 1.00 28.87 ? 421 TYR A CD1 1 
ATOM   3247 C CD2 . TYR A 1 421 ? 16.644  69.272 51.856 1.00 29.22 ? 421 TYR A CD2 1 
ATOM   3248 C CE1 . TYR A 1 421 ? 15.989  69.575 54.522 1.00 28.04 ? 421 TYR A CE1 1 
ATOM   3249 C CE2 . TYR A 1 421 ? 15.352  69.073 52.278 1.00 28.26 ? 421 TYR A CE2 1 
ATOM   3250 C CZ  . TYR A 1 421 ? 15.025  69.187 53.616 1.00 27.49 ? 421 TYR A CZ  1 
ATOM   3251 O OH  . TYR A 1 421 ? 13.711  68.951 53.955 1.00 25.17 ? 421 TYR A OH  1 
ATOM   3252 N N   . PHE A 1 422 ? 20.551  68.973 54.685 1.00 29.78 ? 422 PHE A N   1 
ATOM   3253 C CA  . PHE A 1 422 ? 20.600  68.823 56.133 1.00 29.68 ? 422 PHE A CA  1 
ATOM   3254 C C   . PHE A 1 422 ? 20.311  70.217 56.703 1.00 29.31 ? 422 PHE A C   1 
ATOM   3255 O O   . PHE A 1 422 ? 21.172  71.077 56.624 1.00 29.52 ? 422 PHE A O   1 
ATOM   3256 C CB  . PHE A 1 422 ? 21.904  68.301 56.674 1.00 30.49 ? 422 PHE A CB  1 
ATOM   3257 C CG  . PHE A 1 422 ? 21.945  68.028 58.153 1.00 34.14 ? 422 PHE A CG  1 
ATOM   3258 C CD1 . PHE A 1 422 ? 21.311  66.925 58.694 1.00 35.55 ? 422 PHE A CD1 1 
ATOM   3259 C CD2 . PHE A 1 422 ? 22.683  68.856 59.001 1.00 34.27 ? 422 PHE A CD2 1 
ATOM   3260 C CE1 . PHE A 1 422 ? 21.410  66.626 60.046 1.00 35.74 ? 422 PHE A CE1 1 
ATOM   3261 C CE2 . PHE A 1 422 ? 22.786  68.564 60.348 1.00 35.54 ? 422 PHE A CE2 1 
ATOM   3262 C CZ  . PHE A 1 422 ? 22.146  67.456 60.875 1.00 35.40 ? 422 PHE A CZ  1 
ATOM   3263 N N   . PHE A 1 423 ? 19.106  70.371 57.204 1.00 28.82 ? 423 PHE A N   1 
ATOM   3264 C CA  . PHE A 1 423 ? 18.689  71.651 57.765 1.00 30.11 ? 423 PHE A CA  1 
ATOM   3265 C C   . PHE A 1 423 ? 19.054  71.675 59.258 1.00 31.91 ? 423 PHE A C   1 
ATOM   3266 O O   . PHE A 1 423 ? 18.649  70.850 60.080 1.00 30.12 ? 423 PHE A O   1 
ATOM   3267 C CB  . PHE A 1 423 ? 17.203  71.838 57.480 1.00 25.83 ? 423 PHE A CB  1 
ATOM   3268 C CG  . PHE A 1 423 ? 16.651  73.135 57.988 1.00 30.59 ? 423 PHE A CG  1 
ATOM   3269 C CD1 . PHE A 1 423 ? 16.746  74.296 57.240 1.00 28.22 ? 423 PHE A CD1 1 
ATOM   3270 C CD2 . PHE A 1 423 ? 16.049  73.179 59.254 1.00 27.23 ? 423 PHE A CD2 1 
ATOM   3271 C CE1 . PHE A 1 423 ? 16.214  75.486 57.705 1.00 28.19 ? 423 PHE A CE1 1 
ATOM   3272 C CE2 . PHE A 1 423 ? 15.530  74.373 59.712 1.00 24.62 ? 423 PHE A CE2 1 
ATOM   3273 C CZ  . PHE A 1 423 ? 15.624  75.523 58.960 1.00 28.49 ? 423 PHE A CZ  1 
ATOM   3274 N N   . ASN A 1 424 ? 19.976  72.579 59.580 1.00 33.01 ? 424 ASN A N   1 
ATOM   3275 C CA  . ASN A 1 424 ? 20.482  72.632 60.945 1.00 34.73 ? 424 ASN A CA  1 
ATOM   3276 C C   . ASN A 1 424 ? 20.460  74.073 61.416 1.00 35.00 ? 424 ASN A C   1 
ATOM   3277 O O   . ASN A 1 424 ? 21.388  74.510 62.068 1.00 37.29 ? 424 ASN A O   1 
ATOM   3278 C CB  . ASN A 1 424 ? 21.872  72.018 61.052 1.00 34.24 ? 424 ASN A CB  1 
ATOM   3279 C CG  . ASN A 1 424 ? 22.852  72.718 60.135 1.00 37.57 ? 424 ASN A CG  1 
ATOM   3280 O OD1 . ASN A 1 424 ? 22.424  73.525 59.309 1.00 39.53 ? 424 ASN A OD1 1 
ATOM   3281 N ND2 . ASN A 1 424 ? 24.132  72.417 60.286 1.00 37.92 ? 424 ASN A ND2 1 
ATOM   3282 N N   . HIS A 1 425 ? 19.395  74.791 61.106 1.00 35.45 ? 425 HIS A N   1 
ATOM   3283 C CA  . HIS A 1 425 ? 19.294  76.155 61.560 1.00 35.44 ? 425 HIS A CA  1 
ATOM   3284 C C   . HIS A 1 425 ? 18.135  76.288 62.551 1.00 36.80 ? 425 HIS A C   1 
ATOM   3285 O O   . HIS A 1 425 ? 17.008  75.961 62.195 1.00 36.14 ? 425 HIS A O   1 
ATOM   3286 C CB  . HIS A 1 425 ? 19.037  77.173 60.448 1.00 31.54 ? 425 HIS A CB  1 
ATOM   3287 C CG  . HIS A 1 425 ? 18.780  78.526 61.056 1.00 25.82 ? 425 HIS A CG  1 
ATOM   3288 N ND1 . HIS A 1 425 ? 19.815  79.297 61.545 1.00 25.41 ? 425 HIS A ND1 1 
ATOM   3289 C CD2 . HIS A 1 425 ? 17.648  79.218 61.268 1.00 23.95 ? 425 HIS A CD2 1 
ATOM   3290 C CE1 . HIS A 1 425 ? 19.335  80.429 62.017 1.00 23.75 ? 425 HIS A CE1 1 
ATOM   3291 N NE2 . HIS A 1 425 ? 18.023  80.403 61.857 1.00 24.87 ? 425 HIS A NE2 1 
ATOM   3292 N N   . ARG A 1 426 ? 18.443  76.805 63.741 1.00 37.74 ? 426 ARG A N   1 
ATOM   3293 C CA  . ARG A 1 426 ? 17.387  76.988 64.730 1.00 39.33 ? 426 ARG A CA  1 
ATOM   3294 C C   . ARG A 1 426 ? 16.831  78.389 64.567 1.00 38.81 ? 426 ARG A C   1 
ATOM   3295 O O   . ARG A 1 426 ? 17.622  79.321 64.682 1.00 39.57 ? 426 ARG A O   1 
ATOM   3296 C CB  . ARG A 1 426 ? 17.890  76.756 66.170 1.00 44.10 ? 426 ARG A CB  1 
ATOM   3297 C CG  . ARG A 1 426 ? 16.857  77.231 67.179 1.00 46.54 ? 426 ARG A CG  1 
ATOM   3298 C CD  . ARG A 1 426 ? 17.314  77.164 68.634 1.00 46.39 ? 426 ARG A CD  1 
ATOM   3299 N NE  . ARG A 1 426 ? 16.517  76.141 69.257 1.00 47.10 ? 426 ARG A NE  1 
ATOM   3300 C CZ  . ARG A 1 426 ? 15.515  76.115 70.106 1.00 43.95 ? 426 ARG A CZ  1 
ATOM   3301 N NH1 . ARG A 1 426 ? 15.071  77.201 70.712 1.00 41.85 ? 426 ARG A NH1 1 
ATOM   3302 N NH2 . ARG A 1 426 ? 15.022  74.897 70.322 1.00 39.45 ? 426 ARG A NH2 1 
ATOM   3303 N N   . ALA A 1 427 ? 15.549  78.542 64.275 1.00 39.54 ? 427 ALA A N   1 
ATOM   3304 C CA  . ALA A 1 427 ? 14.993  79.874 64.114 1.00 39.84 ? 427 ALA A CA  1 
ATOM   3305 C C   . ALA A 1 427 ? 15.290  80.693 65.367 1.00 41.56 ? 427 ALA A C   1 
ATOM   3306 O O   . ALA A 1 427 ? 15.237  80.187 66.489 1.00 42.28 ? 427 ALA A O   1 
ATOM   3307 C CB  . ALA A 1 427 ? 13.496  79.844 63.903 1.00 38.65 ? 427 ALA A CB  1 
ATOM   3308 N N   . SER A 1 428 ? 15.526  81.978 65.173 1.00 42.04 ? 428 SER A N   1 
ATOM   3309 C CA  . SER A 1 428 ? 15.821  82.900 66.245 1.00 41.72 ? 428 SER A CA  1 
ATOM   3310 C C   . SER A 1 428 ? 14.619  83.195 67.127 1.00 41.43 ? 428 SER A C   1 
ATOM   3311 O O   . SER A 1 428 ? 14.821  83.514 68.292 1.00 42.28 ? 428 SER A O   1 
ATOM   3312 C CB  . SER A 1 428 ? 16.318  84.224 65.642 1.00 41.55 ? 428 SER A CB  1 
ATOM   3313 O OG  . SER A 1 428 ? 15.198  84.863 65.036 1.00 42.22 ? 428 SER A OG  1 
ATOM   3314 N N   . ASN A 1 429 ? 13.411  83.123 66.602 1.00 40.57 ? 429 ASN A N   1 
ATOM   3315 C CA  . ASN A 1 429 ? 12.189  83.414 67.320 1.00 38.84 ? 429 ASN A CA  1 
ATOM   3316 C C   . ASN A 1 429 ? 11.449  82.162 67.747 1.00 38.36 ? 429 ASN A C   1 
ATOM   3317 O O   . ASN A 1 429 ? 10.228  82.184 67.869 1.00 38.07 ? 429 ASN A O   1 
ATOM   3318 C CB  . ASN A 1 429 ? 11.249  84.249 66.426 1.00 38.94 ? 429 ASN A CB  1 
ATOM   3319 C CG  . ASN A 1 429 ? 11.122  83.625 65.036 1.00 38.78 ? 429 ASN A CG  1 
ATOM   3320 O OD1 . ASN A 1 429 ? 11.452  82.456 64.826 1.00 34.11 ? 429 ASN A OD1 1 
ATOM   3321 N ND2 . ASN A 1 429 ? 10.628  84.388 64.066 1.00 38.48 ? 429 ASN A ND2 1 
ATOM   3322 N N   . LEU A 1 430 ? 12.171  81.069 67.924 1.00 38.49 ? 430 LEU A N   1 
ATOM   3323 C CA  . LEU A 1 430 ? 11.569  79.804 68.335 1.00 38.58 ? 430 LEU A CA  1 
ATOM   3324 C C   . LEU A 1 430 ? 11.171  79.859 69.807 1.00 39.44 ? 430 LEU A C   1 
ATOM   3325 O O   . LEU A 1 430 ? 11.945  80.295 70.665 1.00 39.07 ? 430 LEU A O   1 
ATOM   3326 C CB  . LEU A 1 430 ? 12.587  78.720 68.049 1.00 40.64 ? 430 LEU A CB  1 
ATOM   3327 C CG  . LEU A 1 430 ? 12.118  77.318 67.667 1.00 43.73 ? 430 LEU A CG  1 
ATOM   3328 C CD1 . LEU A 1 430 ? 11.296  77.313 66.392 1.00 43.60 ? 430 LEU A CD1 1 
ATOM   3329 C CD2 . LEU A 1 430 ? 13.339  76.423 67.512 1.00 44.09 ? 430 LEU A CD2 1 
ATOM   3330 N N   . VAL A 1 431 ? 9.967   79.433 70.145 1.00 39.35 ? 431 VAL A N   1 
ATOM   3331 C CA  . VAL A 1 431 ? 9.444   79.442 71.489 1.00 39.57 ? 431 VAL A CA  1 
ATOM   3332 C C   . VAL A 1 431 ? 9.662   78.135 72.237 1.00 39.49 ? 431 VAL A C   1 
ATOM   3333 O O   . VAL A 1 431 ? 9.312   78.033 73.405 1.00 40.00 ? 431 VAL A O   1 
ATOM   3334 C CB  . VAL A 1 431 ? 7.922   79.707 71.488 1.00 40.36 ? 431 VAL A CB  1 
ATOM   3335 C CG1 . VAL A 1 431 ? 7.643   81.098 70.958 1.00 40.13 ? 431 VAL A CG1 1 
ATOM   3336 C CG2 . VAL A 1 431 ? 7.230   78.619 70.678 1.00 40.82 ? 431 VAL A CG2 1 
ATOM   3337 N N   . TRP A 1 432 ? 10.170  77.131 71.549 1.00 39.00 ? 432 TRP A N   1 
ATOM   3338 C CA  . TRP A 1 432 ? 10.431  75.829 72.128 1.00 37.01 ? 432 TRP A CA  1 
ATOM   3339 C C   . TRP A 1 432 ? 11.762  75.928 72.849 1.00 35.79 ? 432 TRP A C   1 
ATOM   3340 O O   . TRP A 1 432 ? 12.616  76.711 72.436 1.00 36.67 ? 432 TRP A O   1 
ATOM   3341 C CB  . TRP A 1 432 ? 10.459  74.750 71.051 1.00 35.94 ? 432 TRP A CB  1 
ATOM   3342 C CG  . TRP A 1 432 ? 9.124   74.339 70.523 1.00 35.65 ? 432 TRP A CG  1 
ATOM   3343 C CD1 . TRP A 1 432 ? 8.584   74.674 69.308 1.00 34.70 ? 432 TRP A CD1 1 
ATOM   3344 C CD2 . TRP A 1 432 ? 8.154   73.514 71.173 1.00 36.07 ? 432 TRP A CD2 1 
ATOM   3345 N NE1 . TRP A 1 432 ? 7.335   74.122 69.181 1.00 34.26 ? 432 TRP A NE1 1 
ATOM   3346 C CE2 . TRP A 1 432 ? 7.054   73.385 70.297 1.00 36.06 ? 432 TRP A CE2 1 
ATOM   3347 C CE3 . TRP A 1 432 ? 8.108   72.856 72.405 1.00 37.20 ? 432 TRP A CE3 1 
ATOM   3348 C CZ2 . TRP A 1 432 ? 5.927   72.629 70.617 1.00 37.72 ? 432 TRP A CZ2 1 
ATOM   3349 C CZ3 . TRP A 1 432 ? 6.977   72.128 72.732 1.00 37.62 ? 432 TRP A CZ3 1 
ATOM   3350 C CH2 . TRP A 1 432 ? 5.902   72.012 71.840 1.00 39.16 ? 432 TRP A CH2 1 
ATOM   3351 N N   . PRO A 1 433 ? 11.945  75.174 73.915 1.00 34.96 ? 433 PRO A N   1 
ATOM   3352 C CA  . PRO A 1 433 ? 13.191  75.207 74.646 1.00 34.40 ? 433 PRO A CA  1 
ATOM   3353 C C   . PRO A 1 433 ? 14.381  74.959 73.741 1.00 35.14 ? 433 PRO A C   1 
ATOM   3354 O O   . PRO A 1 433 ? 14.342  74.151 72.812 1.00 35.44 ? 433 PRO A O   1 
ATOM   3355 C CB  . PRO A 1 433 ? 13.036  74.107 75.682 1.00 33.23 ? 433 PRO A CB  1 
ATOM   3356 C CG  . PRO A 1 433 ? 11.922  73.259 75.174 1.00 33.36 ? 433 PRO A CG  1 
ATOM   3357 C CD  . PRO A 1 433 ? 10.980  74.190 74.460 1.00 33.39 ? 433 PRO A CD  1 
ATOM   3358 N N   . GLU A 1 434 ? 15.510  75.565 74.033 1.00 35.48 ? 434 GLU A N   1 
ATOM   3359 C CA  . GLU A 1 434 ? 16.767  75.422 73.349 1.00 35.35 ? 434 GLU A CA  1 
ATOM   3360 C C   . GLU A 1 434 ? 17.255  73.990 73.226 1.00 34.86 ? 434 GLU A C   1 
ATOM   3361 O O   . GLU A 1 434 ? 17.971  73.656 72.281 1.00 35.67 ? 434 GLU A O   1 
ATOM   3362 C CB  . GLU A 1 434 ? 17.841  76.192 74.136 1.00 37.86 ? 434 GLU A CB  1 
ATOM   3363 C CG  . GLU A 1 434 ? 18.988  76.712 73.281 1.00 43.67 ? 434 GLU A CG  1 
ATOM   3364 N N   . TRP A 1 435 ? 16.946  73.123 74.181 1.00 33.73 ? 435 TRP A N   1 
ATOM   3365 C CA  . TRP A 1 435 ? 17.469  71.767 74.123 1.00 32.79 ? 435 TRP A CA  1 
ATOM   3366 C C   . TRP A 1 435 ? 16.864  70.963 72.970 1.00 31.72 ? 435 TRP A C   1 
ATOM   3367 O O   . TRP A 1 435 ? 17.394  69.947 72.532 1.00 30.92 ? 435 TRP A O   1 
ATOM   3368 C CB  . TRP A 1 435 ? 17.242  71.037 75.454 1.00 27.56 ? 435 TRP A CB  1 
ATOM   3369 C CG  . TRP A 1 435 ? 15.828  70.723 75.805 1.00 28.42 ? 435 TRP A CG  1 
ATOM   3370 C CD1 . TRP A 1 435 ? 15.037  71.471 76.635 1.00 29.72 ? 435 TRP A CD1 1 
ATOM   3371 C CD2 . TRP A 1 435 ? 15.018  69.616 75.386 1.00 28.75 ? 435 TRP A CD2 1 
ATOM   3372 N NE1 . TRP A 1 435 ? 13.782  70.905 76.738 1.00 31.10 ? 435 TRP A NE1 1 
ATOM   3373 C CE2 . TRP A 1 435 ? 13.756  69.757 75.984 1.00 29.76 ? 435 TRP A CE2 1 
ATOM   3374 C CE3 . TRP A 1 435 ? 15.235  68.529 74.536 1.00 29.14 ? 435 TRP A CE3 1 
ATOM   3375 C CZ2 . TRP A 1 435 ? 12.710  68.869 75.776 1.00 29.92 ? 435 TRP A CZ2 1 
ATOM   3376 C CZ3 . TRP A 1 435 ? 14.211  67.625 74.330 1.00 29.37 ? 435 TRP A CZ3 1 
ATOM   3377 C CH2 . TRP A 1 435 ? 12.960  67.818 74.938 1.00 32.93 ? 435 TRP A CH2 1 
ATOM   3378 N N   . MET A 1 436 ? 15.710  71.394 72.494 1.00 31.67 ? 436 MET A N   1 
ATOM   3379 C CA  . MET A 1 436 ? 15.044  70.678 71.406 1.00 31.37 ? 436 MET A CA  1 
ATOM   3380 C C   . MET A 1 436 ? 15.787  70.855 70.081 1.00 30.65 ? 436 MET A C   1 
ATOM   3381 O O   . MET A 1 436 ? 15.602  69.967 69.244 1.00 31.89 ? 436 MET A O   1 
ATOM   3382 C CB  . MET A 1 436 ? 13.593  71.133 71.313 1.00 28.79 ? 436 MET A CB  1 
ATOM   3383 C CG  . MET A 1 436 ? 12.807  70.484 72.460 1.00 26.04 ? 436 MET A CG  1 
ATOM   3384 S SD  . MET A 1 436 ? 11.161  71.193 72.487 1.00 30.01 ? 436 MET A SD  1 
ATOM   3385 C CE  . MET A 1 436 ? 10.293  69.880 71.585 1.00 28.90 ? 436 MET A CE  1 
ATOM   3386 N N   . GLY A 1 437 ? 16.629  71.850 69.963 1.00 28.66 ? 437 GLY A N   1 
ATOM   3387 C CA  . GLY A 1 437 ? 17.476  72.043 68.806 1.00 29.43 ? 437 GLY A CA  1 
ATOM   3388 C C   . GLY A 1 437 ? 16.746  72.513 67.543 1.00 28.41 ? 437 GLY A C   1 
ATOM   3389 O O   . GLY A 1 437 ? 15.923  73.431 67.559 1.00 27.44 ? 437 GLY A O   1 
ATOM   3390 N N   . VAL A 1 438 ? 17.081  71.849 66.442 1.00 28.09 ? 438 VAL A N   1 
ATOM   3391 C CA  . VAL A 1 438 ? 16.476  72.171 65.129 1.00 27.05 ? 438 VAL A CA  1 
ATOM   3392 C C   . VAL A 1 438 ? 15.418  71.100 64.956 1.00 26.03 ? 438 VAL A C   1 
ATOM   3393 O O   . VAL A 1 438 ? 15.688  69.983 64.536 1.00 25.80 ? 438 VAL A O   1 
ATOM   3394 C CB  . VAL A 1 438 ? 17.515  72.195 64.020 1.00 30.84 ? 438 VAL A CB  1 
ATOM   3395 C CG1 . VAL A 1 438 ? 16.904  72.624 62.692 1.00 29.90 ? 438 VAL A CG1 1 
ATOM   3396 C CG2 . VAL A 1 438 ? 18.648  73.127 64.436 1.00 28.42 ? 438 VAL A CG2 1 
ATOM   3397 N N   . ILE A 1 439 ? 14.252  71.453 65.445 1.00 25.28 ? 439 ILE A N   1 
ATOM   3398 C CA  . ILE A 1 439 ? 13.096  70.632 65.603 1.00 25.70 ? 439 ILE A CA  1 
ATOM   3399 C C   . ILE A 1 439 ? 12.366  70.238 64.317 1.00 27.12 ? 439 ILE A C   1 
ATOM   3400 O O   . ILE A 1 439 ? 12.110  71.005 63.400 1.00 28.18 ? 439 ILE A O   1 
ATOM   3401 C CB  . ILE A 1 439 ? 12.059  71.381 66.482 1.00 22.28 ? 439 ILE A CB  1 
ATOM   3402 C CG1 . ILE A 1 439 ? 12.676  71.754 67.848 1.00 25.89 ? 439 ILE A CG1 1 
ATOM   3403 C CG2 . ILE A 1 439 ? 10.784  70.578 66.663 1.00 17.69 ? 439 ILE A CG2 1 
ATOM   3404 C CD1 . ILE A 1 439 ? 11.834  72.773 68.595 1.00 20.73 ? 439 ILE A CD1 1 
ATOM   3405 N N   . HIS A 1 440 ? 11.907  69.004 64.394 1.00 25.73 ? 440 HIS A N   1 
ATOM   3406 C CA  . HIS A 1 440 ? 11.100  68.387 63.398 1.00 26.94 ? 440 HIS A CA  1 
ATOM   3407 C C   . HIS A 1 440 ? 9.982   69.356 63.010 1.00 28.31 ? 440 HIS A C   1 
ATOM   3408 O O   . HIS A 1 440 ? 9.277   69.775 63.918 1.00 28.63 ? 440 HIS A O   1 
ATOM   3409 C CB  . HIS A 1 440 ? 10.482  67.131 63.924 1.00 23.51 ? 440 HIS A CB  1 
ATOM   3410 C CG  . HIS A 1 440 ? 9.691   66.253 63.026 1.00 23.10 ? 440 HIS A CG  1 
ATOM   3411 N ND1 . HIS A 1 440 ? 10.255  65.494 62.018 1.00 20.31 ? 440 HIS A ND1 1 
ATOM   3412 C CD2 . HIS A 1 440 ? 8.366   65.954 63.079 1.00 19.81 ? 440 HIS A CD2 1 
ATOM   3413 C CE1 . HIS A 1 440 ? 9.293   64.727 61.503 1.00 19.40 ? 440 HIS A CE1 1 
ATOM   3414 N NE2 . HIS A 1 440 ? 8.144   65.013 62.114 1.00 20.41 ? 440 HIS A NE2 1 
ATOM   3415 N N   . GLY A 1 441 ? 9.892   69.643 61.699 1.00 26.26 ? 441 GLY A N   1 
ATOM   3416 C CA  . GLY A 1 441 ? 8.836   70.538 61.280 1.00 25.35 ? 441 GLY A CA  1 
ATOM   3417 C C   . GLY A 1 441 ? 9.235   71.979 61.208 1.00 25.32 ? 441 GLY A C   1 
ATOM   3418 O O   . GLY A 1 441 ? 8.445   72.798 60.747 1.00 26.19 ? 441 GLY A O   1 
ATOM   3419 N N   . TYR A 1 442 ? 10.442  72.306 61.641 1.00 26.07 ? 442 TYR A N   1 
ATOM   3420 C CA  . TYR A 1 442 ? 10.807  73.725 61.668 1.00 27.56 ? 442 TYR A CA  1 
ATOM   3421 C C   . TYR A 1 442 ? 11.585  74.215 60.466 1.00 28.91 ? 442 TYR A C   1 
ATOM   3422 O O   . TYR A 1 442 ? 11.921  75.409 60.413 1.00 27.96 ? 442 TYR A O   1 
ATOM   3423 C CB  . TYR A 1 442 ? 11.518  73.953 63.043 1.00 27.11 ? 442 TYR A CB  1 
ATOM   3424 C CG  . TYR A 1 442 ? 10.320  74.139 63.984 1.00 24.77 ? 442 TYR A CG  1 
ATOM   3425 C CD1 . TYR A 1 442 ? 9.667   73.026 64.486 1.00 24.79 ? 442 TYR A CD1 1 
ATOM   3426 C CD2 . TYR A 1 442 ? 9.801   75.391 64.217 1.00 24.67 ? 442 TYR A CD2 1 
ATOM   3427 C CE1 . TYR A 1 442 ? 8.541   73.192 65.275 1.00 25.80 ? 442 TYR A CE1 1 
ATOM   3428 C CE2 . TYR A 1 442 ? 8.669   75.567 64.995 1.00 23.95 ? 442 TYR A CE2 1 
ATOM   3429 C CZ  . TYR A 1 442 ? 8.065   74.456 65.539 1.00 24.23 ? 442 TYR A CZ  1 
ATOM   3430 O OH  . TYR A 1 442 ? 6.932   74.581 66.299 1.00 24.62 ? 442 TYR A OH  1 
ATOM   3431 N N   . GLU A 1 443 ? 11.756  73.342 59.470 1.00 28.71 ? 443 GLU A N   1 
ATOM   3432 C CA  . GLU A 1 443 ? 12.288  73.831 58.198 1.00 30.56 ? 443 GLU A CA  1 
ATOM   3433 C C   . GLU A 1 443 ? 11.112  74.451 57.441 1.00 30.96 ? 443 GLU A C   1 
ATOM   3434 O O   . GLU A 1 443 ? 11.238  75.389 56.673 1.00 31.53 ? 443 GLU A O   1 
ATOM   3435 C CB  . GLU A 1 443 ? 12.938  72.732 57.370 1.00 30.49 ? 443 GLU A CB  1 
ATOM   3436 C CG  . GLU A 1 443 ? 11.972  71.936 56.520 1.00 30.27 ? 443 GLU A CG  1 
ATOM   3437 C CD  . GLU A 1 443 ? 11.092  70.960 57.254 1.00 30.98 ? 443 GLU A CD  1 
ATOM   3438 O OE1 . GLU A 1 443 ? 11.140  70.890 58.495 1.00 27.80 ? 443 GLU A OE1 1 
ATOM   3439 O OE2 . GLU A 1 443 ? 10.344  70.204 56.586 1.00 31.57 ? 443 GLU A OE2 1 
ATOM   3440 N N   . ILE A 1 444 ? 9.909   73.927 57.692 1.00 31.49 ? 444 ILE A N   1 
ATOM   3441 C CA  . ILE A 1 444 ? 8.718   74.376 56.986 1.00 31.57 ? 444 ILE A CA  1 
ATOM   3442 C C   . ILE A 1 444 ? 8.529   75.877 56.921 1.00 33.07 ? 444 ILE A C   1 
ATOM   3443 O O   . ILE A 1 444 ? 8.301   76.374 55.802 1.00 33.69 ? 444 ILE A O   1 
ATOM   3444 C CB  . ILE A 1 444 ? 7.428   73.768 57.581 1.00 28.25 ? 444 ILE A CB  1 
ATOM   3445 C CG1 . ILE A 1 444 ? 7.512   72.249 57.525 1.00 25.54 ? 444 ILE A CG1 1 
ATOM   3446 C CG2 . ILE A 1 444 ? 6.217   74.289 56.823 1.00 30.83 ? 444 ILE A CG2 1 
ATOM   3447 C CD1 . ILE A 1 444 ? 6.247   71.503 57.802 1.00 25.87 ? 444 ILE A CD1 1 
