data_2AEB
# 
_entry.id   2AEB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.290 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   2AEB         
RCSB  RCSB033790   
WWPDB D_1000033790 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 2ZAV 'Unliganded human arginase I'                   unspecified 
PDB 1D3V 'Arginase I from rat liver complexed with ABH.' unspecified 
PDB 1WVA 'Human arginase I-BEC complex'                  unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        2AEB 
_pdbx_database_status.recvd_initial_deposition_date   2005-07-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Di Costanzo, L.'    1 
'Sabio, G.'          2 
'Mora, A.'           3 
'Rodriguez, P.C.'    4 
'Ochoa, A.C.'        5 
'Centeno, F.'        6 
'Christianson, D.W.' 7 
# 
loop_
_citation.id 
_citation.title 
_citation.journal_abbrev 
_citation.journal_volume 
_citation.page_first 
_citation.page_last 
_citation.year 
_citation.journal_id_ASTM 
_citation.country 
_citation.journal_id_ISSN 
_citation.journal_id_CSD 
_citation.book_publisher 
_citation.pdbx_database_id_PubMed 
_citation.pdbx_database_id_DOI 
primary 'Crystal structure of human arginase I at 1.29 A resolution and exploration of inhibition in the immune response.' 
Proc.Natl.Acad.Sci.Usa 102 13058 13063 2005 PNASA6 US 0027-8424 0040 ? 16141327 10.1073/pnas.0504027102 
1       'Human arginase II: crystal structure and physiological role in male and female sexual arousal'                    
Biochemistry           42  8445  8451  2003 BICHAW US 0006-2960 0033 ? 12859189 10.1021/bi034340j       
2       'Arginase-Boronic Acid Complex Highlights a Physiological Role in Erectile Function'                               
Nat.Struct.Biol.       6   1043  1047  1999 NSBIEW US 1072-8368 2024 ? 1052097  10.1300/J010v02n02_04   
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Di Costanzo, L.'    1  
primary 'Sabio, G.'          2  
primary 'Mora, A.'           3  
primary 'Rodriguez, P.C.'    4  
primary 'Ochoa, A.C.'        5  
primary 'Centeno, F.'        6  
primary 'Christianson, D.W.' 7  
1       'Cama, E.'           8  
1       'Colleluori, D.M.'   9  
1       'Emig, F.A.'         10 
1       'Shin, H.'           11 
1       'Kim, S.W.'          12 
1       'Kim, N.N.'          13 
1       'Traish, A.M.'       14 
1       'Ash, D.E.'          15 
1       'Christianson, D.W.' 16 
2       'Cox, J.D.'          17 
2       'Kim, N.N.'          18 
2       'Traish, A.M.'       19 
2       'Christianson, D.W.' 20 
# 
_cell.entry_id           2AEB 
_cell.length_a           91.422 
_cell.length_b           91.422 
_cell.length_c           69.637 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         2AEB 
_symmetry.space_group_name_H-M             'P 3' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                143 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Arginase 1'                       34779.879 2   3.5.3.1 ? ? ? 
2 non-polymer syn 'MANGANESE (II) ION'               54.938    4   ?       ? ? ? 
3 non-polymer syn '2(S)-AMINO-6-BORONOHEXANOIC ACID' 191.998   2   ?       ? ? ? 
4 water       nat water                              18.015    384 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Liver-type arginase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   ALA n 
1 4   LYS n 
1 5   SER n 
1 6   ARG n 
1 7   THR n 
1 8   ILE n 
1 9   GLY n 
1 10  ILE n 
1 11  ILE n 
1 12  GLY n 
1 13  ALA n 
1 14  PRO n 
1 15  PHE n 
1 16  SER n 
1 17  LYS n 
1 18  GLY n 
1 19  GLN n 
1 20  PRO n 
1 21  ARG n 
1 22  GLY n 
1 23  GLY n 
1 24  VAL n 
1 25  GLU n 
1 26  GLU n 
1 27  GLY n 
1 28  PRO n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  ARG n 
1 33  LYS n 
1 34  ALA n 
1 35  GLY n 
1 36  LEU n 
1 37  LEU n 
1 38  GLU n 
1 39  LYS n 
1 40  LEU n 
1 41  LYS n 
1 42  GLU n 
1 43  GLN n 
1 44  GLU n 
1 45  CYS n 
1 46  ASP n 
1 47  VAL n 
1 48  LYS n 
1 49  ASP n 
1 50  TYR n 
1 51  GLY n 
1 52  ASP n 
1 53  LEU n 
1 54  PRO n 
1 55  PHE n 
1 56  ALA n 
1 57  ASP n 
1 58  ILE n 
1 59  PRO n 
1 60  ASN n 
1 61  ASP n 
1 62  SER n 
1 63  PRO n 
1 64  PHE n 
1 65  GLN n 
1 66  ILE n 
1 67  VAL n 
1 68  LYS n 
1 69  ASN n 
1 70  PRO n 
1 71  ARG n 
1 72  SER n 
1 73  VAL n 
1 74  GLY n 
1 75  LYS n 
1 76  ALA n 
1 77  SER n 
1 78  GLU n 
1 79  GLN n 
1 80  LEU n 
1 81  ALA n 
1 82  GLY n 
1 83  LYS n 
1 84  VAL n 
1 85  ALA n 
1 86  GLU n 
1 87  VAL n 
1 88  LYS n 
1 89  LYS n 
1 90  ASN n 
1 91  GLY n 
1 92  ARG n 
1 93  ILE n 
1 94  SER n 
1 95  LEU n 
1 96  VAL n 
1 97  LEU n 
1 98  GLY n 
1 99  GLY n 
1 100 ASP n 
1 101 HIS n 
1 102 SER n 
1 103 LEU n 
1 104 ALA n 
1 105 ILE n 
1 106 GLY n 
1 107 SER n 
1 108 ILE n 
1 109 SER n 
1 110 GLY n 
1 111 HIS n 
1 112 ALA n 
1 113 ARG n 
1 114 VAL n 
1 115 HIS n 
1 116 PRO n 
1 117 ASP n 
1 118 LEU n 
1 119 GLY n 
1 120 VAL n 
1 121 ILE n 
1 122 TRP n 
1 123 VAL n 
1 124 ASP n 
1 125 ALA n 
1 126 HIS n 
1 127 THR n 
1 128 ASP n 
1 129 ILE n 
1 130 ASN n 
1 131 THR n 
1 132 PRO n 
1 133 LEU n 
1 134 THR n 
1 135 THR n 
1 136 THR n 
1 137 SER n 
1 138 GLY n 
1 139 ASN n 
1 140 LEU n 
1 141 HIS n 
1 142 GLY n 
1 143 GLN n 
1 144 PRO n 
1 145 VAL n 
1 146 SER n 
1 147 PHE n 
1 148 LEU n 
1 149 LEU n 
1 150 LYS n 
1 151 GLU n 
1 152 LEU n 
1 153 LYS n 
1 154 GLY n 
1 155 LYS n 
1 156 ILE n 
1 157 PRO n 
1 158 ASP n 
1 159 VAL n 
1 160 PRO n 
1 161 GLY n 
1 162 PHE n 
1 163 SER n 
1 164 TRP n 
1 165 VAL n 
1 166 THR n 
1 167 PRO n 
1 168 CYS n 
1 169 ILE n 
1 170 SER n 
1 171 ALA n 
1 172 LYS n 
1 173 ASP n 
1 174 ILE n 
1 175 VAL n 
1 176 TYR n 
1 177 ILE n 
1 178 GLY n 
1 179 LEU n 
1 180 ARG n 
1 181 ASP n 
1 182 VAL n 
1 183 ASP n 
1 184 PRO n 
1 185 GLY n 
1 186 GLU n 
1 187 HIS n 
1 188 TYR n 
1 189 ILE n 
1 190 LEU n 
1 191 LYS n 
1 192 THR n 
1 193 LEU n 
1 194 GLY n 
1 195 ILE n 
1 196 LYS n 
1 197 TYR n 
1 198 PHE n 
1 199 SER n 
1 200 MET n 
1 201 THR n 
1 202 GLU n 
1 203 VAL n 
1 204 ASP n 
1 205 ARG n 
1 206 LEU n 
1 207 GLY n 
1 208 ILE n 
1 209 GLY n 
1 210 LYS n 
1 211 VAL n 
1 212 MET n 
1 213 GLU n 
1 214 GLU n 
1 215 THR n 
1 216 LEU n 
1 217 SER n 
1 218 TYR n 
1 219 LEU n 
1 220 LEU n 
1 221 GLY n 
1 222 ARG n 
1 223 LYS n 
1 224 LYS n 
1 225 ARG n 
1 226 PRO n 
1 227 ILE n 
1 228 HIS n 
1 229 LEU n 
1 230 SER n 
1 231 PHE n 
1 232 ASP n 
1 233 VAL n 
1 234 ASP n 
1 235 GLY n 
1 236 LEU n 
1 237 ASP n 
1 238 PRO n 
1 239 SER n 
1 240 PHE n 
1 241 THR n 
1 242 PRO n 
1 243 ALA n 
1 244 THR n 
1 245 GLY n 
1 246 THR n 
1 247 PRO n 
1 248 VAL n 
1 249 VAL n 
1 250 GLY n 
1 251 GLY n 
1 252 LEU n 
1 253 THR n 
1 254 TYR n 
1 255 ARG n 
1 256 GLU n 
1 257 GLY n 
1 258 LEU n 
1 259 TYR n 
1 260 ILE n 
1 261 THR n 
1 262 GLU n 
1 263 GLU n 
1 264 ILE n 
1 265 TYR n 
1 266 LYS n 
1 267 THR n 
1 268 GLY n 
1 269 LEU n 
1 270 LEU n 
1 271 SER n 
1 272 GLY n 
1 273 LEU n 
1 274 ASP n 
1 275 ILE n 
1 276 MET n 
1 277 GLU n 
1 278 VAL n 
1 279 ASN n 
1 280 PRO n 
1 281 SER n 
1 282 LEU n 
1 283 GLY n 
1 284 LYS n 
1 285 THR n 
1 286 PRO n 
1 287 GLU n 
1 288 GLU n 
1 289 VAL n 
1 290 THR n 
1 291 ARG n 
1 292 THR n 
1 293 VAL n 
1 294 ASN n 
1 295 THR n 
1 296 ALA n 
1 297 VAL n 
1 298 ALA n 
1 299 ILE n 
1 300 THR n 
1 301 LEU n 
1 302 ALA n 
1 303 CYS n 
1 304 PHE n 
1 305 GLY n 
1 306 LEU n 
1 307 ALA n 
1 308 ARG n 
1 309 GLU n 
1 310 GLY n 
1 311 ASN n 
1 312 HIS n 
1 313 LYS n 
1 314 PRO n 
1 315 ILE n 
1 316 ASP n 
1 317 TYR n 
1 318 LEU n 
1 319 ASN n 
1 320 PRO n 
1 321 PRO n 
1 322 LYS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     Homo 
_entity_src_gen.pdbx_gene_src_gene                 ? 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     Escherichia 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ARGI1_HUMAN 
_struct_ref.pdbx_db_accession          P05089 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQL
AGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVP
GFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVDRLGIGKVMEETLSYLLGRKKRPIHLSFDVDGLDPSF
TPATGTPVVGGLTYREGLYITEEIYKTGLLSGLDIMEVNPSLGKTPEEVTRTVNTAVAITLACFGLAREGNHKPIDYLNP
PK
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 2AEB A 1 ? 322 ? P05089 1 ? 322 ? 1 322 
2 1 2AEB B 1 ? 322 ? P05089 1 ? 322 ? 1 322 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ABH non-polymer         . '2(S)-AMINO-6-BORONOHEXANOIC ACID' ? 'C6 H15 B N O5 -1' 191.998 
ALA 'L-peptide linking' y ALANINE                            ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                           ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                         ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                    ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                           ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                          ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                    ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                            ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                          ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                              ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                         ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                            ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                             ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                         ? 'C5 H11 N O2 S'    149.211 
MN  non-polymer         . 'MANGANESE (II) ION'               ? 'Mn 2'             54.938  
PHE 'L-peptide linking' y PHENYLALANINE                      ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                            ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                             ? 'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                          ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                         ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                           ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                             ? 'C5 H11 N O2'      117.146 
# 
_exptl.entry_id          2AEB 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   49.04 
_exptl_crystal.description           'DATA WERE SCALED AS SG P3.' 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            294.0 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.10 
_exptl_crystal_grow.pdbx_details    'PegMME 5000, Bis Tris, pH 7.1, VAPOR DIFFUSION, SITTING DROP, temperature 294.0K, pH 7.10' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100.0 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 4' 
_diffrn_detector.pdbx_collection_date   2005-04-20 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.912400 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CHESS BEAMLINE F1' 
_diffrn_source.pdbx_synchrotron_site       CHESS 
_diffrn_source.pdbx_synchrotron_beamline   F1 
_diffrn_source.pdbx_wavelength             0.912400 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     2AEB 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.000 
_reflns.d_resolution_high            1.290 
_reflns.number_obs                   150499 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         92.7 
_reflns.pdbx_Rmerge_I_obs            0.063 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.6000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              1.400 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.29 
_reflns_shell.d_res_low              1.34 
_reflns_shell.percent_possible_all   86.0 
_reflns_shell.Rmerge_I_obs           0.56 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.850 
_reflns_shell.pdbx_redundancy        1.40 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 2AEB 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_all                     150499 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             ? 
_refine.ls_d_res_high                            1.29 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_factor_R_free                       0.152 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  7526 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;DUE TO POORLY DEFINED DENSITY, THE FOLLOWING RESIDUES: A5, A48 (NZ), A222 (SIDE CHAINS), B41 (SIDE CHAINS), B48 (SIDE CHAINS), B89 (NZ), B222 (SIDE CHAINS) AND B224 (SIDE CHAINS) HAVE BEEN MODELED AT MINOR OCCUPANCY. BECAUSE PART OF A DISORDERED SIDE CHAINS, RESIDUES A83 AND B217 HAVE DISORDERED DENSITY. THEREFORE, HYDROGENS ARE NOT PLACED IN THE SIDECHAINS OF THESE TWO RESIDUE. REFINED TWIN FRACTIONS: 0.46. TWIN OPERATOR: -H, -K, L
;
_refine.pdbx_starting_model                      1D3V 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4731 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             384 
_refine_hist.number_atoms_total               5145 
_refine_hist.d_res_high                       1.29 
_refine_hist.d_res_low                        . 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.012 ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             0.03  ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      2.79  ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      1.78  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             ?     ? ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            ?     ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_pdbx_refine.entry_id                                    2AEB 
_pdbx_refine.R_factor_all_no_cutoff                      ? 
_pdbx_refine.R_factor_obs_no_cutoff                      0.165 
_pdbx_refine.free_R_factor_no_cutoff                     0.179 
_pdbx_refine.free_R_val_test_set_size_perc_no_cutoff     5.0 
_pdbx_refine.free_R_val_test_set_ct_no_cutoff            7526 
_pdbx_refine.R_factor_all_4sig_cutoff                    ? 
_pdbx_refine.R_factor_obs_4sig_cutoff                    0.137 
_pdbx_refine.free_R_factor_4sig_cutoff                   0.15 
_pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff   ? 
_pdbx_refine.free_R_val_test_set_ct_4sig_cutoff          ? 
_pdbx_refine.number_reflns_obs_4sig_cutoff               ? 
_pdbx_refine.pdbx_refine_id                              'X-RAY DIFFRACTION' 
_pdbx_refine.free_R_error_no_cutoff                      ? 
# 
_struct.entry_id                  2AEB 
_struct.title                     
'Crystal structure of human arginase I at 1.29 A resolution and exploration of inhibition in immune response.' 
_struct.pdbx_descriptor           'Arginase 1 (E.C.3.5.3.1)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        2AEB 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
_struct_keywords.text            
'HYDROLASE, BINUCLEAR MANGANESE CLUSTER, BORONIC ACID INHIBITOR, PERFECTLY TWINNED CRYSTAL, HYDROLASE-HYDROLASE INHIBITOR complex' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
I N N 4 ? 
J N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ARG A 21  ? GLU A 25  ? ARG A 21  GLU A 25  5 ? 5  
HELX_P HELX_P2  2  GLU A 26  ? ALA A 34  ? GLU A 26  ALA A 34  1 ? 9  
HELX_P HELX_P3  3  GLY A 35  ? GLN A 43  ? GLY A 35  GLN A 43  1 ? 9  
HELX_P HELX_P4  4  ASN A 69  ? ASN A 90  ? ASN A 69  ASN A 90  1 ? 22 
HELX_P HELX_P5  5  ASP A 100 ? SER A 102 ? ASP A 100 SER A 102 5 ? 3  
HELX_P HELX_P6  6  LEU A 103 ? HIS A 115 ? LEU A 103 HIS A 115 1 ? 13 
HELX_P HELX_P7  7  ASN A 139 ? GLY A 142 ? ASN A 139 GLY A 142 5 ? 4  
HELX_P HELX_P8  8  GLN A 143 ? LEU A 149 ? GLN A 143 LEU A 149 1 ? 7  
HELX_P HELX_P9  9  LYS A 150 ? LYS A 153 ? LYS A 150 LYS A 153 5 ? 4  
HELX_P HELX_P10 10 SER A 170 ? LYS A 172 ? SER A 170 LYS A 172 5 ? 3  
HELX_P HELX_P11 11 ASP A 183 ? GLY A 194 ? ASP A 183 GLY A 194 1 ? 12 
HELX_P HELX_P12 12 MET A 200 ? GLY A 207 ? MET A 200 GLY A 207 1 ? 8  
HELX_P HELX_P13 13 GLY A 207 ? GLY A 221 ? GLY A 207 GLY A 221 1 ? 15 
HELX_P HELX_P14 14 ASP A 234 ? LEU A 236 ? ASP A 234 LEU A 236 5 ? 3  
HELX_P HELX_P15 15 THR A 253 ? GLY A 268 ? THR A 253 GLY A 268 1 ? 16 
HELX_P HELX_P16 16 ASN A 279 ? GLY A 283 ? ASN A 279 GLY A 283 5 ? 5  
HELX_P HELX_P17 17 THR A 285 ? PHE A 304 ? THR A 285 PHE A 304 1 ? 20 
HELX_P HELX_P18 18 ARG B 21  ? GLU B 25  ? ARG B 21  GLU B 25  5 ? 5  
HELX_P HELX_P19 19 GLU B 26  ? ALA B 34  ? GLU B 26  ALA B 34  1 ? 9  
HELX_P HELX_P20 20 GLY B 35  ? GLN B 43  ? GLY B 35  GLN B 43  1 ? 9  
HELX_P HELX_P21 21 ASN B 69  ? ASN B 90  ? ASN B 69  ASN B 90  1 ? 22 
HELX_P HELX_P22 22 SER B 102 ? HIS B 115 ? SER B 102 HIS B 115 1 ? 14 
HELX_P HELX_P23 23 ASN B 139 ? GLY B 142 ? ASN B 139 GLY B 142 5 ? 4  
HELX_P HELX_P24 24 GLN B 143 ? LEU B 149 ? GLN B 143 LEU B 149 1 ? 7  
HELX_P HELX_P25 25 LYS B 150 ? ILE B 156 ? LYS B 150 ILE B 156 5 ? 7  
HELX_P HELX_P26 26 SER B 170 ? LYS B 172 ? SER B 170 LYS B 172 5 ? 3  
HELX_P HELX_P27 27 ASP B 183 ? GLY B 194 ? ASP B 183 GLY B 194 1 ? 12 
HELX_P HELX_P28 28 SER B 199 ? GLY B 221 ? SER B 199 GLY B 221 1 ? 23 
HELX_P HELX_P29 29 ASP B 234 ? LEU B 236 ? ASP B 234 LEU B 236 5 ? 3  
HELX_P HELX_P30 30 THR B 253 ? GLY B 268 ? THR B 253 GLY B 268 1 ? 16 
HELX_P HELX_P31 31 ASN B 279 ? GLY B 283 ? ASN B 279 GLY B 283 5 ? 5  
HELX_P HELX_P32 32 THR B 285 ? PHE B 304 ? THR B 285 PHE B 304 1 ? 20 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? C MN . MN ? ? ? 1_555 A HIS 126 ND1 ? ? A MN 2362 A HIS 126 1_555 ? ? ? ? ? ? ? 2.229 ? 
metalc2  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 234 OD1 ? ? A MN 2362 A ASP 234 1_555 ? ? ? ? ? ? ? 2.161 ? 
metalc3  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 124 OD1 ? ? A MN 2362 A ASP 124 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc4  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 234 OD2 ? ? A MN 2362 A ASP 234 1_555 ? ? ? ? ? ? ? 2.388 ? 
metalc5  metalc ? ? C MN . MN ? ? ? 1_555 E ABH .   O1  ? ? A MN 2362 A ABH 551 1_555 ? ? ? ? ? ? ? 2.134 ? 
metalc6  metalc ? ? C MN . MN ? ? ? 1_555 A ASP 232 OD2 ? ? A MN 2362 A ASP 232 1_555 ? ? ? ? ? ? ? 2.289 ? 
metalc7  metalc ? ? D MN . MN ? ? ? 1_555 E ABH .   O2  ? ? A MN 2363 A ABH 551 1_555 ? ? ? ? ? ? ? 2.257 ? 
metalc8  metalc ? ? D MN . MN ? ? ? 1_555 E ABH .   O1  ? ? A MN 2363 A ABH 551 1_555 ? ? ? ? ? ? ? 2.227 ? 
metalc9  metalc ? ? D MN . MN ? ? ? 1_555 A ASP 124 OD2 ? ? A MN 2363 A ASP 124 1_555 ? ? ? ? ? ? ? 2.073 ? 
metalc10 metalc ? ? D MN . MN ? ? ? 1_555 A ASP 128 OD2 ? ? A MN 2363 A ASP 128 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc11 metalc ? ? D MN . MN ? ? ? 1_555 A ASP 232 OD2 ? ? A MN 2363 A ASP 232 1_555 ? ? ? ? ? ? ? 2.237 ? 
metalc12 metalc ? ? D MN . MN ? ? ? 1_555 A HIS 101 ND1 ? ? A MN 2363 A HIS 101 1_555 ? ? ? ? ? ? ? 2.216 ? 
metalc13 metalc ? ? F MN . MN ? ? ? 1_555 B HIS 126 ND1 ? ? B MN 1362 B HIS 126 1_555 ? ? ? ? ? ? ? 2.284 ? 
metalc14 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 234 OD1 ? ? B MN 1362 B ASP 234 1_555 ? ? ? ? ? ? ? 2.392 ? 
metalc15 metalc ? ? F MN . MN ? ? ? 1_555 H ABH .   O3  ? ? B MN 1362 B ABH 552 1_555 ? ? ? ? ? ? ? 2.741 ? 
metalc16 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 124 OD1 ? ? B MN 1362 B ASP 124 1_555 ? ? ? ? ? ? ? 2.214 ? 
metalc17 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 232 OD2 ? ? B MN 1362 B ASP 232 1_555 ? ? ? ? ? ? ? 2.319 ? 
metalc18 metalc ? ? F MN . MN ? ? ? 1_555 H ABH .   O1  ? ? B MN 1362 B ABH 552 1_555 ? ? ? ? ? ? ? 2.210 ? 
metalc19 metalc ? ? F MN . MN ? ? ? 1_555 B ASP 234 OD2 ? ? B MN 1362 B ASP 234 1_555 ? ? ? ? ? ? ? 2.099 ? 
metalc20 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 124 OD2 ? ? B MN 1363 B ASP 124 1_555 ? ? ? ? ? ? ? 2.150 ? 
metalc21 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 232 OD2 ? ? B MN 1363 B ASP 232 1_555 ? ? ? ? ? ? ? 2.230 ? 
metalc22 metalc ? ? G MN . MN ? ? ? 1_555 H ABH .   O2  ? ? B MN 1363 B ABH 552 1_555 ? ? ? ? ? ? ? 2.267 ? 
metalc23 metalc ? ? G MN . MN ? ? ? 1_555 B ASP 128 OD1 ? ? B MN 1363 B ASP 128 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc24 metalc ? ? G MN . MN ? ? ? 1_555 H ABH .   O1  ? ? B MN 1363 B ABH 552 1_555 ? ? ? ? ? ? ? 2.127 ? 
metalc25 metalc ? ? G MN . MN ? ? ? 1_555 B HIS 101 ND1 ? ? B MN 1363 B HIS 101 1_555 ? ? ? ? ? ? ? 2.233 ? 
metalc26 metalc ? ? C MN . MN ? ? ? 1_555 E ABH .   O3  ? ? A MN 2362 A ABH 551 1_555 ? ? ? ? ? ? ? 2.795 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 98 A . ? GLY 98 A GLY 99 A ? GLY 99 A 1 1.97  
2 GLY 98 B . ? GLY 98 B GLY 99 B ? GLY 99 B 1 -3.39 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 8 ? 
B ? 8 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel 
A 2 3 ? parallel 
A 3 4 ? parallel 
A 4 5 ? parallel 
A 5 6 ? parallel 
A 6 7 ? parallel 
A 7 8 ? parallel 
B 1 2 ? parallel 
B 2 3 ? parallel 
B 3 4 ? parallel 
B 4 5 ? parallel 
B 5 6 ? parallel 
B 6 7 ? parallel 
B 7 8 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ASP A 46  ? ASP A 52  ? ASP A 46  ASP A 52  
A 2 THR A 7   ? ALA A 13  ? THR A 7   ALA A 13  
A 3 ILE A 93  ? GLY A 98  ? ILE A 93  GLY A 98  
A 4 LEU A 270 ? MET A 276 ? LEU A 270 MET A 276 
A 5 ILE A 227 ? ASP A 232 ? ILE A 227 ASP A 232 
A 6 GLY A 119 ? VAL A 123 ? GLY A 119 VAL A 123 
A 7 ILE A 174 ? LEU A 179 ? ILE A 174 LEU A 179 
A 8 LYS A 196 ? SER A 199 ? LYS A 196 SER A 199 
B 1 VAL B 47  ? ASP B 52  ? VAL B 47  ASP B 52  
B 2 ILE B 8   ? GLY B 12  ? ILE B 8   GLY B 12  
B 3 ILE B 93  ? LEU B 97  ? ILE B 93  LEU B 97  
B 4 LEU B 270 ? MET B 276 ? LEU B 270 MET B 276 
B 5 ILE B 227 ? ASP B 232 ? ILE B 227 ASP B 232 
B 6 GLY B 119 ? VAL B 123 ? GLY B 119 VAL B 123 
B 7 ILE B 174 ? ILE B 177 ? ILE B 174 ILE B 177 
B 8 LYS B 196 ? PHE B 198 ? LYS B 196 PHE B 198 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 51  ? O GLY A 51  N GLY A 12  ? N GLY A 12  
A 2 3 N GLY A 9   ? N GLY A 9   O ILE A 93  ? O ILE A 93  
A 3 4 N VAL A 96  ? N VAL A 96  O LEU A 273 ? O LEU A 273 
A 4 5 O SER A 271 ? O SER A 271 N ILE A 227 ? N ILE A 227 
A 5 6 O ASP A 232 ? O ASP A 232 N VAL A 123 ? N VAL A 123 
A 6 7 N TRP A 122 ? N TRP A 122 O VAL A 175 ? O VAL A 175 
A 7 8 N GLY A 178 ? N GLY A 178 O PHE A 198 ? O PHE A 198 
B 1 2 O GLY B 51  ? O GLY B 51  N GLY B 12  ? N GLY B 12  
B 2 3 N GLY B 9   ? N GLY B 9   O ILE B 93  ? O ILE B 93  
B 3 4 N VAL B 96  ? N VAL B 96  O LEU B 273 ? O LEU B 273 
B 4 5 O SER B 271 ? O SER B 271 N ILE B 227 ? N ILE B 227 
B 5 6 O HIS B 228 ? O HIS B 228 N GLY B 119 ? N GLY B 119 
B 6 7 N TRP B 122 ? N TRP B 122 O VAL B 175 ? O VAL B 175 
B 7 8 N TYR B 176 ? N TYR B 176 O PHE B 198 ? O PHE B 198 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 1362' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN B 1363' 
AC3 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 2362' 
AC4 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE MN A 2363' 
AC5 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ABH A 551' 
AC6 Software ? ? ? ? 20 'BINDING SITE FOR RESIDUE ABH B 552' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  ASP B 124 ? ASP B 124  . ? 1_555 ? 
2  AC1 6  HIS B 126 ? HIS B 126  . ? 1_555 ? 
3  AC1 6  ASP B 232 ? ASP B 232  . ? 1_555 ? 
4  AC1 6  ASP B 234 ? ASP B 234  . ? 1_555 ? 
5  AC1 6  ABH H .   ? ABH B 552  . ? 1_555 ? 
6  AC1 6  MN  G .   ? MN  B 1363 . ? 1_555 ? 
7  AC2 6  HIS B 101 ? HIS B 101  . ? 1_555 ? 
8  AC2 6  ASP B 124 ? ASP B 124  . ? 1_555 ? 
9  AC2 6  ASP B 128 ? ASP B 128  . ? 1_555 ? 
10 AC2 6  ASP B 232 ? ASP B 232  . ? 1_555 ? 
11 AC2 6  ABH H .   ? ABH B 552  . ? 1_555 ? 
12 AC2 6  MN  F .   ? MN  B 1362 . ? 1_555 ? 
13 AC3 6  ASP A 124 ? ASP A 124  . ? 1_555 ? 
14 AC3 6  HIS A 126 ? HIS A 126  . ? 1_555 ? 
15 AC3 6  ASP A 232 ? ASP A 232  . ? 1_555 ? 
16 AC3 6  ASP A 234 ? ASP A 234  . ? 1_555 ? 
17 AC3 6  ABH E .   ? ABH A 551  . ? 1_555 ? 
18 AC3 6  MN  D .   ? MN  A 2363 . ? 1_555 ? 
19 AC4 6  HIS A 101 ? HIS A 101  . ? 1_555 ? 
20 AC4 6  ASP A 124 ? ASP A 124  . ? 1_555 ? 
21 AC4 6  ASP A 128 ? ASP A 128  . ? 1_555 ? 
22 AC4 6  ASP A 232 ? ASP A 232  . ? 1_555 ? 
23 AC4 6  ABH E .   ? ABH A 551  . ? 1_555 ? 
24 AC4 6  MN  C .   ? MN  A 2362 . ? 1_555 ? 
25 AC5 20 HIS A 101 ? HIS A 101  . ? 1_555 ? 
26 AC5 20 ASP A 124 ? ASP A 124  . ? 1_555 ? 
27 AC5 20 HIS A 126 ? HIS A 126  . ? 1_555 ? 
28 AC5 20 ASP A 128 ? ASP A 128  . ? 1_555 ? 
29 AC5 20 ASN A 130 ? ASN A 130  . ? 1_555 ? 
30 AC5 20 SER A 137 ? SER A 137  . ? 1_555 ? 
31 AC5 20 HIS A 141 ? HIS A 141  . ? 1_555 ? 
32 AC5 20 ASP A 183 ? ASP A 183  . ? 1_555 ? 
33 AC5 20 GLU A 186 ? GLU A 186  . ? 1_555 ? 
34 AC5 20 ASP A 232 ? ASP A 232  . ? 1_555 ? 
35 AC5 20 ASP A 234 ? ASP A 234  . ? 1_555 ? 
36 AC5 20 GLU A 277 ? GLU A 277  . ? 1_555 ? 
37 AC5 20 MN  C .   ? MN  A 2362 . ? 1_555 ? 
38 AC5 20 MN  D .   ? MN  A 2363 . ? 1_555 ? 
39 AC5 20 HOH I .   ? HOH A 2369 . ? 1_555 ? 
40 AC5 20 HOH I .   ? HOH A 2372 . ? 1_555 ? 
41 AC5 20 HOH I .   ? HOH A 2391 . ? 1_555 ? 
42 AC5 20 HOH I .   ? HOH A 2394 . ? 1_555 ? 
43 AC5 20 HOH I .   ? HOH A 2396 . ? 1_555 ? 
44 AC5 20 HOH I .   ? HOH A 2402 . ? 1_555 ? 
45 AC6 20 HIS B 101 ? HIS B 101  . ? 1_555 ? 
46 AC6 20 ASP B 124 ? ASP B 124  . ? 1_555 ? 
47 AC6 20 HIS B 126 ? HIS B 126  . ? 1_555 ? 
48 AC6 20 ASP B 128 ? ASP B 128  . ? 1_555 ? 
49 AC6 20 ASN B 130 ? ASN B 130  . ? 1_555 ? 
50 AC6 20 SER B 137 ? SER B 137  . ? 1_555 ? 
51 AC6 20 HIS B 141 ? HIS B 141  . ? 1_555 ? 
52 AC6 20 ASP B 183 ? ASP B 183  . ? 1_555 ? 
53 AC6 20 GLU B 186 ? GLU B 186  . ? 1_555 ? 
54 AC6 20 ASP B 232 ? ASP B 232  . ? 1_555 ? 
55 AC6 20 ASP B 234 ? ASP B 234  . ? 1_555 ? 
56 AC6 20 GLU B 277 ? GLU B 277  . ? 1_555 ? 
57 AC6 20 MN  F .   ? MN  B 1362 . ? 1_555 ? 
58 AC6 20 MN  G .   ? MN  B 1363 . ? 1_555 ? 
59 AC6 20 HOH J .   ? HOH B 1390 . ? 1_555 ? 
60 AC6 20 HOH J .   ? HOH B 1395 . ? 1_555 ? 
61 AC6 20 HOH J .   ? HOH B 1403 . ? 1_555 ? 
62 AC6 20 HOH J .   ? HOH B 1416 . ? 1_555 ? 
63 AC6 20 HOH J .   ? HOH B 1453 . ? 1_555 ? 
64 AC6 20 HOH J .   ? HOH B 1478 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          2AEB 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    2AEB 
_atom_sites.fract_transf_matrix[1][1]   0.010938 
_atom_sites.fract_transf_matrix[1][2]   0.006315 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012630 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.014360 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
B  
C  
H  
MN 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N    . SER A 1 5   ? 74.313  45.569 44.521  0.78 56.25  ? 5    SER A N    1 
ATOM   2     C  CA   . SER A 1 5   ? 73.633  45.249 43.269  0.78 33.28  ? 5    SER A CA   1 
ATOM   3     C  C    . SER A 1 5   ? 73.716  43.739 42.978  0.78 19.72  ? 5    SER A C    1 
ATOM   4     O  O    . SER A 1 5   ? 74.171  43.039 43.889  0.78 22.07  ? 5    SER A O    1 
ATOM   5     C  CB   . SER A 1 5   ? 74.211  46.082 42.124  0.78 34.50  ? 5    SER A CB   1 
ATOM   6     O  OG   . SER A 1 5   ? 73.170  46.500 41.253  0.78 40.40  ? 5    SER A OG   1 
ATOM   7     H  H    . SER A 1 5   ? 73.971  45.076 45.179  0.78 84.37  ? 5    SER A H    1 
ATOM   8     H  HA   . SER A 1 5   ? 72.687  45.487 43.369  0.78 39.94  ? 5    SER A HA   1 
ATOM   9     H  HB2  . SER A 1 5   ? 74.668  46.858 42.484  0.78 41.40  ? 5    SER A HB2  1 
ATOM   10    H  HB3  . SER A 1 5   ? 74.857  45.553 41.630  0.78 41.40  ? 5    SER A HB3  1 
ATOM   11    H  HG   . SER A 1 5   ? 73.491  46.914 40.622  0.78 60.59  ? 5    SER A HG   1 
ATOM   12    N  N    . ARG A 1 6   ? 73.186  43.374 41.783  1.00 23.04  ? 6    ARG A N    1 
ATOM   13    C  CA   . ARG A 1 6   ? 73.135  42.081 41.203  1.00 36.30  ? 6    ARG A CA   1 
ATOM   14    C  C    . ARG A 1 6   ? 73.536  42.164 39.727  1.00 44.64  ? 6    ARG A C    1 
ATOM   15    O  O    . ARG A 1 6   ? 72.746  42.285 38.777  1.00 26.26  ? 6    ARG A O    1 
ATOM   16    C  CB   . ARG A 1 6   ? 71.779  41.383 41.438  1.00 13.50  ? 6    ARG A CB   1 
ATOM   17    C  CG   . ARG A 1 6   ? 71.956  40.129 42.321  1.00 18.82  ? 6    ARG A CG   1 
ATOM   18    C  CD   . ARG A 1 6   ? 71.892  40.428 43.805  1.00 17.36  ? 6    ARG A CD   1 
ATOM   19    N  NE   . ARG A 1 6   ? 72.700  39.687 44.833  1.00 41.98  ? 6    ARG A NE   1 
ATOM   20    C  CZ   . ARG A 1 6   ? 72.854  38.357 45.141  1.00 48.34  ? 6    ARG A CZ   1 
ATOM   21    N  NH1  . ARG A 1 6   ? 72.253  37.413 44.436  1.00 18.76  ? 6    ARG A NH1  1 
ATOM   22    N  NH2  . ARG A 1 6   ? 73.613  37.995 46.165  1.00 48.67  ? 6    ARG A NH2  1 
ATOM   23    H  H    . ARG A 1 6   ? 73.047  43.991 41.298  1.00 27.64  ? 6    ARG A H    1 
ATOM   24    H  HA   . ARG A 1 6   ? 73.760  41.427 41.628  1.00 43.56  ? 6    ARG A HA   1 
ATOM   25    H  HB2  . ARG A 1 6   ? 71.168  42.000 41.870  1.00 16.20  ? 6    ARG A HB2  1 
ATOM   26    H  HB3  . ARG A 1 6   ? 71.395  41.127 40.585  1.00 16.20  ? 6    ARG A HB3  1 
ATOM   27    H  HG2  . ARG A 1 6   ? 71.263  39.488 42.099  1.00 22.58  ? 6    ARG A HG2  1 
ATOM   28    H  HG3  . ARG A 1 6   ? 72.812  39.720 42.119  1.00 22.58  ? 6    ARG A HG3  1 
ATOM   29    H  HD2  . ARG A 1 6   ? 72.112  41.367 43.906  1.00 20.83  ? 6    ARG A HD2  1 
ATOM   30    H  HD3  . ARG A 1 6   ? 70.962  40.333 44.065  1.00 20.83  ? 6    ARG A HD3  1 
ATOM   31    H  HE   . ARG A 1 6   ? 73.147  40.013 45.280  1.00 50.37  ? 6    ARG A HE   1 
ATOM   32    H  HH11 . ARG A 1 6   ? 71.904  37.323 43.827  1.00 22.51  ? 6    ARG A HH11 1 
ATOM   33    H  HH12 . ARG A 1 6   ? 72.467  36.486 44.924  1.00 22.51  ? 6    ARG A HH12 1 
ATOM   34    H  HH21 . ARG A 1 6   ? 73.878  38.729 46.738  1.00 58.41  ? 6    ARG A HH21 1 
ATOM   35    H  HH22 . ARG A 1 6   ? 73.582  37.279 46.571  1.00 58.41  ? 6    ARG A HH22 1 
ATOM   36    N  N    . THR A 1 7   ? 74.861  42.080 39.687  1.00 52.47  ? 7    THR A N    1 
ATOM   37    C  CA   . THR A 1 7   ? 75.782  41.803 38.674  1.00 24.25  ? 7    THR A CA   1 
ATOM   38    C  C    . THR A 1 7   ? 75.717  40.350 38.186  1.00 14.81  ? 7    THR A C    1 
ATOM   39    O  O    . THR A 1 7   ? 75.657  39.362 38.911  1.00 14.05  ? 7    THR A O    1 
ATOM   40    C  CB   . THR A 1 7   ? 77.219  42.111 39.186  1.00 32.78  ? 7    THR A CB   1 
ATOM   41    O  OG1  . THR A 1 7   ? 77.100  43.154 40.161  1.00 59.66  ? 7    THR A OG1  1 
ATOM   42    C  CG2  . THR A 1 7   ? 78.089  42.606 38.053  1.00 51.00  ? 7    THR A CG2  1 
ATOM   43    H  H    . THR A 1 7   ? 75.232  42.228 40.448  1.00 62.97  ? 7    THR A H    1 
ATOM   44    H  HA   . THR A 1 7   ? 75.592  42.393 37.914  1.00 29.11  ? 7    THR A HA   1 
ATOM   45    H  HB   . THR A 1 7   ? 77.613  41.310 39.591  1.00 39.33  ? 7    THR A HB   1 
ATOM   46    H  HG1  . THR A 1 7   ? 77.490  43.824 39.894  1.00 89.49  ? 7    THR A HG1  1 
ATOM   47    H  HG21 . THR A 1 7   ? 78.974  42.780 38.382  1.00 76.50  ? 7    THR A HG21 1 
ATOM   48    H  HG22 . THR A 1 7   ? 77.717  43.415 37.694  1.00 76.50  ? 7    THR A HG22 1 
ATOM   49    H  HG23 . THR A 1 7   ? 78.129  41.938 37.365  1.00 76.50  ? 7    THR A HG23 1 
ATOM   50    N  N    . ILE A 1 8   ? 75.775  40.244 36.879  1.00 14.68  ? 8    ILE A N    1 
ATOM   51    C  CA   . ILE A 1 8   ? 75.616  39.061 36.076  1.00 13.27  ? 8    ILE A CA   1 
ATOM   52    C  C    . ILE A 1 8   ? 76.765  38.915 35.090  1.00 13.64  ? 8    ILE A C    1 
ATOM   53    O  O    . ILE A 1 8   ? 77.296  39.876 34.551  1.00 17.76  ? 8    ILE A O    1 
ATOM   54    C  CB   . ILE A 1 8   ? 74.288  39.122 35.296  1.00 14.38  ? 8    ILE A CB   1 
ATOM   55    C  CG1  . ILE A 1 8   ? 73.144  39.702 36.128  1.00 13.59  ? 8    ILE A CG1  1 
ATOM   56    C  CG2  . ILE A 1 8   ? 73.908  37.757 34.739  1.00 19.85  ? 8    ILE A CG2  1 
ATOM   57    C  CD1  . ILE A 1 8   ? 71.873  39.872 35.311  1.00 17.01  ? 8    ILE A CD1  1 
ATOM   58    H  H    . ILE A 1 8   ? 75.928  40.973 36.449  1.00 17.61  ? 8    ILE A H    1 
ATOM   59    H  HA   . ILE A 1 8   ? 75.602  38.278 36.664  1.00 15.93  ? 8    ILE A HA   1 
ATOM   60    H  HB   . ILE A 1 8   ? 74.426  39.721 34.532  1.00 17.26  ? 8    ILE A HB   1 
ATOM   61    H  HG12 . ILE A 1 8   ? 72.965  39.114 36.878  1.00 16.31  ? 8    ILE A HG12 1 
ATOM   62    H  HG13 . ILE A 1 8   ? 73.413  40.564 36.482  1.00 16.31  ? 8    ILE A HG13 1 
ATOM   63    H  HG21 . ILE A 1 8   ? 74.639  37.406 34.225  1.00 29.77  ? 8    ILE A HG21 1 
ATOM   64    H  HG22 . ILE A 1 8   ? 73.135  37.845 34.176  1.00 29.77  ? 8    ILE A HG22 1 
ATOM   65    H  HG23 . ILE A 1 8   ? 73.710  37.160 35.463  1.00 29.77  ? 8    ILE A HG23 1 
ATOM   66    H  HD11 . ILE A 1 8   ? 71.184  40.245 35.865  1.00 25.51  ? 8    ILE A HD11 1 
ATOM   67    H  HD12 . ILE A 1 8   ? 71.589  39.017 34.980  1.00 25.51  ? 8    ILE A HD12 1 
ATOM   68    H  HD13 . ILE A 1 8   ? 72.043  40.460 34.572  1.00 25.51  ? 8    ILE A HD13 1 
ATOM   69    N  N    . GLY A 1 9   ? 77.143  37.659 34.822  1.00 14.16  ? 9    GLY A N    1 
ATOM   70    C  CA   . GLY A 1 9   ? 78.158  37.299 33.834  1.00 14.78  ? 9    GLY A CA   1 
ATOM   71    C  C    . GLY A 1 9   ? 77.495  36.236 32.947  1.00 12.00  ? 9    GLY A C    1 
ATOM   72    O  O    . GLY A 1 9   ? 77.223  35.149 33.437  1.00 14.71  ? 9    GLY A O    1 
ATOM   73    H  H    . GLY A 1 9   ? 76.765  37.023 35.259  1.00 16.99  ? 9    GLY A H    1 
ATOM   74    H  HA2  . GLY A 1 9   ? 78.415  38.073 33.308  1.00 17.74  ? 9    GLY A HA2  1 
ATOM   75    H  HA3  . GLY A 1 9   ? 78.948  36.940 34.268  1.00 17.74  ? 9    GLY A HA3  1 
ATOM   76    N  N    . ILE A 1 10  ? 77.244  36.570 31.698  1.00 13.38  ? 10   ILE A N    1 
ATOM   77    C  CA   . ILE A 1 10  ? 76.621  35.740 30.680  1.00 14.87  ? 10   ILE A CA   1 
ATOM   78    C  C    . ILE A 1 10  ? 77.676  34.816 30.077  1.00 15.51  ? 10   ILE A C    1 
ATOM   79    O  O    . ILE A 1 10  ? 78.740  35.289 29.694  1.00 16.20  ? 10   ILE A O    1 
ATOM   80    C  CB   . ILE A 1 10  ? 75.952  36.611 29.596  1.00 15.70  ? 10   ILE A CB   1 
ATOM   81    C  CG1  . ILE A 1 10  ? 74.788  37.486 30.050  1.00 28.56  ? 10   ILE A CG1  1 
ATOM   82    C  CG2  . ILE A 1 10  ? 75.475  35.752 28.429  1.00 19.48  ? 10   ILE A CG2  1 
ATOM   83    C  CD1  . ILE A 1 10  ? 74.305  37.222 31.457  1.00 31.64  ? 10   ILE A CD1  1 
ATOM   84    H  H    . ILE A 1 10  ? 77.472  37.364 31.459  1.00 16.05  ? 10   ILE A H    1 
ATOM   85    H  HA   . ILE A 1 10  ? 75.931  35.190 31.107  1.00 17.85  ? 10   ILE A HA   1 
ATOM   86    H  HB   . ILE A 1 10  ? 76.642  37.212 29.246  1.00 18.84  ? 10   ILE A HB   1 
ATOM   87    H  HG12 . ILE A 1 10  ? 75.056  38.415 29.985  1.00 34.28  ? 10   ILE A HG12 1 
ATOM   88    H  HG13 . ILE A 1 10  ? 74.046  37.352 29.439  1.00 34.28  ? 10   ILE A HG13 1 
ATOM   89    H  HG21 . ILE A 1 10  ? 76.207  35.226 28.099  1.00 29.22  ? 10   ILE A HG21 1 
ATOM   90    H  HG22 . ILE A 1 10  ? 75.146  36.320 27.728  1.00 29.22  ? 10   ILE A HG22 1 
ATOM   91    H  HG23 . ILE A 1 10  ? 74.771  35.171 28.727  1.00 29.22  ? 10   ILE A HG23 1 
ATOM   92    H  HD11 . ILE A 1 10  ? 73.521  37.748 31.630  1.00 47.46  ? 10   ILE A HD11 1 
ATOM   93    H  HD12 . ILE A 1 10  ? 74.994  37.459 32.081  1.00 47.46  ? 10   ILE A HD12 1 
ATOM   94    H  HD13 . ILE A 1 10  ? 74.093  36.291 31.553  1.00 47.46  ? 10   ILE A HD13 1 
ATOM   95    N  N    . ILE A 1 11  ? 77.395  33.532 29.971  1.00 16.35  ? 11   ILE A N    1 
ATOM   96    C  CA   . ILE A 1 11  ? 78.241  32.568 29.283  1.00 11.30  ? 11   ILE A CA   1 
ATOM   97    C  C    . ILE A 1 11  ? 77.414  31.845 28.242  1.00 16.33  ? 11   ILE A C    1 
ATOM   98    O  O    . ILE A 1 11  ? 76.478  31.144 28.656  1.00 12.65  ? 11   ILE A O    1 
ATOM   99    C  CB   . ILE A 1 11  ? 78.822  31.520 30.248  1.00 13.51  ? 11   ILE A CB   1 
ATOM   100   C  CG1  . ILE A 1 11  ? 79.627  32.139 31.370  1.00 16.24  ? 11   ILE A CG1  1 
ATOM   101   C  CG2  . ILE A 1 11  ? 79.554  30.499 29.372  1.00 13.89  ? 11   ILE A CG2  1 
ATOM   102   C  CD1  . ILE A 1 11  ? 79.919  31.247 32.559  1.00 13.79  ? 11   ILE A CD1  1 
ATOM   103   H  H    . ILE A 1 11  ? 76.668  33.247 30.330  1.00 19.62  ? 11   ILE A H    1 
ATOM   104   H  HA   . ILE A 1 11  ? 78.976  33.041 28.841  1.00 13.56  ? 11   ILE A HA   1 
ATOM   105   H  HB   . ILE A 1 11  ? 78.063  31.056 30.660  1.00 16.21  ? 11   ILE A HB   1 
ATOM   106   H  HG12 . ILE A 1 11  ? 80.472  32.443 31.005  1.00 19.48  ? 11   ILE A HG12 1 
ATOM   107   H  HG13 . ILE A 1 11  ? 79.151  32.922 31.689  1.00 19.48  ? 11   ILE A HG13 1 
ATOM   108   H  HG21 . ILE A 1 11  ? 78.959  30.175 28.692  1.00 20.84  ? 11   ILE A HG21 1 
ATOM   109   H  HG22 . ILE A 1 11  ? 79.850  29.765 29.915  1.00 20.84  ? 11   ILE A HG22 1 
ATOM   110   H  HG23 . ILE A 1 11  ? 80.313  30.918 28.959  1.00 20.84  ? 11   ILE A HG23 1 
ATOM   111   H  HD11 . ILE A 1 11  ? 80.424  31.738 33.211  1.00 20.68  ? 11   ILE A HD11 1 
ATOM   112   H  HD12 . ILE A 1 11  ? 80.425  30.484 32.270  1.00 20.68  ? 11   ILE A HD12 1 
ATOM   113   H  HD13 . ILE A 1 11  ? 79.093  30.953 32.949  1.00 20.68  ? 11   ILE A HD13 1 
ATOM   114   N  N    . GLY A 1 12  ? 77.706  32.022 26.952  1.00 12.33  ? 12   GLY A N    1 
ATOM   115   C  CA   . GLY A 1 12  ? 76.993  31.226 25.933  1.00 11.77  ? 12   GLY A CA   1 
ATOM   116   C  C    . GLY A 1 12  ? 77.656  29.858 25.859  1.00 12.14  ? 12   GLY A C    1 
ATOM   117   O  O    . GLY A 1 12  ? 78.889  29.751 25.833  1.00 14.73  ? 12   GLY A O    1 
ATOM   118   H  H    . GLY A 1 12  ? 78.303  32.594 26.717  1.00 14.80  ? 12   GLY A H    1 
ATOM   119   H  HA2  . GLY A 1 12  ? 76.059  31.132 26.177  1.00 14.12  ? 12   GLY A HA2  1 
ATOM   120   H  HA3  . GLY A 1 12  ? 77.042  31.668 25.071  1.00 14.12  ? 12   GLY A HA3  1 
ATOM   121   N  N    . ALA A 1 13  ? 76.866  28.793 25.876  1.00 12.15  ? 13   ALA A N    1 
ATOM   122   C  CA   . ALA A 1 13  ? 77.308  27.406 25.769  1.00 13.65  ? 13   ALA A CA   1 
ATOM   123   C  C    . ALA A 1 13  ? 76.578  26.678 24.654  1.00 12.88  ? 13   ALA A C    1 
ATOM   124   O  O    . ALA A 1 13  ? 75.687  25.834 24.902  1.00 13.06  ? 13   ALA A O    1 
ATOM   125   C  CB   . ALA A 1 13  ? 77.171  26.705 27.120  1.00 14.52  ? 13   ALA A CB   1 
ATOM   126   H  H    . ALA A 1 13  ? 76.021  28.932 25.958  1.00 14.58  ? 13   ALA A H    1 
ATOM   127   H  HA   . ALA A 1 13  ? 78.260  27.418 25.538  1.00 16.38  ? 13   ALA A HA   1 
ATOM   128   H  HB1  . ALA A 1 13  ? 77.643  27.206 27.790  1.00 21.77  ? 13   ALA A HB1  1 
ATOM   129   H  HB2  . ALA A 1 13  ? 77.543  25.822 27.061  1.00 21.77  ? 13   ALA A HB2  1 
ATOM   130   H  HB3  . ALA A 1 13  ? 76.243  26.647 27.359  1.00 21.77  ? 13   ALA A HB3  1 
ATOM   131   N  N    . PRO A 1 14  ? 76.922  26.980 23.405  1.00 13.00  ? 14   PRO A N    1 
ATOM   132   C  CA   . PRO A 1 14  ? 76.266  26.426 22.215  1.00 11.23  ? 14   PRO A CA   1 
ATOM   133   C  C    . PRO A 1 14  ? 76.703  25.003 21.937  1.00 12.74  ? 14   PRO A C    1 
ATOM   134   O  O    . PRO A 1 14  ? 77.508  24.718 21.049  1.00 19.72  ? 14   PRO A O    1 
ATOM   135   C  CB   . PRO A 1 14  ? 76.792  27.341 21.084  1.00 15.36  ? 14   PRO A CB   1 
ATOM   136   C  CG   . PRO A 1 14  ? 78.111  27.801 21.552  1.00 15.00  ? 14   PRO A CG   1 
ATOM   137   C  CD   . PRO A 1 14  ? 78.034  27.910 23.050  1.00 16.89  ? 14   PRO A CD   1 
ATOM   138   H  HA   . PRO A 1 14  ? 75.291  26.486 22.291  1.00 13.47  ? 14   PRO A HA   1 
ATOM   139   H  HB2  . PRO A 1 14  ? 76.875  26.847 20.253  1.00 18.43  ? 14   PRO A HB2  1 
ATOM   140   H  HB3  . PRO A 1 14  ? 76.195  28.092 20.943  1.00 18.43  ? 14   PRO A HB3  1 
ATOM   141   H  HG2  . PRO A 1 14  ? 78.800  27.168 21.296  1.00 18.00  ? 14   PRO A HG2  1 
ATOM   142   H  HG3  . PRO A 1 14  ? 78.325  28.664 21.163  1.00 18.00  ? 14   PRO A HG3  1 
ATOM   143   H  HD2  . PRO A 1 14  ? 78.866  27.632 23.464  1.00 20.27  ? 14   PRO A HD2  1 
ATOM   144   H  HD3  . PRO A 1 14  ? 77.831  28.818 23.325  1.00 20.27  ? 14   PRO A HD3  1 
ATOM   145   N  N    . PHE A 1 15  ? 76.241  24.039 22.694  1.00 12.55  ? 15   PHE A N    1 
ATOM   146   C  CA   . PHE A 1 15  ? 76.673  22.661 22.752  1.00 10.57  ? 15   PHE A CA   1 
ATOM   147   C  C    . PHE A 1 15  ? 75.496  21.710 22.734  1.00 13.63  ? 15   PHE A C    1 
ATOM   148   O  O    . PHE A 1 15  ? 74.484  21.972 23.401  1.00 12.21  ? 15   PHE A O    1 
ATOM   149   C  CB   . PHE A 1 15  ? 77.512  22.443 24.014  1.00 12.60  ? 15   PHE A CB   1 
ATOM   150   C  CG   . PHE A 1 15  ? 78.081  21.047 24.057  1.00 13.37  ? 15   PHE A CG   1 
ATOM   151   C  CD1  . PHE A 1 15  ? 79.187  20.693 23.271  1.00 10.07  ? 15   PHE A CD1  1 
ATOM   152   C  CD2  . PHE A 1 15  ? 77.528  20.064 24.872  1.00 11.03  ? 15   PHE A CD2  1 
ATOM   153   C  CE1  . PHE A 1 15  ? 79.665  19.400 23.339  1.00 13.11  ? 15   PHE A CE1  1 
ATOM   154   C  CE2  . PHE A 1 15  ? 78.033  18.798 24.880  1.00 11.30  ? 15   PHE A CE2  1 
ATOM   155   C  CZ   . PHE A 1 15  ? 79.124  18.423 24.137  1.00 12.42  ? 15   PHE A CZ   1 
ATOM   156   H  H    . PHE A 1 15  ? 75.599  24.253 23.224  1.00 15.06  ? 15   PHE A H    1 
ATOM   157   H  HA   . PHE A 1 15  ? 77.234  22.477 21.970  1.00 12.69  ? 15   PHE A HA   1 
ATOM   158   H  HB2  . PHE A 1 15  ? 78.237  23.087 24.034  1.00 15.12  ? 15   PHE A HB2  1 
ATOM   159   H  HB3  . PHE A 1 15  ? 76.959  22.589 24.798  1.00 15.12  ? 15   PHE A HB3  1 
ATOM   160   H  HD1  . PHE A 1 15  ? 79.592  21.318 22.715  1.00 12.08  ? 15   PHE A HD1  1 
ATOM   161   H  HD2  . PHE A 1 15  ? 76.805  20.274 25.418  1.00 13.24  ? 15   PHE A HD2  1 
ATOM   162   H  HE1  . PHE A 1 15  ? 80.397  19.177 22.812  1.00 15.73  ? 15   PHE A HE1  1 
ATOM   163   H  HE2  . PHE A 1 15  ? 77.618  18.158 25.413  1.00 13.56  ? 15   PHE A HE2  1 
ATOM   164   H  HZ   . PHE A 1 15  ? 79.475  17.563 24.172  1.00 14.90  ? 15   PHE A HZ   1 
ATOM   165   N  N    . SER A 1 16  ? 75.555  20.625 21.969  1.00 9.11   ? 16   SER A N    1 
ATOM   166   C  CA   . SER A 1 16  ? 74.461  19.728 21.714  1.00 9.46   ? 16   SER A CA   1 
ATOM   167   C  C    . SER A 1 16  ? 74.784  18.242 21.896  1.00 10.02  ? 16   SER A C    1 
ATOM   168   O  O    . SER A 1 16  ? 73.852  17.433 21.818  1.00 9.92   ? 16   SER A O    1 
ATOM   169   C  CB   . SER A 1 16  ? 73.844  19.870 20.290  1.00 10.83  ? 16   SER A CB   1 
ATOM   170   O  OG   . SER A 1 16  ? 74.787  19.373 19.321  1.00 13.52  ? 16   SER A OG   1 
ATOM   171   H  H    . SER A 1 16  ? 76.308  20.444 21.597  1.00 10.93  ? 16   SER A H    1 
ATOM   172   H  HA   . SER A 1 16  ? 73.754  19.949 22.356  1.00 11.36  ? 16   SER A HA   1 
ATOM   173   H  HB2  . SER A 1 16  ? 73.018  19.365 20.237  1.00 13.00  ? 16   SER A HB2  1 
ATOM   174   H  HB3  . SER A 1 16  ? 73.643  20.802 20.109  1.00 13.00  ? 16   SER A HB3  1 
ATOM   175   H  HG   . SER A 1 16  ? 75.482  19.805 19.370  1.00 20.28  ? 16   SER A HG   1 
ATOM   176   N  N    . LYS A 1 17  ? 76.048  17.856 22.137  1.00 10.12  ? 17   LYS A N    1 
ATOM   177   C  CA   . LYS A 1 17  ? 76.377  16.431 22.090  1.00 9.54   ? 17   LYS A CA   1 
ATOM   178   C  C    . LYS A 1 17  ? 75.958  15.595 23.281  1.00 11.29  ? 17   LYS A C    1 
ATOM   179   O  O    . LYS A 1 17  ? 76.216  14.383 23.291  1.00 12.01  ? 17   LYS A O    1 
ATOM   180   C  CB   . LYS A 1 17  ? 77.904  16.270 21.891  1.00 14.52  ? 17   LYS A CB   1 
ATOM   181   C  CG   . LYS A 1 17  ? 78.428  16.973 20.669  1.00 20.21  ? 17   LYS A CG   1 
ATOM   182   C  CD   . LYS A 1 17  ? 78.230  16.107 19.427  1.00 34.20  ? 17   LYS A CD   1 
ATOM   183   C  CE   . LYS A 1 17  ? 78.330  16.958 18.163  1.00 45.55  ? 17   LYS A CE   1 
ATOM   184   N  NZ   . LYS A 1 17  ? 77.451  16.431 17.081  1.00 42.16  ? 17   LYS A NZ   1 
ATOM   185   H  H    . LYS A 1 17  ? 76.655  18.437 22.317  1.00 12.14  ? 17   LYS A H    1 
ATOM   186   H  HA   . LYS A 1 17  ? 75.937  16.054 21.299  1.00 11.45  ? 17   LYS A HA   1 
ATOM   187   H  HB2  . LYS A 1 17  ? 78.360  16.619 22.673  1.00 17.43  ? 17   LYS A HB2  1 
ATOM   188   H  HB3  . LYS A 1 17  ? 78.114  15.326 21.824  1.00 17.43  ? 17   LYS A HB3  1 
ATOM   189   H  HG2  . LYS A 1 17  ? 77.962  17.816 20.555  1.00 24.26  ? 17   LYS A HG2  1 
ATOM   190   H  HG3  . LYS A 1 17  ? 79.372  17.164 20.784  1.00 24.26  ? 17   LYS A HG3  1 
ATOM   191   H  HD2  . LYS A 1 17  ? 78.905  15.412 19.405  1.00 41.05  ? 17   LYS A HD2  1 
ATOM   192   H  HD3  . LYS A 1 17  ? 77.359  15.681 19.464  1.00 41.05  ? 17   LYS A HD3  1 
ATOM   193   H  HE2  . LYS A 1 17  ? 78.074  17.871 18.369  1.00 54.65  ? 17   LYS A HE2  1 
ATOM   194   H  HE3  . LYS A 1 17  ? 79.249  16.968 17.854  1.00 54.65  ? 17   LYS A HE3  1 
ATOM   195   H  HZ1  . LYS A 1 17  ? 77.569  16.913 16.342  1.00 63.24  ? 17   LYS A HZ1  1 
ATOM   196   H  HZ2  . LYS A 1 17  ? 76.601  16.484 17.338  1.00 63.24  ? 17   LYS A HZ2  1 
ATOM   197   H  HZ3  . LYS A 1 17  ? 77.659  15.581 16.918  1.00 63.24  ? 17   LYS A HZ3  1 
ATOM   198   N  N    . GLY A 1 18  ? 75.299  16.218 24.279  1.00 8.89   ? 18   GLY A N    1 
ATOM   199   C  CA   . GLY A 1 18  ? 74.600  15.482 25.318  1.00 10.60  ? 18   GLY A CA   1 
ATOM   200   C  C    . GLY A 1 18  ? 73.338  14.795 24.900  1.00 8.69   ? 18   GLY A C    1 
ATOM   201   O  O    . GLY A 1 18  ? 72.675  14.017 25.632  1.00 10.21  ? 18   GLY A O    1 
ATOM   202   H  H    . GLY A 1 18  ? 75.293  17.078 24.301  1.00 10.67  ? 18   GLY A H    1 
ATOM   203   H  HA2  . GLY A 1 18  ? 75.205  14.815 25.678  1.00 12.72  ? 18   GLY A HA2  1 
ATOM   204   H  HA3  . GLY A 1 18  ? 74.387  16.098 26.036  1.00 12.72  ? 18   GLY A HA3  1 
ATOM   205   N  N    . GLN A 1 19  ? 72.909  15.004 23.634  1.00 10.66  ? 19   GLN A N    1 
ATOM   206   C  CA   . GLN A 1 19  ? 71.666  14.451 23.095  1.00 8.79   ? 19   GLN A CA   1 
ATOM   207   C  C    . GLN A 1 19  ? 71.684  14.477 21.557  1.00 8.89   ? 19   GLN A C    1 
ATOM   208   O  O    . GLN A 1 19  ? 72.662  15.020 21.009  1.00 11.22  ? 19   GLN A O    1 
ATOM   209   C  CB   . GLN A 1 19  ? 70.469  15.169 23.720  1.00 9.74   ? 19   GLN A CB   1 
ATOM   210   C  CG   . GLN A 1 19  ? 70.413  16.673 23.655  1.00 12.55  ? 19   GLN A CG   1 
ATOM   211   C  CD   . GLN A 1 19  ? 70.054  17.247 22.286  1.00 13.07  ? 19   GLN A CD   1 
ATOM   212   O  OE1  . GLN A 1 19  ? 68.908  17.161 21.857  1.00 14.37  ? 19   GLN A OE1  1 
ATOM   213   N  NE2  . GLN A 1 19  ? 71.054  17.832 21.666  1.00 12.37  ? 19   GLN A NE2  1 
ATOM   214   H  H    . GLN A 1 19  ? 73.394  15.491 23.116  1.00 12.79  ? 19   GLN A H    1 
ATOM   215   H  HA   . GLN A 1 19  ? 71.620  13.512 23.371  1.00 10.55  ? 19   GLN A HA   1 
ATOM   216   H  HB2  . GLN A 1 19  ? 69.666  14.827 23.296  1.00 11.68  ? 19   GLN A HB2  1 
ATOM   217   H  HB3  . GLN A 1 19  ? 70.428  14.914 24.655  1.00 11.68  ? 19   GLN A HB3  1 
ATOM   218   H  HG2  . GLN A 1 19  ? 69.760  16.986 24.301  1.00 15.06  ? 19   GLN A HG2  1 
ATOM   219   H  HG3  . GLN A 1 19  ? 71.277  17.026 23.920  1.00 15.06  ? 19   GLN A HG3  1 
ATOM   220   H  HE21 . GLN A 1 19  ? 70.929  18.195 20.896  1.00 14.85  ? 19   GLN A HE21 1 
ATOM   221   H  HE22 . GLN A 1 19  ? 71.832  17.853 22.031  1.00 14.85  ? 19   GLN A HE22 1 
ATOM   222   N  N    . PRO A 1 20  ? 70.746  13.892 20.855  1.00 10.42  ? 20   PRO A N    1 
ATOM   223   C  CA   . PRO A 1 20  ? 70.957  13.772 19.394  1.00 14.90  ? 20   PRO A CA   1 
ATOM   224   C  C    . PRO A 1 20  ? 70.737  14.972 18.505  1.00 16.29  ? 20   PRO A C    1 
ATOM   225   O  O    . PRO A 1 20  ? 71.362  14.982 17.398  1.00 15.01  ? 20   PRO A O    1 
ATOM   226   C  CB   . PRO A 1 20  ? 69.877  12.747 19.015  1.00 16.83  ? 20   PRO A CB   1 
ATOM   227   C  CG   . PRO A 1 20  ? 69.504  12.037 20.272  1.00 15.22  ? 20   PRO A CG   1 
ATOM   228   C  CD   . PRO A 1 20  ? 69.605  13.113 21.322  1.00 11.86  ? 20   PRO A CD   1 
ATOM   229   H  HA   . PRO A 1 20  ? 71.844  13.394 19.221  1.00 17.88  ? 20   PRO A HA   1 
ATOM   230   H  HB2  . PRO A 1 20  ? 69.104  13.194 18.637  1.00 20.19  ? 20   PRO A HB2  1 
ATOM   231   H  HB3  . PRO A 1 20  ? 70.222  12.118 18.362  1.00 20.19  ? 20   PRO A HB3  1 
ATOM   232   H  HG2  . PRO A 1 20  ? 68.602  11.684 20.219  1.00 18.27  ? 20   PRO A HG2  1 
ATOM   233   H  HG3  . PRO A 1 20  ? 70.118  11.309 20.457  1.00 18.27  ? 20   PRO A HG3  1 
ATOM   234   H  HD2  . PRO A 1 20  ? 68.799  13.651 21.354  1.00 14.23  ? 20   PRO A HD2  1 
ATOM   235   H  HD3  . PRO A 1 20  ? 69.771  12.735 22.200  1.00 14.23  ? 20   PRO A HD3  1 
ATOM   236   N  N    . ARG A 1 21  ? 69.948  15.953 18.857  1.00 14.36  ? 21   ARG A N    1 
ATOM   237   C  CA   . ARG A 1 21  ? 69.476  17.033 18.009  1.00 10.80  ? 21   ARG A CA   1 
ATOM   238   C  C    . ARG A 1 21  ? 70.368  18.238 18.010  1.00 18.13  ? 21   ARG A C    1 
ATOM   239   O  O    . ARG A 1 21  ? 70.640  18.860 19.044  1.00 14.16  ? 21   ARG A O    1 
ATOM   240   C  CB   . ARG A 1 21  ? 68.039  17.404 18.461  1.00 12.36  ? 21   ARG A CB   1 
ATOM   241   C  CG   . ARG A 1 21  ? 67.079  16.269 18.193  1.00 14.73  ? 21   ARG A CG   1 
ATOM   242   C  CD   . ARG A 1 21  ? 65.792  16.320 18.982  1.00 13.46  ? 21   ARG A CD   1 
ATOM   243   N  NE   . ARG A 1 21  ? 66.018  16.073 20.421  1.00 21.68  ? 21   ARG A NE   1 
ATOM   244   C  CZ   . ARG A 1 21  ? 66.000  14.878 20.987  1.00 21.92  ? 21   ARG A CZ   1 
ATOM   245   N  NH1  . ARG A 1 21  ? 65.792  13.760 20.304  1.00 18.18  ? 21   ARG A NH1  1 
ATOM   246   N  NH2  . ARG A 1 21  ? 66.204  14.731 22.301  1.00 20.75  ? 21   ARG A NH2  1 
ATOM   247   H  H    . ARG A 1 21  ? 69.680  15.959 19.674  1.00 17.23  ? 21   ARG A H    1 
ATOM   248   H  HA   . ARG A 1 21  ? 69.425  16.696 17.090  1.00 12.96  ? 21   ARG A HA   1 
ATOM   249   H  HB2  . ARG A 1 21  ? 68.041  17.608 19.410  1.00 14.83  ? 21   ARG A HB2  1 
ATOM   250   H  HB3  . ARG A 1 21  ? 67.744  18.196 17.985  1.00 14.83  ? 21   ARG A HB3  1 
ATOM   251   H  HG2  . ARG A 1 21  ? 66.861  16.267 17.248  1.00 17.67  ? 21   ARG A HG2  1 
ATOM   252   H  HG3  . ARG A 1 21  ? 67.529  15.432 18.391  1.00 17.67  ? 21   ARG A HG3  1 
ATOM   253   H  HD2  . ARG A 1 21  ? 65.382  17.191 18.868  1.00 16.15  ? 21   ARG A HD2  1 
ATOM   254   H  HD3  . ARG A 1 21  ? 65.178  15.653 18.636  1.00 16.15  ? 21   ARG A HD3  1 
ATOM   255   H  HE   . ARG A 1 21  ? 66.172  16.753 20.925  1.00 26.02  ? 21   ARG A HE   1 
ATOM   256   H  HH11 . ARG A 1 21  ? 65.661  13.794 19.454  1.00 21.82  ? 21   ARG A HH11 1 
ATOM   257   H  HH12 . ARG A 1 21  ? 65.788  13.002 20.710  1.00 21.82  ? 21   ARG A HH12 1 
ATOM   258   H  HH21 . ARG A 1 21  ? 66.350  15.421 22.793  1.00 24.90  ? 21   ARG A HH21 1 
ATOM   259   H  HH22 . ARG A 1 21  ? 66.189  13.946 22.653  1.00 24.90  ? 21   ARG A HH22 1 
ATOM   260   N  N    . GLY A 1 22  ? 70.906  18.714 16.868  1.00 14.05  ? 22   GLY A N    1 
ATOM   261   C  CA   . GLY A 1 22  ? 71.954  19.714 16.909  1.00 11.68  ? 22   GLY A CA   1 
ATOM   262   C  C    . GLY A 1 22  ? 71.541  21.117 17.222  1.00 13.90  ? 22   GLY A C    1 
ATOM   263   O  O    . GLY A 1 22  ? 72.308  21.972 17.638  1.00 13.96  ? 22   GLY A O    1 
ATOM   264   H  H    . GLY A 1 22  ? 70.625  18.422 16.110  1.00 16.86  ? 22   GLY A H    1 
ATOM   265   H  HA2  . GLY A 1 22  ? 72.607  19.438 17.571  1.00 14.02  ? 22   GLY A HA2  1 
ATOM   266   H  HA3  . GLY A 1 22  ? 72.400  19.718 16.048  1.00 14.02  ? 22   GLY A HA3  1 
ATOM   267   N  N    . GLY A 1 23  ? 70.241  21.378 17.021  1.00 14.71  ? 23   GLY A N    1 
ATOM   268   C  CA   . GLY A 1 23  ? 69.676  22.687 17.092  1.00 10.69  ? 23   GLY A CA   1 
ATOM   269   C  C    . GLY A 1 23  ? 69.663  23.394 18.431  1.00 9.66   ? 23   GLY A C    1 
ATOM   270   O  O    . GLY A 1 23  ? 69.542  24.597 18.457  1.00 12.34  ? 23   GLY A O    1 
ATOM   271   H  H    . GLY A 1 23  ? 69.718  20.720 16.840  1.00 17.65  ? 23   GLY A H    1 
ATOM   272   H  HA2  . GLY A 1 23  ? 70.156  23.251 16.465  1.00 12.83  ? 23   GLY A HA2  1 
ATOM   273   H  HA3  . GLY A 1 23  ? 68.759  22.630 16.779  1.00 12.83  ? 23   GLY A HA3  1 
ATOM   274   N  N    . VAL A 1 24  ? 69.861  22.617 19.510  1.00 11.39  ? 24   VAL A N    1 
ATOM   275   C  CA   . VAL A 1 24  ? 70.063  23.319 20.791  1.00 11.31  ? 24   VAL A CA   1 
ATOM   276   C  C    . VAL A 1 24  ? 71.307  24.190 20.812  1.00 12.41  ? 24   VAL A C    1 
ATOM   277   O  O    . VAL A 1 24  ? 71.460  25.067 21.660  1.00 13.93  ? 24   VAL A O    1 
ATOM   278   C  CB   . VAL A 1 24  ? 70.165  22.425 22.060  1.00 15.06  ? 24   VAL A CB   1 
ATOM   279   C  CG1  . VAL A 1 24  ? 68.840  21.851 22.475  1.00 19.72  ? 24   VAL A CG1  1 
ATOM   280   C  CG2  . VAL A 1 24  ? 71.225  21.343 21.881  1.00 11.74  ? 24   VAL A CG2  1 
ATOM   281   H  H    . VAL A 1 24  ? 69.870  21.759 19.457  1.00 13.67  ? 24   VAL A H    1 
ATOM   282   H  HA   . VAL A 1 24  ? 69.294  23.913 20.918  1.00 13.57  ? 24   VAL A HA   1 
ATOM   283   H  HB   . VAL A 1 24  ? 70.468  23.003 22.792  1.00 18.08  ? 24   VAL A HB   1 
ATOM   284   H  HG11 . VAL A 1 24  ? 68.198  22.559 22.565  1.00 29.58  ? 24   VAL A HG11 1 
ATOM   285   H  HG12 . VAL A 1 24  ? 68.937  21.398 23.315  1.00 29.58  ? 24   VAL A HG12 1 
ATOM   286   H  HG13 . VAL A 1 24  ? 68.538  21.229 21.809  1.00 29.58  ? 24   VAL A HG13 1 
ATOM   287   H  HG21 . VAL A 1 24  ? 72.060  21.750 21.639  1.00 17.61  ? 24   VAL A HG21 1 
ATOM   288   H  HG22 . VAL A 1 24  ? 70.951  20.738 21.188  1.00 17.61  ? 24   VAL A HG22 1 
ATOM   289   H  HG23 . VAL A 1 24  ? 71.331  20.860 22.704  1.00 17.61  ? 24   VAL A HG23 1 
ATOM   290   N  N    . GLU A 1 25  ? 72.250  24.004 19.873  1.00 12.98  ? 25   GLU A N    1 
ATOM   291   C  CA   . GLU A 1 25  ? 73.398  24.846 19.668  1.00 16.11  ? 25   GLU A CA   1 
ATOM   292   C  C    . GLU A 1 25  ? 72.979  26.296 19.386  1.00 18.88  ? 25   GLU A C    1 
ATOM   293   O  O    . GLU A 1 25  ? 73.816  27.182 19.604  1.00 19.44  ? 25   GLU A O    1 
ATOM   294   C  CB   . GLU A 1 25  ? 74.287  24.363 18.513  1.00 19.93  ? 25   GLU A CB   1 
ATOM   295   C  CG   . GLU A 1 25  ? 75.133  23.154 18.845  1.00 28.80  ? 25   GLU A CG   1 
ATOM   296   C  CD   . GLU A 1 25  ? 75.707  22.419 17.642  1.00 26.12  ? 25   GLU A CD   1 
ATOM   297   O  OE1  . GLU A 1 25  ? 75.602  22.905 16.496  1.00 28.00  ? 25   GLU A OE1  1 
ATOM   298   O  OE2  . GLU A 1 25  ? 76.247  21.307 17.870  1.00 22.01  ? 25   GLU A OE2  1 
ATOM   299   H  H    . GLU A 1 25  ? 72.160  23.325 19.353  1.00 15.57  ? 25   GLU A H    1 
ATOM   300   H  HA   . GLU A 1 25  ? 73.933  24.838 20.489  1.00 19.33  ? 25   GLU A HA   1 
ATOM   301   H  HB2  . GLU A 1 25  ? 73.722  24.149 17.754  1.00 23.92  ? 25   GLU A HB2  1 
ATOM   302   H  HB3  . GLU A 1 25  ? 74.873  25.089 18.247  1.00 23.92  ? 25   GLU A HB3  1 
ATOM   303   H  HG2  . GLU A 1 25  ? 75.867  23.437 19.411  1.00 34.56  ? 25   GLU A HG2  1 
ATOM   304   H  HG3  . GLU A 1 25  ? 74.593  22.531 19.356  1.00 34.56  ? 25   GLU A HG3  1 
ATOM   305   N  N    . GLU A 1 26  ? 71.773  26.532 18.891  1.00 15.57  ? 26   GLU A N    1 
ATOM   306   C  CA   . GLU A 1 26  ? 71.322  27.871 18.574  1.00 19.68  ? 26   GLU A CA   1 
ATOM   307   C  C    . GLU A 1 26  ? 70.737  28.620 19.765  1.00 14.95  ? 26   GLU A C    1 
ATOM   308   O  O    . GLU A 1 26  ? 70.422  29.814 19.651  1.00 15.85  ? 26   GLU A O    1 
ATOM   309   C  CB   . GLU A 1 26  ? 70.272  27.779 17.458  1.00 14.89  ? 26   GLU A CB   1 
ATOM   310   C  CG   . GLU A 1 26  ? 70.515  26.703 16.426  1.00 35.29  ? 26   GLU A CG   1 
ATOM   311   C  CD   . GLU A 1 26  ? 71.913  26.470 15.907  1.00 47.57  ? 26   GLU A CD   1 
ATOM   312   O  OE1  . GLU A 1 26  ? 72.797  27.344 16.033  1.00 67.47  ? 26   GLU A OE1  1 
ATOM   313   O  OE2  . GLU A 1 26  ? 72.177  25.373 15.351  1.00 58.89  ? 26   GLU A OE2  1 
ATOM   314   H  H    . GLU A 1 26  ? 71.242  25.869 18.753  1.00 18.68  ? 26   GLU A H    1 
ATOM   315   H  HA   . GLU A 1 26  ? 72.087  28.381 18.235  1.00 23.62  ? 26   GLU A HA   1 
ATOM   316   H  HB2  . GLU A 1 26  ? 69.405  27.623 17.865  1.00 17.87  ? 26   GLU A HB2  1 
ATOM   317   H  HB3  . GLU A 1 26  ? 70.231  28.635 17.005  1.00 17.87  ? 26   GLU A HB3  1 
ATOM   318   H  HG2  . GLU A 1 26  ? 70.201  25.865 16.800  1.00 42.35  ? 26   GLU A HG2  1 
ATOM   319   H  HG3  . GLU A 1 26  ? 69.951  26.901 15.662  1.00 42.35  ? 26   GLU A HG3  1 
ATOM   320   N  N    . GLY A 1 27  ? 70.564  27.929 20.884  1.00 15.15  ? 27   GLY A N    1 
ATOM   321   C  CA   . GLY A 1 27  ? 70.023  28.578 22.061  1.00 18.05  ? 27   GLY A CA   1 
ATOM   322   C  C    . GLY A 1 27  ? 70.627  29.894 22.439  1.00 18.24  ? 27   GLY A C    1 
ATOM   323   O  O    . GLY A 1 27  ? 69.941  30.902 22.674  1.00 15.57  ? 27   GLY A O    1 
ATOM   324   H  H    . GLY A 1 27  ? 70.774  27.096 20.911  1.00 18.18  ? 27   GLY A H    1 
ATOM   325   H  HA2  . GLY A 1 27  ? 69.072  28.711 21.922  1.00 21.66  ? 27   GLY A HA2  1 
ATOM   326   H  HA3  . GLY A 1 27  ? 70.123  27.972 22.812  1.00 21.66  ? 27   GLY A HA3  1 
ATOM   327   N  N    . PRO A 1 28  ? 71.938  29.987 22.598  1.00 14.23  ? 28   PRO A N    1 
ATOM   328   C  CA   . PRO A 1 28  ? 72.504  31.278 23.009  1.00 11.08  ? 28   PRO A CA   1 
ATOM   329   C  C    . PRO A 1 28  ? 72.260  32.353 21.957  1.00 16.34  ? 28   PRO A C    1 
ATOM   330   O  O    . PRO A 1 28  ? 71.997  33.520 22.265  1.00 21.63  ? 28   PRO A O    1 
ATOM   331   C  CB   . PRO A 1 28  ? 73.976  30.917 23.204  1.00 19.58  ? 28   PRO A CB   1 
ATOM   332   C  CG   . PRO A 1 28  ? 74.007  29.441 23.393  1.00 18.67  ? 28   PRO A CG   1 
ATOM   333   C  CD   . PRO A 1 28  ? 72.915  28.901 22.547  1.00 14.89  ? 28   PRO A CD   1 
ATOM   334   H  HA   . PRO A 1 28  ? 72.113  31.555 23.864  1.00 13.29  ? 28   PRO A HA   1 
ATOM   335   H  HB2  . PRO A 1 28  ? 74.496  31.172 22.425  1.00 23.50  ? 28   PRO A HB2  1 
ATOM   336   H  HB3  . PRO A 1 28  ? 74.339  31.369 23.982  1.00 23.50  ? 28   PRO A HB3  1 
ATOM   337   H  HG2  . PRO A 1 28  ? 74.863  29.079 23.116  1.00 22.41  ? 28   PRO A HG2  1 
ATOM   338   H  HG3  . PRO A 1 28  ? 73.861  29.214 24.325  1.00 22.41  ? 28   PRO A HG3  1 
ATOM   339   H  HD2  . PRO A 1 28  ? 73.217  28.738 21.640  1.00 17.87  ? 28   PRO A HD2  1 
ATOM   340   H  HD3  . PRO A 1 28  ? 72.553  28.081 22.917  1.00 17.87  ? 28   PRO A HD3  1 
ATOM   341   N  N    . THR A 1 29  ? 72.310  32.011 20.674  1.00 18.13  ? 29   THR A N    1 
ATOM   342   C  CA   . THR A 1 29  ? 72.041  32.979 19.617  1.00 19.58  ? 29   THR A CA   1 
ATOM   343   C  C    . THR A 1 29  ? 70.633  33.541 19.629  1.00 15.52  ? 29   THR A C    1 
ATOM   344   O  O    . THR A 1 29  ? 70.379  34.749 19.506  1.00 17.72  ? 29   THR A O    1 
ATOM   345   C  CB   . THR A 1 29  ? 72.308  32.310 18.246  1.00 28.06  ? 29   THR A CB   1 
ATOM   346   O  OG1  . THR A 1 29  ? 73.706  32.006 18.148  1.00 28.83  ? 29   THR A OG1  1 
ATOM   347   C  CG2  . THR A 1 29  ? 71.996  33.270 17.114  1.00 22.22  ? 29   THR A CG2  1 
ATOM   348   H  H    . THR A 1 29  ? 72.505  31.200 20.461  1.00 21.76  ? 29   THR A H    1 
ATOM   349   H  HA   . THR A 1 29  ? 72.668  33.725 19.720  1.00 23.50  ? 29   THR A HA   1 
ATOM   350   H  HB   . THR A 1 29  ? 71.775  31.493 18.156  1.00 33.67  ? 29   THR A HB   1 
ATOM   351   H  HG1  . THR A 1 29  ? 73.914  31.482 18.743  1.00 43.24  ? 29   THR A HG1  1 
ATOM   352   H  HG21 . THR A 1 29  ? 72.172  32.841 16.273  1.00 33.34  ? 29   THR A HG21 1 
ATOM   353   H  HG22 . THR A 1 29  ? 72.547  34.051 17.195  1.00 33.34  ? 29   THR A HG22 1 
ATOM   354   H  HG23 . THR A 1 29  ? 71.071  33.525 17.156  1.00 33.34  ? 29   THR A HG23 1 
ATOM   355   N  N    . VAL A 1 30  ? 69.650  32.641 19.775  1.00 15.00  ? 30   VAL A N    1 
ATOM   356   C  CA   . VAL A 1 30  ? 68.290  33.211 19.703  1.00 13.69  ? 30   VAL A CA   1 
ATOM   357   C  C    . VAL A 1 30  ? 67.883  33.966 20.961  1.00 12.12  ? 30   VAL A C    1 
ATOM   358   O  O    . VAL A 1 30  ? 67.065  34.896 20.910  1.00 14.91  ? 30   VAL A O    1 
ATOM   359   C  CB   . VAL A 1 30  ? 67.240  32.159 19.327  1.00 19.07  ? 30   VAL A CB   1 
ATOM   360   C  CG1  . VAL A 1 30  ? 65.905  32.851 19.111  1.00 46.00  ? 30   VAL A CG1  1 
ATOM   361   C  CG2  . VAL A 1 30  ? 67.603  31.462 18.031  1.00 26.40  ? 30   VAL A CG2  1 
ATOM   362   H  H    . VAL A 1 30  ? 69.799  31.803 19.900  1.00 18.00  ? 30   VAL A H    1 
ATOM   363   H  HA   . VAL A 1 30  ? 68.301  33.867 18.975  1.00 16.43  ? 30   VAL A HA   1 
ATOM   364   H  HB   . VAL A 1 30  ? 67.159  31.499 20.047  1.00 22.88  ? 30   VAL A HB   1 
ATOM   365   H  HG11 . VAL A 1 30  ? 65.641  33.297 19.919  1.00 68.99  ? 30   VAL A HG11 1 
ATOM   366   H  HG12 . VAL A 1 30  ? 65.241  32.200 18.874  1.00 68.99  ? 30   VAL A HG12 1 
ATOM   367   H  HG13 . VAL A 1 30  ? 65.989  33.495 18.404  1.00 68.99  ? 30   VAL A HG13 1 
ATOM   368   H  HG21 . VAL A 1 30  ? 68.447  31.017 18.132  1.00 39.60  ? 30   VAL A HG21 1 
ATOM   369   H  HG22 . VAL A 1 30  ? 67.664  32.110 17.325  1.00 39.60  ? 30   VAL A HG22 1 
ATOM   370   H  HG23 . VAL A 1 30  ? 66.926  30.816 17.814  1.00 39.60  ? 30   VAL A HG23 1 
ATOM   371   N  N    . LEU A 1 31  ? 68.481  33.556 22.081  1.00 14.13  ? 31   LEU A N    1 
ATOM   372   C  CA   . LEU A 1 31  ? 68.180  34.274 23.323  1.00 15.83  ? 31   LEU A CA   1 
ATOM   373   C  C    . LEU A 1 31  ? 68.795  35.652 23.227  1.00 14.75  ? 31   LEU A C    1 
ATOM   374   O  O    . LEU A 1 31  ? 68.176  36.644 23.597  1.00 20.48  ? 31   LEU A O    1 
ATOM   375   C  CB   . LEU A 1 31  ? 68.646  33.463 24.540  1.00 12.65  ? 31   LEU A CB   1 
ATOM   376   C  CG   . LEU A 1 31  ? 67.861  32.174 24.817  1.00 16.32  ? 31   LEU A CG   1 
ATOM   377   C  CD1  . LEU A 1 31  ? 68.594  31.208 25.724  1.00 15.04  ? 31   LEU A CD1  1 
ATOM   378   C  CD2  . LEU A 1 31  ? 66.481  32.529 25.371  1.00 20.20  ? 31   LEU A CD2  1 
ATOM   379   H  H    . LEU A 1 31  ? 69.025  32.890 22.075  1.00 16.95  ? 31   LEU A H    1 
ATOM   380   H  HA   . LEU A 1 31  ? 67.208  34.380 23.385  1.00 19.00  ? 31   LEU A HA   1 
ATOM   381   H  HB2  . LEU A 1 31  ? 69.580  33.232 24.414  1.00 15.18  ? 31   LEU A HB2  1 
ATOM   382   H  HB3  . LEU A 1 31  ? 68.590  34.030 25.325  1.00 15.18  ? 31   LEU A HB3  1 
ATOM   383   H  HG   . LEU A 1 31  ? 67.725  31.724 23.957  1.00 19.58  ? 31   LEU A HG   1 
ATOM   384   H  HD11 . LEU A 1 31  ? 69.456  31.009 25.350  1.00 22.56  ? 31   LEU A HD11 1 
ATOM   385   H  HD12 . LEU A 1 31  ? 68.086  30.397 25.805  1.00 22.56  ? 31   LEU A HD12 1 
ATOM   386   H  HD13 . LEU A 1 31  ? 68.705  31.604 26.591  1.00 22.56  ? 31   LEU A HD13 1 
ATOM   387   H  HD21 . LEU A 1 31  ? 66.042  33.138 24.772  1.00 30.30  ? 31   LEU A HD21 1 
ATOM   388   H  HD22 . LEU A 1 31  ? 66.578  32.942 26.232  1.00 30.30  ? 31   LEU A HD22 1 
ATOM   389   H  HD23 . LEU A 1 31  ? 65.955  31.730 25.457  1.00 30.30  ? 31   LEU A HD23 1 
ATOM   390   N  N    . ARG A 1 32  ? 70.023  35.764 22.726  1.00 15.44  ? 32   ARG A N    1 
ATOM   391   C  CA   . ARG A 1 32  ? 70.691  37.035 22.552  1.00 20.77  ? 32   ARG A CA   1 
ATOM   392   C  C    . ARG A 1 32  ? 69.957  37.904 21.538  1.00 18.32  ? 32   ARG A C    1 
ATOM   393   O  O    . ARG A 1 32  ? 69.847  39.101 21.853  1.00 20.15  ? 32   ARG A O    1 
ATOM   394   C  CB   . ARG A 1 32  ? 72.147  36.839 22.108  1.00 18.75  ? 32   ARG A CB   1 
ATOM   395   C  CG   . ARG A 1 32  ? 73.115  36.454 23.225  1.00 21.06  ? 32   ARG A CG   1 
ATOM   396   C  CD   . ARG A 1 32  ? 74.462  37.113 22.921  1.00 38.08  ? 32   ARG A CD   1 
ATOM   397   N  NE   . ARG A 1 32  ? 75.515  36.841 23.903  1.00 31.60  ? 32   ARG A NE   1 
ATOM   398   C  CZ   . ARG A 1 32  ? 76.099  35.658 23.998  1.00 19.61  ? 32   ARG A CZ   1 
ATOM   399   N  NH1  . ARG A 1 32  ? 75.710  34.682 23.194  1.00 25.75  ? 32   ARG A NH1  1 
ATOM   400   N  NH2  . ARG A 1 32  ? 77.065  35.417 24.902  1.00 22.37  ? 32   ARG A NH2  1 
ATOM   401   H  H    . ARG A 1 32  ? 70.438  35.047 22.495  1.00 18.53  ? 32   ARG A H    1 
ATOM   402   H  HA   . ARG A 1 32  ? 70.692  37.502 23.414  1.00 24.93  ? 32   ARG A HA   1 
ATOM   403   H  HB2  . ARG A 1 32  ? 72.172  36.148 21.428  1.00 22.50  ? 32   ARG A HB2  1 
ATOM   404   H  HB3  . ARG A 1 32  ? 72.459  37.662 21.700  1.00 22.50  ? 32   ARG A HB3  1 
ATOM   405   H  HG2  . ARG A 1 32  ? 72.777  36.763 24.081  1.00 25.27  ? 32   ARG A HG2  1 
ATOM   406   H  HG3  . ARG A 1 32  ? 73.215  35.490 23.264  1.00 25.27  ? 32   ARG A HG3  1 
ATOM   407   H  HD2  . ARG A 1 32  ? 74.765  36.809 22.051  1.00 45.69  ? 32   ARG A HD2  1 
ATOM   408   H  HD3  . ARG A 1 32  ? 74.332  38.073 22.867  1.00 45.69  ? 32   ARG A HD3  1 
ATOM   409   H  HE   . ARG A 1 32  ? 75.760  37.470 24.435  1.00 37.93  ? 32   ARG A HE   1 
ATOM   410   H  HH11 . ARG A 1 32  ? 75.086  34.822 22.619  1.00 30.90  ? 32   ARG A HH11 1 
ATOM   411   H  HH12 . ARG A 1 32  ? 76.082  33.909 23.245  1.00 30.90  ? 32   ARG A HH12 1 
ATOM   412   H  HH21 . ARG A 1 32  ? 77.422  34.636 24.952  1.00 26.84  ? 32   ARG A HH21 1 
ATOM   413   H  HH22 . ARG A 1 32  ? 77.326  36.044 25.430  1.00 26.84  ? 32   ARG A HH22 1 
ATOM   414   N  N    . LYS A 1 33  ? 69.503  37.346 20.416  1.00 14.04  ? 33   LYS A N    1 
ATOM   415   C  CA   . LYS A 1 33  ? 68.783  38.063 19.376  1.00 15.01  ? 33   LYS A CA   1 
ATOM   416   C  C    . LYS A 1 33  ? 67.434  38.588 19.861  1.00 22.90  ? 33   LYS A C    1 
ATOM   417   O  O    . LYS A 1 33  ? 66.904  39.558 19.301  1.00 19.67  ? 33   LYS A O    1 
ATOM   418   C  CB   . LYS A 1 33  ? 68.594  37.209 18.112  1.00 23.34  ? 33   LYS A CB   1 
ATOM   419   C  CG   . LYS A 1 33  ? 69.645  37.476 17.040  1.00 35.16  ? 33   LYS A CG   1 
ATOM   420   C  CD   . LYS A 1 33  ? 70.351  36.201 16.610  1.00 37.66  ? 33   LYS A CD   1 
ATOM   421   C  CE   . LYS A 1 33  ? 70.719  36.144 15.144  1.00 27.76  ? 33   LYS A CE   1 
ATOM   422   N  NZ   . LYS A 1 33  ? 70.555  34.778 14.555  1.00 32.20  ? 33   LYS A NZ   1 
ATOM   423   H  H    . LYS A 1 33  ? 69.646  36.506 20.299  1.00 16.84  ? 33   LYS A H    1 
ATOM   424   H  HA   . LYS A 1 33  ? 69.326  38.839 19.127  1.00 18.01  ? 33   LYS A HA   1 
ATOM   425   H  HB2  . LYS A 1 33  ? 68.627  36.272 18.358  1.00 28.01  ? 33   LYS A HB2  1 
ATOM   426   H  HB3  . LYS A 1 33  ? 67.715  37.387 17.742  1.00 28.01  ? 33   LYS A HB3  1 
ATOM   427   H  HG2  . LYS A 1 33  ? 69.218  37.881 16.269  1.00 42.19  ? 33   LYS A HG2  1 
ATOM   428   H  HG3  . LYS A 1 33  ? 70.299  38.104 17.384  1.00 42.19  ? 33   LYS A HG3  1 
ATOM   429   H  HD2  . LYS A 1 33  ? 71.160  36.104 17.135  1.00 45.19  ? 33   LYS A HD2  1 
ATOM   430   H  HD3  . LYS A 1 33  ? 69.777  35.446 16.814  1.00 45.19  ? 33   LYS A HD3  1 
ATOM   431   H  HE2  . LYS A 1 33  ? 70.162  36.768 14.654  1.00 33.31  ? 33   LYS A HE2  1 
ATOM   432   H  HE3  . LYS A 1 33  ? 71.642  36.424 15.039  1.00 33.31  ? 33   LYS A HE3  1 
