data_2AE0
# 
_entry.id   2AE0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.286 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AE0         
RCSB  RCSB033781   
WWPDB D_1000033781 
# 
_pdbx_database_status.entry_id                        2AE0 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-21 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Van Straaten, K.E.'   1 
'Dijkstra, B.W.'       2 
'Vollmer, W.'          3 
'Thunnissen, A.M.W.H.' 4 
# 
_citation.id                        primary 
_citation.title                     'Crystal Structure of MltA from Escherichia coli Reveals a Unique Lytic Transglycosylase Fold' 
_citation.journal_abbrev            J.Mol.Biol. 
_citation.journal_volume            352 
_citation.page_first                1068 
_citation.page_last                 1080 
_citation.year                      2005 
_citation.journal_id_ASTM           JMOBAK 
_citation.country                   UK 
_citation.journal_id_ISSN           0022-2836 
_citation.journal_id_CSD            0070 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   16139297 
_citation.pdbx_database_id_DOI      10.1016/j.jmb.2005.07.067 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'van Straaten, K.E.'   1 
primary 'Dijkstra, B.W.'       2 
primary 'Vollmer, W.'          3 
primary 'Thunnissen, A.M.W.H.' 4 
# 
_cell.length_a           103.873 
_cell.length_b           103.873 
_cell.length_c           109.777 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.entry_id           2AE0 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              6 
# 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.entry_id                         2AE0 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                152 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Membrane-bound lytic murein transglycosylase A' 38250.688 1   3.2.1.- ? ? ? 
2 non-polymer syn 1,2-ETHANEDIOL                                   62.068    1   ?       ? ? ? 
3 non-polymer syn 'ACETIC ACID'                                    60.052    1   ?       ? ? ? 
4 water       nat water                                            18.015    278 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MltA, Murein hydrolase A, Mlt38' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQF
GIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMD
VQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQS
FAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHR
AGWYNHYGRVWVLKTAPGAGNVFSG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQF
GIDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLSSRAEIYAGALSDKYILAYSNSLMDNFIMD
VQGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQS
FAPVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHR
AGWYNHYGRVWVLKTAPGAGNVFSG
;
_entity_poly.pdbx_strand_id                 X 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   SER n 
1 4   LYS n 
1 5   PRO n 
1 6   THR n 
1 7   ASP n 
1 8   ARG n 
1 9   GLY n 
1 10  GLN n 
1 11  GLN n 
1 12  TYR n 
1 13  LYS n 
1 14  ASP n 
1 15  GLY n 
1 16  LYS n 
1 17  PHE n 
1 18  THR n 
1 19  GLN n 
1 20  PRO n 
1 21  PHE n 
1 22  SER n 
1 23  LEU n 
1 24  VAL n 
1 25  ASN n 
1 26  GLN n 
1 27  PRO n 
1 28  ASP n 
1 29  ALA n 
1 30  VAL n 
1 31  GLY n 
1 32  ALA n 
1 33  PRO n 
1 34  ILE n 
1 35  ASN n 
1 36  ALA n 
1 37  GLY n 
1 38  ASP n 
1 39  PHE n 
1 40  ALA n 
1 41  GLU n 
1 42  GLN n 
1 43  ILE n 
1 44  ASN n 
1 45  HIS n 
1 46  ILE n 
1 47  ARG n 
1 48  ASN n 
1 49  SER n 
1 50  SER n 
1 51  PRO n 
1 52  ARG n 
1 53  LEU n 
1 54  TYR n 
1 55  GLY n 
1 56  ASN n 
1 57  GLN n 
1 58  SER n 
1 59  ASN n 
1 60  VAL n 
1 61  TYR n 
1 62  ASN n 
1 63  ALA n 
1 64  VAL n 
1 65  GLN n 
1 66  GLU n 
1 67  TRP n 
1 68  LEU n 
1 69  ARG n 
1 70  ALA n 
1 71  GLY n 
1 72  GLY n 
1 73  ASP n 
1 74  THR n 
1 75  ARG n 
1 76  ASN n 
1 77  MET n 
1 78  ARG n 
1 79  GLN n 
1 80  PHE n 
1 81  GLY n 
1 82  ILE n 
1 83  ASP n 
1 84  ALA n 
1 85  TRP n 
1 86  GLN n 
1 87  MET n 
1 88  GLU n 
1 89  GLY n 
1 90  ALA n 
1 91  ASP n 
1 92  ASN n 
1 93  TYR n 
1 94  GLY n 
1 95  ASN n 
1 96  VAL n 
1 97  GLN n 
1 98  PHE n 
1 99  THR n 
1 100 GLY n 
1 101 TYR n 
1 102 TYR n 
1 103 THR n 
1 104 PRO n 
1 105 VAL n 
1 106 ILE n 
1 107 GLN n 
1 108 ALA n 
1 109 ARG n 
1 110 HIS n 
1 111 THR n 
1 112 ARG n 
1 113 GLN n 
1 114 GLY n 
1 115 GLU n 
1 116 PHE n 
1 117 GLN n 
1 118 TYR n 
1 119 PRO n 
1 120 ILE n 
1 121 TYR n 
1 122 ARG n 
1 123 MET n 
1 124 PRO n 
1 125 PRO n 
1 126 LYS n 
1 127 ARG n 
1 128 GLY n 
1 129 ARG n 
1 130 LEU n 
1 131 SER n 
1 132 SER n 
1 133 ARG n 
1 134 ALA n 
1 135 GLU n 
1 136 ILE n 
1 137 TYR n 
1 138 ALA n 
1 139 GLY n 
1 140 ALA n 
1 141 LEU n 
1 142 SER n 
1 143 ASP n 
1 144 LYS n 
1 145 TYR n 
1 146 ILE n 
1 147 LEU n 
1 148 ALA n 
1 149 TYR n 
1 150 SER n 
1 151 ASN n 
1 152 SER n 
1 153 LEU n 
1 154 MET n 
1 155 ASP n 
1 156 ASN n 
1 157 PHE n 
1 158 ILE n 
1 159 MET n 
1 160 ASP n 
1 161 VAL n 
1 162 GLN n 
1 163 GLY n 
1 164 SER n 
1 165 GLY n 
1 166 TYR n 
1 167 ILE n 
1 168 ASP n 
1 169 PHE n 
1 170 GLY n 
1 171 ASP n 
1 172 GLY n 
1 173 SER n 
1 174 PRO n 
1 175 LEU n 
1 176 ASN n 
1 177 PHE n 
1 178 PHE n 
1 179 SER n 
1 180 TYR n 
1 181 ALA n 
1 182 GLY n 
1 183 LYS n 
1 184 ASN n 
1 185 GLY n 
1 186 HIS n 
1 187 ALA n 
1 188 TYR n 
1 189 ARG n 
1 190 SER n 
1 191 ILE n 
1 192 GLY n 
1 193 LYS n 
1 194 VAL n 
1 195 LEU n 
1 196 ILE n 
1 197 ASP n 
1 198 ARG n 
1 199 GLY n 
1 200 GLU n 
1 201 VAL n 
1 202 LYS n 
1 203 LYS n 
1 204 GLU n 
1 205 ASP n 
1 206 MET n 
1 207 SER n 
1 208 MET n 
1 209 GLN n 
1 210 ALA n 
1 211 ILE n 
1 212 ARG n 
1 213 HIS n 
1 214 TRP n 
1 215 GLY n 
1 216 GLU n 
1 217 THR n 
1 218 HIS n 
1 219 SER n 
1 220 GLU n 
1 221 ALA n 
1 222 GLU n 
1 223 VAL n 
1 224 ARG n 
1 225 GLU n 
1 226 LEU n 
1 227 LEU n 
1 228 GLU n 
1 229 GLN n 
1 230 ASN n 
1 231 PRO n 
1 232 SER n 
1 233 PHE n 
1 234 VAL n 
1 235 PHE n 
1 236 PHE n 
1 237 LYS n 
1 238 PRO n 
1 239 GLN n 
1 240 SER n 
1 241 PHE n 
1 242 ALA n 
1 243 PRO n 
1 244 VAL n 
1 245 LYS n 
1 246 GLY n 
1 247 ALA n 
1 248 SER n 
1 249 ALA n 
1 250 VAL n 
1 251 PRO n 
1 252 LEU n 
1 253 VAL n 
1 254 GLY n 
1 255 ARG n 
1 256 ALA n 
1 257 SER n 
1 258 VAL n 
1 259 ALA n 
1 260 SER n 
1 261 ASP n 
1 262 ARG n 
1 263 SER n 
1 264 ILE n 
1 265 ILE n 
1 266 PRO n 
1 267 PRO n 
1 268 GLY n 
1 269 THR n 
1 270 THR n 
1 271 LEU n 
1 272 LEU n 
1 273 ALA n 
1 274 GLU n 
1 275 VAL n 
1 276 PRO n 
1 277 LEU n 
1 278 LEU n 
1 279 ASP n 
1 280 ASN n 
1 281 ASN n 
1 282 GLY n 
1 283 LYS n 
1 284 PHE n 
1 285 ASN n 
1 286 GLY n 
1 287 GLN n 
1 288 TYR n 
1 289 GLU n 
1 290 LEU n 
1 291 ARG n 
1 292 LEU n 
1 293 MET n 
1 294 VAL n 
1 295 ALA n 
1 296 LEU n 
1 297 ASP n 
1 298 VAL n 
1 299 GLY n 
1 300 GLY n 
1 301 ALA n 
1 302 ILE n 
1 303 LYS n 
1 304 GLY n 
1 305 GLN n 
1 306 HIS n 
1 307 PHE n 
1 308 ASP n 
1 309 ILE n 
1 310 TYR n 
1 311 GLN n 
1 312 GLY n 
1 313 ILE n 
1 314 GLY n 
1 315 PRO n 
1 316 GLU n 
1 317 ALA n 
1 318 GLY n 
1 319 HIS n 
1 320 ARG n 
1 321 ALA n 
1 322 GLY n 
1 323 TRP n 
1 324 TYR n 
1 325 ASN n 
1 326 HIS n 
1 327 TYR n 
1 328 GLY n 
1 329 ARG n 
1 330 VAL n 
1 331 TRP n 
1 332 VAL n 
1 333 LEU n 
1 334 LYS n 
1 335 THR n 
1 336 ALA n 
1 337 PRO n 
1 338 GLY n 
1 339 ALA n 
1 340 GLY n 
1 341 ASN n 
1 342 VAL n 
1 343 PHE n 
1 344 SER n 
1 345 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     Escherichia 
_entity_src_gen.pdbx_gene_src_gene                 mlta 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     562 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MLTA_ECOLI 
_struct_ref.pdbx_db_accession          P0A935 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;SSKPTDRGQQYKDGKFTQPFSLVNQPDAVGAPINAGDFAEQINHIRNSSPRLYGNQSNVYNAVQEWLRAGGDTRNMRQFG
IDAWQMEGADNYGNVQFTGYYTPVIQARHTRQGEFQYPIYRMPPKRGRLPSRAEIYAGALSDKYILAYSNSLMDNFIMDV
QGSGYIDFGDGSPLNFFSYAGKNGHAYRSIGKVLIDRGEVKKEDMSMQAIRHWGETHSEAEVRELLEQNPSFVFFKPQSF
APVKGASAVPLVGRASVASDRSIIPPGTTLLAEVPLLDNNGKFNGQYELRLMVALDVGGAIKGQHFDIYQGIGPEAGHRA
GWYNHYGRVWVLKTAPGAGNVFSG
;
_struct_ref.pdbx_align_begin           22 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              2AE0 
_struct_ref_seq.pdbx_strand_id                X 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 345 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P0A935 
_struct_ref_seq.db_align_beg                  22 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  365 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       2 
_struct_ref_seq.pdbx_auth_seq_align_end       345 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 2AE0 MET X 1   ? UNP P0A935 ?   ?   'INITIATING METHIONINE' 1   1 
1 2AE0 SER X 131 ? UNP P0A935 PRO 151 'SEE REMARK 999'        131 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ACY non-polymer         . 'ACETIC ACID'   ?                 'C2 H4 O2'       60.052  
ALA 'L-peptide linking' y ALANINE         ?                 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                 'C4 H7 N O4'     133.103 
EDO non-polymer         . 1,2-ETHANEDIOL  'ETHYLENE GLYCOL' 'C2 H6 O2'       62.068  
GLN 'L-peptide linking' y GLUTAMINE       ?                 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ?                 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          2AE0 
_exptl.crystals_number   1 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      4.47 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   72.47 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              4.2 
_exptl_crystal_grow.temp            280 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'PEG 8000, sodium chloride, sodium acetate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 280K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2002-09-23 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.monochromator                    'diamonds (111), Ge(220)' 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.934  1.0 
2 0.9794 1.0 
3 0.9792 1.0 
4 0.9393 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ESRF BEAMLINE ID14-1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.934, 0.9794, 0.9792, 0.9393' 
_diffrn_source.pdbx_synchrotron_site       ESRF 
_diffrn_source.pdbx_synchrotron_beamline   ID14-1 
# 
_reflns.entry_id                     2AE0 
_reflns.d_resolution_low             30.00 
_reflns.d_resolution_high            2.00 
_reflns.number_obs                   46854 
_reflns.percent_possible_obs         100.000 
_reflns.pdbx_Rmerge_I_obs            0.049 
_reflns.pdbx_chi_squared             0.934 
_reflns.pdbx_redundancy              ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.number_all                   46854 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_low              2.07 
_reflns_shell.d_res_high             2.00 
_reflns_shell.number_measured_obs    4652 
_reflns_shell.percent_possible_obs   100.000 
_reflns_shell.Rmerge_I_obs           0.501 
_reflns_shell.pdbx_chi_squared       0.866 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.percent_possible_all   100 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.ls_d_res_high                            2.000 
_refine.ls_d_res_low                             30.000 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.ls_percent_reflns_obs                    99.980 
_refine.ls_number_reflns_obs                     46646 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.ls_R_factor_all                          0.205 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2388 
_refine.B_iso_mean                               37.227 
_refine.aniso_B[1][1]                            2.700 
_refine.aniso_B[2][2]                            2.700 
_refine.aniso_B[3][3]                            -4.040 
_refine.aniso_B[1][2]                            1.350 
_refine.aniso_B[1][3]                            0.000 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.953 
_refine.correlation_coeff_Fo_to_Fc_free          0.932 
_refine.pdbx_overall_ESU_R                       0.124 
_refine.pdbx_overall_ESU_R_Free                  0.124 
_refine.overall_SU_ML                            0.086 
_refine.overall_SU_B                             3.130 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             1.400 
_refine.pdbx_solvent_ion_probe_radii             0.800 
_refine.pdbx_solvent_shrinkage_radii             0.800 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.entry_id                                 2AE0 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_number_reflns_all                     46854 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.pdbx_isotropic_thermal_model             isotropic 
_refine.details                                  ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2637 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         8 
_refine_hist.number_atoms_solvent             278 
_refine_hist.number_atoms_total               2923 
_refine_hist.d_res_high                       2.000 
_refine_hist.d_res_low                        30.000 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         2713 0.004 0.021 ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      3670 1.124 1.933 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   334  1.406 5.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           367  0.102 0.200 ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2163 0.001 0.020 ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1200 0.180 0.300 ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    85   0.130 0.500 ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   22   0.176 0.300 ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 3    0.081 0.500 ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1660 2.051 1.500 ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             2648 3.165 2.000 ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1053 5.261 3.000 ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1022 7.786 4.500 ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.000 
_refine_ls_shell.d_res_low                        2.020 
_refine_ls_shell.pdbx_total_number_of_bins_used   50 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.number_reflns_R_work             1270 
_refine_ls_shell.R_factor_R_work                  0.28 
_refine_ls_shell.R_factor_R_free                  0.32 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             69 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                1339 
_refine_ls_shell.number_reflns_obs                1339 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.R_factor_all                     ? 
# 
_struct.entry_id                  2AE0 
_struct.title                     'Crystal structure of MltA from Escherichia coli reveals a unique lytic transglycosylase fold' 
_struct.pdbx_descriptor           'Membrane-bound lytic murein transglycosylase A (E.C.3.2.1.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AE0 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
'double-psi beta-barrel, small mixed parallel/antiparallel six stranded beta barrel, helical sub-domain, Hydrolase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id   1 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASN A 35  ? SER A 50  ? ASN X 35  SER X 50  1 ? 16 
HELX_P HELX_P2  2  SER A 50  ? ALA A 70  ? SER X 50  ALA X 70  1 ? 21 
HELX_P HELX_P3  3  ASP A 73  ? GLN A 79  ? ASP X 73  GLN X 79  5 ? 7  
HELX_P HELX_P4  4  ARG A 127 ? LEU A 130 ? ARG X 127 LEU X 130 5 ? 4  
HELX_P HELX_P5  5  SER A 132 ? ALA A 138 ? SER X 132 ALA X 138 1 ? 7  
HELX_P HELX_P6  6  LEU A 141 ? LYS A 144 ? LEU X 141 LYS X 144 5 ? 4  
HELX_P HELX_P7  7  SER A 152 ? GLY A 163 ? SER X 152 GLY X 163 1 ? 12 
HELX_P HELX_P8  8  SER A 190 ? ARG A 198 ? SER X 190 ARG X 198 1 ? 9  
HELX_P HELX_P9  9  LYS A 202 ? ASP A 205 ? LYS X 202 ASP X 205 5 ? 4  
HELX_P HELX_P10 10 SER A 207 ? THR A 217 ? SER X 207 THR X 217 1 ? 11 
HELX_P HELX_P11 11 SER A 219 ? GLU A 228 ? SER X 219 GLU X 228 1 ? 10 
HELX_P HELX_P12 12 GLY A 314 ? GLY A 322 ? GLY X 314 GLY X 322 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 9 ? 
B ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
A 6 7 ? anti-parallel 
A 7 8 ? parallel      
A 8 9 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 21  ? VAL A 24  ? PHE X 21  VAL X 24  
A 2 ILE A 82  ? MET A 87  ? ILE X 82  MET X 87  
A 3 HIS A 326 ? THR A 335 ? HIS X 326 THR X 335 
A 4 THR A 270 ? LEU A 278 ? THR X 270 LEU X 278 
A 5 PHE A 284 ? ASP A 297 ? PHE X 284 ASP X 297 
A 6 SER A 257 ? ALA A 259 ? SER X 257 ALA X 259 
A 7 PHE A 307 ? ILE A 313 ? PHE X 307 ILE X 313 
A 8 VAL A 96  ? THR A 103 ? VAL X 96  THR X 103 
A 9 HIS A 326 ? THR A 335 ? HIS X 326 THR X 335 
B 1 TYR A 118 ? TYR A 121 ? TYR X 118 TYR X 121 
B 2 ILE A 146 ? SER A 150 ? ILE X 146 SER X 150 
B 3 VAL A 105 ? ARG A 109 ? VAL X 105 ARG X 109 
B 4 GLY A 165 ? ASP A 168 ? GLY X 165 ASP X 168 
B 5 ASN A 176 ? LYS A 183 ? ASN X 176 LYS X 183 
B 6 VAL A 234 ? GLN A 239 ? VAL X 234 GLN X 239 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 22  ? N SER X 22  O GLN A 86  ? O GLN X 86  
A 2 3 N ASP A 83  ? N ASP X 83  O LYS A 334 ? O LYS X 334 
A 3 4 O ARG A 329 ? O ARG X 329 N GLU A 274 ? N GLU X 274 
A 4 5 N ALA A 273 ? N ALA X 273 O ARG A 291 ? O ARG X 291 
A 5 6 O LEU A 296 ? O LEU X 296 N VAL A 258 ? N VAL X 258 
A 6 7 N ALA A 259 ? N ALA X 259 O ASP A 308 ? O ASP X 308 
A 7 8 O GLN A 311 ? O GLN X 311 N TYR A 101 ? N TYR X 101 
A 8 9 N PHE A 98  ? N PHE X 98  O HIS A 326 ? O HIS X 326 
B 1 2 N ILE A 120 ? N ILE X 120 O LEU A 147 ? O LEU X 147 
B 2 3 O TYR A 149 ? O TYR X 149 N ARG A 109 ? N ARG X 109 
B 3 4 N ILE A 106 ? N ILE X 106 O ASP A 168 ? O ASP X 168 
B 4 5 N ILE A 167 ? N ILE X 167 O ASN A 176 ? O ASN X 176 
B 5 6 N GLY A 182 ? N GLY X 182 O PHE A 235 ? O PHE X 235 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE EDO X 1439' 
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ACY X 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 PHE A 21  ? PHE X 21   . ? 1_555 ? 
2 AC1 4 LYS A 334 ? LYS X 334  . ? 1_555 ? 
3 AC1 4 HOH D .   ? HOH X 1674 . ? 1_555 ? 
4 AC1 4 HOH D .   ? HOH X 1700 . ? 1_555 ? 
5 AC2 5 PHE A 157 ? PHE X 157  . ? 1_555 ? 
6 AC2 5 SER A 190 ? SER X 190  . ? 1_555 ? 
7 AC2 5 ILE A 191 ? ILE X 191  . ? 1_555 ? 
8 AC2 5 GLY A 192 ? GLY X 192  . ? 1_555 ? 
9 AC2 5 HOH D .   ? HOH X 1491 . ? 1_555 ? 
# 
_atom_sites.entry_id                    2AE0 
_atom_sites.fract_transf_matrix[1][1]   0.00963 
_atom_sites.fract_transf_matrix[1][2]   0.00556 
_atom_sites.fract_transf_matrix[1][3]   0.00000 
_atom_sites.fract_transf_matrix[2][1]   0.00000 
_atom_sites.fract_transf_matrix[2][2]   0.01112 
_atom_sites.fract_transf_matrix[2][3]   0.00000 
_atom_sites.fract_transf_matrix[3][1]   0.00000 
_atom_sites.fract_transf_matrix[3][2]   0.00000 
_atom_sites.fract_transf_matrix[3][3]   0.00911 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . SER A 1 3   ? -23.001 43.664 62.787 1.00 65.67 ? 3    SER X N   1 
ATOM   2    C CA  . SER A 1 3   ? -23.384 44.981 63.371 1.00 65.52 ? 3    SER X CA  1 
ATOM   3    C C   . SER A 1 3   ? -22.147 45.774 63.781 1.00 63.61 ? 3    SER X C   1 
ATOM   4    O O   . SER A 1 3   ? -21.803 46.777 63.152 1.00 63.28 ? 3    SER X O   1 
ATOM   5    C CB  . SER A 1 3   ? -24.312 44.785 64.575 1.00 67.45 ? 3    SER X CB  1 
ATOM   6    O OG  . SER A 1 3   ? -23.680 44.020 65.588 1.00 72.01 ? 3    SER X OG  1 
ATOM   7    N N   . LYS A 1 4   ? -21.482 45.318 64.839 1.00 58.76 ? 4    LYS X N   1 
ATOM   8    C CA  . LYS A 1 4   ? -20.282 45.981 65.334 1.00 53.55 ? 4    LYS X CA  1 
ATOM   9    C C   . LYS A 1 4   ? -19.168 44.975 65.627 1.00 47.21 ? 4    LYS X C   1 
ATOM   10   O O   . LYS A 1 4   ? -18.923 44.634 66.785 1.00 46.19 ? 4    LYS X O   1 
ATOM   11   C CB  . LYS A 1 4   ? -20.602 46.800 66.588 1.00 54.68 ? 4    LYS X CB  1 
ATOM   12   C CG  . LYS A 1 4   ? -21.208 48.167 66.303 1.00 56.09 ? 4    LYS X CG  1 
ATOM   13   C CD  . LYS A 1 4   ? -22.181 48.577 67.398 1.00 64.33 ? 4    LYS X CD  1 
ATOM   14   C CE  . LYS A 1 4   ? -22.440 50.076 67.374 1.00 65.56 ? 4    LYS X CE  1 
ATOM   15   N NZ  . LYS A 1 4   ? -22.227 50.697 68.712 1.00 61.03 ? 4    LYS X NZ  1 
ATOM   16   N N   . PRO A 1 5   ? -18.496 44.501 64.579 1.00 43.10 ? 5    PRO X N   1 
ATOM   17   C CA  . PRO A 1 5   ? -17.405 43.534 64.739 1.00 40.42 ? 5    PRO X CA  1 
ATOM   18   C C   . PRO A 1 5   ? -16.184 44.174 65.397 1.00 40.03 ? 5    PRO X C   1 
ATOM   19   O O   . PRO A 1 5   ? -15.975 45.380 65.258 1.00 38.85 ? 5    PRO X O   1 
ATOM   20   C CB  . PRO A 1 5   ? -17.092 43.116 63.299 1.00 39.76 ? 5    PRO X CB  1 
ATOM   21   C CG  . PRO A 1 5   ? -17.542 44.261 62.461 1.00 41.70 ? 5    PRO X CG  1 
ATOM   22   C CD  . PRO A 1 5   ? -18.725 44.853 63.166 1.00 42.47 ? 5    PRO X CD  1 
ATOM   23   N N   . THR A 1 6   ? -15.396 43.370 66.104 1.00 40.17 ? 6    THR X N   1 
ATOM   24   C CA  . THR A 1 6   ? -14.204 43.855 66.799 1.00 40.62 ? 6    THR X CA  1 
ATOM   25   C C   . THR A 1 6   ? -12.998 42.969 66.500 1.00 40.42 ? 6    THR X C   1 
ATOM   26   O O   . THR A 1 6   ? -11.888 43.242 66.957 1.00 41.84 ? 6    THR X O   1 
ATOM   27   C CB  . THR A 1 6   ? -14.447 43.869 68.326 1.00 41.94 ? 6    THR X CB  1 
ATOM   28   O OG1 . THR A 1 6   ? -14.955 42.595 68.743 1.00 35.06 ? 6    THR X OG1 1 
ATOM   29   C CG2 . THR A 1 6   ? -15.564 44.837 68.695 1.00 44.17 ? 6    THR X CG2 1 
ATOM   30   N N   . ASP A 1 7   ? -13.235 41.910 65.731 1.00 40.12 ? 7    ASP X N   1 
ATOM   31   C CA  . ASP A 1 7   ? -12.212 40.936 65.355 1.00 42.23 ? 7    ASP X CA  1 
ATOM   32   C C   . ASP A 1 7   ? -10.930 41.519 64.756 1.00 41.06 ? 7    ASP X C   1 
ATOM   33   O O   . ASP A 1 7   ? -9.848  40.961 64.941 1.00 38.41 ? 7    ASP X O   1 
ATOM   34   C CB  . ASP A 1 7   ? -12.808 39.921 64.372 1.00 46.76 ? 7    ASP X CB  1 
ATOM   35   C CG  . ASP A 1 7   ? -12.286 38.516 64.592 1.00 57.61 ? 7    ASP X CG  1 
ATOM   36   O OD1 . ASP A 1 7   ? -11.104 38.263 64.274 1.00 69.20 ? 7    ASP X OD1 1 
ATOM   37   O OD2 . ASP A 1 7   ? -12.986 37.600 65.076 1.00 71.26 ? 7    ASP X OD2 1 
ATOM   38   N N   . ARG A 1 8   ? -11.050 42.635 64.043 1.00 39.33 ? 8    ARG X N   1 
ATOM   39   C CA  . ARG A 1 8   ? -9.892  43.246 63.397 1.00 38.66 ? 8    ARG X CA  1 
ATOM   40   C C   . ARG A 1 8   ? -9.344  44.531 64.025 1.00 36.07 ? 8    ARG X C   1 
ATOM   41   O O   . ARG A 1 8   ? -8.560  45.247 63.397 1.00 31.64 ? 8    ARG X O   1 
ATOM   42   C CB  . ARG A 1 8   ? -10.142 43.414 61.895 1.00 37.71 ? 8    ARG X CB  1 
ATOM   43   C CG  . ARG A 1 8   ? -10.437 42.098 61.183 1.00 39.00 ? 8    ARG X CG  1 
ATOM   44   C CD  . ARG A 1 8   ? -10.933 42.246 59.755 1.00 41.80 ? 8    ARG X CD  1 
ATOM   45   N NE  . ARG A 1 8   ? -10.772 41.005 59.000 1.00 45.22 ? 8    ARG X NE  1 
ATOM   46   C CZ  . ARG A 1 8   ? -10.621 40.941 57.682 1.00 50.75 ? 8    ARG X CZ  1 
ATOM   47   N NH1 . ARG A 1 8   ? -10.482 39.763 57.088 1.00 54.39 ? 8    ARG X NH1 1 
ATOM   48   N NH2 . ARG A 1 8   ? -10.609 42.051 56.953 1.00 46.67 ? 8    ARG X NH2 1 
ATOM   49   N N   . GLY A 1 9   ? -9.752  44.821 65.258 1.00 33.54 ? 9    GLY X N   1 
ATOM   50   C CA  . GLY A 1 9   ? -9.268  46.004 65.953 1.00 30.53 ? 9    GLY X CA  1 
ATOM   51   C C   . GLY A 1 9   ? -10.246 47.158 66.074 1.00 33.33 ? 9    GLY X C   1 
ATOM   52   O O   . GLY A 1 9   ? -9.907  48.201 66.635 1.00 35.03 ? 9    GLY X O   1 
ATOM   53   N N   . GLN A 1 10  ? -11.456 46.975 65.554 1.00 30.60 ? 10   GLN X N   1 
ATOM   54   C CA  . GLN A 1 10  ? -12.479 48.016 65.601 1.00 34.16 ? 10   GLN X CA  1 
ATOM   55   C C   . GLN A 1 10  ? -12.920 48.366 67.019 1.00 33.95 ? 10   GLN X C   1 
ATOM   56   O O   . GLN A 1 10  ? -13.036 47.492 67.880 1.00 35.10 ? 10   GLN X O   1 
ATOM   57   C CB  . GLN A 1 10  ? -13.707 47.618 64.772 1.00 33.01 ? 10   GLN X CB  1 
ATOM   58   C CG  . GLN A 1 10  ? -13.402 47.211 63.340 1.00 38.39 ? 10   GLN X CG  1 
ATOM   59   C CD  . GLN A 1 10  ? -13.379 45.707 63.158 1.00 34.05 ? 10   GLN X CD  1 
ATOM   60   O OE1 . GLN A 1 10  ? -12.791 44.989 63.967 1.00 33.22 ? 10   GLN X OE1 1 
ATOM   61   N NE2 . GLN A 1 10  ? -14.017 45.226 62.096 1.00 34.29 ? 10   GLN X NE2 1 
ATOM   62   N N   . GLN A 1 11  ? -13.162 49.656 67.244 1.00 32.55 ? 11   GLN X N   1 
ATOM   63   C CA  . GLN A 1 11  ? -13.617 50.163 68.535 1.00 33.35 ? 11   GLN X CA  1 
ATOM   64   C C   . GLN A 1 11  ? -14.782 51.118 68.284 1.00 33.96 ? 11   GLN X C   1 
ATOM   65   O O   . GLN A 1 11  ? -14.891 51.696 67.201 1.00 29.93 ? 11   GLN X O   1 
ATOM   66   C CB  . GLN A 1 11  ? -12.478 50.870 69.276 1.00 34.69 ? 11   GLN X CB  1 
ATOM   67   C CG  . GLN A 1 11  ? -11.373 49.929 69.740 1.00 40.26 ? 11   GLN X CG  1 
ATOM   68   C CD  . GLN A 1 11  ? -10.660 50.415 70.990 1.00 52.45 ? 11   GLN X CD  1 
ATOM   69   O OE1 . GLN A 1 11  ? -10.425 51.613 71.154 1.00 48.20 ? 11   GLN X OE1 1 
ATOM   70   N NE2 . GLN A 1 11  ? -10.314 49.484 71.875 1.00 54.37 ? 11   GLN X NE2 1 
ATOM   71   N N   . TYR A 1 12  ? -15.653 51.283 69.278 1.00 32.68 ? 12   TYR X N   1 
ATOM   72   C CA  . TYR A 1 12  ? -16.820 52.148 69.127 1.00 37.95 ? 12   TYR X CA  1 
ATOM   73   C C   . TYR A 1 12  ? -17.068 53.053 70.333 1.00 39.98 ? 12   TYR X C   1 
ATOM   74   O O   . TYR A 1 12  ? -18.210 53.232 70.762 1.00 40.86 ? 12   TYR X O   1 
ATOM   75   C CB  . TYR A 1 12  ? -18.066 51.300 68.819 1.00 36.77 ? 12   TYR X CB  1 
ATOM   76   C CG  . TYR A 1 12  ? -17.849 50.328 67.679 1.00 39.84 ? 12   TYR X CG  1 
ATOM   77   C CD1 . TYR A 1 12  ? -18.076 50.711 66.362 1.00 38.50 ? 12   TYR X CD1 1 
ATOM   78   C CD2 . TYR A 1 12  ? -17.410 49.028 67.918 1.00 34.23 ? 12   TYR X CD2 1 
ATOM   79   C CE1 . TYR A 1 12  ? -17.876 49.830 65.315 1.00 38.79 ? 12   TYR X CE1 1 
ATOM   80   C CE2 . TYR A 1 12  ? -17.206 48.139 66.876 1.00 36.22 ? 12   TYR X CE2 1 
ATOM   81   C CZ  . TYR A 1 12  ? -17.441 48.545 65.577 1.00 38.06 ? 12   TYR X CZ  1 
ATOM   82   O OH  . TYR A 1 12  ? -17.243 47.670 64.532 1.00 33.58 ? 12   TYR X OH  1 
ATOM   83   N N   . LYS A 1 13  ? -15.997 53.624 70.875 1.00 42.53 ? 13   LYS X N   1 
ATOM   84   C CA  . LYS A 1 13  ? -16.109 54.501 72.037 1.00 44.61 ? 13   LYS X CA  1 
ATOM   85   C C   . LYS A 1 13  ? -15.918 55.980 71.705 1.00 41.58 ? 13   LYS X C   1 
ATOM   86   O O   . LYS A 1 13  ? -15.787 56.806 72.607 1.00 41.82 ? 13   LYS X O   1 
ATOM   87   C CB  . LYS A 1 13  ? -15.128 54.080 73.137 1.00 47.36 ? 13   LYS X CB  1 
ATOM   88   C CG  . LYS A 1 13  ? -14.266 52.874 72.797 1.00 52.32 ? 13   LYS X CG  1 
ATOM   89   C CD  . LYS A 1 13  ? -13.029 52.809 73.683 1.00 62.90 ? 13   LYS X CD  1 
ATOM   90   C CE  . LYS A 1 13  ? -13.202 51.787 74.797 1.00 70.89 ? 13   LYS X CE  1 
ATOM   91   N NZ  . LYS A 1 13  ? -12.059 50.834 74.864 1.00 74.64 ? 13   LYS X NZ  1 
ATOM   92   N N   . ASP A 1 14  ? -15.906 56.314 70.418 1.00 37.53 ? 14   ASP X N   1 
ATOM   93   C CA  . ASP A 1 14  ? -15.715 57.702 70.002 1.00 39.59 ? 14   ASP X CA  1 
ATOM   94   C C   . ASP A 1 14  ? -16.917 58.334 69.301 1.00 41.71 ? 14   ASP X C   1 
ATOM   95   O O   . ASP A 1 14  ? -16.774 59.340 68.599 1.00 41.85 ? 14   ASP X O   1 
ATOM   96   C CB  . ASP A 1 14  ? -14.457 57.834 69.138 1.00 38.36 ? 14   ASP X CB  1 
ATOM   97   C CG  . ASP A 1 14  ? -13.188 57.644 69.937 1.00 42.71 ? 14   ASP X CG  1 
ATOM   98   O OD1 . ASP A 1 14  ? -13.231 57.870 71.163 1.00 41.48 ? 14   ASP X OD1 1 
ATOM   99   O OD2 . ASP A 1 14  ? -12.108 57.273 69.431 1.00 34.31 ? 14   ASP X OD2 1 
ATOM   100  N N   . GLY A 1 15  ? -18.095 57.746 69.492 1.00 39.01 ? 15   GLY X N   1 
ATOM   101  C CA  . GLY A 1 15  ? -19.312 58.255 68.887 1.00 41.47 ? 15   GLY X CA  1 
ATOM   102  C C   . GLY A 1 15  ? -19.408 57.998 67.395 1.00 41.76 ? 15   GLY X C   1 
ATOM   103  O O   . GLY A 1 15  ? -18.504 57.417 66.794 1.00 42.23 ? 15   GLY X O   1 
ATOM   104  N N   . LYS A 1 16  ? -20.513 58.435 66.798 1.00 40.41 ? 16   LYS X N   1 
ATOM   105  C CA  . LYS A 1 16  ? -20.737 58.268 65.366 1.00 41.63 ? 16   LYS X CA  1 
ATOM   106  C C   . LYS A 1 16  ? -20.354 59.552 64.639 1.00 42.61 ? 16   LYS X C   1 
ATOM   107  O O   . LYS A 1 16  ? -20.777 60.643 65.024 1.00 44.71 ? 16   LYS X O   1 
ATOM   108  C CB  . LYS A 1 16  ? -22.199 57.914 65.085 1.00 42.61 ? 16   LYS X CB  1 
ATOM   109  C CG  . LYS A 1 16  ? -22.465 57.445 63.663 1.00 47.55 ? 16   LYS X CG  1 
ATOM   110  C CD  . LYS A 1 16  ? -23.845 56.816 63.537 1.00 60.95 ? 16   LYS X CD  1 
ATOM   111  C CE  . LYS A 1 16  ? -24.003 56.093 62.208 1.00 67.80 ? 16   LYS X CE  1 
ATOM   112  N NZ  . LYS A 1 16  ? -25.167 56.603 61.433 1.00 71.78 ? 16   LYS X NZ  1 
ATOM   113  N N   . PHE A 1 17  ? -19.553 59.415 63.586 1.00 39.92 ? 17   PHE X N   1 
ATOM   114  C CA  . PHE A 1 17  ? -19.091 60.562 62.809 1.00 40.69 ? 17   PHE X CA  1 
ATOM   115  C C   . PHE A 1 17  ? -20.049 60.944 61.684 1.00 40.30 ? 17   PHE X C   1 
ATOM   116  O O   . PHE A 1 17  ? -20.691 60.081 61.083 1.00 38.96 ? 17   PHE X O   1 
ATOM   117  C CB  . PHE A 1 17  ? -17.693 60.292 62.242 1.00 37.82 ? 17   PHE X CB  1 
ATOM   118  C CG  . PHE A 1 17  ? -16.628 60.159 63.294 1.00 38.65 ? 17   PHE X CG  1 
ATOM   119  C CD1 . PHE A 1 17  ? -16.478 58.978 64.006 1.00 36.21 ? 17   PHE X CD1 1 
ATOM   120  C CD2 . PHE A 1 17  ? -15.775 61.216 63.572 1.00 46.49 ? 17   PHE X CD2 1 
ATOM   121  C CE1 . PHE A 1 17  ? -15.500 58.853 64.977 1.00 45.42 ? 17   PHE X CE1 1 
ATOM   122  C CE2 . PHE A 1 17  ? -14.793 61.097 64.542 1.00 52.94 ? 17   PHE X CE2 1 
ATOM   123  C CZ  . PHE A 1 17  ? -14.655 59.914 65.245 1.00 48.46 ? 17   PHE X CZ  1 
ATOM   124  N N   . THR A 1 18  ? -20.136 62.242 61.408 1.00 42.43 ? 18   THR X N   1 
ATOM   125  C CA  . THR A 1 18  ? -21.011 62.756 60.353 1.00 43.10 ? 18   THR X CA  1 
ATOM   126  C C   . THR A 1 18  ? -20.216 63.460 59.251 1.00 43.84 ? 18   THR X C   1 
ATOM   127  O O   . THR A 1 18  ? -20.786 63.956 58.277 1.00 44.45 ? 18   THR X O   1 
ATOM   128  C CB  . THR A 1 18  ? -22.078 63.708 60.939 1.00 43.91 ? 18   THR X CB  1 
ATOM   129  O OG1 . THR A 1 18  ? -21.458 64.644 61.831 1.00 44.96 ? 18   THR X OG1 1 
ATOM   130  C CG2 . THR A 1 18  ? -23.040 62.946 61.840 1.00 46.59 ? 18   THR X CG2 1 
ATOM   131  N N   . GLN A 1 19  ? -18.897 63.499 59.416 1.00 40.10 ? 19   GLN X N   1 
ATOM   132  C CA  . GLN A 1 19  ? -18.005 64.126 58.443 1.00 40.41 ? 19   GLN X CA  1 
ATOM   133  C C   . GLN A 1 19  ? -16.654 63.408 58.451 1.00 37.58 ? 19   GLN X C   1 
ATOM   134  O O   . GLN A 1 19  ? -16.281 62.803 59.457 1.00 37.91 ? 19   GLN X O   1 
ATOM   135  C CB  . GLN A 1 19  ? -17.844 65.624 58.727 1.00 41.09 ? 19   GLN X CB  1 
ATOM   136  C CG  . GLN A 1 19  ? -17.533 65.978 60.170 1.00 50.05 ? 19   GLN X CG  1 
ATOM   137  C CD  . GLN A 1 19  ? -17.440 67.479 60.389 1.00 63.04 ? 19   GLN X CD  1 
ATOM   138  O OE1 . GLN A 1 19  ? -18.322 68.229 59.965 1.00 61.01 ? 19   GLN X OE1 1 
ATOM   139  N NE2 . GLN A 1 19  ? -16.374 67.920 61.049 1.00 58.70 ? 19   GLN X NE2 1 
ATOM   140  N N   . PRO A 1 20  ? -15.927 63.474 57.335 1.00 35.67 ? 20   PRO X N   1 
ATOM   141  C CA  . PRO A 1 20  ? -14.622 62.807 57.205 1.00 34.23 ? 20   PRO X CA  1 
ATOM   142  C C   . PRO A 1 20  ? -13.624 63.107 58.323 1.00 33.46 ? 20   PRO X C   1 
ATOM   143  O O   . PRO A 1 20  ? -12.909 62.203 58.758 1.00 32.37 ? 20   PRO X O   1 
ATOM   144  C CB  . PRO A 1 20  ? -14.096 63.331 55.866 1.00 35.56 ? 20   PRO X CB  1 
ATOM   145  C CG  . PRO A 1 20  ? -15.329 63.669 55.088 1.00 37.82 ? 20   PRO X CG  1 
ATOM   146  C CD  . PRO A 1 20  ? -16.303 64.192 56.103 1.00 34.64 ? 20   PRO X CD  1 
ATOM   147  N N   . PHE A 1 21  ? -13.575 64.355 58.776 1.00 32.23 ? 21   PHE X N   1 
ATOM   148  C CA  . PHE A 1 21  ? -12.657 64.749 59.839 1.00 32.01 ? 21   PHE X CA  1 
ATOM   149  C C   . PHE A 1 21  ? -13.407 65.548 60.900 1.00 34.26 ? 21   PHE X C   1 
ATOM   150  O O   . PHE A 1 21  ? -14.185 66.446 60.577 1.00 34.80 ? 21   PHE X O   1 
ATOM   151  C CB  . PHE A 1 21  ? -11.514 65.598 59.272 1.00 30.92 ? 21   PHE X CB  1 
ATOM   152  C CG  . PHE A 1 21  ? -10.693 64.896 58.222 1.00 33.90 ? 21   PHE X CG  1 
ATOM   153  C CD1 . PHE A 1 21  ? -10.991 65.047 56.875 1.00 33.65 ? 21   PHE X CD1 1 
ATOM   154  C CD2 . PHE A 1 21  ? -9.623  64.089 58.581 1.00 31.32 ? 21   PHE X CD2 1 
ATOM   155  C CE1 . PHE A 1 21  ? -10.237 64.402 55.903 1.00 31.56 ? 21   PHE X CE1 1 
ATOM   156  C CE2 . PHE A 1 21  ? -8.866  63.443 57.615 1.00 28.46 ? 21   PHE X CE2 1 
ATOM   157  C CZ  . PHE A 1 21  ? -9.176  63.602 56.274 1.00 29.11 ? 21   PHE X CZ  1 
ATOM   158  N N   . SER A 1 22  ? -13.176 65.226 62.168 1.00 33.09 ? 22   SER X N   1 
ATOM   159  C CA  . SER A 1 22  ? -13.845 65.946 63.242 1.00 36.48 ? 22   SER X CA  1 
ATOM   160  C C   . SER A 1 22  ? -12.881 66.423 64.325 1.00 34.57 ? 22   SER X C   1 
ATOM   161  O O   . SER A 1 22  ? -12.140 65.634 64.911 1.00 32.08 ? 22   SER X O   1 
ATOM   162  C CB  . SER A 1 22  ? -15.013 65.136 63.818 1.00 38.37 ? 22   SER X CB  1 
ATOM   163  O OG  . SER A 1 22  ? -14.608 64.349 64.923 1.00 55.98 ? 22   SER X OG  1 
ATOM   164  N N   . LEU A 1 23  ? -12.904 67.728 64.577 1.00 34.90 ? 23   LEU X N   1 
ATOM   165  C CA  . LEU A 1 23  ? -12.046 68.354 65.575 1.00 35.76 ? 23   LEU X CA  1 
ATOM   166  C C   . LEU A 1 23  ? -12.434 67.909 66.980 1.00 35.48 ? 23   LEU X C   1 
ATOM   167  O O   . LEU A 1 23  ? -13.584 68.057 67.386 1.00 35.25 ? 23   LEU X O   1 
ATOM   168  C CB  . LEU A 1 23  ? -12.164 69.878 65.474 1.00 34.95 ? 23   LEU X CB  1 
ATOM   169  C CG  . LEU A 1 23  ? -10.978 70.787 65.815 1.00 42.57 ? 23   LEU X CG  1 
ATOM   170  C CD1 . LEU A 1 23  ? -11.392 71.867 66.800 1.00 40.99 ? 23   LEU X CD1 1 
ATOM   171  C CD2 . LEU A 1 23  ? -9.754  70.027 66.313 1.00 41.29 ? 23   LEU X CD2 1 
ATOM   172  N N   . VAL A 1 24  ? -11.473 67.364 67.719 1.00 31.97 ? 24   VAL X N   1 
ATOM   173  C CA  . VAL A 1 24  ? -11.735 66.926 69.085 1.00 34.49 ? 24   VAL X CA  1 
ATOM   174  C C   . VAL A 1 24  ? -10.963 67.802 70.063 1.00 35.73 ? 24   VAL X C   1 
ATOM   175  O O   . VAL A 1 24  ? -9.920  68.358 69.716 1.00 35.84 ? 24   VAL X O   1 
ATOM   176  C CB  . VAL A 1 24  ? -11.376 65.434 69.309 1.00 33.17 ? 24   VAL X CB  1 
ATOM   177  C CG1 . VAL A 1 24  ? -12.282 64.530 68.479 1.00 38.52 ? 24   VAL X CG1 1 
ATOM   178  C CG2 . VAL A 1 24  ? -9.908  65.163 68.997 1.00 33.03 ? 24   VAL X CG2 1 
ATOM   179  N N   . ASN A 1 25  ? -11.478 67.931 71.282 1.00 36.50 ? 25   ASN X N   1 
ATOM   180  C CA  . ASN A 1 25  ? -10.807 68.730 72.300 1.00 39.25 ? 25   ASN X CA  1 
ATOM   181  C C   . ASN A 1 25  ? -9.508  68.034 72.690 1.00 36.99 ? 25   ASN X C   1 
ATOM   182  O O   . ASN A 1 25  ? -8.483  68.676 72.900 1.00 34.84 ? 25   ASN X O   1 
ATOM   183  C CB  . ASN A 1 25  ? -11.703 68.907 73.529 1.00 39.89 ? 25   ASN X CB  1 
ATOM   184  C CG  . ASN A 1 25  ? -12.818 69.919 73.301 1.00 54.27 ? 25   ASN X CG  1 
ATOM   185  O OD1 . ASN A 1 25  ? -12.678 70.851 72.507 1.00 55.78 ? 25   ASN X OD1 1 
ATOM   186  N ND2 . ASN A 1 25  ? -13.933 69.736 74.002 1.00 55.50 ? 25   ASN X ND2 1 
ATOM   187  N N   . GLN A 1 26  ? -9.573  66.710 72.779 1.00 38.02 ? 26   GLN X N   1 
ATOM   188  C CA  . GLN A 1 26  ? -8.422  65.886 73.127 1.00 40.28 ? 26   GLN X CA  1 
ATOM   189  C C   . GLN A 1 26  ? -8.632  64.507 72.518 1.00 35.24 ? 26   GLN X C   1 
ATOM   190  O O   . GLN A 1 26  ? -9.696  63.912 72.679 1.00 35.19 ? 26   GLN X O   1 
ATOM   191  C CB  . GLN A 1 26  ? -8.305  65.750 74.646 1.00 41.62 ? 26   GLN X CB  1 
ATOM   192  C CG  . GLN A 1 26  ? -7.207  66.593 75.276 1.00 49.47 ? 26   GLN X CG  1 
ATOM   193  C CD  . GLN A 1 26  ? -7.502  66.934 76.728 1.00 57.51 ? 26   GLN X CD  1 
ATOM   194  O OE1 . GLN A 1 26  ? -6.656  67.497 77.424 1.00 60.49 ? 26   GLN X OE1 1 
ATOM   195  N NE2 . GLN A 1 26  ? -8.701  66.594 77.186 1.00 60.93 ? 26   GLN X NE2 1 
ATOM   196  N N   . PRO A 1 27  ? -7.628  63.994 71.818 1.00 35.78 ? 27   PRO X N   1 
ATOM   197  C CA  . PRO A 1 27  ? -7.739  62.666 71.208 1.00 36.34 ? 27   PRO X CA  1 
ATOM   198  C C   . PRO A 1 27  ? -7.983  61.593 72.265 1.00 35.60 ? 27   PRO X C   1 
ATOM   199  O O   . PRO A 1 27  ? -7.403  61.658 73.353 1.00 35.63 ? 27   PRO X O   1 
ATOM   200  C CB  . PRO A 1 27  ? -6.371  62.463 70.548 1.00 36.88 ? 27   PRO X CB  1 
ATOM   201  C CG  . PRO A 1 27  ? -5.471  63.462 71.184 1.00 40.25 ? 27   PRO X CG  1 
ATOM   202  C CD  . PRO A 1 27  ? -6.327  64.629 71.553 1.00 35.18 ? 27   PRO X CD  1 
ATOM   203  N N   . ASP A 1 28  ? -8.837  60.625 71.949 1.00 36.37 ? 28   ASP X N   1 
ATOM   204  C CA  . ASP A 1 28  ? -9.120  59.529 72.868 1.00 37.09 ? 28   ASP X CA  1 
ATOM   205  C C   . ASP A 1 28  ? -7.979  58.520 72.754 1.00 38.24 ? 28   ASP X C   1 
ATOM   206  O O   . ASP A 1 28  ? -8.137  57.429 72.199 1.00 38.35 ? 28   ASP X O   1 
ATOM   207  C CB  . ASP A 1 28  ? -10.463 58.868 72.543 1.00 38.88 ? 28   ASP X CB  1 
ATOM   208  C CG  . ASP A 1 28  ? -10.799 57.727 73.493 1.00 43.39 ? 28   ASP X CG  1 
ATOM   209  O OD1 . ASP A 1 28  ? -11.639 56.875 73.135 1.00 43.53 ? 28   ASP X OD1 1 
ATOM   210  O OD2 . ASP A 1 28  ? -10.273 57.598 74.618 1.00 42.89 ? 28   ASP X OD2 1 
ATOM   211  N N   . ALA A 1 29  ? -6.825  58.908 73.286 1.00 34.70 ? 29   ALA X N   1 
ATOM   212  C CA  . ALA A 1 29  ? -5.623  58.083 73.272 1.00 34.63 ? 29   ALA X CA  1 
ATOM   213  C C   . ALA A 1 29  ? -4.822  58.477 74.506 1.00 37.08 ? 29   ALA X C   1 