ATOM   3448 N N   . GLU A 1 445 ? 8.581   76.611 58.028 1.00 32.80 ? 445 GLU A N   1 
ATOM   3449 C CA  . GLU A 1 445 ? 8.345   78.052 57.916 1.00 32.28 ? 445 GLU A CA  1 
ATOM   3450 C C   . GLU A 1 445 ? 9.341   78.697 56.953 1.00 31.57 ? 445 GLU A C   1 
ATOM   3451 O O   . GLU A 1 445 ? 9.033   79.728 56.361 1.00 31.33 ? 445 GLU A O   1 
ATOM   3452 C CB  . GLU A 1 445 ? 8.400   78.713 59.291 1.00 32.79 ? 445 GLU A CB  1 
ATOM   3453 C CG  . GLU A 1 445 ? 9.745   78.520 59.986 1.00 34.92 ? 445 GLU A CG  1 
ATOM   3454 C CD  . GLU A 1 445 ? 9.585   78.571 61.507 1.00 35.19 ? 445 GLU A CD  1 
ATOM   3455 O OE1 . GLU A 1 445 ? 8.706   77.846 62.015 1.00 35.87 ? 445 GLU A OE1 1 
ATOM   3456 O OE2 . GLU A 1 445 ? 10.317  79.360 62.134 1.00 30.94 ? 445 GLU A OE2 1 
ATOM   3457 N N   . PHE A 1 446 ? 10.518  78.128 56.799 1.00 31.19 ? 446 PHE A N   1 
ATOM   3458 C CA  . PHE A 1 446 ? 11.554  78.629 55.920 1.00 33.00 ? 446 PHE A CA  1 
ATOM   3459 C C   . PHE A 1 446 ? 11.239  78.335 54.445 1.00 33.04 ? 446 PHE A C   1 
ATOM   3460 O O   . PHE A 1 446 ? 11.447  79.182 53.583 1.00 33.77 ? 446 PHE A O   1 
ATOM   3461 C CB  . PHE A 1 446 ? 12.916  78.032 56.305 1.00 34.81 ? 446 PHE A CB  1 
ATOM   3462 C CG  . PHE A 1 446 ? 13.508  78.809 57.463 1.00 38.42 ? 446 PHE A CG  1 
ATOM   3463 C CD1 . PHE A 1 446 ? 13.148  78.495 58.770 1.00 38.36 ? 446 PHE A CD1 1 
ATOM   3464 C CD2 . PHE A 1 446 ? 14.295  79.924 57.229 1.00 38.44 ? 446 PHE A CD2 1 
ATOM   3465 C CE1 . PHE A 1 446 ? 13.641  79.238 59.825 1.00 39.37 ? 446 PHE A CE1 1 
ATOM   3466 C CE2 . PHE A 1 446 ? 14.774  80.671 58.289 1.00 41.00 ? 446 PHE A CE2 1 
ATOM   3467 C CZ  . PHE A 1 446 ? 14.460  80.323 59.591 1.00 40.28 ? 446 PHE A CZ  1 
ATOM   3468 N N   . VAL A 1 447 ? 10.705  77.154 54.186 1.00 32.05 ? 447 VAL A N   1 
ATOM   3469 C CA  . VAL A 1 447 ? 10.306  76.717 52.865 1.00 30.72 ? 447 VAL A CA  1 
ATOM   3470 C C   . VAL A 1 447 ? 9.138   77.576 52.403 1.00 31.07 ? 447 VAL A C   1 
ATOM   3471 O O   . VAL A 1 447 ? 9.092   77.974 51.242 1.00 30.12 ? 447 VAL A O   1 
ATOM   3472 C CB  . VAL A 1 447 ? 9.963   75.217 52.887 1.00 26.95 ? 447 VAL A CB  1 
ATOM   3473 C CG1 . VAL A 1 447 ? 9.022   74.845 51.755 1.00 26.13 ? 447 VAL A CG1 1 
ATOM   3474 C CG2 . VAL A 1 447 ? 11.229  74.367 52.838 1.00 24.36 ? 447 VAL A CG2 1 
ATOM   3475 N N   . PHE A 1 448 ? 8.199   77.893 53.298 1.00 30.67 ? 448 PHE A N   1 
ATOM   3476 C CA  . PHE A 1 448 ? 7.053   78.714 52.936 1.00 29.24 ? 448 PHE A CA  1 
ATOM   3477 C C   . PHE A 1 448 ? 7.274   80.212 53.064 1.00 30.13 ? 448 PHE A C   1 
ATOM   3478 O O   . PHE A 1 448 ? 6.307   80.960 52.906 1.00 29.46 ? 448 PHE A O   1 
ATOM   3479 C CB  . PHE A 1 448 ? 5.826   78.309 53.767 1.00 27.65 ? 448 PHE A CB  1 
ATOM   3480 C CG  . PHE A 1 448 ? 5.236   77.042 53.202 1.00 29.55 ? 448 PHE A CG  1 
ATOM   3481 C CD1 . PHE A 1 448 ? 5.801   75.817 53.476 1.00 29.51 ? 448 PHE A CD1 1 
ATOM   3482 C CD2 . PHE A 1 448 ? 4.146   77.098 52.350 1.00 31.44 ? 448 PHE A CD2 1 
ATOM   3483 C CE1 . PHE A 1 448 ? 5.264   74.658 52.947 1.00 30.05 ? 448 PHE A CE1 1 
ATOM   3484 C CE2 . PHE A 1 448 ? 3.608   75.942 51.815 1.00 32.64 ? 448 PHE A CE2 1 
ATOM   3485 C CZ  . PHE A 1 448 ? 4.164   74.720 52.127 1.00 31.16 ? 448 PHE A CZ  1 
ATOM   3486 N N   . GLY A 1 449 ? 8.495   80.673 53.292 1.00 31.37 ? 449 GLY A N   1 
ATOM   3487 C CA  . GLY A 1 449 ? 8.800   82.079 53.362 1.00 33.53 ? 449 GLY A CA  1 
ATOM   3488 C C   . GLY A 1 449 ? 8.240   82.937 54.470 1.00 35.53 ? 449 GLY A C   1 
ATOM   3489 O O   . GLY A 1 449 ? 8.137   84.167 54.286 1.00 35.84 ? 449 GLY A O   1 
ATOM   3490 N N   . LEU A 1 450 ? 8.010   82.368 55.660 1.00 36.24 ? 450 LEU A N   1 
ATOM   3491 C CA  . LEU A 1 450 ? 7.508   83.180 56.787 1.00 37.33 ? 450 LEU A CA  1 
ATOM   3492 C C   . LEU A 1 450 ? 8.524   84.235 57.190 1.00 37.30 ? 450 LEU A C   1 
ATOM   3493 O O   . LEU A 1 450 ? 8.172   85.390 57.455 1.00 37.67 ? 450 LEU A O   1 
ATOM   3494 C CB  . LEU A 1 450 ? 7.083   82.281 57.951 1.00 37.99 ? 450 LEU A CB  1 
ATOM   3495 C CG  . LEU A 1 450 ? 5.668   81.711 57.808 1.00 39.14 ? 450 LEU A CG  1 
ATOM   3496 C CD1 . LEU A 1 450 ? 5.243   81.032 59.099 1.00 42.31 ? 450 LEU A CD1 1 
ATOM   3497 C CD2 . LEU A 1 450 ? 4.649   82.778 57.452 1.00 40.74 ? 450 LEU A CD2 1 
ATOM   3498 N N   . PRO A 1 451 ? 9.806   83.939 57.184 1.00 37.83 ? 451 PRO A N   1 
ATOM   3499 C CA  . PRO A 1 451 ? 10.833  84.909 57.505 1.00 38.91 ? 451 PRO A CA  1 
ATOM   3500 C C   . PRO A 1 451 ? 10.827  86.158 56.650 1.00 40.54 ? 451 PRO A C   1 
ATOM   3501 O O   . PRO A 1 451 ? 11.675  87.030 56.894 1.00 41.43 ? 451 PRO A O   1 
ATOM   3502 C CB  . PRO A 1 451 ? 12.144  84.143 57.316 1.00 37.80 ? 451 PRO A CB  1 
ATOM   3503 C CG  . PRO A 1 451 ? 11.732  82.731 57.577 1.00 37.66 ? 451 PRO A CG  1 
ATOM   3504 C CD  . PRO A 1 451 ? 10.391  82.609 56.881 1.00 37.86 ? 451 PRO A CD  1 
ATOM   3505 N N   . LEU A 1 452 ? 9.961   86.303 55.652 1.00 42.29 ? 452 LEU A N   1 
ATOM   3506 C CA  . LEU A 1 452 ? 9.926   87.491 54.816 1.00 43.66 ? 452 LEU A CA  1 
ATOM   3507 C C   . LEU A 1 452 ? 8.960   88.506 55.427 1.00 44.85 ? 452 LEU A C   1 
ATOM   3508 O O   . LEU A 1 452 ? 9.054   89.685 55.098 1.00 45.15 ? 452 LEU A O   1 
ATOM   3509 C CB  . LEU A 1 452 ? 9.460   87.272 53.385 1.00 45.03 ? 452 LEU A CB  1 
ATOM   3510 C CG  . LEU A 1 452 ? 10.136  86.276 52.467 1.00 47.39 ? 452 LEU A CG  1 
ATOM   3511 C CD1 . LEU A 1 452 ? 10.010  86.737 51.015 1.00 49.40 ? 452 LEU A CD1 1 
ATOM   3512 C CD2 . LEU A 1 452 ? 11.598  86.067 52.826 1.00 47.59 ? 452 LEU A CD2 1 
ATOM   3513 N N   . VAL A 1 453 ? 8.044   88.009 56.251 1.00 46.27 ? 453 VAL A N   1 
ATOM   3514 C CA  . VAL A 1 453 ? 7.094   88.934 56.890 1.00 48.20 ? 453 VAL A CA  1 
ATOM   3515 C C   . VAL A 1 453 ? 7.725   89.408 58.197 1.00 49.38 ? 453 VAL A C   1 
ATOM   3516 O O   . VAL A 1 453 ? 7.819   88.712 59.201 1.00 49.61 ? 453 VAL A O   1 
ATOM   3517 C CB  . VAL A 1 453 ? 5.704   88.308 57.041 1.00 49.33 ? 453 VAL A CB  1 
ATOM   3518 C CG1 . VAL A 1 453 ? 5.774   86.831 56.637 1.00 50.89 ? 453 VAL A CG1 1 
ATOM   3519 C CG2 . VAL A 1 453 ? 5.109   88.444 58.433 1.00 48.46 ? 453 VAL A CG2 1 
ATOM   3520 N N   . LYS A 1 454 ? 8.251   90.625 58.129 1.00 50.52 ? 454 LYS A N   1 
ATOM   3521 C CA  . LYS A 1 454 ? 8.934   91.355 59.174 1.00 52.13 ? 454 LYS A CA  1 
ATOM   3522 C C   . LYS A 1 454 ? 8.282   91.252 60.545 1.00 52.14 ? 454 LYS A C   1 
ATOM   3523 O O   . LYS A 1 454 ? 8.974   91.050 61.537 1.00 52.83 ? 454 LYS A O   1 
ATOM   3524 C CB  . LYS A 1 454 ? 9.005   92.852 58.805 1.00 55.21 ? 454 LYS A CB  1 
ATOM   3525 C CG  . LYS A 1 454 ? 10.152  93.168 57.853 1.00 57.77 ? 454 LYS A CG  1 
ATOM   3526 N N   . GLU A 1 455 ? 6.969   91.368 60.619 1.00 52.37 ? 455 GLU A N   1 
ATOM   3527 C CA  . GLU A 1 455 ? 6.230   91.288 61.863 1.00 53.28 ? 455 GLU A CA  1 
ATOM   3528 C C   . GLU A 1 455 ? 6.353   89.933 62.547 1.00 52.89 ? 455 GLU A C   1 
ATOM   3529 O O   . GLU A 1 455 ? 5.768   89.749 63.615 1.00 52.76 ? 455 GLU A O   1 
ATOM   3530 C CB  . GLU A 1 455 ? 4.751   91.597 61.593 1.00 58.33 ? 455 GLU A CB  1 
ATOM   3531 C CG  . GLU A 1 455 ? 4.522   92.772 60.646 1.00 63.53 ? 455 GLU A CG  1 
ATOM   3532 C CD  . GLU A 1 455 ? 4.341   92.354 59.196 1.00 65.99 ? 455 GLU A CD  1 
ATOM   3533 O OE1 . GLU A 1 455 ? 3.288   91.753 58.881 1.00 66.83 ? 455 GLU A OE1 1 
ATOM   3534 O OE2 . GLU A 1 455 ? 5.244   92.609 58.366 1.00 67.15 ? 455 GLU A OE2 1 
ATOM   3535 N N   . LEU A 1 456 ? 7.070   88.979 61.967 1.00 52.43 ? 456 LEU A N   1 
ATOM   3536 C CA  . LEU A 1 456 ? 7.230   87.659 62.569 1.00 51.25 ? 456 LEU A CA  1 
ATOM   3537 C C   . LEU A 1 456 ? 8.589   87.603 63.272 1.00 50.77 ? 456 LEU A C   1 
ATOM   3538 O O   . LEU A 1 456 ? 8.911   86.674 64.011 1.00 50.80 ? 456 LEU A O   1 
ATOM   3539 C CB  . LEU A 1 456 ? 7.069   86.547 61.548 1.00 51.19 ? 456 LEU A CB  1 
ATOM   3540 C CG  . LEU A 1 456 ? 5.646   86.392 60.992 1.00 51.42 ? 456 LEU A CG  1 
ATOM   3541 C CD1 . LEU A 1 456 ? 5.571   85.142 60.124 1.00 49.65 ? 456 LEU A CD1 1 
ATOM   3542 C CD2 . LEU A 1 456 ? 4.630   86.370 62.118 1.00 48.95 ? 456 LEU A CD2 1 
ATOM   3543 N N   . ASN A 1 457 ? 9.346   88.666 63.047 1.00 49.35 ? 457 ASN A N   1 
ATOM   3544 C CA  . ASN A 1 457 ? 10.594  88.920 63.727 1.00 49.35 ? 457 ASN A CA  1 
ATOM   3545 C C   . ASN A 1 457 ? 11.722  87.928 63.519 1.00 47.90 ? 457 ASN A C   1 
ATOM   3546 O O   . ASN A 1 457 ? 12.376  87.555 64.500 1.00 48.21 ? 457 ASN A O   1 
ATOM   3547 C CB  . ASN A 1 457 ? 10.297  89.001 65.253 1.00 54.10 ? 457 ASN A CB  1 
ATOM   3548 C CG  . ASN A 1 457 ? 9.387   90.179 65.571 1.00 58.05 ? 457 ASN A CG  1 
ATOM   3549 O OD1 . ASN A 1 457 ? 9.525   91.250 64.967 1.00 60.09 ? 457 ASN A OD1 1 
ATOM   3550 N ND2 . ASN A 1 457 ? 8.448   90.001 66.497 1.00 58.91 ? 457 ASN A ND2 1 
ATOM   3551 N N   . TYR A 1 458 ? 11.955  87.522 62.281 1.00 45.65 ? 458 TYR A N   1 
ATOM   3552 C CA  . TYR A 1 458 ? 13.041  86.585 61.992 1.00 43.80 ? 458 TYR A CA  1 
ATOM   3553 C C   . TYR A 1 458 ? 14.261  87.470 61.785 1.00 43.72 ? 458 TYR A C   1 
ATOM   3554 O O   . TYR A 1 458 ? 14.048  88.688 61.656 1.00 43.89 ? 458 TYR A O   1 
ATOM   3555 C CB  . TYR A 1 458 ? 12.730  85.721 60.784 1.00 41.48 ? 458 TYR A CB  1 
ATOM   3556 C CG  . TYR A 1 458 ? 11.705  84.630 60.951 1.00 36.21 ? 458 TYR A CG  1 
ATOM   3557 C CD1 . TYR A 1 458 ? 10.347  84.805 60.747 1.00 35.00 ? 458 TYR A CD1 1 
ATOM   3558 C CD2 . TYR A 1 458 ? 12.132  83.368 61.327 1.00 34.75 ? 458 TYR A CD2 1 
ATOM   3559 C CE1 . TYR A 1 458 ? 9.441   83.765 60.921 1.00 33.35 ? 458 TYR A CE1 1 
ATOM   3560 C CE2 . TYR A 1 458 ? 11.247  82.321 61.508 1.00 33.40 ? 458 TYR A CE2 1 
ATOM   3561 C CZ  . TYR A 1 458 ? 9.906   82.528 61.302 1.00 33.19 ? 458 TYR A CZ  1 
ATOM   3562 O OH  . TYR A 1 458 ? 9.063   81.454 61.502 1.00 34.27 ? 458 TYR A OH  1 
ATOM   3563 N N   . THR A 1 459 ? 15.478  86.960 61.747 1.00 44.49 ? 459 THR A N   1 
ATOM   3564 C CA  . THR A 1 459 ? 16.612  87.848 61.503 1.00 45.31 ? 459 THR A CA  1 
ATOM   3565 C C   . THR A 1 459 ? 16.741  88.098 60.004 1.00 46.54 ? 459 THR A C   1 
ATOM   3566 O O   . THR A 1 459 ? 16.087  87.449 59.186 1.00 46.64 ? 459 THR A O   1 
ATOM   3567 C CB  . THR A 1 459 ? 17.936  87.291 62.025 1.00 45.76 ? 459 THR A CB  1 
ATOM   3568 O OG1 . THR A 1 459 ? 18.209  86.054 61.361 1.00 45.84 ? 459 THR A OG1 1 
ATOM   3569 C CG2 . THR A 1 459 ? 17.860  87.045 63.526 1.00 45.29 ? 459 THR A CG2 1 
ATOM   3570 N N   . ALA A 1 460 ? 17.640  88.998 59.627 1.00 47.33 ? 460 ALA A N   1 
ATOM   3571 C CA  . ALA A 1 460 ? 17.866  89.338 58.224 1.00 46.97 ? 460 ALA A CA  1 
ATOM   3572 C C   . ALA A 1 460 ? 18.442  88.126 57.501 1.00 46.81 ? 460 ALA A C   1 
ATOM   3573 O O   . ALA A 1 460 ? 18.088  87.767 56.378 1.00 47.21 ? 460 ALA A O   1 
ATOM   3574 C CB  . ALA A 1 460 ? 18.792  90.532 58.109 1.00 46.22 ? 460 ALA A CB  1 
ATOM   3575 N N   . GLU A 1 461 ? 19.361  87.476 58.190 1.00 46.43 ? 461 GLU A N   1 
ATOM   3576 C CA  . GLU A 1 461 ? 20.039  86.290 57.715 1.00 46.74 ? 461 GLU A CA  1 
ATOM   3577 C C   . GLU A 1 461 ? 19.038  85.155 57.514 1.00 45.90 ? 461 GLU A C   1 
ATOM   3578 O O   . GLU A 1 461 ? 19.263  84.268 56.701 1.00 45.95 ? 461 GLU A O   1 
ATOM   3579 C CB  . GLU A 1 461 ? 21.117  85.884 58.716 1.00 51.91 ? 461 GLU A CB  1 
ATOM   3580 C CG  . GLU A 1 461 ? 22.167  86.953 58.942 1.00 58.36 ? 461 GLU A CG  1 
ATOM   3581 C CD  . GLU A 1 461 ? 21.827  88.004 59.970 1.00 62.37 ? 461 GLU A CD  1 
ATOM   3582 O OE1 . GLU A 1 461 ? 20.658  88.312 60.282 1.00 63.82 ? 461 GLU A OE1 1 
ATOM   3583 O OE2 . GLU A 1 461 ? 22.794  88.590 60.513 1.00 67.23 ? 461 GLU A OE2 1 
ATOM   3584 N N   . GLU A 1 462 ? 17.954  85.183 58.279 1.00 44.80 ? 462 GLU A N   1 
ATOM   3585 C CA  . GLU A 1 462 ? 16.924  84.161 58.199 1.00 43.89 ? 462 GLU A CA  1 
ATOM   3586 C C   . GLU A 1 462 ? 15.991  84.436 57.026 1.00 43.64 ? 462 GLU A C   1 
ATOM   3587 O O   . GLU A 1 462 ? 15.395  83.535 56.458 1.00 42.76 ? 462 GLU A O   1 
ATOM   3588 C CB  . GLU A 1 462 ? 16.165  84.095 59.528 1.00 40.37 ? 462 GLU A CB  1 
ATOM   3589 C CG  . GLU A 1 462 ? 17.034  83.451 60.602 1.00 40.44 ? 462 GLU A CG  1 
ATOM   3590 C CD  . GLU A 1 462 ? 16.331  83.347 61.943 1.00 38.68 ? 462 GLU A CD  1 
ATOM   3591 O OE1 . GLU A 1 462 ? 15.626  84.290 62.342 1.00 37.73 ? 462 GLU A OE1 1 
ATOM   3592 O OE2 . GLU A 1 462 ? 16.485  82.290 62.579 1.00 39.12 ? 462 GLU A OE2 1 
ATOM   3593 N N   . GLU A 1 463 ? 15.876  85.710 56.662 1.00 43.83 ? 463 GLU A N   1 
ATOM   3594 C CA  . GLU A 1 463 ? 15.093  86.095 55.503 1.00 44.18 ? 463 GLU A CA  1 
ATOM   3595 C C   . GLU A 1 463 ? 15.825  85.540 54.277 1.00 43.56 ? 463 GLU A C   1 
ATOM   3596 O O   . GLU A 1 463 ? 15.259  84.881 53.409 1.00 44.19 ? 463 GLU A O   1 
ATOM   3597 C CB  . GLU A 1 463 ? 14.908  87.595 55.382 1.00 48.93 ? 463 GLU A CB  1 
ATOM   3598 C CG  . GLU A 1 463 ? 13.842  88.006 54.374 1.00 52.97 ? 463 GLU A CG  1 
ATOM   3599 C CD  . GLU A 1 463 ? 14.084  89.373 53.773 1.00 56.11 ? 463 GLU A CD  1 
ATOM   3600 O OE1 . GLU A 1 463 ? 13.744  90.379 54.428 1.00 58.02 ? 463 GLU A OE1 1 
ATOM   3601 O OE2 . GLU A 1 463 ? 14.639  89.441 52.653 1.00 59.38 ? 463 GLU A OE2 1 
ATOM   3602 N N   . ALA A 1 464 ? 17.127  85.775 54.269 1.00 42.09 ? 464 ALA A N   1 
ATOM   3603 C CA  . ALA A 1 464 ? 17.984  85.331 53.195 1.00 41.50 ? 464 ALA A CA  1 
ATOM   3604 C C   . ALA A 1 464 ? 17.957  83.817 53.045 1.00 41.18 ? 464 ALA A C   1 
ATOM   3605 O O   . ALA A 1 464 ? 17.983  83.278 51.933 1.00 41.89 ? 464 ALA A O   1 
ATOM   3606 C CB  . ALA A 1 464 ? 19.417  85.782 53.457 1.00 42.16 ? 464 ALA A CB  1 
ATOM   3607 N N   . LEU A 1 465 ? 17.955  83.127 54.187 1.00 39.65 ? 465 LEU A N   1 
ATOM   3608 C CA  . LEU A 1 465 ? 17.976  81.665 54.128 1.00 37.53 ? 465 LEU A CA  1 
ATOM   3609 C C   . LEU A 1 465 ? 16.638  81.181 53.569 1.00 36.47 ? 465 LEU A C   1 
ATOM   3610 O O   . LEU A 1 465 ? 16.628  80.245 52.777 1.00 35.85 ? 465 LEU A O   1 
ATOM   3611 C CB  . LEU A 1 465 ? 18.302  81.085 55.491 1.00 37.60 ? 465 LEU A CB  1 
ATOM   3612 C CG  . LEU A 1 465 ? 18.078  79.578 55.656 1.00 37.39 ? 465 LEU A CG  1 
ATOM   3613 C CD1 . LEU A 1 465 ? 19.179  78.812 54.935 1.00 37.84 ? 465 LEU A CD1 1 
ATOM   3614 C CD2 . LEU A 1 465 ? 18.001  79.237 57.126 1.00 38.43 ? 465 LEU A CD2 1 
ATOM   3615 N N   . SER A 1 466 ? 15.546  81.814 53.964 1.00 35.47 ? 466 SER A N   1 
ATOM   3616 C CA  . SER A 1 466 ? 14.236  81.433 53.470 1.00 36.65 ? 466 SER A CA  1 
ATOM   3617 C C   . SER A 1 466 ? 14.165  81.602 51.943 1.00 36.99 ? 466 SER A C   1 
ATOM   3618 O O   . SER A 1 466 ? 13.772  80.691 51.225 1.00 37.25 ? 466 SER A O   1 
ATOM   3619 C CB  . SER A 1 466 ? 13.117  82.235 54.129 1.00 34.13 ? 466 SER A CB  1 
ATOM   3620 O OG  . SER A 1 466 ? 11.869  81.722 53.670 1.00 35.63 ? 466 SER A OG  1 
ATOM   3621 N N   . ARG A 1 467 ? 14.608  82.742 51.452 1.00 37.56 ? 467 ARG A N   1 
ATOM   3622 C CA  . ARG A 1 467 ? 14.632  83.106 50.046 1.00 37.67 ? 467 ARG A CA  1 
ATOM   3623 C C   . ARG A 1 467 ? 15.463  82.087 49.279 1.00 37.23 ? 467 ARG A C   1 
ATOM   3624 O O   . ARG A 1 467 ? 15.095  81.651 48.195 1.00 37.82 ? 467 ARG A O   1 
ATOM   3625 C CB  . ARG A 1 467 ? 15.192  84.515 49.826 1.00 37.74 ? 467 ARG A CB  1 
ATOM   3626 C CG  . ARG A 1 467 ? 14.146  85.590 50.084 1.00 37.79 ? 467 ARG A CG  1 
ATOM   3627 C CD  . ARG A 1 467 ? 14.732  86.988 49.923 1.00 39.64 ? 467 ARG A CD  1 
ATOM   3628 N NE  . ARG A 1 467 ? 13.757  88.010 50.307 1.00 40.55 ? 467 ARG A NE  1 
ATOM   3629 C CZ  . ARG A 1 467 ? 12.704  88.328 49.566 1.00 42.27 ? 467 ARG A CZ  1 
ATOM   3630 N NH1 . ARG A 1 467 ? 12.502  87.702 48.414 1.00 43.63 ? 467 ARG A NH1 1 
ATOM   3631 N NH2 . ARG A 1 467 ? 11.846  89.258 49.957 1.00 43.86 ? 467 ARG A NH2 1 
ATOM   3632 N N   . ARG A 1 468 ? 16.576  81.714 49.883 1.00 36.59 ? 468 ARG A N   1 
ATOM   3633 C CA  . ARG A 1 468 ? 17.461  80.731 49.265 1.00 36.38 ? 468 ARG A CA  1 
ATOM   3634 C C   . ARG A 1 468 ? 16.802  79.364 49.228 1.00 36.36 ? 468 ARG A C   1 
ATOM   3635 O O   . ARG A 1 468 ? 16.941  78.625 48.249 1.00 37.80 ? 468 ARG A O   1 
ATOM   3636 C CB  . ARG A 1 468 ? 18.741  80.743 50.057 1.00 39.14 ? 468 ARG A CB  1 
ATOM   3637 C CG  . ARG A 1 468 ? 19.835  79.776 49.690 1.00 44.17 ? 468 ARG A CG  1 
ATOM   3638 C CD  . ARG A 1 468 ? 21.081  80.152 50.519 1.00 49.89 ? 468 ARG A CD  1 
ATOM   3639 N NE  . ARG A 1 468 ? 21.753  78.922 50.914 1.00 56.33 ? 468 ARG A NE  1 
ATOM   3640 C CZ  . ARG A 1 468 ? 22.482  78.736 52.007 1.00 59.79 ? 468 ARG A CZ  1 
ATOM   3641 N NH1 . ARG A 1 468 ? 22.651  79.761 52.835 1.00 61.84 ? 468 ARG A NH1 1 
ATOM   3642 N NH2 . ARG A 1 468 ? 23.023  77.545 52.233 1.00 59.46 ? 468 ARG A NH2 1 
ATOM   3643 N N   . ILE A 1 469 ? 16.052  79.003 50.269 1.00 35.17 ? 469 ILE A N   1 
ATOM   3644 C CA  . ILE A 1 469 ? 15.434  77.680 50.312 1.00 33.69 ? 469 ILE A CA  1 
ATOM   3645 C C   . ILE A 1 469 ? 14.268  77.646 49.329 1.00 33.19 ? 469 ILE A C   1 
ATOM   3646 O O   . ILE A 1 469 ? 14.078  76.657 48.640 1.00 32.57 ? 469 ILE A O   1 
ATOM   3647 C CB  . ILE A 1 469 ? 15.001  77.291 51.746 1.00 30.49 ? 469 ILE A CB  1 
ATOM   3648 C CG1 . ILE A 1 469 ? 16.235  76.856 52.558 1.00 32.15 ? 469 ILE A CG1 1 