ATOM   433   H  HZ1  . LYS A 1 33  ? 70.795  34.794 13.698  1.00 48.30  ? 33   LYS A HZ1  1 
ATOM   434   H  HZ2  . LYS A 1 33  ? 69.704  34.527 14.620  1.00 48.30  ? 33   LYS A HZ2  1 
ATOM   435   H  HZ3  . LYS A 1 33  ? 71.069  34.201 14.997  1.00 48.30  ? 33   LYS A HZ3  1 
ATOM   436   N  N    . ALA A 1 34  ? 66.901  37.954 20.917  1.00 15.41  ? 34   ALA A N    1 
ATOM   437   C  CA   . ALA A 1 34  ? 65.612  38.360 21.468  1.00 14.25  ? 34   ALA A CA   1 
ATOM   438   C  C    . ALA A 1 34  ? 65.768  39.582 22.374  1.00 15.45  ? 34   ALA A C    1 
ATOM   439   O  O    . ALA A 1 34  ? 64.769  40.113 22.836  1.00 20.59  ? 34   ALA A O    1 
ATOM   440   C  CB   . ALA A 1 34  ? 64.994  37.157 22.159  1.00 15.25  ? 34   ALA A CB   1 
ATOM   441   H  H    . ALA A 1 34  ? 67.326  37.298 21.275  1.00 18.50  ? 34   ALA A H    1 
ATOM   442   H  HA   . ALA A 1 34  ? 65.029  38.611 20.721  1.00 17.10  ? 34   ALA A HA   1 
ATOM   443   H  HB1  . ALA A 1 34  ? 64.923  36.432 21.535  1.00 22.87  ? 34   ALA A HB1  1 
ATOM   444   H  HB2  . ALA A 1 34  ? 64.121  37.388 22.483  1.00 22.87  ? 34   ALA A HB2  1 
ATOM   445   H  HB3  . ALA A 1 34  ? 65.549  36.892 22.896  1.00 22.87  ? 34   ALA A HB3  1 
ATOM   446   N  N    . GLY A 1 35  ? 67.002  40.024 22.613  1.00 14.30  ? 35   GLY A N    1 
ATOM   447   C  CA   . GLY A 1 35  ? 67.241  41.213 23.402  1.00 19.60  ? 35   GLY A CA   1 
ATOM   448   C  C    . GLY A 1 35  ? 67.583  40.971 24.858  1.00 16.25  ? 35   GLY A C    1 
ATOM   449   O  O    . GLY A 1 35  ? 67.498  41.879 25.694  1.00 19.09  ? 35   GLY A O    1 
ATOM   450   H  H    . GLY A 1 35  ? 67.672  39.592 22.291  1.00 17.15  ? 35   GLY A H    1 
ATOM   451   H  HA2  . GLY A 1 35  ? 67.969  41.709 22.995  1.00 23.52  ? 35   GLY A HA2  1 
ATOM   452   H  HA3  . GLY A 1 35  ? 66.450  41.772 23.362  1.00 23.52  ? 35   GLY A HA3  1 
ATOM   453   N  N    . LEU A 1 36  ? 67.956  39.759 25.216  1.00 14.45  ? 36   LEU A N    1 
ATOM   454   C  CA   . LEU A 1 36  ? 68.178  39.410 26.614  1.00 15.96  ? 36   LEU A CA   1 
ATOM   455   C  C    . LEU A 1 36  ? 69.129  40.341 27.349  1.00 18.38  ? 36   LEU A C    1 
ATOM   456   O  O    . LEU A 1 36  ? 68.802  40.825 28.442  1.00 16.16  ? 36   LEU A O    1 
ATOM   457   C  CB   . LEU A 1 36  ? 68.701  37.984 26.768  1.00 16.10  ? 36   LEU A CB   1 
ATOM   458   C  CG   . LEU A 1 36  ? 68.982  37.546 28.213  1.00 15.64  ? 36   LEU A CG   1 
ATOM   459   C  CD1  . LEU A 1 36  ? 67.699  37.536 29.046  1.00 13.32  ? 36   LEU A CD1  1 
ATOM   460   C  CD2  . LEU A 1 36  ? 69.662  36.182 28.224  1.00 17.06  ? 36   LEU A CD2  1 
ATOM   461   H  H    . LEU A 1 36  ? 68.072  39.159 24.610  1.00 17.34  ? 36   LEU A H    1 
ATOM   462   H  HA   . LEU A 1 36  ? 67.311  39.455 27.069  1.00 19.16  ? 36   LEU A HA   1 
ATOM   463   H  HB2  . LEU A 1 36  ? 68.053  37.374 26.382  1.00 19.32  ? 36   LEU A HB2  1 
ATOM   464   H  HB3  . LEU A 1 36  ? 69.521  37.900 26.257  1.00 19.32  ? 36   LEU A HB3  1 
ATOM   465   H  HG   . LEU A 1 36  ? 69.598  38.195 28.613  1.00 18.77  ? 36   LEU A HG   1 
ATOM   466   H  HD11 . LEU A 1 36  ? 67.299  38.408 29.027  1.00 19.97  ? 36   LEU A HD11 1 
ATOM   467   H  HD12 . LEU A 1 36  ? 67.908  37.299 29.952  1.00 19.97  ? 36   LEU A HD12 1 
ATOM   468   H  HD13 . LEU A 1 36  ? 67.086  36.895 28.681  1.00 19.97  ? 36   LEU A HD13 1 
ATOM   469   H  HD21 . LEU A 1 36  ? 70.462  36.219 27.695  1.00 25.59  ? 36   LEU A HD21 1 
ATOM   470   H  HD22 . LEU A 1 36  ? 69.066  35.525 27.856  1.00 25.59  ? 36   LEU A HD22 1 
ATOM   471   H  HD23 . LEU A 1 36  ? 69.885  35.943 29.126  1.00 25.59  ? 36   LEU A HD23 1 
ATOM   472   N  N    . LEU A 1 37  ? 70.313  40.630 26.821  1.00 18.64  ? 37   LEU A N    1 
ATOM   473   C  CA   . LEU A 1 37  ? 71.244  41.467 27.607  1.00 20.33  ? 37   LEU A CA   1 
ATOM   474   C  C    . LEU A 1 37  ? 70.704  42.882 27.737  1.00 16.97  ? 37   LEU A C    1 
ATOM   475   O  O    . LEU A 1 37  ? 70.809  43.525 28.772  1.00 21.54  ? 37   LEU A O    1 
ATOM   476   C  CB   . LEU A 1 37  ? 72.640  41.420 27.010  1.00 22.98  ? 37   LEU A CB   1 
ATOM   477   C  CG   . LEU A 1 37  ? 73.240  40.237 26.280  1.00 40.89  ? 37   LEU A CG   1 
ATOM   478   C  CD1  . LEU A 1 37  ? 74.777  40.319 26.332  1.00 34.76  ? 37   LEU A CD1  1 
ATOM   479   C  CD2  . LEU A 1 37  ? 72.814  38.880 26.809  1.00 28.11  ? 37   LEU A CD2  1 
ATOM   480   H  H    . LEU A 1 37  ? 70.533  40.338 26.043  1.00 22.37  ? 37   LEU A H    1 
ATOM   481   H  HA   . LEU A 1 37  ? 71.294  41.086 28.509  1.00 24.40  ? 37   LEU A HA   1 
ATOM   482   H  HB2  . LEU A 1 37  ? 72.693  42.168 26.396  1.00 27.58  ? 37   LEU A HB2  1 
ATOM   483   H  HB3  . LEU A 1 37  ? 73.248  41.621 27.738  1.00 27.58  ? 37   LEU A HB3  1 
ATOM   484   H  HG   . LEU A 1 37  ? 72.967  40.293 25.340  1.00 49.07  ? 37   LEU A HG   1 
ATOM   485   H  HD11 . LEU A 1 37  ? 75.064  41.163 25.977  1.00 52.14  ? 37   LEU A HD11 1 
ATOM   486   H  HD12 . LEU A 1 37  ? 75.153  39.607 25.809  1.00 52.14  ? 37   LEU A HD12 1 
ATOM   487   H  HD13 . LEU A 1 37  ? 75.071  40.237 27.242  1.00 52.14  ? 37   LEU A HD13 1 
ATOM   488   H  HD21 . LEU A 1 37  ? 73.199  38.189 26.265  1.00 42.16  ? 37   LEU A HD21 1 
ATOM   489   H  HD22 . LEU A 1 37  ? 71.857  38.813 26.784  1.00 42.16  ? 37   LEU A HD22 1 
ATOM   490   H  HD23 . LEU A 1 37  ? 73.118  38.780 27.714  1.00 42.16  ? 37   LEU A HD23 1 
ATOM   491   N  N    . GLU A 1 38  ? 70.115  43.441 26.671  1.00 18.03  ? 38   GLU A N    1 
ATOM   492   C  CA   . GLU A 1 38  ? 69.565  44.781 26.748  1.00 21.23  ? 38   GLU A CA   1 
ATOM   493   C  C    . GLU A 1 38  ? 68.430  44.898 27.757  1.00 25.41  ? 38   GLU A C    1 
ATOM   494   O  O    . GLU A 1 38  ? 68.316  45.863 28.539  1.00 19.78  ? 38   GLU A O    1 
ATOM   495   C  CB   . GLU A 1 38  ? 69.115  45.143 25.318  1.00 23.07  ? 38   GLU A CB   1 
ATOM   496   C  CG   . GLU A 1 38  ? 70.269  45.181 24.329  1.00 26.01  ? 38   GLU A CG   1 
ATOM   497   C  CD   . GLU A 1 38  ? 70.533  43.876 23.612  1.00 40.24  ? 38   GLU A CD   1 
ATOM   498   O  OE1  . GLU A 1 38  ? 70.664  43.856 22.369  1.00 56.84  ? 38   GLU A OE1  1 
ATOM   499   O  OE2  . GLU A 1 38  ? 70.623  42.845 24.299  1.00 33.09  ? 38   GLU A OE2  1 
ATOM   500   H  H    . GLU A 1 38  ? 70.063  43.001 25.934  1.00 21.63  ? 38   GLU A H    1 
ATOM   501   H  HA   . GLU A 1 38  ? 70.281  45.396 27.013  1.00 25.48  ? 38   GLU A HA   1 
ATOM   502   H  HB2  . GLU A 1 38  ? 68.462  44.492 25.017  1.00 27.68  ? 38   GLU A HB2  1 
ATOM   503   H  HB3  . GLU A 1 38  ? 68.683  46.011 25.333  1.00 27.68  ? 38   GLU A HB3  1 
ATOM   504   H  HG2  . GLU A 1 38  ? 70.086  45.866 23.666  1.00 31.21  ? 38   GLU A HG2  1 
ATOM   505   H  HG3  . GLU A 1 38  ? 71.074  45.441 24.803  1.00 31.21  ? 38   GLU A HG3  1 
ATOM   506   N  N    . LYS A 1 39  ? 67.558  43.885 27.756  1.00 19.03  ? 39   LYS A N    1 
ATOM   507   C  CA   . LYS A 1 39  ? 66.434  43.828 28.692  1.00 13.75  ? 39   LYS A CA   1 
ATOM   508   C  C    . LYS A 1 39  ? 66.952  43.731 30.116  1.00 16.58  ? 39   LYS A C    1 
ATOM   509   O  O    . LYS A 1 39  ? 66.363  44.344 31.027  1.00 18.34  ? 39   LYS A O    1 
ATOM   510   C  CB   . LYS A 1 39  ? 65.512  42.658 28.359  1.00 15.58  ? 39   LYS A CB   1 
ATOM   511   C  CG   . LYS A 1 39  ? 64.719  42.875 27.073  1.00 17.51  ? 39   LYS A CG   1 
ATOM   512   C  CD   . LYS A 1 39  ? 63.796  41.746 26.691  1.00 14.55  ? 39   LYS A CD   1 
ATOM   513   C  CE   . LYS A 1 39  ? 63.175  41.842 25.317  1.00 20.47  ? 39   LYS A CE   1 
ATOM   514   N  NZ   . LYS A 1 39  ? 63.005  40.511 24.663  1.00 40.39  ? 39   LYS A NZ   1 
ATOM   515   H  H    . LYS A 1 39  ? 67.660  43.247 27.188  1.00 22.84  ? 39   LYS A H    1 
ATOM   516   H  HA   . LYS A 1 39  ? 65.920  44.658 28.607  1.00 16.50  ? 39   LYS A HA   1 
ATOM   517   H  HB2  . LYS A 1 39  ? 66.044  41.852 28.271  1.00 18.70  ? 39   LYS A HB2  1 
ATOM   518   H  HB3  . LYS A 1 39  ? 64.892  42.525 29.093  1.00 18.70  ? 39   LYS A HB3  1 
ATOM   519   H  HG2  . LYS A 1 39  ? 64.193  43.684 27.168  1.00 21.01  ? 39   LYS A HG2  1 
ATOM   520   H  HG3  . LYS A 1 39  ? 65.346  43.018 26.346  1.00 21.01  ? 39   LYS A HG3  1 
ATOM   521   H  HD2  . LYS A 1 39  ? 64.292  40.914 26.744  1.00 17.46  ? 39   LYS A HD2  1 
ATOM   522   H  HD3  . LYS A 1 39  ? 63.082  41.701 27.346  1.00 17.46  ? 39   LYS A HD3  1 
ATOM   523   H  HE2  . LYS A 1 39  ? 62.308  42.271 25.392  1.00 24.56  ? 39   LYS A HE2  1 
ATOM   524   H  HE3  . LYS A 1 39  ? 63.735  42.401 24.756  1.00 24.56  ? 39   LYS A HE3  1 
ATOM   525   H  HZ1  . LYS A 1 39  ? 62.648  40.621 23.855  1.00 60.58  ? 39   LYS A HZ1  1 
ATOM   526   H  HZ2  . LYS A 1 39  ? 62.467  40.004 25.159  1.00 60.58  ? 39   LYS A HZ2  1 
ATOM   527   H  HZ3  . LYS A 1 39  ? 63.798  40.115 24.586  1.00 60.58  ? 39   LYS A HZ3  1 
ATOM   528   N  N    . LEU A 1 40  ? 68.041  43.015 30.367  1.00 14.47  ? 40   LEU A N    1 
ATOM   529   C  CA   . LEU A 1 40  ? 68.597  42.889 31.720  1.00 14.32  ? 40   LEU A CA   1 
ATOM   530   C  C    . LEU A 1 40  ? 69.112  44.269 32.131  1.00 15.90  ? 40   LEU A C    1 
ATOM   531   O  O    . LEU A 1 40  ? 68.908  44.679 33.278  1.00 16.56  ? 40   LEU A O    1 
ATOM   532   C  CB   . LEU A 1 40  ? 69.683  41.821 31.744  1.00 14.11  ? 40   LEU A CB   1 
ATOM   533   C  CG   . LEU A 1 40  ? 69.224  40.374 31.856  1.00 15.23  ? 40   LEU A CG   1 
ATOM   534   C  CD1  . LEU A 1 40  ? 70.419  39.438 31.595  1.00 15.70  ? 40   LEU A CD1  1 
ATOM   535   C  CD2  . LEU A 1 40  ? 68.621  40.101 33.231  1.00 17.38  ? 40   LEU A CD2  1 
ATOM   536   H  H    . LEU A 1 40  ? 68.433  42.612 29.716  1.00 17.36  ? 40   LEU A H    1 
ATOM   537   H  HA   . LEU A 1 40  ? 67.880  42.624 32.333  1.00 17.18  ? 40   LEU A HA   1 
ATOM   538   H  HB2  . LEU A 1 40  ? 70.208  41.908 30.934  1.00 16.94  ? 40   LEU A HB2  1 
ATOM   539   H  HB3  . LEU A 1 40  ? 70.272  42.009 32.492  1.00 16.94  ? 40   LEU A HB3  1 
ATOM   540   H  HG   . LEU A 1 40  ? 68.540  40.207 31.175  1.00 18.27  ? 40   LEU A HG   1 
ATOM   541   H  HD11 . LEU A 1 40  ? 70.133  38.525 31.668  1.00 23.55  ? 40   LEU A HD11 1 
ATOM   542   H  HD12 . LEU A 1 40  ? 71.108  39.610 32.241  1.00 23.55  ? 40   LEU A HD12 1 
ATOM   543   H  HD13 . LEU A 1 40  ? 70.762  39.596 30.712  1.00 23.55  ? 40   LEU A HD13 1 
ATOM   544   H  HD21 . LEU A 1 40  ? 68.342  39.184 33.282  1.00 26.07  ? 40   LEU A HD21 1 
ATOM   545   H  HD22 . LEU A 1 40  ? 67.863  40.674 33.367  1.00 26.07  ? 40   LEU A HD22 1 
ATOM   546   H  HD23 . LEU A 1 40  ? 69.278  40.274 33.909  1.00 26.07  ? 40   LEU A HD23 1 
ATOM   547   N  N    . LYS A 1 41  ? 69.735  44.963 31.185  1.00 19.20  ? 41   LYS A N    1 
ATOM   548   C  CA   . LYS A 1 41  ? 70.293  46.307 31.464  1.00 17.13  ? 41   LYS A CA   1 
ATOM   549   C  C    . LYS A 1 41  ? 69.186  47.299 31.770  1.00 16.87  ? 41   LYS A C    1 
ATOM   550   O  O    . LYS A 1 41  ? 69.393  48.198 32.609  1.00 23.20  ? 41   LYS A O    1 
ATOM   551   C  CB   . LYS A 1 41  ? 71.244  46.770 30.339  1.00 18.58  ? 41   LYS A CB   1 
ATOM   552   C  CG   . LYS A 1 41  ? 72.599  46.088 30.393  1.00 27.80  ? 41   LYS A CG   1 
ATOM   553   C  CD   . LYS A 1 41  ? 73.555  46.442 29.271  1.00 33.01  ? 41   LYS A CD   1 
ATOM   554   C  CE   . LYS A 1 41  ? 74.384  45.244 28.837  1.00 35.15  ? 41   LYS A CE   1 
ATOM   555   N  NZ   . LYS A 1 41  ? 75.280  45.517 27.685  1.00 36.17  ? 41   LYS A NZ   1 
ATOM   556   H  H    . LYS A 1 41  ? 69.817  44.626 30.398  1.00 23.05  ? 41   LYS A H    1 
ATOM   557   H  HA   . LYS A 1 41  ? 70.834  46.227 32.277  1.00 20.55  ? 41   LYS A HA   1 
ATOM   558   H  HB2  . LYS A 1 41  ? 70.831  46.585 29.481  1.00 22.30  ? 41   LYS A HB2  1 
ATOM   559   H  HB3  . LYS A 1 41  ? 71.370  47.729 30.407  1.00 22.30  ? 41   LYS A HB3  1 
ATOM   560   H  HG2  . LYS A 1 41  ? 73.021  46.313 31.237  1.00 33.36  ? 41   LYS A HG2  1 
ATOM   561   H  HG3  . LYS A 1 41  ? 72.459  45.128 30.385  1.00 33.36  ? 41   LYS A HG3  1 
ATOM   562   H  HD2  . LYS A 1 41  ? 73.049  46.773 28.512  1.00 39.61  ? 41   LYS A HD2  1 
ATOM   563   H  HD3  . LYS A 1 41  ? 74.148  47.151 29.566  1.00 39.61  ? 41   LYS A HD3  1 
ATOM   564   H  HE2  . LYS A 1 41  ? 74.922  44.948 29.588  1.00 42.18  ? 41   LYS A HE2  1 
ATOM   565   H  HE3  . LYS A 1 41  ? 73.785  44.518 28.601  1.00 42.18  ? 41   LYS A HE3  1 
ATOM   566   H  HZ1  . LYS A 1 41  ? 75.744  44.784 27.490  1.00 54.26  ? 41   LYS A HZ1  1 
ATOM   567   H  HZ2  . LYS A 1 41  ? 75.840  46.176 27.894  1.00 54.26  ? 41   LYS A HZ2  1 
ATOM   568   H  HZ3  . LYS A 1 41  ? 74.792  45.756 26.980  1.00 54.26  ? 41   LYS A HZ3  1 
ATOM   569   N  N    . GLU A 1 42  ? 68.009  47.174 31.180  1.00 16.97  ? 42   GLU A N    1 
ATOM   570   C  CA   . GLU A 1 42  ? 66.844  48.036 31.326  1.00 17.40  ? 42   GLU A CA   1 
ATOM   571   C  C    . GLU A 1 42  ? 66.236  47.939 32.720  1.00 16.46  ? 42   GLU A C    1 
ATOM   572   O  O    . GLU A 1 42  ? 65.571  48.859 33.200  1.00 24.68  ? 42   GLU A O    1 
ATOM   573   C  CB   . GLU A 1 42  ? 65.804  47.651 30.284  1.00 14.95  ? 42   GLU A CB   1 
ATOM   574   C  CG   . GLU A 1 42  ? 66.131  48.180 28.892  1.00 27.80  ? 42   GLU A CG   1 
ATOM   575   C  CD   . GLU A 1 42  ? 65.419  47.423 27.791  1.00 37.65  ? 42   GLU A CD   1 
ATOM   576   O  OE1  . GLU A 1 42  ? 64.174  47.309 27.860  1.00 47.00  ? 42   GLU A OE1  1 
ATOM   577   O  OE2  . GLU A 1 42  ? 66.090  46.925 26.859  1.00 44.68  ? 42   GLU A OE2  1 
ATOM   578   H  H    . GLU A 1 42  ? 67.922  46.505 30.647  1.00 20.36  ? 42   GLU A H    1 
ATOM   579   H  HA   . GLU A 1 42  ? 67.118  48.963 31.167  1.00 20.88  ? 42   GLU A HA   1 
ATOM   580   H  HB2  . GLU A 1 42  ? 65.738  46.684 30.247  1.00 17.94  ? 42   GLU A HB2  1 
ATOM   581   H  HB3  . GLU A 1 42  ? 64.940  47.996 30.559  1.00 17.94  ? 42   GLU A HB3  1 
ATOM   582   H  HG2  . GLU A 1 42  ? 65.881  49.116 28.844  1.00 33.36  ? 42   GLU A HG2  1 
ATOM   583   H  HG3  . GLU A 1 42  ? 67.088  48.120 28.748  1.00 33.36  ? 42   GLU A HG3  1 
ATOM   584   N  N    . GLN A 1 43  ? 66.486  46.801 33.332  1.00 14.69  ? 43   GLN A N    1 
ATOM   585   C  CA   . GLN A 1 43  ? 66.186  46.343 34.661  1.00 25.40  ? 43   GLN A CA   1 
ATOM   586   C  C    . GLN A 1 43  ? 67.231  46.794 35.646  1.00 21.37  ? 43   GLN A C    1 
ATOM   587   O  O    . GLN A 1 43  ? 68.054  47.685 35.413  1.00 30.77  ? 43   GLN A O    1 
ATOM   588   C  CB   . GLN A 1 43  ? 66.204  44.799 34.713  1.00 43.26  ? 43   GLN A CB   1 
ATOM   589   C  CG   . GLN A 1 43  ? 64.938  44.163 35.219  1.00 39.17  ? 43   GLN A CG   1 
ATOM   590   C  CD   . GLN A 1 43  ? 64.892  42.748 34.615  1.00 16.22  ? 43   GLN A CD   1 
ATOM   591   O  OE1  . GLN A 1 43  ? 64.243  42.609 33.608  1.00 16.11  ? 43   GLN A OE1  1 
ATOM   592   N  NE2  . GLN A 1 43  ? 65.552  41.826 35.292  1.00 13.04  ? 43   GLN A NE2  1 
ATOM   593   H  H    . GLN A 1 43  ? 66.905  46.226 32.848  1.00 17.63  ? 43   GLN A H    1 
ATOM   594   H  HA   . GLN A 1 43  ? 65.306  46.674 34.936  1.00 30.47  ? 43   GLN A HA   1 
ATOM   595   H  HB2  . GLN A 1 43  ? 66.382  44.463 33.820  1.00 51.91  ? 43   GLN A HB2  1 
ATOM   596   H  HB3  . GLN A 1 43  ? 66.938  44.519 35.281  1.00 51.91  ? 43   GLN A HB3  1 
ATOM   597   H  HG2  . GLN A 1 43  ? 64.945  44.118 36.188  1.00 47.00  ? 43   GLN A HG2  1 
ATOM   598   H  HG3  . GLN A 1 43  ? 64.164  44.677 34.938  1.00 47.00  ? 43   GLN A HG3  1 
ATOM   599   H  HE21 . GLN A 1 43  ? 65.549  41.009 35.022  1.00 15.65  ? 43   GLN A HE21 1 
ATOM   600   H  HE22 . GLN A 1 43  ? 65.985  42.042 36.003  1.00 15.65  ? 43   GLN A HE22 1 
ATOM   601   N  N    . GLU A 1 44  ? 67.321  46.153 36.819  1.00 21.22  ? 44   GLU A N    1 
ATOM   602   C  CA   . GLU A 1 44  ? 68.427  46.705 37.624  1.00 45.35  ? 44   GLU A CA   1 
ATOM   603   C  C    . GLU A 1 44  ? 69.857  46.441 37.205  1.00 36.31  ? 44   GLU A C    1 
ATOM   604   O  O    . GLU A 1 44  ? 70.705  46.764 38.065  1.00 25.39  ? 44   GLU A O    1 
ATOM   605   C  CB   . GLU A 1 44  ? 68.242  46.135 39.052  1.00 54.95  ? 44   GLU A CB   1 
ATOM   606   C  CG   . GLU A 1 44  ? 68.041  44.623 39.075  1.00 37.69  ? 44   GLU A CG   1 
ATOM   607   C  CD   . GLU A 1 44  ? 68.512  44.009 40.369  1.00 24.83  ? 44   GLU A CD   1 
ATOM   608   O  OE1  . GLU A 1 44  ? 69.147  42.933 40.348  1.00 24.07  ? 44   GLU A OE1  1 
ATOM   609   O  OE2  . GLU A 1 44  ? 68.260  44.589 41.446  1.00 54.01  ? 44   GLU A OE2  1 
ATOM   610   H  H    . GLU A 1 44  ? 66.806  45.511 37.068  1.00 25.47  ? 44   GLU A H    1 
ATOM   611   H  HA   . GLU A 1 44  ? 68.304  47.676 37.673  1.00 54.41  ? 44   GLU A HA   1 
ATOM   612   H  HB2  . GLU A 1 44  ? 69.024  46.356 39.583  1.00 65.95  ? 44   GLU A HB2  1 
ATOM   613   H  HB3  . GLU A 1 44  ? 67.475  46.561 39.465  1.00 65.95  ? 44   GLU A HB3  1 
ATOM   614   H  HG2  . GLU A 1 44  ? 67.099  44.425 38.952  1.00 45.23  ? 44   GLU A HG2  1 
ATOM   615   H  HG3  . GLU A 1 44  ? 68.528  44.225 38.337  1.00 45.23  ? 44   GLU A HG3  1 
ATOM   616   N  N    . CYS A 1 45  ? 70.302  45.890 36.075  1.00 19.13  ? 45   CYS A N    1 
ATOM   617   C  CA   . CYS A 1 45  ? 71.430  44.992 36.125  1.00 18.32  ? 45   CYS A CA   1 
ATOM   618   C  C    . CYS A 1 45  ? 72.748  45.410 35.482  1.00 16.19  ? 45   CYS A C    1 
ATOM   619   O  O    . CYS A 1 45  ? 72.800  46.078 34.464  1.00 21.99  ? 45   CYS A O    1 
ATOM   620   C  CB   . CYS A 1 45  ? 71.036  43.661 35.428  1.00 19.27  ? 45   CYS A CB   1 
ATOM   621   S  SG   . CYS A 1 45  ? 69.558  42.870 36.124  1.00 19.73  ? 45   CYS A SG   1 
ATOM   622   H  H    . CYS A 1 45  ? 69.920  46.067 35.325  1.00 22.95  ? 45   CYS A H    1 
ATOM   623   H  HA   . CYS A 1 45  ? 71.609  44.792 37.068  1.00 21.99  ? 45   CYS A HA   1 
ATOM   624   H  HB2  . CYS A 1 45  ? 70.881  43.836 34.486  1.00 23.12  ? 45   CYS A HB2  1 
ATOM   625   H  HB3  . CYS A 1 45  ? 71.781  43.043 35.493  1.00 23.12  ? 45   CYS A HB3  1 
ATOM   626   N  N    . ASP A 1 46  ? 73.818  44.937 36.118  1.00 17.63  ? 46   ASP A N    1 
ATOM   627   C  CA   . ASP A 1 46  ? 75.216  45.092 35.740  1.00 17.39  ? 46   ASP A CA   1 
ATOM   628   C  C    . ASP A 1 46  ? 75.637  43.787 35.068  1.00 18.11  ? 46   ASP A C    1 
ATOM   629   O  O    . ASP A 1 46  ? 75.970  42.845 35.784  1.00 18.44  ? 46   ASP A O    1 
ATOM   630   C  CB   . ASP A 1 46  ? 76.042  45.442 36.983  1.00 22.69  ? 46   ASP A CB   1 
ATOM   631   C  CG   . ASP A 1 46  ? 75.432  46.656 37.673  1.00 45.34  ? 46   ASP A CG   1 
ATOM   632   O  OD1  . ASP A 1 46  ? 75.783  47.793 37.269  1.00 50.56  ? 46   ASP A OD1  1 
ATOM   633   O  OD2  . ASP A 1 46  ? 74.608  46.459 38.588  1.00 73.76  ? 46   ASP A OD2  1 
ATOM   634   H  H    . ASP A 1 46  ? 73.665  44.487 36.835  1.00 21.15  ? 46   ASP A H    1 
ATOM   635   H  HA   . ASP A 1 46  ? 75.291  45.823 35.092  1.00 20.86  ? 46   ASP A HA   1 
ATOM   636   H  HB2  . ASP A 1 46  ? 76.052  44.688 37.593  1.00 27.22  ? 46   ASP A HB2  1 
ATOM   637   H  HB3  . ASP A 1 46  ? 76.957  45.636 36.725  1.00 27.22  ? 46   ASP A HB3  1 
ATOM   638   N  N    . VAL A 1 47  ? 75.599  43.810 33.756  1.00 17.19  ? 47   VAL A N    1 
ATOM   639   C  CA   . VAL A 1 47  ? 75.846  42.686 32.894  1.00 15.90  ? 47   VAL A CA   1 
ATOM   640   C  C    . VAL A 1 47  ? 77.176  42.704 32.133  1.00 22.46  ? 47   VAL A C    1 
ATOM   641   O  O    . VAL A 1 47  ? 77.532  43.581 31.353  1.00 26.30  ? 47   VAL A O    1 
ATOM   642   C  CB   . VAL A 1 47  ? 74.736  42.601 31.827  1.00 20.79  ? 47   VAL A CB   1 
ATOM   643   C  CG1  . VAL A 1 47  ? 74.820  41.278 31.073  1.00 26.02  ? 47   VAL A CG1  1 
ATOM   644   C  CG2  . VAL A 1 47  ? 73.361  42.747 32.461  1.00 20.35  ? 47   VAL A CG2  1 
ATOM   645   H  H    . VAL A 1 47  ? 75.412  44.561 33.380  1.00 20.62  ? 47   VAL A H    1 
ATOM   646   H  HA   . VAL A 1 47  ? 75.814  41.870 33.436  1.00 19.08  ? 47   VAL A HA   1 
ATOM   647   H  HB   . VAL A 1 47  ? 74.863  43.332 31.188  1.00 24.94  ? 47   VAL A HB   1 
ATOM   648   H  HG11 . VAL A 1 47  ? 75.698  41.180 30.697  1.00 39.03  ? 47   VAL A HG11 1 
ATOM   649   H  HG12 . VAL A 1 47  ? 74.167  41.270 30.369  1.00 39.03  ? 47   VAL A HG12 1 
ATOM   650   H  HG13 . VAL A 1 47  ? 74.647  40.553 31.679  1.00 39.03  ? 47   VAL A HG13 1 
ATOM   651   H  HG21 . VAL A 1 47  ? 73.300  43.598 32.901  1.00 30.52  ? 47   VAL A HG21 1 
ATOM   652   H  HG22 . VAL A 1 47  ? 73.228  42.045 33.102  1.00 30.52  ? 47   VAL A HG22 1 
ATOM   653   H  HG23 . VAL A 1 47  ? 72.687  42.691 31.780  1.00 30.52  ? 47   VAL A HG23 1 
ATOM   654   N  N    . LYS A 1 48  ? 77.918  41.626 32.339  1.00 19.26  ? 48   LYS A N    1 
ATOM   655   C  CA   . LYS A 1 48  ? 79.160  41.407 31.582  1.00 23.15  ? 48   LYS A CA   1 
ATOM   656   C  C    . LYS A 1 48  ? 79.001  40.135 30.771  1.00 25.13  ? 48   LYS A C    1 
ATOM   657   O  O    . LYS A 1 48  ? 78.679  39.028 31.246  1.00 16.26  ? 48   LYS A O    1 
ATOM   658   C  CB   . LYS A 1 48  ? 80.318  41.458 32.576  1.00 25.30  ? 48   LYS A CB   1 
ATOM   659   C  CG   . LYS A 1 48  ? 80.198  42.677 33.482  1.00 38.56  ? 48   LYS A CG   1 
ATOM   660   C  CD   . LYS A 1 48  ? 80.284  44.006 32.758  1.00 45.38  ? 48   LYS A CD   1 
ATOM   661   C  CE   . LYS A 1 48  ? 79.625  45.126 33.536  1.00 39.46  ? 48   LYS A CE   1 
ATOM   662   N  NZ   . LYS A 1 48  ? 80.602  45.963 34.281  0.39 41.68  ? 48   LYS A NZ   1 
ATOM   663   H  H    . LYS A 1 48  ? 77.670  41.046 32.924  1.00 23.12  ? 48   LYS A H    1 
ATOM   664   H  HA   . LYS A 1 48  ? 79.267  42.153 30.956  1.00 27.78  ? 48   LYS A HA   1 
ATOM   665   H  HB2  . LYS A 1 48  ? 80.317  40.652 33.116  1.00 30.37  ? 48   LYS A HB2  1 
ATOM   666   H  HB3  . LYS A 1 48  ? 81.158  41.495 32.092  1.00 30.37  ? 48   LYS A HB3  1 
ATOM   667   H  HG2  . LYS A 1 48  ? 79.351  42.633 33.951  1.00 46.27  ? 48   LYS A HG2  1 
ATOM   668   H  HG3  . LYS A 1 48  ? 80.904  42.639 34.147  1.00 46.27  ? 48   LYS A HG3  1 
ATOM   669   H  HD2  . LYS A 1 48  ? 81.216  44.228 32.608  1.00 54.45  ? 48   LYS A HD2  1 
ATOM   670   H  HD3  . LYS A 1 48  ? 79.855  43.925 31.892  1.00 54.45  ? 48   LYS A HD3  1 
ATOM   671   H  HE2  . LYS A 1 48  ? 79.131  45.690 32.921  1.00 47.35  ? 48   LYS A HE2  1 
ATOM   672   H  HE3  . LYS A 1 48  ? 78.992  44.745 34.164  1.00 47.35  ? 48   LYS A HE3  1 
ATOM   673   H  HZ1  . LYS A 1 48  ? 80.170  46.613 34.709  0.39 62.52  ? 48   LYS A HZ1  1 
ATOM   674   H  HZ2  . LYS A 1 48  ? 81.184  46.320 33.709  0.39 62.52  ? 48   LYS A HZ2  1 
ATOM   675   H  HZ3  . LYS A 1 48  ? 81.037  45.457 34.870  0.39 62.52  ? 48   LYS A HZ3  1 
ATOM   676   N  N    . ASP A 1 49  ? 79.153  40.302 29.455  1.00 22.78  ? 49   ASP A N    1 
ATOM   677   C  CA   . ASP A 1 49  ? 79.139  39.183 28.524  1.00 14.56  ? 49   ASP A CA   1 
ATOM   678   C  C    . ASP A 1 49  ? 80.517  38.558 28.396  1.00 17.69  ? 49   ASP A C    1 
ATOM   679   O  O    . ASP A 1 49  ? 81.483  39.199 27.957  1.00 30.83  ? 49   ASP A O    1 
ATOM   680   C  CB   . ASP A 1 49  ? 78.612  39.633 27.158  1.00 22.59  ? 49   ASP A CB   1 
ATOM   681   C  CG   . ASP A 1 49  ? 78.030  38.467 26.391  1.00 30.79  ? 49   ASP A CG   1 
ATOM   682   O  OD1  . ASP A 1 49  ? 78.617  37.388 26.568  1.00 19.49  ? 49   ASP A OD1  1 
ATOM   683   O  OD2  . ASP A 1 49  ? 77.035  38.589 25.652  1.00 43.79  ? 49   ASP A OD2  1 
ATOM   684   H  H    . ASP A 1 49  ? 79.264  41.097 29.147  1.00 27.33  ? 49   ASP A H    1 
ATOM   685   H  HA   . ASP A 1 49  ? 78.528  38.502 28.876  1.00 17.47  ? 49   ASP A HA   1 
ATOM   686   H  HB2  . ASP A 1 49  ? 77.928  40.310 27.283  1.00 27.11  ? 49   ASP A HB2  1 
ATOM   687   H  HB3  . ASP A 1 49  ? 79.335  40.028 26.647  1.00 27.11  ? 49   ASP A HB3  1 
ATOM   688   N  N    . TYR A 1 50  ? 80.692  37.313 28.788  1.00 15.38  ? 50   TYR A N    1 
ATOM   689   C  CA   . TYR A 1 50  ? 81.920  36.551 28.718  1.00 16.61  ? 50   TYR A CA   1 
ATOM   690   C  C    . TYR A 1 50  ? 82.015  35.787 27.391  1.00 19.92  ? 50   TYR A C    1 
ATOM   691   O  O    . TYR A 1 50  ? 82.951  35.019 27.173  1.00 19.06  ? 50   TYR A O    1 
ATOM   692   C  CB   . TYR A 1 50  ? 82.047  35.585 29.889  1.00 15.77  ? 50   TYR A CB   1 
ATOM   693   C  CG   . TYR A 1 50  ? 82.376  36.246 31.201  1.00 19.87  ? 50   TYR A CG   1 
ATOM   694   C  CD1  . TYR A 1 50  ? 81.383  36.918 31.909  1.00 17.45  ? 50   TYR A CD1  1 
ATOM   695   C  CD2  . TYR A 1 50  ? 83.658  36.222 31.726  1.00 21.64  ? 50   TYR A CD2  1 
ATOM   696   C  CE1  . TYR A 1 50  ? 81.678  37.538 33.120  1.00 16.97  ? 50   TYR A CE1  1 
ATOM   697   C  CE2  . TYR A 1 50  ? 83.955  36.835 32.930  1.00 23.39  ? 50   TYR A CE2  1 
ATOM   698   C  CZ   . TYR A 1 50  ? 82.949  37.496 33.622  1.00 16.89  ? 50   TYR A CZ   1 
ATOM   699   O  OH   . TYR A 1 50  ? 83.255  38.101 34.825  1.00 20.54  ? 50   TYR A OH   1 
ATOM   700   H  H    . TYR A 1 50  ? 80.007  36.912 29.120  1.00 18.46  ? 50   TYR A H    1 
ATOM   701   H  HA   . TYR A 1 50  ? 82.671  37.180 28.760  1.00 19.93  ? 50   TYR A HA   1 
ATOM   702   H  HB2  . TYR A 1 50  ? 81.211  35.102 29.984  1.00 18.93  ? 50   TYR A HB2  1 
ATOM   703   H  HB3  . TYR A 1 50  ? 82.739  34.938 29.684  1.00 18.93  ? 50   TYR A HB3  1 
ATOM   704   H  HD1  . TYR A 1 50  ? 80.518  36.954 31.571  1.00 20.95  ? 50   TYR A HD1  1 
ATOM   705   H  HD2  . TYR A 1 50  ? 84.333  35.784 31.259  1.00 25.97  ? 50   TYR A HD2  1 
ATOM   706   H  HE1  . TYR A 1 50  ? 81.008  37.982 33.589  1.00 20.36  ? 50   TYR A HE1  1 
ATOM   707   H  HE2  . TYR A 1 50  ? 84.819  36.804 33.272  1.00 28.07  ? 50   TYR A HE2  1 
ATOM   708   H  HH   . TYR A 1 50  ? 84.053  38.000 34.987  1.00 30.82  ? 50   TYR A HH   1 
ATOM   709   N  N    . GLY A 1 51  ? 81.055  35.984 26.520  1.00 17.54  ? 51   GLY A N    1 
ATOM   710   C  CA   . GLY A 1 51  ? 80.954  35.432 25.178  1.00 18.78  ? 51   GLY A CA   1 
ATOM   711   C  C    . GLY A 1 51  ? 80.454  34.010 25.109  1.00 18.81  ? 51   GLY A C    1 
ATOM   712   O  O    . GLY A 1 51  ? 79.987  33.375 26.071  1.00 19.29  ? 51   GLY A O    1 
ATOM   713   H  H    . GLY A 1 51  ? 80.412  36.497 26.771  1.00 21.05  ? 51   GLY A H    1 
ATOM   714   H  HA2  . GLY A 1 51  ? 80.358  35.993 24.658  1.00 22.54  ? 51   GLY A HA2  1 
ATOM   715   H  HA3  . GLY A 1 51  ? 81.829  35.471 24.762  1.00 22.54  ? 51   GLY A HA3  1 
ATOM   716   N  N    . ASP A 1 52  ? 80.570  33.479 23.896  1.00 17.80  ? 52   ASP A N    1 
ATOM   717   C  CA   . ASP A 1 52  ? 80.172  32.097 23.662  1.00 20.68  ? 52   ASP A CA   1 
ATOM   718   C  C    . ASP A 1 52  ? 81.423  31.228 23.720  1.00 26.26  ? 52   ASP A C    1 
ATOM   719   O  O    . ASP A 1 52  ? 82.471  31.482 23.107  1.00 20.60  ? 52   ASP A O    1 
ATOM   720   C  CB   . ASP A 1 52  ? 79.413  31.973 22.346  1.00 17.53  ? 52   ASP A CB   1 
ATOM   721   C  CG   . ASP A 1 52  ? 78.114  32.724 22.291  1.00 26.36  ? 52   ASP A CG   1 
ATOM   722   O  OD1  . ASP A 1 52  ? 77.503  32.951 23.359  1.00 24.53  ? 52   ASP A OD1  1 
ATOM   723   O  OD2  . ASP A 1 52  ? 77.708  33.085 21.159  1.00 33.81  ? 52   ASP A OD2  1 
ATOM   724   H  H    . ASP A 1 52  ? 80.881  33.952 23.248  1.00 21.36  ? 52   ASP A H    1 
ATOM   725   H  HA   . ASP A 1 52  ? 79.574  31.823 24.388  1.00 24.82  ? 52   ASP A HA   1 
ATOM   726   H  HB2  . ASP A 1 52  ? 79.984  32.292 21.629  1.00 21.03  ? 52   ASP A HB2  1 
ATOM   727   H  HB3  . ASP A 1 52  ? 79.234  31.035 22.180  1.00 21.03  ? 52   ASP A HB3  1 
ATOM   728   N  N    . LEU A 1 53  ? 81.381  30.155 24.502  1.00 16.69  ? 53   LEU A N    1 
ATOM   729   C  CA   . LEU A 1 53  ? 82.487  29.208 24.517  1.00 15.01  ? 53   LEU A CA   1 
ATOM   730   C  C    . LEU A 1 53  ? 82.643  28.490 23.184  1.00 15.98  ? 53   LEU A C    1 
ATOM   731   O  O    . LEU A 1 53  ? 81.636  28.008 22.642  1.00 19.42  ? 53   LEU A O    1 
ATOM   732   C  CB   . LEU A 1 53  ? 82.313  28.141 25.591  1.00 15.55  ? 53   LEU A CB   1 
ATOM   733   C  CG   . LEU A 1 53  ? 82.129  28.672 27.020  1.00 17.97  ? 53   LEU A CG   1 
ATOM   734   C  CD1  . LEU A 1 53  ? 82.022  27.476 27.947  1.00 21.47  ? 53   LEU A CD1  1 
ATOM   735   C  CD2  . LEU A 1 53  ? 83.245  29.632 27.342  1.00 30.81  ? 53   LEU A CD2  1 
ATOM   736   H  H    . LEU A 1 53  ? 80.696  30.019 25.004  1.00 20.03  ? 53   LEU A H    1 
ATOM   737   H  HA   . LEU A 1 53  ? 83.314  29.701 24.702  1.00 18.01  ? 53   LEU A HA   1 
ATOM   738   H  HB2  . LEU A 1 53  ? 81.541  27.599 25.363  1.00 18.67  ? 53   LEU A HB2  1 
ATOM   739   H  HB3  . LEU A 1 53  ? 83.090  27.561 25.577  1.00 18.67  ? 53   LEU A HB3  1 
ATOM   740   H  HG   . LEU A 1 53  ? 81.282  29.164 27.057  1.00 21.56  ? 53   LEU A HG   1 
ATOM   741   H  HD11 . LEU A 1 53  ? 81.280  26.929 27.680  1.00 32.20  ? 53   LEU A HD11 1 
ATOM   742   H  HD12 . LEU A 1 53  ? 81.888  27.780 28.848  1.00 32.20  ? 53   LEU A HD12 1 
ATOM   743   H  HD13 . LEU A 1 53  ? 82.832  26.961 27.901  1.00 32.20  ? 53   LEU A HD13 1 
ATOM   744   H  HD21 . LEU A 1 53  ? 83.250  30.344 26.698  1.00 46.21  ? 53   LEU A HD21 1 
ATOM   745   H  HD22 . LEU A 1 53  ? 84.085  29.168 27.312  1.00 46.21  ? 53   LEU A HD22 1 
ATOM   746   H  HD23 . LEU A 1 53  ? 83.111  29.996 28.220  1.00 46.21  ? 53   LEU A HD23 1 
ATOM   747   N  N    . PRO A 1 54  ? 83.893  28.457 22.738  1.00 17.87  ? 54   PRO A N    1 
ATOM   748   C  CA   . PRO A 1 54  ? 84.242  27.662 21.563  1.00 19.87  ? 54   PRO A CA   1 
ATOM   749   C  C    . PRO A 1 54  ? 84.578  26.232 21.962  1.00 10.86  ? 54   PRO A C    1 
ATOM   750   O  O    . PRO A 1 54  ? 85.597  25.911 22.553  1.00 20.71  ? 54   PRO A O    1 
ATOM   751   C  CB   . PRO A 1 54  ? 85.520  28.327 21.063  1.00 28.13  ? 54   PRO A CB   1 
ATOM   752   C  CG   . PRO A 1 54  ? 86.168  28.857 22.298  1.00 25.63  ? 54   PRO A CG   1 
ATOM   753   C  CD   . PRO A 1 54  ? 85.073  29.124 23.304  1.00 24.44  ? 54   PRO A CD   1 
ATOM   754   H  HA   . PRO A 1 54  ? 83.533  27.689 20.887  1.00 23.85  ? 54   PRO A HA   1 
ATOM   755   H  HB2  . PRO A 1 54  ? 86.095  27.683 20.620  1.00 33.75  ? 54   PRO A HB2  1 
ATOM   756   H  HB3  . PRO A 1 54  ? 85.317  29.045 20.444  1.00 33.75  ? 54   PRO A HB3  1 
ATOM   757   H  HG2  . PRO A 1 54  ? 86.797  28.208 22.652  1.00 30.75  ? 54   PRO A HG2  1 
ATOM   758   H  HG3  . PRO A 1 54  ? 86.649  29.676 22.100  1.00 30.75  ? 54   PRO A HG3  1 
ATOM   759   H  HD2  . PRO A 1 54  ? 85.300  28.751 24.170  1.00 29.33  ? 54   PRO A HD2  1 
ATOM   760   H  HD3  . PRO A 1 54  ? 84.919  30.077 23.402  1.00 29.33  ? 54   PRO A HD3  1 
ATOM   761   N  N    . PHE A 1 55  ? 83.686  25.318 21.601  1.00 18.93  ? 55   PHE A N    1 
ATOM   762   C  CA   . PHE A 1 55  ? 83.809  23.909 21.915  1.00 16.57  ? 55   PHE A CA   1 
ATOM   763   C  C    . PHE A 1 55  ? 84.498  23.246 20.723  1.00 26.20  ? 55   PHE A C    1 
ATOM   764   O  O    . PHE A 1 55  ? 83.975  23.307 19.612  1.00 24.79  ? 55   PHE A O    1 
ATOM   765   C  CB   . PHE A 1 55  ? 82.444  23.291 22.189  1.00 15.08  ? 55   PHE A CB   1 
ATOM   766   C  CG   . PHE A 1 55  ? 81.778  23.860 23.416  1.00 16.74  ? 55   PHE A CG   1 
ATOM   767   C  CD1  . PHE A 1 55  ? 82.340  23.662 24.653  1.00 17.75  ? 55   PHE A CD1  1 
ATOM   768   C  CD2  . PHE A 1 55  ? 80.596  24.598 23.319  1.00 16.32  ? 55   PHE A CD2  1 
ATOM   769   C  CE1  . PHE A 1 55  ? 81.793  24.168 25.822  1.00 21.30  ? 55   PHE A CE1  1 
ATOM   770   C  CE2  . PHE A 1 55  ? 80.025  25.082 24.490  1.00 16.79  ? 55   PHE A CE2  1 
ATOM   771   C  CZ   . PHE A 1 55  ? 80.598  24.862 25.726  1.00 14.87  ? 55   PHE A CZ   1 
ATOM   772   H  H    . PHE A 1 55  ? 82.997  25.576 21.156  1.00 22.72  ? 55   PHE A H    1 
ATOM   773   H  HA   . PHE A 1 55  ? 84.373  23.806 22.710  1.00 19.89  ? 55   PHE A HA   1 
ATOM   774   H  HB2  . PHE A 1 55  ? 81.870  23.439 21.421  1.00 18.09  ? 55   PHE A HB2  1 
ATOM   775   H  HB3  . PHE A 1 55  ? 82.548  22.333 22.302  1.00 18.09  ? 55   PHE A HB3  1 
ATOM   776   H  HD1  . PHE A 1 55  ? 83.125  23.166 24.708  1.00 21.30  ? 55   PHE A HD1  1 
ATOM   777   H  HD2  . PHE A 1 55  ? 80.202  24.762 22.492  1.00 19.58  ? 55   PHE A HD2  1 
ATOM   778   H  HE1  . PHE A 1 55  ? 82.214  24.046 26.643  1.00 25.56  ? 55   PHE A HE1  1 
ATOM   779   H  HE2  . PHE A 1 55  ? 79.234  25.568 24.439  1.00 20.15  ? 55   PHE A HE2  1 
ATOM   780   H  HZ   . PHE A 1 55  ? 80.181  25.179 26.494  1.00 17.85  ? 55   PHE A HZ   1 
ATOM   781   N  N    . ALA A 1 56  ? 85.674  22.635 20.886  1.00 26.69  ? 56   ALA A N    1 
ATOM   782   C  CA   . ALA A 1 56  ? 86.248  22.157 19.613  1.00 31.42  ? 56   ALA A CA   1 
ATOM   783   C  C    . ALA A 1 56  ? 85.703  20.761 19.305  1.00 22.37  ? 56   ALA A C    1 
ATOM   784   O  O    . ALA A 1 56  ? 85.318  20.032 20.210  1.00 20.29  ? 56   ALA A O    1 
ATOM   785   C  CB   . ALA A 1 56  ? 87.764  22.195 19.611  1.00 28.34  ? 56   ALA A CB   1 
ATOM   786   H  H    . ALA A 1 56  ? 86.055  22.531 21.650  1.00 32.03  ? 56   ALA A H    1 
ATOM   787   H  HA   . ALA A 1 56  ? 85.936  22.758 18.904  1.00 37.71  ? 56   ALA A HA   1 
ATOM   788   H  HB1  . ALA A 1 56  ? 88.062  23.089 19.798  1.00 42.51  ? 56   ALA A HB1  1 
ATOM   789   H  HB2  . ALA A 1 56  ? 88.090  21.923 18.750  1.00 42.51  ? 56   ALA A HB2  1 
ATOM   790   H  HB3  . ALA A 1 56  ? 88.100  21.598 20.283  1.00 42.51  ? 56   ALA A HB3  1 
ATOM   791   N  N    . ASP A 1 57  ? 85.680  20.439 18.014  1.00 28.71  ? 57   ASP A N    1 
ATOM   792   C  CA   . ASP A 1 57  ? 85.231  19.123 17.593  1.00 16.79  ? 57   ASP A CA   1 
ATOM   793   C  C    . ASP A 1 57  ? 86.142  18.004 18.061  1.00 19.32  ? 57   ASP A C    1 
ATOM   794   O  O    . ASP A 1 57  ? 87.364  18.185 17.991  1.00 23.11  ? 57   ASP A O    1 
ATOM   795   C  CB   . ASP A 1 57  ? 85.111  19.100 16.051  1.00 18.21  ? 57   ASP A CB   1 
ATOM   796   C  CG   . ASP A 1 57  ? 84.069  18.061 15.665  1.00 31.63  ? 57   ASP A CG   1 
ATOM   797   O  OD1  . ASP A 1 57  ? 83.662  18.031 14.495  1.00 54.76  ? 57   ASP A OD1  1 
ATOM   798   O  OD2  . ASP A 1 57  ? 83.679  17.300 16.579  1.00 48.42  ? 57   ASP A OD2  1 
ATOM   799   H  H    . ASP A 1 57  ? 85.933  21.013 17.425  1.00 34.46  ? 57   ASP A H    1 
ATOM   800   H  HA   . ASP A 1 57  ? 84.340  18.969 17.971  1.00 20.15  ? 57   ASP A HA   1 
ATOM   801   H  HB2  . ASP A 1 57  ? 84.844  19.974 15.726  1.00 21.85  ? 57   ASP A HB2  1 
ATOM   802   H  HB3  . ASP A 1 57  ? 85.967  18.875 15.655  1.00 21.85  ? 57   ASP A HB3  1 
ATOM   803   N  N    . ILE A 1 58  ? 85.606  16.874 18.528  1.00 17.53  ? 58   ILE A N    1 
ATOM   804   C  CA   . ILE A 1 58  ? 86.395  15.681 18.821  1.00 15.06  ? 58   ILE A CA   1 
ATOM   805   C  C    . ILE A 1 58  ? 85.948  14.579 17.879  1.00 16.68  ? 58   ILE A C    1 
ATOM   806   O  O    . ILE A 1 58  ? 84.987  13.858 18.105  1.00 19.10  ? 58   ILE A O    1 
ATOM   807   C  CB   . ILE A 1 58  ? 86.293  15.209 20.270  1.00 16.36  ? 58   ILE A CB   1 
ATOM   808   C  CG1  . ILE A 1 58  ? 86.535  16.419 21.199  1.00 22.80  ? 58   ILE A CG1  1 
ATOM   809   C  CG2  . ILE A 1 58  ? 87.189  14.039 20.619  1.00 19.20  ? 58   ILE A CG2  1 
ATOM   810   C  CD1  . ILE A 1 58  ? 86.406  16.151 22.674  1.00 19.07  ? 58   ILE A CD1  1 
ATOM   811   H  H    . ILE A 1 58  ? 84.756  16.848 18.662  1.00 21.03  ? 58   ILE A H    1 
ATOM   812   H  HA   . ILE A 1 58  ? 87.335  15.883 18.631  1.00 18.07  ? 58   ILE A HA   1 
ATOM   813   H  HB   . ILE A 1 58  ? 85.369  14.916 20.413  1.00 19.63  ? 58   ILE A HB   1 
ATOM   814   H  HG12 . ILE A 1 58  ? 87.427  16.760 21.028  1.00 27.36  ? 58   ILE A HG12 1 
ATOM   815   H  HG13 . ILE A 1 58  ? 85.906  17.117 20.960  1.00 27.36  ? 58   ILE A HG13 1 
ATOM   816   H  HG21 . ILE A 1 58  ? 87.062  13.803 21.541  1.00 28.79  ? 58   ILE A HG21 1 
ATOM   817   H  HG22 . ILE A 1 58  ? 88.106  14.284 20.475  1.00 28.79  ? 58   ILE A HG22 1 
ATOM   818   H  HG23 . ILE A 1 58  ? 86.967  13.289 20.063  1.00 28.79  ? 58   ILE A HG23 1 
ATOM   819   H  HD11 . ILE A 1 58  ? 86.549  16.966 23.161  1.00 28.61  ? 58   ILE A HD11 1 
ATOM   820   H  HD12 . ILE A 1 58  ? 87.060  15.500 22.940  1.00 28.61  ? 58   ILE A HD12 1 
ATOM   821   H  HD13 . ILE A 1 58  ? 85.526  15.816 22.863  1.00 28.61  ? 58   ILE A HD13 1 
ATOM   822   N  N    . PRO A 1 59  ? 86.690  14.433 16.771  1.00 15.09  ? 59   PRO A N    1 
ATOM   823   C  CA   . PRO A 1 59  ? 86.296  13.428 15.779  1.00 13.21  ? 59   PRO A CA   1 
ATOM   824   C  C    . PRO A 1 59  ? 86.302  11.988 16.265  1.00 12.43  ? 59   PRO A C    1 
ATOM   825   O  O    . PRO A 1 59  ? 85.446  11.217 15.831  1.00 14.06  ? 59   PRO A O    1 
ATOM   826   C  CB   . PRO A 1 59  ? 87.421  13.589 14.745  1.00 17.84  ? 59   PRO A CB   1 
ATOM   827   C  CG   . PRO A 1 59  ? 87.855  15.012 14.881  1.00 28.30  ? 59   PRO A CG   1 
ATOM   828   C  CD   . PRO A 1 59  ? 87.858  15.246 16.382  1.00 21.25  ? 59   PRO A CD   1 
ATOM   829   H  HA   . PRO A 1 59  ? 85.429  13.655 15.383  1.00 15.86  ? 59   PRO A HA   1 
ATOM   830   H  HB2  . PRO A 1 59  ? 88.155  12.985 14.938  1.00 21.41  ? 59   PRO A HB2  1 
ATOM   831   H  HB3  . PRO A 1 59  ? 87.095  13.412 13.850  1.00 21.41  ? 59   PRO A HB3  1 
ATOM   832   H  HG2  . PRO A 1 59  ? 88.740  15.143 14.506  1.00 33.96  ? 59   PRO A HG2  1 
ATOM   833   H  HG3  . PRO A 1 59  ? 87.232  15.609 14.437  1.00 33.96  ? 59   PRO A HG3  1 
ATOM   834   H  HD2  . PRO A 1 59  ? 88.674  14.923 16.795  1.00 25.50  ? 59   PRO A HD2  1 
ATOM   835   H  HD3  . PRO A 1 59  ? 87.733  16.183 16.600  1.00 25.50  ? 59   PRO A HD3  1 
ATOM   836   N  N    . ASN A 1 60  ? 87.281  11.614 17.093  1.00 12.35  ? 60   ASN A N    1 
ATOM   837   C  CA   . ASN A 1 60  ? 87.333  10.251 17.630  1.00 12.29  ? 60   ASN A CA   1 
ATOM   838   C  C    . ASN A 1 60  ? 86.640  10.241 19.002  1.00 15.31  ? 60   ASN A C    1 
ATOM   839   O  O    . ASN A 1 60  ? 87.241  10.629 19.994  1.00 15.77  ? 60   ASN A O    1 
ATOM   840   C  CB   . ASN A 1 60  ? 88.772  9.726  17.679  1.00 12.81  ? 60   ASN A CB   1 
ATOM   841   C  CG   . ASN A 1 60  ? 89.276  9.492  16.235  1.00 16.14  ? 60   ASN A CG   1 
ATOM   842   O  OD1  . ASN A 1 60  ? 88.918  8.448  15.666  1.00 15.51  ? 60   ASN A OD1  1 
ATOM   843   N  ND2  . ASN A 1 60  ? 90.036  10.460 15.725  1.00 15.00  ? 60   ASN A ND2  1 
ATOM   844   H  H    . ASN A 1 60  ? 87.889  12.180 17.314  1.00 14.82  ? 60   ASN A H    1 
ATOM   845   H  HA   . ASN A 1 60  ? 86.821  9.670  17.029  1.00 14.74  ? 60   ASN A HA   1 
ATOM   846   H  HB2  . ASN A 1 60  ? 89.343  10.370 18.127  1.00 15.37  ? 60   ASN A HB2  1 
ATOM   847   H  HB3  . ASN A 1 60  ? 88.803  8.894  18.178  1.00 15.37  ? 60   ASN A HB3  1 
ATOM   848   H  HD21 . ASN A 1 60  ? 90.333  10.395 14.921  1.00 17.99  ? 60   ASN A HD21 1 
ATOM   849   H  HD22 . ASN A 1 60  ? 90.231  11.149 16.201  1.00 17.99  ? 60   ASN A HD22 1 
ATOM   850   N  N    . ASP A 1 61  ? 85.379  9.823  19.035  1.00 13.04  ? 61   ASP A N    1 
ATOM   851   C  CA   . ASP A 1 61  ? 84.565  9.855  20.274  1.00 11.61  ? 61   ASP A CA   1 
ATOM   852   C  C    . ASP A 1 61  ? 83.502  8.780  20.192  1.00 11.19  ? 61   ASP A C    1 
ATOM   853   O  O    . ASP A 1 61  ? 82.292  9.122  20.114  1.00 15.64  ? 61   ASP A O    1 
ATOM   854   C  CB   . ASP A 1 61  ? 83.972  11.220 20.489  1.00 11.41  ? 61   ASP A CB   1 
ATOM   855   C  CG   . ASP A 1 61  ? 83.456  11.465 21.925  1.00 11.86  ? 61   ASP A CG   1 
ATOM   856   O  OD1  . ASP A 1 61  ? 83.745  10.614 22.786  1.00 11.68  ? 61   ASP A OD1  1 
ATOM   857   O  OD2  . ASP A 1 61  ? 82.791  12.505 22.070  1.00 12.84  ? 61   ASP A OD2  1 
ATOM   858   H  H    . ASP A 1 61  ? 85.022  9.523  18.312  1.00 15.65  ? 61   ASP A H    1 
ATOM   859   H  HA   . ASP A 1 61  ? 85.151  9.651  21.033  1.00 13.93  ? 61   ASP A HA   1 
ATOM   860   H  HB2  . ASP A 1 61  ? 84.645  11.888 20.282  1.00 13.69  ? 61   ASP A HB2  1 
ATOM   861   H  HB3  . ASP A 1 61  ? 83.237  11.342 19.869  1.00 13.69  ? 61   ASP A HB3  1 
ATOM   862   N  N    . SER A 1 62  ? 83.907  7.523  20.170  1.00 13.61  ? 62   SER A N    1 
ATOM   863   C  CA   . SER A 1 62  ? 82.987  6.414  20.048  1.00 12.61  ? 62   SER A CA   1 
ATOM   864   C  C    . SER A 1 62  ? 82.326  6.172  21.412  1.00 13.20  ? 62   SER A C    1 
ATOM   865   O  O    . SER A 1 62  ? 82.934  6.547  22.416  1.00 15.29  ? 62   SER A O    1 
ATOM   866   C  CB   . SER A 1 62  ? 83.705  5.160  19.594  1.00 20.03  ? 62   SER A CB   1 
ATOM   867   O  OG   . SER A 1 62  ? 84.149  5.276  18.249  1.00 21.71  ? 62   SER A OG   1 
ATOM   868   H  H    . SER A 1 62  ? 84.749  7.359  20.230  1.00 16.33  ? 62   SER A H    1 
ATOM   869   H  HA   . SER A 1 62  ? 82.295  6.642  19.393  1.00 15.13  ? 62   SER A HA   1 
ATOM   870   H  HB2  . SER A 1 62  ? 84.467  4.998  20.172  1.00 24.03  ? 62   SER A HB2  1 
ATOM   871   H  HB3  . SER A 1 62  ? 83.105  4.401  19.670  1.00 24.03  ? 62   SER A HB3  1 
ATOM   872   H  HG   . SER A 1 62  ? 83.505  5.400  17.758  1.00 32.56  ? 62   SER A HG   1 
ATOM   873   N  N    . PRO A 1 63  ? 81.137  5.618  21.400  1.00 13.44  ? 63   PRO A N    1 
ATOM   874   C  CA   . PRO A 1 63  ? 80.434  5.371  22.672  1.00 10.89  ? 63   PRO A CA   1 
ATOM   875   C  C    . PRO A 1 63  ? 81.277  4.626  23.669  1.00 10.84  ? 63   PRO A C    1 
ATOM   876   O  O    . PRO A 1 63  ? 82.135  3.761  23.445  1.00 15.13  ? 63   PRO A O    1 
ATOM   877   C  CB   . PRO A 1 63  ? 79.213  4.532  22.225  1.00 15.56  ? 63   PRO A CB   1 
ATOM   878   C  CG   . PRO A 1 63  ? 78.936  5.123  20.859  1.00 28.83  ? 63   PRO A CG   1 
ATOM   879   C  CD   . PRO A 1 63  ? 80.299  5.264  20.230  1.00 15.66  ? 63   PRO A CD   1 
ATOM   880   H  HA   . PRO A 1 63  ? 80.133  6.220  23.058  1.00 13.07  ? 63   PRO A HA   1 
ATOM   881   H  HB2  . PRO A 1 63  ? 79.431  3.588  22.168  1.00 18.67  ? 63   PRO A HB2  1 
ATOM   882   H  HB3  . PRO A 1 63  ? 78.460  4.652  22.824  1.00 18.67  ? 63   PRO A HB3  1 
ATOM   883   H  HG2  . PRO A 1 63  ? 78.373  4.533  20.335  1.00 34.59  ? 63   PRO A HG2  1 
ATOM   884   H  HG3  . PRO A 1 63  ? 78.500  5.986  20.938  1.00 34.59  ? 63   PRO A HG3  1 
ATOM   885   H  HD2  . PRO A 1 63  ? 80.590  4.433  19.824  1.00 18.79  ? 63   PRO A HD2  1 
ATOM   886   H  HD3  . PRO A 1 63  ? 80.310  5.967  19.562  1.00 18.79  ? 63   PRO A HD3  1 
ATOM   887   N  N    . PHE A 1 64  ? 81.007  4.951  24.940  1.00 13.05  ? 64   PHE A N    1 
ATOM   888   C  CA   . PHE A 1 64  ? 81.525  4.214  26.081  1.00 11.19  ? 64   PHE A CA   1 
ATOM   889   C  C    . PHE A 1 64  ? 80.392  3.318  26.524  1.00 14.56  ? 64   PHE A C    1 
ATOM   890   O  O    . PHE A 1 64  ? 79.401  3.834  27.070  1.00 17.36  ? 64   PHE A O    1 
ATOM   891   C  CB   . PHE A 1 64  ? 81.959  5.189  27.177  1.00 16.42  ? 64   PHE A CB   1 
ATOM   892   C  CG   . PHE A 1 64  ? 82.106  4.499  28.527  1.00 26.15  ? 64   PHE A CG   1 
ATOM   893   C  CD1  . PHE A 1 64  ? 83.281  3.808  28.767  1.00 20.32  ? 64   PHE A CD1  1 
ATOM   894   C  CD2  . PHE A 1 64  ? 81.109  4.560  29.480  1.00 33.64  ? 64   PHE A CD2  1 
ATOM   895   C  CE1  . PHE A 1 64  ? 83.407  3.166  30.006  1.00 27.51  ? 64   PHE A CE1  1 
ATOM   896   C  CE2  . PHE A 1 64  ? 81.233  3.914  30.703  1.00 43.57  ? 64   PHE A CE2  1 
ATOM   897   C  CZ   . PHE A 1 64  ? 82.408  3.224  30.947  1.00 43.07  ? 64   PHE A CZ   1 
ATOM   898   H  H    . PHE A 1 64  ? 80.502  5.631  25.088  1.00 15.66  ? 64   PHE A H    1 
ATOM   899   H  HA   . PHE A 1 64  ? 82.289  3.667  25.803  1.00 13.43  ? 64   PHE A HA   1 
ATOM   900   H  HB2  . PHE A 1 64  ? 82.807  5.590  26.930  1.00 19.70  ? 64   PHE A HB2  1 
ATOM   901   H  HB3  . PHE A 1 64  ? 81.303  5.899  27.251  1.00 19.70  ? 64   PHE A HB3  1 
ATOM   902   H  HD1  . PHE A 1 64  ? 83.959  3.772  28.132  1.00 24.39  ? 64   PHE A HD1  1 
ATOM   903   H  HD2  . PHE A 1 64  ? 80.337  5.046  29.298  1.00 40.37  ? 64   PHE A HD2  1 
ATOM   904   H  HE1  . PHE A 1 64  ? 84.184  2.691  30.195  1.00 33.01  ? 64   PHE A HE1  1 
ATOM   905   H  HE2  . PHE A 1 64  ? 80.551  3.943  31.334  1.00 52.29  ? 64   PHE A HE2  1 
ATOM   906   H  HZ   . PHE A 1 64  ? 82.523  2.793  31.763  1.00 51.68  ? 64   PHE A HZ   1 
ATOM   907   N  N    . GLN A 1 65  ? 80.455  2.018  26.274  1.00 18.58  ? 65   GLN A N    1 
ATOM   908   C  CA   . GLN A 1 65  ? 79.290  1.151  26.441  1.00 22.85  ? 65   GLN A CA   1 
ATOM   909   C  C    . GLN A 1 65  ? 78.106  1.775  25.686  1.00 23.89  ? 65   GLN A C    1 
ATOM   910   O  O    . GLN A 1 65  ? 78.183  1.927  24.457  1.00 17.76  ? 65   GLN A O    1 
ATOM   911   C  CB   . GLN A 1 65  ? 79.006  0.874  27.900  1.00 26.17  ? 65   GLN A CB   1 
ATOM   912   C  CG   . GLN A 1 65  ? 80.055  0.166  28.724  1.00 28.34  ? 65   GLN A CG   1 
ATOM   913   C  CD   . GLN A 1 65  ? 79.629  -0.035 30.176  1.00 31.07  ? 65   GLN A CD   1 
ATOM   914   O  OE1  . GLN A 1 65  ? 78.445  -0.145 30.493  1.00 36.13  ? 65   GLN A OE1  1 
ATOM   915   N  NE2  . GLN A 1 65  ? 80.589  -0.079 31.094  1.00 36.47  ? 65   GLN A NE2  1 
ATOM   916   H  H    . GLN A 1 65  ? 81.198  1.677  26.008  1.00 22.30  ? 65   GLN A H    1 
ATOM   917   H  HA   . GLN A 1 65  ? 79.496  0.294  26.012  1.00 27.42  ? 65   GLN A HA   1 
ATOM   918   H  HB2  . GLN A 1 65  ? 78.820  1.724  28.330  1.00 31.40  ? 65   GLN A HB2  1 
ATOM   919   H  HB3  . GLN A 1 65  ? 78.192  0.348  27.946  1.00 31.40  ? 65   GLN A HB3  1 
ATOM   920   H  HG2  . GLN A 1 65  ? 80.240  -0.699 28.326  1.00 34.01  ? 65   GLN A HG2  1 
ATOM   921   H  HG3  . GLN A 1 65  ? 80.876  0.683  28.704  1.00 34.01  ? 65   GLN A HG3  1 
ATOM   922   H  HE21 . GLN A 1 65  ? 80.387  -0.186 31.923  1.00 43.77  ? 65   GLN A HE21 1 
ATOM   923   H  HE22 . GLN A 1 65  ? 81.413  -0.001 30.860  1.00 43.77  ? 65   GLN A HE22 1 
ATOM   924   N  N    . ILE A 1 66  ? 77.036  2.129  26.379  1.00 22.88  ? 66   ILE A N    1 
ATOM   925   C  CA   . ILE A 1 66  ? 75.842  2.780  25.912  1.00 20.79  ? 66   ILE A CA   1 
ATOM   926   C  C    . ILE A 1 66  ? 76.008  4.292  25.695  1.00 15.15  ? 66   ILE A C    1 
ATOM   927   O  O    . ILE A 1 66  ? 75.255  4.917  24.970  1.00 17.27  ? 66   ILE A O    1 
ATOM   928   C  CB   . ILE A 1 66  ? 74.655  2.604  26.910  1.00 23.03  ? 66   ILE A CB   1 
ATOM   929   C  CG1  . ILE A 1 66  ? 73.350  3.169  26.369  1.00 29.26  ? 66   ILE A CG1  1 
ATOM   930   C  CG2  . ILE A 1 66  ? 74.964  3.213  28.268  1.00 32.51  ? 66   ILE A CG2  1 
ATOM   931   C  CD1  . ILE A 1 66  ? 72.064  2.430  26.577  1.00 21.63  ? 66   ILE A CD1  1 
ATOM   932   H  H    . ILE A 1 66  ? 77.058  1.947  27.219  1.00 27.46  ? 66   ILE A H    1 
ATOM   933   H  HA   . ILE A 1 66  ? 75.586  2.374  25.058  1.00 24.95  ? 66   ILE A HA   1 
ATOM   934   H  HB   . ILE A 1 66  ? 74.525  1.641  27.043  1.00 27.64  ? 66   ILE A HB   1 
ATOM   935   H  HG12 . ILE A 1 66  ? 73.239  4.053  26.752  1.00 35.12  ? 66   ILE A HG12 1 
ATOM   936   H  HG13 . ILE A 1 66  ? 73.462  3.287  25.413  1.00 35.12  ? 66   ILE A HG13 1 
ATOM   937   H  HG21 . ILE A 1 66  ? 75.783  2.843  28.607  1.00 48.77  ? 66   ILE A HG21 1 
ATOM   938   H  HG22 . ILE A 1 66  ? 74.248  3.018  28.877  1.00 48.77  ? 66   ILE A HG22 1 
ATOM   939   H  HG23 . ILE A 1 66  ? 75.057  4.165  28.178  1.00 48.77  ? 66   ILE A HG23 1 
ATOM   940   H  HD11 . ILE A 1 66  ? 71.341  2.933  26.194  1.00 32.44  ? 66   ILE A HD11 1 
ATOM   941   H  HD12 . ILE A 1 66  ? 71.910  2.314  27.517  1.00 32.44  ? 66   ILE A HD12 1 
ATOM   942   H  HD13 . ILE A 1 66  ? 72.116  1.571  26.152  1.00 32.44  ? 66   ILE A HD13 1 
ATOM   943   N  N    . VAL A 1 67  ? 76.965  4.847  26.390  1.00 15.91  ? 67   VAL A N    1 
ATOM   944   C  CA   . VAL A 1 67  ? 77.037  6.281  26.572  1.00 14.50  ? 67   VAL A CA   1 
ATOM   945   C  C    . VAL A 1 67  ? 77.604  7.019  25.359  1.00 14.40  ? 67   VAL A C    1 
ATOM   946   O  O    . VAL A 1 67  ? 78.706  6.654  24.945  1.00 13.15  ? 67   VAL A O    1 
ATOM   947   C  CB   . VAL A 1 67  ? 77.859  6.643  27.819  1.00 15.19  ? 67   VAL A CB   1 
ATOM   948   C  CG1  . VAL A 1 67  ? 78.019  8.142  27.835  1.00 15.73  ? 67   VAL A CG1  1 
ATOM   949   C  CG2  . VAL A 1 67  ? 77.116  6.096  29.037  1.00 21.38  ? 67   VAL A CG2  1 
ATOM   950   H  H    . VAL A 1 67  ? 77.568  4.348  26.747  1.00 19.09  ? 67   VAL A H    1 
ATOM   951   H  HA   . VAL A 1 67  ? 76.124  6.606  26.715  1.00 17.40  ? 67   VAL A HA   1 
ATOM   952   H  HB   . VAL A 1 67  ? 78.742  6.222  27.761  1.00 18.23  ? 67   VAL A HB   1 
ATOM   953   H  HG11 . VAL A 1 67  ? 78.472  8.423  27.037  1.00 23.60  ? 67   VAL A HG11 1 
ATOM   954   H  HG12 . VAL A 1 67  ? 78.533  8.401  28.603  1.00 23.60  ? 67   VAL A HG12 1 
ATOM   955   H  HG13 . VAL A 1 67  ? 77.153  8.555  27.875  1.00 23.60  ? 67   VAL A HG13 1 
ATOM   956   H  HG21 . VAL A 1 67  ? 77.061  5.140  28.976  1.00 32.07  ? 67   VAL A HG21 1 
ATOM   957   H  HG22 . VAL A 1 67  ? 76.230  6.467  29.065  1.00 32.07  ? 67   VAL A HG22 1 
ATOM   958   H  HG23 . VAL A 1 67  ? 77.589  6.339  29.836  1.00 32.07  ? 67   VAL A HG23 1 
ATOM   959   N  N    . LYS A 1 68  ? 76.908  7.996  24.803  1.00 13.70  ? 68   LYS A N    1 
ATOM   960   C  CA   . LYS A 1 68  ? 77.329  8.590  23.535  1.00 11.99  ? 68   LYS A CA   1 
ATOM   961   C  C    . LYS A 1 68  ? 78.065  9.915  23.684  1.00 16.08  ? 68   LYS A C    1 
ATOM   962   O  O    . LYS A 1 68  ? 77.775  10.703 24.570  1.00 13.31  ? 68   LYS A O    1 
ATOM   963   C  CB   . LYS A 1 68  ? 76.134  8.838  22.621  1.00 18.50  ? 68   LYS A CB   1 
ATOM   964   C  CG   . LYS A 1 68  ? 75.254  7.614  22.379  1.00 16.07  ? 68   LYS A CG   1 
ATOM   965   C  CD   . LYS A 1 68  ? 73.830  8.118  22.306  1.00 26.00  ? 68   LYS A CD   1 
ATOM   966   C  CE   . LYS A 1 68  ? 72.829  7.086  21.818  1.00 26.38  ? 68   LYS A CE   1 
ATOM   967   N  NZ   . LYS A 1 68  ? 71.555  7.841  21.574  1.00 24.29  ? 68   LYS A NZ   1 
ATOM   968   H  H    . LYS A 1 68  ? 76.198  8.286  25.192  1.00 16.44  ? 68   LYS A H    1 
ATOM   969   H  HA   . LYS A 1 68  ? 77.928  7.958  23.087  1.00 14.39  ? 68   LYS A HA   1 
ATOM   970   H  HB2  . LYS A 1 68  ? 75.588  9.540  23.008  1.00 22.20  ? 68   LYS A HB2  1 
ATOM   971   H  HB3  . LYS A 1 68  ? 76.460  9.159  21.765  1.00 22.20  ? 68   LYS A HB3  1 
ATOM   972   H  HG2  . LYS A 1 68  ? 75.502  7.177  21.550  1.00 19.28  ? 68   LYS A HG2  1 
ATOM   973   H  HG3  . LYS A 1 68  ? 75.352  6.978  23.106  1.00 19.28  ? 68   LYS A HG3  1 
ATOM   974   H  HD2  . LYS A 1 68  ? 73.561  8.419  23.188  1.00 31.20  ? 68   LYS A HD2  1 
ATOM   975   H  HD3  . LYS A 1 68  ? 73.801  8.884  21.713  1.00 31.20  ? 68   LYS A HD3  1 
ATOM   976   H  HE2  . LYS A 1 68  ? 73.141  6.669  20.999  1.00 31.66  ? 68   LYS A HE2  1 
ATOM   977   H  HE3  . LYS A 1 68  ? 72.695  6.397  22.487  1.00 31.66  ? 68   LYS A HE3  1 
ATOM   978   H  HZ1  . LYS A 1 68  ? 70.918  7.273  21.321  1.00 36.43  ? 68   LYS A HZ1  1 
ATOM   979   H  HZ2  . LYS A 1 68  ? 71.686  8.444  20.933  1.00 36.43  ? 68   LYS A HZ2  1 
ATOM   980   H  HZ3  . LYS A 1 68  ? 71.306  8.252  22.322  1.00 36.43  ? 68   LYS A HZ3  1 
ATOM   981   N  N    . ASN A 1 69  ? 78.993  10.109 22.753  1.00 12.11  ? 69   ASN A N    1 
ATOM   982   C  CA   . ASN A 1 69  ? 79.836  11.300 22.689  1.00 16.10  ? 69   ASN A CA   1 
ATOM   983   C  C    . ASN A 1 69  ? 80.458  11.633 24.047  1.00 10.64  ? 69   ASN A C    1 
ATOM   984   O  O    . ASN A 1 69  ? 80.462  12.819 24.391  1.00 11.84  ? 69   ASN A O    1 
ATOM   985   C  CB   . ASN A 1 69  ? 79.094  12.529 22.196  1.00 17.38  ? 69   ASN A CB   1 
ATOM   986   C  CG   . ASN A 1 69  ? 78.220  12.325 20.975  1.00 20.94  ? 69   ASN A CG   1 
ATOM   987   O  OD1  . ASN A 1 69  ? 78.716  11.753 19.991  1.00 19.98  ? 69   ASN A OD1  1 
ATOM   988   N  ND2  . ASN A 1 69  ? 76.989  12.802 21.032  1.00 17.99  ? 69   ASN A ND2  1 
ATOM   989   H  H    . ASN A 1 69  ? 79.103  9.500  22.155  1.00 14.54  ? 69   ASN A H    1 
ATOM   990   H  HA   . ASN A 1 69  ? 80.566  11.118 22.061  1.00 19.32  ? 69   ASN A HA   1 
ATOM   991   H  HB2  . ASN A 1 69  ? 78.537  12.860 22.918  1.00 20.85  ? 69   ASN A HB2  1 
ATOM   992   H  HB3  . ASN A 1 69  ? 79.746  13.219 21.993  1.00 20.85  ? 69   ASN A HB3  1 
ATOM   993   H  HD21 . ASN A 1 69  ? 76.467  12.727 20.353  1.00 21.59  ? 69   ASN A HD21 1 
ATOM   994   H  HD22 . ASN A 1 69  ? 76.710  13.189 21.748  1.00 21.59  ? 69   ASN A HD22 1 
ATOM   995   N  N    . PRO A 1 70  ? 81.003  10.660 24.761  1.00 11.14  ? 70   PRO A N    1 
ATOM   996   C  CA   . PRO A 1 70  ? 81.444  11.008 26.146  1.00 13.02  ? 70   PRO A CA   1 
ATOM   997   C  C    . PRO A 1 70  ? 82.546  12.039 26.219  1.00 13.21  ? 70   PRO A C    1 
ATOM   998   O  O    . PRO A 1 70  ? 82.626  12.937 27.074  1.00 10.63  ? 70   PRO A O    1 
ATOM   999   C  CB   . PRO A 1 70  ? 81.917  9.658  26.667  1.00 12.59  ? 70   PRO A CB   1 
ATOM   1000  C  CG   . PRO A 1 70  ? 82.290  8.828  25.479  1.00 9.48   ? 70   PRO A CG   1 
ATOM   1001  C  CD   . PRO A 1 70  ? 81.318  9.257  24.437  1.00 11.39  ? 70   PRO A CD   1 
ATOM   1002  H  HA   . PRO A 1 70  ? 80.673  11.312 26.670  1.00 15.63  ? 70   PRO A HA   1 
ATOM   1003  H  HB2  . PRO A 1 70  ? 82.683  9.773  27.251  1.00 15.11  ? 70   PRO A HB2  1 
ATOM   1004  H  HB3  . PRO A 1 70  ? 81.209  9.225  27.170  1.00 15.11  ? 70   PRO A HB3  1 
ATOM   1005  H  HG2  . PRO A 1 70  ? 83.202  9.007  25.201  1.00 11.37  ? 70   PRO A HG2  1 
ATOM   1006  H  HG3  . PRO A 1 70  ? 82.199  7.881  25.673  1.00 11.37  ? 70   PRO A HG3  1 
ATOM   1007  H  HD2  . PRO A 1 70  ? 81.710  9.189  23.552  1.00 13.67  ? 70   PRO A HD2  1 
ATOM   1008  H  HD3  . PRO A 1 70  ? 80.517  8.710  24.468  1.00 13.67  ? 70   PRO A HD3  1 
ATOM   1009  N  N    . ARG A 1 71  ? 83.550  11.925 25.328  1.00 12.79  ? 71   ARG A N    1 
ATOM   1010  C  CA   . ARG A 1 71  ? 84.680  12.870 25.387  1.00 10.82  ? 71   ARG A CA   1 
ATOM   1011  C  C    . ARG A 1 71  ? 84.268  14.277 25.036  1.00 11.14  ? 71   ARG A C    1 
ATOM   1012  O  O    . ARG A 1 71  ? 84.779  15.234 25.615  1.00 13.80  ? 71   ARG A O    1 
ATOM   1013  C  CB   . ARG A 1 71  ? 85.779  12.391 24.422  1.00 10.76  ? 71   ARG A CB   1 
ATOM   1014  C  CG   . ARG A 1 71  ? 86.324  11.029 24.791  1.00 12.37  ? 71   ARG A CG   1 
ATOM   1015  C  CD   . ARG A 1 71  ? 87.101  10.353 23.673  1.00 14.07  ? 71   ARG A CD   1 
ATOM   1016  N  NE   . ARG A 1 71  ? 87.323  8.954  23.973  1.00 13.41  ? 71   ARG A NE   1 
ATOM   1017  C  CZ   . ARG A 1 71  ? 86.422  7.986  23.769  1.00 11.25  ? 71   ARG A CZ   1 
ATOM   1018  N  NH1  . ARG A 1 71  ? 85.221  8.263  23.252  1.00 14.97  ? 71   ARG A NH1  1 
ATOM   1019  N  NH2  . ARG A 1 71  ? 86.701  6.729  24.080  1.00 18.96  ? 71   ARG A NH2  1 
ATOM   1020  H  H    . ARG A 1 71  ? 83.532  11.307 24.730  1.00 15.34  ? 71   ARG A H    1 
ATOM   1021  H  HA   . ARG A 1 71  ? 85.041  12.868 26.298  1.00 12.99  ? 71   ARG A HA   1 
ATOM   1022  H  HB2  . ARG A 1 71  ? 85.418  12.355 23.522  1.00 12.92  ? 71   ARG A HB2  1 
ATOM   1023  H  HB3  . ARG A 1 71  ? 86.505  13.034 24.424  1.00 12.92  ? 71   ARG A HB3  1 
ATOM   1024  H  HG2  . ARG A 1 71  ? 86.905  11.123 25.562  1.00 14.84  ? 71   ARG A HG2  1 
ATOM   1025  H  HG3  . ARG A 1 71  ? 85.585  10.456 25.048  1.00 14.84  ? 71   ARG A HG3  1 
ATOM   1026  H  HD2  . ARG A 1 71  ? 86.607  10.431 22.842  1.00 16.89  ? 71   ARG A HD2  1 
ATOM   1027  H  HD3  . ARG A 1 71  ? 87.955  10.798 23.558  1.00 16.89  ? 71   ARG A HD3  1 
ATOM   1028  H  HE   . ARG A 1 71  ? 88.084  8.730  24.304  1.00 16.09  ? 71   ARG A HE   1 
ATOM   1029  H  HH11 . ARG A 1 71  ? 84.650  7.632  23.128  1.00 17.97  ? 71   ARG A HH11 1 
ATOM   1030  H  HH12 . ARG A 1 71  ? 85.019  9.073  23.043  1.00 17.97  ? 71   ARG A HH12 1 
ATOM   1031  H  HH21 . ARG A 1 71  ? 86.115  6.113  23.948  1.00 22.75  ? 71   ARG A HH21 1 
ATOM   1032  H  HH22 . ARG A 1 71  ? 87.468  6.528  24.414  1.00 22.75  ? 71   ARG A HH22 1 
ATOM   1033  N  N    . SER A 1 72  ? 83.348  14.465 24.095  1.00 10.95  ? 72   SER A N    1 
ATOM   1034  C  CA   . SER A 1 72  ? 82.840  15.761 23.712  1.00 14.66  ? 72   SER A CA   1 
ATOM   1035  C  C    . SER A 1 72  ? 82.084  16.368 24.907  1.00 9.68   ? 72   SER A C    1 
ATOM   1036  O  O    . SER A 1 72  ? 82.293  17.528 25.233  1.00 11.41  ? 72   SER A O    1 
ATOM   1037  C  CB   . SER A 1 72  ? 81.885  15.639 22.511  1.00 20.03  ? 72   SER A CB   1 
ATOM   1038  O  OG   . SER A 1 72  ? 82.662  15.141 21.418  1.00 25.12  ? 72   SER A OG   1 
ATOM   1039  H  H    . SER A 1 72  ? 83.038  13.773 23.689  1.00 13.14  ? 72   SER A H    1 
ATOM   1040  H  HA   . SER A 1 72  ? 83.589  16.345 23.472  1.00 17.59  ? 72   SER A HA   1 
ATOM   1041  H  HB2  . SER A 1 72  ? 81.160  15.028 22.716  1.00 24.04  ? 72   SER A HB2  1 
ATOM   1042  H  HB3  . SER A 1 72  ? 81.507  16.505 22.291  1.00 24.04  ? 72   SER A HB3  1 
ATOM   1043  H  HG   . SER A 1 72  ? 82.989  14.418 21.622  1.00 37.68  ? 72   SER A HG   1 
ATOM   1044  N  N    . VAL A 1 73  ? 81.236  15.533 25.504  1.00 10.89  ? 73   VAL A N    1 
ATOM   1045  C  CA   . VAL A 1 73  ? 80.443  16.124 26.601  1.00 12.96  ? 73   VAL A CA   1 
ATOM   1046  C  C    . VAL A 1 73  ? 81.322  16.442 27.807  1.00 11.39  ? 73   VAL A C    1 
ATOM   1047  O  O    . VAL A 1 73  ? 81.129  17.493 28.429  1.00 11.81  ? 73   VAL A O    1 
ATOM   1048  C  CB   . VAL A 1 73  ? 79.340  15.119 26.976  1.00 11.38  ? 73   VAL A CB   1 
ATOM   1049  C  CG1  . VAL A 1 73  ? 78.582  15.557 28.221  1.00 11.03  ? 73   VAL A CG1  1 
ATOM   1050  C  CG2  . VAL A 1 73  ? 78.428  14.963 25.763  1.00 10.44  ? 73   VAL A CG2  1 
ATOM   1051  H  H    . VAL A 1 73  ? 81.156  14.709 25.268  1.00 13.07  ? 73   VAL A H    1 
ATOM   1052  H  HA   . VAL A 1 73  ? 80.026  16.952 26.282  1.00 15.55  ? 73   VAL A HA   1 
ATOM   1053  H  HB   . VAL A 1 73  ? 79.761  14.253 27.159  1.00 13.66  ? 73   VAL A HB   1 
ATOM   1054  H  HG11 . VAL A 1 73  ? 79.194  15.636 28.957  1.00 16.54  ? 73   VAL A HG11 1 
ATOM   1055  H  HG12 . VAL A 1 73  ? 77.911  14.904 28.433  1.00 16.54  ? 73   VAL A HG12 1 
ATOM   1056  H  HG13 . VAL A 1 73  ? 78.164  16.405 28.060  1.00 16.54  ? 73   VAL A HG13 1 
ATOM   1057  H  HG21 . VAL A 1 73  ? 78.949  14.694 25.003  1.00 15.66  ? 73   VAL A HG21 1 
ATOM   1058  H  HG22 . VAL A 1 73  ? 77.998  15.800 25.576  1.00 15.66  ? 73   VAL A HG22 1 
ATOM   1059  H  HG23 . VAL A 1 73  ? 77.763  14.296 25.947  1.00 15.66  ? 73   VAL A HG23 1 
ATOM   1060  N  N    . GLY A 1 74  ? 82.277  15.565 28.089  1.00 12.74  ? 74   GLY A N    1 
ATOM   1061  C  CA   . GLY A 1 74  ? 83.157  15.797 29.223  1.00 12.52  ? 74   GLY A CA   1 
ATOM   1062  C  C    . GLY A 1 74  ? 84.009  17.023 29.087  1.00 12.53  ? 74   GLY A C    1 
ATOM   1063  O  O    . GLY A 1 74  ? 84.209  17.816 30.013  1.00 13.60  ? 74   GLY A O    1 
ATOM   1064  H  H    . GLY A 1 74  ? 82.375  14.862 27.604  1.00 15.29  ? 74   GLY A H    1 
ATOM   1065  H  HA2  . GLY A 1 74  ? 82.619  15.879 30.026  1.00 15.02  ? 74   GLY A HA2  1 
ATOM   1066  H  HA3  . GLY A 1 74  ? 83.735  15.026 29.333  1.00 15.02  ? 74   GLY A HA3  1 
ATOM   1067  N  N    . LYS A 1 75  ? 84.503  17.221 27.857  1.00 12.27  ? 75   LYS A N    1 
ATOM   1068  C  CA   . LYS A 1 75  ? 85.396  18.340 27.617  1.00 15.42  ? 75   LYS A CA   1 
ATOM   1069  C  C    . LYS A 1 75  ? 84.622  19.645 27.675  1.00 12.35  ? 75   LYS A C    1 
ATOM   1070  O  O    . LYS A 1 75  ? 85.108  20.633 28.219  1.00 16.27  ? 75   LYS A O    1 
ATOM   1071  C  CB   . LYS A 1 75  ? 86.119  18.216 26.266  1.00 14.63  ? 75   LYS A CB   1 
ATOM   1072  C  CG   . LYS A 1 75  ? 87.160  19.327 26.063  1.00 18.90  ? 75   LYS A CG   1 
ATOM   1073  C  CD   . LYS A 1 75  ? 88.247  19.183 27.116  1.00 20.69  ? 75   LYS A CD   1 
ATOM   1074  C  CE   . LYS A 1 75  ? 89.663  19.071 26.640  1.00 29.87  ? 75   LYS A CE   1 
ATOM   1075  N  NZ   . LYS A 1 75  ? 90.318  20.415 26.654  1.00 32.74  ? 75   LYS A NZ   1 
ATOM   1076  H  H    . LYS A 1 75  ? 84.293  16.689 27.215  1.00 14.72  ? 75   LYS A H    1 
ATOM   1077  H  HA   . LYS A 1 75  ? 86.071  18.352 28.327  1.00 18.51  ? 75   LYS A HA   1 
ATOM   1078  H  HB2  . LYS A 1 75  ? 86.561  17.354 26.219  1.00 17.56  ? 75   LYS A HB2  1 
ATOM   1079  H  HB3  . LYS A 1 75  ? 85.466  18.256 25.550  1.00 17.56  ? 75   LYS A HB3  1 
ATOM   1080  H  HG2  . LYS A 1 75  ? 87.548  19.258 25.176  1.00 22.68  ? 75   LYS A HG2  1 
ATOM   1081  H  HG3  . LYS A 1 75  ? 86.736  20.196 26.143  1.00 22.68  ? 75   LYS A HG3  1 
ATOM   1082  H  HD2  . LYS A 1 75  ? 88.192  19.949 27.709  1.00 24.83  ? 75   LYS A HD2  1 
ATOM   1083  H  HD3  . LYS A 1 75  ? 88.047  18.395 27.645  1.00 24.83  ? 75   LYS A HD3  1 
ATOM   1084  H  HE2  . LYS A 1 75  ? 90.153  18.463 27.215  1.00 35.85  ? 75   LYS A HE2  1 
ATOM   1085  H  HE3  . LYS A 1 75  ? 89.676  18.711 25.739  1.00 35.85  ? 75   LYS A HE3  1 
ATOM   1086  H  HZ1  . LYS A 1 75  ? 91.156  20.340 26.364  1.00 49.12  ? 75   LYS A HZ1  1 
ATOM   1087  H  HZ2  . LYS A 1 75  ? 90.319  20.736 27.485  1.00 49.12  ? 75   LYS A HZ2  1 
ATOM   1088  H  HZ3  . LYS A 1 75  ? 89.868  20.970 26.123  1.00 49.12  ? 75   LYS A HZ3  1 
ATOM   1089  N  N    . ALA A 1 76  ? 83.411  19.625 27.120  1.00 12.23  ? 76   ALA A N    1 
ATOM   1090  C  CA   . ALA A 1 76  ? 82.583  20.824 27.098  1.00 12.73  ? 76   ALA A CA   1 
ATOM   1091  C  C    . ALA A 1 76  ? 82.269  21.286 28.537  1.00 11.45  ? 76   ALA A C    1 
ATOM   1092  O  O    . ALA A 1 76  ? 82.293  22.472 28.889  1.00 13.94  ? 76   ALA A O    1 
ATOM   1093  C  CB   . ALA A 1 76  ? 81.326  20.579 26.275  1.00 16.02  ? 76   ALA A CB   1 
ATOM   1094  H  H    . ALA A 1 76  ? 83.115  18.897 26.770  1.00 14.67  ? 76   ALA A H    1 
ATOM   1095  H  HA   . ALA A 1 76  ? 83.095  21.535 26.660  1.00 15.28  ? 76   ALA A HA   1 
ATOM   1096  H  HB1  . ALA A 1 76  ? 81.573  20.300 25.390  1.00 24.04  ? 76   ALA A HB1  1 
ATOM   1097  H  HB2  . ALA A 1 76  ? 80.815  21.390 26.224  1.00 24.04  ? 76   ALA A HB2  1 
ATOM   1098  H  HB3  . ALA A 1 76  ? 80.799  19.894 26.692  1.00 24.04  ? 76   ALA A HB3  1 
ATOM   1099  N  N    . SER A 1 77  ? 81.934  20.342 29.396  1.00 11.46  ? 77   SER A N    1 
ATOM   1100  C  CA   . SER A 1 77  ? 81.653  20.691 30.801  1.00 10.74  ? 77   SER A CA   1 
ATOM   1101  C  C    . SER A 1 77  ? 82.934  21.087 31.537  1.00 11.01  ? 77   SER A C    1 
ATOM   1102  O  O    . SER A 1 77  ? 82.893  21.968 32.414  1.00 13.25  ? 77   SER A O    1 
ATOM   1103  C  CB   . SER A 1 77  ? 80.948  19.555 31.498  1.00 11.49  ? 77   SER A CB   1 
ATOM   1104  O  OG   . SER A 1 77  ? 79.520  19.625 31.427  1.00 14.25  ? 77   SER A OG   1 
ATOM   1105  H  H    . SER A 1 77  ? 81.878  19.524 29.136  1.00 13.75  ? 77   SER A H    1 
ATOM   1106  H  HA   . SER A 1 77  ? 81.053  21.465 30.804  1.00 12.88  ? 77   SER A HA   1 
ATOM   1107  H  HB2  . SER A 1 77  ? 81.239  18.718 31.104  1.00 13.79  ? 77   SER A HB2  1 
ATOM   1108  H  HB3  . SER A 1 77  ? 81.214  19.549 32.431  1.00 13.79  ? 77   SER A HB3  1 
ATOM   1109  H  HG   . SER A 1 77  ? 79.284  19.595 30.642  1.00 21.37  ? 77   SER A HG   1 
ATOM   1110  N  N    . GLU A 1 78  ? 84.064  20.472 31.230  1.00 11.50  ? 78   GLU A N    1 
ATOM   1111  C  CA   . GLU A 1 78  ? 85.324  20.863 31.861  1.00 10.37  ? 78   GLU A CA   1 
ATOM   1112  C  C    . GLU A 1 78  ? 85.602  22.322 31.554  1.00 11.30  ? 78   GLU A C    1 
ATOM   1113  O  O    . GLU A 1 78  ? 85.953  23.120 32.444  1.00 12.31  ? 78   GLU A O    1 
ATOM   1114  C  CB   . GLU A 1 78  ? 86.470  19.990 31.346  1.00 18.31  ? 78   GLU A CB   1 
ATOM   1115  C  CG   . GLU A 1 78  ? 87.783  20.188 32.124  1.00 17.71  ? 78   GLU A CG   1 
ATOM   1116  C  CD   . GLU A 1 78  ? 88.838  19.227 31.573  1.00 23.92  ? 78   GLU A CD   1 
ATOM   1117  O  OE1  . GLU A 1 78  ? 88.641  18.571 30.529  1.00 23.89  ? 78   GLU A OE1  1 
ATOM   1118  O  OE2  . GLU A 1 78  ? 89.885  19.140 32.233  1.00 22.03  ? 78   GLU A OE2  1 
ATOM   1119  H  H    . GLU A 1 78  ? 84.058  19.834 30.652  1.00 13.80  ? 78   GLU A H    1 
ATOM   1120  H  HA   . GLU A 1 78  ? 85.246  20.750 32.831  1.00 12.44  ? 78   GLU A HA   1 
ATOM   1121  H  HB2  . GLU A 1 78  ? 86.206  19.059 31.406  1.00 21.97  ? 78   GLU A HB2  1 
ATOM   1122  H  HB3  . GLU A 1 78  ? 86.625  20.194 30.411  1.00 21.97  ? 78   GLU A HB3  1 
ATOM   1123  H  HG2  . GLU A 1 78  ? 88.089  21.103 32.029  1.00 21.26  ? 78   GLU A HG2  1 
ATOM   1124  H  HG3  . GLU A 1 78  ? 87.638  20.012 33.067  1.00 21.26  ? 78   GLU A HG3  1 
ATOM   1125  N  N    . GLN A 1 79  ? 85.455  22.725 30.304  1.00 12.30  ? 79   GLN A N    1 
ATOM   1126  C  CA   . GLN A 1 79  ? 85.619  24.084 29.829  1.00 12.44  ? 79   GLN A CA   1 
ATOM   1127  C  C    . GLN A 1 79  ? 84.650  25.052 30.507  1.00 14.91  ? 79   GLN A C    1 
ATOM   1128  O  O    . GLN A 1 79  ? 85.021  26.117 31.037  1.00 15.38  ? 79   GLN A O    1 
ATOM   1129  C  CB   . GLN A 1 79  ? 85.334  24.185 28.334  1.00 20.90  ? 79   GLN A CB   1 
ATOM   1130  C  CG   . GLN A 1 79  ? 86.229  24.978 27.424  1.00 38.32  ? 79   GLN A CG   1 
ATOM   1131  C  CD   . GLN A 1 79  ? 85.841  24.676 25.964  1.00 25.32  ? 79   GLN A CD   1 
ATOM   1132  O  OE1  . GLN A 1 79  ? 85.787  23.512 25.578  1.00 20.90  ? 79   GLN A OE1  1 
ATOM   1133  N  NE2  . GLN A 1 79  ? 85.597  25.756 25.265  1.00 20.91  ? 79   GLN A NE2  1 
ATOM   1134  H  H    . GLN A 1 79  ? 85.244  22.128 29.721  1.00 14.76  ? 79   GLN A H    1 
ATOM   1135  H  HA   . GLN A 1 79  ? 86.539  24.375 30.001  1.00 14.93  ? 79   GLN A HA   1 
ATOM   1136  H  HB2  . GLN A 1 79  ? 85.307  23.279 27.987  1.00 25.08  ? 79   GLN A HB2  1 
ATOM   1137  H  HB3  . GLN A 1 79  ? 84.439  24.547 28.239  1.00 25.08  ? 79   GLN A HB3  1 
ATOM   1138  H  HG2  . GLN A 1 79  ? 86.128  25.926 27.604  1.00 45.99  ? 79   GLN A HG2  1 
ATOM   1139  H  HG3  . GLN A 1 79  ? 87.156  24.735 27.577  1.00 45.99  ? 79   GLN A HG3  1 
ATOM   1140  H  HE21 . GLN A 1 79  ? 85.369  25.691 24.438  1.00 25.09  ? 79   GLN A HE21 1 
ATOM   1141  H  HE22 . GLN A 1 79  ? 85.664  26.531 25.633  1.00 25.09  ? 79   GLN A HE22 1 
ATOM   1142  N  N    . LEU A 1 80  ? 83.361  24.675 30.487  1.00 13.06  ? 80   LEU A N    1 
ATOM   1143  C  CA   . LEU A 1 80  ? 82.333  25.490 31.135  1.00 15.56  ? 80   LEU A CA   1 
ATOM   1144  C  C    . LEU A 1 80  ? 82.627  25.631 32.623  1.00 12.46  ? 80   LEU A C    1 
ATOM   1145  O  O    . LEU A 1 80  ? 82.453  26.742 33.171  1.00 11.49  ? 80   LEU A O    1 
ATOM   1146  C  CB   . LEU A 1 80  ? 80.953  24.895 30.852  1.00 10.34  ? 80   LEU A CB   1 
ATOM   1147  C  CG   . LEU A 1 80  ? 79.805  25.682 31.499  1.00 10.83  ? 80   LEU A CG   1 