ATOM   214  O O   . ALA A 1 29  ? -4.474  59.646 74.680 1.00 35.27 ? 29   ALA X O   1 
ATOM   215  C CB  . ALA A 1 29  ? -4.816  58.349 72.008 1.00 35.30 ? 29   ALA X CB  1 
ATOM   216  N N   . VAL A 1 30  ? -4.534  57.502 75.359 1.00 32.00 ? 30   VAL X N   1 
ATOM   217  C CA  . VAL A 1 30  ? -3.805  57.762 76.591 1.00 35.81 ? 30   VAL X CA  1 
ATOM   218  C C   . VAL A 1 30  ? -2.291  57.630 76.461 1.00 34.24 ? 30   VAL X C   1 
ATOM   219  O O   . VAL A 1 30  ? -1.788  56.693 75.842 1.00 33.92 ? 30   VAL X O   1 
ATOM   220  C CB  . VAL A 1 30  ? -4.327  56.890 77.758 1.00 36.09 ? 30   VAL X CB  1 
ATOM   221  C CG1 . VAL A 1 30  ? -5.844  57.013 77.875 1.00 35.37 ? 30   VAL X CG1 1 
ATOM   222  C CG2 . VAL A 1 30  ? -3.923  55.432 77.574 1.00 48.44 ? 30   VAL X CG2 1 
ATOM   223  N N   . GLY A 1 31  ? -1.571  58.581 77.048 1.00 31.39 ? 31   GLY X N   1 
ATOM   224  C CA  . GLY A 1 31  ? -0.120  58.558 77.019 1.00 30.40 ? 31   GLY X CA  1 
ATOM   225  C C   . GLY A 1 31  ? 0.522   59.393 75.930 1.00 29.74 ? 31   GLY X C   1 
ATOM   226  O O   . GLY A 1 31  ? -0.085  60.324 75.393 1.00 25.43 ? 31   GLY X O   1 
ATOM   227  N N   . ALA A 1 32  ? 1.764   59.046 75.610 1.00 26.16 ? 32   ALA X N   1 
ATOM   228  C CA  . ALA A 1 32  ? 2.546   59.744 74.600 1.00 29.17 ? 32   ALA X CA  1 
ATOM   229  C C   . ALA A 1 32  ? 2.951   58.785 73.488 1.00 28.44 ? 32   ALA X C   1 
ATOM   230  O O   . ALA A 1 32  ? 3.027   57.574 73.713 1.00 28.39 ? 32   ALA X O   1 
ATOM   231  C CB  . ALA A 1 32  ? 3.798   60.330 75.253 1.00 27.71 ? 32   ALA X CB  1 
ATOM   232  N N   . PRO A 1 33  ? 3.202   59.315 72.289 1.00 29.31 ? 33   PRO X N   1 
ATOM   233  C CA  . PRO A 1 33  ? 3.655   58.482 71.168 1.00 29.44 ? 33   PRO X CA  1 
ATOM   234  C C   . PRO A 1 33  ? 4.947   57.781 71.589 1.00 30.48 ? 33   PRO X C   1 
ATOM   235  O O   . PRO A 1 33  ? 5.742   58.364 72.326 1.00 28.53 ? 33   PRO X O   1 
ATOM   236  C CB  . PRO A 1 33  ? 3.945   59.506 70.064 1.00 30.98 ? 33   PRO X CB  1 
ATOM   237  C CG  . PRO A 1 33  ? 3.095   60.688 70.407 1.00 27.06 ? 33   PRO X CG  1 
ATOM   238  C CD  . PRO A 1 33  ? 3.067   60.733 71.908 1.00 26.89 ? 33   PRO X CD  1 
ATOM   239  N N   . ILE A 1 34  ? 5.151   56.552 71.128 1.00 29.03 ? 34   ILE X N   1 
ATOM   240  C CA  . ILE A 1 34  ? 6.334   55.783 71.509 1.00 31.18 ? 34   ILE X CA  1 
ATOM   241  C C   . ILE A 1 34  ? 7.503   55.880 70.534 1.00 30.26 ? 34   ILE X C   1 
ATOM   242  O O   . ILE A 1 34  ? 8.568   55.306 70.776 1.00 28.58 ? 34   ILE X O   1 
ATOM   243  C CB  . ILE A 1 34  ? 5.953   54.296 71.715 1.00 31.85 ? 34   ILE X CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? 5.483   53.674 70.393 1.00 30.68 ? 34   ILE X CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? 4.866   54.171 72.769 1.00 29.00 ? 34   ILE X CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? 5.355   52.158 70.435 1.00 37.33 ? 34   ILE X CD1 1 
ATOM   247  N N   . ASN A 1 35  ? 7.319   56.606 69.438 1.00 27.69 ? 35   ASN X N   1 
ATOM   248  C CA  . ASN A 1 35  ? 8.374   56.712 68.434 1.00 27.61 ? 35   ASN X CA  1 
ATOM   249  C C   . ASN A 1 35  ? 8.909   58.113 68.153 1.00 29.26 ? 35   ASN X C   1 
ATOM   250  O O   . ASN A 1 35  ? 9.165   58.460 66.998 1.00 28.29 ? 35   ASN X O   1 
ATOM   251  C CB  . ASN A 1 35  ? 7.920   56.043 67.133 1.00 26.78 ? 35   ASN X CB  1 
ATOM   252  C CG  . ASN A 1 35  ? 6.802   56.807 66.440 1.00 30.61 ? 35   ASN X CG  1 
ATOM   253  O OD1 . ASN A 1 35  ? 6.043   57.544 67.077 1.00 27.32 ? 35   ASN X OD1 1 
ATOM   254  N ND2 . ASN A 1 35  ? 6.699   56.635 65.126 1.00 27.67 ? 35   ASN X ND2 1 
ATOM   255  N N   . ALA A 1 36  ? 9.083   58.916 69.200 1.00 28.59 ? 36   ALA X N   1 
ATOM   256  C CA  . ALA A 1 36  ? 9.585   60.283 69.037 1.00 29.06 ? 36   ALA X CA  1 
ATOM   257  C C   . ALA A 1 36  ? 10.898  60.361 68.257 1.00 29.87 ? 36   ALA X C   1 
ATOM   258  O O   . ALA A 1 36  ? 11.075  61.247 67.417 1.00 26.89 ? 36   ALA X O   1 
ATOM   259  C CB  . ALA A 1 36  ? 9.726   60.976 70.384 1.00 27.77 ? 36   ALA X CB  1 
ATOM   260  N N   . GLY A 1 37  ? 11.812  59.435 68.538 1.00 30.04 ? 37   GLY X N   1 
ATOM   261  C CA  . GLY A 1 37  ? 13.098  59.397 67.862 1.00 30.27 ? 37   GLY X CA  1 
ATOM   262  C C   . GLY A 1 37  ? 12.949  59.118 66.375 1.00 27.67 ? 37   GLY X C   1 
ATOM   263  O O   . GLY A 1 37  ? 13.560  59.793 65.544 1.00 28.08 ? 37   GLY X O   1 
ATOM   264  N N   . ASP A 1 38  ? 12.132  58.122 66.045 1.00 29.00 ? 38   ASP X N   1 
ATOM   265  C CA  . ASP A 1 38  ? 11.880  57.748 64.654 1.00 29.51 ? 38   ASP X CA  1 
ATOM   266  C C   . ASP A 1 38  ? 11.189  58.889 63.915 1.00 29.80 ? 38   ASP X C   1 
ATOM   267  O O   . ASP A 1 38  ? 11.483  59.146 62.746 1.00 28.96 ? 38   ASP X O   1 
ATOM   268  C CB  . ASP A 1 38  ? 10.978  56.516 64.580 1.00 25.45 ? 38   ASP X CB  1 
ATOM   269  C CG  . ASP A 1 38  ? 11.667  55.248 65.039 1.00 30.85 ? 38   ASP X CG  1 
ATOM   270  O OD1 . ASP A 1 38  ? 12.909  55.237 65.158 1.00 32.54 ? 38   ASP X OD1 1 
ATOM   271  O OD2 . ASP A 1 38  ? 11.031  54.207 65.303 1.00 32.08 ? 38   ASP X OD2 1 
ATOM   272  N N   . PHE A 1 39  ? 10.269  59.565 64.601 1.00 28.78 ? 39   PHE X N   1 
ATOM   273  C CA  . PHE A 1 39  ? 9.550   60.687 64.000 1.00 25.85 ? 39   PHE X CA  1 
ATOM   274  C C   . PHE A 1 39  ? 10.524  61.804 63.653 1.00 28.54 ? 39   PHE X C   1 
ATOM   275  O O   . PHE A 1 39  ? 10.467  62.367 62.559 1.00 31.05 ? 39   PHE X O   1 
ATOM   276  C CB  . PHE A 1 39  ? 8.450   61.211 64.926 1.00 27.22 ? 39   PHE X CB  1 
ATOM   277  C CG  . PHE A 1 39  ? 7.723   62.407 64.376 1.00 27.38 ? 39   PHE X CG  1 
ATOM   278  C CD1 . PHE A 1 39  ? 6.756   62.255 63.394 1.00 24.87 ? 39   PHE X CD1 1 
ATOM   279  C CD2 . PHE A 1 39  ? 8.011   63.684 64.839 1.00 25.24 ? 39   PHE X CD2 1 
ATOM   280  C CE1 . PHE A 1 39  ? 6.081   63.360 62.881 1.00 29.43 ? 39   PHE X CE1 1 
ATOM   281  C CE2 . PHE A 1 39  ? 7.347   64.789 64.336 1.00 28.67 ? 39   PHE X CE2 1 
ATOM   282  C CZ  . PHE A 1 39  ? 6.378   64.629 63.355 1.00 27.93 ? 39   PHE X CZ  1 
ATOM   283  N N   . ALA A 1 40  ? 11.418  62.122 64.588 1.00 27.48 ? 40   ALA X N   1 
ATOM   284  C CA  . ALA A 1 40  ? 12.419  63.160 64.367 1.00 26.90 ? 40   ALA X CA  1 
ATOM   285  C C   . ALA A 1 40  ? 13.302  62.789 63.176 1.00 29.57 ? 40   ALA X C   1 
ATOM   286  O O   . ALA A 1 40  ? 13.624  63.636 62.341 1.00 34.77 ? 40   ALA X O   1 
ATOM   287  C CB  . ALA A 1 40  ? 13.272  63.356 65.615 1.00 30.47 ? 40   ALA X CB  1 
ATOM   288  N N   . GLU A 1 41  ? 13.689  61.518 63.109 1.00 28.85 ? 41   GLU X N   1 
ATOM   289  C CA  . GLU A 1 41  ? 14.522  61.025 62.018 1.00 31.20 ? 41   GLU X CA  1 
ATOM   290  C C   . GLU A 1 41  ? 13.771  61.166 60.695 1.00 28.87 ? 41   GLU X C   1 
ATOM   291  O O   . GLU A 1 41  ? 14.364  61.500 59.666 1.00 28.33 ? 41   GLU X O   1 
ATOM   292  C CB  . GLU A 1 41  ? 14.917  59.563 62.257 1.00 32.11 ? 41   GLU X CB  1 
ATOM   293  C CG  . GLU A 1 41  ? 15.787  58.963 61.163 1.00 41.78 ? 41   GLU X CG  1 
ATOM   294  C CD  . GLU A 1 41  ? 15.917  57.452 61.264 1.00 52.84 ? 41   GLU X CD  1 
ATOM   295  O OE1 . GLU A 1 41  ? 15.509  56.877 62.296 1.00 55.07 ? 41   GLU X OE1 1 
ATOM   296  O OE2 . GLU A 1 41  ? 16.431  56.836 60.305 1.00 56.57 ? 41   GLU X OE2 1 
ATOM   297  N N   . GLN A 1 42  ? 12.464  60.912 60.728 1.00 28.40 ? 42   GLN X N   1 
ATOM   298  C CA  . GLN A 1 42  ? 11.645  61.021 59.525 1.00 29.24 ? 42   GLN X CA  1 
ATOM   299  C C   . GLN A 1 42  ? 11.561  62.466 59.048 1.00 30.29 ? 42   GLN X C   1 
ATOM   300  O O   . GLN A 1 42  ? 11.660  62.732 57.851 1.00 30.74 ? 42   GLN X O   1 
ATOM   301  C CB  . GLN A 1 42  ? 10.245  60.439 59.746 1.00 28.79 ? 42   GLN X CB  1 
ATOM   302  C CG  . GLN A 1 42  ? 9.381   60.410 58.483 1.00 26.90 ? 42   GLN X CG  1 
ATOM   303  C CD  . GLN A 1 42  ? 9.970   59.526 57.398 1.00 26.99 ? 42   GLN X CD  1 
ATOM   304  O OE1 . GLN A 1 42  ? 9.647   58.343 57.321 1.00 27.17 ? 42   GLN X OE1 1 
ATOM   305  N NE2 . GLN A 1 42  ? 10.837  60.096 56.560 1.00 26.78 ? 42   GLN X NE2 1 
ATOM   306  N N   . ILE A 1 43  ? 11.382  63.393 59.989 1.00 27.99 ? 43   ILE X N   1 
ATOM   307  C CA  . ILE A 1 43  ? 11.300  64.815 59.660 1.00 28.45 ? 43   ILE X CA  1 
ATOM   308  C C   . ILE A 1 43  ? 12.638  65.302 59.085 1.00 29.44 ? 43   ILE X C   1 
ATOM   309  O O   . ILE A 1 43  ? 12.668  66.115 58.157 1.00 28.77 ? 43   ILE X O   1 
ATOM   310  C CB  . ILE A 1 43  ? 10.902  65.646 60.907 1.00 29.00 ? 43   ILE X CB  1 
ATOM   311  C CG1 . ILE A 1 43  ? 9.529   65.218 61.444 1.00 28.81 ? 43   ILE X CG1 1 
ATOM   312  C CG2 . ILE A 1 43  ? 10.913  67.132 60.595 1.00 27.92 ? 43   ILE X CG2 1 
ATOM   313  C CD1 . ILE A 1 43  ? 8.435   65.084 60.393 1.00 30.25 ? 43   ILE X CD1 1 
ATOM   314  N N   . ASN A 1 44  ? 13.741  64.803 59.640 1.00 30.11 ? 44   ASN X N   1 
ATOM   315  C CA  . ASN A 1 44  ? 15.070  65.173 59.154 1.00 31.96 ? 44   ASN X CA  1 
ATOM   316  C C   . ASN A 1 44  ? 15.242  64.728 57.693 1.00 30.83 ? 44   ASN X C   1 
ATOM   317  O O   . ASN A 1 44  ? 15.878  65.415 56.894 1.00 30.06 ? 44   ASN X O   1 
ATOM   318  C CB  . ASN A 1 44  ? 16.162  64.563 60.036 1.00 30.51 ? 44   ASN X CB  1 
ATOM   319  C CG  . ASN A 1 44  ? 17.532  65.169 59.773 1.00 43.12 ? 44   ASN X CG  1 
ATOM   320  O OD1 . ASN A 1 44  ? 18.511  64.455 59.558 1.00 46.10 ? 44   ASN X OD1 1 
ATOM   321  N ND2 . ASN A 1 44  ? 17.605  66.493 59.787 1.00 44.03 ? 44   ASN X ND2 1 
ATOM   322  N N   . HIS A 1 45  ? 14.669  63.577 57.353 1.00 28.33 ? 45   HIS X N   1 
ATOM   323  C CA  . HIS A 1 45  ? 14.732  63.072 55.986 1.00 27.80 ? 45   HIS X CA  1 
ATOM   324  C C   . HIS A 1 45  ? 13.947  63.988 55.049 1.00 31.90 ? 45   HIS X C   1 
ATOM   325  O O   . HIS A 1 45  ? 14.356  64.203 53.909 1.00 29.67 ? 45   HIS X O   1 
ATOM   326  C CB  . HIS A 1 45  ? 14.198  61.643 55.904 1.00 29.58 ? 45   HIS X CB  1 
ATOM   327  C CG  . HIS A 1 45  ? 15.220  60.596 56.224 1.00 31.16 ? 45   HIS X CG  1 
ATOM   328  N ND1 . HIS A 1 45  ? 16.462  60.559 55.627 1.00 45.72 ? 45   HIS X ND1 1 
ATOM   329  C CD2 . HIS A 1 45  ? 15.181  59.545 57.077 1.00 37.19 ? 45   HIS X CD2 1 
ATOM   330  C CE1 . HIS A 1 45  ? 17.145  59.531 56.100 1.00 44.36 ? 45   HIS X CE1 1 
ATOM   331  N NE2 . HIS A 1 45  ? 16.391  58.900 56.982 1.00 37.79 ? 45   HIS X NE2 1 
ATOM   332  N N   . ILE A 1 46  ? 12.821  64.524 55.526 1.00 26.25 ? 46   ILE X N   1 
ATOM   333  C CA  . ILE A 1 46  ? 12.014  65.432 54.708 1.00 29.31 ? 46   ILE X CA  1 
ATOM   334  C C   . ILE A 1 46  ? 12.794  66.732 54.510 1.00 31.13 ? 46   ILE X C   1 
ATOM   335  O O   . ILE A 1 46  ? 12.851  67.283 53.410 1.00 30.46 ? 46   ILE X O   1 
ATOM   336  C CB  . ILE A 1 46  ? 10.650  65.727 55.373 1.00 28.48 ? 46   ILE X CB  1 
ATOM   337  C CG1 . ILE A 1 46  ? 9.872   64.429 55.616 1.00 25.01 ? 46   ILE X CG1 1 
ATOM   338  C CG2 . ILE A 1 46  ? 9.828   66.671 54.496 1.00 31.72 ? 46   ILE X CG2 1 
ATOM   339  C CD1 . ILE A 1 46  ? 8.560   64.628 56.375 1.00 27.50 ? 46   ILE X CD1 1 
ATOM   340  N N   . ARG A 1 47  ? 13.392  67.206 55.598 1.00 28.29 ? 47   ARG X N   1 
ATOM   341  C CA  . ARG A 1 47  ? 14.204  68.419 55.611 1.00 33.70 ? 47   ARG X CA  1 
ATOM   342  C C   . ARG A 1 47  ? 15.278  68.379 54.520 1.00 33.63 ? 47   ARG X C   1 
ATOM   343  O O   . ARG A 1 47  ? 15.448  69.335 53.762 1.00 32.93 ? 47   ARG X O   1 
ATOM   344  C CB  . ARG A 1 47  ? 14.907  68.506 56.967 1.00 35.69 ? 47   ARG X CB  1 
ATOM   345  C CG  . ARG A 1 47  ? 14.953  69.868 57.590 1.00 45.15 ? 47   ARG X CG  1 
ATOM   346  C CD  . ARG A 1 47  ? 15.946  69.959 58.736 1.00 50.16 ? 47   ARG X CD  1 
ATOM   347  N NE  . ARG A 1 47  ? 15.287  69.983 60.040 1.00 40.40 ? 47   ARG X NE  1 
ATOM   348  C CZ  . ARG A 1 47  ? 14.901  71.095 60.650 1.00 45.65 ? 47   ARG X CZ  1 
ATOM   349  N NH1 . ARG A 1 47  ? 15.105  72.274 60.072 1.00 33.25 ? 47   ARG X NH1 1 
ATOM   350  N NH2 . ARG A 1 47  ? 14.309  71.034 61.837 1.00 37.19 ? 47   ARG X NH2 1 
ATOM   351  N N   . ASN A 1 48  ? 15.995  67.261 54.451 1.00 33.54 ? 48   ASN X N   1 
ATOM   352  C CA  . ASN A 1 48  ? 17.080  67.084 53.487 1.00 37.50 ? 48   ASN X CA  1 
ATOM   353  C C   . ASN A 1 48  ? 16.681  66.618 52.088 1.00 36.80 ? 48   ASN X C   1 
ATOM   354  O O   . ASN A 1 48  ? 17.245  67.081 51.095 1.00 36.68 ? 48   ASN X O   1 
ATOM   355  C CB  . ASN A 1 48  ? 18.141  66.132 54.051 1.00 36.75 ? 48   ASN X CB  1 
ATOM   356  C CG  . ASN A 1 48  ? 18.812  66.676 55.301 1.00 45.70 ? 48   ASN X CG  1 
ATOM   357  O OD1 . ASN A 1 48  ? 18.950  67.887 55.473 1.00 47.27 ? 48   ASN X OD1 1 
ATOM   358  N ND2 . ASN A 1 48  ? 19.235  65.775 56.182 1.00 46.61 ? 48   ASN X ND2 1 
ATOM   359  N N   . SER A 1 49  ? 15.716  65.706 52.007 1.00 32.54 ? 49   SER X N   1 
ATOM   360  C CA  . SER A 1 49  ? 15.293  65.165 50.715 1.00 34.26 ? 49   SER X CA  1 
ATOM   361  C C   . SER A 1 49  ? 14.166  65.906 49.998 1.00 36.65 ? 49   SER X C   1 
ATOM   362  O O   . SER A 1 49  ? 14.034  65.804 48.777 1.00 33.13 ? 49   SER X O   1 
ATOM   363  C CB  . SER A 1 49  ? 14.992  63.672 50.826 1.00 31.78 ? 49   SER X CB  1 
ATOM   364  O OG  . SER A 1 49  ? 16.111  62.984 51.365 1.00 33.90 ? 49   SER X OG  1 
ATOM   365  N N   . SER A 1 50  ? 13.358  66.649 50.750 1.00 34.61 ? 50   SER X N   1 
ATOM   366  C CA  . SER A 1 50  ? 12.256  67.410 50.165 1.00 33.91 ? 50   SER X CA  1 
ATOM   367  C C   . SER A 1 50  ? 12.070  68.736 50.898 1.00 33.74 ? 50   SER X C   1 
ATOM   368  O O   . SER A 1 50  ? 11.081  68.921 51.617 1.00 32.05 ? 50   SER X O   1 
ATOM   369  C CB  . SER A 1 50  ? 10.962  66.598 50.219 1.00 36.15 ? 50   SER X CB  1 
ATOM   370  O OG  . SER A 1 50  ? 9.944   67.218 49.456 1.00 35.12 ? 50   SER X OG  1 
ATOM   371  N N   . PRO A 1 51  ? 13.017  69.657 50.714 1.00 33.96 ? 51   PRO X N   1 
ATOM   372  C CA  . PRO A 1 51  ? 12.976  70.963 51.385 1.00 33.48 ? 51   PRO X CA  1 
ATOM   373  C C   . PRO A 1 51  ? 11.702  71.763 51.127 1.00 34.91 ? 51   PRO X C   1 
ATOM   374  O O   . PRO A 1 51  ? 11.279  72.516 52.005 1.00 32.20 ? 51   PRO X O   1 
ATOM   375  C CB  . PRO A 1 51  ? 14.209  71.693 50.830 1.00 33.67 ? 51   PRO X CB  1 
ATOM   376  C CG  . PRO A 1 51  ? 14.600  70.939 49.607 1.00 38.89 ? 51   PRO X CG  1 
ATOM   377  C CD  . PRO A 1 51  ? 14.200  69.516 49.847 1.00 34.87 ? 51   PRO X CD  1 
ATOM   378  N N   . ARG A 1 52  ? 11.107  71.603 49.948 1.00 35.80 ? 52   ARG X N   1 
ATOM   379  C CA  . ARG A 1 52  ? 9.876   72.314 49.611 1.00 41.16 ? 52   ARG X CA  1 
ATOM   380  C C   . ARG A 1 52  ? 8.742   71.823 50.512 1.00 38.56 ? 52   ARG X C   1 
ATOM   381  O O   . ARG A 1 52  ? 7.993   72.624 51.072 1.00 35.39 ? 52   ARG X O   1 
ATOM   382  C CB  . ARG A 1 52  ? 9.517   72.096 48.138 1.00 45.27 ? 52   ARG X CB  1 
ATOM   383  C CG  . ARG A 1 52  ? 8.289   72.862 47.666 1.00 60.43 ? 52   ARG X CG  1 
ATOM   384  C CD  . ARG A 1 52  ? 7.721   72.366 46.340 1.00 76.26 ? 52   ARG X CD  1 
ATOM   385  N NE  . ARG A 1 52  ? 6.414   71.732 46.502 1.00 84.70 ? 52   ARG X NE  1 
ATOM   386  C CZ  . ARG A 1 52  ? 6.227   70.430 46.694 1.00 89.14 ? 52   ARG X CZ  1 
ATOM   387  N NH1 . ARG A 1 52  ? 7.265   69.605 46.752 1.00 85.44 ? 52   ARG X NH1 1 
ATOM   388  N NH2 . ARG A 1 52  ? 4.998   69.950 46.830 1.00 88.89 ? 52   ARG X NH2 1 
ATOM   389  N N   . LEU A 1 53  ? 8.628   70.504 50.645 1.00 37.33 ? 53   LEU X N   1 
ATOM   390  C CA  . LEU A 1 53  ? 7.603   69.903 51.490 1.00 37.49 ? 53   LEU X CA  1 
ATOM   391  C C   . LEU A 1 53  ? 7.863   70.265 52.951 1.00 37.08 ? 53   LEU X C   1 
ATOM   392  O O   . LEU A 1 53  ? 6.929   70.542 53.702 1.00 34.45 ? 53   LEU X O   1 
ATOM   393  C CB  . LEU A 1 53  ? 7.581   68.381 51.322 1.00 39.08 ? 53   LEU X CB  1 
ATOM   394  C CG  . LEU A 1 53  ? 6.455   67.613 52.023 1.00 39.42 ? 53   LEU X CG  1 
ATOM   395  C CD1 . LEU A 1 53  ? 5.093   68.036 51.485 1.00 45.95 ? 53   LEU X CD1 1 
ATOM   396  C CD2 . LEU A 1 53  ? 6.645   66.112 51.870 1.00 37.92 ? 53   LEU X CD2 1 
ATOM   397  N N   . TYR A 1 54  ? 9.134   70.266 53.350 1.00 33.92 ? 54   TYR X N   1 
ATOM   398  C CA  . TYR A 1 54  ? 9.469   70.605 54.724 1.00 34.10 ? 54   TYR X CA  1 
ATOM   399  C C   . TYR A 1 54  ? 9.061   72.036 55.058 1.00 33.46 ? 54   TYR X C   1 
ATOM   400  O O   . TYR A 1 54  ? 8.472   72.287 56.107 1.00 31.79 ? 54   TYR X O   1 
ATOM   401  C CB  . TYR A 1 54  ? 10.951  70.386 55.051 1.00 29.73 ? 54   TYR X CB  1 
ATOM   402  C CG  . TYR A 1 54  ? 11.244  70.802 56.474 1.00 30.82 ? 54   TYR X CG  1 
ATOM   403  C CD1 . TYR A 1 54  ? 10.907  69.975 57.542 1.00 30.61 ? 54   TYR X CD1 1 
ATOM   404  C CD2 . TYR A 1 54  ? 11.843  72.027 56.753 1.00 28.57 ? 54   TYR X CD2 1 
ATOM   405  C CE1 . TYR A 1 54  ? 11.167  70.356 58.855 1.00 31.79 ? 54   TYR X CE1 1 
ATOM   406  C CE2 . TYR A 1 54  ? 12.106  72.416 58.057 1.00 29.89 ? 54   TYR X CE2 1 
ATOM   407  C CZ  . TYR A 1 54  ? 11.767  71.577 59.104 1.00 29.19 ? 54   TYR X CZ  1 
ATOM   408  O OH  . TYR A 1 54  ? 12.027  71.964 60.402 1.00 28.88 ? 54   TYR X OH  1 
ATOM   409  N N   . GLY A 1 55  ? 9.376   72.966 54.160 1.00 33.78 ? 55   GLY X N   1 
ATOM   410  C CA  . GLY A 1 55  ? 9.043   74.367 54.354 1.00 33.07 ? 55   GLY X CA  1 
ATOM   411  C C   . GLY A 1 55  ? 7.555   74.611 54.521 1.00 35.44 ? 55   GLY X C   1 
ATOM   412  O O   . GLY A 1 55  ? 7.141   75.475 55.296 1.00 37.01 ? 55   GLY X O   1 
ATOM   413  N N   . ASN A 1 56  ? 6.748   73.847 53.795 1.00 31.99 ? 56   ASN X N   1 
ATOM   414  C CA  . ASN A 1 56  ? 5.299   73.992 53.867 1.00 35.65 ? 56   ASN X CA  1 
ATOM   415  C C   . ASN A 1 56  ? 4.656   73.394 55.119 1.00 34.83 ? 56   ASN X C   1 
ATOM   416  O O   . ASN A 1 56  ? 3.594   73.844 55.543 1.00 36.70 ? 56   ASN X O   1 
ATOM   417  C CB  . ASN A 1 56  ? 4.636   73.434 52.607 1.00 34.83 ? 56   ASN X CB  1 
ATOM   418  C CG  . ASN A 1 56  ? 4.880   74.308 51.381 1.00 39.49 ? 56   ASN X CG  1 
ATOM   419  O OD1 . ASN A 1 56  ? 4.937   73.814 50.256 1.00 46.74 ? 56   ASN X OD1 1 
ATOM   420  N ND2 . ASN A 1 56  ? 5.024   75.611 51.598 1.00 44.67 ? 56   ASN X ND2 1 
ATOM   421  N N   . GLN A 1 57  ? 5.299   72.390 55.708 1.00 29.79 ? 57   GLN X N   1 
ATOM   422  C CA  . GLN A 1 57  ? 4.760   71.732 56.897 1.00 32.28 ? 57   GLN X CA  1 
ATOM   423  C C   . GLN A 1 57  ? 5.564   71.968 58.175 1.00 33.82 ? 57   GLN X C   1 
ATOM   424  O O   . GLN A 1 57  ? 5.187   71.473 59.243 1.00 31.45 ? 57   GLN X O   1 
ATOM   425  C CB  . GLN A 1 57  ? 4.645   70.223 56.659 1.00 31.92 ? 57   GLN X CB  1 
ATOM   426  C CG  . GLN A 1 57  ? 3.849   69.828 55.423 1.00 37.54 ? 57   GLN X CG  1 
ATOM   427  C CD  . GLN A 1 57  ? 2.377   70.164 55.541 1.00 42.87 ? 57   GLN X CD  1 
ATOM   428  O OE1 . GLN A 1 57  ? 1.714   70.413 54.535 1.00 60.79 ? 57   GLN X OE1 1 
ATOM   429  N NE2 . GLN A 1 57  ? 1.861   70.174 56.767 1.00 35.48 ? 57   GLN X NE2 1 
ATOM   430  N N   . SER A 1 58  ? 6.658   72.717 58.069 1.00 28.93 ? 58   SER X N   1 
ATOM   431  C CA  . SER A 1 58  ? 7.529   72.980 59.217 1.00 32.25 ? 58   SER X CA  1 
ATOM   432  C C   . SER A 1 58  ? 6.828   73.497 60.469 1.00 32.95 ? 58   SER X C   1 
ATOM   433  O O   . SER A 1 58  ? 7.215   73.143 61.582 1.00 30.27 ? 58   SER X O   1 
ATOM   434  C CB  . SER A 1 58  ? 8.710   73.877 58.838 1.00 27.32 ? 58   SER X CB  1 
ATOM   435  O OG  . SER A 1 58  ? 8.288   75.203 58.585 1.00 34.16 ? 58   SER X OG  1 
ATOM   436  N N   . ASN A 1 59  ? 5.804   74.329 60.299 1.00 31.62 ? 59   ASN X N   1 
ATOM   437  C CA  . ASN A 1 59  ? 5.085   74.847 61.459 1.00 33.51 ? 59   ASN X CA  1 
ATOM   438  C C   . ASN A 1 59  ? 4.481   73.712 62.287 1.00 30.85 ? 59   ASN X C   1 
ATOM   439  O O   . ASN A 1 59  ? 4.486   73.761 63.519 1.00 28.48 ? 59   ASN X O   1 
ATOM   440  C CB  . ASN A 1 59  ? 4.014   75.859 61.051 1.00 36.47 ? 59   ASN X CB  1 
ATOM   441  C CG  . ASN A 1 59  ? 3.454   76.620 62.238 1.00 48.73 ? 59   ASN X CG  1 
ATOM   442  O OD1 . ASN A 1 59  ? 4.005   77.640 62.656 1.00 60.63 ? 59   ASN X OD1 1 
ATOM   443  N ND2 . ASN A 1 59  ? 2.354   76.125 62.790 1.00 55.60 ? 59   ASN X ND2 1 
ATOM   444  N N   . VAL A 1 60  ? 3.966   72.693 61.602 1.00 27.07 ? 60   VAL X N   1 
ATOM   445  C CA  . VAL A 1 60  ? 3.376   71.535 62.264 1.00 27.61 ? 60   VAL X CA  1 
ATOM   446  C C   . VAL A 1 60  ? 4.464   70.661 62.887 1.00 28.67 ? 60   VAL X C   1 
ATOM   447  O O   . VAL A 1 60  ? 4.364   70.277 64.053 1.00 24.50 ? 60   VAL X O   1 
ATOM   448  C CB  . VAL A 1 60  ? 2.528   70.679 61.289 1.00 29.97 ? 60   VAL X CB  1 
ATOM   449  C CG1 . VAL A 1 60  ? 1.991   69.438 61.997 1.00 31.49 ? 60   VAL X CG1 1 
ATOM   450  C CG2 . VAL A 1 60  ? 1.380   71.501 60.716 1.00 29.82 ? 60   VAL X CG2 1 
ATOM   451  N N   . TYR A 1 61  ? 5.504   70.352 62.114 1.00 26.27 ? 61   TYR X N   1 
ATOM   452  C CA  . TYR A 1 61  ? 6.593   69.514 62.621 1.00 28.48 ? 61   TYR X CA  1 
ATOM   453  C C   . TYR A 1 61  ? 7.238   70.142 63.855 1.00 28.03 ? 61   TYR X C   1 
ATOM   454  O O   . TYR A 1 61  ? 7.514   69.448 64.832 1.00 28.39 ? 61   TYR X O   1 
ATOM   455  C CB  . TYR A 1 61  ? 7.657   69.251 61.549 1.00 26.96 ? 61   TYR X CB  1 
ATOM   456  C CG  . TYR A 1 61  ? 7.147   68.604 60.276 1.00 27.68 ? 61   TYR X CG  1 
ATOM   457  C CD1 . TYR A 1 61  ? 7.782   68.836 59.059 1.00 29.46 ? 61   TYR X CD1 1 
ATOM   458  C CD2 . TYR A 1 61  ? 6.040   67.764 60.287 1.00 24.62 ? 61   TYR X CD2 1 
ATOM   459  C CE1 . TYR A 1 61  ? 7.329   68.253 57.889 1.00 24.11 ? 61   TYR X CE1 1 
ATOM   460  C CE2 . TYR A 1 61  ? 5.578   67.174 59.117 1.00 28.26 ? 61   TYR X CE2 1 
ATOM   461  C CZ  . TYR A 1 61  ? 6.228   67.424 57.923 1.00 31.10 ? 61   TYR X CZ  1 
ATOM   462  O OH  . TYR A 1 61  ? 5.777   66.845 56.757 1.00 26.66 ? 61   TYR X OH  1 
ATOM   463  N N   . ASN A 1 62  ? 7.470   71.453 63.798 1.00 26.62 ? 62   ASN X N   1 
ATOM   464  C CA  . ASN A 1 62  ? 8.078   72.189 64.904 1.00 25.27 ? 62   ASN X CA  1 
ATOM   465  C C   . ASN A 1 62  ? 7.233   72.104 66.173 1.00 25.95 ? 62   ASN X C   1 
ATOM   466  O O   . ASN A 1 62  ? 7.757   71.841 67.252 1.00 27.34 ? 62   ASN X O   1 
ATOM   467  C CB  . ASN A 1 62  ? 8.279   73.663 64.533 1.00 24.04 ? 62   ASN X CB  1 
ATOM   468  C CG  . ASN A 1 62  ? 9.517   73.898 63.669 1.00 31.28 ? 62   ASN X CG  1 
ATOM   469  O OD1 . ASN A 1 62  ? 9.706   74.986 63.122 1.00 33.86 ? 62   ASN X OD1 1 
ATOM   470  N ND2 . ASN A 1 62  ? 10.360  72.883 63.545 1.00 22.54 ? 62   ASN X ND2 1 
ATOM   471  N N   . ALA A 1 63  ? 5.927   72.330 66.034 1.00 23.50 ? 63   ALA X N   1 
ATOM   472  C CA  . ALA A 1 63  ? 5.008   72.278 67.168 1.00 27.36 ? 63   ALA X CA  1 
ATOM   473  C C   . ALA A 1 63  ? 4.991   70.883 67.789 1.00 26.64 ? 63   ALA X C   1 
ATOM   474  O O   . ALA A 1 63  ? 5.006   70.741 69.012 1.00 25.03 ? 63   ALA X O   1 
ATOM   475  C CB  . ALA A 1 63  ? 3.597   72.692 66.740 1.00 22.68 ? 63   ALA X CB  1 
ATOM   476  N N   . VAL A 1 64  ? 4.960   69.864 66.933 1.00 24.23 ? 64   VAL X N   1 
ATOM   477  C CA  . VAL A 1 64  ? 4.955   68.474 67.379 1.00 26.68 ? 64   VAL X CA  1 
ATOM   478  C C   . VAL A 1 64  ? 6.269   68.157 68.098 1.00 25.95 ? 64   VAL X C   1 
ATOM   479  O O   . VAL A 1 64  ? 6.269   67.514 69.148 1.00 25.06 ? 64   VAL X O   1 
ATOM   480  C CB  . VAL A 1 64  ? 4.722   67.499 66.191 1.00 27.04 ? 64   VAL X CB  1 
ATOM   481  C CG1 . VAL A 1 64  ? 4.996   66.060 66.608 1.00 28.24 ? 64   VAL X CG1 1 
ATOM   482  C CG2 . VAL A 1 64  ? 3.288   67.630 65.673 1.00 26.34 ? 64   VAL X CG2 1 
ATOM   483  N N   . GLN A 1 65  ? 7.386   68.615 67.532 1.00 23.76 ? 65   GLN X N   1 
ATOM   484  C CA  . GLN A 1 65  ? 8.691   68.390 68.152 1.00 24.56 ? 65   GLN X CA  1 
ATOM   485  C C   . GLN A 1 65  ? 8.758   69.064 69.523 1.00 25.27 ? 65   GLN X C   1 
ATOM   486  O O   . GLN A 1 65  ? 9.295   68.500 70.475 1.00 24.60 ? 65   GLN X O   1 
ATOM   487  C CB  . GLN A 1 65  ? 9.822   68.915 67.258 1.00 25.69 ? 65   GLN X CB  1 
ATOM   488  C CG  . GLN A 1 65  ? 10.207  67.975 66.117 1.00 30.62 ? 65   GLN X CG  1 
ATOM   489  C CD  . GLN A 1 65  ? 10.855  66.701 66.616 1.00 34.19 ? 65   GLN X CD  1 
ATOM   490  O OE1 . GLN A 1 65  ? 12.063  66.665 66.868 1.00 32.50 ? 65   GLN X OE1 1 
ATOM   491  N NE2 . GLN A 1 65  ? 10.057  65.653 66.765 1.00 26.06 ? 65   GLN X NE2 1 
ATOM   492  N N   . GLU A 1 66  ? 8.215   70.275 69.621 1.00 26.62 ? 66   GLU X N   1 
ATOM   493  C CA  . GLU A 1 66  ? 8.223   70.995 70.890 1.00 24.70 ? 66   GLU X CA  1 
ATOM   494  C C   . GLU A 1 66  ? 7.388   70.227 71.917 1.00 26.60 ? 66   GLU X C   1 
ATOM   495  O O   . GLU A 1 66  ? 7.809   70.036 73.060 1.00 26.51 ? 66   GLU X O   1 
ATOM   496  C CB  . GLU A 1 66  ? 7.702   72.423 70.706 1.00 23.09 ? 66   GLU X CB  1 
ATOM   497  C CG  . GLU A 1 66  ? 7.541   73.204 72.004 1.00 22.46 ? 66   GLU X CG  1 
ATOM   498  C CD  . GLU A 1 66  ? 8.858   73.679 72.592 1.00 31.19 ? 66   GLU X CD  1 
ATOM   499  O OE1 . GLU A 1 66  ? 9.914   73.490 71.953 1.00 25.84 ? 66   GLU X OE1 1 
ATOM   500  O OE2 . GLU A 1 66  ? 8.835   74.247 73.704 1.00 25.95 ? 66   GLU X OE2 1 
ATOM   501  N N   . TRP A 1 67  ? 6.208   69.791 71.487 1.00 23.08 ? 67   TRP X N   1 
ATOM   502  C CA  . TRP A 1 67  ? 5.286   69.026 72.324 1.00 25.86 ? 67   TRP X CA  1 
ATOM   503  C C   . TRP A 1 67  ? 5.942   67.738 72.845 1.00 26.97 ? 67   TRP X C   1 
ATOM   504  O O   . TRP A 1 67  ? 5.848   67.422 74.035 1.00 25.73 ? 67   TRP X O   1 
ATOM   505  C CB  . TRP A 1 67  ? 4.016   68.724 71.522 1.00 26.05 ? 67   TRP X CB  1 
ATOM   506  C CG  . TRP A 1 67  ? 3.150   67.621 72.058 1.00 24.82 ? 67   TRP X CG  1 
ATOM   507  C CD1 . TRP A 1 67  ? 2.651   67.500 73.326 1.00 22.21 ? 67   TRP X CD1 1 
ATOM   508  C CD2 . TRP A 1 67  ? 2.676   66.483 71.332 1.00 23.70 ? 67   TRP X CD2 1 
ATOM   509  N NE1 . TRP A 1 67  ? 1.898   66.354 73.430 1.00 27.21 ? 67   TRP X NE1 1 
ATOM   510  C CE2 . TRP A 1 67  ? 1.897   65.710 72.219 1.00 26.54 ? 67   TRP X CE2 1 
ATOM   511  C CE3 . TRP A 1 67  ? 2.831   66.034 70.014 1.00 27.38 ? 67   TRP X CE3 1 
ATOM   512  C CZ2 . TRP A 1 67  ? 1.277   64.518 71.832 1.00 25.77 ? 67   TRP X CZ2 1 
ATOM   513  C CZ3 . TRP A 1 67  ? 2.216   64.851 69.632 1.00 31.50 ? 67   TRP X CZ3 1 
ATOM   514  C CH2 . TRP A 1 67  ? 1.448   64.106 70.539 1.00 29.89 ? 67   TRP X CH2 1 
ATOM   515  N N   . LEU A 1 68  ? 6.607   67.008 71.951 1.00 25.93 ? 68   LEU X N   1 
ATOM   516  C CA  . LEU A 1 68  ? 7.283   65.760 72.306 1.00 26.81 ? 68   LEU X CA  1 
ATOM   517  C C   . LEU A 1 68  ? 8.378   65.949 73.357 1.00 28.09 ? 68   LEU X C   1 
ATOM   518  O O   . LEU A 1 68  ? 8.427   65.214 74.345 1.00 24.45 ? 68   LEU X O   1 
ATOM   519  C CB  . LEU A 1 68  ? 7.862   65.081 71.058 1.00 24.26 ? 68   LEU X CB  1 
ATOM   520  C CG  . LEU A 1 68  ? 6.852   64.450 70.093 1.00 27.23 ? 68   LEU X CG  1 
ATOM   521  C CD1 . LEU A 1 68  ? 7.549   64.004 68.804 1.00 25.24 ? 68   LEU X CD1 1 
ATOM   522  C CD2 . LEU A 1 68  ? 6.136   63.273 70.758 1.00 23.55 ? 68   LEU X CD2 1 
ATOM   523  N N   . ARG A 1 69  ? 9.250   66.932 73.142 1.00 27.04 ? 69   ARG X N   1 
ATOM   524  C CA  . ARG A 1 69  ? 10.344  67.216 74.071 1.00 24.37 ? 69   ARG X CA  1 
ATOM   525  C C   . ARG A 1 69  ? 9.828   67.623 75.451 1.00 27.40 ? 69   ARG X C   1 
ATOM   526  O O   . ARG A 1 69  ? 10.485  67.386 76.469 1.00 22.59 ? 69   ARG X O   1 
ATOM   527  C CB  . ARG A 1 69  ? 11.266  68.302 73.507 1.00 23.74 ? 69   ARG X CB  1 
ATOM   528  C CG  . ARG A 1 69  ? 12.448  68.636 74.410 1.00 25.91 ? 69   ARG X CG  1 
ATOM   529  C CD  . ARG A 1 69  ? 13.408  69.664 73.830 1.00 27.76 ? 69   ARG X CD  1 
ATOM   530  N NE  . ARG A 1 69  ? 12.739  70.928 73.516 1.00 24.87 ? 69   ARG X NE  1 
ATOM   531  C CZ  . ARG A 1 69  ? 13.373  72.027 73.128 1.00 30.37 ? 69   ARG X CZ  1 
ATOM   532  N NH1 . ARG A 1 69  ? 14.695  72.022 73.009 1.00 20.92 ? 69   ARG X NH1 1 
ATOM   533  N NH2 . ARG A 1 69  ? 12.690  73.133 72.860 1.00 22.36 ? 69   ARG X NH2 1 
ATOM   534  N N   . ALA A 1 70  ? 8.646   68.233 75.485 1.00 25.47 ? 70   ALA X N   1 
ATOM   535  C CA  . ALA A 1 70  ? 8.053   68.656 76.747 1.00 28.07 ? 70   ALA X CA  1 
ATOM   536  C C   . ALA A 1 70  ? 7.347   67.510 77.484 1.00 28.53 ? 70   ALA X C   1 
ATOM   537  O O   . ALA A 1 70  ? 6.900   67.681 78.621 1.00 27.23 ? 70   ALA X O   1 
ATOM   538  C CB  . ALA A 1 70  ? 7.102   69.830 76.529 1.00 26.21 ? 70   ALA X CB  1 
ATOM   539  N N   . GLY A 1 71  ? 7.245   66.346 76.844 1.00 24.48 ? 71   GLY X N   1 
ATOM   540  C CA  . GLY A 1 71  ? 6.591   65.205 77.469 1.00 25.99 ? 71   GLY X CA  1 
ATOM   541  C C   . GLY A 1 71  ? 5.755   64.363 76.521 1.00 27.91 ? 71   GLY X C   1 
ATOM   542  O O   . GLY A 1 71  ? 5.585   63.162 76.737 1.00 28.30 ? 71   GLY X O   1 
ATOM   543  N N   . GLY A 1 72  ? 5.227   64.992 75.475 1.00 26.93 ? 72   GLY X N   1 
ATOM   544  C CA  . GLY A 1 72  ? 4.433   64.299 74.473 1.00 25.40 ? 72   GLY X CA  1 
ATOM   545  C C   . GLY A 1 72  ? 3.087   63.705 74.863 1.00 26.20 ? 72   GLY X C   1 
ATOM   546  O O   . GLY A 1 72  ? 2.483   62.991 74.066 1.00 27.75 ? 72   GLY X O   1 
ATOM   547  N N   . ASP A 1 73  ? 2.597   63.977 76.067 1.00 25.10 ? 73   ASP X N   1 
ATOM   548  C CA  . ASP A 1 73  ? 1.304   63.420 76.462 1.00 23.67 ? 73   ASP X CA  1 
ATOM   549  C C   . ASP A 1 73  ? 0.175   64.045 75.641 1.00 23.56 ? 73   ASP X C   1 
ATOM   550  O O   . ASP A 1 73  ? 0.152   65.259 75.449 1.00 26.27 ? 73   ASP X O   1 
ATOM   551  C CB  . ASP A 1 73  ? 1.049   63.605 77.958 1.00 21.91 ? 73   ASP X CB  1 
ATOM   552  C CG  . ASP A 1 73  ? -0.041  62.687 78.467 1.00 25.85 ? 73   ASP X CG  1 
ATOM   553  O OD1 . ASP A 1 73  ? 0.263   61.516 78.780 1.00 25.76 ? 73   ASP X OD1 1 
ATOM   554  O OD2 . ASP A 1 73  ? -1.229  63.047 78.581 1.00 23.22 ? 73   ASP X OD2 1 
ATOM   555  N N   . THR A 1 74  ? -0.755  63.219 75.159 1.00 24.01 ? 74   THR X N   1 
ATOM   556  C CA  . THR A 1 74  ? -1.865  63.714 74.340 1.00 26.88 ? 74   THR X CA  1 
ATOM   557  C C   . THR A 1 74  ? -2.733  64.772 75.019 1.00 27.42 ? 74   THR X C   1 
ATOM   558  O O   . THR A 1 74  ? -3.398  65.551 74.340 1.00 29.31 ? 74   THR X O   1 
ATOM   559  C CB  . THR A 1 74  ? -2.754  62.569 73.794 1.00 26.18 ? 74   THR X CB  1 
ATOM   560  O OG1 . THR A 1 74  ? -3.256  61.782 74.879 1.00 29.54 ? 74   THR X OG1 1 
ATOM   561  C CG2 . THR A 1 74  ? -1.937  61.580 72.958 1.00 26.57 ? 74   THR X CG2 1 
ATOM   562  N N   . ARG A 1 75  ? -2.725  64.800 76.350 1.00 25.06 ? 75   ARG X N   1 
ATOM   563  C CA  . ARG A 1 75  ? -3.517  65.777 77.096 1.00 28.89 ? 75   ARG X CA  1 
ATOM   564  C C   . ARG A 1 75  ? -2.926  67.187 77.072 1.00 25.26 ? 75   ARG X C   1 
ATOM   565  O O   . ARG A 1 75  ? -3.609  68.149 77.433 1.00 26.54 ? 75   ARG X O   1 
ATOM   566  C CB  . ARG A 1 75  ? -3.696  65.332 78.551 1.00 31.49 ? 75   ARG X CB  1 
ATOM   567  C CG  . ARG A 1 75  ? -4.421  64.007 78.719 1.00 42.93 ? 75   ARG X CG  1 
ATOM   568  C CD  . ARG A 1 75  ? -5.927  64.131 78.821 1.00 50.33 ? 75   ARG X CD  1 
ATOM   569  N NE  . ARG A 1 75  ? -6.361  64.390 80.190 1.00 57.29 ? 75   ARG X NE  1 
ATOM   570  C CZ  . ARG A 1 75  ? -7.620  64.614 80.541 1.00 62.95 ? 75   ARG X CZ  1 
ATOM   571  N NH1 . ARG A 1 75  ? -8.579  64.614 79.624 1.00 66.93 ? 75   ARG X NH1 1 
ATOM   572  N NH2 . ARG A 1 75  ? -7.925  64.840 81.811 1.00 65.96 ? 75   ARG X NH2 1 
ATOM   573  N N   . ASN A 1 76  ? -1.668  67.311 76.647 1.00 23.29 ? 76   ASN X N   1 
ATOM   574  C CA  . ASN A 1 76  ? -0.991  68.612 76.616 1.00 24.38 ? 76   ASN X CA  1 
ATOM   575  C C   . ASN A 1 76  ? -0.718  69.192 75.226 1.00 26.43 ? 76   ASN X C   1 
ATOM   576  O O   . ASN A 1 76  ? 0.028   70.164 75.096 1.00 24.97 ? 76   ASN X O   1 
ATOM   577  C CB  . ASN A 1 76  ? 0.329   68.537 77.388 1.00 25.74 ? 76   ASN X CB  1 
ATOM   578  C CG  . ASN A 1 76  ? 0.134   68.181 78.849 1.00 28.57 ? 76   ASN X CG  1 
ATOM   579  O OD1 . ASN A 1 76  ? -0.820  68.622 79.485 1.00 28.70 ? 76   ASN X OD1 1 
ATOM   580  N ND2 . ASN A 1 76  ? 1.043   67.378 79.388 1.00 25.71 ? 76   ASN X ND2 1 
ATOM   581  N N   . MET A 1 77  ? -1.321  68.601 74.199 1.00 26.00 ? 77   MET X N   1 
ATOM   582  C CA  . MET A 1 77  ? -1.126  69.041 72.818 1.00 26.82 ? 77   MET X CA  1 
ATOM   583  C C   . MET A 1 77  ? -1.582  70.468 72.528 1.00 27.00 ? 77   MET X C   1 
ATOM   584  O O   . MET A 1 77  ? -0.936  71.185 71.765 1.00 27.08 ? 77   MET X O   1 
ATOM   585  C CB  . MET A 1 77  ? -1.833  68.086 71.852 1.00 27.54 ? 77   MET X CB  1 
ATOM   586  C CG  . MET A 1 77  ? -1.364  66.647 71.945 1.00 31.76 ? 77   MET X CG  1 
ATOM   587  S SD  . MET A 1 77  ? -2.464  65.481 71.102 1.00 34.57 ? 77   MET X SD  1 
ATOM   588  C CE  . MET A 1 77  ? -2.162  65.897 69.424 1.00 34.22 ? 77   MET X CE  1 
ATOM   589  N N   . ARG A 1 78  ? -2.693  70.876 73.134 1.00 26.65 ? 78   ARG X N   1 
ATOM   590  C CA  . ARG A 1 78  ? -3.241  72.210 72.910 1.00 29.57 ? 78   ARG X CA  1 
ATOM   591  C C   . ARG A 1 78  ? -2.324  73.347 73.358 1.00 28.58 ? 78   ARG X C   1 
ATOM   592  O O   . ARG A 1 78  ? -2.416  74.462 72.842 1.00 30.00 ? 78   ARG X O   1 
ATOM   593  C CB  . ARG A 1 78  ? -4.638  72.338 73.513 1.00 32.19 ? 78   ARG X CB  1 
ATOM   594  C CG  . ARG A 1 78  ? -5.717  71.664 72.673 1.00 47.70 ? 78   ARG X CG  1 
ATOM   595  C CD  . ARG A 1 78  ? -6.798  72.610 72.169 1.00 66.46 ? 78   ARG X CD  1 
ATOM   596  N NE  . ARG A 1 78  ? -8.136  72.169 72.559 1.00 69.40 ? 78   ARG X NE  1 
ATOM   597  C CZ  . ARG A 1 78  ? -8.706  72.446 73.726 1.00 76.30 ? 78   ARG X CZ  1 
ATOM   598  N NH1 . ARG A 1 78  ? -9.928  72.001 73.989 1.00 75.85 ? 78   ARG X NH1 1 
ATOM   599  N NH2 . ARG A 1 78  ? -8.059  73.168 74.632 1.00 76.91 ? 78   ARG X NH2 1 
ATOM   600  N N   . GLN A 1 79  ? -1.444  73.061 74.312 1.00 24.85 ? 79   GLN X N   1 
ATOM   601  C CA  . GLN A 1 79  ? -0.481  74.048 74.805 1.00 28.42 ? 79   GLN X CA  1 
ATOM   602  C C   . GLN A 1 79  ? 0.441   74.491 73.669 1.00 25.21 ? 79   GLN X C   1 
ATOM   603  O O   . GLN A 1 79  ? 1.056   75.558 73.731 1.00 23.37 ? 79   GLN X O   1 
ATOM   604  C CB  . GLN A 1 79  ? 0.409   73.420 75.880 1.00 30.68 ? 79   GLN X CB  1 
ATOM   605  C CG  . GLN A 1 79  ? -0.211  73.305 77.255 1.00 38.43 ? 79   GLN X CG  1 
ATOM   606  C CD  . GLN A 1 79  ? 0.687   72.551 78.222 1.00 41.02 ? 79   GLN X CD  1 
ATOM   607  O OE1 . GLN A 1 79  ? 0.202   71.843 79.105 1.00 49.52 ? 79   GLN X OE1 1 
ATOM   608  N NE2 . GLN A 1 79  ? 1.999   72.703 78.059 1.00 24.53 ? 79   GLN X NE2 1 
ATOM   609  N N   . PHE A 1 80  ? 0.534   73.663 72.633 1.00 21.46 ? 80   PHE X N   1 
ATOM   610  C CA  . PHE A 1 80  ? 1.413   73.941 71.503 1.00 24.46 ? 80   PHE X CA  1 
ATOM   611  C C   . PHE A 1 80  ? 0.702   74.291 70.206 1.00 25.62 ? 80   PHE X C   1 
ATOM   612  O O   . PHE A 1 80  ? 1.303   74.266 69.131 1.00 29.16 ? 80   PHE X O   1 
ATOM   613  C CB  . PHE A 1 80  ? 2.413   72.791 71.335 1.00 24.15 ? 80   PHE X CB  1 
ATOM   614  C CG  . PHE A 1 80  ? 3.094   72.422 72.621 1.00 24.05 ? 80   PHE X CG  1 
ATOM   615  C CD1 . PHE A 1 80  ? 2.587   71.413 73.431 1.00 28.40 ? 80   PHE X CD1 1 
ATOM   616  C CD2 . PHE A 1 80  ? 4.233   73.097 73.033 1.00 23.16 ? 80   PHE X CD2 1 
ATOM   617  C CE1 . PHE A 1 80  ? 3.212   71.077 74.626 1.00 25.87 ? 80   PHE X CE1 1 
ATOM   618  C CE2 . PHE A 1 80  ? 4.864   72.766 74.227 1.00 28.27 ? 80   PHE X CE2 1 
ATOM   619  C CZ  . PHE A 1 80  ? 4.350   71.755 75.023 1.00 28.32 ? 80   PHE X CZ  1 
ATOM   620  N N   . GLY A 1 81  ? -0.582  74.620 70.320 1.00 30.61 ? 81   GLY X N   1 
ATOM   621  C CA  . GLY A 1 81  ? -1.392  74.993 69.175 1.00 29.13 ? 81   GLY X CA  1 
ATOM   622  C C   . GLY A 1 81  ? -1.699  73.835 68.247 1.00 31.12 ? 81   GLY X C   1 
ATOM   623  O O   . GLY A 1 81  ? -2.038  74.043 67.085 1.00 28.34 ? 81   GLY X O   1 
ATOM   624  N N   . ILE A 1 82  ? -1.584  72.610 68.754 1.00 31.89 ? 82   ILE X N   1 
ATOM   625  C CA  . ILE A 1 82  ? -1.849  71.432 67.935 1.00 29.26 ? 82   ILE X CA  1 
ATOM   626  C C   . ILE A 1 82  ? -3.311  70.992 67.971 1.00 30.56 ? 82   ILE X C   1 
ATOM   627  O O   . ILE A 1 82  ? -3.841  70.641 69.026 1.00 30.46 ? 82   ILE X O   1 
ATOM   628  C CB  . ILE A 1 82  ? -0.934  70.260 68.341 1.00 31.97 ? 82   ILE X CB  1 
ATOM   629  C CG1 . ILE A 1 82  ? 0.538   70.657 68.218 1.00 29.90 ? 82   ILE X CG1 1 
ATOM   630  C CG2 . ILE A 1 82  ? -1.226  69.031 67.479 1.00 25.94 ? 82   ILE X CG2 1 
ATOM   631  C CD1 . ILE A 1 82  ? 1.492   69.667 68.861 1.00 28.03 ? 82   ILE X CD1 1 
ATOM   632  N N   . ASP A 1 83  ? -3.953  71.017 66.809 1.00 30.28 ? 83   ASP X N   1 
ATOM   633  C CA  . ASP A 1 83  ? -5.342  70.593 66.677 1.00 29.79 ? 83   ASP X CA  1 
ATOM   634  C C   . ASP A 1 83  ? -5.353  69.139 66.219 1.00 32.87 ? 83   ASP X C   1 
ATOM   635  O O   . ASP A 1 83  ? -4.573  68.747 65.343 1.00 30.10 ? 83   ASP X O   1 
ATOM   636  C CB  . ASP A 1 83  ? -6.065  71.450 65.639 1.00 31.21 ? 83   ASP X CB  1 
ATOM   637  C CG  . ASP A 1 83  ? -6.392  72.839 66.154 1.00 41.79 ? 83   ASP X CG  1 
ATOM   638  O OD1 . ASP A 1 83  ? -6.384  73.786 65.340 1.00 47.74 ? 83   ASP X OD1 1 
ATOM   639  O OD2 . ASP A 1 83  ? -6.669  73.079 67.351 1.00 34.86 ? 83   ASP X OD2 1 
ATOM   640  N N   . ALA A 1 84  ? -6.231  68.340 66.814 1.00 28.27 ? 84   ALA X N   1 
ATOM   641  C CA  . ALA A 1 84  ? -6.338  66.935 66.448 1.00 31.12 ? 84   ALA X CA  1 
ATOM   642  C C   . ALA A 1 84  ? -7.674  66.663 65.764 1.00 30.58 ? 84   ALA X C   1 
ATOM   643  O O   . ALA A 1 84  ? -8.734  66.763 66.382 1.00 29.34 ? 84   ALA X O   1 
ATOM   644  C CB  . ALA A 1 84  ? -6.158  66.044 67.671 1.00 28.58 ? 84   ALA X CB  1 
ATOM   645  N N   . TRP A 1 85  ? -7.609  66.321 64.481 1.00 29.56 ? 85   TRP X N   1 