ATOM   3649 C CG2 . ILE A 1 469 ? 13.968  76.179 51.791 1.00 21.24 ? 469 ILE A CG2 1 
ATOM   3650 C CD1 . ILE A 1 469 ? 15.949  76.810 54.053 1.00 31.11 ? 469 ILE A CD1 1 
ATOM   3651 N N   . MET A 1 470 ? 13.497  78.716 49.294 1.00 33.11 ? 470 MET A N   1 
ATOM   3652 C CA  . MET A 1 470 ? 12.350  78.860 48.419 1.00 34.75 ? 470 MET A CA  1 
ATOM   3653 C C   . MET A 1 470 ? 12.781  78.785 46.940 1.00 35.58 ? 470 MET A C   1 
ATOM   3654 O O   . MET A 1 470 ? 12.188  78.087 46.125 1.00 34.46 ? 470 MET A O   1 
ATOM   3655 C CB  . MET A 1 470 ? 11.625  80.181 48.698 1.00 34.36 ? 470 MET A CB  1 
ATOM   3656 C CG  . MET A 1 470 ? 10.644  80.105 49.856 1.00 35.70 ? 470 MET A CG  1 
ATOM   3657 S SD  . MET A 1 470 ? 9.600   81.569 49.981 1.00 38.17 ? 470 MET A SD  1 
ATOM   3658 C CE  . MET A 1 470 ? 10.871  82.815 50.113 1.00 33.44 ? 470 MET A CE  1 
ATOM   3659 N N   . HIS A 1 471 ? 13.889  79.454 46.648 1.00 36.04 ? 471 HIS A N   1 
ATOM   3660 C CA  . HIS A 1 471 ? 14.462  79.497 45.316 1.00 38.12 ? 471 HIS A CA  1 
ATOM   3661 C C   . HIS A 1 471 ? 15.002  78.113 44.969 1.00 38.47 ? 471 HIS A C   1 
ATOM   3662 O O   . HIS A 1 471 ? 14.775  77.642 43.858 1.00 38.81 ? 471 HIS A O   1 
ATOM   3663 C CB  . HIS A 1 471 ? 15.552  80.568 45.179 1.00 41.24 ? 471 HIS A CB  1 
ATOM   3664 C CG  . HIS A 1 471 ? 15.804  80.825 43.717 1.00 44.71 ? 471 HIS A CG  1 
ATOM   3665 N ND1 . HIS A 1 471 ? 14.814  81.317 42.882 1.00 44.92 ? 471 HIS A ND1 1 
ATOM   3666 C CD2 . HIS A 1 471 ? 16.909  80.639 42.958 1.00 43.67 ? 471 HIS A CD2 1 
ATOM   3667 C CE1 . HIS A 1 471 ? 15.307  81.430 41.668 1.00 43.34 ? 471 HIS A CE1 1 
ATOM   3668 N NE2 . HIS A 1 471 ? 16.560  81.025 41.693 1.00 42.76 ? 471 HIS A NE2 1 
ATOM   3669 N N   . TYR A 1 472 ? 15.652  77.465 45.935 1.00 38.47 ? 472 TYR A N   1 
ATOM   3670 C CA  . TYR A 1 472 ? 16.139  76.116 45.717 1.00 37.49 ? 472 TYR A CA  1 
ATOM   3671 C C   . TYR A 1 472 ? 14.967  75.180 45.423 1.00 36.98 ? 472 TYR A C   1 
ATOM   3672 O O   . TYR A 1 472 ? 15.036  74.347 44.533 1.00 37.10 ? 472 TYR A O   1 
ATOM   3673 C CB  . TYR A 1 472 ? 16.844  75.556 46.938 1.00 38.69 ? 472 TYR A CB  1 
ATOM   3674 C CG  . TYR A 1 472 ? 18.307  75.871 47.087 1.00 40.41 ? 472 TYR A CG  1 
ATOM   3675 C CD1 . TYR A 1 472 ? 19.117  76.030 45.964 1.00 40.61 ? 472 TYR A CD1 1 
ATOM   3676 C CD2 . TYR A 1 472 ? 18.876  75.996 48.350 1.00 40.28 ? 472 TYR A CD2 1 
ATOM   3677 C CE1 . TYR A 1 472 ? 20.460  76.312 46.097 1.00 41.03 ? 472 TYR A CE1 1 
ATOM   3678 C CE2 . TYR A 1 472 ? 20.227  76.266 48.483 1.00 41.36 ? 472 TYR A CE2 1 
ATOM   3679 C CZ  . TYR A 1 472 ? 21.003  76.430 47.362 1.00 42.44 ? 472 TYR A CZ  1 
ATOM   3680 O OH  . TYR A 1 472 ? 22.347  76.701 47.486 1.00 45.74 ? 472 TYR A OH  1 
ATOM   3681 N N   . TRP A 1 473 ? 13.894  75.312 46.209 1.00 35.97 ? 473 TRP A N   1 
ATOM   3682 C CA  . TRP A 1 473 ? 12.762  74.414 46.054 1.00 34.96 ? 473 TRP A CA  1 
ATOM   3683 C C   . TRP A 1 473 ? 11.999  74.650 44.742 1.00 34.01 ? 473 TRP A C   1 
ATOM   3684 O O   . TRP A 1 473 ? 11.499  73.697 44.158 1.00 32.71 ? 473 TRP A O   1 
ATOM   3685 C CB  . TRP A 1 473 ? 11.796  74.551 47.226 1.00 31.66 ? 473 TRP A CB  1 
ATOM   3686 C CG  . TRP A 1 473 ? 11.946  73.636 48.403 1.00 33.88 ? 473 TRP A CG  1 
ATOM   3687 C CD1 . TRP A 1 473 ? 10.905  72.991 49.032 1.00 33.11 ? 473 TRP A CD1 1 
ATOM   3688 C CD2 . TRP A 1 473 ? 13.119  73.283 49.151 1.00 30.84 ? 473 TRP A CD2 1 
ATOM   3689 N NE1 . TRP A 1 473 ? 11.366  72.255 50.090 1.00 32.01 ? 473 TRP A NE1 1 
ATOM   3690 C CE2 . TRP A 1 473 ? 12.723  72.428 50.192 1.00 31.28 ? 473 TRP A CE2 1 
ATOM   3691 C CE3 . TRP A 1 473 ? 14.469  73.617 49.048 1.00 30.82 ? 473 TRP A CE3 1 
ATOM   3692 C CZ2 . TRP A 1 473 ? 13.619  71.894 51.115 1.00 30.38 ? 473 TRP A CZ2 1 
ATOM   3693 C CZ3 . TRP A 1 473 ? 15.372  73.089 49.956 1.00 29.65 ? 473 TRP A CZ3 1 
ATOM   3694 C CH2 . TRP A 1 473 ? 14.938  72.239 50.982 1.00 30.52 ? 473 TRP A CH2 1 
ATOM   3695 N N   . ALA A 1 474 ? 11.776  75.909 44.404 1.00 33.80 ? 474 ALA A N   1 
ATOM   3696 C CA  . ALA A 1 474 ? 11.018  76.330 43.240 1.00 32.89 ? 474 ALA A CA  1 
ATOM   3697 C C   . ALA A 1 474 ? 11.864  76.047 41.999 1.00 33.50 ? 474 ALA A C   1 
ATOM   3698 O O   . ALA A 1 474 ? 11.375  75.442 41.054 1.00 34.12 ? 474 ALA A O   1 
ATOM   3699 C CB  . ALA A 1 474 ? 10.636  77.789 43.289 1.00 29.48 ? 474 ALA A CB  1 
ATOM   3700 N N   . THR A 1 475 ? 13.139  76.399 42.066 1.00 33.28 ? 475 THR A N   1 
ATOM   3701 C CA  . THR A 1 475 ? 14.008  76.114 40.942 1.00 33.07 ? 475 THR A CA  1 
ATOM   3702 C C   . THR A 1 475 ? 14.042  74.610 40.706 1.00 34.84 ? 475 THR A C   1 
ATOM   3703 O O   . THR A 1 475 ? 13.987  74.187 39.545 1.00 36.45 ? 475 THR A O   1 
ATOM   3704 C CB  . THR A 1 475 ? 15.420  76.659 41.160 1.00 30.58 ? 475 THR A CB  1 
ATOM   3705 O OG1 . THR A 1 475 ? 15.333  78.084 41.205 1.00 29.97 ? 475 THR A OG1 1 
ATOM   3706 C CG2 . THR A 1 475 ? 16.340  76.227 40.031 1.00 30.90 ? 475 THR A CG2 1 
ATOM   3707 N N   . PHE A 1 476 ? 14.153  73.799 41.761 1.00 34.01 ? 476 PHE A N   1 
ATOM   3708 C CA  . PHE A 1 476 ? 14.208  72.361 41.542 1.00 32.24 ? 476 PHE A CA  1 
ATOM   3709 C C   . PHE A 1 476 ? 12.900  71.856 40.948 1.00 32.44 ? 476 PHE A C   1 
ATOM   3710 O O   . PHE A 1 476 ? 12.877  70.945 40.111 1.00 32.11 ? 476 PHE A O   1 
ATOM   3711 C CB  . PHE A 1 476 ? 14.523  71.626 42.845 1.00 26.30 ? 476 PHE A CB  1 
ATOM   3712 C CG  . PHE A 1 476 ? 14.205  70.153 42.786 1.00 19.53 ? 476 PHE A CG  1 
ATOM   3713 C CD1 . PHE A 1 476 ? 12.940  69.696 43.113 1.00 16.49 ? 476 PHE A CD1 1 
ATOM   3714 C CD2 . PHE A 1 476 ? 15.169  69.251 42.406 1.00 18.68 ? 476 PHE A CD2 1 
ATOM   3715 C CE1 . PHE A 1 476 ? 12.636  68.353 43.019 1.00 16.73 ? 476 PHE A CE1 1 
ATOM   3716 C CE2 . PHE A 1 476 ? 14.871  67.904 42.345 1.00 19.94 ? 476 PHE A CE2 1 
ATOM   3717 C CZ  . PHE A 1 476 ? 13.606  67.446 42.668 1.00 18.12 ? 476 PHE A CZ  1 
ATOM   3718 N N   . ALA A 1 477 ? 11.779  72.416 41.400 1.00 32.64 ? 477 ALA A N   1 
ATOM   3719 C CA  . ALA A 1 477 ? 10.501  71.943 40.876 1.00 33.63 ? 477 ALA A CA  1 
ATOM   3720 C C   . ALA A 1 477 ? 10.374  72.262 39.370 1.00 35.19 ? 477 ALA A C   1 
ATOM   3721 O O   . ALA A 1 477 ? 9.771   71.501 38.624 1.00 33.73 ? 477 ALA A O   1 
ATOM   3722 C CB  . ALA A 1 477 ? 9.347   72.551 41.637 1.00 27.65 ? 477 ALA A CB  1 
ATOM   3723 N N   . LYS A 1 478 ? 10.895  73.417 38.982 1.00 35.66 ? 478 LYS A N   1 
ATOM   3724 C CA  . LYS A 1 478 ? 10.849  73.945 37.642 1.00 37.59 ? 478 LYS A CA  1 
ATOM   3725 C C   . LYS A 1 478 ? 11.729  73.174 36.654 1.00 37.00 ? 478 LYS A C   1 
ATOM   3726 O O   . LYS A 1 478 ? 11.315  72.851 35.549 1.00 37.02 ? 478 LYS A O   1 
ATOM   3727 C CB  . LYS A 1 478 ? 11.328  75.397 37.616 1.00 41.31 ? 478 LYS A CB  1 
ATOM   3728 C CG  . LYS A 1 478 ? 10.372  76.493 38.052 1.00 47.34 ? 478 LYS A CG  1 
ATOM   3729 C CD  . LYS A 1 478 ? 11.145  77.788 38.289 1.00 50.98 ? 478 LYS A CD  1 
ATOM   3730 C CE  . LYS A 1 478 ? 10.473  78.741 39.255 1.00 54.25 ? 478 LYS A CE  1 
ATOM   3731 N NZ  . LYS A 1 478 ? 11.469  79.394 40.174 1.00 55.81 ? 478 LYS A NZ  1 
ATOM   3732 N N   . THR A 1 479 ? 12.956  72.874 37.063 1.00 36.69 ? 479 THR A N   1 
ATOM   3733 C CA  . THR A 1 479 ? 13.911  72.183 36.227 1.00 35.37 ? 479 THR A CA  1 
ATOM   3734 C C   . THR A 1 479 ? 14.502  70.881 36.695 1.00 35.09 ? 479 THR A C   1 
ATOM   3735 O O   . THR A 1 479 ? 15.329  70.315 35.964 1.00 34.47 ? 479 THR A O   1 
ATOM   3736 C CB  . THR A 1 479 ? 15.112  73.162 36.073 1.00 35.77 ? 479 THR A CB  1 
ATOM   3737 O OG1 . THR A 1 479 ? 15.940  73.065 37.242 1.00 34.67 ? 479 THR A OG1 1 
ATOM   3738 C CG2 . THR A 1 479 ? 14.667  74.610 35.906 1.00 32.57 ? 479 THR A CG2 1 
ATOM   3739 N N   . GLY A 1 480 ? 14.179  70.379 37.882 1.00 34.82 ? 480 GLY A N   1 
ATOM   3740 C CA  . GLY A 1 480 ? 14.788  69.125 38.338 1.00 32.88 ? 480 GLY A CA  1 
ATOM   3741 C C   . GLY A 1 480 ? 16.171  69.358 38.937 1.00 32.03 ? 480 GLY A C   1 
ATOM   3742 O O   . GLY A 1 480 ? 16.856  68.383 39.228 1.00 31.24 ? 480 GLY A O   1 
ATOM   3743 N N   . ASN A 1 481 ? 16.597  70.594 39.137 1.00 31.61 ? 481 ASN A N   1 
ATOM   3744 C CA  . ASN A 1 481 ? 17.923  70.872 39.710 1.00 33.78 ? 481 ASN A CA  1 
ATOM   3745 C C   . ASN A 1 481 ? 17.803  72.142 40.542 1.00 34.33 ? 481 ASN A C   1 
ATOM   3746 O O   . ASN A 1 481 ? 17.267  73.147 40.092 1.00 34.94 ? 481 ASN A O   1 
ATOM   3747 C CB  . ASN A 1 481 ? 18.989  70.945 38.633 1.00 36.56 ? 481 ASN A CB  1 
ATOM   3748 C CG  . ASN A 1 481 ? 20.327  71.480 39.075 1.00 39.14 ? 481 ASN A CG  1 
ATOM   3749 O OD1 . ASN A 1 481 ? 20.430  72.299 39.989 1.00 41.36 ? 481 ASN A OD1 1 
ATOM   3750 N ND2 . ASN A 1 481 ? 21.390  71.032 38.424 1.00 38.59 ? 481 ASN A ND2 1 
ATOM   3751 N N   . PRO A 1 482 ? 18.214  72.090 41.812 1.00 34.93 ? 482 PRO A N   1 
ATOM   3752 C CA  . PRO A 1 482 ? 18.064  73.203 42.731 1.00 35.06 ? 482 PRO A CA  1 
ATOM   3753 C C   . PRO A 1 482 ? 18.826  74.442 42.333 1.00 35.73 ? 482 PRO A C   1 
ATOM   3754 O O   . PRO A 1 482 ? 18.419  75.566 42.616 1.00 35.39 ? 482 PRO A O   1 
ATOM   3755 C CB  . PRO A 1 482 ? 18.528  72.645 44.076 1.00 34.75 ? 482 PRO A CB  1 
ATOM   3756 C CG  . PRO A 1 482 ? 19.442  71.533 43.694 1.00 35.28 ? 482 PRO A CG  1 
ATOM   3757 C CD  . PRO A 1 482 ? 18.834  70.905 42.459 1.00 34.44 ? 482 PRO A CD  1 
ATOM   3758 N N   . ASN A 1 483 ? 19.955  74.230 41.691 1.00 38.14 ? 483 ASN A N   1 
ATOM   3759 C CA  . ASN A 1 483 ? 20.869  75.239 41.197 1.00 40.68 ? 483 ASN A CA  1 
ATOM   3760 C C   . ASN A 1 483 ? 20.388  75.967 39.954 1.00 43.26 ? 483 ASN A C   1 
ATOM   3761 O O   . ASN A 1 483 ? 19.838  75.365 39.024 1.00 44.41 ? 483 ASN A O   1 
ATOM   3762 C CB  . ASN A 1 483 ? 22.196  74.529 40.875 1.00 37.00 ? 483 ASN A CB  1 
ATOM   3763 C CG  . ASN A 1 483 ? 22.686  73.772 42.100 1.00 36.77 ? 483 ASN A CG  1 
ATOM   3764 O OD1 . ASN A 1 483 ? 22.874  74.415 43.137 1.00 37.03 ? 483 ASN A OD1 1 
ATOM   3765 N ND2 . ASN A 1 483 ? 22.866  72.465 42.015 1.00 34.64 ? 483 ASN A ND2 1 
ATOM   3766 N N   . GLU A 1 484 ? 20.567  77.276 39.900 1.00 45.48 ? 484 GLU A N   1 
ATOM   3767 C CA  . GLU A 1 484 ? 20.222  78.048 38.714 1.00 48.83 ? 484 GLU A CA  1 
ATOM   3768 C C   . GLU A 1 484 ? 21.305  77.913 37.639 1.00 49.26 ? 484 GLU A C   1 
ATOM   3769 O O   . GLU A 1 484 ? 22.493  77.914 38.069 1.00 50.56 ? 484 GLU A O   1 
ATOM   3770 C CB  . GLU A 1 484 ? 20.043  79.522 39.038 1.00 54.59 ? 484 GLU A CB  1 
ATOM   3771 C CG  . GLU A 1 484 ? 18.575  79.941 38.920 1.00 60.28 ? 484 GLU A CG  1 
ATOM   3772 C CD  . GLU A 1 484 ? 18.439  81.359 39.441 1.00 64.64 ? 484 GLU A CD  1 
ATOM   3773 O OE1 . GLU A 1 484 ? 19.370  81.777 40.163 1.00 67.16 ? 484 GLU A OE1 1 
ATOM   3774 O OE2 . GLU A 1 484 ? 17.428  82.011 39.121 1.00 68.46 ? 484 GLU A OE2 1 
ATOM   3775 N N   . SER A 1 490 ? 27.744  77.844 47.191 1.00 57.45 ? 490 SER A N   1 
ATOM   3776 C CA  . SER A 1 490 ? 27.811  77.738 45.703 1.00 56.83 ? 490 SER A CA  1 
ATOM   3777 C C   . SER A 1 490 ? 26.791  76.745 45.166 1.00 55.48 ? 490 SER A C   1 
ATOM   3778 O O   . SER A 1 490 ? 25.580  76.940 45.278 1.00 56.27 ? 490 SER A O   1 
ATOM   3779 C CB  . SER A 1 490 ? 29.222  77.350 45.259 1.00 59.91 ? 490 SER A CB  1 
ATOM   3780 O OG  . SER A 1 490 ? 29.722  76.275 46.046 1.00 61.07 ? 490 SER A OG  1 
ATOM   3781 N N   . LYS A 1 491 ? 27.295  75.656 44.595 1.00 53.69 ? 491 LYS A N   1 
ATOM   3782 C CA  . LYS A 1 491 ? 26.455  74.627 44.035 1.00 51.64 ? 491 LYS A CA  1 
ATOM   3783 C C   . LYS A 1 491 ? 26.018  73.521 44.987 1.00 49.75 ? 491 LYS A C   1 
ATOM   3784 O O   . LYS A 1 491 ? 26.795  72.932 45.741 1.00 50.09 ? 491 LYS A O   1 
ATOM   3785 C CB  . LYS A 1 491 ? 27.200  73.918 42.880 1.00 53.69 ? 491 LYS A CB  1 
ATOM   3786 C CG  . LYS A 1 491 ? 26.452  74.060 41.559 1.00 55.51 ? 491 LYS A CG  1 
ATOM   3787 N N   . TRP A 1 492 ? 24.731  73.204 44.887 1.00 47.06 ? 492 TRP A N   1 
ATOM   3788 C CA  . TRP A 1 492 ? 24.174  72.091 45.638 1.00 43.58 ? 492 TRP A CA  1 
ATOM   3789 C C   . TRP A 1 492 ? 24.488  70.860 44.788 1.00 43.68 ? 492 TRP A C   1 
ATOM   3790 O O   . TRP A 1 492 ? 23.859  70.613 43.766 1.00 42.58 ? 492 TRP A O   1 
ATOM   3791 C CB  . TRP A 1 492 ? 22.702  72.311 45.895 1.00 35.88 ? 492 TRP A CB  1 
ATOM   3792 C CG  . TRP A 1 492 ? 22.017  71.237 46.689 1.00 28.78 ? 492 TRP A CG  1 
ATOM   3793 C CD1 . TRP A 1 492 ? 22.477  69.986 46.950 1.00 26.37 ? 492 TRP A CD1 1 
ATOM   3794 C CD2 . TRP A 1 492 ? 20.725  71.328 47.295 1.00 25.04 ? 492 TRP A CD2 1 
ATOM   3795 N NE1 . TRP A 1 492 ? 21.556  69.285 47.677 1.00 27.52 ? 492 TRP A NE1 1 
ATOM   3796 C CE2 . TRP A 1 492 ? 20.470  70.091 47.904 1.00 25.85 ? 492 TRP A CE2 1 
ATOM   3797 C CE3 . TRP A 1 492 ? 19.771  72.350 47.389 1.00 22.41 ? 492 TRP A CE3 1 
ATOM   3798 C CZ2 . TRP A 1 492 ? 19.302  69.825 48.625 1.00 25.89 ? 492 TRP A CZ2 1 
ATOM   3799 C CZ3 . TRP A 1 492 ? 18.606  72.079 48.079 1.00 24.36 ? 492 TRP A CZ3 1 
ATOM   3800 C CH2 . TRP A 1 492 ? 18.377  70.835 48.706 1.00 24.64 ? 492 TRP A CH2 1 
ATOM   3801 N N   . PRO A 1 493 ? 25.497  70.098 45.189 1.00 43.56 ? 493 PRO A N   1 
ATOM   3802 C CA  . PRO A 1 493 ? 25.932  68.921 44.490 1.00 43.41 ? 493 PRO A CA  1 
ATOM   3803 C C   . PRO A 1 493 ? 24.865  67.855 44.362 1.00 43.80 ? 493 PRO A C   1 
ATOM   3804 O O   . PRO A 1 493 ? 23.980  67.731 45.199 1.00 44.17 ? 493 PRO A O   1 
ATOM   3805 C CB  . PRO A 1 493 ? 27.094  68.361 45.305 1.00 43.16 ? 493 PRO A CB  1 
ATOM   3806 C CG  . PRO A 1 493 ? 27.559  69.515 46.106 1.00 43.53 ? 493 PRO A CG  1 
ATOM   3807 C CD  . PRO A 1 493 ? 26.328  70.328 46.396 1.00 43.69 ? 493 PRO A CD  1 
ATOM   3808 N N   . LEU A 1 494 ? 24.998  67.071 43.306 1.00 43.07 ? 494 LEU A N   1 
ATOM   3809 C CA  . LEU A 1 494 ? 24.122  65.942 43.087 1.00 42.80 ? 494 LEU A CA  1 
ATOM   3810 C C   . LEU A 1 494 ? 24.463  64.900 44.146 1.00 42.70 ? 494 LEU A C   1 
ATOM   3811 O O   . LEU A 1 494 ? 25.654  64.762 44.466 1.00 42.58 ? 494 LEU A O   1 
ATOM   3812 C CB  . LEU A 1 494 ? 24.355  65.393 41.697 1.00 43.26 ? 494 LEU A CB  1 
ATOM   3813 C CG  . LEU A 1 494 ? 23.293  64.629 40.938 1.00 45.71 ? 494 LEU A CG  1 
ATOM   3814 C CD1 . LEU A 1 494 ? 21.959  65.349 40.896 1.00 43.61 ? 494 LEU A CD1 1 
ATOM   3815 C CD2 . LEU A 1 494 ? 23.799  64.369 39.512 1.00 46.88 ? 494 LEU A CD2 1 
ATOM   3816 N N   . PHE A 1 495 ? 23.465  64.186 44.657 1.00 41.60 ? 495 PHE A N   1 
ATOM   3817 C CA  . PHE A 1 495 ? 23.811  63.153 45.623 1.00 41.22 ? 495 PHE A CA  1 
ATOM   3818 C C   . PHE A 1 495 ? 24.086  61.897 44.800 1.00 41.43 ? 495 PHE A C   1 
ATOM   3819 O O   . PHE A 1 495 ? 23.221  61.484 44.037 1.00 41.32 ? 495 PHE A O   1 
ATOM   3820 C CB  . PHE A 1 495 ? 22.742  62.885 46.684 1.00 37.80 ? 495 PHE A CB  1 
ATOM   3821 C CG  . PHE A 1 495 ? 22.927  61.613 47.464 1.00 35.32 ? 495 PHE A CG  1 
ATOM   3822 C CD1 . PHE A 1 495 ? 22.485  60.399 46.986 1.00 34.60 ? 495 PHE A CD1 1 
ATOM   3823 C CD2 . PHE A 1 495 ? 23.570  61.622 48.698 1.00 35.46 ? 495 PHE A CD2 1 
ATOM   3824 C CE1 . PHE A 1 495 ? 22.668  59.232 47.696 1.00 35.75 ? 495 PHE A CE1 1 
ATOM   3825 C CE2 . PHE A 1 495 ? 23.736  60.462 49.418 1.00 33.04 ? 495 PHE A CE2 1 
ATOM   3826 C CZ  . PHE A 1 495 ? 23.302  59.255 48.926 1.00 33.84 ? 495 PHE A CZ  1 
ATOM   3827 N N   . THR A 1 496 ? 25.248  61.293 44.951 1.00 42.27 ? 496 THR A N   1 
ATOM   3828 C CA  . THR A 1 496 ? 25.568  60.072 44.223 1.00 43.46 ? 496 THR A CA  1 
ATOM   3829 C C   . THR A 1 496 ? 25.865  58.977 45.241 1.00 44.62 ? 496 THR A C   1 
ATOM   3830 O O   . THR A 1 496 ? 26.328  59.250 46.350 1.00 44.62 ? 496 THR A O   1 
ATOM   3831 C CB  . THR A 1 496 ? 26.749  60.236 43.254 1.00 43.45 ? 496 THR A CB  1 
ATOM   3832 O OG1 . THR A 1 496 ? 27.952  60.490 43.994 1.00 46.26 ? 496 THR A OG1 1 
ATOM   3833 C CG2 . THR A 1 496 ? 26.539  61.402 42.294 1.00 40.24 ? 496 THR A CG2 1 
ATOM   3834 N N   . THR A 1 497 ? 25.619  57.726 44.880 1.00 45.88 ? 497 THR A N   1 
ATOM   3835 C CA  . THR A 1 497 ? 25.899  56.633 45.795 1.00 48.37 ? 497 THR A CA  1 
ATOM   3836 C C   . THR A 1 497 ? 27.381  56.558 46.124 1.00 48.85 ? 497 THR A C   1 
ATOM   3837 O O   . THR A 1 497 ? 27.737  56.085 47.203 1.00 49.99 ? 497 THR A O   1 
ATOM   3838 C CB  . THR A 1 497 ? 25.456  55.275 45.219 1.00 52.57 ? 497 THR A CB  1 
ATOM   3839 O OG1 . THR A 1 497 ? 26.080  55.101 43.943 1.00 54.77 ? 497 THR A OG1 1 
ATOM   3840 C CG2 . THR A 1 497 ? 23.945  55.223 45.066 1.00 53.00 ? 497 THR A CG2 1 
ATOM   3841 N N   . LYS A 1 498 ? 28.256  56.995 45.222 1.00 49.19 ? 498 LYS A N   1 
ATOM   3842 C CA  . LYS A 1 498 ? 29.681  56.920 45.510 1.00 49.13 ? 498 LYS A CA  1 
ATOM   3843 C C   . LYS A 1 498 ? 30.141  58.075 46.394 1.00 49.01 ? 498 LYS A C   1 
ATOM   3844 O O   . LYS A 1 498 ? 30.861  57.852 47.367 1.00 49.17 ? 498 LYS A O   1 
ATOM   3845 C CB  . LYS A 1 498 ? 30.516  56.905 44.224 1.00 49.55 ? 498 LYS A CB  1 
ATOM   3846 N N   . GLU A 1 499 ? 29.768  59.298 46.025 1.00 48.45 ? 499 GLU A N   1 
ATOM   3847 C CA  . GLU A 1 499 ? 30.229  60.447 46.806 1.00 47.35 ? 499 GLU A CA  1 
ATOM   3848 C C   . GLU A 1 499 ? 29.269  60.806 47.931 1.00 46.38 ? 499 GLU A C   1 