ATOM   1148  C  CD1  . LEU A 1 80  ? 79.791  27.146 31.075  1.00 13.88  ? 80   LEU A CD1  1 
ATOM   1149  C  CD2  . LEU A 1 80  ? 78.454  25.056 31.211  1.00 9.68   ? 80   LEU A CD2  1 
ATOM   1150  H  H    . LEU A 1 80  ? 83.137  23.947 30.089  1.00 15.67  ? 80   LEU A H    1 
ATOM   1151  H  HA   . LEU A 1 80  ? 82.363  26.385 30.736  1.00 18.67  ? 80   LEU A HA   1 
ATOM   1152  H  HB2  . LEU A 1 80  ? 80.813  24.869 29.892  1.00 12.40  ? 80   LEU A HB2  1 
ATOM   1153  H  HB3  . LEU A 1 80  ? 80.931  23.982 31.179  1.00 12.40  ? 80   LEU A HB3  1 
ATOM   1154  H  HG   . LEU A 1 80  ? 79.941  25.658 32.469  1.00 13.00  ? 80   LEU A HG   1 
ATOM   1155  H  HD11 . LEU A 1 80  ? 80.643  27.544 31.270  1.00 20.82  ? 80   LEU A HD11 1 
ATOM   1156  H  HD12 . LEU A 1 80  ? 79.103  27.611 31.557  1.00 20.82  ? 80   LEU A HD12 1 
ATOM   1157  H  HD13 . LEU A 1 80  ? 79.618  27.204 30.133  1.00 20.82  ? 80   LEU A HD13 1 
ATOM   1158  H  HD21 . LEU A 1 80  ? 78.464  24.135 31.481  1.00 14.52  ? 80   LEU A HD21 1 
ATOM   1159  H  HD22 . LEU A 1 80  ? 78.269  25.113 30.271  1.00 14.52  ? 80   LEU A HD22 1 
ATOM   1160  H  HD23 . LEU A 1 80  ? 77.773  25.526 31.700  1.00 14.52  ? 80   LEU A HD23 1 
ATOM   1161  N  N    . ALA A 1 81  ? 83.084  24.610 33.321  1.00 12.43  ? 81   ALA A N    1 
ATOM   1162  C  CA   . ALA A 1 81  ? 83.391  24.699 34.750  1.00 13.29  ? 81   ALA A CA   1 
ATOM   1163  C  C    . ALA A 1 81  ? 84.416  25.789 34.983  1.00 13.47  ? 81   ALA A C    1 
ATOM   1164  O  O    . ALA A 1 81  ? 84.295  26.576 35.916  1.00 12.09  ? 81   ALA A O    1 
ATOM   1165  C  CB   . ALA A 1 81  ? 83.878  23.354 35.283  1.00 11.38  ? 81   ALA A CB   1 
ATOM   1166  H  H    . ALA A 1 81  ? 83.208  23.860 32.919  1.00 14.92  ? 81   ALA A H    1 
ATOM   1167  H  HA   . ALA A 1 81  ? 82.570  24.941 35.227  1.00 15.95  ? 81   ALA A HA   1 
ATOM   1168  H  HB1  . ALA A 1 81  ? 83.210  22.684 35.120  1.00 17.07  ? 81   ALA A HB1  1 
ATOM   1169  H  HB2  . ALA A 1 81  ? 84.038  23.422 36.227  1.00 17.07  ? 81   ALA A HB2  1 
ATOM   1170  H  HB3  . ALA A 1 81  ? 84.692  23.108 34.837  1.00 17.07  ? 81   ALA A HB3  1 
ATOM   1171  N  N    . GLY A 1 82  ? 85.436  25.808 34.113  1.00 15.74  ? 82   GLY A N    1 
ATOM   1172  C  CA   . GLY A 1 82  ? 86.478  26.833 34.314  1.00 17.26  ? 82   GLY A CA   1 
ATOM   1173  C  C    . GLY A 1 82  ? 85.945  28.235 34.188  1.00 15.37  ? 82   GLY A C    1 
ATOM   1174  O  O    . GLY A 1 82  ? 86.325  29.161 34.932  1.00 17.77  ? 82   GLY A O    1 
ATOM   1175  H  H    . GLY A 1 82  ? 85.482  25.245 33.464  1.00 18.89  ? 82   GLY A H    1 
ATOM   1176  H  HA2  . GLY A 1 82  ? 86.867  26.719 35.194  1.00 20.71  ? 82   GLY A HA2  1 
ATOM   1177  H  HA3  . GLY A 1 82  ? 87.181  26.701 33.659  1.00 20.71  ? 82   GLY A HA3  1 
ATOM   1178  N  N    . LYS A 1 83  ? 85.082  28.404 33.205  1.00 15.20  ? 83   LYS A N    1 
ATOM   1179  C  CA   . LYS A 1 83  ? 84.528  29.720 32.900  1.00 16.57  ? 83   LYS A CA   1 
ATOM   1180  C  C    . LYS A 1 83  ? 83.583  30.233 33.972  1.00 15.32  ? 83   LYS A C    1 
ATOM   1181  O  O    . LYS A 1 83  ? 83.618  31.400 34.340  1.00 15.86  ? 83   LYS A O    1 
ATOM   1182  C  CB   . LYS A 1 83  ? 83.832  29.677 31.538  1.00 16.21  ? 83   LYS A CB   1 
ATOM   1183  C  CG   A LYS A 1 83  ? 84.600  28.830 30.526  0.40 21.90  ? 83   LYS A CG   1 
ATOM   1184  C  CG   B LYS A 1 83  ? 83.224  31.045 31.189  0.60 11.02  ? 83   LYS A CG   1 
ATOM   1185  C  CD   A LYS A 1 83  ? 86.078  29.177 30.528  0.40 28.14  ? 83   LYS A CD   1 
ATOM   1186  C  CD   B LYS A 1 83  ? 84.282  31.904 30.503  0.60 24.85  ? 83   LYS A CD   1 
ATOM   1187  C  CE   A LYS A 1 83  ? 86.882  28.116 29.804  0.40 11.66  ? 83   LYS A CE   1 
ATOM   1188  C  CE   B LYS A 1 83  ? 85.238  30.954 29.778  0.60 33.00  ? 83   LYS A CE   1 
ATOM   1189  N  NZ   A LYS A 1 83  ? 87.960  28.725 28.974  0.40 45.02  ? 83   LYS A NZ   1 
ATOM   1190  N  NZ   B LYS A 1 83  ? 85.838  31.578 28.566  0.60 44.13  ? 83   LYS A NZ   1 
ATOM   1191  H  H    . LYS A 1 83  ? 84.769  27.718 32.800  1.00 18.25  ? 83   LYS A H    1 
ATOM   1192  H  HA   . LYS A 1 83  ? 85.283  30.342 32.836  1.00 19.89  ? 83   LYS A HA   1 
ATOM   1193  N  N    . VAL A 1 84  ? 82.730  29.349 34.467  1.00 14.73  ? 84   VAL A N    1 
ATOM   1194  C  CA   . VAL A 1 84  ? 81.818  29.679 35.563  1.00 15.61  ? 84   VAL A CA   1 
ATOM   1195  C  C    . VAL A 1 84  ? 82.610  30.021 36.820  1.00 12.01  ? 84   VAL A C    1 
ATOM   1196  O  O    . VAL A 1 84  ? 82.307  30.968 37.517  1.00 12.54  ? 84   VAL A O    1 
ATOM   1197  C  CB   . VAL A 1 84  ? 80.856  28.497 35.817  1.00 12.75  ? 84   VAL A CB   1 
ATOM   1198  C  CG1  . VAL A 1 84  ? 80.064  28.604 37.104  1.00 13.16  ? 84   VAL A CG1  1 
ATOM   1199  C  CG2  . VAL A 1 84  ? 79.931  28.370 34.606  1.00 13.43  ? 84   VAL A CG2  1 
ATOM   1200  H  H    . VAL A 1 84  ? 82.711  28.557 34.134  1.00 17.68  ? 84   VAL A H    1 
ATOM   1201  H  HA   . VAL A 1 84  ? 81.289  30.462 35.304  1.00 18.73  ? 84   VAL A HA   1 
ATOM   1202  H  HB   . VAL A 1 84  ? 81.395  27.680 35.866  1.00 15.30  ? 84   VAL A HB   1 
ATOM   1203  H  HG11 . VAL A 1 84  ? 80.668  28.679 37.846  1.00 19.74  ? 84   VAL A HG11 1 
ATOM   1204  H  HG12 . VAL A 1 84  ? 79.521  27.819 37.212  1.00 19.74  ? 84   VAL A HG12 1 
ATOM   1205  H  HG13 . VAL A 1 84  ? 79.501  29.380 37.069  1.00 19.74  ? 84   VAL A HG13 1 
ATOM   1206  H  HG21 . VAL A 1 84  ? 80.459  28.311 33.806  1.00 20.14  ? 84   VAL A HG21 1 
ATOM   1207  H  HG22 . VAL A 1 84  ? 79.361  29.141 34.557  1.00 20.14  ? 84   VAL A HG22 1 
ATOM   1208  H  HG23 . VAL A 1 84  ? 79.394  27.580 34.694  1.00 20.14  ? 84   VAL A HG23 1 
ATOM   1209  N  N    . ALA A 1 85  ? 83.658  29.235 37.093  1.00 14.70  ? 85   ALA A N    1 
ATOM   1210  C  CA   . ALA A 1 85  ? 84.457  29.546 38.305  1.00 17.04  ? 85   ALA A CA   1 
ATOM   1211  C  C    . ALA A 1 85  ? 85.074  30.916 38.164  1.00 15.70  ? 85   ALA A C    1 
ATOM   1212  O  O    . ALA A 1 85  ? 85.104  31.731 39.090  1.00 17.95  ? 85   ALA A O    1 
ATOM   1213  C  CB   . ALA A 1 85  ? 85.466  28.442 38.523  1.00 22.60  ? 85   ALA A CB   1 
ATOM   1214  H  H    . ALA A 1 85  ? 83.862  28.573 36.584  1.00 17.64  ? 85   ALA A H    1 
ATOM   1215  H  HA   . ALA A 1 85  ? 83.851  29.562 39.074  1.00 20.45  ? 85   ALA A HA   1 
ATOM   1216  H  HB1  . ALA A 1 85  ? 85.009  27.601 38.600  1.00 33.89  ? 85   ALA A HB1  1 
ATOM   1217  H  HB2  . ALA A 1 85  ? 85.958  28.614 39.330  1.00 33.89  ? 85   ALA A HB2  1 
ATOM   1218  H  HB3  . ALA A 1 85  ? 86.072  28.411 37.779  1.00 33.89  ? 85   ALA A HB3  1 
ATOM   1219  N  N    . GLU A 1 86  ? 85.540  31.277 36.993  1.00 12.77  ? 86   GLU A N    1 
ATOM   1220  C  CA   . GLU A 1 86  ? 86.053  32.639 36.708  1.00 15.81  ? 86   GLU A CA   1 
ATOM   1221  C  C    . GLU A 1 86  ? 84.999  33.694 37.040  1.00 24.61  ? 86   GLU A C    1 
ATOM   1222  O  O    . GLU A 1 86  ? 85.246  34.615 37.837  1.00 19.83  ? 86   GLU A O    1 
ATOM   1223  C  CB   . GLU A 1 86  ? 86.500  32.720 35.253  1.00 16.39  ? 86   GLU A CB   1 
ATOM   1224  C  CG   . GLU A 1 86  ? 87.057  34.066 34.801  1.00 26.44  ? 86   GLU A CG   1 
ATOM   1225  C  CD   . GLU A 1 86  ? 87.659  33.927 33.411  1.00 37.28  ? 86   GLU A CD   1 
ATOM   1226  O  OE1  . GLU A 1 86  ? 88.924  34.134 33.291  1.00 74.59  ? 86   GLU A OE1  1 
ATOM   1227  O  OE2  . GLU A 1 86  ? 86.896  33.611 32.442  1.00 57.88  ? 86   GLU A OE2  1 
ATOM   1228  H  H    . GLU A 1 86  ? 85.550  30.695 36.359  1.00 15.33  ? 86   GLU A H    1 
ATOM   1229  H  HA   . GLU A 1 86  ? 86.834  32.797 37.278  1.00 18.97  ? 86   GLU A HA   1 
ATOM   1230  H  HB2  . GLU A 1 86  ? 87.179  32.044 35.105  1.00 19.67  ? 86   GLU A HB2  1 
ATOM   1231  H  HB3  . GLU A 1 86  ? 85.743  32.499 34.688  1.00 19.67  ? 86   GLU A HB3  1 
ATOM   1232  H  HG2  . GLU A 1 86  ? 86.347  34.726 34.787  1.00 31.73  ? 86   GLU A HG2  1 
ATOM   1233  H  HG3  . GLU A 1 86  ? 87.737  34.365 35.425  1.00 31.73  ? 86   GLU A HG3  1 
ATOM   1234  N  N    . VAL A 1 87  ? 83.781  33.611 36.476  1.00 16.20  ? 87   VAL A N    1 
ATOM   1235  C  CA   . VAL A 1 87  ? 82.813  34.704 36.697  1.00 22.75  ? 87   VAL A CA   1 
ATOM   1236  C  C    . VAL A 1 87  ? 82.387  34.735 38.164  1.00 15.04  ? 87   VAL A C    1 
ATOM   1237  O  O    . VAL A 1 87  ? 82.165  35.861 38.664  1.00 15.49  ? 87   VAL A O    1 
ATOM   1238  C  CB   . VAL A 1 87  ? 81.643  34.768 35.678  1.00 27.97  ? 87   VAL A CB   1 
ATOM   1239  C  CG1  . VAL A 1 87  ? 81.674  33.633 34.673  1.00 25.75  ? 87   VAL A CG1  1 
ATOM   1240  C  CG2  . VAL A 1 87  ? 80.279  34.892 36.355  1.00 14.19  ? 87   VAL A CG2  1 
ATOM   1241  H  H    . VAL A 1 87  ? 83.569  32.931 35.994  1.00 19.45  ? 87   VAL A H    1 
ATOM   1242  H  HA   . VAL A 1 87  ? 83.321  35.531 36.558  1.00 27.30  ? 87   VAL A HA   1 
ATOM   1243  H  HB   . VAL A 1 87  ? 81.770  35.593 35.164  1.00 33.57  ? 87   VAL A HB   1 
ATOM   1244  H  HG11 . VAL A 1 87  ? 82.551  33.570 34.288  1.00 38.62  ? 87   VAL A HG11 1 
ATOM   1245  H  HG12 . VAL A 1 87  ? 81.032  33.801 33.980  1.00 38.62  ? 87   VAL A HG12 1 
ATOM   1246  H  HG13 . VAL A 1 87  ? 81.458  32.808 35.115  1.00 38.62  ? 87   VAL A HG13 1 
ATOM   1247  H  HG21 . VAL A 1 87  ? 80.285  35.644 36.952  1.00 21.29  ? 87   VAL A HG21 1 
ATOM   1248  H  HG22 . VAL A 1 87  ? 80.093  34.091 36.850  1.00 21.29  ? 87   VAL A HG22 1 
ATOM   1249  H  HG23 . VAL A 1 87  ? 79.601  35.020 35.687  1.00 21.29  ? 87   VAL A HG23 1 
ATOM   1250  N  N    . LYS A 1 88  ? 82.315  33.615 38.858  1.00 12.81  ? 88   LYS A N    1 
ATOM   1251  C  CA   . LYS A 1 88  ? 82.088  33.619 40.302  1.00 17.44  ? 88   LYS A CA   1 
ATOM   1252  C  C    . LYS A 1 88  ? 83.217  34.331 41.033  1.00 22.97  ? 88   LYS A C    1 
ATOM   1253  O  O    . LYS A 1 88  ? 83.040  35.090 41.993  1.00 19.91  ? 88   LYS A O    1 
ATOM   1254  C  CB   . LYS A 1 88  ? 81.934  32.159 40.745  1.00 19.08  ? 88   LYS A CB   1 
ATOM   1255  C  CG   . LYS A 1 88  ? 80.624  31.475 40.380  1.00 14.13  ? 88   LYS A CG   1 
ATOM   1256  C  CD   . LYS A 1 88  ? 79.391  32.350 40.393  1.00 10.73  ? 88   LYS A CD   1 
ATOM   1257  C  CE   . LYS A 1 88  ? 79.090  32.838 41.793  1.00 10.41  ? 88   LYS A CE   1 
ATOM   1258  N  NZ   . LYS A 1 88  ? 77.968  33.796 41.808  1.00 15.60  ? 88   LYS A NZ   1 
ATOM   1259  H  H    . LYS A 1 88  ? 82.403  32.863 38.450  1.00 15.38  ? 88   LYS A H    1 
ATOM   1260  H  HA   . LYS A 1 88  ? 81.249  34.091 40.485  1.00 20.93  ? 88   LYS A HA   1 
ATOM   1261  H  HB2  . LYS A 1 88  ? 82.662  31.647 40.359  1.00 22.90  ? 88   LYS A HB2  1 
ATOM   1262  H  HB3  . LYS A 1 88  ? 82.036  32.123 41.709  1.00 22.90  ? 88   LYS A HB3  1 
ATOM   1263  H  HG2  . LYS A 1 88  ? 80.717  31.094 39.493  1.00 16.95  ? 88   LYS A HG2  1 
ATOM   1264  H  HG3  . LYS A 1 88  ? 80.482  30.741 40.997  1.00 16.95  ? 88   LYS A HG3  1 
ATOM   1265  H  HD2  . LYS A 1 88  ? 79.529  33.112 39.808  1.00 12.88  ? 88   LYS A HD2  1 
ATOM   1266  H  HD3  . LYS A 1 88  ? 78.634  31.846 40.056  1.00 12.88  ? 88   LYS A HD3  1 
ATOM   1267  H  HE2  . LYS A 1 88  ? 78.871  32.079 42.356  1.00 12.49  ? 88   LYS A HE2  1 
ATOM   1268  H  HE3  . LYS A 1 88  ? 79.880  33.264 42.161  1.00 12.49  ? 88   LYS A HE3  1 
ATOM   1269  H  HZ1  . LYS A 1 88  ? 77.813  34.058 42.644  1.00 23.40  ? 88   LYS A HZ1  1 
ATOM   1270  H  HZ2  . LYS A 1 88  ? 77.240  33.404 41.479  1.00 23.40  ? 88   LYS A HZ2  1 
ATOM   1271  H  HZ3  . LYS A 1 88  ? 78.176  34.503 41.309  1.00 23.40  ? 88   LYS A HZ3  1 
ATOM   1272  N  N    . LYS A 1 89  ? 84.456  34.081 40.574  1.00 21.94  ? 89   LYS A N    1 
ATOM   1273  C  CA   . LYS A 1 89  ? 85.566  34.783 41.240  1.00 17.67  ? 89   LYS A CA   1 
ATOM   1274  C  C    . LYS A 1 89  ? 85.451  36.275 41.042  1.00 22.11  ? 89   LYS A C    1 
ATOM   1275  O  O    . LYS A 1 89  ? 85.917  37.167 41.768  1.00 26.24  ? 89   LYS A O    1 
ATOM   1276  C  CB   . LYS A 1 89  ? 86.877  34.228 40.670  1.00 16.99  ? 89   LYS A CB   1 
ATOM   1277  C  CG   . LYS A 1 89  ? 87.269  32.967 41.417  1.00 19.99  ? 89   LYS A CG   1 
ATOM   1278  C  CD   . LYS A 1 89  ? 88.689  32.531 41.099  1.00 41.40  ? 89   LYS A CD   1 
ATOM   1279  C  CE   . LYS A 1 89  ? 88.745  31.560 39.931  1.00 49.73  ? 89   LYS A CE   1 
ATOM   1280  N  NZ   . LYS A 1 89  ? 89.920  30.650 40.069  1.00 34.98  ? 89   LYS A NZ   1 
ATOM   1281  H  H    . LYS A 1 89  ? 84.594  33.537 39.922  1.00 26.33  ? 89   LYS A H    1 
ATOM   1282  H  HA   . LYS A 1 89  ? 85.532  34.589 42.200  1.00 21.21  ? 89   LYS A HA   1 
ATOM   1283  H  HB2  . LYS A 1 89  ? 86.765  34.028 39.727  1.00 20.39  ? 89   LYS A HB2  1 
ATOM   1284  H  HB3  . LYS A 1 89  ? 87.579  34.891 40.757  1.00 20.39  ? 89   LYS A HB3  1 
ATOM   1285  H  HG2  . LYS A 1 89  ? 87.190  33.124 42.371  1.00 23.98  ? 89   LYS A HG2  1 
ATOM   1286  H  HG3  . LYS A 1 89  ? 86.657  32.253 41.181  1.00 23.98  ? 89   LYS A HG3  1 
ATOM   1287  H  HD2  . LYS A 1 89  ? 89.222  33.314 40.888  1.00 49.67  ? 89   LYS A HD2  1 
ATOM   1288  H  HD3  . LYS A 1 89  ? 89.076  32.110 41.882  1.00 49.67  ? 89   LYS A HD3  1 
ATOM   1289  H  HE2  . LYS A 1 89  ? 87.930  31.035 39.904  1.00 59.68  ? 89   LYS A HE2  1 
ATOM   1290  H  HE3  . LYS A 1 89  ? 88.813  32.054 39.099  1.00 59.68  ? 89   LYS A HE3  1 
ATOM   1291  H  HZ1  . LYS A 1 89  ? 89.938  30.083 39.383  1.00 52.47  ? 89   LYS A HZ1  1 
ATOM   1292  H  HZ2  . LYS A 1 89  ? 89.854  30.193 40.830  1.00 52.47  ? 89   LYS A HZ2  1 
ATOM   1293  H  HZ3  . LYS A 1 89  ? 90.668  31.132 40.076  1.00 52.47  ? 89   LYS A HZ3  1 
ATOM   1294  N  N    . ASN A 1 90  ? 84.781  36.684 39.960  1.00 16.05  ? 90   ASN A N    1 
ATOM   1295  C  CA   . ASN A 1 90  ? 84.672  38.078 39.609  1.00 18.43  ? 90   ASN A CA   1 
ATOM   1296  C  C    . ASN A 1 90  ? 83.434  38.682 40.281  1.00 18.88  ? 90   ASN A C    1 
ATOM   1297  O  O    . ASN A 1 90  ? 83.120  39.823 39.950  1.00 19.36  ? 90   ASN A O    1 
ATOM   1298  C  CB   . ASN A 1 90  ? 84.659  38.267 38.097  1.00 25.31  ? 90   ASN A CB   1 
ATOM   1299  C  CG   . ASN A 1 90  ? 85.945  37.794 37.439  1.00 36.29  ? 90   ASN A CG   1 
ATOM   1300  O  OD1  . ASN A 1 90  ? 87.059  38.193 37.794  1.00 36.39  ? 90   ASN A OD1  1 
ATOM   1301  N  ND2  . ASN A 1 90  ? 85.843  36.912 36.452  1.00 48.48  ? 90   ASN A ND2  1 
ATOM   1302  H  H    . ASN A 1 90  ? 84.403  36.097 39.457  1.00 19.26  ? 90   ASN A H    1 
ATOM   1303  H  HA   . ASN A 1 90  ? 85.461  38.539 39.963  1.00 22.12  ? 90   ASN A HA   1 
ATOM   1304  H  HB2  . ASN A 1 90  ? 83.912  37.776 37.722  1.00 30.37  ? 90   ASN A HB2  1 
ATOM   1305  H  HB3  . ASN A 1 90  ? 84.528  39.207 37.897  1.00 30.37  ? 90   ASN A HB3  1 
ATOM   1306  H  HD21 . ASN A 1 90  ? 86.551  36.620 36.062  1.00 58.18  ? 90   ASN A HD21 1 
ATOM   1307  H  HD22 . ASN A 1 90  ? 85.068  36.633 36.204  1.00 58.18  ? 90   ASN A HD22 1 
ATOM   1308  N  N    . GLY A 1 91  ? 82.814  37.922 41.186  1.00 17.23  ? 91   GLY A N    1 
ATOM   1309  C  CA   . GLY A 1 91  ? 81.696  38.343 41.986  1.00 16.62  ? 91   GLY A CA   1 
ATOM   1310  C  C    . GLY A 1 91  ? 80.364  38.588 41.309  1.00 17.40  ? 91   GLY A C    1 
ATOM   1311  O  O    . GLY A 1 91  ? 79.537  39.452 41.647  1.00 20.13  ? 91   GLY A O    1 
ATOM   1312  H  H    . GLY A 1 91  ? 83.104  37.121 41.300  1.00 20.68  ? 91   GLY A H    1 
ATOM   1313  H  HA2  . GLY A 1 91  ? 81.557  37.671 42.672  1.00 19.95  ? 91   GLY A HA2  1 
ATOM   1314  H  HA3  . GLY A 1 91  ? 81.951  39.162 42.438  1.00 19.95  ? 91   GLY A HA3  1 
ATOM   1315  N  N    . ARG A 1 92  ? 80.144  37.774 40.274  1.00 16.18  ? 92   ARG A N    1 
ATOM   1316  C  CA   . ARG A 1 92  ? 78.931  37.876 39.457  1.00 15.62  ? 92   ARG A CA   1 
ATOM   1317  C  C    . ARG A 1 92  ? 78.158  36.566 39.500  1.00 13.39  ? 92   ARG A C    1 
ATOM   1318  O  O    . ARG A 1 92  ? 78.699  35.520 39.789  1.00 15.13  ? 92   ARG A O    1 
ATOM   1319  C  CB   . ARG A 1 92  ? 79.270  38.289 38.023  1.00 17.95  ? 92   ARG A CB   1 
ATOM   1320  C  CG   . ARG A 1 92  ? 80.123  39.534 37.879  1.00 20.87  ? 92   ARG A CG   1 
ATOM   1321  C  CD   . ARG A 1 92  ? 80.517  39.832 36.430  1.00 20.56  ? 92   ARG A CD   1 
ATOM   1322  N  NE   . ARG A 1 92  ? 80.714  41.262 36.239  1.00 20.48  ? 92   ARG A NE   1 
ATOM   1323  C  CZ   . ARG A 1 92  ? 81.725  42.089 36.345  1.00 43.51  ? 92   ARG A CZ   1 
ATOM   1324  N  NH1  . ARG A 1 92  ? 82.958  41.726 36.675  1.00 44.15  ? 92   ARG A NH1  1 
ATOM   1325  N  NH2  . ARG A 1 92  ? 81.495  43.387 36.095  1.00 52.10  ? 92   ARG A NH2  1 
ATOM   1326  H  H    . ARG A 1 92  ? 80.729  37.174 40.082  1.00 19.42  ? 92   ARG A H    1 
ATOM   1327  H  HA   . ARG A 1 92  ? 78.364  38.574 39.846  1.00 18.74  ? 92   ARG A HA   1 
ATOM   1328  H  HB2  . ARG A 1 92  ? 79.732  37.551 37.594  1.00 21.54  ? 92   ARG A HB2  1 
ATOM   1329  H  HB3  . ARG A 1 92  ? 78.440  38.430 37.542  1.00 21.54  ? 92   ARG A HB3  1 
ATOM   1330  H  HG2  . ARG A 1 92  ? 79.634  40.293 38.235  1.00 25.04  ? 92   ARG A HG2  1 
ATOM   1331  H  HG3  . ARG A 1 92  ? 80.928  39.427 38.409  1.00 25.04  ? 92   ARG A HG3  1 
ATOM   1332  H  HD2  . ARG A 1 92  ? 81.335  39.360 36.212  1.00 24.67  ? 92   ARG A HD2  1 
ATOM   1333  H  HD3  . ARG A 1 92  ? 79.819  39.518 35.833  1.00 24.67  ? 92   ARG A HD3  1 
ATOM   1334  H  HE   . ARG A 1 92  ? 79.991  41.661 35.998  1.00 24.57  ? 92   ARG A HE   1 
ATOM   1335  H  HH11 . ARG A 1 92  ? 83.134  40.900 36.835  1.00 52.98  ? 92   ARG A HH11 1 
ATOM   1336  H  HH12 . ARG A 1 92  ? 83.580  42.317 36.729  1.00 52.98  ? 92   ARG A HH12 1 
ATOM   1337  H  HH21 . ARG A 1 92  ? 80.706  43.649 35.873  1.00 62.52  ? 92   ARG A HH21 1 
ATOM   1338  H  HH22 . ARG A 1 92  ? 82.136  43.957 36.155  1.00 62.52  ? 92   ARG A HH22 1 
ATOM   1339  N  N    . ILE A 1 93  ? 76.856  36.719 39.225  1.00 15.81  ? 93   ILE A N    1 
ATOM   1340  C  CA   . ILE A 1 93  ? 75.988  35.545 39.033  1.00 15.08  ? 93   ILE A CA   1 
ATOM   1341  C  C    . ILE A 1 93  ? 76.241  34.993 37.630  1.00 9.42   ? 93   ILE A C    1 
ATOM   1342  O  O    . ILE A 1 93  ? 76.058  35.728 36.651  1.00 15.42  ? 93   ILE A O    1 
ATOM   1343  C  CB   . ILE A 1 93  ? 74.521  35.957 39.245  1.00 13.19  ? 93   ILE A CB   1 
ATOM   1344  C  CG1  . ILE A 1 93  ? 74.235  36.328 40.714  1.00 14.47  ? 93   ILE A CG1  1 
ATOM   1345  C  CG2  . ILE A 1 93  ? 73.547  34.906 38.764  1.00 12.97  ? 93   ILE A CG2  1 
ATOM   1346  C  CD1  . ILE A 1 93  ? 72.961  37.127 40.825  1.00 15.70  ? 93   ILE A CD1  1 
ATOM   1347  H  H    . ILE A 1 93  ? 76.525  37.509 39.160  1.00 18.97  ? 93   ILE A H    1 
ATOM   1348  H  HA   . ILE A 1 93  ? 76.226  34.860 39.693  1.00 18.09  ? 93   ILE A HA   1 
ATOM   1349  H  HB   . ILE A 1 93  ? 74.367  36.762 38.708  1.00 15.82  ? 93   ILE A HB   1 
ATOM   1350  H  HG12 . ILE A 1 93  ? 74.157  35.518 41.243  1.00 17.37  ? 93   ILE A HG12 1 
ATOM   1351  H  HG13 . ILE A 1 93  ? 74.975  36.847 41.067  1.00 17.37  ? 93   ILE A HG13 1 
ATOM   1352  H  HG21 . ILE A 1 93  ? 72.649  35.209 38.917  1.00 19.46  ? 93   ILE A HG21 1 
ATOM   1353  H  HG22 . ILE A 1 93  ? 73.694  34.088 39.246  1.00 19.46  ? 93   ILE A HG22 1 
ATOM   1354  H  HG23 . ILE A 1 93  ? 73.678  34.753 37.826  1.00 19.46  ? 93   ILE A HG23 1 
ATOM   1355  H  HD11 . ILE A 1 93  ? 72.805  37.355 41.745  1.00 23.54  ? 93   ILE A HD11 1 
ATOM   1356  H  HD12 . ILE A 1 93  ? 72.225  36.605 40.497  1.00 23.54  ? 93   ILE A HD12 1 
ATOM   1357  H  HD13 . ILE A 1 93  ? 73.040  37.930 40.305  1.00 23.54  ? 93   ILE A HD13 1 
ATOM   1358  N  N    . SER A 1 94  ? 76.626  33.718 37.579  1.00 12.09  ? 94   SER A N    1 
ATOM   1359  C  CA   . SER A 1 94  ? 76.846  33.062 36.280  1.00 10.82  ? 94   SER A CA   1 
ATOM   1360  C  C    . SER A 1 94  ? 75.495  32.752 35.667  1.00 13.29  ? 94   SER A C    1 
ATOM   1361  O  O    . SER A 1 94  ? 74.631  32.141 36.307  1.00 14.81  ? 94   SER A O    1 
ATOM   1362  C  CB   . SER A 1 94  ? 77.680  31.805 36.399  1.00 14.31  ? 94   SER A CB   1 
ATOM   1363  O  OG   . SER A 1 94  ? 77.200  30.953 37.394  1.00 13.47  ? 94   SER A OG   1 
ATOM   1364  H  H    . SER A 1 94  ? 76.747  33.278 38.308  1.00 14.51  ? 94   SER A H    1 
ATOM   1365  H  HA   . SER A 1 94  ? 77.316  33.690 35.692  1.00 12.98  ? 94   SER A HA   1 
ATOM   1366  H  HB2  . SER A 1 94  ? 77.676  31.337 35.549  1.00 17.17  ? 94   SER A HB2  1 
ATOM   1367  H  HB3  . SER A 1 94  ? 78.598  32.047 36.601  1.00 17.17  ? 94   SER A HB3  1 
ATOM   1368  H  HG   . SER A 1 94  ? 76.432  30.730 37.216  1.00 20.20  ? 94   SER A HG   1 
ATOM   1369  N  N    . LEU A 1 95  ? 75.347  33.157 34.413  1.00 11.77  ? 95   LEU A N    1 
ATOM   1370  C  CA   . LEU A 1 95  ? 74.124  32.882 33.668  1.00 15.03  ? 95   LEU A CA   1 
ATOM   1371  C  C    . LEU A 1 95  ? 74.530  32.133 32.392  1.00 13.52  ? 95   LEU A C    1 
ATOM   1372  O  O    . LEU A 1 95  ? 75.024  32.752 31.456  1.00 12.80  ? 95   LEU A O    1 
ATOM   1373  C  CB   . LEU A 1 95  ? 73.373  34.126 33.340  1.00 11.81  ? 95   LEU A CB   1 
ATOM   1374  C  CG   . LEU A 1 95  ? 71.896  34.193 33.019  1.00 35.25  ? 95   LEU A CG   1 
ATOM   1375  C  CD1  . LEU A 1 95  ? 71.469  35.617 32.645  1.00 24.42  ? 95   LEU A CD1  1 
ATOM   1376  C  CD2  . LEU A 1 95  ? 71.492  33.275 31.881  1.00 27.36  ? 95   LEU A CD2  1 
ATOM   1377  H  H    . LEU A 1 95  ? 75.985  33.590 34.032  1.00 14.13  ? 95   LEU A H    1 
ATOM   1378  H  HA   . LEU A 1 95  ? 73.550  32.299 34.208  1.00 18.04  ? 95   LEU A HA   1 
ATOM   1379  H  HB2  . LEU A 1 95  ? 73.513  34.729 34.087  1.00 14.17  ? 95   LEU A HB2  1 
ATOM   1380  H  HB3  . LEU A 1 95  ? 73.830  34.523 32.581  1.00 14.17  ? 95   LEU A HB3  1 
ATOM   1381  H  HG   . LEU A 1 95  ? 71.398  33.925 33.819  1.00 42.29  ? 95   LEU A HG   1 
ATOM   1382  H  HD11 . LEU A 1 95  ? 70.533  35.624 32.433  1.00 36.63  ? 95   LEU A HD11 1 
ATOM   1383  H  HD12 . LEU A 1 95  ? 71.972  35.912 31.883  1.00 36.63  ? 95   LEU A HD12 1 
ATOM   1384  H  HD13 . LEU A 1 95  ? 71.634  36.205 33.386  1.00 36.63  ? 95   LEU A HD13 1 
ATOM   1385  H  HD21 . LEU A 1 95  ? 70.548  33.354 31.726  1.00 41.04  ? 95   LEU A HD21 1 
ATOM   1386  H  HD22 . LEU A 1 95  ? 71.704  32.368 32.111  1.00 41.04  ? 95   LEU A HD22 1 
ATOM   1387  H  HD23 . LEU A 1 95  ? 71.969  33.523 31.085  1.00 41.04  ? 95   LEU A HD23 1 
ATOM   1388  N  N    . VAL A 1 96  ? 74.286  30.860 32.395  1.00 9.92   ? 96   VAL A N    1 
ATOM   1389  C  CA   . VAL A 1 96  ? 74.681  29.944 31.331  1.00 10.75  ? 96   VAL A CA   1 
ATOM   1390  C  C    . VAL A 1 96  ? 73.511  29.761 30.381  1.00 13.44  ? 96   VAL A C    1 
ATOM   1391  O  O    . VAL A 1 96  ? 72.451  29.259 30.771  1.00 11.28  ? 96   VAL A O    1 
ATOM   1392  C  CB   . VAL A 1 96  ? 75.161  28.578 31.841  1.00 9.21   ? 96   VAL A CB   1 
ATOM   1393  C  CG1  . VAL A 1 96  ? 75.454  27.603 30.700  1.00 14.91  ? 96   VAL A CG1  1 
ATOM   1394  C  CG2  . VAL A 1 96  ? 76.428  28.776 32.677  1.00 12.61  ? 96   VAL A CG2  1 
ATOM   1395  H  H    . VAL A 1 96  ? 73.863  30.533 33.068  1.00 11.90  ? 96   VAL A H    1 
ATOM   1396  H  HA   . VAL A 1 96  ? 75.416  30.358 30.832  1.00 12.90  ? 96   VAL A HA   1 
ATOM   1397  H  HB   . VAL A 1 96  ? 74.464  28.194 32.412  1.00 11.05  ? 96   VAL A HB   1 
ATOM   1398  H  HG11 . VAL A 1 96  ? 74.666  27.493 30.162  1.00 22.36  ? 96   VAL A HG11 1 
ATOM   1399  H  HG12 . VAL A 1 96  ? 75.713  26.753 31.064  1.00 22.36  ? 96   VAL A HG12 1 
ATOM   1400  H  HG13 . VAL A 1 96  ? 76.166  27.949 30.158  1.00 22.36  ? 96   VAL A HG13 1 
ATOM   1401  H  HG21 . VAL A 1 96  ? 76.244  29.386 33.396  1.00 18.91  ? 96   VAL A HG21 1 
ATOM   1402  H  HG22 . VAL A 1 96  ? 77.124  29.135 32.123  1.00 18.91  ? 96   VAL A HG22 1 
ATOM   1403  H  HG23 . VAL A 1 96  ? 76.708  27.932 33.037  1.00 18.91  ? 96   VAL A HG23 1 
ATOM   1404  N  N    . LEU A 1 97  ? 73.685  30.159 29.134  1.00 11.79  ? 97   LEU A N    1 
ATOM   1405  C  CA   . LEU A 1 97  ? 72.691  29.938 28.094  1.00 10.06  ? 97   LEU A CA   1 
ATOM   1406  C  C    . LEU A 1 97  ? 72.981  28.642 27.337  1.00 10.64  ? 97   LEU A C    1 
ATOM   1407  O  O    . LEU A 1 97  ? 73.982  28.578 26.608  1.00 12.75  ? 97   LEU A O    1 
ATOM   1408  C  CB   . LEU A 1 97  ? 72.651  31.115 27.138  1.00 13.33  ? 97   LEU A CB   1 
ATOM   1409  C  CG   . LEU A 1 97  ? 72.591  32.503 27.781  1.00 12.68  ? 97   LEU A CG   1 
ATOM   1410  C  CD1  . LEU A 1 97  ? 72.717  33.552 26.684  1.00 17.81  ? 97   LEU A CD1  1 
ATOM   1411  C  CD2  . LEU A 1 97  ? 71.297  32.597 28.581  1.00 16.89  ? 97   LEU A CD2  1 
ATOM   1412  H  H    . LEU A 1 97  ? 74.415  30.564 28.927  1.00 14.15  ? 97   LEU A H    1 
ATOM   1413  H  HA   . LEU A 1 97  ? 71.812  29.857 28.519  1.00 12.07  ? 97   LEU A HA   1 
ATOM   1414  H  HB2  . LEU A 1 97  ? 73.440  31.075 26.574  1.00 16.00  ? 97   LEU A HB2  1 
ATOM   1415  H  HB3  . LEU A 1 97  ? 71.878  31.013 26.562  1.00 16.00  ? 97   LEU A HB3  1 
ATOM   1416  H  HG   . LEU A 1 97  ? 73.348  32.598 28.396  1.00 15.21  ? 97   LEU A HG   1 
ATOM   1417  H  HD11 . LEU A 1 97  ? 73.557  33.443 26.231  1.00 26.71  ? 97   LEU A HD11 1 
ATOM   1418  H  HD12 . LEU A 1 97  ? 72.675  34.429 27.073  1.00 26.71  ? 97   LEU A HD12 1 
ATOM   1419  H  HD13 . LEU A 1 97  ? 71.999  33.446 26.055  1.00 26.71  ? 97   LEU A HD13 1 
ATOM   1420  H  HD21 . LEU A 1 97  ? 71.280  31.903 29.244  1.00 25.33  ? 97   LEU A HD21 1 
ATOM   1421  H  HD22 . LEU A 1 97  ? 70.547  32.494 27.991  1.00 25.33  ? 97   LEU A HD22 1 
ATOM   1422  H  HD23 . LEU A 1 97  ? 71.249  33.453 29.013  1.00 25.33  ? 97   LEU A HD23 1 
ATOM   1423  N  N    . GLY A 1 98  ? 72.230  27.583 27.467  1.00 11.68  ? 98   GLY A N    1 
ATOM   1424  C  CA   . GLY A 1 98  ? 72.528  26.360 26.754  1.00 10.02  ? 98   GLY A CA   1 
ATOM   1425  C  C    . GLY A 1 98  ? 71.865  26.356 25.373  1.00 9.98   ? 98   GLY A C    1 
ATOM   1426  O  O    . GLY A 1 98  ? 71.175  27.296 24.989  1.00 12.45  ? 98   GLY A O    1 
ATOM   1427  H  H    . GLY A 1 98  ? 71.545  27.613 27.986  1.00 14.02  ? 98   GLY A H    1 
ATOM   1428  H  HA2  . GLY A 1 98  ? 73.489  26.272 26.651  1.00 12.02  ? 98   GLY A HA2  1 
ATOM   1429  H  HA3  . GLY A 1 98  ? 72.210  25.601 27.268  1.00 12.02  ? 98   GLY A HA3  1 
ATOM   1430  N  N    . GLY A 1 99  ? 72.099  25.270 24.668  1.00 12.39  ? 99   GLY A N    1 
ATOM   1431  C  CA   . GLY A 1 99  ? 72.830  24.087 24.983  1.00 12.80  ? 99   GLY A CA   1 
ATOM   1432  C  C    . GLY A 1 99  ? 72.020  23.045 25.742  1.00 11.01  ? 99   GLY A C    1 
ATOM   1433  O  O    . GLY A 1 99  ? 71.011  23.380 26.363  1.00 12.69  ? 99   GLY A O    1 
ATOM   1434  H  H    . GLY A 1 99  ? 71.751  25.275 23.881  1.00 14.87  ? 99   GLY A H    1 
ATOM   1435  H  HA2  . GLY A 1 99  ? 73.154  23.691 24.158  1.00 15.36  ? 99   GLY A HA2  1 
ATOM   1436  H  HA3  . GLY A 1 99  ? 73.604  24.330 25.515  1.00 15.36  ? 99   GLY A HA3  1 
ATOM   1437  N  N    . ASP A 1 100 ? 72.447  21.787 25.674  1.00 10.39  ? 100  ASP A N    1 
ATOM   1438  C  CA   . ASP A 1 100 ? 71.759  20.680 26.311  1.00 10.00  ? 100  ASP A CA   1 
ATOM   1439  C  C    . ASP A 1 100 ? 72.147  20.600 27.795  1.00 10.67  ? 100  ASP A C    1 
ATOM   1440  O  O    . ASP A 1 100 ? 73.176  21.176 28.199  1.00 10.17  ? 100  ASP A O    1 
ATOM   1441  C  CB   . ASP A 1 100 ? 72.020  19.361 25.553  1.00 11.09  ? 100  ASP A CB   1 
ATOM   1442  C  CG   . ASP A 1 100 ? 73.364  18.770 25.771  1.00 12.64  ? 100  ASP A CG   1 
ATOM   1443  O  OD1  . ASP A 1 100 ? 73.716  18.274 26.864  1.00 10.68  ? 100  ASP A OD1  1 
ATOM   1444  O  OD2  . ASP A 1 100 ? 74.142  18.754 24.767  1.00 14.34  ? 100  ASP A OD2  1 
ATOM   1445  H  H    . ASP A 1 100 ? 73.166  21.622 25.232  1.00 12.47  ? 100  ASP A H    1 
ATOM   1446  H  HA   . ASP A 1 100 ? 70.798  20.864 26.265  1.00 12.00  ? 100  ASP A HA   1 
ATOM   1447  H  HB2  . ASP A 1 100 ? 71.350  18.713 25.823  1.00 13.31  ? 100  ASP A HB2  1 
ATOM   1448  H  HB3  . ASP A 1 100 ? 71.904  19.523 24.604  1.00 13.31  ? 100  ASP A HB3  1 
ATOM   1449  N  N    . HIS A 1 101 ? 71.321  19.886 28.539  1.00 8.95   ? 101  HIS A N    1 
ATOM   1450  C  CA   . HIS A 1 101 ? 71.462  19.898 30.017  1.00 10.62  ? 101  HIS A CA   1 
ATOM   1451  C  C    . HIS A 1 101 ? 72.652  19.126 30.493  1.00 11.38  ? 101  HIS A C    1 
ATOM   1452  O  O    . HIS A 1 101 ? 72.938  19.165 31.708  1.00 10.41  ? 101  HIS A O    1 
ATOM   1453  C  CB   . HIS A 1 101 ? 70.170  19.343 30.652  1.00 8.93   ? 101  HIS A CB   1 
ATOM   1454  C  CG   . HIS A 1 101 ? 69.771  20.054 31.921  1.00 9.12   ? 101  HIS A CG   1 
ATOM   1455  N  ND1  . HIS A 1 101 ? 68.503  19.964 32.449  1.00 6.75   ? 101  HIS A ND1  1 
ATOM   1456  C  CD2  . HIS A 1 101 ? 70.500  20.916 32.667  1.00 8.51   ? 101  HIS A CD2  1 
ATOM   1457  C  CE1  . HIS A 1 101 ? 68.515  20.717 33.539  1.00 8.35   ? 101  HIS A CE1  1 
ATOM   1458  N  NE2  . HIS A 1 101 ? 69.669  21.319 33.704  1.00 9.76   ? 101  HIS A NE2  1 
ATOM   1459  H  H    . HIS A 1 101 ? 70.703  19.415 28.169  1.00 10.74  ? 101  HIS A H    1 
ATOM   1460  H  HA   . HIS A 1 101 ? 71.567  20.829 30.305  1.00 12.75  ? 101  HIS A HA   1 
ATOM   1461  H  HB2  . HIS A 1 101 ? 69.447  19.418 30.009  1.00 10.72  ? 101  HIS A HB2  1 
ATOM   1462  H  HB3  . HIS A 1 101 ? 70.296  18.401 30.846  1.00 10.72  ? 101  HIS A HB3  1 
ATOM   1463  H  HD2  . HIS A 1 101 ? 71.378  21.183 32.517  1.00 10.21  ? 101  HIS A HD2  1 
ATOM   1464  H  HE1  . HIS A 1 101 ? 67.792  20.808 34.117  1.00 10.02  ? 101  HIS A HE1  1 
ATOM   1465  H  HE2  . HIS A 1 101 ? 69.873  21.863 34.338  1.00 11.71  ? 101  HIS A HE2  1 
ATOM   1466  N  N    . SER A 1 102 ? 73.413  18.399 29.673  1.00 9.13   ? 102  SER A N    1 
ATOM   1467  C  CA   . SER A 1 102 ? 74.647  17.781 30.153  1.00 12.07  ? 102  SER A CA   1 
ATOM   1468  C  C    . SER A 1 102 ? 75.581  18.852 30.669  1.00 8.43   ? 102  SER A C    1 
ATOM   1469  O  O    . SER A 1 102 ? 76.458  18.564 31.524  1.00 9.71   ? 102  SER A O    1 
ATOM   1470  C  CB   . SER A 1 102 ? 75.344  16.969 29.059  1.00 10.78  ? 102  SER A CB   1 
ATOM   1471  O  OG   . SER A 1 102 ? 75.939  17.805 28.058  1.00 10.86  ? 102  SER A OG   1 
ATOM   1472  H  H    . SER A 1 102 ? 73.175  18.293 28.854  1.00 10.96  ? 102  SER A H    1 
ATOM   1473  H  HA   . SER A 1 102 ? 74.425  17.179 30.894  1.00 14.49  ? 102  SER A HA   1 
ATOM   1474  H  HB2  . SER A 1 102 ? 76.032  16.416 29.462  1.00 12.94  ? 102  SER A HB2  1 
ATOM   1475  H  HB3  . SER A 1 102 ? 74.698  16.380 28.639  1.00 12.94  ? 102  SER A HB3  1 
ATOM   1476  H  HG   . SER A 1 102 ? 75.360  18.271 27.712  1.00 16.29  ? 102  SER A HG   1 
ATOM   1477  N  N    . LEU A 1 103 ? 75.479  20.072 30.216  1.00 9.62   ? 103  LEU A N    1 
ATOM   1478  C  CA   . LEU A 1 103 ? 76.330  21.190 30.607  1.00 11.99  ? 103  LEU A CA   1 
ATOM   1479  C  C    . LEU A 1 103 ? 76.231  21.503 32.100  1.00 10.57  ? 103  LEU A C    1 
ATOM   1480  O  O    . LEU A 1 103 ? 77.089  22.198 32.655  1.00 12.41  ? 103  LEU A O    1 
ATOM   1481  C  CB   . LEU A 1 103 ? 76.005  22.445 29.766  1.00 12.39  ? 103  LEU A CB   1 
ATOM   1482  C  CG   . LEU A 1 103 ? 76.409  22.338 28.295  1.00 10.66  ? 103  LEU A CG   1 
ATOM   1483  C  CD1  . LEU A 1 103 ? 75.686  23.422 27.506  1.00 17.05  ? 103  LEU A CD1  1 
ATOM   1484  C  CD2  . LEU A 1 103 ? 77.914  22.503 28.150  1.00 13.24  ? 103  LEU A CD2  1 
ATOM   1485  H  H    . LEU A 1 103 ? 74.860  20.229 29.640  1.00 11.54  ? 103  LEU A H    1 
ATOM   1486  H  HA   . LEU A 1 103 ? 77.257  20.938 30.418  1.00 14.39  ? 103  LEU A HA   1 
ATOM   1487  H  HB2  . LEU A 1 103 ? 75.051  22.614 29.815  1.00 14.87  ? 103  LEU A HB2  1 
ATOM   1488  H  HB3  . LEU A 1 103 ? 76.459  23.208 30.159  1.00 14.87  ? 103  LEU A HB3  1 
ATOM   1489  H  HG   . LEU A 1 103 ? 76.146  21.459 27.951  1.00 12.79  ? 103  LEU A HG   1 
ATOM   1490  H  HD11 . LEU A 1 103 ? 74.737  23.308 27.601  1.00 25.57  ? 103  LEU A HD11 1 
ATOM   1491  H  HD12 . LEU A 1 103 ? 75.925  23.357 26.579  1.00 25.57  ? 103  LEU A HD12 1 
ATOM   1492  H  HD13 . LEU A 1 103 ? 75.939  24.285 27.842  1.00 25.57  ? 103  LEU A HD13 1 
ATOM   1493  H  HD21 . LEU A 1 103 ? 78.361  21.824 28.662  1.00 19.86  ? 103  LEU A HD21 1 
ATOM   1494  H  HD22 . LEU A 1 103 ? 78.174  23.369 28.472  1.00 19.86  ? 103  LEU A HD22 1 
ATOM   1495  H  HD23 . LEU A 1 103 ? 78.158  22.419 27.225  1.00 19.86  ? 103  LEU A HD23 1 
ATOM   1496  N  N    . ALA A 1 104 ? 75.153  21.030 32.727  1.00 11.44  ? 104  ALA A N    1 
ATOM   1497  C  CA   . ALA A 1 104 ? 75.044  21.313 34.180  1.00 10.06  ? 104  ALA A CA   1 
ATOM   1498  C  C    . ALA A 1 104 ? 76.148  20.639 34.975  1.00 8.71   ? 104  ALA A C    1 
ATOM   1499  O  O    . ALA A 1 104 ? 76.482  21.122 36.067  1.00 11.42  ? 104  ALA A O    1 
ATOM   1500  C  CB   . ALA A 1 104 ? 73.670  20.877 34.648  1.00 12.42  ? 104  ALA A CB   1 
ATOM   1501  H  H    . ALA A 1 104 ? 74.549  20.582 32.309  1.00 13.72  ? 104  ALA A H    1 
ATOM   1502  H  HA   . ALA A 1 104 ? 75.119  22.281 34.311  1.00 12.08  ? 104  ALA A HA   1 
ATOM   1503  H  HB1  . ALA A 1 104 ? 72.998  21.320 34.124  1.00 18.63  ? 104  ALA A HB1  1 
ATOM   1504  H  HB2  . ALA A 1 104 ? 73.558  21.109 35.573  1.00 18.63  ? 104  ALA A HB2  1 
ATOM   1505  H  HB3  . ALA A 1 104 ? 73.583  19.927 34.544  1.00 18.63  ? 104  ALA A HB3  1 
ATOM   1506  N  N    . ILE A 1 105 ? 76.741  19.564 34.461  1.00 9.75   ? 105  ILE A N    1 
ATOM   1507  C  CA   . ILE A 1 105 ? 77.904  18.956 35.097  1.00 11.74  ? 105  ILE A CA   1 
ATOM   1508  C  C    . ILE A 1 105 ? 78.968  20.043 35.229  1.00 14.25  ? 105  ILE A C    1 
ATOM   1509  O  O    . ILE A 1 105 ? 79.513  20.173 36.338  1.00 13.21  ? 105  ILE A O    1 
ATOM   1510  C  CB   . ILE A 1 105 ? 78.501  17.751 34.356  1.00 9.88   ? 105  ILE A CB   1 
ATOM   1511  C  CG1  . ILE A 1 105 ? 77.445  16.665 34.229  1.00 13.68  ? 105  ILE A CG1  1 
ATOM   1512  C  CG2  . ILE A 1 105 ? 79.787  17.270 35.005  1.00 11.51  ? 105  ILE A CG2  1 
ATOM   1513  C  CD1  . ILE A 1 105 ? 77.839  15.511 33.330  1.00 16.58  ? 105  ILE A CD1  1 
ATOM   1514  H  H    . ILE A 1 105 ? 76.431  19.219 33.737  1.00 11.70  ? 105  ILE A H    1 
ATOM   1515  H  HA   . ILE A 1 105 ? 77.647  18.667 35.997  1.00 14.09  ? 105  ILE A HA   1 
ATOM   1516  H  HB   . ILE A 1 105 ? 78.725  18.048 33.449  1.00 11.86  ? 105  ILE A HB   1 
ATOM   1517  H  HG12 . ILE A 1 105 ? 77.250  16.317 35.113  1.00 16.42  ? 105  ILE A HG12 1 
ATOM   1518  H  HG13 . ILE A 1 105 ? 76.630  17.063 33.885  1.00 16.42  ? 105  ILE A HG13 1 
ATOM   1519  H  HG21 . ILE A 1 105 ? 80.410  17.999 35.058  1.00 17.26  ? 105  ILE A HG21 1 
ATOM   1520  H  HG22 . ILE A 1 105 ? 80.166  16.562 34.479  1.00 17.26  ? 105  ILE A HG22 1 
ATOM   1521  H  HG23 . ILE A 1 105 ? 79.597  16.947 35.889  1.00 17.26  ? 105  ILE A HG23 1 
ATOM   1522  H  HD11 . ILE A 1 105 ? 77.126  14.868 33.303  1.00 24.86  ? 105  ILE A HD11 1 
ATOM   1523  H  HD12 . ILE A 1 105 ? 78.633  15.094 33.673  1.00 24.86  ? 105  ILE A HD12 1 
ATOM   1524  H  HD13 . ILE A 1 105 ? 78.007  15.839 32.443  1.00 24.86  ? 105  ILE A HD13 1 
ATOM   1525  N  N    . GLY A 1 106 ? 79.291  20.805 34.183  1.00 10.49  ? 106  GLY A N    1 
ATOM   1526  C  CA   . GLY A 1 106 ? 80.294  21.836 34.286  1.00 10.46  ? 106  GLY A CA   1 
ATOM   1527  C  C    . GLY A 1 106 ? 79.832  23.054 35.042  1.00 14.31  ? 106  GLY A C    1 
ATOM   1528  O  O    . GLY A 1 106 ? 80.532  23.684 35.851  1.00 12.66  ? 106  GLY A O    1 
ATOM   1529  H  H    . GLY A 1 106 ? 78.893  20.678 33.431  1.00 12.58  ? 106  GLY A H    1 
ATOM   1530  H  HA2  . GLY A 1 106 ? 81.075  21.470 34.729  1.00 12.55  ? 106  GLY A HA2  1 
ATOM   1531  H  HA3  . GLY A 1 106 ? 80.560  22.105 33.393  1.00 12.55  ? 106  GLY A HA3  1 
ATOM   1532  N  N    . SER A 1 107 ? 78.597  23.476 34.809  1.00 11.77  ? 107  SER A N    1 
ATOM   1533  C  CA   . SER A 1 107 ? 78.099  24.682 35.429  1.00 10.03  ? 107  SER A CA   1 
ATOM   1534  C  C    . SER A 1 107 ? 78.082  24.561 36.947  1.00 10.63  ? 107  SER A C    1 
ATOM   1535  O  O    . SER A 1 107 ? 78.603  25.504 37.593  1.00 11.94  ? 107  SER A O    1 
ATOM   1536  C  CB   . SER A 1 107 ? 76.703  24.974 34.892  1.00 10.88  ? 107  SER A CB   1 
ATOM   1537  O  OG   . SER A 1 107 ? 76.222  26.146 35.524  1.00 11.52  ? 107  SER A OG   1 
ATOM   1538  H  H    . SER A 1 107 ? 78.086  23.027 34.282  1.00 14.12  ? 107  SER A H    1 
ATOM   1539  H  HA   . SER A 1 107 ? 78.689  25.424 35.183  1.00 12.04  ? 107  SER A HA   1 
ATOM   1540  H  HB2  . SER A 1 107 ? 76.736  25.104 33.931  1.00 13.06  ? 107  SER A HB2  1 
ATOM   1541  H  HB3  . SER A 1 107 ? 76.111  24.228 35.080  1.00 13.06  ? 107  SER A HB3  1 
ATOM   1542  H  HG   . SER A 1 107 ? 75.472  26.320 35.242  1.00 17.27  ? 107  SER A HG   1 
ATOM   1543  N  N    . ILE A 1 108 ? 77.518  23.480 37.470  1.00 10.65  ? 108  ILE A N    1 
ATOM   1544  C  CA   . ILE A 1 108 ? 77.457  23.285 38.928  1.00 10.67  ? 108  ILE A CA   1 
ATOM   1545  C  C    . ILE A 1 108 ? 78.851  22.997 39.475  1.00 14.19  ? 108  ILE A C    1 
ATOM   1546  O  O    . ILE A 1 108 ? 79.205  23.513 40.550  1.00 11.83  ? 108  ILE A O    1 
ATOM   1547  C  CB   . ILE A 1 108 ? 76.428  22.211 39.286  1.00 8.59   ? 108  ILE A CB   1 
ATOM   1548  C  CG1  . ILE A 1 108 ? 75.023  22.665 38.916  1.00 10.19  ? 108  ILE A CG1  1 
ATOM   1549  C  CG2  . ILE A 1 108 ? 76.467  21.853 40.764  1.00 12.74  ? 108  ILE A CG2  1 
ATOM   1550  C  CD1  . ILE A 1 108 ? 73.933  21.654 38.942  1.00 10.64  ? 108  ILE A CD1  1 
ATOM   1551  H  H    . ILE A 1 108 ? 77.183  22.884 36.948  1.00 12.78  ? 108  ILE A H    1 
ATOM   1552  H  HA   . ILE A 1 108 ? 77.153  24.128 39.325  1.00 12.81  ? 108  ILE A HA   1 
ATOM   1553  H  HB   . ILE A 1 108 ? 76.635  21.404 38.770  1.00 10.31  ? 108  ILE A HB   1 
ATOM   1554  H  HG12 . ILE A 1 108 ? 74.775  23.384 39.518  1.00 12.23  ? 108  ILE A HG12 1 
ATOM   1555  H  HG13 . ILE A 1 108 ? 75.058  23.039 38.022  1.00 12.23  ? 108  ILE A HG13 1 
ATOM   1556  H  HG21 . ILE A 1 108 ? 77.353  21.571 41.002  1.00 19.11  ? 108  ILE A HG21 1 
ATOM   1557  H  HG22 . ILE A 1 108 ? 75.847  21.141 40.937  1.00 19.11  ? 108  ILE A HG22 1 
ATOM   1558  H  HG23 . ILE A 1 108 ? 76.225  22.622 41.286  1.00 19.11  ? 108  ILE A HG23 1 
ATOM   1559  H  HD11 . ILE A 1 108 ? 73.107  22.068 38.681  1.00 15.96  ? 108  ILE A HD11 1 
ATOM   1560  H  HD12 . ILE A 1 108 ? 73.847  21.299 39.830  1.00 15.96  ? 108  ILE A HD12 1 
ATOM   1561  H  HD13 . ILE A 1 108 ? 74.142  20.943 38.332  1.00 15.96  ? 108  ILE A HD13 1 
ATOM   1562  N  N    . SER A 1 109 ? 79.693  22.230 38.814  1.00 10.07  ? 109  SER A N    1 
ATOM   1563  C  CA   . SER A 1 109 ? 81.038  21.955 39.296  1.00 13.62  ? 109  SER A CA   1 
ATOM   1564  C  C    . SER A 1 109 ? 81.814  23.243 39.400  1.00 12.88  ? 109  SER A C    1 
ATOM   1565  O  O    . SER A 1 109 ? 82.521  23.482 40.421  1.00 12.83  ? 109  SER A O    1 
ATOM   1566  C  CB   . SER A 1 109 ? 81.807  21.008 38.376  1.00 10.99  ? 109  SER A CB   1 
ATOM   1567  O  OG   . SER A 1 109 ? 81.339  19.693 38.318  1.00 14.90  ? 109  SER A OG   1 
ATOM   1568  H  H    . SER A 1 109 ? 79.438  21.879 38.071  1.00 12.09  ? 109  SER A H    1 
ATOM   1569  H  HA   . SER A 1 109 ? 80.978  21.550 40.186  1.00 16.35  ? 109  SER A HA   1 
ATOM   1570  H  HB2  . SER A 1 109 ? 81.790  21.376 37.479  1.00 13.18  ? 109  SER A HB2  1 
ATOM   1571  H  HB3  . SER A 1 109 ? 82.732  20.989 38.665  1.00 13.18  ? 109  SER A HB3  1 
ATOM   1572  H  HG   . SER A 1 109 ? 80.568  19.689 38.039  1.00 22.36  ? 109  SER A HG   1 
ATOM   1573  N  N    . GLY A 1 110 ? 81.822  24.099 38.400  1.00 13.22  ? 110  GLY A N    1 
ATOM   1574  C  CA   . GLY A 1 110 ? 82.588  25.338 38.420  1.00 12.55  ? 110  GLY A CA   1 
ATOM   1575  C  C    . GLY A 1 110 ? 82.098  26.240 39.533  1.00 14.53  ? 110  GLY A C    1 
ATOM   1576  O  O    . GLY A 1 110 ? 82.863  26.846 40.271  1.00 13.14  ? 110  GLY A O    1 
ATOM   1577  H  H    . GLY A 1 110 ? 81.353  23.918 37.702  1.00 15.87  ? 110  GLY A H    1 
ATOM   1578  H  HA2  . GLY A 1 110 ? 83.528  25.138 38.554  1.00 15.06  ? 110  GLY A HA2  1 
ATOM   1579  H  HA3  . GLY A 1 110 ? 82.495  25.792 37.568  1.00 15.06  ? 110  GLY A HA3  1 
ATOM   1580  N  N    . HIS A 1 111 ? 80.780  26.328 39.662  1.00 12.07  ? 111  HIS A N    1 
ATOM   1581  C  CA   . HIS A 1 111 ? 80.186  27.122 40.725  1.00 14.22  ? 111  HIS A CA   1 
ATOM   1582  C  C    . HIS A 1 111 ? 80.641  26.647 42.107  1.00 12.86  ? 111  HIS A C    1 
ATOM   1583  O  O    . HIS A 1 111 ? 80.946  27.485 42.962  1.00 14.40  ? 111  HIS A O    1 
ATOM   1584  C  CB   . HIS A 1 111 ? 78.655  27.010 40.624  1.00 14.54  ? 111  HIS A CB   1 
ATOM   1585  C  CG   . HIS A 1 111 ? 77.986  28.061 41.468  1.00 13.27  ? 111  HIS A CG   1 
ATOM   1586  N  ND1  . HIS A 1 111 ? 76.654  28.023 41.669  1.00 20.90  ? 111  HIS A ND1  1 
ATOM   1587  C  CD2  . HIS A 1 111 ? 78.293  29.115 42.227  1.00 14.71  ? 111  HIS A CD2  1 
ATOM   1588  C  CE1  . HIS A 1 111 ? 76.106  28.951 42.391  1.00 16.14  ? 111  HIS A CE1  1 
ATOM   1589  N  NE2  . HIS A 1 111 ? 77.150  29.646 42.779  1.00 12.24  ? 111  HIS A NE2  1 
ATOM   1590  H  H    . HIS A 1 111 ? 80.270  25.909 39.110  1.00 14.48  ? 111  HIS A H    1 
ATOM   1591  H  HA   . HIS A 1 111 ? 80.446  28.060 40.607  1.00 17.06  ? 111  HIS A HA   1 
ATOM   1592  H  HB2  . HIS A 1 111 ? 78.383  27.117 39.699  1.00 17.45  ? 111  HIS A HB2  1 
ATOM   1593  H  HB3  . HIS A 1 111 ? 78.374  26.130 40.920  1.00 17.45  ? 111  HIS A HB3  1 
ATOM   1594  H  HD1  . HIS A 1 111 ? 76.176  27.396 41.324  1.00 25.08  ? 111  HIS A HD1  1 
ATOM   1595  H  HD2  . HIS A 1 111 ? 79.153  29.441 42.364  1.00 17.66  ? 111  HIS A HD2  1 
ATOM   1596  H  HE1  . HIS A 1 111 ? 75.207  29.088 42.584  1.00 19.37  ? 111  HIS A HE1  1 
ATOM   1597  N  N    . ALA A 1 112 ? 80.673  25.364 42.332  1.00 12.51  ? 112  ALA A N    1 
ATOM   1598  C  CA   . ALA A 1 112 ? 80.966  24.786 43.634  1.00 13.25  ? 112  ALA A CA   1 
ATOM   1599  C  C    . ALA A 1 112 ? 82.465  24.933 43.923  1.00 12.12  ? 112  ALA A C    1 
ATOM   1600  O  O    . ALA A 1 112 ? 82.816  24.846 45.112  1.00 16.59  ? 112  ALA A O    1 
ATOM   1601  C  CB   . ALA A 1 112 ? 80.556  23.355 43.778  1.00 12.75  ? 112  ALA A CB   1 
ATOM   1602  H  H    . ALA A 1 112 ? 80.511  24.831 41.677  1.00 15.01  ? 112  ALA A H    1 
ATOM   1603  H  HA   . ALA A 1 112 ? 80.480  25.306 44.308  1.00 15.89  ? 112  ALA A HA   1 
ATOM   1604  H  HB1  . ALA A 1 112 ? 79.618  23.271 43.594  1.00 19.13  ? 112  ALA A HB1  1 
ATOM   1605  H  HB2  . ALA A 1 112 ? 80.734  23.060 44.674  1.00 19.13  ? 112  ALA A HB2  1 
ATOM   1606  H  HB3  . ALA A 1 112 ? 81.053  22.816 43.159  1.00 19.13  ? 112  ALA A HB3  1 
ATOM   1607  N  N    . ARG A 1 113 ? 83.321  25.119 42.933  1.00 13.99  ? 113  ARG A N    1 
ATOM   1608  C  CA   . ARG A 1 113 ? 84.734  25.377 43.209  1.00 16.76  ? 113  ARG A CA   1 
ATOM   1609  C  C    . ARG A 1 113 ? 84.862  26.641 44.057  1.00 24.37  ? 113  ARG A C    1 
ATOM   1610  O  O    . ARG A 1 113 ? 85.783  26.762 44.875  1.00 28.80  ? 113  ARG A O    1 
ATOM   1611  C  CB   . ARG A 1 113 ? 85.538  25.540 41.928  1.00 18.81  ? 113  ARG A CB   1 
ATOM   1612  C  CG   . ARG A 1 113 ? 85.839  24.257 41.186  1.00 16.42  ? 113  ARG A CG   1 
ATOM   1613  C  CD   . ARG A 1 113 ? 86.596  24.583 39.898  1.00 19.31  ? 113  ARG A CD   1 
ATOM   1614  N  NE   . ARG A 1 113 ? 86.568  23.373 39.083  1.00 20.87  ? 113  ARG A NE   1 
ATOM   1615  C  CZ   . ARG A 1 113 ? 86.813  23.311 37.786  1.00 15.23  ? 113  ARG A CZ   1 
ATOM   1616  N  NH1  . ARG A 1 113 ? 87.117  24.425 37.156  1.00 18.18  ? 113  ARG A NH1  1 
ATOM   1617  N  NH2  . ARG A 1 113 ? 86.743  22.136 37.184  1.00 16.57  ? 113  ARG A NH2  1 
ATOM   1618  H  H    . ARG A 1 113 ? 83.045  25.088 42.119  1.00 16.79  ? 113  ARG A H    1 
ATOM   1619  H  HA   . ARG A 1 113 ? 85.098  24.621 43.715  1.00 20.11  ? 113  ARG A HA   1 
ATOM   1620  H  HB2  . ARG A 1 113 ? 85.051  26.131 41.333  1.00 22.58  ? 113  ARG A HB2  1 
ATOM   1621  H  HB3  . ARG A 1 113 ? 86.378  25.972 42.146  1.00 22.58  ? 113  ARG A HB3  1 
ATOM   1622  H  HG2  . ARG A 1 113 ? 86.375  23.672 41.744  1.00 19.70  ? 113  ARG A HG2  1 
ATOM   1623  H  HG3  . ARG A 1 113 ? 85.011  23.798 40.974  1.00 19.70  ? 113  ARG A HG3  1 
ATOM   1624  H  HD2  . ARG A 1 113 ? 86.168  25.316 39.430  1.00 23.17  ? 113  ARG A HD2  1 
ATOM   1625  H  HD3  . ARG A 1 113 ? 87.511  24.835 40.098  1.00 23.17  ? 113  ARG A HD3  1 
ATOM   1626  H  HE   . ARG A 1 113 ? 86.375  22.635 39.481  1.00 25.04  ? 113  ARG A HE   1 
ATOM   1627  H  HH11 . ARG A 1 113 ? 87.152  25.168 37.589  1.00 21.82  ? 113  ARG A HH11 1 
ATOM   1628  H  HH12 . ARG A 1 113 ? 87.280  24.412 36.312  1.00 21.82  ? 113  ARG A HH12 1 
ATOM   1629  H  HH21 . ARG A 1 113 ? 86.899  22.075 36.340  1.00 19.88  ? 113  ARG A HH21 1 
ATOM   1630  H  HH22 . ARG A 1 113 ? 86.540  21.433 37.635  1.00 19.88  ? 113  ARG A HH22 1 
ATOM   1631  N  N    . VAL A 1 114 ? 83.953  27.598 43.877  1.00 23.46  ? 114  VAL A N    1 
ATOM   1632  C  CA   . VAL A 1 114 ? 84.026  28.880 44.553  1.00 14.95  ? 114  VAL A CA   1 
ATOM   1633  C  C    . VAL A 1 114 ? 83.083  28.937 45.736  1.00 18.95  ? 114  VAL A C    1 
ATOM   1634  O  O    . VAL A 1 114 ? 83.376  29.620 46.719  1.00 19.76  ? 114  VAL A O    1 
ATOM   1635  C  CB   . VAL A 1 114 ? 83.699  30.031 43.570  1.00 21.68  ? 114  VAL A CB   1 
ATOM   1636  C  CG1  . VAL A 1 114 ? 83.919  31.402 44.144  1.00 18.03  ? 114  VAL A CG1  1 
ATOM   1637  C  CG2  . VAL A 1 114 ? 84.592  29.880 42.333  1.00 19.80  ? 114  VAL A CG2  1 
ATOM   1638  H  H    . VAL A 1 114 ? 83.298  27.450 43.340  1.00 28.15  ? 114  VAL A H    1 
ATOM   1639  H  HA   . VAL A 1 114 ? 84.941  29.005 44.882  1.00 17.94  ? 114  VAL A HA   1 
ATOM   1640  H  HB   . VAL A 1 114 ? 82.762  29.952 43.293  1.00 26.02  ? 114  VAL A HB   1 
ATOM   1641  H  HG11 . VAL A 1 114 ? 83.379  31.511 44.930  1.00 27.05  ? 114  VAL A HG11 1 
ATOM   1642  H  HG12 . VAL A 1 114 ? 83.674  32.065 43.494  1.00 27.05  ? 114  VAL A HG12 1 
ATOM   1643  H  HG13 . VAL A 1 114 ? 84.845  31.508 44.376  1.00 27.05  ? 114  VAL A HG13 1 
ATOM   1644  H  HG21 . VAL A 1 114 ? 84.463  29.009 41.951  1.00 29.70  ? 114  VAL A HG21 1 
ATOM   1645  H  HG22 . VAL A 1 114 ? 85.511  29.985 42.588  1.00 29.70  ? 114  VAL A HG22 1 
ATOM   1646  H  HG23 . VAL A 1 114 ? 84.360  30.551 41.687  1.00 29.70  ? 114  VAL A HG23 1 
ATOM   1647  N  N    . HIS A 1 115 ? 81.951  28.244 45.648  1.00 16.30  ? 115  HIS A N    1 
ATOM   1648  C  CA   . HIS A 1 115 ? 80.909  28.218 46.663  1.00 14.40  ? 115  HIS A CA   1 
ATOM   1649  C  C    . HIS A 1 115 ? 80.509  26.792 46.980  1.00 16.87  ? 115  HIS A C    1 
ATOM   1650  O  O    . HIS A 1 115 ? 79.486  26.251 46.562  1.00 14.71  ? 115  HIS A O    1 
ATOM   1651  C  CB   . HIS A 1 115 ? 79.715  29.051 46.185  1.00 15.64  ? 115  HIS A CB   1 
ATOM   1652  C  CG   . HIS A 1 115 ? 80.051  30.493 45.923  1.00 15.17  ? 115  HIS A CG   1 
ATOM   1653  N  ND1  . HIS A 1 115 ? 80.297  31.329 46.997  1.00 22.36  ? 115  HIS A ND1  1 
ATOM   1654  C  CD2  . HIS A 1 115 ? 80.208  31.244 44.836  1.00 19.83  ? 115  HIS A CD2  1 
ATOM   1655  C  CE1  . HIS A 1 115 ? 80.577  32.535 46.553  1.00 26.11  ? 115  HIS A CE1  1 
ATOM   1656  N  NE2  . HIS A 1 115 ? 80.524  32.529 45.233  1.00 19.73  ? 115  HIS A NE2  1 
ATOM   1657  H  H    . HIS A 1 115 ? 81.827  27.775 44.938  1.00 19.56  ? 115  HIS A H    1 
ATOM   1658  H  HA   . HIS A 1 115 ? 81.264  28.627 47.479  1.00 17.28  ? 115  HIS A HA   1 
ATOM   1659  H  HB2  . HIS A 1 115 ? 79.364  28.658 45.371  1.00 18.77  ? 115  HIS A HB2  1 
ATOM   1660  H  HB3  . HIS A 1 115 ? 79.016  29.009 46.857  1.00 18.77  ? 115  HIS A HB3  1 
ATOM   1661  H  HD1  . HIS A 1 115 ? 80.271  31.097 47.824  1.00 26.83  ? 115  HIS A HD1  1 
ATOM   1662  H  HD2  . HIS A 1 115 ? 80.121  30.953 43.957  1.00 23.79  ? 115  HIS A HD2  1 
ATOM   1663  H  HE1  . HIS A 1 115 ? 80.779  33.272 47.083  1.00 31.33  ? 115  HIS A HE1  1 
ATOM   1664  N  N    . PRO A 1 116 ? 81.331  26.062 47.723  1.00 12.70  ? 116  PRO A N    1 
ATOM   1665  C  CA   . PRO A 1 116 ? 81.121  24.649 47.981  1.00 16.42  ? 116  PRO A CA   1 
ATOM   1666  C  C    . PRO A 1 116 ? 79.841  24.382 48.738  1.00 12.54  ? 116  PRO A C    1 
ATOM   1667  O  O    . PRO A 1 116 ? 79.399  23.237 48.746  1.00 17.23  ? 116  PRO A O    1 
ATOM   1668  C  CB   . PRO A 1 116 ? 82.345  24.192 48.826  1.00 16.79  ? 116  PRO A CB   1 
ATOM   1669  C  CG   . PRO A 1 116 ? 83.091  25.424 49.110  1.00 20.16  ? 116  PRO A CG   1 
ATOM   1670  C  CD   . PRO A 1 116 ? 82.600  26.556 48.283  1.00 17.91  ? 116  PRO A CD   1 
ATOM   1671  H  HA   . PRO A 1 116 ? 81.108  24.159 47.132  1.00 19.71  ? 116  PRO A HA   1 
ATOM   1672  H  HB2  . PRO A 1 116 ? 82.055  23.768 49.649  1.00 20.15  ? 116  PRO A HB2  1 
ATOM   1673  H  HB3  . PRO A 1 116 ? 82.893  23.566 48.327  1.00 20.15  ? 116  PRO A HB3  1 
ATOM   1674  H  HG2  . PRO A 1 116 ? 82.996  25.648 50.049  1.00 24.19  ? 116  PRO A HG2  1 
ATOM   1675  H  HG3  . PRO A 1 116 ? 84.033  25.279 48.930  1.00 24.19  ? 116  PRO A HG3  1 
ATOM   1676  H  HD2  . PRO A 1 116 ? 82.456  27.346 48.826  1.00 21.49  ? 116  PRO A HD2  1 
ATOM   1677  H  HD3  . PRO A 1 116 ? 83.231  26.769 47.577  1.00 21.49  ? 116  PRO A HD3  1 
ATOM   1678  N  N    . ASP A 1 117 ? 79.270  25.440 49.354  1.00 15.32  ? 117  ASP A N    1 
ATOM   1679  C  CA   . ASP A 1 117 ? 78.082  25.299 50.166  1.00 14.22  ? 117  ASP A CA   1 
ATOM   1680  C  C    . ASP A 1 117 ? 76.789  25.490 49.359  1.00 14.58  ? 117  ASP A C    1 
ATOM   1681  O  O    . ASP A 1 117 ? 75.717  25.541 49.959  1.00 15.63  ? 117  ASP A O    1 
ATOM   1682  C  CB   . ASP A 1 117 ? 78.059  26.286 51.340  1.00 13.41  ? 117  ASP A CB   1 
ATOM   1683  C  CG   . ASP A 1 117 ? 78.260  27.731 50.995  1.00 17.94  ? 117  ASP A CG   1 
ATOM   1684  O  OD1  . ASP A 1 117 ? 78.754  28.037 49.885  1.00 18.88  ? 117  ASP A OD1  1 
ATOM   1685  O  OD2  . ASP A 1 117 ? 77.946  28.634 51.822  1.00 18.00  ? 117  ASP A OD2  1 
ATOM   1686  H  H    . ASP A 1 117 ? 79.623  26.218 49.260  1.00 18.38  ? 117  ASP A H    1 
ATOM   1687  H  HA   . ASP A 1 117 ? 78.076  24.392 50.536  1.00 17.07  ? 117  ASP A HA   1 
ATOM   1688  H  HB2  . ASP A 1 117 ? 77.205  26.198 51.793  1.00 16.09  ? 117  ASP A HB2  1 
ATOM   1689  H  HB3  . ASP A 1 117 ? 78.749  26.025 51.970  1.00 16.09  ? 117  ASP A HB3  1 
ATOM   1690  N  N    . LEU A 1 118 ? 76.860  25.598 48.034  1.00 13.14  ? 118  LEU A N    1 
ATOM   1691  C  CA   . LEU A 1 118 ? 75.624  25.873 47.277  1.00 11.27  ? 118  LEU A CA   1 
ATOM   1692  C  C    . LEU A 1 118 ? 74.535  24.837 47.455  1.00 12.49  ? 118  LEU A C    1 
ATOM   1693  O  O    . LEU A 1 118 ? 74.771  23.666 47.725  1.00 10.30  ? 118  LEU A O    1 
ATOM   1694  C  CB   . LEU A 1 118 ? 76.032  26.086 45.813  1.00 10.71  ? 118  LEU A CB   1 
ATOM   1695  C  CG   . LEU A 1 118 ? 76.521  24.905 44.982  1.00 13.53  ? 118  LEU A CG   1 
ATOM   1696  C  CD1  . LEU A 1 118 ? 75.379  24.087 44.388  1.00 23.06  ? 118  LEU A CD1  1 
ATOM   1697  C  CD2  . LEU A 1 118 ? 77.375  25.367 43.807  1.00 29.60  ? 118  LEU A CD2  1 
ATOM   1698  H  H    . LEU A 1 118 ? 77.612  25.508 47.627  1.00 15.76  ? 118  LEU A H    1 
ATOM   1699  H  HA   . LEU A 1 118 ? 75.268  26.725 47.605  1.00 13.52  ? 118  LEU A HA   1 
ATOM   1700  H  HB2  . LEU A 1 118 ? 75.268  26.467 45.352  1.00 12.86  ? 118  LEU A HB2  1 
ATOM   1701  H  HB3  . LEU A 1 118 ? 76.732  26.757 45.802  1.00 12.86  ? 118  LEU A HB3  1 
ATOM   1702  H  HG   . LEU A 1 118 ? 77.062  24.321 45.553  1.00 16.23  ? 118  LEU A HG   1 
ATOM   1703  H  HD11 . LEU A 1 118 ? 74.811  23.770 45.094  1.00 34.59  ? 118  LEU A HD11 1 
ATOM   1704  H  HD12 . LEU A 1 118 ? 75.738  23.338 43.907  1.00 34.59  ? 118  LEU A HD12 1 
ATOM   1705  H  HD13 . LEU A 1 118 ? 74.869  24.637 43.789  1.00 34.59  ? 118  LEU A HD13 1 
ATOM   1706  H  HD21 . LEU A 1 118 ? 77.664  24.604 43.301  1.00 44.40  ? 118  LEU A HD21 1 
ATOM   1707  H  HD22 . LEU A 1 118 ? 78.142  25.842 44.136  1.00 44.40  ? 118  LEU A HD22 1 
ATOM   1708  H  HD23 . LEU A 1 118 ? 76.857  25.947 43.244  1.00 44.40  ? 118  LEU A HD23 1 
ATOM   1709  N  N    . GLY A 1 119 ? 73.305  25.269 47.189  1.00 13.83  ? 119  GLY A N    1 
ATOM   1710  C  CA   . GLY A 1 119 ? 72.127  24.413 47.085  1.00 9.95   ? 119  GLY A CA   1 
ATOM   1711  C  C    . GLY A 1 119 ? 71.573  24.507 45.663  1.00 10.47  ? 119  GLY A C    1 
ATOM   1712  O  O    . GLY A 1 119 ? 71.612  25.603 45.075  1.00 13.36  ? 119  GLY A O    1 
ATOM   1713  H  H    . GLY A 1 119 ? 73.196  26.113 47.069  1.00 16.60  ? 119  GLY A H    1 
ATOM   1714  H  HA2  . GLY A 1 119 ? 72.367  23.495 47.287  1.00 11.94  ? 119  GLY A HA2  1 
ATOM   1715  H  HA3  . GLY A 1 119 ? 71.454  24.699 47.722  1.00 11.94  ? 119  GLY A HA3  1 
ATOM   1716  N  N    . VAL A 1 120 ? 71.018  23.388 45.172  1.00 9.78   ? 120  VAL A N    1 
ATOM   1717  C  CA   . VAL A 1 120 ? 70.530  23.384 43.780  1.00 7.72   ? 120  VAL A CA   1 
ATOM   1718  C  C    . VAL A 1 120 ? 69.029  23.237 43.746  1.00 7.93   ? 120  VAL A C    1 
ATOM   1719  O  O    . VAL A 1 120 ? 68.427  22.404 44.429  1.00 8.75   ? 120  VAL A O    1 
ATOM   1720  C  CB   . VAL A 1 120 ? 71.185  22.252 42.978  1.00 8.89   ? 120  VAL A CB   1 
ATOM   1721  C  CG1  . VAL A 1 120 ? 70.644  22.164 41.550  1.00 9.58   ? 120  VAL A CG1  1 
ATOM   1722  C  CG2  . VAL A 1 120 ? 72.705  22.428 42.963  1.00 11.84  ? 120  VAL A CG2  1 
ATOM   1723  H  H    . VAL A 1 120 ? 70.948  22.685 45.661  1.00 11.73  ? 120  VAL A H    1 
ATOM   1724  H  HA   . VAL A 1 120 ? 70.768  24.239 43.364  1.00 9.26   ? 120  VAL A HA   1 
ATOM   1725  H  HB   . VAL A 1 120 ? 70.983  21.407 43.430  1.00 10.67  ? 120  VAL A HB   1 
ATOM   1726  H  HG11 . VAL A 1 120 ? 69.691  22.057 41.574  1.00 14.37  ? 120  VAL A HG11 1 
ATOM   1727  H  HG12 . VAL A 1 120 ? 71.039  21.410 41.104  1.00 14.37  ? 120  VAL A HG12 1 
ATOM   1728  H  HG13 . VAL A 1 120 ? 70.864  22.968 41.074  1.00 14.37  ? 120  VAL A HG13 1 
ATOM   1729  H  HG21 . VAL A 1 120 ? 73.030  22.481 43.865  1.00 17.76  ? 120  VAL A HG21 1 
ATOM   1730  H  HG22 . VAL A 1 120 ? 72.930  23.234 42.493  1.00 17.76  ? 120  VAL A HG22 1 
ATOM   1731  H  HG23 . VAL A 1 120 ? 73.109  21.677 42.521  1.00 17.76  ? 120  VAL A HG23 1 
ATOM   1732  N  N    . ILE A 1 121 ? 68.408  24.070 42.887  1.00 8.73   ? 121  ILE A N    1 
ATOM   1733  C  CA   . ILE A 1 121 ? 67.002  23.918 42.524  1.00 11.55  ? 121  ILE A CA   1 
ATOM   1734  C  C    . ILE A 1 121 ? 66.971  23.507 41.027  1.00 9.71   ? 121  ILE A C    1 
ATOM   1735  O  O    . ILE A 1 121 ? 67.532  24.236 40.204  1.00 9.21   ? 121  ILE A O    1 
ATOM   1736  C  CB   . ILE A 1 121 ? 66.127  25.148 42.792  1.00 7.65   ? 121  ILE A CB   1 
ATOM   1737  C  CG1  . ILE A 1 121 ? 66.165  25.553 44.280  1.00 9.20   ? 121  ILE A CG1  1 
ATOM   1738  C  CG2  . ILE A 1 121 ? 64.691  24.988 42.312  1.00 8.44   ? 121  ILE A CG2  1 
ATOM   1739  C  CD1  . ILE A 1 121 ? 65.567  26.874 44.714  1.00 9.83   ? 121  ILE A CD1  1 
ATOM   1740  H  H    . ILE A 1 121 ? 68.857  24.716 42.539  1.00 10.48  ? 121  ILE A H    1 
ATOM   1741  H  HA   . ILE A 1 121 ? 66.638  23.172 43.046  1.00 13.86  ? 121  ILE A HA   1 
ATOM   1742  H  HB   . ILE A 1 121 ? 66.516  25.891 42.285  1.00 9.18   ? 121  ILE A HB   1 
ATOM   1743  H  HG12 . ILE A 1 121 ? 65.719  24.853 44.782  1.00 11.04  ? 121  ILE A HG12 1 
ATOM   1744  H  HG13 . ILE A 1 121 ? 67.095  25.551 44.557  1.00 11.04  ? 121  ILE A HG13 1 
ATOM   1745  H  HG21 . ILE A 1 121 ? 64.197  25.788 42.506  1.00 12.65  ? 121  ILE A HG21 1 
ATOM   1746  H  HG22 . ILE A 1 121 ? 64.284  24.243 42.761  1.00 12.65  ? 121  ILE A HG22 1 
ATOM   1747  H  HG23 . ILE A 1 121 ? 64.686  24.831 41.364  1.00 12.65  ? 121  ILE A HG23 1 
ATOM   1748  H  HD11 . ILE A 1 121 ? 65.675  26.978 45.662  1.00 14.74  ? 121  ILE A HD11 1 
ATOM   1749  H  HD12 . ILE A 1 121 ? 64.632  26.889 44.495  1.00 14.74  ? 121  ILE A HD12 1 
ATOM   1750  H  HD13 . ILE A 1 121 ? 66.014  27.592 44.260  1.00 14.74  ? 121  ILE A HD13 1 
ATOM   1751  N  N    . TRP A 1 122 ? 66.344  22.382 40.793  1.00 8.11   ? 122  TRP A N    1 
ATOM   1752  C  CA   . TRP A 1 122 ? 66.341  21.747 39.439  1.00 6.45   ? 122  TRP A CA   1 
ATOM   1753  C  C    . TRP A 1 122 ? 64.938  21.706 38.889  1.00 6.78   ? 122  TRP A C    1 
ATOM   1754  O  O    . TRP A 1 122 ? 64.101  20.911 39.374  1.00 8.72   ? 122  TRP A O    1 
ATOM   1755  C  CB   . TRP A 1 122 ? 66.957  20.377 39.563  1.00 6.22   ? 122  TRP A CB   1 
ATOM   1756  C  CG   . TRP A 1 122 ? 67.383  19.719 38.266  1.00 7.64   ? 122  TRP A CG   1 
ATOM   1757  C  CD1  . TRP A 1 122 ? 66.520  19.117 37.366  1.00 7.64   ? 122  TRP A CD1  1 
ATOM   1758  C  CD2  . TRP A 1 122 ? 68.706  19.582 37.758  1.00 8.27   ? 122  TRP A CD2  1 
ATOM   1759  N  NE1  . TRP A 1 122 ? 67.277  18.654 36.329  1.00 8.67   ? 122  TRP A NE1  1 
ATOM   1760  C  CE2  . TRP A 1 122 ? 68.611  18.894 36.520  1.00 7.94   ? 122  TRP A CE2  1 
ATOM   1761  C  CE3  . TRP A 1 122 ? 69.988  19.955 38.174  1.00 9.86   ? 122  TRP A CE3  1 
ATOM   1762  C  CZ2  . TRP A 1 122 ? 69.732  18.582 35.739  1.00 8.84   ? 122  TRP A CZ2  1 
ATOM   1763  C  CZ3  . TRP A 1 122 ? 71.119  19.664 37.426  1.00 7.78   ? 122  TRP A CZ3  1 
ATOM   1764  C  CH2  . TRP A 1 122 ? 70.973  18.968 36.189  1.00 8.55   ? 122  TRP A CH2  1 
ATOM   1765  H  H    . TRP A 1 122 ? 65.922  21.997 41.436  1.00 9.74   ? 122  TRP A H    1 
ATOM   1766  H  HA   . TRP A 1 122 ? 66.897  22.287 38.840  1.00 7.74   ? 122  TRP A HA   1 
ATOM   1767  H  HB2  . TRP A 1 122 ? 67.735  20.445 40.140  1.00 7.46   ? 122  TRP A HB2  1 
ATOM   1768  H  HB3  . TRP A 1 122 ? 66.319  19.796 40.005  1.00 7.46   ? 122  TRP A HB3  1 
ATOM   1769  H  HD1  . TRP A 1 122 ? 65.597  19.042 37.451  1.00 9.17   ? 122  TRP A HD1  1 
ATOM   1770  H  HE1  . TRP A 1 122 ? 66.955  18.258 35.637  1.00 10.40  ? 122  TRP A HE1  1 
ATOM   1771  H  HE3  . TRP A 1 122 ? 70.086  20.412 38.978  1.00 11.83  ? 122  TRP A HE3  1 
ATOM   1772  H  HZ2  . TRP A 1 122 ? 69.638  18.125 34.935  1.00 10.61  ? 122  TRP A HZ2  1 
ATOM   1773  H  HZ3  . TRP A 1 122 ? 71.961  19.920 37.726  1.00 9.34   ? 122  TRP A HZ3  1 
ATOM   1774  H  HH2  . TRP A 1 122 ? 71.727  18.773 35.681  1.00 10.26  ? 122  TRP A HH2  1 
ATOM   1775  N  N    . VAL A 1 123 ? 64.670  22.619 37.954  1.00 7.04   ? 123  VAL A N    1 
ATOM   1776  C  CA   . VAL A 1 123 ? 63.317  22.710 37.364  1.00 7.42   ? 123  VAL A CA   1 
ATOM   1777  C  C    . VAL A 1 123 ? 63.287  21.941 36.039  1.00 7.41   ? 123  VAL A C    1 
ATOM   1778  O  O    . VAL A 1 123 ? 64.053  22.339 35.138  1.00 8.43   ? 123  VAL A O    1 
ATOM   1779  C  CB   . VAL A 1 123 ? 62.812  24.141 37.188  1.00 7.36   ? 123  VAL A CB   1 
ATOM   1780  C  CG1  . VAL A 1 123 ? 61.474  24.215 36.501  1.00 9.61   ? 123  VAL A CG1  1 
ATOM   1781  C  CG2  . VAL A 1 123 ? 62.709  24.852 38.559  1.00 9.09   ? 123  VAL A CG2  1 
ATOM   1782  H  H    . VAL A 1 123 ? 65.287  23.158 37.693  1.00 8.45   ? 123  VAL A H    1 
ATOM   1783  H  HA   . VAL A 1 123 ? 62.701  22.258 37.978  1.00 8.90   ? 123  VAL A HA   1 
ATOM   1784  H  HB   . VAL A 1 123 ? 63.463  24.629 36.641  1.00 8.84   ? 123  VAL A HB   1 
ATOM   1785  H  HG11 . VAL A 1 123 ? 61.209  25.134 36.414  1.00 14.42  ? 123  VAL A HG11 1 
ATOM   1786  H  HG12 . VAL A 1 123 ? 60.821  23.742 37.021  1.00 14.42  ? 123  VAL A HG12 1 
ATOM   1787  H  HG13 . VAL A 1 123 ? 61.539  23.817 35.630  1.00 14.42  ? 123  VAL A HG13 1 
ATOM   1788  H  HG21 . VAL A 1 123 ? 63.559  24.816 39.003  1.00 13.63  ? 123  VAL A HG21 1 
ATOM   1789  H  HG22 . VAL A 1 123 ? 62.047  24.413 39.098  1.00 13.63  ? 123  VAL A HG22 1 
ATOM   1790  H  HG23 . VAL A 1 123 ? 62.456  25.769 38.426  1.00 13.63  ? 123  VAL A HG23 1 
ATOM   1791  N  N    . ASP A 1 124 ? 62.489  20.926 35.947  1.00 7.01   ? 124  ASP A N    1 
ATOM   1792  C  CA   . ASP A 1 124 ? 62.602  19.945 34.836  1.00 6.19   ? 124  ASP A CA   1 
ATOM   1793  C  C    . ASP A 1 124 ? 61.433  19.003 34.871  1.00 7.47   ? 124  ASP A C    1 
ATOM   1794  O  O    . ASP A 1 124 ? 60.927  18.627 35.960  1.00 7.86   ? 124  ASP A O    1 
ATOM   1795  C  CB   . ASP A 1 124 ? 63.942  19.252 34.960  1.00 7.89   ? 124  ASP A CB   1 
ATOM   1796  C  CG   . ASP A 1 124 ? 64.586  18.629 33.727  1.00 6.51   ? 124  ASP A CG   1 
ATOM   1797  O  OD1  . ASP A 1 124 ? 63.775  18.092 32.935  1.00 7.60   ? 124  ASP A OD1  1 
ATOM   1798  O  OD2  . ASP A 1 124 ? 65.837  18.709 33.602  1.00 8.36   ? 124  ASP A OD2  1 
ATOM   1799  H  H    . ASP A 1 124 ? 61.879  20.817 36.544  1.00 8.41   ? 124  ASP A H    1 
ATOM   1800  H  HA   . ASP A 1 124 ? 62.582  20.434 33.987  1.00 7.43   ? 124  ASP A HA   1 
ATOM   1801  H  HB2  . ASP A 1 124 ? 64.570  19.898 35.320  1.00 9.47   ? 124  ASP A HB2  1 
ATOM   1802  H  HB3  . ASP A 1 124 ? 63.846  18.551 35.623  1.00 9.47   ? 124  ASP A HB3  1 
ATOM   1803  N  N    . ALA A 1 125 ? 60.939  18.487 33.760  1.00 8.39   ? 125  ALA A N    1 
ATOM   1804  C  CA   . ALA A 1 125 ? 60.098  17.312 33.707  1.00 7.56   ? 125  ALA A CA   1 
ATOM   1805  C  C    . ALA A 1 125 ? 60.801  16.030 34.157  1.00 6.74   ? 125  ALA A C    1 
ATOM   1806  O  O    . ALA A 1 125 ? 60.128  15.086 34.525  1.00 8.83   ? 125  ALA A O    1 
ATOM   1807  C  CB   . ALA A 1 125 ? 59.545  17.156 32.289  1.00 7.51   ? 125  ALA A CB   1 
ATOM   1808  H  H    . ALA A 1 125 ? 61.131  18.876 33.018  1.00 10.07  ? 125  ALA A H    1 
ATOM   1809  H  HA   . ALA A 1 125 ? 59.338  17.462 34.308  1.00 9.07   ? 125  ALA A HA   1 
ATOM   1810  H  HB1  . ALA A 1 125 ? 59.109  17.970 32.024  1.00 11.27  ? 125  ALA A HB1  1 
ATOM   1811  H  HB2  . ALA A 1 125 ? 58.913  16.434 32.269  1.00 11.27  ? 125  ALA A HB2  1 
ATOM   1812  H  HB3  . ALA A 1 125 ? 60.265  16.967 31.683  1.00 11.27  ? 125  ALA A HB3  1 
ATOM   1813  N  N    . HIS A 1 126 ? 62.101  15.994 34.062  1.00 8.02   ? 126  HIS A N    1 
ATOM   1814  C  CA   . HIS A 1 126 ? 63.004  14.896 34.222  1.00 8.92   ? 126  HIS A CA   1 
ATOM   1815  C  C    . HIS A 1 126 ? 63.955  15.055 35.393  1.00 9.48   ? 126  HIS A C    1 
ATOM   1816  O  O    . HIS A 1 126 ? 64.320  16.160 35.757  1.00 9.20   ? 126  HIS A O    1 
ATOM   1817  C  CB   . HIS A 1 126 ? 63.846  14.775 32.907  1.00 7.43   ? 126  HIS A CB   1 
ATOM   1818  C  CG   . HIS A 1 126 ? 62.947  14.706 31.689  1.00 10.68  ? 126  HIS A CG   1 
ATOM   1819  N  ND1  . HIS A 1 126 ? 62.804  15.817 30.855  1.00 8.00   ? 126  HIS A ND1  1 
ATOM   1820  C  CD2  . HIS A 1 126 ? 62.208  13.694 31.210  1.00 8.03   ? 126  HIS A CD2  1 
ATOM   1821  C  CE1  . HIS A 1 126 ? 61.960  15.408 29.918  1.00 7.74   ? 126  HIS A CE1  1 
ATOM   1822  N  NE2  . HIS A 1 126 ? 61.571  14.180 30.085  1.00 8.49   ? 126  HIS A NE2  1 
ATOM   1823  H  H    . HIS A 1 126 ? 62.474  16.746 33.874  1.00 9.63   ? 126  HIS A H    1 
ATOM   1824  H  HA   . HIS A 1 126 ? 62.485  14.074 34.344  1.00 10.70  ? 126  HIS A HA   1 
ATOM   1825  H  HB2  . HIS A 1 126 ? 64.436  15.541 32.829  1.00 8.91   ? 126  HIS A HB2  1 
ATOM   1826  H  HB3  . HIS A 1 126 ? 64.395  13.976 32.948  1.00 8.91   ? 126  HIS A HB3  1 
ATOM   1827  H  HD2  . HIS A 1 126 ? 62.138  12.837 31.565  1.00 9.63   ? 126  HIS A HD2  1 
ATOM   1828  H  HE1  . HIS A 1 126 ? 61.677  15.945 29.213  1.00 9.29   ? 126  HIS A HE1  1 
ATOM   1829  H  HE2  . HIS A 1 126 ? 61.018  13.749 29.587  1.00 10.19  ? 126  HIS A HE2  1 
ATOM   1830  N  N    . THR A 1 127 ? 64.349  13.918 35.983  1.00 7.59   ? 127  THR A N    1 
ATOM   1831  C  CA   . THR A 1 127 ? 65.344  14.016 37.041  1.00 8.10   ? 127  THR A CA   1 
ATOM   1832  C  C    . THR A 1 127 ? 66.787  14.077 36.587  1.00 7.90   ? 127  THR A C    1 
ATOM   1833  O  O    . THR A 1 127 ? 67.667  14.502 37.338  1.00 9.85   ? 127  THR A O    1 
ATOM   1834  C  CB   . THR A 1 127 ? 65.232  12.803 37.997  1.00 8.00   ? 127  THR A CB   1 
ATOM   1835  O  OG1  . THR A 1 127 ? 64.963  11.590 37.305  1.00 10.34  ? 127  THR A OG1  1 
ATOM   1836  C  CG2  . THR A 1 127 ? 64.093  13.034 38.976  1.00 7.93   ? 127  THR A CG2  1 
ATOM   1837  H  H    . THR A 1 127 ? 64.025  13.157 35.745  1.00 9.10   ? 127  THR A H    1 
ATOM   1838  H  HA   . THR A 1 127 ? 65.156  14.827 37.558  1.00 9.72   ? 127  THR A HA   1 
ATOM   1839  H  HB   . THR A 1 127 ? 66.070  12.709 38.496  1.00 9.60   ? 127  THR A HB   1 
ATOM   1840  H  HG1  . THR A 1 127 ? 65.567  11.441 36.770  1.00 15.51  ? 127  THR A HG1  1 
ATOM   1841  H  HG21 . THR A 1 127 ? 64.023  12.281 39.567  1.00 11.90  ? 127  THR A HG21 1 
ATOM   1842  H  HG22 . THR A 1 127 ? 63.271  13.138 38.491  1.00 11.90  ? 127  THR A HG22 1 
ATOM   1843  H  HG23 . THR A 1 127 ? 64.267  13.827 39.487  1.00 11.90  ? 127  THR A HG23 1 
ATOM   1844  N  N    . ASP A 1 128 ? 67.106  13.589 35.345  1.00 7.49   ? 128  ASP A N    1 
ATOM   1845  C  CA   . ASP A 1 128 ? 68.456  13.718 34.834  1.00 7.08   ? 128  ASP A CA   1 
ATOM   1846  C  C    . ASP A 1 128 ? 69.496  13.060 35.768  1.00 5.57   ? 128  ASP A C    1 
ATOM   1847  O  O    . ASP A 1 128 ? 70.627  13.556 35.835  1.00 8.65   ? 128  ASP A O    1 
ATOM   1848  C  CB   . ASP A 1 128 ? 68.749  15.190 34.542  1.00 10.68  ? 128  ASP A CB   1 
ATOM   1849  C  CG   . ASP A 1 128 ? 67.950  15.885 33.439  1.00 5.92   ? 128  ASP A CG   1 
ATOM   1850  O  OD1  . ASP A 1 128 ? 67.091  15.131 32.902  1.00 8.89   ? 128  ASP A OD1  1 
ATOM   1851  O  OD2  . ASP A 1 128 ? 68.168  17.076 33.147  1.00 7.13   ? 128  ASP A OD2  1 
ATOM   1852  H  H    . ASP A 1 128 ? 66.502  13.206 34.868  1.00 8.99   ? 128  ASP A H    1 
ATOM   1853  H  HA   . ASP A 1 128 ? 68.489  13.240 33.980  1.00 8.49   ? 128  ASP A HA   1 
ATOM   1854  H  HB2  . ASP A 1 128 ? 68.612  15.687 35.364  1.00 12.82  ? 128  ASP A HB2  1 
ATOM   1855  H  HB3  . ASP A 1 128 ? 69.690  15.265 34.317  1.00 12.82  ? 128  ASP A HB3  1 
ATOM   1856  N  N    . ILE A 1 129 ? 69.115  11.972 36.380  1.00 7.19   ? 129  ILE A N    1 
ATOM   1857  C  CA   . ILE A 1 129 ? 69.944  11.296 37.375  1.00 7.48   ? 129  ILE A CA   1 
ATOM   1858  C  C    . ILE A 1 129 ? 70.236  9.871  37.007  1.00 9.99   ? 129  ILE A C    1 
ATOM   1859  O  O    . ILE A 1 129 ? 70.740  9.074  37.844  1.00 9.72   ? 129  ILE A O    1 
ATOM   1860  C  CB   . ILE A 1 129 ? 69.281  11.403 38.787  1.00 7.91   ? 129  ILE A CB   1 
ATOM   1861  C  CG1  . ILE A 1 129 ? 70.298  11.259 39.913  1.00 9.77   ? 129  ILE A CG1  1 