ATOM   646  C CA  . TRP A 1 85  ? -8.797  66.030 63.689 1.00 28.28 ? 85   TRP X CA  1 
ATOM   647  C C   . TRP A 1 85  ? -8.943  64.522 63.522 1.00 29.18 ? 85   TRP X C   1 
ATOM   648  O O   . TRP A 1 85  ? -8.200  63.901 62.756 1.00 27.83 ? 85   TRP X O   1 
ATOM   649  C CB  . TRP A 1 85  ? -8.678  66.683 62.311 1.00 27.78 ? 85   TRP X CB  1 
ATOM   650  C CG  . TRP A 1 85  ? -8.676  68.188 62.343 1.00 35.35 ? 85   TRP X CG  1 
ATOM   651  C CD1 . TRP A 1 85  ? -7.605  69.003 62.566 1.00 33.94 ? 85   TRP X CD1 1 
ATOM   652  C CD2 . TRP A 1 85  ? -9.801  69.053 62.141 1.00 32.26 ? 85   TRP X CD2 1 
ATOM   653  N NE1 . TRP A 1 85  ? -7.992  70.321 62.516 1.00 35.39 ? 85   TRP X NE1 1 
ATOM   654  C CE2 . TRP A 1 85  ? -9.337  70.380 62.256 1.00 35.27 ? 85   TRP X CE2 1 
ATOM   655  C CE3 . TRP A 1 85  ? -11.159 68.841 61.873 1.00 32.45 ? 85   TRP X CE3 1 
ATOM   656  C CZ2 . TRP A 1 85  ? -10.178 71.486 62.114 1.00 38.69 ? 85   TRP X CZ2 1 
ATOM   657  C CZ3 . TRP A 1 85  ? -11.994 69.942 61.731 1.00 38.69 ? 85   TRP X CZ3 1 
ATOM   658  C CH2 . TRP A 1 85  ? -11.500 71.246 61.853 1.00 40.86 ? 85   TRP X CH2 1 
ATOM   659  N N   . GLN A 1 86  ? -9.897  63.934 64.235 1.00 29.23 ? 86   GLN X N   1 
ATOM   660  C CA  . GLN A 1 86  ? -10.113 62.495 64.146 1.00 32.48 ? 86   GLN X CA  1 
ATOM   661  C C   . GLN A 1 86  ? -10.763 62.087 62.832 1.00 32.27 ? 86   GLN X C   1 
ATOM   662  O O   . GLN A 1 86  ? -11.745 62.688 62.397 1.00 29.86 ? 86   GLN X O   1 
ATOM   663  C CB  . GLN A 1 86  ? -10.940 61.976 65.322 1.00 32.30 ? 86   GLN X CB  1 
ATOM   664  C CG  . GLN A 1 86  ? -11.043 60.459 65.351 1.00 28.77 ? 86   GLN X CG  1 
ATOM   665  C CD  . GLN A 1 86  ? -11.410 59.913 66.713 1.00 34.23 ? 86   GLN X CD  1 
ATOM   666  O OE1 . GLN A 1 86  ? -11.813 60.662 67.601 1.00 34.19 ? 86   GLN X OE1 1 
ATOM   667  N NE2 . GLN A 1 86  ? -11.271 58.604 66.882 1.00 30.19 ? 86   GLN X NE2 1 
ATOM   668  N N   . MET A 1 87  ? -10.201 61.059 62.206 1.00 31.61 ? 87   MET X N   1 
ATOM   669  C CA  . MET A 1 87  ? -10.720 60.550 60.945 1.00 31.23 ? 87   MET X CA  1 
ATOM   670  C C   . MET A 1 87  ? -11.880 59.598 61.210 1.00 29.94 ? 87   MET X C   1 
ATOM   671  O O   . MET A 1 87  ? -11.817 58.772 62.121 1.00 27.21 ? 87   MET X O   1 
ATOM   672  C CB  . MET A 1 87  ? -9.609  59.846 60.170 1.00 28.37 ? 87   MET X CB  1 
ATOM   673  C CG  . MET A 1 87  ? -8.393  60.733 59.943 1.00 28.53 ? 87   MET X CG  1 
ATOM   674  S SD  . MET A 1 87  ? -7.057  59.946 59.046 1.00 29.21 ? 87   MET X SD  1 
ATOM   675  C CE  . MET A 1 87  ? -7.883  59.472 57.545 1.00 32.35 ? 87   MET X CE  1 
ATOM   676  N N   . GLU A 1 88  ? -12.938 59.718 60.412 1.00 28.91 ? 88   GLU X N   1 
ATOM   677  C CA  . GLU A 1 88  ? -14.115 58.866 60.578 1.00 32.35 ? 88   GLU X CA  1 
ATOM   678  C C   . GLU A 1 88  ? -13.848 57.409 60.201 1.00 29.90 ? 88   GLU X C   1 
ATOM   679  O O   . GLU A 1 88  ? -14.558 56.503 60.638 1.00 31.24 ? 88   GLU X O   1 
ATOM   680  C CB  . GLU A 1 88  ? -15.318 59.434 59.823 1.00 30.26 ? 88   GLU X CB  1 
ATOM   681  C CG  . GLU A 1 88  ? -15.292 59.222 58.320 1.00 39.88 ? 88   GLU X CG  1 
ATOM   682  C CD  . GLU A 1 88  ? -16.543 59.749 57.646 1.00 45.38 ? 88   GLU X CD  1 
ATOM   683  O OE1 . GLU A 1 88  ? -17.578 59.883 58.336 1.00 41.75 ? 88   GLU X OE1 1 
ATOM   684  O OE2 . GLU A 1 88  ? -16.492 60.028 56.431 1.00 44.49 ? 88   GLU X OE2 1 
ATOM   685  N N   . GLY A 1 89  ? -12.820 57.189 59.389 1.00 31.22 ? 89   GLY X N   1 
ATOM   686  C CA  . GLY A 1 89  ? -12.448 55.846 58.987 1.00 31.80 ? 89   GLY X CA  1 
ATOM   687  C C   . GLY A 1 89  ? -13.366 55.179 57.983 1.00 35.61 ? 89   GLY X C   1 
ATOM   688  O O   . GLY A 1 89  ? -14.106 55.841 57.253 1.00 32.22 ? 89   GLY X O   1 
ATOM   689  N N   . ALA A 1 90  ? -13.310 53.851 57.960 1.00 35.10 ? 90   ALA X N   1 
ATOM   690  C CA  . ALA A 1 90  ? -14.091 53.041 57.032 1.00 39.75 ? 90   ALA X CA  1 
ATOM   691  C C   . ALA A 1 90  ? -15.553 52.786 57.406 1.00 40.19 ? 90   ALA X C   1 
ATOM   692  O O   . ALA A 1 90  ? -16.356 52.425 56.546 1.00 39.92 ? 90   ALA X O   1 
ATOM   693  C CB  . ALA A 1 90  ? -13.373 51.715 56.777 1.00 36.78 ? 90   ALA X CB  1 
ATOM   694  N N   . ASP A 1 91  ? -15.902 52.974 58.676 1.00 39.47 ? 91   ASP X N   1 
ATOM   695  C CA  . ASP A 1 91  ? -17.272 52.711 59.125 1.00 37.40 ? 91   ASP X CA  1 
ATOM   696  C C   . ASP A 1 91  ? -17.968 53.884 59.816 1.00 36.77 ? 91   ASP X C   1 
ATOM   697  O O   . ASP A 1 91  ? -19.027 53.706 60.422 1.00 34.05 ? 91   ASP X O   1 
ATOM   698  C CB  . ASP A 1 91  ? -17.265 51.513 60.075 1.00 34.99 ? 91   ASP X CB  1 
ATOM   699  C CG  . ASP A 1 91  ? -16.411 51.758 61.306 1.00 35.07 ? 91   ASP X CG  1 
ATOM   700  O OD1 . ASP A 1 91  ? -16.230 50.821 62.112 1.00 31.15 ? 91   ASP X OD1 1 
ATOM   701  O OD2 . ASP A 1 91  ? -15.877 52.862 61.549 1.00 36.02 ? 91   ASP X OD2 1 
ATOM   702  N N   . ASN A 1 92  ? -17.377 55.072 59.730 1.00 33.88 ? 92   ASN X N   1 
ATOM   703  C CA  . ASN A 1 92  ? -17.937 56.267 60.363 1.00 38.12 ? 92   ASN X CA  1 
ATOM   704  C C   . ASN A 1 92  ? -17.964 56.194 61.896 1.00 37.84 ? 92   ASN X C   1 
ATOM   705  O O   . ASN A 1 92  ? -18.717 56.919 62.550 1.00 36.45 ? 92   ASN X O   1 
ATOM   706  C CB  . ASN A 1 92  ? -19.328 56.603 59.805 1.00 41.54 ? 92   ASN X CB  1 
ATOM   707  C CG  . ASN A 1 92  ? -19.320 56.826 58.300 1.00 51.13 ? 92   ASN X CG  1 
ATOM   708  O OD1 . ASN A 1 92  ? -20.371 56.833 57.660 1.00 57.45 ? 92   ASN X OD1 1 
ATOM   709  N ND2 . ASN A 1 92  ? -18.133 57.010 57.728 1.00 51.88 ? 92   ASN X ND2 1 
ATOM   710  N N   . TYR A 1 93  ? -17.138 55.313 62.456 1.00 34.35 ? 93   TYR X N   1 
ATOM   711  C CA  . TYR A 1 93  ? -17.028 55.153 63.904 1.00 33.43 ? 93   TYR X CA  1 
ATOM   712  C C   . TYR A 1 93  ? -15.586 55.426 64.334 1.00 31.31 ? 93   TYR X C   1 
ATOM   713  O O   . TYR A 1 93  ? -15.216 55.211 65.488 1.00 31.80 ? 93   TYR X O   1 
ATOM   714  C CB  . TYR A 1 93  ? -17.462 53.752 64.341 1.00 33.15 ? 93   TYR X CB  1 
ATOM   715  C CG  . TYR A 1 93  ? -18.965 53.583 64.455 1.00 37.01 ? 93   TYR X CG  1 
ATOM   716  C CD1 . TYR A 1 93  ? -19.671 54.141 65.517 1.00 38.18 ? 93   TYR X CD1 1 
ATOM   717  C CD2 . TYR A 1 93  ? -19.677 52.866 63.499 1.00 43.69 ? 93   TYR X CD2 1 
ATOM   718  C CE1 . TYR A 1 93  ? -21.046 53.988 65.623 1.00 45.38 ? 93   TYR X CE1 1 
ATOM   719  C CE2 . TYR A 1 93  ? -21.052 52.708 63.596 1.00 45.88 ? 93   TYR X CE2 1 
ATOM   720  C CZ  . TYR A 1 93  ? -21.730 53.271 64.659 1.00 49.08 ? 93   TYR X CZ  1 
ATOM   721  O OH  . TYR A 1 93  ? -23.096 53.114 64.758 1.00 53.65 ? 93   TYR X OH  1 
ATOM   722  N N   . GLY A 1 94  ? -14.776 55.902 63.391 1.00 29.89 ? 94   GLY X N   1 
ATOM   723  C CA  . GLY A 1 94  ? -13.383 56.220 63.664 1.00 27.25 ? 94   GLY X CA  1 
ATOM   724  C C   . GLY A 1 94  ? -12.420 55.076 63.410 1.00 28.83 ? 94   GLY X C   1 
ATOM   725  O O   . GLY A 1 94  ? -11.223 55.200 63.667 1.00 29.05 ? 94   GLY X O   1 
ATOM   726  N N   . ASN A 1 95  ? -12.932 53.957 62.906 1.00 28.14 ? 95   ASN X N   1 
ATOM   727  C CA  . ASN A 1 95  ? -12.078 52.807 62.634 1.00 28.37 ? 95   ASN X CA  1 
ATOM   728  C C   . ASN A 1 95  ? -11.383 52.931 61.286 1.00 32.16 ? 95   ASN X C   1 
ATOM   729  O O   . ASN A 1 95  ? -11.944 52.596 60.240 1.00 32.17 ? 95   ASN X O   1 
ATOM   730  C CB  . ASN A 1 95  ? -12.857 51.498 62.776 1.00 31.90 ? 95   ASN X CB  1 
ATOM   731  C CG  . ASN A 1 95  ? -13.304 51.250 64.204 1.00 30.91 ? 95   ASN X CG  1 
ATOM   732  O OD1 . ASN A 1 95  ? -12.495 51.288 65.134 1.00 31.90 ? 95   ASN X OD1 1 
ATOM   733  N ND2 . ASN A 1 95  ? -14.593 51.000 64.387 1.00 34.98 ? 95   ASN X ND2 1 
ATOM   734  N N   . VAL A 1 96  ? -10.150 53.425 61.332 1.00 29.31 ? 96   VAL X N   1 
ATOM   735  C CA  . VAL A 1 96  ? -9.345  53.640 60.140 1.00 27.97 ? 96   VAL X CA  1 
ATOM   736  C C   . VAL A 1 96  ? -8.720  52.345 59.640 1.00 29.72 ? 96   VAL X C   1 
ATOM   737  O O   . VAL A 1 96  ? -8.084  51.615 60.402 1.00 27.94 ? 96   VAL X O   1 
ATOM   738  C CB  . VAL A 1 96  ? -8.259  54.704 60.399 1.00 27.49 ? 96   VAL X CB  1 
ATOM   739  C CG1 . VAL A 1 96  ? -7.374  54.889 59.173 1.00 27.06 ? 96   VAL X CG1 1 
ATOM   740  C CG2 . VAL A 1 96  ? -8.911  56.028 60.799 1.00 25.66 ? 96   VAL X CG2 1 
ATOM   741  N N   . GLN A 1 97  ? -8.914  52.077 58.351 1.00 29.84 ? 97   GLN X N   1 
ATOM   742  C CA  . GLN A 1 97  ? -8.397  50.878 57.705 1.00 29.26 ? 97   GLN X CA  1 
ATOM   743  C C   . GLN A 1 97  ? -6.885  50.926 57.571 1.00 31.30 ? 97   GLN X C   1 
ATOM   744  O O   . GLN A 1 97  ? -6.325  51.836 56.952 1.00 29.44 ? 97   GLN X O   1 
ATOM   745  C CB  . GLN A 1 97  ? -9.052  50.695 56.331 1.00 31.98 ? 97   GLN X CB  1 
ATOM   746  C CG  . GLN A 1 97  ? -8.486  49.563 55.488 1.00 28.13 ? 97   GLN X CG  1 
ATOM   747  C CD  . GLN A 1 97  ? -8.992  49.611 54.052 1.00 31.64 ? 97   GLN X CD  1 
ATOM   748  O OE1 . GLN A 1 97  ? -9.761  50.503 53.692 1.00 38.98 ? 97   GLN X OE1 1 
ATOM   749  N NE2 . GLN A 1 97  ? -8.562  48.656 53.235 1.00 33.22 ? 97   GLN X NE2 1 
ATOM   750  N N   . PHE A 1 98  ? -6.230  49.934 58.158 1.00 29.79 ? 98   PHE X N   1 
ATOM   751  C CA  . PHE A 1 98  ? -4.782  49.851 58.121 1.00 28.15 ? 98   PHE X CA  1 
ATOM   752  C C   . PHE A 1 98  ? -4.305  48.545 57.498 1.00 33.42 ? 98   PHE X C   1 
ATOM   753  O O   . PHE A 1 98  ? -4.822  47.470 57.807 1.00 28.56 ? 98   PHE X O   1 
ATOM   754  C CB  . PHE A 1 98  ? -4.227  49.875 59.551 1.00 32.47 ? 98   PHE X CB  1 
ATOM   755  C CG  . PHE A 1 98  ? -3.965  51.249 60.098 1.00 32.99 ? 98   PHE X CG  1 
ATOM   756  C CD1 . PHE A 1 98  ? -4.682  51.720 61.188 1.00 32.70 ? 98   PHE X CD1 1 
ATOM   757  C CD2 . PHE A 1 98  ? -3.002  52.067 59.533 1.00 37.80 ? 98   PHE X CD2 1 
ATOM   758  C CE1 . PHE A 1 98  ? -4.444  52.985 61.701 1.00 33.03 ? 98   PHE X CE1 1 
ATOM   759  C CE2 . PHE A 1 98  ? -2.755  53.333 60.041 1.00 39.93 ? 98   PHE X CE2 1 
ATOM   760  C CZ  . PHE A 1 98  ? -3.476  53.792 61.125 1.00 35.52 ? 98   PHE X CZ  1 
ATOM   761  N N   . THR A 1 99  ? -3.323  48.650 56.613 1.00 33.00 ? 99   THR X N   1 
ATOM   762  C CA  . THR A 1 99  ? -2.674  47.477 56.040 1.00 32.48 ? 99   THR X CA  1 
ATOM   763  C C   . THR A 1 99  ? -1.209  47.839 56.206 1.00 31.67 ? 99   THR X C   1 
ATOM   764  O O   . THR A 1 99  ? -0.885  48.980 56.547 1.00 26.55 ? 99   THR X O   1 
ATOM   765  C CB  . THR A 1 99  ? -3.017  47.217 54.550 1.00 33.29 ? 99   THR X CB  1 
ATOM   766  O OG1 . THR A 1 99  ? -2.936  48.431 53.794 1.00 34.43 ? 99   THR X OG1 1 
ATOM   767  C CG2 . THR A 1 99  ? -4.456  46.755 54.391 1.00 30.71 ? 99   THR X CG2 1 
ATOM   768  N N   . GLY A 1 100 ? -0.319  46.887 55.977 1.00 32.53 ? 100  GLY X N   1 
ATOM   769  C CA  . GLY A 1 100 ? 1.090   47.175 56.120 1.00 29.74 ? 100  GLY X CA  1 
ATOM   770  C C   . GLY A 1 100 ? 1.890   46.738 54.917 1.00 29.09 ? 100  GLY X C   1 
ATOM   771  O O   . GLY A 1 100 ? 1.491   45.840 54.181 1.00 31.81 ? 100  GLY X O   1 
ATOM   772  N N   . TYR A 1 101 ? 3.026   47.389 54.711 1.00 30.71 ? 101  TYR X N   1 
ATOM   773  C CA  . TYR A 1 101 ? 3.912   47.020 53.623 1.00 30.32 ? 101  TYR X CA  1 
ATOM   774  C C   . TYR A 1 101 ? 5.336   47.156 54.109 1.00 32.85 ? 101  TYR X C   1 
ATOM   775  O O   . TYR A 1 101 ? 5.594   47.835 55.107 1.00 30.42 ? 101  TYR X O   1 
ATOM   776  C CB  . TYR A 1 101 ? 3.621   47.762 52.309 1.00 31.29 ? 101  TYR X CB  1 
ATOM   777  C CG  . TYR A 1 101 ? 4.024   49.228 52.226 1.00 30.73 ? 101  TYR X CG  1 
ATOM   778  C CD1 . TYR A 1 101 ? 5.010   49.644 51.336 1.00 31.03 ? 101  TYR X CD1 1 
ATOM   779  C CD2 . TYR A 1 101 ? 3.414   50.191 53.023 1.00 30.75 ? 101  TYR X CD2 1 
ATOM   780  C CE1 . TYR A 1 101 ? 5.383   50.981 51.243 1.00 29.49 ? 101  TYR X CE1 1 
ATOM   781  C CE2 . TYR A 1 101 ? 3.778   51.529 52.940 1.00 30.02 ? 101  TYR X CE2 1 
ATOM   782  C CZ  . TYR A 1 101 ? 4.760   51.918 52.050 1.00 34.75 ? 101  TYR X CZ  1 
ATOM   783  O OH  . TYR A 1 101 ? 5.121   53.244 51.967 1.00 31.33 ? 101  TYR X OH  1 
ATOM   784  N N   . TYR A 1 102 ? 6.260   46.504 53.417 1.00 30.42 ? 102  TYR X N   1 
ATOM   785  C CA  . TYR A 1 102 ? 7.651   46.548 53.834 1.00 30.90 ? 102  TYR X CA  1 
ATOM   786  C C   . TYR A 1 102 ? 8.587   46.252 52.682 1.00 32.14 ? 102  TYR X C   1 
ATOM   787  O O   . TYR A 1 102 ? 8.152   45.880 51.596 1.00 31.08 ? 102  TYR X O   1 
ATOM   788  C CB  . TYR A 1 102 ? 7.882   45.535 54.961 1.00 31.72 ? 102  TYR X CB  1 
ATOM   789  C CG  . TYR A 1 102 ? 7.927   44.090 54.510 1.00 31.39 ? 102  TYR X CG  1 
ATOM   790  C CD1 . TYR A 1 102 ? 6.778   43.440 54.062 1.00 34.34 ? 102  TYR X CD1 1 
ATOM   791  C CD2 . TYR A 1 102 ? 9.119   43.373 54.535 1.00 31.32 ? 102  TYR X CD2 1 
ATOM   792  C CE1 . TYR A 1 102 ? 6.816   42.117 53.651 1.00 33.83 ? 102  TYR X CE1 1 
ATOM   793  C CE2 . TYR A 1 102 ? 9.169   42.050 54.125 1.00 28.38 ? 102  TYR X CE2 1 
ATOM   794  C CZ  . TYR A 1 102 ? 8.015   41.428 53.685 1.00 41.07 ? 102  TYR X CZ  1 
ATOM   795  O OH  . TYR A 1 102 ? 8.063   40.117 53.281 1.00 33.74 ? 102  TYR X OH  1 
ATOM   796  N N   . THR A 1 103 ? 9.880   46.425 52.929 1.00 29.47 ? 103  THR X N   1 
ATOM   797  C CA  . THR A 1 103 ? 10.883  46.146 51.917 1.00 31.81 ? 103  THR X CA  1 
ATOM   798  C C   . THR A 1 103 ? 11.421  44.750 52.205 1.00 31.75 ? 103  THR X C   1 
ATOM   799  O O   . THR A 1 103 ? 12.112  44.545 53.199 1.00 30.39 ? 103  THR X O   1 
ATOM   800  C CB  . THR A 1 103 ? 12.031  47.160 52.002 1.00 32.48 ? 103  THR X CB  1 
ATOM   801  O OG1 . THR A 1 103 ? 11.518  48.489 51.850 1.00 29.46 ? 103  THR X OG1 1 
ATOM   802  C CG2 . THR A 1 103 ? 12.969  46.991 50.811 1.00 26.56 ? 103  THR X CG2 1 
ATOM   803  N N   . PRO A 1 104 ? 11.108  43.788 51.349 1.00 30.98 ? 104  PRO X N   1 
ATOM   804  C CA  . PRO A 1 104 ? 11.598  42.425 51.553 1.00 31.10 ? 104  PRO X CA  1 
ATOM   805  C C   . PRO A 1 104 ? 13.071  42.343 51.192 1.00 32.67 ? 104  PRO X C   1 
ATOM   806  O O   . PRO A 1 104 ? 13.554  43.118 50.361 1.00 31.59 ? 104  PRO X O   1 
ATOM   807  C CB  . PRO A 1 104 ? 10.782  41.596 50.551 1.00 29.70 ? 104  PRO X CB  1 
ATOM   808  C CG  . PRO A 1 104 ? 9.733   42.519 50.014 1.00 34.04 ? 104  PRO X CG  1 
ATOM   809  C CD  . PRO A 1 104 ? 10.283  43.906 50.136 1.00 29.76 ? 104  PRO X CD  1 
ATOM   810  N N   . VAL A 1 105 ? 13.772  41.415 51.828 1.00 32.97 ? 105  VAL X N   1 
ATOM   811  C CA  . VAL A 1 105 ? 15.174  41.173 51.535 1.00 30.45 ? 105  VAL X CA  1 
ATOM   812  C C   . VAL A 1 105 ? 15.182  39.714 51.109 1.00 33.07 ? 105  VAL X C   1 
ATOM   813  O O   . VAL A 1 105 ? 15.010  38.813 51.930 1.00 30.76 ? 105  VAL X O   1 
ATOM   814  C CB  . VAL A 1 105 ? 16.083  41.373 52.760 1.00 31.56 ? 105  VAL X CB  1 
ATOM   815  C CG1 . VAL A 1 105 ? 17.479  40.812 52.483 1.00 29.83 ? 105  VAL X CG1 1 
ATOM   816  C CG2 . VAL A 1 105 ? 16.181  42.849 53.110 1.00 30.48 ? 105  VAL X CG2 1 
ATOM   817  N N   . ILE A 1 106 ? 15.373  39.488 49.817 1.00 28.39 ? 106  ILE X N   1 
ATOM   818  C CA  . ILE A 1 106 ? 15.383  38.141 49.283 1.00 28.08 ? 106  ILE X CA  1 
ATOM   819  C C   . ILE A 1 106 ? 16.708  37.441 49.566 1.00 30.71 ? 106  ILE X C   1 
ATOM   820  O O   . ILE A 1 106 ? 17.783  37.977 49.284 1.00 28.39 ? 106  ILE X O   1 
ATOM   821  C CB  . ILE A 1 106 ? 15.084  38.171 47.770 1.00 29.77 ? 106  ILE X CB  1 
ATOM   822  C CG1 . ILE A 1 106 ? 13.693  38.760 47.522 1.00 33.30 ? 106  ILE X CG1 1 
ATOM   823  C CG2 . ILE A 1 106 ? 15.191  36.779 47.168 1.00 30.93 ? 106  ILE X CG2 1 
ATOM   824  C CD1 . ILE A 1 106 ? 13.386  39.011 46.061 1.00 39.05 ? 106  ILE X CD1 1 
ATOM   825  N N   . GLN A 1 107 ? 16.619  36.246 50.136 1.00 31.20 ? 107  GLN X N   1 
ATOM   826  C CA  . GLN A 1 107 ? 17.802  35.451 50.425 1.00 31.88 ? 107  GLN X CA  1 
ATOM   827  C C   . GLN A 1 107 ? 18.098  34.703 49.138 1.00 31.72 ? 107  GLN X C   1 
ATOM   828  O O   . GLN A 1 107 ? 17.222  34.035 48.586 1.00 30.74 ? 107  GLN X O   1 
ATOM   829  C CB  . GLN A 1 107 ? 17.526  34.458 51.556 1.00 31.70 ? 107  GLN X CB  1 
ATOM   830  C CG  . GLN A 1 107 ? 17.471  35.083 52.947 1.00 34.38 ? 107  GLN X CG  1 
ATOM   831  C CD  . GLN A 1 107 ? 18.805  35.657 53.395 1.00 40.92 ? 107  GLN X CD  1 
ATOM   832  O OE1 . GLN A 1 107 ? 19.855  35.050 53.180 1.00 44.05 ? 107  GLN X OE1 1 
ATOM   833  N NE2 . GLN A 1 107 ? 18.766  36.830 54.020 1.00 39.47 ? 107  GLN X NE2 1 
ATOM   834  N N   . ALA A 1 108 ? 19.329  34.818 48.655 1.00 29.56 ? 108  ALA X N   1 
ATOM   835  C CA  . ALA A 1 108 ? 19.712  34.145 47.424 1.00 29.11 ? 108  ALA X CA  1 
ATOM   836  C C   . ALA A 1 108 ? 21.173  33.720 47.446 1.00 30.10 ? 108  ALA X C   1 
ATOM   837  O O   . ALA A 1 108 ? 21.960  34.211 48.259 1.00 30.44 ? 108  ALA X O   1 
ATOM   838  C CB  . ALA A 1 108 ? 19.427  35.038 46.219 1.00 26.97 ? 108  ALA X CB  1 
ATOM   839  N N   . ARG A 1 109 ? 21.525  32.802 46.549 1.00 31.54 ? 109  ARG X N   1 
ATOM   840  C CA  . ARG A 1 109 ? 22.895  32.305 46.434 1.00 30.32 ? 109  ARG X CA  1 
ATOM   841  C C   . ARG A 1 109 ? 23.371  32.432 44.985 1.00 31.60 ? 109  ARG X C   1 
ATOM   842  O O   . ARG A 1 109 ? 22.574  32.686 44.081 1.00 28.91 ? 109  ARG X O   1 
ATOM   843  C CB  . ARG A 1 109 ? 22.986  30.846 46.896 1.00 30.99 ? 109  ARG X CB  1 
ATOM   844  C CG  . ARG A 1 109 ? 22.690  30.632 48.376 1.00 31.16 ? 109  ARG X CG  1 
ATOM   845  C CD  . ARG A 1 109 ? 23.598  31.397 49.329 1.00 34.59 ? 109  ARG X CD  1 
ATOM   846  N NE  . ARG A 1 109 ? 23.278  31.110 50.725 1.00 33.45 ? 109  ARG X NE  1 
ATOM   847  C CZ  . ARG A 1 109 ? 22.618  31.933 51.529 1.00 33.26 ? 109  ARG X CZ  1 
ATOM   848  N NH1 . ARG A 1 109 ? 22.197  33.108 51.085 1.00 31.73 ? 109  ARG X NH1 1 
ATOM   849  N NH2 . ARG A 1 109 ? 22.375  31.580 52.784 1.00 52.48 ? 109  ARG X NH2 1 
ATOM   850  N N   . HIS A 1 110 ? 24.670  32.255 44.772 1.00 31.91 ? 110  HIS X N   1 
ATOM   851  C CA  . HIS A 1 110 ? 25.257  32.362 43.437 1.00 34.84 ? 110  HIS X CA  1 
ATOM   852  C C   . HIS A 1 110 ? 25.164  31.069 42.631 1.00 35.44 ? 110  HIS X C   1 
ATOM   853  O O   . HIS A 1 110 ? 25.307  31.080 41.410 1.00 36.26 ? 110  HIS X O   1 
ATOM   854  C CB  . HIS A 1 110 ? 26.708  32.839 43.527 1.00 35.93 ? 110  HIS X CB  1 
ATOM   855  C CG  . HIS A 1 110 ? 26.844  34.260 43.975 1.00 32.59 ? 110  HIS X CG  1 
ATOM   856  N ND1 . HIS A 1 110 ? 27.364  34.606 45.204 1.00 36.14 ? 110  HIS X ND1 1 
ATOM   857  C CD2 . HIS A 1 110 ? 26.525  35.423 43.360 1.00 29.02 ? 110  HIS X CD2 1 
ATOM   858  C CE1 . HIS A 1 110 ? 27.360  35.921 45.326 1.00 32.55 ? 110  HIS X CE1 1 
ATOM   859  N NE2 . HIS A 1 110 ? 26.856  36.441 44.221 1.00 38.08 ? 110  HIS X NE2 1 
ATOM   860  N N   . THR A 1 111 ? 24.926  29.959 43.322 1.00 33.91 ? 111  THR X N   1 
ATOM   861  C CA  . THR A 1 111 ? 24.789  28.650 42.687 1.00 36.55 ? 111  THR X CA  1 
ATOM   862  C C   . THR A 1 111 ? 23.570  27.976 43.311 1.00 37.67 ? 111  THR X C   1 
ATOM   863  O O   . THR A 1 111 ? 23.188  28.312 44.432 1.00 34.83 ? 111  THR X O   1 
ATOM   864  C CB  . THR A 1 111 ? 26.046  27.784 42.944 1.00 37.74 ? 111  THR X CB  1 
ATOM   865  O OG1 . THR A 1 111 ? 26.262  27.658 44.355 1.00 39.15 ? 111  THR X OG1 1 
ATOM   866  C CG2 . THR A 1 111 ? 27.311  28.490 42.458 1.00 35.71 ? 111  THR X CG2 1 
ATOM   867  N N   . ARG A 1 112 ? 22.953  27.035 42.603 1.00 40.67 ? 112  ARG X N   1 
ATOM   868  C CA  . ARG A 1 112 ? 21.792  26.364 43.178 1.00 44.87 ? 112  ARG X CA  1 
ATOM   869  C C   . ARG A 1 112 ? 22.197  25.334 44.226 1.00 43.92 ? 112  ARG X C   1 
ATOM   870  O O   . ARG A 1 112 ? 22.879  24.353 43.932 1.00 47.34 ? 112  ARG X O   1 
ATOM   871  C CB  . ARG A 1 112 ? 20.805  25.827 42.130 1.00 45.92 ? 112  ARG X CB  1 
ATOM   872  C CG  . ARG A 1 112 ? 21.365  24.889 41.084 1.00 48.88 ? 112  ARG X CG  1 
ATOM   873  C CD  . ARG A 1 112 ? 20.283  24.180 40.272 1.00 54.62 ? 112  ARG X CD  1 
ATOM   874  N NE  . ARG A 1 112 ? 19.684  25.048 39.257 1.00 47.20 ? 112  ARG X NE  1 
ATOM   875  C CZ  . ARG A 1 112 ? 18.409  25.431 39.245 1.00 45.44 ? 112  ARG X CZ  1 
ATOM   876  N NH1 . ARG A 1 112 ? 17.574  25.029 40.193 1.00 40.72 ? 112  ARG X NH1 1 
ATOM   877  N NH2 . ARG A 1 112 ? 17.964  26.221 38.277 1.00 42.90 ? 112  ARG X NH2 1 
ATOM   878  N N   . GLN A 1 113 ? 21.767  25.585 45.457 1.00 43.19 ? 113  GLN X N   1 
ATOM   879  C CA  . GLN A 1 113 ? 22.085  24.729 46.591 1.00 42.08 ? 113  GLN X CA  1 
ATOM   880  C C   . GLN A 1 113 ? 20.901  24.695 47.551 1.00 40.22 ? 113  GLN X C   1 
ATOM   881  O O   . GLN A 1 113 ? 20.189  25.689 47.705 1.00 35.77 ? 113  GLN X O   1 
ATOM   882  C CB  . GLN A 1 113 ? 23.311  25.291 47.321 1.00 42.61 ? 113  GLN X CB  1 
ATOM   883  C CG  . GLN A 1 113 ? 23.168  26.768 47.705 1.00 44.50 ? 113  GLN X CG  1 
ATOM   884  C CD  . GLN A 1 113 ? 24.497  27.477 47.899 1.00 50.95 ? 113  GLN X CD  1 
ATOM   885  O OE1 . GLN A 1 113 ? 24.890  27.769 49.030 1.00 43.50 ? 113  GLN X OE1 1 
ATOM   886  N NE2 . GLN A 1 113 ? 25.189  27.758 46.800 1.00 52.18 ? 113  GLN X NE2 1 
ATOM   887  N N   . GLY A 1 114 ? 20.698  23.549 48.193 1.00 38.46 ? 114  GLY X N   1 
ATOM   888  C CA  . GLY A 1 114 ? 19.618  23.375 49.150 1.00 38.51 ? 114  GLY X CA  1 
ATOM   889  C C   . GLY A 1 114 ? 18.278  23.949 48.726 1.00 34.38 ? 114  GLY X C   1 
ATOM   890  O O   . GLY A 1 114 ? 17.700  23.527 47.725 1.00 33.94 ? 114  GLY X O   1 
ATOM   891  N N   . GLU A 1 115 ? 17.788  24.917 49.495 1.00 36.21 ? 115  GLU X N   1 
ATOM   892  C CA  . GLU A 1 115 ? 16.500  25.554 49.226 1.00 38.05 ? 115  GLU X CA  1 
ATOM   893  C C   . GLU A 1 115 ? 16.553  26.624 48.139 1.00 37.22 ? 115  GLU X C   1 
ATOM   894  O O   . GLU A 1 115 ? 15.512  27.078 47.657 1.00 35.69 ? 115  GLU X O   1 
ATOM   895  C CB  . GLU A 1 115 ? 15.929  26.154 50.513 1.00 39.80 ? 115  GLU X CB  1 
ATOM   896  C CG  . GLU A 1 115 ? 15.591  25.131 51.585 1.00 54.87 ? 115  GLU X CG  1 
ATOM   897  C CD  . GLU A 1 115 ? 14.628  25.674 52.624 1.00 73.00 ? 115  GLU X CD  1 
ATOM   898  O OE1 . GLU A 1 115 ? 14.983  26.657 53.313 1.00 76.30 ? 115  GLU X OE1 1 
ATOM   899  O OE2 . GLU A 1 115 ? 13.516  25.118 52.752 1.00 81.44 ? 115  GLU X OE2 1 
ATOM   900  N N   . PHE A 1 116 ? 17.762  27.024 47.758 1.00 35.96 ? 116  PHE X N   1 
ATOM   901  C CA  . PHE A 1 116 ? 17.951  28.052 46.734 1.00 36.08 ? 116  PHE X CA  1 
ATOM   902  C C   . PHE A 1 116 ? 17.926  27.433 45.339 1.00 37.29 ? 116  PHE X C   1 
ATOM   903  O O   . PHE A 1 116 ? 18.957  27.002 44.816 1.00 33.74 ? 116  PHE X O   1 
ATOM   904  C CB  . PHE A 1 116 ? 19.253  28.816 46.990 1.00 33.97 ? 116  PHE X CB  1 
ATOM   905  C CG  . PHE A 1 116 ? 19.359  29.371 48.385 1.00 32.87 ? 116  PHE X CG  1 
ATOM   906  C CD1 . PHE A 1 116 ? 18.851  30.627 48.685 1.00 31.00 ? 116  PHE X CD1 1 
ATOM   907  C CD2 . PHE A 1 116 ? 19.962  28.637 49.398 1.00 30.74 ? 116  PHE X CD2 1 
ATOM   908  C CE1 . PHE A 1 116 ? 18.942  31.142 49.966 1.00 33.90 ? 116  PHE X CE1 1 
ATOM   909  C CE2 . PHE A 1 116 ? 20.059  29.144 50.683 1.00 30.19 ? 116  PHE X CE2 1 
ATOM   910  C CZ  . PHE A 1 116 ? 19.547  30.401 50.969 1.00 31.10 ? 116  PHE X CZ  1 
ATOM   911  N N   . GLN A 1 117 ? 16.737  27.393 44.742 1.00 34.45 ? 117  GLN X N   1 
ATOM   912  C CA  . GLN A 1 117 ? 16.556  26.787 43.424 1.00 35.86 ? 117  GLN X CA  1 
ATOM   913  C C   . GLN A 1 117 ? 15.721  27.620 42.458 1.00 35.82 ? 117  GLN X C   1 
ATOM   914  O O   . GLN A 1 117 ? 15.300  27.118 41.415 1.00 36.38 ? 117  GLN X O   1 
ATOM   915  C CB  . GLN A 1 117 ? 15.877  25.423 43.579 1.00 39.90 ? 117  GLN X CB  1 
ATOM   916  C CG  . GLN A 1 117 ? 16.520  24.495 44.597 1.00 41.31 ? 117  GLN X CG  1 
ATOM   917  C CD  . GLN A 1 117 ? 17.768  23.826 44.060 1.00 43.53 ? 117  GLN X CD  1 
ATOM   918  O OE1 . GLN A 1 117 ? 17.933  23.692 42.848 1.00 48.54 ? 117  GLN X OE1 1 
ATOM   919  N NE2 . GLN A 1 117 ? 18.649  23.404 44.960 1.00 32.17 ? 117  GLN X NE2 1 
ATOM   920  N N   . TYR A 1 118 ? 15.481  28.883 42.795 1.00 29.88 ? 118  TYR X N   1 
ATOM   921  C CA  . TYR A 1 118 ? 14.655  29.746 41.953 1.00 31.54 ? 118  TYR X CA  1 
ATOM   922  C C   . TYR A 1 118 ? 15.410  30.938 41.381 1.00 32.34 ? 118  TYR X C   1 
ATOM   923  O O   . TYR A 1 118 ? 15.595  31.957 42.045 1.00 31.49 ? 118  TYR X O   1 
ATOM   924  C CB  . TYR A 1 118 ? 13.395  30.156 42.717 1.00 28.25 ? 118  TYR X CB  1 
ATOM   925  C CG  . TYR A 1 118 ? 12.802  28.976 43.461 1.00 36.86 ? 118  TYR X CG  1 
ATOM   926  C CD1 . TYR A 1 118 ? 12.942  28.851 44.838 1.00 35.11 ? 118  TYR X CD1 1 
ATOM   927  C CD2 . TYR A 1 118 ? 12.110  27.981 42.780 1.00 33.54 ? 118  TYR X CD2 1 
ATOM   928  C CE1 . TYR A 1 118 ? 12.404  27.768 45.518 1.00 35.66 ? 118  TYR X CE1 1 
ATOM   929  C CE2 . TYR A 1 118 ? 11.568  26.896 43.450 1.00 40.90 ? 118  TYR X CE2 1 
ATOM   930  C CZ  . TYR A 1 118 ? 11.719  26.795 44.818 1.00 40.51 ? 118  TYR X CZ  1 
ATOM   931  O OH  . TYR A 1 118 ? 11.183  25.719 45.487 1.00 37.19 ? 118  TYR X OH  1 
ATOM   932  N N   . PRO A 1 119 ? 15.841  30.789 40.133 1.00 33.85 ? 119  PRO X N   1 
ATOM   933  C CA  . PRO A 1 119 ? 16.612  31.818 39.428 1.00 32.25 ? 119  PRO X CA  1 
ATOM   934  C C   . PRO A 1 119 ? 15.905  33.143 39.167 1.00 33.68 ? 119  PRO X C   1 
ATOM   935  O O   . PRO A 1 119 ? 14.701  33.191 38.917 1.00 30.94 ? 119  PRO X O   1 
ATOM   936  C CB  . PRO A 1 119 ? 16.936  31.152 38.083 1.00 34.01 ? 119  PRO X CB  1 
ATOM   937  C CG  . PRO A 1 119 ? 16.728  29.692 38.309 1.00 37.22 ? 119  PRO X CG  1 
ATOM   938  C CD  . PRO A 1 119 ? 15.616  29.596 39.298 1.00 34.78 ? 119  PRO X CD  1 
ATOM   939  N N   . ILE A 1 120 ? 16.691  34.212 39.235 1.00 31.31 ? 120  ILE X N   1 
ATOM   940  C CA  . ILE A 1 120 ? 16.242  35.568 38.950 1.00 31.85 ? 120  ILE X CA  1 
ATOM   941  C C   . ILE A 1 120 ? 17.148  35.923 37.769 1.00 34.33 ? 120  ILE X C   1 
ATOM   942  O O   . ILE A 1 120 ? 18.370  35.776 37.857 1.00 34.94 ? 120  ILE X O   1 
ATOM   943  C CB  . ILE A 1 120 ? 16.477  36.484 40.168 1.00 31.04 ? 120  ILE X CB  1 
ATOM   944  C CG1 . ILE A 1 120 ? 15.567  36.048 41.325 1.00 31.67 ? 120  ILE X CG1 1 
ATOM   945  C CG2 . ILE A 1 120 ? 16.213  37.937 39.805 1.00 28.82 ? 120  ILE X CG2 1 
ATOM   946  C CD1 . ILE A 1 120 ? 15.830  36.763 42.643 1.00 35.31 ? 120  ILE X CD1 1 
ATOM   947  N N   . TYR A 1 121 ? 16.558  36.385 36.671 1.00 32.24 ? 121  TYR X N   1 
ATOM   948  C CA  . TYR A 1 121 ? 17.322  36.649 35.451 1.00 29.41 ? 121  TYR X CA  1 
ATOM   949  C C   . TYR A 1 121 ? 17.582  38.080 35.016 1.00 31.73 ? 121  TYR X C   1 
ATOM   950  O O   . TYR A 1 121 ? 16.827  39.001 35.336 1.00 28.32 ? 121  TYR X O   1 
ATOM   951  C CB  . TYR A 1 121 ? 16.613  35.985 34.261 1.00 28.55 ? 121  TYR X CB  1 
ATOM   952  C CG  . TYR A 1 121 ? 16.451  34.485 34.330 1.00 30.20 ? 121  TYR X CG  1 
ATOM   953  C CD1 . TYR A 1 121 ? 15.380  33.911 35.005 1.00 30.80 ? 121  TYR X CD1 1 
ATOM   954  C CD2 . TYR A 1 121 ? 17.366  33.642 33.711 1.00 33.40 ? 121  TYR X CD2 1 
ATOM   955  C CE1 . TYR A 1 121 ? 15.228  32.533 35.066 1.00 32.52 ? 121  TYR X CE1 1 
ATOM   956  C CE2 . TYR A 1 121 ? 17.223  32.266 33.766 1.00 34.39 ? 121  TYR X CE2 1 
ATOM   957  C CZ  . TYR A 1 121 ? 16.154  31.719 34.444 1.00 36.17 ? 121  TYR X CZ  1 
ATOM   958  O OH  . TYR A 1 121 ? 16.010  30.356 34.499 1.00 33.42 ? 121  TYR X OH  1 
ATOM   959  N N   . ARG A 1 122 ? 18.670  38.247 34.267 1.00 29.18 ? 122  ARG X N   1 
ATOM   960  C CA  . ARG A 1 122 ? 18.995  39.536 33.675 1.00 30.28 ? 122  ARG X CA  1 
ATOM   961  C C   . ARG A 1 122 ? 18.428  39.420 32.258 1.00 31.17 ? 122  ARG X C   1 
ATOM   962  O O   . ARG A 1 122 ? 17.924  38.360 31.883 1.00 29.42 ? 122  ARG X O   1 
ATOM   963  C CB  . ARG A 1 122 ? 20.504  39.811 33.663 1.00 29.64 ? 122  ARG X CB  1 
ATOM   964  C CG  . ARG A 1 122 ? 21.357  38.818 32.891 1.00 34.11 ? 122  ARG X CG  1 
ATOM   965  C CD  . ARG A 1 122 ? 22.850  39.135 32.948 1.00 42.46 ? 122  ARG X CD  1 
ATOM   966  N NE  . ARG A 1 122 ? 23.672  38.073 32.372 1.00 45.99 ? 122  ARG X NE  1 
ATOM   967  C CZ  . ARG A 1 122 ? 24.227  38.126 31.166 1.00 49.50 ? 122  ARG X CZ  1 
ATOM   968  N NH1 . ARG A 1 122 ? 24.959  37.109 30.727 1.00 48.86 ? 122  ARG X NH1 1 
ATOM   969  N NH2 . ARG A 1 122 ? 24.051  39.191 30.395 1.00 36.03 ? 122  ARG X NH2 1 
ATOM   970  N N   . MET A 1 123 ? 18.506  40.492 31.479 1.00 32.02 ? 123  MET X N   1 
ATOM   971  C CA  . MET A 1 123 ? 17.973  40.494 30.118 1.00 35.44 ? 123  MET X CA  1 
ATOM   972  C C   . MET A 1 123 ? 18.694  39.569 29.135 1.00 35.53 ? 123  MET X C   1 
ATOM   973  O O   . MET A 1 123 ? 19.891  39.719 28.894 1.00 36.67 ? 123  MET X O   1 
ATOM   974  C CB  . MET A 1 123 ? 17.965  41.915 29.553 1.00 36.90 ? 123  MET X CB  1 
ATOM   975  C CG  . MET A 1 123 ? 16.766  42.745 29.960 1.00 46.93 ? 123  MET X CG  1 
ATOM   976  S SD  . MET A 1 123 ? 15.320  42.428 28.938 1.00 42.95 ? 123  MET X SD  1 
ATOM   977  C CE  . MET A 1 123 ? 15.376  43.815 27.818 1.00 45.93 ? 123  MET X CE  1 
ATOM   978  N N   . PRO A 1 124 ? 17.961  38.611 28.576 1.00 35.27 ? 124  PRO X N   1 
ATOM   979  C CA  . PRO A 1 124 ? 18.508  37.698 27.568 1.00 38.56 ? 124  PRO X CA  1 
ATOM   980  C C   . PRO A 1 124 ? 18.264  38.313 26.182 1.00 40.20 ? 124  PRO X C   1 
ATOM   981  O O   . PRO A 1 124 ? 17.597  39.347 26.115 1.00 39.97 ? 124  PRO X O   1 
ATOM   982  C CB  . PRO A 1 124 ? 17.651  36.444 27.754 1.00 38.86 ? 124  PRO X CB  1 
ATOM   983  C CG  . PRO A 1 124 ? 16.315  36.961 28.237 1.00 37.66 ? 124  PRO X CG  1 
ATOM   984  C CD  . PRO A 1 124 ? 16.548  38.316 28.877 1.00 36.71 ? 124  PRO X CD  1 
ATOM   985  N N   . PRO A 1 125 ? 18.782  37.718 25.107 1.00 44.54 ? 125  PRO X N   1 
ATOM   986  C CA  . PRO A 1 125 ? 18.558  38.261 23.760 1.00 43.45 ? 125  PRO X CA  1 
ATOM   987  C C   . PRO A 1 125 ? 17.082  38.190 23.370 1.00 42.50 ? 125  PRO X C   1 
ATOM   988  O O   . PRO A 1 125 ? 16.331  37.409 23.960 1.00 40.38 ? 125  PRO X O   1 
ATOM   989  C CB  . PRO A 1 125 ? 19.404  37.352 22.860 1.00 45.14 ? 125  PRO X CB  1 
ATOM   990  C CG  . PRO A 1 125 ? 19.605  36.105 23.639 1.00 49.04 ? 125  PRO X CG  1 
ATOM   991  C CD  . PRO A 1 125 ? 19.615  36.502 25.084 1.00 43.31 ? 125  PRO X CD  1 
ATOM   992  N N   . LYS A 1 126 ? 16.680  38.996 22.390 1.00 44.18 ? 126  LYS X N   1 
ATOM   993  C CA  . LYS A 1 126 ? 15.290  39.049 21.936 1.00 46.09 ? 126  LYS X CA  1 
ATOM   994  C C   . LYS A 1 126 ? 14.601  37.698 21.748 1.00 43.21 ? 126  LYS X C   1 
ATOM   995  O O   . LYS A 1 126 ? 13.419  37.557 22.062 1.00 42.11 ? 126  LYS X O   1 
ATOM   996  C CB  . LYS A 1 126 ? 15.136  39.927 20.687 1.00 48.62 ? 126  LYS X CB  1 
ATOM   997  C CG  . LYS A 1 126 ? 15.989  39.508 19.499 1.00 58.18 ? 126  LYS X CG  1 
ATOM   998  C CD  . LYS A 1 126 ? 15.538  40.206 18.224 1.00 72.68 ? 126  LYS X CD  1 
ATOM   999  C CE  . LYS A 1 126 ? 16.409  41.416 17.916 1.00 80.31 ? 126  LYS X CE  1 
ATOM   1000 N NZ  . LYS A 1 126 ? 15.973  42.624 18.673 1.00 82.23 ? 126  LYS X NZ  1 
ATOM   1001 N N   . ARG A 1 127 ? 15.338  36.713 21.242 1.00 42.32 ? 127  ARG X N   1 
ATOM   1002 C CA  . ARG A 1 127 ? 14.787  35.380 21.020 1.00 41.77 ? 127  ARG X CA  1 
ATOM   1003 C C   . ARG A 1 127 ? 14.313  34.743 22.326 1.00 40.55 ? 127  ARG X C   1 
ATOM   1004 O O   . ARG A 1 127 ? 13.192  34.237 22.407 1.00 41.11 ? 127  ARG X O   1 
ATOM   1005 C CB  . ARG A 1 127 ? 15.816  34.480 20.325 1.00 45.56 ? 127  ARG X CB  1 
ATOM   1006 C CG  . ARG A 1 127 ? 15.361  33.040 20.123 1.00 56.00 ? 127  ARG X CG  1 
ATOM   1007 C CD  . ARG A 1 127 ? 14.166  32.886 19.193 1.00 74.21 ? 127  ARG X CD  1 
ATOM   1008 N NE  . ARG A 1 127 ? 14.164  31.597 18.506 1.00 80.76 ? 127  ARG X NE  1 
ATOM   1009 C CZ  . ARG A 1 127 ? 13.218  31.203 17.662 1.00 85.61 ? 127  ARG X CZ  1 
ATOM   1010 N NH1 . ARG A 1 127 ? 12.189  31.998 17.394 1.00 85.34 ? 127  ARG X NH1 1 
ATOM   1011 N NH2 . ARG A 1 127 ? 13.299  30.013 17.082 1.00 83.64 ? 127  ARG X NH2 1 
ATOM   1012 N N   . GLY A 1 128 ? 15.170  34.772 23.343 1.00 36.40 ? 128  GLY X N   1 
ATOM   1013 C CA  . GLY A 1 128 ? 14.842  34.209 24.642 1.00 38.22 ? 128  GLY X CA  1 
ATOM   1014 C C   . GLY A 1 128 ? 13.696  34.926 25.338 1.00 39.72 ? 128  GLY X C   1 
ATOM   1015 O O   . GLY A 1 128 ? 12.964  34.325 26.125 1.00 39.04 ? 128  GLY X O   1 
ATOM   1016 N N   . ARG A 1 129 ? 13.541  36.213 25.039 1.00 35.98 ? 129  ARG X N   1 
ATOM   1017 C CA  . ARG A 1 129 ? 12.484  37.032 25.627 1.00 36.65 ? 129  ARG X CA  1 
ATOM   1018 C C   . ARG A 1 129 ? 11.080  36.614 25.198 1.00 35.41 ? 129  ARG X C   1 
ATOM   1019 O O   . ARG A 1 129 ? 10.094  37.014 25.815 1.00 37.76 ? 129  ARG X O   1 
ATOM   1020 C CB  . ARG A 1 129 ? 12.703  38.504 25.282 1.00 36.87 ? 129  ARG X CB  1 
ATOM   1021 C CG  . ARG A 1 129 ? 13.245  39.326 26.425 1.00 45.17 ? 129  ARG X CG  1 
ATOM   1022 C CD  . ARG A 1 129 ? 14.441  40.177 26.063 1.00 53.95 ? 129  ARG X CD  1 
ATOM   1023 N NE  . ARG A 1 129 ? 14.127  41.170 25.041 1.00 46.40 ? 129  ARG X NE  1 
ATOM   1024 C CZ  . ARG A 1 129 ? 15.041  41.878 24.390 1.00 53.66 ? 129  ARG X CZ  1 
ATOM   1025 N NH1 . ARG A 1 129 ? 16.329  41.704 24.655 1.00 47.99 ? 129  ARG X NH1 1 
ATOM   1026 N NH2 . ARG A 1 129 ? 14.670  42.762 23.474 1.00 51.32 ? 129  ARG X NH2 1 
ATOM   1027 N N   . LEU A 1 130 ? 10.992  35.812 24.140 1.00 31.87 ? 130  LEU X N   1 
ATOM   1028 C CA  . LEU A 1 130 ? 9.705   35.346 23.636 1.00 33.22 ? 130  LEU X CA  1 
ATOM   1029 C C   . LEU A 1 130 ? 9.068   34.288 24.538 1.00 33.22 ? 130  LEU X C   1 
ATOM   1030 O O   . LEU A 1 130 ? 7.853   34.094 24.509 1.00 32.70 ? 130  LEU X O   1 
ATOM   1031 C CB  . LEU A 1 130 ? 9.870   34.765 22.228 1.00 32.87 ? 130  LEU X CB  1 
ATOM   1032 C CG  . LEU A 1 130 ? 9.477   35.585 20.995 1.00 42.11 ? 130  LEU X CG  1 
ATOM   1033 C CD1 . LEU A 1 130 ? 9.035   36.994 21.333 1.00 40.23 ? 130  LEU X CD1 1 
ATOM   1034 C CD2 . LEU A 1 130 ? 10.605  35.591 19.970 1.00 53.23 ? 130  LEU X CD2 1 
ATOM   1035 N N   . SER A 1 131 ? 9.890   33.609 25.334 1.00 32.61 ? 131  SER X N   1 
ATOM   1036 C CA  . SER A 1 131 ? 9.407   32.547 26.217 1.00 32.57 ? 131  SER X CA  1 
ATOM   1037 C C   . SER A 1 131 ? 8.481   33.019 27.332 1.00 32.57 ? 131  SER X C   1 
ATOM   1038 O O   . SER A 1 131 ? 8.692   34.072 27.933 1.00 32.21 ? 131  SER X O   1 
ATOM   1039 C CB  . SER A 1 131 ? 10.576  31.759 26.821 1.00 33.01 ? 131  SER X CB  1 
ATOM   1040 O OG  . SER A 1 131 ? 11.504  31.352 25.829 1.00 36.73 ? 131  SER X OG  1 
ATOM   1041 N N   . SER A 1 132 ? 7.453   32.222 27.601 1.00 31.84 ? 132  SER X N   1 
ATOM   1042 C CA  . SER A 1 132 ? 6.493   32.519 28.654 1.00 32.81 ? 132  SER X CA  1 
ATOM   1043 C C   . SER A 1 132 ? 7.110   32.178 30.010 1.00 30.87 ? 132  SER X C   1 
ATOM   1044 O O   . SER A 1 132 ? 8.185   31.579 30.078 1.00 31.19 ? 132  SER X O   1 
ATOM   1045 C CB  . SER A 1 132 ? 5.235   31.675 28.452 1.00 34.81 ? 132  SER X CB  1 
ATOM   1046 O OG  . SER A 1 132 ? 5.526   30.305 28.672 1.00 31.17 ? 132  SER X OG  1 
ATOM   1047 N N   . ARG A 1 133 ? 6.422   32.561 31.082 1.00 32.24 ? 133  ARG X N   1 
ATOM   1048 C CA  . ARG A 1 133 ? 6.882   32.286 32.440 1.00 30.71 ? 133  ARG X CA  1 
ATOM   1049 C C   . ARG A 1 133 ? 7.033   30.777 32.651 1.00 31.24 ? 133  ARG X C   1 
ATOM   1050 O O   . ARG A 1 133 ? 8.013   30.322 33.236 1.00 31.70 ? 133  ARG X O   1 
ATOM   1051 C CB  . ARG A 1 133 ? 5.897   32.866 33.458 1.00 27.79 ? 133  ARG X CB  1 
ATOM   1052 C CG  . ARG A 1 133 ? 6.134   32.428 34.899 1.00 25.94 ? 133  ARG X CG  1 
ATOM   1053 C CD  . ARG A 1 133 ? 5.250   33.147 35.910 1.00 32.79 ? 133  ARG X CD  1 
ATOM   1054 N NE  . ARG A 1 133 ? 5.427   34.599 35.846 1.00 30.96 ? 133  ARG X NE  1 
ATOM   1055 C CZ  . ARG A 1 133 ? 6.237   35.284 36.643 1.00 29.78 ? 133  ARG X CZ  1 
ATOM   1056 N NH1 . ARG A 1 133 ? 6.949   34.649 37.573 1.00 23.18 ? 133  ARG X NH1 1 
ATOM   1057 N NH2 . ARG A 1 133 ? 6.341   36.604 36.516 1.00 27.33 ? 133  ARG X NH2 1 
ATOM   1058 N N   . ALA A 1 134 ? 6.056   30.011 32.168 1.00 31.34 ? 134  ALA X N   1 
ATOM   1059 C CA  . ALA A 1 134 ? 6.079   28.552 32.298 1.00 33.62 ? 134  ALA X CA  1 
ATOM   1060 C C   . ALA A 1 134 ? 7.303   27.947 31.614 1.00 33.97 ? 134  ALA X C   1 
ATOM   1061 O O   . ALA A 1 134 ? 7.969   27.075 32.177 1.00 37.40 ? 134  ALA X O   1 
ATOM   1062 C CB  . ALA A 1 134 ? 4.800   27.941 31.739 1.00 33.39 ? 134  ALA X CB  1 
ATOM   1063 N N   . GLU A 1 135 ? 7.595   28.413 30.403 1.00 32.06 ? 135  GLU X N   1 
ATOM   1064 C CA  . GLU A 1 135 ? 8.748   27.921 29.654 1.00 30.81 ? 135  GLU X CA  1 
ATOM   1065 C C   . GLU A 1 135 ? 10.054  28.269 30.366 1.00 31.58 ? 135  GLU X C   1 
ATOM   1066 O O   . GLU A 1 135 ? 10.976  27.452 30.421 1.00 31.38 ? 135  GLU X O   1 
ATOM   1067 C CB  . GLU A 1 135 ? 8.748   28.478 28.229 1.00 31.78 ? 135  GLU X CB  1 
ATOM   1068 C CG  . GLU A 1 135 ? 7.869   27.697 27.262 1.00 36.77 ? 135  GLU X CG  1 
ATOM   1069 C CD  . GLU A 1 135 ? 7.309   28.556 26.143 1.00 43.84 ? 135  GLU X CD  1 
ATOM   1070 O OE1 . GLU A 1 135 ? 7.739   29.721 26.005 1.00 47.27 ? 135  GLU X OE1 1 
ATOM   1071 O OE2 . GLU A 1 135 ? 6.435   28.067 25.398 1.00 37.93 ? 135  GLU X OE2 1 
ATOM   1072 N N   . ILE A 1 136 ? 10.130  29.480 30.913 1.00 28.84 ? 136  ILE X N   1 
ATOM   1073 C CA  . ILE A 1 136 ? 11.328  29.914 31.628 1.00 31.16 ? 136  ILE X CA  1 
ATOM   1074 C C   . ILE A 1 136 ? 11.527  29.061 32.883 1.00 32.94 ? 136  ILE X C   1 
ATOM   1075 O O   . ILE A 1 136 ? 12.645  28.626 33.181 1.00 29.37 ? 136  ILE X O   1 
ATOM   1076 C CB  . ILE A 1 136 ? 11.255  31.423 31.963 1.00 31.76 ? 136  ILE X CB  1 