ATOM   3849 O O   . GLU A 1 499 ? 29.719  61.362 48.933 1.00 46.43 ? 499 GLU A O   1 
ATOM   3850 C CB  . GLU A 1 499 ? 30.474  61.629 45.869 1.00 48.53 ? 499 GLU A CB  1 
ATOM   3851 C CG  . GLU A 1 499 ? 31.556  61.438 44.826 1.00 50.61 ? 499 GLU A CG  1 
ATOM   3852 C CD  . GLU A 1 499 ? 32.813  60.767 45.325 1.00 51.99 ? 499 GLU A CD  1 
ATOM   3853 N N   . GLN A 1 500 ? 27.978  60.521 47.836 1.00 45.18 ? 500 GLN A N   1 
ATOM   3854 C CA  . GLN A 1 500 ? 27.047  60.813 48.915 1.00 44.01 ? 500 GLN A CA  1 
ATOM   3855 C C   . GLN A 1 500 ? 27.066  62.249 49.417 1.00 42.02 ? 500 GLN A C   1 
ATOM   3856 O O   . GLN A 1 500 ? 26.840  62.453 50.618 1.00 41.25 ? 500 GLN A O   1 
ATOM   3857 C CB  . GLN A 1 500 ? 27.366  59.936 50.134 1.00 47.26 ? 500 GLN A CB  1 
ATOM   3858 C CG  . GLN A 1 500 ? 27.616  58.468 49.875 1.00 52.66 ? 500 GLN A CG  1 
ATOM   3859 C CD  . GLN A 1 500 ? 26.469  57.608 50.368 1.00 58.09 ? 500 GLN A CD  1 
ATOM   3860 O OE1 . GLN A 1 500 ? 25.856  57.882 51.413 1.00 59.84 ? 500 GLN A OE1 1 
ATOM   3861 N NE2 . GLN A 1 500 ? 26.161  56.590 49.566 1.00 58.98 ? 500 GLN A NE2 1 
ATOM   3862 N N   . LYS A 1 501 ? 27.354  63.227 48.574 1.00 40.37 ? 501 LYS A N   1 
ATOM   3863 C CA  . LYS A 1 501 ? 27.402  64.599 49.047 1.00 38.88 ? 501 LYS A CA  1 
ATOM   3864 C C   . LYS A 1 501 ? 26.012  65.146 49.368 1.00 37.68 ? 501 LYS A C   1 
ATOM   3865 O O   . LYS A 1 501 ? 24.993  64.729 48.838 1.00 37.57 ? 501 LYS A O   1 
ATOM   3866 C CB  . LYS A 1 501 ? 28.049  65.545 48.043 1.00 41.45 ? 501 LYS A CB  1 
ATOM   3867 C CG  . LYS A 1 501 ? 29.400  65.071 47.524 1.00 46.38 ? 501 LYS A CG  1 
ATOM   3868 C CD  . LYS A 1 501 ? 30.029  66.186 46.692 1.00 48.80 ? 501 LYS A CD  1 
ATOM   3869 C CE  . LYS A 1 501 ? 31.505  65.905 46.465 1.00 51.34 ? 501 LYS A CE  1 
ATOM   3870 N NZ  . LYS A 1 501 ? 31.814  65.828 45.011 1.00 53.10 ? 501 LYS A NZ  1 
ATOM   3871 N N   . PHE A 1 502 ? 26.020  66.122 50.273 1.00 36.28 ? 502 PHE A N   1 
ATOM   3872 C CA  . PHE A 1 502 ? 24.791  66.779 50.673 1.00 35.64 ? 502 PHE A CA  1 
ATOM   3873 C C   . PHE A 1 502 ? 25.201  68.161 51.162 1.00 35.47 ? 502 PHE A C   1 
ATOM   3874 O O   . PHE A 1 502 ? 26.398  68.368 51.357 1.00 35.67 ? 502 PHE A O   1 
ATOM   3875 C CB  . PHE A 1 502 ? 24.017  66.062 51.760 1.00 36.05 ? 502 PHE A CB  1 
ATOM   3876 C CG  . PHE A 1 502 ? 24.723  65.982 53.088 1.00 34.58 ? 502 PHE A CG  1 
ATOM   3877 C CD1 . PHE A 1 502 ? 25.656  64.985 53.319 1.00 32.79 ? 502 PHE A CD1 1 
ATOM   3878 C CD2 . PHE A 1 502 ? 24.430  66.896 54.085 1.00 35.29 ? 502 PHE A CD2 1 
ATOM   3879 C CE1 . PHE A 1 502 ? 26.291  64.909 54.545 1.00 35.68 ? 502 PHE A CE1 1 
ATOM   3880 C CE2 . PHE A 1 502 ? 25.069  66.813 55.311 1.00 37.23 ? 502 PHE A CE2 1 
ATOM   3881 C CZ  . PHE A 1 502 ? 26.000  65.819 55.549 1.00 35.26 ? 502 PHE A CZ  1 
ATOM   3882 N N   . ILE A 1 503 ? 24.216  69.021 51.326 1.00 35.62 ? 503 ILE A N   1 
ATOM   3883 C CA  . ILE A 1 503 ? 24.522  70.354 51.806 1.00 36.46 ? 503 ILE A CA  1 
ATOM   3884 C C   . ILE A 1 503 ? 23.777  70.664 53.109 1.00 37.31 ? 503 ILE A C   1 
ATOM   3885 O O   . ILE A 1 503 ? 22.733  70.097 53.414 1.00 36.09 ? 503 ILE A O   1 
ATOM   3886 C CB  . ILE A 1 503 ? 24.144  71.438 50.784 1.00 36.51 ? 503 ILE A CB  1 
ATOM   3887 C CG1 . ILE A 1 503 ? 22.688  71.228 50.361 1.00 35.96 ? 503 ILE A CG1 1 
ATOM   3888 C CG2 . ILE A 1 503 ? 25.067  71.414 49.580 1.00 38.78 ? 503 ILE A CG2 1 
ATOM   3889 C CD1 . ILE A 1 503 ? 21.923  72.528 50.346 1.00 37.89 ? 503 ILE A CD1 1 
ATOM   3890 N N   . ASP A 1 504 ? 24.331  71.645 53.805 1.00 38.10 ? 504 ASP A N   1 
ATOM   3891 C CA  . ASP A 1 504 ? 23.787  72.210 54.999 1.00 39.99 ? 504 ASP A CA  1 
ATOM   3892 C C   . ASP A 1 504 ? 22.878  73.376 54.594 1.00 40.96 ? 504 ASP A C   1 
ATOM   3893 O O   . ASP A 1 504 ? 23.198  74.077 53.636 1.00 40.75 ? 504 ASP A O   1 
ATOM   3894 C CB  . ASP A 1 504 ? 24.791  72.861 55.944 1.00 43.56 ? 504 ASP A CB  1 
ATOM   3895 C CG  . ASP A 1 504 ? 25.847  71.934 56.485 1.00 48.26 ? 504 ASP A CG  1 
ATOM   3896 O OD1 . ASP A 1 504 ? 25.472  70.816 56.907 1.00 49.13 ? 504 ASP A OD1 1 
ATOM   3897 O OD2 . ASP A 1 504 ? 27.033  72.342 56.465 1.00 50.24 ? 504 ASP A OD2 1 
ATOM   3898 N N   . LEU A 1 505 ? 21.821  73.538 55.363 1.00 41.28 ? 505 LEU A N   1 
ATOM   3899 C CA  . LEU A 1 505 ? 20.912  74.640 55.090 1.00 43.11 ? 505 LEU A CA  1 
ATOM   3900 C C   . LEU A 1 505 ? 20.875  75.476 56.372 1.00 44.41 ? 505 LEU A C   1 
ATOM   3901 O O   . LEU A 1 505 ? 20.222  75.107 57.342 1.00 43.99 ? 505 LEU A O   1 
ATOM   3902 C CB  . LEU A 1 505 ? 19.529  74.192 54.659 1.00 41.39 ? 505 LEU A CB  1 
ATOM   3903 C CG  . LEU A 1 505 ? 19.361  73.702 53.219 1.00 39.95 ? 505 LEU A CG  1 
ATOM   3904 C CD1 . LEU A 1 505 ? 17.913  73.312 52.956 1.00 37.65 ? 505 LEU A CD1 1 
ATOM   3905 C CD2 . LEU A 1 505 ? 19.829  74.758 52.232 1.00 38.92 ? 505 LEU A CD2 1 
ATOM   3906 N N   . ASN A 1 506 ? 21.659  76.545 56.397 1.00 45.77 ? 506 ASN A N   1 
ATOM   3907 C CA  . ASN A 1 506 ? 21.628  77.415 57.574 1.00 48.36 ? 506 ASN A CA  1 
ATOM   3908 C C   . ASN A 1 506 ? 22.105  78.795 57.162 1.00 49.44 ? 506 ASN A C   1 
ATOM   3909 O O   . ASN A 1 506 ? 22.586  78.971 56.047 1.00 49.73 ? 506 ASN A O   1 
ATOM   3910 C CB  . ASN A 1 506 ? 22.467  76.853 58.717 1.00 48.58 ? 506 ASN A CB  1 
ATOM   3911 C CG  . ASN A 1 506 ? 23.885  76.628 58.223 1.00 49.69 ? 506 ASN A CG  1 
ATOM   3912 O OD1 . ASN A 1 506 ? 24.440  77.557 57.640 1.00 51.15 ? 506 ASN A OD1 1 
ATOM   3913 N ND2 . ASN A 1 506 ? 24.407  75.437 58.454 1.00 49.31 ? 506 ASN A ND2 1 
ATOM   3914 N N   . THR A 1 507 ? 22.012  79.744 58.067 1.00 50.80 ? 507 THR A N   1 
ATOM   3915 C CA  . THR A 1 507 ? 22.396  81.125 57.794 1.00 52.60 ? 507 THR A CA  1 
ATOM   3916 C C   . THR A 1 507 ? 23.869  81.305 57.487 1.00 54.05 ? 507 THR A C   1 
ATOM   3917 O O   . THR A 1 507 ? 24.284  82.411 57.130 1.00 54.50 ? 507 THR A O   1 
ATOM   3918 C CB  . THR A 1 507 ? 21.971  81.964 59.014 1.00 51.83 ? 507 THR A CB  1 
ATOM   3919 O OG1 . THR A 1 507 ? 22.506  81.332 60.184 1.00 53.15 ? 507 THR A OG1 1 
ATOM   3920 C CG2 . THR A 1 507 ? 20.458  82.019 59.071 1.00 50.65 ? 507 THR A CG2 1 
ATOM   3921 N N   . GLU A 1 508 ? 24.670  80.256 57.606 1.00 55.25 ? 508 GLU A N   1 
ATOM   3922 C CA  . GLU A 1 508 ? 26.089  80.327 57.295 1.00 57.24 ? 508 GLU A CA  1 
ATOM   3923 C C   . GLU A 1 508 ? 26.278  79.899 55.839 1.00 58.32 ? 508 GLU A C   1 
ATOM   3924 O O   . GLU A 1 508 ? 25.383  79.304 55.239 1.00 58.63 ? 508 GLU A O   1 
ATOM   3925 C CB  . GLU A 1 508 ? 26.938  79.448 58.204 1.00 58.24 ? 508 GLU A CB  1 
ATOM   3926 C CG  . GLU A 1 508 ? 26.776  79.708 59.694 1.00 60.01 ? 508 GLU A CG  1 
ATOM   3927 N N   . PRO A 1 509 ? 27.422  80.213 55.263 1.00 59.17 ? 509 PRO A N   1 
ATOM   3928 C CA  . PRO A 1 509 ? 27.737  79.860 53.886 1.00 59.33 ? 509 PRO A CA  1 
ATOM   3929 C C   . PRO A 1 509 ? 27.696  78.356 53.690 1.00 58.89 ? 509 PRO A C   1 
ATOM   3930 O O   . PRO A 1 509 ? 28.531  77.628 54.230 1.00 59.17 ? 509 PRO A O   1 
ATOM   3931 C CB  . PRO A 1 509 ? 29.108  80.470 53.644 1.00 59.62 ? 509 PRO A CB  1 
ATOM   3932 C CG  . PRO A 1 509 ? 29.256  81.513 54.702 1.00 59.69 ? 509 PRO A CG  1 
ATOM   3933 C CD  . PRO A 1 509 ? 28.544  80.949 55.908 1.00 59.55 ? 509 PRO A CD  1 
ATOM   3934 N N   . MET A 1 510 ? 26.708  77.879 52.944 1.00 58.56 ? 510 MET A N   1 
ATOM   3935 C CA  . MET A 1 510 ? 26.536  76.452 52.708 1.00 57.69 ? 510 MET A CA  1 
ATOM   3936 C C   . MET A 1 510 ? 27.887  75.748 52.581 1.00 56.30 ? 510 MET A C   1 
ATOM   3937 O O   . MET A 1 510 ? 28.854  76.257 52.019 1.00 56.45 ? 510 MET A O   1 
ATOM   3938 C CB  . MET A 1 510 ? 25.687  76.188 51.468 1.00 62.36 ? 510 MET A CB  1 
ATOM   3939 C CG  . MET A 1 510 ? 26.436  75.795 50.203 1.00 66.75 ? 510 MET A CG  1 
ATOM   3940 S SD  . MET A 1 510 ? 25.348  75.551 48.777 1.00 70.45 ? 510 MET A SD  1 
ATOM   3941 C CE  . MET A 1 510 ? 23.753  75.471 49.607 1.00 69.11 ? 510 MET A CE  1 
ATOM   3942 N N   . LYS A 1 511 ? 27.914  74.544 53.143 1.00 54.42 ? 511 LYS A N   1 
ATOM   3943 C CA  . LYS A 1 511 ? 29.096  73.700 53.117 1.00 52.08 ? 511 LYS A CA  1 
ATOM   3944 C C   . LYS A 1 511 ? 28.625  72.354 52.567 1.00 50.17 ? 511 LYS A C   1 
ATOM   3945 O O   . LYS A 1 511 ? 27.454  72.027 52.771 1.00 50.31 ? 511 LYS A O   1 
ATOM   3946 C CB  . LYS A 1 511 ? 29.765  73.516 54.468 1.00 52.34 ? 511 LYS A CB  1 
ATOM   3947 C CG  . LYS A 1 511 ? 30.262  74.786 55.130 1.00 51.97 ? 511 LYS A CG  1 
ATOM   3948 N N   . VAL A 1 512 ? 29.508  71.655 51.886 1.00 48.47 ? 512 VAL A N   1 
ATOM   3949 C CA  . VAL A 1 512 ? 29.163  70.358 51.316 1.00 46.96 ? 512 VAL A CA  1 
ATOM   3950 C C   . VAL A 1 512 ? 29.746  69.271 52.205 1.00 46.09 ? 512 VAL A C   1 
ATOM   3951 O O   . VAL A 1 512 ? 30.924  69.344 52.554 1.00 46.07 ? 512 VAL A O   1 
ATOM   3952 C CB  . VAL A 1 512 ? 29.668  70.187 49.869 1.00 44.38 ? 512 VAL A CB  1 
ATOM   3953 C CG1 . VAL A 1 512 ? 29.581  68.742 49.400 1.00 41.56 ? 512 VAL A CG1 1 
ATOM   3954 C CG2 . VAL A 1 512 ? 28.877  71.091 48.930 1.00 42.31 ? 512 VAL A CG2 1 
ATOM   3955 N N   . HIS A 1 513 ? 28.938  68.288 52.576 1.00 45.37 ? 513 HIS A N   1 
ATOM   3956 C CA  . HIS A 1 513 ? 29.441  67.198 53.407 1.00 44.72 ? 513 HIS A CA  1 
ATOM   3957 C C   . HIS A 1 513 ? 29.165  65.881 52.701 1.00 44.76 ? 513 HIS A C   1 
ATOM   3958 O O   . HIS A 1 513 ? 28.492  65.865 51.669 1.00 44.65 ? 513 HIS A O   1 
ATOM   3959 C CB  . HIS A 1 513 ? 28.822  67.207 54.808 1.00 43.62 ? 513 HIS A CB  1 
ATOM   3960 C CG  . HIS A 1 513 ? 28.846  68.566 55.437 1.00 43.24 ? 513 HIS A CG  1 
ATOM   3961 N ND1 . HIS A 1 513 ? 29.964  69.079 56.048 1.00 43.19 ? 513 HIS A ND1 1 
ATOM   3962 C CD2 . HIS A 1 513 ? 27.899  69.532 55.514 1.00 43.47 ? 513 HIS A CD2 1 
ATOM   3963 C CE1 . HIS A 1 513 ? 29.701  70.299 56.485 1.00 43.56 ? 513 HIS A CE1 1 
ATOM   3964 N NE2 . HIS A 1 513 ? 28.456  70.598 56.179 1.00 42.49 ? 513 HIS A NE2 1 
ATOM   3965 N N   . GLN A 1 514 ? 29.645  64.786 53.274 1.00 44.67 ? 514 GLN A N   1 
ATOM   3966 C CA  . GLN A 1 514 ? 29.442  63.472 52.696 1.00 44.66 ? 514 GLN A CA  1 
ATOM   3967 C C   . GLN A 1 514 ? 28.931  62.453 53.699 1.00 43.38 ? 514 GLN A C   1 
ATOM   3968 O O   . GLN A 1 514 ? 29.335  62.434 54.852 1.00 43.65 ? 514 GLN A O   1 
ATOM   3969 C CB  . GLN A 1 514 ? 30.776  62.960 52.115 1.00 47.89 ? 514 GLN A CB  1 
ATOM   3970 C CG  . GLN A 1 514 ? 31.255  63.842 50.978 1.00 52.65 ? 514 GLN A CG  1 
ATOM   3971 C CD  . GLN A 1 514 ? 32.515  63.356 50.302 1.00 54.95 ? 514 GLN A CD  1 
ATOM   3972 O OE1 . GLN A 1 514 ? 33.562  63.977 50.486 1.00 57.17 ? 514 GLN A OE1 1 
ATOM   3973 N NE2 . GLN A 1 514 ? 32.411  62.281 49.531 1.00 54.59 ? 514 GLN A NE2 1 
ATOM   3974 N N   . ARG A 1 515 ? 28.093  61.531 53.238 1.00 42.71 ? 515 ARG A N   1 
ATOM   3975 C CA  . ARG A 1 515 ? 27.678  60.440 54.095 1.00 41.56 ? 515 ARG A CA  1 
ATOM   3976 C C   . ARG A 1 515 ? 27.010  60.890 55.384 1.00 40.67 ? 515 ARG A C   1 
ATOM   3977 O O   . ARG A 1 515 ? 27.577  60.724 56.456 1.00 39.01 ? 515 ARG A O   1 
ATOM   3978 C CB  . ARG A 1 515 ? 28.959  59.634 54.397 1.00 42.26 ? 515 ARG A CB  1 
ATOM   3979 C CG  . ARG A 1 515 ? 29.567  59.037 53.141 1.00 44.11 ? 515 ARG A CG  1 
ATOM   3980 C CD  . ARG A 1 515 ? 30.961  58.479 53.363 1.00 44.54 ? 515 ARG A CD  1 
ATOM   3981 N NE  . ARG A 1 515 ? 31.117  57.177 52.710 1.00 44.90 ? 515 ARG A NE  1 
ATOM   3982 N N   . LEU A 1 516 ? 25.813  61.450 55.280 1.00 39.84 ? 516 LEU A N   1 
ATOM   3983 C CA  . LEU A 1 516 ? 25.058  61.918 56.430 1.00 39.13 ? 516 LEU A CA  1 
ATOM   3984 C C   . LEU A 1 516 ? 24.850  60.777 57.433 1.00 38.29 ? 516 LEU A C   1 
ATOM   3985 O O   . LEU A 1 516 ? 24.278  59.734 57.113 1.00 37.59 ? 516 LEU A O   1 
ATOM   3986 C CB  . LEU A 1 516 ? 23.719  62.496 55.991 1.00 40.53 ? 516 LEU A CB  1 
ATOM   3987 C CG  . LEU A 1 516 ? 22.806  63.062 57.077 1.00 41.34 ? 516 LEU A CG  1 
ATOM   3988 C CD1 . LEU A 1 516 ? 23.524  64.111 57.908 1.00 41.77 ? 516 LEU A CD1 1 
ATOM   3989 C CD2 . LEU A 1 516 ? 21.551  63.676 56.470 1.00 43.74 ? 516 LEU A CD2 1 
ATOM   3990 N N   . ARG A 1 517 ? 25.372  60.978 58.634 1.00 36.91 ? 517 ARG A N   1 
ATOM   3991 C CA  . ARG A 1 517 ? 25.325  60.068 59.769 1.00 35.49 ? 517 ARG A CA  1 
ATOM   3992 C C   . ARG A 1 517 ? 25.523  58.614 59.409 1.00 34.12 ? 517 ARG A C   1 
ATOM   3993 O O   . ARG A 1 517 ? 24.780  57.723 59.823 1.00 34.86 ? 517 ARG A O   1 
ATOM   3994 C CB  . ARG A 1 517 ? 23.987  60.275 60.523 1.00 35.68 ? 517 ARG A CB  1 
ATOM   3995 C CG  . ARG A 1 517 ? 24.081  61.605 61.284 1.00 38.80 ? 517 ARG A CG  1 
ATOM   3996 C CD  . ARG A 1 517 ? 22.835  61.917 62.081 1.00 42.11 ? 517 ARG A CD  1 
ATOM   3997 N NE  . ARG A 1 517 ? 22.690  61.047 63.254 1.00 46.30 ? 517 ARG A NE  1 
ATOM   3998 C CZ  . ARG A 1 517 ? 23.482  61.158 64.329 1.00 45.32 ? 517 ARG A CZ  1 
ATOM   3999 N NH1 . ARG A 1 517 ? 24.461  62.058 64.305 1.00 43.13 ? 517 ARG A NH1 1 
ATOM   4000 N NH2 . ARG A 1 517 ? 23.318  60.378 65.385 1.00 43.05 ? 517 ARG A NH2 1 
ATOM   4001 N N   . VAL A 1 518 ? 26.577  58.343 58.649 1.00 33.69 ? 518 VAL A N   1 
ATOM   4002 C CA  . VAL A 1 518 ? 26.891  57.019 58.176 1.00 32.19 ? 518 VAL A CA  1 
ATOM   4003 C C   . VAL A 1 518 ? 26.951  55.965 59.279 1.00 30.73 ? 518 VAL A C   1 
ATOM   4004 O O   . VAL A 1 518 ? 26.379  54.892 59.161 1.00 29.91 ? 518 VAL A O   1 
ATOM   4005 C CB  . VAL A 1 518 ? 28.300  56.882 57.516 1.00 32.16 ? 518 VAL A CB  1 
ATOM   4006 C CG1 . VAL A 1 518 ? 28.150  55.968 56.317 1.00 30.72 ? 518 VAL A CG1 1 
ATOM   4007 C CG2 . VAL A 1 518 ? 28.893  58.231 57.230 1.00 31.78 ? 518 VAL A CG2 1 
ATOM   4008 N N   . GLN A 1 519 ? 27.869  56.233 60.206 1.00 31.30 ? 519 GLN A N   1 
ATOM   4009 C CA  . GLN A 1 519 ? 28.141  55.331 61.329 1.00 31.74 ? 519 GLN A CA  1 
ATOM   4010 C C   . GLN A 1 519 ? 26.834  54.853 61.929 1.00 29.75 ? 519 GLN A C   1 
ATOM   4011 O O   . GLN A 1 519 ? 26.523  53.670 61.937 1.00 30.87 ? 519 GLN A O   1 
ATOM   4012 C CB  . GLN A 1 519 ? 29.008  56.032 62.381 1.00 37.78 ? 519 GLN A CB  1 
ATOM   4013 C CG  . GLN A 1 519 ? 29.865  55.048 63.171 1.00 45.04 ? 519 GLN A CG  1 
ATOM   4014 C CD  . GLN A 1 519 ? 31.086  54.629 62.370 1.00 51.13 ? 519 GLN A CD  1 
ATOM   4015 O OE1 . GLN A 1 519 ? 31.768  55.478 61.784 1.00 53.18 ? 519 GLN A OE1 1 
ATOM   4016 N NE2 . GLN A 1 519 ? 31.359  53.324 62.349 1.00 53.74 ? 519 GLN A NE2 1 
ATOM   4017 N N   . MET A 1 520 ? 26.007  55.797 62.350 1.00 29.05 ? 520 MET A N   1 
ATOM   4018 C CA  . MET A 1 520 ? 24.714  55.415 62.915 1.00 30.05 ? 520 MET A CA  1 
ATOM   4019 C C   . MET A 1 520 ? 23.806  54.722 61.927 1.00 29.80 ? 520 MET A C   1 
ATOM   4020 O O   . MET A 1 520 ? 23.179  53.714 62.321 1.00 29.97 ? 520 MET A O   1 
ATOM   4021 C CB  . MET A 1 520 ? 24.060  56.679 63.516 1.00 34.37 ? 520 MET A CB  1 
ATOM   4022 C CG  . MET A 1 520 ? 24.976  57.274 64.588 1.00 41.43 ? 520 MET A CG  1 
ATOM   4023 S SD  . MET A 1 520 ? 25.443  56.102 65.879 1.00 47.95 ? 520 MET A SD  1 
ATOM   4024 C CE  . MET A 1 520 ? 26.868  55.245 65.262 1.00 43.03 ? 520 MET A CE  1 
ATOM   4025 N N   . CYS A 1 521 ? 23.719  55.201 60.670 1.00 29.49 ? 521 CYS A N   1 
ATOM   4026 C CA  . CYS A 1 521 ? 22.745  54.541 59.765 1.00 27.81 ? 521 CYS A CA  1 
ATOM   4027 C C   . CYS A 1 521 ? 23.240  53.161 59.400 1.00 26.63 ? 521 CYS A C   1 
ATOM   4028 O O   . CYS A 1 521 ? 22.405  52.277 59.184 1.00 26.01 ? 521 CYS A O   1 
ATOM   4029 C CB  . CYS A 1 521 ? 22.437  55.446 58.582 1.00 30.44 ? 521 CYS A CB  1 
ATOM   4030 S SG  . CYS A 1 521 ? 21.632  56.964 59.160 1.00 31.42 ? 521 CYS A SG  1 
ATOM   4031 N N   . VAL A 1 522 ? 24.552  52.910 59.414 1.00 26.67 ? 522 VAL A N   1 
ATOM   4032 C CA  . VAL A 1 522 ? 24.910  51.508 59.142 1.00 27.57 ? 522 VAL A CA  1 
ATOM   4033 C C   . VAL A 1 522 ? 24.330  50.708 60.306 1.00 28.52 ? 522 VAL A C   1 
ATOM   4034 O O   . VAL A 1 522 ? 23.790  49.615 60.115 1.00 30.40 ? 522 VAL A O   1 
ATOM   4035 C CB  . VAL A 1 522 ? 26.400  51.236 58.989 1.00 30.19 ? 522 VAL A CB  1 
ATOM   4036 C CG1 . VAL A 1 522 ? 26.677  49.732 58.990 1.00 30.89 ? 522 VAL A CG1 1 
ATOM   4037 C CG2 . VAL A 1 522 ? 26.956  51.852 57.711 1.00 29.54 ? 522 VAL A CG2 1 
ATOM   4038 N N   . PHE A 1 523 ? 24.403  51.270 61.527 1.00 28.13 ? 523 PHE A N   1 
ATOM   4039 C CA  . PHE A 1 523 ? 23.852  50.586 62.693 1.00 26.51 ? 523 PHE A CA  1 
ATOM   4040 C C   . PHE A 1 523 ? 22.361  50.373 62.513 1.00 24.90 ? 523 PHE A C   1 
ATOM   4041 O O   . PHE A 1 523 ? 21.841  49.267 62.636 1.00 24.08 ? 523 PHE A O   1 
ATOM   4042 C CB  . PHE A 1 523 ? 24.153  51.352 64.006 1.00 28.81 ? 523 PHE A CB  1 
ATOM   4043 C CG  . PHE A 1 523 ? 23.345  50.795 65.152 1.00 25.83 ? 523 PHE A CG  1 
ATOM   4044 C CD1 . PHE A 1 523 ? 23.787  49.680 65.843 1.00 29.15 ? 523 PHE A CD1 1 
ATOM   4045 C CD2 . PHE A 1 523 ? 22.142  51.361 65.507 1.00 24.47 ? 523 PHE A CD2 1 
ATOM   4046 C CE1 . PHE A 1 523 ? 23.061  49.153 66.899 1.00 28.52 ? 523 PHE A CE1 1 
ATOM   4047 C CE2 . PHE A 1 523 ? 21.406  50.828 66.544 1.00 28.53 ? 523 PHE A CE2 1 
ATOM   4048 C CZ  . PHE A 1 523 ? 21.868  49.736 67.251 1.00 29.12 ? 523 PHE A CZ  1 
ATOM   4049 N N   . TRP A 1 524 ? 21.611  51.423 62.221 1.00 25.52 ? 524 TRP A N   1 