ATOM   1862  C  CG2  . ILE A 1 129 ? 68.096  10.491 38.949  1.00 10.91  ? 129  ILE A CG2  1 
ATOM   1863  C  CD1  . ILE A 1 129 ? 69.710  11.698 41.268  1.00 11.75  ? 129  ILE A CD1  1 
ATOM   1864  H  H    . ILE A 1 129 ? 68.345  11.640 36.189  1.00 8.63   ? 129  ILE A H    1 
ATOM   1865  H  HA   . ILE A 1 129 ? 70.800  11.770 37.416  1.00 8.98   ? 129  ILE A HA   1 
ATOM   1866  H  HB   . ILE A 1 129 ? 68.930  12.315 38.853  1.00 9.49   ? 129  ILE A HB   1 
ATOM   1867  H  HG12 . ILE A 1 129 ? 70.583  10.334 39.972  1.00 11.72  ? 129  ILE A HG12 1 
ATOM   1868  H  HG13 . ILE A 1 129 ? 71.078  11.799 39.712  1.00 11.72  ? 129  ILE A HG13 1 
ATOM   1869  H  HG21 . ILE A 1 129 ? 67.484  10.629 38.223  1.00 16.36  ? 129  ILE A HG21 1 
ATOM   1870  H  HG22 . ILE A 1 129 ? 67.656  10.683 39.780  1.00 16.36  ? 129  ILE A HG22 1 
ATOM   1871  H  HG23 . ILE A 1 129 ? 68.393  9.578  38.949  1.00 16.36  ? 129  ILE A HG23 1 
ATOM   1872  H  HD11 . ILE A 1 129 ? 70.372  11.586 41.955  1.00 17.62  ? 129  ILE A HD11 1 
ATOM   1873  H  HD12 . ILE A 1 129 ? 68.942  11.161 41.473  1.00 17.62  ? 129  ILE A HD12 1 
ATOM   1874  H  HD13 . ILE A 1 129 ? 69.452  12.622 41.221  1.00 17.62  ? 129  ILE A HD13 1 
ATOM   1875  N  N    . ASN A 1 130 ? 69.977  9.447  35.754  1.00 10.39  ? 130  ASN A N    1 
ATOM   1876  C  CA   . ASN A 1 130 ? 70.569  8.197  35.306  1.00 9.30   ? 130  ASN A CA   1 
ATOM   1877  C  C    . ASN A 1 130 ? 72.069  8.221  35.451  1.00 8.09   ? 130  ASN A C    1 
ATOM   1878  O  O    . ASN A 1 130 ? 72.748  9.236  35.327  1.00 10.26  ? 130  ASN A O    1 
ATOM   1879  C  CB   . ASN A 1 130 ? 70.193  7.936  33.818  1.00 9.86   ? 130  ASN A CB   1 
ATOM   1880  C  CG   . ASN A 1 130 ? 68.864  7.206  33.739  1.00 11.59  ? 130  ASN A CG   1 
ATOM   1881  O  OD1  . ASN A 1 130 ? 68.632  6.149  34.291  1.00 12.40  ? 130  ASN A OD1  1 
ATOM   1882  N  ND2  . ASN A 1 130 ? 67.915  7.778  33.045  1.00 13.62  ? 130  ASN A ND2  1 
ATOM   1883  H  H    . ASN A 1 130 ? 69.473  9.907  35.231  1.00 12.47  ? 130  ASN A H    1 
ATOM   1884  H  HA   . ASN A 1 130 ? 70.213  7.466  35.853  1.00 11.16  ? 130  ASN A HA   1 
ATOM   1885  H  HB2  . ASN A 1 130 ? 70.130  8.780  33.345  1.00 11.84  ? 130  ASN A HB2  1 
ATOM   1886  H  HB3  . ASN A 1 130 ? 70.884  7.403  33.395  1.00 11.84  ? 130  ASN A HB3  1 
ATOM   1887  H  HD21 . ASN A 1 130 ? 67.143  7.405  32.985  1.00 16.35  ? 130  ASN A HD21 1 
ATOM   1888  H  HD22 . ASN A 1 130 ? 68.064  8.526  32.649  1.00 16.35  ? 130  ASN A HD22 1 
ATOM   1889  N  N    . THR A 1 131 ? 72.656  7.030  35.738  1.00 11.75  ? 131  THR A N    1 
ATOM   1890  C  CA   . THR A 1 131 ? 74.091  6.818  35.710  1.00 9.84   ? 131  THR A CA   1 
ATOM   1891  C  C    . THR A 1 131 ? 74.469  6.264  34.335  1.00 10.03  ? 131  THR A C    1 
ATOM   1892  O  O    . THR A 1 131 ? 73.605  5.843  33.568  1.00 11.47  ? 131  THR A O    1 
ATOM   1893  C  CB   . THR A 1 131 ? 74.607  5.919  36.835  1.00 11.57  ? 131  THR A CB   1 
ATOM   1894  O  OG1  . THR A 1 131 ? 74.201  4.576  36.609  1.00 16.48  ? 131  THR A OG1  1 
ATOM   1895  C  CG2  . THR A 1 131 ? 73.967  6.241  38.171  1.00 16.55  ? 131  THR A CG2  1 
ATOM   1896  H  H    . THR A 1 131 ? 72.151  6.367  35.949  1.00 14.10  ? 131  THR A H    1 
ATOM   1897  H  HA   . THR A 1 131 ? 74.522  7.692  35.806  1.00 11.81  ? 131  THR A HA   1 
ATOM   1898  H  HB   . THR A 1 131 ? 75.583  5.977  36.899  1.00 13.89  ? 131  THR A HB   1 
ATOM   1899  H  HG1  . THR A 1 131 ? 74.508  4.313  35.896  1.00 24.73  ? 131  THR A HG1  1 
ATOM   1900  H  HG21 . THR A 1 131 ? 74.322  5.656  38.845  1.00 24.83  ? 131  THR A HG21 1 
ATOM   1901  H  HG22 . THR A 1 131 ? 73.017  6.117  38.109  1.00 24.83  ? 131  THR A HG22 1 
ATOM   1902  H  HG23 . THR A 1 131 ? 74.156  7.152  38.406  1.00 24.83  ? 131  THR A HG23 1 
ATOM   1903  N  N    . PRO A 1 132 ? 75.736  6.243  33.983  1.00 12.16  ? 132  PRO A N    1 
ATOM   1904  C  CA   . PRO A 1 132 ? 76.126  5.588  32.721  1.00 12.06  ? 132  PRO A CA   1 
ATOM   1905  C  C    . PRO A 1 132 ? 75.760  4.138  32.530  1.00 14.30  ? 132  PRO A C    1 
ATOM   1906  O  O    . PRO A 1 132 ? 75.816  3.548  31.441  1.00 16.63  ? 132  PRO A O    1 
ATOM   1907  C  CB   . PRO A 1 132 ? 77.667  5.752  32.810  1.00 15.03  ? 132  PRO A CB   1 
ATOM   1908  C  CG   . PRO A 1 132 ? 77.849  7.021  33.530  1.00 12.29  ? 132  PRO A CG   1 
ATOM   1909  C  CD   . PRO A 1 132 ? 76.860  6.918  34.664  1.00 12.06  ? 132  PRO A CD   1 
ATOM   1910  H  HA   . PRO A 1 132 ? 75.787  6.111  31.965  1.00 14.47  ? 132  PRO A HA   1 
ATOM   1911  H  HB2  . PRO A 1 132 ? 78.066  5.015  33.299  1.00 18.03  ? 132  PRO A HB2  1 
ATOM   1912  H  HB3  . PRO A 1 132 ? 78.063  5.795  31.926  1.00 18.03  ? 132  PRO A HB3  1 
ATOM   1913  H  HG2  . PRO A 1 132 ? 78.756  7.107  33.863  1.00 14.75  ? 132  PRO A HG2  1 
ATOM   1914  H  HG3  . PRO A 1 132 ? 77.648  7.779  32.959  1.00 14.75  ? 132  PRO A HG3  1 
ATOM   1915  H  HD2  . PRO A 1 132 ? 77.209  6.384  35.395  1.00 14.47  ? 132  PRO A HD2  1 
ATOM   1916  H  HD3  . PRO A 1 132 ? 76.604  7.792  34.996  1.00 14.47  ? 132  PRO A HD3  1 
ATOM   1917  N  N    . LEU A 1 133 ? 75.436  3.362  33.545  1.00 14.07  ? 133  LEU A N    1 
ATOM   1918  C  CA   . LEU A 1 133 ? 74.941  2.019  33.716  1.00 14.63  ? 133  LEU A CA   1 
ATOM   1919  C  C    . LEU A 1 133 ? 73.437  1.908  33.906  1.00 19.09  ? 133  LEU A C    1 
ATOM   1920  O  O    . LEU A 1 133 ? 72.854  0.862  33.614  1.00 21.45  ? 133  LEU A O    1 
ATOM   1921  C  CB   . LEU A 1 133 ? 75.687  1.353  34.895  1.00 14.04  ? 133  LEU A CB   1 
ATOM   1922  C  CG   . LEU A 1 133 ? 77.207  1.385  34.935  1.00 19.72  ? 133  LEU A CG   1 
ATOM   1923  C  CD1  . LEU A 1 133 ? 77.668  0.583  36.152  1.00 19.85  ? 133  LEU A CD1  1 
ATOM   1924  C  CD2  . LEU A 1 133 ? 77.864  0.796  33.688  1.00 16.22  ? 133  LEU A CD2  1 
ATOM   1925  H  H    . LEU A 1 133 ? 75.550  3.759  34.300  1.00 16.89  ? 133  LEU A H    1 
ATOM   1926  H  HA   . LEU A 1 133 ? 75.170  1.518  32.906  1.00 17.56  ? 133  LEU A HA   1 
ATOM   1927  H  HB2  . LEU A 1 133 ? 75.366  1.765  35.713  1.00 16.85  ? 133  LEU A HB2  1 
ATOM   1928  H  HB3  . LEU A 1 133 ? 75.415  0.422  34.922  1.00 16.85  ? 133  LEU A HB3  1 
ATOM   1929  H  HG   . LEU A 1 133 ? 77.501  2.315  35.039  1.00 23.66  ? 133  LEU A HG   1 
ATOM   1930  H  HD11 . LEU A 1 133 ? 78.627  0.590  36.196  1.00 29.77  ? 133  LEU A HD11 1 
ATOM   1931  H  HD12 . LEU A 1 133 ? 77.358  -0.322 36.075  1.00 29.77  ? 133  LEU A HD12 1 
ATOM   1932  H  HD13 . LEU A 1 133 ? 77.308  0.977  36.950  1.00 29.77  ? 133  LEU A HD13 1 
ATOM   1933  H  HD21 . LEU A 1 133 ? 78.819  0.856  33.771  1.00 24.33  ? 133  LEU A HD21 1 
ATOM   1934  H  HD22 . LEU A 1 133 ? 77.579  1.287  32.914  1.00 24.33  ? 133  LEU A HD22 1 
ATOM   1935  H  HD23 . LEU A 1 133 ? 77.608  -0.124 33.596  1.00 24.33  ? 133  LEU A HD23 1 
ATOM   1936  N  N    . THR A 1 134 ? 72.649  2.908  34.325  1.00 12.78  ? 134  THR A N    1 
ATOM   1937  C  CA   . THR A 1 134 ? 71.212  2.750  34.350  1.00 12.56  ? 134  THR A CA   1 
ATOM   1938  C  C    . THR A 1 134 ? 70.549  3.334  33.100  1.00 13.32  ? 134  THR A C    1 
ATOM   1939  O  O    . THR A 1 134 ? 69.414  3.046  32.789  1.00 15.26  ? 134  THR A O    1 
ATOM   1940  C  CB   . THR A 1 134 ? 70.513  3.452  35.540  1.00 14.29  ? 134  THR A CB   1 
ATOM   1941  O  OG1  . THR A 1 134 ? 70.777  4.877  35.572  1.00 15.11  ? 134  THR A OG1  1 
ATOM   1942  C  CG2  . THR A 1 134 ? 71.007  2.903  36.859  1.00 15.30  ? 134  THR A CG2  1 
ATOM   1943  H  H    . THR A 1 134 ? 73.001  3.650  34.581  1.00 15.34  ? 134  THR A H    1 
ATOM   1944  H  HA   . THR A 1 134 ? 71.006  1.793  34.391  1.00 15.07  ? 134  THR A HA   1 
ATOM   1945  H  HB   . THR A 1 134 ? 69.546  3.307  35.475  1.00 17.14  ? 134  THR A HB   1 
ATOM   1946  H  HG1  . THR A 1 134 ? 70.523  5.218  34.871  1.00 22.66  ? 134  THR A HG1  1 
ATOM   1947  H  HG21 . THR A 1 134 ? 70.558  3.350  37.580  1.00 22.95  ? 134  THR A HG21 1 
ATOM   1948  H  HG22 . THR A 1 134 ? 71.953  3.048  36.931  1.00 22.95  ? 134  THR A HG22 1 
ATOM   1949  H  HG23 . THR A 1 134 ? 70.823  1.962  36.902  1.00 22.95  ? 134  THR A HG23 1 
ATOM   1950  N  N    . THR A 1 135 ? 71.254  4.215  32.398  1.00 12.92  ? 135  THR A N    1 
ATOM   1951  C  CA   . THR A 1 135 ? 70.729  4.836  31.188  1.00 11.06  ? 135  THR A CA   1 
ATOM   1952  C  C    . THR A 1 135 ? 70.340  3.786  30.154  1.00 11.23  ? 135  THR A C    1 
ATOM   1953  O  O    . THR A 1 135 ? 70.998  2.763  29.944  1.00 13.36  ? 135  THR A O    1 
ATOM   1954  C  CB   . THR A 1 135 ? 71.720  5.880  30.619  1.00 8.96   ? 135  THR A CB   1 
ATOM   1955  O  OG1  . THR A 1 135 ? 71.015  6.614  29.630  1.00 15.91  ? 135  THR A OG1  1 
ATOM   1956  C  CG2  . THR A 1 135 ? 72.973  5.231  30.073  1.00 10.52  ? 135  THR A CG2  1 
ATOM   1957  H  H    . THR A 1 135 ? 72.044  4.425  32.666  1.00 15.50  ? 135  THR A H    1 
ATOM   1958  H  HA   . THR A 1 135 ? 69.912  5.316  31.438  1.00 13.27  ? 135  THR A HA   1 
ATOM   1959  H  HB   . THR A 1 135 ? 71.976  6.494  31.339  1.00 10.75  ? 135  THR A HB   1 
ATOM   1960  H  HG1  . THR A 1 135 ? 71.406  6.552  28.912  1.00 23.87  ? 135  THR A HG1  1 
ATOM   1961  H  HG21 . THR A 1 135 ? 73.561  5.907  29.730  1.00 15.78  ? 135  THR A HG21 1 
ATOM   1962  H  HG22 . THR A 1 135 ? 72.737  4.624  29.367  1.00 15.78  ? 135  THR A HG22 1 
ATOM   1963  H  HG23 . THR A 1 135 ? 73.415  4.748  30.775  1.00 15.78  ? 135  THR A HG23 1 
ATOM   1964  N  N    . THR A 1 136 ? 69.189  4.073  29.527  1.00 13.69  ? 136  THR A N    1 
ATOM   1965  C  CA   . THR A 1 136 ? 68.786  3.256  28.362  1.00 11.75  ? 136  THR A CA   1 
ATOM   1966  C  C    . THR A 1 136 ? 68.991  3.993  27.042  1.00 14.83  ? 136  THR A C    1 
ATOM   1967  O  O    . THR A 1 136 ? 69.022  3.359  25.979  1.00 21.13  ? 136  THR A O    1 
ATOM   1968  C  CB   . THR A 1 136 ? 67.338  2.746  28.435  1.00 18.93  ? 136  THR A CB   1 
ATOM   1969  O  OG1  . THR A 1 136 ? 66.385  3.817  28.539  1.00 18.30  ? 136  THR A OG1  1 
ATOM   1970  C  CG2  . THR A 1 136 ? 67.215  1.836  29.656  1.00 20.95  ? 136  THR A CG2  1 
ATOM   1971  H  H    . THR A 1 136 ? 68.694  4.722  29.798  1.00 16.43  ? 136  THR A H    1 
ATOM   1972  H  HA   . THR A 1 136 ? 69.369  2.469  28.347  1.00 14.10  ? 136  THR A HA   1 
ATOM   1973  H  HB   . THR A 1 136 ? 67.144  2.225  27.628  1.00 22.72  ? 136  THR A HB   1 
ATOM   1974  H  HG1  . THR A 1 136 ? 65.960  3.737  29.236  1.00 27.44  ? 136  THR A HG1  1 
ATOM   1975  H  HG21 . THR A 1 136 ? 66.314  1.511  29.723  1.00 31.43  ? 136  THR A HG21 1 
ATOM   1976  H  HG22 . THR A 1 136 ? 67.436  2.331  30.448  1.00 31.43  ? 136  THR A HG22 1 
ATOM   1977  H  HG23 . THR A 1 136 ? 67.817  1.093  29.564  1.00 31.43  ? 136  THR A HG23 1 
ATOM   1978  N  N    . SER A 1 137 ? 69.087  5.300  27.040  1.00 12.93  ? 137  SER A N    1 
ATOM   1979  C  CA   . SER A 1 137 ? 69.209  6.062  25.790  1.00 15.15  ? 137  SER A CA   1 
ATOM   1980  C  C    . SER A 1 137 ? 70.655  6.310  25.408  1.00 14.40  ? 137  SER A C    1 
ATOM   1981  O  O    . SER A 1 137 ? 70.999  6.556  24.240  1.00 18.20  ? 137  SER A O    1 
ATOM   1982  C  CB   . SER A 1 137 ? 68.459  7.391  25.852  1.00 12.80  ? 137  SER A CB   1 
ATOM   1983  O  OG   . SER A 1 137 ? 68.795  8.210  26.941  1.00 15.91  ? 137  SER A OG   1 
ATOM   1984  H  H    . SER A 1 137 ? 69.077  5.722  27.789  1.00 15.51  ? 137  SER A H    1 
ATOM   1985  H  HA   . SER A 1 137 ? 68.803  5.527  25.077  1.00 18.17  ? 137  SER A HA   1 
ATOM   1986  H  HB2  . SER A 1 137 ? 68.632  7.881  25.033  1.00 15.36  ? 137  SER A HB2  1 
ATOM   1987  H  HB3  . SER A 1 137 ? 67.508  7.206  25.886  1.00 15.36  ? 137  SER A HB3  1 
ATOM   1988  H  HG   . SER A 1 137 ? 69.578  8.442  26.877  1.00 23.87  ? 137  SER A HG   1 
ATOM   1989  N  N    . GLY A 1 138 ? 71.575  6.273  26.306  1.00 13.91  ? 138  GLY A N    1 
ATOM   1990  C  CA   . GLY A 1 138 ? 72.962  6.715  26.416  1.00 11.08  ? 138  GLY A CA   1 
ATOM   1991  C  C    . GLY A 1 138 ? 73.211  8.201  26.278  1.00 10.37  ? 138  GLY A C    1 
ATOM   1992  O  O    . GLY A 1 138 ? 74.327  8.686  26.078  1.00 14.97  ? 138  GLY A O    1 
ATOM   1993  H  H    . GLY A 1 138 ? 71.303  5.889  27.027  1.00 16.70  ? 138  GLY A H    1 
ATOM   1994  H  HA2  . GLY A 1 138 ? 73.302  6.430  27.279  1.00 13.30  ? 138  GLY A HA2  1 
ATOM   1995  H  HA3  . GLY A 1 138 ? 73.480  6.257  25.736  1.00 13.30  ? 138  GLY A HA3  1 
ATOM   1996  N  N    . ASN A 1 139 ? 72.252  9.070  26.383  1.00 8.19   ? 139  ASN A N    1 
ATOM   1997  C  CA   . ASN A 1 139 ? 72.223  10.495 26.144  1.00 8.63   ? 139  ASN A CA   1 
ATOM   1998  C  C    . ASN A 1 139 ? 72.660  11.194 27.452  1.00 12.38  ? 139  ASN A C    1 
ATOM   1999  O  O    . ASN A 1 139 ? 71.938  11.090 28.455  1.00 10.75  ? 139  ASN A O    1 
ATOM   2000  C  CB   . ASN A 1 139 ? 70.948  11.113 25.596  1.00 12.96  ? 139  ASN A CB   1 
ATOM   2001  C  CG   . ASN A 1 139 ? 70.537  10.540 24.226  1.00 11.25  ? 139  ASN A CG   1 
ATOM   2002  O  OD1  . ASN A 1 139 ? 71.387  10.138 23.438  1.00 13.63  ? 139  ASN A OD1  1 
ATOM   2003  N  ND2  . ASN A 1 139 ? 69.244  10.504 24.002  1.00 11.62  ? 139  ASN A ND2  1 
ATOM   2004  H  H    . ASN A 1 139 ? 71.502  8.739  26.641  1.00 9.83   ? 139  ASN A H    1 
ATOM   2005  H  HA   . ASN A 1 139 ? 72.925  10.679 25.485  1.00 10.36  ? 139  ASN A HA   1 
ATOM   2006  H  HB2  . ASN A 1 139 ? 70.228  10.964 26.229  1.00 15.55  ? 139  ASN A HB2  1 
ATOM   2007  H  HB3  . ASN A 1 139 ? 71.073  12.072 25.512  1.00 15.55  ? 139  ASN A HB3  1 
ATOM   2008  H  HD21 . ASN A 1 139 ? 68.945  10.183 23.262  1.00 13.95  ? 139  ASN A HD21 1 
ATOM   2009  H  HD22 . ASN A 1 139 ? 68.697  10.802 24.594  1.00 13.95  ? 139  ASN A HD22 1 
ATOM   2010  N  N    . LEU A 1 140 ? 73.801  11.832 27.442  1.00 9.33   ? 140  LEU A N    1 
ATOM   2011  C  CA   . LEU A 1 140 ? 74.377  12.372 28.679  1.00 8.22   ? 140  LEU A CA   1 
ATOM   2012  C  C    . LEU A 1 140 ? 73.537  13.492 29.264  1.00 8.47   ? 140  LEU A C    1 
ATOM   2013  O  O    . LEU A 1 140 ? 73.658  13.729 30.488  1.00 9.53   ? 140  LEU A O    1 
ATOM   2014  C  CB   . LEU A 1 140 ? 75.831  12.781 28.424  1.00 10.63  ? 140  LEU A CB   1 
ATOM   2015  C  CG   . LEU A 1 140 ? 76.773  11.591 28.563  1.00 12.95  ? 140  LEU A CG   1 
ATOM   2016  C  CD1  . LEU A 1 140 ? 78.121  11.790 27.890  1.00 10.02  ? 140  LEU A CD1  1 
ATOM   2017  C  CD2  . LEU A 1 140 ? 76.994  11.245 30.036  1.00 12.56  ? 140  LEU A CD2  1 
ATOM   2018  H  H    . LEU A 1 140 ? 74.221  11.938 26.699  1.00 11.20  ? 140  LEU A H    1 
ATOM   2019  H  HA   . LEU A 1 140 ? 74.390  11.645 29.336  1.00 9.86   ? 140  LEU A HA   1 
ATOM   2020  H  HB2  . LEU A 1 140 ? 75.909  13.150 27.530  1.00 12.76  ? 140  LEU A HB2  1 
ATOM   2021  H  HB3  . LEU A 1 140 ? 76.087  13.470 29.056  1.00 12.76  ? 140  LEU A HB3  1 
ATOM   2022  H  HG   . LEU A 1 140 ? 76.341  10.820 28.140  1.00 15.54  ? 140  LEU A HG   1 
ATOM   2023  H  HD11 . LEU A 1 140 ? 78.663  11.008 28.021  1.00 15.03  ? 140  LEU A HD11 1 
ATOM   2024  H  HD12 . LEU A 1 140 ? 78.561  12.552 28.273  1.00 15.03  ? 140  LEU A HD12 1 
ATOM   2025  H  HD13 . LEU A 1 140 ? 77.990  11.935 26.950  1.00 15.03  ? 140  LEU A HD13 1 
ATOM   2026  H  HD21 . LEU A 1 140 ? 76.146  11.111 30.464  1.00 18.84  ? 140  LEU A HD21 1 
ATOM   2027  H  HD22 . LEU A 1 140 ? 77.461  11.965 30.467  1.00 18.84  ? 140  LEU A HD22 1 
ATOM   2028  H  HD23 . LEU A 1 140 ? 77.516  10.441 30.101  1.00 18.84  ? 140  LEU A HD23 1 
ATOM   2029  N  N    . HIS A 1 141 ? 72.643  14.163 28.540  1.00 9.83   ? 141  HIS A N    1 
ATOM   2030  C  CA   . HIS A 1 141 ? 71.794  15.199 29.136  1.00 7.92   ? 141  HIS A CA   1 
ATOM   2031  C  C    . HIS A 1 141 ? 70.804  14.583 30.134  1.00 10.74  ? 141  HIS A C    1 
ATOM   2032  O  O    . HIS A 1 141 ? 70.181  15.400 30.858  1.00 9.32   ? 141  HIS A O    1 
ATOM   2033  C  CB   . HIS A 1 141 ? 71.111  16.005 28.041  1.00 10.11  ? 141  HIS A CB   1 
ATOM   2034  C  CG   . HIS A 1 141 ? 69.957  15.348 27.341  1.00 7.32   ? 141  HIS A CG   1 
ATOM   2035  N  ND1  . HIS A 1 141 ? 68.910  16.046 26.762  1.00 8.38   ? 141  HIS A ND1  1 
ATOM   2036  C  CD2  . HIS A 1 141 ? 69.670  14.054 27.122  1.00 6.93   ? 141  HIS A CD2  1 
ATOM   2037  C  CE1  . HIS A 1 141 ? 68.065  15.168 26.263  1.00 7.54   ? 141  HIS A CE1  1 
ATOM   2038  N  NE2  . HIS A 1 141 ? 68.470  13.941 26.430  1.00 8.60   ? 141  HIS A NE2  1 
ATOM   2039  H  H    . HIS A 1 141 ? 72.561  13.984 27.702  1.00 11.80  ? 141  HIS A H    1 
ATOM   2040  H  HA   . HIS A 1 141 ? 72.376  15.809 29.635  1.00 9.50   ? 141  HIS A HA   1 
ATOM   2041  H  HB2  . HIS A 1 141 ? 70.796  16.836 28.429  1.00 12.13  ? 141  HIS A HB2  1 
ATOM   2042  H  HB3  . HIS A 1 141 ? 71.778  16.233 27.374  1.00 12.13  ? 141  HIS A HB3  1 
ATOM   2043  H  HD1  . HIS A 1 141 ? 68.827  16.902 26.732  1.00 10.06  ? 141  HIS A HD1  1 
ATOM   2044  H  HD2  . HIS A 1 141 ? 70.198  13.338 27.394  1.00 8.32   ? 141  HIS A HD2  1 
ATOM   2045  H  HE1  . HIS A 1 141 ? 67.268  15.398 25.841  1.00 9.05   ? 141  HIS A HE1  1 
ATOM   2046  H  HE2  . HIS A 1 141 ? 68.081  13.220 26.169  1.00 10.32  ? 141  HIS A HE2  1 
ATOM   2047  N  N    . GLY A 1 142 ? 70.649  13.273 30.147  1.00 7.58   ? 142  GLY A N    1 
ATOM   2048  C  CA   . GLY A 1 142 ? 69.813  12.553 31.091  1.00 8.88   ? 142  GLY A CA   1 
ATOM   2049  C  C    . GLY A 1 142 ? 70.594  12.038 32.291  1.00 7.13   ? 142  GLY A C    1 
ATOM   2050  O  O    . GLY A 1 142 ? 69.970  11.321 33.099  1.00 9.16   ? 142  GLY A O    1 
ATOM   2051  H  H    . GLY A 1 142 ? 71.072  12.814 29.556  1.00 9.10   ? 142  GLY A H    1 
ATOM   2052  H  HA2  . GLY A 1 142 ? 69.107  13.141 31.402  1.00 10.66  ? 142  GLY A HA2  1 
ATOM   2053  H  HA3  . GLY A 1 142 ? 69.398  11.803 30.638  1.00 10.66  ? 142  GLY A HA3  1 
ATOM   2054  N  N    . GLN A 1 143 ? 71.860  12.280 32.401  1.00 8.53   ? 143  GLN A N    1 
ATOM   2055  C  CA   . GLN A 1 143 ? 72.772  11.834 33.432  1.00 9.06   ? 143  GLN A CA   1 
ATOM   2056  C  C    . GLN A 1 143 ? 73.449  12.896 34.300  1.00 8.35   ? 143  GLN A C    1 
ATOM   2057  O  O    . GLN A 1 143 ? 74.199  12.439 35.201  1.00 10.54  ? 143  GLN A O    1 
ATOM   2058  C  CB   . GLN A 1 143 ? 73.859  10.937 32.821  1.00 7.74   ? 143  GLN A CB   1 
ATOM   2059  C  CG   . GLN A 1 143 ? 73.263  9.765  32.090  1.00 11.59  ? 143  GLN A CG   1 
ATOM   2060  C  CD   . GLN A 1 143 ? 74.346  9.043  31.307  1.00 12.64  ? 143  GLN A CD   1 
ATOM   2061  O  OE1  . GLN A 1 143 ? 75.367  8.569  31.781  1.00 11.27  ? 143  GLN A OE1  1 
ATOM   2062  N  NE2  . GLN A 1 143 ? 74.077  8.974  29.997  1.00 12.27  ? 143  GLN A NE2  1 
ATOM   2063  H  H    . GLN A 1 143 ? 72.203  12.768 31.782  1.00 10.24  ? 143  GLN A H    1 
ATOM   2064  H  HA   . GLN A 1 143 ? 72.252  11.268 34.039  1.00 10.88  ? 143  GLN A HA   1 
ATOM   2065  H  HB2  . GLN A 1 143 ? 74.397  11.459 32.205  1.00 9.29   ? 143  GLN A HB2  1 
ATOM   2066  H  HB3  . GLN A 1 143 ? 74.440  10.612 33.526  1.00 9.29   ? 143  GLN A HB3  1 
ATOM   2067  H  HG2  . GLN A 1 143 ? 72.857  9.155  32.725  1.00 13.90  ? 143  GLN A HG2  1 
ATOM   2068  H  HG3  . GLN A 1 143 ? 72.572  10.075 31.483  1.00 13.90  ? 143  GLN A HG3  1 
ATOM   2069  H  HE21 . GLN A 1 143 ? 74.630  8.587  29.464  1.00 14.73  ? 143  GLN A HE21 1 
ATOM   2070  H  HE22 . GLN A 1 143 ? 73.350  9.316  29.689  1.00 14.73  ? 143  GLN A HE22 1 
ATOM   2071  N  N    . PRO A 1 144 ? 73.304  14.190 34.112  1.00 8.17   ? 144  PRO A N    1 
ATOM   2072  C  CA   . PRO A 1 144 ? 74.266  15.084 34.821  1.00 10.09  ? 144  PRO A CA   1 
ATOM   2073  C  C    . PRO A 1 144 ? 74.237  14.995 36.344  1.00 10.70  ? 144  PRO A C    1 
ATOM   2074  O  O    . PRO A 1 144 ? 75.314  15.111 36.958  1.00 10.19  ? 144  PRO A O    1 
ATOM   2075  C  CB   . PRO A 1 144 ? 73.825  16.454 34.370  1.00 9.71   ? 144  PRO A CB   1 
ATOM   2076  C  CG   . PRO A 1 144 ? 72.437  16.355 33.911  1.00 7.38   ? 144  PRO A CG   1 
ATOM   2077  C  CD   . PRO A 1 144 ? 72.379  15.010 33.296  1.00 6.72   ? 144  PRO A CD   1 
ATOM   2078  H  HA   . PRO A 1 144 ? 75.175  14.909 34.500  1.00 12.11  ? 144  PRO A HA   1 
ATOM   2079  H  HB2  . PRO A 1 144 ? 73.889  17.083 35.105  1.00 11.65  ? 144  PRO A HB2  1 
ATOM   2080  H  HB3  . PRO A 1 144 ? 74.394  16.766 33.649  1.00 11.65  ? 144  PRO A HB3  1 
ATOM   2081  H  HG2  . PRO A 1 144 ? 71.817  16.427 34.653  1.00 8.85   ? 144  PRO A HG2  1 
ATOM   2082  H  HG3  . PRO A 1 144 ? 72.234  17.045 33.260  1.00 8.85   ? 144  PRO A HG3  1 
ATOM   2083  H  HD2  . PRO A 1 144 ? 71.478  14.652 33.331  1.00 8.06   ? 144  PRO A HD2  1 
ATOM   2084  H  HD3  . PRO A 1 144 ? 72.670  15.040 32.371  1.00 8.06   ? 144  PRO A HD3  1 
ATOM   2085  N  N    . VAL A 1 145 ? 73.070  14.823 36.938  1.00 9.26   ? 145  VAL A N    1 
ATOM   2086  C  CA   . VAL A 1 145 ? 73.020  14.804 38.420  1.00 8.35   ? 145  VAL A CA   1 
ATOM   2087  C  C    . VAL A 1 145 ? 73.785  13.643 38.993  1.00 12.20  ? 145  VAL A C    1 
ATOM   2088  O  O    . VAL A 1 145 ? 74.390  13.765 40.085  1.00 10.51  ? 145  VAL A O    1 
ATOM   2089  C  CB   . VAL A 1 145 ? 71.553  14.872 38.898  1.00 9.61   ? 145  VAL A CB   1 
ATOM   2090  C  CG1  . VAL A 1 145 ? 71.493  14.957 40.436  1.00 11.41  ? 145  VAL A CG1  1 
ATOM   2091  C  CG2  . VAL A 1 145 ? 70.856  16.062 38.266  1.00 10.30  ? 145  VAL A CG2  1 
ATOM   2092  H  H    . VAL A 1 145 ? 72.353  14.724 36.474  1.00 11.11  ? 145  VAL A H    1 
ATOM   2093  H  HA   . VAL A 1 145 ? 73.462  15.621 38.733  1.00 10.02  ? 145  VAL A HA   1 
ATOM   2094  H  HB   . VAL A 1 145 ? 71.094  14.054 38.613  1.00 11.53  ? 145  VAL A HB   1 
ATOM   2095  H  HG11 . VAL A 1 145 ? 71.945  14.199 40.816  1.00 17.11  ? 145  VAL A HG11 1 
ATOM   2096  H  HG12 . VAL A 1 145 ? 70.577  14.959 40.721  1.00 17.11  ? 145  VAL A HG12 1 
ATOM   2097  H  HG13 . VAL A 1 145 ? 71.921  15.765 40.729  1.00 17.11  ? 145  VAL A HG13 1 
ATOM   2098  H  HG21 . VAL A 1 145 ? 70.905  15.991 37.310  1.00 15.44  ? 145  VAL A HG21 1 
ATOM   2099  H  HG22 . VAL A 1 145 ? 71.286  16.872 38.549  1.00 15.44  ? 145  VAL A HG22 1 
ATOM   2100  H  HG23 . VAL A 1 145 ? 69.936  16.075 38.539  1.00 15.44  ? 145  VAL A HG23 1 
ATOM   2101  N  N    . SER A 1 146 ? 73.853  12.487 38.312  1.00 10.01  ? 146  SER A N    1 
ATOM   2102  C  CA   . SER A 1 146 ? 74.560  11.349 38.880  1.00 10.13  ? 146  SER A CA   1 
ATOM   2103  C  C    . SER A 1 146 ? 76.054  11.637 38.966  1.00 10.40  ? 146  SER A C    1 
ATOM   2104  O  O    . SER A 1 146 ? 76.659  11.072 39.897  1.00 12.56  ? 146  SER A O    1 
ATOM   2105  C  CB   . SER A 1 146 ? 74.393  10.032 38.124  1.00 10.09  ? 146  SER A CB   1 
ATOM   2106  O  OG   . SER A 1 146 ? 75.033  10.087 36.854  1.00 14.74  ? 146  SER A OG   1 
ATOM   2107  H  H    . SER A 1 146 ? 73.478  12.419 37.541  1.00 12.01  ? 146  SER A H    1 
ATOM   2108  H  HA   . SER A 1 146 ? 74.228  11.215 39.792  1.00 12.16  ? 146  SER A HA   1 
ATOM   2109  H  HB2  . SER A 1 146 ? 74.775  9.310  38.647  1.00 12.11  ? 146  SER A HB2  1 
ATOM   2110  H  HB3  . SER A 1 146 ? 73.449  9.848  38.002  1.00 12.11  ? 146  SER A HB3  1 
ATOM   2111  H  HG   . SER A 1 146 ? 74.702  10.689 36.407  1.00 22.11  ? 146  SER A HG   1 
ATOM   2112  N  N    . PHE A 1 147 ? 76.660  12.384 38.064  1.00 8.73   ? 147  PHE A N    1 
ATOM   2113  C  CA   . PHE A 1 147 ? 78.062  12.750 38.122  1.00 10.81  ? 147  PHE A CA   1 
ATOM   2114  C  C    . PHE A 1 147 ? 78.344  13.727 39.265  1.00 13.30  ? 147  PHE A C    1 
ATOM   2115  O  O    . PHE A 1 147 ? 79.497  13.807 39.716  1.00 15.07  ? 147  PHE A O    1 
ATOM   2116  C  CB   . PHE A 1 147 ? 78.517  13.378 36.818  1.00 12.09  ? 147  PHE A CB   1 
ATOM   2117  C  CG   . PHE A 1 147 ? 78.745  12.404 35.670  1.00 12.71  ? 147  PHE A CG   1 
ATOM   2118  C  CD1  . PHE A 1 147 ? 77.708  12.021 34.847  1.00 11.89  ? 147  PHE A CD1  1 
ATOM   2119  C  CD2  . PHE A 1 147 ? 80.009  11.891 35.434  1.00 16.82  ? 147  PHE A CD2  1 
ATOM   2120  C  CE1  . PHE A 1 147 ? 77.862  11.134 33.798  1.00 13.64  ? 147  PHE A CE1  1 
ATOM   2121  C  CE2  . PHE A 1 147 ? 80.195  11.011 34.376  1.00 15.84  ? 147  PHE A CE2  1 
ATOM   2122  C  CZ   . PHE A 1 147 ? 79.137  10.652 33.564  1.00 12.57  ? 147  PHE A CZ   1 
ATOM   2123  H  H    . PHE A 1 147 ? 76.196  12.672 37.400  1.00 10.48  ? 147  PHE A H    1 
ATOM   2124  H  HA   . PHE A 1 147 ? 78.588  11.937 38.274  1.00 12.98  ? 147  PHE A HA   1 
ATOM   2125  H  HB2  . PHE A 1 147 ? 77.852  14.027 36.541  1.00 14.51  ? 147  PHE A HB2  1 
ATOM   2126  H  HB3  . PHE A 1 147 ? 79.343  13.859 36.981  1.00 14.51  ? 147  PHE A HB3  1 
ATOM   2127  H  HD1  . PHE A 1 147 ? 76.863  12.375 35.005  1.00 14.26  ? 147  PHE A HD1  1 
ATOM   2128  H  HD2  . PHE A 1 147 ? 80.724  12.133 35.977  1.00 20.18  ? 147  PHE A HD2  1 
ATOM   2129  H  HE1  . PHE A 1 147 ? 77.141  10.874 33.272  1.00 16.37  ? 147  PHE A HE1  1 
ATOM   2130  H  HE2  . PHE A 1 147 ? 81.040  10.660 34.212  1.00 19.00  ? 147  PHE A HE2  1 
ATOM   2131  H  HZ   . PHE A 1 147 ? 79.283  10.076 32.848  1.00 15.09  ? 147  PHE A HZ   1 
ATOM   2132  N  N    . LEU A 1 148 ? 77.303  14.465 39.671  1.00 12.55  ? 148  LEU A N    1 
ATOM   2133  C  CA   . LEU A 1 148 ? 77.502  15.504 40.685  1.00 13.19  ? 148  LEU A CA   1 
ATOM   2134  C  C    . LEU A 1 148 ? 77.314  15.011 42.110  1.00 11.62  ? 148  LEU A C    1 
ATOM   2135  O  O    . LEU A 1 148 ? 77.868  15.690 42.999  1.00 13.94  ? 148  LEU A O    1 
ATOM   2136  C  CB   . LEU A 1 148 ? 76.534  16.663 40.417  1.00 10.80  ? 148  LEU A CB   1 
ATOM   2137  C  CG   . LEU A 1 148 ? 76.735  17.425 39.112  1.00 14.05  ? 148  LEU A CG   1 
ATOM   2138  C  CD1  . LEU A 1 148 ? 75.577  18.372 38.841  1.00 17.76  ? 148  LEU A CD1  1 
ATOM   2139  C  CD2  . LEU A 1 148 ? 78.049  18.187 39.110  1.00 16.38  ? 148  LEU A CD2  1 
ATOM   2140  H  H    . LEU A 1 148 ? 76.521  14.330 39.338  1.00 15.06  ? 148  LEU A H    1 
ATOM   2141  H  HA   . LEU A 1 148 ? 78.417  15.845 40.598  1.00 15.83  ? 148  LEU A HA   1 
ATOM   2142  H  HB2  . LEU A 1 148 ? 75.630  16.311 40.427  1.00 12.96  ? 148  LEU A HB2  1 
ATOM   2143  H  HB3  . LEU A 1 148 ? 76.606  17.294 41.151  1.00 12.96  ? 148  LEU A HB3  1 
ATOM   2144  H  HG   . LEU A 1 148 ? 76.765  16.770 38.383  1.00 16.86  ? 148  LEU A HG   1 
ATOM   2145  H  HD11 . LEU A 1 148 ? 74.752  17.880 38.850  1.00 26.64  ? 148  LEU A HD11 1 
ATOM   2146  H  HD12 . LEU A 1 148 ? 75.695  18.784 37.982  1.00 26.64  ? 148  LEU A HD12 1 
ATOM   2147  H  HD13 . LEU A 1 148 ? 75.552  19.050 39.521  1.00 26.64  ? 148  LEU A HD13 1 
ATOM   2148  H  HD21 . LEU A 1 148 ? 78.773  17.577 39.271  1.00 24.57  ? 148  LEU A HD21 1 
ATOM   2149  H  HD22 . LEU A 1 148 ? 78.033  18.854 39.801  1.00 24.57  ? 148  LEU A HD22 1 
ATOM   2150  H  HD23 . LEU A 1 148 ? 78.172  18.612 38.258  1.00 24.57  ? 148  LEU A HD23 1 
ATOM   2151  N  N    . LEU A 1 149 ? 76.637  13.940 42.327  1.00 10.94  ? 149  LEU A N    1 
ATOM   2152  C  CA   . LEU A 1 149 ? 76.249  13.532 43.674  1.00 14.07  ? 149  LEU A CA   1 
ATOM   2153  C  C    . LEU A 1 149 ? 77.337  12.721 44.348  1.00 11.67  ? 149  LEU A C    1 
ATOM   2154  O  O    . LEU A 1 149 ? 77.787  11.679 43.877  1.00 15.14  ? 149  LEU A O    1 
ATOM   2155  C  CB   . LEU A 1 149 ? 74.940  12.726 43.621  1.00 18.03  ? 149  LEU A CB   1 
ATOM   2156  C  CG   . LEU A 1 149 ? 73.652  13.527 43.479  1.00 15.26  ? 149  LEU A CG   1 
ATOM   2157  C  CD1  . LEU A 1 149 ? 72.529  12.532 43.208  1.00 19.79  ? 149  LEU A CD1  1 
ATOM   2158  C  CD2  . LEU A 1 149 ? 73.324  14.363 44.702  1.00 20.41  ? 149  LEU A CD2  1 
ATOM   2159  H  H    . LEU A 1 149 ? 76.407  13.449 41.660  1.00 13.13  ? 149  LEU A H    1 
ATOM   2160  H  HA   . LEU A 1 149 ? 76.092  14.339 44.207  1.00 16.89  ? 149  LEU A HA   1 
ATOM   2161  H  HB2  . LEU A 1 149 ? 74.995  12.109 42.875  1.00 21.64  ? 149  LEU A HB2  1 
ATOM   2162  H  HB3  . LEU A 1 149 ? 74.879  12.196 44.430  1.00 21.64  ? 149  LEU A HB3  1 
ATOM   2163  H  HG   . LEU A 1 149 ? 73.737  14.123 42.706  1.00 18.31  ? 149  LEU A HG   1 
ATOM   2164  H  HD11 . LEU A 1 149 ? 72.751  12.000 42.440  1.00 29.68  ? 149  LEU A HD11 1 
ATOM   2165  H  HD12 . LEU A 1 149 ? 71.712  13.009 43.040  1.00 29.68  ? 149  LEU A HD12 1 
ATOM   2166  H  HD13 . LEU A 1 149 ? 72.415  11.961 43.971  1.00 29.68  ? 149  LEU A HD13 1 
ATOM   2167  H  HD21 . LEU A 1 149 ? 72.505  14.841 44.552  1.00 30.62  ? 149  LEU A HD21 1 
ATOM   2168  H  HD22 . LEU A 1 149 ? 74.034  14.989 44.862  1.00 30.62  ? 149  LEU A HD22 1 
ATOM   2169  H  HD23 . LEU A 1 149 ? 73.225  13.789 45.465  1.00 30.62  ? 149  LEU A HD23 1 
ATOM   2170  N  N    . LYS A 1 150 ? 77.765  13.208 45.513  1.00 14.43  ? 150  LYS A N    1 
ATOM   2171  C  CA   . LYS A 1 150 ? 78.768  12.465 46.271  1.00 18.64  ? 150  LYS A CA   1 
ATOM   2172  C  C    . LYS A 1 150 ? 78.308  11.052 46.622  1.00 16.85  ? 150  LYS A C    1 
ATOM   2173  O  O    . LYS A 1 150 ? 79.149  10.153 46.593  1.00 18.44  ? 150  LYS A O    1 
ATOM   2174  C  CB   . LYS A 1 150 ? 79.109  13.267 47.524  1.00 17.85  ? 150  LYS A CB   1 
ATOM   2175  C  CG   . LYS A 1 150 ? 79.467  14.726 47.320  1.00 18.83  ? 150  LYS A CG   1 
ATOM   2176  C  CD   . LYS A 1 150 ? 79.836  15.355 48.667  1.00 27.34  ? 150  LYS A CD   1 
ATOM   2177  C  CE   . LYS A 1 150 ? 80.582  16.649 48.487  1.00 20.71  ? 150  LYS A CE   1 
ATOM   2178  N  NZ   . LYS A 1 150 ? 81.022  17.203 49.815  1.00 22.53  ? 150  LYS A NZ   1 
ATOM   2179  H  H    . LYS A 1 150 ? 77.455  13.951 45.814  1.00 17.32  ? 150  LYS A H    1 
ATOM   2180  H  HA   . LYS A 1 150 ? 79.578  12.396 45.723  1.00 22.37  ? 150  LYS A HA   1 
ATOM   2181  H  HB2  . LYS A 1 150 ? 78.349  13.223 48.126  1.00 21.42  ? 150  LYS A HB2  1 
ATOM   2182  H  HB3  . LYS A 1 150 ? 79.854  12.832 47.967  1.00 21.42  ? 150  LYS A HB3  1 
ATOM   2183  H  HG2  . LYS A 1 150 ? 80.216  14.797 46.708  1.00 22.60  ? 150  LYS A HG2  1 
ATOM   2184  H  HG3  . LYS A 1 150 ? 78.713  15.198 46.934  1.00 22.60  ? 150  LYS A HG3  1 
ATOM   2185  H  HD2  . LYS A 1 150 ? 79.028  15.519 49.177  1.00 32.81  ? 150  LYS A HD2  1 
ATOM   2186  H  HD3  . LYS A 1 150 ? 80.387  14.735 49.170  1.00 32.81  ? 150  LYS A HD3  1 
ATOM   2187  H  HE2  . LYS A 1 150 ? 81.359  16.499 47.925  1.00 24.85  ? 150  LYS A HE2  1 
ATOM   2188  H  HE3  . LYS A 1 150 ? 80.009  17.293 48.042  1.00 24.85  ? 150  LYS A HE3  1 
ATOM   2189  H  HZ1  . LYS A 1 150 ? 81.421  17.988 49.691  1.00 33.79  ? 150  LYS A HZ1  1 
ATOM   2190  H  HZ2  . LYS A 1 150 ? 81.593  16.637 50.197  1.00 33.79  ? 150  LYS A HZ2  1 
ATOM   2191  H  HZ3  . LYS A 1 150 ? 80.313  17.310 50.341  1.00 33.79  ? 150  LYS A HZ3  1 
ATOM   2192  N  N    . GLU A 1 151 ? 77.048  10.786 46.937  1.00 15.76  ? 151  GLU A N    1 
ATOM   2193  C  CA   . GLU A 1 151 ? 76.598  9.443  47.313  1.00 18.03  ? 151  GLU A CA   1 
ATOM   2194  C  C    . GLU A 1 151 ? 76.756  8.439  46.175  1.00 21.45  ? 151  GLU A C    1 
ATOM   2195  O  O    . GLU A 1 151 ? 76.906  7.233  46.431  1.00 20.33  ? 151  GLU A O    1 
ATOM   2196  C  CB   . GLU A 1 151 ? 75.164  9.517  47.825  1.00 19.95  ? 151  GLU A CB   1 
ATOM   2197  C  CG   . GLU A 1 151 ? 74.948  10.219 49.155  1.00 14.73  ? 151  GLU A CG   1 
ATOM   2198  C  CD   . GLU A 1 151 ? 74.757  11.710 49.068  1.00 18.70  ? 151  GLU A CD   1 
ATOM   2199  O  OE1  . GLU A 1 151 ? 74.935  12.310 47.976  1.00 18.48  ? 151  GLU A OE1  1 
ATOM   2200  O  OE2  . GLU A 1 151 ? 74.417  12.380 50.081  1.00 25.76  ? 151  GLU A OE2  1 
ATOM   2201  H  H    . GLU A 1 151 ? 76.473  11.426 46.921  1.00 18.92  ? 151  GLU A H    1 
ATOM   2202  H  HA   . GLU A 1 151 ? 77.161  9.140  48.055  1.00 21.63  ? 151  GLU A HA   1 
ATOM   2203  H  HB2  . GLU A 1 151 ? 74.627  9.969  47.155  1.00 23.94  ? 151  GLU A HB2  1 
ATOM   2204  H  HB3  . GLU A 1 151 ? 74.824  8.612  47.904  1.00 23.94  ? 151  GLU A HB3  1 
ATOM   2205  H  HG2  . GLU A 1 151 ? 74.168  9.834  49.583  1.00 17.68  ? 151  GLU A HG2  1 
ATOM   2206  H  HG3  . GLU A 1 151 ? 75.712  10.040 49.725  1.00 17.68  ? 151  GLU A HG3  1 
ATOM   2207  N  N    . LEU A 1 152 ? 76.767  8.916  44.929  1.00 16.92  ? 152  LEU A N    1 
ATOM   2208  C  CA   . LEU A 1 152 ? 76.782  7.995  43.791  1.00 14.55  ? 152  LEU A CA   1 
ATOM   2209  C  C    . LEU A 1 152 ? 78.208  7.761  43.289  1.00 18.20  ? 152  LEU A C    1 
ATOM   2210  O  O    . LEU A 1 152 ? 78.455  7.050  42.308  1.00 18.91  ? 152  LEU A O    1 
ATOM   2211  C  CB   . LEU A 1 152 ? 75.922  8.522  42.661  1.00 15.65  ? 152  LEU A CB   1 
ATOM   2212  C  CG   . LEU A 1 152 ? 74.595  7.892  42.262  1.00 34.44  ? 152  LEU A CG   1 
ATOM   2213  C  CD1  . LEU A 1 152 ? 73.987  6.986  43.316  1.00 23.12  ? 152  LEU A CD1  1 
ATOM   2214  C  CD2  . LEU A 1 152 ? 73.609  9.000  41.872  1.00 17.58  ? 152  LEU A CD2  1 
ATOM   2215  H  H    . LEU A 1 152 ? 76.766  9.765  44.794  1.00 20.30  ? 152  LEU A H    1 
ATOM   2216  H  HA   . LEU A 1 152 ? 76.413  7.136  44.085  1.00 17.46  ? 152  LEU A HA   1 
ATOM   2217  H  HB2  . LEU A 1 152 ? 75.735  9.452  42.866  1.00 18.79  ? 152  LEU A HB2  1 
ATOM   2218  H  HB3  . LEU A 1 152 ? 76.478  8.521  41.866  1.00 18.79  ? 152  LEU A HB3  1 
ATOM   2219  H  HG   . LEU A 1 152 ? 74.756  7.347  41.464  1.00 41.33  ? 152  LEU A HG   1 
ATOM   2220  H  HD11 . LEU A 1 152 ? 73.150  6.639  42.996  1.00 34.68  ? 152  LEU A HD11 1 
ATOM   2221  H  HD12 . LEU A 1 152 ? 73.838  7.486  44.122  1.00 34.68  ? 152  LEU A HD12 1 
ATOM   2222  H  HD13 . LEU A 1 152 ? 74.586  6.258  43.497  1.00 34.68  ? 152  LEU A HD13 1 
ATOM   2223  H  HD21 . LEU A 1 152 ? 74.006  9.560  41.200  1.00 26.36  ? 152  LEU A HD21 1 
ATOM   2224  H  HD22 . LEU A 1 152 ? 73.399  9.529  42.645  1.00 26.36  ? 152  LEU A HD22 1 
ATOM   2225  H  HD23 . LEU A 1 152 ? 72.805  8.606  41.525  1.00 26.36  ? 152  LEU A HD23 1 
ATOM   2226  N  N    . LYS A 1 153 ? 79.157  8.299  44.070  1.00 21.05  ? 153  LYS A N    1 
ATOM   2227  C  CA   . LYS A 1 153 ? 80.531  7.956  43.863  1.00 31.14  ? 153  LYS A CA   1 
ATOM   2228  C  C    . LYS A 1 153 ? 80.633  6.469  44.184  1.00 24.23  ? 153  LYS A C    1 
ATOM   2229  O  O    . LYS A 1 153 ? 80.230  6.027  45.265  1.00 41.02  ? 153  LYS A O    1 
ATOM   2230  C  CB   A LYS A 1 153 ? 81.571  8.785  44.550  0.71 26.67  ? 153  LYS A CB   1 
ATOM   2231  C  CB   B LYS A 1 153 ? 81.638  8.775  44.441  0.29 28.23  ? 153  LYS A CB   1 
ATOM   2232  C  CG   A LYS A 1 153 ? 83.021  8.649  44.142  0.71 31.34  ? 153  LYS A CG   1 
ATOM   2233  C  CG   B LYS A 1 153 ? 81.611  9.010  45.921  0.29 30.88  ? 153  LYS A CG   1 
ATOM   2234  C  CD   A LYS A 1 153 ? 83.974  8.636  45.326  0.71 50.34  ? 153  LYS A CD   1 
ATOM   2235  C  CD   B LYS A 1 153 ? 82.185  7.888  46.754  0.29 34.95  ? 153  LYS A CD   1 
ATOM   2236  C  CE   A LYS A 1 153 ? 83.827  7.368  46.144  0.71 57.00  ? 153  LYS A CE   1 
ATOM   2237  C  CE   B LYS A 1 153 ? 81.185  7.196  47.657  0.29 34.70  ? 153  LYS A CE   1 
ATOM   2238  N  NZ   A LYS A 1 153 ? 83.092  7.645  47.447  0.71 48.02  ? 153  LYS A NZ   1 
ATOM   2239  N  NZ   B LYS A 1 153 ? 80.061  8.036  48.142  0.29 11.92  ? 153  LYS A NZ   1 
ATOM   2240  H  H    . LYS A 1 153 ? 79.002  8.984  44.538  1.00 25.25  ? 153  LYS A H    1 
ATOM   2241  H  HA   . LYS A 1 153 ? 80.772  8.013  42.813  1.00 37.37  ? 153  LYS A HA   1 
ATOM   2242  H  HB2  A LYS A 1 153 ? 81.321  9.719  44.469  0.71 32.00  ? 153  LYS A HB2  1 
ATOM   2243  H  HB2  B LYS A 1 153 ? 82.488  8.356  44.235  0.29 33.88  ? 153  LYS A HB2  1 
ATOM   2244  H  HB3  A LYS A 1 153 ? 81.496  8.546  45.487  0.71 32.00  ? 153  LYS A HB3  1 
ATOM   2245  H  HB3  B LYS A 1 153 ? 81.644  9.646  44.014  0.29 33.88  ? 153  LYS A HB3  1 
ATOM   2246  H  HG2  A LYS A 1 153 ? 83.131  7.826  43.640  0.71 37.61  ? 153  LYS A HG2  1 
ATOM   2247  H  HG2  B LYS A 1 153 ? 82.105  9.822  46.114  0.29 37.05  ? 153  LYS A HG2  1 
ATOM   2248  H  HG3  A LYS A 1 153 ? 83.255  9.386  43.557  0.71 37.61  ? 153  LYS A HG3  1 
ATOM   2249  H  HG3  B LYS A 1 153 ? 80.691  9.157  46.193  0.29 37.05  ? 153  LYS A HG3  1 
ATOM   2250  H  HD2  A LYS A 1 153 ? 84.886  8.706  45.004  0.71 60.41  ? 153  LYS A HD2  1 
ATOM   2251  H  HD2  B LYS A 1 153 ? 82.573  7.227  46.158  0.29 41.94  ? 153  LYS A HD2  1 
ATOM   2252  H  HD3  A LYS A 1 153 ? 83.795  9.405  45.890  0.71 60.41  ? 153  LYS A HD3  1 
ATOM   2253  H  HD3  B LYS A 1 153 ? 82.902  8.244  47.302  0.29 41.94  ? 153  LYS A HD3  1 
ATOM   2254  H  HE2  A LYS A 1 153 ? 83.336  6.707  45.631  0.71 68.40  ? 153  LYS A HE2  1 
ATOM   2255  H  HE2  B LYS A 1 153 ? 80.815  6.438  47.177  0.29 41.64  ? 153  LYS A HE2  1 
ATOM   2256  H  HE3  A LYS A 1 153 ? 84.705  7.005  46.339  0.71 68.40  ? 153  LYS A HE3  1 
ATOM   2257  H  HE3  B LYS A 1 153 ? 81.660  6.848  48.427  0.29 41.64  ? 153  LYS A HE3  1 
ATOM   2258  H  HZ1  A LYS A 1 153 ? 83.049  6.897  47.928  0.71 72.03  ? 153  LYS A HZ1  1 
ATOM   2259  H  HZ1  B LYS A 1 153 ? 79.698  7.659  48.862  0.29 17.88  ? 153  LYS A HZ1  1 
ATOM   2260  H  HZ2  A LYS A 1 153 ? 82.268  7.930  47.269  0.71 72.03  ? 153  LYS A HZ2  1 
ATOM   2261  H  HZ2  B LYS A 1 153 ? 79.446  8.106  47.502  0.29 17.88  ? 153  LYS A HZ2  1 
ATOM   2262  H  HZ3  A LYS A 1 153 ? 83.529  8.269  47.908  0.71 72.03  ? 153  LYS A HZ3  1 
ATOM   2263  H  HZ3  B LYS A 1 153 ? 80.365  8.846  48.352  0.29 17.88  ? 153  LYS A HZ3  1 
ATOM   2264  N  N    . GLY A 1 154 ? 81.194  5.727  43.205  1.00 19.46  ? 154  GLY A N    1 
ATOM   2265  C  CA   . GLY A 1 154 ? 81.333  4.276  43.271  1.00 19.48  ? 154  GLY A CA   1 
ATOM   2266  C  C    . GLY A 1 154 ? 80.439  3.639  42.205  1.00 20.83  ? 154  GLY A C    1 
ATOM   2267  O  O    . GLY A 1 154 ? 80.725  2.567  41.674  1.00 20.98  ? 154  GLY A O    1 
ATOM   2268  H  H    . GLY A 1 154 ? 81.560  6.098  42.715  1.00 23.36  ? 154  GLY A H    1 
ATOM   2269  H  HA2  . GLY A 1 154 ? 82.279  4.104  42.937  1.00 23.38  ? 154  GLY A HA2  1 
ATOM   2270  H  HA3  . GLY A 1 154 ? 81.228  3.851  44.069  1.00 23.38  ? 154  GLY A HA3  1 
ATOM   2271  N  N    . LYS A 1 155 ? 79.347  4.330  41.886  1.00 17.10  ? 155  LYS A N    1 
ATOM   2272  C  CA   . LYS A 1 155 ? 78.408  3.866  40.889  1.00 13.31  ? 155  LYS A CA   1 
ATOM   2273  C  C    . LYS A 1 155 ? 78.672  4.517  39.502  1.00 16.86  ? 155  LYS A C    1 
ATOM   2274  O  O    . LYS A 1 155 ? 78.024  4.148  38.515  1.00 16.27  ? 155  LYS A O    1 
ATOM   2275  C  CB   . LYS A 1 155 ? 76.945  4.138  41.305  1.00 15.83  ? 155  LYS A CB   1 
ATOM   2276  C  CG   . LYS A 1 155 ? 76.600  3.658  42.715  1.00 21.89  ? 155  LYS A CG   1 
ATOM   2277  C  CD   . LYS A 1 155 ? 76.887  2.173  42.905  1.00 22.42  ? 155  LYS A CD   1 
ATOM   2278  C  CE   . LYS A 1 155 ? 76.345  1.342  41.775  1.00 20.64  ? 155  LYS A CE   1 
ATOM   2279  N  NZ   . LYS A 1 155 ? 76.422  -0.116 42.067  1.00 30.80  ? 155  LYS A NZ   1 
ATOM   2280  H  H    . LYS A 1 155 ? 79.195  5.077  42.285  1.00 20.52  ? 155  LYS A H    1 
ATOM   2281  H  HA   . LYS A 1 155 ? 78.522  2.898  40.790  1.00 15.98  ? 155  LYS A HA   1 
ATOM   2282  H  HB2  . LYS A 1 155 ? 76.785  5.095  41.277  1.00 19.00  ? 155  LYS A HB2  1 
ATOM   2283  H  HB3  . LYS A 1 155 ? 76.353  3.721  40.660  1.00 19.00  ? 155  LYS A HB3  1 
ATOM   2284  H  HG2  . LYS A 1 155 ? 77.081  4.147  43.347  1.00 26.27  ? 155  LYS A HG2  1 
ATOM   2285  H  HG3  . LYS A 1 155 ? 75.651  3.747  42.841  1.00 26.27  ? 155  LYS A HG3  1 
ATOM   2286  H  HD2  . LYS A 1 155 ? 77.915  2.075  42.820  1.00 26.90  ? 155  LYS A HD2  1 
ATOM   2287  H  HD3  . LYS A 1 155 ? 76.641  1.867  43.710  1.00 26.90  ? 155  LYS A HD3  1 
ATOM   2288  H  HE2  . LYS A 1 155 ? 75.379  1.373  41.836  1.00 24.77  ? 155  LYS A HE2  1 
ATOM   2289  H  HE3  . LYS A 1 155 ? 76.608  1.660  40.909  1.00 24.77  ? 155  LYS A HE3  1 
ATOM   2290  H  HZ1  . LYS A 1 155 ? 76.094  -0.574 41.378  1.00 46.20  ? 155  LYS A HZ1  1 
ATOM   2291  H  HZ2  . LYS A 1 155 ? 75.948  -0.298 42.798  1.00 46.20  ? 155  LYS A HZ2  1 
ATOM   2292  H  HZ3  . LYS A 1 155 ? 77.271  -0.348 42.199  1.00 46.20  ? 155  LYS A HZ3  1 
ATOM   2293  N  N    . ILE A 1 156 ? 79.580  5.471  39.402  1.00 15.60  ? 156  ILE A N    1 
ATOM   2294  C  CA   . ILE A 1 156 ? 79.886  6.103  38.127  1.00 14.61  ? 156  ILE A CA   1 
ATOM   2295  C  C    . ILE A 1 156 ? 81.157  5.445  37.587  1.00 22.32  ? 156  ILE A C    1 
ATOM   2296  O  O    . ILE A 1 156 ? 82.241  5.611  38.162  1.00 19.51  ? 156  ILE A O    1 
ATOM   2297  C  CB   . ILE A 1 156 ? 80.082  7.609  38.221  1.00 13.31  ? 156  ILE A CB   1 
ATOM   2298  C  CG1  . ILE A 1 156 ? 78.974  8.300  39.033  1.00 12.00  ? 156  ILE A CG1  1 
ATOM   2299  C  CG2  . ILE A 1 156 ? 80.208  8.272  36.854  1.00 19.21  ? 156  ILE A CG2  1 
ATOM   2300  C  CD1  . ILE A 1 156 ? 77.579  7.993  38.578  1.00 16.57  ? 156  ILE A CD1  1 
ATOM   2301  H  H    . ILE A 1 156 ? 80.009  5.730  40.102  1.00 18.72  ? 156  ILE A H    1 
ATOM   2302  H  HA   . ILE A 1 156 ? 79.151  5.921  37.504  1.00 17.53  ? 156  ILE A HA   1 
ATOM   2303  H  HB   . ILE A 1 156 ? 80.926  7.761  38.695  1.00 15.98  ? 156  ILE A HB   1 
ATOM   2304  H  HG12 . ILE A 1 156 ? 79.061  8.035  39.963  1.00 14.41  ? 156  ILE A HG12 1 
ATOM   2305  H  HG13 . ILE A 1 156 ? 79.110  9.259  38.988  1.00 14.41  ? 156  ILE A HG13 1 
ATOM   2306  H  HG21 . ILE A 1 156 ? 80.331  9.217  36.968  1.00 28.81  ? 156  ILE A HG21 1 
ATOM   2307  H  HG22 . ILE A 1 156 ? 79.410  8.112  36.346  1.00 28.81  ? 156  ILE A HG22 1 
ATOM   2308  H  HG23 . ILE A 1 156 ? 80.963  7.905  36.389  1.00 28.81  ? 156  ILE A HG23 1 
ATOM   2309  H  HD11 . ILE A 1 156 ? 76.952  8.474  39.122  1.00 24.85  ? 156  ILE A HD11 1 
ATOM   2310  H  HD12 . ILE A 1 156 ? 77.417  7.050  38.658  1.00 24.85  ? 156  ILE A HD12 1 
ATOM   2311  H  HD13 . ILE A 1 156 ? 77.477  8.258  37.661  1.00 24.85  ? 156  ILE A HD13 1 
ATOM   2312  N  N    . PRO A 1 157 ? 81.089  4.696  36.488  1.00 17.83  ? 157  PRO A N    1 
ATOM   2313  C  CA   . PRO A 1 157 ? 82.354  4.161  35.958  1.00 18.63  ? 157  PRO A CA   1 
ATOM   2314  C  C    . PRO A 1 157 ? 83.227  5.301  35.475  1.00 16.23  ? 157  PRO A C    1 
ATOM   2315  O  O    . PRO A 1 157 ? 82.806  6.441  35.377  1.00 18.42  ? 157  PRO A O    1 
ATOM   2316  C  CB   . PRO A 1 157 ? 81.927  3.275  34.797  1.00 21.28  ? 157  PRO A CB   1 
ATOM   2317  C  CG   . PRO A 1 157 ? 80.493  3.545  34.547  1.00 24.64  ? 157  PRO A CG   1 
ATOM   2318  C  CD   . PRO A 1 157 ? 79.928  4.313  35.694  1.00 18.12  ? 157  PRO A CD   1 
ATOM   2319  H  HA   . PRO A 1 157 ? 82.820  3.635  36.641  1.00 22.36  ? 157  PRO A HA   1 
ATOM   2320  H  HB2  . PRO A 1 157 ? 82.451  3.480  34.007  1.00 25.54  ? 157  PRO A HB2  1 
ATOM   2321  H  HB3  . PRO A 1 157 ? 82.059  2.341  35.021  1.00 25.54  ? 157  PRO A HB3  1 
ATOM   2322  H  HG2  . PRO A 1 157 ? 80.393  4.056  33.729  1.00 29.57  ? 157  PRO A HG2  1 
ATOM   2323  H  HG3  . PRO A 1 157 ? 80.014  2.708  34.444  1.00 29.57  ? 157  PRO A HG3  1 
ATOM   2324  H  HD2  . PRO A 1 157 ? 79.449  5.097  35.382  1.00 21.74  ? 157  PRO A HD2  1 
ATOM   2325  H  HD3  . PRO A 1 157 ? 79.321  3.761  36.213  1.00 21.74  ? 157  PRO A HD3  1 
ATOM   2326  N  N    . ASP A 1 158 ? 84.472  4.946  35.176  1.00 19.86  ? 158  ASP A N    1 
ATOM   2327  C  CA   . ASP A 1 158 ? 85.431  5.879  34.594  1.00 21.16  ? 158  ASP A CA   1 
ATOM   2328  C  C    . ASP A 1 158 ? 85.165  6.092  33.118  1.00 22.61  ? 158  ASP A C    1 
ATOM   2329  O  O    . ASP A 1 158 ? 85.643  5.373  32.243  1.00 26.76  ? 158  ASP A O    1 
ATOM   2330  C  CB   . ASP A 1 158 ? 86.843  5.338  34.859  1.00 27.88  ? 158  ASP A CB   1 
ATOM   2331  C  CG   . ASP A 1 158 ? 87.192  5.427  36.347  1.00 38.20  ? 158  ASP A CG   1 
ATOM   2332  O  OD1  . ASP A 1 158 ? 86.566  6.232  37.079  1.00 41.77  ? 158  ASP A OD1  1 
ATOM   2333  O  OD2  . ASP A 1 158 ? 88.093  4.705  36.827  1.00 45.34  ? 158  ASP A OD2  1 
ATOM   2334  H  H    . ASP A 1 158 ? 84.721  4.137  35.331  1.00 23.84  ? 158  ASP A H    1 
ATOM   2335  H  HA   . ASP A 1 158 ? 85.340  6.741  35.051  1.00 25.39  ? 158  ASP A HA   1 
ATOM   2336  H  HB2  . ASP A 1 158 ? 86.894  4.413  34.571  1.00 33.46  ? 158  ASP A HB2  1 
ATOM   2337  H  HB3  . ASP A 1 158 ? 87.487  5.850  34.345  1.00 33.46  ? 158  ASP A HB3  1 
ATOM   2338  N  N    . VAL A 1 159 ? 84.357  7.104  32.859  1.00 17.80  ? 159  VAL A N    1 
ATOM   2339  C  CA   . VAL A 1 159 ? 83.879  7.427  31.520  1.00 15.54  ? 159  VAL A CA   1 
ATOM   2340  C  C    . VAL A 1 159 ? 84.904  8.327  30.873  1.00 12.76  ? 159  VAL A C    1 
ATOM   2341  O  O    . VAL A 1 159 ? 85.294  9.318  31.489  1.00 15.40  ? 159  VAL A O    1 
ATOM   2342  C  CB   . VAL A 1 159 ? 82.502  8.113  31.594  1.00 15.42  ? 159  VAL A CB   1 
ATOM   2343  C  CG1  . VAL A 1 159 ? 82.092  8.605  30.213  1.00 14.35  ? 159  VAL A CG1  1 
ATOM   2344  C  CG2  . VAL A 1 159 ? 81.526  7.133  32.226  1.00 15.70  ? 159  VAL A CG2  1 
ATOM   2345  H  H    . VAL A 1 159 ? 84.100  7.597  33.514  1.00 21.36  ? 159  VAL A H    1 
ATOM   2346  H  HA   . VAL A 1 159 ? 83.801  6.601  30.998  1.00 18.65  ? 159  VAL A HA   1 
ATOM   2347  H  HB   . VAL A 1 159 ? 82.579  8.891  32.185  1.00 18.50  ? 159  VAL A HB   1 
ATOM   2348  H  HG11 . VAL A 1 159 ? 82.752  9.220  29.883  1.00 21.52  ? 159  VAL A HG11 1 
ATOM   2349  H  HG12 . VAL A 1 159 ? 81.242  9.048  30.270  1.00 21.52  ? 159  VAL A HG12 1 
ATOM   2350  H  HG13 . VAL A 1 159 ? 82.024  7.858  29.614  1.00 21.52  ? 159  VAL A HG13 1 
ATOM   2351  H  HG21 . VAL A 1 159 ? 81.851  6.869  33.090  1.00 23.55  ? 159  VAL A HG21 1 
ATOM   2352  H  HG22 . VAL A 1 159 ? 81.442  6.358  31.666  1.00 23.55  ? 159  VAL A HG22 1 
ATOM   2353  H  HG23 . VAL A 1 159 ? 80.668  7.553  32.322  1.00 23.55  ? 159  VAL A HG23 1 
ATOM   2354  N  N    . PRO A 1 160 ? 85.372  8.036  29.671  1.00 14.60  ? 160  PRO A N    1 
ATOM   2355  C  CA   . PRO A 1 160 ? 86.363  8.930  29.055  1.00 14.46  ? 160  PRO A CA   1 
ATOM   2356  C  C    . PRO A 1 160 ? 85.845  10.368 28.905  1.00 12.89  ? 160  PRO A C    1 
ATOM   2357  O  O    . PRO A 1 160 ? 84.732  10.522 28.420  1.00 13.29  ? 160  PRO A O    1 
ATOM   2358  C  CB   . PRO A 1 160 ? 86.591  8.312  27.679  1.00 16.08  ? 160  PRO A CB   1 
ATOM   2359  C  CG   . PRO A 1 160 ? 86.175  6.899  27.801  1.00 22.38  ? 160  PRO A CG   1 
ATOM   2360  C  CD   . PRO A 1 160 ? 85.057  6.883  28.809  1.00 16.90  ? 160  PRO A CD   1 
ATOM   2361  H  HA   . PRO A 1 160 ? 87.195  8.922  29.573  1.00 17.36  ? 160  PRO A HA   1 
ATOM   2362  H  HB2  . PRO A 1 160 ? 86.059  8.767  27.008  1.00 19.30  ? 160  PRO A HB2  1 
ATOM   2363  H  HB3  . PRO A 1 160 ? 87.526  8.372  27.429  1.00 19.30  ? 160  PRO A HB3  1 
ATOM   2364  H  HG2  . PRO A 1 160 ? 85.867  6.560  26.946  1.00 26.86  ? 160  PRO A HG2  1 
ATOM   2365  H  HG3  . PRO A 1 160 ? 86.916  6.352  28.105  1.00 26.86  ? 160  PRO A HG3  1 
ATOM   2366  H  HD2  . PRO A 1 160 ? 84.195  6.992  28.378  1.00 20.28  ? 160  PRO A HD2  1 
ATOM   2367  H  HD3  . PRO A 1 160 ? 85.055  6.056  29.317  1.00 20.28  ? 160  PRO A HD3  1 
ATOM   2368  N  N    . GLY A 1 161 ? 86.594  11.378 29.316  1.00 14.08  ? 161  GLY A N    1 
ATOM   2369  C  CA   . GLY A 1 161 ? 86.225  12.755 29.275  1.00 14.31  ? 161  GLY A CA   1 
ATOM   2370  C  C    . GLY A 1 161 ? 85.822  13.293 30.639  1.00 12.96  ? 161  GLY A C    1 
ATOM   2371  O  O    . GLY A 1 161 ? 85.712  14.492 30.716  1.00 12.63  ? 161  GLY A O    1 
ATOM   2372  H  H    . GLY A 1 161 ? 87.369  11.188 29.636  1.00 16.89  ? 161  GLY A H    1 
ATOM   2373  H  HA2  . GLY A 1 161 ? 86.972  13.273 28.937  1.00 17.17  ? 161  GLY A HA2  1 
ATOM   2374  H  HA3  . GLY A 1 161 ? 85.484  12.866 28.659  1.00 17.17  ? 161  GLY A HA3  1 
ATOM   2375  N  N    . PHE A 1 162 ? 85.674  12.388 31.606  1.00 15.39  ? 162  PHE A N    1 
ATOM   2376  C  CA   . PHE A 1 162 ? 85.173  12.906 32.899  1.00 10.85  ? 162  PHE A CA   1 
ATOM   2377  C  C    . PHE A 1 162 ? 86.121  12.714 34.057  1.00 14.16  ? 162  PHE A C    1 
ATOM   2378  O  O    . PHE A 1 162 ? 85.706  12.811 35.254  1.00 15.46  ? 162  PHE A O    1 
ATOM   2379  C  CB   . PHE A 1 162 ? 83.847  12.184 33.119  1.00 14.18  ? 162  PHE A CB   1 
ATOM   2380  C  CG   . PHE A 1 162 ? 82.723  12.593 32.180  1.00 13.72  ? 162  PHE A CG   1 
ATOM   2381  C  CD1  . PHE A 1 162 ? 82.481  11.870 31.023  1.00 12.34  ? 162  PHE A CD1  1 
ATOM   2382  C  CD2  . PHE A 1 162 ? 81.942  13.705 32.471  1.00 17.22  ? 162  PHE A CD2  1 
ATOM   2383  C  CE1  . PHE A 1 162 ? 81.474  12.263 30.173  1.00 12.58  ? 162  PHE A CE1  1 
ATOM   2384  C  CE2  . PHE A 1 162 ? 80.919  14.073 31.613  1.00 13.48  ? 162  PHE A CE2  1 
ATOM   2385  C  CZ   . PHE A 1 162 ? 80.691  13.335 30.469  1.00 14.72  ? 162  PHE A CZ   1 
ATOM   2386  H  H    . PHE A 1 162 ? 85.857  11.556 31.486  1.00 18.46  ? 162  PHE A H    1 
ATOM   2387  H  HA   . PHE A 1 162 ? 84.992  13.865 32.801  1.00 13.02  ? 162  PHE A HA   1 
ATOM   2388  H  HB2  . PHE A 1 162 ? 83.997  11.231 33.022  1.00 17.01  ? 162  PHE A HB2  1 
ATOM   2389  H  HB3  . PHE A 1 162 ? 83.558  12.343 34.031  1.00 17.01  ? 162  PHE A HB3  1 
ATOM   2390  H  HD1  . PHE A 1 162 ? 82.997  11.123 30.821  1.00 14.81  ? 162  PHE A HD1  1 
ATOM   2391  H  HD2  . PHE A 1 162 ? 82.106  14.200 33.240  1.00 20.67  ? 162  PHE A HD2  1 
ATOM   2392  H  HE1  . PHE A 1 162 ? 81.327  11.791 29.386  1.00 15.09  ? 162  PHE A HE1  1 
ATOM   2393  H  HE2  . PHE A 1 162 ? 80.389  14.813 31.807  1.00 16.17  ? 162  PHE A HE2  1 
ATOM   2394  H  HZ   . PHE A 1 162 ? 79.997  13.572 29.897  1.00 17.67  ? 162  PHE A HZ   1 
ATOM   2395  N  N    . SER A 1 163 ? 87.384  12.415 33.861  1.00 17.03  ? 163  SER A N    1 
ATOM   2396  C  CA   . SER A 1 163 ? 88.253  12.119 34.998  1.00 19.85  ? 163  SER A CA   1 
ATOM   2397  C  C    . SER A 1 163 ? 88.478  13.326 35.890  1.00 19.39  ? 163  SER A C    1 
ATOM   2398  O  O    . SER A 1 163 ? 88.874  13.168 37.058  1.00 19.31  ? 163  SER A O    1 
ATOM   2399  C  CB   . SER A 1 163 ? 89.606  11.572 34.510  1.00 16.65  ? 163  SER A CB   1 
ATOM   2400  O  OG   . SER A 1 163 ? 90.297  12.466 33.689  1.00 20.68  ? 163  SER A OG   1 
ATOM   2401  H  H    . SER A 1 163 ? 87.701  12.393 33.061  1.00 20.43  ? 163  SER A H    1 
ATOM   2402  H  HA   . SER A 1 163 ? 87.821  11.423 35.535  1.00 23.83  ? 163  SER A HA   1 
ATOM   2403  H  HB2  . SER A 1 163 ? 90.156  11.361 35.280  1.00 19.98  ? 163  SER A HB2  1 
ATOM   2404  H  HB3  . SER A 1 163 ? 89.454  10.748 34.021  1.00 19.98  ? 163  SER A HB3  1 
ATOM   2405  H  HG   . SER A 1 163 ? 89.837  12.648 33.035  1.00 31.02  ? 163  SER A HG   1 
ATOM   2406  N  N    . TRP A 1 164 ? 88.233  14.508 35.427  1.00 15.30  ? 164  TRP A N    1 
ATOM   2407  C  CA   . TRP A 1 164 ? 88.335  15.788 36.099  1.00 14.05  ? 164  TRP A CA   1 
ATOM   2408  C  C    . TRP A 1 164 ? 87.193  16.046 37.083  1.00 14.58  ? 164  TRP A C    1 
ATOM   2409  O  O    . TRP A 1 164 ? 87.292  16.974 37.915  1.00 17.24  ? 164  TRP A O    1 
ATOM   2410  C  CB   . TRP A 1 164 ? 88.365  16.944 35.088  1.00 13.52  ? 164  TRP A CB   1 
ATOM   2411  C  CG   . TRP A 1 164 ? 87.069  17.082 34.326  1.00 14.30  ? 164  TRP A CG   1 
ATOM   2412  C  CD1  . TRP A 1 164 ? 86.735  16.424 33.157  1.00 12.85  ? 164  TRP A CD1  1 
ATOM   2413  C  CD2  . TRP A 1 164 ? 85.938  17.894 34.643  1.00 13.94  ? 164  TRP A CD2  1 
ATOM   2414  N  NE1  . TRP A 1 164 ? 85.481  16.792 32.752  1.00 13.57  ? 164  TRP A NE1  1 
ATOM   2415  C  CE2  . TRP A 1 164 ? 84.978  17.691 33.640  1.00 14.28  ? 164  TRP A CE2  1 
ATOM   2416  C  CE3  . TRP A 1 164 ? 85.628  18.798 35.678  1.00 16.83  ? 164  TRP A CE3  1 
ATOM   2417  C  CZ2  . TRP A 1 164 ? 83.736  18.342 33.640  1.00 12.11  ? 164  TRP A CZ2  1 
ATOM   2418  C  CZ3  . TRP A 1 164 ? 84.404  19.429 35.656  1.00 12.92  ? 164  TRP A CZ3  1 
ATOM   2419  C  CH2  . TRP A 1 164 ? 83.462  19.207 34.654  1.00 13.54  ? 164  TRP A CH2  1 
ATOM   2420  H  H    . TRP A 1 164 ? 87.975  14.539 34.607  1.00 18.36  ? 164  TRP A H    1 
ATOM   2421  H  HA   . TRP A 1 164 ? 89.177  15.802 36.601  1.00 16.87  ? 164  TRP A HA   1 
ATOM   2422  H  HB2  . TRP A 1 164 ? 88.545  17.773 35.559  1.00 16.22  ? 164  TRP A HB2  1 
ATOM   2423  H  HB3  . TRP A 1 164 ? 89.088  16.797 34.459  1.00 16.22  ? 164  TRP A HB3  1 
ATOM   2424  H  HD1  . TRP A 1 164 ? 87.283  15.820 32.710  1.00 15.42  ? 164  TRP A HD1  1 
ATOM   2425  H  HE1  . TRP A 1 164 ? 85.077  16.502 32.050  1.00 16.29  ? 164  TRP A HE1  1 
ATOM   2426  H  HE3  . TRP A 1 164 ? 86.236  18.965 36.362  1.00 20.19  ? 164  TRP A HE3  1 
ATOM   2427  H  HZ2  . TRP A 1 164 ? 83.116  18.187 32.964  1.00 14.53  ? 164  TRP A HZ2  1 
ATOM   2428  H  HZ3  . TRP A 1 164 ? 84.199  20.027 36.338  1.00 15.50  ? 164  TRP A HZ3  1 
ATOM   2429  H  HH2  . TRP A 1 164 ? 82.645  19.651 34.678  1.00 16.24  ? 164  TRP A HH2  1 
ATOM   2430  N  N    . VAL A 1 165 ? 86.117  15.264 37.022  1.00 12.55  ? 165  VAL A N    1 
ATOM   2431  C  CA   . VAL A 1 165 ? 84.954  15.539 37.828  1.00 17.34  ? 165  VAL A CA   1 
ATOM   2432  C  C    . VAL A 1 165 ? 85.192  15.068 39.255  1.00 14.52  ? 165  VAL A C    1 
ATOM   2433  O  O    . VAL A 1 165 ? 85.673  13.955 39.465  1.00 18.16  ? 165  VAL A O    1 
ATOM   2434  C  CB   . VAL A 1 165 ? 83.721  14.803 37.258  1.00 15.97  ? 165  VAL A CB   1 
ATOM   2435  C  CG1  . VAL A 1 165 ? 82.577  14.826 38.264  1.00 18.36  ? 165  VAL A CG1  1 
ATOM   2436  C  CG2  . VAL A 1 165 ? 83.311  15.409 35.945  1.00 17.52  ? 165  VAL A CG2  1 
ATOM   2437  H  H    . VAL A 1 165 ? 86.116  14.585 36.494  1.00 15.06  ? 165  VAL A H    1 
ATOM   2438  H  HA   . VAL A 1 165 ? 84.783  16.504 37.830  1.00 20.81  ? 165  VAL A HA   1 
ATOM   2439  H  HB   . VAL A 1 165 ? 83.970  13.869 37.099  1.00 19.16  ? 165  VAL A HB   1 
ATOM   2440  H  HG11 . VAL A 1 165 ? 82.869  14.436 39.091  1.00 27.54  ? 165  VAL A HG11 1 
ATOM   2441  H  HG12 . VAL A 1 165 ? 81.836  14.324 37.918  1.00 27.54  ? 165  VAL A HG12 1 
ATOM   2442  H  HG13 . VAL A 1 165 ? 82.304  15.734 38.418  1.00 27.54  ? 165  VAL A HG13 1 
ATOM   2443  H  HG21 . VAL A 1 165 ? 84.046  15.364 35.329  1.00 26.28  ? 165  VAL A HG21 1 
ATOM   2444  H  HG22 . VAL A 1 165 ? 83.062  16.326 36.080  1.00 26.28  ? 165  VAL A HG22 1 
ATOM   2445  H  HG23 . VAL A 1 165 ? 82.564  14.923 35.588  1.00 26.28  ? 165  VAL A HG23 1 
ATOM   2446  N  N    . THR A 1 166 ? 84.783  15.935 40.183  1.00 20.03  ? 166  THR A N    1 
ATOM   2447  C  CA   . THR A 1 166 ? 84.727  15.558 41.597  1.00 13.36  ? 166  THR A CA   1 
ATOM   2448  C  C    . THR A 1 166 ? 83.295  15.852 42.086  1.00 14.31  ? 166  THR A C    1 
ATOM   2449  O  O    . THR A 1 166 ? 82.895  17.014 42.033  1.00 18.02  ? 166  THR A O    1 
ATOM   2450  C  CB   . THR A 1 166 ? 85.800  16.225 42.451  1.00 21.17  ? 166  THR A CB   1 
ATOM   2451  O  OG1  . THR A 1 166 ? 87.050  15.532 42.216  1.00 40.15  ? 166  THR A OG1  1 
ATOM   2452  C  CG2  . THR A 1 166 ? 85.596  16.073 43.952  1.00 32.81  ? 166  THR A CG2  1 
ATOM   2453  H  H    . THR A 1 166 ? 84.549  16.729 39.947  1.00 24.04  ? 166  THR A H    1 
ATOM   2454  H  HA   . THR A 1 166 ? 84.866  14.589 41.650  1.00 16.03  ? 166  THR A HA   1 
ATOM   2455  H  HB   . THR A 1 166 ? 85.886  17.172 42.213  1.00 25.40  ? 166  THR A HB   1 
ATOM   2456  H  HG1  . THR A 1 166 ? 87.236  15.568 41.418  1.00 60.22  ? 166  THR A HG1  1 
ATOM   2457  H  HG21 . THR A 1 166 ? 86.306  16.520 44.418  1.00 49.22  ? 166  THR A HG21 1 
ATOM   2458  H  HG22 . THR A 1 166 ? 85.598  15.142 44.182  1.00 49.22  ? 166  THR A HG22 1 
ATOM   2459  H  HG23 . THR A 1 166 ? 84.755  16.463 44.201  1.00 49.22  ? 166  THR A HG23 1 
ATOM   2460  N  N    . PRO A 1 167 ? 82.575  14.824 42.522  1.00 13.57  ? 167  PRO A N    1 
ATOM   2461  C  CA   . PRO A 1 167 ? 81.190  15.072 42.987  1.00 14.88  ? 167  PRO A CA   1 
ATOM   2462  C  C    . PRO A 1 167 ? 81.163  16.176 44.037  1.00 15.58  ? 167  PRO A C    1 
ATOM   2463  O  O    . PRO A 1 167 ? 82.018  16.159 44.926  1.00 16.62  ? 167  PRO A O    1 
ATOM   2464  C  CB   . PRO A 1 167 ? 80.772  13.773 43.654  1.00 16.01  ? 167  PRO A CB   1 
ATOM   2465  C  CG   . PRO A 1 167 ? 81.643  12.728 43.055  1.00 23.33  ? 167  PRO A CG   1 
ATOM   2466  C  CD   . PRO A 1 167 ? 82.914  13.412 42.670  1.00 18.90  ? 167  PRO A CD   1 
ATOM   2467  H  HA   . PRO A 1 167 ? 80.600  15.287 42.235  1.00 17.86  ? 167  PRO A HA   1 
ATOM   2468  H  HB2  . PRO A 1 167 ? 80.906  13.822 44.614  1.00 19.21  ? 167  PRO A HB2  1 
ATOM   2469  H  HB3  . PRO A 1 167 ? 79.837  13.583 43.478  1.00 19.21  ? 167  PRO A HB3  1 
ATOM   2470  H  HG2  . PRO A 1 167 ? 81.818  12.023 43.697  1.00 28.00  ? 167  PRO A HG2  1 
ATOM   2471  H  HG3  . PRO A 1 167 ? 81.218  12.338 42.275  1.00 28.00  ? 167  PRO A HG3  1 
ATOM   2472  H  HD2  . PRO A 1 167 ? 83.588  13.292 43.358  1.00 22.68  ? 167  PRO A HD2  1 
ATOM   2473  H  HD3  . PRO A 1 167 ? 83.255  13.054 41.835  1.00 22.68  ? 167  PRO A HD3  1 
ATOM   2474  N  N    . CYS A 1 168 ? 80.260  17.127 43.932  1.00 15.45  ? 168  CYS A N    1 
ATOM   2475  C  CA   . CYS A 1 168 ? 80.310  18.366 44.709  1.00 11.78  ? 168  CYS A CA   1 
ATOM   2476  C  C    . CYS A 1 168 ? 79.019  18.642 45.457  1.00 17.56  ? 168  CYS A C    1 
ATOM   2477  O  O    . CYS A 1 168 ? 78.992  19.605 46.232  1.00 18.35  ? 168  CYS A O    1 
ATOM   2478  C  CB   . CYS A 1 168 ? 80.702  19.530 43.795  1.00 16.76  ? 168  CYS A CB   1 
ATOM   2479  S  SG   . CYS A 1 168 ? 79.532  19.772 42.437  1.00 22.97  ? 168  CYS A SG   1 
ATOM   2480  H  H    . CYS A 1 168 ? 79.610  17.015 43.380  1.00 18.54  ? 168  CYS A H    1 
ATOM   2481  H  HA   . CYS A 1 168 ? 81.020  18.265 45.377  1.00 14.14  ? 168  CYS A HA   1 
ATOM   2482  H  HB2  . CYS A 1 168 ? 80.750  20.344 44.321  1.00 20.11  ? 168  CYS A HB2  1 
ATOM   2483  H  HB3  . CYS A 1 168 ? 81.583  19.361 43.427  1.00 20.11  ? 168  CYS A HB3  1 
ATOM   2484  N  N    . ILE A 1 169 ? 77.971  17.834 45.261  1.00 16.29  ? 169  ILE A N    1 
ATOM   2485  C  CA   . ILE A 1 169 ? 76.783  18.122 46.063  1.00 18.25  ? 169  ILE A CA   1 
ATOM   2486  C  C    . ILE A 1 169 ? 76.278  16.822 46.680  1.00 18.30  ? 169  ILE A C    1 
ATOM   2487  O  O    . ILE A 1 169 ? 76.434  15.739 46.119  1.00 20.00  ? 169  ILE A O    1 
ATOM   2488  C  CB   . ILE A 1 169 ? 75.669  18.796 45.271  1.00 23.09  ? 169  ILE A CB   1 
ATOM   2489  C  CG1  . ILE A 1 169 ? 75.433  18.155 43.897  1.00 19.24  ? 169  ILE A CG1  1 
ATOM   2490  C  CG2  . ILE A 1 169 ? 75.871  20.298 45.069  1.00 20.67  ? 169  ILE A CG2  1 
ATOM   2491  C  CD1  . ILE A 1 169 ? 74.044  18.507 43.400  1.00 27.13  ? 169  ILE A CD1  1 
ATOM   2492  H  H    . ILE A 1 169 ? 77.995  17.186 44.697  1.00 19.55  ? 169  ILE A H    1 
ATOM   2493  H  HA   . ILE A 1 169 ? 77.045  18.724 46.791  1.00 21.90  ? 169  ILE A HA   1 
ATOM   2494  H  HB   . ILE A 1 169 ? 74.842  18.684 45.785  1.00 27.71  ? 169  ILE A HB   1 
ATOM   2495  H  HG12 . ILE A 1 169 ? 76.097  18.477 43.267  1.00 23.09  ? 169  ILE A HG12 1 
ATOM   2496  H  HG13 . ILE A 1 169 ? 75.522  17.192 43.965  1.00 23.09  ? 169  ILE A HG13 1 
ATOM   2497  H  HG21 . ILE A 1 169 ? 75.133  20.657 44.572  1.00 31.01  ? 169  ILE A HG21 1 
ATOM   2498  H  HG22 . ILE A 1 169 ? 76.686  20.449 44.584  1.00 31.01  ? 169  ILE A HG22 1 
ATOM   2499  H  HG23 . ILE A 1 169 ? 75.923  20.732 45.924  1.00 31.01  ? 169  ILE A HG23 1 
ATOM   2500  H  HD11 . ILE A 1 169 ? 73.889  18.080 42.554  1.00 40.70  ? 169  ILE A HD11 1 
ATOM   2501  H  HD12 . ILE A 1 169 ? 73.973  19.459 43.295  1.00 40.70  ? 169  ILE A HD12 1 
ATOM   2502  H  HD13 . ILE A 1 169 ? 73.391  18.205 44.036  1.00 40.70  ? 169  ILE A HD13 1 
ATOM   2503  N  N    . SER A 1 170 ? 75.666  16.906 47.854  1.00 17.73  ? 170  SER A N    1 
ATOM   2504  C  CA   . SER A 1 170 ? 75.064  15.719 48.458  1.00 19.36  ? 170  SER A CA   1 
ATOM   2505  C  C    . SER A 1 170 ? 73.564  15.691 48.150  1.00 12.88  ? 170  SER A C    1 
ATOM   2506  O  O    . SER A 1 170 ? 73.006  16.748 47.818  1.00 12.90  ? 170  SER A O    1 
ATOM   2507  C  CB   . SER A 1 170 ? 75.308  15.713 49.971  1.00 24.79  ? 170  SER A CB   1 
ATOM   2508  O  OG   . SER A 1 170 ? 76.701  15.903 50.219  1.00 35.40  ? 170  SER A OG   1 
ATOM   2509  H  H    . SER A 1 170 ? 75.624  17.662 48.261  1.00 21.28  ? 170  SER A H    1 
ATOM   2510  H  HA   . SER A 1 170 ? 75.481  14.922 48.068  1.00 23.24  ? 170  SER A HA   1 
ATOM   2511  H  HB2  . SER A 1 170 ? 74.798  16.424 50.390  1.00 29.74  ? 170  SER A HB2  1 
ATOM   2512  H  HB3  . SER A 1 170 ? 75.018  14.868 50.348  1.00 29.74  ? 170  SER A HB3  1 
ATOM   2513  H  HG   . SER A 1 170 ? 76.837  15.904 51.027  1.00 53.10  ? 170  SER A HG   1 
ATOM   2514  N  N    . ALA A 1 171 ? 72.985  14.521 48.298  1.00 16.43  ? 171  ALA A N    1 
ATOM   2515  C  CA   . ALA A 1 171 ? 71.568  14.287 48.008  1.00 12.25  ? 171  ALA A CA   1 
ATOM   2516  C  C    . ALA A 1 171 ? 70.724  15.285 48.773  1.00 17.55  ? 171  ALA A C    1 
ATOM   2517  O  O    . ALA A 1 171 ? 69.686  15.706 48.282  1.00 14.87  ? 171  ALA A O    1 
ATOM   2518  C  CB   . ALA A 1 171 ? 71.194  12.865 48.326  1.00 17.60  ? 171  ALA A CB   1 
ATOM   2519  H  H    . ALA A 1 171 ? 73.461  13.862 48.578  1.00 19.71  ? 171  ALA A H    1 
ATOM   2520  H  HA   . ALA A 1 171 ? 71.423  14.434 47.050  1.00 14.70  ? 171  ALA A HA   1 
ATOM   2521  H  HB1  . ALA A 1 171 ? 71.753  12.268 47.823  1.00 26.40  ? 171  ALA A HB1  1 
ATOM   2522  H  HB2  . ALA A 1 171 ? 70.275  12.716 48.092  1.00 26.40  ? 171  ALA A HB2  1 
ATOM   2523  H  HB3  . ALA A 1 171 ? 71.316  12.704 49.264  1.00 26.40  ? 171  ALA A HB3  1 
ATOM   2524  N  N    . LYS A 1 172 ? 71.116  15.736 49.969  1.00 12.64  ? 172  LYS A N    1 
ATOM   2525  C  CA   . LYS A 1 172 ? 70.322  16.680 50.724  1.00 11.79  ? 172  LYS A CA   1 
ATOM   2526  C  C    . LYS A 1 172 ? 70.351  18.103 50.233  1.00 14.70  ? 172  LYS A C    1 
ATOM   2527  O  O    . LYS A 1 172 ? 69.617  18.976 50.736  1.00 17.38  ? 172  LYS A O    1 
ATOM   2528  C  CB   . LYS A 1 172 ? 70.836  16.646 52.200  1.00 17.22  ? 172  LYS A CB   1 
ATOM   2529  C  CG   . LYS A 1 172 ? 72.083  17.498 52.376  1.00 24.30  ? 172  LYS A CG   1 
ATOM   2530  C  CD   . LYS A 1 172 ? 72.507  17.613 53.835  1.00 24.30  ? 172  LYS A CD   1 
ATOM   2531  C  CE   . LYS A 1 172 ? 74.031  17.591 53.913  1.00 35.36  ? 172  LYS A CE   1 
ATOM   2532  N  NZ   . LYS A 1 172 ? 74.598  16.248 53.572  1.00 45.29  ? 172  LYS A NZ   1 
ATOM   2533  H  H    . LYS A 1 172 ? 71.860  15.458 50.298  1.00 15.17  ? 172  LYS A H    1 
ATOM   2534  H  HA   . LYS A 1 172 ? 69.392  16.373 50.716  1.00 14.14  ? 172  LYS A HA   1 
ATOM   2535  H  HB2  . LYS A 1 172 ? 70.138  16.972 52.790  1.00 20.66  ? 172  LYS A HB2  1 
ATOM   2536  H  HB3  . LYS A 1 172 ? 71.034  15.730 52.449  1.00 20.66  ? 172  LYS A HB3  1 
ATOM   2537  H  HG2  . LYS A 1 172 ? 72.809  17.108 51.864  1.00 29.16  ? 172  LYS A HG2  1 
ATOM   2538  H  HG3  . LYS A 1 172 ? 71.914  18.385 52.023  1.00 29.16  ? 172  LYS A HG3  1 
ATOM   2539  H  HD2  . LYS A 1 172 ? 72.170  18.441 54.212  1.00 29.16  ? 172  LYS A HD2  1 
ATOM   2540  H  HD3  . LYS A 1 172 ? 72.140  16.874 54.344  1.00 29.16  ? 172  LYS A HD3  1 
ATOM   2541  H  HE2  . LYS A 1 172 ? 74.390  18.253 53.302  1.00 42.43  ? 172  LYS A HE2  1 
ATOM   2542  H  HE3  . LYS A 1 172 ? 74.307  17.834 54.810  1.00 42.43  ? 172  LYS A HE3  1 
ATOM   2543  H  HZ1  . LYS A 1 172 ? 75.485  16.276 53.636  1.00 67.93  ? 172  LYS A HZ1  1 
ATOM   2544  H  HZ2  . LYS A 1 172 ? 74.367  16.031 52.740  1.00 67.93  ? 172  LYS A HZ2  1 
ATOM   2545  H  HZ3  . LYS A 1 172 ? 74.279  15.639 54.137  1.00 67.93  ? 172  LYS A HZ3  1 
ATOM   2546  N  N    . ASP A 1 173 ? 71.165  18.417 49.212  1.00 12.78  ? 173  ASP A N    1 
ATOM   2547  C  CA   . ASP A 1 173 ? 71.427  19.740 48.722  1.00 16.17  ? 173  ASP A CA   1 
ATOM   2548  C  C    . ASP A 1 173 ? 70.732  20.078 47.395  1.00 14.92  ? 173  ASP A C    1 
ATOM   2549  O  O    . ASP A 1 173 ? 71.040  21.131 46.824  1.00 13.74  ? 173  ASP A O    1 
ATOM   2550  C  CB   . ASP A 1 173 ? 72.929  20.006 48.492  1.00 22.82  ? 173  ASP A CB   1 
ATOM   2551  C  CG   . ASP A 1 173 ? 73.812  19.724 49.691  1.00 28.31  ? 173  ASP A CG   1 
ATOM   2552  O  OD1  . ASP A 1 173 ? 73.474  20.223 50.780  1.00 26.80  ? 173  ASP A OD1  1 
ATOM   2553  O  OD2  . ASP A 1 173 ? 74.841  19.015 49.567  1.00 25.84  ? 173  ASP A OD2  1 
ATOM   2554  H  H    . ASP A 1 173 ? 71.566  17.767 48.816  1.00 15.34  ? 173  ASP A H    1 
ATOM   2555  H  HA   . ASP A 1 173 ? 71.110  20.377 49.397  1.00 19.40  ? 173  ASP A HA   1 
ATOM   2556  H  HB2  . ASP A 1 173 ? 73.230  19.457 47.751  1.00 27.38  ? 173  ASP A HB2  1 
ATOM   2557  H  HB3  . ASP A 1 173 ? 73.043  20.934 48.235  1.00 27.38  ? 173  ASP A HB3  1 
ATOM   2558  N  N    . ILE A 1 174 ? 69.869  19.197 46.927  1.00 12.64  ? 174  ILE A N    1 
ATOM   2559  C  CA   . ILE A 1 174 ? 69.139  19.495 45.671  1.00 11.27  ? 174  ILE A CA   1 
ATOM   2560  C  C    . ILE A 1 174 ? 67.666  19.358 45.908  1.00 10.94  ? 174  ILE A C    1 
ATOM   2561  O  O    . ILE A 1 174 ? 67.219  18.480 46.668  1.00 11.68  ? 174  ILE A O    1 
ATOM   2562  C  CB   . ILE A 1 174 ? 69.652  18.568 44.548  1.00 11.60  ? 174  ILE A CB   1 
ATOM   2563  C  CG1  . ILE A 1 174 ? 68.923  18.867 43.232  1.00 12.22  ? 174  ILE A CG1  1 
ATOM   2564  C  CG2  . ILE A 1 174 ? 69.579  17.117 45.002  1.00 18.03  ? 174  ILE A CG2  1 
ATOM   2565  C  CD1  . ILE A 1 174 ? 69.651  18.480 41.979  1.00 14.30  ? 174  ILE A CD1  1 
ATOM   2566  H  H    . ILE A 1 174 ? 69.731  18.459 47.346  1.00 15.17  ? 174  ILE A H    1 
ATOM   2567  H  HA   . ILE A 1 174 ? 69.327  20.423 45.416  1.00 13.52  ? 174  ILE A HA   1 
ATOM   2568  H  HB   . ILE A 1 174 ? 70.599  18.779 44.409  1.00 13.92  ? 174  ILE A HB   1 
ATOM   2569  H  HG12 . ILE A 1 174 ? 68.070  18.405 43.245  1.00 14.66  ? 174  ILE A HG12 1 
ATOM   2570  H  HG13 . ILE A 1 174 ? 68.737  19.818 43.196  1.00 14.66  ? 174  ILE A HG13 1 
ATOM   2571  H  HG21 . ILE A 1 174 ? 70.056  17.016 45.829  1.00 27.04  ? 174  ILE A HG21 1 
ATOM   2572  H  HG22 . ILE A 1 174 ? 69.974  16.552 44.333  1.00 27.04  ? 174  ILE A HG22 1 
ATOM   2573  H  HG23 . ILE A 1 174 ? 68.661  16.868 45.130  1.00 27.04  ? 174  ILE A HG23 1 
ATOM   2574  H  HD11 . ILE A 1 174 ? 69.115  18.707 41.215  1.00 21.45  ? 174  ILE A HD11 1 
ATOM   2575  H  HD12 . ILE A 1 174 ? 69.816  17.534 41.984  1.00 21.45  ? 174  ILE A HD12 1 
ATOM   2576  H  HD13 . ILE A 1 174 ? 70.486  18.951 41.935  1.00 21.45  ? 174  ILE A HD13 1 