ATOM   1077 C CG1 . ILE A 1 136 ? 11.455  32.253 30.690 1.00 30.86 ? 136  ILE X CG1 1 
ATOM   1078 C CG2 . ILE A 1 136 ? 12.309  31.795 32.996 1.00 32.04 ? 136  ILE X CG2 1 
ATOM   1079 C CD1 . ILE A 1 136 ? 10.865  33.652 30.757 1.00 29.12 ? 136  ILE X CD1 1 
ATOM   1080 N N   . TYR A 1 137 ? 10.435  28.823 33.609 1.00 32.42 ? 137  TYR X N   1 
ATOM   1081 C CA  . TYR A 1 137 ? 10.468  27.998 34.816 1.00 30.89 ? 137  TYR X CA  1 
ATOM   1082 C C   . TYR A 1 137 ? 10.994  26.612 34.435 1.00 36.05 ? 137  TYR X C   1 
ATOM   1083 O O   . TYR A 1 137 ? 11.671  25.951 35.226 1.00 35.56 ? 137  TYR X O   1 
ATOM   1084 C CB  . TYR A 1 137 ? 9.051   27.824 35.374 1.00 32.98 ? 137  TYR X CB  1 
ATOM   1085 C CG  . TYR A 1 137 ? 8.543   28.935 36.268 1.00 27.36 ? 137  TYR X CG  1 
ATOM   1086 C CD1 . TYR A 1 137 ? 9.347   30.017 36.617 1.00 31.41 ? 137  TYR X CD1 1 
ATOM   1087 C CD2 . TYR A 1 137 ? 7.246   28.896 36.766 1.00 28.13 ? 137  TYR X CD2 1 
ATOM   1088 C CE1 . TYR A 1 137 ? 8.866   31.029 37.440 1.00 29.73 ? 137  TYR X CE1 1 
ATOM   1089 C CE2 . TYR A 1 137 ? 6.759   29.896 37.583 1.00 28.95 ? 137  TYR X CE2 1 
ATOM   1090 C CZ  . TYR A 1 137 ? 7.568   30.958 37.918 1.00 30.26 ? 137  TYR X CZ  1 
ATOM   1091 O OH  . TYR A 1 137 ? 7.068   31.944 38.732 1.00 31.59 ? 137  TYR X OH  1 
ATOM   1092 N N   . ALA A 1 138 ? 10.672  26.185 33.216 1.00 34.41 ? 138  ALA X N   1 
ATOM   1093 C CA  . ALA A 1 138 ? 11.088  24.881 32.700 1.00 37.06 ? 138  ALA X CA  1 
ATOM   1094 C C   . ALA A 1 138 ? 12.519  24.865 32.157 1.00 37.85 ? 138  ALA X C   1 
ATOM   1095 O O   . ALA A 1 138 ? 12.994  23.831 31.686 1.00 35.38 ? 138  ALA X O   1 
ATOM   1096 C CB  . ALA A 1 138 ? 10.106  24.388 31.643 1.00 36.09 ? 138  ALA X CB  1 
ATOM   1097 N N   . GLY A 1 139 ? 13.198  26.008 32.220 1.00 37.01 ? 139  GLY X N   1 
ATOM   1098 C CA  . GLY A 1 139 ? 14.574  26.108 31.762 1.00 38.19 ? 139  GLY X CA  1 
ATOM   1099 C C   . GLY A 1 139 ? 14.797  26.513 30.315 1.00 38.43 ? 139  GLY X C   1 
ATOM   1100 O O   . GLY A 1 139 ? 15.727  26.024 29.672 1.00 37.87 ? 139  GLY X O   1 
ATOM   1101 N N   . ALA A 1 140 ? 13.956  27.404 29.799 1.00 35.54 ? 140  ALA X N   1 
ATOM   1102 C CA  . ALA A 1 140 ? 14.082  27.862 28.417 1.00 36.22 ? 140  ALA X CA  1 
ATOM   1103 C C   . ALA A 1 140 ? 15.260  28.809 28.197 1.00 37.67 ? 140  ALA X C   1 
ATOM   1104 O O   . ALA A 1 140 ? 15.742  28.955 27.074 1.00 36.77 ? 140  ALA X O   1 
ATOM   1105 C CB  . ALA A 1 140 ? 12.789  28.515 27.948 1.00 37.93 ? 140  ALA X CB  1 
ATOM   1106 N N   . LEU A 1 141 ? 15.722  29.450 29.267 1.00 35.79 ? 141  LEU X N   1 
ATOM   1107 C CA  . LEU A 1 141 ? 16.830  30.394 29.169 1.00 37.22 ? 141  LEU X CA  1 
ATOM   1108 C C   . LEU A 1 141 ? 18.148  29.803 29.648 1.00 35.81 ? 141  LEU X C   1 
ATOM   1109 O O   . LEU A 1 141 ? 18.172  28.941 30.527 1.00 39.10 ? 141  LEU X O   1 
ATOM   1110 C CB  . LEU A 1 141 ? 16.523  31.674 29.958 1.00 34.97 ? 141  LEU X CB  1 
ATOM   1111 C CG  . LEU A 1 141 ? 15.292  32.494 29.566 1.00 41.58 ? 141  LEU X CG  1 
ATOM   1112 C CD1 . LEU A 1 141 ? 15.165  33.724 30.455 1.00 36.69 ? 141  LEU X CD1 1 
ATOM   1113 C CD2 . LEU A 1 141 ? 15.347  32.897 28.099 1.00 37.22 ? 141  LEU X CD2 1 
ATOM   1114 N N   . SER A 1 142 ? 19.245  30.278 29.066 1.00 37.77 ? 142  SER X N   1 
ATOM   1115 C CA  . SER A 1 142 ? 20.575  29.813 29.440 1.00 39.20 ? 142  SER X CA  1 
ATOM   1116 C C   . SER A 1 142 ? 20.911  30.249 30.863 1.00 40.28 ? 142  SER X C   1 
ATOM   1117 O O   . SER A 1 142 ? 20.446  31.292 31.331 1.00 37.71 ? 142  SER X O   1 
ATOM   1118 C CB  . SER A 1 142 ? 21.626  30.352 28.469 1.00 41.09 ? 142  SER X CB  1 
ATOM   1119 O OG  . SER A 1 142 ? 22.934  30.027 28.910 1.00 40.60 ? 142  SER X OG  1 
ATOM   1120 N N   . ASP A 1 143 ? 21.723  29.444 31.543 1.00 38.24 ? 143  ASP X N   1 
ATOM   1121 C CA  . ASP A 1 143 ? 22.127  29.727 32.916 1.00 37.18 ? 143  ASP X CA  1 
ATOM   1122 C C   . ASP A 1 143 ? 23.017  30.964 33.031 1.00 37.94 ? 143  ASP X C   1 
ATOM   1123 O O   . ASP A 1 143 ? 23.151  31.536 34.113 1.00 36.56 ? 143  ASP X O   1 
ATOM   1124 C CB  . ASP A 1 143 ? 22.827  28.514 33.532 1.00 41.47 ? 143  ASP X CB  1 
ATOM   1125 C CG  . ASP A 1 143 ? 21.851  27.465 34.037 1.00 43.41 ? 143  ASP X CG  1 
ATOM   1126 O OD1 . ASP A 1 143 ? 22.314  26.448 34.594 1.00 50.72 ? 143  ASP X OD1 1 
ATOM   1127 O OD2 . ASP A 1 143 ? 20.611  27.566 33.924 1.00 43.28 ? 143  ASP X OD2 1 
ATOM   1128 N N   . LYS A 1 144 ? 23.622  31.378 31.920 1.00 35.78 ? 144  LYS X N   1 
ATOM   1129 C CA  . LYS A 1 144 ? 24.492  32.552 31.926 1.00 36.95 ? 144  LYS X CA  1 
ATOM   1130 C C   . LYS A 1 144 ? 23.737  33.849 32.217 1.00 34.83 ? 144  LYS X C   1 
ATOM   1131 O O   . LYS A 1 144 ? 24.347  34.875 32.526 1.00 32.50 ? 144  LYS X O   1 
ATOM   1132 C CB  . LYS A 1 144 ? 25.288  32.664 30.621 1.00 39.07 ? 144  LYS X CB  1 
ATOM   1133 C CG  . LYS A 1 144 ? 24.465  33.011 29.394 1.00 46.85 ? 144  LYS X CG  1 
ATOM   1134 C CD  . LYS A 1 144 ? 25.150  32.518 28.124 1.00 63.97 ? 144  LYS X CD  1 
ATOM   1135 C CE  . LYS A 1 144 ? 25.174  33.592 27.046 1.00 72.43 ? 144  LYS X CE  1 
ATOM   1136 N NZ  . LYS A 1 144 ? 26.091  34.716 27.389 1.00 77.13 ? 144  LYS X NZ  1 
ATOM   1137 N N   . TYR A 1 145 ? 22.412  33.796 32.121 1.00 31.42 ? 145  TYR X N   1 
ATOM   1138 C CA  . TYR A 1 145 ? 21.579  34.968 32.377 1.00 32.43 ? 145  TYR X CA  1 
ATOM   1139 C C   . TYR A 1 145 ? 21.019  35.006 33.800 1.00 32.35 ? 145  TYR X C   1 
ATOM   1140 O O   . TYR A 1 145 ? 20.275  35.918 34.157 1.00 33.64 ? 145  TYR X O   1 
ATOM   1141 C CB  . TYR A 1 145 ? 20.467  35.079 31.328 1.00 26.83 ? 145  TYR X CB  1 
ATOM   1142 C CG  . TYR A 1 145 ? 21.009  35.188 29.919 1.00 32.09 ? 145  TYR X CG  1 
ATOM   1143 C CD1 . TYR A 1 145 ? 20.821  34.164 28.997 1.00 37.94 ? 145  TYR X CD1 1 
ATOM   1144 C CD2 . TYR A 1 145 ? 21.716  36.315 29.512 1.00 37.94 ? 145  TYR X CD2 1 
ATOM   1145 C CE1 . TYR A 1 145 ? 21.321  34.262 27.705 1.00 41.16 ? 145  TYR X CE1 1 
ATOM   1146 C CE2 . TYR A 1 145 ? 22.219  36.421 28.225 1.00 41.51 ? 145  TYR X CE2 1 
ATOM   1147 C CZ  . TYR A 1 145 ? 22.019  35.393 27.327 1.00 41.44 ? 145  TYR X CZ  1 
ATOM   1148 O OH  . TYR A 1 145 ? 22.518  35.498 26.048 1.00 48.21 ? 145  TYR X OH  1 
ATOM   1149 N N   . ILE A 1 146 ? 21.383  34.017 34.613 1.00 34.67 ? 146  ILE X N   1 
ATOM   1150 C CA  . ILE A 1 146 ? 20.909  33.957 35.994 1.00 33.45 ? 146  ILE X CA  1 
ATOM   1151 C C   . ILE A 1 146 ? 21.707  34.902 36.886 1.00 32.91 ? 146  ILE X C   1 
ATOM   1152 O O   . ILE A 1 146 ? 22.931  34.810 36.961 1.00 32.20 ? 146  ILE X O   1 
ATOM   1153 C CB  . ILE A 1 146 ? 20.965  32.509 36.534 1.00 35.46 ? 146  ILE X CB  1 
ATOM   1154 C CG1 . ILE A 1 146 ? 19.993  31.620 35.755 1.00 33.26 ? 146  ILE X CG1 1 
ATOM   1155 C CG2 . ILE A 1 146 ? 20.634  32.479 38.024 1.00 32.87 ? 146  ILE X CG2 1 
ATOM   1156 C CD1 . ILE A 1 146 ? 20.091  30.147 36.090 1.00 35.38 ? 146  ILE X CD1 1 
ATOM   1157 N N   . LEU A 1 147 ? 21.009  35.813 37.559 1.00 28.58 ? 147  LEU X N   1 
ATOM   1158 C CA  . LEU A 1 147 ? 21.659  36.765 38.452 1.00 29.85 ? 147  LEU X CA  1 
ATOM   1159 C C   . LEU A 1 147 ? 21.797  36.198 39.862 1.00 31.93 ? 147  LEU X C   1 
ATOM   1160 O O   . LEU A 1 147 ? 22.739  36.533 40.585 1.00 28.77 ? 147  LEU X O   1 
ATOM   1161 C CB  . LEU A 1 147 ? 20.867  38.074 38.511 1.00 30.22 ? 147  LEU X CB  1 
ATOM   1162 C CG  . LEU A 1 147 ? 20.878  38.969 37.270 1.00 33.98 ? 147  LEU X CG  1 
ATOM   1163 C CD1 . LEU A 1 147 ? 19.766  40.011 37.363 1.00 32.72 ? 147  LEU X CD1 1 
ATOM   1164 C CD2 . LEU A 1 147 ? 22.242  39.642 37.102 1.00 33.91 ? 147  LEU X CD2 1 
ATOM   1165 N N   . ALA A 1 148 ? 20.852  35.342 40.246 1.00 30.06 ? 148  ALA X N   1 
ATOM   1166 C CA  . ALA A 1 148 ? 20.852  34.740 41.575 1.00 30.76 ? 148  ALA X CA  1 
ATOM   1167 C C   . ALA A 1 148 ? 19.830  33.618 41.683 1.00 31.09 ? 148  ALA X C   1 
ATOM   1168 O O   . ALA A 1 148 ? 18.915  33.519 40.869 1.00 31.37 ? 148  ALA X O   1 
ATOM   1169 C CB  . ALA A 1 148 ? 20.553  35.803 42.629 1.00 32.79 ? 148  ALA X CB  1 
ATOM   1170 N N   . TYR A 1 149 ? 19.997  32.778 42.700 1.00 28.93 ? 149  TYR X N   1 
ATOM   1171 C CA  . TYR A 1 149 ? 19.081  31.676 42.959 1.00 29.49 ? 149  TYR X CA  1 
ATOM   1172 C C   . TYR A 1 149 ? 18.436  31.938 44.318 1.00 29.05 ? 149  TYR X C   1 
ATOM   1173 O O   . TYR A 1 149 ? 19.078  31.772 45.355 1.00 30.14 ? 149  TYR X O   1 
ATOM   1174 C CB  . TYR A 1 149 ? 19.835  30.343 43.008 1.00 28.05 ? 149  TYR X CB  1 
ATOM   1175 C CG  . TYR A 1 149 ? 20.452  29.902 41.697 1.00 33.08 ? 149  TYR X CG  1 
ATOM   1176 C CD1 . TYR A 1 149 ? 19.739  29.113 40.797 1.00 34.92 ? 149  TYR X CD1 1 
ATOM   1177 C CD2 . TYR A 1 149 ? 21.752  30.269 41.361 1.00 31.44 ? 149  TYR X CD2 1 
ATOM   1178 C CE1 . TYR A 1 149 ? 20.305  28.705 39.594 1.00 29.07 ? 149  TYR X CE1 1 
ATOM   1179 C CE2 . TYR A 1 149 ? 22.324  29.867 40.165 1.00 36.36 ? 149  TYR X CE2 1 
ATOM   1180 C CZ  . TYR A 1 149 ? 21.597  29.087 39.287 1.00 38.88 ? 149  TYR X CZ  1 
ATOM   1181 O OH  . TYR A 1 149 ? 22.169  28.689 38.101 1.00 36.66 ? 149  TYR X OH  1 
ATOM   1182 N N   . SER A 1 150 ? 17.173  32.351 44.317 1.00 29.42 ? 150  SER X N   1 
ATOM   1183 C CA  . SER A 1 150 ? 16.477  32.631 45.571 1.00 29.24 ? 150  SER X CA  1 
ATOM   1184 C C   . SER A 1 150 ? 15.910  31.356 46.178 1.00 29.64 ? 150  SER X C   1 
ATOM   1185 O O   . SER A 1 150 ? 15.924  30.294 45.547 1.00 25.83 ? 150  SER X O   1 
ATOM   1186 C CB  . SER A 1 150 ? 15.345  33.634 45.348 1.00 32.18 ? 150  SER X CB  1 
ATOM   1187 O OG  . SER A 1 150 ? 14.116  32.964 45.110 1.00 33.54 ? 150  SER X OG  1 
ATOM   1188 N N   . ASN A 1 151 ? 15.411  31.468 47.406 1.00 27.94 ? 151  ASN X N   1 
ATOM   1189 C CA  . ASN A 1 151 ? 14.811  30.331 48.093 1.00 27.32 ? 151  ASN X CA  1 
ATOM   1190 C C   . ASN A 1 151 ? 13.284  30.416 48.124 1.00 30.59 ? 151  ASN X C   1 
ATOM   1191 O O   . ASN A 1 151 ? 12.633  29.727 48.908 1.00 29.54 ? 151  ASN X O   1 
ATOM   1192 C CB  . ASN A 1 151 ? 15.379  30.179 49.510 1.00 30.20 ? 151  ASN X CB  1 
ATOM   1193 C CG  . ASN A 1 151 ? 15.008  31.335 50.422 1.00 30.12 ? 151  ASN X CG  1 
ATOM   1194 O OD1 . ASN A 1 151 ? 14.414  32.323 49.992 1.00 29.80 ? 151  ASN X OD1 1 
ATOM   1195 N ND2 . ASN A 1 151 ? 15.360  31.212 51.696 1.00 29.35 ? 151  ASN X ND2 1 
ATOM   1196 N N   . SER A 1 152 ? 12.717  31.265 47.268 1.00 29.73 ? 152  SER X N   1 
ATOM   1197 C CA  . SER A 1 152 ? 11.267  31.425 47.220 1.00 30.70 ? 152  SER X CA  1 
ATOM   1198 C C   . SER A 1 152 ? 10.747  31.893 45.865 1.00 31.55 ? 152  SER X C   1 
ATOM   1199 O O   . SER A 1 152 ? 11.065  32.994 45.405 1.00 31.20 ? 152  SER X O   1 
ATOM   1200 C CB  . SER A 1 152 ? 10.793  32.370 48.325 1.00 32.85 ? 152  SER X CB  1 
ATOM   1201 O OG  . SER A 1 152 ? 9.433   32.725 48.142 1.00 35.31 ? 152  SER X OG  1 
ATOM   1202 N N   . LEU A 1 153 ? 9.942   31.045 45.233 1.00 31.46 ? 153  LEU X N   1 
ATOM   1203 C CA  . LEU A 1 153 ? 9.359   31.357 43.936 1.00 30.41 ? 153  LEU X CA  1 
ATOM   1204 C C   . LEU A 1 153 ? 8.373   32.517 44.051 1.00 30.77 ? 153  LEU X C   1 
ATOM   1205 O O   . LEU A 1 153 ? 8.281   33.353 43.151 1.00 28.01 ? 153  LEU X O   1 
ATOM   1206 C CB  . LEU A 1 153 ? 8.683   30.120 43.335 1.00 28.54 ? 153  LEU X CB  1 
ATOM   1207 C CG  . LEU A 1 153 ? 8.333   30.184 41.845 1.00 32.37 ? 153  LEU X CG  1 
ATOM   1208 C CD1 . LEU A 1 153 ? 9.577   30.415 40.996 1.00 27.59 ? 153  LEU X CD1 1 
ATOM   1209 C CD2 . LEU A 1 153 ? 7.616   28.913 41.413 1.00 34.21 ? 153  LEU X CD2 1 
ATOM   1210 N N   . MET A 1 154 ? 7.640   32.567 45.161 1.00 28.61 ? 154  MET X N   1 
ATOM   1211 C CA  . MET A 1 154 ? 6.680   33.644 45.381 1.00 29.90 ? 154  MET X CA  1 
ATOM   1212 C C   . MET A 1 154 ? 7.389   34.982 45.586 1.00 27.85 ? 154  MET X C   1 
ATOM   1213 O O   . MET A 1 154 ? 6.929   36.010 45.094 1.00 28.82 ? 154  MET X O   1 
ATOM   1214 C CB  . MET A 1 154 ? 5.758   33.343 46.565 1.00 32.69 ? 154  MET X CB  1 
ATOM   1215 C CG  . MET A 1 154 ? 4.662   34.390 46.770 1.00 28.91 ? 154  MET X CG  1 
ATOM   1216 S SD  . MET A 1 154 ? 3.578   34.561 45.337 1.00 31.82 ? 154  MET X SD  1 
ATOM   1217 C CE  . MET A 1 154 ? 2.416   33.198 45.637 1.00 27.20 ? 154  MET X CE  1 
ATOM   1218 N N   . ASP A 1 155 ? 8.507   34.965 46.312 1.00 26.05 ? 155  ASP X N   1 
ATOM   1219 C CA  . ASP A 1 155 ? 9.272   36.188 46.549 1.00 29.36 ? 155  ASP X CA  1 
ATOM   1220 C C   . ASP A 1 155 ? 9.735   36.750 45.212 1.00 30.15 ? 155  ASP X C   1 
ATOM   1221 O O   . ASP A 1 155 ? 9.722   37.966 45.001 1.00 27.46 ? 155  ASP X O   1 
ATOM   1222 C CB  . ASP A 1 155 ? 10.472  35.928 47.462 1.00 25.00 ? 155  ASP X CB  1 
ATOM   1223 C CG  . ASP A 1 155 ? 10.066  35.681 48.904 1.00 33.14 ? 155  ASP X CG  1 
ATOM   1224 O OD1 . ASP A 1 155 ? 10.955  35.408 49.737 1.00 34.39 ? 155  ASP X OD1 1 
ATOM   1225 O OD2 . ASP A 1 155 ? 8.881   35.737 49.296 1.00 37.17 ? 155  ASP X OD2 1 
ATOM   1226 N N   . ASN A 1 156 ? 10.143  35.854 44.315 1.00 30.32 ? 156  ASN X N   1 
ATOM   1227 C CA  . ASN A 1 156 ? 10.587  36.247 42.983 1.00 31.87 ? 156  ASN X CA  1 
ATOM   1228 C C   . ASN A 1 156 ? 9.474   36.948 42.222 1.00 30.77 ? 156  ASN X C   1 
ATOM   1229 O O   . ASN A 1 156 ? 9.714   37.947 41.542 1.00 31.78 ? 156  ASN X O   1 
ATOM   1230 C CB  . ASN A 1 156 ? 11.053  35.026 42.190 1.00 29.93 ? 156  ASN X CB  1 
ATOM   1231 C CG  . ASN A 1 156 ? 12.412  34.543 42.628 1.00 29.35 ? 156  ASN X CG  1 
ATOM   1232 O OD1 . ASN A 1 156 ? 12.905  34.940 43.681 1.00 27.94 ? 156  ASN X OD1 1 
ATOM   1233 N ND2 . ASN A 1 156 ? 13.026  33.682 41.825 1.00 31.28 ? 156  ASN X ND2 1 
ATOM   1234 N N   . PHE A 1 157 ? 8.257   36.421 42.341 1.00 27.52 ? 157  PHE X N   1 
ATOM   1235 C CA  . PHE A 1 157 ? 7.112   37.013 41.660 1.00 29.69 ? 157  PHE X CA  1 
ATOM   1236 C C   . PHE A 1 157 ? 6.783   38.395 42.215 1.00 28.14 ? 157  PHE X C   1 
ATOM   1237 O O   . PHE A 1 157 ? 6.513   39.326 41.454 1.00 31.49 ? 157  PHE X O   1 
ATOM   1238 C CB  . PHE A 1 157 ? 5.875   36.112 41.731 1.00 26.05 ? 157  PHE X CB  1 
ATOM   1239 C CG  . PHE A 1 157 ? 4.615   36.795 41.272 1.00 32.55 ? 157  PHE X CG  1 
ATOM   1240 C CD1 . PHE A 1 157 ? 4.466   37.179 39.946 1.00 29.60 ? 157  PHE X CD1 1 
ATOM   1241 C CD2 . PHE A 1 157 ? 3.586   37.060 42.163 1.00 29.11 ? 157  PHE X CD2 1 
ATOM   1242 C CE1 . PHE A 1 157 ? 3.308   37.815 39.515 1.00 31.33 ? 157  PHE X CE1 1 
ATOM   1243 C CE2 . PHE A 1 157 ? 2.424   37.695 41.739 1.00 33.91 ? 157  PHE X CE2 1 
ATOM   1244 C CZ  . PHE A 1 157 ? 2.286   38.073 40.415 1.00 29.07 ? 157  PHE X CZ  1 
ATOM   1245 N N   . ILE A 1 158 ? 6.802   38.530 43.538 1.00 26.08 ? 158  ILE X N   1 
ATOM   1246 C CA  . ILE A 1 158 ? 6.513   39.819 44.155 1.00 30.20 ? 158  ILE X CA  1 
ATOM   1247 C C   . ILE A 1 158 ? 7.545   40.838 43.662 1.00 30.44 ? 158  ILE X C   1 
ATOM   1248 O O   . ILE A 1 158 ? 7.229   42.008 43.446 1.00 31.01 ? 158  ILE X O   1 
ATOM   1249 C CB  . ILE A 1 158 ? 6.467   39.697 45.696 1.00 33.45 ? 158  ILE X CB  1 
ATOM   1250 C CG1 . ILE A 1 158 ? 5.232   38.881 46.107 1.00 30.14 ? 158  ILE X CG1 1 
ATOM   1251 C CG2 . ILE A 1 158 ? 6.408   41.079 46.351 1.00 32.35 ? 158  ILE X CG2 1 
ATOM   1252 C CD1 . ILE A 1 158 ? 5.376   38.171 47.438 1.00 35.47 ? 158  ILE X CD1 1 
ATOM   1253 N N   . MET A 1 159 ? 8.779   40.378 43.477 1.00 29.96 ? 159  MET X N   1 
ATOM   1254 C CA  . MET A 1 159 ? 9.848   41.226 42.965 1.00 27.53 ? 159  MET X CA  1 
ATOM   1255 C C   . MET A 1 159 ? 9.529   41.620 41.512 1.00 29.18 ? 159  MET X C   1 
ATOM   1256 O O   . MET A 1 159 ? 9.829   42.740 41.087 1.00 29.90 ? 159  MET X O   1 
ATOM   1257 C CB  . MET A 1 159 ? 11.195  40.502 43.065 1.00 26.66 ? 159  MET X CB  1 
ATOM   1258 C CG  . MET A 1 159 ? 12.388  41.303 42.570 1.00 24.97 ? 159  MET X CG  1 
ATOM   1259 S SD  . MET A 1 159 ? 13.920  40.356 42.643 1.00 30.16 ? 159  MET X SD  1 
ATOM   1260 C CE  . MET A 1 159 ? 15.058  41.477 41.844 1.00 31.54 ? 159  MET X CE  1 
ATOM   1261 N N   . ASP A 1 160 ? 8.919   40.700 40.763 1.00 29.94 ? 160  ASP X N   1 
ATOM   1262 C CA  . ASP A 1 160 ? 8.536   40.954 39.369 1.00 30.47 ? 160  ASP X CA  1 
ATOM   1263 C C   . ASP A 1 160 ? 7.550   42.114 39.300 1.00 28.77 ? 160  ASP X C   1 
ATOM   1264 O O   . ASP A 1 160 ? 7.697   43.020 38.482 1.00 29.06 ? 160  ASP X O   1 
ATOM   1265 C CB  . ASP A 1 160 ? 7.847   39.728 38.750 1.00 29.75 ? 160  ASP X CB  1 
ATOM   1266 C CG  . ASP A 1 160 ? 8.793   38.573 38.504 1.00 29.03 ? 160  ASP X CG  1 
ATOM   1267 O OD1 . ASP A 1 160 ? 10.023  38.790 38.450 1.00 33.36 ? 160  ASP X OD1 1 
ATOM   1268 O OD2 . ASP A 1 160 ? 8.382   37.401 38.350 1.00 38.56 ? 160  ASP X OD2 1 
ATOM   1269 N N   . VAL A 1 161 ? 6.541   42.069 40.166 1.00 29.65 ? 161  VAL X N   1 
ATOM   1270 C CA  . VAL A 1 161 ? 5.507   43.097 40.216 1.00 30.15 ? 161  VAL X CA  1 
ATOM   1271 C C   . VAL A 1 161 ? 6.081   44.443 40.643 1.00 29.08 ? 161  VAL X C   1 
ATOM   1272 O O   . VAL A 1 161 ? 5.758   45.477 40.059 1.00 31.44 ? 161  VAL X O   1 
ATOM   1273 C CB  . VAL A 1 161 ? 4.355   42.688 41.165 1.00 34.14 ? 161  VAL X CB  1 
ATOM   1274 C CG1 . VAL A 1 161 ? 3.319   43.803 41.284 1.00 29.72 ? 161  VAL X CG1 1 
ATOM   1275 C CG2 . VAL A 1 161 ? 3.701   41.405 40.679 1.00 33.04 ? 161  VAL X CG2 1 
ATOM   1276 N N   . GLN A 1 162 ? 6.935   44.422 41.663 1.00 25.36 ? 162  GLN X N   1 
ATOM   1277 C CA  . GLN A 1 162 ? 7.560   45.642 42.168 1.00 29.32 ? 162  GLN X CA  1 
ATOM   1278 C C   . GLN A 1 162 ? 8.495   46.242 41.112 1.00 28.98 ? 162  GLN X C   1 
ATOM   1279 O O   . GLN A 1 162 ? 8.603   47.462 40.983 1.00 29.97 ? 162  GLN X O   1 
ATOM   1280 C CB  . GLN A 1 162 ? 8.321   45.342 43.466 1.00 30.98 ? 162  GLN X CB  1 
ATOM   1281 C CG  . GLN A 1 162 ? 9.054   46.538 44.072 1.00 41.73 ? 162  GLN X CG  1 
ATOM   1282 C CD  . GLN A 1 162 ? 8.220   47.289 45.109 1.00 55.48 ? 162  GLN X CD  1 
ATOM   1283 O OE1 . GLN A 1 162 ? 8.647   48.326 45.622 1.00 57.24 ? 162  GLN X OE1 1 
ATOM   1284 N NE2 . GLN A 1 162 ? 7.036   46.769 45.417 1.00 55.29 ? 162  GLN X NE2 1 
ATOM   1285 N N   . GLY A 1 163 ? 9.163   45.372 40.358 1.00 29.84 ? 163  GLY X N   1 
ATOM   1286 C CA  . GLY A 1 163 ? 10.083  45.800 39.317 1.00 29.99 ? 163  GLY X CA  1 
ATOM   1287 C C   . GLY A 1 163 ? 11.510  45.916 39.812 1.00 30.26 ? 163  GLY X C   1 
ATOM   1288 O O   . GLY A 1 163 ? 12.436  46.144 39.032 1.00 28.26 ? 163  GLY X O   1 
ATOM   1289 N N   . SER A 1 164 ? 11.686  45.756 41.119 1.00 29.06 ? 164  SER X N   1 
ATOM   1290 C CA  . SER A 1 164 ? 13.004  45.849 41.731 1.00 30.30 ? 164  SER X CA  1 
ATOM   1291 C C   . SER A 1 164 ? 13.007  45.096 43.054 1.00 32.69 ? 164  SER X C   1 
ATOM   1292 O O   . SER A 1 164 ? 11.951  44.749 43.580 1.00 29.09 ? 164  SER X O   1 
ATOM   1293 C CB  . SER A 1 164 ? 13.374  47.317 41.966 1.00 31.76 ? 164  SER X CB  1 
ATOM   1294 O OG  . SER A 1 164 ? 12.341  48.003 42.653 1.00 29.83 ? 164  SER X OG  1 
ATOM   1295 N N   . GLY A 1 165 ? 14.194  44.842 43.593 1.00 28.25 ? 165  GLY X N   1 
ATOM   1296 C CA  . GLY A 1 165 ? 14.294  44.131 44.851 1.00 31.14 ? 165  GLY X CA  1 
ATOM   1297 C C   . GLY A 1 165 ? 15.699  44.076 45.409 1.00 31.98 ? 165  GLY X C   1 
ATOM   1298 O O   . GLY A 1 165 ? 16.680  44.206 44.673 1.00 29.54 ? 165  GLY X O   1 
ATOM   1299 N N   . TYR A 1 166 ? 15.784  43.883 46.723 1.00 28.26 ? 166  TYR X N   1 
ATOM   1300 C CA  . TYR A 1 166 ? 17.061  43.797 47.414 1.00 26.78 ? 166  TYR X CA  1 
ATOM   1301 C C   . TYR A 1 166 ? 17.416  42.333 47.668 1.00 30.30 ? 166  TYR X C   1 
ATOM   1302 O O   . TYR A 1 166 ? 16.575  41.542 48.105 1.00 29.68 ? 166  TYR X O   1 
ATOM   1303 C CB  . TYR A 1 166 ? 17.017  44.594 48.719 1.00 26.36 ? 166  TYR X CB  1 
ATOM   1304 C CG  . TYR A 1 166 ? 16.763  46.077 48.506 1.00 28.48 ? 166  TYR X CG  1 
ATOM   1305 C CD1 . TYR A 1 166 ? 15.468  46.570 48.369 1.00 37.57 ? 166  TYR X CD1 1 
ATOM   1306 C CD2 . TYR A 1 166 ? 17.818  46.982 48.442 1.00 33.25 ? 166  TYR X CD2 1 
ATOM   1307 C CE1 . TYR A 1 166 ? 15.230  47.929 48.172 1.00 33.65 ? 166  TYR X CE1 1 
ATOM   1308 C CE2 . TYR A 1 166 ? 17.591  48.345 48.246 1.00 29.26 ? 166  TYR X CE2 1 
ATOM   1309 C CZ  . TYR A 1 166 ? 16.295  48.810 48.113 1.00 40.56 ? 166  TYR X CZ  1 
ATOM   1310 O OH  . TYR A 1 166 ? 16.065  50.159 47.919 1.00 39.17 ? 166  TYR X OH  1 
ATOM   1311 N N   . ILE A 1 167 ? 18.665  41.977 47.388 1.00 26.29 ? 167  ILE X N   1 
ATOM   1312 C CA  . ILE A 1 167 ? 19.117  40.606 47.569 1.00 26.04 ? 167  ILE X CA  1 
ATOM   1313 C C   . ILE A 1 167 ? 20.300  40.491 48.520 1.00 28.14 ? 167  ILE X C   1 
ATOM   1314 O O   . ILE A 1 167 ? 21.264  41.254 48.432 1.00 27.91 ? 167  ILE X O   1 
ATOM   1315 C CB  . ILE A 1 167 ? 19.465  39.967 46.209 1.00 28.98 ? 167  ILE X CB  1 
ATOM   1316 C CG1 . ILE A 1 167 ? 18.191  39.730 45.389 1.00 29.11 ? 167  ILE X CG1 1 
ATOM   1317 C CG2 . ILE A 1 167 ? 20.239  38.661 46.411 1.00 25.98 ? 167  ILE X CG2 1 
ATOM   1318 C CD1 . ILE A 1 167 ? 18.433  39.051 44.054 1.00 37.01 ? 167  ILE X CD1 1 
ATOM   1319 N N   . ASP A 1 168 ? 20.205  39.526 49.427 1.00 24.87 ? 168  ASP X N   1 
ATOM   1320 C CA  . ASP A 1 168 ? 21.245  39.254 50.403 1.00 25.70 ? 168  ASP X CA  1 
ATOM   1321 C C   . ASP A 1 168 ? 21.867  37.905 50.035 1.00 26.19 ? 168  ASP X C   1 
ATOM   1322 O O   . ASP A 1 168 ? 21.201  36.878 50.114 1.00 24.04 ? 168  ASP X O   1 
ATOM   1323 C CB  . ASP A 1 168 ? 20.610  39.186 51.794 1.00 26.78 ? 168  ASP X CB  1 
ATOM   1324 C CG  . ASP A 1 168 ? 21.588  38.774 52.875 1.00 35.15 ? 168  ASP X CG  1 
ATOM   1325 O OD1 . ASP A 1 168 ? 21.122  38.515 54.004 1.00 31.89 ? 168  ASP X OD1 1 
ATOM   1326 O OD2 . ASP A 1 168 ? 22.822  38.681 52.699 1.00 27.08 ? 168  ASP X OD2 1 
ATOM   1327 N N   . PHE A 1 169 ? 23.138  37.914 49.632 1.00 25.70 ? 169  PHE X N   1 
ATOM   1328 C CA  . PHE A 1 169 ? 23.832  36.682 49.258 1.00 25.53 ? 169  PHE X CA  1 
ATOM   1329 C C   . PHE A 1 169 ? 24.395  35.919 50.460 1.00 24.62 ? 169  PHE X C   1 
ATOM   1330 O O   . PHE A 1 169 ? 25.005  34.863 50.298 1.00 22.82 ? 169  PHE X O   1 
ATOM   1331 C CB  . PHE A 1 169 ? 24.919  36.949 48.210 1.00 25.72 ? 169  PHE X CB  1 
ATOM   1332 C CG  . PHE A 1 169 ? 24.380  37.164 46.820 1.00 27.78 ? 169  PHE X CG  1 
ATOM   1333 C CD1 . PHE A 1 169 ? 23.887  36.100 46.078 1.00 30.84 ? 169  PHE X CD1 1 
ATOM   1334 C CD2 . PHE A 1 169 ? 24.363  38.434 46.256 1.00 31.17 ? 169  PHE X CD2 1 
ATOM   1335 C CE1 . PHE A 1 169 ? 23.388  36.296 44.797 1.00 33.44 ? 169  PHE X CE1 1 
ATOM   1336 C CE2 . PHE A 1 169 ? 23.865  38.639 44.975 1.00 31.62 ? 169  PHE X CE2 1 
ATOM   1337 C CZ  . PHE A 1 169 ? 23.377  37.570 44.244 1.00 26.58 ? 169  PHE X CZ  1 
ATOM   1338 N N   . GLY A 1 170 ? 24.186  36.464 51.658 1.00 26.87 ? 170  GLY X N   1 
ATOM   1339 C CA  . GLY A 1 170 ? 24.628  35.845 52.900 1.00 25.64 ? 170  GLY X CA  1 
ATOM   1340 C C   . GLY A 1 170 ? 26.119  35.691 53.139 1.00 27.47 ? 170  GLY X C   1 
ATOM   1341 O O   . GLY A 1 170 ? 26.534  34.820 53.908 1.00 23.71 ? 170  GLY X O   1 
ATOM   1342 N N   . ASP A 1 171 ? 26.928  36.528 52.497 1.00 26.76 ? 171  ASP X N   1 
ATOM   1343 C CA  . ASP A 1 171 ? 28.383  36.446 52.647 1.00 23.79 ? 171  ASP X CA  1 
ATOM   1344 C C   . ASP A 1 171 ? 28.971  37.671 53.345 1.00 25.16 ? 171  ASP X C   1 
ATOM   1345 O O   . ASP A 1 171 ? 30.190  37.865 53.361 1.00 24.57 ? 171  ASP X O   1 
ATOM   1346 C CB  . ASP A 1 171 ? 29.041  36.262 51.280 1.00 24.02 ? 171  ASP X CB  1 
ATOM   1347 C CG  . ASP A 1 171 ? 28.692  37.384 50.317 1.00 25.12 ? 171  ASP X CG  1 
ATOM   1348 O OD1 . ASP A 1 171 ? 29.172  37.361 49.166 1.00 31.83 ? 171  ASP X OD1 1 
ATOM   1349 O OD2 . ASP A 1 171 ? 27.941  38.330 50.631 1.00 25.36 ? 171  ASP X OD2 1 
ATOM   1350 N N   . GLY A 1 172 ? 28.101  38.495 53.916 1.00 24.88 ? 172  GLY X N   1 
ATOM   1351 C CA  . GLY A 1 172 ? 28.526  39.690 54.625 1.00 28.25 ? 172  GLY X CA  1 
ATOM   1352 C C   . GLY A 1 172 ? 28.809  40.891 53.740 1.00 27.12 ? 172  GLY X C   1 
ATOM   1353 O O   . GLY A 1 172 ? 29.191  41.952 54.231 1.00 28.00 ? 172  GLY X O   1 
ATOM   1354 N N   . SER A 1 173 ? 28.624  40.728 52.434 1.00 28.80 ? 173  SER X N   1 
ATOM   1355 C CA  . SER A 1 173 ? 28.860  41.817 51.495 1.00 29.81 ? 173  SER X CA  1 
ATOM   1356 C C   . SER A 1 173 ? 27.683  42.790 51.559 1.00 33.17 ? 173  SER X C   1 
ATOM   1357 O O   . SER A 1 173 ? 26.664  42.492 52.185 1.00 30.33 ? 173  SER X O   1 
ATOM   1358 C CB  . SER A 1 173 ? 29.046  41.267 50.077 1.00 29.42 ? 173  SER X CB  1 
ATOM   1359 O OG  . SER A 1 173 ? 27.850  40.684 49.593 1.00 31.25 ? 173  SER X OG  1 
ATOM   1360 N N   . PRO A 1 174 ? 27.812  43.954 50.925 1.00 36.42 ? 174  PRO X N   1 
ATOM   1361 C CA  . PRO A 1 174 ? 26.723  44.937 50.929 1.00 35.86 ? 174  PRO X CA  1 
ATOM   1362 C C   . PRO A 1 174 ? 25.454  44.368 50.303 1.00 29.72 ? 174  PRO X C   1 
ATOM   1363 O O   . PRO A 1 174 ? 25.533  43.499 49.434 1.00 32.07 ? 174  PRO X O   1 
ATOM   1364 C CB  . PRO A 1 174 ? 27.272  46.070 50.056 1.00 37.69 ? 174  PRO X CB  1 
ATOM   1365 C CG  . PRO A 1 174 ? 28.755  45.910 50.114 1.00 40.99 ? 174  PRO X CG  1 
ATOM   1366 C CD  . PRO A 1 174 ? 28.986  44.428 50.169 1.00 39.07 ? 174  PRO X CD  1 
ATOM   1367 N N   . LEU A 1 175 ? 24.302  44.855 50.749 1.00 33.49 ? 175  LEU X N   1 
ATOM   1368 C CA  . LEU A 1 175 ? 23.016  44.426 50.217 1.00 34.24 ? 175  LEU X CA  1 
ATOM   1369 C C   . LEU A 1 175 ? 23.009  44.721 48.718 1.00 33.56 ? 175  LEU X C   1 
ATOM   1370 O O   . LEU A 1 175 ? 23.440  45.791 48.293 1.00 35.29 ? 175  LEU X O   1 
ATOM   1371 C CB  . LEU A 1 175 ? 21.898  45.238 50.878 1.00 37.01 ? 175  LEU X CB  1 
ATOM   1372 C CG  . LEU A 1 175 ? 20.651  44.583 51.477 1.00 43.24 ? 175  LEU X CG  1 
ATOM   1373 C CD1 . LEU A 1 175 ? 19.462  45.532 51.409 1.00 33.95 ? 175  LEU X CD1 1 
ATOM   1374 C CD2 . LEU A 1 175 ? 20.316  43.243 50.863 1.00 33.79 ? 175  LEU X CD2 1 
ATOM   1375 N N   . ASN A 1 176 ? 22.526  43.777 47.919 1.00 32.54 ? 176  ASN X N   1 
ATOM   1376 C CA  . ASN A 1 176 ? 22.468  43.978 46.476 1.00 33.53 ? 176  ASN X CA  1 
ATOM   1377 C C   . ASN A 1 176 ? 21.111  44.520 46.069 1.00 33.32 ? 176  ASN X C   1 
ATOM   1378 O O   . ASN A 1 176 ? 20.088  44.129 46.626 1.00 38.07 ? 176  ASN X O   1 
ATOM   1379 C CB  . ASN A 1 176 ? 22.720  42.665 45.733 1.00 32.65 ? 176  ASN X CB  1 
ATOM   1380 C CG  . ASN A 1 176 ? 24.185  42.293 45.688 1.00 38.16 ? 176  ASN X CG  1 
ATOM   1381 O OD1 . ASN A 1 176 ? 24.856  42.480 44.674 1.00 47.21 ? 176  ASN X OD1 1 
ATOM   1382 N ND2 . ASN A 1 176 ? 24.690  41.761 46.789 1.00 28.81 ? 176  ASN X ND2 1 
ATOM   1383 N N   . PHE A 1 177 ? 21.105  45.423 45.100 1.00 32.01 ? 177  PHE X N   1 
ATOM   1384 C CA  . PHE A 1 177 ? 19.861  45.990 44.606 1.00 30.72 ? 177  PHE X CA  1 
ATOM   1385 C C   . PHE A 1 177 ? 19.784  45.717 43.110 1.00 31.11 ? 177  PHE X C   1 
ATOM   1386 O O   . PHE A 1 177 ? 20.768  45.888 42.387 1.00 31.30 ? 177  PHE X O   1 
ATOM   1387 C CB  . PHE A 1 177 ? 19.790  47.493 44.897 1.00 28.93 ? 177  PHE X CB  1 
ATOM   1388 C CG  . PHE A 1 177 ? 18.469  48.124 44.543 1.00 35.42 ? 177  PHE X CG  1 
ATOM   1389 C CD1 . PHE A 1 177 ? 18.424  49.297 43.802 1.00 42.70 ? 177  PHE X CD1 1 
ATOM   1390 C CD2 . PHE A 1 177 ? 17.272  47.549 44.950 1.00 33.21 ? 177  PHE X CD2 1 
ATOM   1391 C CE1 . PHE A 1 177 ? 17.208  49.886 43.472 1.00 52.19 ? 177  PHE X CE1 1 
ATOM   1392 C CE2 . PHE A 1 177 ? 16.054  48.131 44.626 1.00 32.04 ? 177  PHE X CE2 1 
ATOM   1393 C CZ  . PHE A 1 177 ? 16.021  49.301 43.885 1.00 41.53 ? 177  PHE X CZ  1 
ATOM   1394 N N   . PHE A 1 178 ? 18.614  45.284 42.655 1.00 26.94 ? 178  PHE X N   1 
ATOM   1395 C CA  . PHE A 1 178 ? 18.392  44.993 41.244 1.00 27.33 ? 178  PHE X CA  1 
ATOM   1396 C C   . PHE A 1 178 ? 17.152  45.756 40.792 1.00 31.75 ? 178  PHE X C   1 
ATOM   1397 O O   . PHE A 1 178 ? 16.150  45.781 41.501 1.00 31.49 ? 178  PHE X O   1 
ATOM   1398 C CB  . PHE A 1 178 ? 18.212  43.488 41.029 1.00 28.59 ? 178  PHE X CB  1 
ATOM   1399 C CG  . PHE A 1 178 ? 19.455  42.687 41.303 1.00 31.29 ? 178  PHE X CG  1 
ATOM   1400 C CD1 . PHE A 1 178 ? 19.707  42.179 42.568 1.00 31.09 ? 178  PHE X CD1 1 
ATOM   1401 C CD2 . PHE A 1 178 ? 20.374  42.445 40.295 1.00 29.52 ? 178  PHE X CD2 1 
ATOM   1402 C CE1 . PHE A 1 178 ? 20.856  41.441 42.822 1.00 32.35 ? 178  PHE X CE1 1 
ATOM   1403 C CE2 . PHE A 1 178 ? 21.524  41.708 40.542 1.00 39.29 ? 178  PHE X CE2 1 
ATOM   1404 C CZ  . PHE A 1 178 ? 21.763  41.206 41.808 1.00 35.75 ? 178  PHE X CZ  1 
ATOM   1405 N N   . SER A 1 179 ? 17.223  46.376 39.618 1.00 30.13 ? 179  SER X N   1 
ATOM   1406 C CA  . SER A 1 179 ? 16.101  47.155 39.101 1.00 29.91 ? 179  SER X CA  1 
ATOM   1407 C C   . SER A 1 179 ? 15.594  46.634 37.763 1.00 30.15 ? 179  SER X C   1 
ATOM   1408 O O   . SER A 1 179 ? 16.202  45.751 37.154 1.00 28.04 ? 179  SER X O   1 
ATOM   1409 C CB  . SER A 1 179 ? 16.490  48.629 38.979 1.00 28.33 ? 179  SER X CB  1 
ATOM   1410 O OG  . SER A 1 179 ? 17.490  48.794 37.992 1.00 33.03 ? 179  SER X OG  1 
ATOM   1411 N N   . TYR A 1 180 ? 14.476  47.195 37.315 1.00 28.37 ? 180  TYR X N   1 
ATOM   1412 C CA  . TYR A 1 180 ? 13.839  46.799 36.063 1.00 29.27 ? 180  TYR X CA  1 
ATOM   1413 C C   . TYR A 1 180 ? 14.713  46.973 34.826 1.00 28.97 ? 180  TYR X C   1 
ATOM   1414 O O   . TYR A 1 180 ? 15.208  48.066 34.548 1.00 28.11 ? 180  TYR X O   1 
ATOM   1415 C CB  . TYR A 1 180 ? 12.514  47.545 35.882 1.00 27.39 ? 180  TYR X CB  1 
ATOM   1416 C CG  . TYR A 1 180 ? 11.797  47.215 34.589 1.00 30.68 ? 180  TYR X CG  1 
ATOM   1417 C CD1 . TYR A 1 180 ? 11.087  46.026 34.448 1.00 27.00 ? 180  TYR X CD1 1 
ATOM   1418 C CD2 . TYR A 1 180 ? 11.830  48.094 33.508 1.00 32.59 ? 180  TYR X CD2 1 
ATOM   1419 C CE1 . TYR A 1 180 ? 10.428  45.720 33.265 1.00 28.24 ? 180  TYR X CE1 1 
ATOM   1420 C CE2 . TYR A 1 180 ? 11.175  47.797 32.320 1.00 27.99 ? 180  TYR X CE2 1 
ATOM   1421 C CZ  . TYR A 1 180 ? 10.476  46.609 32.208 1.00 24.36 ? 180  TYR X CZ  1 
ATOM   1422 O OH  . TYR A 1 180 ? 9.828   46.315 31.035 1.00 29.38 ? 180  TYR X OH  1 
ATOM   1423 N N   . ALA A 1 181 ? 14.898  45.883 34.088 1.00 28.63 ? 181  ALA X N   1 
ATOM   1424 C CA  . ALA A 1 181 ? 15.699  45.908 32.872 1.00 30.59 ? 181  ALA X CA  1 
ATOM   1425 C C   . ALA A 1 181 ? 14.831  45.697 31.636 1.00 30.30 ? 181  ALA X C   1 
ATOM   1426 O O   . ALA A 1 181 ? 15.089  46.277 30.581 1.00 31.38 ? 181  ALA X O   1 
ATOM   1427 C CB  . ALA A 1 181 ? 16.796  44.854 32.934 1.00 26.50 ? 181  ALA X CB  1 
ATOM   1428 N N   . GLY A 1 182 ? 13.803  44.865 31.772 1.00 31.88 ? 182  GLY X N   1 
ATOM   1429 C CA  . GLY A 1 182 ? 12.915  44.568 30.662 1.00 30.63 ? 182  GLY X CA  1 
ATOM   1430 C C   . GLY A 1 182 ? 11.887  43.509 31.008 1.00 31.89 ? 182  GLY X C   1 
ATOM   1431 O O   . GLY A 1 182 ? 11.863  42.995 32.129 1.00 28.53 ? 182  GLY X O   1 
ATOM   1432 N N   . LYS A 1 183 ? 11.041  43.184 30.037 1.00 31.61 ? 183  LYS X N   1 
ATOM   1433 C CA  . LYS A 1 183 ? 9.972   42.210 30.219 1.00 29.39 ? 183  LYS X CA  1 
ATOM   1434 C C   . LYS A 1 183 ? 9.935   41.245 29.041 1.00 32.55 ? 183  LYS X C   1 
ATOM   1435 O O   . LYS A 1 183 ? 10.456  41.553 27.965 1.00 31.56 ? 183  LYS X O   1 
ATOM   1436 C CB  . LYS A 1 183 ? 8.636   42.965 30.266 1.00 31.86 ? 183  LYS X CB  1 
ATOM   1437 C CG  . LYS A 1 183 ? 7.521   42.284 31.044 1.00 35.20 ? 183  LYS X CG  1 
ATOM   1438 C CD  . LYS A 1 183 ? 6.251   43.134 31.023 1.00 35.51 ? 183  LYS X CD  1 
ATOM   1439 C CE  . LYS A 1 183 ? 5.159   42.497 30.173 1.00 32.26 ? 183  LYS X CE  1 
ATOM   1440 N NZ  . LYS A 1 183 ? 5.483   41.097 29.777 1.00 31.89 ? 183  LYS X NZ  1 
ATOM   1441 N N   . ASN A 1 184 ? 9.319   40.081 29.243 1.00 29.59 ? 184  ASN X N   1 
ATOM   1442 C CA  . ASN A 1 184 ? 9.188   39.102 28.167 1.00 30.15 ? 184  ASN X CA  1 
ATOM   1443 C C   . ASN A 1 184 ? 8.069   39.512 27.203 1.00 28.10 ? 184  ASN X C   1 
ATOM   1444 O O   . ASN A 1 184 ? 7.373   40.504 27.441 1.00 30.06 ? 184  ASN X O   1 
ATOM   1445 C CB  . ASN A 1 184 ? 9.012   37.676 28.712 1.00 28.02 ? 184  ASN X CB  1 
ATOM   1446 C CG  . ASN A 1 184 ? 7.599   37.392 29.200 1.00 29.96 ? 184  ASN X CG  1 
ATOM   1447 O OD1 . ASN A 1 184 ? 6.816   38.305 29.450 1.00 27.47 ? 184  ASN X OD1 1 
ATOM   1448 N ND2 . ASN A 1 184 ? 7.272   36.109 29.341 1.00 26.24 ? 184  ASN X ND2 1 
ATOM   1449 N N   . GLY A 1 185 ? 7.894   38.756 26.123 1.00 28.67 ? 185  GLY X N   1 
ATOM   1450 C CA  . GLY A 1 185 ? 6.892   39.074 25.121 1.00 28.83 ? 185  GLY X CA  1 
ATOM   1451 C C   . GLY A 1 185 ? 5.450   38.689 25.392 1.00 28.59 ? 185  GLY X C   1 
ATOM   1452 O O   . GLY A 1 185 ? 4.630   38.712 24.476 1.00 27.00 ? 185  GLY X O   1 
ATOM   1453 N N   . HIS A 1 186 ? 5.132   38.341 26.635 1.00 28.28 ? 186  HIS X N   1 
ATOM   1454 C CA  . HIS A 1 186 ? 3.768   37.944 26.987 1.00 29.26 ? 186  HIS X CA  1 
ATOM   1455 C C   . HIS A 1 186 ? 3.085   38.964 27.892 1.00 29.87 ? 186  HIS X C   1 
ATOM   1456 O O   . HIS A 1 186 ? 3.677   39.434 28.860 1.00 30.40 ? 186  HIS X O   1 
ATOM   1457 C CB  . HIS A 1 186 ? 3.779   36.572 27.671 1.00 30.08 ? 186  HIS X CB  1 
ATOM   1458 C CG  . HIS A 1 186 ? 4.170   35.447 26.763 1.00 33.33 ? 186  HIS X CG  1 
ATOM   1459 N ND1 . HIS A 1 186 ? 3.249   34.596 26.191 1.00 38.01 ? 186  HIS X ND1 1 
ATOM   1460 C CD2 . HIS A 1 186 ? 5.384   35.035 26.327 1.00 32.14 ? 186  HIS X CD2 1 
ATOM   1461 C CE1 . HIS A 1 186 ? 3.877   33.707 25.442 1.00 33.84 ? 186  HIS X CE1 1 
ATOM   1462 N NE2 . HIS A 1 186 ? 5.174   33.951 25.508 1.00 32.39 ? 186  HIS X NE2 1 
ATOM   1463 N N   . ALA A 1 187 ? 1.839   39.307 27.577 1.00 28.57 ? 187  ALA X N   1 
ATOM   1464 C CA  . ALA A 1 187 ? 1.097   40.264 28.394 1.00 30.50 ? 187  ALA X CA  1 
ATOM   1465 C C   . ALA A 1 187 ? 0.846   39.646 29.768 1.00 29.94 ? 187  ALA X C   1 
ATOM   1466 O O   . ALA A 1 187 ? 0.612   38.440 29.876 1.00 28.08 ? 187  ALA X O   1 
ATOM   1467 C CB  . ALA A 1 187 ? -0.219  40.622 27.725 1.00 29.14 ? 187  ALA X CB  1 
ATOM   1468 N N   . TYR A 1 188 ? 0.898   40.456 30.820 1.00 26.02 ? 188  TYR X N   1 
ATOM   1469 C CA  . TYR A 1 188 ? 0.657   39.916 32.150 1.00 27.83 ? 188  TYR X CA  1 
ATOM   1470 C C   . TYR A 1 188 ? -0.810  39.684 32.466 1.00 29.87 ? 188  TYR X C   1 
ATOM   1471 O O   . TYR A 1 188 ? -1.694  40.286 31.856 1.00 25.81 ? 188  TYR X O   1 
ATOM   1472 C CB  . TYR A 1 188 ? 1.383   40.690 33.271 1.00 28.64 ? 188  TYR X CB  1 
ATOM   1473 C CG  . TYR A 1 188 ? 1.137   42.187 33.354 1.00 27.09 ? 188  TYR X CG  1 
ATOM   1474 C CD1 . TYR A 1 188 ? 2.205   43.081 33.370 1.00 30.42 ? 188  TYR X CD1 1 
ATOM   1475 C CD2 . TYR A 1 188 ? -0.152  42.707 33.427 1.00 25.63 ? 188  TYR X CD2 1 
ATOM   1476 C CE1 . TYR A 1 188 ? 1.995   44.454 33.450 1.00 25.35 ? 188  TYR X CE1 1 
ATOM   1477 C CE2 . TYR A 1 188 ? -0.373  44.077 33.507 1.00 29.31 ? 188  TYR X CE2 1 
ATOM   1478 C CZ  . TYR A 1 188 ? 0.703   44.945 33.517 1.00 29.53 ? 188  TYR X CZ  1 
ATOM   1479 O OH  . TYR A 1 188 ? 0.487   46.306 33.598 1.00 28.28 ? 188  TYR X OH  1 
ATOM   1480 N N   . ARG A 1 189 ? -1.051  38.793 33.420 1.00 30.79 ? 189  ARG X N   1 
ATOM   1481 C CA  . ARG A 1 189 ? -2.393  38.472 33.882 1.00 30.43 ? 189  ARG X CA  1 
ATOM   1482 C C   . ARG A 1 189 ? -2.324  38.652 35.393 1.00 29.56 ? 189  ARG X C   1 
ATOM   1483 O O   . ARG A 1 189 ? -1.277  38.415 36.000 1.00 27.62 ? 189  ARG X O   1 
ATOM   1484 C CB  . ARG A 1 189 ? -2.766  37.027 33.529 1.00 31.77 ? 189  ARG X CB  1 
ATOM   1485 C CG  . ARG A 1 189 ? -2.934  36.770 32.036 1.00 37.25 ? 189  ARG X CG  1 
ATOM   1486 C CD  . ARG A 1 189 ? -3.769  35.539 31.706 1.00 60.39 ? 189  ARG X CD  1 
ATOM   1487 N NE  . ARG A 1 189 ? -4.277  35.567 30.335 1.00 78.11 ? 189  ARG X NE  1 
ATOM   1488 C CZ  . ARG A 1 189 ? -5.437  36.107 29.974 1.00 84.53 ? 189  ARG X CZ  1 
ATOM   1489 N NH1 . ARG A 1 189 ? -6.224  36.673 30.881 1.00 84.66 ? 189  ARG X NH1 1 
ATOM   1490 N NH2 . ARG A 1 189 ? -5.813  36.084 28.702 1.00 87.38 ? 189  ARG X NH2 1 
ATOM   1491 N N   . SER A 1 190 ? -3.428  39.071 35.996 1.00 30.29 ? 190  SER X N   1 
ATOM   1492 C CA  . SER A 1 190 ? -3.467  39.301 37.436 1.00 33.05 ? 190  SER X CA  1 
ATOM   1493 C C   . SER A 1 190 ? -3.562  38.008 38.237 1.00 32.52 ? 190  SER X C   1 
ATOM   1494 O O   . SER A 1 190 ? -4.489  37.224 38.051 1.00 30.98 ? 190  SER X O   1 
ATOM   1495 C CB  . SER A 1 190 ? -4.639  40.216 37.797 1.00 32.24 ? 190  SER X CB  1 
ATOM   1496 O OG  . SER A 1 190 ? -4.745  40.369 39.204 1.00 33.70 ? 190  SER X OG  1 
ATOM   1497 N N   . ILE A 1 191 ? -2.597  37.792 39.126 1.00 31.70 ? 191  ILE X N   1 
ATOM   1498 C CA  . ILE A 1 191 ? -2.587  36.604 39.972 1.00 32.23 ? 191  ILE X CA  1 
ATOM   1499 C C   . ILE A 1 191 ? -3.627  36.796 41.070 1.00 33.52 ? 191  ILE X C   1 
ATOM   1500 O O   . ILE A 1 191 ? -4.280  35.843 41.498 1.00 34.70 ? 191  ILE X O   1 
ATOM   1501 C CB  . ILE A 1 191 ? -1.183  36.379 40.574 1.00 32.38 ? 191  ILE X CB  1 
ATOM   1502 C CG1 . ILE A 1 191 ? -0.222  35.859 39.501 1.00 30.91 ? 191  ILE X CG1 1 
ATOM   1503 C CG2 . ILE A 1 191 ? -1.245  35.418 41.764 1.00 25.82 ? 191  ILE X CG2 1 
ATOM   1504 C CD1 . ILE A 1 191 ? -0.719  34.622 38.756 1.00 27.10 ? 191  ILE X CD1 1 
ATOM   1505 N N   . GLY A 1 192 ? -3.773  38.041 41.515 1.00 34.83 ? 192  GLY X N   1 
ATOM   1506 C CA  . GLY A 1 192 ? -4.742  38.390 42.537 1.00 37.21 ? 192  GLY X CA  1 
ATOM   1507 C C   . GLY A 1 192 ? -6.150  38.068 42.072 1.00 40.83 ? 192  GLY X C   1 
ATOM   1508 O O   . GLY A 1 192 ? -6.970  37.577 42.851 1.00 39.98 ? 192  GLY X O   1 