ATOM   4050 C CA  . TRP A 1 524 ? 20.178  51.192 62.031 1.00 27.71 ? 524 TRP A CA  1 
ATOM   4051 C C   . TRP A 1 524 ? 19.804  50.435 60.766 1.00 29.69 ? 524 TRP A C   1 
ATOM   4052 O O   . TRP A 1 524 ? 18.867  49.616 60.823 1.00 30.67 ? 524 TRP A O   1 
ATOM   4053 C CB  . TRP A 1 524 ? 19.455  52.538 62.011 1.00 27.50 ? 524 TRP A CB  1 
ATOM   4054 C CG  . TRP A 1 524 ? 19.530  53.211 63.351 1.00 28.34 ? 524 TRP A CG  1 
ATOM   4055 C CD1 . TRP A 1 524 ? 20.382  54.211 63.706 1.00 29.11 ? 524 TRP A CD1 1 
ATOM   4056 C CD2 . TRP A 1 524 ? 18.781  52.872 64.520 1.00 27.59 ? 524 TRP A CD2 1 
ATOM   4057 N NE1 . TRP A 1 524 ? 20.160  54.563 65.004 1.00 29.19 ? 524 TRP A NE1 1 
ATOM   4058 C CE2 . TRP A 1 524 ? 19.191  53.749 65.535 1.00 29.80 ? 524 TRP A CE2 1 
ATOM   4059 C CE3 . TRP A 1 524 ? 17.782  51.938 64.799 1.00 29.23 ? 524 TRP A CE3 1 
ATOM   4060 C CZ2 . TRP A 1 524 ? 18.669  53.708 66.833 1.00 28.22 ? 524 TRP A CZ2 1 
ATOM   4061 C CZ3 . TRP A 1 524 ? 17.251  51.905 66.083 1.00 30.92 ? 524 TRP A CZ3 1 
ATOM   4062 C CH2 . TRP A 1 524 ? 17.689  52.789 67.077 1.00 27.86 ? 524 TRP A CH2 1 
ATOM   4063 N N   . ASN A 1 525 ? 20.479  50.620 59.635 1.00 30.79 ? 525 ASN A N   1 
ATOM   4064 C CA  . ASN A 1 525 ? 19.989  49.991 58.392 1.00 32.01 ? 525 ASN A CA  1 
ATOM   4065 C C   . ASN A 1 525 ? 20.508  48.597 58.165 1.00 32.33 ? 525 ASN A C   1 
ATOM   4066 O O   . ASN A 1 525 ? 19.793  47.794 57.595 1.00 33.00 ? 525 ASN A O   1 
ATOM   4067 C CB  . ASN A 1 525 ? 20.351  50.863 57.169 1.00 29.84 ? 525 ASN A CB  1 
ATOM   4068 C CG  . ASN A 1 525 ? 19.567  52.148 57.306 1.00 30.48 ? 525 ASN A CG  1 
ATOM   4069 O OD1 . ASN A 1 525 ? 18.479  52.069 57.885 1.00 34.03 ? 525 ASN A OD1 1 
ATOM   4070 N ND2 . ASN A 1 525 ? 20.087  53.265 56.854 1.00 30.95 ? 525 ASN A ND2 1 
ATOM   4071 N N   . GLN A 1 526 ? 21.726  48.328 58.609 1.00 33.53 ? 526 GLN A N   1 
ATOM   4072 C CA  . GLN A 1 526 ? 22.297  47.011 58.424 1.00 33.97 ? 526 GLN A CA  1 
ATOM   4073 C C   . GLN A 1 526 ? 22.385  46.199 59.714 1.00 34.34 ? 526 GLN A C   1 
ATOM   4074 O O   . GLN A 1 526 ? 21.869  45.076 59.747 1.00 34.64 ? 526 GLN A O   1 
ATOM   4075 C CB  . GLN A 1 526 ? 23.712  47.112 57.838 1.00 35.13 ? 526 GLN A CB  1 
ATOM   4076 C CG  . GLN A 1 526 ? 23.884  48.190 56.785 1.00 42.28 ? 526 GLN A CG  1 
ATOM   4077 C CD  . GLN A 1 526 ? 25.166  48.018 55.978 1.00 45.11 ? 526 GLN A CD  1 
ATOM   4078 N N   . PHE A 1 527 ? 23.082  46.734 60.722 1.00 34.07 ? 527 PHE A N   1 
ATOM   4079 C CA  . PHE A 1 527 ? 23.373  45.900 61.886 1.00 33.65 ? 527 PHE A CA  1 
ATOM   4080 C C   . PHE A 1 527 ? 22.171  45.609 62.763 1.00 32.95 ? 527 PHE A C   1 
ATOM   4081 O O   . PHE A 1 527 ? 21.896  44.416 62.957 1.00 32.19 ? 527 PHE A O   1 
ATOM   4082 C CB  . PHE A 1 527 ? 24.508  46.528 62.726 1.00 35.93 ? 527 PHE A CB  1 
ATOM   4083 C CG  . PHE A 1 527 ? 24.891  45.586 63.844 1.00 37.60 ? 527 PHE A CG  1 
ATOM   4084 C CD1 . PHE A 1 527 ? 25.661  44.468 63.592 1.00 36.33 ? 527 PHE A CD1 1 
ATOM   4085 C CD2 . PHE A 1 527 ? 24.443  45.828 65.140 1.00 36.56 ? 527 PHE A CD2 1 
ATOM   4086 C CE1 . PHE A 1 527 ? 26.000  43.605 64.617 1.00 37.85 ? 527 PHE A CE1 1 
ATOM   4087 C CE2 . PHE A 1 527 ? 24.786  44.964 66.156 1.00 36.33 ? 527 PHE A CE2 1 
ATOM   4088 C CZ  . PHE A 1 527 ? 25.562  43.854 65.904 1.00 36.19 ? 527 PHE A CZ  1 
ATOM   4089 N N   . LEU A 1 528 ? 21.450  46.611 63.250 1.00 33.26 ? 528 LEU A N   1 
ATOM   4090 C CA  . LEU A 1 528 ? 20.329  46.286 64.138 1.00 33.98 ? 528 LEU A CA  1 
ATOM   4091 C C   . LEU A 1 528 ? 19.368  45.290 63.513 1.00 35.87 ? 528 LEU A C   1 
ATOM   4092 O O   . LEU A 1 528 ? 19.050  44.266 64.125 1.00 36.11 ? 528 LEU A O   1 
ATOM   4093 C CB  . LEU A 1 528 ? 19.611  47.557 64.598 1.00 32.67 ? 528 LEU A CB  1 
ATOM   4094 C CG  . LEU A 1 528 ? 18.498  47.317 65.645 1.00 33.48 ? 528 LEU A CG  1 
ATOM   4095 C CD1 . LEU A 1 528 ? 19.049  46.614 66.890 1.00 31.22 ? 528 LEU A CD1 1 
ATOM   4096 C CD2 . LEU A 1 528 ? 17.824  48.636 65.982 1.00 30.84 ? 528 LEU A CD2 1 
ATOM   4097 N N   . PRO A 1 529 ? 18.884  45.524 62.305 1.00 37.54 ? 529 PRO A N   1 
ATOM   4098 C CA  . PRO A 1 529 ? 17.972  44.612 61.629 1.00 38.02 ? 529 PRO A CA  1 
ATOM   4099 C C   . PRO A 1 529 ? 18.538  43.217 61.573 1.00 38.08 ? 529 PRO A C   1 
ATOM   4100 O O   . PRO A 1 529 ? 17.836  42.230 61.781 1.00 38.52 ? 529 PRO A O   1 
ATOM   4101 C CB  . PRO A 1 529 ? 17.753  45.237 60.259 1.00 37.95 ? 529 PRO A CB  1 
ATOM   4102 C CG  . PRO A 1 529 ? 18.024  46.691 60.482 1.00 38.27 ? 529 PRO A CG  1 
ATOM   4103 C CD  . PRO A 1 529 ? 19.164  46.729 61.474 1.00 37.86 ? 529 PRO A CD  1 
ATOM   4104 N N   . LYS A 1 530 ? 19.832  43.088 61.313 1.00 39.42 ? 530 LYS A N   1 
ATOM   4105 C CA  . LYS A 1 530 ? 20.418  41.740 61.283 1.00 41.19 ? 530 LYS A CA  1 
ATOM   4106 C C   . LYS A 1 530 ? 20.358  41.130 62.682 1.00 41.63 ? 530 LYS A C   1 
ATOM   4107 O O   . LYS A 1 530 ? 19.999  39.972 62.884 1.00 41.31 ? 530 LYS A O   1 
ATOM   4108 C CB  . LYS A 1 530 ? 21.833  41.807 60.732 1.00 44.88 ? 530 LYS A CB  1 
ATOM   4109 C CG  . LYS A 1 530 ? 22.400  40.456 60.326 1.00 49.45 ? 530 LYS A CG  1 
ATOM   4110 C CD  . LYS A 1 530 ? 23.738  40.619 59.601 1.00 53.32 ? 530 LYS A CD  1 
ATOM   4111 C CE  . LYS A 1 530 ? 24.378  39.254 59.372 1.00 54.43 ? 530 LYS A CE  1 
ATOM   4112 N NZ  . LYS A 1 530 ? 25.703  39.359 58.707 1.00 54.25 ? 530 LYS A NZ  1 
ATOM   4113 N N   . LEU A 1 531 ? 20.664  41.933 63.698 1.00 42.14 ? 531 LEU A N   1 
ATOM   4114 C CA  . LEU A 1 531 ? 20.638  41.489 65.077 1.00 43.03 ? 531 LEU A CA  1 
ATOM   4115 C C   . LEU A 1 531 ? 19.282  40.928 65.490 1.00 43.31 ? 531 LEU A C   1 
ATOM   4116 O O   . LEU A 1 531 ? 19.221  39.792 65.960 1.00 42.23 ? 531 LEU A O   1 
ATOM   4117 C CB  . LEU A 1 531 ? 21.009  42.644 66.029 1.00 45.25 ? 531 LEU A CB  1 
ATOM   4118 C CG  . LEU A 1 531 ? 21.312  42.203 67.464 1.00 46.71 ? 531 LEU A CG  1 
ATOM   4119 C CD1 . LEU A 1 531 ? 22.059  40.873 67.418 1.00 49.01 ? 531 LEU A CD1 1 
ATOM   4120 C CD2 . LEU A 1 531 ? 22.129  43.222 68.233 1.00 45.90 ? 531 LEU A CD2 1 
ATOM   4121 N N   . LEU A 1 532 ? 18.228  41.718 65.305 1.00 44.09 ? 532 LEU A N   1 
ATOM   4122 C CA  . LEU A 1 532 ? 16.880  41.332 65.680 1.00 46.39 ? 532 LEU A CA  1 
ATOM   4123 C C   . LEU A 1 532 ? 16.371  40.124 64.903 1.00 48.80 ? 532 LEU A C   1 
ATOM   4124 O O   . LEU A 1 532 ? 15.500  39.422 65.418 1.00 49.52 ? 532 LEU A O   1 
ATOM   4125 C CB  . LEU A 1 532 ? 15.879  42.480 65.490 1.00 44.74 ? 532 LEU A CB  1 
ATOM   4126 C CG  . LEU A 1 532 ? 16.154  43.761 66.284 1.00 45.06 ? 532 LEU A CG  1 
ATOM   4127 C CD1 . LEU A 1 532 ? 15.271  44.906 65.799 1.00 42.76 ? 532 LEU A CD1 1 
ATOM   4128 C CD2 . LEU A 1 532 ? 15.970  43.513 67.774 1.00 44.13 ? 532 LEU A CD2 1 
ATOM   4129 N N   . ASN A 1 533 ? 16.875  39.906 63.697 1.00 50.45 ? 533 ASN A N   1 
ATOM   4130 C CA  . ASN A 1 533 ? 16.468  38.749 62.915 1.00 52.67 ? 533 ASN A CA  1 
ATOM   4131 C C   . ASN A 1 533 ? 17.197  37.521 63.454 1.00 53.88 ? 533 ASN A C   1 
ATOM   4132 O O   . ASN A 1 533 ? 16.582  36.462 63.570 1.00 54.20 ? 533 ASN A O   1 
ATOM   4133 C CB  . ASN A 1 533 ? 16.751  38.952 61.426 1.00 55.04 ? 533 ASN A CB  1 
ATOM   4134 C CG  . ASN A 1 533 ? 16.067  37.959 60.511 1.00 55.23 ? 533 ASN A CG  1 
ATOM   4135 N N   . ALA A 1 534 ? 18.480  37.665 63.765 1.00 54.75 ? 534 ALA A N   1 
ATOM   4136 C CA  . ALA A 1 534 ? 19.263  36.546 64.273 1.00 56.54 ? 534 ALA A CA  1 
ATOM   4137 C C   . ALA A 1 534 ? 18.661  36.020 65.572 1.00 58.10 ? 534 ALA A C   1 
ATOM   4138 O O   . ALA A 1 534 ? 18.203  34.890 65.699 1.00 59.24 ? 534 ALA A O   1 
ATOM   4139 C CB  . ALA A 1 534 ? 20.712  36.941 64.518 1.00 55.63 ? 534 ALA A CB  1 
ATOM   4140 N N   . THR A 1 535 ? 18.673  36.889 66.566 1.00 59.26 ? 535 THR A N   1 
ATOM   4141 C CA  . THR A 1 535 ? 18.154  36.587 67.889 1.00 60.05 ? 535 THR A CA  1 
ATOM   4142 C C   . THR A 1 535 ? 16.751  36.015 67.793 1.00 60.77 ? 535 THR A C   1 
ATOM   4143 O O   . THR A 1 535 ? 15.797  36.824 67.750 1.00 62.05 ? 535 THR A O   1 
ATOM   4144 C CB  . THR A 1 535 ? 18.191  37.868 68.743 1.00 59.73 ? 535 THR A CB  1 
ATOM   4145 O OG1 . THR A 1 535 ? 17.374  38.886 68.153 1.00 59.15 ? 535 THR A OG1 1 
ATOM   4146 C CG2 . THR A 1 535 ? 19.623  38.374 68.829 1.00 58.46 ? 535 THR A CG2 1 
HETATM 4147 C C1  . EDR B 2 .   ? 3.172   66.220 64.233 1.00 29.13 ? 999 EDR A C1  1 
HETATM 4148 C C2  . EDR B 2 .   ? 4.077   66.867 63.414 1.00 30.78 ? 999 EDR A C2  1 
HETATM 4149 C C3  . EDR B 2 .   ? 5.036   66.079 62.764 1.00 29.46 ? 999 EDR A C3  1 
HETATM 4150 C C4  . EDR B 2 .   ? 5.065   64.701 62.954 1.00 28.93 ? 999 EDR A C4  1 
HETATM 4151 C C5  . EDR B 2 .   ? 4.163   64.075 63.813 1.00 28.90 ? 999 EDR A C5  1 
HETATM 4152 C C6  . EDR B 2 .   ? 3.195   64.839 64.454 1.00 27.91 ? 999 EDR A C6  1 
HETATM 4153 O O4  . EDR B 2 .   ? 6.028   63.937 62.374 1.00 28.42 ? 999 EDR A O4  1 
HETATM 4154 N N2  . EDR B 2 .   ? 4.093   68.328 63.122 1.00 32.41 ? 999 EDR A N2  1 
HETATM 4155 C C7  . EDR B 2 .   ? 4.771   68.645 61.758 1.00 32.59 ? 999 EDR A C7  1 
HETATM 4156 C C8  . EDR B 2 .   ? 2.610   68.795 63.017 1.00 32.64 ? 999 EDR A C8  1 
HETATM 4157 C C9  . EDR B 2 .   ? 4.849   69.080 64.233 1.00 32.76 ? 999 EDR A C9  1 
HETATM 4158 C C10 . EDR B 2 .   ? 6.409   69.010 64.259 1.00 34.04 ? 999 EDR A C10 1 
HETATM 4159 O O   . HOH C 3 .   ? -1.346  69.844 52.425 1.00 21.02 ? 601 HOH A O   1 
HETATM 4160 O O   . HOH C 3 .   ? 10.656  55.518 68.116 1.00 21.42 ? 602 HOH A O   1 
HETATM 4161 O O   . HOH C 3 .   ? 10.822  68.441 59.102 1.00 21.03 ? 603 HOH A O   1 
HETATM 4162 O O   . HOH C 3 .   ? 12.278  67.234 66.876 1.00 18.60 ? 604 HOH A O   1 
HETATM 4163 O O   . HOH C 3 .   ? -6.436  49.884 60.636 1.00 26.79 ? 605 HOH A O   1 
HETATM 4164 O O   . HOH C 3 .   ? 13.445  68.592 56.799 1.00 22.68 ? 606 HOH A O   1 
HETATM 4165 O O   . HOH C 3 .   ? 2.985   54.083 63.359 1.00 26.65 ? 607 HOH A O   1 
HETATM 4166 O O   . HOH C 3 .   ? 3.635   69.121 57.744 1.00 27.96 ? 608 HOH A O   1 
HETATM 4167 O O   . HOH C 3 .   ? -6.564  61.882 64.864 1.00 27.25 ? 609 HOH A O   1 
HETATM 4168 O O   . HOH C 3 .   ? -0.221  63.423 58.635 1.00 29.27 ? 610 HOH A O   1 
HETATM 4169 O O   . HOH C 3 .   ? 0.053   67.923 63.739 1.00 22.66 ? 611 HOH A O   1 
HETATM 4170 O O   . HOH C 3 .   ? 7.811   63.409 78.381 1.00 18.84 ? 612 HOH A O   1 
HETATM 4171 O O   . HOH C 3 .   ? -13.215 58.384 56.290 1.00 24.84 ? 613 HOH A O   1 
HETATM 4172 O O   . HOH C 3 .   ? -1.600  58.184 62.276 1.00 26.86 ? 614 HOH A O   1 
HETATM 4173 O O   . HOH C 3 .   ? -11.883 63.633 59.007 1.00 24.91 ? 615 HOH A O   1 
HETATM 4174 O O   . HOH C 3 .   ? 6.752   52.218 56.004 1.00 35.40 ? 616 HOH A O   1 
HETATM 4175 O O   . HOH C 3 .   ? 0.468   69.452 59.347 1.00 29.11 ? 617 HOH A O   1 
HETATM 4176 O O   . HOH C 3 .   ? -9.356  62.537 59.413 1.00 32.34 ? 618 HOH A O   1 
HETATM 4177 O O   . HOH C 3 .   ? 0.625   77.615 61.836 1.00 33.45 ? 619 HOH A O   1 
HETATM 4178 O O   . HOH C 3 .   ? 4.447   80.506 50.935 1.00 30.92 ? 620 HOH A O   1 
HETATM 4179 O O   . HOH C 3 .   ? -0.151  69.669 62.108 1.00 26.31 ? 621 HOH A O   1 
HETATM 4180 O O   . HOH C 3 .   ? -13.189 62.855 56.564 1.00 34.49 ? 622 HOH A O   1 
HETATM 4181 O O   . HOH C 3 .   ? -3.966  70.342 61.949 1.00 25.54 ? 623 HOH A O   1 
HETATM 4182 O O   . HOH C 3 .   ? -20.101 57.784 59.394 1.00 30.29 ? 624 HOH A O   1 
HETATM 4183 O O   . HOH C 3 .   ? 0.985   43.745 54.509 1.00 31.39 ? 625 HOH A O   1 
HETATM 4184 O O   . HOH C 3 .   ? -7.304  70.705 56.071 1.00 26.10 ? 626 HOH A O   1 
HETATM 4185 O O   . HOH C 3 .   ? 4.843   62.001 60.694 1.00 25.28 ? 627 HOH A O   1 
HETATM 4186 O O   . HOH C 3 .   ? 0.887   70.420 67.927 1.00 32.26 ? 628 HOH A O   1 
HETATM 4187 O O   . HOH C 3 .   ? 18.306  59.798 41.596 1.00 31.88 ? 629 HOH A O   1 
HETATM 4188 O O   . HOH C 3 .   ? -3.915  51.358 59.375 1.00 36.33 ? 630 HOH A O   1 
HETATM 4189 O O   . HOH C 3 .   ? 15.473  52.813 61.570 1.00 37.83 ? 631 HOH A O   1 
HETATM 4190 O O   . HOH C 3 .   ? 9.327   56.117 35.840 1.00 37.03 ? 632 HOH A O   1 
HETATM 4191 O O   . HOH C 3 .   ? 2.589   51.629 64.058 1.00 39.67 ? 633 HOH A O   1 
HETATM 4192 O O   . HOH C 3 .   ? -10.236 52.488 54.547 1.00 34.52 ? 634 HOH A O   1 
HETATM 4193 O O   . HOH C 3 .   ? -4.415  52.356 56.034 1.00 24.06 ? 635 HOH A O   1 
HETATM 4194 O O   . HOH C 3 .   ? 17.623  50.528 44.607 1.00 31.97 ? 636 HOH A O   1 
HETATM 4195 O O   . HOH C 3 .   ? -15.200 66.830 51.736 1.00 29.06 ? 637 HOH A O   1 
HETATM 4196 O O   . HOH C 3 .   ? 23.092  66.431 47.615 1.00 35.58 ? 638 HOH A O   1 
HETATM 4197 O O   . HOH C 3 .   ? -3.733  57.728 63.515 1.00 37.24 ? 639 HOH A O   1 
HETATM 4198 O O   . HOH C 3 .   ? 7.142   47.037 53.493 1.00 25.15 ? 640 HOH A O   1 
HETATM 4199 O O   . HOH C 3 .   ? -8.853  58.739 64.056 1.00 34.13 ? 641 HOH A O   1 
HETATM 4200 O O   . HOH C 3 .   ? 0.379   83.110 57.101 1.00 43.77 ? 642 HOH A O   1 
HETATM 4201 O O   . HOH C 3 .   ? 5.053   59.721 69.658 1.00 31.54 ? 643 HOH A O   1 
HETATM 4202 O O   . HOH C 3 .   ? -2.071  62.898 30.983 1.00 46.24 ? 644 HOH A O   1 
HETATM 4203 O O   . HOH C 3 .   ? -7.048  68.356 57.494 1.00 33.79 ? 645 HOH A O   1 
HETATM 4204 O O   . HOH C 3 .   ? 24.959  61.385 52.502 1.00 42.19 ? 646 HOH A O   1 
HETATM 4205 O O   . HOH C 3 .   ? 27.562  63.043 45.541 1.00 35.12 ? 647 HOH A O   1 
HETATM 4206 O O   . HOH C 3 .   ? -15.626 60.760 48.579 1.00 38.40 ? 648 HOH A O   1 
HETATM 4207 O O   . HOH C 3 .   ? 8.029   75.449 60.604 1.00 39.42 ? 649 HOH A O   1 
HETATM 4208 O O   . HOH C 3 .   ? 18.372  67.338 72.764 1.00 37.99 ? 650 HOH A O   1 
HETATM 4209 O O   . HOH C 3 .   ? 3.331   66.679 36.335 1.00 24.91 ? 651 HOH A O   1 
HETATM 4210 O O   . HOH C 3 .   ? 10.126  80.412 64.830 1.00 42.74 ? 652 HOH A O   1 
HETATM 4211 O O   . HOH C 3 .   ? 13.946  85.964 46.786 1.00 39.91 ? 653 HOH A O   1 
HETATM 4212 O O   . HOH C 3 .   ? 2.786   63.788 69.508 1.00 50.81 ? 654 HOH A O   1 
HETATM 4213 O O   . HOH C 3 .   ? 14.028  51.141 55.960 1.00 55.85 ? 655 HOH A O   1 
HETATM 4214 O O   . HOH C 3 .   ? -1.405  68.549 66.473 1.00 41.18 ? 656 HOH A O   1 
HETATM 4215 O O   . HOH C 3 .   ? 15.713  77.094 76.596 1.00 49.55 ? 657 HOH A O   1 
HETATM 4216 O O   . HOH C 3 .   ? -2.100  57.825 66.360 1.00 36.58 ? 658 HOH A O   1 
HETATM 4217 O O   . HOH C 3 .   ? 4.832   51.052 61.727 1.00 34.07 ? 659 HOH A O   1 
HETATM 4218 O O   . HOH C 3 .   ? -5.879  45.376 57.330 1.00 32.82 ? 660 HOH A O   1 
HETATM 4219 O O   . HOH C 3 .   ? 11.490  63.931 35.299 1.00 41.17 ? 661 HOH A O   1 
HETATM 4220 O O   . HOH C 3 .   ? 20.651  51.389 53.448 1.00 52.58 ? 662 HOH A O   1 
HETATM 4221 O O   . HOH C 3 .   ? 26.790  63.313 59.094 1.00 47.95 ? 663 HOH A O   1 
HETATM 4222 O O   . HOH C 3 .   ? 13.285  83.416 47.069 1.00 46.35 ? 664 HOH A O   1 
HETATM 4223 O O   . HOH C 3 .   ? 4.900   57.032 35.269 1.00 48.77 ? 665 HOH A O   1 
HETATM 4224 O O   . HOH C 3 .   ? 21.215  64.957 63.482 1.00 32.19 ? 666 HOH A O   1 
HETATM 4225 O O   . HOH C 3 .   ? -13.365 41.318 62.255 1.00 58.31 ? 667 HOH A O   1 
HETATM 4226 O O   . HOH C 3 .   ? -15.101 74.990 50.727 1.00 47.86 ? 668 HOH A O   1 
HETATM 4227 O O   . HOH C 3 .   ? -17.929 69.387 48.662 1.00 56.99 ? 669 HOH A O   1 
HETATM 4228 O O   . HOH C 3 .   ? -15.042 67.958 49.153 1.00 33.53 ? 670 HOH A O   1 
HETATM 4229 O O   . HOH C 3 .   ? 21.529  65.953 69.797 1.00 48.13 ? 671 HOH A O   1 
HETATM 4230 O O   . HOH C 3 .   ? 14.430  76.199 63.159 1.00 35.64 ? 672 HOH A O   1 
HETATM 4231 O O   . HOH C 3 .   ? 3.916   61.118 72.990 1.00 50.39 ? 673 HOH A O   1 
HETATM 4232 O O   . HOH C 3 .   ? 2.085   54.716 36.264 1.00 29.10 ? 674 HOH A O   1 
HETATM 4233 O O   . HOH C 3 .   ? 1.142   65.744 69.433 1.00 42.25 ? 675 HOH A O   1 
HETATM 4234 O O   . HOH C 3 .   ? -8.570  61.194 63.174 1.00 27.69 ? 676 HOH A O   1 
HETATM 4235 O O   . HOH C 3 .   ? 3.207   64.430 35.355 1.00 34.07 ? 677 HOH A O   1 
HETATM 4236 O O   . HOH C 3 .   ? -0.740  61.332 72.646 1.00 44.27 ? 678 HOH A O   1 
HETATM 4237 O O   . HOH C 3 .   ? -0.198  57.467 37.781 1.00 34.41 ? 679 HOH A O   1 
HETATM 4238 O O   . HOH C 3 .   ? -3.032  76.335 64.198 1.00 44.81 ? 680 HOH A O   1 
HETATM 4239 O O   . HOH C 3 .   ? -9.726  70.635 54.379 1.00 40.72 ? 681 HOH A O   1 
HETATM 4240 O O   . HOH C 3 .   ? 17.145  63.792 66.460 1.00 47.28 ? 682 HOH A O   1 
HETATM 4241 O O   . HOH C 3 .   ? 7.993   50.218 36.878 1.00 49.84 ? 683 HOH A O   1 
HETATM 4242 O O   . HOH C 3 .   ? -1.107  51.370 42.342 1.00 39.88 ? 684 HOH A O   1 
HETATM 4243 O O   . HOH C 3 .   ? -3.823  85.417 39.006 1.00 35.77 ? 685 HOH A O   1 
HETATM 4244 O O   . HOH C 3 .   ? -7.889  71.926 52.093 1.00 39.35 ? 686 HOH A O   1 
HETATM 4245 O O   . HOH C 3 .   ? 20.994  61.339 35.960 1.00 43.03 ? 687 HOH A O   1 
HETATM 4246 O O   . HOH C 3 .   ? 7.474   70.687 38.982 1.00 35.44 ? 688 HOH A O   1 
HETATM 4247 O O   . HOH C 3 .   ? -1.589  75.430 52.572 1.00 39.33 ? 689 HOH A O   1 
HETATM 4248 O O   . HOH C 3 .   ? 3.271   46.201 60.788 1.00 35.99 ? 690 HOH A O   1 
HETATM 4249 O O   . HOH C 3 .   ? 19.212  62.184 33.725 1.00 51.80 ? 691 HOH A O   1 
HETATM 4250 O O   . HOH C 3 .   ? -2.834  77.460 30.582 1.00 47.44 ? 692 HOH A O   1 