ATOM   2577  N  N    . VAL A 1 175 ? 66.820  20.204 45.293  1.00 9.34   ? 175  VAL A N    1 
ATOM   2578  C  CA   . VAL A 1 175 ? 65.395  20.046 45.216  1.00 9.11   ? 175  VAL A CA   1 
ATOM   2579  C  C    . VAL A 1 175 ? 64.947  20.047 43.736  1.00 7.13   ? 175  VAL A C    1 
ATOM   2580  O  O    . VAL A 1 175 ? 65.294  20.954 43.003  1.00 9.32   ? 175  VAL A O    1 
ATOM   2581  C  CB   . VAL A 1 175 ? 64.629  21.136 46.009  1.00 10.79  ? 175  VAL A CB   1 
ATOM   2582  C  CG1  . VAL A 1 175 ? 63.113  20.935 45.890  1.00 9.52   ? 175  VAL A CG1  1 
ATOM   2583  C  CG2  . VAL A 1 175 ? 65.127  21.154 47.449  1.00 10.59  ? 175  VAL A CG2  1 
ATOM   2584  H  H    . VAL A 1 175 ? 67.161  20.897 44.915  1.00 11.21  ? 175  VAL A H    1 
ATOM   2585  H  HA   . VAL A 1 175 ? 65.166  19.175 45.601  1.00 10.94  ? 175  VAL A HA   1 
ATOM   2586  H  HB   . VAL A 1 175 ? 64.847  22.003 45.608  1.00 12.94  ? 175  VAL A HB   1 
ATOM   2587  H  HG11 . VAL A 1 175 ? 62.861  20.939 44.964  1.00 14.28  ? 175  VAL A HG11 1 
ATOM   2588  H  HG12 . VAL A 1 175 ? 62.659  21.646 46.348  1.00 14.28  ? 175  VAL A HG12 1 
ATOM   2589  H  HG13 . VAL A 1 175 ? 62.870  20.094 46.284  1.00 14.28  ? 175  VAL A HG13 1 
ATOM   2590  H  HG21 . VAL A 1 175 ? 66.078  21.280 47.458  1.00 15.88  ? 175  VAL A HG21 1 
ATOM   2591  H  HG22 . VAL A 1 175 ? 64.910  20.320 47.873  1.00 15.88  ? 175  VAL A HG22 1 
ATOM   2592  H  HG23 . VAL A 1 175 ? 64.704  21.873 47.925  1.00 15.88  ? 175  VAL A HG23 1 
ATOM   2593  N  N    . TYR A 1 176 ? 64.163  19.067 43.374  1.00 8.22   ? 176  TYR A N    1 
ATOM   2594  C  CA   . TYR A 1 176 ? 63.511  19.023 42.066  1.00 7.55   ? 176  TYR A CA   1 
ATOM   2595  C  C    . TYR A 1 176 ? 62.130  19.650 42.109  1.00 8.69   ? 176  TYR A C    1 
ATOM   2596  O  O    . TYR A 1 176 ? 61.318  19.432 43.017  1.00 9.16   ? 176  TYR A O    1 
ATOM   2597  C  CB   . TYR A 1 176 ? 63.348  17.614 41.598  1.00 7.77   ? 176  TYR A CB   1 
ATOM   2598  C  CG   . TYR A 1 176 ? 64.585  16.858 41.164  1.00 6.75   ? 176  TYR A CG   1 
ATOM   2599  C  CD1  . TYR A 1 176 ? 65.210  17.062 39.947  1.00 6.99   ? 176  TYR A CD1  1 
ATOM   2600  C  CD2  . TYR A 1 176 ? 65.159  15.902 42.030  1.00 9.42   ? 176  TYR A CD2  1 
ATOM   2601  C  CE1  . TYR A 1 176 ? 66.327  16.397 39.552  1.00 7.04   ? 176  TYR A CE1  1 
ATOM   2602  C  CE2  . TYR A 1 176 ? 66.278  15.200 41.654  1.00 10.21  ? 176  TYR A CE2  1 
ATOM   2603  C  CZ   . TYR A 1 176 ? 66.855  15.466 40.434  1.00 9.46   ? 176  TYR A CZ   1 
ATOM   2604  O  OH   . TYR A 1 176 ? 67.949  14.719 40.076  1.00 11.77  ? 176  TYR A OH   1 
ATOM   2605  H  H    . TYR A 1 176 ? 64.025  18.423 43.927  1.00 9.86   ? 176  TYR A H    1 
ATOM   2606  H  HA   . TYR A 1 176 ? 64.062  19.511 41.420  1.00 9.06   ? 176  TYR A HA   1 
ATOM   2607  H  HB2  . TYR A 1 176 ? 62.930  17.110 42.313  1.00 9.32   ? 176  TYR A HB2  1 
ATOM   2608  H  HB3  . TYR A 1 176 ? 62.728  17.619 40.852  1.00 9.32   ? 176  TYR A HB3  1 
ATOM   2609  H  HD1  . TYR A 1 176 ? 64.845  17.690 39.367  1.00 8.39   ? 176  TYR A HD1  1 
ATOM   2610  H  HD2  . TYR A 1 176 ? 64.776  15.746 42.863  1.00 11.30  ? 176  TYR A HD2  1 
ATOM   2611  H  HE1  . TYR A 1 176 ? 66.721  16.559 38.725  1.00 8.44   ? 176  TYR A HE1  1 
ATOM   2612  H  HE2  . TYR A 1 176 ? 66.641  14.554 42.216  1.00 12.25  ? 176  TYR A HE2  1 
ATOM   2613  H  HH   . TYR A 1 176 ? 68.212  14.957 39.337  1.00 17.66  ? 176  TYR A HH   1 
ATOM   2614  N  N    . ILE A 1 177 ? 61.782  20.394 41.047  1.00 7.45   ? 177  ILE A N    1 
ATOM   2615  C  CA   . ILE A 1 177 ? 60.408  20.850 40.846  1.00 10.70  ? 177  ILE A CA   1 
ATOM   2616  C  C    . ILE A 1 177 ? 59.937  20.578 39.407  1.00 6.31   ? 177  ILE A C    1 
ATOM   2617  O  O    . ILE A 1 177 ? 60.666  21.010 38.483  1.00 7.69   ? 177  ILE A O    1 
ATOM   2618  C  CB   . ILE A 1 177 ? 60.221  22.351 41.156  1.00 8.31   ? 177  ILE A CB   1 
ATOM   2619  C  CG1  . ILE A 1 177 ? 60.586  22.704 42.600  1.00 9.60   ? 177  ILE A CG1  1 
ATOM   2620  C  CG2  . ILE A 1 177 ? 58.832  22.851 40.839  1.00 8.64   ? 177  ILE A CG2  1 
ATOM   2621  C  CD1  . ILE A 1 177 ? 60.716  24.171 42.887  1.00 9.90   ? 177  ILE A CD1  1 
ATOM   2622  H  H    . ILE A 1 177 ? 62.383  20.609 40.470  1.00 8.94   ? 177  ILE A H    1 
ATOM   2623  H  HA   . ILE A 1 177 ? 59.830  20.342 41.453  1.00 12.84  ? 177  ILE A HA   1 
ATOM   2624  H  HB   . ILE A 1 177 ? 60.840  22.842 40.576  1.00 9.97   ? 177  ILE A HB   1 
ATOM   2625  H  HG12 . ILE A 1 177 ? 59.907  22.336 43.187  1.00 11.52  ? 177  ILE A HG12 1 
ATOM   2626  H  HG13 . ILE A 1 177 ? 61.426  22.273 42.818  1.00 11.52  ? 177  ILE A HG13 1 
ATOM   2627  H  HG21 . ILE A 1 177 ? 58.611  22.628 39.932  1.00 12.97  ? 177  ILE A HG21 1 
ATOM   2628  H  HG22 . ILE A 1 177 ? 58.802  23.804 40.950  1.00 12.97  ? 177  ILE A HG22 1 
ATOM   2629  H  HG23 . ILE A 1 177 ? 58.200  22.440 41.433  1.00 12.97  ? 177  ILE A HG23 1 
ATOM   2630  H  HD11 . ILE A 1 177 ? 60.940  24.297 43.812  1.00 14.85  ? 177  ILE A HD11 1 
ATOM   2631  H  HD12 . ILE A 1 177 ? 59.884  24.610 42.696  1.00 14.85  ? 177  ILE A HD12 1 
ATOM   2632  H  HD13 . ILE A 1 177 ? 61.409  24.544 42.336  1.00 14.85  ? 177  ILE A HD13 1 
ATOM   2633  N  N    . GLY A 1 178 ? 58.817  19.947 39.185  1.00 9.05   ? 178  GLY A N    1 
ATOM   2634  C  CA   . GLY A 1 178 ? 58.216  19.762 37.869  1.00 8.69   ? 178  GLY A CA   1 
ATOM   2635  C  C    . GLY A 1 178 ? 58.168  18.371 37.321  1.00 8.26   ? 178  GLY A C    1 
ATOM   2636  O  O    . GLY A 1 178 ? 57.656  18.108 36.213  1.00 8.39   ? 178  GLY A O    1 
ATOM   2637  H  H    . GLY A 1 178 ? 58.403  19.616 39.863  1.00 10.86  ? 178  GLY A H    1 
ATOM   2638  H  HA2  . GLY A 1 178 ? 57.307  20.100 37.906  1.00 10.42  ? 178  GLY A HA2  1 
ATOM   2639  H  HA3  . GLY A 1 178 ? 58.703  20.315 37.239  1.00 10.42  ? 178  GLY A HA3  1 
ATOM   2640  N  N    . LEU A 1 179 ? 58.628  17.367 38.050  1.00 6.14   ? 179  LEU A N    1 
ATOM   2641  C  CA   . LEU A 1 179 ? 58.860  16.022 37.573  1.00 5.94   ? 179  LEU A CA   1 
ATOM   2642  C  C    . LEU A 1 179 ? 57.565  15.389 37.108  1.00 6.10   ? 179  LEU A C    1 
ATOM   2643  O  O    . LEU A 1 179 ? 56.531  15.454 37.742  1.00 8.32   ? 179  LEU A O    1 
ATOM   2644  C  CB   . LEU A 1 179 ? 59.479  15.151 38.663  1.00 8.99   ? 179  LEU A CB   1 
ATOM   2645  C  CG   . LEU A 1 179 ? 60.784  15.636 39.293  1.00 6.69   ? 179  LEU A CG   1 
ATOM   2646  C  CD1  . LEU A 1 179 ? 61.208  14.596 40.308  1.00 9.68   ? 179  LEU A CD1  1 
ATOM   2647  C  CD2  . LEU A 1 179 ? 61.836  15.909 38.216  1.00 9.58   ? 179  LEU A CD2  1 
ATOM   2648  H  H    . LEU A 1 179 ? 58.803  17.528 38.877  1.00 7.37   ? 179  LEU A H    1 
ATOM   2649  H  HA   . LEU A 1 179 ? 59.480  16.062 36.814  1.00 7.13   ? 179  LEU A HA   1 
ATOM   2650  H  HB2  . LEU A 1 179 ? 58.825  15.049 39.372  1.00 10.79  ? 179  LEU A HB2  1 
ATOM   2651  H  HB3  . LEU A 1 179 ? 59.637  14.270 38.289  1.00 10.79  ? 179  LEU A HB3  1 
ATOM   2652  H  HG   . LEU A 1 179 ? 60.604  16.475 39.767  1.00 8.03   ? 179  LEU A HG   1 
ATOM   2653  H  HD11 . LEU A 1 179 ? 60.509  14.478 40.956  1.00 14.52  ? 179  LEU A HD11 1 
ATOM   2654  H  HD12 . LEU A 1 179 ? 62.008  14.888 40.750  1.00 14.52  ? 179  LEU A HD12 1 
ATOM   2655  H  HD13 . LEU A 1 179 ? 61.375  13.763 39.862  1.00 14.52  ? 179  LEU A HD13 1 
ATOM   2656  H  HD21 . LEU A 1 179 ? 61.505  16.574 37.607  1.00 14.38  ? 179  LEU A HD21 1 
ATOM   2657  H  HD22 . LEU A 1 179 ? 62.020  15.098 37.736  1.00 14.38  ? 179  LEU A HD22 1 
ATOM   2658  H  HD23 . LEU A 1 179 ? 62.642  16.227 38.630  1.00 14.38  ? 179  LEU A HD23 1 
ATOM   2659  N  N    . ARG A 1 180 ? 57.662  14.739 35.927  1.00 8.64   ? 180  ARG A N    1 
ATOM   2660  C  CA   . ARG A 1 180 ? 56.561  13.941 35.357  1.00 6.72   ? 180  ARG A CA   1 
ATOM   2661  C  C    . ARG A 1 180 ? 57.010  12.878 34.365  1.00 8.98   ? 180  ARG A C    1 
ATOM   2662  O  O    . ARG A 1 180 ? 56.122  12.262 33.745  1.00 12.02  ? 180  ARG A O    1 
ATOM   2663  C  CB   . ARG A 1 180 ? 55.508  14.879 34.746  1.00 8.97   ? 180  ARG A CB   1 
ATOM   2664  C  CG   . ARG A 1 180 ? 56.092  15.837 33.711  1.00 7.11   ? 180  ARG A CG   1 
ATOM   2665  C  CD   . ARG A 1 180 ? 55.090  16.890 33.354  1.00 8.27   ? 180  ARG A CD   1 
ATOM   2666  N  NE   . ARG A 1 180 ? 55.464  17.776 32.264  1.00 8.50   ? 180  ARG A NE   1 
ATOM   2667  C  CZ   . ARG A 1 180 ? 56.257  18.815 32.319  1.00 9.53   ? 180  ARG A CZ   1 
ATOM   2668  N  NH1  . ARG A 1 180 ? 56.839  19.160 33.459  1.00 9.01   ? 180  ARG A NH1  1 
ATOM   2669  N  NH2  . ARG A 1 180 ? 56.496  19.580 31.237  1.00 6.54   ? 180  ARG A NH2  1 
ATOM   2670  H  H    . ARG A 1 180 ? 58.400  14.794 35.487  1.00 10.37  ? 180  ARG A H    1 
ATOM   2671  H  HA   . ARG A 1 180 ? 56.130  13.474 36.103  1.00 8.06   ? 180  ARG A HA   1 
ATOM   2672  H  HB2  . ARG A 1 180 ? 54.815  14.345 34.327  1.00 10.77  ? 180  ARG A HB2  1 
ATOM   2673  H  HB3  . ARG A 1 180 ? 55.095  15.395 35.456  1.00 10.77  ? 180  ARG A HB3  1 
ATOM   2674  H  HG2  . ARG A 1 180 ? 56.890  16.255 34.069  1.00 8.53   ? 180  ARG A HG2  1 
ATOM   2675  H  HG3  . ARG A 1 180 ? 56.341  15.342 32.915  1.00 8.53   ? 180  ARG A HG3  1 
ATOM   2676  H  HD2  . ARG A 1 180 ? 54.257  16.452 33.119  1.00 9.93   ? 180  ARG A HD2  1 
ATOM   2677  H  HD3  . ARG A 1 180 ? 54.921  17.430 34.142  1.00 9.93   ? 180  ARG A HD3  1 
ATOM   2678  H  HE   . ARG A 1 180 ? 55.125  17.596 31.494  1.00 10.20  ? 180  ARG A HE   1 
ATOM   2679  H  HH11 . ARG A 1 180 ? 56.697  18.698 34.171  1.00 10.81  ? 180  ARG A HH11 1 
ATOM   2680  H  HH12 . ARG A 1 180 ? 57.359  19.844 33.487  1.00 10.81  ? 180  ARG A HH12 1 
ATOM   2681  H  HH21 . ARG A 1 180 ? 56.124  19.390 30.485  1.00 7.85   ? 180  ARG A HH21 1 
ATOM   2682  H  HH22 . ARG A 1 180 ? 57.021  20.258 31.297  1.00 7.85   ? 180  ARG A HH22 1 
ATOM   2683  N  N    . ASP A 1 181 ? 58.284  12.570 34.162  1.00 10.52  ? 181  ASP A N    1 
ATOM   2684  C  CA   . ASP A 1 181 ? 58.752  11.502 33.267  1.00 11.76  ? 181  ASP A CA   1 
ATOM   2685  C  C    . ASP A 1 181 ? 60.074  10.994 33.815  1.00 12.40  ? 181  ASP A C    1 
ATOM   2686  O  O    . ASP A 1 181 ? 61.155  11.324 33.337  1.00 12.12  ? 181  ASP A O    1 
ATOM   2687  C  CB   . ASP A 1 181 ? 58.838  12.093 31.880  1.00 11.17  ? 181  ASP A CB   1 
ATOM   2688  C  CG   . ASP A 1 181 ? 59.264  11.235 30.725  1.00 25.11  ? 181  ASP A CG   1 
ATOM   2689  O  OD1  . ASP A 1 181 ? 59.243  10.013 30.894  1.00 24.04  ? 181  ASP A OD1  1 
ATOM   2690  O  OD2  . ASP A 1 181 ? 59.615  11.832 29.671  1.00 27.02  ? 181  ASP A OD2  1 
ATOM   2691  H  H    . ASP A 1 181 ? 58.878  13.027 34.583  1.00 12.62  ? 181  ASP A H    1 
ATOM   2692  H  HA   . ASP A 1 181 ? 58.099  10.771 33.267  1.00 14.11  ? 181  ASP A HA   1 
ATOM   2693  H  HB2  . ASP A 1 181 ? 57.963  12.454 31.665  1.00 13.40  ? 181  ASP A HB2  1 
ATOM   2694  H  HB3  . ASP A 1 181 ? 59.450  12.844 31.923  1.00 13.40  ? 181  ASP A HB3  1 
ATOM   2695  N  N    . VAL A 1 182 ? 59.999  10.170 34.857  1.00 8.84   ? 182  VAL A N    1 
ATOM   2696  C  CA   . VAL A 1 182 ? 61.106  9.690  35.659  1.00 9.47   ? 182  VAL A CA   1 
ATOM   2697  C  C    . VAL A 1 182 ? 61.269  8.213  35.355  1.00 15.13  ? 182  VAL A C    1 
ATOM   2698  O  O    . VAL A 1 182 ? 60.279  7.469  35.480  1.00 11.91  ? 182  VAL A O    1 
ATOM   2699  C  CB   . VAL A 1 182 ? 60.818  9.950  37.158  1.00 9.90   ? 182  VAL A CB   1 
ATOM   2700  C  CG1  . VAL A 1 182 ? 61.870  9.365  38.080  1.00 10.99  ? 182  VAL A CG1  1 
ATOM   2701  C  CG2  . VAL A 1 182 ? 60.639  11.439 37.407  1.00 13.12  ? 182  VAL A CG2  1 
ATOM   2702  H  H    . VAL A 1 182 ? 59.214  9.895  35.076  1.00 10.60  ? 182  VAL A H    1 
ATOM   2703  H  HA   . VAL A 1 182 ? 61.923  10.166 35.400  1.00 11.37  ? 182  VAL A HA   1 
ATOM   2704  H  HB   . VAL A 1 182 ? 59.967  9.514  37.372  1.00 11.88  ? 182  VAL A HB   1 
ATOM   2705  H  HG11 . VAL A 1 182 ? 61.965  8.426  37.902  1.00 16.48  ? 182  VAL A HG11 1 
ATOM   2706  H  HG12 . VAL A 1 182 ? 61.601  9.492  38.993  1.00 16.48  ? 182  VAL A HG12 1 
ATOM   2707  H  HG13 . VAL A 1 182 ? 62.709  9.806  37.929  1.00 16.48  ? 182  VAL A HG13 1 
ATOM   2708  H  HG21 . VAL A 1 182 ? 59.973  11.786 36.809  1.00 19.68  ? 182  VAL A HG21 1 
ATOM   2709  H  HG22 . VAL A 1 182 ? 61.472  11.891 37.254  1.00 19.68  ? 182  VAL A HG22 1 
ATOM   2710  H  HG23 . VAL A 1 182 ? 60.360  11.581 38.315  1.00 19.68  ? 182  VAL A HG23 1 
ATOM   2711  N  N    . ASP A 1 183 ? 62.454  7.790  34.933  1.00 9.92   ? 183  ASP A N    1 
ATOM   2712  C  CA   . ASP A 1 183 ? 62.678  6.378  34.648  1.00 11.32  ? 183  ASP A CA   1 
ATOM   2713  C  C    . ASP A 1 183 ? 62.709  5.531  35.914  1.00 11.83  ? 183  ASP A C    1 
ATOM   2714  O  O    . ASP A 1 183 ? 62.989  6.107  36.967  1.00 11.07  ? 183  ASP A O    1 
ATOM   2715  C  CB   . ASP A 1 183 ? 64.004  6.150  33.899  1.00 13.32  ? 183  ASP A CB   1 
ATOM   2716  C  CG   . ASP A 1 183 ? 64.130  6.895  32.579  1.00 14.14  ? 183  ASP A CG   1 
ATOM   2717  O  OD1  . ASP A 1 183 ? 63.065  7.156  31.961  1.00 17.68  ? 183  ASP A OD1  1 
ATOM   2718  O  OD2  . ASP A 1 183 ? 65.256  7.196  32.146  1.00 15.69  ? 183  ASP A OD2  1 
ATOM   2719  H  H    . ASP A 1 183 ? 63.096  8.354  34.828  1.00 11.90  ? 183  ASP A H    1 
ATOM   2720  H  HA   . ASP A 1 183 ? 61.945  6.058  34.081  1.00 13.59  ? 183  ASP A HA   1 
ATOM   2721  H  HB2  . ASP A 1 183 ? 64.735  6.421  34.477  1.00 15.98  ? 183  ASP A HB2  1 
ATOM   2722  H  HB3  . ASP A 1 183 ? 64.103  5.201  33.728  1.00 15.98  ? 183  ASP A HB3  1 
ATOM   2723  N  N    . PRO A 1 184 ? 62.417  4.233  35.840  1.00 11.79  ? 184  PRO A N    1 
ATOM   2724  C  CA   . PRO A 1 184 ? 62.428  3.402  37.051  1.00 11.74  ? 184  PRO A CA   1 
ATOM   2725  C  C    . PRO A 1 184 ? 63.722  3.470  37.830  1.00 12.01  ? 184  PRO A C    1 
ATOM   2726  O  O    . PRO A 1 184 ? 63.638  3.621  39.071  1.00 11.59  ? 184  PRO A O    1 
ATOM   2727  C  CB   . PRO A 1 184 ? 62.092  1.993  36.513  1.00 15.91  ? 184  PRO A CB   1 
ATOM   2728  C  CG   . PRO A 1 184 ? 61.286  2.302  35.281  1.00 15.77  ? 184  PRO A CG   1 
ATOM   2729  C  CD   . PRO A 1 184 ? 61.975  3.487  34.650  1.00 11.68  ? 184  PRO A CD   1 
ATOM   2730  H  HA   . PRO A 1 184 ? 61.698  3.694  37.635  1.00 14.08  ? 184  PRO A HA   1 
ATOM   2731  H  HB2  . PRO A 1 184 ? 62.898  1.499  36.292  1.00 19.09  ? 184  PRO A HB2  1 
ATOM   2732  H  HB3  . PRO A 1 184 ? 61.573  1.485  37.156  1.00 19.09  ? 184  PRO A HB3  1 
ATOM   2733  H  HG2  . PRO A 1 184 ? 61.280  1.544  34.675  1.00 18.92  ? 184  PRO A HG2  1 
ATOM   2734  H  HG3  . PRO A 1 184 ? 60.370  2.521  35.516  1.00 18.92  ? 184  PRO A HG3  1 
ATOM   2735  H  HD2  . PRO A 1 184 ? 62.727  3.211  34.103  1.00 14.02  ? 184  PRO A HD2  1 
ATOM   2736  H  HD3  . PRO A 1 184 ? 61.361  4.010  34.111  1.00 14.02  ? 184  PRO A HD3  1 
ATOM   2737  N  N    . GLY A 1 185 ? 64.913  3.342  37.251  1.00 10.75  ? 185  GLY A N    1 
ATOM   2738  C  CA   . GLY A 1 185 ? 66.155  3.412  38.014  1.00 9.38   ? 185  GLY A CA   1 
ATOM   2739  C  C    . GLY A 1 185 ? 66.308  4.759  38.684  1.00 8.96   ? 185  GLY A C    1 
ATOM   2740  O  O    . GLY A 1 185 ? 66.927  4.866  39.755  1.00 11.48  ? 185  GLY A O    1 
ATOM   2741  H  H    . GLY A 1 185 ? 64.952  3.215  36.401  1.00 12.90  ? 185  GLY A H    1 
ATOM   2742  H  HA2  . GLY A 1 185 ? 66.159  2.715  38.688  1.00 11.26  ? 185  GLY A HA2  1 
ATOM   2743  H  HA3  . GLY A 1 185 ? 66.907  3.260  37.420  1.00 11.26  ? 185  GLY A HA3  1 
ATOM   2744  N  N    . GLU A 1 186 ? 65.879  5.830  38.065  1.00 8.59   ? 186  GLU A N    1 
ATOM   2745  C  CA   . GLU A 1 186 ? 65.881  7.159  38.603  1.00 10.10  ? 186  GLU A CA   1 
ATOM   2746  C  C    . GLU A 1 186 ? 64.984  7.235  39.860  1.00 8.21   ? 186  GLU A C    1 
ATOM   2747  O  O    . GLU A 1 186 ? 65.456  7.847  40.844  1.00 9.82   ? 186  GLU A O    1 
ATOM   2748  C  CB   . GLU A 1 186 ? 65.446  8.163  37.522  1.00 11.10  ? 186  GLU A CB   1 
ATOM   2749  C  CG   . GLU A 1 186 ? 66.478  8.305  36.371  1.00 10.66  ? 186  GLU A CG   1 
ATOM   2750  C  CD   . GLU A 1 186 ? 66.097  9.421  35.413  1.00 7.00   ? 186  GLU A CD   1 
ATOM   2751  O  OE1  . GLU A 1 186 ? 65.077  9.216  34.702  1.00 9.95   ? 186  GLU A OE1  1 
ATOM   2752  O  OE2  . GLU A 1 186 ? 66.688  10.499 35.454  1.00 10.08  ? 186  GLU A OE2  1 
ATOM   2753  H  H    . GLU A 1 186 ? 65.570  5.728  37.269  1.00 10.31  ? 186  GLU A H    1 
ATOM   2754  H  HA   . GLU A 1 186 ? 66.799  7.378  38.870  1.00 12.12  ? 186  GLU A HA   1 
ATOM   2755  H  HB2  . GLU A 1 186 ? 64.597  7.877  37.150  1.00 13.32  ? 186  GLU A HB2  1 
ATOM   2756  H  HB3  . GLU A 1 186 ? 65.311  9.031  37.933  1.00 13.32  ? 186  GLU A HB3  1 
ATOM   2757  H  HG2  . GLU A 1 186 ? 67.353  8.490  36.747  1.00 12.79  ? 186  GLU A HG2  1 
ATOM   2758  H  HG3  . GLU A 1 186 ? 66.532  7.468  35.884  1.00 12.79  ? 186  GLU A HG3  1 
ATOM   2759  N  N    . HIS A 1 187 ? 63.798  6.717  39.777  1.00 8.72   ? 187  HIS A N    1 
ATOM   2760  C  CA   . HIS A 1 187 ? 62.884  6.711  40.914  1.00 8.66   ? 187  HIS A CA   1 
ATOM   2761  C  C    . HIS A 1 187 ? 63.512  5.908  42.045  1.00 10.85  ? 187  HIS A C    1 
ATOM   2762  O  O    . HIS A 1 187 ? 63.405  6.321  43.200  1.00 11.64  ? 187  HIS A O    1 
ATOM   2763  C  CB   . HIS A 1 187 ? 61.536  6.109  40.497  1.00 10.06  ? 187  HIS A CB   1 
ATOM   2764  C  CG   . HIS A 1 187 ? 60.452  6.371  41.490  1.00 8.61   ? 187  HIS A CG   1 
ATOM   2765  N  ND1  . HIS A 1 187 ? 59.665  5.429  42.084  1.00 23.00  ? 187  HIS A ND1  1 
ATOM   2766  C  CD2  . HIS A 1 187 ? 59.938  7.506  42.001  1.00 11.77  ? 187  HIS A CD2  1 
ATOM   2767  C  CE1  . HIS A 1 187 ? 58.791  5.897  42.940  1.00 15.14  ? 187  HIS A CE1  1 
ATOM   2768  N  NE2  . HIS A 1 187 ? 58.942  7.194  42.892  1.00 11.67  ? 187  HIS A NE2  1 
ATOM   2769  H  H    . HIS A 1 187 ? 63.544  6.368  39.033  1.00 10.46  ? 187  HIS A H    1 
ATOM   2770  H  HA   . HIS A 1 187 ? 62.743  7.632  41.216  1.00 10.39  ? 187  HIS A HA   1 
ATOM   2771  H  HB2  . HIS A 1 187 ? 61.276  6.480  39.640  1.00 12.07  ? 187  HIS A HB2  1 
ATOM   2772  H  HB3  . HIS A 1 187 ? 61.638  5.151  40.387  1.00 12.07  ? 187  HIS A HB3  1 
ATOM   2773  H  HD1  . HIS A 1 187 ? 59.737  4.590  41.908  1.00 27.60  ? 187  HIS A HD1  1 
ATOM   2774  H  HD2  . HIS A 1 187 ? 60.215  8.367  41.785  1.00 14.12  ? 187  HIS A HD2  1 
ATOM   2775  H  HE1  . HIS A 1 187 ? 58.196  5.413  43.466  1.00 18.17  ? 187  HIS A HE1  1 
ATOM   2776  N  N    . TYR A 1 188 ? 64.155  4.797  41.739  1.00 9.45   ? 188  TYR A N    1 
ATOM   2777  C  CA   . TYR A 1 188 ? 64.886  4.044  42.762  1.00 12.55  ? 188  TYR A CA   1 
ATOM   2778  C  C    . TYR A 1 188 ? 65.914  4.916  43.441  1.00 12.56  ? 188  TYR A C    1 
ATOM   2779  O  O    . TYR A 1 188 ? 66.023  4.927  44.704  1.00 11.69  ? 188  TYR A O    1 
ATOM   2780  C  CB   . TYR A 1 188 ? 65.586  2.807  42.123  1.00 10.99  ? 188  TYR A CB   1 
ATOM   2781  C  CG   . TYR A 1 188 ? 66.494  2.115  43.118  1.00 12.45  ? 188  TYR A CG   1 
ATOM   2782  C  CD1  . TYR A 1 188 ? 65.923  1.266  44.053  1.00 17.74  ? 188  TYR A CD1  1 
ATOM   2783  C  CD2  . TYR A 1 188 ? 67.863  2.281  43.166  1.00 13.34  ? 188  TYR A CD2  1 
ATOM   2784  C  CE1  . TYR A 1 188 ? 66.733  0.619  44.988  1.00 12.66  ? 188  TYR A CE1  1 
ATOM   2785  C  CE2  . TYR A 1 188 ? 68.685  1.644  44.102  1.00 11.64  ? 188  TYR A CE2  1 
ATOM   2786  C  CZ   . TYR A 1 188 ? 68.083  0.797  45.006  1.00 11.52  ? 188  TYR A CZ   1 
ATOM   2787  O  OH   . TYR A 1 188 ? 68.856  0.147  45.968  1.00 12.78  ? 188  TYR A OH   1 
ATOM   2788  H  H    . TYR A 1 188 ? 64.145  4.511  40.928  1.00 11.34  ? 188  TYR A H    1 
ATOM   2789  H  HA   . TYR A 1 188 ? 64.247  3.730  43.436  1.00 15.06  ? 188  TYR A HA   1 
ATOM   2790  H  HB2  . TYR A 1 188 ? 64.913  2.182  41.812  1.00 13.19  ? 188  TYR A HB2  1 
ATOM   2791  H  HB3  . TYR A 1 188 ? 66.107  3.093  41.356  1.00 13.19  ? 188  TYR A HB3  1 
ATOM   2792  H  HD1  . TYR A 1 188 ? 65.003  1.128  44.058  1.00 21.29  ? 188  TYR A HD1  1 
ATOM   2793  H  HD2  . TYR A 1 188 ? 68.261  2.846  42.543  1.00 16.01  ? 188  TYR A HD2  1 
ATOM   2794  H  HE1  . TYR A 1 188 ? 66.342  0.052  45.613  1.00 15.20  ? 188  TYR A HE1  1 
ATOM   2795  H  HE2  . TYR A 1 188 ? 69.604  1.787  44.113  1.00 13.96  ? 188  TYR A HE2  1 
ATOM   2796  H  HH   . TYR A 1 188 ? 69.645  0.342  45.861  1.00 19.17  ? 188  TYR A HH   1 
ATOM   2797  N  N    . ILE A 1 189 ? 66.760  5.623  42.675  1.00 9.24   ? 189  ILE A N    1 
ATOM   2798  C  CA   . ILE A 1 189 ? 67.753  6.523  43.255  1.00 7.95   ? 189  ILE A CA   1 
ATOM   2799  C  C    . ILE A 1 189 ? 67.107  7.591  44.125  1.00 10.71  ? 189  ILE A C    1 
ATOM   2800  O  O    . ILE A 1 189 ? 67.584  7.813  45.242  1.00 12.13  ? 189  ILE A O    1 
ATOM   2801  C  CB   . ILE A 1 189 ? 68.637  7.150  42.152  1.00 13.05  ? 189  ILE A CB   1 
ATOM   2802  C  CG1  . ILE A 1 189 ? 69.447  6.061  41.444  1.00 10.07  ? 189  ILE A CG1  1 
ATOM   2803  C  CG2  . ILE A 1 189 ? 69.505  8.265  42.706  1.00 12.04  ? 189  ILE A CG2  1 
ATOM   2804  C  CD1  . ILE A 1 189 ? 70.064  6.484  40.130  1.00 13.28  ? 189  ILE A CD1  1 
ATOM   2805  H  H    . ILE A 1 189 ? 66.716  5.543  41.820  1.00 11.08  ? 189  ILE A H    1 
ATOM   2806  H  HA   . ILE A 1 189 ? 68.336  5.987  43.831  1.00 9.54   ? 189  ILE A HA   1 
ATOM   2807  H  HB   . ILE A 1 189 ? 68.037  7.548  41.487  1.00 15.66  ? 189  ILE A HB   1 
ATOM   2808  H  HG12 . ILE A 1 189 ? 70.156  5.768  42.038  1.00 12.09  ? 189  ILE A HG12 1 
ATOM   2809  H  HG13 . ILE A 1 189 ? 68.868  5.300  41.283  1.00 12.09  ? 189  ILE A HG13 1 
ATOM   2810  H  HG21 . ILE A 1 189 ? 68.950  8.915  43.144  1.00 18.06  ? 189  ILE A HG21 1 
ATOM   2811  H  HG22 . ILE A 1 189 ? 69.982  8.686  41.987  1.00 18.06  ? 189  ILE A HG22 1 
ATOM   2812  H  HG23 . ILE A 1 189 ? 70.130  7.901  43.336  1.00 18.06  ? 189  ILE A HG23 1 
ATOM   2813  H  HD11 . ILE A 1 189 ? 70.548  5.746  39.751  1.00 19.93  ? 189  ILE A HD11 1 
ATOM   2814  H  HD12 . ILE A 1 189 ? 70.664  7.218  40.280  1.00 19.93  ? 189  ILE A HD12 1 
ATOM   2815  H  HD13 . ILE A 1 189 ? 69.370  6.756  39.524  1.00 19.93  ? 189  ILE A HD13 1 
ATOM   2816  N  N    . LEU A 1 190 ? 66.046  8.238  43.632  1.00 11.48  ? 190  LEU A N    1 
ATOM   2817  C  CA   . LEU A 1 190 ? 65.375  9.252  44.446  1.00 10.87  ? 190  LEU A CA   1 
ATOM   2818  C  C    . LEU A 1 190 ? 64.964  8.727  45.812  1.00 9.72   ? 190  LEU A C    1 
ATOM   2819  O  O    . LEU A 1 190 ? 65.196  9.387  46.838  1.00 12.66  ? 190  LEU A O    1 
ATOM   2820  C  CB   . LEU A 1 190 ? 64.091  9.722  43.775  1.00 17.02  ? 190  LEU A CB   1 
ATOM   2821  C  CG   . LEU A 1 190 ? 64.143  10.754 42.660  1.00 18.74  ? 190  LEU A CG   1 
ATOM   2822  C  CD1  . LEU A 1 190 ? 62.707  11.075 42.251  1.00 13.96  ? 190  LEU A CD1  1 
ATOM   2823  C  CD2  . LEU A 1 190 ? 64.892  11.994 43.066  1.00 16.13  ? 190  LEU A CD2  1 
ATOM   2824  H  H    . LEU A 1 190 ? 65.759  8.060  42.841  1.00 13.77  ? 190  LEU A H    1 
ATOM   2825  H  HA   . LEU A 1 190 ? 65.975  10.018 44.564  1.00 13.04  ? 190  LEU A HA   1 
ATOM   2826  H  HB2  . LEU A 1 190 ? 63.648  8.936  43.419  1.00 20.42  ? 190  LEU A HB2  1 
ATOM   2827  H  HB3  . LEU A 1 190 ? 63.517  10.079 44.471  1.00 20.42  ? 190  LEU A HB3  1 
ATOM   2828  H  HG   . LEU A 1 190 ? 64.601  10.355 41.892  1.00 22.49  ? 190  LEU A HG   1 
ATOM   2829  H  HD11 . LEU A 1 190 ? 62.258  10.266 41.996  1.00 20.95  ? 190  LEU A HD11 1 
ATOM   2830  H  HD12 . LEU A 1 190 ? 62.714  11.684 41.509  1.00 20.95  ? 190  LEU A HD12 1 
ATOM   2831  H  HD13 . LEU A 1 190 ? 62.245  11.477 42.991  1.00 20.95  ? 190  LEU A HD13 1 
ATOM   2832  H  HD21 . LEU A 1 190 ? 64.901  12.616 42.335  1.00 24.20  ? 190  LEU A HD21 1 
ATOM   2833  H  HD22 . LEU A 1 190 ? 65.794  11.762 43.299  1.00 24.20  ? 190  LEU A HD22 1 
ATOM   2834  H  HD23 . LEU A 1 190 ? 64.459  12.396 43.823  1.00 24.20  ? 190  LEU A HD23 1 
ATOM   2835  N  N    . LYS A 1 191 ? 64.288  7.593  45.874  1.00 11.20  ? 191  LYS A N    1 
ATOM   2836  C  CA   . LYS A 1 191 ? 63.806  6.999  47.120  1.00 14.12  ? 191  LYS A CA   1 
ATOM   2837  C  C    . LYS A 1 191 ? 64.913  6.468  47.993  1.00 14.11  ? 191  LYS A C    1 
ATOM   2838  O  O    . LYS A 1 191 ? 64.892  6.554  49.221  1.00 13.72  ? 191  LYS A O    1 
ATOM   2839  C  CB   . LYS A 1 191 ? 62.809  5.888  46.754  1.00 13.68  ? 191  LYS A CB   1 
ATOM   2840  C  CG   . LYS A 1 191 ? 61.565  6.443  46.065  1.00 14.23  ? 191  LYS A CG   1 
ATOM   2841  C  CD   . LYS A 1 191 ? 60.809  7.417  47.000  1.00 23.14  ? 191  LYS A CD   1 
ATOM   2842  C  CE   . LYS A 1 191 ? 59.495  7.830  46.389  1.00 24.83  ? 191  LYS A CE   1 
ATOM   2843  N  NZ   . LYS A 1 191 ? 58.462  8.304  47.353  1.00 36.46  ? 191  LYS A NZ   1 
ATOM   2844  H  H    . LYS A 1 191 ? 64.121  7.180  45.138  1.00 13.45  ? 191  LYS A H    1 
ATOM   2845  H  HA   . LYS A 1 191 ? 63.325  7.690  47.622  1.00 16.94  ? 191  LYS A HA   1 
ATOM   2846  H  HB2  . LYS A 1 191 ? 63.243  5.250  46.165  1.00 16.42  ? 191  LYS A HB2  1 
ATOM   2847  H  HB3  . LYS A 1 191 ? 62.545  5.417  47.560  1.00 16.42  ? 191  LYS A HB3  1 
ATOM   2848  H  HG2  . LYS A 1 191 ? 61.824  6.908  45.254  1.00 17.08  ? 191  LYS A HG2  1 
ATOM   2849  H  HG3  . LYS A 1 191 ? 60.978  5.711  45.818  1.00 17.08  ? 191  LYS A HG3  1 
ATOM   2850  H  HD2  . LYS A 1 191 ? 60.648  6.987  47.854  1.00 27.77  ? 191  LYS A HD2  1 
ATOM   2851  H  HD3  . LYS A 1 191 ? 61.355  8.204  47.157  1.00 27.77  ? 191  LYS A HD3  1 
ATOM   2852  H  HE2  . LYS A 1 191 ? 59.664  8.538  45.748  1.00 29.80  ? 191  LYS A HE2  1 
ATOM   2853  H  HE3  . LYS A 1 191 ? 59.134  7.074  45.899  1.00 29.80  ? 191  LYS A HE3  1 
ATOM   2854  H  HZ1  . LYS A 1 191 ? 57.715  8.505  46.913  1.00 54.69  ? 191  LYS A HZ1  1 
ATOM   2855  H  HZ2  . LYS A 1 191 ? 58.761  9.028  47.776  1.00 54.69  ? 191  LYS A HZ2  1 
ATOM   2856  H  HZ3  . LYS A 1 191 ? 58.293  7.663  47.947  1.00 54.69  ? 191  LYS A HZ3  1 
ATOM   2857  N  N    . THR A 1 192 ? 65.912  5.862  47.398  1.00 11.14  ? 192  THR A N    1 
ATOM   2858  C  CA   . THR A 1 192 ? 67.052  5.330  48.133  1.00 12.21  ? 192  THR A CA   1 
ATOM   2859  C  C    . THR A 1 192 ? 67.789  6.460  48.813  1.00 12.24  ? 192  THR A C    1 
ATOM   2860  O  O    . THR A 1 192 ? 68.187  6.370  49.994  1.00 15.61  ? 192  THR A O    1 
ATOM   2861  C  CB   . THR A 1 192 ? 67.975  4.578  47.126  1.00 12.62  ? 192  THR A CB   1 
ATOM   2862  O  OG1  . THR A 1 192 ? 67.300  3.388  46.725  1.00 14.29  ? 192  THR A OG1  1 
ATOM   2863  C  CG2  . THR A 1 192 ? 69.297  4.172  47.763  1.00 16.86  ? 192  THR A CG2  1 
ATOM   2864  H  H    . THR A 1 192 ? 65.893  5.775  46.543  1.00 13.37  ? 192  THR A H    1 
ATOM   2865  H  HA   . THR A 1 192 ? 66.732  4.698  48.811  1.00 14.66  ? 192  THR A HA   1 
ATOM   2866  H  HB   . THR A 1 192 ? 68.144  5.144  46.344  1.00 15.14  ? 192  THR A HB   1 
ATOM   2867  H  HG1  . THR A 1 192 ? 66.586  3.584  46.374  1.00 21.43  ? 192  THR A HG1  1 
ATOM   2868  H  HG21 . THR A 1 192 ? 69.836  3.711  47.115  1.00 25.30  ? 192  THR A HG21 1 
ATOM   2869  H  HG22 . THR A 1 192 ? 69.129  3.593  48.510  1.00 25.30  ? 192  THR A HG22 1 
ATOM   2870  H  HG23 . THR A 1 192 ? 69.762  4.956  48.065  1.00 25.30  ? 192  THR A HG23 1 
ATOM   2871  N  N    . LEU A 1 193 ? 68.091  7.556  48.128  1.00 11.15  ? 193  LEU A N    1 
ATOM   2872  C  CA   . LEU A 1 193 ? 68.938  8.610  48.696  1.00 11.10  ? 193  LEU A CA   1 
ATOM   2873  C  C    . LEU A 1 193 ? 68.121  9.647  49.441  1.00 10.75  ? 193  LEU A C    1 
ATOM   2874  O  O    . LEU A 1 193 ? 68.708  10.488 50.150  1.00 15.72  ? 193  LEU A O    1 
ATOM   2875  C  CB   . LEU A 1 193 ? 69.806  9.284  47.627  1.00 12.21  ? 193  LEU A CB   1 
ATOM   2876  C  CG   . LEU A 1 193 ? 70.763  8.372  46.858  1.00 15.75  ? 193  LEU A CG   1 
ATOM   2877  C  CD1  . LEU A 1 193 ? 71.620  9.178  45.888  1.00 19.41  ? 193  LEU A CD1  1 
ATOM   2878  C  CD2  . LEU A 1 193 ? 71.617  7.560  47.819  1.00 23.34  ? 193  LEU A CD2  1 
ATOM   2879  H  H    . LEU A 1 193 ? 67.783  7.651  47.331  1.00 13.38  ? 193  LEU A H    1 
ATOM   2880  H  HA   . LEU A 1 193 ? 69.541  8.187  49.344  1.00 13.32  ? 193  LEU A HA   1 
ATOM   2881  H  HB2  . LEU A 1 193 ? 69.218  9.716  46.987  1.00 14.65  ? 193  LEU A HB2  1 
ATOM   2882  H  HB3  . LEU A 1 193 ? 70.329  9.980  48.055  1.00 14.65  ? 193  LEU A HB3  1 
ATOM   2883  H  HG   . LEU A 1 193 ? 70.224  7.745  46.332  1.00 18.89  ? 193  LEU A HG   1 
ATOM   2884  H  HD11 . LEU A 1 193 ? 71.051  9.690  45.308  1.00 29.12  ? 193  LEU A HD11 1 
ATOM   2885  H  HD12 . LEU A 1 193 ? 72.158  8.581  45.363  1.00 29.12  ? 193  LEU A HD12 1 
ATOM   2886  H  HD13 . LEU A 1 193 ? 72.190  9.772  46.383  1.00 29.12  ? 193  LEU A HD13 1 
ATOM   2887  H  HD21 . LEU A 1 193 ? 71.048  7.068  48.416  1.00 35.02  ? 193  LEU A HD21 1 
ATOM   2888  H  HD22 . LEU A 1 193 ? 72.177  8.152  48.327  1.00 35.02  ? 193  LEU A HD22 1 
ATOM   2889  H  HD23 . LEU A 1 193 ? 72.166  6.949  47.322  1.00 35.02  ? 193  LEU A HD23 1 
ATOM   2890  N  N    . GLY A 1 194 ? 66.808  9.631  49.409  1.00 10.88  ? 194  GLY A N    1 
ATOM   2891  C  CA   . GLY A 1 194 ? 65.939  10.554 50.100  1.00 14.60  ? 194  GLY A CA   1 
ATOM   2892  C  C    . GLY A 1 194 ? 66.017  11.994 49.607  1.00 11.20  ? 194  GLY A C    1 
ATOM   2893  O  O    . GLY A 1 194 ? 65.975  12.940 50.389  1.00 14.23  ? 194  GLY A O    1 
ATOM   2894  H  H    . GLY A 1 194 ? 66.434  9.018  48.937  1.00 13.06  ? 194  GLY A H    1 
ATOM   2895  H  HA2  . GLY A 1 194 ? 65.024  10.245 50.009  1.00 17.52  ? 194  GLY A HA2  1 
ATOM   2896  H  HA3  . GLY A 1 194 ? 66.160  10.539 51.045  1.00 17.52  ? 194  GLY A HA3  1 
ATOM   2897  N  N    . ILE A 1 195 ? 66.082  12.110 48.273  1.00 9.54   ? 195  ILE A N    1 
ATOM   2898  C  CA   . ILE A 1 195 ? 66.164  13.400 47.625  1.00 8.36   ? 195  ILE A CA   1 
ATOM   2899  C  C    . ILE A 1 195 ? 64.823  14.103 47.669  1.00 9.52   ? 195  ILE A C    1 
ATOM   2900  O  O    . ILE A 1 195 ? 63.785  13.481 47.464  1.00 12.65  ? 195  ILE A O    1 
ATOM   2901  C  CB   . ILE A 1 195 ? 66.694  13.205 46.177  1.00 8.60   ? 195  ILE A CB   1 
ATOM   2902  C  CG1  . ILE A 1 195 ? 68.179  12.788 46.141  1.00 10.42  ? 195  ILE A CG1  1 
ATOM   2903  C  CG2  . ILE A 1 195 ? 66.409  14.460 45.371  1.00 14.47  ? 195  ILE A CG2  1 
ATOM   2904  C  CD1  . ILE A 1 195 ? 68.675  12.321 44.774  1.00 12.26  ? 195  ILE A CD1  1 
ATOM   2905  H  H    . ILE A 1 195 ? 66.074  11.399 47.789  1.00 11.45  ? 195  ILE A H    1 
ATOM   2906  H  HA   . ILE A 1 195 ? 66.811  13.947 48.116  1.00 10.03  ? 195  ILE A HA   1 
ATOM   2907  H  HB   . ILE A 1 195 ? 66.178  12.476 45.774  1.00 10.32  ? 195  ILE A HB   1 
ATOM   2908  H  HG12 . ILE A 1 195 ? 68.719  13.542 46.425  1.00 12.50  ? 195  ILE A HG12 1 
ATOM   2909  H  HG13 . ILE A 1 195 ? 68.315  12.072 46.781  1.00 12.50  ? 195  ILE A HG13 1 
ATOM   2910  H  HG21 . ILE A 1 195 ? 65.477  14.679 45.439  1.00 21.70  ? 195  ILE A HG21 1 
ATOM   2911  H  HG22 . ILE A 1 195 ? 66.635  14.308 44.450  1.00 21.70  ? 195  ILE A HG22 1 
ATOM   2912  H  HG23 . ILE A 1 195 ? 66.934  15.187 45.713  1.00 21.70  ? 195  ILE A HG23 1 
ATOM   2913  H  HD11 . ILE A 1 195 ? 69.598  12.065 44.838  1.00 18.39  ? 195  ILE A HD11 1 
ATOM   2914  H  HD12 . ILE A 1 195 ? 68.585  13.036 44.139  1.00 18.39  ? 195  ILE A HD12 1 
ATOM   2915  H  HD13 . ILE A 1 195 ? 68.154  11.569 44.484  1.00 18.39  ? 195  ILE A HD13 1 
ATOM   2916  N  N    . LYS A 1 196 ? 64.768  15.371 47.968  1.00 11.33  ? 196  LYS A N    1 
ATOM   2917  C  CA   . LYS A 1 196 ? 63.572  16.180 48.025  1.00 8.28   ? 196  LYS A CA   1 
ATOM   2918  C  C    . LYS A 1 196 ? 63.051  16.533 46.622  1.00 9.33   ? 196  LYS A C    1 
ATOM   2919  O  O    . LYS A 1 196 ? 63.843  17.000 45.802  1.00 9.66   ? 196  LYS A O    1 
ATOM   2920  C  CB   . LYS A 1 196 ? 63.889  17.472 48.768  1.00 11.16  ? 196  LYS A CB   1 
ATOM   2921  C  CG   . LYS A 1 196 ? 62.630  18.297 49.072  1.00 14.09  ? 196  LYS A CG   1 
ATOM   2922  C  CD   . LYS A 1 196 ? 61.640  17.505 49.894  1.00 20.34  ? 196  LYS A CD   1 
ATOM   2923  C  CE   . LYS A 1 196 ? 60.705  18.451 50.657  1.00 28.30  ? 196  LYS A CE   1 
ATOM   2924  N  NZ   . LYS A 1 196 ? 59.632  17.709 51.372  1.00 25.85  ? 196  LYS A NZ   1 
ATOM   2925  H  H    . LYS A 1 196 ? 65.513  15.762 48.148  1.00 13.60  ? 196  LYS A H    1 
ATOM   2926  H  HA   . LYS A 1 196 ? 62.876  15.692 48.513  1.00 9.94   ? 196  LYS A HA   1 
ATOM   2927  H  HB2  . LYS A 1 196 ? 64.337  17.258 49.601  1.00 13.40  ? 196  LYS A HB2  1 
ATOM   2928  H  HB3  . LYS A 1 196 ? 64.496  18.005 48.232  1.00 13.40  ? 196  LYS A HB3  1 
ATOM   2929  H  HG2  . LYS A 1 196 ? 62.881  19.099 49.556  1.00 16.91  ? 196  LYS A HG2  1 
ATOM   2930  H  HG3  . LYS A 1 196 ? 62.214  18.567 48.239  1.00 16.91  ? 196  LYS A HG3  1 
ATOM   2931  H  HD2  . LYS A 1 196 ? 61.118  16.932 49.311  1.00 24.41  ? 196  LYS A HD2  1 
ATOM   2932  H  HD3  . LYS A 1 196 ? 62.116  16.941 50.523  1.00 24.41  ? 196  LYS A HD3  1 
ATOM   2933  H  HE2  . LYS A 1 196 ? 61.222  18.963 51.298  1.00 33.96  ? 196  LYS A HE2  1 
ATOM   2934  H  HE3  . LYS A 1 196 ? 60.302  19.075 50.033  1.00 33.96  ? 196  LYS A HE3  1 
ATOM   2935  H  HZ1  . LYS A 1 196 ? 59.109  18.286 51.802  1.00 38.77  ? 196  LYS A HZ1  1 
ATOM   2936  H  HZ2  . LYS A 1 196 ? 59.999  17.148 51.957  1.00 38.77  ? 196  LYS A HZ2  1 
ATOM   2937  H  HZ3  . LYS A 1 196 ? 59.147  17.250 50.784  1.00 38.77  ? 196  LYS A HZ3  1 
ATOM   2938  N  N    . TYR A 1 197 ? 61.783  16.306 46.381  1.00 8.47   ? 197  TYR A N    1 
ATOM   2939  C  CA   . TYR A 1 197 ? 61.198  16.612 45.073  1.00 8.68   ? 197  TYR A CA   1 
ATOM   2940  C  C    . TYR A 1 197 ? 59.754  17.025 45.254  1.00 9.43   ? 197  TYR A C    1 
ATOM   2941  O  O    . TYR A 1 197 ? 58.996  16.593 46.149  1.00 9.89   ? 197  TYR A O    1 
ATOM   2942  C  CB   . TYR A 1 197 ? 61.324  15.417 44.116  1.00 9.13   ? 197  TYR A CB   1 
ATOM   2943  C  CG   . TYR A 1 197 ? 60.580  14.196 44.603  1.00 11.47  ? 197  TYR A CG   1 
ATOM   2944  C  CD1  . TYR A 1 197 ? 59.267  13.939 44.290  1.00 11.57  ? 197  TYR A CD1  1 
ATOM   2945  C  CD2  . TYR A 1 197 ? 61.258  13.241 45.362  1.00 15.06  ? 197  TYR A CD2  1 
ATOM   2946  C  CE1  . TYR A 1 197 ? 58.567  12.826 44.705  1.00 14.99  ? 197  TYR A CE1  1 
ATOM   2947  C  CE2  . TYR A 1 197 ? 60.571  12.126 45.801  1.00 14.08  ? 197  TYR A CE2  1 
ATOM   2948  C  CZ   . TYR A 1 197 ? 59.263  11.913 45.471  1.00 17.42  ? 197  TYR A CZ   1 
ATOM   2949  O  OH   . TYR A 1 197 ? 58.563  10.812 45.918  1.00 19.40  ? 197  TYR A OH   1 
ATOM   2950  H  H    . TYR A 1 197 ? 61.287  15.974 47.000  1.00 10.17  ? 197  TYR A H    1 
ATOM   2951  H  HA   . TYR A 1 197 ? 61.687  17.367 44.687  1.00 10.41  ? 197  TYR A HA   1 
ATOM   2952  H  HB2  . TYR A 1 197 ? 60.979  15.671 43.246  1.00 10.95  ? 197  TYR A HB2  1 
ATOM   2953  H  HB3  . TYR A 1 197 ? 62.262  15.194 44.010  1.00 10.95  ? 197  TYR A HB3  1 
ATOM   2954  H  HD1  . TYR A 1 197 ? 58.819  14.559 43.761  1.00 13.88  ? 197  TYR A HD1  1 
ATOM   2955  H  HD2  . TYR A 1 197 ? 62.158  13.353 45.568  1.00 18.07  ? 197  TYR A HD2  1 
ATOM   2956  H  HE1  . TYR A 1 197 ? 57.673  12.697 44.481  1.00 17.98  ? 197  TYR A HE1  1 
ATOM   2957  H  HE2  . TYR A 1 197 ? 61.009  11.504 46.336  1.00 16.89  ? 197  TYR A HE2  1 
ATOM   2958  H  HH   . TYR A 1 197 ? 57.793  10.845 45.638  1.00 29.11  ? 197  TYR A HH   1 
ATOM   2959  N  N    . PHE A 1 198 ? 59.356  17.815 44.269  1.00 8.01   ? 198  PHE A N    1 
ATOM   2960  C  CA   . PHE A 1 198 ? 57.976  18.231 44.045  1.00 10.45  ? 198  PHE A CA   1 
ATOM   2961  C  C    . PHE A 1 198 ? 57.698  17.843 42.587  1.00 8.40   ? 198  PHE A C    1 
ATOM   2962  O  O    . PHE A 1 198 ? 57.993  18.612 41.674  1.00 9.18   ? 198  PHE A O    1 
ATOM   2963  C  CB   . PHE A 1 198 ? 57.721  19.696 44.352  1.00 11.19  ? 198  PHE A CB   1 
ATOM   2964  C  CG   . PHE A 1 198 ? 58.066  20.068 45.796  1.00 8.83   ? 198  PHE A CG   1 
ATOM   2965  C  CD1  . PHE A 1 198 ? 59.309  20.512 46.142  1.00 10.73  ? 198  PHE A CD1  1 
ATOM   2966  C  CD2  . PHE A 1 198 ? 57.083  19.935 46.782  1.00 12.96  ? 198  PHE A CD2  1 
ATOM   2967  C  CE1  . PHE A 1 198 ? 59.616  20.886 47.453  1.00 10.05  ? 198  PHE A CE1  1 
ATOM   2968  C  CE2  . PHE A 1 198 ? 57.374  20.336 48.103  1.00 11.99  ? 198  PHE A CE2  1 
ATOM   2969  C  CZ   . PHE A 1 198 ? 58.645  20.757 48.436  1.00 11.36  ? 198  PHE A CZ   1 
ATOM   2970  H  H    . PHE A 1 198 ? 59.953  18.103 43.722  1.00 9.61   ? 198  PHE A H    1 
ATOM   2971  H  HA   . PHE A 1 198 ? 57.396  17.691 44.622  1.00 12.54  ? 198  PHE A HA   1 
ATOM   2972  H  HB2  . PHE A 1 198 ? 58.250  20.242 43.750  1.00 13.42  ? 198  PHE A HB2  1 
ATOM   2973  H  HB3  . PHE A 1 198 ? 56.785  19.895 44.190  1.00 13.42  ? 198  PHE A HB3  1 
ATOM   2974  H  HD1  . PHE A 1 198 ? 59.968  20.568 45.489  1.00 12.87  ? 198  PHE A HD1  1 
ATOM   2975  H  HD2  . PHE A 1 198 ? 56.247  19.586 46.570  1.00 15.56  ? 198  PHE A HD2  1 
ATOM   2976  H  HE1  . PHE A 1 198 ? 60.460  21.216 47.664  1.00 12.06  ? 198  PHE A HE1  1 
ATOM   2977  H  HE2  . PHE A 1 198 ? 56.708  20.317 48.751  1.00 14.38  ? 198  PHE A HE2  1 
ATOM   2978  H  HZ   . PHE A 1 198 ? 58.851  20.955 49.321  1.00 13.63  ? 198  PHE A HZ   1 
ATOM   2979  N  N    . SER A 1 199 ? 57.158  16.666 42.443  1.00 9.65   ? 199  SER A N    1 
ATOM   2980  C  CA   . SER A 1 199 ? 56.600  16.248 41.145  1.00 8.68   ? 199  SER A CA   1 
ATOM   2981  C  C    . SER A 1 199 ? 55.370  17.074 40.857  1.00 7.40   ? 199  SER A C    1 
ATOM   2982  O  O    . SER A 1 199 ? 54.827  17.775 41.690  1.00 7.09   ? 199  SER A O    1 
ATOM   2983  C  CB   . SER A 1 199 ? 56.306  14.780 41.169  1.00 10.23  ? 199  SER A CB   1 
ATOM   2984  O  OG   . SER A 1 199 ? 55.038  14.433 41.666  1.00 9.89   ? 199  SER A OG   1 
ATOM   2985  H  H    . SER A 1 199 ? 57.126  16.127 43.113  1.00 11.58  ? 199  SER A H    1 
ATOM   2986  H  HA   . SER A 1 199 ? 57.266  16.423 40.447  1.00 10.41  ? 199  SER A HA   1 
ATOM   2987  H  HB2  . SER A 1 199 ? 56.387  14.435 40.266  1.00 12.28  ? 199  SER A HB2  1 
ATOM   2988  H  HB3  . SER A 1 199 ? 56.980  14.340 41.711  1.00 12.28  ? 199  SER A HB3  1 
ATOM   2989  H  HG   . SER A 1 199 ? 54.964  14.701 42.438  1.00 14.83  ? 199  SER A HG   1 
ATOM   2990  N  N    . MET A 1 200 ? 54.853  16.967 39.605  1.00 8.16   ? 200  MET A N    1 
ATOM   2991  C  CA   . MET A 1 200 ? 53.619  17.671 39.340  1.00 7.22   ? 200  MET A CA   1 
ATOM   2992  C  C    . MET A 1 200 ? 52.470  17.251 40.260  1.00 8.04   ? 200  MET A C    1 
ATOM   2993  O  O    . MET A 1 200 ? 51.579  18.064 40.470  1.00 8.42   ? 200  MET A O    1 
ATOM   2994  C  CB   . MET A 1 200 ? 53.170  17.438 37.892  1.00 7.55   ? 200  MET A CB   1 
ATOM   2995  C  CG   . MET A 1 200 ? 54.111  18.073 36.867  1.00 9.85   ? 200  MET A CG   1 
ATOM   2996  S  SD   . MET A 1 200 ? 54.597  19.804 37.082  1.00 9.39   ? 200  MET A SD   1 
ATOM   2997  C  CE   . MET A 1 200 ? 53.012  20.604 37.021  1.00 9.32   ? 200  MET A CE   1 
ATOM   2998  H  H    . MET A 1 200 ? 55.243  16.501 38.996  1.00 9.80   ? 200  MET A H    1 
ATOM   2999  H  HA   . MET A 1 200 ? 53.778  18.630 39.463  1.00 8.66   ? 200  MET A HA   1 
ATOM   3000  H  HB2  . MET A 1 200 ? 53.120  16.484 37.726  1.00 9.06   ? 200  MET A HB2  1 
ATOM   3001  H  HB3  . MET A 1 200 ? 52.280  17.806 37.774  1.00 9.06   ? 200  MET A HB3  1 
ATOM   3002  H  HG2  . MET A 1 200 ? 54.921  17.542 36.844  1.00 11.82  ? 200  MET A HG2  1 
ATOM   3003  H  HG3  . MET A 1 200 ? 53.693  17.993 35.995  1.00 11.82  ? 200  MET A HG3  1 
ATOM   3004  H  HE1  . MET A 1 200 ? 53.128  21.552 37.122  1.00 13.98  ? 200  MET A HE1  1 
ATOM   3005  H  HE2  . MET A 1 200 ? 52.458  20.272 37.731  1.00 13.98  ? 200  MET A HE2  1 
ATOM   3006  H  HE3  . MET A 1 200 ? 52.593  20.421 36.177  1.00 13.98  ? 200  MET A HE3  1 
ATOM   3007  N  N    . THR A 1 201 ? 52.506  16.009 40.769  1.00 8.54   ? 201  THR A N    1 
ATOM   3008  C  CA   . THR A 1 201 ? 51.494  15.608 41.768  1.00 7.44   ? 201  THR A CA   1 
ATOM   3009  C  C    . THR A 1 201 ? 51.537  16.459 43.016  1.00 8.53   ? 201  THR A C    1 
ATOM   3010  O  O    . THR A 1 201 ? 50.491  16.896 43.514  1.00 9.69   ? 201  THR A O    1 
ATOM   3011  C  CB   . THR A 1 201 ? 51.750  14.147 42.153  1.00 8.62   ? 201  THR A CB   1 
ATOM   3012  O  OG1  . THR A 1 201 ? 51.691  13.326 40.963  1.00 9.81   ? 201  THR A OG1  1 
ATOM   3013  C  CG2  . THR A 1 201 ? 50.736  13.642 43.163  1.00 11.01  ? 201  THR A CG2  1 
ATOM   3014  H  H    . THR A 1 201 ? 53.111  15.452 40.516  1.00 10.25  ? 201  THR A H    1 
ATOM   3015  H  HA   . THR A 1 201 ? 50.603  15.679 41.365  1.00 8.92   ? 201  THR A HA   1 
ATOM   3016  H  HB   . THR A 1 201 ? 52.647  14.075 42.542  1.00 10.35  ? 201  THR A HB   1 
ATOM   3017  H  HG1  . THR A 1 201 ? 51.115  12.750 41.056  1.00 14.72  ? 201  THR A HG1  1 
ATOM   3018  H  HG21 . THR A 1 201 ? 50.929  12.727 43.381  1.00 16.51  ? 201  THR A HG21 1 
ATOM   3019  H  HG22 . THR A 1 201 ? 49.854  13.702 42.788  1.00 16.51  ? 201  THR A HG22 1 
ATOM   3020  H  HG23 . THR A 1 201 ? 50.782  14.177 43.959  1.00 16.51  ? 201  THR A HG23 1 
ATOM   3021  N  N    . GLU A 1 202 ? 52.724  16.741 43.473  1.00 8.33   ? 202  GLU A N    1 
ATOM   3022  C  CA   . GLU A 1 202 ? 52.882  17.631 44.627  1.00 7.42   ? 202  GLU A CA   1 
ATOM   3023  C  C    . GLU A 1 202 ? 52.504  19.062 44.299  1.00 9.97   ? 202  GLU A C    1 
ATOM   3024  O  O    . GLU A 1 202 ? 51.899  19.780 45.102  1.00 8.56   ? 202  GLU A O    1 
ATOM   3025  C  CB   . GLU A 1 202 ? 54.297  17.618 45.174  1.00 10.61  ? 202  GLU A CB   1 
ATOM   3026  C  CG   . GLU A 1 202 ? 54.696  16.382 45.968  1.00 8.84   ? 202  GLU A CG   1 
ATOM   3027  C  CD   . GLU A 1 202 ? 54.666  15.135 45.128  1.00 12.27  ? 202  GLU A CD   1 
ATOM   3028  O  OE1  . GLU A 1 202 ? 55.467  15.051 44.163  1.00 11.80  ? 202  GLU A OE1  1 
ATOM   3029  O  OE2  . GLU A 1 202 ? 53.904  14.195 45.397  1.00 12.31  ? 202  GLU A OE2  1 
ATOM   3030  H  H    . GLU A 1 202 ? 53.419  16.404 43.096  1.00 9.99   ? 202  GLU A H    1 
ATOM   3031  H  HA   . GLU A 1 202 ? 52.282  17.316 45.336  1.00 8.90   ? 202  GLU A HA   1 
ATOM   3032  H  HB2  . GLU A 1 202 ? 54.911  17.712 44.429  1.00 12.73  ? 202  GLU A HB2  1 
ATOM   3033  H  HB3  . GLU A 1 202 ? 54.410  18.395 45.743  1.00 12.73  ? 202  GLU A HB3  1 
ATOM   3034  H  HG2  . GLU A 1 202 ? 55.590  16.506 46.322  1.00 10.61  ? 202  GLU A HG2  1 
ATOM   3035  H  HG3  . GLU A 1 202 ? 54.090  16.276 46.718  1.00 10.61  ? 202  GLU A HG3  1 
ATOM   3036  N  N    . VAL A 1 203 ? 52.883  19.571 43.097  1.00 9.11   ? 203  VAL A N    1 
ATOM   3037  C  CA   . VAL A 1 203 ? 52.465  20.918 42.737  1.00 7.40   ? 203  VAL A CA   1 
ATOM   3038  C  C    . VAL A 1 203 ? 50.960  21.018 42.666  1.00 6.40   ? 203  VAL A C    1 
ATOM   3039  O  O    . VAL A 1 203 ? 50.312  21.979 43.131  1.00 8.93   ? 203  VAL A O    1 
ATOM   3040  C  CB   . VAL A 1 203 ? 53.076  21.337 41.374  1.00 7.80   ? 203  VAL A CB   1 
ATOM   3041  C  CG1  . VAL A 1 203 ? 52.704  22.750 41.033  1.00 7.93   ? 203  VAL A CG1  1 
ATOM   3042  C  CG2  . VAL A 1 203 ? 54.600  21.246 41.361  1.00 9.39   ? 203  VAL A CG2  1 
ATOM   3043  H  H    . VAL A 1 203 ? 53.363  19.104 42.558  1.00 10.94  ? 203  VAL A H    1 
ATOM   3044  H  HA   . VAL A 1 203 ? 52.785  21.537 43.425  1.00 8.88   ? 203  VAL A HA   1 
ATOM   3045  H  HB   . VAL A 1 203 ? 52.722  20.745 40.678  1.00 9.36   ? 203  VAL A HB   1 
ATOM   3046  H  HG11 . VAL A 1 203 ? 51.749  22.839 41.033  1.00 11.90  ? 203  VAL A HG11 1 
ATOM   3047  H  HG12 . VAL A 1 203 ? 53.046  22.970 40.164  1.00 11.90  ? 203  VAL A HG12 1 
ATOM   3048  H  HG13 . VAL A 1 203 ? 53.081  23.346 41.685  1.00 11.90  ? 203  VAL A HG13 1 
ATOM   3049  H  HG21 . VAL A 1 203 ? 54.869  20.348 41.569  1.00 14.08  ? 203  VAL A HG21 1 
ATOM   3050  H  HG22 . VAL A 1 203 ? 54.962  21.848 42.016  1.00 14.08  ? 203  VAL A HG22 1 
ATOM   3051  H  HG23 . VAL A 1 203 ? 54.928  21.485 40.491  1.00 14.08  ? 203  VAL A HG23 1 
ATOM   3052  N  N    . ASP A 1 204 ? 50.248  20.001 42.153  1.00 8.15   ? 204  ASP A N    1 
ATOM   3053  C  CA   . ASP A 1 204 ? 48.811  19.928 42.113  1.00 8.36   ? 204  ASP A CA   1 
ATOM   3054  C  C    . ASP A 1 204 ? 48.203  19.910 43.524  1.00 8.62   ? 204  ASP A C    1 
ATOM   3055  O  O    . ASP A 1 204 ? 47.218  20.619 43.789  1.00 9.93   ? 204  ASP A O    1 
ATOM   3056  C  CB   . ASP A 1 204 ? 48.314  18.731 41.345  1.00 9.64   ? 204  ASP A CB   1 
ATOM   3057  C  CG   . ASP A 1 204 ? 48.561  18.733 39.855  1.00 9.20   ? 204  ASP A CG   1 
ATOM   3058  O  OD1  . ASP A 1 204 ? 48.762  19.855 39.324  1.00 10.18  ? 204  ASP A OD1  1 
ATOM   3059  O  OD2  . ASP A 1 204 ? 48.551  17.653 39.255  1.00 8.58   ? 204  ASP A OD2  1 
ATOM   3060  H  H    . ASP A 1 204 ? 50.686  19.340 41.821  1.00 9.78   ? 204  ASP A H    1 
ATOM   3061  H  HA   . ASP A 1 204 ? 48.484  20.732 41.658  1.00 10.03  ? 204  ASP A HA   1 
ATOM   3062  H  HB2  . ASP A 1 204 ? 48.729  17.938 41.718  1.00 11.57  ? 204  ASP A HB2  1 
ATOM   3063  H  HB3  . ASP A 1 204 ? 47.358  18.653 41.492  1.00 11.57  ? 204  ASP A HB3  1 
ATOM   3064  N  N    . ARG A 1 205 ? 48.751  19.091 44.403  1.00 8.79   ? 205  ARG A N    1 
ATOM   3065  C  CA   . ARG A 1 205 ? 48.248  19.009 45.777  1.00 8.34   ? 205  ARG A CA   1 
ATOM   3066  C  C    . ARG A 1 205 ? 48.402  20.295 46.559  1.00 10.05  ? 205  ARG A C    1 
ATOM   3067  O  O    . ARG A 1 205 ? 47.457  20.738 47.244  1.00 10.95  ? 205  ARG A O    1 
ATOM   3068  C  CB   . ARG A 1 205 ? 49.002  17.898 46.495  1.00 9.28   ? 205  ARG A CB   1 
ATOM   3069  C  CG   . ARG A 1 205 ? 48.637  17.675 47.962  1.00 9.81   ? 205  ARG A CG   1 
ATOM   3070  C  CD   . ARG A 1 205 ? 49.521  16.643 48.638  1.00 14.76  ? 205  ARG A CD   1 
ATOM   3071  N  NE   . ARG A 1 205 ? 49.473  15.372 47.932  1.00 21.53  ? 205  ARG A NE   1 
ATOM   3072  C  CZ   . ARG A 1 205 ? 50.369  14.617 47.350  1.00 20.00  ? 205  ARG A CZ   1 
ATOM   3073  N  NH1  . ARG A 1 205 ? 49.991  13.476 46.758  1.00 14.99  ? 205  ARG A NH1  1 
ATOM   3074  N  NH2  . ARG A 1 205 ? 51.667  14.937 47.301  1.00 17.22  ? 205  ARG A NH2  1 
ATOM   3075  H  H    . ARG A 1 205 ? 49.415  18.598 44.165  1.00 10.55  ? 205  ARG A H    1 
ATOM   3076  H  HA   . ARG A 1 205 ? 47.297  18.773 45.748  1.00 10.01  ? 205  ARG A HA   1 
ATOM   3077  H  HB2  . ARG A 1 205 ? 48.850  17.069 46.015  1.00 11.13  ? 205  ARG A HB2  1 
ATOM   3078  H  HB3  . ARG A 1 205 ? 49.951  18.093 46.444  1.00 11.13  ? 205  ARG A HB3  1 
ATOM   3079  H  HG2  . ARG A 1 205 ? 48.713  18.517 48.438  1.00 11.78  ? 205  ARG A HG2  1 
ATOM   3080  H  HG3  . ARG A 1 205 ? 47.713  17.386 48.017  1.00 11.78  ? 205  ARG A HG3  1 
ATOM   3081  H  HD2  . ARG A 1 205 ? 50.436  16.966 48.660  1.00 17.72  ? 205  ARG A HD2  1 
ATOM   3082  H  HD3  . ARG A 1 205 ? 49.226  16.515 49.553  1.00 17.72  ? 205  ARG A HD3  1 
ATOM   3083  H  HE   . ARG A 1 205 ? 48.680  15.044 47.888  1.00 25.84  ? 205  ARG A HE   1 
ATOM   3084  H  HH11 . ARG A 1 205 ? 49.163  13.243 46.762  1.00 17.99  ? 205  ARG A HH11 1 
ATOM   3085  H  HH12 . ARG A 1 205 ? 50.576  12.977 46.374  1.00 17.99  ? 205  ARG A HH12 1 
ATOM   3086  H  HH21 . ARG A 1 205 ? 51.945  15.667 47.662  1.00 20.66  ? 205  ARG A HH21 1 
ATOM   3087  H  HH22 . ARG A 1 205 ? 52.225  14.413 46.908  1.00 20.66  ? 205  ARG A HH22 1 
ATOM   3088  N  N    . LEU A 1 206 ? 49.591  20.888 46.482  1.00 10.25  ? 206  LEU A N    1 
ATOM   3089  C  CA   . LEU A 1 206 ? 49.992  21.956 47.396  1.00 9.64   ? 206  LEU A CA   1 
ATOM   3090  C  C    . LEU A 1 206 ? 49.790  23.365 46.891  1.00 9.82   ? 206  LEU A C    1 
ATOM   3091  O  O    . LEU A 1 206 ? 49.589  24.310 47.652  1.00 11.03  ? 206  LEU A O    1 
ATOM   3092  C  CB   . LEU A 1 206 ? 51.462  21.770 47.734  1.00 10.73  ? 206  LEU A CB   1 
ATOM   3093  C  CG   . LEU A 1 206 ? 51.839  20.502 48.503  1.00 11.33  ? 206  LEU A CG   1 
ATOM   3094  C  CD1  . LEU A 1 206 ? 53.332  20.462 48.742  1.00 16.22  ? 206  LEU A CD1  1 
ATOM   3095  C  CD2  . LEU A 1 206 ? 51.088  20.406 49.829  1.00 17.36  ? 206  LEU A CD2  1 
ATOM   3096  H  H    . LEU A 1 206 ? 50.143  20.634 45.874  1.00 12.30  ? 206  LEU A H    1 
ATOM   3097  H  HA   . LEU A 1 206 ? 49.477  21.855 48.224  1.00 11.57  ? 206  LEU A HA   1 
ATOM   3098  H  HB2  . LEU A 1 206 ? 51.965  21.781 46.905  1.00 12.88  ? 206  LEU A HB2  1 
ATOM   3099  H  HB3  . LEU A 1 206 ? 51.750  22.536 48.256  1.00 12.88  ? 206  LEU A HB3  1 
ATOM   3100  H  HG   . LEU A 1 206 ? 51.595  19.727 47.955  1.00 13.60  ? 206  LEU A HG   1 
ATOM   3101  H  HD11 . LEU A 1 206 ? 53.792  20.521 47.902  1.00 24.33  ? 206  LEU A HD11 1 
ATOM   3102  H  HD12 . LEU A 1 206 ? 53.564  19.639 49.177  1.00 24.33  ? 206  LEU A HD12 1 
ATOM   3103  H  HD13 . LEU A 1 206 ? 53.586  21.202 49.299  1.00 24.33  ? 206  LEU A HD13 1 
ATOM   3104  H  HD21 . LEU A 1 206 ? 50.143  20.445 49.664  1.00 26.05  ? 206  LEU A HD21 1 
ATOM   3105  H  HD22 . LEU A 1 206 ? 51.344  21.137 50.395  1.00 26.05  ? 206  LEU A HD22 1 
ATOM   3106  H  HD23 . LEU A 1 206 ? 51.304  19.576 50.260  1.00 26.05  ? 206  LEU A HD23 1 
ATOM   3107  N  N    . GLY A 1 207 ? 49.890  23.523 45.568  1.00 8.16   ? 207  GLY A N    1 
ATOM   3108  C  CA   . GLY A 1 207 ? 50.005  24.800 44.906  1.00 12.08  ? 207  GLY A CA   1 
ATOM   3109  C  C    . GLY A 1 207 ? 51.449  25.281 44.882  1.00 9.46   ? 207  GLY A C    1 
ATOM   3110  O  O    . GLY A 1 207 ? 52.279  24.951 45.745  1.00 9.27   ? 207  GLY A O    1 
ATOM   3111  H  H    . GLY A 1 207 ? 49.885  22.817 45.078  1.00 9.80   ? 207  GLY A H    1 
ATOM   3112  H  HA2  . GLY A 1 207 ? 49.677  24.721 43.996  1.00 14.49  ? 207  GLY A HA2  1 
ATOM   3113  H  HA3  . GLY A 1 207 ? 49.456  25.453 45.367  1.00 14.49  ? 207  GLY A HA3  1 
ATOM   3114  N  N    . ILE A 1 208 ? 51.809  26.056 43.858  1.00 9.93   ? 208  ILE A N    1 
ATOM   3115  C  CA   . ILE A 1 208 ? 53.174  26.529 43.688  1.00 9.01   ? 208  ILE A CA   1 
ATOM   3116  C  C    . ILE A 1 208 ? 53.625  27.433 44.846  1.00 7.59   ? 208  ILE A C    1 
ATOM   3117  O  O    . ILE A 1 208 ? 54.811  27.516 45.141  1.00 9.32   ? 208  ILE A O    1 
ATOM   3118  C  CB   . ILE A 1 208 ? 53.363  27.204 42.301  1.00 8.46   ? 208  ILE A CB   1 
ATOM   3119  C  CG1  . ILE A 1 208 ? 54.835  27.185 41.916  1.00 7.23   ? 208  ILE A CG1  1 
ATOM   3120  C  CG2  . ILE A 1 208 ? 52.710  28.573 42.270  1.00 9.42   ? 208  ILE A CG2  1 
ATOM   3121  C  CD1  . ILE A 1 208 ? 55.453  25.818 41.672  1.00 12.10  ? 208  ILE A CD1  1 
ATOM   3122  H  H    . ILE A 1 208 ? 51.215  26.284 43.280  1.00 11.91  ? 208  ILE A H    1 
ATOM   3123  H  HA   . ILE A 1 208 ? 53.753  25.738 43.701  1.00 10.82  ? 208  ILE A HA   1 
ATOM   3124  H  HB   . ILE A 1 208 ? 52.890  26.649 41.647  1.00 10.15  ? 208  ILE A HB   1 
ATOM   3125  H  HG12 . ILE A 1 208 ? 54.944  27.714 41.110  1.00 8.67   ? 208  ILE A HG12 1 
ATOM   3126  H  HG13 . ILE A 1 208 ? 55.338  27.624 42.620  1.00 8.67   ? 208  ILE A HG13 1 
ATOM   3127  H  HG21 . ILE A 1 208 ? 51.791  28.495 42.534  1.00 14.14  ? 208  ILE A HG21 1 
ATOM   3128  H  HG22 . ILE A 1 208 ? 52.758  28.931 41.380  1.00 14.14  ? 208  ILE A HG22 1 
ATOM   3129  H  HG23 . ILE A 1 208 ? 53.168  29.160 42.876  1.00 14.14  ? 208  ILE A HG23 1 
ATOM   3130  H  HD11 . ILE A 1 208 ? 56.375  25.922 41.427  1.00 18.15  ? 208  ILE A HD11 1 
ATOM   3131  H  HD12 . ILE A 1 208 ? 54.982  25.375 40.963  1.00 18.15  ? 208  ILE A HD12 1 
ATOM   3132  H  HD13 . ILE A 1 208 ? 55.393  25.292 42.474  1.00 18.15  ? 208  ILE A HD13 1 
ATOM   3133  N  N    . GLY A 1 209 ? 52.682  28.094 45.510  1.00 9.41   ? 209  GLY A N    1 
ATOM   3134  C  CA   . GLY A 1 209 ? 53.076  28.958 46.644  1.00 8.43   ? 209  GLY A CA   1 
ATOM   3135  C  C    . GLY A 1 209 ? 53.686  28.125 47.757  1.00 9.06   ? 209  GLY A C    1 
ATOM   3136  O  O    . GLY A 1 209 ? 54.801  28.425 48.250  1.00 11.40  ? 209  GLY A O    1 
ATOM   3137  H  H    . GLY A 1 209 ? 51.856  28.020 45.283  1.00 11.30  ? 209  GLY A H    1 
ATOM   3138  H  HA2  . GLY A 1 209 ? 53.719  29.618 46.341  1.00 10.12  ? 209  GLY A HA2  1 
ATOM   3139  H  HA3  . GLY A 1 209 ? 52.297  29.429 46.979  1.00 10.12  ? 209  GLY A HA3  1 
ATOM   3140  N  N    . LYS A 1 210 ? 53.024  27.093 48.178  1.00 9.62   ? 210  LYS A N    1 
ATOM   3141  C  CA   . LYS A 1 210 ? 53.543  26.195 49.231  1.00 9.51   ? 210  LYS A CA   1 
ATOM   3142  C  C    . LYS A 1 210 ? 54.747  25.411 48.737  1.00 9.60   ? 210  LYS A C    1 
ATOM   3143  O  O    . LYS A 1 210 ? 55.717  25.146 49.477  1.00 11.24  ? 210  LYS A O    1 
ATOM   3144  C  CB   . LYS A 1 210 ? 52.424  25.290 49.688  1.00 13.92  ? 210  LYS A CB   1 
ATOM   3145  C  CG   . LYS A 1 210 ? 52.680  24.556 50.980  1.00 23.84  ? 210  LYS A CG   1 
ATOM   3146  C  CD   . LYS A 1 210 ? 52.833  25.463 52.178  1.00 26.18  ? 210  LYS A CD   1 
ATOM   3147  C  CE   . LYS A 1 210 ? 52.883  24.675 53.480  1.00 36.17  ? 210  LYS A CE   1 
ATOM   3148  N  NZ   . LYS A 1 210 ? 54.260  24.190 53.765  1.00 41.52  ? 210  LYS A NZ   1 
ATOM   3149  H  H    . LYS A 1 210 ? 52.255  26.925 47.832  1.00 11.55  ? 210  LYS A H    1 
ATOM   3150  H  HA   . LYS A 1 210 ? 53.825  26.744 49.993  1.00 11.42  ? 210  LYS A HA   1 
ATOM   3151  H  HB2  . LYS A 1 210 ? 51.620  25.823 49.791  1.00 16.70  ? 210  LYS A HB2  1 
ATOM   3152  H  HB3  . LYS A 1 210 ? 52.253  24.636 48.991  1.00 16.70  ? 210  LYS A HB3  1 
ATOM   3153  H  HG2  . LYS A 1 210 ? 51.944  23.945 51.143  1.00 28.60  ? 210  LYS A HG2  1 
ATOM   3154  H  HG3  . LYS A 1 210 ? 53.487  24.026 50.884  1.00 28.60  ? 210  LYS A HG3  1 
ATOM   3155  H  HD2  . LYS A 1 210 ? 53.649  25.981 52.086  1.00 31.41  ? 210  LYS A HD2  1 
ATOM   3156  H  HD3  . LYS A 1 210 ? 52.088  26.083 52.208  1.00 31.41  ? 210  LYS A HD3  1 
ATOM   3157  H  HE2  . LYS A 1 210 ? 52.583  25.239 54.209  1.00 43.41  ? 210  LYS A HE2  1 
ATOM   3158  H  HE3  . LYS A 1 210 ? 52.282  23.916 53.420  1.00 43.41  ? 210  LYS A HE3  1 
ATOM   3159  H  HZ1  . LYS A 1 210 ? 54.265  23.752 54.540  1.00 62.28  ? 210  LYS A HZ1  1 
ATOM   3160  H  HZ2  . LYS A 1 210 ? 54.815  24.885 53.814  1.00 62.28  ? 210  LYS A HZ2  1 
ATOM   3161  H  HZ3  . LYS A 1 210 ? 54.524  23.645 53.113  1.00 62.28  ? 210  LYS A HZ3  1 
ATOM   3162  N  N    . VAL A 1 211 ? 54.761  25.007 47.449  1.00 10.40  ? 211  VAL A N    1 
ATOM   3163  C  CA   . VAL A 1 211 ? 55.975  24.371 46.929  1.00 8.98   ? 211  VAL A CA   1 
ATOM   3164  C  C    . VAL A 1 211 ? 57.201  25.224 47.113  1.00 9.09   ? 211  VAL A C    1 
ATOM   3165  O  O    . VAL A 1 211 ? 58.271  24.760 47.553  1.00 10.04  ? 211  VAL A O    1 
ATOM   3166  C  CB   . VAL A 1 211 ? 55.787  24.008 45.437  1.00 9.00   ? 211  VAL A CB   1 
ATOM   3167  C  CG1  . VAL A 1 211 ? 57.123  23.619 44.801  1.00 10.18  ? 211  VAL A CG1  1 
ATOM   3168  C  CG2  . VAL A 1 211 ? 54.783  22.875 45.382  1.00 10.13  ? 211  VAL A CG2  1 
ATOM   3169  H  H    . VAL A 1 211 ? 54.074  25.120 46.945  1.00 12.48  ? 211  VAL A H    1 
ATOM   3170  H  HA   . VAL A 1 211 ? 56.112  23.537 47.425  1.00 10.78  ? 211  VAL A HA   1 
ATOM   3171  H  HB   . VAL A 1 211 ? 55.421  24.783 44.963  1.00 10.79  ? 211  VAL A HB   1 
ATOM   3172  H  HG11 . VAL A 1 211 ? 57.735  24.356 44.864  1.00 15.27  ? 211  VAL A HG11 1 
ATOM   3173  H  HG12 . VAL A 1 211 ? 56.985  23.395 43.878  1.00 15.27  ? 211  VAL A HG12 1 
ATOM   3174  H  HG13 . VAL A 1 211 ? 57.489  22.860 45.262  1.00 15.27  ? 211  VAL A HG13 1 
ATOM   3175  H  HG21 . VAL A 1 211 ? 53.961  23.156 45.791  1.00 15.19  ? 211  VAL A HG21 1 
ATOM   3176  H  HG22 . VAL A 1 211 ? 55.132  22.116 45.855  1.00 15.19  ? 211  VAL A HG22 1 
ATOM   3177  H  HG23 . VAL A 1 211 ? 54.620  22.636 44.467  1.00 15.19  ? 211  VAL A HG23 1 
ATOM   3178  N  N    . MET A 1 212 ? 57.140  26.525 46.801  1.00 8.01   ? 212  MET A N    1 
ATOM   3179  C  CA   . MET A 1 212 ? 58.280  27.424 46.941  1.00 8.13   ? 212  MET A CA   1 
ATOM   3180  C  C    . MET A 1 212 ? 58.614  27.671 48.418  1.00 10.52  ? 212  MET A C    1 
ATOM   3181  O  O    . MET A 1 212 ? 59.783  27.740 48.779  1.00 10.20  ? 212  MET A O    1 
ATOM   3182  C  CB   . MET A 1 212 ? 58.085  28.716 46.152  1.00 10.02  ? 212  MET A CB   1 
ATOM   3183  C  CG   . MET A 1 212 ? 58.150  28.526 44.638  1.00 7.19   ? 212  MET A CG   1 
ATOM   3184  S  SD   . MET A 1 212 ? 59.599  27.604 44.066  1.00 11.84  ? 212  MET A SD   1 
ATOM   3185  C  CE   . MET A 1 212 ? 60.949  28.634 44.626  1.00 11.59  ? 212  MET A CE   1 
ATOM   3186  H  H    . MET A 1 212 ? 56.398  26.843 46.506  1.00 9.62   ? 212  MET A H    1 
ATOM   3187  H  HA   . MET A 1 212 ? 59.052  26.967 46.549  1.00 9.76   ? 212  MET A HA   1 
ATOM   3188  H  HB2  . MET A 1 212 ? 57.223  29.097 46.383  1.00 12.02  ? 212  MET A HB2  1 
ATOM   3189  H  HB3  . MET A 1 212 ? 58.768  29.351 46.418  1.00 12.02  ? 212  MET A HB3  1 
ATOM   3190  H  HG2  . MET A 1 212 ? 57.350  28.060 44.348  1.00 8.63   ? 212  MET A HG2  1 
ATOM   3191  H  HG3  . MET A 1 212 ? 58.150  29.399 44.215  1.00 8.63   ? 212  MET A HG3  1 
ATOM   3192  H  HE1  . MET A 1 212 ? 61.783  28.233 44.374  1.00 17.39  ? 212  MET A HE1  1 
ATOM   3193  H  HE2  . MET A 1 212 ? 60.910  28.720 45.581  1.00 17.39  ? 212  MET A HE2  1 
ATOM   3194  H  HE3  . MET A 1 212 ? 60.877  29.502 44.223  1.00 17.39  ? 212  MET A HE3  1 
ATOM   3195  N  N    . GLU A 1 213 ? 57.558  27.815 49.210  1.00 10.17  ? 213  GLU A N    1 
ATOM   3196  C  CA   . GLU A 1 213 ? 57.852  28.038 50.638  1.00 13.62  ? 213  GLU A CA   1 
ATOM   3197  C  C    . GLU A 1 213 ? 58.671  26.870 51.195  1.00 6.76   ? 213  GLU A C    1 
ATOM   3198  O  O    . GLU A 1 213 ? 59.669  27.024 51.905  1.00 11.85  ? 213  GLU A O    1 
ATOM   3199  C  CB   . GLU A 1 213 ? 56.561  28.190 51.437  1.00 12.40  ? 213  GLU A CB   1 
ATOM   3200  C  CG   . GLU A 1 213 ? 56.799  28.341 52.949  1.00 14.29  ? 213  GLU A CG   1 
ATOM   3201  C  CD   . GLU A 1 213 ? 55.489  28.770 53.605  1.00 29.92  ? 213  GLU A CD   1 
ATOM   3202  O  OE1  . GLU A 1 213 ? 54.739  29.545 52.963  1.00 38.01  ? 213  GLU A OE1  1 
ATOM   3203  O  OE2  . GLU A 1 213 ? 55.246  28.328 54.743  1.00 42.56  ? 213  GLU A OE2  1 
ATOM   3204  H  H    . GLU A 1 213 ? 56.754  27.782 48.908  1.00 12.20  ? 213  GLU A H    1 
ATOM   3205  H  HA   . GLU A 1 213 ? 58.376  28.861 50.727  1.00 16.34  ? 213  GLU A HA   1 
ATOM   3206  H  HB2  . GLU A 1 213 ? 56.081  28.968 51.115  1.00 14.88  ? 213  GLU A HB2  1 
ATOM   3207  H  HB3  . GLU A 1 213 ? 56.002  27.412 51.283  1.00 14.88  ? 213  GLU A HB3  1 
ATOM   3208  H  HG2  . GLU A 1 213 ? 57.097  27.497 53.324  1.00 17.15  ? 213  GLU A HG2  1 
ATOM   3209  H  HG3  . GLU A 1 213 ? 57.485  29.007 53.112  1.00 17.15  ? 213  GLU A HG3  1 
ATOM   3210  N  N    . GLU A 1 214 ? 58.218  25.670 50.889  1.00 9.04   ? 214  GLU A N    1 
ATOM   3211  C  CA   . GLU A 1 214 ? 58.845  24.421 51.333  1.00 9.58   ? 214  GLU A CA   1 
ATOM   3212  C  C    . GLU A 1 214 ? 60.214  24.236 50.687  1.00 12.68  ? 214  GLU A C    1 
ATOM   3213  O  O    . GLU A 1 214 ? 61.172  23.764 51.328  1.00 12.18  ? 214  GLU A O    1 
ATOM   3214  C  CB   . GLU A 1 214 ? 57.932  23.231 51.051  1.00 11.76  ? 214  GLU A CB   1 
ATOM   3215  C  CG   . GLU A 1 214 ? 56.700  23.130 51.923  1.00 14.50  ? 214  GLU A CG   1 
ATOM   3216  C  CD   . GLU A 1 214 ? 56.114  21.726 51.908  1.00 19.81  ? 214  GLU A CD   1 
ATOM   3217  O  OE1  . GLU A 1 214 ? 56.873  20.778 51.603  1.00 23.89  ? 214  GLU A OE1  1 
ATOM   3218  O  OE2  . GLU A 1 214 ? 54.921  21.621 52.232  1.00 28.96  ? 214  GLU A OE2  1 
ATOM   3219  H  H    . GLU A 1 214 ? 57.512  25.617 50.400  1.00 10.85  ? 214  GLU A H    1 
ATOM   3220  H  HA   . GLU A 1 214 ? 58.975  24.477 52.303  1.00 11.49  ? 214  GLU A HA   1 
ATOM   3221  H  HB2  . GLU A 1 214 ? 57.648  23.276 50.125  1.00 14.12  ? 214  GLU A HB2  1 
ATOM   3222  H  HB3  . GLU A 1 214 ? 58.449  22.417 51.158  1.00 14.12  ? 214  GLU A HB3  1 
ATOM   3223  H  HG2  . GLU A 1 214 ? 56.931  23.371 52.834  1.00 17.40  ? 214  GLU A HG2  1 
ATOM   3224  H  HG3  . GLU A 1 214 ? 56.032  23.759 51.608  1.00 17.40  ? 214  GLU A HG3  1 
ATOM   3225  N  N    . THR A 1 215 ? 60.399  24.556 49.403  1.00 9.77   ? 215  THR A N    1 
ATOM   3226  C  CA   . THR A 1 215 ? 61.716  24.423 48.735  1.00 12.98  ? 215  THR A CA   1 
ATOM   3227  C  C    . THR A 1 215 ? 62.735  25.261 49.462  1.00 10.94  ? 215  THR A C    1 
ATOM   3228  O  O    . THR A 1 215 ? 63.880  24.889 49.763  1.00 11.11  ? 215  THR A O    1 
ATOM   3229  C  CB   . THR A 1 215 ? 61.590  24.815 47.251  1.00 9.76   ? 215  THR A CB   1 
ATOM   3230  O  OG1  . THR A 1 215 ? 60.796  23.801 46.589  1.00 9.57   ? 215  THR A OG1  1 
ATOM   3231  C  CG2  . THR A 1 215 ? 62.935  24.832 46.512  1.00 10.85  ? 215  THR A CG2  1 
ATOM   3232  H  H    . THR A 1 215 ? 59.731  24.849 48.948  1.00 11.72  ? 215  THR A H    1 
ATOM   3233  H  HA   . THR A 1 215 ? 61.995  23.485 48.785  1.00 15.58  ? 215  THR A HA   1 
ATOM   3234  H  HB   . THR A 1 215 ? 61.153  25.688 47.170  1.00 11.71  ? 215  THR A HB   1 
ATOM   3235  H  HG1  . THR A 1 215 ? 60.061  23.752 46.948  1.00 14.36  ? 215  THR A HG1  1 
ATOM   3236  H  HG21 . THR A 1 215 ? 62.795  25.086 45.597  1.00 16.28  ? 215  THR A HG21 1 
ATOM   3237  H  HG22 . THR A 1 215 ? 63.329  23.957 46.544  1.00 16.28  ? 215  THR A HG22 1 
ATOM   3238  H  HG23 . THR A 1 215 ? 63.523  25.463 46.933  1.00 16.28  ? 215  THR A HG23 1 
ATOM   3239  N  N    . LEU A 1 216 ? 62.326  26.510 49.724  1.00 10.73  ? 216  LEU A N    1 
ATOM   3240  C  CA   . LEU A 1 216 ? 63.310  27.479 50.186  1.00 12.02  ? 216  LEU A CA   1 
ATOM   3241  C  C    . LEU A 1 216 ? 63.572  27.220 51.680  1.00 12.68  ? 216  LEU A C    1 
ATOM   3242  O  O    . LEU A 1 216 ? 64.723  27.463 52.073  1.00 14.38  ? 216  LEU A O    1 
ATOM   3243  C  CB   . LEU A 1 216 ? 62.879  28.904 49.876  1.00 9.55   ? 216  LEU A CB   1 
ATOM   3244  C  CG   . LEU A 1 216 ? 62.801  29.265 48.395  1.00 11.51  ? 216  LEU A CG   1 
ATOM   3245  C  CD1  . LEU A 1 216 ? 62.203  30.643 48.190  1.00 15.39  ? 216  LEU A CD1  1 
ATOM   3246  C  CD2  . LEU A 1 216 ? 64.166  29.181 47.724  1.00 14.40  ? 216  LEU A CD2  1 
ATOM   3247  H  H    . LEU A 1 216 ? 61.502  26.734 49.621  1.00 12.88  ? 216  LEU A H    1 
ATOM   3248  H  HA   . LEU A 1 216 ? 64.146  27.309 49.703  1.00 14.42  ? 216  LEU A HA   1 
ATOM   3249  H  HB2  . LEU A 1 216 ? 62.007  29.053 50.273  1.00 11.46  ? 216  LEU A HB2  1 
ATOM   3250  H  HB3  . LEU A 1 216 ? 63.501  29.512 50.306  1.00 11.46  ? 216  LEU A HB3  1 
ATOM   3251  H  HG   . LEU A 1 216 ? 62.212  28.615 47.958  1.00 13.82  ? 216  LEU A HG   1 
ATOM   3252  H  HD11 . LEU A 1 216 ? 61.349  30.689 48.626  1.00 23.09  ? 216  LEU A HD11 1 
ATOM   3253  H  HD12 . LEU A 1 216 ? 62.093  30.807 47.251  1.00 23.09  ? 216  LEU A HD12 1 
ATOM   3254  H  HD13 . LEU A 1 216 ? 62.790  31.304 48.564  1.00 23.09  ? 216  LEU A HD13 1 
ATOM   3255  H  HD21 . LEU A 1 216 ? 64.529  28.301 47.846  1.00 21.60  ? 216  LEU A HD21 1 
ATOM   3256  H  HD22 . LEU A 1 216 ? 64.756  29.829 48.117  1.00 21.60  ? 216  LEU A HD22 1 
ATOM   3257  H  HD23 . LEU A 1 216 ? 64.073  29.362 46.786  1.00 21.60  ? 216  LEU A HD23 1 
ATOM   3258  N  N    . SER A 1 217 ? 62.583  26.714 52.402  1.00 13.51  ? 217  SER A N    1 
ATOM   3259  C  CA   . SER A 1 217 ? 62.788  26.428 53.816  1.00 12.58  ? 217  SER A CA   1 
ATOM   3260  C  C    . SER A 1 217 ? 63.696  25.221 53.926  1.00 13.26  ? 217  SER A C    1 
ATOM   3261  O  O    . SER A 1 217 ? 64.563  25.210 54.784  1.00 15.44  ? 217  SER A O    1 
ATOM   3262  C  CB   . SER A 1 217 ? 61.442  26.143 54.490  1.00 17.41  ? 217  SER A CB   1 
ATOM   3263  O  OG   . SER A 1 217 ? 61.689  25.834 55.867  1.00 24.07  ? 217  SER A OG   1 
ATOM   3264  H  H    . SER A 1 217 ? 61.821  26.554 52.037  1.00 16.21  ? 217  SER A H    1 
ATOM   3265  H  HA   . SER A 1 217 ? 63.213  27.198 54.247  1.00 15.09  ? 217  SER A HA   1 
ATOM   3266  H  HB2  . SER A 1 217 ? 60.864  26.919 54.421  1.00 20.90  ? 217  SER A HB2  1 
ATOM   3267  H  HB3  . SER A 1 217 ? 61.003  25.395 54.054  1.00 20.90  ? 217  SER A HB3  1 
ATOM   3268  H  HG   . SER A 1 217 ? 62.171  25.173 55.917  1.00 36.10  ? 217  SER A HG   1 
ATOM   3269  N  N    . TYR A 1 218 ? 63.554  24.227 53.082  1.00 13.46  ? 218  TYR A N    1 
ATOM   3270  C  CA   . TYR A 1 218 ? 64.418  23.058 53.026  1.00 13.29  ? 218  TYR A CA   1 
ATOM   3271  C  C    . TYR A 1 218 ? 65.840  23.407 52.690  1.00 13.89  ? 218  TYR A C    1 
ATOM   3272  O  O    . TYR A 1 218 ? 66.757  22.841 53.311  1.00 18.76  ? 218  TYR A O    1 
ATOM   3273  C  CB   . TYR A 1 218 ? 63.887  22.070 51.991  1.00 16.27  ? 218  TYR A CB   1 
ATOM   3274  C  CG   . TYR A 1 218 ? 64.630  20.789 51.825  1.00 12.64  ? 218  TYR A CG   1 
ATOM   3275  C  CD1  . TYR A 1 218 ? 64.328  19.679 52.606  1.00 16.76  ? 218  TYR A CD1  1 
ATOM   3276  C  CD2  . TYR A 1 218 ? 65.622  20.662 50.872  1.00 12.02  ? 218  TYR A CD2  1 
ATOM   3277  C  CE1  . TYR A 1 218 ? 64.998  18.484 52.474  1.00 13.80  ? 218  TYR A CE1  1 
ATOM   3278  C  CE2  . TYR A 1 218 ? 66.298  19.466 50.722  1.00 12.18  ? 218  TYR A CE2  1 
ATOM   3279  C  CZ   . TYR A 1 218 ? 65.997  18.370 51.513  1.00 13.14  ? 218  TYR A CZ   1 
ATOM   3280  O  OH   . TYR A 1 218 ? 66.641  17.165 51.372  1.00 14.36  ? 218  TYR A OH   1 
ATOM   3281  H  H    . TYR A 1 218 ? 62.903  24.269 52.521  1.00 16.15  ? 218  TYR A H    1 
ATOM   3282  H  HA   . TYR A 1 218 ? 64.407  22.623 53.904  1.00 15.95  ? 218  TYR A HA   1 
ATOM   3283  H  HB2  . TYR A 1 218 ? 62.970  21.857 52.225  1.00 19.52  ? 218  TYR A HB2  1 
ATOM   3284  H  HB3  . TYR A 1 218 ? 63.867  22.519 51.131  1.00 19.52  ? 218  TYR A HB3  1 
ATOM   3285  H  HD1  . TYR A 1 218 ? 63.651  19.747 53.240  1.00 20.11  ? 218  TYR A HD1  1 
ATOM   3286  H  HD2  . TYR A 1 218 ? 65.837  21.386 50.329  1.00 14.42  ? 218  TYR A HD2  1 
ATOM   3287  H  HE1  . TYR A 1 218 ? 64.786  17.762 53.020  1.00 16.56  ? 218  TYR A HE1  1 
ATOM   3288  H  HE2  . TYR A 1 218 ? 66.966  19.396 50.079  1.00 14.62  ? 218  TYR A HE2  1 
ATOM   3289  H  HH   . TYR A 1 218 ? 67.202  17.222 50.776  1.00 21.55  ? 218  TYR A HH   1 
ATOM   3290  N  N    . LEU A 1 219 ? 66.139  24.291 51.738  1.00 12.35  ? 219  LEU A N    1 
ATOM   3291  C  CA   . LEU A 1 219 ? 67.497  24.570 51.392  1.00 14.88  ? 219  LEU A CA   1 