ATOM   1509 N N   . LYS A 1 193 ? -6.426  38.343 40.799 1.00 40.38 ? 193  LYS X N   1 
ATOM   1510 C CA  . LYS A 1 193 ? -7.734  38.073 40.209 1.00 42.01 ? 193  LYS X CA  1 
ATOM   1511 C C   . LYS A 1 193 ? -8.006  36.573 40.182 1.00 42.45 ? 193  LYS X C   1 
ATOM   1512 O O   . LYS A 1 193 ? -9.134  36.135 40.410 1.00 42.40 ? 193  LYS X O   1 
ATOM   1513 C CB  . LYS A 1 193 ? -7.823  38.648 38.793 1.00 39.68 ? 193  LYS X CB  1 
ATOM   1514 C CG  . LYS A 1 193 ? -9.223  38.607 38.190 1.00 49.50 ? 193  LYS X CG  1 
ATOM   1515 C CD  . LYS A 1 193 ? -9.218  39.040 36.728 1.00 54.07 ? 193  LYS X CD  1 
ATOM   1516 C CE  . LYS A 1 193 ? -10.124 38.158 35.877 1.00 56.64 ? 193  LYS X CE  1 
ATOM   1517 N NZ  . LYS A 1 193 ? -11.493 38.021 36.452 1.00 47.22 ? 193  LYS X NZ  1 
ATOM   1518 N N   . VAL A 1 194 ? -6.967  35.789 39.900 1.00 42.00 ? 194  VAL X N   1 
ATOM   1519 C CA  . VAL A 1 194 ? -7.097  34.336 39.862 1.00 38.88 ? 194  VAL X CA  1 
ATOM   1520 C C   . VAL A 1 194 ? -7.463  33.823 41.255 1.00 40.11 ? 194  VAL X C   1 
ATOM   1521 O O   . VAL A 1 194 ? -8.345  32.974 41.401 1.00 41.49 ? 194  VAL X O   1 
ATOM   1522 C CB  . VAL A 1 194 ? -5.804  33.655 39.354 1.00 41.09 ? 194  VAL X CB  1 
ATOM   1523 C CG1 . VAL A 1 194 ? -5.882  32.141 39.528 1.00 33.50 ? 194  VAL X CG1 1 
ATOM   1524 C CG2 . VAL A 1 194 ? -5.558  34.004 37.890 1.00 37.82 ? 194  VAL X CG2 1 
ATOM   1525 N N   . LEU A 1 195 ? -6.786  34.348 42.274 1.00 38.03 ? 195  LEU X N   1 
ATOM   1526 C CA  . LEU A 1 195 ? -7.040  33.954 43.657 1.00 41.33 ? 195  LEU X CA  1 
ATOM   1527 C C   . LEU A 1 195 ? -8.444  34.354 44.107 1.00 46.07 ? 195  LEU X C   1 
ATOM   1528 O O   . LEU A 1 195 ? -9.085  33.637 44.878 1.00 47.91 ? 195  LEU X O   1 
ATOM   1529 C CB  . LEU A 1 195 ? -5.994  34.556 44.595 1.00 40.31 ? 195  LEU X CB  1 
ATOM   1530 C CG  . LEU A 1 195 ? -4.601  33.924 44.554 1.00 40.35 ? 195  LEU X CG  1 
ATOM   1531 C CD1 . LEU A 1 195 ? -3.620  34.735 45.382 1.00 41.28 ? 195  LEU X CD1 1 
ATOM   1532 C CD2 . LEU A 1 195 ? -4.644  32.477 45.030 1.00 37.93 ? 195  LEU X CD2 1 
ATOM   1533 N N   . ILE A 1 196 ? -8.913  35.501 43.623 1.00 46.61 ? 196  ILE X N   1 
ATOM   1534 C CA  . ILE A 1 196 ? -10.244 35.994 43.963 1.00 49.22 ? 196  ILE X CA  1 
ATOM   1535 C C   . ILE A 1 196 ? -11.315 35.120 43.310 1.00 51.19 ? 196  ILE X C   1 
ATOM   1536 O O   . ILE A 1 196 ? -12.319 34.779 43.939 1.00 53.17 ? 196  ILE X O   1 
ATOM   1537 C CB  . ILE A 1 196 ? -10.404 37.469 43.528 1.00 48.09 ? 196  ILE X CB  1 
ATOM   1538 C CG1 . ILE A 1 196 ? -9.704  38.399 44.522 1.00 40.66 ? 196  ILE X CG1 1 
ATOM   1539 C CG2 . ILE A 1 196 ? -11.878 37.842 43.401 1.00 49.56 ? 196  ILE X CG2 1 
ATOM   1540 C CD1 . ILE A 1 196 ? -9.356  39.761 43.948 1.00 38.75 ? 196  ILE X CD1 1 
ATOM   1541 N N   . ASP A 1 197 ? -11.086 34.760 42.048 1.00 53.91 ? 197  ASP X N   1 
ATOM   1542 C CA  . ASP A 1 197 ? -12.017 33.929 41.288 1.00 55.69 ? 197  ASP X CA  1 
ATOM   1543 C C   . ASP A 1 197 ? -12.106 32.501 41.826 1.00 57.51 ? 197  ASP X C   1 
ATOM   1544 O O   . ASP A 1 197 ? -13.140 31.845 41.694 1.00 58.21 ? 197  ASP X O   1 
ATOM   1545 C CB  . ASP A 1 197 ? -11.625 33.901 39.806 1.00 56.32 ? 197  ASP X CB  1 
ATOM   1546 C CG  . ASP A 1 197 ? -11.854 35.234 39.113 1.00 54.34 ? 197  ASP X CG  1 
ATOM   1547 O OD1 . ASP A 1 197 ? -12.445 36.140 39.736 1.00 52.25 ? 197  ASP X OD1 1 
ATOM   1548 O OD2 . ASP A 1 197 ? -11.477 35.465 37.944 1.00 49.48 ? 197  ASP X OD2 1 
ATOM   1549 N N   . ARG A 1 198 ? -11.019 32.028 42.429 1.00 57.36 ? 198  ARG X N   1 
ATOM   1550 C CA  . ARG A 1 198 ? -10.969 30.678 42.987 1.00 57.29 ? 198  ARG X CA  1 
ATOM   1551 C C   . ARG A 1 198 ? -11.570 30.623 44.388 1.00 57.83 ? 198  ARG X C   1 
ATOM   1552 O O   . ARG A 1 198 ? -11.734 29.544 44.959 1.00 57.97 ? 198  ARG X O   1 
ATOM   1553 C CB  . ARG A 1 198 ? -9.526  30.170 43.028 1.00 56.65 ? 198  ARG X CB  1 
ATOM   1554 C CG  . ARG A 1 198 ? -9.010  29.634 41.706 1.00 54.75 ? 198  ARG X CG  1 
ATOM   1555 C CD  . ARG A 1 198 ? -7.522  29.320 41.714 1.00 51.57 ? 198  ARG X CD  1 
ATOM   1556 N NE  . ARG A 1 198 ? -7.034  28.964 40.385 1.00 56.98 ? 198  ARG X NE  1 
ATOM   1557 C CZ  . ARG A 1 198 ? -5.853  28.408 40.146 1.00 55.63 ? 198  ARG X CZ  1 
ATOM   1558 N NH1 . ARG A 1 198 ? -5.027  28.139 41.149 1.00 52.52 ? 198  ARG X NH1 1 
ATOM   1559 N NH2 . ARG A 1 198 ? -5.496  28.119 38.901 1.00 54.23 ? 198  ARG X NH2 1 
ATOM   1560 N N   . GLY A 1 199 ? -11.894 31.790 44.938 1.00 58.18 ? 199  GLY X N   1 
ATOM   1561 C CA  . GLY A 1 199 ? -12.473 31.882 46.266 1.00 59.63 ? 199  GLY X CA  1 
ATOM   1562 C C   . GLY A 1 199 ? -11.456 31.661 47.370 1.00 61.17 ? 199  GLY X C   1 
ATOM   1563 O O   . GLY A 1 199 ? -11.823 31.404 48.517 1.00 62.47 ? 199  GLY X O   1 
ATOM   1564 N N   . GLU A 1 200 ? -10.176 31.764 47.024 1.00 61.09 ? 200  GLU X N   1 
ATOM   1565 C CA  . GLU A 1 200 ? -9.095  31.567 47.985 1.00 59.92 ? 200  GLU X CA  1 
ATOM   1566 C C   . GLU A 1 200 ? -8.867  32.797 48.857 1.00 59.86 ? 200  GLU X C   1 
ATOM   1567 O O   . GLU A 1 200 ? -8.621  32.676 50.058 1.00 61.05 ? 200  GLU X O   1 
ATOM   1568 C CB  . GLU A 1 200 ? -7.800  31.172 47.270 1.00 59.48 ? 200  GLU X CB  1 
ATOM   1569 C CG  . GLU A 1 200 ? -7.913  29.905 46.435 1.00 62.78 ? 200  GLU X CG  1 
ATOM   1570 C CD  . GLU A 1 200 ? -7.268  28.699 47.095 1.00 68.06 ? 200  GLU X CD  1 
ATOM   1571 O OE1 . GLU A 1 200 ? -7.131  28.693 48.337 1.00 68.17 ? 200  GLU X OE1 1 
ATOM   1572 O OE2 . GLU A 1 200 ? -6.897  27.753 46.367 1.00 67.59 ? 200  GLU X OE2 1 
ATOM   1573 N N   . VAL A 1 201 ? -8.946  33.977 48.248 1.00 58.98 ? 201  VAL X N   1 
ATOM   1574 C CA  . VAL A 1 201 ? -8.751  35.234 48.969 1.00 57.72 ? 201  VAL X CA  1 
ATOM   1575 C C   . VAL A 1 201 ? -9.898  36.201 48.684 1.00 57.84 ? 201  VAL X C   1 
ATOM   1576 O O   . VAL A 1 201 ? -10.396 36.271 47.559 1.00 56.93 ? 201  VAL X O   1 
ATOM   1577 C CB  . VAL A 1 201 ? -7.409  35.915 48.595 1.00 57.74 ? 201  VAL X CB  1 
ATOM   1578 C CG1 . VAL A 1 201 ? -7.113  37.079 49.534 1.00 52.41 ? 201  VAL X CG1 1 
ATOM   1579 C CG2 . VAL A 1 201 ? -6.261  34.915 48.614 1.00 58.44 ? 201  VAL X CG2 1 
ATOM   1580 N N   . LYS A 1 202 ? -10.311 36.942 49.709 1.00 58.48 ? 202  LYS X N   1 
ATOM   1581 C CA  . LYS A 1 202 ? -11.393 37.914 49.578 1.00 62.43 ? 202  LYS X CA  1 
ATOM   1582 C C   . LYS A 1 202 ? -10.920 39.159 48.830 1.00 61.62 ? 202  LYS X C   1 
ATOM   1583 O O   . LYS A 1 202 ? -9.776  39.586 48.984 1.00 61.76 ? 202  LYS X O   1 
ATOM   1584 C CB  . LYS A 1 202 ? -11.936 38.300 50.956 1.00 63.69 ? 202  LYS X CB  1 
ATOM   1585 C CG  . LYS A 1 202 ? -13.098 37.438 51.431 1.00 72.26 ? 202  LYS X CG  1 
ATOM   1586 C CD  . LYS A 1 202 ? -14.339 38.283 51.699 1.00 86.18 ? 202  LYS X CD  1 
ATOM   1587 C CE  . LYS A 1 202 ? -14.975 37.900 53.044 1.00 93.54 ? 202  LYS X CE  1 
ATOM   1588 N NZ  . LYS A 1 202 ? -15.059 39.077 53.976 1.00 97.21 ? 202  LYS X NZ  1 
ATOM   1589 N N   . LYS A 1 203 ? -11.812 39.730 48.024 1.00 60.77 ? 203  LYS X N   1 
ATOM   1590 C CA  . LYS A 1 203 ? -11.512 40.922 47.230 1.00 61.07 ? 203  LYS X CA  1 
ATOM   1591 C C   . LYS A 1 203 ? -10.985 42.093 48.056 1.00 58.47 ? 203  LYS X C   1 
ATOM   1592 O O   . LYS A 1 203 ? -9.960  42.686 47.719 1.00 56.64 ? 203  LYS X O   1 
ATOM   1593 C CB  . LYS A 1 203 ? -12.749 41.366 46.442 1.00 61.81 ? 203  LYS X CB  1 
ATOM   1594 C CG  . LYS A 1 203 ? -13.433 40.254 45.666 1.00 71.26 ? 203  LYS X CG  1 
ATOM   1595 C CD  . LYS A 1 203 ? -14.778 39.893 46.280 1.00 82.26 ? 203  LYS X CD  1 
ATOM   1596 C CE  . LYS A 1 203 ? -15.101 38.422 46.072 1.00 84.18 ? 203  LYS X CE  1 
ATOM   1597 N NZ  . LYS A 1 203 ? -15.744 38.176 44.751 1.00 85.10 ? 203  LYS X NZ  1 
ATOM   1598 N N   . GLU A 1 204 ? -11.690 42.417 49.136 1.00 57.88 ? 204  GLU X N   1 
ATOM   1599 C CA  . GLU A 1 204 ? -11.311 43.528 50.010 1.00 57.70 ? 204  GLU X CA  1 
ATOM   1600 C C   . GLU A 1 204 ? -9.974  43.315 50.718 1.00 53.49 ? 204  GLU X C   1 
ATOM   1601 O O   . GLU A 1 204 ? -9.326  44.277 51.137 1.00 54.42 ? 204  GLU X O   1 
ATOM   1602 C CB  . GLU A 1 204 ? -12.415 43.809 51.032 1.00 61.01 ? 204  GLU X CB  1 
ATOM   1603 C CG  . GLU A 1 204 ? -13.763 44.155 50.415 1.00 71.59 ? 204  GLU X CG  1 
ATOM   1604 C CD  . GLU A 1 204 ? -14.683 42.952 50.305 1.00 84.49 ? 204  GLU X CD  1 
ATOM   1605 O OE1 . GLU A 1 204 ? -15.017 42.356 51.352 1.00 90.21 ? 204  GLU X OE1 1 
ATOM   1606 O OE2 . GLU A 1 204 ? -15.074 42.601 49.171 1.00 86.48 ? 204  GLU X OE2 1 
ATOM   1607 N N   . ASP A 1 205 ? -9.566  42.057 50.847 1.00 50.21 ? 205  ASP X N   1 
ATOM   1608 C CA  . ASP A 1 205 ? -8.309  41.722 51.505 1.00 48.72 ? 205  ASP X CA  1 
ATOM   1609 C C   . ASP A 1 205 ? -7.163  41.488 50.527 1.00 47.14 ? 205  ASP X C   1 
ATOM   1610 O O   . ASP A 1 205 ? -6.018  41.291 50.941 1.00 45.96 ? 205  ASP X O   1 
ATOM   1611 C CB  . ASP A 1 205 ? -8.487  40.501 52.406 1.00 50.10 ? 205  ASP X CB  1 
ATOM   1612 C CG  . ASP A 1 205 ? -9.300  40.809 53.645 1.00 51.14 ? 205  ASP X CG  1 
ATOM   1613 O OD1 . ASP A 1 205 ? -9.054  41.863 54.276 1.00 46.92 ? 205  ASP X OD1 1 
ATOM   1614 O OD2 . ASP A 1 205 ? -10.204 40.057 54.060 1.00 44.23 ? 205  ASP X OD2 1 
ATOM   1615 N N   . MET A 1 206 ? -7.474  41.510 49.234 1.00 43.36 ? 206  MET X N   1 
ATOM   1616 C CA  . MET A 1 206 ? -6.466  41.295 48.201 1.00 40.35 ? 206  MET X CA  1 
ATOM   1617 C C   . MET A 1 206 ? -5.403  42.385 48.192 1.00 40.95 ? 206  MET X C   1 
ATOM   1618 O O   . MET A 1 206 ? -5.710  43.578 48.244 1.00 39.31 ? 206  MET X O   1 
ATOM   1619 C CB  . MET A 1 206 ? -7.113  41.156 46.818 1.00 42.82 ? 206  MET X CB  1 
ATOM   1620 C CG  . MET A 1 206 ? -6.129  40.886 45.679 1.00 40.20 ? 206  MET X CG  1 
ATOM   1621 S SD  . MET A 1 206 ? -4.923  39.590 46.050 1.00 40.39 ? 206  MET X SD  1 
ATOM   1622 C CE  . MET A 1 206 ? -5.968  38.145 46.040 1.00 37.94 ? 206  MET X CE  1 
ATOM   1623 N N   . SER A 1 207 ? -4.150  41.946 48.127 1.00 38.27 ? 207  SER X N   1 
ATOM   1624 C CA  . SER A 1 207 ? -2.982  42.816 48.099 1.00 36.89 ? 207  SER X CA  1 
ATOM   1625 C C   . SER A 1 207 ? -1.792  41.905 47.843 1.00 35.57 ? 207  SER X C   1 
ATOM   1626 O O   . SER A 1 207 ? -1.944  40.680 47.805 1.00 34.30 ? 207  SER X O   1 
ATOM   1627 C CB  . SER A 1 207 ? -2.801  43.517 49.450 1.00 40.36 ? 207  SER X CB  1 
ATOM   1628 O OG  . SER A 1 207 ? -2.526  42.573 50.474 1.00 43.02 ? 207  SER X OG  1 
ATOM   1629 N N   . MET A 1 208 ? -0.611  42.490 47.668 1.00 33.83 ? 208  MET X N   1 
ATOM   1630 C CA  . MET A 1 208 ? 0.590   41.696 47.433 1.00 34.13 ? 208  MET X CA  1 
ATOM   1631 C C   . MET A 1 208 ? 0.901   40.858 48.675 1.00 35.26 ? 208  MET X C   1 
ATOM   1632 O O   . MET A 1 208 ? 1.384   39.729 48.569 1.00 36.41 ? 208  MET X O   1 
ATOM   1633 C CB  . MET A 1 208 ? 1.778   42.590 47.060 1.00 34.21 ? 208  MET X CB  1 
ATOM   1634 C CG  . MET A 1 208 ? 1.708   43.182 45.647 1.00 41.58 ? 208  MET X CG  1 
ATOM   1635 S SD  . MET A 1 208 ? 1.325   41.966 44.349 1.00 43.30 ? 208  MET X SD  1 
ATOM   1636 C CE  . MET A 1 208 ? -0.304  42.518 43.851 1.00 55.94 ? 208  MET X CE  1 
ATOM   1637 N N   . GLN A 1 209 ? 0.617   41.418 49.849 1.00 35.44 ? 209  GLN X N   1 
ATOM   1638 C CA  . GLN A 1 209 ? 0.839   40.722 51.115 1.00 34.17 ? 209  GLN X CA  1 
ATOM   1639 C C   . GLN A 1 209 ? -0.082  39.511 51.231 1.00 34.26 ? 209  GLN X C   1 
ATOM   1640 O O   . GLN A 1 209 ? 0.307   38.475 51.771 1.00 33.99 ? 209  GLN X O   1 
ATOM   1641 C CB  . GLN A 1 209 ? 0.620   41.662 52.303 1.00 33.54 ? 209  GLN X CB  1 
ATOM   1642 C CG  . GLN A 1 209 ? 1.857   42.452 52.716 1.00 33.70 ? 209  GLN X CG  1 
ATOM   1643 C CD  . GLN A 1 209 ? 3.029   41.559 53.086 1.00 37.59 ? 209  GLN X CD  1 
ATOM   1644 O OE1 . GLN A 1 209 ? 3.908   41.311 52.260 1.00 46.43 ? 209  GLN X OE1 1 
ATOM   1645 N NE2 . GLN A 1 209 ? 3.044   41.075 54.325 1.00 39.38 ? 209  GLN X NE2 1 
ATOM   1646 N N   . ALA A 1 210 ? -1.305  39.644 50.723 1.00 35.65 ? 210  ALA X N   1 
ATOM   1647 C CA  . ALA A 1 210 ? -2.269  38.549 50.759 1.00 34.97 ? 210  ALA X CA  1 
ATOM   1648 C C   . ALA A 1 210 ? -1.828  37.426 49.821 1.00 36.77 ? 210  ALA X C   1 
ATOM   1649 O O   . ALA A 1 210 ? -2.052  36.246 50.103 1.00 36.89 ? 210  ALA X O   1 
ATOM   1650 C CB  . ALA A 1 210 ? -3.654  39.040 50.393 1.00 33.90 ? 210  ALA X CB  1 
ATOM   1651 N N   . ILE A 1 211 ? -1.204  37.801 48.707 1.00 33.79 ? 211  ILE X N   1 
ATOM   1652 C CA  . ILE A 1 211 ? -0.702  36.827 47.741 1.00 34.72 ? 211  ILE X CA  1 
ATOM   1653 C C   . ILE A 1 211 ? 0.497   36.122 48.377 1.00 34.92 ? 211  ILE X C   1 
ATOM   1654 O O   . ILE A 1 211 ? 0.693   34.920 48.200 1.00 35.34 ? 211  ILE X O   1 
ATOM   1655 C CB  . ILE A 1 211 ? -0.299  37.526 46.418 1.00 32.95 ? 211  ILE X CB  1 
ATOM   1656 C CG1 . ILE A 1 211 ? -1.548  37.944 45.637 1.00 31.21 ? 211  ILE X CG1 1 
ATOM   1657 C CG2 . ILE A 1 211 ? 0.566   36.609 45.560 1.00 33.84 ? 211  ILE X CG2 1 
ATOM   1658 C CD1 . ILE A 1 211 ? -1.266  38.803 44.412 1.00 36.18 ? 211  ILE X CD1 1 
ATOM   1659 N N   . ARG A 1 212 ? 1.290   36.887 49.122 1.00 36.29 ? 212  ARG X N   1 
ATOM   1660 C CA  . ARG A 1 212 ? 2.459   36.354 49.814 1.00 39.55 ? 212  ARG X CA  1 
ATOM   1661 C C   . ARG A 1 212 ? 2.039   35.307 50.848 1.00 40.20 ? 212  ARG X C   1 
ATOM   1662 O O   . ARG A 1 212 ? 2.633   34.230 50.930 1.00 39.70 ? 212  ARG X O   1 
ATOM   1663 C CB  . ARG A 1 212 ? 3.234   37.481 50.498 1.00 38.87 ? 212  ARG X CB  1 
ATOM   1664 C CG  . ARG A 1 212 ? 4.375   37.000 51.391 1.00 43.82 ? 212  ARG X CG  1 
ATOM   1665 C CD  . ARG A 1 212 ? 5.077   38.109 52.161 1.00 40.32 ? 212  ARG X CD  1 
ATOM   1666 N NE  . ARG A 1 212 ? 5.659   39.113 51.273 1.00 39.38 ? 212  ARG X NE  1 
ATOM   1667 C CZ  . ARG A 1 212 ? 6.821   38.974 50.645 1.00 42.70 ? 212  ARG X CZ  1 
ATOM   1668 N NH1 . ARG A 1 212 ? 7.267   39.942 49.858 1.00 36.50 ? 212  ARG X NH1 1 
ATOM   1669 N NH2 . ARG A 1 212 ? 7.540   37.867 50.799 1.00 34.01 ? 212  ARG X NH2 1 
ATOM   1670 N N   . HIS A 1 213 ? 1.014   35.631 51.632 1.00 38.85 ? 213  HIS X N   1 
ATOM   1671 C CA  . HIS A 1 213 ? 0.517   34.715 52.654 1.00 42.46 ? 213  HIS X CA  1 
ATOM   1672 C C   . HIS A 1 213 ? -0.056  33.437 52.049 1.00 41.49 ? 213  HIS X C   1 
ATOM   1673 O O   . HIS A 1 213 ? 0.091   32.356 52.620 1.00 40.91 ? 213  HIS X O   1 
ATOM   1674 C CB  . HIS A 1 213 ? -0.532  35.383 53.542 1.00 42.21 ? 213  HIS X CB  1 
ATOM   1675 C CG  . HIS A 1 213 ? -1.043  34.492 54.631 1.00 49.37 ? 213  HIS X CG  1 
ATOM   1676 N ND1 . HIS A 1 213 ? -0.355  34.286 55.808 1.00 44.57 ? 213  HIS X ND1 1 
ATOM   1677 C CD2 . HIS A 1 213 ? -2.172  33.750 54.721 1.00 52.77 ? 213  HIS X CD2 1 
ATOM   1678 C CE1 . HIS A 1 213 ? -1.039  33.457 56.576 1.00 52.86 ? 213  HIS X CE1 1 
ATOM   1679 N NE2 . HIS A 1 213 ? -2.145  33.117 55.940 1.00 52.84 ? 213  HIS X NE2 1 
ATOM   1680 N N   . TRP A 1 214 ? -0.709  33.563 50.896 1.00 38.79 ? 214  TRP X N   1 
ATOM   1681 C CA  . TRP A 1 214 ? -1.280  32.405 50.221 1.00 39.61 ? 214  TRP X CA  1 
ATOM   1682 C C   . TRP A 1 214 ? -0.163  31.439 49.848 1.00 40.56 ? 214  TRP X C   1 
ATOM   1683 O O   . TRP A 1 214 ? -0.304  30.222 49.989 1.00 39.73 ? 214  TRP X O   1 
ATOM   1684 C CB  . TRP A 1 214 ? -2.044  32.824 48.962 1.00 38.05 ? 214  TRP X CB  1 
ATOM   1685 C CG  . TRP A 1 214 ? -2.768  31.681 48.316 1.00 41.67 ? 214  TRP X CG  1 
ATOM   1686 C CD1 . TRP A 1 214 ? -4.071  31.322 48.509 1.00 39.23 ? 214  TRP X CD1 1 
ATOM   1687 C CD2 . TRP A 1 214 ? -2.232  30.742 47.373 1.00 38.77 ? 214  TRP X CD2 1 
ATOM   1688 N NE1 . TRP A 1 214 ? -4.379  30.222 47.745 1.00 41.38 ? 214  TRP X NE1 1 
ATOM   1689 C CE2 . TRP A 1 214 ? -3.267  29.845 47.038 1.00 39.79 ? 214  TRP X CE2 1 
ATOM   1690 C CE3 . TRP A 1 214 ? -0.978  30.568 46.775 1.00 40.63 ? 214  TRP X CE3 1 
ATOM   1691 C CZ2 . TRP A 1 214 ? -3.087  28.795 46.136 1.00 40.68 ? 214  TRP X CZ2 1 
ATOM   1692 C CZ3 . TRP A 1 214 ? -0.802  29.521 45.879 1.00 33.27 ? 214  TRP X CZ3 1 
ATOM   1693 C CH2 . TRP A 1 214 ? -1.851  28.651 45.569 1.00 38.01 ? 214  TRP X CH2 1 
ATOM   1694 N N   . GLY A 1 215 ? 0.946   31.998 49.370 1.00 37.74 ? 215  GLY X N   1 
ATOM   1695 C CA  . GLY A 1 215 ? 2.097   31.211 48.977 1.00 41.52 ? 215  GLY X CA  1 
ATOM   1696 C C   . GLY A 1 215 ? 2.719   30.482 50.151 1.00 43.07 ? 215  GLY X C   1 
ATOM   1697 O O   . GLY A 1 215 ? 3.132   29.330 50.023 1.00 41.44 ? 215  GLY X O   1 
ATOM   1698 N N   . GLU A 1 216 ? 2.783   31.157 51.296 1.00 44.28 ? 216  GLU X N   1 
ATOM   1699 C CA  . GLU A 1 216 ? 3.358   30.583 52.511 1.00 47.11 ? 216  GLU X CA  1 
ATOM   1700 C C   . GLU A 1 216 ? 2.525   29.429 53.071 1.00 47.57 ? 216  GLU X C   1 
ATOM   1701 O O   . GLU A 1 216 ? 3.063   28.511 53.692 1.00 50.63 ? 216  GLU X O   1 
ATOM   1702 C CB  . GLU A 1 216 ? 3.545   31.665 53.579 1.00 48.13 ? 216  GLU X CB  1 
ATOM   1703 C CG  . GLU A 1 216 ? 4.852   32.436 53.459 1.00 55.88 ? 216  GLU X CG  1 
ATOM   1704 C CD  . GLU A 1 216 ? 4.856   33.722 54.267 1.00 68.69 ? 216  GLU X CD  1 
ATOM   1705 O OE1 . GLU A 1 216 ? 3.864   33.986 54.982 1.00 73.14 ? 216  GLU X OE1 1 
ATOM   1706 O OE2 . GLU A 1 216 ? 5.853   34.471 54.188 1.00 69.43 ? 216  GLU X OE2 1 
ATOM   1707 N N   . THR A 1 217 ? 1.216   29.477 52.849 1.00 45.79 ? 217  THR X N   1 
ATOM   1708 C CA  . THR A 1 217 ? 0.324   28.428 53.337 1.00 47.68 ? 217  THR X CA  1 
ATOM   1709 C C   . THR A 1 217 ? 0.050   27.347 52.290 1.00 45.75 ? 217  THR X C   1 
ATOM   1710 O O   . THR A 1 217 ? -0.843  26.517 52.466 1.00 43.55 ? 217  THR X O   1 
ATOM   1711 C CB  . THR A 1 217 ? -1.003  29.029 53.853 1.00 48.56 ? 217  THR X CB  1 
ATOM   1712 O OG1 . THR A 1 217 ? -1.442  30.069 52.970 1.00 54.19 ? 217  THR X OG1 1 
ATOM   1713 C CG2 . THR A 1 217 ? -0.783  29.756 55.173 1.00 49.90 ? 217  THR X CG2 1 
ATOM   1714 N N   . HIS A 1 218 ? 0.819   27.359 51.203 1.00 43.32 ? 218  HIS X N   1 
ATOM   1715 C CA  . HIS A 1 218 ? 0.645   26.377 50.137 1.00 42.88 ? 218  HIS X CA  1 
ATOM   1716 C C   . HIS A 1 218 ? 1.961   25.754 49.674 1.00 42.01 ? 218  HIS X C   1 
ATOM   1717 O O   . HIS A 1 218 ? 3.036   26.313 49.898 1.00 41.10 ? 218  HIS X O   1 
ATOM   1718 C CB  . HIS A 1 218 ? -0.127  26.980 48.962 1.00 43.49 ? 218  HIS X CB  1 
ATOM   1719 C CG  . HIS A 1 218 ? -1.581  27.196 49.249 1.00 43.38 ? 218  HIS X CG  1 
ATOM   1720 N ND1 . HIS A 1 218 ? -2.047  28.289 49.949 1.00 44.13 ? 218  HIS X ND1 1 
ATOM   1721 C CD2 . HIS A 1 218 ? -2.672  26.458 48.933 1.00 42.03 ? 218  HIS X CD2 1 
ATOM   1722 C CE1 . HIS A 1 218 ? -3.362  28.215 50.051 1.00 44.30 ? 218  HIS X CE1 1 
ATOM   1723 N NE2 . HIS A 1 218 ? -3.766  27.114 49.443 1.00 46.46 ? 218  HIS X NE2 1 
ATOM   1724 N N   . SER A 1 219 ? 1.862   24.595 49.027 1.00 40.89 ? 219  SER X N   1 
ATOM   1725 C CA  . SER A 1 219 ? 3.029   23.865 48.538 1.00 39.75 ? 219  SER X CA  1 
ATOM   1726 C C   . SER A 1 219 ? 3.726   24.528 47.352 1.00 41.10 ? 219  SER X C   1 
ATOM   1727 O O   . SER A 1 219 ? 3.185   25.442 46.729 1.00 40.32 ? 219  SER X O   1 
ATOM   1728 C CB  . SER A 1 219 ? 2.642   22.428 48.179 1.00 41.43 ? 219  SER X CB  1 
ATOM   1729 O OG  . SER A 1 219 ? 2.049   22.363 46.893 1.00 37.92 ? 219  SER X OG  1 
ATOM   1730 N N   . GLU A 1 220 ? 4.932   24.053 47.051 1.00 40.86 ? 220  GLU X N   1 
ATOM   1731 C CA  . GLU A 1 220 ? 5.721   24.575 45.940 1.00 39.95 ? 220  GLU X CA  1 
ATOM   1732 C C   . GLU A 1 220 ? 5.034   24.316 44.601 1.00 39.09 ? 220  GLU X C   1 
ATOM   1733 O O   . GLU A 1 220 ? 5.075   25.155 43.698 1.00 35.74 ? 220  GLU X O   1 
ATOM   1734 C CB  . GLU A 1 220 ? 7.123   23.958 45.943 1.00 42.31 ? 220  GLU X CB  1 
ATOM   1735 C CG  . GLU A 1 220 ? 7.990   24.339 44.749 1.00 45.33 ? 220  GLU X CG  1 
ATOM   1736 C CD  . GLU A 1 220 ? 8.140   25.842 44.572 1.00 49.57 ? 220  GLU X CD  1 
ATOM   1737 O OE1 . GLU A 1 220 ? 8.345   26.288 43.423 1.00 48.14 ? 220  GLU X OE1 1 
ATOM   1738 O OE2 . GLU A 1 220 ? 8.055   26.582 45.576 1.00 57.76 ? 220  GLU X OE2 1 
ATOM   1739 N N   . ALA A 1 221 ? 4.406   23.151 44.482 1.00 35.97 ? 221  ALA X N   1 
ATOM   1740 C CA  . ALA A 1 221 ? 3.703   22.781 43.260 1.00 36.56 ? 221  ALA X CA  1 
ATOM   1741 C C   . ALA A 1 221 ? 2.489   23.679 43.032 1.00 34.11 ? 221  ALA X C   1 
ATOM   1742 O O   . ALA A 1 221 ? 2.200   24.062 41.901 1.00 34.95 ? 221  ALA X O   1 
ATOM   1743 C CB  . ALA A 1 221 ? 3.283   21.311 43.308 1.00 37.13 ? 221  ALA X CB  1 
ATOM   1744 N N   . GLU A 1 222 ? 1.786   24.009 44.113 1.00 34.42 ? 222  GLU X N   1 
ATOM   1745 C CA  . GLU A 1 222 ? 0.599   24.857 44.032 1.00 35.79 ? 222  GLU X CA  1 
ATOM   1746 C C   . GLU A 1 222 ? 0.966   26.301 43.710 1.00 35.28 ? 222  GLU X C   1 
ATOM   1747 O O   . GLU A 1 222 ? 0.247   26.983 42.978 1.00 35.82 ? 222  GLU X O   1 
ATOM   1748 C CB  . GLU A 1 222 ? -0.211  24.786 45.330 1.00 37.59 ? 222  GLU X CB  1 
ATOM   1749 C CG  . GLU A 1 222 ? -0.911  23.451 45.549 1.00 41.74 ? 222  GLU X CG  1 
ATOM   1750 C CD  . GLU A 1 222 ? -1.418  23.276 46.969 1.00 50.18 ? 222  GLU X CD  1 
ATOM   1751 O OE1 . GLU A 1 222 ? -2.509  22.690 47.141 1.00 49.70 ? 222  GLU X OE1 1 
ATOM   1752 O OE2 . GLU A 1 222 ? -0.729  23.722 47.913 1.00 46.38 ? 222  GLU X OE2 1 
ATOM   1753 N N   . VAL A 1 223 ? 2.086   26.759 44.261 1.00 33.25 ? 223  VAL X N   1 
ATOM   1754 C CA  . VAL A 1 223 ? 2.563   28.118 44.026 1.00 34.82 ? 223  VAL X CA  1 
ATOM   1755 C C   . VAL A 1 223 ? 2.982   28.256 42.560 1.00 33.76 ? 223  VAL X C   1 
ATOM   1756 O O   . VAL A 1 223 ? 2.640   29.234 41.892 1.00 35.51 ? 223  VAL X O   1 
ATOM   1757 C CB  . VAL A 1 223 ? 3.743   28.469 44.966 1.00 33.94 ? 223  VAL X CB  1 
ATOM   1758 C CG1 . VAL A 1 223 ? 4.514   29.668 44.451 1.00 30.65 ? 223  VAL X CG1 1 
ATOM   1759 C CG2 . VAL A 1 223 ? 3.243   28.728 46.380 1.00 30.53 ? 223  VAL X CG2 1 
ATOM   1760 N N   . ARG A 1 224 ? 3.718   27.265 42.068 1.00 32.97 ? 224  ARG X N   1 
ATOM   1761 C CA  . ARG A 1 224 ? 4.175   27.262 40.684 1.00 34.95 ? 224  ARG X CA  1 
ATOM   1762 C C   . ARG A 1 224 ? 2.983   27.238 39.728 1.00 34.87 ? 224  ARG X C   1 
ATOM   1763 O O   . ARG A 1 224 ? 2.960   27.972 38.738 1.00 32.25 ? 224  ARG X O   1 
ATOM   1764 C CB  . ARG A 1 224 ? 5.086   26.060 40.424 1.00 36.04 ? 224  ARG X CB  1 
ATOM   1765 C CG  . ARG A 1 224 ? 5.692   26.023 39.030 1.00 35.88 ? 224  ARG X CG  1 
ATOM   1766 C CD  . ARG A 1 224 ? 6.716   24.918 38.836 1.00 41.97 ? 224  ARG X CD  1 
ATOM   1767 N NE  . ARG A 1 224 ? 7.115   24.778 37.438 1.00 38.56 ? 224  ARG X NE  1 
ATOM   1768 C CZ  . ARG A 1 224 ? 8.217   24.156 37.035 1.00 43.15 ? 224  ARG X CZ  1 
ATOM   1769 N NH1 . ARG A 1 224 ? 8.502   24.075 35.743 1.00 37.61 ? 224  ARG X NH1 1 
ATOM   1770 N NH2 . ARG A 1 224 ? 9.038   23.611 37.925 1.00 44.59 ? 224  ARG X NH2 1 
ATOM   1771 N N   . GLU A 1 225 ? 1.998   26.395 40.032 1.00 34.55 ? 225  GLU X N   1 
ATOM   1772 C CA  . GLU A 1 225 ? 0.802   26.282 39.203 1.00 35.27 ? 225  GLU X CA  1 
ATOM   1773 C C   . GLU A 1 225 ? 0.071   27.617 39.127 1.00 34.07 ? 225  GLU X C   1 
ATOM   1774 O O   . GLU A 1 225 ? -0.367  28.033 38.052 1.00 32.24 ? 225  GLU X O   1 
ATOM   1775 C CB  . GLU A 1 225 ? -0.136  25.191 39.735 1.00 34.74 ? 225  GLU X CB  1 
ATOM   1776 C CG  . GLU A 1 225 ? -1.235  24.783 38.763 1.00 38.73 ? 225  GLU X CG  1 
ATOM   1777 C CD  . GLU A 1 225 ? -2.415  25.742 38.761 1.00 46.64 ? 225  GLU X CD  1 
ATOM   1778 O OE1 . GLU A 1 225 ? -2.749  26.293 39.834 1.00 41.45 ? 225  GLU X OE1 1 
ATOM   1779 O OE2 . GLU A 1 225 ? -3.011  25.947 37.681 1.00 48.31 ? 225  GLU X OE2 1 
ATOM   1780 N N   . LEU A 1 226 ? -0.059  28.282 40.273 1.00 34.23 ? 226  LEU X N   1 
ATOM   1781 C CA  . LEU A 1 226 ? -0.729  29.575 40.334 1.00 35.85 ? 226  LEU X CA  1 
ATOM   1782 C C   . LEU A 1 226 ? 0.029   30.627 39.532 1.00 34.03 ? 226  LEU X C   1 
ATOM   1783 O O   . LEU A 1 226 ? -0.539  31.282 38.656 1.00 32.01 ? 226  LEU X O   1 
ATOM   1784 C CB  . LEU A 1 226 ? -0.872  30.049 41.786 1.00 35.42 ? 226  LEU X CB  1 
ATOM   1785 C CG  . LEU A 1 226 ? -1.388  31.483 41.952 1.00 34.69 ? 226  LEU X CG  1 
ATOM   1786 C CD1 . LEU A 1 226 ? -2.848  31.588 41.531 1.00 35.64 ? 226  LEU X CD1 1 
ATOM   1787 C CD2 . LEU A 1 226 ? -1.198  31.989 43.371 1.00 31.26 ? 226  LEU X CD2 1 
ATOM   1788 N N   . LEU A 1 227 ? 1.314   30.776 39.842 1.00 34.40 ? 227  LEU X N   1 
ATOM   1789 C CA  . LEU A 1 227 ? 2.171   31.760 39.187 1.00 33.09 ? 227  LEU X CA  1 
ATOM   1790 C C   . LEU A 1 227 ? 2.219   31.620 37.671 1.00 31.71 ? 227  LEU X C   1 
ATOM   1791 O O   . LEU A 1 227 ? 2.310   32.620 36.958 1.00 27.19 ? 227  LEU X O   1 
ATOM   1792 C CB  . LEU A 1 227 ? 3.584   31.719 39.772 1.00 32.99 ? 227  LEU X CB  1 
ATOM   1793 C CG  . LEU A 1 227 ? 3.962   32.788 40.800 1.00 41.21 ? 227  LEU X CG  1 
ATOM   1794 C CD1 . LEU A 1 227 ? 2.749   33.472 41.430 1.00 34.14 ? 227  LEU X CD1 1 
ATOM   1795 C CD2 . LEU A 1 227 ? 4.863   32.198 41.863 1.00 31.98 ? 227  LEU X CD2 1 
ATOM   1796 N N   . GLU A 1 228 ? 2.155   30.383 37.186 1.00 30.24 ? 228  GLU X N   1 
ATOM   1797 C CA  . GLU A 1 228 ? 2.190   30.113 35.751 1.00 32.51 ? 228  GLU X CA  1 
ATOM   1798 C C   . GLU A 1 228 ? 0.958   30.622 34.997 1.00 31.03 ? 228  GLU X C   1 
ATOM   1799 O O   . GLU A 1 228 ? 0.955   30.658 33.765 1.00 30.74 ? 228  GLU X O   1 
ATOM   1800 C CB  . GLU A 1 228 ? 2.424   28.625 35.476 1.00 32.60 ? 228  GLU X CB  1 
ATOM   1801 C CG  . GLU A 1 228 ? 3.890   28.225 35.533 1.00 33.98 ? 228  GLU X CG  1 
ATOM   1802 C CD  . GLU A 1 228 ? 4.110   26.739 35.325 1.00 37.48 ? 228  GLU X CD  1 
ATOM   1803 O OE1 . GLU A 1 228 ? 3.154   26.041 34.929 1.00 37.64 ? 228  GLU X OE1 1 
ATOM   1804 O OE2 . GLU A 1 228 ? 5.244   26.268 35.558 1.00 32.29 ? 228  GLU X OE2 1 
ATOM   1805 N N   . GLN A 1 229 ? -0.083  31.011 35.733 1.00 31.12 ? 229  GLN X N   1 
ATOM   1806 C CA  . GLN A 1 229 ? -1.298  31.543 35.114 1.00 32.86 ? 229  GLN X CA  1 
ATOM   1807 C C   . GLN A 1 229 ? -1.008  32.933 34.535 1.00 33.14 ? 229  GLN X C   1 
ATOM   1808 O O   . GLN A 1 229 ? -1.789  33.468 33.746 1.00 32.85 ? 229  GLN X O   1 
ATOM   1809 C CB  . GLN A 1 229 ? -2.462  31.592 36.110 1.00 32.82 ? 229  GLN X CB  1 
ATOM   1810 C CG  . GLN A 1 229 ? -2.949  30.222 36.592 1.00 38.06 ? 229  GLN X CG  1 
ATOM   1811 C CD  . GLN A 1 229 ? -3.175  29.237 35.459 1.00 49.14 ? 229  GLN X CD  1 
ATOM   1812 O OE1 . GLN A 1 229 ? -4.024  29.460 34.594 1.00 47.09 ? 229  GLN X OE1 1 
ATOM   1813 N NE2 . GLN A 1 229 ? -2.417  28.144 35.461 1.00 49.71 ? 229  GLN X NE2 1 
ATOM   1814 N N   . ASN A 1 230 ? 0.121   33.509 34.944 1.00 28.97 ? 230  ASN X N   1 
ATOM   1815 C CA  . ASN A 1 230 ? 0.571   34.799 34.433 1.00 29.11 ? 230  ASN X CA  1 
ATOM   1816 C C   . ASN A 1 230 ? 1.778   34.475 33.555 1.00 30.31 ? 230  ASN X C   1 
ATOM   1817 O O   . ASN A 1 230 ? 2.854   34.173 34.069 1.00 28.06 ? 230  ASN X O   1 
ATOM   1818 C CB  . ASN A 1 230 ? 0.983   35.732 35.576 1.00 27.29 ? 230  ASN X CB  1 
ATOM   1819 C CG  . ASN A 1 230 ? 1.832   36.896 35.096 1.00 29.43 ? 230  ASN X CG  1 
ATOM   1820 O OD1 . ASN A 1 230 ? 1.554   37.487 34.055 1.00 27.32 ? 230  ASN X OD1 1 
ATOM   1821 N ND2 . ASN A 1 230 ? 2.873   37.228 35.853 1.00 30.63 ? 230  ASN X ND2 1 
ATOM   1822 N N   . PRO A 1 231 ? 1.602   34.538 32.237 1.00 30.06 ? 231  PRO X N   1 
ATOM   1823 C CA  . PRO A 1 231 ? 2.676   34.191 31.298 1.00 28.13 ? 231  PRO X CA  1 
ATOM   1824 C C   . PRO A 1 231 ? 3.783   35.231 31.175 1.00 28.81 ? 231  PRO X C   1 
ATOM   1825 O O   . PRO A 1 231 ? 4.814   34.946 30.564 1.00 28.36 ? 231  PRO X O   1 
ATOM   1826 C CB  . PRO A 1 231 ? 1.938   34.001 29.969 1.00 26.55 ? 231  PRO X CB  1 
ATOM   1827 C CG  . PRO A 1 231 ? 0.720   34.877 30.081 1.00 31.29 ? 231  PRO X CG  1 
ATOM   1828 C CD  . PRO A 1 231 ? 0.367   34.954 31.548 1.00 30.40 ? 231  PRO X CD  1 
ATOM   1829 N N   . SER A 1 232 ? 3.572   36.414 31.745 1.00 28.69 ? 232  SER X N   1 
ATOM   1830 C CA  . SER A 1 232 ? 4.571   37.476 31.699 1.00 27.70 ? 232  SER X CA  1 
ATOM   1831 C C   . SER A 1 232 ? 5.759   37.145 32.603 1.00 28.60 ? 232  SER X C   1 
ATOM   1832 O O   . SER A 1 232 ? 5.636   36.369 33.553 1.00 28.76 ? 232  SER X O   1 
ATOM   1833 C CB  . SER A 1 232 ? 3.939   38.809 32.109 1.00 29.28 ? 232  SER X CB  1 
ATOM   1834 O OG  . SER A 1 232 ? 4.866   39.880 32.062 1.00 26.73 ? 232  SER X OG  1 
ATOM   1835 N N   . PHE A 1 233 ? 6.910   37.734 32.302 1.00 29.21 ? 233  PHE X N   1 
ATOM   1836 C CA  . PHE A 1 233 ? 8.117   37.508 33.090 1.00 28.92 ? 233  PHE X CA  1 
ATOM   1837 C C   . PHE A 1 233 ? 8.981   38.760 33.069 1.00 29.61 ? 233  PHE X C   1 
ATOM   1838 O O   . PHE A 1 233 ? 9.068   39.440 32.048 1.00 30.48 ? 233  PHE X O   1 
ATOM   1839 C CB  . PHE A 1 233 ? 8.893   36.300 32.566 1.00 26.33 ? 233  PHE X CB  1 
ATOM   1840 C CG  . PHE A 1 233 ? 9.852   35.721 33.563 1.00 30.18 ? 233  PHE X CG  1 
ATOM   1841 C CD1 . PHE A 1 233 ? 9.415   34.822 34.525 1.00 29.56 ? 233  PHE X CD1 1 
ATOM   1842 C CD2 . PHE A 1 233 ? 11.192  36.076 33.542 1.00 25.03 ? 233  PHE X CD2 1 
ATOM   1843 C CE1 . PHE A 1 233 ? 10.296  34.286 35.448 1.00 31.19 ? 233  PHE X CE1 1 
ATOM   1844 C CE2 . PHE A 1 233 ? 12.079  35.544 34.460 1.00 28.36 ? 233  PHE X CE2 1 
ATOM   1845 C CZ  . PHE A 1 233 ? 11.629  34.646 35.417 1.00 26.96 ? 233  PHE X CZ  1 
ATOM   1846 N N   . VAL A 1 234 ? 9.619   39.060 34.198 1.00 29.52 ? 234  VAL X N   1 
ATOM   1847 C CA  . VAL A 1 234 ? 10.442  40.258 34.317 1.00 28.73 ? 234  VAL X CA  1 
ATOM   1848 C C   . VAL A 1 234 ? 11.941  39.980 34.421 1.00 29.58 ? 234  VAL X C   1 
ATOM   1849 O O   . VAL A 1 234 ? 12.362  39.017 35.061 1.00 28.30 ? 234  VAL X O   1 
ATOM   1850 C CB  . VAL A 1 234 ? 9.969   41.124 35.513 1.00 30.87 ? 234  VAL X CB  1 
ATOM   1851 C CG1 . VAL A 1 234 ? 10.842  42.365 35.682 1.00 29.93 ? 234  VAL X CG1 1 
ATOM   1852 C CG2 . VAL A 1 234 ? 8.506   41.523 35.327 1.00 26.95 ? 234  VAL X CG2 1 
ATOM   1853 N N   . PHE A 1 235 ? 12.736  40.836 33.781 1.00 30.20 ? 235  PHE X N   1 
ATOM   1854 C CA  . PHE A 1 235 ? 14.192  40.722 33.809 1.00 30.69 ? 235  PHE X CA  1 
ATOM   1855 C C   . PHE A 1 235 ? 14.768  41.917 34.556 1.00 30.12 ? 235  PHE X C   1 
ATOM   1856 O O   . PHE A 1 235 ? 14.207  43.013 34.513 1.00 30.12 ? 235  PHE X O   1 
ATOM   1857 C CB  . PHE A 1 235 ? 14.753  40.611 32.393 1.00 28.44 ? 235  PHE X CB  1 
ATOM   1858 C CG  . PHE A 1 235 ? 14.174  39.467 31.617 1.00 31.44 ? 235  PHE X CG  1 
ATOM   1859 C CD1 . PHE A 1 235 ? 13.274  39.696 30.588 1.00 29.41 ? 235  PHE X CD1 1 
ATOM   1860 C CD2 . PHE A 1 235 ? 14.522  38.158 31.923 1.00 32.17 ? 235  PHE X CD2 1 
ATOM   1861 C CE1 . PHE A 1 235 ? 12.733  38.638 29.871 1.00 29.06 ? 235  PHE X CE1 1 
ATOM   1862 C CE2 . PHE A 1 235 ? 13.985  37.096 31.211 1.00 29.35 ? 235  PHE X CE2 1 
ATOM   1863 C CZ  . PHE A 1 235 ? 13.090  37.337 30.183 1.00 29.36 ? 235  PHE X CZ  1 
ATOM   1864 N N   . PHE A 1 236 ? 15.888  41.702 35.240 1.00 28.39 ? 236  PHE X N   1 
ATOM   1865 C CA  . PHE A 1 236 ? 16.495  42.754 36.048 1.00 29.52 ? 236  PHE X CA  1 
ATOM   1866 C C   . PHE A 1 236 ? 17.954  43.042 35.717 1.00 31.84 ? 236  PHE X C   1 
ATOM   1867 O O   . PHE A 1 236 ? 18.579  42.342 34.926 1.00 32.42 ? 236  PHE X O   1 
ATOM   1868 C CB  . PHE A 1 236 ? 16.384  42.388 37.535 1.00 31.31 ? 236  PHE X CB  1 
ATOM   1869 C CG  . PHE A 1 236 ? 14.989  42.012 37.971 1.00 30.17 ? 236  PHE X CG  1 
ATOM   1870 C CD1 . PHE A 1 236 ? 14.140  42.965 38.510 1.00 28.74 ? 236  PHE X CD1 1 
ATOM   1871 C CD2 . PHE A 1 236 ? 14.532  40.707 37.844 1.00 29.81 ? 236  PHE X CD2 1 
ATOM   1872 C CE1 . PHE A 1 236 ? 12.857  42.630 38.916 1.00 31.56 ? 236  PHE X CE1 1 
ATOM   1873 C CE2 . PHE A 1 236 ? 13.247  40.363 38.247 1.00 31.10 ? 236  PHE X CE2 1 
ATOM   1874 C CZ  . PHE A 1 236 ? 12.411  41.327 38.784 1.00 28.94 ? 236  PHE X CZ  1 
ATOM   1875 N N   . LYS A 1 237 ? 18.488  44.089 36.336 1.00 31.92 ? 237  LYS X N   1 
ATOM   1876 C CA  . LYS A 1 237 ? 19.882  44.470 36.143 1.00 32.68 ? 237  LYS X CA  1 
ATOM   1877 C C   . LYS A 1 237 ? 20.417  45.029 37.456 1.00 31.96 ? 237  LYS X C   1 
ATOM   1878 O O   . LYS A 1 237 ? 19.656  45.592 38.248 1.00 30.69 ? 237  LYS X O   1 
ATOM   1879 C CB  . LYS A 1 237 ? 20.019  45.505 35.017 1.00 28.05 ? 237  LYS X CB  1 
ATOM   1880 C CG  . LYS A 1 237 ? 19.497  46.890 35.362 1.00 34.05 ? 237  LYS X CG  1 
ATOM   1881 C CD  . LYS A 1 237 ? 19.644  47.835 34.183 1.00 41.97 ? 237  LYS X CD  1 
ATOM   1882 C CE  . LYS A 1 237 ? 18.707  49.021 34.308 1.00 49.20 ? 237  LYS X CE  1 
ATOM   1883 N NZ  . LYS A 1 237 ? 18.560  49.732 33.008 1.00 60.95 ? 237  LYS X NZ  1 
ATOM   1884 N N   . PRO A 1 238 ? 21.718  44.875 37.695 1.00 33.88 ? 238  PRO X N   1 
ATOM   1885 C CA  . PRO A 1 238 ? 22.330  45.390 38.923 1.00 33.76 ? 238  PRO X CA  1 
ATOM   1886 C C   . PRO A 1 238 ? 22.156  46.900 38.990 1.00 34.83 ? 238  PRO X C   1 
ATOM   1887 O O   . PRO A 1 238 ? 22.244  47.576 37.965 1.00 33.12 ? 238  PRO X O   1 
ATOM   1888 C CB  . PRO A 1 238 ? 23.812  45.028 38.759 1.00 36.41 ? 238  PRO X CB  1 
ATOM   1889 C CG  . PRO A 1 238 ? 23.824  43.910 37.768 1.00 35.80 ? 238  PRO X CG  1 
ATOM   1890 C CD  . PRO A 1 238 ? 22.699  44.201 36.823 1.00 32.28 ? 238  PRO X CD  1 
ATOM   1891 N N   . GLN A 1 239 ? 21.906  47.419 40.184 1.00 32.53 ? 239  GLN X N   1 
ATOM   1892 C CA  . GLN A 1 239 ? 21.720  48.852 40.361 1.00 36.32 ? 239  GLN X CA  1 
ATOM   1893 C C   . GLN A 1 239 ? 22.389  49.289 41.654 1.00 36.83 ? 239  GLN X C   1 
ATOM   1894 O O   . GLN A 1 239 ? 22.320  48.580 42.658 1.00 35.93 ? 239  GLN X O   1 
ATOM   1895 C CB  . GLN A 1 239 ? 20.224  49.182 40.394 1.00 35.33 ? 239  GLN X CB  1 
ATOM   1896 C CG  . GLN A 1 239 ? 19.897  50.622 40.767 1.00 43.62 ? 239  GLN X CG  1 
ATOM   1897 C CD  . GLN A 1 239 ? 19.311  51.410 39.614 1.00 47.82 ? 239  GLN X CD  1 
ATOM   1898 O OE1 . GLN A 1 239 ? 19.177  50.895 38.504 1.00 43.21 ? 239  GLN X OE1 1 
ATOM   1899 N NE2 . GLN A 1 239 ? 18.961  52.664 39.874 1.00 52.56 ? 239  GLN X NE2 1 
ATOM   1900 N N   . SER A 1 240 ? 23.039  50.453 41.629 1.00 38.48 ? 240  SER X N   1 
ATOM   1901 C CA  . SER A 1 240 ? 23.706  50.975 42.818 1.00 42.28 ? 240  SER X CA  1 
ATOM   1902 C C   . SER A 1 240 ? 22.674  51.143 43.931 1.00 40.85 ? 240  SER X C   1 
ATOM   1903 O O   . SER A 1 240 ? 21.565  51.621 43.690 1.00 40.72 ? 240  SER X O   1 
ATOM   1904 C CB  . SER A 1 240 ? 24.405  52.306 42.516 1.00 44.49 ? 240  SER X CB  1 
ATOM   1905 O OG  . SER A 1 240 ? 23.485  53.270 42.034 1.00 55.17 ? 240  SER X OG  1 
ATOM   1906 N N   . PHE A 1 241 ? 23.045  50.744 45.144 1.00 41.80 ? 241  PHE X N   1 
ATOM   1907 C CA  . PHE A 1 241 ? 22.149  50.820 46.294 1.00 43.14 ? 241  PHE X CA  1 
ATOM   1908 C C   . PHE A 1 241 ? 21.651  52.226 46.599 1.00 42.17 ? 241  PHE X C   1 
ATOM   1909 O O   . PHE A 1 241 ? 22.402  53.195 46.538 1.00 36.74 ? 241  PHE X O   1 
ATOM   1910 C CB  . PHE A 1 241 ? 22.802  50.218 47.546 1.00 42.77 ? 241  PHE X CB  1 
ATOM   1911 C CG  . PHE A 1 241 ? 21.978  50.380 48.800 1.00 43.05 ? 241  PHE X CG  1 
ATOM   1912 C CD1 . PHE A 1 241 ? 21.036  49.427 49.156 1.00 45.23 ? 241  PHE X CD1 1 
ATOM   1913 C CD2 . PHE A 1 241 ? 22.147  51.488 49.624 1.00 47.05 ? 241  PHE X CD2 1 
ATOM   1914 C CE1 . PHE A 1 241 ? 20.274  49.573 50.310 1.00 45.92 ? 241  PHE X CE1 1 
ATOM   1915 C CE2 . PHE A 1 241 ? 21.390  51.640 50.776 1.00 54.36 ? 241  PHE X CE2 1 
ATOM   1916 C CZ  . PHE A 1 241 ? 20.452  50.681 51.120 1.00 52.01 ? 241  PHE X CZ  1 
ATOM   1917 N N   . ALA A 1 242 ? 20.370  52.313 46.930 1.00 41.84 ? 242  ALA X N   1 
ATOM   1918 C CA  . ALA A 1 242 ? 19.730  53.569 47.292 1.00 45.55 ? 242  ALA X CA  1 
ATOM   1919 C C   . ALA A 1 242 ? 18.746  53.240 48.412 1.00 43.68 ? 242  ALA X C   1 
ATOM   1920 O O   . ALA A 1 242 ? 18.100  52.195 48.376 1.00 43.85 ? 242  ALA X O   1 
ATOM   1921 C CB  . ALA A 1 242 ? 18.992  54.157 46.086 1.00 46.06 ? 242  ALA X CB  1 
ATOM   1922 N N   . PRO A 1 243 ? 18.634  54.115 49.407 1.00 49.01 ? 243  PRO X N   1 
ATOM   1923 C CA  . PRO A 1 243 ? 17.697  53.891 50.514 1.00 48.36 ? 243  PRO X CA  1 
ATOM   1924 C C   . PRO A 1 243 ? 16.266  53.852 49.984 1.00 45.08 ? 243  PRO X C   1 
ATOM   1925 O O   . PRO A 1 243 ? 15.970  54.487 48.969 1.00 47.70 ? 243  PRO X O   1 
ATOM   1926 C CB  . PRO A 1 243 ? 17.901  55.123 51.400 1.00 50.76 ? 243  PRO X CB  1 
ATOM   1927 C CG  . PRO A 1 243 ? 18.504  56.145 50.494 1.00 56.41 ? 243  PRO X CG  1 
ATOM   1928 C CD  . PRO A 1 243 ? 19.384  55.374 49.559 1.00 50.53 ? 243  PRO X CD  1 
ATOM   1929 N N   . VAL A 1 244 ? 15.393  53.112 50.655 1.00 38.81 ? 244  VAL X N   1 
ATOM   1930 C CA  . VAL A 1 244 ? 14.007  53.015 50.224 1.00 36.61 ? 244  VAL X CA  1 
ATOM   1931 C C   . VAL A 1 244 ? 13.315  54.361 50.401 1.00 37.64 ? 244  VAL X C   1 
ATOM   1932 O O   . VAL A 1 244 ? 13.335  54.947 51.486 1.00 38.00 ? 244  VAL X O   1 
ATOM   1933 C CB  . VAL A 1 244 ? 13.249  51.914 50.984 1.00 36.23 ? 244  VAL X CB  1 
ATOM   1934 C CG1 . VAL A 1 244 ? 11.766  51.921 50.612 1.00 35.63 ? 244  VAL X CG1 1 
ATOM   1935 C CG2 . VAL A 1 244 ? 13.867  50.556 50.690 1.00 39.12 ? 244  VAL X CG2 1 
ATOM   1936 N N   . LYS A 1 245 ? 12.710  54.847 49.323 1.00 33.86 ? 245  LYS X N   1 
ATOM   1937 C CA  . LYS A 1 245 ? 12.008  56.123 49.352 1.00 35.92 ? 245  LYS X CA  1 
ATOM   1938 C C   . LYS A 1 245 ? 10.587  55.935 48.856 1.00 36.44 ? 245  LYS X C   1 
ATOM   1939 O O   . LYS A 1 245 ? 10.298  54.993 48.116 1.00 37.60 ? 245  LYS X O   1 
ATOM   1940 C CB  . LYS A 1 245 ? 12.705  57.141 48.449 1.00 36.44 ? 245  LYS X CB  1 