HETATM 4251 O O   . HOH C 3 .   ? -14.563 60.433 56.593 1.00 40.58 ? 693 HOH A O   1 
HETATM 4252 O O   . HOH C 3 .   ? 3.647   50.822 69.118 1.00 30.82 ? 694 HOH A O   1 
HETATM 4253 O O   . HOH C 3 .   ? 9.402   46.657 53.235 1.00 33.13 ? 695 HOH A O   1 
HETATM 4254 O O   . HOH C 3 .   ? -9.742  45.484 50.981 1.00 46.28 ? 696 HOH A O   1 
HETATM 4255 O O   . HOH C 3 .   ? -20.067 60.110 59.176 1.00 37.61 ? 697 HOH A O   1 
HETATM 4256 O O   . HOH C 3 .   ? -2.044  77.973 62.022 1.00 44.59 ? 698 HOH A O   1 
HETATM 4257 O O   . HOH C 3 .   ? 16.668  74.306 76.958 1.00 43.93 ? 699 HOH A O   1 
HETATM 4258 O O   . HOH C 3 .   ? -8.288  58.267 44.536 1.00 34.81 ? 700 HOH A O   1 
HETATM 4259 O O   . HOH C 3 .   ? 3.760   56.658 69.804 1.00 41.37 ? 701 HOH A O   1 
HETATM 4260 O O   . HOH C 3 .   ? -17.077 64.238 66.917 1.00 45.12 ? 702 HOH A O   1 
HETATM 4261 O O   . HOH C 3 .   ? 19.304  65.745 67.817 1.00 47.80 ? 703 HOH A O   1 
HETATM 4262 O O   . HOH C 3 .   ? -6.891  55.604 42.160 1.00 53.95 ? 704 HOH A O   1 
HETATM 4263 O O   . HOH C 3 .   ? -4.509  56.488 38.802 1.00 45.15 ? 705 HOH A O   1 
HETATM 4264 O O   . HOH C 3 .   ? 18.052  74.527 37.267 1.00 36.97 ? 706 HOH A O   1 
HETATM 4265 O O   . HOH C 3 .   ? 26.261  59.099 77.061 1.00 51.92 ? 707 HOH A O   1 
HETATM 4266 O O   . HOH C 3 .   ? 25.421  47.998 76.103 1.00 57.83 ? 708 HOH A O   1 
HETATM 4267 O O   . HOH C 3 .   ? -1.019  72.602 72.774 1.00 48.42 ? 709 HOH A O   1 
HETATM 4268 O O   . HOH C 3 .   ? 28.811  59.262 60.828 1.00 47.71 ? 710 HOH A O   1 
HETATM 4269 O O   . HOH C 3 .   ? -5.665  83.896 38.658 1.00 34.22 ? 711 HOH A O   1 
HETATM 4270 O O   . HOH C 3 .   ? 20.981  70.848 67.563 1.00 63.34 ? 712 HOH A O   1 
HETATM 4271 O O   . HOH C 3 .   ? 16.277  79.890 69.495 1.00 51.44 ? 713 HOH A O   1 
HETATM 4272 O O   . HOH C 3 .   ? 21.845  61.593 41.842 1.00 38.47 ? 714 HOH A O   1 
HETATM 4273 O O   . HOH C 3 .   ? 20.325  62.498 64.522 1.00 35.34 ? 715 HOH A O   1 
HETATM 4274 O O   . HOH C 3 .   ? 24.112  76.966 54.285 1.00 51.51 ? 716 HOH A O   1 
HETATM 4275 O O   . HOH C 3 .   ? 20.234  84.517 62.247 1.00 54.73 ? 717 HOH A O   1 
HETATM 4276 O O   . HOH C 3 .   ? -10.247 66.365 68.409 1.00 46.85 ? 718 HOH A O   1 
HETATM 4277 O O   . HOH C 3 .   ? 5.547   77.583 81.167 1.00 70.20 ? 719 HOH A O   1 
HETATM 4278 O O   . HOH C 3 .   ? 3.461   81.002 32.034 1.00 63.98 ? 720 HOH A O   1 
HETATM 4279 O O   . HOH C 3 .   ? 16.332  49.925 62.403 1.00 71.09 ? 721 HOH A O   1 
HETATM 4280 O O   . HOH C 3 .   ? -19.949 75.576 37.538 1.00 57.94 ? 722 HOH A O   1 
HETATM 4281 O O   . HOH C 3 .   ? 5.616   47.743 75.052 1.00 50.16 ? 723 HOH A O   1 
HETATM 4282 O O   . HOH C 3 .   ? 26.353  67.858 40.699 1.00 53.23 ? 724 HOH A O   1 
HETATM 4283 O O   . HOH C 3 .   ? 24.547  57.683 55.088 1.00 42.15 ? 725 HOH A O   1 
HETATM 4284 O O   . HOH C 3 .   ? -4.426  66.337 73.909 1.00 46.68 ? 726 HOH A O   1 
HETATM 4285 O O   . HOH C 3 .   ? 17.375  54.016 35.647 1.00 57.53 ? 727 HOH A O   1 
HETATM 4286 O O   . HOH C 3 .   ? 25.292  62.341 72.632 1.00 63.98 ? 728 HOH A O   1 
HETATM 4287 O O   . HOH C 3 .   ? -3.334  83.321 51.574 1.00 44.35 ? 729 HOH A O   1 
HETATM 4288 O O   . HOH C 3 .   ? -4.903  40.672 62.704 1.00 43.20 ? 730 HOH A O   1 
HETATM 4289 O O   . HOH C 3 .   ? 11.860  67.326 82.905 1.00 46.93 ? 731 HOH A O   1 
HETATM 4290 O O   . HOH C 3 .   ? 2.219   87.510 41.494 1.00 46.11 ? 732 HOH A O   1 
HETATM 4291 O O   . HOH C 3 .   ? -7.572  73.273 66.990 1.00 54.67 ? 733 HOH A O   1 
HETATM 4292 O O   . HOH C 3 .   ? 5.979   67.168 78.308 1.00 42.18 ? 734 HOH A O   1 
HETATM 4293 O O   . HOH C 3 .   ? -13.747 52.125 49.258 1.00 39.49 ? 735 HOH A O   1 
HETATM 4294 O O   . HOH C 3 .   ? 26.355  48.130 68.768 1.00 57.24 ? 736 HOH A O   1 
HETATM 4295 O O   . HOH C 3 .   ? -0.828  71.173 29.026 1.00 60.63 ? 737 HOH A O   1 
HETATM 4296 O O   . HOH C 3 .   ? -17.761 65.823 60.919 1.00 49.11 ? 738 HOH A O   1 
HETATM 4297 O O   . HOH C 3 .   ? 4.277   56.011 77.736 1.00 41.94 ? 739 HOH A O   1 
HETATM 4298 O O   . HOH C 3 .   ? -16.416 55.105 47.510 1.00 52.11 ? 740 HOH A O   1 
HETATM 4299 O O   . HOH C 3 .   ? 4.577   46.557 40.111 1.00 54.74 ? 741 HOH A O   1 
HETATM 4300 O O   . HOH C 3 .   ? 14.330  39.887 75.234 1.00 52.85 ? 742 HOH A O   1 
HETATM 4301 O O   . HOH C 3 .   ? 6.198   61.287 71.654 1.00 44.48 ? 743 HOH A O   1 
HETATM 4302 O O   . HOH C 3 .   ? 0.913   76.263 77.876 1.00 47.22 ? 744 HOH A O   1 
HETATM 4303 O O   . HOH C 3 .   ? 22.307  78.786 61.248 1.00 49.84 ? 745 HOH A O   1 
HETATM 4304 O O   . HOH C 3 .   ? 16.415  52.606 58.944 1.00 31.91 ? 746 HOH A O   1 
HETATM 4305 O O   . HOH C 3 .   ? 16.644  68.687 84.003 1.00 49.39 ? 747 HOH A O   1 
HETATM 4306 O O   . HOH C 3 .   ? 0.052   66.161 67.315 1.00 45.61 ? 748 HOH A O   1 
HETATM 4307 O O   . HOH C 3 .   ? 25.003  44.534 76.907 1.00 54.36 ? 749 HOH A O   1 
HETATM 4308 O O   . HOH C 3 .   ? -3.187  52.665 43.631 1.00 51.24 ? 750 HOH A O   1 
HETATM 4309 O O   . HOH C 3 .   ? -2.669  69.665 29.102 1.00 54.96 ? 751 HOH A O   1 
HETATM 4310 O O   . HOH C 3 .   ? -3.858  68.340 65.760 1.00 49.88 ? 752 HOH A O   1 
HETATM 4311 O O   . HOH C 3 .   ? 26.771  68.534 59.117 1.00 57.37 ? 753 HOH A O   1 
HETATM 4312 O O   . HOH C 3 .   ? -7.907  59.451 41.838 1.00 39.44 ? 754 HOH A O   1 
HETATM 4313 O O   . HOH C 3 .   ? 5.560   62.460 79.501 1.00 50.78 ? 755 HOH A O   1 
HETATM 4314 O O   . HOH C 3 .   ? 12.093  77.645 62.335 1.00 38.00 ? 756 HOH A O   1 
HETATM 4315 O O   . HOH C 3 .   ? 19.220  78.127 43.310 1.00 43.89 ? 757 HOH A O   1 
HETATM 4316 O O   . HOH C 3 .   ? 7.012   62.596 35.109 1.00 52.23 ? 758 HOH A O   1 
HETATM 4317 O O   . HOH C 3 .   ? -2.909  57.797 36.195 1.00 57.74 ? 759 HOH A O   1 
HETATM 4318 O O   . HOH C 3 .   ? 29.030  60.522 83.900 1.00 49.75 ? 760 HOH A O   1 
HETATM 4319 O O   . HOH C 3 .   ? -4.847  74.875 69.868 1.00 52.40 ? 761 HOH A O   1 
HETATM 4320 O O   . HOH C 3 .   ? -10.187 65.490 37.872 1.00 38.74 ? 762 HOH A O   1 
HETATM 4321 O O   . HOH C 3 .   ? 15.152  64.720 83.781 1.00 42.75 ? 763 HOH A O   1 
HETATM 4322 O O   . HOH C 3 .   ? -3.564  85.659 53.563 1.00 48.55 ? 764 HOH A O   1 
HETATM 4323 O O   . HOH C 3 .   ? -1.201  66.340 39.647 1.00 46.92 ? 765 HOH A O   1 
HETATM 4324 O O   . HOH C 3 .   ? 21.710  62.233 32.824 1.00 48.39 ? 766 HOH A O   1 
HETATM 4325 O O   . HOH C 3 .   ? 7.894   75.709 34.135 1.00 45.98 ? 767 HOH A O   1 
HETATM 4326 O O   . HOH C 3 .   ? -11.866 67.502 36.941 1.00 47.03 ? 768 HOH A O   1 
HETATM 4327 O O   . HOH C 3 .   ? -4.203  70.679 33.855 1.00 39.48 ? 769 HOH A O   1 
HETATM 4328 O O   . HOH C 3 .   ? 7.696   78.073 35.861 1.00 56.41 ? 770 HOH A O   1 
HETATM 4329 O O   . HOH C 3 .   ? 15.941  62.176 83.973 1.00 42.95 ? 771 HOH A O   1 
HETATM 4330 O O   . HOH C 3 .   ? -19.220 85.513 48.364 1.00 63.90 ? 772 HOH A O   1 
HETATM 4331 O O   . HOH C 3 .   ? 25.819  66.159 59.737 1.00 58.32 ? 773 HOH A O   1 
HETATM 4332 O O   . HOH C 3 .   ? 8.941   76.761 75.953 1.00 41.70 ? 774 HOH A O   1 
HETATM 4333 O O   . HOH C 3 .   ? 22.246  53.185 54.696 1.00 54.21 ? 775 HOH A O   1 
HETATM 4334 O O   . HOH C 3 .   ? -19.118 61.063 41.943 1.00 55.57 ? 776 HOH A O   1 
HETATM 4335 O O   . HOH C 3 .   ? -21.657 48.060 57.239 1.00 71.08 ? 777 HOH A O   1 
HETATM 4336 O O   . HOH C 3 .   ? 0.228   41.057 57.051 1.00 50.34 ? 778 HOH A O   1 
HETATM 4337 O O   . HOH C 3 .   ? -14.264 66.157 66.932 1.00 55.23 ? 779 HOH A O   1 
HETATM 4338 O O   . HOH C 3 .   ? 1.359   62.338 70.794 1.00 69.20 ? 780 HOH A O   1 
HETATM 4339 O O   . HOH C 3 .   ? 11.590  77.427 83.273 1.00 63.24 ? 781 HOH A O   1 
HETATM 4340 O O   . HOH C 3 .   ? 2.143   89.896 53.923 1.00 44.59 ? 782 HOH A O   1 
HETATM 4341 O O   . HOH C 3 .   ? 9.821   62.366 35.294 1.00 36.16 ? 783 HOH A O   1 
HETATM 4342 O O   . HOH C 3 .   ? -19.351 63.777 60.596 1.00 47.31 ? 784 HOH A O   1 
HETATM 4343 O O   . HOH C 3 .   ? 7.091   81.963 65.033 1.00 61.70 ? 785 HOH A O   1 
HETATM 4344 O O   . HOH C 3 .   ? -24.289 45.024 60.269 1.00 59.59 ? 786 HOH A O   1 
HETATM 4345 O O   . HOH C 3 .   ? 3.046   86.898 37.446 1.00 66.76 ? 787 HOH A O   1 
HETATM 4346 O O   . HOH C 3 .   ? 13.422  74.782 78.768 1.00 59.97 ? 788 HOH A O   1 
HETATM 4347 O O   . HOH C 3 .   ? 6.708   79.074 63.701 1.00 66.95 ? 789 HOH A O   1 
HETATM 4348 O O   . HOH C 3 .   ? -14.361 78.408 49.848 1.00 53.08 ? 790 HOH A O   1 
HETATM 4349 O O   . HOH C 3 .   ? -8.203  52.237 44.553 1.00 53.62 ? 791 HOH A O   1 
HETATM 4350 O O   . HOH C 3 .   ? -19.593 77.995 46.533 1.00 61.52 ? 792 HOH A O   1 
HETATM 4351 O O   . HOH C 3 .   ? 3.284   47.662 64.752 1.00 62.35 ? 793 HOH A O   1 
HETATM 4352 O O   . HOH C 3 .   ? 5.212   57.477 75.641 1.00 54.26 ? 794 HOH A O   1 
HETATM 4353 O O   . HOH C 3 .   ? -6.322  58.860 39.859 1.00 55.57 ? 795 HOH A O   1 
HETATM 4354 O O   . HOH C 3 .   ? 22.759  59.588 85.627 1.00 64.78 ? 796 HOH A O   1 
HETATM 4355 O O   . HOH C 3 .   ? 10.007  74.651 33.520 1.00 62.73 ? 797 HOH A O   1 
HETATM 4356 O O   . HOH C 3 .   ? -6.828  57.143 73.470 1.00 55.21 ? 798 HOH A O   1 
HETATM 4357 O O   . HOH C 3 .   ? -3.869  47.107 71.232 1.00 61.87 ? 799 HOH A O   1 
HETATM 4358 O O   . HOH C 3 .   ? -11.981 65.683 34.632 1.00 56.34 ? 800 HOH A O   1 
HETATM 4359 O O   . HOH C 3 .   ? -5.652  88.688 42.040 1.00 63.01 ? 801 HOH A O   1 
HETATM 4360 O O   . HOH C 3 .   ? 18.526  91.037 61.838 1.00 60.64 ? 802 HOH A O   1 
HETATM 4361 O O   . HOH C 3 .   ? -10.431 81.947 55.180 1.00 64.93 ? 803 HOH A O   1 
HETATM 4362 O O   . HOH C 3 .   ? 19.562  74.438 70.641 1.00 65.27 ? 804 HOH A O   1 
HETATM 4363 O O   . HOH C 3 .   ? -24.611 58.355 54.026 1.00 60.59 ? 805 HOH A O   1 
HETATM 4364 O O   . HOH C 3 .   ? 31.809  72.832 51.619 1.00 68.42 ? 806 HOH A O   1 
HETATM 4365 O O   . HOH C 3 .   ? 13.213  58.963 78.645 1.00 45.83 ? 807 HOH A O   1 
HETATM 4366 O O   . HOH C 3 .   ? 25.234  66.339 74.026 1.00 58.99 ? 808 HOH A O   1 
HETATM 4367 O O   . HOH C 3 .   ? 21.647  78.411 42.596 1.00 60.23 ? 809 HOH A O   1 
HETATM 4368 O O   . HOH C 3 .   ? 31.459  58.656 50.330 1.00 57.98 ? 810 HOH A O   1 
HETATM 4369 O O   . HOH C 3 .   ? 10.815  75.978 77.910 1.00 67.35 ? 811 HOH A O   1 
HETATM 4370 O O   . HOH C 3 .   ? 1.348   41.264 54.131 1.00 59.07 ? 812 HOH A O   1 
HETATM 4371 O O   . HOH C 3 .   ? -4.269  68.253 31.374 1.00 65.94 ? 813 HOH A O   1 
HETATM 4372 O O   . HOH C 3 .   ? 20.485  58.812 40.657 1.00 57.70 ? 814 HOH A O   1 
HETATM 4373 O O   . HOH C 3 .   ? 8.499   45.406 43.242 1.00 60.58 ? 815 HOH A O   1 
HETATM 4374 O O   . HOH C 3 .   ? -12.364 65.014 41.341 1.00 53.36 ? 816 HOH A O   1 
HETATM 4375 O O   . HOH C 3 .   ? 24.108  69.682 73.844 1.00 58.56 ? 817 HOH A O   1 
HETATM 4376 O O   . HOH C 3 .   ? 20.352  44.517 79.645 1.00 72.66 ? 818 HOH A O   1 
HETATM 4377 O O   . HOH C 3 .   ? 16.239  49.954 56.462 1.00 64.27 ? 819 HOH A O   1 
HETATM 4378 O O   . HOH C 3 .   ? -6.995  49.281 73.677 1.00 68.37 ? 820 HOH A O   1 
HETATM 4379 O O   . HOH C 3 .   ? 4.374   50.041 66.719 1.00 52.86 ? 821 HOH A O   1 
HETATM 4380 O O   . HOH C 3 .   ? 21.732  77.485 64.198 1.00 58.18 ? 822 HOH A O   1 
HETATM 4381 O O   . HOH C 3 .   ? 18.642  79.484 46.291 1.00 48.22 ? 823 HOH A O   1 
HETATM 4382 O O   . HOH C 3 .   ? 29.564  64.801 83.566 1.00 62.51 ? 824 HOH A O   1 
HETATM 4383 O O   . HOH C 3 .   ? 5.769   58.956 78.899 1.00 60.01 ? 825 HOH A O   1 
HETATM 4384 O O   . HOH C 3 .   ? 11.882  56.033 83.715 1.00 58.17 ? 826 HOH A O   1 
HETATM 4385 O O   . HOH C 3 .   ? -4.316  80.832 58.331 1.00 69.89 ? 827 HOH A O   1 
HETATM 4386 O O   . HOH C 3 .   ? 7.026   91.899 55.453 1.00 59.73 ? 828 HOH A O   1 
HETATM 4387 O O   . HOH C 3 .   ? -1.334  95.343 45.154 1.00 70.13 ? 829 HOH A O   1 
HETATM 4388 O O   . HOH C 3 .   ? 4.846   86.627 41.154 1.00 56.72 ? 830 HOH A O   1 
HETATM 4389 O O   . HOH C 3 .   ? 1.834   68.130 66.574 1.00 54.72 ? 831 HOH A O   1 
HETATM 4390 O O   . HOH C 3 .   ? 19.646  73.619 77.161 1.00 64.52 ? 832 HOH A O   1 
HETATM 4391 O O   . HOH C 3 .   ? 18.999  84.971 49.912 1.00 58.37 ? 833 HOH A O   1 
HETATM 4392 O O   . HOH C 3 .   ? 20.457  56.012 86.751 1.00 60.12 ? 834 HOH A O   1 
HETATM 4393 O O   . HOH C 3 .   ? 24.547  54.170 41.125 1.00 63.97 ? 835 HOH A O   1 
HETATM 4394 O O   . HOH C 3 .   ? 30.177  52.354 65.630 1.00 58.31 ? 836 HOH A O   1 
HETATM 4395 O O   . HOH C 3 .   ? 12.512  65.768 33.430 1.00 71.69 ? 837 HOH A O   1 
HETATM 4396 O O   . HOH C 3 .   ? 3.395   93.410 53.975 1.00 74.48 ? 838 HOH A O   1 
HETATM 4397 O O   . HOH C 3 .   ? 2.672   41.822 60.682 1.00 69.56 ? 839 HOH A O   1 
HETATM 4398 O O   . HOH C 3 .   ? -21.429 62.677 50.768 1.00 65.04 ? 840 HOH A O   1 
HETATM 4399 O O   . HOH C 3 .   ? 19.192  65.307 36.712 1.00 60.88 ? 841 HOH A O   1 
HETATM 4400 O O   . HOH C 3 .   ? -0.285  41.734 63.830 1.00 69.01 ? 842 HOH A O   1 
HETATM 4401 O O   . HOH C 3 .   ? 6.087   48.459 55.829 1.00 48.23 ? 843 HOH A O   1 
HETATM 4402 O O   . HOH C 3 .   ? 20.663  68.458 70.320 1.00 62.91 ? 844 HOH A O   1 
HETATM 4403 O O   . HOH C 3 .   ? -10.258 69.199 78.189 1.00 59.30 ? 845 HOH A O   1 
HETATM 4404 O O   . HOH C 3 .   ? 11.283  70.413 33.742 1.00 55.83 ? 846 HOH A O   1 
HETATM 4405 O O   . HOH C 3 .   ? -15.927 39.601 58.347 1.00 74.26 ? 847 HOH A O   1 
HETATM 4406 O O   . HOH C 3 .   ? -5.388  73.376 72.681 1.00 56.59 ? 848 HOH A O   1 
HETATM 4407 O O   . HOH C 3 .   ? -8.017  81.005 58.729 1.00 74.52 ? 849 HOH A O   1 
HETATM 4408 O O   . HOH C 3 .   ? 6.016   80.789 33.598 1.00 65.84 ? 850 HOH A O   1 
HETATM 4409 O O   . HOH C 3 .   ? -14.850 41.949 54.490 1.00 53.69 ? 851 HOH A O   1 
HETATM 4410 O O   . HOH C 3 .   ? 20.407  70.843 71.193 1.00 64.06 ? 852 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ASP 1   1   ?   ?   ?   A . n 
A 1 2   ASP 2   2   ?   ?   ?   A . n 
A 1 3   HIS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   4   SER SER A . n 
A 1 5   GLU 5   5   5   GLU GLU A . n 
A 1 6   LEU 6   6   6   LEU LEU A . n 
A 1 7   LEU 7   7   7   LEU LEU A . n 
A 1 8   VAL 8   8   8   VAL VAL A . n 
A 1 9   ASN 9   9   9   ASN ASN A . n 
A 1 10  THR 10  10  10  THR THR A . n 
A 1 11  LYS 11  11  11  LYS LYS A . n 
A 1 12  SER 12  12  12  SER SER A . n 
A 1 13  GLY 13  13  13  GLY GLY A . n 
A 1 14  LYS 14  14  14  LYS LYS A . n 
A 1 15  VAL 15  15  15  VAL VAL A . n 
A 1 16  MET 16  16  16  MET MET A . n 
A 1 17  GLY 17  17  17  GLY GLY A . n 
A 1 18  THR 18  18  18  THR THR A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  PRO 21  21  21  PRO PRO A . n 
A 1 22  VAL 22  22  22  VAL VAL A . n 
A 1 23  LEU 23  23  23  LEU LEU A . n 
A 1 24  SER 24  24  24  SER SER A . n 
A 1 25  SER 25  25  25  SER SER A . n 
A 1 26  HIS 26  26  26  HIS HIS A . n 
A 1 27  ILE 27  27  27  ILE ILE A . n 
A 1 28  SER 28  28  28  SER SER A . n 
A 1 29  ALA 29  29  29  ALA ALA A . n 
A 1 30  PHE 30  30  30  PHE PHE A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  GLY 32  32  32  GLY GLY A . n 
A 1 33  ILE 33  33  33  ILE ILE A . n 
A 1 34  PRO 34  34  34  PRO PRO A . n 
A 1 35  PHE 35  35  35  PHE PHE A . n 
A 1 36  ALA 36  36  36  ALA ALA A . n 
A 1 37  GLU 37  37  37  GLU GLU A . n 
A 1 38  PRO 38  38  38  PRO PRO A . n 
A 1 39  PRO 39  39  39  PRO PRO A . n 
A 1 40  VAL 40  40  40  VAL VAL A . n 
A 1 41  GLY 41  41  41  GLY GLY A . n 
A 1 42  ASN 42  42  42  ASN ASN A . n 
A 1 43  MET 43  43  43  MET MET A . n 
A 1 44  ARG 44  44  44  ARG ARG A . n 
A 1 45  PHE 45  45  45  PHE PHE A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  PRO 48  48  48  PRO PRO A . n 
A 1 49  GLU 49  49  49  GLU GLU A . n 
A 1 50  PRO 50  50  50  PRO PRO A . n 
A 1 51  LYS 51  51  51  LYS LYS A . n 
A 1 52  LYS 52  52  52  LYS LYS A . n 
A 1 53  PRO 53  53  53  PRO PRO A . n 
A 1 54  TRP 54  54  54  TRP TRP A . n 
A 1 55  SER 55  55  55  SER SER A . n 
A 1 56  GLY 56  56  56  GLY GLY A . n 
A 1 57  VAL 57  57  57  VAL VAL A . n 
A 1 58  TRP 58  58  58  TRP TRP A . n 
A 1 59  ASN 59  59  59  ASN ASN A . n 
A 1 60  ALA 60  60  60  ALA ALA A . n 
A 1 61  SER 61  61  61  SER SER A . n 
A 1 62  THR 62  62  62  THR THR A . n 
A 1 63  TYR 63  63  63  TYR TYR A . n 
A 1 64  PRO 64  64  64  PRO PRO A . n 
A 1 65  ASN 65  65  65  ASN ASN A . n 
A 1 66  ASN 66  66  66  ASN ASN A . n 
A 1 67  CYS 67  67  67  CYS CYS A . n 
A 1 68  GLN 68  68  68  GLN GLN A . n 
A 1 69  GLN 69  69  69  GLN GLN A . n 
A 1 70  TYR 70  70  70  TYR TYR A . n 
A 1 71  VAL 71  71  71  VAL VAL A . n 
A 1 72  ASP 72  72  72  ASP ASP A . n 
A 1 73  GLU 73  73  73  GLU GLU A . n 
A 1 74  GLN 74  74  74  GLN GLN A . n 
A 1 75  PHE 75  75  75  PHE PHE A . n 
A 1 76  PRO 76  76  76  PRO PRO A . n 
A 1 77  GLY 77  77  77  GLY GLY A . n 
A 1 78  PHE 78  78  78  PHE PHE A . n 
A 1 79  SER 79  79  79  SER SER A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  SER 81  81  81  SER SER A . n 
A 1 82  GLU 82  82  82  GLU GLU A . n 
A 1 83  MET 83  83  83  MET MET A . n 
A 1 84  TRP 84  84  84  TRP TRP A . n 
A 1 85  ASN 85  85  85  ASN ASN A . n 
A 1 86  PRO 86  86  86  PRO PRO A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  ARG 88  88  88  ARG ARG A . n 
A 1 89  GLU 89  89  89  GLU GLU A . n 
A 1 90  MET 90  90  90  MET MET A . n 
A 1 91  SER 91  91  91  SER SER A . n 
A 1 92  GLU 92  92  92  GLU GLU A . n 