ATOM   3292  C  C    . LEU A 1 219 ? 68.136  25.658 52.266  1.00 12.39  ? 219  LEU A C    1 
ATOM   3293  O  O    . LEU A 1 219 ? 69.370  25.624 52.462  1.00 14.82  ? 219  LEU A O    1 
ATOM   3294  C  CB   . LEU A 1 219 ? 67.576  25.006 49.924  1.00 13.60  ? 219  LEU A CB   1 
ATOM   3295  C  CG   . LEU A 1 219 ? 67.358  23.916 48.892  1.00 13.04  ? 219  LEU A CG   1 
ATOM   3296  C  CD1  . LEU A 1 219 ? 67.335  24.577 47.520  1.00 14.04  ? 219  LEU A CD1  1 
ATOM   3297  C  CD2  . LEU A 1 219 ? 68.466  22.882 48.912  1.00 15.34  ? 219  LEU A CD2  1 
ATOM   3298  H  H    . LEU A 1 219 ? 65.505  24.700 51.325  1.00 14.82  ? 219  LEU A H    1 
ATOM   3299  H  HA   . LEU A 1 219 ? 68.018  23.746 51.497  1.00 17.86  ? 219  LEU A HA   1 
ATOM   3300  H  HB2  . LEU A 1 219 ? 66.914  25.700 49.777  1.00 16.32  ? 219  LEU A HB2  1 
ATOM   3301  H  HB3  . LEU A 1 219 ? 68.449  25.400 49.770  1.00 16.32  ? 219  LEU A HB3  1 
ATOM   3302  H  HG   . LEU A 1 219 ? 66.498  23.477 49.057  1.00 15.65  ? 219  LEU A HG   1 
ATOM   3303  H  HD11 . LEU A 1 219 ? 66.639  25.237 47.495  1.00 21.06  ? 219  LEU A HD11 1 
ATOM   3304  H  HD12 . LEU A 1 219 ? 67.171  23.912 46.848  1.00 21.06  ? 219  LEU A HD12 1 
ATOM   3305  H  HD13 . LEU A 1 219 ? 68.182  24.998 47.354  1.00 21.06  ? 219  LEU A HD13 1 
ATOM   3306  H  HD21 . LEU A 1 219 ? 68.286  22.208 48.251  1.00 23.01  ? 219  LEU A HD21 1 
ATOM   3307  H  HD22 . LEU A 1 219 ? 68.508  22.475 49.780  1.00 23.01  ? 219  LEU A HD22 1 
ATOM   3308  H  HD23 . LEU A 1 219 ? 69.304  23.306 48.716  1.00 23.01  ? 219  LEU A HD23 1 
ATOM   3309  N  N    . LEU A 1 220 ? 67.351  26.614 52.732  1.00 12.62  ? 220  LEU A N    1 
ATOM   3310  C  CA   . LEU A 1 220 ? 67.899  27.762 53.458  1.00 15.72  ? 220  LEU A CA   1 
ATOM   3311  C  C    . LEU A 1 220 ? 67.474  27.807 54.931  1.00 13.63  ? 220  LEU A C    1 
ATOM   3312  O  O    . LEU A 1 220 ? 67.877  28.794 55.584  1.00 24.95  ? 220  LEU A O    1 
ATOM   3313  C  CB   . LEU A 1 220 ? 67.472  29.047 52.749  1.00 14.58  ? 220  LEU A CB   1 
ATOM   3314  C  CG   . LEU A 1 220 ? 67.692  29.258 51.250  1.00 16.17  ? 220  LEU A CG   1 
ATOM   3315  C  CD1  . LEU A 1 220 ? 66.959  30.506 50.790  1.00 20.64  ? 220  LEU A CD1  1 
ATOM   3316  C  CD2  . LEU A 1 220 ? 69.167  29.337 50.920  1.00 14.59  ? 220  LEU A CD2  1 
ATOM   3317  H  H    . LEU A 1 220 ? 66.502  26.560 52.606  1.00 15.14  ? 220  LEU A H    1 
ATOM   3318  H  HA   . LEU A 1 220 ? 68.877  27.706 53.424  1.00 18.86  ? 220  LEU A HA   1 
ATOM   3319  H  HB2  . LEU A 1 220 ? 66.521  29.155 52.911  1.00 17.50  ? 220  LEU A HB2  1 
ATOM   3320  H  HB3  . LEU A 1 220 ? 67.916  29.780 53.204  1.00 17.50  ? 220  LEU A HB3  1 
ATOM   3321  H  HG   . LEU A 1 220 ? 67.313  28.489 50.775  1.00 19.40  ? 220  LEU A HG   1 
ATOM   3322  H  HD11 . LEU A 1 220 ? 66.025  30.421 50.991  1.00 30.96  ? 220  LEU A HD11 1 
ATOM   3323  H  HD12 . LEU A 1 220 ? 67.074  30.613 49.843  1.00 30.96  ? 220  LEU A HD12 1 
ATOM   3324  H  HD13 . LEU A 1 220 ? 67.317  31.272 51.244  1.00 30.96  ? 220  LEU A HD13 1 
ATOM   3325  H  HD21 . LEU A 1 220 ? 69.609  28.545 51.233  1.00 21.89  ? 220  LEU A HD21 1 
ATOM   3326  H  HD22 . LEU A 1 220 ? 69.550  30.107 51.348  1.00 21.89  ? 220  LEU A HD22 1 
ATOM   3327  H  HD23 . LEU A 1 220 ? 69.279  29.411 49.969  1.00 21.89  ? 220  LEU A HD23 1 
ATOM   3328  N  N    . GLY A 1 221 ? 66.776  26.819 55.432  1.00 16.08  ? 221  GLY A N    1 
ATOM   3329  C  CA   . GLY A 1 221 ? 66.294  26.847 56.817  1.00 22.85  ? 221  GLY A CA   1 
ATOM   3330  C  C    . GLY A 1 221 ? 67.403  26.910 57.838  1.00 17.09  ? 221  GLY A C    1 
ATOM   3331  O  O    . GLY A 1 221 ? 67.331  27.747 58.751  1.00 31.61  ? 221  GLY A O    1 
ATOM   3332  H  H    . GLY A 1 221 ? 66.597  26.138 54.938  1.00 19.30  ? 221  GLY A H    1 
ATOM   3333  H  HA2  . GLY A 1 221 ? 65.716  27.617 56.932  1.00 27.41  ? 221  GLY A HA2  1 
ATOM   3334  H  HA3  . GLY A 1 221 ? 65.762  26.052 56.980  1.00 27.41  ? 221  GLY A HA3  1 
ATOM   3335  N  N    . ARG A 1 222 ? 68.424  26.083 57.745  1.00 18.50  ? 222  ARG A N    1 
ATOM   3336  C  CA   . ARG A 1 222 ? 69.560  26.054 58.670  1.00 18.47  ? 222  ARG A CA   1 
ATOM   3337  C  C    . ARG A 1 222 ? 70.425  27.298 58.570  0.70 23.01  ? 222  ARG A C    1 
ATOM   3338  O  O    . ARG A 1 222 ? 70.861  27.853 59.594  0.70 19.33  ? 222  ARG A O    1 
ATOM   3339  C  CB   . ARG A 1 222 ? 70.351  24.770 58.413  0.70 23.29  ? 222  ARG A CB   1 
ATOM   3340  C  CG   . ARG A 1 222 ? 71.577  24.573 59.284  0.70 30.06  ? 222  ARG A CG   1 
ATOM   3341  C  CD   . ARG A 1 222 ? 72.510  23.516 58.741  0.70 41.24  ? 222  ARG A CD   1 
ATOM   3342  N  NE   . ARG A 1 222 ? 72.029  22.146 58.872  0.70 49.66  ? 222  ARG A NE   1 
ATOM   3343  C  CZ   . ARG A 1 222 ? 71.552  21.507 59.959  0.70 50.14  ? 222  ARG A CZ   1 
ATOM   3344  N  NH1  . ARG A 1 222 ? 71.464  22.092 61.214  0.70 79.05  ? 222  ARG A NH1  1 
ATOM   3345  N  NH2  . ARG A 1 222 ? 71.182  20.232 59.833  0.70 47.08  ? 222  ARG A NH2  1 
ATOM   3346  H  H    . ARG A 1 222 ? 68.424  25.521 57.094  1.00 22.20  ? 222  ARG A H    1 
ATOM   3347  H  HA   . ARG A 1 222 ? 69.203  26.009 59.581  1.00 22.16  ? 222  ARG A HA   1 
ATOM   3348  H  HB2  . ARG A 1 222 ? 69.759  24.013 58.544  0.70 27.94  ? 222  ARG A HB2  1 
ATOM   3349  H  HB3  . ARG A 1 222 ? 70.632  24.763 57.485  0.70 27.94  ? 222  ARG A HB3  1 
ATOM   3350  H  HG2  . ARG A 1 222 ? 72.055  25.414 59.353  0.70 36.07  ? 222  ARG A HG2  1 
ATOM   3351  H  HG3  . ARG A 1 222 ? 71.294  24.318 60.176  0.70 36.07  ? 222  ARG A HG3  1 
ATOM   3352  H  HD2  . ARG A 1 222 ? 72.671  23.699 57.802  0.70 49.48  ? 222  ARG A HD2  1 
ATOM   3353  H  HD3  . ARG A 1 222 ? 73.361  23.590 59.202  0.70 49.48  ? 222  ARG A HD3  1 
ATOM   3354  H  HE   . ARG A 1 222 ? 72.052  21.678 58.151  0.70 59.59  ? 222  ARG A HE   1 
ATOM   3355  H  HH11 . ARG A 1 222 ? 71.721  22.904 61.329  0.70 94.86  ? 222  ARG A HH11 1 
ATOM   3356  H  HH12 . ARG A 1 222 ? 71.152  21.642 61.877  0.70 94.86  ? 222  ARG A HH12 1 
ATOM   3357  H  HH21 . ARG A 1 222 ? 71.249  19.838 59.072  0.70 56.50  ? 222  ARG A HH21 1 
ATOM   3358  H  HH22 . ARG A 1 222 ? 70.875  19.804 60.513  0.70 56.50  ? 222  ARG A HH22 1 
ATOM   3359  N  N    . LYS A 1 223 ? 70.710  27.774 57.364  1.00 24.53  ? 223  LYS A N    1 
ATOM   3360  C  CA   . LYS A 1 223 ? 71.587  28.900 57.118  1.00 29.05  ? 223  LYS A CA   1 
ATOM   3361  C  C    . LYS A 1 223 ? 71.490  29.391 55.668  1.00 19.63  ? 223  LYS A C    1 
ATOM   3362  O  O    . LYS A 1 223 ? 71.129  28.624 54.775  1.00 28.69  ? 223  LYS A O    1 
ATOM   3363  C  CB   . LYS A 1 223 ? 73.045  28.538 57.385  1.00 25.35  ? 223  LYS A CB   1 
ATOM   3364  C  CG   . LYS A 1 223 ? 73.409  27.088 57.169  1.00 32.14  ? 223  LYS A CG   1 
ATOM   3365  C  CD   . LYS A 1 223 ? 73.411  26.610 55.734  1.00 40.25  ? 223  LYS A CD   1 
ATOM   3366  C  CE   . LYS A 1 223 ? 73.891  25.164 55.618  1.00 48.21  ? 223  LYS A CE   1 
ATOM   3367  N  NZ   . LYS A 1 223 ? 72.997  24.269 54.824  1.00 24.54  ? 223  LYS A NZ   1 
ATOM   3368  H  H    . LYS A 1 223 ? 70.350  27.388 56.685  1.00 29.43  ? 223  LYS A H    1 
ATOM   3369  H  HA   . LYS A 1 223 ? 71.332  29.633 57.716  1.00 34.86  ? 223  LYS A HA   1 
ATOM   3370  H  HB2  . LYS A 1 223 ? 73.605  29.082 56.809  1.00 30.41  ? 223  LYS A HB2  1 
ATOM   3371  H  HB3  . LYS A 1 223 ? 73.255  28.772 58.302  1.00 30.41  ? 223  LYS A HB3  1 
ATOM   3372  H  HG2  . LYS A 1 223 ? 74.292  26.938 57.541  1.00 38.57  ? 223  LYS A HG2  1 
ATOM   3373  H  HG3  . LYS A 1 223 ? 72.786  26.540 57.671  1.00 38.57  ? 223  LYS A HG3  1 
ATOM   3374  H  HD2  . LYS A 1 223 ? 72.513  26.678 55.372  1.00 48.30  ? 223  LYS A HD2  1 
ATOM   3375  H  HD3  . LYS A 1 223 ? 73.989  27.182 55.206  1.00 48.30  ? 223  LYS A HD3  1 
ATOM   3376  H  HE2  . LYS A 1 223 ? 74.771  25.163 55.210  1.00 57.85  ? 223  LYS A HE2  1 
ATOM   3377  H  HE3  . LYS A 1 223 ? 73.982  24.797 56.511  1.00 57.85  ? 223  LYS A HE3  1 
ATOM   3378  H  HZ1  . LYS A 1 223 ? 73.259  23.424 54.922  1.00 36.81  ? 223  LYS A HZ1  1 
ATOM   3379  H  HZ2  . LYS A 1 223 ? 73.040  24.494 53.964  1.00 36.81  ? 223  LYS A HZ2  1 
ATOM   3380  H  HZ3  . LYS A 1 223 ? 72.159  24.355 55.112  1.00 36.81  ? 223  LYS A HZ3  1 
ATOM   3381  N  N    . LYS A 1 224 ? 71.780  30.663 55.487  1.00 21.44  ? 224  LYS A N    1 
ATOM   3382  C  CA   . LYS A 1 224 ? 71.780  31.224 54.130  1.00 25.84  ? 224  LYS A CA   1 
ATOM   3383  C  C    . LYS A 1 224 ? 72.958  30.601 53.375  1.00 25.09  ? 224  LYS A C    1 
ATOM   3384  O  O    . LYS A 1 224 ? 74.031  30.410 53.953  1.00 17.86  ? 224  LYS A O    1 
ATOM   3385  C  CB   . LYS A 1 224 ? 71.871  32.731 54.163  1.00 31.54  ? 224  LYS A CB   1 
ATOM   3386  C  CG   . LYS A 1 224 ? 70.607  33.532 54.416  1.00 28.63  ? 224  LYS A CG   1 
ATOM   3387  C  CD   . LYS A 1 224 ? 69.534  32.815 55.187  1.00 32.54  ? 224  LYS A CD   1 
ATOM   3388  C  CE   . LYS A 1 224 ? 68.144  33.383 54.918  1.00 46.40  ? 224  LYS A CE   1 
ATOM   3389  N  NZ   . LYS A 1 224 ? 67.093  32.329 55.037  1.00 43.41  ? 224  LYS A NZ   1 
ATOM   3390  H  H    . LYS A 1 224 ? 71.969  31.163 56.161  1.00 25.72  ? 224  LYS A H    1 
ATOM   3391  H  HA   . LYS A 1 224 ? 70.947  30.967 53.683  1.00 31.01  ? 224  LYS A HA   1 
ATOM   3392  H  HB2  . LYS A 1 224 ? 72.514  32.972 54.847  1.00 37.85  ? 224  LYS A HB2  1 
ATOM   3393  H  HB3  . LYS A 1 224 ? 72.238  33.021 53.313  1.00 37.85  ? 224  LYS A HB3  1 
ATOM   3394  H  HG2  . LYS A 1 224 ? 70.846  34.337 54.901  1.00 34.36  ? 224  LYS A HG2  1 
ATOM   3395  H  HG3  . LYS A 1 224 ? 70.240  33.805 53.561  1.00 34.36  ? 224  LYS A HG3  1 
ATOM   3396  H  HD2  . LYS A 1 224 ? 69.544  31.875 54.946  1.00 39.05  ? 224  LYS A HD2  1 
ATOM   3397  H  HD3  . LYS A 1 224 ? 69.726  32.881 56.135  1.00 39.05  ? 224  LYS A HD3  1 
ATOM   3398  H  HE2  . LYS A 1 224 ? 67.959  34.093 55.552  1.00 55.67  ? 224  LYS A HE2  1 
ATOM   3399  H  HE3  . LYS A 1 224 ? 68.119  33.763 54.026  1.00 55.67  ? 224  LYS A HE3  1 
ATOM   3400  H  HZ1  . LYS A 1 224 ? 66.290  32.697 54.933  1.00 65.12  ? 224  LYS A HZ1  1 
ATOM   3401  H  HZ2  . LYS A 1 224 ? 67.143  31.949 55.840  1.00 65.12  ? 224  LYS A HZ2  1 
ATOM   3402  H  HZ3  . LYS A 1 224 ? 67.220  31.712 54.408  1.00 65.12  ? 224  LYS A HZ3  1 
ATOM   3403  N  N    . ARG A 1 225 ? 72.732  30.290 52.113  1.00 16.09  ? 225  ARG A N    1 
ATOM   3404  C  CA   . ARG A 1 225 ? 73.767  29.790 51.210  1.00 13.76  ? 225  ARG A CA   1 
ATOM   3405  C  C    . ARG A 1 225 ? 73.448  30.106 49.758  1.00 12.42  ? 225  ARG A C    1 
ATOM   3406  O  O    . ARG A 1 225 ? 72.277  30.380 49.482  1.00 14.98  ? 225  ARG A O    1 
ATOM   3407  C  CB   . ARG A 1 225 ? 73.805  28.264 51.368  1.00 20.49  ? 225  ARG A CB   1 
ATOM   3408  C  CG   . ARG A 1 225 ? 72.587  27.678 50.627  1.00 25.87  ? 225  ARG A CG   1 
ATOM   3409  C  CD   . ARG A 1 225 ? 72.932  26.308 50.072  1.00 34.80  ? 225  ARG A CD   1 
ATOM   3410  N  NE   . ARG A 1 225 ? 72.108  25.310 50.672  1.00 34.82  ? 225  ARG A NE   1 
ATOM   3411  C  CZ   . ARG A 1 225 ? 72.280  24.032 50.939  1.00 13.87  ? 225  ARG A CZ   1 
ATOM   3412  N  NH1  . ARG A 1 225 ? 73.387  23.369 50.649  1.00 18.25  ? 225  ARG A NH1  1 
ATOM   3413  N  NH2  . ARG A 1 225 ? 71.254  23.423 51.523  1.00 16.18  ? 225  ARG A NH2  1 
ATOM   3414  H  H    . ARG A 1 225 ? 71.935  30.387 51.805  1.00 19.31  ? 225  ARG A H    1 
ATOM   3415  H  HA   . ARG A 1 225 ? 74.635  30.173 51.453  1.00 16.51  ? 225  ARG A HA   1 
ATOM   3416  H  HB2  . ARG A 1 225 ? 74.626  27.910 50.992  1.00 24.59  ? 225  ARG A HB2  1 
ATOM   3417  H  HB3  . ARG A 1 225 ? 73.770  28.025 52.308  1.00 24.59  ? 225  ARG A HB3  1 
ATOM   3418  H  HG2  . ARG A 1 225 ? 71.837  27.604 51.237  1.00 31.04  ? 225  ARG A HG2  1 
ATOM   3419  H  HG3  . ARG A 1 225 ? 72.330  28.269 49.902  1.00 31.04  ? 225  ARG A HG3  1 
ATOM   3420  H  HD2  . ARG A 1 225 ? 72.801  26.304 49.111  1.00 41.76  ? 225  ARG A HD2  1 
ATOM   3421  H  HD3  . ARG A 1 225 ? 73.865  26.110 50.250  1.00 41.76  ? 225  ARG A HD3  1 
ATOM   3422  H  HE   . ARG A 1 225 ? 71.336  25.606 50.909  1.00 41.79  ? 225  ARG A HE   1 
ATOM   3423  H  HH11 . ARG A 1 225 ? 74.041  23.773 50.265  1.00 21.90  ? 225  ARG A HH11 1 
ATOM   3424  H  HH12 . ARG A 1 225 ? 73.451  22.534 50.843  1.00 21.90  ? 225  ARG A HH12 1 
ATOM   3425  H  HH21 . ARG A 1 225 ? 70.538  23.863 51.701  1.00 19.41  ? 225  ARG A HH21 1 
ATOM   3426  H  HH22 . ARG A 1 225 ? 71.307  22.588 51.722  1.00 19.41  ? 225  ARG A HH22 1 
ATOM   3427  N  N    . PRO A 1 226 ? 74.423  30.087 48.878  1.00 12.17  ? 226  PRO A N    1 
ATOM   3428  C  CA   . PRO A 1 226 ? 74.183  30.379 47.473  1.00 11.88  ? 226  PRO A CA   1 
ATOM   3429  C  C    . PRO A 1 226 ? 73.283  29.333 46.831  1.00 11.24  ? 226  PRO A C    1 
ATOM   3430  O  O    . PRO A 1 226 ? 73.395  28.161 47.129  1.00 13.66  ? 226  PRO A O    1 
ATOM   3431  C  CB   . PRO A 1 226 ? 75.572  30.348 46.840  1.00 13.14  ? 226  PRO A CB   1 
ATOM   3432  C  CG   . PRO A 1 226 ? 76.553  30.410 47.964  1.00 15.66  ? 226  PRO A CG   1 
ATOM   3433  C  CD   . PRO A 1 226 ? 75.845  29.872 49.167  1.00 14.41  ? 226  PRO A CD   1 
ATOM   3434  H  HA   . PRO A 1 226 ? 73.787  31.271 47.375  1.00 14.26  ? 226  PRO A HA   1 
ATOM   3435  H  HB2  . PRO A 1 226 ? 75.693  29.532 46.329  1.00 15.77  ? 226  PRO A HB2  1 
ATOM   3436  H  HB3  . PRO A 1 226 ? 75.690  31.105 46.246  1.00 15.77  ? 226  PRO A HB3  1 
ATOM   3437  H  HG2  . PRO A 1 226 ? 77.335  29.872 47.762  1.00 18.79  ? 226  PRO A HG2  1 
ATOM   3438  H  HG3  . PRO A 1 226 ? 76.837  31.324 48.118  1.00 18.79  ? 226  PRO A HG3  1 
ATOM   3439  H  HD2  . PRO A 1 226 ? 76.034  28.928 49.288  1.00 17.29  ? 226  PRO A HD2  1 
ATOM   3440  H  HD3  . PRO A 1 226 ? 76.111  30.351 49.968  1.00 17.29  ? 226  PRO A HD3  1 
ATOM   3441  N  N    . ILE A 1 227 ? 72.401  29.823 45.958  1.00 12.44  ? 227  ILE A N    1 
ATOM   3442  C  CA   . ILE A 1 227 ? 71.495  29.001 45.191  1.00 17.07  ? 227  ILE A CA   1 
ATOM   3443  C  C    . ILE A 1 227 ? 71.896  28.957 43.702  1.00 10.22  ? 227  ILE A C    1 
ATOM   3444  O  O    . ILE A 1 227 ? 72.188  29.960 43.080  1.00 10.44  ? 227  ILE A O    1 
ATOM   3445  C  CB   . ILE A 1 227 ? 70.046  29.488 45.345  1.00 11.24  ? 227  ILE A CB   1 
ATOM   3446  C  CG1  . ILE A 1 227 ? 69.549  29.452 46.805  1.00 11.63  ? 227  ILE A CG1  1 
ATOM   3447  C  CG2  . ILE A 1 227 ? 69.074  28.717 44.438  1.00 12.74  ? 227  ILE A CG2  1 
ATOM   3448  C  CD1  . ILE A 1 227 ? 68.240  30.209 46.972  1.00 21.00  ? 227  ILE A CD1  1 
ATOM   3449  H  H    . ILE A 1 227 ? 72.370  30.675 45.845  1.00 14.93  ? 227  ILE A H    1 
ATOM   3450  H  HA   . ILE A 1 227 ? 71.545  28.088 45.543  1.00 20.48  ? 227  ILE A HA   1 
ATOM   3451  H  HB   . ILE A 1 227 ? 70.025  30.424 45.057  1.00 13.49  ? 227  ILE A HB   1 
ATOM   3452  H  HG12 . ILE A 1 227 ? 69.422  28.530 47.077  1.00 13.95  ? 227  ILE A HG12 1 
ATOM   3453  H  HG13 . ILE A 1 227 ? 70.222  29.845 47.382  1.00 13.95  ? 227  ILE A HG13 1 
ATOM   3454  H  HG21 . ILE A 1 227 ? 68.184  29.054 44.564  1.00 19.10  ? 227  ILE A HG21 1 
ATOM   3455  H  HG22 . ILE A 1 227 ? 69.098  27.784 44.663  1.00 19.10  ? 227  ILE A HG22 1 
ATOM   3456  H  HG23 . ILE A 1 227 ? 69.332  28.832 43.521  1.00 19.10  ? 227  ILE A HG23 1 
ATOM   3457  H  HD11 . ILE A 1 227 ? 67.961  30.166 47.889  1.00 31.50  ? 227  ILE A HD11 1 
ATOM   3458  H  HD12 . ILE A 1 227 ? 67.568  29.813 46.413  1.00 31.50  ? 227  ILE A HD12 1 
ATOM   3459  H  HD13 . ILE A 1 227 ? 68.367  31.126 46.719  1.00 31.50  ? 227  ILE A HD13 1 
ATOM   3460  N  N    . HIS A 1 228 ? 71.900  27.720 43.203  1.00 9.75   ? 228  HIS A N    1 
ATOM   3461  C  CA   . HIS A 1 228 ? 72.083  27.414 41.784  1.00 9.08   ? 228  HIS A CA   1 
ATOM   3462  C  C    . HIS A 1 228 ? 70.734  26.920 41.212  1.00 10.03  ? 228  HIS A C    1 
ATOM   3463  O  O    . HIS A 1 228 ? 70.268  25.868 41.629  1.00 10.98  ? 228  HIS A O    1 
ATOM   3464  C  CB   . HIS A 1 228 ? 73.181  26.380 41.540  1.00 11.56  ? 228  HIS A CB   1 
ATOM   3465  C  CG   . HIS A 1 228 ? 73.495  26.145 40.091  1.00 11.25  ? 228  HIS A CG   1 
ATOM   3466  N  ND1  . HIS A 1 228 ? 74.540  26.585 39.337  1.00 16.65  ? 228  HIS A ND1  1 
ATOM   3467  C  CD2  . HIS A 1 228 ? 72.822  25.496 39.114  1.00 10.32  ? 228  HIS A CD2  1 
ATOM   3468  C  CE1  . HIS A 1 228 ? 74.609  26.266 38.087  1.00 16.32  ? 228  HIS A CE1  1 
ATOM   3469  N  NE2  . HIS A 1 228 ? 73.504  25.578 37.945  1.00 11.65  ? 228  HIS A NE2  1 
ATOM   3470  H  H    . HIS A 1 228 ? 71.789  27.063 43.747  1.00 11.70  ? 228  HIS A H    1 
ATOM   3471  H  HA   . HIS A 1 228 ? 72.330  28.241 41.320  1.00 10.90  ? 228  HIS A HA   1 
ATOM   3472  H  HB2  . HIS A 1 228 ? 73.989  26.672 41.990  1.00 13.87  ? 228  HIS A HB2  1 
ATOM   3473  H  HB3  . HIS A 1 228 ? 72.910  25.539 41.940  1.00 13.87  ? 228  HIS A HB3  1 
ATOM   3474  H  HD1  . HIS A 1 228 ? 75.152  27.074 39.692  1.00 19.98  ? 228  HIS A HD1  1 
ATOM   3475  H  HD2  . HIS A 1 228 ? 72.010  25.058 39.228  1.00 12.38  ? 228  HIS A HD2  1 
ATOM   3476  H  HE1  . HIS A 1 228 ? 75.265  26.469 37.459  1.00 19.58  ? 228  HIS A HE1  1 
ATOM   3477  N  N    . LEU A 1 229 ? 70.168  27.679 40.293  1.00 10.53  ? 229  LEU A N    1 
ATOM   3478  C  CA   . LEU A 1 229 ? 68.917  27.259 39.635  1.00 9.75   ? 229  LEU A CA   1 
ATOM   3479  C  C    . LEU A 1 229 ? 69.256  26.651 38.265  1.00 7.75   ? 229  LEU A C    1 
ATOM   3480  O  O    . LEU A 1 229 ? 69.782  27.406 37.430  1.00 9.84   ? 229  LEU A O    1 
ATOM   3481  C  CB   . LEU A 1 229 ? 67.964  28.447 39.517  1.00 9.15   ? 229  LEU A CB   1 
ATOM   3482  C  CG   . LEU A 1 229 ? 66.723  28.200 38.673  1.00 11.27  ? 229  LEU A CG   1 
ATOM   3483  C  CD1  . LEU A 1 229 ? 65.873  27.043 39.221  1.00 9.02   ? 229  LEU A CD1  1 
ATOM   3484  C  CD2  . LEU A 1 229 ? 65.890  29.472 38.581  1.00 12.79  ? 229  LEU A CD2  1 
ATOM   3485  H  H    . LEU A 1 229 ? 70.534  28.427 40.075  1.00 12.63  ? 229  LEU A H    1 
ATOM   3486  H  HA   . LEU A 1 229 ? 68.490  26.570 40.186  1.00 11.69  ? 229  LEU A HA   1 
ATOM   3487  H  HB2  . LEU A 1 229 ? 67.682  28.705 40.409  1.00 10.98  ? 229  LEU A HB2  1 
ATOM   3488  H  HB3  . LEU A 1 229 ? 68.450  29.195 39.137  1.00 10.98  ? 229  LEU A HB3  1 
ATOM   3489  H  HG   . LEU A 1 229 ? 67.014  27.961 37.768  1.00 13.53  ? 229  LEU A HG   1 
ATOM   3490  H  HD11 . LEU A 1 229 ? 65.101  26.921 38.664  1.00 13.53  ? 229  LEU A HD11 1 
ATOM   3491  H  HD12 . LEU A 1 229 ? 65.593  27.247 40.116  1.00 13.53  ? 229  LEU A HD12 1 
ATOM   3492  H  HD13 . LEU A 1 229 ? 66.394  26.236 39.225  1.00 13.53  ? 229  LEU A HD13 1 
ATOM   3493  H  HD21 . LEU A 1 229 ? 65.112  29.307 38.044  1.00 19.19  ? 229  LEU A HD21 1 
ATOM   3494  H  HD22 . LEU A 1 229 ? 66.414  30.169 38.178  1.00 19.19  ? 229  LEU A HD22 1 
ATOM   3495  H  HD23 . LEU A 1 229 ? 65.620  29.743 39.461  1.00 19.19  ? 229  LEU A HD23 1 
ATOM   3496  N  N    . SER A 1 230 ? 68.979  25.396 38.065  1.00 7.63   ? 230  SER A N    1 
ATOM   3497  C  CA   . SER A 1 230 ? 69.198  24.753 36.755  1.00 11.17  ? 230  SER A CA   1 
ATOM   3498  C  C    . SER A 1 230 ? 67.809  24.573 36.118  1.00 8.76   ? 230  SER A C    1 
ATOM   3499  O  O    . SER A 1 230 ? 67.012  23.775 36.595  1.00 9.85   ? 230  SER A O    1 
ATOM   3500  C  CB   . SER A 1 230 ? 69.962  23.444 36.834  1.00 12.06  ? 230  SER A CB   1 
ATOM   3501  O  OG   . SER A 1 230 ? 70.591  23.102 35.607  1.00 9.18   ? 230  SER A OG   1 
ATOM   3502  H  H    . SER A 1 230 ? 68.660  24.929 38.713  1.00 9.15   ? 230  SER A H    1 
ATOM   3503  H  HA   . SER A 1 230 ? 69.711  25.372 36.195  1.00 13.41  ? 230  SER A HA   1 
ATOM   3504  H  HB2  . SER A 1 230 ? 70.637  23.513 37.527  1.00 14.47  ? 230  SER A HB2  1 
ATOM   3505  H  HB3  . SER A 1 230 ? 69.351  22.734 37.085  1.00 14.47  ? 230  SER A HB3  1 
ATOM   3506  H  HG   . SER A 1 230 ? 71.114  23.695 35.393  1.00 13.77  ? 230  SER A HG   1 
ATOM   3507  N  N    . PHE A 1 231 ? 67.594  25.370 35.093  1.00 6.51   ? 231  PHE A N    1 
ATOM   3508  C  CA   . PHE A 1 231 ? 66.238  25.424 34.498  1.00 8.74   ? 231  PHE A CA   1 
ATOM   3509  C  C    . PHE A 1 231 ? 66.162  24.811 33.102  1.00 9.82   ? 231  PHE A C    1 
ATOM   3510  O  O    . PHE A 1 231 ? 66.720  25.400 32.181  1.00 9.88   ? 231  PHE A O    1 
ATOM   3511  C  CB   . PHE A 1 231 ? 65.749  26.880 34.474  1.00 8.19   ? 231  PHE A CB   1 
ATOM   3512  C  CG   . PHE A 1 231 ? 64.236  27.090 34.402  1.00 11.26  ? 231  PHE A CG   1 
ATOM   3513  C  CD1  . PHE A 1 231 ? 63.558  26.817 33.241  1.00 20.02  ? 231  PHE A CD1  1 
ATOM   3514  C  CD2  . PHE A 1 231 ? 63.555  27.587 35.499  1.00 12.99  ? 231  PHE A CD2  1 
ATOM   3515  C  CE1  . PHE A 1 231 ? 62.202  27.015 33.143  1.00 17.86  ? 231  PHE A CE1  1 
ATOM   3516  C  CE2  . PHE A 1 231 ? 62.180  27.772 35.442  1.00 17.61  ? 231  PHE A CE2  1 
ATOM   3517  C  CZ   . PHE A 1 231 ? 61.529  27.499 34.258  1.00 14.84  ? 231  PHE A CZ   1 
ATOM   3518  H  H    . PHE A 1 231 ? 68.230  25.852 34.773  1.00 7.82   ? 231  PHE A H    1 
ATOM   3519  H  HA   . PHE A 1 231 ? 65.636  24.916 35.081  1.00 10.49  ? 231  PHE A HA   1 
ATOM   3520  H  HB2  . PHE A 1 231 ? 66.078  27.323 35.271  1.00 9.83   ? 231  PHE A HB2  1 
ATOM   3521  H  HB3  . PHE A 1 231 ? 66.152  27.322 33.710  1.00 9.83   ? 231  PHE A HB3  1 
ATOM   3522  H  HD1  . PHE A 1 231 ? 64.026  26.492 32.505  1.00 24.02  ? 231  PHE A HD1  1 
ATOM   3523  H  HD2  . PHE A 1 231 ? 64.020  27.798 36.276  1.00 15.59  ? 231  PHE A HD2  1 
ATOM   3524  H  HE1  . PHE A 1 231 ? 61.748  26.831 32.352  1.00 21.43  ? 231  PHE A HE1  1 
ATOM   3525  H  HE2  . PHE A 1 231 ? 61.710  28.073 36.186  1.00 21.14  ? 231  PHE A HE2  1 
ATOM   3526  H  HZ   . PHE A 1 231 ? 60.611  27.642 34.204  1.00 17.81  ? 231  PHE A HZ   1 
ATOM   3527  N  N    . ASP A 1 232 ? 65.531  23.656 33.007  1.00 8.12   ? 232  ASP A N    1 
ATOM   3528  C  CA   . ASP A 1 232 ? 65.270  22.988 31.733  1.00 4.64   ? 232  ASP A CA   1 
ATOM   3529  C  C    . ASP A 1 232 ? 63.928  23.512 31.283  1.00 7.43   ? 232  ASP A C    1 
ATOM   3530  O  O    . ASP A 1 232 ? 62.915  23.413 32.010  1.00 7.88   ? 232  ASP A O    1 
ATOM   3531  C  CB   . ASP A 1 232 ? 65.309  21.505 31.901  1.00 6.97   ? 232  ASP A CB   1 
ATOM   3532  C  CG   . ASP A 1 232 ? 65.072  20.628 30.699  1.00 6.47   ? 232  ASP A CG   1 
ATOM   3533  O  OD1  . ASP A 1 232 ? 64.526  21.151 29.684  1.00 7.88   ? 232  ASP A OD1  1 
ATOM   3534  O  OD2  . ASP A 1 232 ? 65.484  19.440 30.764  1.00 7.44   ? 232  ASP A OD2  1 
ATOM   3535  H  H    . ASP A 1 232 ? 65.261  23.278 33.730  1.00 9.75   ? 232  ASP A H    1 
ATOM   3536  H  HA   . ASP A 1 232 ? 65.953  23.256 31.084  1.00 5.57   ? 232  ASP A HA   1 
ATOM   3537  H  HB2  . ASP A 1 232 ? 66.179  21.274 32.265  1.00 8.37   ? 232  ASP A HB2  1 
ATOM   3538  H  HB3  . ASP A 1 232 ? 64.649  21.268 32.571  1.00 8.37   ? 232  ASP A HB3  1 
ATOM   3539  N  N    . VAL A 1 233 ? 63.899  24.140 30.093  1.00 8.79   ? 233  VAL A N    1 
ATOM   3540  C  CA   . VAL A 1 233 ? 62.630  24.678 29.621  1.00 9.96   ? 233  VAL A CA   1 
ATOM   3541  C  C    . VAL A 1 233 ? 61.527  23.660 29.459  1.00 7.41   ? 233  VAL A C    1 
ATOM   3542  O  O    . VAL A 1 233 ? 60.338  24.053 29.495  1.00 9.14   ? 233  VAL A O    1 
ATOM   3543  C  CB   . VAL A 1 233 ? 62.805  25.510 28.312  1.00 12.01  ? 233  VAL A CB   1 
ATOM   3544  C  CG1  . VAL A 1 233 ? 63.727  26.674 28.577  1.00 13.06  ? 233  VAL A CG1  1 
ATOM   3545  C  CG2  . VAL A 1 233 ? 63.317  24.673 27.161  1.00 13.74  ? 233  VAL A CG2  1 
ATOM   3546  H  H    . VAL A 1 233 ? 64.614  24.221 29.622  1.00 10.54  ? 233  VAL A H    1 
ATOM   3547  H  HA   . VAL A 1 233 ? 62.325  25.307 30.308  1.00 11.95  ? 233  VAL A HA   1 
ATOM   3548  H  HB   . VAL A 1 233 ? 61.929  25.868 28.061  1.00 14.42  ? 233  VAL A HB   1 
ATOM   3549  H  HG11 . VAL A 1 233 ? 63.384  27.194 29.308  1.00 19.59  ? 233  VAL A HG11 1 
ATOM   3550  H  HG12 . VAL A 1 233 ? 63.782  27.224 27.792  1.00 19.59  ? 233  VAL A HG12 1 
ATOM   3551  H  HG13 . VAL A 1 233 ? 64.601  26.347 28.800  1.00 19.59  ? 233  VAL A HG13 1 
ATOM   3552  H  HG21 . VAL A 1 233 ? 62.712  23.945 27.001  1.00 20.62  ? 233  VAL A HG21 1 
ATOM   3553  H  HG22 . VAL A 1 233 ? 64.185  24.326 27.379  1.00 20.62  ? 233  VAL A HG22 1 
ATOM   3554  H  HG23 . VAL A 1 233 ? 63.379  25.218 26.373  1.00 20.62  ? 233  VAL A HG23 1 
ATOM   3555  N  N    . ASP A 1 234 ? 61.822  22.362 29.383  1.00 9.04   ? 234  ASP A N    1 
ATOM   3556  C  CA   . ASP A 1 234 ? 60.763  21.333 29.352  1.00 7.45   ? 234  ASP A CA   1 
ATOM   3557  C  C    . ASP A 1 234 ? 60.109  21.109 30.709  1.00 8.36   ? 234  ASP A C    1 
ATOM   3558  O  O    . ASP A 1 234 ? 59.155  20.359 30.786  1.00 8.64   ? 234  ASP A O    1 
ATOM   3559  C  CB   . ASP A 1 234 ? 61.296  20.063 28.687  1.00 9.04   ? 234  ASP A CB   1 
ATOM   3560  C  CG   . ASP A 1 234 ? 62.196  19.194 29.482  1.00 9.60   ? 234  ASP A CG   1 
ATOM   3561  O  OD1  . ASP A 1 234 ? 62.996  18.349 28.994  1.00 8.46   ? 234  ASP A OD1  1 
ATOM   3562  O  OD2  . ASP A 1 234 ? 62.158  19.209 30.757  1.00 8.57   ? 234  ASP A OD2  1 
ATOM   3563  H  H    . ASP A 1 234 ? 62.647  22.118 29.351  1.00 10.84  ? 234  ASP A H    1 
ATOM   3564  H  HA   . ASP A 1 234 ? 60.061  21.679 28.762  1.00 8.93   ? 234  ASP A HA   1 
ATOM   3565  H  HB2  . ASP A 1 234 ? 60.535  19.530 28.410  1.00 10.85  ? 234  ASP A HB2  1 
ATOM   3566  H  HB3  . ASP A 1 234 ? 61.771  20.325 27.883  1.00 10.85  ? 234  ASP A HB3  1 
ATOM   3567  N  N    . GLY A 1 235 ? 60.602  21.790 31.737  1.00 7.57   ? 235  GLY A N    1 
ATOM   3568  C  CA   . GLY A 1 235 ? 59.847  21.818 32.994  1.00 7.90   ? 235  GLY A CA   1 
ATOM   3569  C  C    . GLY A 1 235 ? 58.483  22.449 32.816  1.00 9.14   ? 235  GLY A C    1 
ATOM   3570  O  O    . GLY A 1 235 ? 57.482  21.997 33.418  1.00 8.47   ? 235  GLY A O    1 
ATOM   3571  H  H    . GLY A 1 235 ? 61.351  22.207 31.667  1.00 9.08   ? 235  GLY A H    1 
ATOM   3572  H  HA2  . GLY A 1 235 ? 59.739  20.912 33.323  1.00 9.47   ? 235  GLY A HA2  1 
ATOM   3573  H  HA3  . GLY A 1 235 ? 60.347  22.319 33.657  1.00 9.47   ? 235  GLY A HA3  1 
ATOM   3574  N  N    . LEU A 1 236 ? 58.432  23.481 31.974  1.00 6.81   ? 236  LEU A N    1 
ATOM   3575  C  CA   . LEU A 1 236 ? 57.168  24.127 31.608  1.00 8.97   ? 236  LEU A CA   1 
ATOM   3576  C  C    . LEU A 1 236 ? 56.401  23.282 30.587  1.00 9.67   ? 236  LEU A C    1 
ATOM   3577  O  O    . LEU A 1 236 ? 57.001  22.513 29.808  1.00 9.31   ? 236  LEU A O    1 
ATOM   3578  C  CB   . LEU A 1 236 ? 57.449  25.536 31.090  1.00 8.53   ? 236  LEU A CB   1 
ATOM   3579  C  CG   . LEU A 1 236 ? 58.334  26.430 31.958  1.00 14.87  ? 236  LEU A CG   1 
ATOM   3580  C  CD1  . LEU A 1 236 ? 58.396  27.841 31.347  1.00 16.31  ? 236  LEU A CD1  1 
ATOM   3581  C  CD2  . LEU A 1 236 ? 57.869  26.492 33.384  1.00 14.94  ? 236  LEU A CD2  1 
ATOM   3582  H  H    . LEU A 1 236 ? 59.165  23.778 31.635  1.00 8.17   ? 236  LEU A H    1 
ATOM   3583  H  HA   . LEU A 1 236 ? 56.618  24.203 32.416  1.00 10.77  ? 236  LEU A HA   1 
ATOM   3584  H  HB2  . LEU A 1 236 ? 57.865  25.458 30.217  1.00 10.24  ? 236  LEU A HB2  1 
ATOM   3585  H  HB3  . LEU A 1 236 ? 56.599  25.986 30.965  1.00 10.24  ? 236  LEU A HB3  1 
ATOM   3586  H  HG   . LEU A 1 236 ? 59.240  26.057 31.951  1.00 17.85  ? 236  LEU A HG   1 
ATOM   3587  H  HD11 . LEU A 1 236 ? 58.693  27.783 30.436  1.00 24.46  ? 236  LEU A HD11 1 
ATOM   3588  H  HD12 . LEU A 1 236 ? 59.010  28.381 31.850  1.00 24.46  ? 236  LEU A HD12 1 
ATOM   3589  H  HD13 . LEU A 1 236 ? 57.523  28.240 31.374  1.00 24.46  ? 236  LEU A HD13 1 
ATOM   3590  H  HD21 . LEU A 1 236 ? 58.454  27.065 33.886  1.00 22.41  ? 236  LEU A HD21 1 
ATOM   3591  H  HD22 . LEU A 1 236 ? 57.881  25.610 33.764  1.00 22.41  ? 236  LEU A HD22 1 
ATOM   3592  H  HD23 . LEU A 1 236 ? 56.975  26.841 33.415  1.00 22.41  ? 236  LEU A HD23 1 
ATOM   3593  N  N    . ASP A 1 237 ? 55.077  23.413 30.622  1.00 7.71   ? 237  ASP A N    1 
ATOM   3594  C  CA   . ASP A 1 237 ? 54.283  22.689 29.649  1.00 9.14   ? 237  ASP A CA   1 
ATOM   3595  C  C    . ASP A 1 237 ? 54.681  23.068 28.212  1.00 6.74   ? 237  ASP A C    1 
ATOM   3596  O  O    . ASP A 1 237 ? 54.996  24.232 27.954  1.00 8.83   ? 237  ASP A O    1 
ATOM   3597  C  CB   . ASP A 1 237 ? 52.809  23.042 29.840  1.00 9.90   ? 237  ASP A CB   1 
ATOM   3598  C  CG   . ASP A 1 237 ? 51.876  22.074 29.168  1.00 9.75   ? 237  ASP A CG   1 
ATOM   3599  O  OD1  . ASP A 1 237 ? 51.276  22.498 28.128  1.00 15.18  ? 237  ASP A OD1  1 
ATOM   3600  O  OD2  . ASP A 1 237 ? 51.696  20.929 29.614  1.00 10.06  ? 237  ASP A OD2  1 
ATOM   3601  H  H    . ASP A 1 237 ? 54.701  23.915 31.210  1.00 9.25   ? 237  ASP A H    1 
ATOM   3602  H  HA   . ASP A 1 237 ? 54.407  21.726 29.778  1.00 10.97  ? 237  ASP A HA   1 
ATOM   3603  H  HB2  . ASP A 1 237 ? 52.610  23.062 30.789  1.00 11.88  ? 237  ASP A HB2  1 
ATOM   3604  H  HB3  . ASP A 1 237 ? 52.649  23.930 29.485  1.00 11.88  ? 237  ASP A HB3  1 
ATOM   3605  N  N    . PRO A 1 238 ? 54.588  22.066 27.363  1.00 7.49   ? 238  PRO A N    1 
ATOM   3606  C  CA   . PRO A 1 238 ? 54.870  22.378 25.923  1.00 7.55   ? 238  PRO A CA   1 
ATOM   3607  C  C    . PRO A 1 238 ? 53.923  23.365 25.294  1.00 12.66  ? 238  PRO A C    1 
ATOM   3608  O  O    . PRO A 1 238 ? 54.250  23.940 24.205  1.00 13.04  ? 238  PRO A O    1 
ATOM   3609  C  CB   . PRO A 1 238 ? 54.745  21.061 25.188  1.00 16.37  ? 238  PRO A CB   1 
ATOM   3610  C  CG   . PRO A 1 238 ? 54.368  20.031 26.190  1.00 13.69  ? 238  PRO A CG   1 
ATOM   3611  C  CD   . PRO A 1 238 ? 54.354  20.654 27.541  1.00 7.83   ? 238  PRO A CD   1 
ATOM   3612  H  HA   . PRO A 1 238 ? 55.788  22.710 25.838  1.00 9.06   ? 238  PRO A HA   1 
ATOM   3613  H  HB2  . PRO A 1 238 ? 54.065  21.124 24.499  1.00 19.65  ? 238  PRO A HB2  1 
ATOM   3614  H  HB3  . PRO A 1 238 ? 55.588  20.829 24.768  1.00 19.65  ? 238  PRO A HB3  1 
ATOM   3615  H  HG2  . PRO A 1 238 ? 53.491  19.673 25.982  1.00 16.43  ? 238  PRO A HG2  1 
ATOM   3616  H  HG3  . PRO A 1 238 ? 55.007  19.301 26.169  1.00 16.43  ? 238  PRO A HG3  1 
ATOM   3617  H  HD2  . PRO A 1 238 ? 53.497  20.506 27.970  1.00 9.39   ? 238  PRO A HD2  1 
ATOM   3618  H  HD3  . PRO A 1 238 ? 55.048  20.266 28.097  1.00 9.39   ? 238  PRO A HD3  1 
ATOM   3619  N  N    . SER A 1 239 ? 52.788  23.727 25.867  1.00 10.15  ? 239  SER A N    1 
ATOM   3620  C  CA   . SER A 1 239 ? 52.044  24.876 25.384  1.00 11.53  ? 239  SER A CA   1 
ATOM   3621  C  C    . SER A 1 239 ? 52.739  26.188 25.642  1.00 12.85  ? 239  SER A C    1 
ATOM   3622  O  O    . SER A 1 239 ? 52.262  27.182 25.066  1.00 16.22  ? 239  SER A O    1 
ATOM   3623  C  CB   . SER A 1 239 ? 50.655  24.953 25.993  1.00 12.13  ? 239  SER A CB   1 
ATOM   3624  O  OG   . SER A 1 239 ? 50.658  25.151 27.392  1.00 15.57  ? 239  SER A OG   1 
ATOM   3625  H  H    . SER A 1 239 ? 52.486  23.277 26.535  1.00 12.18  ? 239  SER A H    1 
ATOM   3626  H  HA   . SER A 1 239 ? 51.940  24.778 24.414  1.00 13.84  ? 239  SER A HA   1 
ATOM   3627  H  HB2  . SER A 1 239 ? 50.170  25.681 25.574  1.00 14.56  ? 239  SER A HB2  1 
ATOM   3628  H  HB3  . SER A 1 239 ? 50.181  24.130 25.795  1.00 14.56  ? 239  SER A HB3  1 
ATOM   3629  H  HG   . SER A 1 239 ? 49.886  25.199 27.663  1.00 23.36  ? 239  SER A HG   1 
ATOM   3630  N  N    . PHE A 1 240 ? 53.770  26.252 26.466  1.00 10.13  ? 240  PHE A N    1 
ATOM   3631  C  CA   . PHE A 1 240 ? 54.536  27.436 26.684  1.00 10.13  ? 240  PHE A CA   1 
ATOM   3632  C  C    . PHE A 1 240 ? 55.917  27.349 26.076  1.00 10.32  ? 240  PHE A C    1 
ATOM   3633  O  O    . PHE A 1 240 ? 56.441  28.369 25.540  1.00 11.35  ? 240  PHE A O    1 
ATOM   3634  C  CB   . PHE A 1 240 ? 54.619  27.745 28.202  1.00 11.77  ? 240  PHE A CB   1 
ATOM   3635  C  CG   . PHE A 1 240 ? 53.216  27.889 28.798  1.00 11.51  ? 240  PHE A CG   1 
ATOM   3636  C  CD1  . PHE A 1 240 ? 52.498  29.005 28.412  1.00 11.67  ? 240  PHE A CD1  1 
ATOM   3637  C  CD2  . PHE A 1 240 ? 52.676  26.947 29.638  1.00 14.02  ? 240  PHE A CD2  1 
ATOM   3638  C  CE1  . PHE A 1 240 ? 51.209  29.184 28.882  1.00 13.47  ? 240  PHE A CE1  1 
ATOM   3639  C  CE2  . PHE A 1 240 ? 51.385  27.106 30.142  1.00 12.30  ? 240  PHE A CE2  1 
ATOM   3640  C  CZ   . PHE A 1 240 ? 50.710  28.239 29.729  1.00 13.15  ? 240  PHE A CZ   1 
ATOM   3641  H  H    . PHE A 1 240 ? 53.992  25.541 26.896  1.00 12.15  ? 240  PHE A H    1 
ATOM   3642  H  HA   . PHE A 1 240 ? 54.065  28.180 26.253  1.00 12.16  ? 240  PHE A HA   1 
ATOM   3643  H  HB2  . PHE A 1 240 ? 55.091  27.028 28.654  1.00 14.12  ? 240  PHE A HB2  1 
ATOM   3644  H  HB3  . PHE A 1 240 ? 55.115  28.566 28.340  1.00 14.12  ? 240  PHE A HB3  1 
ATOM   3645  H  HD1  . PHE A 1 240 ? 52.878  29.631 27.839  1.00 14.01  ? 240  PHE A HD1  1 
ATOM   3646  H  HD2  . PHE A 1 240 ? 53.174  26.198 29.874  1.00 16.82  ? 240  PHE A HD2  1 
ATOM   3647  H  HE1  . PHE A 1 240 ? 50.702  29.921 28.630  1.00 16.16  ? 240  PHE A HE1  1 
ATOM   3648  H  HE2  . PHE A 1 240 ? 51.001  26.488 30.721  1.00 14.76  ? 240  PHE A HE2  1 
ATOM   3649  H  HZ   . PHE A 1 240 ? 49.848  28.368 30.054  1.00 15.77  ? 240  PHE A HZ   1 
ATOM   3650  N  N    . THR A 1 241 ? 56.570  26.200 26.107  1.00 8.63   ? 241  THR A N    1 
ATOM   3651  C  CA   . THR A 1 241 ? 57.896  25.940 25.613  1.00 9.03   ? 241  THR A CA   1 
ATOM   3652  C  C    . THR A 1 241 ? 57.973  24.731 24.673  1.00 8.80   ? 241  THR A C    1 
ATOM   3653  O  O    . THR A 1 241 ? 58.592  23.707 24.935  1.00 8.72   ? 241  THR A O    1 
ATOM   3654  C  CB   . THR A 1 241 ? 58.934  25.805 26.770  1.00 7.98   ? 241  THR A CB   1 
ATOM   3655  O  OG1  . THR A 1 241 ? 58.345  24.919 27.730  1.00 11.77  ? 241  THR A OG1  1 
ATOM   3656  C  CG2  . THR A 1 241 ? 59.184  27.164 27.376  1.00 10.32  ? 241  THR A CG2  1 
ATOM   3657  H  H    . THR A 1 241 ? 56.157  25.534 26.462  1.00 10.35  ? 241  THR A H    1 
ATOM   3658  H  HA   . THR A 1 241 ? 58.159  26.724 25.087  1.00 10.83  ? 241  THR A HA   1 
ATOM   3659  H  HB   . THR A 1 241 ? 59.772  25.427 26.429  1.00 9.57   ? 241  THR A HB   1 
ATOM   3660  H  HG1  . THR A 1 241 ? 58.216  24.187 27.383  1.00 17.66  ? 241  THR A HG1  1 
ATOM   3661  H  HG21 . THR A 1 241 ? 59.825  27.085 28.086  1.00 15.48  ? 241  THR A HG21 1 
ATOM   3662  H  HG22 . THR A 1 241 ? 58.361  27.515 27.725  1.00 15.48  ? 241  THR A HG22 1 
ATOM   3663  H  HG23 . THR A 1 241 ? 59.524  27.758 26.702  1.00 15.48  ? 241  THR A HG23 1 
ATOM   3664  N  N    . PRO A 1 242 ? 57.272  24.810 23.514  1.00 8.08   ? 242  PRO A N    1 
ATOM   3665  C  CA   . PRO A 1 242 ? 57.273  23.673 22.577  1.00 8.24   ? 242  PRO A CA   1 
ATOM   3666  C  C    . PRO A 1 242 ? 58.574  23.347 21.861  1.00 10.23  ? 242  PRO A C    1 
ATOM   3667  O  O    . PRO A 1 242 ? 58.745  22.146 21.557  1.00 10.28  ? 242  PRO A O    1 
ATOM   3668  C  CB   . PRO A 1 242 ? 56.160  24.123 21.571  1.00 12.38  ? 242  PRO A CB   1 
ATOM   3669  C  CG   . PRO A 1 242 ? 56.210  25.613 21.625  1.00 11.74  ? 242  PRO A CG   1 
ATOM   3670  C  CD   . PRO A 1 242 ? 56.453  25.933 23.083  1.00 10.67  ? 242  PRO A CD   1 
ATOM   3671  H  HA   . PRO A 1 242 ? 56.964  22.872 23.052  1.00 9.89   ? 242  PRO A HA   1 
ATOM   3672  H  HB2  . PRO A 1 242 ? 56.351  23.801 20.676  1.00 14.86  ? 242  PRO A HB2  1 
ATOM   3673  H  HB3  . PRO A 1 242 ? 55.290  23.794 21.845  1.00 14.86  ? 242  PRO A HB3  1 
ATOM   3674  H  HG2  . PRO A 1 242 ? 56.931  25.955 21.072  1.00 14.09  ? 242  PRO A HG2  1 
ATOM   3675  H  HG3  . PRO A 1 242 ? 55.373  25.998 21.321  1.00 14.09  ? 242  PRO A HG3  1 
ATOM   3676  H  HD2  . PRO A 1 242 ? 56.925  26.774 23.186  1.00 12.81  ? 242  PRO A HD2  1 
ATOM   3677  H  HD3  . PRO A 1 242 ? 55.620  25.972 23.579  1.00 12.81  ? 242  PRO A HD3  1 
ATOM   3678  N  N    . ALA A 1 243 ? 59.420  24.330 21.638  1.00 9.01   ? 243  ALA A N    1 
ATOM   3679  C  CA   . ALA A 1 243 ? 60.670  24.145 20.891  1.00 10.10  ? 243  ALA A CA   1 
ATOM   3680  C  C    . ALA A 1 243 ? 61.771  23.634 21.835  1.00 6.26   ? 243  ALA A C    1 
ATOM   3681  O  O    . ALA A 1 243 ? 62.681  24.319 22.264  1.00 10.95  ? 243  ALA A O    1 
ATOM   3682  C  CB   . ALA A 1 243 ? 60.968  25.413 20.164  1.00 11.71  ? 243  ALA A CB   1 
ATOM   3683  H  H    . ALA A 1 243 ? 59.233  25.113 21.942  1.00 10.82  ? 243  ALA A H    1 
ATOM   3684  H  HA   . ALA A 1 243 ? 60.512  23.450 20.219  1.00 12.12  ? 243  ALA A HA   1 
ATOM   3685  H  HB1  . ALA A 1 243 ? 60.223  25.644 19.604  1.00 17.56  ? 243  ALA A HB1  1 
ATOM   3686  H  HB2  . ALA A 1 243 ? 61.752  25.295 19.622  1.00 17.56  ? 243  ALA A HB2  1 
ATOM   3687  H  HB3  . ALA A 1 243 ? 61.122  26.117 20.799  1.00 17.56  ? 243  ALA A HB3  1 
ATOM   3688  N  N    . THR A 1 244 ? 61.637  22.369 22.168  1.00 8.76   ? 244  THR A N    1 
ATOM   3689  C  CA   . THR A 1 244 ? 62.523  21.623 23.060  1.00 11.68  ? 244  THR A CA   1 
ATOM   3690  C  C    . THR A 1 244 ? 62.456  20.143 22.753  1.00 9.32   ? 244  THR A C    1 
ATOM   3691  O  O    . THR A 1 244 ? 61.500  19.608 22.212  1.00 9.14   ? 244  THR A O    1 
ATOM   3692  C  CB   . THR A 1 244 ? 62.166  21.988 24.512  1.00 9.69   ? 244  THR A CB   1 
ATOM   3693  O  OG1  . THR A 1 244 ? 63.195  21.536 25.411  1.00 10.88  ? 244  THR A OG1  1 
ATOM   3694  C  CG2  . THR A 1 244 ? 60.908  21.251 24.939  1.00 12.50  ? 244  THR A CG2  1 
ATOM   3695  H  H    . THR A 1 244 ? 60.970  21.943 21.832  1.00 10.51  ? 244  THR A H    1 
ATOM   3696  H  HA   . THR A 1 244 ? 63.440  21.924 22.892  1.00 14.02  ? 244  THR A HA   1 
ATOM   3697  H  HB   . THR A 1 244 ? 62.040  22.956 24.599  1.00 11.62  ? 244  THR A HB   1 
ATOM   3698  H  HG1  . THR A 1 244 ? 63.903  21.905 25.223  1.00 16.33  ? 244  THR A HG1  1 
ATOM   3699  H  HG21 . THR A 1 244 ? 60.692  21.485 25.845  1.00 18.75  ? 244  THR A HG21 1 
ATOM   3700  H  HG22 . THR A 1 244 ? 61.056  20.305 24.879  1.00 18.75  ? 244  THR A HG22 1 
ATOM   3701  H  HG23 . THR A 1 244 ? 60.181  21.499 24.363  1.00 18.75  ? 244  THR A HG23 1 
ATOM   3702  N  N    . GLY A 1 245 ? 63.513  19.385 23.085  1.00 12.01  ? 245  GLY A N    1 
ATOM   3703  C  CA   . GLY A 1 245 ? 63.699  18.053 22.545  1.00 8.63   ? 245  GLY A CA   1 
ATOM   3704  C  C    . GLY A 1 245 ? 62.906  16.947 23.129  1.00 11.39  ? 245  GLY A C    1 
ATOM   3705  O  O    . GLY A 1 245 ? 62.589  15.908 22.496  1.00 13.45  ? 245  GLY A O    1 
ATOM   3706  H  H    . GLY A 1 245 ? 64.097  19.699 23.634  1.00 14.42  ? 245  GLY A H    1 
ATOM   3707  H  HA2  . GLY A 1 245 ? 63.505  18.088 21.595  1.00 10.36  ? 245  GLY A HA2  1 
ATOM   3708  H  HA3  . GLY A 1 245 ? 64.638  17.825 22.636  1.00 10.36  ? 245  GLY A HA3  1 
ATOM   3709  N  N    . THR A 1 246 ? 62.493  17.057 24.413  1.00 11.00  ? 246  THR A N    1 
ATOM   3710  C  CA   . THR A 1 246 ? 61.810  16.001 25.129  1.00 9.30   ? 246  THR A CA   1 
ATOM   3711  C  C    . THR A 1 246 ? 60.598  16.596 25.833  1.00 11.61  ? 246  THR A C    1 
ATOM   3712  O  O    . THR A 1 246 ? 60.496  16.552 27.090  1.00 11.96  ? 246  THR A O    1 
ATOM   3713  C  CB   . THR A 1 246 ? 62.707  15.303 26.156  1.00 11.15  ? 246  THR A CB   1 
ATOM   3714  O  OG1  . THR A 1 246 ? 63.884  14.895 25.460  1.00 14.60  ? 246  THR A OG1  1 
ATOM   3715  C  CG2  . THR A 1 246 ? 61.955  14.087 26.688  1.00 14.43  ? 246  THR A CG2  1 
ATOM   3716  H  H    . THR A 1 246 ? 62.644  17.796 24.827  1.00 13.20  ? 246  THR A H    1 
ATOM   3717  H  HA   . THR A 1 246 ? 61.500  15.335 24.481  1.00 11.17  ? 246  THR A HA   1 
ATOM   3718  H  HB   . THR A 1 246 ? 62.934  15.915 26.887  1.00 13.38  ? 246  THR A HB   1 
ATOM   3719  H  HG1  . THR A 1 246 ? 63.940  14.077 25.476  1.00 21.90  ? 246  THR A HG1  1 
ATOM   3720  H  HG21 . THR A 1 246 ? 62.500  13.630 27.333  1.00 21.65  ? 246  THR A HG21 1 
ATOM   3721  H  HG22 . THR A 1 246 ? 61.753  13.493 25.961  1.00 21.65  ? 246  THR A HG22 1 
ATOM   3722  H  HG23 . THR A 1 246 ? 61.139  14.372 27.104  1.00 21.65  ? 246  THR A HG23 1 
ATOM   3723  N  N    . PRO A 1 247 ? 59.615  17.158 25.154  1.00 8.96   ? 247  PRO A N    1 
ATOM   3724  C  CA   . PRO A 1 247 ? 58.426  17.723 25.748  1.00 9.24   ? 247  PRO A CA   1 
ATOM   3725  C  C    . PRO A 1 247 ? 57.553  16.681 26.401  1.00 12.57  ? 247  PRO A C    1 
ATOM   3726  O  O    . PRO A 1 247 ? 57.428  15.547 25.932  1.00 12.97  ? 247  PRO A O    1 
ATOM   3727  C  CB   . PRO A 1 247 ? 57.644  18.306 24.530  1.00 9.32   ? 247  PRO A CB   1 
ATOM   3728  C  CG   . PRO A 1 247 ? 58.180  17.526 23.386  1.00 11.63  ? 247  PRO A CG   1 
ATOM   3729  C  CD   . PRO A 1 247 ? 59.604  17.218 23.658  1.00 11.52  ? 247  PRO A CD   1 
ATOM   3730  H  HA   . PRO A 1 247 ? 58.658  18.431 26.385  1.00 11.09  ? 247  PRO A HA   1 
ATOM   3731  H  HB2  . PRO A 1 247 ? 56.689  18.170 24.630  1.00 11.18  ? 247  PRO A HB2  1 
ATOM   3732  H  HB3  . PRO A 1 247 ? 57.821  19.254 24.422  1.00 11.18  ? 247  PRO A HB3  1 
ATOM   3733  H  HG2  . PRO A 1 247 ? 57.677  16.703 23.280  1.00 13.96  ? 247  PRO A HG2  1 
ATOM   3734  H  HG3  . PRO A 1 247 ? 58.102  18.040 22.567  1.00 13.96  ? 247  PRO A HG3  1 
ATOM   3735  H  HD2  . PRO A 1 247 ? 59.866  16.371 23.266  1.00 13.82  ? 247  PRO A HD2  1 
ATOM   3736  H  HD3  . PRO A 1 247 ? 60.188  17.919 23.327  1.00 13.82  ? 247  PRO A HD3  1 
ATOM   3737  N  N    . VAL A 1 248 ? 56.900  17.126 27.504  1.00 10.64  ? 248  VAL A N    1 
ATOM   3738  C  CA   . VAL A 1 248 ? 56.025  16.227 28.237  1.00 8.62   ? 248  VAL A CA   1 
ATOM   3739  C  C    . VAL A 1 248 ? 54.789  16.974 28.701  1.00 8.51   ? 248  VAL A C    1 
ATOM   3740  O  O    . VAL A 1 248 ? 54.875  18.027 29.355  1.00 7.90   ? 248  VAL A O    1 
ATOM   3741  C  CB   . VAL A 1 248 ? 56.706  15.615 29.469  1.00 11.20  ? 248  VAL A CB   1 
ATOM   3742  C  CG1  . VAL A 1 248 ? 55.725  14.640 30.113  1.00 11.44  ? 248  VAL A CG1  1 
ATOM   3743  C  CG2  . VAL A 1 248 ? 58.027  14.922 29.139  1.00 12.44  ? 248  VAL A CG2  1 
ATOM   3744  H  H    . VAL A 1 248 ? 57.004  17.938 27.768  1.00 12.77  ? 248  VAL A H    1 
ATOM   3745  H  HA   . VAL A 1 248 ? 55.748  15.502 27.639  1.00 10.34  ? 248  VAL A HA   1 
ATOM   3746  H  HB   . VAL A 1 248 ? 56.888  16.335 30.109  1.00 13.44  ? 248  VAL A HB   1 
ATOM   3747  H  HG11 . VAL A 1 248 ? 54.905  15.097 30.314  1.00 17.16  ? 248  VAL A HG11 1 
ATOM   3748  H  HG12 . VAL A 1 248 ? 56.104  14.292 30.923  1.00 17.16  ? 248  VAL A HG12 1 
ATOM   3749  H  HG13 . VAL A 1 248 ? 55.547  13.918 29.506  1.00 17.16  ? 248  VAL A HG13 1 
ATOM   3750  H  HG21 . VAL A 1 248 ? 58.627  15.552 28.735  1.00 18.66  ? 248  VAL A HG21 1 
ATOM   3751  H  HG22 . VAL A 1 248 ? 57.864  14.198 28.529  1.00 18.66  ? 248  VAL A HG22 1 
ATOM   3752  H  HG23 . VAL A 1 248 ? 58.418  14.578 29.945  1.00 18.66  ? 248  VAL A HG23 1 
ATOM   3753  N  N    . VAL A 1 249 ? 53.585  16.517 28.372  1.00 10.84  ? 249  VAL A N    1 
ATOM   3754  C  CA   . VAL A 1 249 ? 52.374  17.225 28.685  1.00 11.11  ? 249  VAL A CA   1 
ATOM   3755  C  C    . VAL A 1 249 ? 52.169  17.304 30.208  1.00 11.00  ? 249  VAL A C    1 
ATOM   3756  O  O    . VAL A 1 249 ? 52.723  16.530 31.001  1.00 11.87  ? 249  VAL A O    1 
ATOM   3757  C  CB   . VAL A 1 249 ? 51.160  16.557 27.996  1.00 14.71  ? 249  VAL A CB   1 
ATOM   3758  C  CG1  . VAL A 1 249 ? 51.349  16.529 26.475  1.00 19.59  ? 249  VAL A CG1  1 
ATOM   3759  C  CG2  . VAL A 1 249 ? 50.941  15.141 28.505  1.00 20.37  ? 249  VAL A CG2  1 
ATOM   3760  H  H    . VAL A 1 249 ? 53.529  15.767 27.955  1.00 13.01  ? 249  VAL A H    1 
ATOM   3761  H  HA   . VAL A 1 249 ? 52.456  18.138 28.339  1.00 13.34  ? 249  VAL A HA   1 
ATOM   3762  H  HB   . VAL A 1 249 ? 50.360  17.086 28.198  1.00 17.65  ? 249  VAL A HB   1 
ATOM   3763  H  HG11 . VAL A 1 249 ? 51.488  17.423 26.154  1.00 29.39  ? 249  VAL A HG11 1 
ATOM   3764  H  HG12 . VAL A 1 249 ? 50.566  16.158 26.062  1.00 29.39  ? 249  VAL A HG12 1 
ATOM   3765  H  HG13 . VAL A 1 249 ? 52.112  15.989 26.258  1.00 29.39  ? 249  VAL A HG13 1 
ATOM   3766  H  HG21 . VAL A 1 249 ? 50.841  15.156 29.460  1.00 30.55  ? 249  VAL A HG21 1 
ATOM   3767  H  HG22 . VAL A 1 249 ? 51.695  14.596 28.270  1.00 30.55  ? 249  VAL A HG22 1 
ATOM   3768  H  HG23 . VAL A 1 249 ? 50.147  14.777 28.106  1.00 30.55  ? 249  VAL A HG23 1 
ATOM   3769  N  N    . GLY A 1 250 ? 51.326  18.243 30.608  1.00 10.74  ? 250  GLY A N    1 
ATOM   3770  C  CA   . GLY A 1 250 ? 50.929  18.397 32.003  1.00 8.66   ? 250  GLY A CA   1 
ATOM   3771  C  C    . GLY A 1 250 ? 51.993  19.142 32.790  1.00 9.91   ? 250  GLY A C    1 
ATOM   3772  O  O    . GLY A 1 250 ? 52.162  18.866 33.993  1.00 9.49   ? 250  GLY A O    1 
ATOM   3773  H  H    . GLY A 1 250 ? 51.001  18.783 30.024  1.00 12.89  ? 250  GLY A H    1 
ATOM   3774  H  HA2  . GLY A 1 250 ? 50.092  18.886 32.048  1.00 10.39  ? 250  GLY A HA2  1 
ATOM   3775  H  HA3  . GLY A 1 250 ? 50.788  17.522 32.397  1.00 10.39  ? 250  GLY A HA3  1 
ATOM   3776  N  N    . GLY A 1 251 ? 52.707  20.059 32.224  1.00 8.49   ? 251  GLY A N    1 
ATOM   3777  C  CA   . GLY A 1 251 ? 53.741  20.803 32.867  1.00 7.51   ? 251  GLY A CA   1 
ATOM   3778  C  C    . GLY A 1 251 ? 53.360  21.995 33.672  1.00 6.69   ? 251  GLY A C    1 
ATOM   3779  O  O    . GLY A 1 251 ? 52.186  22.382 33.830  1.00 8.07   ? 251  GLY A O    1 
ATOM   3780  H  H    . GLY A 1 251 ? 52.546  20.233 31.398  1.00 10.19  ? 251  GLY A H    1 
ATOM   3781  H  HA2  . GLY A 1 251 ? 54.223  20.196 33.449  1.00 9.02   ? 251  GLY A HA2  1 
ATOM   3782  H  HA3  . GLY A 1 251 ? 54.362  21.096 32.182  1.00 9.02   ? 251  GLY A HA3  1 
ATOM   3783  N  N    . LEU A 1 252 ? 54.401  22.625 34.218  1.00 8.27   ? 252  LEU A N    1 
ATOM   3784  C  CA   . LEU A 1 252 ? 54.272  23.879 34.945  1.00 8.69   ? 252  LEU A CA   1 
ATOM   3785  C  C    . LEU A 1 252 ? 53.716  24.935 34.004  1.00 9.18   ? 252  LEU A C    1 
ATOM   3786  O  O    . LEU A 1 252 ? 54.058  24.957 32.814  1.00 10.31  ? 252  LEU A O    1 
ATOM   3787  C  CB   . LEU A 1 252 ? 55.627  24.274 35.523  1.00 10.29  ? 252  LEU A CB   1 
ATOM   3788  C  CG   . LEU A 1 252 ? 56.280  23.414 36.602  1.00 9.41   ? 252  LEU A CG   1 
ATOM   3789  C  CD1  . LEU A 1 252 ? 57.759  23.705 36.744  1.00 8.36   ? 252  LEU A CD1  1 
ATOM   3790  C  CD2  . LEU A 1 252 ? 55.573  23.660 37.946  1.00 10.79  ? 252  LEU A CD2  1 
ATOM   3791  H  H    . LEU A 1 252 ? 55.182  22.275 34.137  1.00 9.92   ? 252  LEU A H    1 
ATOM   3792  H  HA   . LEU A 1 252 ? 53.641  23.751 35.683  1.00 10.43  ? 252  LEU A HA   1 
ATOM   3793  H  HB2  . LEU A 1 252 ? 56.251  24.332 34.783  1.00 12.34  ? 252  LEU A HB2  1 
ATOM   3794  H  HB3  . LEU A 1 252 ? 55.535  25.170 35.885  1.00 12.34  ? 252  LEU A HB3  1 
ATOM   3795  H  HG   . LEU A 1 252 ? 56.169  22.471 36.359  1.00 11.29  ? 252  LEU A HG   1 
ATOM   3796  H  HD11 . LEU A 1 252 ? 58.131  23.147 37.431  1.00 12.54  ? 252  LEU A HD11 1 
ATOM   3797  H  HD12 . LEU A 1 252 ? 57.882  24.628 36.981  1.00 12.54  ? 252  LEU A HD12 1 
ATOM   3798  H  HD13 . LEU A 1 252 ? 58.203  23.527 35.912  1.00 12.54  ? 252  LEU A HD13 1 
ATOM   3799  H  HD21 . LEU A 1 252 ? 54.635  23.478 37.853  1.00 16.19  ? 252  LEU A HD21 1 
ATOM   3800  H  HD22 . LEU A 1 252 ? 55.697  24.575 38.209  1.00 16.19  ? 252  LEU A HD22 1 
ATOM   3801  H  HD23 . LEU A 1 252 ? 55.947  23.082 38.615  1.00 16.19  ? 252  LEU A HD23 1 
ATOM   3802  N  N    . THR A 1 253 ? 52.858  25.805 34.529  1.00 8.01   ? 253  THR A N    1 
ATOM   3803  C  CA   . THR A 1 253 ? 52.351  26.878 33.647  1.00 8.36   ? 253  THR A CA   1 
ATOM   3804  C  C    . THR A 1 253 ? 53.352  27.990 33.569  1.00 8.57   ? 253  THR A C    1 
ATOM   3805  O  O    . THR A 1 253 ? 54.357  28.078 34.271  1.00 8.67   ? 253  THR A O    1 
ATOM   3806  C  CB   . THR A 1 253 ? 50.968  27.357 34.096  1.00 7.84   ? 253  THR A CB   1 
ATOM   3807  O  OG1  . THR A 1 253 ? 51.151  27.994 35.355  1.00 8.26   ? 253  THR A OG1  1 
ATOM   3808  C  CG2  . THR A 1 253 ? 49.945  26.280 34.325  1.00 9.99   ? 253  THR A CG2  1 
ATOM   3809  H  H    . THR A 1 253 ? 52.608  25.745 35.350  1.00 9.61   ? 253  THR A H    1 
ATOM   3810  H  HA   . THR A 1 253 ? 52.256  26.501 32.747  1.00 10.04  ? 253  THR A HA   1 
ATOM   3811  H  HB   . THR A 1 253 ? 50.621  28.006 33.449  1.00 9.41   ? 253  THR A HB   1 
ATOM   3812  H  HG1  . THR A 1 253 ? 51.710  28.589 35.282  1.00 12.39  ? 253  THR A HG1  1 
ATOM   3813  H  HG21 . THR A 1 253 ? 49.130  26.675 34.641  1.00 14.99  ? 253  THR A HG21 1 
ATOM   3814  H  HG22 . THR A 1 253 ? 50.275  25.659 34.979  1.00 14.99  ? 253  THR A HG22 1 
ATOM   3815  H  HG23 . THR A 1 253 ? 49.778  25.818 33.500  1.00 14.99  ? 253  THR A HG23 1 
ATOM   3816  N  N    . TYR A 1 254 ? 53.105  28.926 32.601  1.00 7.79   ? 254  TYR A N    1 
ATOM   3817  C  CA   . TYR A 1 254 ? 53.887  30.141 32.476  1.00 7.80   ? 254  TYR A CA   1 
ATOM   3818  C  C    . TYR A 1 254 ? 53.932  30.882 33.817  1.00 7.20   ? 254  TYR A C    1 
ATOM   3819  O  O    . TYR A 1 254 ? 54.993  31.324 34.269  1.00 7.99   ? 254  TYR A O    1 
ATOM   3820  C  CB   . TYR A 1 254 ? 53.258  30.960 31.345  1.00 9.70   ? 254  TYR A CB   1 
ATOM   3821  C  CG   . TYR A 1 254 ? 53.969  32.232 30.957  1.00 10.56  ? 254  TYR A CG   1 
ATOM   3822  C  CD1  . TYR A 1 254 ? 54.887  32.169 29.909  1.00 17.40  ? 254  TYR A CD1  1 
ATOM   3823  C  CD2  . TYR A 1 254 ? 53.752  33.462 31.553  1.00 9.22   ? 254  TYR A CD2  1 
ATOM   3824  C  CE1  . TYR A 1 254 ? 55.570  33.305 29.498  1.00 13.31  ? 254  TYR A CE1  1 
ATOM   3825  C  CE2  . TYR A 1 254 ? 54.444  34.603 31.142  1.00 12.54  ? 254  TYR A CE2  1 
ATOM   3826  C  CZ   . TYR A 1 254 ? 55.358  34.498 30.123  1.00 14.42  ? 254  TYR A CZ   1 
ATOM   3827  O  OH   . TYR A 1 254 ? 56.090  35.574 29.597  1.00 18.60  ? 254  TYR A OH   1 
ATOM   3828  H  H    . TYR A 1 254 ? 52.462  28.788 32.047  1.00 9.35   ? 254  TYR A H    1 
ATOM   3829  H  HA   . TYR A 1 254 ? 54.802  29.901 32.218  1.00 9.36   ? 254  TYR A HA   1 
ATOM   3830  H  HB2  . TYR A 1 254 ? 53.199  30.395 30.559  1.00 11.64  ? 254  TYR A HB2  1 
ATOM   3831  H  HB3  . TYR A 1 254 ? 52.352  31.188 31.606  1.00 11.64  ? 254  TYR A HB3  1 
ATOM   3832  H  HD1  . TYR A 1 254 ? 55.043  31.358 29.481  1.00 20.89  ? 254  TYR A HD1  1 
ATOM   3833  H  HD2  . TYR A 1 254 ? 53.133  33.529 32.244  1.00 11.07  ? 254  TYR A HD2  1 
ATOM   3834  H  HE1  . TYR A 1 254 ? 56.176  33.252 28.794  1.00 15.98  ? 254  TYR A HE1  1 
ATOM   3835  H  HE2  . TYR A 1 254 ? 54.288  35.423 31.552  1.00 15.05  ? 254  TYR A HE2  1 
ATOM   3836  H  HH   . TYR A 1 254 ? 55.921  36.254 30.023  1.00 27.89  ? 254  TYR A HH   1 
ATOM   3837  N  N    . ARG A 1 255 ? 52.757  31.059 34.394  1.00 7.35   ? 255  ARG A N    1 
ATOM   3838  C  CA   . ARG A 1 255 ? 52.575  31.692 35.718  1.00 7.55   ? 255  ARG A CA   1 
ATOM   3839  C  C    . ARG A 1 255 ? 53.435  31.008 36.770  1.00 7.47   ? 255  ARG A C    1 
ATOM   3840  O  O    . ARG A 1 255 ? 54.174  31.676 37.492  1.00 8.88   ? 255  ARG A O    1 
ATOM   3841  C  CB   . ARG A 1 255 ? 51.132  31.703 36.168  1.00 5.42   ? 255  ARG A CB   1 
ATOM   3842  C  CG   . ARG A 1 255 ? 50.308  32.719 35.382  1.00 7.72   ? 255  ARG A CG   1 
ATOM   3843  C  CD   . ARG A 1 255 ? 48.808  32.586 35.494  1.00 10.31  ? 255  ARG A CD   1 
ATOM   3844  N  NE   . ARG A 1 255 ? 48.389  32.454 36.908  1.00 7.97   ? 255  ARG A NE   1 
ATOM   3845  C  CZ   . ARG A 1 255 ? 47.139  32.338 37.243  1.00 7.87   ? 255  ARG A CZ   1 
ATOM   3846  N  NH1  . ARG A 1 255 ? 46.085  32.348 36.422  1.00 8.06   ? 255  ARG A NH1  1 
ATOM   3847  N  NH2  . ARG A 1 255 ? 46.859  32.190 38.544  1.00 11.98  ? 255  ARG A NH2  1 
ATOM   3848  H  H    . ARG A 1 255 ? 52.056  30.789 33.975  1.00 8.82   ? 255  ARG A H    1 
ATOM   3849  H  HA   . ARG A 1 255 ? 52.874  32.623 35.648  1.00 9.06   ? 255  ARG A HA   1 
ATOM   3850  H  HB2  . ARG A 1 255 ? 50.751  30.819 36.048  1.00 6.50   ? 255  ARG A HB2  1 
ATOM   3851  H  HB3  . ARG A 1 255 ? 51.092  31.920 37.113  1.00 6.50   ? 255  ARG A HB3  1 
ATOM   3852  H  HG2  . ARG A 1 255 ? 50.558  33.608 35.679  1.00 9.26   ? 255  ARG A HG2  1 
ATOM   3853  H  HG3  . ARG A 1 255 ? 50.551  32.647 34.446  1.00 9.26   ? 255  ARG A HG3  1 
ATOM   3854  H  HD2  . ARG A 1 255 ? 48.385  33.367 35.104  1.00 12.37  ? 255  ARG A HD2  1 
ATOM   3855  H  HD3  . ARG A 1 255 ? 48.515  31.806 34.997  1.00 12.37  ? 255  ARG A HD3  1 
ATOM   3856  H  HE   . ARG A 1 255 ? 48.989  32.454 37.524  1.00 9.57   ? 255  ARG A HE   1 
ATOM   3857  H  HH11 . ARG A 1 255 ? 46.201  32.437 35.575  1.00 9.67   ? 255  ARG A HH11 1 
ATOM   3858  H  HH12 . ARG A 1 255 ? 45.291  32.264 36.742  1.00 9.67   ? 255  ARG A HH12 1 
ATOM   3859  H  HH21 . ARG A 1 255 ? 47.495  32.174 39.122  1.00 14.38  ? 255  ARG A HH21 1 
ATOM   3860  H  HH22 . ARG A 1 255 ? 46.042  32.111 38.801  1.00 14.38  ? 255  ARG A HH22 1 
ATOM   3861  N  N    . GLU A 1 256 ? 53.456  29.745 37.003  1.00 9.22   ? 256  GLU A N    1 
ATOM   3862  C  CA   . GLU A 1 256 ? 54.173  28.910 37.911  1.00 8.00   ? 256  GLU A CA   1 
ATOM   3863  C  C    . GLU A 1 256 ? 55.627  29.126 37.601  1.00 8.87   ? 256  GLU A C    1 
ATOM   3864  O  O    . GLU A 1 256 ? 56.384  29.308 38.585  1.00 8.22   ? 256  GLU A O    1 
ATOM   3865  C  CB   . GLU A 1 256 ? 53.791  27.442 37.892  1.00 7.84   ? 256  GLU A CB   1 
ATOM   3866  C  CG   . GLU A 1 256 ? 52.444  27.167 38.521  1.00 8.78   ? 256  GLU A CG   1 
ATOM   3867  C  CD   . GLU A 1 256 ? 51.865  25.808 38.275  1.00 10.47  ? 256  GLU A CD   1 
ATOM   3868  O  OE1  . GLU A 1 256 ? 52.245  25.133 37.278  1.00 9.41   ? 256  GLU A OE1  1 
ATOM   3869  O  OE2  . GLU A 1 256 ? 51.016  25.344 39.092  1.00 9.53   ? 256  GLU A OE2  1 
ATOM   3870  H  H    . GLU A 1 256 ? 52.918  29.303 36.498  1.00 11.06  ? 256  GLU A H    1 
ATOM   3871  H  HA   . GLU A 1 256 ? 54.009  29.248 38.817  1.00 9.60   ? 256  GLU A HA   1 
ATOM   3872  H  HB2  . GLU A 1 256 ? 53.778  27.133 36.973  1.00 9.41   ? 256  GLU A HB2  1 
ATOM   3873  H  HB3  . GLU A 1 256 ? 54.469  26.935 38.366  1.00 9.41   ? 256  GLU A HB3  1 
ATOM   3874  H  HG2  . GLU A 1 256 ? 52.525  27.293 39.480  1.00 10.53  ? 256  GLU A HG2  1 
ATOM   3875  H  HG3  . GLU A 1 256 ? 51.815  27.829 38.194  1.00 10.53  ? 256  GLU A HG3  1 
ATOM   3876  N  N    . GLY A 1 257 ? 56.110  29.181 36.369  1.00 9.24   ? 257  GLY A N    1 
ATOM   3877  C  CA   . GLY A 1 257 ? 57.488  29.446 36.060  1.00 9.99   ? 257  GLY A CA   1 
ATOM   3878  C  C    . GLY A 1 257 ? 57.962  30.783 36.570  1.00 7.68   ? 257  GLY A C    1 
ATOM   3879  O  O    . GLY A 1 257 ? 59.052  30.863 37.168  1.00 10.11  ? 257  GLY A O    1 
ATOM   3880  H  H    . GLY A 1 257 ? 55.566  29.051 35.715  1.00 11.08  ? 257  GLY A H    1 
ATOM   3881  H  HA2  . GLY A 1 257 ? 58.038  28.748 36.448  1.00 11.99  ? 257  GLY A HA2  1 
ATOM   3882  H  HA3  . GLY A 1 257 ? 57.606  29.416 35.098  1.00 11.99  ? 257  GLY A HA3  1 
ATOM   3883  N  N    . LEU A 1 258 ? 57.187  31.814 36.340  1.00 7.71   ? 258  LEU A N    1 
ATOM   3884  C  CA   . LEU A 1 258 ? 57.478  33.151 36.825  1.00 6.89   ? 258  LEU A CA   1 
ATOM   3885  C  C    . LEU A 1 258 ? 57.417  33.172 38.353  1.00 9.77   ? 258  LEU A C    1 
ATOM   3886  O  O    . LEU A 1 258 ? 58.233  33.840 38.943  1.00 9.13   ? 258  LEU A O    1 
ATOM   3887  C  CB   . LEU A 1 258 ? 56.589  34.252 36.261  1.00 8.99   ? 258  LEU A CB   1 
ATOM   3888  C  CG   . LEU A 1 258 ? 56.727  34.455 34.765  1.00 10.69  ? 258  LEU A CG   1 
ATOM   3889  C  CD1  . LEU A 1 258 ? 55.700  35.454 34.244  1.00 18.00  ? 258  LEU A CD1  1 
ATOM   3890  C  CD2  . LEU A 1 258 ? 58.096  34.981 34.411  1.00 14.52  ? 258  LEU A CD2  1 
ATOM   3891  H  H    . LEU A 1 258 ? 56.472  31.693 35.879  1.00 9.25   ? 258  LEU A H    1 
ATOM   3892  H  HA   . LEU A 1 258 ? 58.400  33.361 36.567  1.00 8.27   ? 258  LEU A HA   1 
ATOM   3893  H  HB2  . LEU A 1 258 ? 55.664  34.038 36.462  1.00 10.79  ? 258  LEU A HB2  1 
ATOM   3894  H  HB3  . LEU A 1 258 ? 56.802  35.085 36.709  1.00 10.79  ? 258  LEU A HB3  1 
ATOM   3895  H  HG   . LEU A 1 258 ? 56.590  33.596 34.314  1.00 12.83  ? 258  LEU A HG   1 
ATOM   3896  H  HD11 . LEU A 1 258 ? 54.816  35.143 34.454  1.00 26.99  ? 258  LEU A HD11 1 
ATOM   3897  H  HD12 . LEU A 1 258 ? 55.791  35.539 33.292  1.00 26.99  ? 258  LEU A HD12 1 
ATOM   3898  H  HD13 . LEU A 1 258 ? 55.846  36.308 34.657  1.00 26.99  ? 258  LEU A HD13 1 
ATOM   3899  H  HD21 . LEU A 1 258 ? 58.158  35.099 33.460  1.00 21.79  ? 258  LEU A HD21 1 
ATOM   3900  H  HD22 . LEU A 1 258 ? 58.764  34.354 34.699  1.00 21.79  ? 258  LEU A HD22 1 
ATOM   3901  H  HD23 . LEU A 1 258 ? 58.238  35.824 34.847  1.00 21.79  ? 258  LEU A HD23 1 
ATOM   3902  N  N    . TYR A 1 259 ? 56.514  32.448 38.944  1.00 8.70   ? 259  TYR A N    1 
ATOM   3903  C  CA   . TYR A 1 259 ? 56.433  32.478 40.407  1.00 6.18   ? 259  TYR A CA   1 
ATOM   3904  C  C    . TYR A 1 259 ? 57.665  31.865 41.026  1.00 9.17   ? 259  TYR A C    1 
ATOM   3905  O  O    . TYR A 1 259 ? 58.278  32.467 41.948  1.00 7.51   ? 259  TYR A O    1 
ATOM   3906  C  CB   . TYR A 1 259 ? 55.167  31.700 40.872  1.00 8.47   ? 259  TYR A CB   1 
ATOM   3907  C  CG   . TYR A 1 259 ? 54.989  31.965 42.367  1.00 10.38  ? 259  TYR A CG   1 
ATOM   3908  C  CD1  . TYR A 1 259 ? 54.515  33.174 42.842  1.00 10.89  ? 259  TYR A CD1  1 
ATOM   3909  C  CD2  . TYR A 1 259 ? 55.346  31.008 43.288  1.00 10.47  ? 259  TYR A CD2  1 
ATOM   3910  C  CE1  . TYR A 1 259 ? 54.378  33.408 44.208  1.00 8.18   ? 259  TYR A CE1  1 
ATOM   3911  C  CE2  . TYR A 1 259 ? 55.224  31.217 44.653  1.00 10.84  ? 259  TYR A CE2  1 
ATOM   3912  C  CZ   . TYR A 1 259 ? 54.727  32.432 45.101  1.00 10.25  ? 259  TYR A CZ   1 
ATOM   3913  O  OH   . TYR A 1 259 ? 54.610  32.660 46.480  1.00 11.15  ? 259  TYR A OH   1 
ATOM   3914  H  H    . TYR A 1 259 ? 55.974  31.960 38.485  1.00 10.44  ? 259  TYR A H    1 
ATOM   3915  H  HA   . TYR A 1 259 ? 56.360  33.410 40.702  1.00 7.42   ? 259  TYR A HA   1 
ATOM   3916  H  HB2  . TYR A 1 259 ? 54.387  32.005 40.382  1.00 10.17  ? 259  TYR A HB2  1 
ATOM   3917  H  HB3  . TYR A 1 259 ? 55.280  30.750 40.711  1.00 10.17  ? 259  TYR A HB3  1 
ATOM   3918  H  HD1  . TYR A 1 259 ? 54.283  33.842 42.238  1.00 13.07  ? 259  TYR A HD1  1 
ATOM   3919  H  HD2  . TYR A 1 259 ? 55.679  30.194 42.986  1.00 12.57  ? 259  TYR A HD2  1 
ATOM   3920  H  HE1  . TYR A 1 259 ? 54.052  34.224 44.512  1.00 9.82   ? 259  TYR A HE1  1 
ATOM   3921  H  HE2  . TYR A 1 259 ? 55.472  30.555 45.258  1.00 13.01  ? 259  TYR A HE2  1 
ATOM   3922  H  HH   . TYR A 1 259 ? 54.854  31.992 46.889  1.00 16.73  ? 259  TYR A HH   1 
ATOM   3923  N  N    . ILE A 1 260 ? 58.098  30.706 40.502  1.00 9.00   ? 260  ILE A N    1 
ATOM   3924  C  CA   . ILE A 1 260 ? 59.311  30.067 41.007  1.00 8.30   ? 260  ILE A CA   1 
ATOM   3925  C  C    . ILE A 1 260 ? 60.465  31.022 40.988  1.00 10.63  ? 260  ILE A C    1 
ATOM   3926  O  O    . ILE A 1 260 ? 61.209  31.211 41.974  1.00 9.28   ? 260  ILE A O    1 
ATOM   3927  C  CB   . ILE A 1 260 ? 59.633  28.828 40.121  1.00 8.83   ? 260  ILE A CB   1 
ATOM   3928  C  CG1  . ILE A 1 260 ? 58.608  27.735 40.297  1.00 7.50   ? 260  ILE A CG1  1 
ATOM   3929  C  CG2  . ILE A 1 260 ? 61.064  28.372 40.405  1.00 9.75   ? 260  ILE A CG2  1 
ATOM   3930  C  CD1  . ILE A 1 260 ? 58.659  26.645 39.234  1.00 8.15   ? 260  ILE A CD1  1 
ATOM   3931  H  H    . ILE A 1 260 ? 57.657  30.337 39.863  1.00 10.81  ? 260  ILE A H    1 
ATOM   3932  H  HA   . ILE A 1 260 ? 59.157  29.769 41.928  1.00 9.97   ? 260  ILE A HA   1 
ATOM   3933  H  HB   . ILE A 1 260 ? 59.596  29.118 39.185  1.00 10.60  ? 260  ILE A HB   1 
ATOM   3934  H  HG12 . ILE A 1 260 ? 58.738  27.326 41.167  1.00 9.00   ? 260  ILE A HG12 1 
ATOM   3935  H  HG13 . ILE A 1 260 ? 57.724  28.134 40.290  1.00 9.00   ? 260  ILE A HG13 1 
ATOM   3936  H  HG21 . ILE A 1 260 ? 61.666  29.109 40.276  1.00 14.62  ? 260  ILE A HG21 1 
ATOM   3937  H  HG22 . ILE A 1 260 ? 61.298  27.659 39.805  1.00 14.62  ? 260  ILE A HG22 1 
ATOM   3938  H  HG23 . ILE A 1 260 ? 61.127  28.062 41.311  1.00 14.62  ? 260  ILE A HG23 1 
ATOM   3939  H  HD11 . ILE A 1 260 ? 57.977  25.993 39.411  1.00 12.23  ? 260  ILE A HD11 1 
ATOM   3940  H  HD12 . ILE A 1 260 ? 59.520  26.221 39.252  1.00 12.23  ? 260  ILE A HD12 1 
ATOM   3941  H  HD13 . ILE A 1 260 ? 58.512  27.035 38.369  1.00 12.23  ? 260  ILE A HD13 1 
ATOM   3942  N  N    . THR A 1 261 ? 60.640  31.722 39.872  1.00 8.92   ? 261  THR A N    1 
ATOM   3943  C  CA   . THR A 1 261 ? 61.840  32.543 39.624  1.00 9.37   ? 261  THR A CA   1 
ATOM   3944  C  C    . THR A 1 261 ? 61.751  33.871 40.349  1.00 8.69   ? 261  THR A C    1 
ATOM   3945  O  O    . THR A 1 261 ? 62.755  34.379 40.866  1.00 10.12  ? 261  THR A O    1 
ATOM   3946  C  CB   . THR A 1 261 ? 62.088  32.715 38.110  1.00 7.54   ? 261  THR A CB   1 
ATOM   3947  O  OG1  . THR A 1 261 ? 60.895  33.156 37.433  1.00 10.36  ? 261  THR A OG1  1 
ATOM   3948  C  CG2  . THR A 1 261 ? 62.561  31.370 37.575  1.00 12.71  ? 261  THR A CG2  1 
ATOM   3949  H  H    . THR A 1 261 ? 60.028  31.695 39.268  1.00 10.70  ? 261  THR A H    1 
ATOM   3950  H  HA   . THR A 1 261 ? 62.607  32.059 39.994  1.00 11.24  ? 261  THR A HA   1 
ATOM   3951  H  HB   . THR A 1 261 ? 62.796  33.379 37.975  1.00 9.05   ? 261  THR A HB   1 
ATOM   3952  H  HG1  . THR A 1 261 ? 60.676  32.598 36.873  1.00 15.54  ? 261  THR A HG1  1 
ATOM   3953  H  HG21 . THR A 1 261 ? 62.724  31.440 36.632  1.00 19.06  ? 261  THR A HG21 1 
ATOM   3954  H  HG22 . THR A 1 261 ? 61.886  30.706 37.736  1.00 19.06  ? 261  THR A HG22 1 
ATOM   3955  H  HG23 . THR A 1 261 ? 63.372  31.115 38.022  1.00 19.06  ? 261  THR A HG23 1 
ATOM   3956  N  N    . GLU A 1 262 ? 60.558  34.454 40.457  1.00 7.64   ? 262  GLU A N    1 
ATOM   3957  C  CA   . GLU A 1 262 ? 60.366  35.626 41.306  1.00 10.67  ? 262  GLU A CA   1 
ATOM   3958  C  C    . GLU A 1 262 ? 60.754  35.298 42.738  1.00 9.34   ? 262  GLU A C    1 
ATOM   3959  O  O    . GLU A 1 262 ? 61.416  36.085 43.428  1.00 11.06  ? 262  GLU A O    1 
ATOM   3960  C  CB   . GLU A 1 262 ? 58.897  36.094 41.251  1.00 10.55  ? 262  GLU A CB   1 
ATOM   3961  C  CG   . GLU A 1 262 ? 58.507  36.820 39.958  1.00 10.30  ? 262  GLU A CG   1 
ATOM   3962  C  CD   . GLU A 1 262 ? 57.023  37.098 39.797  1.00 11.80  ? 262  GLU A CD   1 
ATOM   3963  O  OE1  . GLU A 1 262 ? 56.194  36.505 40.536  1.00 10.91  ? 262  GLU A OE1  1 
ATOM   3964  O  OE2  . GLU A 1 262 ? 56.650  37.961 38.944  1.00 11.99  ? 262  GLU A OE2  1 
ATOM   3965  H  H    . GLU A 1 262 ? 59.890  34.134 40.020  1.00 9.17   ? 262  GLU A H    1 
ATOM   3966  H  HA   . GLU A 1 262 ? 60.941  36.350 40.981  1.00 12.80  ? 262  GLU A HA   1 
ATOM   3967  H  HB2  . GLU A 1 262 ? 58.322  35.320 41.358  1.00 12.66  ? 262  GLU A HB2  1 
ATOM   3968  H  HB3  . GLU A 1 262 ? 58.732  36.686 42.001  1.00 12.66  ? 262  GLU A HB3  1 
ATOM   3969  H  HG2  . GLU A 1 262 ? 58.983  37.664 39.924  1.00 12.36  ? 262  GLU A HG2  1 
ATOM   3970  H  HG3  . GLU A 1 262 ? 58.803  36.287 39.204  1.00 12.36  ? 262  GLU A HG3  1 
ATOM   3971  N  N    . GLU A 1 263 ? 60.329  34.149 43.244  1.00 8.91   ? 263  GLU A N    1 
ATOM   3972  C  CA   . GLU A 1 263 ? 60.587  33.832 44.670  1.00 9.53   ? 263  GLU A CA   1 
ATOM   3973  C  C    . GLU A 1 263 ? 62.066  33.610 44.908  1.00 12.48  ? 263  GLU A C    1 
ATOM   3974  O  O    . GLU A 1 263 ? 62.623  34.045 45.924  1.00 10.97  ? 263  GLU A O    1 
ATOM   3975  C  CB   . GLU A 1 263 ? 59.700  32.668 45.094  1.00 11.11  ? 263  GLU A CB   1 
ATOM   3976  C  CG   . GLU A 1 263 ? 58.224  33.039 45.229  1.00 11.76  ? 263  GLU A CG   1 
ATOM   3977  C  CD   . GLU A 1 263 ? 57.959  34.088 46.293  1.00 15.80  ? 263  GLU A CD   1 
ATOM   3978  O  OE1  . GLU A 1 263 ? 58.362  33.990 47.470  1.00 14.86  ? 263  GLU A OE1  1 
ATOM   3979  O  OE2  . GLU A 1 263 ? 57.300  35.089 45.968  1.00 14.92  ? 263  GLU A OE2  1 
ATOM   3980  H  H    . GLU A 1 263 ? 59.905  33.589 42.748  1.00 10.69  ? 263  GLU A H    1 
ATOM   3981  H  HA   . GLU A 1 263 ? 60.318  34.613 45.198  1.00 11.43  ? 263  GLU A HA   1 
ATOM   3982  H  HB2  . GLU A 1 263 ? 59.785  31.955 44.441  1.00 13.33  ? 263  GLU A HB2  1 
ATOM   3983  H  HB3  . GLU A 1 263 ? 60.017  32.327 45.945  1.00 13.33  ? 263  GLU A HB3  1 
ATOM   3984  H  HG2  . GLU A 1 263 ? 57.904  33.370 44.376  1.00 14.11  ? 263  GLU A HG2  1 
ATOM   3985  H  HG3  . GLU A 1 263 ? 57.718  32.239 45.444  1.00 14.11  ? 263  GLU A HG3  1 
ATOM   3986  N  N    . ILE A 1 264 ? 62.724  32.980 43.934  1.00 10.40  ? 264  ILE A N    1 
ATOM   3987  C  CA   . ILE A 1 264 ? 64.167  32.770 44.102  1.00 10.70  ? 264  ILE A CA   1 
ATOM   3988  C  C    . ILE A 1 264 ? 64.858  34.112 44.037  1.00 11.51  ? 264  ILE A C    1 
ATOM   3989  O  O    . ILE A 1 264 ? 65.802  34.380 44.839  1.00 10.67  ? 264  ILE A O    1 
ATOM   3990  C  CB   . ILE A 1 264 ? 64.647  31.753 43.055  1.00 12.26  ? 264  ILE A CB   1 
ATOM   3991  C  CG1  . ILE A 1 264 ? 64.134  30.348 43.296  1.00 9.04   ? 264  ILE A CG1  1 
ATOM   3992  C  CG2  . ILE A 1 264 ? 66.175  31.779 42.976  1.00 12.71  ? 264  ILE A CG2  1 
ATOM   3993  C  CD1  . ILE A 1 264 ? 64.255  29.383 42.125  1.00 11.78  ? 264  ILE A CD1  1 
ATOM   3994  H  H    . ILE A 1 264 ? 62.315  32.706 43.228  1.00 12.48  ? 264  ILE A H    1 
ATOM   3995  H  HA   . ILE A 1 264 ? 64.320  32.390 44.992  1.00 12.84  ? 264  ILE A HA   1 
ATOM   3996  H  HB   . ILE A 1 264 ? 64.304  32.044 42.185  1.00 14.71  ? 264  ILE A HB   1 
ATOM   3997  H  HG12 . ILE A 1 264 ? 64.616  29.974 44.050  1.00 10.85  ? 264  ILE A HG12 1 
ATOM   3998  H  HG13 . ILE A 1 264 ? 63.200  30.405 43.548  1.00 10.85  ? 264  ILE A HG13 1 
ATOM   3999  H  HG21 . ILE A 1 264 ? 66.471  32.680 42.824  1.00 19.06  ? 264  ILE A HG21 1 
ATOM   4000  H  HG22 . ILE A 1 264 ? 66.467  31.220 42.253  1.00 19.06  ? 264  ILE A HG22 1 
ATOM   4001  H  HG23 . ILE A 1 264 ? 66.544  31.455 43.801  1.00 19.06  ? 264  ILE A HG23 1 
ATOM   4002  H  HD11 . ILE A 1 264 ? 63.903  28.526 42.379  1.00 17.66  ? 264  ILE A HD11 1 
ATOM   4003  H  HD12 . ILE A 1 264 ? 65.179  29.289 41.881  1.00 17.66  ? 264  ILE A HD12 1 
ATOM   4004  H  HD13 . ILE A 1 264 ? 63.759  29.723 41.377  1.00 17.66  ? 264  ILE A HD13 1 
ATOM   4005  N  N    . TYR A 1 265 ? 64.505  35.038 43.196  1.00 11.01  ? 265  TYR A N    1 