ATOM   1941 C CG  . LYS A 1 245 ? 14.149  57.439 48.805 1.00 39.21 ? 245  LYS X CG  1 
ATOM   1942 C CD  . LYS A 1 245 ? 14.889  57.978 47.590 1.00 48.39 ? 245  LYS X CD  1 
ATOM   1943 C CE  . LYS A 1 245 ? 16.155  58.713 47.991 1.00 58.42 ? 245  LYS X CE  1 
ATOM   1944 N NZ  . LYS A 1 245 ? 16.737  59.456 46.838 1.00 65.00 ? 245  LYS X NZ  1 
ATOM   1945 N N   . GLY A 1 246 ? 9.703   56.836 49.268 1.00 33.85 ? 246  GLY X N   1 
ATOM   1946 C CA  . GLY A 1 246 ? 8.322   56.790 48.835 1.00 31.68 ? 246  GLY X CA  1 
ATOM   1947 C C   . GLY A 1 246 ? 8.174   57.680 47.617 1.00 31.67 ? 246  GLY X C   1 
ATOM   1948 O O   . GLY A 1 246 ? 9.158   58.257 47.146 1.00 29.47 ? 246  GLY X O   1 
ATOM   1949 N N   . ALA A 1 247 ? 6.952   57.797 47.106 1.00 28.15 ? 247  ALA X N   1 
ATOM   1950 C CA  . ALA A 1 247 ? 6.687   58.629 45.933 1.00 29.92 ? 247  ALA X CA  1 
ATOM   1951 C C   . ALA A 1 247 ? 7.134   60.073 46.159 1.00 29.05 ? 247  ALA X C   1 
ATOM   1952 O O   . ALA A 1 247 ? 7.458   60.788 45.212 1.00 28.35 ? 247  ALA X O   1 
ATOM   1953 C CB  . ALA A 1 247 ? 5.207   58.585 45.574 1.00 26.57 ? 247  ALA X CB  1 
ATOM   1954 N N   . SER A 1 248 ? 7.152   60.495 47.421 1.00 27.46 ? 248  SER X N   1 
ATOM   1955 C CA  . SER A 1 248 ? 7.561   61.849 47.771 1.00 30.33 ? 248  SER X CA  1 
ATOM   1956 C C   . SER A 1 248 ? 9.071   62.051 47.644 1.00 31.37 ? 248  SER X C   1 
ATOM   1957 O O   . SER A 1 248 ? 9.561   63.170 47.810 1.00 32.23 ? 248  SER X O   1 
ATOM   1958 C CB  . SER A 1 248 ? 7.113   62.177 49.197 1.00 32.48 ? 248  SER X CB  1 
ATOM   1959 O OG  . SER A 1 248 ? 7.740   61.300 50.120 1.00 44.00 ? 248  SER X OG  1 
ATOM   1960 N N   . ALA A 1 249 ? 9.793   60.967 47.351 1.00 29.20 ? 249  ALA X N   1 
ATOM   1961 C CA  . ALA A 1 249 ? 11.254  60.981 47.204 1.00 29.03 ? 249  ALA X CA  1 
ATOM   1962 C C   . ALA A 1 249 ? 11.981  61.143 48.542 1.00 31.24 ? 249  ALA X C   1 
ATOM   1963 O O   . ALA A 1 249 ? 13.157  61.509 48.591 1.00 31.95 ? 249  ALA X O   1 
ATOM   1964 C CB  . ALA A 1 249 ? 11.708  62.049 46.199 1.00 29.74 ? 249  ALA X CB  1 
ATOM   1965 N N   . VAL A 1 250 ? 11.274  60.866 49.630 1.00 28.32 ? 250  VAL X N   1 
ATOM   1966 C CA  . VAL A 1 250 ? 11.851  60.976 50.962 1.00 27.77 ? 250  VAL X CA  1 
ATOM   1967 C C   . VAL A 1 250 ? 12.085  59.579 51.510 1.00 27.97 ? 250  VAL X C   1 
ATOM   1968 O O   . VAL A 1 250 ? 11.177  58.751 51.482 1.00 30.75 ? 250  VAL X O   1 
ATOM   1969 C CB  . VAL A 1 250 ? 10.895  61.729 51.917 1.00 29.92 ? 250  VAL X CB  1 
ATOM   1970 C CG1 . VAL A 1 250 ? 11.456  61.765 53.336 1.00 29.06 ? 250  VAL X CG1 1 
ATOM   1971 C CG2 . VAL A 1 250 ? 10.634  63.142 51.404 1.00 28.26 ? 250  VAL X CG2 1 
ATOM   1972 N N   . PRO A 1 251 ? 13.297  59.309 51.994 1.00 30.57 ? 251  PRO X N   1 
ATOM   1973 C CA  . PRO A 1 251 ? 13.606  58.005 52.591 1.00 32.29 ? 251  PRO X CA  1 
ATOM   1974 C C   . PRO A 1 251 ? 12.599  57.711 53.698 1.00 30.69 ? 251  PRO X C   1 
ATOM   1975 O O   . PRO A 1 251 ? 12.369  58.559 54.563 1.00 29.98 ? 251  PRO X O   1 
ATOM   1976 C CB  . PRO A 1 251 ? 15.001  58.212 53.182 1.00 29.45 ? 251  PRO X CB  1 
ATOM   1977 C CG  . PRO A 1 251 ? 15.603  59.281 52.333 1.00 37.32 ? 251  PRO X CG  1 
ATOM   1978 C CD  . PRO A 1 251 ? 14.460  60.211 52.001 1.00 32.98 ? 251  PRO X CD  1 
ATOM   1979 N N   . LEU A 1 252 ? 12.010  56.520 53.661 1.00 27.58 ? 252  LEU X N   1 
ATOM   1980 C CA  . LEU A 1 252 ? 11.002  56.120 54.632 1.00 31.24 ? 252  LEU X CA  1 
ATOM   1981 C C   . LEU A 1 252 ? 11.559  55.504 55.910 1.00 30.79 ? 252  LEU X C   1 
ATOM   1982 O O   . LEU A 1 252 ? 12.477  54.682 55.875 1.00 29.18 ? 252  LEU X O   1 
ATOM   1983 C CB  . LEU A 1 252 ? 10.006  55.152 53.990 1.00 30.92 ? 252  LEU X CB  1 
ATOM   1984 C CG  . LEU A 1 252 ? 9.387   55.575 52.660 1.00 32.76 ? 252  LEU X CG  1 
ATOM   1985 C CD1 . LEU A 1 252 ? 8.568   54.422 52.089 1.00 31.35 ? 252  LEU X CD1 1 
ATOM   1986 C CD2 . LEU A 1 252 ? 8.520   56.809 52.850 1.00 31.65 ? 252  LEU X CD2 1 
ATOM   1987 N N   . VAL A 1 253 ? 10.989  55.914 57.037 1.00 28.84 ? 253  VAL X N   1 
ATOM   1988 C CA  . VAL A 1 253 ? 11.390  55.399 58.341 1.00 28.67 ? 253  VAL X CA  1 
ATOM   1989 C C   . VAL A 1 253 ? 10.310  54.417 58.780 1.00 28.99 ? 253  VAL X C   1 
ATOM   1990 O O   . VAL A 1 253 ? 9.116   54.741 58.758 1.00 27.28 ? 253  VAL X O   1 
ATOM   1991 C CB  . VAL A 1 253 ? 11.547  56.536 59.380 1.00 29.93 ? 253  VAL X CB  1 
ATOM   1992 C CG1 . VAL A 1 253 ? 11.839  55.973 60.770 1.00 29.62 ? 253  VAL X CG1 1 
ATOM   1993 C CG2 . VAL A 1 253 ? 12.664  57.490 58.958 1.00 27.35 ? 253  VAL X CG2 1 
ATOM   1994 N N   . GLY A 1 254 ? 10.727  53.217 59.171 1.00 27.80 ? 254  GLY X N   1 
ATOM   1995 C CA  . GLY A 1 254 ? 9.794   52.190 59.602 1.00 25.25 ? 254  GLY X CA  1 
ATOM   1996 C C   . GLY A 1 254 ? 8.857   52.652 60.706 1.00 29.42 ? 254  GLY X C   1 
ATOM   1997 O O   . GLY A 1 254 ? 9.299   53.211 61.712 1.00 29.33 ? 254  GLY X O   1 
ATOM   1998 N N   . ARG A 1 255 ? 7.561   52.416 60.505 1.00 28.68 ? 255  ARG X N   1 
ATOM   1999 C CA  . ARG A 1 255 ? 6.514   52.782 61.461 1.00 30.40 ? 255  ARG X CA  1 
ATOM   2000 C C   . ARG A 1 255 ? 6.358   54.277 61.758 1.00 30.70 ? 255  ARG X C   1 
ATOM   2001 O O   . ARG A 1 255 ? 5.658   54.662 62.699 1.00 29.15 ? 255  ARG X O   1 
ATOM   2002 C CB  . ARG A 1 255 ? 6.603   51.947 62.742 1.00 29.18 ? 255  ARG X CB  1 
ATOM   2003 C CG  . ARG A 1 255 ? 6.215   50.483 62.527 1.00 32.25 ? 255  ARG X CG  1 
ATOM   2004 C CD  . ARG A 1 255 ? 6.485   49.571 63.720 1.00 34.11 ? 255  ARG X CD  1 
ATOM   2005 N NE  . ARG A 1 255 ? 7.914   49.394 63.973 1.00 31.14 ? 255  ARG X NE  1 
ATOM   2006 C CZ  . ARG A 1 255 ? 8.413   48.637 64.943 1.00 37.58 ? 255  ARG X CZ  1 
ATOM   2007 N NH1 . ARG A 1 255 ? 7.600   47.978 65.763 1.00 31.32 ? 255  ARG X NH1 1 
ATOM   2008 N NH2 . ARG A 1 255 ? 9.726   48.538 65.096 1.00 32.34 ? 255  ARG X NH2 1 
ATOM   2009 N N   . ALA A 1 256 ? 7.011   55.108 60.951 1.00 26.70 ? 256  ALA X N   1 
ATOM   2010 C CA  . ALA A 1 256 ? 6.926   56.559 61.090 1.00 28.95 ? 256  ALA X CA  1 
ATOM   2011 C C   . ALA A 1 256 ? 6.473   57.177 59.762 1.00 29.27 ? 256  ALA X C   1 
ATOM   2012 O O   . ALA A 1 256 ? 6.517   58.395 59.584 1.00 27.95 ? 256  ALA X O   1 
ATOM   2013 C CB  . ALA A 1 256 ? 8.279   57.134 61.517 1.00 27.15 ? 256  ALA X CB  1 
ATOM   2014 N N   . SER A 1 257 ? 6.039   56.329 58.832 1.00 27.96 ? 257  SER X N   1 
ATOM   2015 C CA  . SER A 1 257 ? 5.584   56.797 57.526 1.00 27.93 ? 257  SER X CA  1 
ATOM   2016 C C   . SER A 1 257 ? 4.494   55.914 56.944 1.00 29.47 ? 257  SER X C   1 
ATOM   2017 O O   . SER A 1 257 ? 4.428   54.718 57.230 1.00 28.90 ? 257  SER X O   1 
ATOM   2018 C CB  . SER A 1 257 ? 6.758   56.868 56.545 1.00 29.93 ? 257  SER X CB  1 
ATOM   2019 O OG  . SER A 1 257 ? 7.399   55.610 56.449 1.00 29.92 ? 257  SER X OG  1 
ATOM   2020 N N   . VAL A 1 258 ? 3.631   56.506 56.123 1.00 28.49 ? 258  VAL X N   1 
ATOM   2021 C CA  . VAL A 1 258 ? 2.561   55.745 55.496 1.00 26.69 ? 258  VAL X CA  1 
ATOM   2022 C C   . VAL A 1 258 ? 2.342   56.145 54.050 1.00 28.69 ? 258  VAL X C   1 
ATOM   2023 O O   . VAL A 1 258 ? 2.802   57.197 53.596 1.00 27.13 ? 258  VAL X O   1 
ATOM   2024 C CB  . VAL A 1 258 ? 1.190   55.901 56.227 1.00 29.45 ? 258  VAL X CB  1 
ATOM   2025 C CG1 . VAL A 1 258 ? 1.292   55.526 57.707 1.00 26.42 ? 258  VAL X CG1 1 
ATOM   2026 C CG2 . VAL A 1 258 ? 0.628   57.314 56.052 1.00 24.54 ? 258  VAL X CG2 1 
ATOM   2027 N N   . ALA A 1 259 ? 1.637   55.277 53.336 1.00 27.01 ? 259  ALA X N   1 
ATOM   2028 C CA  . ALA A 1 259 ? 1.235   55.539 51.971 1.00 28.14 ? 259  ALA X CA  1 
ATOM   2029 C C   . ALA A 1 259 ? -0.220  55.939 52.192 1.00 30.47 ? 259  ALA X C   1 
ATOM   2030 O O   . ALA A 1 259 ? -0.923  55.309 52.989 1.00 30.96 ? 259  ALA X O   1 
ATOM   2031 C CB  . ALA A 1 259 ? 1.315   54.270 51.126 1.00 24.58 ? 259  ALA X CB  1 
ATOM   2032 N N   . SER A 1 260 ? -0.671  56.978 51.503 1.00 29.86 ? 260  SER X N   1 
ATOM   2033 C CA  . SER A 1 260 ? -2.044  57.443 51.653 1.00 30.33 ? 260  SER X CA  1 
ATOM   2034 C C   . SER A 1 260 ? -2.565  58.004 50.339 1.00 31.06 ? 260  SER X C   1 
ATOM   2035 O O   . SER A 1 260 ? -1.815  58.139 49.375 1.00 31.51 ? 260  SER X O   1 
ATOM   2036 C CB  . SER A 1 260 ? -2.104  58.542 52.718 1.00 31.81 ? 260  SER X CB  1 
ATOM   2037 O OG  . SER A 1 260 ? -1.525  59.743 52.231 1.00 33.07 ? 260  SER X OG  1 
ATOM   2038 N N   . ASP A 1 261 ? -3.856  58.325 50.315 1.00 28.91 ? 261  ASP X N   1 
ATOM   2039 C CA  . ASP A 1 261 ? -4.500  58.906 49.143 1.00 30.98 ? 261  ASP X CA  1 
ATOM   2040 C C   . ASP A 1 261 ? -4.208  60.409 49.175 1.00 30.08 ? 261  ASP X C   1 
ATOM   2041 O O   . ASP A 1 261 ? -4.623  61.107 50.104 1.00 29.75 ? 261  ASP X O   1 
ATOM   2042 C CB  . ASP A 1 261 ? -6.015  58.648 49.201 1.00 28.92 ? 261  ASP X CB  1 
ATOM   2043 C CG  . ASP A 1 261 ? -6.746  59.108 47.948 1.00 31.86 ? 261  ASP X CG  1 
ATOM   2044 O OD1 . ASP A 1 261 ? -7.823  58.545 47.649 1.00 32.48 ? 261  ASP X OD1 1 
ATOM   2045 O OD2 . ASP A 1 261 ? -6.331  60.018 47.204 1.00 34.79 ? 261  ASP X OD2 1 
ATOM   2046 N N   . ARG A 1 262 ? -3.495  60.894 48.160 1.00 30.14 ? 262  ARG X N   1 
ATOM   2047 C CA  . ARG A 1 262 ? -3.112  62.310 48.058 1.00 31.65 ? 262  ARG X CA  1 
ATOM   2048 C C   . ARG A 1 262 ? -4.268  63.302 48.174 1.00 35.64 ? 262  ARG X C   1 
ATOM   2049 O O   . ARG A 1 262 ? -4.113  64.373 48.765 1.00 37.32 ? 262  ARG X O   1 
ATOM   2050 C CB  . ARG A 1 262 ? -2.355  62.569 46.751 1.00 35.78 ? 262  ARG X CB  1 
ATOM   2051 C CG  . ARG A 1 262 ? -0.869  62.222 46.786 1.00 32.99 ? 262  ARG X CG  1 
ATOM   2052 C CD  . ARG A 1 262 ? -0.030  63.022 45.785 1.00 39.03 ? 262  ARG X CD  1 
ATOM   2053 N NE  . ARG A 1 262 ? 1.255   62.385 45.506 1.00 31.78 ? 262  ARG X NE  1 
ATOM   2054 C CZ  . ARG A 1 262 ? 1.449   61.465 44.568 1.00 31.27 ? 262  ARG X CZ  1 
ATOM   2055 N NH1 . ARG A 1 262 ? 0.442   61.064 43.805 1.00 28.97 ? 262  ARG X NH1 1 
ATOM   2056 N NH2 . ARG A 1 262 ? 2.655   60.943 44.391 1.00 31.11 ? 262  ARG X NH2 1 
ATOM   2057 N N   . SER A 1 263 ? -5.419  62.944 47.609 1.00 35.70 ? 263  SER X N   1 
ATOM   2058 C CA  . SER A 1 263 ? -6.598  63.807 47.635 1.00 34.69 ? 263  SER X CA  1 
ATOM   2059 C C   . SER A 1 263 ? -7.263  63.920 49.006 1.00 34.26 ? 263  SER X C   1 
ATOM   2060 O O   . SER A 1 263 ? -8.040  64.845 49.245 1.00 34.04 ? 263  SER X O   1 
ATOM   2061 C CB  . SER A 1 263 ? -7.623  63.352 46.590 1.00 37.39 ? 263  SER X CB  1 
ATOM   2062 O OG  . SER A 1 263 ? -8.128  62.059 46.892 1.00 38.65 ? 263  SER X OG  1 
ATOM   2063 N N   . ILE A 1 264 ? -6.961  62.985 49.905 1.00 29.60 ? 264  ILE X N   1 
ATOM   2064 C CA  . ILE A 1 264 ? -7.547  63.000 51.245 1.00 30.23 ? 264  ILE X CA  1 
ATOM   2065 C C   . ILE A 1 264 ? -6.516  63.360 52.311 1.00 30.09 ? 264  ILE X C   1 
ATOM   2066 O O   . ILE A 1 264 ? -6.778  64.172 53.204 1.00 29.27 ? 264  ILE X O   1 
ATOM   2067 C CB  . ILE A 1 264 ? -8.192  61.632 51.571 1.00 32.71 ? 264  ILE X CB  1 
ATOM   2068 C CG1 . ILE A 1 264 ? -9.115  61.178 50.431 1.00 33.86 ? 264  ILE X CG1 1 
ATOM   2069 C CG2 . ILE A 1 264 ? -8.941  61.692 52.897 1.00 29.87 ? 264  ILE X CG2 1 
ATOM   2070 C CD1 . ILE A 1 264 ? -10.321 62.084 50.194 1.00 36.49 ? 264  ILE X CD1 1 
ATOM   2071 N N   . ILE A 1 265 ? -5.345  62.740 52.205 1.00 28.57 ? 265  ILE X N   1 
ATOM   2072 C CA  . ILE A 1 265 ? -4.243  62.956 53.130 1.00 29.22 ? 265  ILE X CA  1 
ATOM   2073 C C   . ILE A 1 265 ? -3.020  63.294 52.276 1.00 28.88 ? 265  ILE X C   1 
ATOM   2074 O O   . ILE A 1 265 ? -2.294  62.404 51.838 1.00 31.72 ? 265  ILE X O   1 
ATOM   2075 C CB  . ILE A 1 265 ? -3.987  61.674 53.959 1.00 28.76 ? 265  ILE X CB  1 
ATOM   2076 C CG1 . ILE A 1 265 ? -5.261  61.237 54.700 1.00 28.56 ? 265  ILE X CG1 1 
ATOM   2077 C CG2 . ILE A 1 265 ? -2.816  61.870 54.925 1.00 28.98 ? 265  ILE X CG2 1 
ATOM   2078 C CD1 . ILE A 1 265 ? -5.648  62.137 55.879 1.00 28.87 ? 265  ILE X CD1 1 
ATOM   2079 N N   . PRO A 1 266 ? -2.800  64.584 52.041 1.00 31.75 ? 266  PRO X N   1 
ATOM   2080 C CA  . PRO A 1 266 ? -1.684  65.041 51.207 1.00 29.40 ? 266  PRO X CA  1 
ATOM   2081 C C   . PRO A 1 266 ? -0.328  64.633 51.766 1.00 32.41 ? 266  PRO X C   1 
ATOM   2082 O O   . PRO A 1 266 ? -0.192  64.458 52.980 1.00 30.01 ? 266  PRO X O   1 
ATOM   2083 C CB  . PRO A 1 266 ? -1.817  66.570 51.245 1.00 31.81 ? 266  PRO X CB  1 
ATOM   2084 C CG  . PRO A 1 266 ? -3.233  66.833 51.649 1.00 36.57 ? 266  PRO X CG  1 
ATOM   2085 C CD  . PRO A 1 266 ? -3.607  65.703 52.562 1.00 32.01 ? 266  PRO X CD  1 
ATOM   2086 N N   . PRO A 1 267 ? 0.663   64.479 50.893 1.00 28.38 ? 267  PRO X N   1 
ATOM   2087 C CA  . PRO A 1 267 ? 2.015   64.126 51.335 1.00 29.96 ? 267  PRO X CA  1 
ATOM   2088 C C   . PRO A 1 267 ? 2.486   65.157 52.366 1.00 30.64 ? 267  PRO X C   1 
ATOM   2089 O O   . PRO A 1 267 ? 2.199   66.344 52.207 1.00 24.80 ? 267  PRO X O   1 
ATOM   2090 C CB  . PRO A 1 267 ? 2.845   64.256 50.052 1.00 29.76 ? 267  PRO X CB  1 
ATOM   2091 C CG  . PRO A 1 267 ? 1.866   64.029 48.946 1.00 31.95 ? 267  PRO X CG  1 
ATOM   2092 C CD  . PRO A 1 267 ? 0.569   64.626 49.428 1.00 27.87 ? 267  PRO X CD  1 
ATOM   2093 N N   . GLY A 1 268 ? 3.187   64.711 53.403 1.00 27.53 ? 268  GLY X N   1 
ATOM   2094 C CA  . GLY A 1 268 ? 3.681   65.614 54.425 1.00 30.11 ? 268  GLY X CA  1 
ATOM   2095 C C   . GLY A 1 268 ? 2.760   65.768 55.624 1.00 32.09 ? 268  GLY X C   1 
ATOM   2096 O O   . GLY A 1 268 ? 3.150   66.353 56.640 1.00 28.75 ? 268  GLY X O   1 
ATOM   2097 N N   . THR A 1 269 ? 1.540   65.248 55.509 1.00 27.60 ? 269  THR X N   1 
ATOM   2098 C CA  . THR A 1 269 ? 0.562   65.335 56.593 1.00 29.57 ? 269  THR X CA  1 
ATOM   2099 C C   . THR A 1 269 ? 1.041   64.558 57.820 1.00 29.27 ? 269  THR X C   1 
ATOM   2100 O O   . THR A 1 269 ? 1.527   63.438 57.695 1.00 26.93 ? 269  THR X O   1 
ATOM   2101 C CB  . THR A 1 269 ? -0.802  64.776 56.136 1.00 30.32 ? 269  THR X CB  1 
ATOM   2102 O OG1 . THR A 1 269 ? -1.280  65.519 55.008 1.00 31.86 ? 269  THR X OG1 1 
ATOM   2103 C CG2 . THR A 1 269 ? -1.877  65.024 57.195 1.00 28.27 ? 269  THR X CG2 1 
ATOM   2104 N N   . THR A 1 270 ? 0.898   65.160 58.997 1.00 26.29 ? 270  THR X N   1 
ATOM   2105 C CA  . THR A 1 270 ? 1.299   64.523 60.248 1.00 26.55 ? 270  THR X CA  1 
ATOM   2106 C C   . THR A 1 270 ? 0.111   63.768 60.845 1.00 28.73 ? 270  THR X C   1 
ATOM   2107 O O   . THR A 1 270 ? -0.985  64.313 60.967 1.00 28.59 ? 270  THR X O   1 
ATOM   2108 C CB  . THR A 1 270 ? 1.799   65.585 61.251 1.00 31.28 ? 270  THR X CB  1 
ATOM   2109 O OG1 . THR A 1 270 ? 2.975   66.222 60.735 1.00 29.15 ? 270  THR X OG1 1 
ATOM   2110 C CG2 . THR A 1 270 ? 2.285   64.930 62.535 1.00 25.29 ? 270  THR X CG2 1 
ATOM   2111 N N   . LEU A 1 271 ? 0.333   62.511 61.213 1.00 26.12 ? 271  LEU X N   1 
ATOM   2112 C CA  . LEU A 1 271 ? -0.722  61.688 61.793 1.00 26.74 ? 271  LEU X CA  1 
ATOM   2113 C C   . LEU A 1 271 ? -0.330  61.119 63.143 1.00 27.10 ? 271  LEU X C   1 
ATOM   2114 O O   . LEU A 1 271 ? 0.806   60.690 63.337 1.00 25.40 ? 271  LEU X O   1 
ATOM   2115 C CB  . LEU A 1 271 ? -1.053  60.510 60.866 1.00 24.58 ? 271  LEU X CB  1 
ATOM   2116 C CG  . LEU A 1 271 ? -1.227  60.821 59.380 1.00 31.04 ? 271  LEU X CG  1 
ATOM   2117 C CD1 . LEU A 1 271 ? -1.090  59.548 58.561 1.00 31.24 ? 271  LEU X CD1 1 
ATOM   2118 C CD2 . LEU A 1 271 ? -2.582  61.484 59.141 1.00 24.87 ? 271  LEU X CD2 1 
ATOM   2119 N N   . LEU A 1 272 ? -1.283  61.127 64.068 1.00 26.67 ? 272  LEU X N   1 
ATOM   2120 C CA  . LEU A 1 272 ? -1.102  60.539 65.386 1.00 26.58 ? 272  LEU X CA  1 
ATOM   2121 C C   . LEU A 1 272 ? -2.001  59.315 65.259 1.00 29.80 ? 272  LEU X C   1 
ATOM   2122 O O   . LEU A 1 272 ? -3.190  59.450 64.977 1.00 28.25 ? 272  LEU X O   1 
ATOM   2123 C CB  . LEU A 1 272 ? -1.628  61.465 66.486 1.00 26.21 ? 272  LEU X CB  1 
ATOM   2124 C CG  . LEU A 1 272 ? -1.622  60.869 67.898 1.00 29.66 ? 272  LEU X CG  1 
ATOM   2125 C CD1 . LEU A 1 272 ? -0.195  60.564 68.355 1.00 25.33 ? 272  LEU X CD1 1 
ATOM   2126 C CD2 . LEU A 1 272 ? -2.321  61.794 68.884 1.00 27.63 ? 272  LEU X CD2 1 
ATOM   2127 N N   . ALA A 1 273 ? -1.448  58.125 65.459 1.00 27.47 ? 273  ALA X N   1 
ATOM   2128 C CA  . ALA A 1 273 ? -2.252  56.930 65.279 1.00 30.65 ? 273  ALA X CA  1 
ATOM   2129 C C   . ALA A 1 273 ? -2.147  55.837 66.328 1.00 30.33 ? 273  ALA X C   1 
ATOM   2130 O O   . ALA A 1 273 ? -1.078  55.573 66.875 1.00 32.09 ? 273  ALA X O   1 
ATOM   2131 C CB  . ALA A 1 273 ? -1.977  56.340 63.908 1.00 27.07 ? 273  ALA X CB  1 
ATOM   2132 N N   . GLU A 1 274 ? -3.286  55.209 66.595 1.00 29.51 ? 274  GLU X N   1 
ATOM   2133 C CA  . GLU A 1 274 ? -3.341  54.074 67.497 1.00 31.03 ? 274  GLU X CA  1 
ATOM   2134 C C   . GLU A 1 274 ? -3.337  52.916 66.502 1.00 30.41 ? 274  GLU X C   1 
ATOM   2135 O O   . GLU A 1 274 ? -4.356  52.614 65.876 1.00 29.44 ? 274  GLU X O   1 
ATOM   2136 C CB  . GLU A 1 274 ? -4.624  54.084 68.333 1.00 28.31 ? 274  GLU X CB  1 
ATOM   2137 C CG  . GLU A 1 274 ? -4.599  55.069 69.496 1.00 35.62 ? 274  GLU X CG  1 
ATOM   2138 C CD  . GLU A 1 274 ? -3.820  54.561 70.699 1.00 36.73 ? 274  GLU X CD  1 
ATOM   2139 O OE1 . GLU A 1 274 ? -3.070  53.571 70.564 1.00 36.35 ? 274  GLU X OE1 1 
ATOM   2140 O OE2 . GLU A 1 274 ? -3.958  55.157 71.788 1.00 36.66 ? 274  GLU X OE2 1 
ATOM   2141 N N   . VAL A 1 275 ? -2.179  52.283 66.357 1.00 32.06 ? 275  VAL X N   1 
ATOM   2142 C CA  . VAL A 1 275 ? -2.002  51.187 65.411 1.00 31.68 ? 275  VAL X CA  1 
ATOM   2143 C C   . VAL A 1 275 ? -2.248  49.814 66.030 1.00 33.24 ? 275  VAL X C   1 
ATOM   2144 O O   . VAL A 1 275 ? -1.651  49.476 67.048 1.00 31.69 ? 275  VAL X O   1 
ATOM   2145 C CB  . VAL A 1 275 ? -0.579  51.227 64.805 1.00 32.56 ? 275  VAL X CB  1 
ATOM   2146 C CG1 . VAL A 1 275 ? -0.386  50.122 63.778 1.00 28.34 ? 275  VAL X CG1 1 
ATOM   2147 C CG2 . VAL A 1 275 ? -0.299  52.596 64.189 1.00 31.01 ? 275  VAL X CG2 1 
ATOM   2148 N N   . PRO A 1 276 ? -3.127  49.025 65.415 1.00 33.32 ? 276  PRO X N   1 
ATOM   2149 C CA  . PRO A 1 276 ? -3.428  47.676 65.911 1.00 34.86 ? 276  PRO X CA  1 
ATOM   2150 C C   . PRO A 1 276 ? -2.216  46.758 65.774 1.00 35.14 ? 276  PRO X C   1 
ATOM   2151 O O   . PRO A 1 276 ? -1.557  46.760 64.730 1.00 35.06 ? 276  PRO X O   1 
ATOM   2152 C CB  . PRO A 1 276 ? -4.558  47.205 64.990 1.00 35.00 ? 276  PRO X CB  1 
ATOM   2153 C CG  . PRO A 1 276 ? -4.401  48.018 63.743 1.00 34.74 ? 276  PRO X CG  1 
ATOM   2154 C CD  . PRO A 1 276 ? -3.899  49.360 64.204 1.00 34.76 ? 276  PRO X CD  1 
ATOM   2155 N N   . LEU A 1 277 ? -1.928  45.990 66.822 1.00 32.24 ? 277  LEU X N   1 
ATOM   2156 C CA  . LEU A 1 277 ? -0.799  45.064 66.811 1.00 35.00 ? 277  LEU X CA  1 
ATOM   2157 C C   . LEU A 1 277 ? -1.293  43.679 66.409 1.00 35.11 ? 277  LEU X C   1 
ATOM   2158 O O   . LEU A 1 277 ? -2.452  43.332 66.652 1.00 35.92 ? 277  LEU X O   1 
ATOM   2159 C CB  . LEU A 1 277 ? -0.116  45.019 68.181 1.00 33.53 ? 277  LEU X CB  1 
ATOM   2160 C CG  . LEU A 1 277 ? 0.608   46.287 68.647 1.00 34.23 ? 277  LEU X CG  1 
ATOM   2161 C CD1 . LEU A 1 277 ? 1.456   46.000 69.883 1.00 32.19 ? 277  LEU X CD1 1 
ATOM   2162 C CD2 . LEU A 1 277 ? 1.465   46.885 67.534 1.00 31.79 ? 277  LEU X CD2 1 
ATOM   2163 N N   . LEU A 1 278 ? -0.418  42.888 65.796 1.00 33.82 ? 278  LEU X N   1 
ATOM   2164 C CA  . LEU A 1 278 ? -0.805  41.555 65.343 1.00 37.64 ? 278  LEU X CA  1 
ATOM   2165 C C   . LEU A 1 278 ? -0.001  40.426 65.966 1.00 39.86 ? 278  LEU X C   1 
ATOM   2166 O O   . LEU A 1 278 ? 1.175   40.592 66.289 1.00 38.53 ? 278  LEU X O   1 
ATOM   2167 C CB  . LEU A 1 278 ? -0.710  41.454 63.815 1.00 35.93 ? 278  LEU X CB  1 
ATOM   2168 C CG  . LEU A 1 278 ? -1.110  42.666 62.972 1.00 37.27 ? 278  LEU X CG  1 
ATOM   2169 C CD1 . LEU A 1 278 ? -0.804  42.416 61.506 1.00 37.43 ? 278  LEU X CD1 1 
ATOM   2170 C CD2 . LEU A 1 278 ? -2.582  42.996 63.163 1.00 34.61 ? 278  LEU X CD2 1 
ATOM   2171 N N   . ASP A 1 279 ? -0.647  39.272 66.129 1.00 42.04 ? 279  ASP X N   1 
ATOM   2172 C CA  . ASP A 1 279 ? 0.022   38.101 66.680 1.00 45.56 ? 279  ASP X CA  1 
ATOM   2173 C C   . ASP A 1 279 ? 0.814   37.415 65.567 1.00 46.48 ? 279  ASP X C   1 
ATOM   2174 O O   . ASP A 1 279 ? 0.980   37.981 64.484 1.00 46.56 ? 279  ASP X O   1 
ATOM   2175 C CB  . ASP A 1 279 ? -0.970  37.142 67.362 1.00 44.86 ? 279  ASP X CB  1 
ATOM   2176 C CG  . ASP A 1 279 ? -2.006  36.565 66.404 1.00 46.03 ? 279  ASP X CG  1 
ATOM   2177 O OD1 . ASP A 1 279 ? -3.054  36.089 66.892 1.00 52.22 ? 279  ASP X OD1 1 
ATOM   2178 O OD2 . ASP A 1 279 ? -1.873  36.535 65.164 1.00 45.82 ? 279  ASP X OD2 1 
ATOM   2179 N N   . ASN A 1 280 ? 1.297   36.205 65.826 1.00 47.22 ? 280  ASN X N   1 
ATOM   2180 C CA  . ASN A 1 280 ? 2.082   35.471 64.836 1.00 51.69 ? 280  ASN X CA  1 
ATOM   2181 C C   . ASN A 1 280 ? 1.310   35.000 63.604 1.00 49.74 ? 280  ASN X C   1 
ATOM   2182 O O   . ASN A 1 280 ? 1.912   34.614 62.601 1.00 49.23 ? 280  ASN X O   1 
ATOM   2183 C CB  . ASN A 1 280 ? 2.827   34.303 65.488 1.00 55.74 ? 280  ASN X CB  1 
ATOM   2184 C CG  . ASN A 1 280 ? 4.228   34.684 65.930 1.00 66.33 ? 280  ASN X CG  1 
ATOM   2185 O OD1 . ASN A 1 280 ? 4.412   35.603 66.729 1.00 71.12 ? 280  ASN X OD1 1 
ATOM   2186 N ND2 . ASN A 1 280 ? 5.225   33.977 65.409 1.00 76.40 ? 280  ASN X ND2 1 
ATOM   2187 N N   . ASN A 1 281 ? -0.017  35.032 63.681 1.00 48.01 ? 281  ASN X N   1 
ATOM   2188 C CA  . ASN A 1 281 ? -0.861  34.612 62.565 1.00 48.74 ? 281  ASN X CA  1 
ATOM   2189 C C   . ASN A 1 281 ? -1.472  35.786 61.801 1.00 45.76 ? 281  ASN X C   1 
ATOM   2190 O O   . ASN A 1 281 ? -2.340  35.599 60.948 1.00 46.38 ? 281  ASN X O   1 
ATOM   2191 C CB  . ASN A 1 281 ? -1.961  33.662 63.050 1.00 48.82 ? 281  ASN X CB  1 
ATOM   2192 C CG  . ASN A 1 281 ? -1.404  32.388 63.655 1.00 54.95 ? 281  ASN X CG  1 
ATOM   2193 O OD1 . ASN A 1 281 ? -0.511  31.757 63.089 1.00 59.75 ? 281  ASN X OD1 1 
ATOM   2194 N ND2 . ASN A 1 281 ? -1.931  32.004 64.812 1.00 52.18 ? 281  ASN X ND2 1 
ATOM   2195 N N   . GLY A 1 282 ? -1.012  36.995 62.111 1.00 44.18 ? 282  GLY X N   1 
ATOM   2196 C CA  . GLY A 1 282 ? -1.509  38.193 61.457 1.00 40.18 ? 282  GLY X CA  1 
ATOM   2197 C C   . GLY A 1 282 ? -2.876  38.615 61.960 1.00 41.69 ? 282  GLY X C   1 
ATOM   2198 O O   . GLY A 1 282 ? -3.606  39.327 61.273 1.00 40.30 ? 282  GLY X O   1 
ATOM   2199 N N   . LYS A 1 283 ? -3.223  38.173 63.165 1.00 38.32 ? 283  LYS X N   1 
ATOM   2200 C CA  . LYS A 1 283 ? -4.508  38.508 63.763 1.00 39.35 ? 283  LYS X CA  1 
ATOM   2201 C C   . LYS A 1 283 ? -4.341  39.583 64.836 1.00 36.67 ? 283  LYS X C   1 
ATOM   2202 O O   . LYS A 1 283 ? -3.352  39.585 65.569 1.00 33.81 ? 283  LYS X O   1 
ATOM   2203 C CB  . LYS A 1 283 ? -5.143  37.255 64.379 1.00 38.90 ? 283  LYS X CB  1 
ATOM   2204 C CG  . LYS A 1 283 ? -6.633  37.374 64.662 1.00 47.72 ? 283  LYS X CG  1 
ATOM   2205 C CD  . LYS A 1 283 ? -6.945  37.059 66.117 1.00 60.37 ? 283  LYS X CD  1 
ATOM   2206 C CE  . LYS A 1 283 ? -7.652  35.721 66.253 1.00 63.28 ? 283  LYS X CE  1 
ATOM   2207 N NZ  . LYS A 1 283 ? -9.132  35.861 66.156 1.00 66.64 ? 283  LYS X NZ  1 
ATOM   2208 N N   . PHE A 1 284 ? -5.312  40.490 64.917 1.00 36.25 ? 284  PHE X N   1 
ATOM   2209 C CA  . PHE A 1 284 ? -5.305  41.561 65.912 1.00 36.80 ? 284  PHE X CA  1 
ATOM   2210 C C   . PHE A 1 284 ? -5.199  40.905 67.287 1.00 36.40 ? 284  PHE X C   1 
ATOM   2211 O O   . PHE A 1 284 ? -6.025  40.065 67.644 1.00 32.27 ? 284  PHE X O   1 
ATOM   2212 C CB  . PHE A 1 284 ? -6.598  42.378 65.798 1.00 39.56 ? 284  PHE X CB  1 
ATOM   2213 C CG  . PHE A 1 284 ? -6.836  43.320 66.946 1.00 40.08 ? 284  PHE X CG  1 
ATOM   2214 C CD1 . PHE A 1 284 ? -7.973  43.195 67.731 1.00 39.40 ? 284  PHE X CD1 1 
ATOM   2215 C CD2 . PHE A 1 284 ? -5.931  44.331 67.238 1.00 37.07 ? 284  PHE X CD2 1 
ATOM   2216 C CE1 . PHE A 1 284 ? -8.204  44.057 68.790 1.00 36.43 ? 284  PHE X CE1 1 
ATOM   2217 C CE2 . PHE A 1 284 ? -6.154  45.198 68.295 1.00 32.67 ? 284  PHE X CE2 1 
ATOM   2218 C CZ  . PHE A 1 284 ? -7.293  45.061 69.072 1.00 37.07 ? 284  PHE X CZ  1 
ATOM   2219 N N   . ASN A 1 285 ? -4.180  41.292 68.050 1.00 35.60 ? 285  ASN X N   1 
ATOM   2220 C CA  . ASN A 1 285 ? -3.940  40.707 69.367 1.00 37.74 ? 285  ASN X CA  1 
ATOM   2221 C C   . ASN A 1 285 ? -4.552  41.415 70.575 1.00 37.48 ? 285  ASN X C   1 
ATOM   2222 O O   . ASN A 1 285 ? -4.321  41.009 71.714 1.00 37.79 ? 285  ASN X O   1 
ATOM   2223 C CB  . ASN A 1 285 ? -2.442  40.460 69.581 1.00 39.26 ? 285  ASN X CB  1 
ATOM   2224 C CG  . ASN A 1 285 ? -1.650  41.748 69.757 1.00 40.94 ? 285  ASN X CG  1 
ATOM   2225 O OD1 . ASN A 1 285 ? -2.217  42.836 69.859 1.00 34.76 ? 285  ASN X OD1 1 
ATOM   2226 N ND2 . ASN A 1 285 ? -0.326  41.624 69.796 1.00 33.27 ? 285  ASN X ND2 1 
ATOM   2227 N N   . GLY A 1 286 ? -5.326  42.467 70.330 1.00 35.89 ? 286  GLY X N   1 
ATOM   2228 C CA  . GLY A 1 286 ? -5.961  43.204 71.408 1.00 36.91 ? 286  GLY X CA  1 
ATOM   2229 C C   . GLY A 1 286 ? -5.237  44.475 71.816 1.00 36.35 ? 286  GLY X C   1 
ATOM   2230 O O   . GLY A 1 286 ? -5.797  45.306 72.530 1.00 39.25 ? 286  GLY X O   1 
ATOM   2231 N N   . GLN A 1 287 ? -3.996  44.632 71.364 1.00 35.32 ? 287  GLN X N   1 
ATOM   2232 C CA  . GLN A 1 287 ? -3.202  45.806 71.718 1.00 35.61 ? 287  GLN X CA  1 
ATOM   2233 C C   . GLN A 1 287 ? -2.983  46.791 70.575 1.00 35.23 ? 287  GLN X C   1 
ATOM   2234 O O   . GLN A 1 287 ? -3.074  46.434 69.400 1.00 33.56 ? 287  GLN X O   1 
ATOM   2235 C CB  . GLN A 1 287 ? -1.847  45.383 72.289 1.00 37.15 ? 287  GLN X CB  1 
ATOM   2236 C CG  . GLN A 1 287 ? -1.927  44.506 73.533 1.00 45.14 ? 287  GLN X CG  1 
ATOM   2237 C CD  . GLN A 1 287 ? -0.570  43.963 73.941 1.00 61.74 ? 287  GLN X CD  1 
ATOM   2238 O OE1 . GLN A 1 287 ? -0.438  42.777 74.247 1.00 70.55 ? 287  GLN X OE1 1 
ATOM   2239 N NE2 . GLN A 1 287 ? 0.441   44.827 73.947 1.00 63.82 ? 287  GLN X NE2 1 
ATOM   2240 N N   . TYR A 1 288 ? -2.691  48.035 70.944 1.00 34.28 ? 288  TYR X N   1 
ATOM   2241 C CA  . TYR A 1 288 ? -2.433  49.105 69.990 1.00 34.11 ? 288  TYR X CA  1 
ATOM   2242 C C   . TYR A 1 288 ? -1.183  49.861 70.423 1.00 36.70 ? 288  TYR X C   1 
ATOM   2243 O O   . TYR A 1 288 ? -0.809  49.841 71.597 1.00 36.40 ? 288  TYR X O   1 
ATOM   2244 C CB  . TYR A 1 288 ? -3.591  50.109 69.959 1.00 33.40 ? 288  TYR X CB  1 
ATOM   2245 C CG  . TYR A 1 288 ? -4.955  49.536 69.645 1.00 32.30 ? 288  TYR X CG  1 
ATOM   2246 C CD1 . TYR A 1 288 ? -5.780  49.063 70.658 1.00 32.66 ? 288  TYR X CD1 1 
ATOM   2247 C CD2 . TYR A 1 288 ? -5.421  49.478 68.334 1.00 27.86 ? 288  TYR X CD2 1 
ATOM   2248 C CE1 . TYR A 1 288 ? -7.033  48.539 70.377 1.00 33.80 ? 288  TYR X CE1 1 
ATOM   2249 C CE2 . TYR A 1 288 ? -6.673  48.957 68.042 1.00 27.99 ? 288  TYR X CE2 1 
ATOM   2250 C CZ  . TYR A 1 288 ? -7.473  48.490 69.069 1.00 31.80 ? 288  TYR X CZ  1 
ATOM   2251 O OH  . TYR A 1 288 ? -8.716  47.971 68.792 1.00 30.28 ? 288  TYR X OH  1 
ATOM   2252 N N   . GLU A 1 289 ? -0.544  50.526 69.469 1.00 34.67 ? 289  GLU X N   1 
ATOM   2253 C CA  . GLU A 1 289 ? 0.639   51.326 69.753 1.00 31.29 ? 289  GLU X CA  1 
ATOM   2254 C C   . GLU A 1 289 ? 0.369   52.741 69.263 1.00 30.32 ? 289  GLU X C   1 
ATOM   2255 O O   . GLU A 1 289 ? -0.092  52.935 68.135 1.00 29.95 ? 289  GLU X O   1 
ATOM   2256 C CB  . GLU A 1 289 ? 1.875   50.752 69.054 1.00 31.23 ? 289  GLU X CB  1 
ATOM   2257 C CG  . GLU A 1 289 ? 2.660   49.758 69.898 1.00 32.73 ? 289  GLU X CG  1 
ATOM   2258 C CD  . GLU A 1 289 ? 3.822   49.128 69.147 1.00 32.85 ? 289  GLU X CD  1 
ATOM   2259 O OE1 . GLU A 1 289 ? 3.913   49.309 67.914 1.00 33.22 ? 289  GLU X OE1 1 
ATOM   2260 O OE2 . GLU A 1 289 ? 4.649   48.449 69.792 1.00 37.73 ? 289  GLU X OE2 1 
ATOM   2261 N N   . LEU A 1 290 ? 0.653   53.722 70.114 1.00 28.87 ? 290  LEU X N   1 
ATOM   2262 C CA  . LEU A 1 290 ? 0.461   55.128 69.771 1.00 28.47 ? 290  LEU X CA  1 
ATOM   2263 C C   . LEU A 1 290 ? 1.737   55.621 69.096 1.00 28.57 ? 290  LEU X C   1 
ATOM   2264 O O   . LEU A 1 290 ? 2.799   55.657 69.715 1.00 26.62 ? 290  LEU X O   1 
ATOM   2265 C CB  . LEU A 1 290 ? 0.164   55.952 71.030 1.00 26.17 ? 290  LEU X CB  1 
ATOM   2266 C CG  . LEU A 1 290 ? -0.268  57.409 70.835 1.00 33.51 ? 290  LEU X CG  1 
ATOM   2267 C CD1 . LEU A 1 290 ? -1.531  57.497 69.981 1.00 20.57 ? 290  LEU X CD1 1 
ATOM   2268 C CD2 . LEU A 1 290 ? -0.484  58.086 72.191 1.00 30.70 ? 290  LEU X CD2 1 
ATOM   2269 N N   . ARG A 1 291 ? 1.627   55.996 67.826 1.00 27.76 ? 291  ARG X N   1 
ATOM   2270 C CA  . ARG A 1 291 ? 2.784   56.455 67.061 1.00 29.81 ? 291  ARG X CA  1 
ATOM   2271 C C   . ARG A 1 291 ? 2.464   57.665 66.207 1.00 27.40 ? 291  ARG X C   1 
ATOM   2272 O O   . ARG A 1 291 ? 1.311   57.914 65.872 1.00 26.13 ? 291  ARG X O   1 
ATOM   2273 C CB  . ARG A 1 291 ? 3.223   55.359 66.081 1.00 29.98 ? 291  ARG X CB  1 
ATOM   2274 C CG  . ARG A 1 291 ? 4.023   54.220 66.671 1.00 39.31 ? 291  ARG X CG  1 
ATOM   2275 C CD  . ARG A 1 291 ? 4.398   53.154 65.642 1.00 36.66 ? 291  ARG X CD  1 
ATOM   2276 N NE  . ARG A 1 291 ? 4.938   51.966 66.288 1.00 37.78 ? 291  ARG X NE  1 
ATOM   2277 C CZ  . ARG A 1 291 ? 6.221   51.780 66.551 1.00 38.89 ? 291  ARG X CZ  1 
ATOM   2278 N NH1 . ARG A 1 291 ? 6.617   50.663 67.148 1.00 41.37 ? 291  ARG X NH1 1 
ATOM   2279 N NH2 . ARG A 1 291 ? 7.111   52.706 66.219 1.00 41.57 ? 291  ARG X NH2 1 
ATOM   2280 N N   . LEU A 1 292 ? 3.510   58.407 65.860 1.00 23.58 ? 292  LEU X N   1 
ATOM   2281 C CA  . LEU A 1 292 ? 3.394   59.553 64.975 1.00 26.29 ? 292  LEU X CA  1 
ATOM   2282 C C   . LEU A 1 292 ? 3.930   59.065 63.633 1.00 29.40 ? 292  LEU X C   1 
ATOM   2283 O O   . LEU A 1 292 ? 4.922   58.330 63.589 1.00 26.11 ? 292  LEU X O   1 
ATOM   2284 C CB  . LEU A 1 292 ? 4.254   60.710 65.479 1.00 23.59 ? 292  LEU X CB  1 
ATOM   2285 C CG  . LEU A 1 292 ? 3.628   61.543 66.597 1.00 28.63 ? 292  LEU X CG  1 
ATOM   2286 C CD1 . LEU A 1 292 ? 4.716   62.342 67.305 1.00 26.74 ? 292  LEU X CD1 1 
ATOM   2287 C CD2 . LEU A 1 292 ? 2.545   62.468 66.028 1.00 25.68 ? 292  LEU X CD2 1 
ATOM   2288 N N   . MET A 1 293 ? 3.281   59.469 62.546 1.00 28.95 ? 293  MET X N   1 
ATOM   2289 C CA  . MET A 1 293 ? 3.689   59.060 61.203 1.00 31.16 ? 293  MET X CA  1 
ATOM   2290 C C   . MET A 1 293 ? 3.414   60.177 60.210 1.00 29.83 ? 293  MET X C   1 
ATOM   2291 O O   . MET A 1 293 ? 2.568   61.036 60.454 1.00 30.89 ? 293  MET X O   1 
ATOM   2292 C CB  . MET A 1 293 ? 2.904   57.819 60.757 1.00 27.85 ? 293  MET X CB  1 
ATOM   2293 C CG  . MET A 1 293 ? 3.113   56.577 61.606 1.00 43.76 ? 293  MET X CG  1 
ATOM   2294 S SD  . MET A 1 293 ? 1.964   55.246 61.200 1.00 47.22 ? 293  MET X SD  1 
ATOM   2295 C CE  . MET A 1 293 ? 0.458   56.119 61.081 1.00 37.26 ? 293  MET X CE  1 
ATOM   2296 N N   . VAL A 1 294 ? 4.132   60.156 59.089 1.00 28.39 ? 294  VAL X N   1 
ATOM   2297 C CA  . VAL A 1 294 ? 3.958   61.161 58.044 1.00 25.72 ? 294  VAL X CA  1 
ATOM   2298 C C   . VAL A 1 294 ? 3.610   60.482 56.713 1.00 27.08 ? 294  VAL X C   1 
ATOM   2299 O O   . VAL A 1 294 ? 4.207   59.464 56.353 1.00 27.83 ? 294  VAL X O   1 
ATOM   2300 C CB  . VAL A 1 294 ? 5.236   62.033 57.873 1.00 26.13 ? 294  VAL X CB  1 
ATOM   2301 C CG1 . VAL A 1 294 ? 5.016   63.122 56.827 1.00 27.83 ? 294  VAL X CG1 1 
ATOM   2302 C CG2 . VAL A 1 294 ? 5.648   62.663 59.207 1.00 26.49 ? 294  VAL X CG2 1 
ATOM   2303 N N   . ALA A 1 295 ? 2.639   61.038 55.991 1.00 29.45 ? 295  ALA X N   1 
ATOM   2304 C CA  . ALA A 1 295 ? 2.250   60.494 54.686 1.00 29.09 ? 295  ALA X CA  1 
ATOM   2305 C C   . ALA A 1 295 ? 3.361   60.866 53.704 1.00 28.27 ? 295  ALA X C   1 
ATOM   2306 O O   . ALA A 1 295 ? 3.551   62.045 53.391 1.00 27.93 ? 295  ALA X O   1 
ATOM   2307 C CB  . ALA A 1 295 ? 0.922   61.093 54.238 1.00 26.00 ? 295  ALA X CB  1 
ATOM   2308 N N   . LEU A 1 296 ? 4.094   59.866 53.221 1.00 27.20 ? 296  LEU X N   1 
ATOM   2309 C CA  . LEU A 1 296 ? 5.214   60.118 52.315 1.00 30.71 ? 296  LEU X CA  1 
ATOM   2310 C C   . LEU A 1 296 ? 5.271   59.180 51.116 1.00 28.84 ? 296  LEU X C   1 
ATOM   2311 O O   . LEU A 1 296 ? 6.281   59.120 50.417 1.00 27.72 ? 296  LEU X O   1 
ATOM   2312 C CB  . LEU A 1 296 ? 6.539   60.046 53.087 1.00 28.24 ? 296  LEU X CB  1 
ATOM   2313 C CG  . LEU A 1 296 ? 6.788   61.122 54.150 1.00 30.39 ? 296  LEU X CG  1 
ATOM   2314 C CD1 . LEU A 1 296 ? 7.971   60.749 55.022 1.00 24.75 ? 296  LEU X CD1 1 
ATOM   2315 C CD2 . LEU A 1 296 ? 7.000   62.501 53.519 1.00 23.37 ? 296  LEU X CD2 1 
ATOM   2316 N N   . ASP A 1 297 ? 4.188   58.453 50.879 1.00 29.39 ? 297  ASP X N   1 
ATOM   2317 C CA  . ASP A 1 297 ? 4.131   57.510 49.769 1.00 31.03 ? 297  ASP X CA  1 
ATOM   2318 C C   . ASP A 1 297 ? 2.687   57.364 49.312 1.00 31.39 ? 297  ASP X C   1 
ATOM   2319 O O   . ASP A 1 297 ? 1.773   57.898 49.943 1.00 26.64 ? 297  ASP X O   1 
ATOM   2320 C CB  . ASP A 1 297 ? 4.657   56.145 50.238 1.00 30.50 ? 297  ASP X CB  1 
ATOM   2321 C CG  . ASP A 1 297 ? 5.218   55.295 49.103 1.00 32.92 ? 297  ASP X CG  1 
ATOM   2322 O OD1 . ASP A 1 297 ? 5.244   55.747 47.936 1.00 33.57 ? 297  ASP X OD1 1 
ATOM   2323 O OD2 . ASP A 1 297 ? 5.659   54.147 49.298 1.00 31.00 ? 297  ASP X OD2 1 
ATOM   2324 N N   . VAL A 1 298 ? 2.494   56.647 48.210 1.00 27.15 ? 298  VAL X N   1 
ATOM   2325 C CA  . VAL A 1 298 ? 1.168   56.376 47.669 1.00 28.97 ? 298  VAL X CA  1 
ATOM   2326 C C   . VAL A 1 298 ? 1.149   54.916 47.235 1.00 28.63 ? 298  VAL X C   1 
ATOM   2327 O O   . VAL A 1 298 ? 2.191   54.257 47.202 1.00 27.85 ? 298  VAL X O   1 
ATOM   2328 C CB  . VAL A 1 298 ? 0.804   57.277 46.451 1.00 32.43 ? 298  VAL X CB  1 
ATOM   2329 C CG1 . VAL A 1 298 ? 0.739   58.750 46.852 1.00 27.63 ? 298  VAL X CG1 1 
ATOM   2330 C CG2 . VAL A 1 298 ? 1.758   57.050 45.278 1.00 26.56 ? 298  VAL X CG2 1 
ATOM   2331 N N   . GLY A 1 299 ? -0.034  54.418 46.906 1.00 30.04 ? 299  GLY X N   1 
ATOM   2332 C CA  . GLY A 1 299 ? -0.200  53.046 46.464 1.00 29.42 ? 299  GLY X CA  1 
ATOM   2333 C C   . GLY A 1 299 ? -1.386  52.961 45.529 1.00 29.72 ? 299  GLY X C   1 
ATOM   2334 O O   . GLY A 1 299 ? -2.381  53.654 45.731 1.00 31.15 ? 299  GLY X O   1 
ATOM   2335 N N   . GLY A 1 300 ? -1.282  52.111 44.510 1.00 31.89 ? 300  GLY X N   1 
ATOM   2336 C CA  . GLY A 1 300 ? -2.339  51.949 43.524 1.00 33.31 ? 300  GLY X CA  1 
ATOM   2337 C C   . GLY A 1 300 ? -3.707  51.616 44.091 1.00 33.97 ? 300  GLY X C   1 
ATOM   2338 O O   . GLY A 1 300 ? -4.729  52.055 43.559 1.00 31.31 ? 300  GLY X O   1 
ATOM   2339 N N   . ALA A 1 301 ? -3.730  50.842 45.171 1.00 34.29 ? 301  ALA X N   1 
ATOM   2340 C CA  . ALA A 1 301 ? -4.988  50.454 45.803 1.00 37.74 ? 301  ALA X CA  1 
ATOM   2341 C C   . ALA A 1 301 ? -5.159  51.082 47.191 1.00 38.15 ? 301  ALA X C   1 
ATOM   2342 O O   . ALA A 1 301 ? -5.959  50.608 48.002 1.00 39.29 ? 301  ALA X O   1 
ATOM   2343 C CB  . ALA A 1 301 ? -5.102  48.933 45.874 1.00 37.28 ? 301  ALA X CB  1 
ATOM   2344 N N   . ILE A 1 302 ? -4.403  52.145 47.460 1.00 35.01 ? 302  ILE X N   1 
ATOM   2345 C CA  . ILE A 1 302 ? -4.495  52.848 48.741 1.00 33.89 ? 302  ILE X CA  1 
ATOM   2346 C C   . ILE A 1 302 ? -5.277  54.136 48.495 1.00 35.70 ? 302  ILE X C   1 
ATOM   2347 O O   . ILE A 1 302 ? -4.705  55.167 48.122 1.00 32.43 ? 302  ILE X O   1 
ATOM   2348 C CB  . ILE A 1 302 ? -3.093  53.143 49.314 1.00 34.23 ? 302  ILE X CB  1 
ATOM   2349 C CG1 . ILE A 1 302 ? -2.260  51.859 49.388 1.00 33.43 ? 302  ILE X CG1 1 
ATOM   2350 C CG2 . ILE A 1 302 ? -3.197  53.792 50.695 1.00 34.05 ? 302  ILE X CG2 1 
ATOM   2351 C CD1 . ILE A 1 302 ? -2.888  50.750 50.214 1.00 35.38 ? 302  ILE X CD1 1 
ATOM   2352 N N   . LYS A 1 303 ? -6.590  54.061 48.705 1.00 32.82 ? 303  LYS X N   1 
ATOM   2353 C CA  . LYS A 1 303 ? -7.486  55.188 48.466 1.00 33.55 ? 303  LYS X CA  1 
ATOM   2354 C C   . LYS A 1 303 ? -8.367  55.539 49.662 1.00 35.02 ? 303  LYS X C   1 
ATOM   2355 O O   . LYS A 1 303 ? -8.507  54.754 50.598 1.00 32.80 ? 303  LYS X O   1 
ATOM   2356 C CB  . LYS A 1 303 ? -8.375  54.884 47.252 1.00 36.61 ? 303  LYS X CB  1 
ATOM   2357 C CG  . LYS A 1 303 ? -7.608  54.462 45.998 1.00 35.74 ? 303  LYS X CG  1 
ATOM   2358 C CD  . LYS A 1 303 ? -7.136  55.678 45.209 1.00 46.49 ? 303  LYS X CD  1 
ATOM   2359 C CE  . LYS A 1 303 ? -6.229  55.282 44.051 1.00 48.45 ? 303  LYS X CE  1 
ATOM   2360 N NZ  . LYS A 1 303 ? -5.227  56.346 43.755 1.00 44.21 ? 303  LYS X NZ  1 
ATOM   2361 N N   . GLY A 1 304 ? -8.964  56.727 49.617 1.00 33.76 ? 304  GLY X N   1 
ATOM   2362 C CA  . GLY A 1 304 ? -9.834  57.191 50.681 1.00 34.04 ? 304  GLY X CA  1 
ATOM   2363 C C   . GLY A 1 304 ? -9.088  57.395 51.985 1.00 32.41 ? 304  GLY X C   1 
ATOM   2364 O O   . GLY A 1 304 ? -8.033  58.026 52.013 1.00 33.91 ? 304  GLY X O   1 
ATOM   2365 N N   . GLN A 1 305 ? -9.638  56.855 53.068 1.00 31.25 ? 305  GLN X N   1 
ATOM   2366 C CA  . GLN A 1 305 ? -9.019  56.977 54.383 1.00 31.36 ? 305  GLN X CA  1 
ATOM   2367 C C   . GLN A 1 305 ? -8.252  55.713 54.782 1.00 33.94 ? 305  GLN X C   1 
ATOM   2368 O O   . GLN A 1 305 ? -8.065  55.423 55.964 1.00 37.41 ? 305  GLN X O   1 
ATOM   2369 C CB  . GLN A 1 305 ? -10.067 57.355 55.432 1.00 29.03 ? 305  GLN X CB  1 
ATOM   2370 C CG  . GLN A 1 305 ? -10.612 58.771 55.265 1.00 28.64 ? 305  GLN X CG  1 
ATOM   2371 C CD  . GLN A 1 305 ? -11.252 59.311 56.530 1.00 29.20 ? 305  GLN X CD  1 
ATOM   2372 O OE1 . GLN A 1 305 ? -11.214 58.665 57.577 1.00 30.38 ? 305  GLN X OE1 1 