A 1 93  ASP 93  93  93  ASP ASP A . n 
A 1 94  CYS 94  94  94  CYS CYS A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  TYR 96  96  96  TYR TYR A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  ASN 98  98  98  ASN ASN A . n 
A 1 99  ILE 99  99  99  ILE ILE A . n 
A 1 100 TRP 100 100 100 TRP TRP A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 PRO 102 102 102 PRO PRO A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 PRO 104 104 104 PRO PRO A . n 
A 1 105 ARG 105 105 105 ARG ARG A . n 
A 1 106 PRO 106 106 106 PRO PRO A . n 
A 1 107 LYS 107 107 107 LYS LYS A . n 
A 1 108 SER 108 108 108 SER SER A . n 
A 1 109 THR 109 109 109 THR THR A . n 
A 1 110 THR 110 110 110 THR THR A . n 
A 1 111 VAL 111 111 111 VAL VAL A . n 
A 1 112 MET 112 112 112 MET MET A . n 
A 1 113 VAL 113 113 113 VAL VAL A . n 
A 1 114 TRP 114 114 114 TRP TRP A . n 
A 1 115 ILE 115 115 115 ILE ILE A . n 
A 1 116 TYR 116 116 116 TYR TYR A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 GLY 118 118 118 GLY GLY A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 PHE 120 120 120 PHE PHE A . n 
A 1 121 TYR 121 121 121 TYR TYR A . n 
A 1 122 SER 122 122 122 SER SER A . n 
A 1 123 GLY 123 123 123 GLY GLY A . n 
A 1 124 SER 124 124 124 SER SER A . n 
A 1 125 SER 125 125 125 SER SER A . n 
A 1 126 THR 126 126 126 THR THR A . n 
A 1 127 LEU 127 127 127 LEU LEU A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 VAL 129 129 129 VAL VAL A . n 
A 1 130 TYR 130 130 130 TYR TYR A . n 
A 1 131 ASN 131 131 131 ASN ASN A . n 
A 1 132 GLY 132 132 132 GLY GLY A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 TYR 134 134 134 TYR TYR A . n 
A 1 135 LEU 135 135 135 LEU LEU A . n 
A 1 136 ALA 136 136 136 ALA ALA A . n 
A 1 137 TYR 137 137 137 TYR TYR A . n 
A 1 138 THR 138 138 138 THR THR A . n 
A 1 139 GLU 139 139 139 GLU GLU A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 VAL 141 141 141 VAL VAL A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 VAL 144 144 144 VAL VAL A . n 
A 1 145 SER 145 145 145 SER SER A . n 
A 1 146 LEU 146 146 146 LEU LEU A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 TYR 148 148 148 TYR TYR A . n 
A 1 149 ARG 149 149 149 ARG ARG A . n 
A 1 150 VAL 150 150 150 VAL VAL A . n 
A 1 151 GLY 151 151 151 GLY GLY A . n 
A 1 152 ALA 152 152 152 ALA ALA A . n 
A 1 153 PHE 153 153 153 PHE PHE A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 PHE 155 155 155 PHE PHE A . n 
A 1 156 LEU 156 156 156 LEU LEU A . n 
A 1 157 ALA 157 157 157 ALA ALA A . n 
A 1 158 LEU 158 158 158 LEU LEU A . n 
A 1 159 HIS 159 159 159 HIS HIS A . n 
A 1 160 GLY 160 160 160 GLY GLY A . n 
A 1 161 SER 161 161 161 SER SER A . n 
A 1 162 GLN 162 162 162 GLN GLN A . n 
A 1 163 GLU 163 163 163 GLU GLU A . n 
A 1 164 ALA 164 164 164 ALA ALA A . n 
A 1 165 PRO 165 165 165 PRO PRO A . n 
A 1 166 GLY 166 166 166 GLY GLY A . n 
A 1 167 ASN 167 167 167 ASN ASN A . n 
A 1 168 VAL 168 168 168 VAL VAL A . n 
A 1 169 GLY 169 169 169 GLY GLY A . n 
A 1 170 LEU 170 170 170 LEU LEU A . n 
A 1 171 LEU 171 171 171 LEU LEU A . n 
A 1 172 ASP 172 172 172 ASP ASP A . n 
A 1 173 GLN 173 173 173 GLN GLN A . n 
A 1 174 ARG 174 174 174 ARG ARG A . n 
A 1 175 MET 175 175 175 MET MET A . n 
A 1 176 ALA 176 176 176 ALA ALA A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 GLN 178 178 178 GLN GLN A . n 
A 1 179 TRP 179 179 179 TRP TRP A . n 
A 1 180 VAL 180 180 180 VAL VAL A . n 
A 1 181 HIS 181 181 181 HIS HIS A . n 
A 1 182 ASP 182 182 182 ASP ASP A . n 
A 1 183 ASN 183 183 183 ASN ASN A . n 
A 1 184 ILE 184 184 184 ILE ILE A . n 
A 1 185 GLN 185 185 185 GLN GLN A . n 
A 1 186 PHE 186 186 186 PHE PHE A . n 
A 1 187 PHE 187 187 187 PHE PHE A . n 
A 1 188 GLY 188 188 188 GLY GLY A . n 
A 1 189 GLY 189 189 189 GLY GLY A . n 
A 1 190 ASP 190 190 190 ASP ASP A . n 
A 1 191 PRO 191 191 191 PRO PRO A . n 
A 1 192 LYS 192 192 192 LYS LYS A . n 
A 1 193 THR 193 193 193 THR THR A . n 
A 1 194 VAL 194 194 194 VAL VAL A . n 
A 1 195 THR 195 195 195 THR THR A . n 
A 1 196 ILE 196 196 196 ILE ILE A . n 
A 1 197 PHE 197 197 197 PHE PHE A . n 
A 1 198 GLY 198 198 198 GLY GLY A . n 
A 1 199 GLU 199 199 199 GLU GLU A . n 
A 1 200 SER 200 200 200 SER SER A . n 
A 1 201 ALA 201 201 201 ALA ALA A . n 
A 1 202 GLY 202 202 202 GLY GLY A . n 
A 1 203 GLY 203 203 203 GLY GLY A . n 
A 1 204 ALA 204 204 204 ALA ALA A . n 
A 1 205 SER 205 205 205 SER SER A . n 
A 1 206 VAL 206 206 206 VAL VAL A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 MET 208 208 208 MET MET A . n 
A 1 209 HIS 209 209 209 HIS HIS A . n 
A 1 210 ILE 210 210 210 ILE ILE A . n 
A 1 211 LEU 211 211 211 LEU LEU A . n 
A 1 212 SER 212 212 212 SER SER A . n 
A 1 213 PRO 213 213 213 PRO PRO A . n 
A 1 214 GLY 214 214 214 GLY GLY A . n 
A 1 215 SER 215 215 215 SER SER A . n 
A 1 216 ARG 216 216 216 ARG ARG A . n 
A 1 217 ASP 217 217 217 ASP ASP A . n 
A 1 218 LEU 218 218 218 LEU LEU A . n 
A 1 219 PHE 219 219 219 PHE PHE A . n 
A 1 220 ARG 220 220 220 ARG ARG A . n 
A 1 221 ARG 221 221 221 ARG ARG A . n 
A 1 222 ALA 222 222 222 ALA ALA A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLN 225 225 225 GLN GLN A . n 
A 1 226 SER 226 226 226 SER SER A . n 
A 1 227 GLY 227 227 227 GLY GLY A . n 
A 1 228 SER 228 228 228 SER SER A . n 
A 1 229 PRO 229 229 229 PRO PRO A . n 
A 1 230 ASN 230 230 230 ASN ASN A . n 
A 1 231 CYS 231 231 231 CYS CYS A . n 
A 1 232 PRO 232 232 232 PRO PRO A . n 
A 1 233 TRP 233 233 233 TRP TRP A . n 
A 1 234 ALA 234 234 234 ALA ALA A . n 
A 1 235 SER 235 235 235 SER SER A . n 
A 1 236 VAL 236 236 236 VAL VAL A . n 
A 1 237 SER 237 237 237 SER SER A . n 
A 1 238 VAL 238 238 238 VAL VAL A . n 
A 1 239 ALA 239 239 239 ALA ALA A . n 
A 1 240 GLU 240 240 240 GLU GLU A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 ARG 242 242 242 ARG ARG A . n 
A 1 243 ARG 243 243 243 ARG ARG A . n 
A 1 244 ARG 244 244 244 ARG ARG A . n 
A 1 245 ALA 245 245 245 ALA ALA A . n 
A 1 246 VAL 246 246 246 VAL VAL A . n 
A 1 247 GLU 247 247 247 GLU GLU A . n 
A 1 248 LEU 248 248 248 LEU LEU A . n 
A 1 249 GLY 249 249 249 GLY GLY A . n 
A 1 250 ARG 250 250 250 ARG ARG A . n 
A 1 251 ASN 251 251 251 ASN ASN A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 ASN 253 253 253 ASN ASN A . n 
A 1 254 CYS 254 254 254 CYS CYS A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 LEU 256 256 256 LEU LEU A . n 
A 1 257 ASN 257 257 257 ASN ASN A . n 
A 1 258 SER 258 258 258 SER SER A . n 
A 1 259 ASP 259 259 259 ASP ASP A . n 
A 1 260 GLU 260 260 260 GLU GLU A . n 
A 1 261 GLU 261 261 261 GLU GLU A . n 
A 1 262 LEU 262 262 262 LEU LEU A . n 
A 1 263 ILE 263 263 263 ILE ILE A . n 
A 1 264 HIS 264 264 264 HIS HIS A . n 
A 1 265 CYS 265 265 265 CYS CYS A . n 
A 1 266 LEU 266 266 266 LEU LEU A . n 
A 1 267 ARG 267 267 267 ARG ARG A . n 
A 1 268 GLU 268 268 268 GLU GLU A . n 
A 1 269 LYS 269 269 269 LYS LYS A . n 
A 1 270 LYS 270 270 270 LYS LYS A . n 
A 1 271 PRO 271 271 271 PRO PRO A . n 
A 1 272 GLN 272 272 272 GLN GLN A . n 
A 1 273 GLU 273 273 273 GLU GLU A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 ASP 276 276 276 ASP ASP A . n 
A 1 277 VAL 277 277 277 VAL VAL A . n 
A 1 278 GLU 278 278 278 GLU GLU A . n 
A 1 279 TRP 279 279 279 TRP TRP A . n 
A 1 280 ASN 280 280 280 ASN ASN A . n 
A 1 281 VAL 281 281 281 VAL VAL A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 PRO 283 283 283 PRO PRO A . n 
A 1 284 PHE 284 284 284 PHE PHE A . n 
A 1 285 ASP 285 285 285 ASP ASP A . n 
A 1 286 SER 286 286 286 SER SER A . n 
A 1 287 ILE 287 287 287 ILE ILE A . n 
A 1 288 PHE 288 288 288 PHE PHE A . n 
A 1 289 ARG 289 289 289 ARG ARG A . n 
A 1 290 PHE 290 290 290 PHE PHE A . n 
A 1 291 SER 291 291 291 SER SER A . n 
A 1 292 PHE 292 292 292 PHE PHE A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 PRO 294 294 294 PRO PRO A . n 
A 1 295 VAL 295 295 295 VAL VAL A . n 
A 1 296 ILE 296 296 296 ILE ILE A . n 
A 1 297 ASP 297 297 297 ASP ASP A . n 
A 1 298 GLY 298 298 298 GLY GLY A . n 
A 1 299 GLU 299 299 299 GLU GLU A . n 
A 1 300 PHE 300 300 300 PHE PHE A . n 
A 1 301 PHE 301 301 301 PHE PHE A . n 
A 1 302 PRO 302 302 302 PRO PRO A . n 
A 1 303 THR 303 303 303 THR THR A . n 
A 1 304 SER 304 304 304 SER SER A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 GLU 306 306 306 GLU GLU A . n 
A 1 307 SER 307 307 307 SER SER A . n 
A 1 308 MET 308 308 308 MET MET A . n 
A 1 309 LEU 309 309 309 LEU LEU A . n 
A 1 310 ASN 310 310 310 ASN ASN A . n 
A 1 311 SER 311 311 311 SER SER A . n 
A 1 312 GLY 312 312 312 GLY GLY A . n 
A 1 313 ASN 313 313 313 ASN ASN A . n 
A 1 314 PHE 314 314 314 PHE PHE A . n 
A 1 315 LYS 315 315 315 LYS LYS A . n 
A 1 316 LYS 316 316 316 LYS LYS A . n 
A 1 317 THR 317 317 317 THR THR A . n 
A 1 318 GLN 318 318 318 GLN GLN A . n 
A 1 319 ILE 319 319 319 ILE ILE A . n 
A 1 320 LEU 320 320 320 LEU LEU A . n 
A 1 321 LEU 321 321 321 LEU LEU A . n 
A 1 322 GLY 322 322 322 GLY GLY A . n 
A 1 323 VAL 323 323 323 VAL VAL A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 LYS 325 325 325 LYS LYS A . n 
A 1 326 ASP 326 326 326 ASP ASP A . n 
A 1 327 GLU 327 327 327 GLU GLU A . n 
A 1 328 GLY 328 328 328 GLY GLY A . n 
A 1 329 SER 329 329 329 SER SER A . n 
A 1 330 PHE 330 330 330 PHE PHE A . n 
A 1 331 PHE 331 331 331 PHE PHE A . n 
A 1 332 LEU 332 332 332 LEU LEU A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 TYR 334 334 334 TYR TYR A . n 
A 1 335 GLY 335 335 335 GLY GLY A . n 
A 1 336 ALA 336 336 336 ALA ALA A . n 
A 1 337 PRO 337 337 337 PRO PRO A . n 
A 1 338 GLY 338 338 338 GLY GLY A . n 
A 1 339 PHE 339 339 339 PHE PHE A . n 
A 1 340 SER 340 340 340 SER SER A . n 
A 1 341 LYS 341 341 341 LYS LYS A . n 
A 1 342 ASP 342 342 342 ASP ASP A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 GLU 344 344 344 GLU GLU A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 LYS 346 346 346 LYS LYS A . n 
A 1 347 ILE 347 347 347 ILE ILE A . n 
A 1 348 SER 348 348 348 SER SER A . n 
A 1 349 ARG 349 349 349 ARG ARG A . n 
A 1 350 GLU 350 350 350 GLU GLU A . n 
A 1 351 ASP 351 351 351 ASP ASP A . n 
A 1 352 PHE 352 352 352 PHE PHE A . n 
A 1 353 MET 353 353 353 MET MET A . n 
A 1 354 SER 354 354 354 SER SER A . n 
A 1 355 GLY 355 355 355 GLY GLY A . n 
A 1 356 VAL 356 356 356 VAL VAL A . n 
A 1 357 LYS 357 357 357 LYS LYS A . n 
A 1 358 LEU 358 358 358 LEU LEU A . n 
A 1 359 SER 359 359 359 SER SER A . n 
A 1 360 VAL 360 360 360 VAL VAL A . n 
A 1 361 PRO 361 361 361 PRO PRO A . n 
A 1 362 HIS 362 362 362 HIS HIS A . n 
A 1 363 ALA 363 363 363 ALA ALA A . n 
A 1 364 ASN 364 364 364 ASN ASN A . n 
A 1 365 ASP 365 365 365 ASP ASP A . n 
A 1 366 LEU 366 366 366 LEU LEU A . n 
A 1 367 GLY 367 367 367 GLY GLY A . n 
A 1 368 LEU 368 368 368 LEU LEU A . n 
A 1 369 ASP 369 369 369 ASP ASP A . n 
A 1 370 ALA 370 370 370 ALA ALA A . n 
A 1 371 VAL 371 371 371 VAL VAL A . n 
A 1 372 THR 372 372 372 THR THR A . n 
A 1 373 LEU 373 373 373 LEU LEU A . n 
A 1 374 GLN 374 374 374 GLN GLN A . n 
A 1 375 TYR 375 375 375 TYR TYR A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ASP 377 377 377 ASP ASP A . n 
A 1 378 TRP 378 378 378 TRP TRP A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 ASP 381 381 381 ASP ASP A . n 
A 1 382 ASN 382 382 382 ASN ASN A . n 
A 1 383 ASN 383 383 383 ASN ASN A . n 
A 1 384 GLY 384 384 384 GLY GLY A . n 
A 1 385 ILE 385 385 385 ILE ILE A . n 
A 1 386 LYS 386 386 386 LYS LYS A . n 
A 1 387 ASN 387 387 387 ASN ASN A . n 
A 1 388 ARG 388 388 388 ARG ARG A . n 
A 1 389 ASP 389 389 389 ASP ASP A . n 
A 1 390 GLY 390 390 390 GLY GLY A . n 
A 1 391 LEU 391 391 391 LEU LEU A . n 
A 1 392 ASP 392 392 392 ASP ASP A . n 
A 1 393 ASP 393 393 393 ASP ASP A . n 
A 1 394 ILE 394 394 394 ILE ILE A . n 
A 1 395 VAL 395 395 395 VAL VAL A . n 
A 1 396 GLY 396 396 396 GLY GLY A . n 
A 1 397 ASP 397 397 397 ASP ASP A . n 
A 1 398 HIS 398 398 398 HIS HIS A . n 
A 1 399 ASN 399 399 399 ASN ASN A . n 
A 1 400 VAL 400 400 400 VAL VAL A . n 
A 1 401 ILE 401 401 401 ILE ILE A . n 
A 1 402 CYS 402 402 402 CYS CYS A . n 
A 1 403 PRO 403 403 403 PRO PRO A . n 
A 1 404 LEU 404 404 404 LEU LEU A . n 
A 1 405 MET 405 405 405 MET MET A . n 
A 1 406 HIS 406 406 406 HIS HIS A . n 
A 1 407 PHE 407 407 407 PHE PHE A . n 
A 1 408 VAL 408 408 408 VAL VAL A . n 
A 1 409 ASN 409 409 409 ASN ASN A . n 
A 1 410 LYS 410 410 410 LYS LYS A . n 
A 1 411 TYR 411 411 411 TYR TYR A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 LYS 413 413 413 LYS LYS A . n 
A 1 414 PHE 414 414 414 PHE PHE A . n 
A 1 415 GLY 415 415 415 GLY GLY A . n 
A 1 416 ASN 416 416 416 ASN ASN A . n 
A 1 417 GLY 417 417 417 GLY GLY A . n 
A 1 418 THR 418 418 418 THR THR A . n 
A 1 419 TYR 419 419 419 TYR TYR A . n 
A 1 420 LEU 420 420 420 LEU LEU A . n 
A 1 421 TYR 421 421 421 TYR TYR A . n 
A 1 422 PHE 422 422 422 PHE PHE A . n 
A 1 423 PHE 423 423 423 PHE PHE A . n 
A 1 424 ASN 424 424 424 ASN ASN A . n 
A 1 425 HIS 425 425 425 HIS HIS A . n 
A 1 426 ARG 426 426 426 ARG ARG A . n 
A 1 427 ALA 427 427 427 ALA ALA A . n 
A 1 428 SER 428 428 428 SER SER A . n 
A 1 429 ASN 429 429 429 ASN ASN A . n 
A 1 430 LEU 430 430 430 LEU LEU A . n 
A 1 431 VAL 431 431 431 VAL VAL A . n 
A 1 432 TRP 432 432 432 TRP TRP A . n 
A 1 433 PRO 433 433 433 PRO PRO A . n 
A 1 434 GLU 434 434 434 GLU GLU A . n 
A 1 435 TRP 435 435 435 TRP TRP A . n 
A 1 436 MET 436 436 436 MET MET A . n 
A 1 437 GLY 437 437 437 GLY GLY A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 ILE 439 439 439 ILE ILE A . n 
A 1 440 HIS 440 440 440 HIS HIS A . n 
A 1 441 GLY 441 441 441 GLY GLY A . n 
A 1 442 TYR 442 442 442 TYR TYR A . n 
A 1 443 GLU 443 443 443 GLU GLU A . n 
A 1 444 ILE 444 444 444 ILE ILE A . n 
A 1 445 GLU 445 445 445 GLU GLU A . n 
A 1 446 PHE 446 446 446 PHE PHE A . n 
A 1 447 VAL 447 447 447 VAL VAL A . n 
A 1 448 PHE 448 448 448 PHE PHE A . n 
A 1 449 GLY 449 449 449 GLY GLY A . n 
A 1 450 LEU 450 450 450 LEU LEU A . n 
A 1 451 PRO 451 451 451 PRO PRO A . n 
A 1 452 LEU 452 452 452 LEU LEU A . n 
A 1 453 VAL 453 453 453 VAL VAL A . n 
A 1 454 LYS 454 454 454 LYS LYS A . n 
A 1 455 GLU 455 455 455 GLU GLU A . n 
A 1 456 LEU 456 456 456 LEU LEU A . n 
A 1 457 ASN 457 457 457 ASN ASN A . n 
A 1 458 TYR 458 458 458 TYR TYR A . n 
A 1 459 THR 459 459 459 THR THR A . n 
A 1 460 ALA 460 460 460 ALA ALA A . n 
A 1 461 GLU 461 461 461 GLU GLU A . n 
A 1 462 GLU 462 462 462 GLU GLU A . n 
A 1 463 GLU 463 463 463 GLU GLU A . n 
A 1 464 ALA 464 464 464 ALA ALA A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 SER 466 466 466 SER SER A . n 
A 1 467 ARG 467 467 467 ARG ARG A . n 
A 1 468 ARG 468 468 468 ARG ARG A . n 
A 1 469 ILE 469 469 469 ILE ILE A . n 
A 1 470 MET 470 470 470 MET MET A . n 
A 1 471 HIS 471 471 471 HIS HIS A . n 
A 1 472 TYR 472 472 472 TYR TYR A . n 
A 1 473 TRP 473 473 473 TRP TRP A . n 
A 1 474 ALA 474 474 474 ALA ALA A . n 
A 1 475 THR 475 475 475 THR THR A . n 
A 1 476 PHE 476 476 476 PHE PHE A . n 
A 1 477 ALA 477 477 477 ALA ALA A . n 
A 1 478 LYS 478 478 478 LYS LYS A . n 
A 1 479 THR 479 479 479 THR THR A . n 
A 1 480 GLY 480 480 480 GLY GLY A . n 
A 1 481 ASN 481 481 481 ASN ASN A . n 
A 1 482 PRO 482 482 482 PRO PRO A . n 
A 1 483 ASN 483 483 483 ASN ASN A . n 
A 1 484 GLU 484 484 484 GLU GLU A . n 
A 1 485 PRO 485 485 ?   ?   ?   A . n 
A 1 486 HIS 486 486 ?   ?   ?   A . n 
A 1 487 SER 487 487 ?   ?   ?   A . n 
A 1 488 GLN 488 488 ?   ?   ?   A . n 
A 1 489 GLU 489 489 ?   ?   ?   A . n 
A 1 490 SER 490 490 490 SER SER A . n 
A 1 491 LYS 491 491 491 LYS LYS A . n 
A 1 492 TRP 492 492 492 TRP TRP A . n 
A 1 493 PRO 493 493 493 PRO PRO A . n 
A 1 494 LEU 494 494 494 LEU LEU A . n 
A 1 495 PHE 495 495 495 PHE PHE A . n 
A 1 496 THR 496 496 496 THR THR A . n 
A 1 497 THR 497 497 497 THR THR A . n 
A 1 498 LYS 498 498 498 LYS LYS A . n 
A 1 499 GLU 499 499 499 GLU GLU A . n 
A 1 500 GLN 500 500 500 GLN GLN A . n 
A 1 501 LYS 501 501 501 LYS LYS A . n 
A 1 502 PHE 502 502 502 PHE PHE A . n 
A 1 503 ILE 503 503 503 ILE ILE A . n 
A 1 504 ASP 504 504 504 ASP ASP A . n 
A 1 505 LEU 505 505 505 LEU LEU A . n 
A 1 506 ASN 506 506 506 ASN ASN A . n 
A 1 507 THR 507 507 507 THR THR A . n 
A 1 508 GLU 508 508 508 GLU GLU A . n 
A 1 509 PRO 509 509 509 PRO PRO A . n 
A 1 510 MET 510 510 510 MET MET A . n 
A 1 511 LYS 511 511 511 LYS LYS A . n 
A 1 512 VAL 512 512 512 VAL VAL A . n 
A 1 513 HIS 513 513 513 HIS HIS A . n 
A 1 514 GLN 514 514 514 GLN GLN A . n 
A 1 515 ARG 515 515 515 ARG ARG A . n 
A 1 516 LEU 516 516 516 LEU LEU A . n 
A 1 517 ARG 517 517 517 ARG ARG A . n 
A 1 518 VAL 518 518 518 VAL VAL A . n 
A 1 519 GLN 519 519 519 GLN GLN A . n 
A 1 520 MET 520 520 520 MET MET A . n 
A 1 521 CYS 521 521 521 CYS CYS A . n 
A 1 522 VAL 522 522 522 VAL VAL A . n 
A 1 523 PHE 523 523 523 PHE PHE A . n 
A 1 524 TRP 524 524 524 TRP TRP A . n 
A 1 525 ASN 525 525 525 ASN ASN A . n 
A 1 526 GLN 526 526 526 GLN GLN A . n 
A 1 527 PHE 527 527 527 PHE PHE A . n 
A 1 528 LEU 528 528 528 LEU LEU A . n 
A 1 529 PRO 529 529 529 PRO PRO A . n 
A 1 530 LYS 530 530 530 LYS LYS A . n 
A 1 531 LEU 531 531 531 LEU LEU A . n 
A 1 532 LEU 532 532 532 LEU LEU A . n 
A 1 533 ASN 533 533 533 ASN ASN A . n 
A 1 534 ALA 534 534 534 ALA ALA A . n 
A 1 535 THR 535 535 535 THR THR A . n 
A 1 536 ALA 536 536 ?   ?   ?   A . n 
A 1 537 CYS 537 537 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2870  ? 