ATOM   4006  C  CA   . TYR A 1 265 ? 65.115  36.357 43.127  1.00 11.00  ? 265  TYR A CA   1 
ATOM   4007  C  C    . TYR A 1 265 ? 65.060  37.034 44.504  1.00 10.74  ? 265  TYR A C    1 
ATOM   4008  O  O    . TYR A 1 265 ? 66.075  37.592 44.917  1.00 10.78  ? 265  TYR A O    1 
ATOM   4009  C  CB   . TYR A 1 265 ? 64.456  37.263 42.071  1.00 13.23  ? 265  TYR A CB   1 
ATOM   4010  C  CG   . TYR A 1 265 ? 64.899  38.696 42.287  1.00 11.28  ? 265  TYR A CG   1 
ATOM   4011  C  CD1  . TYR A 1 265 ? 66.178  39.083 41.980  1.00 13.51  ? 265  TYR A CD1  1 
ATOM   4012  C  CD2  . TYR A 1 265 ? 64.015  39.641 42.825  1.00 15.77  ? 265  TYR A CD2  1 
ATOM   4013  C  CE1  . TYR A 1 265 ? 66.588  40.383 42.185  1.00 14.58  ? 265  TYR A CE1  1 
ATOM   4014  C  CE2  . TYR A 1 265 ? 64.418  40.951 43.045  1.00 15.03  ? 265  TYR A CE2  1 
ATOM   4015  C  CZ   . TYR A 1 265 ? 65.706  41.305 42.712  1.00 16.20  ? 265  TYR A CZ   1 
ATOM   4016  O  OH   . TYR A 1 265 ? 66.101  42.617 42.931  1.00 20.40  ? 265  TYR A OH   1 
ATOM   4017  H  H    . TYR A 1 265 ? 63.871  34.860 42.644  1.00 13.21  ? 265  TYR A H    1 
ATOM   4018  H  HA   . TYR A 1 265 ? 66.058  36.243 42.883  1.00 13.20  ? 265  TYR A HA   1 
ATOM   4019  H  HB2  . TYR A 1 265 ? 64.712  36.971 41.183  1.00 15.88  ? 265  TYR A HB2  1 
ATOM   4020  H  HB3  . TYR A 1 265 ? 63.491  37.203 42.144  1.00 15.88  ? 265  TYR A HB3  1 
ATOM   4021  H  HD1  . TYR A 1 265 ? 66.775  38.462 41.629  1.00 16.21  ? 265  TYR A HD1  1 
ATOM   4022  H  HD2  . TYR A 1 265 ? 63.146  39.386 43.038  1.00 18.93  ? 265  TYR A HD2  1 
ATOM   4023  H  HE1  . TYR A 1 265 ? 67.455  40.638 41.969  1.00 17.49  ? 265  TYR A HE1  1 
ATOM   4024  H  HE2  . TYR A 1 265 ? 63.832  41.575 43.408  1.00 18.04  ? 265  TYR A HE2  1 
ATOM   4025  H  HH   . TYR A 1 265 ? 65.476  43.040 43.253  1.00 30.59  ? 265  TYR A HH   1 
ATOM   4026  N  N    . LYS A 1 266 ? 63.887  36.936 45.097  1.00 10.12  ? 266  LYS A N    1 
ATOM   4027  C  CA   . LYS A 1 266 ? 63.632  37.634 46.351  1.00 9.91   ? 266  LYS A CA   1 
ATOM   4028  C  C    . LYS A 1 266 ? 64.425  37.048 47.486  1.00 13.52  ? 266  LYS A C    1 
ATOM   4029  O  O    . LYS A 1 266 ? 64.505  37.740 48.534  1.00 15.97  ? 266  LYS A O    1 
ATOM   4030  C  CB   . LYS A 1 266 ? 62.123  37.598 46.626  1.00 13.10  ? 266  LYS A CB   1 
ATOM   4031  C  CG   . LYS A 1 266 ? 61.402  38.588 45.750  1.00 15.33  ? 266  LYS A CG   1 
ATOM   4032  C  CD   . LYS A 1 266 ? 60.157  38.177 45.030  1.00 36.19  ? 266  LYS A CD   1 
ATOM   4033  C  CE   . LYS A 1 266 ? 59.145  37.567 45.963  1.00 20.45  ? 266  LYS A CE   1 
ATOM   4034  N  NZ   . LYS A 1 266 ? 57.753  37.787 45.442  1.00 29.52  ? 266  LYS A NZ   1 
ATOM   4035  H  H    . LYS A 1 266 ? 63.267  36.456 44.742  1.00 12.14  ? 266  LYS A H    1 
ATOM   4036  H  HA   . LYS A 1 266 ? 63.901  38.570 46.241  1.00 11.89  ? 266  LYS A HA   1 
ATOM   4037  H  HB2  . LYS A 1 266 ? 61.783  36.706 46.454  1.00 15.72  ? 266  LYS A HB2  1 
ATOM   4038  H  HB3  . LYS A 1 266 ? 61.958  37.809 47.558  1.00 15.72  ? 266  LYS A HB3  1 
ATOM   4039  H  HG2  . LYS A 1 266 ? 61.177  39.353 46.303  1.00 18.40  ? 266  LYS A HG2  1 
ATOM   4040  H  HG3  . LYS A 1 266 ? 62.033  38.898 45.083  1.00 18.40  ? 266  LYS A HG3  1 
ATOM   4041  H  HD2  . LYS A 1 266 ? 59.767  38.953 44.598  1.00 43.42  ? 266  LYS A HD2  1 
ATOM   4042  H  HD3  . LYS A 1 266 ? 60.385  37.535 44.340  1.00 43.42  ? 266  LYS A HD3  1 
ATOM   4043  H  HE2  . LYS A 1 266 ? 59.314  36.616 46.048  1.00 24.54  ? 266  LYS A HE2  1 
ATOM   4044  H  HE3  . LYS A 1 266 ? 59.230  37.968 46.842  1.00 24.54  ? 266  LYS A HE3  1 
ATOM   4045  H  HZ1  . LYS A 1 266 ? 57.163  37.482 46.035  1.00 44.28  ? 266  LYS A HZ1  1 
ATOM   4046  H  HZ2  . LYS A 1 266 ? 57.652  37.352 44.672  1.00 44.28  ? 266  LYS A HZ2  1 
ATOM   4047  H  HZ3  . LYS A 1 266 ? 57.619  38.657 45.311  1.00 44.28  ? 266  LYS A HZ3  1 
ATOM   4048  N  N    . THR A 1 267 ? 65.019  35.885 47.397  1.00 13.61  ? 267  THR A N    1 
ATOM   4049  C  CA   . THR A 1 267 ? 65.871  35.420 48.496  1.00 13.31  ? 267  THR A CA   1 
ATOM   4050  C  C    . THR A 1 267 ? 67.140  36.250 48.548  1.00 15.71  ? 267  THR A C    1 
ATOM   4051  O  O    . THR A 1 267 ? 67.773  36.331 49.623  1.00 21.71  ? 267  THR A O    1 
ATOM   4052  C  CB   . THR A 1 267 ? 66.289  33.952 48.395  1.00 13.34  ? 267  THR A CB   1 
ATOM   4053  O  OG1  . THR A 1 267 ? 66.962  33.750 47.170  1.00 15.93  ? 267  THR A OG1  1 
ATOM   4054  C  CG2  . THR A 1 267 ? 65.092  33.029 48.356  1.00 14.88  ? 267  THR A CG2  1 
ATOM   4055  H  H    . THR A 1 267 ? 64.910  35.397 46.697  1.00 16.33  ? 267  THR A H    1 
ATOM   4056  H  HA   . THR A 1 267 ? 65.385  35.546 49.338  1.00 15.97  ? 267  THR A HA   1 
ATOM   4057  H  HB   . THR A 1 267 ? 66.874  33.714 49.145  1.00 16.01  ? 267  THR A HB   1 
ATOM   4058  H  HG1  . THR A 1 267 ? 67.623  34.233 47.139  1.00 23.90  ? 267  THR A HG1  1 
ATOM   4059  H  HG21 . THR A 1 267 ? 65.391  32.119 48.295  1.00 22.31  ? 267  THR A HG21 1 
ATOM   4060  H  HG22 . THR A 1 267 ? 64.551  33.239 47.591  1.00 22.31  ? 267  THR A HG22 1 
ATOM   4061  H  HG23 . THR A 1 267 ? 64.574  33.142 49.156  1.00 22.31  ? 267  THR A HG23 1 
ATOM   4062  N  N    . GLY A 1 268 ? 67.585  36.902 47.497  1.00 13.53  ? 268  GLY A N    1 
ATOM   4063  C  CA   . GLY A 1 268 ? 68.838  37.587 47.344  1.00 14.90  ? 268  GLY A CA   1 
ATOM   4064  C  C    . GLY A 1 268 ? 70.110  36.789 47.203  1.00 22.13  ? 268  GLY A C    1 
ATOM   4065  O  O    . GLY A 1 268 ? 71.219  37.343 47.231  1.00 19.47  ? 268  GLY A O    1 
ATOM   4066  H  H    . GLY A 1 268 ? 67.061  36.920 46.816  1.00 16.23  ? 268  GLY A H    1 
ATOM   4067  H  HA2  . GLY A 1 268 ? 68.764  38.157 46.563  1.00 17.88  ? 268  GLY A HA2  1 
ATOM   4068  H  HA3  . GLY A 1 268 ? 68.945  38.171 48.111  1.00 17.88  ? 268  GLY A HA3  1 
ATOM   4069  N  N    . LEU A 1 269 ? 69.883  35.444 47.146  1.00 15.47  ? 269  LEU A N    1 
ATOM   4070  C  CA   . LEU A 1 269 ? 70.868  34.369 47.127  1.00 13.43  ? 269  LEU A CA   1 
ATOM   4071  C  C    . LEU A 1 269 ? 71.056  33.651 45.790  1.00 11.82  ? 269  LEU A C    1 
ATOM   4072  O  O    . LEU A 1 269 ? 71.905  32.781 45.747  1.00 13.19  ? 269  LEU A O    1 
ATOM   4073  C  CB   . LEU A 1 269 ? 70.513  33.372 48.237  1.00 13.23  ? 269  LEU A CB   1 
ATOM   4074  C  CG   . LEU A 1 269 ? 70.567  33.916 49.684  1.00 15.18  ? 269  LEU A CG   1 
ATOM   4075  C  CD1  . LEU A 1 269 ? 69.972  32.938 50.665  1.00 15.70  ? 269  LEU A CD1  1 
ATOM   4076  C  CD2  . LEU A 1 269 ? 72.011  34.250 50.041  1.00 18.00  ? 269  LEU A CD2  1 
ATOM   4077  H  H    . LEU A 1 269 ? 69.260  35.276 46.739  1.00 18.56  ? 269  LEU A H    1 
ATOM   4078  H  HA   . LEU A 1 269 ? 71.784  34.707 47.407  1.00 16.12  ? 269  LEU A HA   1 
ATOM   4079  H  HB2  . LEU A 1 269 ? 69.569  33.093 48.064  1.00 15.88  ? 269  LEU A HB2  1 
ATOM   4080  H  HB3  . LEU A 1 269 ? 71.046  32.586 48.167  1.00 15.88  ? 269  LEU A HB3  1 
ATOM   4081  H  HG   . LEU A 1 269 ? 70.045  34.745 49.727  1.00 18.21  ? 269  LEU A HG   1 
ATOM   4082  H  HD11 . LEU A 1 269 ? 69.069  32.737 50.408  1.00 23.55  ? 269  LEU A HD11 1 
ATOM   4083  H  HD12 . LEU A 1 269 ? 69.976  33.324 51.544  1.00 23.55  ? 269  LEU A HD12 1 
ATOM   4084  H  HD13 . LEU A 1 269 ? 70.491  32.131 50.667  1.00 23.55  ? 269  LEU A HD13 1 
ATOM   4085  H  HD21 . LEU A 1 269 ? 72.358  34.886 49.411  1.00 27.00  ? 269  LEU A HD21 1 
ATOM   4086  H  HD22 . LEU A 1 269 ? 72.541  33.450 50.012  1.00 27.00  ? 269  LEU A HD22 1 
ATOM   4087  H  HD23 . LEU A 1 269 ? 72.044  34.625 50.924  1.00 27.00  ? 269  LEU A HD23 1 
ATOM   4088  N  N    . LEU A 1 270 ? 70.332  34.000 44.739  1.00 12.50  ? 270  LEU A N    1 
ATOM   4089  C  CA   . LEU A 1 270 ? 70.702  33.438 43.431  1.00 11.03  ? 270  LEU A CA   1 
ATOM   4090  C  C    . LEU A 1 270 ? 72.174  33.671 43.118  1.00 11.52  ? 270  LEU A C    1 
ATOM   4091  O  O    . LEU A 1 270 ? 72.659  34.797 43.173  1.00 13.08  ? 270  LEU A O    1 
ATOM   4092  C  CB   . LEU A 1 270 ? 69.851  34.031 42.298  1.00 10.84  ? 270  LEU A CB   1 
ATOM   4093  C  CG   . LEU A 1 270 ? 70.077  33.276 40.958  1.00 10.44  ? 270  LEU A CG   1 
ATOM   4094  C  CD1  . LEU A 1 270 ? 69.727  31.820 40.998  1.00 11.20  ? 270  LEU A CD1  1 
ATOM   4095  C  CD2  . LEU A 1 270 ? 69.275  33.950 39.851  1.00 20.83  ? 270  LEU A CD2  1 
ATOM   4096  H  H    . LEU A 1 270 ? 69.665  34.537 44.818  1.00 15.00  ? 270  LEU A H    1 
ATOM   4097  H  HA   . LEU A 1 270 ? 70.544  32.471 43.458  1.00 13.24  ? 270  LEU A HA   1 
ATOM   4098  H  HB2  . LEU A 1 270 ? 68.913  33.980 42.541  1.00 13.01  ? 270  LEU A HB2  1 
ATOM   4099  H  HB3  . LEU A 1 270 ? 70.079  34.967 42.181  1.00 13.01  ? 270  LEU A HB3  1 
ATOM   4100  H  HG   . LEU A 1 270 ? 71.027  33.351 40.729  1.00 12.53  ? 270  LEU A HG   1 
ATOM   4101  H  HD11 . LEU A 1 270 ? 70.226  31.390 41.697  1.00 16.80  ? 270  LEU A HD11 1 
ATOM   4102  H  HD12 . LEU A 1 270 ? 69.943  31.415 40.155  1.00 16.80  ? 270  LEU A HD12 1 
ATOM   4103  H  HD13 . LEU A 1 270 ? 68.787  31.721 41.169  1.00 16.80  ? 270  LEU A HD13 1 
ATOM   4104  H  HD21 . LEU A 1 270 ? 69.500  34.882 39.815  1.00 31.24  ? 270  LEU A HD21 1 
ATOM   4105  H  HD22 . LEU A 1 270 ? 68.337  33.853 40.032  1.00 31.24  ? 270  LEU A HD22 1 
ATOM   4106  H  HD23 . LEU A 1 270 ? 69.482  33.537 39.010  1.00 31.24  ? 270  LEU A HD23 1 
ATOM   4107  N  N    . SER A 1 271 ? 72.890  32.608 42.808  1.00 9.72   ? 271  SER A N    1 
ATOM   4108  C  CA   . SER A 1 271 ? 74.341  32.651 42.549  1.00 12.86  ? 271  SER A CA   1 
ATOM   4109  C  C    . SER A 1 271 ? 74.752  32.087 41.186  1.00 12.08  ? 271  SER A C    1 
ATOM   4110  O  O    . SER A 1 271 ? 75.800  32.452 40.607  1.00 13.19  ? 271  SER A O    1 
ATOM   4111  C  CB   . SER A 1 271 ? 74.980  31.920 43.717  1.00 12.28  ? 271  SER A CB   1 
ATOM   4112  O  OG   . SER A 1 271 ? 76.400  31.991 43.728  1.00 13.84  ? 271  SER A OG   1 
ATOM   4113  H  H    . SER A 1 271 ? 72.489  31.849 42.754  1.00 11.66  ? 271  SER A H    1 
ATOM   4114  H  HA   . SER A 1 271 ? 74.627  33.587 42.586  1.00 15.44  ? 271  SER A HA   1 
ATOM   4115  H  HB2  . SER A 1 271 ? 74.641  32.296 44.544  1.00 14.73  ? 271  SER A HB2  1 
ATOM   4116  H  HB3  . SER A 1 271 ? 74.714  30.987 43.686  1.00 14.73  ? 271  SER A HB3  1 
ATOM   4117  H  HG   . SER A 1 271 ? 76.697  31.644 43.047  1.00 20.77  ? 271  SER A HG   1 
ATOM   4118  N  N    . GLY A 1 272 ? 73.962  31.188 40.613  1.00 11.17  ? 272  GLY A N    1 
ATOM   4119  C  CA   . GLY A 1 272 ? 74.169  30.632 39.308  1.00 16.94  ? 272  GLY A CA   1 
ATOM   4120  C  C    . GLY A 1 272 ? 72.846  30.204 38.687  1.00 12.43  ? 272  GLY A C    1 
ATOM   4121  O  O    . GLY A 1 272 ? 71.971  29.741 39.405  1.00 11.42  ? 272  GLY A O    1 
ATOM   4122  H  H    . GLY A 1 272 ? 73.276  30.920 41.056  1.00 13.40  ? 272  GLY A H    1 
ATOM   4123  H  HA2  . GLY A 1 272 ? 74.596  31.291 38.739  1.00 20.32  ? 272  GLY A HA2  1 
ATOM   4124  H  HA3  . GLY A 1 272 ? 74.759  29.864 39.374  1.00 20.32  ? 272  GLY A HA3  1 
ATOM   4125  N  N    . LEU A 1 273 ? 72.775  30.381 37.383  1.00 12.30  ? 273  LEU A N    1 
ATOM   4126  C  CA   . LEU A 1 273 ? 71.554  30.083 36.624  1.00 11.41  ? 273  LEU A CA   1 
ATOM   4127  C  C    . LEU A 1 273 ? 71.909  29.367 35.319  1.00 11.26  ? 273  LEU A C    1 
ATOM   4128  O  O    . LEU A 1 273 ? 72.836  29.771 34.611  1.00 12.26  ? 273  LEU A O    1 
ATOM   4129  C  CB   . LEU A 1 273 ? 70.816  31.380 36.313  1.00 12.18  ? 273  LEU A CB   1 
ATOM   4130  C  CG   . LEU A 1 273 ? 69.505  31.289 35.542  1.00 10.01  ? 273  LEU A CG   1 
ATOM   4131  C  CD1  . LEU A 1 273 ? 68.466  30.380 36.179  1.00 10.37  ? 273  LEU A CD1  1 
ATOM   4132  C  CD2  . LEU A 1 273 ? 68.982  32.705 35.343  1.00 12.80  ? 273  LEU A CD2  1 
ATOM   4133  H  H    . LEU A 1 273 ? 73.464  30.680 36.964  1.00 14.76  ? 273  LEU A H    1 
ATOM   4134  H  HA   . LEU A 1 273 ? 70.975  29.503 37.161  1.00 13.69  ? 273  LEU A HA   1 
ATOM   4135  H  HB2  . LEU A 1 273 ? 70.635  31.827 37.155  1.00 14.62  ? 273  LEU A HB2  1 
ATOM   4136  H  HB3  . LEU A 1 273 ? 71.418  31.950 35.810  1.00 14.62  ? 273  LEU A HB3  1 
ATOM   4137  H  HG   . LEU A 1 273 ? 69.710  30.925 34.656  1.00 12.01  ? 273  LEU A HG   1 
ATOM   4138  H  HD11 . LEU A 1 273 ? 68.836  29.501 36.292  1.00 15.55  ? 273  LEU A HD11 1 
ATOM   4139  H  HD12 . LEU A 1 273 ? 67.693  30.331 35.613  1.00 15.55  ? 273  LEU A HD12 1 
ATOM   4140  H  HD13 . LEU A 1 273 ? 68.214  30.733 37.036  1.00 15.55  ? 273  LEU A HD13 1 
ATOM   4141  H  HD21 . LEU A 1 273 ? 68.153  32.675 34.860  1.00 19.21  ? 273  LEU A HD21 1 
ATOM   4142  H  HD22 . LEU A 1 273 ? 69.624  33.216 34.845  1.00 19.21  ? 273  LEU A HD22 1 
ATOM   4143  H  HD23 . LEU A 1 273 ? 68.839  33.116 36.198  1.00 19.21  ? 273  LEU A HD23 1 
ATOM   4144  N  N    . ASP A 1 274 ? 71.147  28.361 34.988  1.00 10.63  ? 274  ASP A N    1 
ATOM   4145  C  CA   . ASP A 1 274 ? 71.252  27.629 33.701  1.00 9.46   ? 274  ASP A CA   1 
ATOM   4146  C  C    . ASP A 1 274 ? 69.907  27.759 32.984  1.00 10.62  ? 274  ASP A C    1 
ATOM   4147  O  O    . ASP A 1 274 ? 68.919  27.428 33.629  1.00 8.17   ? 274  ASP A O    1 
ATOM   4148  C  CB   . ASP A 1 274 ? 71.550  26.159 33.873  1.00 8.02   ? 274  ASP A CB   1 
ATOM   4149  C  CG   . ASP A 1 274 ? 72.777  25.858 34.742  1.00 10.51  ? 274  ASP A CG   1 
ATOM   4150  O  OD1  . ASP A 1 274 ? 73.726  26.651 34.658  1.00 11.10  ? 274  ASP A OD1  1 
ATOM   4151  O  OD2  . ASP A 1 274 ? 72.700  24.818 35.412  1.00 10.43  ? 274  ASP A OD2  1 
ATOM   4152  H  H    . ASP A 1 274 ? 70.548  28.107 35.550  1.00 12.75  ? 274  ASP A H    1 
ATOM   4153  H  HA   . ASP A 1 274 ? 71.952  28.039 33.152  1.00 11.36  ? 274  ASP A HA   1 
ATOM   4154  H  HB2  . ASP A 1 274 ? 70.776  25.729 34.270  1.00 9.62   ? 274  ASP A HB2  1 
ATOM   4155  H  HB3  . ASP A 1 274 ? 71.686  25.765 32.997  1.00 9.62   ? 274  ASP A HB3  1 
ATOM   4156  N  N    . ILE A 1 275 ? 69.897  28.160 31.718  1.00 10.13  ? 275  ILE A N    1 
ATOM   4157  C  CA   . ILE A 1 275 ? 68.692  28.204 30.874  1.00 10.85  ? 275  ILE A CA   1 
ATOM   4158  C  C    . ILE A 1 275 ? 68.928  27.184 29.752  1.00 10.79  ? 275  ILE A C    1 
ATOM   4159  O  O    . ILE A 1 275 ? 69.699  27.511 28.837  1.00 11.16  ? 275  ILE A O    1 
ATOM   4160  C  CB   . ILE A 1 275 ? 68.355  29.587 30.341  1.00 10.24  ? 275  ILE A CB   1 
ATOM   4161  C  CG1  . ILE A 1 275 ? 68.217  30.645 31.445  1.00 11.87  ? 275  ILE A CG1  1 
ATOM   4162  C  CG2  . ILE A 1 275 ? 67.105  29.588 29.437  1.00 12.27  ? 275  ILE A CG2  1 
ATOM   4163  C  CD1  . ILE A 1 275 ? 67.074  30.327 32.378  1.00 14.77  ? 275  ILE A CD1  1 
ATOM   4164  H  H    . ILE A 1 275 ? 70.642  28.411 31.369  1.00 12.16  ? 275  ILE A H    1 
ATOM   4165  H  HA   . ILE A 1 275 ? 67.934  27.893 31.411  1.00 13.02  ? 275  ILE A HA   1 
ATOM   4166  H  HB   . ILE A 1 275 ? 69.109  29.864 29.779  1.00 12.29  ? 275  ILE A HB   1 
ATOM   4167  H  HG12 . ILE A 1 275 ? 69.043  30.689 31.953  1.00 14.24  ? 275  ILE A HG12 1 
ATOM   4168  H  HG13 . ILE A 1 275 ? 68.068  31.514 31.041  1.00 14.24  ? 275  ILE A HG13 1 
ATOM   4169  H  HG21 . ILE A 1 275 ? 66.936  30.480 29.126  1.00 18.40  ? 275  ILE A HG21 1 
ATOM   4170  H  HG22 . ILE A 1 275 ? 66.348  29.275 29.938  1.00 18.40  ? 275  ILE A HG22 1 
ATOM   4171  H  HG23 . ILE A 1 275 ? 67.253  29.010 28.685  1.00 18.40  ? 275  ILE A HG23 1 
ATOM   4172  H  HD11 . ILE A 1 275 ? 67.015  31.005 33.056  1.00 22.15  ? 275  ILE A HD11 1 
ATOM   4173  H  HD12 . ILE A 1 275 ? 67.227  29.474 32.792  1.00 22.15  ? 275  ILE A HD12 1 
ATOM   4174  H  HD13 . ILE A 1 275 ? 66.253  30.299 31.881  1.00 22.15  ? 275  ILE A HD13 1 
ATOM   4175  N  N    . MET A 1 276 ? 68.359  26.002 29.864  1.00 9.86   ? 276  MET A N    1 
ATOM   4176  C  CA   . MET A 1 276 ? 68.777  24.874 29.038  1.00 8.60   ? 276  MET A CA   1 
ATOM   4177  C  C    . MET A 1 276 ? 67.661  24.297 28.202  1.00 10.79  ? 276  MET A C    1 
ATOM   4178  O  O    . MET A 1 276 ? 66.465  24.371 28.490  1.00 9.15   ? 276  MET A O    1 
ATOM   4179  C  CB   . MET A 1 276 ? 69.325  23.799 29.996  1.00 9.35   ? 276  MET A CB   1 
ATOM   4180  C  CG   . MET A 1 276 ? 70.238  24.441 31.027  1.00 9.47   ? 276  MET A CG   1 
ATOM   4181  S  SD   . MET A 1 276 ? 71.616  25.352 30.311  1.00 18.44  ? 276  MET A SD   1 
ATOM   4182  C  CE   . MET A 1 276 ? 72.429  23.888 29.703  1.00 13.01  ? 276  MET A CE   1 
ATOM   4183  H  H    . MET A 1 276 ? 67.727  25.892 30.436  1.00 11.83  ? 276  MET A H    1 
ATOM   4184  H  HA   . MET A 1 276 ? 69.500  25.166 28.443  1.00 10.33  ? 276  MET A HA   1 
ATOM   4185  H  HB2  . MET A 1 276 ? 68.588  23.354 30.444  1.00 11.23  ? 276  MET A HB2  1 
ATOM   4186  H  HB3  . MET A 1 276 ? 69.818  23.133 29.492  1.00 11.23  ? 276  MET A HB3  1 
ATOM   4187  H  HG2  . MET A 1 276 ? 69.714  25.046 31.575  1.00 11.36  ? 276  MET A HG2  1 
ATOM   4188  H  HG3  . MET A 1 276 ? 70.589  23.748 31.608  1.00 11.36  ? 276  MET A HG3  1 
ATOM   4189  H  HE1  . MET A 1 276 ? 73.241  24.135 29.255  1.00 19.51  ? 276  MET A HE1  1 
ATOM   4190  H  HE2  . MET A 1 276 ? 71.849  23.432 29.088  1.00 19.51  ? 276  MET A HE2  1 
ATOM   4191  H  HE3  . MET A 1 276 ? 72.634  23.307 30.440  1.00 19.51  ? 276  MET A HE3  1 
ATOM   4192  N  N    . GLU A 1 277 ? 68.105  23.666 27.103  1.00 8.68   ? 277  GLU A N    1 
ATOM   4193  C  CA   . GLU A 1 277 ? 67.306  22.838 26.196  1.00 10.22  ? 277  GLU A CA   1 
ATOM   4194  C  C    . GLU A 1 277 ? 66.403  23.640 25.262  1.00 7.40   ? 277  GLU A C    1 
ATOM   4195  O  O    . GLU A 1 277 ? 65.460  23.030 24.664  1.00 9.72   ? 277  GLU A O    1 
ATOM   4196  C  CB   . GLU A 1 277 ? 66.544  21.739 26.972  1.00 10.68  ? 277  GLU A CB   1 
ATOM   4197  C  CG   . GLU A 1 277 ? 67.480  20.714 27.621  1.00 11.64  ? 277  GLU A CG   1 
ATOM   4198  C  CD   . GLU A 1 277 ? 68.140  19.680 26.750  1.00 13.79  ? 277  GLU A CD   1 
ATOM   4199  O  OE1  . GLU A 1 277 ? 67.957  19.655 25.502  1.00 12.54  ? 277  GLU A OE1  1 
ATOM   4200  O  OE2  . GLU A 1 277 ? 68.939  18.814 27.251  1.00 10.65  ? 277  GLU A OE2  1 
ATOM   4201  H  H    . GLU A 1 277 ? 68.939  23.757 26.913  1.00 10.42  ? 277  GLU A H    1 
ATOM   4202  H  HA   . GLU A 1 277 ? 67.946  22.370 25.620  1.00 12.26  ? 277  GLU A HA   1 
ATOM   4203  H  HB2  . GLU A 1 277 ? 66.004  22.156 27.661  1.00 12.82  ? 277  GLU A HB2  1 
ATOM   4204  H  HB3  . GLU A 1 277 ? 65.945  21.280 26.363  1.00 12.82  ? 277  GLU A HB3  1 
ATOM   4205  H  HG2  . GLU A 1 277 ? 68.181  21.205 28.077  1.00 13.97  ? 277  GLU A HG2  1 
ATOM   4206  H  HG3  . GLU A 1 277 ? 66.973  20.244 28.302  1.00 13.97  ? 277  GLU A HG3  1 
ATOM   4207  N  N    . VAL A 1 278 ? 66.640  24.920 25.059  1.00 8.02   ? 278  VAL A N    1 
ATOM   4208  C  CA   . VAL A 1 278 ? 65.946  25.633 23.975  1.00 8.03   ? 278  VAL A CA   1 
ATOM   4209  C  C    . VAL A 1 278 ? 66.457  25.180 22.584  1.00 11.14  ? 278  VAL A C    1 
ATOM   4210  O  O    . VAL A 1 278 ? 67.667  25.317 22.380  1.00 10.26  ? 278  VAL A O    1 
ATOM   4211  C  CB   . VAL A 1 278 ? 66.047  27.153 24.135  1.00 7.57   ? 278  VAL A CB   1 
ATOM   4212  C  CG1  . VAL A 1 278 ? 65.455  27.882 22.951  1.00 14.21  ? 278  VAL A CG1  1 
ATOM   4213  C  CG2  . VAL A 1 278 ? 65.400  27.603 25.440  1.00 10.35  ? 278  VAL A CG2  1 
ATOM   4214  H  H    . VAL A 1 278 ? 67.199  25.339 25.560  1.00 9.63   ? 278  VAL A H    1 
ATOM   4215  H  HA   . VAL A 1 278 ? 64.997  25.396 24.029  1.00 9.64   ? 278  VAL A HA   1 
ATOM   4216  H  HB   . VAL A 1 278 ? 66.999  27.383 24.181  1.00 9.08   ? 278  VAL A HB   1 
ATOM   4217  H  HG11 . VAL A 1 278 ? 65.882  27.584 22.145  1.00 21.31  ? 278  VAL A HG11 1 
ATOM   4218  H  HG12 . VAL A 1 278 ? 65.593  28.827 23.055  1.00 21.31  ? 278  VAL A HG12 1 
ATOM   4219  H  HG13 . VAL A 1 278 ? 64.514  27.700 22.901  1.00 21.31  ? 278  VAL A HG13 1 
ATOM   4220  H  HG21 . VAL A 1 278 ? 65.789  27.120 26.173  1.00 15.52  ? 278  VAL A HG21 1 
ATOM   4221  H  HG22 . VAL A 1 278 ? 64.457  27.430 25.406  1.00 15.52  ? 278  VAL A HG22 1 
ATOM   4222  H  HG23 . VAL A 1 278 ? 65.549  28.544 25.562  1.00 15.52  ? 278  VAL A HG23 1 
ATOM   4223  N  N    . ASN A 1 279 ? 65.536  24.655 21.764  1.00 9.98   ? 279  ASN A N    1 
ATOM   4224  C  CA   . ASN A 1 279 ? 65.917  24.169 20.426  1.00 11.54  ? 279  ASN A CA   1 
ATOM   4225  C  C    . ASN A 1 279 ? 64.971  24.732 19.384  1.00 8.19   ? 279  ASN A C    1 
ATOM   4226  O  O    . ASN A 1 279 ? 63.951  24.119 19.041  1.00 9.73   ? 279  ASN A O    1 
ATOM   4227  C  CB   . ASN A 1 279 ? 65.967  22.629 20.405  1.00 12.17  ? 279  ASN A CB   1 
ATOM   4228  C  CG   . ASN A 1 279 ? 66.589  22.086 19.095  1.00 12.37  ? 279  ASN A CG   1 
ATOM   4229  O  OD1  . ASN A 1 279 ? 66.668  22.916 18.162  1.00 13.04  ? 279  ASN A OD1  1 
ATOM   4230  N  ND2  . ASN A 1 279 ? 67.010  20.840 19.065  1.00 10.47  ? 279  ASN A ND2  1 
ATOM   4231  H  H    . ASN A 1 279 ? 64.717  24.602 22.020  1.00 11.98  ? 279  ASN A H    1 
ATOM   4232  H  HA   . ASN A 1 279 ? 66.817  24.503 20.228  1.00 13.85  ? 279  ASN A HA   1 
ATOM   4233  H  HB2  . ASN A 1 279 ? 66.490  22.316 21.160  1.00 14.61  ? 279  ASN A HB2  1 
ATOM   4234  H  HB3  . ASN A 1 279 ? 65.067  22.279 20.500  1.00 14.61  ? 279  ASN A HB3  1 
ATOM   4235  H  HD21 . ASN A 1 279 ? 67.380  20.528 18.354  1.00 12.57  ? 279  ASN A HD21 1 
ATOM   4236  H  HD22 . ASN A 1 279 ? 66.914  20.337 19.755  1.00 12.57  ? 279  ASN A HD22 1 
ATOM   4237  N  N    . PRO A 1 280 ? 65.350  25.871 18.816  1.00 11.28  ? 280  PRO A N    1 
ATOM   4238  C  CA   . PRO A 1 280 ? 64.422  26.508 17.855  1.00 13.45  ? 280  PRO A CA   1 
ATOM   4239  C  C    . PRO A 1 280 ? 64.066  25.649 16.646  1.00 15.14  ? 280  PRO A C    1 
ATOM   4240  O  O    . PRO A 1 280 ? 62.929  25.741 16.167  1.00 15.93  ? 280  PRO A O    1 
ATOM   4241  C  CB   . PRO A 1 280 ? 65.228  27.747 17.464  1.00 15.94  ? 280  PRO A CB   1 
ATOM   4242  C  CG   . PRO A 1 280 ? 66.028  28.053 18.698  1.00 15.90  ? 280  PRO A CG   1 
ATOM   4243  C  CD   . PRO A 1 280 ? 66.530  26.663 19.078  1.00 14.03  ? 280  PRO A CD   1 
ATOM   4244  H  HA   . PRO A 1 280 ? 63.602  26.780 18.319  1.00 16.14  ? 280  PRO A HA   1 
ATOM   4245  H  HB2  . PRO A 1 280 ? 65.810  27.561 16.710  1.00 19.13  ? 280  PRO A HB2  1 
ATOM   4246  H  HB3  . PRO A 1 280 ? 64.643  28.486 17.237  1.00 19.13  ? 280  PRO A HB3  1 
ATOM   4247  H  HG2  . PRO A 1 280 ? 66.762  28.657 18.506  1.00 19.08  ? 280  PRO A HG2  1 
ATOM   4248  H  HG3  . PRO A 1 280 ? 65.472  28.434 19.396  1.00 19.08  ? 280  PRO A HG3  1 
ATOM   4249  H  HD2  . PRO A 1 280 ? 67.276  26.388 18.523  1.00 16.84  ? 280  PRO A HD2  1 
ATOM   4250  H  HD3  . PRO A 1 280 ? 66.790  26.620 20.012  1.00 16.84  ? 280  PRO A HD3  1 
ATOM   4251  N  N    . SER A 1 281 ? 65.015  24.815 16.150  1.00 12.24  ? 281  SER A N    1 
ATOM   4252  C  CA   . SER A 1 281 ? 64.677  23.980 14.995  1.00 13.75  ? 281  SER A CA   1 
ATOM   4253  C  C    . SER A 1 281 ? 63.555  23.003 15.196  1.00 14.44  ? 281  SER A C    1 
ATOM   4254  O  O    . SER A 1 281 ? 62.983  22.366 14.274  1.00 16.24  ? 281  SER A O    1 
ATOM   4255  C  CB   . SER A 1 281 ? 65.906  23.195 14.573  1.00 12.35  ? 281  SER A CB   1 
ATOM   4256  O  OG   . SER A 1 281 ? 66.256  22.260 15.582  1.00 14.81  ? 281  SER A OG   1 
ATOM   4257  H  H    . SER A 1 281 ? 65.797  24.777 16.505  1.00 14.68  ? 281  SER A H    1 
ATOM   4258  H  HA   . SER A 1 281 ? 64.430  24.574 14.256  1.00 16.50  ? 281  SER A HA   1 
ATOM   4259  H  HB2  . SER A 1 281 ? 65.725  22.727 13.743  1.00 14.82  ? 281  SER A HB2  1 
ATOM   4260  H  HB3  . SER A 1 281 ? 66.646  23.803 14.421  1.00 14.82  ? 281  SER A HB3  1 
ATOM   4261  H  HG   . SER A 1 281 ? 66.412  22.658 16.282  1.00 22.22  ? 281  SER A HG   1 
ATOM   4262  N  N    . LEU A 1 282 ? 63.120  22.724 16.426  1.00 14.48  ? 282  LEU A N    1 
ATOM   4263  C  CA   . LEU A 1 282 ? 62.056  21.834 16.751  1.00 17.34  ? 282  LEU A CA   1 
ATOM   4264  C  C    . LEU A 1 282 ? 60.720  22.557 16.861  1.00 14.62  ? 282  LEU A C    1 
ATOM   4265  O  O    . LEU A 1 282 ? 59.680  21.922 17.076  1.00 18.51  ? 282  LEU A O    1 
ATOM   4266  C  CB   . LEU A 1 282 ? 62.336  21.132 18.081  1.00 11.98  ? 282  LEU A CB   1 
ATOM   4267  C  CG   . LEU A 1 282 ? 63.655  20.331 18.125  1.00 20.10  ? 282  LEU A CG   1 
ATOM   4268  C  CD1  . LEU A 1 282 ? 63.876  19.684 19.484  1.00 14.82  ? 282  LEU A CD1  1 
ATOM   4269  C  CD2  . LEU A 1 282 ? 63.686  19.266 17.042  1.00 26.12  ? 282  LEU A CD2  1 
ATOM   4270  H  H    . LEU A 1 282 ? 63.517  23.115 17.080  1.00 17.37  ? 282  LEU A H    1 
ATOM   4271  H  HA   . LEU A 1 282 ? 61.988  21.156 16.047  1.00 20.80  ? 282  LEU A HA   1 
ATOM   4272  H  HB2  . LEU A 1 282 ? 62.356  21.799 18.784  1.00 14.38  ? 282  LEU A HB2  1 
ATOM   4273  H  HB3  . LEU A 1 282 ? 61.602  20.528 18.272  1.00 14.38  ? 282  LEU A HB3  1 
ATOM   4274  H  HG   . LEU A 1 282 ? 64.394  20.954 17.961  1.00 24.11  ? 282  LEU A HG   1 
ATOM   4275  H  HD11 . LEU A 1 282 ? 63.870  20.360 20.165  1.00 22.23  ? 282  LEU A HD11 1 
ATOM   4276  H  HD12 . LEU A 1 282 ? 64.724  19.233 19.489  1.00 22.23  ? 282  LEU A HD12 1 
ATOM   4277  H  HD13 . LEU A 1 282 ? 63.175  19.051 19.655  1.00 22.23  ? 282  LEU A HD13 1 
ATOM   4278  H  HD21 . LEU A 1 282 ? 63.533  19.675 16.187  1.00 39.18  ? 282  LEU A HD21 1 
ATOM   4279  H  HD22 . LEU A 1 282 ? 63.001  18.616 17.213  1.00 39.18  ? 282  LEU A HD22 1 
ATOM   4280  H  HD23 . LEU A 1 282 ? 64.544  18.835 17.041  1.00 39.18  ? 282  LEU A HD23 1 
ATOM   4281  N  N    . GLY A 1 283 ? 60.664  23.878 16.714  1.00 13.87  ? 283  GLY A N    1 
ATOM   4282  C  CA   . GLY A 1 283 ? 59.278  24.394 16.691  1.00 16.74  ? 283  GLY A CA   1 
ATOM   4283  C  C    . GLY A 1 283 ? 58.648  24.037 15.347  1.00 19.42  ? 283  GLY A C    1 
ATOM   4284  O  O    . GLY A 1 283 ? 59.353  23.987 14.339  1.00 20.71  ? 283  GLY A O    1 
ATOM   4285  H  H    . GLY A 1 283 ? 61.360  24.378 16.639  1.00 16.65  ? 283  GLY A H    1 
ATOM   4286  H  HA2  . GLY A 1 283 ? 58.765  23.998 17.412  1.00 20.09  ? 283  GLY A HA2  1 
ATOM   4287  H  HA3  . GLY A 1 283 ? 59.281  25.356 16.810  1.00 20.09  ? 283  GLY A HA3  1 
ATOM   4288  N  N    . LYS A 1 284 ? 57.357  23.767 15.327  1.00 19.61  ? 284  LYS A N    1 
ATOM   4289  C  CA   . LYS A 1 284 ? 56.656  23.312 14.136  1.00 21.48  ? 284  LYS A CA   1 
ATOM   4290  C  C    . LYS A 1 284 ? 56.222  24.517 13.314  1.00 26.17  ? 284  LYS A C    1 
ATOM   4291  O  O    . LYS A 1 284 ? 55.764  24.391 12.175  1.00 23.17  ? 284  LYS A O    1 
ATOM   4292  C  CB   . LYS A 1 284 ? 55.433  22.476 14.511  1.00 21.03  ? 284  LYS A CB   1 
ATOM   4293  C  CG   . LYS A 1 284 ? 55.747  21.215 15.287  1.00 30.98  ? 284  LYS A CG   1 
ATOM   4294  C  CD   . LYS A 1 284 ? 54.637  20.893 16.291  1.00 39.32  ? 284  LYS A CD   1 
ATOM   4295  C  CE   . LYS A 1 284 ? 55.027  19.680 17.135  1.00 30.20  ? 284  LYS A CE   1 
ATOM   4296  N  NZ   . LYS A 1 284 ? 53.923  19.203 18.008  1.00 38.99  ? 284  LYS A NZ   1 
ATOM   4297  H  H    . LYS A 1 284 ? 56.907  23.864 16.053  1.00 23.53  ? 284  LYS A H    1 
ATOM   4298  H  HA   . LYS A 1 284 ? 57.264  22.762 13.599  1.00 25.78  ? 284  LYS A HA   1 
ATOM   4299  H  HB2  . LYS A 1 284 ? 54.834  23.025 15.041  1.00 25.24  ? 284  LYS A HB2  1 
ATOM   4300  H  HB3  . LYS A 1 284 ? 54.964  22.231 13.698  1.00 25.24  ? 284  LYS A HB3  1 
ATOM   4301  H  HG2  . LYS A 1 284 ? 55.849  20.474 14.670  1.00 37.18  ? 284  LYS A HG2  1 
ATOM   4302  H  HG3  . LYS A 1 284 ? 56.587  21.328 15.760  1.00 37.18  ? 284  LYS A HG3  1 
ATOM   4303  H  HD2  . LYS A 1 284 ? 54.488  21.658 16.868  1.00 47.18  ? 284  LYS A HD2  1 
ATOM   4304  H  HD3  . LYS A 1 284 ? 53.812  20.708 15.816  1.00 47.18  ? 284  LYS A HD3  1 
ATOM   4305  H  HE2  . LYS A 1 284 ? 55.297  18.959 16.545  1.00 36.24  ? 284  LYS A HE2  1 
ATOM   4306  H  HE3  . LYS A 1 284 ? 55.789  19.913 17.688  1.00 36.24  ? 284  LYS A HE3  1 
ATOM   4307  H  HZ1  . LYS A 1 284 ? 54.204  18.508 18.488  1.00 58.48  ? 284  LYS A HZ1  1 
ATOM   4308  H  HZ2  . LYS A 1 284 ? 53.232  18.956 17.505  1.00 58.48  ? 284  LYS A HZ2  1 
ATOM   4309  H  HZ3  . LYS A 1 284 ? 53.672  19.859 18.555  1.00 58.48  ? 284  LYS A HZ3  1 
ATOM   4310  N  N    . THR A 1 285 ? 56.296  25.709 13.900  1.00 23.15  ? 285  THR A N    1 
ATOM   4311  C  CA   . THR A 1 285 ? 56.018  26.961 13.198  1.00 22.20  ? 285  THR A CA   1 
ATOM   4312  C  C    . THR A 1 285 ? 56.904  28.071 13.752  1.00 23.90  ? 285  THR A C    1 
ATOM   4313  O  O    . THR A 1 285 ? 57.506  27.956 14.837  1.00 18.54  ? 285  THR A O    1 
ATOM   4314  C  CB   . THR A 1 285 ? 54.551  27.393 13.243  1.00 24.03  ? 285  THR A CB   1 
ATOM   4315  O  OG1  . THR A 1 285 ? 54.259  27.924 14.553  1.00 46.28  ? 285  THR A OG1  1 
ATOM   4316  C  CG2  . THR A 1 285 ? 53.496  26.306 13.045  1.00 22.69  ? 285  THR A CG2  1 
ATOM   4317  H  H    . THR A 1 285 ? 56.516  25.744 14.731  1.00 27.78  ? 285  THR A H    1 
ATOM   4318  H  HA   . THR A 1 285 ? 56.260  26.832 12.257  1.00 26.65  ? 285  THR A HA   1 
ATOM   4319  H  HB   . THR A 1 285 ? 54.408  28.098 12.577  1.00 28.83  ? 285  THR A HB   1 
ATOM   4320  H  HG1  . THR A 1 285 ? 54.792  28.521 14.731  1.00 69.43  ? 285  THR A HG1  1 
ATOM   4321  H  HG21 . THR A 1 285 ? 52.621  26.698 13.088  1.00 34.04  ? 285  THR A HG21 1 
ATOM   4322  H  HG22 . THR A 1 285 ? 53.585  25.645 13.735  1.00 34.04  ? 285  THR A HG22 1 
ATOM   4323  H  HG23 . THR A 1 285 ? 53.620  25.892 12.188  1.00 34.04  ? 285  THR A HG23 1 
ATOM   4324  N  N    . PRO A 1 286 ? 57.082  29.191 13.077  1.00 16.19  ? 286  PRO A N    1 
ATOM   4325  C  CA   . PRO A 1 286 ? 57.909  30.276 13.615  1.00 17.47  ? 286  PRO A CA   1 
ATOM   4326  C  C    . PRO A 1 286 ? 57.316  30.834 14.908  1.00 19.29  ? 286  PRO A C    1 
ATOM   4327  O  O    . PRO A 1 286 ? 58.092  31.325 15.736  1.00 22.43  ? 286  PRO A O    1 
ATOM   4328  C  CB   . PRO A 1 286 ? 57.905  31.324 12.496  1.00 29.44  ? 286  PRO A CB   1 
ATOM   4329  C  CG   . PRO A 1 286 ? 57.588  30.509 11.266  1.00 24.26  ? 286  PRO A CG   1 
ATOM   4330  C  CD   . PRO A 1 286 ? 56.531  29.564 11.756  1.00 18.81  ? 286  PRO A CD   1 
ATOM   4331  H  HA   . PRO A 1 286 ? 58.821  29.956 13.774  1.00 20.96  ? 286  PRO A HA   1 
ATOM   4332  H  HB2  . PRO A 1 286 ? 57.227  32.000 12.652  1.00 35.33  ? 286  PRO A HB2  1 
ATOM   4333  H  HB3  . PRO A 1 286 ? 58.770  31.754 12.417  1.00 35.33  ? 286  PRO A HB3  1 
ATOM   4334  H  HG2  . PRO A 1 286 ? 57.252  31.071 10.551  1.00 29.12  ? 286  PRO A HG2  1 
ATOM   4335  H  HG3  . PRO A 1 286 ? 58.370  30.029 10.953  1.00 29.12  ? 286  PRO A HG3  1 
ATOM   4336  H  HD2  . PRO A 1 286 ? 55.670  30.003 11.839  1.00 22.57  ? 286  PRO A HD2  1 
ATOM   4337  H  HD3  . PRO A 1 286 ? 56.444  28.792 11.174  1.00 22.57  ? 286  PRO A HD3  1 
ATOM   4338  N  N    . GLU A 1 287 ? 56.017  30.788 15.129  1.00 18.59  ? 287  GLU A N    1 
ATOM   4339  C  CA   . GLU A 1 287 ? 55.414  31.233 16.364  1.00 14.99  ? 287  GLU A CA   1 
ATOM   4340  C  C    . GLU A 1 287 ? 55.766  30.274 17.515  1.00 14.02  ? 287  GLU A C    1 
ATOM   4341  O  O    . GLU A 1 287 ? 55.792  30.853 18.622  1.00 14.67  ? 287  GLU A O    1 
ATOM   4342  C  CB   . GLU A 1 287 ? 53.903  31.388 16.276  1.00 19.18  ? 287  GLU A CB   1 
ATOM   4343  C  CG   . GLU A 1 287 ? 53.225  31.938 17.510  1.00 17.20  ? 287  GLU A CG   1 
ATOM   4344  C  CD   . GLU A 1 287 ? 52.801  30.982 18.611  1.00 23.16  ? 287  GLU A CD   1 
ATOM   4345  O  OE1  . GLU A 1 287 ? 52.727  29.779 18.275  1.00 19.19  ? 287  GLU A OE1  1 
ATOM   4346  O  OE2  . GLU A 1 287 ? 52.655  31.362 19.789  1.00 22.59  ? 287  GLU A OE2  1 
ATOM   4347  H  H    . GLU A 1 287 ? 55.506  30.478 14.511  1.00 22.31  ? 287  GLU A H    1 
ATOM   4348  H  HA   . GLU A 1 287 ? 55.792  32.111 16.580  1.00 17.99  ? 287  GLU A HA   1 
ATOM   4349  H  HB2  . GLU A 1 287 ? 53.698  31.972 15.530  1.00 23.02  ? 287  GLU A HB2  1 
ATOM   4350  H  HB3  . GLU A 1 287 ? 53.518  30.519 16.079  1.00 23.02  ? 287  GLU A HB3  1 
ATOM   4351  H  HG2  . GLU A 1 287 ? 53.824  32.591 17.905  1.00 20.64  ? 287  GLU A HG2  1 
ATOM   4352  H  HG3  . GLU A 1 287 ? 52.435  32.419 17.219  1.00 20.64  ? 287  GLU A HG3  1 
ATOM   4353  N  N    . GLU A 1 288 ? 55.877  28.981 17.359  1.00 12.86  ? 288  GLU A N    1 
ATOM   4354  C  CA   . GLU A 1 288 ? 56.286  28.067 18.414  1.00 12.28  ? 288  GLU A CA   1 
ATOM   4355  C  C    . GLU A 1 288 ? 57.695  28.467 18.854  1.00 13.92  ? 288  GLU A C    1 
ATOM   4356  O  O    . GLU A 1 288 ? 58.081  28.441 20.053  1.00 13.74  ? 288  GLU A O    1 
ATOM   4357  C  CB   . GLU A 1 288 ? 56.256  26.613 17.941  1.00 15.21  ? 288  GLU A CB   1 
ATOM   4358  C  CG   . GLU A 1 288 ? 54.894  25.978 17.857  1.00 12.34  ? 288  GLU A CG   1 
ATOM   4359  C  CD   . GLU A 1 288 ? 54.867  24.474 17.836  1.00 17.69  ? 288  GLU A CD   1 
ATOM   4360  O  OE1  . GLU A 1 288 ? 55.903  23.762 17.805  1.00 21.76  ? 288  GLU A OE1  1 
ATOM   4361  O  OE2  . GLU A 1 288 ? 53.724  23.947 17.874  1.00 26.86  ? 288  GLU A OE2  1 
ATOM   4362  H  H    . GLU A 1 288 ? 55.696  28.651 16.585  1.00 15.44  ? 288  GLU A H    1 
ATOM   4363  H  HA   . GLU A 1 288 ? 55.676  28.166 19.174  1.00 14.74  ? 288  GLU A HA   1 
ATOM   4364  H  HB2  . GLU A 1 288 ? 56.668  26.569 17.064  1.00 18.25  ? 288  GLU A HB2  1 
ATOM   4365  H  HB3  . GLU A 1 288 ? 56.802  26.085 18.544  1.00 18.25  ? 288  GLU A HB3  1 
ATOM   4366  H  HG2  . GLU A 1 288 ? 54.370  26.281 18.615  1.00 14.81  ? 288  GLU A HG2  1 
ATOM   4367  H  HG3  . GLU A 1 288 ? 54.457  26.302 17.054  1.00 14.81  ? 288  GLU A HG3  1 
ATOM   4368  N  N    . VAL A 1 289 ? 58.573  28.839 17.935  1.00 14.06  ? 289  VAL A N    1 
ATOM   4369  C  CA   . VAL A 1 289 ? 59.881  29.345 18.282  1.00 10.56  ? 289  VAL A CA   1 
ATOM   4370  C  C    . VAL A 1 289 ? 59.819  30.615 19.132  1.00 13.54  ? 289  VAL A C    1 
ATOM   4371  O  O    . VAL A 1 289 ? 60.405  30.709 20.234  1.00 12.53  ? 289  VAL A O    1 
ATOM   4372  C  CB   . VAL A 1 289 ? 60.784  29.603 17.056  1.00 14.35  ? 289  VAL A CB   1 
ATOM   4373  C  CG1  . VAL A 1 289 ? 62.167  30.055 17.492  1.00 15.26  ? 289  VAL A CG1  1 
ATOM   4374  C  CG2  . VAL A 1 289 ? 60.898  28.373 16.172  1.00 14.17  ? 289  VAL A CG2  1 
ATOM   4375  H  H    . VAL A 1 289 ? 58.357  28.778 17.105  1.00 16.88  ? 289  VAL A H    1 
ATOM   4376  H  HA   . VAL A 1 289 ? 60.322  28.657 18.824  1.00 12.67  ? 289  VAL A HA   1 
ATOM   4377  H  HB   . VAL A 1 289 ? 60.381  30.323 16.527  1.00 17.22  ? 289  VAL A HB   1 
ATOM   4378  H  HG11 . VAL A 1 289 ? 62.088  30.828 18.055  1.00 22.89  ? 289  VAL A HG11 1 
ATOM   4379  H  HG12 . VAL A 1 289 ? 62.691  30.274 16.718  1.00 22.89  ? 289  VAL A HG12 1 
ATOM   4380  H  HG13 . VAL A 1 289 ? 62.596  29.347 17.978  1.00 22.89  ? 289  VAL A HG13 1 
ATOM   4381  H  HG21 . VAL A 1 289 ? 60.022  28.102 15.886  1.00 21.26  ? 289  VAL A HG21 1 
ATOM   4382  H  HG22 . VAL A 1 289 ? 61.307  27.659 16.667  1.00 21.26  ? 289  VAL A HG22 1 
ATOM   4383  H  HG23 . VAL A 1 289 ? 61.435  28.579 15.404  1.00 21.26  ? 289  VAL A HG23 1 
ATOM   4384  N  N    . THR A 1 290 ? 59.138  31.665 18.670  1.00 11.93  ? 290  THR A N    1 
ATOM   4385  C  CA   . THR A 1 290 ? 59.044  32.915 19.409  1.00 18.69  ? 290  THR A CA   1 
ATOM   4386  C  C    . THR A 1 290 ? 58.456  32.641 20.793  1.00 14.70  ? 290  THR A C    1 
ATOM   4387  O  O    . THR A 1 290 ? 58.921  33.225 21.760  1.00 14.50  ? 290  THR A O    1 
ATOM   4388  C  CB   . THR A 1 290 ? 58.230  34.014 18.685  1.00 20.84  ? 290  THR A CB   1 
ATOM   4389  O  OG1  . THR A 1 290 ? 56.848  33.675 18.574  1.00 27.00  ? 290  THR A OG1  1 
ATOM   4390  C  CG2  . THR A 1 290 ? 58.678  34.178 17.230  1.00 21.04  ? 290  THR A CG2  1 
ATOM   4391  H  H    . THR A 1 290 ? 58.742  31.601 17.910  1.00 14.32  ? 290  THR A H    1 
ATOM   4392  H  HA   . THR A 1 290 ? 59.954  33.254 19.536  1.00 22.43  ? 290  THR A HA   1 
ATOM   4393  H  HB   . THR A 1 290 ? 58.326  34.866 19.160  1.00 25.01  ? 290  THR A HB   1 
ATOM   4394  H  HG1  . THR A 1 290 ? 56.537  33.547 19.322  1.00 40.50  ? 290  THR A HG1  1 
ATOM   4395  H  HG21 . THR A 1 290 ? 58.146  34.855 16.806  1.00 31.56  ? 290  THR A HG21 1 
ATOM   4396  H  HG22 . THR A 1 290 ? 58.567  33.346 16.766  1.00 31.56  ? 290  THR A HG22 1 
ATOM   4397  H  HG23 . THR A 1 290 ? 59.602  34.437 17.207  1.00 31.56  ? 290  THR A HG23 1 
ATOM   4398  N  N    . ARG A 1 291 ? 57.467  31.774 20.888  1.00 11.35  ? 291  ARG A N    1 
ATOM   4399  C  CA   . ARG A 1 291 ? 56.776  31.425 22.114  1.00 17.14  ? 291  ARG A CA   1 
ATOM   4400  C  C    . ARG A 1 291 ? 57.777  30.903 23.133  1.00 12.28  ? 291  ARG A C    1 
ATOM   4401  O  O    . ARG A 1 291 ? 57.796  31.350 24.310  1.00 11.69  ? 291  ARG A O    1 
ATOM   4402  C  CB   . ARG A 1 291 ? 55.662  30.379 21.840  1.00 14.25  ? 291  ARG A CB   1 
ATOM   4403  C  CG   . ARG A 1 291 ? 54.824  30.240 23.090  1.00 20.30  ? 291  ARG A CG   1 
ATOM   4404  C  CD   . ARG A 1 291 ? 53.612  29.366 23.016  1.00 16.74  ? 291  ARG A CD   1 
ATOM   4405  N  NE   . ARG A 1 291 ? 53.085  29.084 21.679  1.00 14.97  ? 291  ARG A NE   1 
ATOM   4406  C  CZ   . ARG A 1 291 ? 52.539  27.940 21.305  1.00 15.83  ? 291  ARG A CZ   1 
ATOM   4407  N  NH1  . ARG A 1 291 ? 52.378  26.881 22.073  1.00 19.91  ? 291  ARG A NH1  1 
ATOM   4408  N  NH2  . ARG A 1 291 ? 52.088  27.770 20.044  1.00 18.31  ? 291  ARG A NH2  1 
ATOM   4409  H  H    . ARG A 1 291 ? 57.212  31.385 20.165  1.00 13.62  ? 291  ARG A H    1 
ATOM   4410  H  HA   . ARG A 1 291 ? 56.359  32.235 22.476  1.00 20.57  ? 291  ARG A HA   1 
ATOM   4411  H  HB2  . ARG A 1 291 ? 55.108  30.670 21.099  1.00 17.10  ? 291  ARG A HB2  1 
ATOM   4412  H  HB3  . ARG A 1 291 ? 56.059  29.524 21.609  1.00 17.10  ? 291  ARG A HB3  1 
ATOM   4413  H  HG2  . ARG A 1 291 ? 55.395  29.899 23.796  1.00 24.36  ? 291  ARG A HG2  1 
ATOM   4414  H  HG3  . ARG A 1 291 ? 54.536  31.127 23.357  1.00 24.36  ? 291  ARG A HG3  1 
ATOM   4415  H  HD2  . ARG A 1 291 ? 53.823  28.521 23.442  1.00 20.09  ? 291  ARG A HD2  1 
ATOM   4416  H  HD3  . ARG A 1 291 ? 52.907  29.784 23.536  1.00 20.09  ? 291  ARG A HD3  1 
ATOM   4417  H  HE   . ARG A 1 291 ? 53.135  29.710 21.092  1.00 17.96  ? 291  ARG A HE   1 
ATOM   4418  H  HH11 . ARG A 1 291 ? 52.638  26.900 22.892  1.00 23.90  ? 291  ARG A HH11 1 
ATOM   4419  H  HH12 . ARG A 1 291 ? 52.012  26.171 21.754  1.00 23.90  ? 291  ARG A HH12 1 
ATOM   4420  H  HH21 . ARG A 1 291 ? 51.736  27.021 19.811  1.00 21.97  ? 291  ARG A HH21 1 
ATOM   4421  H  HH22 . ARG A 1 291 ? 52.153  28.411 19.474  1.00 21.97  ? 291  ARG A HH22 1 
ATOM   4422  N  N    . THR A 1 292 ? 58.587  29.970 22.694  1.00 11.32  ? 292  THR A N    1 
ATOM   4423  C  CA   . THR A 1 292 ? 59.571  29.295 23.504  1.00 8.43   ? 292  THR A CA   1 
ATOM   4424  C  C    . THR A 1 292 ? 60.637  30.268 23.950  1.00 9.22   ? 292  THR A C    1 
ATOM   4425  O  O    . THR A 1 292 ? 60.979  30.380 25.152  1.00 12.17  ? 292  THR A O    1 
ATOM   4426  C  CB   . THR A 1 292 ? 60.183  28.101 22.758  1.00 9.88   ? 292  THR A CB   1 
ATOM   4427  O  OG1  . THR A 1 292 ? 59.125  27.207 22.381  1.00 12.22  ? 292  THR A OG1  1 
ATOM   4428  C  CG2  . THR A 1 292 ? 61.141  27.341 23.667  1.00 10.96  ? 292  THR A CG2  1 
ATOM   4429  H  H    . THR A 1 292 ? 58.527  29.745 21.866  1.00 13.59  ? 292  THR A H    1 
ATOM   4430  H  HA   . THR A 1 292 ? 59.121  28.952 24.304  1.00 10.11  ? 292  THR A HA   1 
ATOM   4431  H  HB   . THR A 1 292 ? 60.657  28.413 21.959  1.00 11.85  ? 292  THR A HB   1 
ATOM   4432  H  HG1  . THR A 1 292 ? 58.596  27.600 21.893  1.00 18.33  ? 292  THR A HG1  1 
ATOM   4433  H  HG21 . THR A 1 292 ? 61.514  26.597 23.188  1.00 16.44  ? 292  THR A HG21 1 
ATOM   4434  H  HG22 . THR A 1 292 ? 60.665  27.020 24.436  1.00 16.44  ? 292  THR A HG22 1 
ATOM   4435  H  HG23 . THR A 1 292 ? 61.847  27.927 23.949  1.00 16.44  ? 292  THR A HG23 1 
ATOM   4436  N  N    . VAL A 1 293 ? 61.251  31.032 23.062  1.00 10.90  ? 293  VAL A N    1 
ATOM   4437  C  CA   . VAL A 1 293 ? 62.303  31.993 23.372  1.00 10.39  ? 293  VAL A CA   1 
ATOM   4438  C  C    . VAL A 1 293 ? 61.742  33.070 24.279  1.00 9.55   ? 293  VAL A C    1 
ATOM   4439  O  O    . VAL A 1 293 ? 62.370  33.484 25.266  1.00 11.60  ? 293  VAL A O    1 
ATOM   4440  C  CB   . VAL A 1 293 ? 62.862  32.568 22.056  1.00 12.21  ? 293  VAL A CB   1 
ATOM   4441  C  CG1  . VAL A 1 293 ? 63.760  33.743 22.347  1.00 11.86  ? 293  VAL A CG1  1 
ATOM   4442  C  CG2  . VAL A 1 293 ? 63.571  31.506 21.248  1.00 15.71  ? 293  VAL A CG2  1 
ATOM   4443  H  H    . VAL A 1 293 ? 61.012  30.956 22.239  1.00 13.09  ? 293  VAL A H    1 
ATOM   4444  H  HA   . VAL A 1 293 ? 63.025  31.528 23.844  1.00 12.46  ? 293  VAL A HA   1 
ATOM   4445  H  HB   . VAL A 1 293 ? 62.105  32.893 21.525  1.00 14.66  ? 293  VAL A HB   1 
ATOM   4446  H  HG11 . VAL A 1 293 ? 63.277  34.395 22.860  1.00 17.79  ? 293  VAL A HG11 1 
ATOM   4447  H  HG12 . VAL A 1 293 ? 64.050  34.137 21.521  1.00 17.79  ? 293  VAL A HG12 1 
ATOM   4448  H  HG13 . VAL A 1 293 ? 64.524  33.446 22.846  1.00 17.79  ? 293  VAL A HG13 1 
ATOM   4449  H  HG21 . VAL A 1 293 ? 62.968  30.778 21.077  1.00 23.57  ? 293  VAL A HG21 1 
ATOM   4450  H  HG22 . VAL A 1 293 ? 64.330  31.183 21.740  1.00 23.57  ? 293  VAL A HG22 1 
ATOM   4451  H  HG23 . VAL A 1 293 ? 63.865  31.880 20.415  1.00 23.57  ? 293  VAL A HG23 1 
ATOM   4452  N  N    . ASN A 1 294 ? 60.542  33.567 24.010  1.00 12.44  ? 294  ASN A N    1 
ATOM   4453  C  CA   . ASN A 1 294 ? 59.973  34.657 24.826  1.00 12.28  ? 294  ASN A CA   1 
ATOM   4454  C  C    . ASN A 1 294 ? 59.743  34.169 26.255  1.00 12.44  ? 294  ASN A C    1 
ATOM   4455  O  O    . ASN A 1 294 ? 59.963  34.902 27.219  1.00 12.03  ? 294  ASN A O    1 
ATOM   4456  C  CB   . ASN A 1 294 ? 58.702  35.177 24.175  1.00 16.81  ? 294  ASN A CB   1 
ATOM   4457  C  CG   . ASN A 1 294 ? 58.925  36.059 22.954  1.00 22.48  ? 294  ASN A CG   1 
ATOM   4458  O  OD1  . ASN A 1 294 ? 60.030  36.524 22.652  1.00 18.55  ? 294  ASN A OD1  1 
ATOM   4459  N  ND2  . ASN A 1 294 ? 57.795  36.278 22.261  1.00 22.70  ? 294  ASN A ND2  1 
ATOM   4460  H  H    . ASN A 1 294 ? 60.090  33.250 23.351  1.00 14.93  ? 294  ASN A H    1 
ATOM   4461  H  HA   . ASN A 1 294 ? 60.623  35.389 24.854  1.00 14.73  ? 294  ASN A HA   1 
ATOM   4462  H  HB2  . ASN A 1 294 ? 58.156  34.419 23.914  1.00 20.17  ? 294  ASN A HB2  1 
ATOM   4463  H  HB3  . ASN A 1 294 ? 58.202  35.683 24.835  1.00 20.17  ? 294  ASN A HB3  1 
ATOM   4464  H  HD21 . ASN A 1 294 ? 57.812  36.771 21.556  1.00 27.24  ? 294  ASN A HD21 1 
ATOM   4465  H  HD22 . ASN A 1 294 ? 57.055  35.925 22.522  1.00 27.24  ? 294  ASN A HD22 1 
ATOM   4466  N  N    . THR A 1 295 ? 59.299  32.939 26.379  1.00 11.49  ? 295  THR A N    1 
ATOM   4467  C  CA   . THR A 1 295 ? 59.085  32.402 27.711  1.00 9.31   ? 295  THR A CA   1 
ATOM   4468  C  C    . THR A 1 295 ? 60.389  32.256 28.434  1.00 9.36   ? 295  THR A C    1 
ATOM   4469  O  O    . THR A 1 295 ? 60.515  32.654 29.602  1.00 9.82   ? 295  THR A O    1 
ATOM   4470  C  CB   . THR A 1 295 ? 58.373  31.041 27.619  1.00 11.80  ? 295  THR A CB   1 
ATOM   4471  O  OG1  . THR A 1 295 ? 57.054  31.252 27.108  1.00 13.08  ? 295  THR A OG1  1 
ATOM   4472  C  CG2  . THR A 1 295 ? 58.288  30.464 29.022  1.00 10.12  ? 295  THR A CG2  1 
ATOM   4473  H  H    . THR A 1 295 ? 59.137  32.459 25.683  1.00 13.79  ? 295  THR A H    1 
ATOM   4474  H  HA   . THR A 1 295 ? 58.516  33.022 28.212  1.00 11.17  ? 295  THR A HA   1 
ATOM   4475  H  HB   . THR A 1 295 ? 58.872  30.435 27.032  1.00 14.16  ? 295  THR A HB   1 
ATOM   4476  H  HG1  . THR A 1 295 ? 57.101  31.565 26.352  1.00 19.61  ? 295  THR A HG1  1 
ATOM   4477  H  HG21 . THR A 1 295 ? 57.843  29.614 28.992  1.00 15.18  ? 295  THR A HG21 1 
ATOM   4478  H  HG22 . THR A 1 295 ? 57.793  31.064 29.586  1.00 15.18  ? 295  THR A HG22 1 
ATOM   4479  H  HG23 . THR A 1 295 ? 59.173  30.350 29.376  1.00 15.18  ? 295  THR A HG23 1 
ATOM   4480  N  N    . ALA A 1 296 ? 61.461  31.777 27.811  1.00 10.45  ? 296  ALA A N    1 
ATOM   4481  C  CA   . ALA A 1 296 ? 62.785  31.632 28.385  1.00 8.02   ? 296  ALA A CA   1 
ATOM   4482  C  C    . ALA A 1 296 ? 63.393  32.953 28.817  1.00 10.76  ? 296  ALA A C    1 
ATOM   4483  O  O    . ALA A 1 296 ? 64.013  33.111 29.880  1.00 11.82  ? 296  ALA A O    1 
ATOM   4484  C  CB   . ALA A 1 296 ? 63.664  30.944 27.331  1.00 12.54  ? 296  ALA A CB   1 
ATOM   4485  H  H    . ALA A 1 296 ? 61.361  31.530 26.994  1.00 12.55  ? 296  ALA A H    1 
ATOM   4486  H  HA   . ALA A 1 296 ? 62.723  31.047 29.168  1.00 9.63   ? 296  ALA A HA   1 
ATOM   4487  H  HB1  . ALA A 1 296 ? 63.260  30.113 27.071  1.00 18.81  ? 296  ALA A HB1  1 
ATOM   4488  H  HB2  . ALA A 1 296 ? 64.534  30.774 27.701  1.00 18.81  ? 296  ALA A HB2  1 
ATOM   4489  H  HB3  . ALA A 1 296 ? 63.748  31.513 26.563  1.00 18.81  ? 296  ALA A HB3  1 
ATOM   4490  N  N    . VAL A 1 297 ? 63.183  33.991 27.996  1.00 9.84   ? 297  VAL A N    1 
ATOM   4491  C  CA   . VAL A 1 297 ? 63.571  35.366 28.363  1.00 10.43  ? 297  VAL A CA   1 
ATOM   4492  C  C    . VAL A 1 297 ? 62.786  35.815 29.581  1.00 10.50  ? 297  VAL A C    1 
ATOM   4493  O  O    . VAL A 1 297 ? 63.413  36.342 30.510  1.00 10.48  ? 297  VAL A O    1 
ATOM   4494  C  CB   . VAL A 1 297 ? 63.398  36.335 27.172  1.00 10.57  ? 297  VAL A CB   1 
ATOM   4495  C  CG1  . VAL A 1 297 ? 63.629  37.780 27.577  1.00 13.02  ? 297  VAL A CG1  1 
ATOM   4496  C  CG2  . VAL A 1 297 ? 64.405  35.965 26.093  1.00 15.61  ? 297  VAL A CG2  1 
ATOM   4497  H  H    . VAL A 1 297 ? 62.810  33.851 27.233  1.00 11.81  ? 297  VAL A H    1 
ATOM   4498  H  HA   . VAL A 1 297 ? 64.521  35.354 28.605  1.00 12.51  ? 297  VAL A HA   1 
ATOM   4499  H  HB   . VAL A 1 297 ? 62.492  36.243 26.812  1.00 12.68  ? 297  VAL A HB   1 
ATOM   4500  H  HG11 . VAL A 1 297 ? 62.994  38.029 28.252  1.00 19.53  ? 297  VAL A HG11 1 
ATOM   4501  H  HG12 . VAL A 1 297 ? 63.522  38.347 26.810  1.00 19.53  ? 297  VAL A HG12 1 
ATOM   4502  H  HG13 . VAL A 1 297 ? 64.519  37.876 27.924  1.00 19.53  ? 297  VAL A HG13 1 
ATOM   4503  H  HG21 . VAL A 1 297 ? 64.276  35.050 25.835  1.00 23.41  ? 297  VAL A HG21 1 
ATOM   4504  H  HG22 . VAL A 1 297 ? 65.295  36.079 26.433  1.00 23.41  ? 297  VAL A HG22 1 
ATOM   4505  H  HG23 . VAL A 1 297 ? 64.279  36.534 25.329  1.00 23.41  ? 297  VAL A HG23 1 
ATOM   4506  N  N    . ALA A 1 298 ? 61.492  35.599 29.643  1.00 10.65  ? 298  ALA A N    1 
ATOM   4507  C  CA   . ALA A 1 298 ? 60.685  36.080 30.769  1.00 12.34  ? 298  ALA A CA   1 
ATOM   4508  C  C    . ALA A 1 298 ? 61.130  35.424 32.067  1.00 9.43   ? 298  ALA A C    1 
ATOM   4509  O  O    . ALA A 1 298 ? 61.196  36.116 33.093  1.00 13.14  ? 298  ALA A O    1 
ATOM   4510  C  CB   . ALA A 1 298 ? 59.243  35.821 30.459  1.00 9.69   ? 298  ALA A CB   1 
ATOM   4511  H  H    . ALA A 1 298 ? 61.109  35.165 29.008  1.00 12.77  ? 298  ALA A H    1 
ATOM   4512  H  HA   . ALA A 1 298 ? 60.815  37.048 30.852  1.00 14.80  ? 298  ALA A HA   1 
ATOM   4513  H  HB1  . ALA A 1 298 ? 59.010  36.258 29.637  1.00 14.54  ? 298  ALA A HB1  1 
ATOM   4514  H  HB2  . ALA A 1 298 ? 58.696  36.163 31.170  1.00 14.54  ? 298  ALA A HB2  1 
ATOM   4515  H  HB3  . ALA A 1 298 ? 59.100  34.875 30.371  1.00 14.54  ? 298  ALA A HB3  1 
ATOM   4516  N  N    . ILE A 1 299 ? 61.418  34.145 32.031  1.00 10.28  ? 299  ILE A N    1 
ATOM   4517  C  CA   . ILE A 1 299 ? 61.888  33.372 33.215  1.00 12.82  ? 299  ILE A CA   1 
ATOM   4518  C  C    . ILE A 1 299 ? 63.212  33.947 33.638  1.00 14.55  ? 299  ILE A C    1 
ATOM   4519  O  O    . ILE A 1 299 ? 63.495  34.181 34.810  1.00 12.99  ? 299  ILE A O    1 
ATOM   4520  C  CB   . ILE A 1 299 ? 61.979  31.878 32.863  1.00 13.11  ? 299  ILE A CB   1 
ATOM   4521  C  CG1  . ILE A 1 299 ? 60.594  31.199 32.938  1.00 18.40  ? 299  ILE A CG1  1 
ATOM   4522  C  CG2  . ILE A 1 299 ? 62.987  31.051 33.642  1.00 17.62  ? 299  ILE A CG2  1 
ATOM   4523  C  CD1  . ILE A 1 299 ? 59.526  31.824 32.085  1.00 49.01  ? 299  ILE A CD1  1 
ATOM   4524  H  H    . ILE A 1 299 ? 61.330  33.729 31.284  1.00 12.34  ? 299  ILE A H    1 
ATOM   4525  H  HA   . ILE A 1 299 ? 61.244  33.488 33.945  1.00 15.38  ? 299  ILE A HA   1 
ATOM   4526  H  HB   . ILE A 1 299 ? 62.255  31.833 31.924  1.00 15.74  ? 299  ILE A HB   1 
ATOM   4527  H  HG12 . ILE A 1 299 ? 60.693  30.270 32.676  1.00 22.08  ? 299  ILE A HG12 1 
ATOM   4528  H  HG13 . ILE A 1 299 ? 60.296  31.211 33.861  1.00 22.08  ? 299  ILE A HG13 1 
ATOM   4529  H  HG21 . ILE A 1 299 ? 62.953  30.140 33.343  1.00 26.43  ? 299  ILE A HG21 1 
ATOM   4530  H  HG22 . ILE A 1 299 ? 62.777  31.089 34.578  1.00 26.43  ? 299  ILE A HG22 1 
ATOM   4531  H  HG23 . ILE A 1 299 ? 63.869  31.403 33.498  1.00 26.43  ? 299  ILE A HG23 1 
ATOM   4532  H  HD11 . ILE A 1 299 ? 58.703  31.342 32.198  1.00 73.52  ? 299  ILE A HD11 1 
ATOM   4533  H  HD12 . ILE A 1 299 ? 59.792  31.790 31.164  1.00 73.52  ? 299  ILE A HD12 1 
ATOM   4534  H  HD13 . ILE A 1 299 ? 59.400  32.738 32.349  1.00 73.52  ? 299  ILE A HD13 1 
ATOM   4535  N  N    . THR A 1 300 ? 64.073  34.247 32.671  1.00 8.54   ? 300  THR A N    1 
ATOM   4536  C  CA   . THR A 1 300 ? 65.392  34.780 32.973  1.00 9.90   ? 300  THR A CA   1 
ATOM   4537  C  C    . THR A 1 300 ? 65.256  36.170 33.585  1.00 10.48  ? 300  THR A C    1 
ATOM   4538  O  O    . THR A 1 300 ? 65.895  36.450 34.612  1.00 13.05  ? 300  THR A O    1 
ATOM   4539  C  CB   . THR A 1 300 ? 66.325  34.807 31.740  1.00 10.45  ? 300  THR A CB   1 
ATOM   4540  O  OG1  . THR A 1 300 ? 66.486  33.503 31.211  1.00 11.15  ? 300  THR A OG1  1 
ATOM   4541  C  CG2  . THR A 1 300 ? 67.706  35.291 32.120  1.00 8.44   ? 300  THR A CG2  1 
ATOM   4542  H  H    . THR A 1 300 ? 63.846  34.124 31.851  1.00 10.25  ? 300  THR A H    1 
ATOM   4543  H  HA   . THR A 1 300 ? 65.802  34.197 33.645  1.00 11.88  ? 300  THR A HA   1 
ATOM   4544  H  HB   . THR A 1 300 ? 65.947  35.396 31.054  1.00 12.54  ? 300  THR A HB   1 
ATOM   4545  H  HG1  . THR A 1 300 ? 65.753  33.203 30.996  1.00 16.72  ? 300  THR A HG1  1 
ATOM   4546  H  HG21 . THR A 1 300 ? 68.266  35.304 31.340  1.00 12.66  ? 300  THR A HG21 1 
ATOM   4547  H  HG22 . THR A 1 300 ? 68.083  34.700 32.775  1.00 12.66  ? 300  THR A HG22 1 
ATOM   4548  H  HG23 . THR A 1 300 ? 67.645  36.177 32.485  1.00 12.66  ? 300  THR A HG23 1 
ATOM   4549  N  N    . LEU A 1 301 ? 64.443  37.074 33.073  1.00 11.20  ? 301  LEU A N    1 
ATOM   4550  C  CA   . LEU A 1 301 ? 64.328  38.407 33.681  1.00 10.47  ? 301  LEU A CA   1 
ATOM   4551  C  C    . LEU A 1 301 ? 63.756  38.391 35.089  1.00 12.28  ? 301  LEU A C    1 
ATOM   4552  O  O    . LEU A 1 301 ? 64.170  39.221 35.909  1.00 10.24  ? 301  LEU A O    1 
ATOM   4553  C  CB   . LEU A 1 301 ? 63.465  39.257 32.761  1.00 12.11  ? 301  LEU A CB   1 
ATOM   4554  C  CG   . LEU A 1 301 ? 63.980  39.509 31.331  1.00 10.97  ? 301  LEU A CG   1 
ATOM   4555  C  CD1  . LEU A 1 301 ? 62.939  40.315 30.563  1.00 13.06  ? 301  LEU A CD1  1 
ATOM   4556  C  CD2  . LEU A 1 301 ? 65.321  40.195 31.294  1.00 15.93  ? 301  LEU A CD2  1 
ATOM   4557  H  H    . LEU A 1 301 ? 63.976  36.881 32.377  1.00 13.44  ? 301  LEU A H    1 
ATOM   4558  H  HA   . LEU A 1 301 ? 65.223  38.806 33.718  1.00 12.57  ? 301  LEU A HA   1 
ATOM   4559  H  HB2  . LEU A 1 301 ? 62.594  38.835 32.694  1.00 14.53  ? 301  LEU A HB2  1 
ATOM   4560  H  HB3  . LEU A 1 301 ? 63.334  40.119 33.187  1.00 14.53  ? 301  LEU A HB3  1 
ATOM   4561  H  HG   . LEU A 1 301 ? 64.074  38.640 30.888  1.00 13.16  ? 301  LEU A HG   1 
ATOM   4562  H  HD11 . LEU A 1 301 ? 62.096  39.856 30.589  1.00 19.59  ? 301  LEU A HD11 1 
ATOM   4563  H  HD12 . LEU A 1 301 ? 63.221  40.416 29.651  1.00 19.59  ? 301  LEU A HD12 1 
ATOM   4564  H  HD13 . LEU A 1 301 ? 62.844  41.181 30.967  1.00 19.59  ? 301  LEU A HD13 1 
ATOM   4565  H  HD21 . LEU A 1 301 ? 65.962  39.671 31.779  1.00 23.89  ? 301  LEU A HD21 1 
ATOM   4566  H  HD22 . LEU A 1 301 ? 65.247  41.064 31.696  1.00 23.89  ? 301  LEU A HD22 1 
ATOM   4567  H  HD23 . LEU A 1 301 ? 65.608  40.288 30.382  1.00 23.89  ? 301  LEU A HD23 1 
ATOM   4568  N  N    . ALA A 1 302 ? 62.848  37.459 35.355  1.00 9.60   ? 302  ALA A N    1 
ATOM   4569  C  CA   . ALA A 1 302 ? 62.338  37.278 36.716  1.00 9.78   ? 302  ALA A CA   1 
ATOM   4570  C  C    . ALA A 1 302 ? 63.420  36.875 37.699  1.00 10.35  ? 302  ALA A C    1 
ATOM   4571  O  O    . ALA A 1 302 ? 63.362  37.330 38.843  1.00 11.34  ? 302  ALA A O    1 
ATOM   4572  C  CB   . ALA A 1 302 ? 61.245  36.211 36.741  1.00 12.12  ? 302  ALA A CB   1 
ATOM   4573  H  H    . ALA A 1 302 ? 62.556  36.956 34.722  1.00 11.52  ? 302  ALA A H    1 
ATOM   4574  H  HA   . ALA A 1 302 ? 61.948  38.127 37.016  1.00 11.74  ? 302  ALA A HA   1 
ATOM   4575  H  HB1  . ALA A 1 302 ? 60.551  36.450 36.123  1.00 18.17  ? 302  ALA A HB1  1 
ATOM   4576  H  HB2  . ALA A 1 302 ? 60.878  36.149 37.626  1.00 18.17  ? 302  ALA A HB2  1 
ATOM   4577  H  HB3  . ALA A 1 302 ? 61.620  35.364 36.489  1.00 18.17  ? 302  ALA A HB3  1 
ATOM   4578  N  N    . CYS A 1 303 ? 64.373  36.071 37.281  1.00 11.79  ? 303  CYS A N    1 
ATOM   4579  C  CA   . CYS A 1 303 ? 65.489  35.681 38.125  1.00 11.81  ? 303  CYS A CA   1 
ATOM   4580  C  C    . CYS A 1 303 ? 66.282  36.900 38.574  1.00 11.53  ? 303  CYS A C    1 
ATOM   4581  O  O    . CYS A 1 303 ? 67.015  36.777 39.574  1.00 11.13  ? 303  CYS A O    1 
ATOM   4582  C  CB   . CYS A 1 303 ? 66.390  34.680 37.398  1.00 11.46  ? 303  CYS A CB   1 
ATOM   4583  S  SG   . CYS A 1 303 ? 65.688  33.019 37.259  1.00 12.09  ? 303  CYS A SG   1 
ATOM   4584  H  H    . CYS A 1 303 ? 64.334  35.765 36.478  1.00 14.15  ? 303  CYS A H    1 
ATOM   4585  H  HA   . CYS A 1 303 ? 65.128  35.242 38.923  1.00 14.18  ? 303  CYS A HA   1 
ATOM   4586  H  HB2  . CYS A 1 303 ? 66.573  35.016 36.507  1.00 13.75  ? 303  CYS A HB2  1 
ATOM   4587  H  HB3  . CYS A 1 303 ? 67.235  34.622 37.870  1.00 13.75  ? 303  CYS A HB3  1 
ATOM   4588  N  N    . PHE A 1 304 ? 66.222  38.024 37.876  1.00 9.02   ? 304  PHE A N    1 
ATOM   4589  C  CA   . PHE A 1 304 ? 67.071  39.174 38.169  1.00 10.91  ? 304  PHE A CA   1 
ATOM   4590  C  C    . PHE A 1 304 ? 66.190  40.373 38.518  1.00 11.70  ? 304  PHE A C    1 
ATOM   4591  O  O    . PHE A 1 304 ? 66.652  41.487 38.299  1.00 13.30  ? 304  PHE A O    1 
ATOM   4592  C  CB   . PHE A 1 304 ? 68.006  39.459 36.993  1.00 11.93  ? 304  PHE A CB   1 
ATOM   4593  C  CG   . PHE A 1 304 ? 68.968  38.281 36.829  1.00 9.24   ? 304  PHE A CG   1 
ATOM   4594  C  CD1  . PHE A 1 304 ? 69.995  38.051 37.723  1.00 17.36  ? 304  PHE A CD1  1 
ATOM   4595  C  CD2  . PHE A 1 304 ? 68.770  37.434 35.738  1.00 13.38  ? 304  PHE A CD2  1 
ATOM   4596  C  CE1  . PHE A 1 304 ? 70.848  36.975 37.554  1.00 14.87  ? 304  PHE A CE1  1 
ATOM   4597  C  CE2  . PHE A 1 304 ? 69.638  36.361 35.583  1.00 15.13  ? 304  PHE A CE2  1 
ATOM   4598  C  CZ   . PHE A 1 304 ? 70.678  36.134 36.473  1.00 17.76  ? 304  PHE A CZ   1 
ATOM   4599  H  H    . PHE A 1 304 ? 65.662  38.079 37.226  1.00 10.82  ? 304  PHE A H    1 
ATOM   4600  H  HA   . PHE A 1 304 ? 67.620  38.958 38.952  1.00 13.09  ? 304  PHE A HA   1 
ATOM   4601  H  HB2  . PHE A 1 304 ? 67.488  39.579 36.181  1.00 14.31  ? 304  PHE A HB2  1 
ATOM   4602  H  HB3  . PHE A 1 304 ? 68.506  40.274 37.159  1.00 14.31  ? 304  PHE A HB3  1 
ATOM   4603  H  HD1  . PHE A 1 304 ? 70.114  38.625 38.445  1.00 20.83  ? 304  PHE A HD1  1 
ATOM   4604  H  HD2  . PHE A 1 304 ? 68.078  37.582 35.135  1.00 16.06  ? 304  PHE A HD2  1 
ATOM   4605  H  HE1  . PHE A 1 304 ? 71.532  36.819 38.165  1.00 17.85  ? 304  PHE A HE1  1 
ATOM   4606  H  HE2  . PHE A 1 304 ? 69.520  35.782 34.865  1.00 18.15  ? 304  PHE A HE2  1 
ATOM   4607  H  HZ   . PHE A 1 304 ? 71.257  35.418 36.342  1.00 21.31  ? 304  PHE A HZ   1 
ATOM   4608  N  N    . GLY A 1 305 ? 64.985  40.102 39.017  1.00 12.53  ? 305  GLY A N    1 
ATOM   4609  C  CA   . GLY A 1 305 ? 64.199  41.154 39.642  1.00 11.55  ? 305  GLY A CA   1 
ATOM   4610  C  C    . GLY A 1 305 ? 62.989  41.677 38.942  1.00 10.39  ? 305  GLY A C    1 
ATOM   4611  O  O    . GLY A 1 305 ? 62.219  42.483 39.514  1.00 12.87  ? 305  GLY A O    1 
ATOM   4612  H  H    . GLY A 1 305 ? 64.671  39.303 38.969  1.00 15.04  ? 305  GLY A H    1 
ATOM   4613  H  HA2  . GLY A 1 305 ? 63.915  40.828 40.511  1.00 13.86  ? 305  GLY A HA2  1 
ATOM   4614  H  HA3  . GLY A 1 305 ? 64.792  41.905 39.802  1.00 13.86  ? 305  GLY A HA3  1 
ATOM   4615  N  N    . LEU A 1 306 ? 62.647  41.359 37.697  1.00 10.19  ? 306  LEU A N    1 
ATOM   4616  C  CA   . LEU A 1 306 ? 61.445  41.824 37.012  1.00 9.31   ? 306  LEU A CA   1 
ATOM   4617  C  C    . LEU A 1 306 ? 60.247  41.233 37.736  1.00 10.25  ? 306  LEU A C    1 
ATOM   4618  O  O    . LEU A 1 306 ? 60.161  40.001 37.813  1.00 10.80  ? 306  LEU A O    1 
ATOM   4619  C  CB   . LEU A 1 306 ? 61.434  41.387 35.554  1.00 14.24  ? 306  LEU A CB   1 
ATOM   4620  C  CG   . LEU A 1 306 ? 61.215  42.355 34.405  1.00 37.18  ? 306  LEU A CG   1 
ATOM   4621  C  CD1  . LEU A 1 306 ? 60.477  41.618 33.288  1.00 14.52  ? 306  LEU A CD1  1 
ATOM   4622  C  CD2  . LEU A 1 306 ? 60.496  43.637 34.794  1.00 19.60  ? 306  LEU A CD2  1 
ATOM   4623  H  H    . LEU A 1 306 ? 63.176  40.839 37.261  1.00 12.23  ? 306  LEU A H    1 
ATOM   4624  H  HA   . LEU A 1 306 ? 61.403  42.802 37.058  1.00 11.18  ? 306  LEU A HA   1 
ATOM   4625  H  HB2  . LEU A 1 306 ? 62.284  40.950 35.389  1.00 17.09  ? 306  LEU A HB2  1 
ATOM   4626  H  HB3  . LEU A 1 306 ? 60.751  40.703 35.475  1.00 17.09  ? 306  LEU A HB3  1 
ATOM   4627  H  HG   . LEU A 1 306 ? 62.097  42.606 34.059  1.00 44.62  ? 306  LEU A HG   1 
ATOM   4628  H  HD11 . LEU A 1 306 ? 60.334  42.216 32.550  1.00 21.78  ? 306  LEU A HD11 1 
ATOM   4629  H  HD12 . LEU A 1 306 ? 59.631  41.305 33.615  1.00 21.78  ? 306  LEU A HD12 1 
ATOM   4630  H  HD13 . LEU A 1 306 ? 61.004  40.870 32.996  1.00 21.78  ? 306  LEU A HD13 1 
ATOM   4631  H  HD21 . LEU A 1 306 ? 60.400  44.197 34.021  1.00 29.40  ? 306  LEU A HD21 1 
ATOM   4632  H  HD22 . LEU A 1 306 ? 61.006  44.099 35.463  1.00 29.40  ? 306  LEU A HD22 1 
ATOM   4633  H  HD23 . LEU A 1 306 ? 59.628  43.423 35.145  1.00 29.40  ? 306  LEU A HD23 1 
ATOM   4634  N  N    . ALA A 1 307 ? 59.355  42.057 38.239  1.00 9.44   ? 307  ALA A N    1 
ATOM   4635  C  CA   . ALA A 1 307 ? 58.261  41.564 39.085  1.00 11.60  ? 307  ALA A CA   1 
ATOM   4636  C  C    . ALA A 1 307 ? 56.930  41.881 38.405  1.00 9.73   ? 307  ALA A C    1 
ATOM   4637  O  O    . ALA A 1 307 ? 56.701  43.015 37.936  1.00 11.28  ? 307  ALA A O    1 
ATOM   4638  C  CB   . ALA A 1 307 ? 58.293  42.192 40.446  1.00 10.92  ? 307  ALA A CB   1 
ATOM   4639  H  H    . ALA A 1 307 ? 59.413  42.898 38.070  1.00 11.33  ? 307  ALA A H    1 
ATOM   4640  H  HA   . ALA A 1 307 ? 58.346  40.592 39.181  1.00 13.92  ? 307  ALA A HA   1 
ATOM   4641  H  HB1  . ALA A 1 307 ? 59.133  41.998 40.868  1.00 16.37  ? 307  ALA A HB1  1 
ATOM   4642  H  HB2  . ALA A 1 307 ? 57.578  41.838 40.979  1.00 16.37  ? 307  ALA A HB2  1 
ATOM   4643  H  HB3  . ALA A 1 307 ? 58.190  43.142 40.362  1.00 16.37  ? 307  ALA A HB3  1 
ATOM   4644  N  N    . ARG A 1 308 ? 56.026  40.927 38.440  1.00 10.34  ? 308  ARG A N    1 
ATOM   4645  C  CA   . ARG A 1 308 ? 54.720  41.197 37.807  1.00 9.32   ? 308  ARG A CA   1 
ATOM   4646  C  C    . ARG A 1 308 ? 53.948  42.323 38.419  1.00 11.71  ? 308  ARG A C    1 
ATOM   4647  O  O    . ARG A 1 308 ? 53.193  43.026 37.726  1.00 10.24  ? 308  ARG A O    1 
ATOM   4648  C  CB   . ARG A 1 308 ? 53.882  39.901 37.715  1.00 8.41   ? 308  ARG A CB   1 
ATOM   4649  C  CG   . ARG A 1 308 ? 54.403  38.966 36.601  1.00 10.37  ? 308  ARG A CG   1 
ATOM   4650  C  CD   . ARG A 1 308 ? 53.716  37.620 36.581  1.00 10.59  ? 308  ARG A CD   1 
ATOM   4651  N  NE   . ARG A 1 308 ? 54.142  36.809 37.740  1.00 8.10   ? 308  ARG A NE   1 
ATOM   4652  C  CZ   . ARG A 1 308 ? 53.599  35.673 38.105  1.00 8.87   ? 308  ARG A CZ   1 
ATOM   4653  N  NH1  . ARG A 1 308 ? 52.614  35.166 37.409  1.00 8.62   ? 308  ARG A NH1  1 
ATOM   4654  N  NH2  . ARG A 1 308 ? 54.055  35.044 39.183  1.00 10.09  ? 308  ARG A NH2  1 
ATOM   4655  H  H    . ARG A 1 308 ? 56.190  40.172 38.819  1.00 12.40  ? 308  ARG A H    1 
ATOM   4656  H  HA   . ARG A 1 308 ? 54.912  41.466 36.884  1.00 11.19  ? 308  ARG A HA   1 
ATOM   4657  H  HB2  . ARG A 1 308 ? 53.916  39.436 38.566  1.00 10.09  ? 308  ARG A HB2  1 
ATOM   4658  H  HB3  . ARG A 1 308 ? 52.956  40.129 37.536  1.00 10.09  ? 308  ARG A HB3  1 
ATOM   4659  H  HG2  . ARG A 1 308 ? 54.273  39.398 35.742  1.00 12.45  ? 308  ARG A HG2  1 
ATOM   4660  H  HG3  . ARG A 1 308 ? 55.355  38.831 36.723  1.00 12.45  ? 308  ARG A HG3  1 
ATOM   4661  H  HD2  . ARG A 1 308 ? 52.754  37.745 36.607  1.00 12.70  ? 308  ARG A HD2  1 
ATOM   4662  H  HD3  . ARG A 1 308 ? 53.937  37.154 35.759  1.00 12.70  ? 308  ARG A HD3  1 
ATOM   4663  H  HE   . ARG A 1 308 ? 54.797  37.106 38.212  1.00 9.71   ? 308  ARG A HE   1 
ATOM   4664  H  HH11 . ARG A 1 308 ? 52.323  35.578 36.712  1.00 10.35  ? 308  ARG A HH11 1 
ATOM   4665  H  HH12 . ARG A 1 308 ? 52.257  34.421 37.647  1.00 10.35  ? 308  ARG A HH12 1 
ATOM   4666  H  HH21 . ARG A 1 308 ? 53.702  34.299 39.427  1.00 12.10  ? 308  ARG A HH21 1 
ATOM   4667  H  HH22 . ARG A 1 308 ? 54.702  35.383 39.636  1.00 12.10  ? 308  ARG A HH22 1 
ATOM   4668  N  N    . GLU A 1 309 ? 54.102  42.641 39.704  1.00 9.68   ? 309  GLU A N    1 
ATOM   4669  C  CA   . GLU A 1 309 ? 53.433  43.752 40.356  1.00 13.48  ? 309  GLU A CA   1 
ATOM   4670  C  C    . GLU A 1 309 ? 53.975  45.114 39.893  1.00 10.55  ? 309  GLU A C    1 
ATOM   4671  O  O    . GLU A 1 309 ? 53.277  46.088 40.122  1.00 9.44   ? 309  GLU A O    1 
ATOM   4672  C  CB   . GLU A 1 309 ? 53.555  43.665 41.886  1.00 10.32  ? 309  GLU A CB   1 
ATOM   4673  C  CG   . GLU A 1 309 ? 54.924  43.856 42.488  1.00 11.49  ? 309  GLU A CG   1 
ATOM   4674  C  CD   . GLU A 1 309 ? 54.897  44.182 43.965  1.00 11.17  ? 309  GLU A CD   1 
ATOM   4675  O  OE1  . GLU A 1 309 ? 54.362  43.355 44.716  1.00 12.34  ? 309  GLU A OE1  1 
ATOM   4676  O  OE2  . GLU A 1 309 ? 55.392  45.262 44.383  1.00 16.42  ? 309  GLU A OE2  1 
ATOM   4677  H  H    . GLU A 1 309 ? 54.632  42.157 40.178  1.00 11.62  ? 309  GLU A H    1 
ATOM   4678  H  HA   . GLU A 1 309 ? 52.481  43.710 40.125  1.00 16.17  ? 309  GLU A HA   1 
ATOM   4679  H  HB2  . GLU A 1 309 ? 52.963  44.330 42.270  1.00 12.39  ? 309  GLU A HB2  1 
ATOM   4680  H  HB3  . GLU A 1 309 ? 53.226  42.795 42.162  1.00 12.39  ? 309  GLU A HB3  1 
ATOM   4681  H  HG2  . GLU A 1 309 ? 55.441  43.046 42.356  1.00 13.79  ? 309  GLU A HG2  1 
ATOM   4682  H  HG3  . GLU A 1 309 ? 55.376  44.574 42.017  1.00 13.79  ? 309  GLU A HG3  1 
ATOM   4683  N  N    . GLY A 1 310 ? 55.146  45.122 39.267  1.00 10.07  ? 310  GLY A N    1 
ATOM   4684  C  CA   . GLY A 1 310 ? 55.843  46.298 38.837  1.00 12.45  ? 310  GLY A CA   1 
ATOM   4685  C  C    . GLY A 1 310 ? 57.111  46.579 39.613  1.00 9.78   ? 310  GLY A C    1 
ATOM   4686  O  O    . GLY A 1 310 ? 57.435  45.901 40.597  1.00 11.40  ? 310  GLY A O    1 
ATOM   4687  H  H    . GLY A 1 310 ? 55.515  44.361 39.107  1.00 12.08  ? 310  GLY A H    1 
ATOM   4688  H  HA2  . GLY A 1 310 ? 56.066  46.203 37.898  1.00 14.94  ? 310  GLY A HA2  1 
ATOM   4689  H  HA3  . GLY A 1 310 ? 55.250  47.061 38.922  1.00 14.94  ? 310  GLY A HA3  1 
ATOM   4690  N  N    . ASN A 1 311 ? 57.859  47.545 39.078  1.00 10.68  ? 311  ASN A N    1 
ATOM   4691  C  CA   . ASN A 1 311 ? 59.209  47.890 39.460  1.00 13.41  ? 311  ASN A CA   1 
ATOM   4692  C  C    . ASN A 1 311 ? 59.363  49.411 39.384  1.00 13.55  ? 311  ASN A C    1 
ATOM   4693  O  O    . ASN A 1 311 ? 58.881  50.003 38.411  1.00 15.60  ? 311  ASN A O    1 
ATOM   4694  C  CB   . ASN A 1 311 ? 60.222  47.200 38.529  1.00 12.55  ? 311  ASN A CB   1 
ATOM   4695  C  CG   . ASN A 1 311 ? 60.305  45.691 38.720  1.00 15.65  ? 311  ASN A CG   1 
ATOM   4696  O  OD1  . ASN A 1 311 ? 59.663  44.936 38.030  1.00 21.01  ? 311  ASN A OD1  1 
ATOM   4697  N  ND2  . ASN A 1 311 ? 61.101  45.197 39.664  1.00 32.21  ? 311  ASN A ND2  1 
ATOM   4698  H  H    . ASN A 1 311 ? 57.504  48.007 38.446  1.00 12.82  ? 311  ASN A H    1 
ATOM   4699  H  HA   . ASN A 1 311 ? 59.367  47.597 40.381  1.00 16.10  ? 311  ASN A HA   1 
ATOM   4700  H  HB2  . ASN A 1 311 ? 59.977  47.385 37.609  1.00 15.05  ? 311  ASN A HB2  1 
ATOM   4701  H  HB3  . ASN A 1 311 ? 61.099  47.583 38.684  1.00 15.05  ? 311  ASN A HB3  1 
ATOM   4702  H  HD21 . ASN A 1 311 ? 61.155  44.346 39.779  1.00 38.65  ? 311  ASN A HD21 1 
ATOM   4703  H  HD22 . ASN A 1 311 ? 61.561  45.728 40.159  1.00 38.65  ? 311  ASN A HD22 1 
ATOM   4704  N  N    . HIS A 1 312 ? 60.062  50.051 40.303  1.00 12.98  ? 312  HIS A N    1 
ATOM   4705  C  CA   . HIS A 1 312 ? 60.376  51.477 40.108  1.00 11.22  ? 312  HIS A CA   1 
ATOM   4706  C  C    . HIS A 1 312 ? 61.730  51.808 40.746  1.00 15.68  ? 312  HIS A C    1 
ATOM   4707  O  O    . HIS A 1 312 ? 62.161  51.127 41.674  1.00 17.89  ? 312  HIS A O    1 
ATOM   4708  C  CB   . HIS A 1 312 ? 59.325  52.387 40.721  1.00 12.82  ? 312  HIS A CB   1 
ATOM   4709  C  CG   . HIS A 1 312 ? 59.174  52.539 42.197  1.00 16.27  ? 312  HIS A CG   1 
ATOM   4710  N  ND1  . HIS A 1 312 ? 58.282  51.857 42.963  1.00 21.22  ? 312  HIS A ND1  1 
ATOM   4711  C  CD2  . HIS A 1 312 ? 59.753  53.302 43.166  1.00 16.21  ? 312  HIS A CD2  1 
ATOM   4712  C  CE1  . HIS A 1 312 ? 58.273  52.090 44.241  1.00 19.62  ? 312  HIS A CE1  1 
ATOM   4713  N  NE2  . HIS A 1 312 ? 59.208  53.028 44.388  1.00 16.27  ? 312  HIS A NE2  1 
ATOM   4714  H  H    . HIS A 1 312 ? 60.332  49.639 41.009  1.00 15.58  ? 312  HIS A H    1 
ATOM   4715  H  HA   . HIS A 1 312 ? 60.428  51.659 39.147  1.00 13.46  ? 312  HIS A HA   1 
ATOM   4716  H  HB2  . HIS A 1 312 ? 59.478  53.274 40.361  1.00 15.38  ? 312  HIS A HB2  1 
ATOM   4717  H  HB3  . HIS A 1 312 ? 58.466  52.092 40.380  1.00 15.38  ? 312  HIS A HB3  1 
ATOM   4718  H  HD1  . HIS A 1 312 ? 57.739  51.289 42.612  1.00 25.46  ? 312  HIS A HD1  1 
ATOM   4719  H  HD2  . HIS A 1 312 ? 60.428  53.924 43.015  1.00 19.45  ? 312  HIS A HD2  1 
ATOM   4720  H  HE1  . HIS A 1 312 ? 57.742  51.696 44.896  1.00 23.54  ? 312  HIS A HE1  1 