ATOM   2373 N NE2 . GLN A 1 305 ? -11.842 60.497 56.438 1.00 34.26 ? 305  GLN X NE2 1 
ATOM   2374 N N   . HIS A 1 306 ? -7.808  54.966 53.777 1.00 34.04 ? 306  HIS X N   1 
ATOM   2375 C CA  . HIS A 1 306 ? -7.047  53.737 53.982 1.00 28.66 ? 306  HIS X CA  1 
ATOM   2376 C C   . HIS A 1 306 ? -5.564  54.116 54.050 1.00 30.16 ? 306  HIS X C   1 
ATOM   2377 O O   . HIS A 1 306 ? -5.088  54.918 53.246 1.00 31.35 ? 306  HIS X O   1 
ATOM   2378 C CB  . HIS A 1 306 ? -7.337  52.781 52.810 1.00 29.61 ? 306  HIS X CB  1 
ATOM   2379 C CG  . HIS A 1 306 ? -6.508  51.531 52.794 1.00 32.55 ? 306  HIS X CG  1 
ATOM   2380 N ND1 . HIS A 1 306 ? -6.520  50.655 51.729 1.00 32.60 ? 306  HIS X ND1 1 
ATOM   2381 C CD2 . HIS A 1 306 ? -5.649  51.008 53.701 1.00 31.82 ? 306  HIS X CD2 1 
ATOM   2382 C CE1 . HIS A 1 306 ? -5.702  49.648 51.979 1.00 34.87 ? 306  HIS X CE1 1 
ATOM   2383 N NE2 . HIS A 1 306 ? -5.160  49.838 53.169 1.00 31.75 ? 306  HIS X NE2 1 
ATOM   2384 N N   . PHE A 1 307 ? -4.842  53.548 55.013 1.00 30.27 ? 307  PHE X N   1 
ATOM   2385 C CA  . PHE A 1 307 ? -3.417  53.817 55.163 1.00 29.23 ? 307  PHE X CA  1 
ATOM   2386 C C   . PHE A 1 307 ? -2.607  52.540 55.041 1.00 31.93 ? 307  PHE X C   1 
ATOM   2387 O O   . PHE A 1 307 ? -3.022  51.478 55.517 1.00 29.14 ? 307  PHE X O   1 
ATOM   2388 C CB  . PHE A 1 307 ? -3.103  54.407 56.543 1.00 31.95 ? 307  PHE X CB  1 
ATOM   2389 C CG  . PHE A 1 307 ? -3.512  55.835 56.712 1.00 31.98 ? 307  PHE X CG  1 
ATOM   2390 C CD1 . PHE A 1 307 ? -4.377  56.197 57.735 1.00 31.93 ? 307  PHE X CD1 1 
ATOM   2391 C CD2 . PHE A 1 307 ? -3.035  56.820 55.859 1.00 34.32 ? 307  PHE X CD2 1 
ATOM   2392 C CE1 . PHE A 1 307 ? -4.761  57.515 57.905 1.00 26.44 ? 307  PHE X CE1 1 
ATOM   2393 C CE2 . PHE A 1 307 ? -3.419  58.143 56.024 1.00 29.74 ? 307  PHE X CE2 1 
ATOM   2394 C CZ  . PHE A 1 307 ? -4.281  58.489 57.047 1.00 25.37 ? 307  PHE X CZ  1 
ATOM   2395 N N   . ASP A 1 308 ? -1.448  52.651 54.402 1.00 29.77 ? 308  ASP X N   1 
ATOM   2396 C CA  . ASP A 1 308 ? -0.535  51.526 54.274 1.00 31.24 ? 308  ASP X CA  1 
ATOM   2397 C C   . ASP A 1 308 ? 0.691   51.940 55.081 1.00 31.19 ? 308  ASP X C   1 
ATOM   2398 O O   . ASP A 1 308 ? 1.453   52.810 54.657 1.00 32.69 ? 308  ASP X O   1 
ATOM   2399 C CB  . ASP A 1 308 ? -0.159  51.280 52.810 1.00 30.25 ? 308  ASP X CB  1 
ATOM   2400 C CG  . ASP A 1 308 ? 0.083   49.811 52.508 1.00 37.89 ? 308  ASP X CG  1 
ATOM   2401 O OD1 . ASP A 1 308 ? 0.335   49.470 51.330 1.00 34.32 ? 308  ASP X OD1 1 
ATOM   2402 O OD2 . ASP A 1 308 ? 0.041   48.925 53.386 1.00 36.70 ? 308  ASP X OD2 1 
ATOM   2403 N N   . ILE A 1 309 ? 0.875   51.327 56.247 1.00 29.76 ? 309  ILE X N   1 
ATOM   2404 C CA  . ILE A 1 309 ? 2.009   51.665 57.101 1.00 31.71 ? 309  ILE X CA  1 
ATOM   2405 C C   . ILE A 1 309 ? 3.282   50.999 56.625 1.00 30.38 ? 309  ILE X C   1 
ATOM   2406 O O   . ILE A 1 309 ? 3.325   49.778 56.463 1.00 28.11 ? 309  ILE X O   1 
ATOM   2407 C CB  . ILE A 1 309 ? 1.767   51.230 58.567 1.00 32.34 ? 309  ILE X CB  1 
ATOM   2408 C CG1 . ILE A 1 309 ? 0.402   51.682 59.065 1.00 43.54 ? 309  ILE X CG1 1 
ATOM   2409 C CG2 . ILE A 1 309 ? 2.870   51.771 59.475 1.00 35.23 ? 309  ILE X CG2 1 
ATOM   2410 C CD1 . ILE A 1 309 ? -0.022  50.963 60.326 1.00 54.77 ? 309  ILE X CD1 1 
ATOM   2411 N N   . TYR A 1 310 ? 4.319   51.797 56.403 1.00 26.78 ? 310  TYR X N   1 
ATOM   2412 C CA  . TYR A 1 310 ? 5.595   51.238 55.993 1.00 31.26 ? 310  TYR X CA  1 
ATOM   2413 C C   . TYR A 1 310 ? 6.223   50.668 57.259 1.00 32.08 ? 310  TYR X C   1 
ATOM   2414 O O   . TYR A 1 310 ? 6.535   51.404 58.197 1.00 30.94 ? 310  TYR X O   1 
ATOM   2415 C CB  . TYR A 1 310 ? 6.508   52.303 55.383 1.00 29.54 ? 310  TYR X CB  1 
ATOM   2416 C CG  . TYR A 1 310 ? 7.857   51.747 54.983 1.00 32.07 ? 310  TYR X CG  1 
ATOM   2417 C CD1 . TYR A 1 310 ? 9.025   52.191 55.595 1.00 25.94 ? 310  TYR X CD1 1 
ATOM   2418 C CD2 . TYR A 1 310 ? 7.962   50.771 53.997 1.00 29.92 ? 310  TYR X CD2 1 
ATOM   2419 C CE1 . TYR A 1 310 ? 10.259  51.681 55.233 1.00 29.44 ? 310  TYR X CE1 1 
ATOM   2420 C CE2 . TYR A 1 310 ? 9.197   50.254 53.628 1.00 29.61 ? 310  TYR X CE2 1 
ATOM   2421 C CZ  . TYR A 1 310 ? 10.340  50.714 54.250 1.00 33.00 ? 310  TYR X CZ  1 
ATOM   2422 O OH  . TYR A 1 310 ? 11.568  50.209 53.891 1.00 29.92 ? 310  TYR X OH  1 
ATOM   2423 N N   . GLN A 1 311 ? 6.406   49.354 57.280 1.00 34.51 ? 311  GLN X N   1 
ATOM   2424 C CA  . GLN A 1 311 ? 6.959   48.683 58.451 1.00 30.95 ? 311  GLN X CA  1 
ATOM   2425 C C   . GLN A 1 311 ? 8.476   48.677 58.551 1.00 31.28 ? 311  GLN X C   1 
ATOM   2426 O O   . GLN A 1 311 ? 9.033   48.461 59.629 1.00 32.54 ? 311  GLN X O   1 
ATOM   2427 C CB  . GLN A 1 311 ? 6.404   47.263 58.547 1.00 28.09 ? 311  GLN X CB  1 
ATOM   2428 C CG  . GLN A 1 311 ? 4.938   47.228 58.968 1.00 29.83 ? 311  GLN X CG  1 
ATOM   2429 C CD  . GLN A 1 311 ? 4.759   47.559 60.440 1.00 27.43 ? 311  GLN X CD  1 
ATOM   2430 O OE1 . GLN A 1 311 ? 5.731   47.582 61.191 1.00 30.16 ? 311  GLN X OE1 1 
ATOM   2431 N NE2 . GLN A 1 311 ? 3.523   47.813 60.853 1.00 34.47 ? 311  GLN X NE2 1 
ATOM   2432 N N   . GLY A 1 312 ? 9.149   48.916 57.433 1.00 31.45 ? 312  GLY X N   1 
ATOM   2433 C CA  . GLY A 1 312 ? 10.601  48.914 57.427 1.00 28.73 ? 312  GLY X CA  1 
ATOM   2434 C C   . GLY A 1 312 ? 11.144  47.860 56.482 1.00 31.34 ? 312  GLY X C   1 
ATOM   2435 O O   . GLY A 1 312 ? 10.463  47.454 55.546 1.00 30.23 ? 312  GLY X O   1 
ATOM   2436 N N   . ILE A 1 313 ? 12.370  47.410 56.733 1.00 32.34 ? 313  ILE X N   1 
ATOM   2437 C CA  . ILE A 1 313 ? 13.012  46.419 55.879 1.00 33.24 ? 313  ILE X CA  1 
ATOM   2438 C C   . ILE A 1 313 ? 13.344  45.118 56.615 1.00 32.15 ? 313  ILE X C   1 
ATOM   2439 O O   . ILE A 1 313 ? 13.734  45.137 57.783 1.00 31.91 ? 313  ILE X O   1 
ATOM   2440 C CB  . ILE A 1 313 ? 14.287  47.040 55.237 1.00 31.89 ? 313  ILE X CB  1 
ATOM   2441 C CG1 . ILE A 1 313 ? 14.952  46.065 54.263 1.00 33.60 ? 313  ILE X CG1 1 
ATOM   2442 C CG2 . ILE A 1 313 ? 15.270  47.513 56.309 1.00 36.52 ? 313  ILE X CG2 1 
ATOM   2443 C CD1 . ILE A 1 313 ? 15.986  46.716 53.348 1.00 30.21 ? 313  ILE X CD1 1 
ATOM   2444 N N   . GLY A 1 314 ? 13.181  43.988 55.929 1.00 31.64 ? 314  GLY X N   1 
ATOM   2445 C CA  . GLY A 1 314 ? 13.506  42.698 56.514 1.00 31.25 ? 314  GLY X CA  1 
ATOM   2446 C C   . GLY A 1 314 ? 12.358  41.866 57.058 1.00 33.01 ? 314  GLY X C   1 
ATOM   2447 O O   . GLY A 1 314 ? 11.199  42.277 57.019 1.00 30.34 ? 314  GLY X O   1 
ATOM   2448 N N   . PRO A 1 315 ? 12.705  40.689 57.577 1.00 34.05 ? 315  PRO X N   1 
ATOM   2449 C CA  . PRO A 1 315 ? 11.736  39.724 58.116 1.00 33.80 ? 315  PRO X CA  1 
ATOM   2450 C C   . PRO A 1 315 ? 10.831  40.234 59.232 1.00 32.96 ? 315  PRO X C   1 
ATOM   2451 O O   . PRO A 1 315 ? 9.637   39.939 59.203 1.00 33.92 ? 315  PRO X O   1 
ATOM   2452 C CB  . PRO A 1 315 ? 12.625  38.588 58.637 1.00 37.20 ? 315  PRO X CB  1 
ATOM   2453 C CG  . PRO A 1 315 ? 13.906  38.727 57.882 1.00 37.09 ? 315  PRO X CG  1 
ATOM   2454 C CD  . PRO A 1 315 ? 14.091  40.202 57.684 1.00 32.25 ? 315  PRO X CD  1 
ATOM   2455 N N   . GLU A 1 316 ? 11.377  40.976 60.193 1.00 32.42 ? 316  GLU X N   1 
ATOM   2456 C CA  . GLU A 1 316 ? 10.565  41.490 61.292 1.00 32.72 ? 316  GLU X CA  1 
ATOM   2457 C C   . GLU A 1 316 ? 9.507   42.462 60.781 1.00 33.43 ? 316  GLU X C   1 
ATOM   2458 O O   . GLU A 1 316 ? 8.359   42.426 61.224 1.00 34.26 ? 316  GLU X O   1 
ATOM   2459 C CB  . GLU A 1 316 ? 11.429  42.119 62.386 1.00 33.97 ? 316  GLU X CB  1 
ATOM   2460 C CG  . GLU A 1 316 ? 12.210  41.108 63.215 1.00 38.69 ? 316  GLU X CG  1 
ATOM   2461 C CD  . GLU A 1 316 ? 11.375  39.901 63.614 1.00 56.44 ? 316  GLU X CD  1 
ATOM   2462 O OE1 . GLU A 1 316 ? 10.411  40.073 64.391 1.00 58.10 ? 316  GLU X OE1 1 
ATOM   2463 O OE2 . GLU A 1 316 ? 11.680  38.778 63.151 1.00 52.18 ? 316  GLU X OE2 1 
ATOM   2464 N N   . ALA A 1 317 ? 9.899   43.327 59.849 1.00 29.42 ? 317  ALA X N   1 
ATOM   2465 C CA  . ALA A 1 317 ? 8.969   44.282 59.251 1.00 31.01 ? 317  ALA X CA  1 
ATOM   2466 C C   . ALA A 1 317 ? 7.899   43.496 58.494 1.00 29.04 ? 317  ALA X C   1 
ATOM   2467 O O   . ALA A 1 317 ? 6.724   43.868 58.486 1.00 29.74 ? 317  ALA X O   1 
ATOM   2468 C CB  . ALA A 1 317 ? 9.707   45.222 58.307 1.00 32.53 ? 317  ALA X CB  1 
ATOM   2469 N N   . GLY A 1 318 ? 8.322   42.405 57.861 1.00 29.04 ? 318  GLY X N   1 
ATOM   2470 C CA  . GLY A 1 318 ? 7.420   41.545 57.114 1.00 31.80 ? 318  GLY X CA  1 
ATOM   2471 C C   . GLY A 1 318 ? 6.349   40.928 57.993 1.00 32.37 ? 318  GLY X C   1 
ATOM   2472 O O   . GLY A 1 318 ? 5.184   40.857 57.601 1.00 32.29 ? 318  GLY X O   1 
ATOM   2473 N N   . HIS A 1 319 ? 6.745   40.484 59.183 1.00 30.53 ? 319  HIS X N   1 
ATOM   2474 C CA  . HIS A 1 319 ? 5.814   39.871 60.128 1.00 35.68 ? 319  HIS X CA  1 
ATOM   2475 C C   . HIS A 1 319 ? 4.792   40.880 60.656 1.00 35.43 ? 319  HIS X C   1 
ATOM   2476 O O   . HIS A 1 319 ? 3.623   40.545 60.854 1.00 38.65 ? 319  HIS X O   1 
ATOM   2477 C CB  . HIS A 1 319 ? 6.570   39.242 61.304 1.00 35.21 ? 319  HIS X CB  1 
ATOM   2478 C CG  . HIS A 1 319 ? 7.408   38.061 60.925 1.00 42.79 ? 319  HIS X CG  1 
ATOM   2479 N ND1 . HIS A 1 319 ? 6.963   37.075 60.069 1.00 49.17 ? 319  HIS X ND1 1 
ATOM   2480 C CD2 . HIS A 1 319 ? 8.664   37.707 61.285 1.00 46.37 ? 319  HIS X CD2 1 
ATOM   2481 C CE1 . HIS A 1 319 ? 7.910   36.166 59.919 1.00 51.83 ? 319  HIS X CE1 1 
ATOM   2482 N NE2 . HIS A 1 319 ? 8.952   36.526 60.646 1.00 50.17 ? 319  HIS X NE2 1 
ATOM   2483 N N   . ARG A 1 320 ? 5.243   42.112 60.878 1.00 31.79 ? 320  ARG X N   1 
ATOM   2484 C CA  . ARG A 1 320 ? 4.384   43.181 61.389 1.00 33.25 ? 320  ARG X CA  1 
ATOM   2485 C C   . ARG A 1 320 ? 3.411   43.717 60.339 1.00 33.34 ? 320  ARG X C   1 
ATOM   2486 O O   . ARG A 1 320 ? 2.360   44.268 60.678 1.00 32.02 ? 320  ARG X O   1 
ATOM   2487 C CB  . ARG A 1 320 ? 5.236   44.342 61.918 1.00 31.25 ? 320  ARG X CB  1 
ATOM   2488 C CG  . ARG A 1 320 ? 5.950   44.069 63.241 1.00 31.43 ? 320  ARG X CG  1 
ATOM   2489 C CD  . ARG A 1 320 ? 6.666   45.288 63.824 1.00 31.91 ? 320  ARG X CD  1 
ATOM   2490 N NE  . ARG A 1 320 ? 7.465   45.997 62.823 1.00 31.54 ? 320  ARG X NE  1 
ATOM   2491 C CZ  . ARG A 1 320 ? 8.789   45.928 62.731 1.00 38.18 ? 320  ARG X CZ  1 
ATOM   2492 N NH1 . ARG A 1 320 ? 9.487   45.180 63.579 1.00 31.67 ? 320  ARG X NH1 1 
ATOM   2493 N NH2 . ARG A 1 320 ? 9.421   46.609 61.786 1.00 26.48 ? 320  ARG X NH2 1 
ATOM   2494 N N   . ALA A 1 321 ? 3.765   43.554 59.067 1.00 33.11 ? 321  ALA X N   1 
ATOM   2495 C CA  . ALA A 1 321 ? 2.943   44.047 57.965 1.00 36.03 ? 321  ALA X CA  1 
ATOM   2496 C C   . ALA A 1 321 ? 1.546   43.444 57.867 1.00 36.27 ? 321  ALA X C   1 
ATOM   2497 O O   . ALA A 1 321 ? 0.597   44.139 57.512 1.00 31.69 ? 321  ALA X O   1 
ATOM   2498 C CB  . ALA A 1 321 ? 3.678   43.909 56.640 1.00 37.19 ? 321  ALA X CB  1 
ATOM   2499 N N   . GLY A 1 322 ? 1.422   42.157 58.179 1.00 34.84 ? 322  GLY X N   1 
ATOM   2500 C CA  . GLY A 1 322 ? 0.139   41.482 58.104 1.00 33.56 ? 322  GLY X CA  1 
ATOM   2501 C C   . GLY A 1 322 ? -0.227  41.151 56.670 1.00 35.55 ? 322  GLY X C   1 
ATOM   2502 O O   . GLY A 1 322 ? 0.542   41.439 55.748 1.00 34.00 ? 322  GLY X O   1 
ATOM   2503 N N   . TRP A 1 323 ? -1.400  40.551 56.478 1.00 33.33 ? 323  TRP X N   1 
ATOM   2504 C CA  . TRP A 1 323 ? -1.855  40.170 55.142 1.00 35.12 ? 323  TRP X CA  1 
ATOM   2505 C C   . TRP A 1 323 ? -3.325  40.469 54.847 1.00 35.50 ? 323  TRP X C   1 
ATOM   2506 O O   . TRP A 1 323 ? -3.854  40.059 53.810 1.00 35.05 ? 323  TRP X O   1 
ATOM   2507 C CB  . TRP A 1 323 ? -1.510  38.710 54.828 1.00 37.71 ? 323  TRP X CB  1 
ATOM   2508 C CG  . TRP A 1 323 ? -1.916  37.737 55.889 1.00 35.59 ? 323  TRP X CG  1 
ATOM   2509 C CD1 . TRP A 1 323 ? -1.259  37.473 57.057 1.00 41.59 ? 323  TRP X CD1 1 
ATOM   2510 C CD2 . TRP A 1 323 ? -3.072  36.892 55.882 1.00 46.46 ? 323  TRP X CD2 1 
ATOM   2511 N NE1 . TRP A 1 323 ? -1.937  36.518 57.777 1.00 47.82 ? 323  TRP X NE1 1 
ATOM   2512 C CE2 . TRP A 1 323 ? -3.055  36.144 57.078 1.00 46.56 ? 323  TRP X CE2 1 
ATOM   2513 C CE3 . TRP A 1 323 ? -4.127  36.691 54.983 1.00 54.23 ? 323  TRP X CE3 1 
ATOM   2514 C CZ2 . TRP A 1 323 ? -4.047  35.213 57.397 1.00 57.92 ? 323  TRP X CZ2 1 
ATOM   2515 C CZ3 . TRP A 1 323 ? -5.113  35.764 55.301 1.00 58.92 ? 323  TRP X CZ3 1 
ATOM   2516 C CH2 . TRP A 1 323 ? -5.064  35.038 56.498 1.00 58.34 ? 323  TRP X CH2 1 
ATOM   2517 N N   . TYR A 1 324 ? -3.978  41.181 55.762 1.00 36.25 ? 324  TYR X N   1 
ATOM   2518 C CA  . TYR A 1 324 ? -5.373  41.581 55.586 1.00 33.65 ? 324  TYR X CA  1 
ATOM   2519 C C   . TYR A 1 324 ? -5.717  42.824 56.410 1.00 33.94 ? 324  TYR X C   1 
ATOM   2520 O O   . TYR A 1 324 ? -4.930  43.253 57.253 1.00 32.75 ? 324  TYR X O   1 
ATOM   2521 C CB  . TYR A 1 324 ? -6.370  40.428 55.792 1.00 34.87 ? 324  TYR X CB  1 
ATOM   2522 C CG  . TYR A 1 324 ? -6.414  39.806 57.174 1.00 37.63 ? 324  TYR X CG  1 
ATOM   2523 C CD1 . TYR A 1 324 ? -7.151  40.388 58.202 1.00 35.57 ? 324  TYR X CD1 1 
ATOM   2524 C CD2 . TYR A 1 324 ? -5.727  38.628 57.447 1.00 40.56 ? 324  TYR X CD2 1 
ATOM   2525 C CE1 . TYR A 1 324 ? -7.195  39.815 59.466 1.00 38.73 ? 324  TYR X CE1 1 
ATOM   2526 C CE2 . TYR A 1 324 ? -5.765  38.049 58.707 1.00 44.15 ? 324  TYR X CE2 1 
ATOM   2527 C CZ  . TYR A 1 324 ? -6.500  38.647 59.712 1.00 43.58 ? 324  TYR X CZ  1 
ATOM   2528 O OH  . TYR A 1 324 ? -6.538  38.072 60.962 1.00 46.84 ? 324  TYR X OH  1 
ATOM   2529 N N   . ASN A 1 325 ? -6.889  43.395 56.158 1.00 32.70 ? 325  ASN X N   1 
ATOM   2530 C CA  . ASN A 1 325 ? -7.329  44.605 56.847 1.00 34.66 ? 325  ASN X CA  1 
ATOM   2531 C C   . ASN A 1 325 ? -7.433  44.538 58.370 1.00 34.84 ? 325  ASN X C   1 
ATOM   2532 O O   . ASN A 1 325 ? -7.909  43.553 58.935 1.00 33.38 ? 325  ASN X O   1 
ATOM   2533 C CB  . ASN A 1 325 ? -8.670  45.083 56.286 1.00 36.00 ? 325  ASN X CB  1 
ATOM   2534 C CG  . ASN A 1 325 ? -8.569  45.569 54.858 1.00 38.38 ? 325  ASN X CG  1 
ATOM   2535 O OD1 . ASN A 1 325 ? -7.573  46.171 54.460 1.00 35.44 ? 325  ASN X OD1 1 
ATOM   2536 N ND2 . ASN A 1 325 ? -9.609  45.311 54.075 1.00 34.20 ? 325  ASN X ND2 1 
ATOM   2537 N N   . HIS A 1 326 ? -6.975  45.605 59.018 1.00 29.61 ? 326  HIS X N   1 
ATOM   2538 C CA  . HIS A 1 326 ? -7.055  45.752 60.467 1.00 29.95 ? 326  HIS X CA  1 
ATOM   2539 C C   . HIS A 1 326 ? -7.468  47.193 60.712 1.00 29.87 ? 326  HIS X C   1 
ATOM   2540 O O   . HIS A 1 326 ? -7.424  48.010 59.790 1.00 30.56 ? 326  HIS X O   1 
ATOM   2541 C CB  . HIS A 1 326 ? -5.742  45.392 61.154 1.00 30.78 ? 326  HIS X CB  1 
ATOM   2542 C CG  . HIS A 1 326 ? -5.414  43.937 61.061 1.00 35.13 ? 326  HIS X CG  1 
ATOM   2543 N ND1 . HIS A 1 326 ? -4.453  43.444 60.205 1.00 35.75 ? 326  HIS X ND1 1 
ATOM   2544 C CD2 . HIS A 1 326 ? -5.928  42.864 61.710 1.00 35.86 ? 326  HIS X CD2 1 
ATOM   2545 C CE1 . HIS A 1 326 ? -4.385  42.131 60.333 1.00 37.94 ? 326  HIS X CE1 1 
ATOM   2546 N NE2 . HIS A 1 326 ? -5.269  41.754 61.240 1.00 34.67 ? 326  HIS X NE2 1 
ATOM   2547 N N   . TYR A 1 327 ? -7.871  47.511 61.937 1.00 28.54 ? 327  TYR X N   1 
ATOM   2548 C CA  . TYR A 1 327 ? -8.351  48.854 62.229 1.00 30.84 ? 327  TYR X CA  1 
ATOM   2549 C C   . TYR A 1 327 ? -7.784  49.527 63.466 1.00 29.89 ? 327  TYR X C   1 
ATOM   2550 O O   . TYR A 1 327 ? -7.567  48.894 64.502 1.00 29.60 ? 327  TYR X O   1 
ATOM   2551 C CB  . TYR A 1 327 ? -9.890  48.870 62.237 1.00 25.35 ? 327  TYR X CB  1 
ATOM   2552 C CG  . TYR A 1 327 ? -10.450 48.356 60.931 1.00 34.21 ? 327  TYR X CG  1 
ATOM   2553 C CD1 . TYR A 1 327 ? -10.777 49.230 59.904 1.00 28.86 ? 327  TYR X CD1 1 
ATOM   2554 C CD2 . TYR A 1 327 ? -10.641 46.993 60.720 1.00 35.60 ? 327  TYR X CD2 1 
ATOM   2555 C CE1 . TYR A 1 327 ? -11.282 48.765 58.704 1.00 31.34 ? 327  TYR X CE1 1 
ATOM   2556 C CE2 . TYR A 1 327 ? -11.144 46.520 59.524 1.00 38.89 ? 327  TYR X CE2 1 
ATOM   2557 C CZ  . TYR A 1 327 ? -11.463 47.412 58.519 1.00 34.51 ? 327  TYR X CZ  1 
ATOM   2558 O OH  . TYR A 1 327 ? -11.964 46.951 57.326 1.00 33.97 ? 327  TYR X OH  1 
ATOM   2559 N N   . GLY A 1 328 ? -7.545  50.827 63.331 1.00 29.59 ? 328  GLY X N   1 
ATOM   2560 C CA  . GLY A 1 328 ? -7.028  51.644 64.408 1.00 28.09 ? 328  GLY X CA  1 
ATOM   2561 C C   . GLY A 1 328 ? -7.741  52.981 64.398 1.00 28.26 ? 328  GLY X C   1 
ATOM   2562 O O   . GLY A 1 328 ? -8.787  53.128 63.768 1.00 31.08 ? 328  GLY X O   1 
ATOM   2563 N N   . ARG A 1 329 ? -7.177  53.957 65.098 1.00 28.09 ? 329  ARG X N   1 
ATOM   2564 C CA  . ARG A 1 329 ? -7.753  55.293 65.150 1.00 28.25 ? 329  ARG X CA  1 
ATOM   2565 C C   . ARG A 1 329 ? -6.664  56.248 64.702 1.00 30.14 ? 329  ARG X C   1 
ATOM   2566 O O   . ARG A 1 329 ? -5.486  56.018 64.979 1.00 27.99 ? 329  ARG X O   1 
ATOM   2567 C CB  . ARG A 1 329 ? -8.192  55.638 66.576 1.00 28.03 ? 329  ARG X CB  1 
ATOM   2568 C CG  . ARG A 1 329 ? -9.648  55.302 66.881 1.00 34.49 ? 329  ARG X CG  1 
ATOM   2569 C CD  . ARG A 1 329 ? -9.839  54.095 67.784 1.00 41.53 ? 329  ARG X CD  1 
ATOM   2570 N NE  . ARG A 1 329 ? -8.870  54.042 68.880 1.00 40.41 ? 329  ARG X NE  1 
ATOM   2571 C CZ  . ARG A 1 329 ? -8.205  52.946 69.232 1.00 47.20 ? 329  ARG X CZ  1 
ATOM   2572 N NH1 . ARG A 1 329 ? -8.402  51.812 68.573 1.00 44.75 ? 329  ARG X NH1 1 
ATOM   2573 N NH2 . ARG A 1 329 ? -7.342  52.979 70.241 1.00 42.38 ? 329  ARG X NH2 1 
ATOM   2574 N N   . VAL A 1 330 ? -7.050  57.314 64.007 1.00 28.28 ? 330  VAL X N   1 
ATOM   2575 C CA  . VAL A 1 330 ? -6.080  58.291 63.530 1.00 28.04 ? 330  VAL X CA  1 
ATOM   2576 C C   . VAL A 1 330 ? -6.587  59.718 63.683 1.00 29.36 ? 330  VAL X C   1 
ATOM   2577 O O   . VAL A 1 330 ? -7.763  60.001 63.459 1.00 27.51 ? 330  VAL X O   1 
ATOM   2578 C CB  . VAL A 1 330 ? -5.711  58.073 62.033 1.00 28.85 ? 330  VAL X CB  1 
ATOM   2579 C CG1 . VAL A 1 330 ? -4.721  59.138 61.561 1.00 28.34 ? 330  VAL X CG1 1 
ATOM   2580 C CG2 . VAL A 1 330 ? -5.132  56.687 61.801 1.00 27.32 ? 330  VAL X CG2 1 
ATOM   2581 N N   . TRP A 1 331 ? -5.677  60.605 64.069 1.00 26.79 ? 331  TRP X N   1 
ATOM   2582 C CA  . TRP A 1 331 ? -5.963  62.021 64.215 1.00 25.74 ? 331  TRP X CA  1 
ATOM   2583 C C   . TRP A 1 331 ? -4.949  62.765 63.351 1.00 27.86 ? 331  TRP X C   1 
ATOM   2584 O O   . TRP A 1 331 ? -3.737  62.550 63.475 1.00 26.87 ? 331  TRP X O   1 
ATOM   2585 C CB  . TRP A 1 331 ? -5.789  62.468 65.672 1.00 25.76 ? 331  TRP X CB  1 
ATOM   2586 C CG  . TRP A 1 331 ? -6.780  61.859 66.608 1.00 25.68 ? 331  TRP X CG  1 
ATOM   2587 C CD1 . TRP A 1 331 ? -7.991  62.379 66.981 1.00 27.80 ? 331  TRP X CD1 1 
ATOM   2588 C CD2 . TRP A 1 331 ? -6.652  60.614 67.296 1.00 28.04 ? 331  TRP X CD2 1 
ATOM   2589 N NE1 . TRP A 1 331 ? -8.623  61.528 67.858 1.00 24.86 ? 331  TRP X NE1 1 
ATOM   2590 C CE2 . TRP A 1 331 ? -7.822  60.435 68.068 1.00 29.74 ? 331  TRP X CE2 1 
ATOM   2591 C CE3 . TRP A 1 331 ? -5.663  59.622 67.339 1.00 30.02 ? 331  TRP X CE3 1 
ATOM   2592 C CZ2 . TRP A 1 331 ? -8.026  59.312 68.870 1.00 26.62 ? 331  TRP X CZ2 1 
ATOM   2593 C CZ3 . TRP A 1 331 ? -5.869  58.507 68.136 1.00 26.91 ? 331  TRP X CZ3 1 
ATOM   2594 C CH2 . TRP A 1 331 ? -7.040  58.361 68.889 1.00 23.67 ? 331  TRP X CH2 1 
ATOM   2595 N N   . VAL A 1 332 ? -5.442  63.629 62.474 1.00 26.63 ? 332  VAL X N   1 
ATOM   2596 C CA  . VAL A 1 332 ? -4.565  64.431 61.637 1.00 27.59 ? 332  VAL X CA  1 
ATOM   2597 C C   . VAL A 1 332 ? -4.165  65.607 62.522 1.00 27.33 ? 332  VAL X C   1 
ATOM   2598 O O   . VAL A 1 332 ? -5.027  66.241 63.136 1.00 27.57 ? 332  VAL X O   1 
ATOM   2599 C CB  . VAL A 1 332 ? -5.303  64.962 60.386 1.00 29.55 ? 332  VAL X CB  1 
ATOM   2600 C CG1 . VAL A 1 332 ? -4.498  66.085 59.714 1.00 27.49 ? 332  VAL X CG1 1 
ATOM   2601 C CG2 . VAL A 1 332 ? -5.566  63.829 59.407 1.00 26.08 ? 332  VAL X CG2 1 
ATOM   2602 N N   . LEU A 1 333 ? -2.869  65.893 62.597 1.00 26.74 ? 333  LEU X N   1 
ATOM   2603 C CA  . LEU A 1 333 ? -2.392  67.002 63.419 1.00 27.86 ? 333  LEU X CA  1 
ATOM   2604 C C   . LEU A 1 333 ? -2.069  68.229 62.583 1.00 28.65 ? 333  LEU X C   1 
ATOM   2605 O O   . LEU A 1 333 ? -1.305  68.150 61.619 1.00 29.00 ? 333  LEU X O   1 
ATOM   2606 C CB  . LEU A 1 333 ? -1.174  66.591 64.248 1.00 26.66 ? 333  LEU X CB  1 
ATOM   2607 C CG  . LEU A 1 333 ? -1.321  65.346 65.122 1.00 29.16 ? 333  LEU X CG  1 
ATOM   2608 C CD1 . LEU A 1 333 ? -0.134  65.217 66.072 1.00 26.92 ? 333  LEU X CD1 1 
ATOM   2609 C CD2 . LEU A 1 333 ? -2.647  65.372 65.895 1.00 25.39 ? 333  LEU X CD2 1 
ATOM   2610 N N   . LYS A 1 334 ? -2.658  69.360 62.968 1.00 30.92 ? 334  LYS X N   1 
ATOM   2611 C CA  . LYS A 1 334 ? -2.467  70.636 62.284 1.00 34.27 ? 334  LYS X CA  1 
ATOM   2612 C C   . LYS A 1 334 ? -2.413  71.762 63.311 1.00 35.31 ? 334  LYS X C   1 
ATOM   2613 O O   . LYS A 1 334 ? -2.751  71.565 64.478 1.00 33.76 ? 334  LYS X O   1 
ATOM   2614 C CB  . LYS A 1 334 ? -3.659  70.917 61.356 1.00 36.61 ? 334  LYS X CB  1 
ATOM   2615 C CG  . LYS A 1 334 ? -3.723  70.066 60.097 1.00 39.70 ? 334  LYS X CG  1 
ATOM   2616 C CD  . LYS A 1 334 ? -4.958  70.419 59.274 1.00 41.00 ? 334  LYS X CD  1 
ATOM   2617 C CE  . LYS A 1 334 ? -4.858  69.888 57.848 1.00 39.17 ? 334  LYS X CE  1 
ATOM   2618 N NZ  . LYS A 1 334 ? -6.035  70.305 57.022 1.00 36.51 ? 334  LYS X NZ  1 
ATOM   2619 N N   . THR A 1 335 ? -1.985  72.942 62.873 1.00 39.55 ? 335  THR X N   1 
ATOM   2620 C CA  . THR A 1 335 ? -1.946  74.113 63.744 1.00 45.50 ? 335  THR X CA  1 
ATOM   2621 C C   . THR A 1 335 ? -2.881  75.163 63.153 1.00 52.92 ? 335  THR X C   1 
ATOM   2622 O O   . THR A 1 335 ? -2.999  75.280 61.933 1.00 54.22 ? 335  THR X O   1 
ATOM   2623 C CB  . THR A 1 335 ? -0.520  74.689 63.877 1.00 44.50 ? 335  THR X CB  1 
ATOM   2624 O OG1 . THR A 1 335 ? 0.014   74.976 62.578 1.00 40.84 ? 335  THR X OG1 1 
ATOM   2625 C CG2 . THR A 1 335 ? 0.438   73.654 64.448 1.00 41.85 ? 335  THR X CG2 1 
ATOM   2626 N N   . ALA A 1 336 ? -3.546  75.924 64.018 1.00 62.53 ? 336  ALA X N   1 
ATOM   2627 C CA  . ALA A 1 336 ? -4.462  76.966 63.564 1.00 68.19 ? 336  ALA X CA  1 
ATOM   2628 C C   . ALA A 1 336 ? -3.776  78.330 63.580 1.00 71.90 ? 336  ALA X C   1 
ATOM   2629 O O   . ALA A 1 336 ? -3.216  78.736 64.600 1.00 71.36 ? 336  ALA X O   1 
ATOM   2630 C CB  . ALA A 1 336 ? -5.718  76.988 64.425 1.00 68.97 ? 336  ALA X CB  1 
ATOM   2631 N N   . PRO A 1 337 ? -3.821  79.031 62.448 1.00 76.54 ? 337  PRO X N   1 
ATOM   2632 C CA  . PRO A 1 337 ? -3.203  80.359 62.324 1.00 77.68 ? 337  PRO X CA  1 
ATOM   2633 C C   . PRO A 1 337 ? -3.918  81.425 63.153 1.00 77.88 ? 337  PRO X C   1 
ATOM   2634 O O   . PRO A 1 337 ? -5.070  81.225 63.541 1.00 77.84 ? 337  PRO X O   1 
ATOM   2635 C CB  . PRO A 1 337 ? -3.343  80.671 60.830 1.00 78.16 ? 337  PRO X CB  1 
ATOM   2636 C CG  . PRO A 1 337 ? -4.513  79.862 60.381 1.00 78.66 ? 337  PRO X CG  1 
ATOM   2637 C CD  . PRO A 1 337 ? -4.470  78.600 61.196 1.00 77.45 ? 337  PRO X CD  1 
HETATM 2638 C C1  . EDO B 2 .   ? -7.716  67.281 58.211 1.00 48.35 ? 1439 EDO X C1  1 
HETATM 2639 O O1  . EDO B 2 .   ? -7.309  67.235 56.861 1.00 54.95 ? 1439 EDO X O1  1 
HETATM 2640 C C2  . EDO B 2 .   ? -8.947  68.147 58.350 1.00 56.27 ? 1439 EDO X C2  1 
HETATM 2641 O O2  . EDO B 2 .   ? -8.581  69.510 58.387 1.00 58.41 ? 1439 EDO X O2  1 
HETATM 2642 C C   . ACY C 3 .   ? -0.859  40.675 40.181 1.00 53.74 ? 1002 ACY X C   1 
HETATM 2643 O O   . ACY C 3 .   ? -1.804  40.509 40.989 1.00 55.40 ? 1002 ACY X O   1 
HETATM 2644 O OXT . ACY C 3 .   ? -0.454  39.810 39.372 1.00 46.15 ? 1002 ACY X OXT 1 
HETATM 2645 C CH3 . ACY C 3 .   ? -0.166  42.003 40.183 1.00 56.70 ? 1002 ACY X CH3 1 
HETATM 2646 O O   . HOH D 4 .   ? 10.016  71.379 74.230 1.00 35.03 ? 1440 HOH X O   1 
HETATM 2647 O O   . HOH D 4 .   ? 15.153  74.945 71.699 1.00 20.87 ? 1441 HOH X O   1 
HETATM 2648 O O   . HOH D 4 .   ? 15.987  38.108 54.396 1.00 45.90 ? 1442 HOH X O   1 
HETATM 2649 O O   . HOH D 4 .   ? 12.440  40.008 54.277 1.00 29.90 ? 1443 HOH X O   1 
HETATM 2650 O O   . HOH D 4 .   ? 2.507   53.398 43.943 1.00 28.95 ? 1444 HOH X O   1 
HETATM 2651 O O   . HOH D 4 .   ? 1.550   43.453 29.795 1.00 21.97 ? 1445 HOH X O   1 
HETATM 2652 O O   . HOH D 4 .   ? 14.903  29.267 32.063 1.00 47.50 ? 1446 HOH X O   1 
HETATM 2653 O O   . HOH D 4 .   ? 13.965  37.333 36.734 1.00 37.06 ? 1447 HOH X O   1 
HETATM 2654 O O   . HOH D 4 .   ? 4.218   62.691 46.456 1.00 30.82 ? 1448 HOH X O   1 
HETATM 2655 O O   . HOH D 4 .   ? 7.551   77.078 64.205 1.00 34.52 ? 1449 HOH X O   1 
HETATM 2656 O O   . HOH D 4 .   ? 3.740   70.471 78.084 1.00 38.11 ? 1450 HOH X O   1 
HETATM 2657 O O   . HOH D 4 .   ? 11.626  46.292 47.396 1.00 39.85 ? 1451 HOH X O   1 
HETATM 2658 O O   . HOH D 4 .   ? 12.729  44.859 25.161 1.00 43.36 ? 1452 HOH X O   1 
HETATM 2659 O O   . HOH D 4 .   ? 4.979   44.584 51.320 1.00 37.56 ? 1453 HOH X O   1 
HETATM 2660 O O   . HOH D 4 .   ? -1.853  42.353 36.647 1.00 37.01 ? 1454 HOH X O   1 
HETATM 2661 O O   . HOH D 4 .   ? 29.531  34.518 48.263 1.00 43.69 ? 1455 HOH X O   1 
HETATM 2662 O O   . HOH D 4 .   ? 9.943   39.779 47.262 1.00 41.63 ? 1456 HOH X O   1 
HETATM 2663 O O   . HOH D 4 .   ? 4.936   47.528 66.036 1.00 39.98 ? 1457 HOH X O   1 
HETATM 2664 O O   . HOH D 4 .   ? 0.520   38.250 25.062 1.00 42.75 ? 1458 HOH X O   1 
HETATM 2665 O O   . HOH D 4 .   ? 10.215  48.697 49.393 1.00 44.64 ? 1459 HOH X O   1 
HETATM 2666 O O   . HOH D 4 .   ? -4.788  43.220 52.401 1.00 49.07 ? 1460 HOH X O   1 
HETATM 2667 O O   . HOH D 4 .   ? 5.913   48.167 47.903 1.00 57.07 ? 1461 HOH X O   1 
HETATM 2668 O O   . HOH D 4 .   ? 11.122  70.385 62.275 1.00 37.52 ? 1462 HOH X O   1 
HETATM 2669 O O   . HOH D 4 .   ? -1.502  73.148 59.920 1.00 42.70 ? 1463 HOH X O   1 
HETATM 2670 O O   . HOH D 4 .   ? -15.281 46.999 60.339 1.00 51.80 ? 1464 HOH X O   1 
HETATM 2671 O O   . HOH D 4 .   ? 1.669   60.628 50.438 1.00 42.45 ? 1465 HOH X O   1 
HETATM 2672 O O   . HOH D 4 .   ? 7.308   30.488 47.159 1.00 46.36 ? 1466 HOH X O   1 
HETATM 2673 O O   . HOH D 4 .   ? 12.732  31.153 38.762 1.00 52.75 ? 1467 HOH X O   1 
HETATM 2674 O O   . HOH D 4 .   ? 12.259  37.949 40.732 1.00 40.03 ? 1468 HOH X O   1 
HETATM 2675 O O   . HOH D 4 .   ? 11.652  74.845 60.927 1.00 39.68 ? 1469 HOH X O   1 
HETATM 2676 O O   . HOH D 4 .   ? 4.627   62.892 79.475 1.00 41.81 ? 1470 HOH X O   1 
HETATM 2677 O O   . HOH D 4 .   ? 11.221  42.278 46.582 1.00 60.49 ? 1471 HOH X O   1 
HETATM 2678 O O   . HOH D 4 .   ? -5.344  68.364 70.307 1.00 48.83 ? 1472 HOH X O   1 
HETATM 2679 O O   . HOH D 4 .   ? -4.640  46.918 50.452 1.00 55.53 ? 1473 HOH X O   1 
HETATM 2680 O O   . HOH D 4 .   ? 5.242   42.242 49.950 1.00 54.71 ? 1474 HOH X O   1 
HETATM 2681 O O   . HOH D 4 .   ? -7.539  69.329 69.151 1.00 41.94 ? 1475 HOH X O   1 
HETATM 2682 O O   . HOH D 4 .   ? 1.448   50.681 44.208 1.00 41.79 ? 1476 HOH X O   1 
HETATM 2683 O O   . HOH D 4 .   ? 12.017  48.122 45.507 1.00 49.27 ? 1477 HOH X O   1 
HETATM 2684 O O   . HOH D 4 .   ? 3.187   47.837 63.923 1.00 38.14 ? 1478 HOH X O   1 
HETATM 2685 O O   . HOH D 4 .   ? 1.776   50.350 49.179 1.00 43.24 ? 1479 HOH X O   1 
HETATM 2686 O O   . HOH D 4 .   ? -3.176  45.047 58.645 1.00 51.60 ? 1480 HOH X O   1 
HETATM 2687 O O   . HOH D 4 .   ? 8.549   54.446 64.221 1.00 33.61 ? 1481 HOH X O   1 
HETATM 2688 O O   . HOH D 4 .   ? 11.682  56.155 68.303 1.00 37.26 ? 1482 HOH X O   1 
HETATM 2689 O O   . HOH D 4 .   ? 25.249  38.972 54.276 1.00 39.98 ? 1483 HOH X O   1 
HETATM 2690 O O   . HOH D 4 .   ? 0.714   46.813 59.756 1.00 43.04 ? 1484 HOH X O   1 
HETATM 2691 O O   . HOH D 4 .   ? 24.471  40.504 49.312 1.00 36.62 ? 1485 HOH X O   1 
HETATM 2692 O O   . HOH D 4 .   ? 4.128   68.232 76.323 1.00 31.30 ? 1486 HOH X O   1 
HETATM 2693 O O   . HOH D 4 .   ? 13.115  53.560 46.769 1.00 48.00 ? 1487 HOH X O   1 
HETATM 2694 O O   . HOH D 4 .   ? -2.886  61.210 77.593 1.00 38.09 ? 1488 HOH X O   1 
HETATM 2695 O O   . HOH D 4 .   ? 17.294  62.431 53.701 1.00 38.47 ? 1489 HOH X O   1 
HETATM 2696 O O   . HOH D 4 .   ? -13.877 42.134 61.594 1.00 47.54 ? 1490 HOH X O   1 
HETATM 2697 O O   . HOH D 4 .   ? 0.298   40.461 36.900 1.00 39.59 ? 1491 HOH X O   1 
HETATM 2698 O O   . HOH D 4 .   ? -15.644 49.325 71.816 1.00 54.14 ? 1492 HOH X O   1 
HETATM 2699 O O   . HOH D 4 .   ? -13.027 54.021 66.590 1.00 42.45 ? 1493 HOH X O   1 
HETATM 2700 O O   . HOH D 4 .   ? -9.705  56.124 70.458 1.00 46.84 ? 1494 HOH X O   1 
HETATM 2701 O O   . HOH D 4 .   ? -4.581  69.487 75.358 1.00 58.65 ? 1495 HOH X O   1 
HETATM 2702 O O   . HOH D 4 .   ? -15.135 69.418 63.553 1.00 49.28 ? 1496 HOH X O   1 
HETATM 2703 O O   . HOH D 4 .   ? 13.926  51.192 54.716 1.00 40.09 ? 1497 HOH X O   1 
HETATM 2704 O O   . HOH D 4 .   ? 3.184   30.893 31.835 1.00 47.98 ? 1498 HOH X O   1 
HETATM 2705 O O   . HOH D 4 .   ? 3.717   28.485 27.975 1.00 51.07 ? 1499 HOH X O   1 
HETATM 2706 O O   . HOH D 4 .   ? -1.114  37.025 28.356 1.00 48.55 ? 1500 HOH X O   1 
HETATM 2707 O O   . HOH D 4 .   ? 7.349   69.667 80.357 1.00 48.22 ? 1501 HOH X O   1 
HETATM 2708 O O   . HOH D 4 .   ? -2.741  61.359 43.581 1.00 42.00 ? 1502 HOH X O   1 
HETATM 2709 O O   . HOH D 4 .   ? 5.537   65.147 47.865 1.00 38.47 ? 1503 HOH X O   1 
HETATM 2710 O O   . HOH D 4 .   ? 24.611  38.720 40.226 1.00 46.86 ? 1504 HOH X O   1 
HETATM 2711 O O   . HOH D 4 .   ? -12.664 61.306 53.483 1.00 43.03 ? 1505 HOH X O   1 
HETATM 2712 O O   . HOH D 4 .   ? 8.423   58.617 72.172 1.00 40.45 ? 1506 HOH X O   1 
HETATM 2713 O O   . HOH D 4 .   ? 3.812   60.717 48.676 1.00 39.05 ? 1507 HOH X O   1 
HETATM 2714 O O   . HOH D 4 .   ? 17.457  47.224 30.161 1.00 47.84 ? 1508 HOH X O   1 
HETATM 2715 O O   . HOH D 4 .   ? -3.652  42.582 34.456 1.00 47.57 ? 1509 HOH X O   1 
HETATM 2716 O O   . HOH D 4 .   ? 11.978  36.539 38.610 1.00 43.93 ? 1510 HOH X O   1 
HETATM 2717 O O   . HOH D 4 .   ? 10.600  46.859 67.300 1.00 60.65 ? 1511 HOH X O   1 
HETATM 2718 O O   . HOH D 4 .   ? -8.097  51.663 49.642 1.00 35.39 ? 1512 HOH X O   1 
HETATM 2719 O O   . HOH D 4 .   ? 11.109  62.914 73.379 1.00 53.27 ? 1513 HOH X O   1 
HETATM 2720 O O   . HOH D 4 .   ? 0.564   77.009 77.498 1.00 41.45 ? 1514 HOH X O   1 
HETATM 2721 O O   . HOH D 4 .   ? -3.646  43.999 31.781 1.00 48.48 ? 1515 HOH X O   1 
HETATM 2722 O O   . HOH D 4 .   ? 2.014   43.847 65.069 1.00 45.66 ? 1516 HOH X O   1 
HETATM 2723 O O   . HOH D 4 .   ? 1.564   45.615 63.095 1.00 44.02 ? 1517 HOH X O   1 
HETATM 2724 O O   . HOH D 4 .   ? -9.919  50.923 66.183 1.00 39.12 ? 1518 HOH X O   1 
HETATM 2725 O O   . HOH D 4 .   ? -10.110 57.559 64.060 1.00 35.96 ? 1519 HOH X O   1 
HETATM 2726 O O   . HOH D 4 .   ? -10.203 54.012 56.887 1.00 45.72 ? 1520 HOH X O   1 
HETATM 2727 O O   . HOH D 4 .   ? -16.644 55.349 67.693 1.00 45.35 ? 1521 HOH X O   1 
HETATM 2728 O O   . HOH D 4 .   ? 25.564  41.003 55.989 1.00 39.82 ? 1522 HOH X O   1 
HETATM 2729 O O   . HOH D 4 .   ? 24.781  26.518 39.915 1.00 66.28 ? 1523 HOH X O   1 
HETATM 2730 O O   . HOH D 4 .   ? 19.772  45.344 30.743 1.00 46.56 ? 1524 HOH X O   1 
HETATM 2731 O O   . HOH D 4 .   ? 15.052  71.885 54.421 1.00 45.32 ? 1525 HOH X O   1 
HETATM 2732 O O   . HOH D 4 .   ? -2.534  54.747 73.976 1.00 47.39 ? 1526 HOH X O   1 
HETATM 2733 O O   . HOH D 4 .   ? 26.378  41.799 48.197 1.00 40.28 ? 1527 HOH X O   1 
HETATM 2734 O O   . HOH D 4 .   ? 3.508   66.303 77.923 1.00 36.95 ? 1528 HOH X O   1 
HETATM 2735 O O   . HOH D 4 .   ? 15.921  72.883 57.000 1.00 45.81 ? 1529 HOH X O   1 
HETATM 2736 O O   . HOH D 4 .   ? 1.378   53.083 72.862 1.00 39.14 ? 1530 HOH X O   1 
HETATM 2737 O O   . HOH D 4 .   ? -2.381  56.193 47.420 1.00 38.55 ? 1531 HOH X O   1 
HETATM 2738 O O   . HOH D 4 .   ? -3.243  59.488 45.717 1.00 44.98 ? 1532 HOH X O   1 
HETATM 2739 O O   . HOH D 4 .   ? 13.246  73.573 53.525 1.00 43.93 ? 1533 HOH X O   1 
HETATM 2740 O O   . HOH D 4 .   ? 10.933  47.482 28.717 1.00 37.05 ? 1534 HOH X O   1 
HETATM 2741 O O   . HOH D 4 .   ? 2.976   57.252 77.435 1.00 51.74 ? 1535 HOH X O   1 
HETATM 2742 O O   . HOH D 4 .   ? 0.946   49.461 46.635 1.00 41.22 ? 1536 HOH X O   1 
HETATM 2743 O O   . HOH D 4 .   ? 2.192   68.003 58.732 1.00 39.21 ? 1537 HOH X O   1 
HETATM 2744 O O   . HOH D 4 .   ? 13.039  68.943 63.432 1.00 37.45 ? 1538 HOH X O   1 
HETATM 2745 O O   . HOH D 4 .   ? -2.235  43.390 53.747 1.00 46.85 ? 1539 HOH X O   1 
HETATM 2746 O O   . HOH D 4 .   ? 11.903  69.881 47.304 1.00 49.84 ? 1540 HOH X O   1 
HETATM 2747 O O   . HOH D 4 .   ? -1.325  52.686 72.943 1.00 47.12 ? 1541 HOH X O   1 
HETATM 2748 O O   . HOH D 4 .   ? 11.088  63.754 68.276 1.00 43.72 ? 1542 HOH X O   1 
HETATM 2749 O O   . HOH D 4 .   ? -2.269  26.337 42.400 1.00 54.05 ? 1543 HOH X O   1 
HETATM 2750 O O   . HOH D 4 .   ? -5.975  36.751 35.931 1.00 53.59 ? 1544 HOH X O   1 
HETATM 2751 O O   . HOH D 4 .   ? 14.191  66.789 62.981 1.00 45.89 ? 1545 HOH X O   1 
HETATM 2752 O O   . HOH D 4 .   ? 6.904   25.111 33.763 1.00 47.79 ? 1546 HOH X O   1 
HETATM 2753 O O   . HOH D 4 .   ? -6.908  67.706 50.889 1.00 62.83 ? 1547 HOH X O   1 
HETATM 2754 O O   . HOH D 4 .   ? -0.461  45.391 47.403 1.00 47.40 ? 1548 HOH X O   1 
HETATM 2755 O O   . HOH D 4 .   ? 2.632   50.069 65.640 1.00 45.92 ? 1549 HOH X O   1 
HETATM 2756 O O   . HOH D 4 .   ? -5.346  57.697 52.637 1.00 36.45 ? 1550 HOH X O   1 
HETATM 2757 O O   . HOH D 4 .   ? 12.131  28.109 38.967 1.00 50.24 ? 1551 HOH X O   1 
HETATM 2758 O O   . HOH D 4 .   ? 10.769  26.302 39.409 1.00 59.97 ? 1552 HOH X O   1 
HETATM 2759 O O   . HOH D 4 .   ? 13.407  52.432 59.197 1.00 50.15 ? 1553 HOH X O   1 
HETATM 2760 O O   . HOH D 4 .   ? -6.855  73.146 62.662 1.00 49.05 ? 1554 HOH X O   1 
HETATM 2761 O O   . HOH D 4 .   ? 19.845  42.979 32.320 1.00 44.72 ? 1555 HOH X O   1 
HETATM 2762 O O   . HOH D 4 .   ? -3.009  39.836 58.672 1.00 43.01 ? 1556 HOH X O   1 
HETATM 2763 O O   . HOH D 4 .   ? 3.177   34.954 37.928 1.00 46.74 ? 1557 HOH X O   1 
HETATM 2764 O O   . HOH D 4 .   ? 8.251   65.640 47.957 1.00 46.31 ? 1558 HOH X O   1 
HETATM 2765 O O   . HOH D 4 .   ? 28.218  38.099 47.052 1.00 43.26 ? 1559 HOH X O   1 
HETATM 2766 O O   . HOH D 4 .   ? -15.336 48.297 58.266 1.00 56.59 ? 1560 HOH X O   1 
HETATM 2767 O O   . HOH D 4 .   ? -5.732  39.736 34.139 1.00 39.85 ? 1561 HOH X O   1 
HETATM 2768 O O   . HOH D 4 .   ? 11.960  57.515 70.734 1.00 44.22 ? 1562 HOH X O   1 
HETATM 2769 O O   . HOH D 4 .   ? -0.397  67.782 59.229 1.00 36.02 ? 1563 HOH X O   1 
HETATM 2770 O O   . HOH D 4 .   ? 1.676   55.287 74.452 1.00 40.76 ? 1564 HOH X O   1 
HETATM 2771 O O   . HOH D 4 .   ? -14.260 66.578 71.467 1.00 55.83 ? 1565 HOH X O   1 
HETATM 2772 O O   . HOH D 4 .   ? 14.259  54.122 53.928 1.00 46.88 ? 1566 HOH X O   1 
HETATM 2773 O O   . HOH D 4 .   ? 3.967   74.719 77.342 1.00 31.74 ? 1567 HOH X O   1 
HETATM 2774 O O   . HOH D 4 .   ? 23.588  46.886 44.224 1.00 44.07 ? 1568 HOH X O   1 
HETATM 2775 O O   . HOH D 4 .   ? 13.097  43.818 47.934 1.00 38.73 ? 1569 HOH X O   1 
HETATM 2776 O O   . HOH D 4 .   ? -10.685 61.133 69.911 1.00 43.87 ? 1570 HOH X O   1 
HETATM 2777 O O   . HOH D 4 .   ? 16.013  60.785 66.032 1.00 36.18 ? 1571 HOH X O   1 
HETATM 2778 O O   . HOH D 4 .   ? -1.657  42.649 30.337 1.00 41.01 ? 1572 HOH X O   1 
HETATM 2779 O O   . HOH D 4 .   ? -0.181  69.981 81.980 1.00 44.72 ? 1573 HOH X O   1 
HETATM 2780 O O   . HOH D 4 .   ? -14.389 66.985 57.193 1.00 48.56 ? 1574 HOH X O   1 
HETATM 2781 O O   . HOH D 4 .   ? -0.533  45.365 52.406 1.00 44.90 ? 1575 HOH X O   1 
HETATM 2782 O O   . HOH D 4 .   ? 1.557   76.412 67.310 1.00 42.61 ? 1576 HOH X O   1 
HETATM 2783 O O   . HOH D 4 .   ? 16.362  51.246 52.879 1.00 52.70 ? 1577 HOH X O   1 
HETATM 2784 O O   . HOH D 4 .   ? 23.434  44.476 42.497 1.00 44.58 ? 1578 HOH X O   1 
HETATM 2785 O O   . HOH D 4 .   ? -6.666  48.144 48.868 1.00 46.22 ? 1579 HOH X O   1 
HETATM 2786 O O   . HOH D 4 .   ? 17.281  61.827 49.169 1.00 52.68 ? 1580 HOH X O   1 
HETATM 2787 O O   . HOH D 4 .   ? -17.166 48.502 61.963 1.00 48.57 ? 1581 HOH X O   1 
HETATM 2788 O O   . HOH D 4 .   ? 2.730   76.636 75.507 1.00 38.97 ? 1582 HOH X O   1 
HETATM 2789 O O   . HOH D 4 .   ? 13.457  48.533 59.228 1.00 46.14 ? 1583 HOH X O   1 
HETATM 2790 O O   . HOH D 4 .   ? 3.567   69.241 81.084 1.00 58.40 ? 1584 HOH X O   1 
HETATM 2791 O O   . HOH D 4 .   ? -13.571 54.188 69.337 1.00 46.97 ? 1585 HOH X O   1 
HETATM 2792 O O   . HOH D 4 .   ? 8.509   43.561 65.954 1.00 48.59 ? 1586 HOH X O   1 
HETATM 2793 O O   . HOH D 4 .   ? 27.723  40.640 46.402 1.00 50.25 ? 1587 HOH X O   1 
HETATM 2794 O O   . HOH D 4 .   ? 8.022   47.476 49.194 1.00 58.16 ? 1588 HOH X O   1 
HETATM 2795 O O   . HOH D 4 .   ? 12.995  43.527 59.814 1.00 37.67 ? 1589 HOH X O   1 
HETATM 2796 O O   . HOH D 4 .   ? -1.665  68.169 55.021 1.00 44.79 ? 1590 HOH X O   1 
HETATM 2797 O O   . HOH D 4 .   ? 4.987   39.164 55.412 1.00 65.26 ? 1591 HOH X O   1 
HETATM 2798 O O   . HOH D 4 .   ? 27.103  35.047 33.252 1.00 61.31 ? 1592 HOH X O   1 
HETATM 2799 O O   . HOH D 4 .   ? 24.928  34.875 40.909 1.00 54.58 ? 1593 HOH X O   1 
HETATM 2800 O O   . HOH D 4 .   ? 5.412   45.731 69.506 1.00 62.39 ? 1594 HOH X O   1 
HETATM 2801 O O   . HOH D 4 .   ? -12.763 56.273 53.017 1.00 59.53 ? 1595 HOH X O   1 
HETATM 2802 O O   . HOH D 4 .   ? 21.742  41.215 29.887 1.00 55.71 ? 1596 HOH X O   1 
HETATM 2803 O O   . HOH D 4 .   ? -5.395  60.652 78.612 1.00 47.27 ? 1597 HOH X O   1 
HETATM 2804 O O   . HOH D 4 .   ? 2.778   50.824 73.667 1.00 43.73 ? 1598 HOH X O   1 