1 MORE         -1    ? 
1 'SSA (A^2)'  35540 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z    1.0000000000  0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_556 y,x,-z+1 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 136.5500000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 1998-02-11 
2 'Structure model' 1 1 2008-03-24 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2016-06-29 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Version format compliance' 
3 4 'Structure model' 'Derived calculations'      
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
DENZO     'data reduction' . ? 1 
SCALEPACK 'data scaling'   . ? 2 
REFMAC    refinement       . ? 3 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   ND2 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ASN 
_pdbx_validate_close_contact.auth_seq_id_1    416 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    691 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.09 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE A ARG 221 ? ? CZ A ARG 221 ? ? NH2 A ARG 221 ? ? 115.83 120.30 -4.47  0.50 N 
2 1 CD A ARG 388 ? ? NE A ARG 388 ? ? CZ  A ARG 388 ? ? 137.80 123.60 14.20  1.40 N 
3 1 NE A ARG 388 ? ? CZ A ARG 388 ? ? NH1 A ARG 388 ? ? 125.68 120.30 5.38   0.50 N 
4 1 NE A ARG 388 ? ? CZ A ARG 388 ? ? NH2 A ARG 388 ? ? 114.36 120.30 -5.94  0.50 N 
5 1 CD A ARG 426 ? ? NE A ARG 426 ? ? CZ  A ARG 426 ? ? 135.77 123.60 12.17  1.40 N 
6 1 NE A ARG 426 ? ? CZ A ARG 426 ? ? NH2 A ARG 426 ? ? 113.91 120.30 -6.39  0.50 N 
7 1 CA A TYR 442 ? ? CB A TYR 442 ? ? CG  A TYR 442 ? ? 101.64 113.40 -11.76 1.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 LEU A 23  ? ? 46.69   -129.12 
2  1 SER A 25  ? ? -142.67 -156.25 
3  1 PRO A 39  ? ? -80.33  49.16   
4  1 PHE A 45  ? ? 82.65   -13.04  
5  1 SER A 108 ? ? -156.05 75.67   
6  1 LEU A 158 ? ? -105.86 70.95   
7  1 ALA A 164 ? ? -152.95 73.06   
8  1 ASN A 167 ? ? 56.98   4.53    
9  1 PRO A 191 ? ? -58.28  -0.72   
10 1 SER A 200 ? ? 50.11   -112.65 
11 1 GLU A 299 ? ? -108.09 -81.32  
12 1 ASN A 313 ? ? -68.82  73.03   
13 1 THR A 317 ? ? -161.69 -162.23 
14 1 VAL A 360 ? ? -119.42 65.90   
15 1 ASP A 380 ? ? -159.04 49.86   
16 1 VAL A 400 ? ? -129.79 -68.14  
17 1 PRO A 451 ? ? -56.96  -2.37   
18 1 MET A 510 ? ? -36.26  141.87  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A ASN 42  ? OD1 ? A ASN 42  OD1 
2  1 Y 1 A ASN 42  ? ND2 ? A ASN 42  ND2 
3  1 Y 1 A ARG 46  ? CZ  ? A ARG 46  CZ  
4  1 Y 1 A ARG 46  ? NH1 ? A ARG 46  NH1 
5  1 Y 1 A ARG 46  ? NH2 ? A ARG 46  NH2 
6  1 Y 1 A GLU 49  ? OE1 ? A GLU 49  OE1 
7  1 Y 1 A GLU 49  ? OE2 ? A GLU 49  OE2 
8  1 Y 1 A GLN 162 ? OE1 ? A GLN 162 OE1 
9  1 Y 1 A GLN 162 ? NE2 ? A GLN 162 NE2 
10 1 Y 1 A ARG 250 ? CZ  ? A ARG 250 CZ  
11 1 Y 1 A ARG 250 ? NH1 ? A ARG 250 NH1 
12 1 Y 1 A ARG 250 ? NH2 ? A ARG 250 NH2 
13 1 Y 1 A ASN 257 ? CG  ? A ASN 257 CG  
14 1 Y 1 A ASN 257 ? OD1 ? A ASN 257 OD1 
15 1 Y 1 A ASN 257 ? ND2 ? A ASN 257 ND2 
16 1 Y 1 A GLU 268 ? OE1 ? A GLU 268 OE1 
17 1 Y 1 A GLU 268 ? OE2 ? A GLU 268 OE2 
18 1 Y 1 A LYS 270 ? CE  ? A LYS 270 CE  
19 1 Y 1 A LYS 270 ? NZ  ? A LYS 270 NZ  
20 1 Y 1 A GLU 299 ? CD  ? A GLU 299 CD  
21 1 Y 1 A GLU 299 ? OE1 ? A GLU 299 OE1 
22 1 Y 1 A GLU 299 ? OE2 ? A GLU 299 OE2 
23 1 Y 1 A GLU 344 ? OE1 ? A GLU 344 OE1 
24 1 Y 1 A GLU 344 ? OE2 ? A GLU 344 OE2 
25 1 Y 1 A GLU 350 ? OE1 ? A GLU 350 OE1 
26 1 Y 1 A GLU 350 ? OE2 ? A GLU 350 OE2 
27 1 Y 1 A LYS 413 ? CD  ? A LYS 413 CD  
28 1 Y 1 A LYS 413 ? CE  ? A LYS 413 CE  
29 1 Y 1 A LYS 413 ? NZ  ? A LYS 413 NZ  
30 1 Y 1 A GLU 434 ? CD  ? A GLU 434 CD  
31 1 Y 1 A GLU 434 ? OE1 ? A GLU 434 OE1 
32 1 Y 1 A GLU 434 ? OE2 ? A GLU 434 OE2 
33 1 Y 1 A LYS 454 ? CD  ? A LYS 454 CD  
34 1 Y 1 A LYS 454 ? CE  ? A LYS 454 CE  
35 1 Y 1 A LYS 454 ? NZ  ? A LYS 454 NZ  
36 1 Y 1 A LYS 491 ? CD  ? A LYS 491 CD  
37 1 Y 1 A LYS 491 ? CE  ? A LYS 491 CE  
38 1 Y 1 A LYS 491 ? NZ  ? A LYS 491 NZ  
39 1 Y 1 A LYS 498 ? CG  ? A LYS 498 CG  
40 1 Y 1 A LYS 498 ? CD  ? A LYS 498 CD  
41 1 Y 1 A LYS 498 ? CE  ? A LYS 498 CE  
42 1 Y 1 A LYS 498 ? NZ  ? A LYS 498 NZ  
43 1 Y 1 A GLU 499 ? OE1 ? A GLU 499 OE1 
44 1 Y 1 A GLU 499 ? OE2 ? A GLU 499 OE2 
45 1 Y 1 A GLU 508 ? CD  ? A GLU 508 CD  
46 1 Y 1 A GLU 508 ? OE1 ? A GLU 508 OE1 
47 1 Y 1 A GLU 508 ? OE2 ? A GLU 508 OE2 
48 1 Y 1 A LYS 511 ? CD  ? A LYS 511 CD  
49 1 Y 1 A LYS 511 ? CE  ? A LYS 511 CE  
50 1 Y 1 A LYS 511 ? NZ  ? A LYS 511 NZ  
51 1 Y 1 A ARG 515 ? CZ  ? A ARG 515 CZ  
52 1 Y 1 A ARG 515 ? NH1 ? A ARG 515 NH1 
53 1 Y 1 A ARG 515 ? NH2 ? A ARG 515 NH2 
54 1 Y 1 A GLN 526 ? OE1 ? A GLN 526 OE1 
55 1 Y 1 A GLN 526 ? NE2 ? A GLN 526 NE2 
56 1 Y 1 A ASN 533 ? OD1 ? A ASN 533 OD1 
57 1 Y 1 A ASN 533 ? ND2 ? A ASN 533 ND2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ASP 1   ? A ASP 1   
2  1 Y 1 A ASP 2   ? A ASP 2   
3  1 Y 1 A HIS 3   ? A HIS 3   
4  1 Y 1 A PRO 485 ? A PRO 485 
5  1 Y 1 A HIS 486 ? A HIS 486 
6  1 Y 1 A SER 487 ? A SER 487 
7  1 Y 1 A GLN 488 ? A GLN 488 
8  1 Y 1 A GLU 489 ? A GLU 489 
9  1 Y 1 A ALA 536 ? A ALA 536 
10 1 Y 1 A CYS 537 ? A CYS 537 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'EDROPHONIUM ION' EDR 
3 water             HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDR 1   999 999 EDR EDR A . 
C 3 HOH 1   601 601 HOH HOH A . 
C 3 HOH 2   602 602 HOH HOH A . 
C 3 HOH 3   603 603 HOH HOH A . 
C 3 HOH 4   604 604 HOH HOH A . 
C 3 HOH 5   605 605 HOH HOH A . 
C 3 HOH 6   606 606 HOH HOH A . 
C 3 HOH 7   607 607 HOH HOH A . 
C 3 HOH 8   608 608 HOH HOH A . 
C 3 HOH 9   609 609 HOH HOH A . 
C 3 HOH 10  610 610 HOH HOH A . 
C 3 HOH 11  611 611 HOH HOH A . 
C 3 HOH 12  612 612 HOH HOH A . 
C 3 HOH 13  613 613 HOH HOH A . 
C 3 HOH 14  614 614 HOH HOH A . 
C 3 HOH 15  615 615 HOH HOH A . 
C 3 HOH 16  616 616 HOH HOH A . 
C 3 HOH 17  617 617 HOH HOH A . 
C 3 HOH 18  618 618 HOH HOH A . 
C 3 HOH 19  619 619 HOH HOH A . 
C 3 HOH 20  620 620 HOH HOH A . 
C 3 HOH 21  621 621 HOH HOH A . 
C 3 HOH 22  622 622 HOH HOH A . 
C 3 HOH 23  623 623 HOH HOH A . 
C 3 HOH 24  624 624 HOH HOH A . 
C 3 HOH 25  625 625 HOH HOH A . 
C 3 HOH 26  626 626 HOH HOH A . 
C 3 HOH 27  627 627 HOH HOH A . 
C 3 HOH 28  628 628 HOH HOH A . 
C 3 HOH 29  629 629 HOH HOH A . 
C 3 HOH 30  630 630 HOH HOH A . 
C 3 HOH 31  631 631 HOH HOH A . 
C 3 HOH 32  632 632 HOH HOH A . 
C 3 HOH 33  633 633 HOH HOH A . 
C 3 HOH 34  634 634 HOH HOH A . 
C 3 HOH 35  635 635 HOH HOH A . 
C 3 HOH 36  636 636 HOH HOH A . 
C 3 HOH 37  637 637 HOH HOH A . 
C 3 HOH 38  638 638 HOH HOH A . 
C 3 HOH 39  639 639 HOH HOH A . 
C 3 HOH 40  640 640 HOH HOH A . 
C 3 HOH 41  641 641 HOH HOH A . 
C 3 HOH 42  642 642 HOH HOH A . 
C 3 HOH 43  643 643 HOH HOH A . 
C 3 HOH 44  644 644 HOH HOH A . 
C 3 HOH 45  645 645 HOH HOH A . 
C 3 HOH 46  646 646 HOH HOH A . 
C 3 HOH 47  647 647 HOH HOH A . 
C 3 HOH 48  648 648 HOH HOH A . 
C 3 HOH 49  649 649 HOH HOH A . 
C 3 HOH 50  650 650 HOH HOH A . 
C 3 HOH 51  651 651 HOH HOH A . 
C 3 HOH 52  652 652 HOH HOH A . 
C 3 HOH 53  653 653 HOH HOH A . 
C 3 HOH 54  654 654 HOH HOH A . 
C 3 HOH 55  655 655 HOH HOH A . 
C 3 HOH 56  656 656 HOH HOH A . 
C 3 HOH 57  657 657 HOH HOH A . 
C 3 HOH 58  658 658 HOH HOH A . 
C 3 HOH 59  659 659 HOH HOH A . 
C 3 HOH 60  660 660 HOH HOH A . 
C 3 HOH 61  661 661 HOH HOH A . 
C 3 HOH 62  662 662 HOH HOH A . 
C 3 HOH 63  663 663 HOH HOH A . 
C 3 HOH 64  664 664 HOH HOH A . 
C 3 HOH 65  665 665 HOH HOH A . 
C 3 HOH 66  666 666 HOH HOH A . 
C 3 HOH 67  667 667 HOH HOH A . 
C 3 HOH 68  668 668 HOH HOH A . 
C 3 HOH 69  669 669 HOH HOH A . 
C 3 HOH 70  670 670 HOH HOH A . 
C 3 HOH 71  671 671 HOH HOH A . 
C 3 HOH 72  672 672 HOH HOH A . 
C 3 HOH 73  673 673 HOH HOH A . 
C 3 HOH 74  674 674 HOH HOH A . 
C 3 HOH 75  675 675 HOH HOH A . 
C 3 HOH 76  676 676 HOH HOH A . 
C 3 HOH 77  677 677 HOH HOH A . 
C 3 HOH 78  678 678 HOH HOH A . 
C 3 HOH 79  679 679 HOH HOH A . 
C 3 HOH 80  680 680 HOH HOH A . 
C 3 HOH 81  681 681 HOH HOH A . 
C 3 HOH 82  682 682 HOH HOH A . 
C 3 HOH 83  683 683 HOH HOH A . 
C 3 HOH 84  684 684 HOH HOH A . 
C 3 HOH 85  685 685 HOH HOH A . 
C 3 HOH 86  686 686 HOH HOH A . 
C 3 HOH 87  687 687 HOH HOH A . 
C 3 HOH 88  688 688 HOH HOH A . 
C 3 HOH 89  689 689 HOH HOH A . 
C 3 HOH 90  690 690 HOH HOH A . 
C 3 HOH 91  691 691 HOH HOH A . 
C 3 HOH 92  692 692 HOH HOH A . 
C 3 HOH 93  693 693 HOH HOH A . 
C 3 HOH 94  694 694 HOH HOH A . 
C 3 HOH 95  695 695 HOH HOH A . 
C 3 HOH 96  696 696 HOH HOH A . 
C 3 HOH 97  697 697 HOH HOH A . 
C 3 HOH 98  698 698 HOH HOH A . 
C 3 HOH 99  699 699 HOH HOH A . 
C 3 HOH 100 700 700 HOH HOH A . 
C 3 HOH 101 701 701 HOH HOH A . 
C 3 HOH 102 702 702 HOH HOH A . 
C 3 HOH 103 703 703 HOH HOH A . 
C 3 HOH 104 704 704 HOH HOH A . 
C 3 HOH 105 705 705 HOH HOH A . 
C 3 HOH 106 706 706 HOH HOH A . 
C 3 HOH 107 707 707 HOH HOH A . 
C 3 HOH 108 708 708 HOH HOH A . 
C 3 HOH 109 709 709 HOH HOH A . 
C 3 HOH 110 710 710 HOH HOH A . 
C 3 HOH 111 711 711 HOH HOH A . 
C 3 HOH 112 712 712 HOH HOH A . 
C 3 HOH 113 713 713 HOH HOH A . 
C 3 HOH 114 714 714 HOH HOH A . 
C 3 HOH 115 715 715 HOH HOH A . 
C 3 HOH 116 716 716 HOH HOH A . 
C 3 HOH 117 717 717 HOH HOH A . 
C 3 HOH 118 718 718 HOH HOH A . 
C 3 HOH 119 719 719 HOH HOH A . 
C 3 HOH 120 720 720 HOH HOH A . 
C 3 HOH 121 721 721 HOH HOH A . 
C 3 HOH 122 722 722 HOH HOH A . 
C 3 HOH 123 723 723 HOH HOH A . 
C 3 HOH 124 724 724 HOH HOH A . 
C 3 HOH 125 725 725 HOH HOH A . 
C 3 HOH 126 726 726 HOH HOH A . 
C 3 HOH 127 727 727 HOH HOH A . 
C 3 HOH 128 728 728 HOH HOH A . 
C 3 HOH 129 729 729 HOH HOH A . 
C 3 HOH 130 730 730 HOH HOH A . 
C 3 HOH 131 731 731 HOH HOH A . 
C 3 HOH 132 732 732 HOH HOH A . 
C 3 HOH 133 733 733 HOH HOH A . 
C 3 HOH 134 734 734 HOH HOH A . 
C 3 HOH 135 735 735 HOH HOH A . 
C 3 HOH 136 736 736 HOH HOH A . 
C 3 HOH 137 737 737 HOH HOH A . 
C 3 HOH 138 738 738 HOH HOH A . 
C 3 HOH 139 739 739 HOH HOH A . 
C 3 HOH 140 740 740 HOH HOH A . 
C 3 HOH 141 741 741 HOH HOH A . 
C 3 HOH 142 742 742 HOH HOH A . 
C 3 HOH 143 743 743 HOH HOH A . 
C 3 HOH 144 744 744 HOH HOH A . 
C 3 HOH 145 745 745 HOH HOH A . 
C 3 HOH 146 746 746 HOH HOH A . 
C 3 HOH 147 747 747 HOH HOH A . 
C 3 HOH 148 748 748 HOH HOH A . 
C 3 HOH 149 749 749 HOH HOH A . 
C 3 HOH 150 750 750 HOH HOH A . 
C 3 HOH 151 751 751 HOH HOH A . 
C 3 HOH 152 752 752 HOH HOH A . 
C 3 HOH 153 753 753 HOH HOH A . 
C 3 HOH 154 754 754 HOH HOH A . 
C 3 HOH 155 755 755 HOH HOH A . 
C 3 HOH 156 756 756 HOH HOH A . 
C 3 HOH 157 757 757 HOH HOH A . 
C 3 HOH 158 758 758 HOH HOH A . 
C 3 HOH 159 759 759 HOH HOH A . 
C 3 HOH 160 760 760 HOH HOH A . 
C 3 HOH 161 761 761 HOH HOH A . 
C 3 HOH 162 762 762 HOH HOH A . 
C 3 HOH 163 763 763 HOH HOH A . 
C 3 HOH 164 764 764 HOH HOH A . 
C 3 HOH 165 765 765 HOH HOH A . 
C 3 HOH 166 766 766 HOH HOH A . 
C 3 HOH 167 767 767 HOH HOH A . 
C 3 HOH 168 768 768 HOH HOH A . 
C 3 HOH 169 769 769 HOH HOH A . 
C 3 HOH 170 770 770 HOH HOH A . 
C 3 HOH 171 771 771 HOH HOH A . 
C 3 HOH 172 772 772 HOH HOH A . 
C 3 HOH 173 773 773 HOH HOH A . 
C 3 HOH 174 774 774 HOH HOH A . 
C 3 HOH 175 775 775 HOH HOH A . 
C 3 HOH 176 776 776 HOH HOH A . 
C 3 HOH 177 777 777 HOH HOH A . 
C 3 HOH 178 778 778 HOH HOH A . 
C 3 HOH 179 779 779 HOH HOH A . 
C 3 HOH 180 780 780 HOH HOH A . 
C 3 HOH 181 781 781 HOH HOH A . 
C 3 HOH 182 782 782 HOH HOH A . 
C 3 HOH 183 783 783 HOH HOH A . 
C 3 HOH 184 784 784 HOH HOH A . 
C 3 HOH 185 785 785 HOH HOH A . 
C 3 HOH 186 786 786 HOH HOH A . 
C 3 HOH 187 787 787 HOH HOH A . 
C 3 HOH 188 788 788 HOH HOH A . 
C 3 HOH 189 789 789 HOH HOH A . 
C 3 HOH 190 790 790 HOH HOH A . 
C 3 HOH 191 791 791 HOH HOH A . 
C 3 HOH 192 792 792 HOH HOH A . 
C 3 HOH 193 793 793 HOH HOH A . 
C 3 HOH 194 794 794 HOH HOH A . 
C 3 HOH 195 795 795 HOH HOH A . 
C 3 HOH 196 796 796 HOH HOH A . 
C 3 HOH 197 797 797 HOH HOH A . 
C 3 HOH 198 798 798 HOH HOH A . 
C 3 HOH 199 799 799 HOH HOH A . 
C 3 HOH 200 800 800 HOH HOH A . 
C 3 HOH 201 801 801 HOH HOH A . 
C 3 HOH 202 802 802 HOH HOH A . 
C 3 HOH 203 803 803 HOH HOH A . 
C 3 HOH 204 804 804 HOH HOH A . 
C 3 HOH 205 805 805 HOH HOH A . 
C 3 HOH 206 806 806 HOH HOH A . 
C 3 HOH 207 807 807 HOH HOH A . 
C 3 HOH 208 808 808 HOH HOH A . 
C 3 HOH 209 809 809 HOH HOH A . 
C 3 HOH 210 810 810 HOH HOH A . 
C 3 HOH 211 811 811 HOH HOH A . 
C 3 HOH 212 812 812 HOH HOH A . 
C 3 HOH 213 813 813 HOH HOH A . 
C 3 HOH 214 814 814 HOH HOH A . 
C 3 HOH 215 815 815 HOH HOH A . 
C 3 HOH 216 816 816 HOH HOH A . 
C 3 HOH 217 817 817 HOH HOH A . 
C 3 HOH 218 818 818 HOH HOH A . 
C 3 HOH 219 819 819 HOH HOH A . 
C 3 HOH 220 820 820 HOH HOH A . 
C 3 HOH 221 821 821 HOH HOH A . 
C 3 HOH 222 822 822 HOH HOH A . 
C 3 HOH 223 823 823 HOH HOH A . 
C 3 HOH 224 824 824 HOH HOH A . 
C 3 HOH 225 825 825 HOH HOH A . 
C 3 HOH 226 826 826 HOH HOH A . 
C 3 HOH 227 827 827 HOH HOH A . 
C 3 HOH 228 828 828 HOH HOH A . 
C 3 HOH 229 829 829 HOH HOH A . 
C 3 HOH 230 830 830 HOH HOH A . 
C 3 HOH 231 831 831 HOH HOH A . 
C 3 HOH 232 832 832 HOH HOH A . 
C 3 HOH 233 833 833 HOH HOH A . 
C 3 HOH 234 834 834 HOH HOH A . 
C 3 HOH 235 835 835 HOH HOH A . 
C 3 HOH 236 836 836 HOH HOH A . 
C 3 HOH 237 837 837 HOH HOH A . 
C 3 HOH 238 838 838 HOH HOH A . 
C 3 HOH 239 839 839 HOH HOH A . 
C 3 HOH 240 840 840 HOH HOH A . 
C 3 HOH 241 841 841 HOH HOH A . 
C 3 HOH 242 842 842 HOH HOH A . 
C 3 HOH 243 843 843 HOH HOH A . 
C 3 HOH 244 844 844 HOH HOH A . 
C 3 HOH 245 845 845 HOH HOH A . 
C 3 HOH 246 846 846 HOH HOH A . 
C 3 HOH 247 847 847 HOH HOH A . 
C 3 HOH 248 848 848 HOH HOH A . 
C 3 HOH 249 849 849 HOH HOH A . 
C 3 HOH 250 850 850 HOH HOH A . 
C 3 HOH 251 851 851 HOH HOH A . 
C 3 HOH 252 852 852 HOH HOH A . 
#