HETATM 2805 O O   . HOH D 4 .   ? 9.909   70.178 80.642 1.00 53.37 ? 1599 HOH X O   1 
HETATM 2806 O O   . HOH D 4 .   ? 2.932   60.566 79.395 1.00 39.86 ? 1600 HOH X O   1 
HETATM 2807 O O   . HOH D 4 .   ? 16.564  62.837 64.419 1.00 52.87 ? 1601 HOH X O   1 
HETATM 2808 O O   . HOH D 4 .   ? 13.002  73.291 63.444 1.00 44.39 ? 1602 HOH X O   1 
HETATM 2809 O O   . HOH D 4 .   ? -1.591  49.260 46.509 1.00 37.70 ? 1603 HOH X O   1 
HETATM 2810 O O   . HOH D 4 .   ? 15.602  50.421 35.692 1.00 55.11 ? 1604 HOH X O   1 
HETATM 2811 O O   . HOH D 4 .   ? 12.549  76.220 58.658 1.00 41.46 ? 1605 HOH X O   1 
HETATM 2812 O O   . HOH D 4 .   ? 11.684  52.451 62.908 1.00 47.40 ? 1606 HOH X O   1 
HETATM 2813 O O   . HOH D 4 .   ? 0.943   35.918 58.889 1.00 65.68 ? 1607 HOH X O   1 
HETATM 2814 O O   . HOH D 4 .   ? -3.073  48.664 73.789 1.00 58.42 ? 1608 HOH X O   1 
HETATM 2815 O O   . HOH D 4 .   ? 25.233  42.909 41.382 1.00 48.91 ? 1609 HOH X O   1 
HETATM 2816 O O   . HOH D 4 .   ? -5.935  47.634 73.934 1.00 57.08 ? 1610 HOH X O   1 
HETATM 2817 O O   . HOH D 4 .   ? 12.250  46.000 61.440 1.00 55.40 ? 1611 HOH X O   1 
HETATM 2818 O O   . HOH D 4 .   ? 20.202  53.705 42.611 1.00 57.24 ? 1612 HOH X O   1 
HETATM 2819 O O   . HOH D 4 .   ? -2.944  71.480 76.739 1.00 49.85 ? 1613 HOH X O   1 
HETATM 2820 O O   . HOH D 4 .   ? -5.426  54.798 74.597 1.00 57.74 ? 1614 HOH X O   1 
HETATM 2821 O O   . HOH D 4 .   ? 1.591   46.717 46.276 1.00 49.47 ? 1615 HOH X O   1 
HETATM 2822 O O   . HOH D 4 .   ? 4.358   44.585 66.762 1.00 48.19 ? 1616 HOH X O   1 
HETATM 2823 O O   . HOH D 4 .   ? 18.418  25.557 31.272 1.00 69.80 ? 1617 HOH X O   1 
HETATM 2824 O O   . HOH D 4 .   ? 8.583   61.642 73.508 1.00 58.68 ? 1618 HOH X O   1 
HETATM 2825 O O   . HOH D 4 .   ? 10.512  34.553 52.138 1.00 58.65 ? 1619 HOH X O   1 
HETATM 2826 O O   . HOH D 4 .   ? -9.595  58.666 45.729 1.00 60.56 ? 1620 HOH X O   1 
HETATM 2827 O O   . HOH D 4 .   ? -1.307  72.098 57.587 1.00 53.51 ? 1621 HOH X O   1 
HETATM 2828 O O   . HOH D 4 .   ? 11.498  58.437 44.859 1.00 62.64 ? 1622 HOH X O   1 
HETATM 2829 O O   . HOH D 4 .   ? 18.110  36.850 19.545 1.00 57.47 ? 1623 HOH X O   1 
HETATM 2830 O O   . HOH D 4 .   ? 26.376  43.060 54.897 1.00 47.36 ? 1624 HOH X O   1 
HETATM 2831 O O   . HOH D 4 .   ? 0.572   35.079 26.315 1.00 51.42 ? 1625 HOH X O   1 
HETATM 2832 O O   . HOH D 4 .   ? 18.885  31.983 26.434 1.00 59.41 ? 1626 HOH X O   1 
HETATM 2833 O O   . HOH D 4 .   ? -1.048  70.147 53.269 1.00 58.96 ? 1627 HOH X O   1 
HETATM 2834 O O   . HOH D 4 .   ? 15.888  47.232 59.919 1.00 59.58 ? 1628 HOH X O   1 
HETATM 2835 O O   . HOH D 4 .   ? 13.434  50.593 46.499 1.00 60.00 ? 1629 HOH X O   1 
HETATM 2836 O O   . HOH D 4 .   ? 24.175  51.429 38.793 1.00 72.52 ? 1630 HOH X O   1 
HETATM 2837 O O   . HOH D 4 .   ? 15.341  61.955 47.218 1.00 45.63 ? 1631 HOH X O   1 
HETATM 2838 O O   . HOH D 4 .   ? 3.326   47.973 48.699 1.00 51.64 ? 1632 HOH X O   1 
HETATM 2839 O O   . HOH D 4 .   ? -1.791  44.342 56.497 1.00 43.56 ? 1633 HOH X O   1 
HETATM 2840 O O   . HOH D 4 .   ? 16.057  45.545 24.607 1.00 66.57 ? 1634 HOH X O   1 
HETATM 2841 O O   . HOH D 4 .   ? 3.023   74.160 58.390 1.00 58.50 ? 1635 HOH X O   1 
HETATM 2842 O O   . HOH D 4 .   ? 10.020  53.077 68.884 1.00 63.25 ? 1636 HOH X O   1 
HETATM 2843 O O   . HOH D 4 .   ? -11.131 52.854 54.403 1.00 48.90 ? 1637 HOH X O   1 
HETATM 2844 O O   . HOH D 4 .   ? 7.377   48.764 69.456 1.00 59.69 ? 1638 HOH X O   1 
HETATM 2845 O O   . HOH D 4 .   ? 9.930   57.362 73.558 1.00 65.82 ? 1639 HOH X O   1 
HETATM 2846 O O   . HOH D 4 .   ? 29.588  44.698 53.507 1.00 58.32 ? 1640 HOH X O   1 
HETATM 2847 O O   . HOH D 4 .   ? 22.568  26.545 30.678 1.00 57.25 ? 1641 HOH X O   1 
HETATM 2848 O O   . HOH D 4 .   ? 10.581  27.907 48.917 1.00 50.45 ? 1642 HOH X O   1 
HETATM 2849 O O   . HOH D 4 .   ? 0.591   44.390 50.158 1.00 46.30 ? 1643 HOH X O   1 
HETATM 2850 O O   . HOH D 4 .   ? -2.186  47.080 51.078 1.00 48.77 ? 1644 HOH X O   1 
HETATM 2851 O O   . HOH D 4 .   ? -7.793  29.493 37.635 1.00 74.32 ? 1645 HOH X O   1 
HETATM 2852 O O   . HOH D 4 .   ? 24.610  46.511 53.095 1.00 54.26 ? 1646 HOH X O   1 
HETATM 2853 O O   . HOH D 4 .   ? 12.831  78.475 60.038 1.00 44.58 ? 1647 HOH X O   1 
HETATM 2854 O O   . HOH D 4 .   ? 5.099   50.604 46.006 1.00 55.61 ? 1648 HOH X O   1 
HETATM 2855 O O   . HOH D 4 .   ? 10.962  33.646 39.039 1.00 27.87 ? 1649 HOH X O   1 
HETATM 2856 O O   . HOH D 4 .   ? 8.305   33.503 40.337 1.00 38.57 ? 1650 HOH X O   1 
HETATM 2857 O O   . HOH D 4 .   ? 9.875   38.554 49.606 1.00 60.06 ? 1651 HOH X O   1 
HETATM 2858 O O   . HOH D 4 .   ? 14.068  35.034 50.553 1.00 49.12 ? 1652 HOH X O   1 
HETATM 2859 O O   . HOH D 4 .   ? 10.742  78.257 61.814 1.00 46.86 ? 1653 HOH X O   1 
HETATM 2860 O O   . HOH D 4 .   ? -0.919  46.656 61.670 1.00 48.52 ? 1654 HOH X O   1 
HETATM 2861 O O   . HOH D 4 .   ? 1.990   29.806 29.476 1.00 53.56 ? 1655 HOH X O   1 
HETATM 2862 O O   . HOH D 4 .   ? 1.654   68.184 50.262 1.00 48.43 ? 1656 HOH X O   1 
HETATM 2863 O O   . HOH D 4 .   ? -13.771 57.389 55.148 1.00 55.73 ? 1657 HOH X O   1 
HETATM 2864 O O   . HOH D 4 .   ? 10.313  50.013 62.182 1.00 53.57 ? 1658 HOH X O   1 
HETATM 2865 O O   . HOH D 4 .   ? 4.903   54.570 45.388 1.00 36.28 ? 1659 HOH X O   1 
HETATM 2866 O O   . HOH D 4 .   ? -7.676  40.177 63.042 1.00 49.17 ? 1660 HOH X O   1 
HETATM 2867 O O   . HOH D 4 .   ? 3.551   77.675 65.870 1.00 43.98 ? 1661 HOH X O   1 
HETATM 2868 O O   . HOH D 4 .   ? 6.123   31.437 24.126 1.00 54.21 ? 1662 HOH X O   1 
HETATM 2869 O O   . HOH D 4 .   ? 30.775  34.278 45.772 1.00 50.91 ? 1663 HOH X O   1 
HETATM 2870 O O   . HOH D 4 .   ? 24.509  41.191 51.826 1.00 44.27 ? 1664 HOH X O   1 
HETATM 2871 O O   . HOH D 4 .   ? 11.635  39.339 21.713 1.00 45.14 ? 1665 HOH X O   1 
HETATM 2872 O O   . HOH D 4 .   ? 3.206   51.769 47.497 1.00 42.91 ? 1666 HOH X O   1 
HETATM 2873 O O   . HOH D 4 .   ? 27.036  33.482 48.885 1.00 47.67 ? 1667 HOH X O   1 
HETATM 2874 O O   . HOH D 4 .   ? 26.292  31.906 46.942 1.00 47.22 ? 1668 HOH X O   1 
HETATM 2875 O O   . HOH D 4 .   ? 5.636   71.886 79.325 1.00 45.82 ? 1669 HOH X O   1 
HETATM 2876 O O   . HOH D 4 .   ? 24.383  36.832 34.979 1.00 50.98 ? 1670 HOH X O   1 
HETATM 2877 O O   . HOH D 4 .   ? 7.655   60.811 76.127 1.00 53.86 ? 1671 HOH X O   1 
HETATM 2878 O O   . HOH D 4 .   ? 23.541  48.547 52.367 1.00 51.85 ? 1672 HOH X O   1 
HETATM 2879 O O   . HOH D 4 .   ? 5.375   27.642 49.600 1.00 62.32 ? 1673 HOH X O   1 
HETATM 2880 O O   . HOH D 4 .   ? -8.856  71.914 58.548 1.00 63.22 ? 1674 HOH X O   1 
HETATM 2881 O O   . HOH D 4 .   ? 22.466  43.194 33.285 1.00 47.71 ? 1675 HOH X O   1 
HETATM 2882 O O   . HOH D 4 .   ? 7.648   52.832 48.003 1.00 52.64 ? 1676 HOH X O   1 
HETATM 2883 O O   . HOH D 4 .   ? 3.512   67.618 47.931 1.00 49.43 ? 1677 HOH X O   1 
HETATM 2884 O O   . HOH D 4 .   ? -2.752  57.270 44.990 1.00 45.21 ? 1678 HOH X O   1 
HETATM 2885 O O   . HOH D 4 .   ? 11.195  39.310 19.010 1.00 51.38 ? 1679 HOH X O   1 
HETATM 2886 O O   . HOH D 4 .   ? -8.666  66.379 52.834 1.00 56.92 ? 1680 HOH X O   1 
HETATM 2887 O O   . HOH D 4 .   ? -13.187 66.674 54.159 1.00 54.44 ? 1681 HOH X O   1 
HETATM 2888 O O   . HOH D 4 .   ? -5.803  63.082 75.405 1.00 42.36 ? 1682 HOH X O   1 
HETATM 2889 O O   . HOH D 4 .   ? -12.279 44.356 57.028 1.00 46.32 ? 1683 HOH X O   1 
HETATM 2890 O O   . HOH D 4 .   ? -18.515 64.074 62.835 1.00 47.69 ? 1684 HOH X O   1 
HETATM 2891 O O   . HOH D 4 .   ? 18.073  33.289 24.242 1.00 55.71 ? 1685 HOH X O   1 
HETATM 2892 O O   . HOH D 4 .   ? 12.295  45.526 64.115 1.00 45.52 ? 1686 HOH X O   1 
HETATM 2893 O O   . HOH D 4 .   ? 4.790   33.271 49.972 1.00 48.99 ? 1687 HOH X O   1 
HETATM 2894 O O   . HOH D 4 .   ? 17.020  61.165 59.021 1.00 53.44 ? 1688 HOH X O   1 
HETATM 2895 O O   . HOH D 4 .   ? -12.226 59.088 51.774 1.00 48.89 ? 1689 HOH X O   1 
HETATM 2896 O O   . HOH D 4 .   ? 10.899  76.155 57.041 1.00 45.62 ? 1690 HOH X O   1 
HETATM 2897 O O   . HOH D 4 .   ? 19.744  68.460 58.175 1.00 54.32 ? 1691 HOH X O   1 
HETATM 2898 O O   . HOH D 4 .   ? -4.312  75.218 70.676 1.00 52.42 ? 1692 HOH X O   1 
HETATM 2899 O O   . HOH D 4 .   ? 1.034   34.813 68.417 1.00 52.56 ? 1693 HOH X O   1 
HETATM 2900 O O   . HOH D 4 .   ? 19.005  25.754 52.025 1.00 48.60 ? 1694 HOH X O   1 
HETATM 2901 O O   . HOH D 4 .   ? 2.580   70.302 51.761 1.00 46.43 ? 1695 HOH X O   1 
HETATM 2902 O O   . HOH D 4 .   ? 27.005  40.278 43.192 1.00 49.60 ? 1696 HOH X O   1 
HETATM 2903 O O   . HOH D 4 .   ? 15.230  56.649 66.766 1.00 54.20 ? 1697 HOH X O   1 
HETATM 2904 O O   . HOH D 4 .   ? 10.387  38.588 53.099 1.00 53.76 ? 1698 HOH X O   1 
HETATM 2905 O O   . HOH D 4 .   ? -2.392  70.849 79.419 1.00 49.83 ? 1699 HOH X O   1 
HETATM 2906 O O   . HOH D 4 .   ? -5.434  67.682 55.055 1.00 55.19 ? 1700 HOH X O   1 
HETATM 2907 O O   . HOH D 4 .   ? 8.005   41.002 63.935 1.00 50.74 ? 1701 HOH X O   1 
HETATM 2908 O O   . HOH D 4 .   ? -3.515  42.742 39.481 1.00 51.72 ? 1702 HOH X O   1 
HETATM 2909 O O   . HOH D 4 .   ? 8.605   77.104 60.587 1.00 47.29 ? 1703 HOH X O   1 
HETATM 2910 O O   . HOH D 4 .   ? -22.217 59.932 68.729 1.00 53.12 ? 1704 HOH X O   1 
HETATM 2911 O O   . HOH D 4 .   ? 1.807   38.653 62.064 1.00 56.01 ? 1705 HOH X O   1 
HETATM 2912 O O   . HOH D 4 .   ? -9.321  48.050 50.615 1.00 52.29 ? 1706 HOH X O   1 
HETATM 2913 O O   . HOH D 4 .   ? -19.504 61.368 56.841 1.00 53.79 ? 1707 HOH X O   1 
HETATM 2914 O O   . HOH D 4 .   ? 16.024  55.597 57.836 1.00 50.16 ? 1708 HOH X O   1 
HETATM 2915 O O   . HOH D 4 .   ? 18.371  63.071 57.416 1.00 53.58 ? 1709 HOH X O   1 
HETATM 2916 O O   . HOH D 4 .   ? -19.058 55.686 70.837 1.00 52.54 ? 1710 HOH X O   1 
HETATM 2917 O O   . HOH D 4 .   ? 11.891  37.646 51.263 1.00 52.79 ? 1711 HOH X O   1 
HETATM 2918 O O   . HOH D 4 .   ? -4.407  33.863 65.949 1.00 50.69 ? 1712 HOH X O   1 
HETATM 2919 O O   . HOH D 4 .   ? 10.197  21.913 34.558 1.00 51.77 ? 1713 HOH X O   1 
HETATM 2920 O O   . HOH D 4 .   ? 3.102   64.856 44.972 1.00 48.80 ? 1714 HOH X O   1 
HETATM 2921 O O   . HOH D 4 .   ? 6.310   22.167 48.995 1.00 55.50 ? 1715 HOH X O   1 
HETATM 2922 O O   . HOH D 4 .   ? 15.101  26.343 38.188 1.00 53.93 ? 1716 HOH X O   1 
HETATM 2923 O O   . HOH D 4 .   ? -15.859 40.674 65.390 1.00 57.98 ? 1717 HOH X O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   X . n 
A 1 2   SER 2   2   ?   ?   ?   X . n 
A 1 3   SER 3   3   3   SER SER X . n 
A 1 4   LYS 4   4   4   LYS LYS X . n 
A 1 5   PRO 5   5   5   PRO PRO X . n 
A 1 6   THR 6   6   6   THR THR X . n 
A 1 7   ASP 7   7   7   ASP ASP X . n 
A 1 8   ARG 8   8   8   ARG ARG X . n 
A 1 9   GLY 9   9   9   GLY GLY X . n 
A 1 10  GLN 10  10  10  GLN GLN X . n 
A 1 11  GLN 11  11  11  GLN GLN X . n 
A 1 12  TYR 12  12  12  TYR TYR X . n 
A 1 13  LYS 13  13  13  LYS LYS X . n 
A 1 14  ASP 14  14  14  ASP ASP X . n 
A 1 15  GLY 15  15  15  GLY GLY X . n 
A 1 16  LYS 16  16  16  LYS LYS X . n 
A 1 17  PHE 17  17  17  PHE PHE X . n 
A 1 18  THR 18  18  18  THR THR X . n 
A 1 19  GLN 19  19  19  GLN GLN X . n 
A 1 20  PRO 20  20  20  PRO PRO X . n 
A 1 21  PHE 21  21  21  PHE PHE X . n 
A 1 22  SER 22  22  22  SER SER X . n 
A 1 23  LEU 23  23  23  LEU LEU X . n 
A 1 24  VAL 24  24  24  VAL VAL X . n 
A 1 25  ASN 25  25  25  ASN ASN X . n 
A 1 26  GLN 26  26  26  GLN GLN X . n 
A 1 27  PRO 27  27  27  PRO PRO X . n 
A 1 28  ASP 28  28  28  ASP ASP X . n 
A 1 29  ALA 29  29  29  ALA ALA X . n 
A 1 30  VAL 30  30  30  VAL VAL X . n 
A 1 31  GLY 31  31  31  GLY GLY X . n 
A 1 32  ALA 32  32  32  ALA ALA X . n 
A 1 33  PRO 33  33  33  PRO PRO X . n 
A 1 34  ILE 34  34  34  ILE ILE X . n 
A 1 35  ASN 35  35  35  ASN ASN X . n 
A 1 36  ALA 36  36  36  ALA ALA X . n 
A 1 37  GLY 37  37  37  GLY GLY X . n 
A 1 38  ASP 38  38  38  ASP ASP X . n 
A 1 39  PHE 39  39  39  PHE PHE X . n 
A 1 40  ALA 40  40  40  ALA ALA X . n 
A 1 41  GLU 41  41  41  GLU GLU X . n 
A 1 42  GLN 42  42  42  GLN GLN X . n 
A 1 43  ILE 43  43  43  ILE ILE X . n 
A 1 44  ASN 44  44  44  ASN ASN X . n 
A 1 45  HIS 45  45  45  HIS HIS X . n 
A 1 46  ILE 46  46  46  ILE ILE X . n 
A 1 47  ARG 47  47  47  ARG ARG X . n 
A 1 48  ASN 48  48  48  ASN ASN X . n 
A 1 49  SER 49  49  49  SER SER X . n 
A 1 50  SER 50  50  50  SER SER X . n 
A 1 51  PRO 51  51  51  PRO PRO X . n 
A 1 52  ARG 52  52  52  ARG ARG X . n 
A 1 53  LEU 53  53  53  LEU LEU X . n 
A 1 54  TYR 54  54  54  TYR TYR X . n 
A 1 55  GLY 55  55  55  GLY GLY X . n 
A 1 56  ASN 56  56  56  ASN ASN X . n 
A 1 57  GLN 57  57  57  GLN GLN X . n 
A 1 58  SER 58  58  58  SER SER X . n 
A 1 59  ASN 59  59  59  ASN ASN X . n 
A 1 60  VAL 60  60  60  VAL VAL X . n 
A 1 61  TYR 61  61  61  TYR TYR X . n 
A 1 62  ASN 62  62  62  ASN ASN X . n 
A 1 63  ALA 63  63  63  ALA ALA X . n 
A 1 64  VAL 64  64  64  VAL VAL X . n 
A 1 65  GLN 65  65  65  GLN GLN X . n 
A 1 66  GLU 66  66  66  GLU GLU X . n 
A 1 67  TRP 67  67  67  TRP TRP X . n 
A 1 68  LEU 68  68  68  LEU LEU X . n 
A 1 69  ARG 69  69  69  ARG ARG X . n 
A 1 70  ALA 70  70  70  ALA ALA X . n 
A 1 71  GLY 71  71  71  GLY GLY X . n 
A 1 72  GLY 72  72  72  GLY GLY X . n 
A 1 73  ASP 73  73  73  ASP ASP X . n 
A 1 74  THR 74  74  74  THR THR X . n 
A 1 75  ARG 75  75  75  ARG ARG X . n 
A 1 76  ASN 76  76  76  ASN ASN X . n 
A 1 77  MET 77  77  77  MET MET X . n 
A 1 78  ARG 78  78  78  ARG ARG X . n 
A 1 79  GLN 79  79  79  GLN GLN X . n 
A 1 80  PHE 80  80  80  PHE PHE X . n 
A 1 81  GLY 81  81  81  GLY GLY X . n 
A 1 82  ILE 82  82  82  ILE ILE X . n 
A 1 83  ASP 83  83  83  ASP ASP X . n 
A 1 84  ALA 84  84  84  ALA ALA X . n 
A 1 85  TRP 85  85  85  TRP TRP X . n 
A 1 86  GLN 86  86  86  GLN GLN X . n 
A 1 87  MET 87  87  87  MET MET X . n 
A 1 88  GLU 88  88  88  GLU GLU X . n 
A 1 89  GLY 89  89  89  GLY GLY X . n 
A 1 90  ALA 90  90  90  ALA ALA X . n 
A 1 91  ASP 91  91  91  ASP ASP X . n 
A 1 92  ASN 92  92  92  ASN ASN X . n 
A 1 93  TYR 93  93  93  TYR TYR X . n 
A 1 94  GLY 94  94  94  GLY GLY X . n 
A 1 95  ASN 95  95  95  ASN ASN X . n 
A 1 96  VAL 96  96  96  VAL VAL X . n 
A 1 97  GLN 97  97  97  GLN GLN X . n 
A 1 98  PHE 98  98  98  PHE PHE X . n 
A 1 99  THR 99  99  99  THR THR X . n 
A 1 100 GLY 100 100 100 GLY GLY X . n 
A 1 101 TYR 101 101 101 TYR TYR X . n 
A 1 102 TYR 102 102 102 TYR TYR X . n 
A 1 103 THR 103 103 103 THR THR X . n 
A 1 104 PRO 104 104 104 PRO PRO X . n 
A 1 105 VAL 105 105 105 VAL VAL X . n 
A 1 106 ILE 106 106 106 ILE ILE X . n 
A 1 107 GLN 107 107 107 GLN GLN X . n 
A 1 108 ALA 108 108 108 ALA ALA X . n 
A 1 109 ARG 109 109 109 ARG ARG X . n 
A 1 110 HIS 110 110 110 HIS HIS X . n 
A 1 111 THR 111 111 111 THR THR X . n 
A 1 112 ARG 112 112 112 ARG ARG X . n 
A 1 113 GLN 113 113 113 GLN GLN X . n 
A 1 114 GLY 114 114 114 GLY GLY X . n 
A 1 115 GLU 115 115 115 GLU GLU X . n 
A 1 116 PHE 116 116 116 PHE PHE X . n 
A 1 117 GLN 117 117 117 GLN GLN X . n 
A 1 118 TYR 118 118 118 TYR TYR X . n 
A 1 119 PRO 119 119 119 PRO PRO X . n 
A 1 120 ILE 120 120 120 ILE ILE X . n 
A 1 121 TYR 121 121 121 TYR TYR X . n 
A 1 122 ARG 122 122 122 ARG ARG X . n 
A 1 123 MET 123 123 123 MET MET X . n 
A 1 124 PRO 124 124 124 PRO PRO X . n 
A 1 125 PRO 125 125 125 PRO PRO X . n 
A 1 126 LYS 126 126 126 LYS LYS X . n 
A 1 127 ARG 127 127 127 ARG ARG X . n 
A 1 128 GLY 128 128 128 GLY GLY X . n 
A 1 129 ARG 129 129 129 ARG ARG X . n 
A 1 130 LEU 130 130 130 LEU LEU X . n 
A 1 131 SER 131 131 131 SER SER X . n 
A 1 132 SER 132 132 132 SER SER X . n 
A 1 133 ARG 133 133 133 ARG ARG X . n 
A 1 134 ALA 134 134 134 ALA ALA X . n 
A 1 135 GLU 135 135 135 GLU GLU X . n 
A 1 136 ILE 136 136 136 ILE ILE X . n 
A 1 137 TYR 137 137 137 TYR TYR X . n 
A 1 138 ALA 138 138 138 ALA ALA X . n 
A 1 139 GLY 139 139 139 GLY GLY X . n 
A 1 140 ALA 140 140 140 ALA ALA X . n 
A 1 141 LEU 141 141 141 LEU LEU X . n 
A 1 142 SER 142 142 142 SER SER X . n 
A 1 143 ASP 143 143 143 ASP ASP X . n 
A 1 144 LYS 144 144 144 LYS LYS X . n 
A 1 145 TYR 145 145 145 TYR TYR X . n 
A 1 146 ILE 146 146 146 ILE ILE X . n 
A 1 147 LEU 147 147 147 LEU LEU X . n 
A 1 148 ALA 148 148 148 ALA ALA X . n 
A 1 149 TYR 149 149 149 TYR TYR X . n 
A 1 150 SER 150 150 150 SER SER X . n 
A 1 151 ASN 151 151 151 ASN ASN X . n 
A 1 152 SER 152 152 152 SER SER X . n 
A 1 153 LEU 153 153 153 LEU LEU X . n 
A 1 154 MET 154 154 154 MET MET X . n 
A 1 155 ASP 155 155 155 ASP ASP X . n 
A 1 156 ASN 156 156 156 ASN ASN X . n 
A 1 157 PHE 157 157 157 PHE PHE X . n 
A 1 158 ILE 158 158 158 ILE ILE X . n 
A 1 159 MET 159 159 159 MET MET X . n 
A 1 160 ASP 160 160 160 ASP ASP X . n 
A 1 161 VAL 161 161 161 VAL VAL X . n 
A 1 162 GLN 162 162 162 GLN GLN X . n 
A 1 163 GLY 163 163 163 GLY GLY X . n 
A 1 164 SER 164 164 164 SER SER X . n 
A 1 165 GLY 165 165 165 GLY GLY X . n 
A 1 166 TYR 166 166 166 TYR TYR X . n 
A 1 167 ILE 167 167 167 ILE ILE X . n 
A 1 168 ASP 168 168 168 ASP ASP X . n 
A 1 169 PHE 169 169 169 PHE PHE X . n 
A 1 170 GLY 170 170 170 GLY GLY X . n 
A 1 171 ASP 171 171 171 ASP ASP X . n 
A 1 172 GLY 172 172 172 GLY GLY X . n 
A 1 173 SER 173 173 173 SER SER X . n 
A 1 174 PRO 174 174 174 PRO PRO X . n 
A 1 175 LEU 175 175 175 LEU LEU X . n 
A 1 176 ASN 176 176 176 ASN ASN X . n 
A 1 177 PHE 177 177 177 PHE PHE X . n 
A 1 178 PHE 178 178 178 PHE PHE X . n 
A 1 179 SER 179 179 179 SER SER X . n 
A 1 180 TYR 180 180 180 TYR TYR X . n 
A 1 181 ALA 181 181 181 ALA ALA X . n 
A 1 182 GLY 182 182 182 GLY GLY X . n 
A 1 183 LYS 183 183 183 LYS LYS X . n 
A 1 184 ASN 184 184 184 ASN ASN X . n 
A 1 185 GLY 185 185 185 GLY GLY X . n 
A 1 186 HIS 186 186 186 HIS HIS X . n 
A 1 187 ALA 187 187 187 ALA ALA X . n 
A 1 188 TYR 188 188 188 TYR TYR X . n 
A 1 189 ARG 189 189 189 ARG ARG X . n 
A 1 190 SER 190 190 190 SER SER X . n 
A 1 191 ILE 191 191 191 ILE ILE X . n 
A 1 192 GLY 192 192 192 GLY GLY X . n 
A 1 193 LYS 193 193 193 LYS LYS X . n 
A 1 194 VAL 194 194 194 VAL VAL X . n 
A 1 195 LEU 195 195 195 LEU LEU X . n 
A 1 196 ILE 196 196 196 ILE ILE X . n 
A 1 197 ASP 197 197 197 ASP ASP X . n 
A 1 198 ARG 198 198 198 ARG ARG X . n 
A 1 199 GLY 199 199 199 GLY GLY X . n 
A 1 200 GLU 200 200 200 GLU GLU X . n 
A 1 201 VAL 201 201 201 VAL VAL X . n 
A 1 202 LYS 202 202 202 LYS LYS X . n 
A 1 203 LYS 203 203 203 LYS LYS X . n 
A 1 204 GLU 204 204 204 GLU GLU X . n 
A 1 205 ASP 205 205 205 ASP ASP X . n 
A 1 206 MET 206 206 206 MET MET X . n 
A 1 207 SER 207 207 207 SER SER X . n 
A 1 208 MET 208 208 208 MET MET X . n 
A 1 209 GLN 209 209 209 GLN GLN X . n 
A 1 210 ALA 210 210 210 ALA ALA X . n 
A 1 211 ILE 211 211 211 ILE ILE X . n 
A 1 212 ARG 212 212 212 ARG ARG X . n 
A 1 213 HIS 213 213 213 HIS HIS X . n 
A 1 214 TRP 214 214 214 TRP TRP X . n 
A 1 215 GLY 215 215 215 GLY GLY X . n 
A 1 216 GLU 216 216 216 GLU GLU X . n 
A 1 217 THR 217 217 217 THR THR X . n 
A 1 218 HIS 218 218 218 HIS HIS X . n 
A 1 219 SER 219 219 219 SER SER X . n 
A 1 220 GLU 220 220 220 GLU GLU X . n 
A 1 221 ALA 221 221 221 ALA ALA X . n 
A 1 222 GLU 222 222 222 GLU GLU X . n 
A 1 223 VAL 223 223 223 VAL VAL X . n 
A 1 224 ARG 224 224 224 ARG ARG X . n 
A 1 225 GLU 225 225 225 GLU GLU X . n 
A 1 226 LEU 226 226 226 LEU LEU X . n 
A 1 227 LEU 227 227 227 LEU LEU X . n 
A 1 228 GLU 228 228 228 GLU GLU X . n 
A 1 229 GLN 229 229 229 GLN GLN X . n 
A 1 230 ASN 230 230 230 ASN ASN X . n 
A 1 231 PRO 231 231 231 PRO PRO X . n 
A 1 232 SER 232 232 232 SER SER X . n 
A 1 233 PHE 233 233 233 PHE PHE X . n 
A 1 234 VAL 234 234 234 VAL VAL X . n 
A 1 235 PHE 235 235 235 PHE PHE X . n 
A 1 236 PHE 236 236 236 PHE PHE X . n 
A 1 237 LYS 237 237 237 LYS LYS X . n 
A 1 238 PRO 238 238 238 PRO PRO X . n 
A 1 239 GLN 239 239 239 GLN GLN X . n 
A 1 240 SER 240 240 240 SER SER X . n 
A 1 241 PHE 241 241 241 PHE PHE X . n 
A 1 242 ALA 242 242 242 ALA ALA X . n 
A 1 243 PRO 243 243 243 PRO PRO X . n 
A 1 244 VAL 244 244 244 VAL VAL X . n 
A 1 245 LYS 245 245 245 LYS LYS X . n 
A 1 246 GLY 246 246 246 GLY GLY X . n 
A 1 247 ALA 247 247 247 ALA ALA X . n 
A 1 248 SER 248 248 248 SER SER X . n 
A 1 249 ALA 249 249 249 ALA ALA X . n 
A 1 250 VAL 250 250 250 VAL VAL X . n 
A 1 251 PRO 251 251 251 PRO PRO X . n 
A 1 252 LEU 252 252 252 LEU LEU X . n 
A 1 253 VAL 253 253 253 VAL VAL X . n 
A 1 254 GLY 254 254 254 GLY GLY X . n 
A 1 255 ARG 255 255 255 ARG ARG X . n 
A 1 256 ALA 256 256 256 ALA ALA X . n 
A 1 257 SER 257 257 257 SER SER X . n 
A 1 258 VAL 258 258 258 VAL VAL X . n 
A 1 259 ALA 259 259 259 ALA ALA X . n 
A 1 260 SER 260 260 260 SER SER X . n 
A 1 261 ASP 261 261 261 ASP ASP X . n 
A 1 262 ARG 262 262 262 ARG ARG X . n 
A 1 263 SER 263 263 263 SER SER X . n 
A 1 264 ILE 264 264 264 ILE ILE X . n 
A 1 265 ILE 265 265 265 ILE ILE X . n 
A 1 266 PRO 266 266 266 PRO PRO X . n 
A 1 267 PRO 267 267 267 PRO PRO X . n 
A 1 268 GLY 268 268 268 GLY GLY X . n 
A 1 269 THR 269 269 269 THR THR X . n 
A 1 270 THR 270 270 270 THR THR X . n 
A 1 271 LEU 271 271 271 LEU LEU X . n 
A 1 272 LEU 272 272 272 LEU LEU X . n 
A 1 273 ALA 273 273 273 ALA ALA X . n 
A 1 274 GLU 274 274 274 GLU GLU X . n 
A 1 275 VAL 275 275 275 VAL VAL X . n 
A 1 276 PRO 276 276 276 PRO PRO X . n 
A 1 277 LEU 277 277 277 LEU LEU X . n 
A 1 278 LEU 278 278 278 LEU LEU X . n 
A 1 279 ASP 279 279 279 ASP ASP X . n 
A 1 280 ASN 280 280 280 ASN ASN X . n 
A 1 281 ASN 281 281 281 ASN ASN X . n 
A 1 282 GLY 282 282 282 GLY GLY X . n 
A 1 283 LYS 283 283 283 LYS LYS X . n 
A 1 284 PHE 284 284 284 PHE PHE X . n 
A 1 285 ASN 285 285 285 ASN ASN X . n 
A 1 286 GLY 286 286 286 GLY GLY X . n 
A 1 287 GLN 287 287 287 GLN GLN X . n 
A 1 288 TYR 288 288 288 TYR TYR X . n 
A 1 289 GLU 289 289 289 GLU GLU X . n 
A 1 290 LEU 290 290 290 LEU LEU X . n 
A 1 291 ARG 291 291 291 ARG ARG X . n 
A 1 292 LEU 292 292 292 LEU LEU X . n 
A 1 293 MET 293 293 293 MET MET X . n 
A 1 294 VAL 294 294 294 VAL VAL X . n 
A 1 295 ALA 295 295 295 ALA ALA X . n 
A 1 296 LEU 296 296 296 LEU LEU X . n 
A 1 297 ASP 297 297 297 ASP ASP X . n 
A 1 298 VAL 298 298 298 VAL VAL X . n 
A 1 299 GLY 299 299 299 GLY GLY X . n 
A 1 300 GLY 300 300 300 GLY GLY X . n 
A 1 301 ALA 301 301 301 ALA ALA X . n 
A 1 302 ILE 302 302 302 ILE ILE X . n 
A 1 303 LYS 303 303 303 LYS LYS X . n 
A 1 304 GLY 304 304 304 GLY GLY X . n 
A 1 305 GLN 305 305 305 GLN GLN X . n 
A 1 306 HIS 306 306 306 HIS HIS X . n 
A 1 307 PHE 307 307 307 PHE PHE X . n 
A 1 308 ASP 308 308 308 ASP ASP X . n 
A 1 309 ILE 309 309 309 ILE ILE X . n 
A 1 310 TYR 310 310 310 TYR TYR X . n 
A 1 311 GLN 311 311 311 GLN GLN X . n 
A 1 312 GLY 312 312 312 GLY GLY X . n 
A 1 313 ILE 313 313 313 ILE ILE X . n 
A 1 314 GLY 314 314 314 GLY GLY X . n 
A 1 315 PRO 315 315 315 PRO PRO X . n 
A 1 316 GLU 316 316 316 GLU GLU X . n 
A 1 317 ALA 317 317 317 ALA ALA X . n 
A 1 318 GLY 318 318 318 GLY GLY X . n 
A 1 319 HIS 319 319 319 HIS HIS X . n 
A 1 320 ARG 320 320 320 ARG ARG X . n 
A 1 321 ALA 321 321 321 ALA ALA X . n 
A 1 322 GLY 322 322 322 GLY GLY X . n 
A 1 323 TRP 323 323 323 TRP TRP X . n 
A 1 324 TYR 324 324 324 TYR TYR X . n 
A 1 325 ASN 325 325 325 ASN ASN X . n 
A 1 326 HIS 326 326 326 HIS HIS X . n 
A 1 327 TYR 327 327 327 TYR TYR X . n 
A 1 328 GLY 328 328 328 GLY GLY X . n 
A 1 329 ARG 329 329 329 ARG ARG X . n 
A 1 330 VAL 330 330 330 VAL VAL X . n 
A 1 331 TRP 331 331 331 TRP TRP X . n 
A 1 332 VAL 332 332 332 VAL VAL X . n 
A 1 333 LEU 333 333 333 LEU LEU X . n 
A 1 334 LYS 334 334 334 LYS LYS X . n 
A 1 335 THR 335 335 335 THR THR X . n 
A 1 336 ALA 336 336 336 ALA ALA X . n 
A 1 337 PRO 337 337 337 PRO PRO X . n 
A 1 338 GLY 338 338 ?   ?   ?   X . n 
A 1 339 ALA 339 339 ?   ?   ?   X . n 
A 1 340 GLY 340 340 ?   ?   ?   X . n 
A 1 341 ASN 341 341 ?   ?   ?   X . n 
A 1 342 VAL 342 342 ?   ?   ?   X . n 
A 1 343 PHE 343 343 ?   ?   ?   X . n 
A 1 344 SER 344 344 ?   ?   ?   X . n 
A 1 345 GLY 345 345 ?   ?   ?   X . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 EDO 1   1439 1439 EDO EDO X . 
C 3 ACY 1   1002 1002 ACY ACY X . 
D 4 HOH 1   1440 1    HOH HOH X . 
D 4 HOH 2   1441 2    HOH HOH X . 
D 4 HOH 3   1442 3    HOH HOH X . 
D 4 HOH 4   1443 4    HOH HOH X . 
D 4 HOH 5   1444 5    HOH HOH X . 
D 4 HOH 6   1445 6    HOH HOH X . 
D 4 HOH 7   1446 7    HOH HOH X . 
D 4 HOH 8   1447 8    HOH HOH X . 
D 4 HOH 9   1448 9    HOH HOH X . 
D 4 HOH 10  1449 10   HOH HOH X . 
D 4 HOH 11  1450 11   HOH HOH X . 
D 4 HOH 12  1451 12   HOH HOH X . 
D 4 HOH 13  1452 13   HOH HOH X . 
D 4 HOH 14  1453 14   HOH HOH X . 
D 4 HOH 15  1454 15   HOH HOH X . 
D 4 HOH 16  1455 16   HOH HOH X . 
D 4 HOH 17  1456 17   HOH HOH X . 
D 4 HOH 18  1457 18   HOH HOH X . 
D 4 HOH 19  1458 19   HOH HOH X . 
D 4 HOH 20  1459 20   HOH HOH X . 
D 4 HOH 21  1460 21   HOH HOH X . 
D 4 HOH 22  1461 22   HOH HOH X . 
D 4 HOH 23  1462 23   HOH HOH X . 
D 4 HOH 24  1463 24   HOH HOH X . 
D 4 HOH 25  1464 25   HOH HOH X . 
D 4 HOH 26  1465 26   HOH HOH X . 
D 4 HOH 27  1466 27   HOH HOH X . 
D 4 HOH 28  1467 28   HOH HOH X . 
D 4 HOH 29  1468 29   HOH HOH X . 
D 4 HOH 30  1469 30   HOH HOH X . 
D 4 HOH 31  1470 31   HOH HOH X . 
D 4 HOH 32  1471 32   HOH HOH X . 
D 4 HOH 33  1472 33   HOH HOH X . 
D 4 HOH 34  1473 34   HOH HOH X . 
D 4 HOH 35  1474 35   HOH HOH X . 
D 4 HOH 36  1475 36   HOH HOH X . 
D 4 HOH 37  1476 37   HOH HOH X . 
D 4 HOH 38  1477 38   HOH HOH X . 
D 4 HOH 39  1478 39   HOH HOH X . 
D 4 HOH 40  1479 40   HOH HOH X . 
D 4 HOH 41  1480 41   HOH HOH X . 
D 4 HOH 42  1481 42   HOH HOH X . 
D 4 HOH 43  1482 43   HOH HOH X . 
D 4 HOH 44  1483 44   HOH HOH X . 
D 4 HOH 45  1484 45   HOH HOH X . 
D 4 HOH 46  1485 46   HOH HOH X . 
D 4 HOH 47  1486 47   HOH HOH X . 
D 4 HOH 48  1487 48   HOH HOH X . 
D 4 HOH 49  1488 49   HOH HOH X . 
D 4 HOH 50  1489 50   HOH HOH X . 
D 4 HOH 51  1490 51   HOH HOH X . 
D 4 HOH 52  1491 52   HOH HOH X . 
D 4 HOH 53  1492 53   HOH HOH X . 
D 4 HOH 54  1493 54   HOH HOH X . 
D 4 HOH 55  1494 55   HOH HOH X . 
D 4 HOH 56  1495 56   HOH HOH X . 
D 4 HOH 57  1496 57   HOH HOH X . 
D 4 HOH 58  1497 58   HOH HOH X . 
D 4 HOH 59  1498 59   HOH HOH X . 
D 4 HOH 60  1499 60   HOH HOH X . 
D 4 HOH 61  1500 61   HOH HOH X . 
D 4 HOH 62  1501 62   HOH HOH X . 
D 4 HOH 63  1502 63   HOH HOH X . 
D 4 HOH 64  1503 64   HOH HOH X . 
D 4 HOH 65  1504 65   HOH HOH X . 
D 4 HOH 66  1505 66   HOH HOH X . 
D 4 HOH 67  1506 67   HOH HOH X . 
D 4 HOH 68  1507 68   HOH HOH X . 
D 4 HOH 69  1508 69   HOH HOH X . 
D 4 HOH 70  1509 70   HOH HOH X . 
D 4 HOH 71  1510 71   HOH HOH X . 
D 4 HOH 72  1511 72   HOH HOH X . 
D 4 HOH 73  1512 73   HOH HOH X . 
D 4 HOH 74  1513 74   HOH HOH X . 
D 4 HOH 75  1514 75   HOH HOH X . 
D 4 HOH 76  1515 76   HOH HOH X . 
D 4 HOH 77  1516 77   HOH HOH X . 
D 4 HOH 78  1517 78   HOH HOH X . 
D 4 HOH 79  1518 79   HOH HOH X . 
D 4 HOH 80  1519 80   HOH HOH X . 
D 4 HOH 81  1520 81   HOH HOH X . 
D 4 HOH 82  1521 82   HOH HOH X . 
D 4 HOH 83  1522 83   HOH HOH X . 
D 4 HOH 84  1523 84   HOH HOH X . 
D 4 HOH 85  1524 85   HOH HOH X . 
D 4 HOH 86  1525 86   HOH HOH X . 
D 4 HOH 87  1526 87   HOH HOH X . 
D 4 HOH 88  1527 88   HOH HOH X . 
D 4 HOH 89  1528 89   HOH HOH X . 
D 4 HOH 90  1529 90   HOH HOH X . 
D 4 HOH 91  1530 91   HOH HOH X . 
D 4 HOH 92  1531 92   HOH HOH X . 
D 4 HOH 93  1532 93   HOH HOH X . 
D 4 HOH 94  1533 94   HOH HOH X . 
D 4 HOH 95  1534 95   HOH HOH X . 
D 4 HOH 96  1535 96   HOH HOH X . 
D 4 HOH 97  1536 97   HOH HOH X . 
D 4 HOH 98  1537 98   HOH HOH X . 
D 4 HOH 99  1538 99   HOH HOH X . 
D 4 HOH 100 1539 100  HOH HOH X . 
D 4 HOH 101 1540 101  HOH HOH X . 
D 4 HOH 102 1541 102  HOH HOH X . 
D 4 HOH 103 1542 103  HOH HOH X . 
D 4 HOH 104 1543 104  HOH HOH X . 
D 4 HOH 105 1544 105  HOH HOH X . 
D 4 HOH 106 1545 106  HOH HOH X . 
D 4 HOH 107 1546 107  HOH HOH X . 
D 4 HOH 108 1547 108  HOH HOH X . 
D 4 HOH 109 1548 109  HOH HOH X . 
D 4 HOH 110 1549 110  HOH HOH X . 
D 4 HOH 111 1550 111  HOH HOH X . 
D 4 HOH 112 1551 112  HOH HOH X . 
D 4 HOH 113 1552 113  HOH HOH X . 
D 4 HOH 114 1553 114  HOH HOH X . 
D 4 HOH 115 1554 115  HOH HOH X . 
D 4 HOH 116 1555 116  HOH HOH X . 
D 4 HOH 117 1556 117  HOH HOH X . 
D 4 HOH 118 1557 118  HOH HOH X . 
D 4 HOH 119 1558 119  HOH HOH X . 
D 4 HOH 120 1559 120  HOH HOH X . 
D 4 HOH 121 1560 121  HOH HOH X . 
D 4 HOH 122 1561 122  HOH HOH X . 
D 4 HOH 123 1562 123  HOH HOH X . 
D 4 HOH 124 1563 124  HOH HOH X . 
D 4 HOH 125 1564 125  HOH HOH X . 
D 4 HOH 126 1565 126  HOH HOH X . 
D 4 HOH 127 1566 127  HOH HOH X . 
D 4 HOH 128 1567 128  HOH HOH X . 
D 4 HOH 129 1568 129  HOH HOH X . 
D 4 HOH 130 1569 130  HOH HOH X . 
D 4 HOH 131 1570 131  HOH HOH X . 
D 4 HOH 132 1571 132  HOH HOH X . 
D 4 HOH 133 1572 133  HOH HOH X . 
D 4 HOH 134 1573 134  HOH HOH X . 
D 4 HOH 135 1574 135  HOH HOH X . 
D 4 HOH 136 1575 136  HOH HOH X . 
D 4 HOH 137 1576 137  HOH HOH X . 
D 4 HOH 138 1577 138  HOH HOH X . 
D 4 HOH 139 1578 139  HOH HOH X . 
D 4 HOH 140 1579 140  HOH HOH X . 
D 4 HOH 141 1580 141  HOH HOH X . 
D 4 HOH 142 1581 142  HOH HOH X . 
D 4 HOH 143 1582 143  HOH HOH X . 
D 4 HOH 144 1583 144  HOH HOH X . 
D 4 HOH 145 1584 145  HOH HOH X . 
D 4 HOH 146 1585 146  HOH HOH X . 
D 4 HOH 147 1586 147  HOH HOH X . 
D 4 HOH 148 1587 148  HOH HOH X . 
D 4 HOH 149 1588 149  HOH HOH X . 
D 4 HOH 150 1589 150  HOH HOH X . 
D 4 HOH 151 1590 151  HOH HOH X . 
D 4 HOH 152 1591 152  HOH HOH X . 
D 4 HOH 153 1592 153  HOH HOH X . 
D 4 HOH 154 1593 154  HOH HOH X . 
D 4 HOH 155 1594 155  HOH HOH X . 
D 4 HOH 156 1595 156  HOH HOH X . 
D 4 HOH 157 1596 157  HOH HOH X . 
D 4 HOH 158 1597 158  HOH HOH X . 
D 4 HOH 159 1598 159  HOH HOH X . 
D 4 HOH 160 1599 160  HOH HOH X . 
D 4 HOH 161 1600 161  HOH HOH X . 
D 4 HOH 162 1601 162  HOH HOH X . 
D 4 HOH 163 1602 163  HOH HOH X . 
D 4 HOH 164 1603 164  HOH HOH X . 
D 4 HOH 165 1604 165  HOH HOH X . 
D 4 HOH 166 1605 166  HOH HOH X . 
D 4 HOH 167 1606 167  HOH HOH X . 
D 4 HOH 168 1607 168  HOH HOH X . 
D 4 HOH 169 1608 169  HOH HOH X . 
D 4 HOH 170 1609 170  HOH HOH X . 
D 4 HOH 171 1610 171  HOH HOH X . 
D 4 HOH 172 1611 172  HOH HOH X . 
D 4 HOH 173 1612 173  HOH HOH X . 
D 4 HOH 174 1613 174  HOH HOH X . 
D 4 HOH 175 1614 175  HOH HOH X . 
D 4 HOH 176 1615 176  HOH HOH X . 
D 4 HOH 177 1616 177  HOH HOH X . 
D 4 HOH 178 1617 178  HOH HOH X . 
D 4 HOH 179 1618 179  HOH HOH X . 
D 4 HOH 180 1619 180  HOH HOH X . 
D 4 HOH 181 1620 181  HOH HOH X . 
D 4 HOH 182 1621 182  HOH HOH X . 
D 4 HOH 183 1622 183  HOH HOH X . 
D 4 HOH 184 1623 184  HOH HOH X . 
D 4 HOH 185 1624 185  HOH HOH X . 
D 4 HOH 186 1625 186  HOH HOH X . 
D 4 HOH 187 1626 187  HOH HOH X . 
D 4 HOH 188 1627 188  HOH HOH X . 
D 4 HOH 189 1628 189  HOH HOH X . 
D 4 HOH 190 1629 190  HOH HOH X . 
D 4 HOH 191 1630 191  HOH HOH X . 
D 4 HOH 192 1631 192  HOH HOH X . 
D 4 HOH 193 1632 193  HOH HOH X . 
D 4 HOH 194 1633 194  HOH HOH X . 
D 4 HOH 195 1634 195  HOH HOH X . 
D 4 HOH 196 1635 196  HOH HOH X . 
D 4 HOH 197 1636 197  HOH HOH X . 
D 4 HOH 198 1637 198  HOH HOH X . 
D 4 HOH 199 1638 199  HOH HOH X . 
D 4 HOH 200 1639 200  HOH HOH X . 
D 4 HOH 201 1640 201  HOH HOH X . 
D 4 HOH 202 1641 202  HOH HOH X . 
D 4 HOH 203 1642 203  HOH HOH X . 
D 4 HOH 204 1643 204  HOH HOH X . 
D 4 HOH 205 1644 205  HOH HOH X . 
D 4 HOH 206 1645 206  HOH HOH X . 
D 4 HOH 207 1646 207  HOH HOH X . 
D 4 HOH 208 1647 208  HOH HOH X . 
D 4 HOH 209 1648 209  HOH HOH X . 
D 4 HOH 210 1649 210  HOH HOH X . 
D 4 HOH 211 1650 211  HOH HOH X . 
D 4 HOH 212 1651 212  HOH HOH X . 
D 4 HOH 213 1652 213  HOH HOH X . 
D 4 HOH 214 1653 214  HOH HOH X . 
D 4 HOH 215 1654 215  HOH HOH X . 
D 4 HOH 216 1655 216  HOH HOH X . 
D 4 HOH 217 1656 217  HOH HOH X . 
D 4 HOH 218 1657 218  HOH HOH X . 
D 4 HOH 219 1658 219  HOH HOH X . 
D 4 HOH 220 1659 220  HOH HOH X . 
D 4 HOH 221 1660 221  HOH HOH X . 
D 4 HOH 222 1661 222  HOH HOH X . 
D 4 HOH 223 1662 223  HOH HOH X . 
D 4 HOH 224 1663 224  HOH HOH X . 
D 4 HOH 225 1664 225  HOH HOH X . 
D 4 HOH 226 1665 226  HOH HOH X . 
D 4 HOH 227 1666 227  HOH HOH X . 
D 4 HOH 228 1667 228  HOH HOH X . 
D 4 HOH 229 1668 229  HOH HOH X . 
D 4 HOH 230 1669 230  HOH HOH X . 
D 4 HOH 231 1670 231  HOH HOH X . 
D 4 HOH 232 1671 232  HOH HOH X . 
D 4 HOH 233 1672 233  HOH HOH X . 
D 4 HOH 234 1673 234  HOH HOH X . 
D 4 HOH 235 1674 235  HOH HOH X . 
D 4 HOH 236 1675 236  HOH HOH X . 
D 4 HOH 237 1676 237  HOH HOH X . 
D 4 HOH 238 1677 238  HOH HOH X . 
D 4 HOH 239 1678 239  HOH HOH X . 
D 4 HOH 240 1679 240  HOH HOH X . 
D 4 HOH 241 1680 241  HOH HOH X . 
D 4 HOH 242 1681 242  HOH HOH X . 
D 4 HOH 243 1682 243  HOH HOH X . 
D 4 HOH 244 1683 244  HOH HOH X . 
D 4 HOH 245 1684 245  HOH HOH X . 
D 4 HOH 246 1685 246  HOH HOH X . 
D 4 HOH 247 1686 247  HOH HOH X . 
D 4 HOH 248 1687 248  HOH HOH X . 
D 4 HOH 249 1688 249  HOH HOH X . 
D 4 HOH 250 1689 250  HOH HOH X . 
D 4 HOH 251 1690 251  HOH HOH X . 
D 4 HOH 252 1691 252  HOH HOH X . 
D 4 HOH 253 1692 253  HOH HOH X . 
D 4 HOH 254 1693 254  HOH HOH X . 
D 4 HOH 255 1694 255  HOH HOH X . 
D 4 HOH 256 1695 256  HOH HOH X . 
D 4 HOH 257 1696 257  HOH HOH X . 
D 4 HOH 258 1697 258  HOH HOH X . 
D 4 HOH 259 1698 259  HOH HOH X . 
D 4 HOH 260 1699 260  HOH HOH X . 
D 4 HOH 261 1700 261  HOH HOH X . 
D 4 HOH 262 1701 262  HOH HOH X . 
D 4 HOH 263 1702 263  HOH HOH X . 
D 4 HOH 264 1703 264  HOH HOH X . 
D 4 HOH 265 1704 265  HOH HOH X . 
D 4 HOH 266 1705 266  HOH HOH X . 
D 4 HOH 267 1706 267  HOH HOH X . 
D 4 HOH 268 1707 268  HOH HOH X . 
D 4 HOH 269 1708 269  HOH HOH X . 
D 4 HOH 270 1709 270  HOH HOH X . 
D 4 HOH 271 1710 271  HOH HOH X . 
D 4 HOH 272 1711 272  HOH HOH X . 
D 4 HOH 273 1712 273  HOH HOH X . 
D 4 HOH 274 1713 274  HOH HOH X . 
D 4 HOH 275 1714 275  HOH HOH X . 
D 4 HOH 276 1715 276  HOH HOH X . 
D 4 HOH 277 1716 277  HOH HOH X . 
D 4 HOH 278 1717 278  HOH HOH X . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_defined_assembly 
_pdbx_struct_assembly.method_details       ? 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-10-04 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2017-10-11 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' Advisory                    
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    4 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         3.7960 
_pdbx_refine_tls.origin_y         48.5200 
_pdbx_refine_tls.origin_z         52.5150 
_pdbx_refine_tls.T[1][1]          0.0310 
_pdbx_refine_tls.T[2][2]          0.0445 
_pdbx_refine_tls.T[3][3]          0.0941 
_pdbx_refine_tls.T[1][2]          -0.0339 
_pdbx_refine_tls.T[1][3]          -0.0342 
_pdbx_refine_tls.T[2][3]          0.0170 
_pdbx_refine_tls.L[1][1]          0.5211 
_pdbx_refine_tls.L[2][2]          0.7963 
_pdbx_refine_tls.L[3][3]          1.4664 
_pdbx_refine_tls.L[1][2]          -0.2071 
_pdbx_refine_tls.L[1][3]          -0.0290 
_pdbx_refine_tls.L[2][3]          0.5691 
_pdbx_refine_tls.S[1][1]          0.0905 
_pdbx_refine_tls.S[2][2]          -0.0469 
_pdbx_refine_tls.S[3][3]          -0.0436 
_pdbx_refine_tls.S[1][2]          -0.0510 
_pdbx_refine_tls.S[1][3]          -0.0790 
_pdbx_refine_tls.S[2][3]          0.0552 
_pdbx_refine_tls.S[2][1]          0.0142 
_pdbx_refine_tls.S[3][1]          0.1511 
_pdbx_refine_tls.S[3][2]          -0.1328 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_label_asym_id   A 
_pdbx_refine_tls_group.beg_label_seq_id    3 
_pdbx_refine_tls_group.end_label_asym_id   A 
_pdbx_refine_tls_group.end_label_seq_id    337 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.beg_auth_asym_id    X 
_pdbx_refine_tls_group.beg_auth_seq_id     3 
_pdbx_refine_tls_group.end_auth_asym_id    X 
_pdbx_refine_tls_group.end_auth_seq_id     337 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.selection_details   ? 
# 
loop_
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
_software.pdbx_ordinal 
DENZO       .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data reduction'  
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?       ? 1 
SCALEPACK   .     ?               package 'Zbyszek Otwinowski' zbyszek@mix.swmed.edu    'data scaling'    
http://www.lnls.br/infra/linhasluz/denzo-hkl.htm ?       ? 2 
REFMAC      .     ?               program 'Murshudov, G.N.'    ccp4@dl.ac.uk            refinement        
http://www.ccp4.ac.uk/main.html                  Fortran ? 3 
PDB_EXTRACT 1.700 'May. 30, 2005' package PDB                  sw-help@rcsb.rutgers.edu 'data extraction' 
http://pdb.rutgers.edu/software/                 C++     ? 4 
SnB         .     ?               ?       ?                    ?                        phasing           ? ?       ? 5 
SOLVE       .     ?               ?       ?                    ?                        phasing           ? ?       ? 6 
RESOLVE     .     ?               ?       ?                    ?                        phasing           ? ?       ? 7 
# 
_pdbx_database_remark.id     650 
_pdbx_database_remark.text   
;HELIX
DETERMINATION METHOD: AUTHOR DETERMINED
;
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 CB X ASP 168 ? ? CG X ASP 168 ? ? OD2 X ASP 168 ? ? 123.86 118.30 5.56 0.90 N 
2 1 CB X ASP 279 ? ? CG X ASP 279 ? ? OD2 X ASP 279 ? ? 124.15 118.30 5.85 0.90 N 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 X MET 1   ? A MET 1   
2  1 Y 1 X SER 2   ? A SER 2   
3  1 Y 1 X GLY 338 ? A GLY 338 
4  1 Y 1 X ALA 339 ? A ALA 339 
5  1 Y 1 X GLY 340 ? A GLY 340 
6  1 Y 1 X ASN 341 ? A ASN 341 
7  1 Y 1 X VAL 342 ? A VAL 342 
8  1 Y 1 X PHE 343 ? A PHE 343 
9  1 Y 1 X SER 344 ? A SER 344 
10 1 Y 1 X GLY 345 ? A GLY 345 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 1,2-ETHANEDIOL EDO 
3 'ACETIC ACID'  ACY 
4 water          HOH 
#