ATOM   4721  N  N    . LYS A 1 313 ? 62.364  52.882 40.289  1.00 14.44  ? 313  LYS A N    1 
ATOM   4722  C  CA   . LYS A 1 313 ? 63.620  53.350 40.881  1.00 15.02  ? 313  LYS A CA   1 
ATOM   4723  C  C    . LYS A 1 313 ? 63.373  54.166 42.133  1.00 19.37  ? 313  LYS A C    1 
ATOM   4724  O  O    . LYS A 1 313 ? 62.288  54.697 42.334  1.00 16.76  ? 313  LYS A O    1 
ATOM   4725  C  CB   . LYS A 1 313 ? 64.431  54.153 39.854  1.00 24.99  ? 313  LYS A CB   1 
ATOM   4726  C  CG   . LYS A 1 313 ? 64.708  53.278 38.626  1.00 22.83  ? 313  LYS A CG   1 
ATOM   4727  C  CD   . LYS A 1 313 ? 65.092  54.128 37.428  1.00 24.55  ? 313  LYS A CD   1 
ATOM   4728  C  CE   . LYS A 1 313 ? 66.355  53.649 36.760  1.00 36.66  ? 313  LYS A CE   1 
ATOM   4729  N  NZ   . LYS A 1 313 ? 67.397  53.206 37.740  1.00 72.13  ? 313  LYS A NZ   1 
ATOM   4730  H  H    . LYS A 1 313 ? 62.027  53.316 39.627  1.00 17.32  ? 313  LYS A H    1 
ATOM   4731  H  HA   . LYS A 1 313 ? 64.147  52.563 41.133  1.00 18.02  ? 313  LYS A HA   1 
ATOM   4732  H  HB2  . LYS A 1 313 ? 63.935  54.943 39.589  1.00 29.99  ? 313  LYS A HB2  1 
ATOM   4733  H  HB3  . LYS A 1 313 ? 65.269  54.439 40.249  1.00 29.99  ? 313  LYS A HB3  1 
ATOM   4734  H  HG2  . LYS A 1 313 ? 65.427  52.658 38.827  1.00 27.40  ? 313  LYS A HG2  1 
ATOM   4735  H  HG3  . LYS A 1 313 ? 63.916  52.760 38.414  1.00 27.40  ? 313  LYS A HG3  1 
ATOM   4736  H  HD2  . LYS A 1 313 ? 64.368  54.113 36.784  1.00 29.46  ? 313  LYS A HD2  1 
ATOM   4737  H  HD3  . LYS A 1 313 ? 65.215  55.046 37.717  1.00 29.46  ? 313  LYS A HD3  1 
ATOM   4738  H  HE2  . LYS A 1 313 ? 66.141  52.909 36.171  1.00 43.99  ? 313  LYS A HE2  1 
ATOM   4739  H  HE3  . LYS A 1 313 ? 66.717  54.366 36.217  1.00 43.99  ? 313  LYS A HE3  1 
ATOM   4740  H  HZ1  . LYS A 1 313 ? 68.206  53.356 37.402  1.00 108.20 ? 313  LYS A HZ1  1 
ATOM   4741  H  HZ2  . LYS A 1 313 ? 67.300  52.336 37.903  1.00 108.20 ? 313  LYS A HZ2  1 
ATOM   4742  H  HZ3  . LYS A 1 313 ? 67.303  53.661 38.499  1.00 108.20 ? 313  LYS A HZ3  1 
ATOM   4743  N  N    . PRO A 1 314 ? 64.322  54.269 43.071  1.00 23.68  ? 314  PRO A N    1 
ATOM   4744  C  CA   . PRO A 1 314 ? 64.028  54.978 44.321  1.00 21.32  ? 314  PRO A CA   1 
ATOM   4745  C  C    . PRO A 1 314 ? 64.077  56.484 44.108  1.00 25.19  ? 314  PRO A C    1 
ATOM   4746  O  O    . PRO A 1 314 ? 64.893  57.189 44.695  1.00 29.17  ? 314  PRO A O    1 
ATOM   4747  C  CB   . PRO A 1 314 ? 65.151  54.498 45.251  1.00 24.90  ? 314  PRO A CB   1 
ATOM   4748  C  CG   . PRO A 1 314 ? 66.305  54.287 44.320  1.00 19.03  ? 314  PRO A CG   1 
ATOM   4749  C  CD   . PRO A 1 314 ? 65.680  53.728 43.052  1.00 21.94  ? 314  PRO A CD   1 
ATOM   4750  H  HA   . PRO A 1 314 ? 63.154  54.708 44.671  1.00 25.58  ? 314  PRO A HA   1 
ATOM   4751  H  HB2  . PRO A 1 314 ? 65.360  55.168 45.920  1.00 29.88  ? 314  PRO A HB2  1 
ATOM   4752  H  HB3  . PRO A 1 314 ? 64.906  53.672 45.696  1.00 29.88  ? 314  PRO A HB3  1 
ATOM   4753  H  HG2  . PRO A 1 314 ? 66.760  55.125 44.139  1.00 22.84  ? 314  PRO A HG2  1 
ATOM   4754  H  HG3  . PRO A 1 314 ? 66.942  53.659 44.696  1.00 22.84  ? 314  PRO A HG3  1 
ATOM   4755  H  HD2  . PRO A 1 314 ? 66.162  54.026 42.265  1.00 26.33  ? 314  PRO A HD2  1 
ATOM   4756  H  HD3  . PRO A 1 314 ? 65.669  52.758 43.068  1.00 26.33  ? 314  PRO A HD3  1 
ATOM   4757  N  N    . ILE A 1 315 ? 63.196  56.948 43.243  1.00 21.43  ? 315  ILE A N    1 
ATOM   4758  C  CA   . ILE A 1 315 ? 62.929  58.349 42.931  1.00 19.32  ? 315  ILE A CA   1 
ATOM   4759  C  C    . ILE A 1 315 ? 61.477  58.653 43.245  1.00 20.86  ? 315  ILE A C    1 
ATOM   4760  O  O    . ILE A 1 315 ? 60.694  57.692 43.320  1.00 18.27  ? 315  ILE A O    1 
ATOM   4761  C  CB   . ILE A 1 315 ? 63.276  58.622 41.463  1.00 37.08  ? 315  ILE A CB   1 
ATOM   4762  C  CG1  . ILE A 1 315 ? 64.810  58.660 41.244  1.00 37.13  ? 315  ILE A CG1  1 
ATOM   4763  C  CG2  . ILE A 1 315 ? 62.664  59.880 40.857  1.00 63.93  ? 315  ILE A CG2  1 
ATOM   4764  C  CD1  . ILE A 1 315 ? 65.138  58.201 39.830  1.00 34.74  ? 315  ILE A CD1  1 
ATOM   4765  H  H    . ILE A 1 315 ? 62.730  56.363 42.818  1.00 25.72  ? 315  ILE A H    1 
ATOM   4766  H  HA   . ILE A 1 315 ? 63.497  58.911 43.498  1.00 23.18  ? 315  ILE A HA   1 
ATOM   4767  H  HB   . ILE A 1 315 ? 62.935  57.863 40.945  1.00 44.49  ? 315  ILE A HB   1 
ATOM   4768  H  HG12 . ILE A 1 315 ? 65.137  59.563 41.379  1.00 44.56  ? 315  ILE A HG12 1 
ATOM   4769  H  HG13 . ILE A 1 315 ? 65.247  58.080 41.886  1.00 44.56  ? 315  ILE A HG13 1 
ATOM   4770  H  HG21 . ILE A 1 315 ? 61.708  59.800 40.851  1.00 95.89  ? 315  ILE A HG21 1 
ATOM   4771  H  HG22 . ILE A 1 315 ? 62.981  59.989 39.957  1.00 95.89  ? 315  ILE A HG22 1 
ATOM   4772  H  HG23 . ILE A 1 315 ? 62.918  60.644 41.380  1.00 95.89  ? 315  ILE A HG23 1 
ATOM   4773  H  HD11 . ILE A 1 315 ? 66.006  58.527 39.580  1.00 52.11  ? 315  ILE A HD11 1 
ATOM   4774  H  HD12 . ILE A 1 315 ? 64.480  58.543 39.221  1.00 52.11  ? 315  ILE A HD12 1 
ATOM   4775  H  HD13 . ILE A 1 315 ? 65.136  57.241 39.796  1.00 52.11  ? 315  ILE A HD13 1 
ATOM   4776  N  N    . ASP A 1 316 ? 61.090  59.902 43.408  1.00 15.99  ? 316  ASP A N    1 
ATOM   4777  C  CA   . ASP A 1 316 ? 59.740  60.385 43.478  1.00 12.67  ? 316  ASP A CA   1 
ATOM   4778  C  C    . ASP A 1 316 ? 59.164  60.603 42.090  1.00 12.88  ? 316  ASP A C    1 
ATOM   4779  O  O    . ASP A 1 316 ? 59.539  61.582 41.433  1.00 17.65  ? 316  ASP A O    1 
ATOM   4780  C  CB   . ASP A 1 316 ? 59.730  61.701 44.261  1.00 19.96  ? 316  ASP A CB   1 
ATOM   4781  C  CG   . ASP A 1 316 ? 58.354  62.245 44.481  1.00 15.95  ? 316  ASP A CG   1 
ATOM   4782  O  OD1  . ASP A 1 316 ? 58.247  63.267 45.235  1.00 18.55  ? 316  ASP A OD1  1 
ATOM   4783  O  OD2  . ASP A 1 316 ? 57.347  61.742 43.931  1.00 13.23  ? 316  ASP A OD2  1 
ATOM   4784  H  H    . ASP A 1 316 ? 61.713  60.490 43.481  1.00 19.18  ? 316  ASP A H    1 
ATOM   4785  H  HA   . ASP A 1 316 ? 59.189  59.727 43.952  1.00 15.21  ? 316  ASP A HA   1 
ATOM   4786  H  HB2  . ASP A 1 316 ? 60.154  61.559 45.122  1.00 23.95  ? 316  ASP A HB2  1 
ATOM   4787  H  HB3  . ASP A 1 316 ? 60.255  62.359 43.778  1.00 23.95  ? 316  ASP A HB3  1 
ATOM   4788  N  N    . TYR A 1 317 ? 58.309  59.681 41.625  1.00 11.53  ? 317  TYR A N    1 
ATOM   4789  C  CA   . TYR A 1 317 ? 57.800  59.816 40.264  1.00 11.77  ? 317  TYR A CA   1 
ATOM   4790  C  C    . TYR A 1 317 ? 56.710  60.848 40.140  1.00 14.79  ? 317  TYR A C    1 
ATOM   4791  O  O    . TYR A 1 317 ? 56.366  61.250 39.015  1.00 19.34  ? 317  TYR A O    1 
ATOM   4792  C  CB   . TYR A 1 317 ? 57.237  58.476 39.764  1.00 14.43  ? 317  TYR A CB   1 
ATOM   4793  C  CG   . TYR A 1 317 ? 58.299  57.504 39.369  1.00 12.93  ? 317  TYR A CG   1 
ATOM   4794  C  CD1  . TYR A 1 317 ? 58.591  57.195 38.033  1.00 13.83  ? 317  TYR A CD1  1 
ATOM   4795  C  CD2  . TYR A 1 317 ? 59.070  56.850 40.327  1.00 14.44  ? 317  TYR A CD2  1 
ATOM   4796  C  CE1  . TYR A 1 317 ? 59.572  56.297 37.722  1.00 14.94  ? 317  TYR A CE1  1 
ATOM   4797  C  CE2  . TYR A 1 317 ? 60.061  55.961 40.009  1.00 12.03  ? 317  TYR A CE2  1 
ATOM   4798  C  CZ   . TYR A 1 317 ? 60.328  55.661 38.691  1.00 12.53  ? 317  TYR A CZ   1 
ATOM   4799  O  OH   . TYR A 1 317 ? 61.332  54.764 38.411  1.00 16.32  ? 317  TYR A OH   1 
ATOM   4800  H  H    . TYR A 1 317 ? 58.065  59.021 42.120  1.00 13.84  ? 317  TYR A H    1 
ATOM   4801  H  HA   . TYR A 1 317 ? 58.543  60.078 39.680  1.00 14.13  ? 317  TYR A HA   1 
ATOM   4802  H  HB2  . TYR A 1 317 ? 56.694  58.082 40.465  1.00 17.31  ? 317  TYR A HB2  1 
ATOM   4803  H  HB3  . TYR A 1 317 ? 56.662  58.641 39.001  1.00 17.31  ? 317  TYR A HB3  1 
ATOM   4804  H  HD1  . TYR A 1 317 ? 58.110  57.606 37.351  1.00 16.60  ? 317  TYR A HD1  1 
ATOM   4805  H  HD2  . TYR A 1 317 ? 58.904  57.027 41.225  1.00 17.33  ? 317  TYR A HD2  1 
ATOM   4806  H  HE1  . TYR A 1 317 ? 59.739  56.107 36.827  1.00 17.93  ? 317  TYR A HE1  1 
ATOM   4807  H  HE2  . TYR A 1 317 ? 60.555  55.557 40.686  1.00 14.44  ? 317  TYR A HE2  1 
ATOM   4808  H  HH   . TYR A 1 317 ? 61.393  54.667 37.599  1.00 24.48  ? 317  TYR A HH   1 
ATOM   4809  N  N    . LEU A 1 318 ? 56.130  61.319 41.258  1.00 13.70  ? 318  LEU A N    1 
ATOM   4810  C  CA   . LEU A 1 318 ? 55.133  62.356 41.247  1.00 15.75  ? 318  LEU A CA   1 
ATOM   4811  C  C    . LEU A 1 318 ? 55.742  63.768 41.303  1.00 15.16  ? 318  LEU A C    1 
ATOM   4812  O  O    . LEU A 1 318 ? 56.893  63.949 41.689  1.00 21.25  ? 318  LEU A O    1 
ATOM   4813  C  CB   . LEU A 1 318 ? 54.151  62.144 42.402  1.00 13.34  ? 318  LEU A CB   1 
ATOM   4814  C  CG   . LEU A 1 318 ? 53.138  61.015 42.253  1.00 10.77  ? 318  LEU A CG   1 
ATOM   4815  C  CD1  . LEU A 1 318 ? 52.289  60.894 43.519  1.00 13.47  ? 318  LEU A CD1  1 
ATOM   4816  C  CD2  . LEU A 1 318 ? 52.275  61.205 40.999  1.00 16.87  ? 318  LEU A CD2  1 
ATOM   4817  H  H    . LEU A 1 318 ? 56.366  60.985 42.014  1.00 16.44  ? 318  LEU A H    1 
ATOM   4818  H  HA   . LEU A 1 318 ? 54.630  62.279 40.409  1.00 18.90  ? 318  LEU A HA   1 
ATOM   4819  H  HB2  . LEU A 1 318 ? 54.666  61.981 43.208  1.00 16.01  ? 318  LEU A HB2  1 
ATOM   4820  H  HB3  . LEU A 1 318 ? 53.661  62.971 42.536  1.00 16.01  ? 318  LEU A HB3  1 
ATOM   4821  H  HG   . LEU A 1 318 ? 53.638  60.178 42.148  1.00 12.93  ? 318  LEU A HG   1 
ATOM   4822  H  HD11 . LEU A 1 318 ? 51.661  60.175 43.416  1.00 20.21  ? 318  LEU A HD11 1 
ATOM   4823  H  HD12 . LEU A 1 318 ? 51.814  61.715 43.666  1.00 20.21  ? 318  LEU A HD12 1 
ATOM   4824  H  HD13 . LEU A 1 318 ? 52.859  60.715 44.271  1.00 20.21  ? 318  LEU A HD13 1 
ATOM   4825  H  HD21 . LEU A 1 318 ? 51.651  60.479 40.927  1.00 25.31  ? 318  LEU A HD21 1 
ATOM   4826  H  HD22 . LEU A 1 318 ? 52.839  61.220 40.222  1.00 25.31  ? 318  LEU A HD22 1 
ATOM   4827  H  HD23 . LEU A 1 318 ? 51.796  62.034 41.063  1.00 25.31  ? 318  LEU A HD23 1 
ATOM   4828  N  N    . SER B 1 5   ? -5.950  34.629 8.360   1.00 35.74  ? 5    SER B N    1 
ATOM   4829  C  CA   . SER B 1 5   ? -5.888  33.321 9.030   1.00 37.42  ? 5    SER B CA   1 
ATOM   4830  C  C    . SER B 1 5   ? -4.493  32.723 8.872   1.00 28.43  ? 5    SER B C    1 
ATOM   4831  O  O    . SER B 1 5   ? -3.729  32.572 9.832   1.00 24.33  ? 5    SER B O    1 
ATOM   4832  C  CB   . SER B 1 5   ? -6.947  32.379 8.475   1.00 21.68  ? 5    SER B CB   1 
ATOM   4833  O  OG   . SER B 1 5   ? -7.443  32.830 7.216   1.00 41.92  ? 5    SER B OG   1 
ATOM   4834  H  H    . SER B 1 5   ? -6.766  34.971 8.451   1.00 53.61  ? 5    SER B H    1 
ATOM   4835  H  HA   . SER B 1 5   ? -6.062  33.454 9.985   1.00 44.90  ? 5    SER B HA   1 
ATOM   4836  H  HB2  . SER B 1 5   ? -6.565  31.494 8.370   1.00 26.01  ? 5    SER B HB2  1 
ATOM   4837  H  HB3  . SER B 1 5   ? -7.682  32.316 9.104   1.00 26.01  ? 5    SER B HB3  1 
ATOM   4838  H  HG   . SER B 1 5   ? -6.819  32.911 6.690   1.00 62.88  ? 5    SER B HG   1 
ATOM   4839  N  N    . ARG B 1 6   ? -4.202  32.398 7.610   1.00 20.76  ? 6    ARG B N    1 
ATOM   4840  C  CA   . ARG B 1 6   ? -2.854  31.887 7.298   1.00 44.72  ? 6    ARG B CA   1 
ATOM   4841  C  C    . ARG B 1 6   ? -2.476  32.261 5.886   1.00 44.15  ? 6    ARG B C    1 
ATOM   4842  O  O    . ARG B 1 6   ? -2.623  31.633 4.841   1.00 26.12  ? 6    ARG B O    1 
ATOM   4843  C  CB   . ARG B 1 6   ? -2.810  30.383 7.577   1.00 48.98  ? 6    ARG B CB   1 
ATOM   4844  C  CG   . ARG B 1 6   ? -2.510  30.092 9.050   1.00 37.43  ? 6    ARG B CG   1 
ATOM   4845  C  CD   . ARG B 1 6   ? -1.068  30.443 9.382   1.00 56.72  ? 6    ARG B CD   1 
ATOM   4846  N  NE   . ARG B 1 6   ? -0.858  30.695 10.806  1.00 62.91  ? 6    ARG B NE   1 
ATOM   4847  C  CZ   . ARG B 1 6   ? -1.019  31.877 11.389  1.00 57.64  ? 6    ARG B CZ   1 
ATOM   4848  N  NH1  . ARG B 1 6   ? -1.403  32.921 10.667  1.00 35.04  ? 6    ARG B NH1  1 
ATOM   4849  N  NH2  . ARG B 1 6   ? -0.808  32.041 12.688  1.00 54.93  ? 6    ARG B NH2  1 
ATOM   4850  H  H    . ARG B 1 6   ? -4.790  32.486 6.989   1.00 24.92  ? 6    ARG B H    1 
ATOM   4851  H  HA   . ARG B 1 6   ? -2.220  32.324 7.904   1.00 53.66  ? 6    ARG B HA   1 
ATOM   4852  H  HB2  . ARG B 1 6   ? -3.663  29.988 7.339   1.00 58.78  ? 6    ARG B HB2  1 
ATOM   4853  H  HB3  . ARG B 1 6   ? -2.126  29.975 7.023   1.00 58.78  ? 6    ARG B HB3  1 
ATOM   4854  H  HG2  . ARG B 1 6   ? -3.107  30.611 9.612   1.00 44.91  ? 6    ARG B HG2  1 
ATOM   4855  H  HG3  . ARG B 1 6   ? -2.665  29.152 9.233   1.00 44.91  ? 6    ARG B HG3  1 
ATOM   4856  H  HD2  . ARG B 1 6   ? -0.493  29.714 9.102   1.00 68.06  ? 6    ARG B HD2  1 
ATOM   4857  H  HD3  . ARG B 1 6   ? -0.811  31.232 8.880   1.00 68.06  ? 6    ARG B HD3  1 
ATOM   4858  H  HE   . ARG B 1 6   ? -0.613  30.035 11.299  1.00 75.49  ? 6    ARG B HE   1 
ATOM   4859  H  HH11 . ARG B 1 6   ? -1.511  33.687 11.043  1.00 42.05  ? 6    ARG B HH11 1 
ATOM   4860  H  HH12 . ARG B 1 6   ? -1.544  32.831 9.824   1.00 42.05  ? 6    ARG B HH12 1 
ATOM   4861  H  HH21 . ARG B 1 6   ? -0.921  32.814 13.048  1.00 65.92  ? 6    ARG B HH21 1 
ATOM   4862  H  HH22 . ARG B 1 6   ? -0.559  31.374 13.171  1.00 65.92  ? 6    ARG B HH22 1 
ATOM   4863  N  N    . THR B 1 7   ? -1.939  33.490 5.757   1.00 36.61  ? 7    THR B N    1 
ATOM   4864  C  CA   . THR B 1 7   ? -1.732  33.892 4.357   1.00 27.28  ? 7    THR B CA   1 
ATOM   4865  C  C    . THR B 1 7   ? -0.565  33.155 3.716   1.00 25.24  ? 7    THR B C    1 
ATOM   4866  O  O    . THR B 1 7   ? 0.298   32.595 4.414   1.00 17.67  ? 7    THR B O    1 
ATOM   4867  C  CB   . THR B 1 7   ? -1.595  35.428 4.427   1.00 26.63  ? 7    THR B CB   1 
ATOM   4868  O  OG1  . THR B 1 7   ? -2.837  35.900 4.987   1.00 70.07  ? 7    THR B OG1  1 
ATOM   4869  C  CG2  . THR B 1 7   ? -1.447  36.115 3.091   1.00 56.76  ? 7    THR B CG2  1 
ATOM   4870  H  H    . THR B 1 7   ? -1.738  33.990 6.427   1.00 43.93  ? 7    THR B H    1 
ATOM   4871  H  HA   . THR B 1 7   ? -2.544  33.679 3.853   1.00 32.73  ? 7    THR B HA   1 
ATOM   4872  H  HB   . THR B 1 7   ? -0.849  35.671 5.014   1.00 31.95  ? 7    THR B HB   1 
ATOM   4873  H  HG1  . THR B 1 7   ? -3.190  36.425 4.465   1.00 105.11 ? 7    THR B HG1  1 
ATOM   4874  H  HG21 . THR B 1 7   ? -1.374  37.063 3.225   1.00 85.14  ? 7    THR B HG21 1 
ATOM   4875  H  HG22 . THR B 1 7   ? -2.215  35.927 2.547   1.00 85.14  ? 7    THR B HG22 1 
ATOM   4876  H  HG23 . THR B 1 7   ? -0.656  35.792 2.652   1.00 85.14  ? 7    THR B HG23 1 
ATOM   4877  N  N    . ILE B 1 8   ? -0.548  33.183 2.386   1.00 21.65  ? 8    ILE B N    1 
ATOM   4878  C  CA   . ILE B 1 8   ? 0.493   32.598 1.559   1.00 16.20  ? 8    ILE B CA   1 
ATOM   4879  C  C    . ILE B 1 8   ? 1.155   33.588 0.610   1.00 20.45  ? 8    ILE B C    1 
ATOM   4880  O  O    . ILE B 1 8   ? 0.483   34.474 0.077   1.00 20.52  ? 8    ILE B O    1 
ATOM   4881  C  CB   . ILE B 1 8   ? -0.116  31.474 0.704   1.00 22.35  ? 8    ILE B CB   1 
ATOM   4882  C  CG1  . ILE B 1 8   ? -0.934  30.541 1.595   1.00 21.52  ? 8    ILE B CG1  1 
ATOM   4883  C  CG2  . ILE B 1 8   ? 0.928   30.712 -0.092  1.00 18.96  ? 8    ILE B CG2  1 
ATOM   4884  C  CD1  . ILE B 1 8   ? -1.524  29.378 0.841   1.00 16.18  ? 8    ILE B CD1  1 
ATOM   4885  H  H    . ILE B 1 8   ? -1.201  33.576 1.987   1.00 25.97  ? 8    ILE B H    1 
ATOM   4886  H  HA   . ILE B 1 8   ? 1.180   32.213 2.143   1.00 19.44  ? 8    ILE B HA   1 
ATOM   4887  H  HB   . ILE B 1 8   ? -0.731  31.889 0.064   1.00 26.82  ? 8    ILE B HB   1 
ATOM   4888  H  HG12 . ILE B 1 8   ? -0.366  30.202 2.304   1.00 25.83  ? 8    ILE B HG12 1 
ATOM   4889  H  HG13 . ILE B 1 8   ? -1.652  31.047 2.007   1.00 25.83  ? 8    ILE B HG13 1 
ATOM   4890  H  HG21 . ILE B 1 8   ? 1.428   31.326 -0.635  1.00 28.43  ? 8    ILE B HG21 1 
ATOM   4891  H  HG22 . ILE B 1 8   ? 0.493   30.067 -0.655  1.00 28.43  ? 8    ILE B HG22 1 
ATOM   4892  H  HG23 . ILE B 1 8   ? 1.522   30.259 0.511   1.00 28.43  ? 8    ILE B HG23 1 
ATOM   4893  H  HD11 . ILE B 1 8   ? -2.021  28.823 1.446   1.00 24.27  ? 8    ILE B HD11 1 
ATOM   4894  H  HD12 . ILE B 1 8   ? -0.818  28.864 0.442   1.00 24.27  ? 8    ILE B HD12 1 
ATOM   4895  H  HD13 . ILE B 1 8   ? -2.109  29.706 0.154   1.00 24.27  ? 8    ILE B HD13 1 
ATOM   4896  N  N    . GLY B 1 9   ? 2.442   33.422 0.388   1.00 16.18  ? 9    GLY B N    1 
ATOM   4897  C  CA   . GLY B 1 9   ? 3.203   34.236 -0.541  1.00 19.12  ? 9    GLY B CA   1 
ATOM   4898  C  C    . GLY B 1 9   ? 3.930   33.260 -1.466  1.00 14.00  ? 9    GLY B C    1 
ATOM   4899  O  O    . GLY B 1 9   ? 4.858   32.578 -1.046  1.00 17.70  ? 9    GLY B O    1 
ATOM   4900  H  H    . GLY B 1 9   ? 2.852   32.800 0.816   1.00 19.42  ? 9    GLY B H    1 
ATOM   4901  H  HA2  . GLY B 1 9   ? 2.613   34.811 -1.052  1.00 22.95  ? 9    GLY B HA2  1 
ATOM   4902  H  HA3  . GLY B 1 9   ? 3.841   34.790 -0.064  1.00 22.95  ? 9    GLY B HA3  1 
ATOM   4903  N  N    . ILE B 1 10  ? 3.502   33.170 -2.700  1.00 18.30  ? 10   ILE B N    1 
ATOM   4904  C  CA   . ILE B 1 10  ? 4.091   32.318 -3.703  1.00 15.78  ? 10   ILE B CA   1 
ATOM   4905  C  C    . ILE B 1 10  ? 5.336   32.987 -4.327  1.00 20.72  ? 10   ILE B C    1 
ATOM   4906  O  O    . ILE B 1 10  ? 5.234   34.179 -4.645  1.00 21.53  ? 10   ILE B O    1 
ATOM   4907  C  CB   . ILE B 1 10  ? 3.182   32.015 -4.910  1.00 18.50  ? 10   ILE B CB   1 
ATOM   4908  C  CG1  . ILE B 1 10  ? 1.712   31.726 -4.552  1.00 36.77  ? 10   ILE B CG1  1 
ATOM   4909  C  CG2  . ILE B 1 10  ? 3.764   30.927 -5.791  1.00 22.90  ? 10   ILE B CG2  1 
ATOM   4910  C  CD1  . ILE B 1 10  ? 1.421   30.312 -4.116  1.00 30.87  ? 10   ILE B CD1  1 
ATOM   4911  H  H    . ILE B 1 10  ? 2.826   33.650 -2.927  1.00 21.96  ? 10   ILE B H    1 
ATOM   4912  H  HA   . ILE B 1 10  ? 4.359   31.473 -3.286  1.00 18.93  ? 10   ILE B HA   1 
ATOM   4913  H  HB   . ILE B 1 10  ? 3.174   32.830 -5.455  1.00 22.20  ? 10   ILE B HB   1 
ATOM   4914  H  HG12 . ILE B 1 10  ? 1.446   32.328 -3.839  1.00 44.13  ? 10   ILE B HG12 1 
ATOM   4915  H  HG13 . ILE B 1 10  ? 1.163   31.929 -5.324  1.00 44.13  ? 10   ILE B HG13 1 
ATOM   4916  H  HG21 . ILE B 1 10  ? 4.667   31.153 -6.025  1.00 34.36  ? 10   ILE B HG21 1 
ATOM   4917  H  HG22 . ILE B 1 10  ? 3.237   30.847 -6.590  1.00 34.36  ? 10   ILE B HG22 1 
ATOM   4918  H  HG23 . ILE B 1 10  ? 3.755   30.092 -5.317  1.00 34.36  ? 10   ILE B HG23 1 
ATOM   4919  H  HD11 . ILE B 1 10  ? 0.514   30.252 -3.809  1.00 46.30  ? 10   ILE B HD11 1 
ATOM   4920  H  HD12 . ILE B 1 10  ? 2.017   30.067 -3.404  1.00 46.30  ? 10   ILE B HD12 1 
ATOM   4921  H  HD13 . ILE B 1 10  ? 1.548   29.716 -4.858  1.00 46.30  ? 10   ILE B HD13 1 
ATOM   4922  N  N    . ILE B 1 11  ? 6.388   32.220 -4.525  1.00 15.96  ? 11   ILE B N    1 
ATOM   4923  C  CA   . ILE B 1 11  ? 7.665   32.599 -5.123  1.00 14.34  ? 11   ILE B CA   1 
ATOM   4924  C  C    . ILE B 1 11  ? 7.960   31.579 -6.191  1.00 13.89  ? 11   ILE B C    1 
ATOM   4925  O  O    . ILE B 1 11  ? 8.128   30.377 -5.914  1.00 15.14  ? 11   ILE B O    1 
ATOM   4926  C  CB   . ILE B 1 11  ? 8.837   32.685 -4.131  1.00 14.04  ? 11   ILE B CB   1 
ATOM   4927  C  CG1  . ILE B 1 11  ? 8.510   33.536 -2.887  1.00 18.17  ? 11   ILE B CG1  1 
ATOM   4928  C  CG2  . ILE B 1 11  ? 10.152  33.114 -4.791  1.00 20.72  ? 11   ILE B CG2  1 
ATOM   4929  C  CD1  . ILE B 1 11  ? 9.571   33.459 -1.814  1.00 17.78  ? 11   ILE B CD1  1 
ATOM   4930  H  H    . ILE B 1 11  ? 6.314   31.400 -4.274  1.00 19.15  ? 11   ILE B H    1 
ATOM   4931  H  HA   . ILE B 1 11  ? 7.558   33.474 -5.552  1.00 17.21  ? 11   ILE B HA   1 
ATOM   4932  H  HB   . ILE B 1 11  ? 8.983   31.772 -3.804  1.00 16.84  ? 11   ILE B HB   1 
ATOM   4933  H  HG12 . ILE B 1 11  ? 8.404   34.462 -3.158  1.00 21.80  ? 11   ILE B HG12 1 
ATOM   4934  H  HG13 . ILE B 1 11  ? 7.665   33.239 -2.516  1.00 21.80  ? 11   ILE B HG13 1 
ATOM   4935  H  HG21 . ILE B 1 11  ? 10.846  33.149 -4.128  1.00 31.08  ? 11   ILE B HG21 1 
ATOM   4936  H  HG22 . ILE B 1 11  ? 10.043  33.982 -5.186  1.00 31.08  ? 11   ILE B HG22 1 
ATOM   4937  H  HG23 . ILE B 1 11  ? 10.391  32.480 -5.471  1.00 31.08  ? 11   ILE B HG23 1 
ATOM   4938  H  HD11 . ILE B 1 11  ? 9.319   34.016 -1.074  1.00 26.66  ? 11   ILE B HD11 1 
ATOM   4939  H  HD12 . ILE B 1 11  ? 10.410  33.761 -2.170  1.00 26.66  ? 11   ILE B HD12 1 
ATOM   4940  H  HD13 . ILE B 1 11  ? 9.658   32.551 -1.515  1.00 26.66  ? 11   ILE B HD13 1 
ATOM   4941  N  N    . GLY B 1 12  ? 8.040   31.932 -7.475  1.00 17.21  ? 12   GLY B N    1 
ATOM   4942  C  CA   . GLY B 1 12  ? 8.515   30.932 -8.419  1.00 14.37  ? 12   GLY B CA   1 
ATOM   4943  C  C    . GLY B 1 12  ? 10.049  30.978 -8.497  1.00 14.31  ? 12   GLY B C    1 
ATOM   4944  O  O    . GLY B 1 12  ? 10.603  32.082 -8.507  1.00 15.78  ? 12   GLY B O    1 
ATOM   4945  H  H    . GLY B 1 12  ? 7.820   32.722 -7.734  1.00 20.65  ? 12   GLY B H    1 
ATOM   4946  H  HA2  . GLY B 1 12  ? 8.228   30.050 -8.134  1.00 17.24  ? 12   GLY B HA2  1 
ATOM   4947  H  HA3  . GLY B 1 12  ? 8.137   31.104 -9.296  1.00 17.24  ? 12   GLY B HA3  1 
ATOM   4948  N  N    . ALA B 1 13  ? 10.701  29.818 -8.526  1.00 15.42  ? 13   ALA B N    1 
ATOM   4949  C  CA   . ALA B 1 13  ? 12.150  29.710 -8.681  1.00 15.71  ? 13   ALA B CA   1 
ATOM   4950  C  C    . ALA B 1 13  ? 12.523  28.791 -9.828  1.00 19.09  ? 13   ALA B C    1 
ATOM   4951  O  O    . ALA B 1 13  ? 12.945  27.649 -9.668  1.00 17.29  ? 13   ALA B O    1 
ATOM   4952  C  CB   . ALA B 1 13  ? 12.775  29.257 -7.357  1.00 18.29  ? 13   ALA B CB   1 
ATOM   4953  H  H    . ALA B 1 13  ? 10.245  29.093 -8.449  1.00 18.51  ? 13   ALA B H    1 
ATOM   4954  H  HA   . ALA B 1 13  ? 12.498  30.603 -8.886  1.00 18.85  ? 13   ALA B HA   1 
ATOM   4955  H  HB1  . ALA B 1 13  ? 12.518  29.862 -6.658  1.00 27.44  ? 13   ALA B HB1  1 
ATOM   4956  H  HB2  . ALA B 1 13  ? 13.732  29.251 -7.440  1.00 27.44  ? 13   ALA B HB2  1 
ATOM   4957  H  HB3  . ALA B 1 13  ? 12.467  28.373 -7.144  1.00 27.44  ? 13   ALA B HB3  1 
ATOM   4958  N  N    . PRO B 1 14  ? 12.385  29.294 -11.063 1.00 18.67  ? 14   PRO B N    1 
ATOM   4959  C  CA   . PRO B 1 14  ? 12.709  28.531 -12.272 1.00 17.02  ? 14   PRO B CA   1 
ATOM   4960  C  C    . PRO B 1 14  ? 14.208  28.389 -12.514 1.00 21.88  ? 14   PRO B C    1 
ATOM   4961  O  O    . PRO B 1 14  ? 14.799  29.076 -13.380 1.00 19.50  ? 14   PRO B O    1 
ATOM   4962  C  CB   . PRO B 1 14  ? 12.141  29.410 -13.402 1.00 15.39  ? 14   PRO B CB   1 
ATOM   4963  C  CG   . PRO B 1 14  ? 12.328  30.767 -12.850 1.00 18.53  ? 14   PRO B CG   1 
ATOM   4964  C  CD   . PRO B 1 14  ? 11.918  30.652 -11.395 1.00 19.22  ? 14   PRO B CD   1 
ATOM   4965  H  HA   . PRO B 1 14  ? 12.273  27.653 -12.259 1.00 20.42  ? 14   PRO B HA   1 
ATOM   4966  H  HB2  . PRO B 1 14  ? 12.638  29.291 -14.226 1.00 18.47  ? 14   PRO B HB2  1 
ATOM   4967  H  HB3  . PRO B 1 14  ? 11.204  29.218 -13.562 1.00 18.47  ? 14   PRO B HB3  1 
ATOM   4968  H  HG2  . PRO B 1 14  ? 13.254  31.045 -12.927 1.00 22.24  ? 14   PRO B HG2  1 
ATOM   4969  H  HG3  . PRO B 1 14  ? 11.768  31.408 -13.316 1.00 22.24  ? 14   PRO B HG3  1 
ATOM   4970  H  HD2  . PRO B 1 14  ? 12.358  31.322 -10.848 1.00 23.07  ? 14   PRO B HD2  1 
ATOM   4971  H  HD3  . PRO B 1 14  ? 10.957  30.732 -11.289 1.00 23.07  ? 14   PRO B HD3  1 
ATOM   4972  N  N    . PHE B 1 15  ? 14.834  27.520 -11.740 1.00 16.99  ? 15   PHE B N    1 
ATOM   4973  C  CA   . PHE B 1 15  ? 16.273  27.313 -11.729 1.00 18.71  ? 15   PHE B CA   1 
ATOM   4974  C  C    . PHE B 1 15  ? 16.686  25.847 -11.841 1.00 18.89  ? 15   PHE B C    1 
ATOM   4975  O  O    . PHE B 1 15  ? 16.079  25.019 -11.137 1.00 20.87  ? 15   PHE B O    1 
ATOM   4976  C  CB   . PHE B 1 15  ? 16.839  27.874 -10.424 1.00 18.60  ? 15   PHE B CB   1 
ATOM   4977  C  CG   . PHE B 1 15  ? 18.347  27.753 -10.343 1.00 15.05  ? 15   PHE B CG   1 
ATOM   4978  C  CD1  . PHE B 1 15  ? 19.135  28.648 -11.069 1.00 19.45  ? 15   PHE B CD1  1 
ATOM   4979  C  CD2  . PHE B 1 15  ? 18.958  26.773 -9.591  1.00 16.33  ? 15   PHE B CD2  1 
ATOM   4980  C  CE1  . PHE B 1 15  ? 20.506  28.534 -11.015 1.00 15.44  ? 15   PHE B CE1  1 
ATOM   4981  C  CE2  . PHE B 1 15  ? 20.325  26.658 -9.519  1.00 15.20  ? 15   PHE B CE2  1 
ATOM   4982  C  CZ   . PHE B 1 15  ? 21.098  27.544 -10.246 1.00 21.39  ? 15   PHE B CZ   1 
ATOM   4983  H  H    . PHE B 1 15  ? 14.357  27.044 -11.206 1.00 20.39  ? 15   PHE B H    1 
ATOM   4984  H  HA   . PHE B 1 15  ? 16.666  27.807 -12.478 1.00 22.46  ? 15   PHE B HA   1 
ATOM   4985  H  HB2  . PHE B 1 15  ? 16.592  28.809 -10.347 1.00 22.32  ? 15   PHE B HB2  1 
ATOM   4986  H  HB3  . PHE B 1 15  ? 16.443  27.400 -9.677  1.00 22.32  ? 15   PHE B HB3  1 
ATOM   4987  H  HD1  . PHE B 1 15  ? 18.739  29.313 -11.584 1.00 23.34  ? 15   PHE B HD1  1 
ATOM   4988  H  HD2  . PHE B 1 15  ? 18.429  26.172 -9.118  1.00 19.60  ? 15   PHE B HD2  1 
ATOM   4989  H  HE1  . PHE B 1 15  ? 21.038  29.124 -11.497 1.00 18.53  ? 15   PHE B HE1  1 
ATOM   4990  H  HE2  . PHE B 1 15  ? 20.720  26.000 -8.994  1.00 18.24  ? 15   PHE B HE2  1 
ATOM   4991  H  HZ   . PHE B 1 15  ? 22.025  27.476 -10.218 1.00 25.67  ? 15   PHE B HZ   1 
ATOM   4992  N  N    . SER B 1 16  ? 17.672  25.529 -12.686 1.00 19.27  ? 16   SER B N    1 
ATOM   4993  C  CA   . SER B 1 16  ? 18.021  24.150 -12.910 1.00 14.32  ? 16   SER B CA   1 
ATOM   4994  C  C    . SER B 1 16  ? 19.496  23.798 -12.668 1.00 13.90  ? 16   SER B C    1 
ATOM   4995  O  O    . SER B 1 16  ? 19.857  22.619 -12.749 1.00 13.61  ? 16   SER B O    1 
ATOM   4996  C  CB   . SER B 1 16  ? 17.664  23.661 -14.328 1.00 19.55  ? 16   SER B CB   1 
ATOM   4997  O  OG   . SER B 1 16  ? 18.476  24.370 -15.299 1.00 16.86  ? 16   SER B OG   1 
ATOM   4998  H  H    . SER B 1 16  ? 18.100  26.151 -13.097 1.00 23.12  ? 16   SER B H    1 
ATOM   4999  H  HA   . SER B 1 16  ? 17.492  23.616 -12.281 1.00 17.18  ? 16   SER B HA   1 
ATOM   5000  H  HB2  . SER B 1 16  ? 17.826  22.707 -14.397 1.00 23.46  ? 16   SER B HB2  1 
ATOM   5001  H  HB3  . SER B 1 16  ? 16.724  23.824 -14.505 1.00 23.46  ? 16   SER B HB3  1 
ATOM   5002  H  HG   . SER B 1 16  ? 18.337  25.175 -15.236 1.00 25.28  ? 16   SER B HG   1 
ATOM   5003  N  N    . LYS B 1 17  ? 20.371  24.743 -12.404 1.00 14.65  ? 17   LYS B N    1 
ATOM   5004  C  CA   . LYS B 1 17  ? 21.797  24.505 -12.437 1.00 14.97  ? 17   LYS B CA   1 
ATOM   5005  C  C    . LYS B 1 17  ? 22.364  23.789 -11.230 1.00 17.35  ? 17   LYS B C    1 
ATOM   5006  O  O    . LYS B 1 17  ? 23.560  23.486 -11.225 1.00 16.95  ? 17   LYS B O    1 
ATOM   5007  C  CB   . LYS B 1 17  ? 22.554  25.819 -12.693 1.00 14.16  ? 17   LYS B CB   1 
ATOM   5008  C  CG   . LYS B 1 17  ? 22.329  26.352 -14.116 1.00 24.75  ? 17   LYS B CG   1 
ATOM   5009  C  CD   . LYS B 1 17  ? 23.008  27.694 -14.322 1.00 36.93  ? 17   LYS B CD   1 
ATOM   5010  C  CE   . LYS B 1 17  ? 22.913  28.176 -15.762 1.00 44.14  ? 17   LYS B CE   1 
ATOM   5011  N  NZ   . LYS B 1 17  ? 23.600  29.485 -15.966 1.00 38.30  ? 17   LYS B NZ   1 
ATOM   5012  H  H    . LYS B 1 17  ? 20.086  25.530 -12.205 1.00 17.58  ? 17   LYS B H    1 
ATOM   5013  H  HA   . LYS B 1 17  ? 21.967  23.928 -13.211 1.00 17.96  ? 17   LYS B HA   1 
ATOM   5014  H  HB2  . LYS B 1 17  ? 22.260  26.486 -12.053 1.00 16.99  ? 17   LYS B HB2  1 
ATOM   5015  H  HB3  . LYS B 1 17  ? 23.503  25.671 -12.554 1.00 16.99  ? 17   LYS B HB3  1 
ATOM   5016  H  HG2  . LYS B 1 17  ? 22.679  25.713 -14.757 1.00 29.70  ? 17   LYS B HG2  1 
ATOM   5017  H  HG3  . LYS B 1 17  ? 21.377  26.446 -14.277 1.00 29.70  ? 17   LYS B HG3  1 
ATOM   5018  H  HD2  . LYS B 1 17  ? 22.597  28.351 -13.740 1.00 44.31  ? 17   LYS B HD2  1 
ATOM   5019  H  HD3  . LYS B 1 17  ? 23.943  27.619 -14.073 1.00 44.31  ? 17   LYS B HD3  1 
ATOM   5020  H  HE2  . LYS B 1 17  ? 23.312  27.512 -16.346 1.00 52.97  ? 17   LYS B HE2  1 
ATOM   5021  H  HE3  . LYS B 1 17  ? 21.979  28.265 -16.006 1.00 52.97  ? 17   LYS B HE3  1 
ATOM   5022  H  HZ1  . LYS B 1 17  ? 23.546  29.718 -16.823 1.00 57.45  ? 17   LYS B HZ1  1 
ATOM   5023  H  HZ2  . LYS B 1 17  ? 24.456  29.411 -15.733 1.00 57.45  ? 17   LYS B HZ2  1 
ATOM   5024  H  HZ3  . LYS B 1 17  ? 23.209  30.107 -15.464 1.00 57.45  ? 17   LYS B HZ3  1 
ATOM   5025  N  N    . GLY B 1 18  ? 21.531  23.406 -10.246 1.00 14.34  ? 18   GLY B N    1 
ATOM   5026  C  CA   . GLY B 1 18  ? 21.991  22.417 -9.276  1.00 14.66  ? 18   GLY B CA   1 
ATOM   5027  C  C    . GLY B 1 18  ? 22.055  21.010 -9.758  1.00 13.12  ? 18   GLY B C    1 
ATOM   5028  O  O    . GLY B 1 18  ? 22.404  20.050 -9.032  1.00 15.92  ? 18   GLY B O    1 
ATOM   5029  H  H    . GLY B 1 18  ? 20.741  23.740 -10.188 1.00 17.21  ? 18   GLY B H    1 
ATOM   5030  H  HA2  . GLY B 1 18  ? 22.875  22.676 -8.973  1.00 17.60  ? 18   GLY B HA2  1 
ATOM   5031  H  HA3  . GLY B 1 18  ? 21.400  22.448 -8.507  1.00 17.60  ? 18   GLY B HA3  1 
ATOM   5032  N  N    . GLN B 1 19  ? 21.705  20.753 -11.033 1.00 14.00  ? 19   GLN B N    1 
ATOM   5033  C  CA   . GLN B 1 19  ? 21.700  19.401 -11.541 1.00 13.88  ? 19   GLN B CA   1 
ATOM   5034  C  C    . GLN B 1 19  ? 21.714  19.442 -13.081 1.00 17.80  ? 19   GLN B C    1 
ATOM   5035  O  O    . GLN B 1 19  ? 21.551  20.538 -13.602 1.00 15.70  ? 19   GLN B O    1 
ATOM   5036  C  CB   . GLN B 1 19  ? 20.494  18.616 -11.036 1.00 16.07  ? 19   GLN B CB   1 
ATOM   5037  C  CG   . GLN B 1 19  ? 19.140  19.293 -11.072 1.00 13.57  ? 19   GLN B CG   1 
ATOM   5038  C  CD   . GLN B 1 19  ? 18.493  19.089 -12.433 1.00 16.49  ? 19   GLN B CD   1 
ATOM   5039  O  OE1  . GLN B 1 19  ? 18.104  17.985 -12.803 1.00 15.59  ? 19   GLN B OE1  1 
ATOM   5040  N  NE2  . GLN B 1 19  ? 18.392  20.170 -13.191 1.00 19.54  ? 19   GLN B NE2  1 
ATOM   5041  H  H    . GLN B 1 19  ? 21.481  21.402 -11.551 1.00 16.80  ? 19   GLN B H    1 
ATOM   5042  H  HA   . GLN B 1 19  ? 22.515  18.950 -11.234 1.00 16.66  ? 19   GLN B HA   1 
ATOM   5043  H  HB2  . GLN B 1 19  ? 20.432  17.800 -11.557 1.00 19.29  ? 19   GLN B HB2  1 
ATOM   5044  H  HB3  . GLN B 1 19  ? 20.671  18.356 -10.118 1.00 19.29  ? 19   GLN B HB3  1 
ATOM   5045  H  HG2  . GLN B 1 19  ? 18.571  18.921 -10.381 1.00 16.28  ? 19   GLN B HG2  1 
ATOM   5046  H  HG3  . GLN B 1 19  ? 19.246  20.242 -10.900 1.00 16.28  ? 19   GLN B HG3  1 
ATOM   5047  H  HE21 . GLN B 1 19  ? 18.042  20.113 -13.975 1.00 23.45  ? 19   GLN B HE21 1 
ATOM   5048  H  HE22 . GLN B 1 19  ? 18.675  20.928 -12.900 1.00 23.45  ? 19   GLN B HE22 1 
ATOM   5049  N  N    . PRO B 1 20  ? 21.966  18.353 -13.758 1.00 18.12  ? 20   PRO B N    1 
ATOM   5050  C  CA   . PRO B 1 20  ? 22.163  18.455 -15.227 1.00 20.36  ? 20   PRO B CA   1 
ATOM   5051  C  C    . PRO B 1 20  ? 20.962  18.688 -16.130 1.00 16.47  ? 20   PRO B C    1 
ATOM   5052  O  O    . PRO B 1 20  ? 21.204  19.210 -17.252 1.00 17.31  ? 20   PRO B O    1 
ATOM   5053  C  CB   . PRO B 1 20  ? 22.773  17.082 -15.568 1.00 18.30  ? 20   PRO B CB   1 
ATOM   5054  C  CG   . PRO B 1 20  ? 23.288  16.508 -14.280 1.00 17.01  ? 20   PRO B CG   1 
ATOM   5055  C  CD   . PRO B 1 20  ? 22.299  17.012 -13.267 1.00 14.92  ? 20   PRO B CD   1 
ATOM   5056  H  HA   . PRO B 1 20  ? 22.831  19.149 -15.407 1.00 24.43  ? 20   PRO B HA   1 
ATOM   5057  H  HB2  . PRO B 1 20  ? 22.100  16.500 -15.953 1.00 21.96  ? 20   PRO B HB2  1 
ATOM   5058  H  HB3  . PRO B 1 20  ? 23.496  17.183 -16.206 1.00 21.96  ? 20   PRO B HB3  1 
ATOM   5059  H  HG2  . PRO B 1 20  ? 23.297  15.538 -14.308 1.00 20.41  ? 20   PRO B HG2  1 
ATOM   5060  H  HG3  . PRO B 1 20  ? 24.183  16.828 -14.086 1.00 20.41  ? 20   PRO B HG3  1 
ATOM   5061  H  HD2  . PRO B 1 20  ? 21.512  16.446 -13.236 1.00 17.91  ? 20   PRO B HD2  1 
ATOM   5062  H  HD3  . PRO B 1 20  ? 22.696  17.053 -12.383 1.00 17.91  ? 20   PRO B HD3  1 
ATOM   5063  N  N    . ARG B 1 21  ? 19.747  18.345 -15.734 1.00 16.76  ? 21   ARG B N    1 
ATOM   5064  C  CA   . ARG B 1 21  ? 18.586  18.419 -16.665 1.00 13.97  ? 21   ARG B CA   1 
ATOM   5065  C  C    . ARG B 1 21  ? 17.867  19.731 -16.601 1.00 16.33  ? 21   ARG B C    1 
ATOM   5066  O  O    . ARG B 1 21  ? 17.318  20.171 -15.576 1.00 15.56  ? 21   ARG B O    1 
ATOM   5067  C  CB   . ARG B 1 21  ? 17.710  17.211 -16.329 1.00 13.94  ? 21   ARG B CB   1 
ATOM   5068  C  CG   . ARG B 1 21  ? 18.421  15.889 -16.540 1.00 16.85  ? 21   ARG B CG   1 
ATOM   5069  C  CD   . ARG B 1 21  ? 17.672  14.782 -15.797 1.00 27.85  ? 21   ARG B CD   1 
ATOM   5070  N  NE   . ARG B 1 21  ? 17.963  14.958 -14.355 1.00 19.37  ? 21   ARG B NE   1 
ATOM   5071  C  CZ   . ARG B 1 21  ? 19.067  14.461 -13.819 1.00 19.09  ? 21   ARG B CZ   1 
ATOM   5072  N  NH1  . ARG B 1 21  ? 19.990  13.781 -14.499 1.00 21.64  ? 21   ARG B NH1  1 
ATOM   5073  N  NH2  . ARG B 1 21  ? 19.294  14.635 -12.519 1.00 20.37  ? 21   ARG B NH2  1 
ATOM   5074  H  H    . ARG B 1 21  ? 19.625  18.076 -14.926 1.00 20.11  ? 21   ARG B H    1 
ATOM   5075  H  HA   . ARG B 1 21  ? 18.923  18.304 -17.578 1.00 16.76  ? 21   ARG B HA   1 
ATOM   5076  H  HB2  . ARG B 1 21  ? 17.428  17.274 -15.403 1.00 16.73  ? 21   ARG B HB2  1 
ATOM   5077  H  HB3  . ARG B 1 21  ? 16.914  17.234 -16.884 1.00 16.73  ? 21   ARG B HB3  1 
ATOM   5078  H  HG2  . ARG B 1 21  ? 18.455  15.682 -17.488 1.00 20.22  ? 21   ARG B HG2  1 
ATOM   5079  H  HG3  . ARG B 1 21  ? 19.331  15.949 -16.210 1.00 20.22  ? 21   ARG B HG3  1 
ATOM   5080  H  HD2  . ARG B 1 21  ? 16.718  14.853 -15.960 1.00 33.41  ? 21   ARG B HD2  1 
ATOM   5081  H  HD3  . ARG B 1 21  ? 17.973  13.911 -16.098 1.00 33.41  ? 21   ARG B HD3  1 
ATOM   5082  H  HE   . ARG B 1 21  ? 17.407  15.388 -13.859 1.00 23.25  ? 21   ARG B HE   1 
ATOM   5083  H  HH11 . ARG B 1 21  ? 19.887  13.641 -15.341 1.00 25.96  ? 21   ARG B HH11 1 
ATOM   5084  H  HH12 . ARG B 1 21  ? 20.688  13.483 -14.095 1.00 25.96  ? 21   ARG B HH12 1 
ATOM   5085  H  HH21 . ARG B 1 21  ? 18.726  15.066 -12.037 1.00 24.44  ? 21   ARG B HH21 1 
ATOM   5086  H  HH22 . ARG B 1 21  ? 20.008  14.317 -12.160 1.00 24.44  ? 21   ARG B HH22 1 
ATOM   5087  N  N    . GLY B 1 22  ? 17.831  20.517 -17.691 1.00 18.14  ? 22   GLY B N    1 
ATOM   5088  C  CA   . GLY B 1 22  ? 17.280  21.859 -17.579 1.00 19.53  ? 22   GLY B CA   1 
ATOM   5089  C  C    . GLY B 1 22  ? 15.801  22.055 -17.349 1.00 13.69  ? 22   GLY B C    1 
ATOM   5090  O  O    . GLY B 1 22  ? 15.347  23.142 -16.997 1.00 16.47  ? 22   GLY B O    1 
ATOM   5091  H  H    . GLY B 1 22  ? 18.130  20.231 -18.445 1.00 21.76  ? 22   GLY B H    1 
ATOM   5092  H  HA2  . GLY B 1 22  ? 17.746  22.302 -16.853 1.00 23.44  ? 22   GLY B HA2  1 
ATOM   5093  H  HA3  . GLY B 1 22  ? 17.510  22.334 -18.393 1.00 23.44  ? 22   GLY B HA3  1 
ATOM   5094  N  N    . GLY B 1 23  ? 14.974  21.031 -17.575 1.00 18.03  ? 23   GLY B N    1 
ATOM   5095  C  CA   . GLY B 1 23  ? 13.540  21.277 -17.619 1.00 19.62  ? 23   GLY B CA   1 
ATOM   5096  C  C    . GLY B 1 23  ? 12.839  21.430 -16.293 1.00 22.24  ? 23   GLY B C    1 
ATOM   5097  O  O    . GLY B 1 23  ? 11.650  21.770 -16.221 1.00 17.44  ? 23   GLY B O    1 
ATOM   5098  H  H    . GLY B 1 23  ? 15.285  20.237 -17.693 1.00 21.64  ? 23   GLY B H    1 
ATOM   5099  H  HA2  . GLY B 1 23  ? 13.388  22.084 -18.136 1.00 23.55  ? 23   GLY B HA2  1 
ATOM   5100  H  HA3  . GLY B 1 23  ? 13.122  20.545 -18.099 1.00 23.55  ? 23   GLY B HA3  1 
ATOM   5101  N  N    . VAL B 1 24  ? 13.516  21.225 -15.167 1.00 14.80  ? 24   VAL B N    1 
ATOM   5102  C  CA   . VAL B 1 24  ? 12.994  21.592 -13.854 1.00 14.04  ? 24   VAL B CA   1 
ATOM   5103  C  C    . VAL B 1 24  ? 12.750  23.079 -13.771 1.00 18.64  ? 24   VAL B C    1 
ATOM   5104  O  O    . VAL B 1 24  ? 12.000  23.557 -12.903 1.00 15.81  ? 24   VAL B O    1 
ATOM   5105  C  CB   . VAL B 1 24  ? 13.991  21.011 -12.818 1.00 18.05  ? 24   VAL B CB   1 
ATOM   5106  C  CG1  . VAL B 1 24  ? 15.196  21.922 -12.666 1.00 14.85  ? 24   VAL B CG1  1 
ATOM   5107  C  CG2  . VAL B 1 24  ? 13.305  20.757 -11.499 1.00 22.82  ? 24   VAL B CG2  1 
ATOM   5108  H  H    . VAL B 1 24  ? 14.294  20.861 -15.214 1.00 17.76  ? 24   VAL B H    1 
ATOM   5109  H  HA   . VAL B 1 24  ? 12.134  21.137 -13.734 1.00 16.84  ? 24   VAL B HA   1 
ATOM   5110  H  HB   . VAL B 1 24  ? 14.309  20.150 -13.159 1.00 21.67  ? 24   VAL B HB   1 
ATOM   5111  H  HG11 . VAL B 1 24  ? 15.606  22.057 -13.524 1.00 22.27  ? 24   VAL B HG11 1 
ATOM   5112  H  HG12 . VAL B 1 24  ? 15.830  21.518 -12.069 1.00 22.27  ? 24   VAL B HG12 1 
ATOM   5113  H  HG13 . VAL B 1 24  ? 14.915  22.768 -12.309 1.00 22.27  ? 24   VAL B HG13 1 
ATOM   5114  H  HG21 . VAL B 1 24  ? 12.559  20.168 -11.634 1.00 34.23  ? 24   VAL B HG21 1 
ATOM   5115  H  HG22 . VAL B 1 24  ? 12.994  21.589 -11.134 1.00 34.23  ? 24   VAL B HG22 1 
ATOM   5116  H  HG23 . VAL B 1 24  ? 13.925  20.353 -10.888 1.00 34.23  ? 24   VAL B HG23 1 
ATOM   5117  N  N    . GLU B 1 25  ? 13.300  23.897 -14.679 1.00 17.21  ? 25   GLU B N    1 
ATOM   5118  C  CA   . GLU B 1 25  ? 12.994  25.298 -14.864 1.00 20.26  ? 25   GLU B CA   1 
ATOM   5119  C  C    . GLU B 1 25  ? 11.509  25.586 -15.125 1.00 13.72  ? 25   GLU B C    1 
ATOM   5120  O  O    . GLU B 1 25  ? 11.058  26.700 -14.785 1.00 17.57  ? 25   GLU B O    1 
ATOM   5121  C  CB   . GLU B 1 25  ? 13.803  25.853 -16.056 1.00 17.24  ? 25   GLU B CB   1 
ATOM   5122  C  CG   . GLU B 1 25  ? 15.220  26.215 -15.624 1.00 27.74  ? 25   GLU B CG   1 
ATOM   5123  C  CD   . GLU B 1 25  ? 16.096  26.520 -16.834 1.00 30.34  ? 25   GLU B CD   1 
ATOM   5124  O  OE1  . GLU B 1 25  ? 15.519  27.166 -17.726 1.00 22.00  ? 25   GLU B OE1  1 
ATOM   5125  O  OE2  . GLU B 1 25  ? 17.269  26.114 -16.883 1.00 54.88  ? 25   GLU B OE2  1 
ATOM   5126  H  H    . GLU B 1 25  ? 13.891  23.556 -15.202 1.00 20.65  ? 25   GLU B H    1 
ATOM   5127  H  HA   . GLU B 1 25  ? 13.265  25.782 -14.056 1.00 24.31  ? 25   GLU B HA   1 
ATOM   5128  H  HB2  . GLU B 1 25  ? 13.840  25.186 -16.760 1.00 20.69  ? 25   GLU B HB2  1 
ATOM   5129  H  HB3  . GLU B 1 25  ? 13.361  26.640 -16.410 1.00 20.69  ? 25   GLU B HB3  1 
ATOM   5130  H  HG2  . GLU B 1 25  ? 15.192  26.991 -15.042 1.00 33.29  ? 25   GLU B HG2  1 
ATOM   5131  H  HG3  . GLU B 1 25  ? 15.605  25.478 -15.124 1.00 33.29  ? 25   GLU B HG3  1 
ATOM   5132  N  N    . GLU B 1 26  ? 10.794  24.661 -15.666 1.00 14.69  ? 26   GLU B N    1 
ATOM   5133  C  CA   . GLU B 1 26  ? 9.404   24.671 -16.066 1.00 18.43  ? 26   GLU B CA   1 
ATOM   5134  C  C    . GLU B 1 26  ? 8.434   24.483 -14.889 1.00 20.17  ? 26   GLU B C    1 
ATOM   5135  O  O    . GLU B 1 26  ? 7.237   24.791 -14.982 1.00 20.59  ? 26   GLU B O    1 
ATOM   5136  C  CB   A GLU B 1 26  ? 9.073   23.611 -17.115 0.42 17.05  ? 26   GLU B CB   1 
ATOM   5137  C  CB   B GLU B 1 26  ? 9.154   23.509 -17.041 0.58 19.30  ? 26   GLU B CB   1 
ATOM   5138  C  CG   A GLU B 1 26  ? 7.858   23.994 -17.948 0.42 11.74  ? 26   GLU B CG   1 
ATOM   5139  C  CG   B GLU B 1 26  ? 10.111  23.234 -18.153 0.58 30.42  ? 26   GLU B CG   1 
ATOM   5140  C  CD   A GLU B 1 26  ? 7.322   22.893 -18.831 0.42 10.00  ? 26   GLU B CD   1 
ATOM   5141  C  CD   B GLU B 1 26  ? 10.480  21.917 -18.754 0.58 29.32  ? 26   GLU B CD   1 
ATOM   5142  O  OE1  A GLU B 1 26  ? 7.977   21.869 -19.071 0.42 12.43  ? 26   GLU B OE1  1 
ATOM   5143  O  OE1  B GLU B 1 26  ? 10.336  20.771 -18.260 0.58 13.75  ? 26   GLU B OE1  1 
ATOM   5144  O  OE2  A GLU B 1 26  ? 6.169   23.086 -19.307 0.42 19.96  ? 26   GLU B OE2  1 
ATOM   5145  O  OE2  B GLU B 1 26  ? 11.034  21.975 -19.900 0.58 51.41  ? 26   GLU B OE2  1 
ATOM   5146  H  H    . GLU B 1 26  ? 11.208  23.922 -15.812 1.00 17.63  ? 26   GLU B H    1 
ATOM   5147  H  HA   . GLU B 1 26  ? 9.218   25.547 -16.463 1.00 22.11  ? 26   GLU B HA   1 
ATOM   5148  H  HB2  A GLU B 1 26  ? 9.837   23.493 -17.701 0.42 20.47  ? 26   GLU B HB2  1 
ATOM   5149  H  HB2  B GLU B 1 26  ? 9.089   22.699 -16.511 0.58 23.16  ? 26   GLU B HB2  1 
ATOM   5150  H  HB3  A GLU B 1 26  ? 8.903   22.765 -16.673 0.42 20.47  ? 26   GLU B HB3  1 
ATOM   5151  H  HB3  B GLU B 1 26  ? 8.283   23.653 -17.442 0.58 23.16  ? 26   GLU B HB3  1 
ATOM   5152  H  HG2  A GLU B 1 26  ? 7.152   24.281 -17.349 0.42 14.09  ? 26   GLU B HG2  1 
ATOM   5153  H  HG2  B GLU B 1 26  ? 9.800   23.775 -18.896 0.58 36.50  ? 26   GLU B HG2  1 
ATOM   5154  H  HG3  A GLU B 1 26  ? 8.093   24.751 -18.506 0.42 14.09  ? 26   GLU B HG3  1 
ATOM   5155  H  HG3  B GLU B 1 26  ? 10.951  23.628 -17.869 0.58 36.50  ? 26   GLU B HG3  1 
ATOM   5156  N  N    . GLY B 1 27  ? 8.956   23.943 -13.792 1.00 15.59  ? 27   GLY B N    1 
ATOM   5157  C  CA   . GLY B 1 27  ? 8.075   23.652 -12.680 1.00 17.92  ? 27   GLY B CA   1 
ATOM   5158  C  C    . GLY B 1 27  ? 7.169   24.749 -12.194 1.00 19.56  ? 27   GLY B C    1 
ATOM   5159  O  O    . GLY B 1 27  ? 5.978   24.441 -11.939 1.00 19.25  ? 27   GLY B O    1 
ATOM   5160  H  H    . GLY B 1 27  ? 9.797   23.771 -13.744 1.00 18.71  ? 27   GLY B H    1 
ATOM   5161  H  HA2  . GLY B 1 27  ? 7.519   22.898 -12.931 1.00 21.51  ? 27   GLY B HA2  1 
ATOM   5162  H  HA3  . GLY B 1 27  ? 8.624   23.367 -11.933 1.00 21.51  ? 27   GLY B HA3  1 
ATOM   5163  N  N    . PRO B 1 28  ? 7.596   25.995 -12.016 1.00 17.71  ? 28   PRO B N    1 
ATOM   5164  C  CA   . PRO B 1 28  ? 6.645   27.040 -11.590 1.00 21.24  ? 28   PRO B CA   1 
ATOM   5165  C  C    . PRO B 1 28  ? 5.528   27.228 -12.594 1.00 19.42  ? 28   PRO B C    1 
ATOM   5166  O  O    . PRO B 1 28  ? 4.344   27.389 -12.281 1.00 20.07  ? 28   PRO B O    1 
ATOM   5167  C  CB   . PRO B 1 28  ? 7.525   28.282 -11.498 1.00 24.53  ? 28   PRO B CB   1 
ATOM   5168  C  CG   . PRO B 1 28  ? 8.856   27.694 -11.135 1.00 23.85  ? 28   PRO B CG   1 
ATOM   5169  C  CD   . PRO B 1 28  ? 8.980   26.519 -12.054 1.00 17.42  ? 28   PRO B CD   1 
ATOM   5170  H  HA   . PRO B 1 28  ? 6.275   26.822 -10.709 1.00 25.49  ? 28   PRO B HA   1 
ATOM   5171  H  HB2  . PRO B 1 28  ? 7.565   28.750 -12.346 1.00 29.44  ? 28   PRO B HB2  1 
ATOM   5172  H  HB3  . PRO B 1 28  ? 7.208   28.890 -10.812 1.00 29.44  ? 28   PRO B HB3  1 
ATOM   5173  H  HG2  . PRO B 1 28  ? 9.571   28.331 -11.286 1.00 28.62  ? 28   PRO B HG2  1 
ATOM   5174  H  HG3  . PRO B 1 28  ? 8.872   27.414 -10.207 1.00 28.62  ? 28   PRO B HG3  1 
ATOM   5175  H  HD2  . PRO B 1 28  ? 9.236   26.791 -12.949 1.00 20.90  ? 28   PRO B HD2  1 
ATOM   5176  H  HD3  . PRO B 1 28  ? 9.618   25.869 -11.719 1.00 20.90  ? 28   PRO B HD3  1 
ATOM   5177  N  N    . THR B 1 29  ? 5.913   27.216 -13.863 1.00 21.09  ? 29   THR B N    1 
ATOM   5178  C  CA   . THR B 1 29  ? 4.861   27.471 -14.844 1.00 20.22  ? 29   THR B CA   1 
ATOM   5179  C  C    . THR B 1 29  ? 3.827   26.358 -14.831 1.00 21.38  ? 29   THR B C    1 
ATOM   5180  O  O    . THR B 1 29  ? 2.629   26.651 -14.844 1.00 22.85  ? 29   THR B O    1 
ATOM   5181  C  CB   . THR B 1 29  ? 5.488   27.637 -16.241 1.00 33.91  ? 29   THR B CB   1 
ATOM   5182  O  OG1  . THR B 1 29  ? 6.586   28.545 -16.150 1.00 28.46  ? 29   THR B OG1  1 
ATOM   5183  C  CG2  . THR B 1 29  ? 4.471   28.262 -17.175 1.00 25.25  ? 29   THR B CG2  1 
ATOM   5184  H  H    . THR B 1 29  ? 6.728   27.069 -14.093 1.00 25.30  ? 29   THR B H    1 
ATOM   5185  H  HA   . THR B 1 29  ? 4.414   28.310 -14.605 1.00 24.27  ? 29   THR B HA   1 
ATOM   5186  H  HB   . THR B 1 29  ? 5.786   26.770 -16.589 1.00 40.69  ? 29   THR B HB   1 
ATOM   5187  H  HG1  . THR B 1 29  ? 6.438   29.200 -16.621 1.00 42.70  ? 29   THR B HG1  1 
ATOM   5188  H  HG21 . THR B 1 29  ? 4.851   28.345 -18.052 1.00 37.87  ? 29   THR B HG21 1 
ATOM   5189  H  HG22 . THR B 1 29  ? 4.228   29.131 -16.847 1.00 37.87  ? 29   THR B HG22 1 
ATOM   5190  H  HG23 . THR B 1 29  ? 3.690   27.705 -17.216 1.00 37.87  ? 29   THR B HG23 1 
ATOM   5191  N  N    . VAL B 1 30  ? 4.285   25.101 -14.842 1.00 18.57  ? 30   VAL B N    1 
ATOM   5192  C  CA   . VAL B 1 30  ? 3.284   24.042 -14.942 1.00 22.56  ? 30   VAL B CA   1 
ATOM   5193  C  C    . VAL B 1 30  ? 2.402   23.918 -13.704 1.00 21.67  ? 30   VAL B C    1 
ATOM   5194  O  O    . VAL B 1 30  ? 1.218   23.587 -13.836 1.00 16.96  ? 30   VAL B O    1 
ATOM   5195  C  CB   . VAL B 1 30  ? 3.951   22.707 -15.292 1.00 22.14  ? 30   VAL B CB   1 
ATOM   5196  C  CG1  . VAL B 1 30  ? 2.942   21.608 -15.507 1.00 56.32  ? 30   VAL B CG1  1 
ATOM   5197  C  CG2  . VAL B 1 30  ? 4.738   22.927 -16.579 1.00 32.38  ? 30   VAL B CG2  1 
ATOM   5198  H  H    . VAL B 1 30  ? 5.125   24.925 -14.792 1.00 22.29  ? 30   VAL B H    1 
ATOM   5199  H  HA   . VAL B 1 30  ? 2.696   24.274 -15.691 1.00 27.08  ? 30   VAL B HA   1 
ATOM   5200  H  HB   . VAL B 1 30  ? 4.565   22.451 -14.573 1.00 26.57  ? 30   VAL B HB   1 
ATOM   5201  H  HG11 . VAL B 1 30  ? 2.434   21.477 -14.702 1.00 84.48  ? 30   VAL B HG11 1 
ATOM   5202  H  HG12 . VAL B 1 30  ? 3.398   20.794 -15.733 1.00 84.48  ? 30   VAL B HG12 1 
ATOM   5203  H  HG13 . VAL B 1 30  ? 2.350   21.852 -16.222 1.00 84.48  ? 30   VAL B HG13 1 
ATOM   5204  H  HG21 . VAL B 1 30  ? 5.399   23.609 -16.437 1.00 48.57  ? 30   VAL B HG21 1 
ATOM   5205  H  HG22 . VAL B 1 30  ? 4.139   23.202 -17.277 1.00 48.57  ? 30   VAL B HG22 1 
ATOM   5206  H  HG23 . VAL B 1 30  ? 5.171   22.109 -16.832 1.00 48.57  ? 30   VAL B HG23 1 
ATOM   5207  N  N    . LEU B 1 31  ? 2.978   24.167 -12.537 1.00 17.26  ? 31   LEU B N    1 
ATOM   5208  C  CA   . LEU B 1 31  ? 2.165   24.278 -11.311 1.00 17.73  ? 31   LEU B CA   1 
ATOM   5209  C  C    . LEU B 1 31  ? 1.100   25.357 -11.380 1.00 20.12  ? 31   LEU B C    1 
ATOM   5210  O  O    . LEU B 1 31  ? -0.057  25.172 -10.977 1.00 19.02  ? 31   LEU B O    1 
ATOM   5211  C  CB   . LEU B 1 31  ? 3.135   24.444 -10.125 1.00 15.01  ? 31   LEU B CB   1 
ATOM   5212  C  CG   . LEU B 1 31  ? 3.921   23.171 -9.810  1.00 14.37  ? 31   LEU B CG   1 
ATOM   5213  C  CD1  . LEU B 1 31  ? 5.165   23.352 -8.971  1.00 17.42  ? 31   LEU B CD1  1 
ATOM   5214  C  CD2  . LEU B 1 31  ? 3.006   22.162 -9.103  1.00 24.14  ? 31   LEU B CD2  1 
ATOM   5215  H  H    . LEU B 1 31  ? 3.831   24.266 -12.494 1.00 20.72  ? 31   LEU B H    1 
ATOM   5216  H  HA   . LEU B 1 31  ? 1.704   23.422 -11.190 1.00 21.27  ? 31   LEU B HA   1 
ATOM   5217  H  HB2  . LEU B 1 31  ? 3.759   25.159 -10.326 1.00 18.01  ? 31   LEU B HB2  1 
ATOM   5218  H  HB3  . LEU B 1 31  ? 2.630   24.705 -9.339  1.00 18.01  ? 31   LEU B HB3  1 
ATOM   5219  H  HG   . LEU B 1 31  ? 4.196   22.775 -10.663 1.00 17.25  ? 31   LEU B HG   1 
ATOM   5220  H  HD11 . LEU B 1 31  ? 5.590   22.501 -8.841  1.00 26.13  ? 31   LEU B HD11 1 
ATOM   5221  H  HD12 . LEU B 1 31  ? 4.925   23.723 -8.118  1.00 26.13  ? 31   LEU B HD12 1 
ATOM   5222  H  HD13 . LEU B 1 31  ? 5.771   23.946 -9.419  1.00 26.13  ? 31   LEU B HD13 1 
ATOM   5223  H  HD21 . LEU B 1 31  ? 2.216   22.023 -9.630  1.00 36.20  ? 31   LEU B HD21 1 
ATOM   5224  H  HD22 . LEU B 1 31  ? 2.759   22.503 -8.240  1.00 36.20  ? 31   LEU B HD22 1 
ATOM   5225  H  HD23 . LEU B 1 31  ? 3.470   21.328 -8.997  1.00 36.20  ? 31   LEU B HD23 1 
ATOM   5226  N  N    . ARG B 1 32  ? 1.416   26.540 -11.907 1.00 18.00  ? 32   ARG B N    1 
ATOM   5227  C  CA   . ARG B 1 32  ? 0.499   27.669 -12.023 1.00 21.31  ? 32   ARG B CA   1 
ATOM   5228  C  C    . ARG B 1 32  ? -0.548  27.354 -13.088 1.00 21.51  ? 32   ARG B C    1 
ATOM   5229  O  O    . ARG B 1 32  ? -1.743  27.635 -12.924 1.00 21.18  ? 32   ARG B O    1 
ATOM   5230  C  CB   . ARG B 1 32  ? 1.235   28.962 -12.364 1.00 21.37  ? 32   ARG B CB   1 
ATOM   5231  C  CG   . ARG B 1 32  ? 2.018   29.630 -11.238 1.00 23.92  ? 32   ARG B CG   1 
ATOM   5232  C  CD   . ARG B 1 32  ? 1.910   31.135 -11.294 1.00 35.58  ? 32   ARG B CD   1 
ATOM   5233  N  NE   . ARG B 1 32  ? 2.787   31.888 -10.418 1.00 29.43  ? 32   ARG B NE   1 
ATOM   5234  C  CZ   . ARG B 1 32  ? 4.110   31.925 -10.394 1.00 22.77  ? 32   ARG B CZ   1 
ATOM   5235  N  NH1  . ARG B 1 32  ? 4.863   31.214 -11.228 1.00 25.31  ? 32   ARG B NH1  1 
ATOM   5236  N  NH2  . ARG B 1 32  ? 4.745   32.695 -9.508  1.00 26.76  ? 32   ARG B NH2  1 
ATOM   5237  H  H    . ARG B 1 32  ? 2.218   26.646 -12.199 1.00 21.60  ? 32   ARG B H    1 
ATOM   5238  H  HA   . ARG B 1 32  ? 0.043   27.789 -11.164 1.00 25.57  ? 32   ARG B HA   1 
ATOM   5239  H  HB2  . ARG B 1 32  ? 1.851   28.775 -13.089 1.00 25.64  ? 32   ARG B HB2  1 
ATOM   5240  H  HB3  . ARG B 1 32  ? 0.584   29.600 -12.696 1.00 25.64  ? 32   ARG B HB3  1 
ATOM   5241  H  HG2  . ARG B 1 32  ? 1.681   29.316 -10.384 1.00 28.70  ? 32   ARG B HG2  1 
ATOM   5242  H  HG3  . ARG B 1 32  ? 2.952   29.374 -11.302 1.00 28.70  ? 32   ARG B HG3  1 
ATOM   5243  H  HD2  . ARG B 1 32  ? 2.082   31.415 -12.206 1.00 42.70  ? 32   ARG B HD2  1 
ATOM   5244  H  HD3  . ARG B 1 32  ? 0.995   31.379 -11.085 1.00 42.70  ? 32   ARG B HD3  1 
ATOM   5245  H  HE   . ARG B 1 32  ? 2.393   32.378 -9.832  1.00 35.32  ? 32   ARG B HE   1 
ATOM   5246  H  HH11 . ARG B 1 32  ? 4.493   30.704 -11.813 1.00 30.37  ? 32   ARG B HH11 1 
ATOM   5247  H  HH12 . ARG B 1 32  ? 5.720   31.264 -11.182 1.00 30.37  ? 32   ARG B HH12 1 
ATOM   5248  H  HH21 . ARG B 1 32  ? 4.295   33.169 -8.950  1.00 32.11  ? 32   ARG B HH21 1 
ATOM   5249  H  HH22 . ARG B 1 32  ? 5.605   32.716 -9.496  1.00 32.11  ? 32   ARG B HH22 1 
ATOM   5250  N  N    . LYS B 1 33  ? -0.108  26.741 -14.182 1.00 18.60  ? 33   LYS B N    1 
ATOM   5251  C  CA   . LYS B 1 33  ? -1.009  26.407 -15.299 1.00 21.48  ? 33   LYS B CA   1 
ATOM   5252  C  C    . LYS B 1 33  ? -2.017  25.362 -14.848 1.00 20.02  ? 33   LYS B C    1 
ATOM   5253  O  O    . LYS B 1 33  ? -3.138  25.386 -15.366 1.00 23.47  ? 33   LYS B O    1 
ATOM   5254  C  CB   . LYS B 1 33  ? -0.235  26.039 -16.566 1.00 18.02  ? 33   LYS B CB   1 
ATOM   5255  C  CG   . LYS B 1 33  ? 0.206   24.616 -16.773 1.00 39.82  ? 33   LYS B CG   1 
ATOM   5256  C  CD   . LYS B 1 33  ? 1.155   24.400 -17.953 1.00 29.83  ? 33   LYS B CD   1 
ATOM   5257  C  CE   . LYS B 1 33  ? 1.078   22.978 -18.432 1.00 17.62  ? 33   LYS B CE   1 
ATOM   5258  N  NZ   . LYS B 1 33  ? 2.157   22.427 -19.260 1.00 48.83  ? 33   LYS B NZ   1 
ATOM   5259  H  H    . LYS B 1 33  ? 0.724   26.534 -14.240 1.00 22.33  ? 33   LYS B H    1 
ATOM   5260  H  HA   . LYS B 1 33  ? -1.517  27.219 -15.505 1.00 25.78  ? 33   LYS B HA   1 
ATOM   5261  H  HB2  . LYS B 1 33  ? -0.784  26.287 -17.326 1.00 21.62  ? 33   LYS B HB2  1 
ATOM   5262  H  HB3  . LYS B 1 33  ? 0.558   26.597 -16.595 1.00 21.62  ? 33   LYS B HB3  1 
ATOM   5263  H  HG2  . LYS B 1 33  ? 0.644   24.308 -15.965 1.00 47.78  ? 33   LYS B HG2  1 
ATOM   5264  H  HG3  . LYS B 1 33  ? -0.582  24.066 -16.907 1.00 47.78  ? 33   LYS B HG3  1 
ATOM   5265  H  HD2  . LYS B 1 33  ? 0.916   25.000 -18.677 1.00 35.79  ? 33   LYS B HD2  1 
ATOM   5266  H  HD3  . LYS B 1 33  ? 2.064   24.603 -17.681 1.00 35.79  ? 33   LYS B HD3  1 
ATOM   5267  H  HE2  . LYS B 1 33  ? 0.998   22.413 -17.647 1.00 21.15  ? 33   LYS B HE2  1 
ATOM   5268  H  HE3  . LYS B 1 33  ? 0.253   22.885 -18.932 1.00 21.15  ? 33   LYS B HE3  1 
ATOM   5269  H  HZ1  . LYS B 1 33  ? 1.948   21.598 -19.506 1.00 73.25  ? 33   LYS B HZ1  1 
ATOM   5270  H  HZ2  . LYS B 1 33  ? 2.914   22.416 -18.792 1.00 73.25  ? 33   LYS B HZ2  1 
ATOM   5271  H  HZ3  . LYS B 1 33  ? 2.264   22.934 -19.984 1.00 73.25  ? 33   LYS B HZ3  1 
ATOM   5272  N  N    . ALA B 1 34  ? -1.690  24.497 -13.897 1.00 22.37  ? 34   ALA B N    1 
ATOM   5273  C  CA   . ALA B 1 34  ? -2.614  23.493 -13.378 1.00 22.36  ? 34   ALA B CA   1 
ATOM   5274  C  C    . ALA B 1 34  ? -3.641  24.093 -12.420 1.00 25.48  ? 34   ALA B C    1 
ATOM   5275  O  O    . ALA B 1 34  ? -4.561  23.401 -11.963 1.00 31.30  ? 34   ALA B O    1 
ATOM   5276  C  CB   . ALA B 1 34  ? -1.802  22.375 -12.738 1.00 22.11  ? 34   ALA B CB   1 
ATOM   5277  H  H    . ALA B 1 34  ? -0.895  24.529 -13.570 1.00 26.84  ? 34   ALA B H    1 
ATOM   5278  H  HA   . ALA B 1 34  ? -3.101  23.112 -14.139 1.00 26.83  ? 34   ALA B HA   1 
ATOM   5279  H  HB1  . ALA B 1 34  ? -1.168  22.035 -13.374 1.00 33.16  ? 34   ALA B HB1  1 
ATOM   5280  H  HB2  . ALA B 1 34  ? -2.391  21.668 -12.464 1.00 33.16  ? 34   ALA B HB2  1 
ATOM   5281  H  HB3  . ALA B 1 34  ? -1.335  22.716 -11.972 1.00 33.16  ? 34   ALA B HB3  1 
ATOM   5282  N  N    . GLY B 1 35  ? -3.526  25.373 -12.104 1.00 17.79  ? 35   GLY B N    1 
ATOM   5283  C  CA   . GLY B 1 35  ? -4.563  26.061 -11.348 1.00 23.68  ? 35   GLY B CA   1 
ATOM   5284  C  C    . GLY B 1 35  ? -4.254  26.184 -9.867  1.00 23.17  ? 35   GLY B C    1 
ATOM   5285  O  O    . GLY B 1 35  ? -5.196  26.435 -9.104  1.00 18.70  ? 35   GLY B O    1 
ATOM   5286  H  H    . GLY B 1 35  ? -2.826  25.807 -12.350 1.00 21.35  ? 35   GLY B H    1 
ATOM   5287  H  HA2  . GLY B 1 35  ? -4.683  26.949 -11.719 1.00 28.42  ? 35   GLY B HA2  1 
ATOM   5288  H  HA3  . GLY B 1 35  ? -5.399  25.581 -11.455 1.00 28.42  ? 35   GLY B HA3  1 
ATOM   5289  N  N    . LEU B 1 36  ? -2.982  26.013 -9.504  1.00 18.99  ? 36   LEU B N    1 
ATOM   5290  C  CA   . LEU B 1 36  ? -2.625  26.097 -8.081  1.00 23.25  ? 36   LEU B CA   1 
ATOM   5291  C  C    . LEU B 1 36  ? -3.174  27.324 -7.385  1.00 19.94  ? 36   LEU B C    1 
ATOM   5292  O  O    . LEU B 1 36  ? -3.777  27.211 -6.317  1.00 24.09  ? 36   LEU B O    1 
ATOM   5293  C  CB   . LEU B 1 36  ? -1.100  26.059 -7.896  1.00 20.42  ? 36   LEU B CB   1 
ATOM   5294  C  CG   . LEU B 1 36  ? -0.578  26.192 -6.455  1.00 14.49  ? 36   LEU B CG   1 
ATOM   5295  C  CD1  . LEU B 1 36  ? -1.125  25.118 -5.544  1.00 18.04  ? 36   LEU B CD1  1 
ATOM   5296  C  CD2  . LEU B 1 36  ? 0.932   26.173 -6.448  1.00 23.81  ? 36   LEU B CD2  1 
ATOM   5297  H  H    . LEU B 1 36  ? -2.378  25.856 -10.095 1.00 22.79  ? 36   LEU B H    1 
ATOM   5298  H  HA   . LEU B 1 36  ? -2.999  25.309 -7.634  1.00 27.90  ? 36   LEU B HA   1 
ATOM   5299  H  HB2  . LEU B 1 36  ? -0.772  25.221 -8.260  1.00 24.51  ? 36   LEU B HB2  1 
ATOM   5300  H  HB3  . LEU B 1 36  ? -0.713  26.774 -8.425  1.00 24.51  ? 36   LEU B HB3  1 
ATOM   5301  H  HG   . LEU B 1 36  ? -0.871  27.060 -6.107  1.00 17.39  ? 36   LEU B HG   1 
ATOM   5302  H  HD11 . LEU B 1 36  ? -2.085  25.145 -5.558  1.00 27.06  ? 36   LEU B HD11 1 
ATOM   5303  H  HD12 . LEU B 1 36  ? -0.814  25.269 -4.649  1.00 27.06  ? 36   LEU B HD12 1 
ATOM   5304  H  HD13 . LEU B 1 36  ? -0.825  24.258 -5.847  1.00 27.06  ? 36   LEU B HD13 1 
ATOM   5305  H  HD21 . LEU B 1 36  ? 1.263   26.847 -7.047  1.00 35.72  ? 36   LEU B HD21 1 
ATOM   5306  H  HD22 . LEU B 1 36  ? 1.243   25.311 -6.733  1.00 35.72  ? 36   LEU B HD22 1 
ATOM   5307  H  HD23 . LEU B 1 36  ? 1.251   26.351 -5.560  1.00 35.72  ? 36   LEU B HD23 1 
ATOM   5308  N  N    . LEU B 1 37  ? -2.958  28.528 -7.916  1.00 19.88  ? 37   LEU B N    1 
ATOM   5309  C  CA   . LEU B 1 37  ? -3.319  29.747 -7.192  1.00 19.89  ? 37   LEU B CA   1 
ATOM   5310  C  C    . LEU B 1 37  ? -4.837  29.825 -7.035  1.00 20.98  ? 37   LEU B C    1 
ATOM   5311  O  O    . LEU B 1 37  ? -5.357  30.131 -5.959  1.00 33.92  ? 37   LEU B O    1 
ATOM   5312  C  CB   . LEU B 1 37  ? -2.744  30.970 -7.902  1.00 34.17  ? 37   LEU B CB   1 
ATOM   5313  C  CG   . LEU B 1 37  ? -1.220  30.987 -8.071  1.00 50.15  ? 37   LEU B CG   1 
ATOM   5314  C  CD1  . LEU B 1 37  ? -0.703  32.312 -8.622  1.00 33.18  ? 37   LEU B CD1  1 
ATOM   5315  C  CD2  . LEU B 1 37  ? -0.525  30.690 -6.747  1.00 58.80  ? 37   LEU B CD2  1 
ATOM   5316  H  H    . LEU B 1 37  ? -2.600  28.589 -8.696  1.00 23.86  ? 37   LEU B H    1 
ATOM   5317  H  HA   . LEU B 1 37  ? -2.922  29.699 -6.298  1.00 23.87  ? 37   LEU B HA   1 
ATOM   5318  H  HB2  . LEU B 1 37  ? -3.150  31.031 -8.781  1.00 41.01  ? 37   LEU B HB2  1 
ATOM   5319  H  HB3  . LEU B 1 37  ? -3.005  31.761 -7.405  1.00 41.01  ? 37   LEU B HB3  1 
ATOM   5320  H  HG   . LEU B 1 37  ? -0.978  30.280 -8.705  1.00 60.18  ? 37   LEU B HG   1 
ATOM   5321  H  HD11 . LEU B 1 37  ? -1.074  32.462 -9.495  1.00 49.77  ? 37   LEU B HD11 1 
ATOM   5322  H  HD12 . LEU B 1 37  ? 0.255   32.281 -8.683  1.00 49.77  ? 37   LEU B HD12 1 
ATOM   5323  H  HD13 . LEU B 1 37  ? -0.964  33.026 -8.036  1.00 49.77  ? 37   LEU B HD13 1 
ATOM   5324  H  HD21 . LEU B 1 37  ? -0.847  29.857 -6.396  1.00 88.21  ? 37   LEU B HD21 1 
ATOM   5325  H  HD22 . LEU B 1 37  ? -0.713  31.394 -6.122  1.00 88.21  ? 37   LEU B HD22 1 
ATOM   5326  H  HD23 . LEU B 1 37  ? 0.423   30.634 -6.889  1.00 88.21  ? 37   LEU B HD23 1 
ATOM   5327  N  N    . GLU B 1 38  ? -5.560  29.539 -8.128  1.00 20.21  ? 38   GLU B N    1 
ATOM   5328  C  CA   . GLU B 1 38  ? -7.018  29.504 -8.111  1.00 23.10  ? 38   GLU B CA   1 
ATOM   5329  C  C    . GLU B 1 38  ? -7.510  28.492 -7.084  1.00 29.49  ? 38   GLU B C    1 
ATOM   5330  O  O    . GLU B 1 38  ? -8.358  28.774 -6.231  1.00 25.02  ? 38   GLU B O    1 
ATOM   5331  C  CB   . GLU B 1 38  ? -7.506  29.207 -9.536  1.00 24.35  ? 38   GLU B CB   1 
ATOM   5332  C  CG   . GLU B 1 38  ? -7.298  30.381 -10.480 1.00 34.61  ? 38   GLU B CG   1 
ATOM   5333  C  CD   . GLU B 1 38  ? -5.932  30.487 -11.126 1.00 46.16  ? 38   GLU B CD   1 
ATOM   5334  O  OE1  . GLU B 1 38  ? -5.072  29.613 -10.880 1.00 30.86  ? 38   GLU B OE1  1 
ATOM   5335  O  OE2  . GLU B 1 38  ? -5.710  31.461 -11.894 1.00 40.38  ? 38   GLU B OE2  1 
ATOM   5336  H  H    . GLU B 1 38  ? -5.150  29.370 -8.864  1.00 24.26  ? 38   GLU B H    1 
ATOM   5337  H  HA   . GLU B 1 38  ? -7.344  30.391 -7.851  1.00 27.72  ? 38   GLU B HA   1 
ATOM   5338  H  HB2  . GLU B 1 38  ? -7.031  28.435 -9.880  1.00 29.22  ? 38   GLU B HB2  1 
ATOM   5339  H  HB3  . GLU B 1 38  ? -8.451  28.987 -9.508  1.00 29.22  ? 38   GLU B HB3  1 
ATOM   5340  H  HG2  . GLU B 1 38  ? -7.962  30.326 -11.185 1.00 41.53  ? 38   GLU B HG2  1 
ATOM   5341  H  HG3  . GLU B 1 38  ? -7.465  31.200 -9.988  1.00 41.53  ? 38   GLU B HG3  1 
ATOM   5342  N  N    . LYS B 1 39  ? -6.970  27.280 -7.121  1.00 18.19  ? 39   LYS B N    1 
ATOM   5343  C  CA   . LYS B 1 39  ? -7.348  26.247 -6.141  1.00 18.61  ? 39   LYS B CA   1 
ATOM   5344  C  C    . LYS B 1 39  ? -7.082  26.640 -4.713  1.00 16.14  ? 39   LYS B C    1 
ATOM   5345  O  O    . LYS B 1 39  ? -7.916  26.367 -3.824  1.00 19.63  ? 39   LYS B O    1 
ATOM   5346  C  CB   . LYS B 1 39  ? -6.596  24.956 -6.530  1.00 20.77  ? 39   LYS B CB   1 
ATOM   5347  C  CG   . LYS B 1 39  ? -7.174  24.274 -7.747  1.00 16.10  ? 39   LYS B CG   1 
ATOM   5348  C  CD   . LYS B 1 39  ? -6.359  23.098 -8.204  1.00 25.13  ? 39   LYS B CD   1 
ATOM   5349  C  CE   . LYS B 1 39  ? -6.692  22.701 -9.631  1.00 23.00  ? 39   LYS B CE   1 
ATOM   5350  N  NZ   . LYS B 1 39  ? -6.213  21.316 -9.910  1.00 47.24  ? 39   LYS B NZ   1 
ATOM   5351  H  H    . LYS B 1 39  ? -6.389  27.095 -7.727  1.00 21.83  ? 39   LYS B H    1 
ATOM   5352  H  HA   . LYS B 1 39  ? -8.308  26.078 -6.235  1.00 22.33  ? 39   LYS B HA   1 
ATOM   5353  H  HB2  . LYS B 1 39  ? -5.666  25.173 -6.703  1.00 24.92  ? 39   LYS B HB2  1 
ATOM   5354  H  HB3  . LYS B 1 39  ? -6.621  24.339 -5.782  1.00 24.92  ? 39   LYS B HB3  1 
ATOM   5355  H  HG2  . LYS B 1 39  ? -8.074  23.975 -7.543  1.00 19.32  ? 39   LYS B HG2  1 
ATOM   5356  H  HG3  . LYS B 1 39  ? -7.233  24.918 -8.471  1.00 19.32  ? 39   LYS B HG3  1 
ATOM   5357  H  HD2  . LYS B 1 39  ? -5.417  23.320 -8.145  1.00 30.15  ? 39   LYS B HD2  1 
ATOM   5358  H  HD3  . LYS B 1 39  ? -6.526  22.345 -7.615  1.00 30.15  ? 39   LYS B HD3  1 
ATOM   5359  H  HE2  . LYS B 1 39  ? -7.651  22.746 -9.765  1.00 27.60  ? 39   LYS B HE2  1 
ATOM   5360  H  HE3  . LYS B 1 39  ? -6.271  23.320 -10.247 1.00 27.60  ? 39   LYS B HE3  1 
ATOM   5361  H  HZ1  . LYS B 1 39  ? -6.438  21.087 -10.740 1.00 70.86  ? 39   LYS B HZ1  1 
ATOM   5362  H  HZ2  . LYS B 1 39  ? -6.587  20.751 -9.334  1.00 70.86  ? 39   LYS B HZ2  1 
ATOM   5363  H  HZ3  . LYS B 1 39  ? -5.328  21.285 -9.823  1.00 70.86  ? 39   LYS B HZ3  1 
ATOM   5364  N  N    . LEU B 1 40  ? -6.026  27.313 -4.348  1.00 15.69  ? 40   LEU B N    1 
ATOM   5365  C  CA   . LEU B 1 40  ? -5.803  27.822 -3.000  1.00 13.90  ? 40   LEU B CA   1 
ATOM   5366  C  C    . LEU B 1 40  ? -6.889  28.823 -2.617  1.00 19.79  ? 40   LEU B C    1 
ATOM   5367  O  O    . LEU B 1 40  ? -7.437  28.726 -1.508  1.00 21.77  ? 40   LEU B O    1 
ATOM   5368  C  CB   . LEU B 1 40  ? -4.391  28.422 -2.857  1.00 15.86  ? 40   LEU B CB   1 
ATOM   5369  C  CG   . LEU B 1 40  ? -3.226  27.447 -2.915  1.00 17.84  ? 40   LEU B CG   1 
ATOM   5370  C  CD1  . LEU B 1 40  ? -1.875  28.166 -3.077  1.00 15.84  ? 40   LEU B CD1  1 
ATOM   5371  C  CD2  . LEU B 1 40  ? -3.222  26.575 -1.663  1.00 19.15  ? 40   LEU B CD2  1 
ATOM   5372  H  H    . LEU B 1 40  ? -5.422  27.466 -4.941  1.00 18.83  ? 40   LEU B H    1 
ATOM   5373  H  HA   . LEU B 1 40  ? -5.867  27.064 -2.382  1.00 16.69  ? 40   LEU B HA   1 
ATOM   5374  H  HB2  . LEU B 1 40  ? -4.270  29.079 -3.561  1.00 19.04  ? 40   LEU B HB2  1 
ATOM   5375  H  HB3  . LEU B 1 40  ? -4.348  28.894 -2.011  1.00 19.04  ? 40   LEU B HB3  1 
ATOM   5376  H  HG   . LEU B 1 40  ? -3.355  26.864 -3.692  1.00 21.40  ? 40   LEU B HG   1 
ATOM   5377  H  HD11 . LEU B 1 40  ? -1.169  27.516 -3.112  1.00 23.76  ? 40   LEU B HD11 1 
ATOM   5378  H  HD12 . LEU B 1 40  ? -1.734  28.753 -2.331  1.00 23.76  ? 40   LEU B HD12 1 
ATOM   5379  H  HD13 . LEU B 1 40  ? -1.880  28.677 -3.890  1.00 23.76  ? 40   LEU B HD13 1 
ATOM   5380  H  HD21 . LEU B 1 40  ? -2.487  25.959 -1.704  1.00 28.73  ? 40   LEU B HD21 1 
ATOM   5381  H  HD22 . LEU B 1 40  ? -4.047  26.086 -1.611  1.00 28.73  ? 40   LEU B HD22 1 
ATOM   5382  H  HD23 . LEU B 1 40  ? -3.131  27.131 -0.886  1.00 28.73  ? 40   LEU B HD23 1 
ATOM   5383  N  N    . LYS B 1 41  ? -7.203  29.777 -3.503  1.00 17.59  ? 41   LYS B N    1 
ATOM   5384  C  CA   . LYS B 1 41  ? -8.214  30.768 -3.119  1.00 23.95  ? 41   LYS B CA   1 
ATOM   5385  C  C    . LYS B 1 41  ? -9.578  30.092 -2.985  0.69 15.71  ? 41   LYS B C    1 
ATOM   5386  O  O    . LYS B 1 41  ? -10.404 30.567 -2.187  0.69 22.46  ? 41   LYS B O    1 
ATOM   5387  C  CB   . LYS B 1 41  ? -8.255  31.954 -4.083  0.69 21.71  ? 41   LYS B CB   1 
ATOM   5388  C  CG   . LYS B 1 41  ? -6.974  32.774 -4.141  0.69 23.32  ? 41   LYS B CG   1 
ATOM   5389  C  CD   . LYS B 1 41  ? -6.838  33.726 -2.965  0.69 34.59  ? 41   LYS B CD   1 
ATOM   5390  C  CE   . LYS B 1 41  ? -6.257  35.071 -3.384  0.69 40.01  ? 41   LYS B CE   1 
ATOM   5391  N  NZ   . LYS B 1 41  ? -6.364  36.085 -2.303  0.69 30.73  ? 41   LYS B NZ   1 
ATOM   5392  H  H    . LYS B 1 41  ? -6.824  29.807 -4.274  1.00 21.11  ? 41   LYS B H    1 
ATOM   5393  H  HA   . LYS B 1 41  ? -7.968  31.114 -2.235  1.00 28.74  ? 41   LYS B HA   1 
ATOM   5394  H  HB2  . LYS B 1 41  ? -8.450  31.622 -4.974  0.69 26.05  ? 41   LYS B HB2  1 
ATOM   5395  H  HB3  . LYS B 1 41  ? -8.984  32.539 -3.824  0.69 26.05  ? 41   LYS B HB3  1 
ATOM   5396  H  HG2  . LYS B 1 41  ? -6.213  32.172 -4.151  0.69 27.98  ? 41   LYS B HG2  1 
ATOM   5397  H  HG3  . LYS B 1 41  ? -6.960  33.284 -4.966  0.69 27.98  ? 41   LYS B HG3  1 
ATOM   5398  H  HD2  . LYS B 1 41  ? -7.711  33.866 -2.566  0.69 41.50  ? 41   LYS B HD2  1 
ATOM   5399  H  HD3  . LYS B 1 41  ? -6.264  33.325 -2.294  0.69 41.50  ? 41   LYS B HD3  1 
ATOM   5400  H  HE2  . LYS B 1 41  ? -5.324  34.955 -3.622  0.69 48.01  ? 41   LYS B HE2  1 
ATOM   5401  H  HE3  . LYS B 1 41  ? -6.728  35.392 -4.169  0.69 48.01  ? 41   LYS B HE3  1 
ATOM   5402  H  HZ1  . LYS B 1 41  ? -5.914  36.816 -2.537  0.69 46.09  ? 41   LYS B HZ1  1 
ATOM   5403  H  HZ2  . LYS B 1 41  ? -6.022  35.754 -1.551  0.69 46.09  ? 41   LYS B HZ2  1 
ATOM   5404  H  HZ3  . LYS B 1 41  ? -7.220  36.291 -2.173  0.69 46.09  ? 41   LYS B HZ3  1 
ATOM   5405  N  N    . GLU B 1 42  ? -9.841  29.007 -3.699  1.00 19.68  ? 42   GLU B N    1 
ATOM   5406  C  CA   . GLU B 1 42  ? -11.094 28.259 -3.560  1.00 27.39  ? 42   GLU B CA   1 
ATOM   5407  C  C    . GLU B 1 42  ? -11.290 27.668 -2.160  1.00 32.23  ? 42   GLU B C    1 
ATOM   5408  O  O    . GLU B 1 42  ? -12.414 27.440 -1.694  1.00 31.56  ? 42   GLU B O    1 
ATOM   5409  C  CB   . GLU B 1 42  ? -11.187 27.129 -4.572  1.00 22.40  ? 42   GLU B CB   1 
ATOM   5410  C  CG   . GLU B 1 42  ? -10.808 27.445 -6.007  1.00 41.41  ? 42   GLU B CG   1 
ATOM   5411  C  CD   . GLU B 1 42  ? -10.873 26.178 -6.847  1.00 42.18  ? 42   GLU B CD   1 
ATOM   5412  O  OE1  . GLU B 1 42  ? -11.204 25.153 -6.208  1.00 32.16  ? 42   GLU B OE1  1 
ATOM   5413  O  OE2  . GLU B 1 42  ? -10.623 26.222 -8.068  1.00 54.26  ? 42   GLU B OE2  1 
ATOM   5414  H  H    . GLU B 1 42  ? -9.255  28.731 -4.265  1.00 23.62  ? 42   GLU B H    1 
ATOM   5415  H  HA   . GLU B 1 42  ? -11.834 28.878 -3.731  1.00 32.87  ? 42   GLU B HA   1 
ATOM   5416  H  HB2  . GLU B 1 42  ? -10.619 26.405 -4.266  1.00 26.89  ? 42   GLU B HB2  1 
ATOM   5417  H  HB3  . GLU B 1 42  ? -12.099 26.799 -4.570  1.00 26.89  ? 42   GLU B HB3  1 
ATOM   5418  H  HG2  . GLU B 1 42  ? -11.416 28.109 -6.367  1.00 49.69  ? 42   GLU B HG2  1 
ATOM   5419  H  HG3  . GLU B 1 42  ? -9.910  27.810 -6.035  1.00 49.69  ? 42   GLU B HG3  1 
ATOM   5420  N  N    . GLN B 1 43  ? -10.209 27.374 -1.465  1.00 19.31  ? 43   GLN B N    1 
ATOM   5421  C  CA   . GLN B 1 43  ? -10.254 26.863 -0.080  1.00 17.28  ? 43   GLN B CA   1 
ATOM   5422  C  C    . GLN B 1 43  ? -9.959  28.015 0.849   1.00 26.41  ? 43   GLN B C    1 
ATOM   5423  O  O    . GLN B 1 43  ? -10.269 29.191 0.539   1.00 34.72  ? 43   GLN B O    1 
ATOM   5424  C  CB   . GLN B 1 43  ? -9.339  25.643 0.078   1.00 19.81  ? 43   GLN B CB   1 
ATOM   5425  C  CG   . GLN B 1 43  ? -7.889  25.811 -0.320  1.00 22.85  ? 43   GLN B CG   1 
ATOM   5426  C  CD   . GLN B 1 43  ? -7.060  24.548 -0.442  1.00 22.66  ? 43   GLN B CD   1 
ATOM   5427  O  OE1  . GLN B 1 43  ? -7.217  23.664 -1.283  1.00 20.12  ? 43   GLN B OE1  1 
ATOM   5428  N  NE2  . GLN B 1 43  ? -6.082  24.457 0.452   1.00 17.55  ? 43   GLN B NE2  1 
ATOM   5429  H  H    . GLN B 1 43  ? -9.441  27.484 -1.836  1.00 23.18  ? 43   GLN B H    1 
ATOM   5430  H  HA   . GLN B 1 43  ? -11.172 26.569 0.097   1.00 20.74  ? 43   GLN B HA   1 
ATOM   5431  H  HB2  . GLN B 1 43  ? -9.365  25.367 1.008   1.00 23.77  ? 43   GLN B HB2  1 
ATOM   5432  H  HB3  . GLN B 1 43  ? -9.712  24.918 -0.448  1.00 23.77  ? 43   GLN B HB3  1 
ATOM   5433  H  HG2  . GLN B 1 43  ? -7.863  26.272 -1.173  1.00 27.42  ? 43   GLN B HG2  1 
ATOM   5434  H  HG3  . GLN B 1 43  ? -7.463  26.388 0.333   1.00 27.42  ? 43   GLN B HG3  1 
ATOM   5435  H  HE21 . GLN B 1 43  ? -5.556  23.777 0.445   1.00 21.06  ? 43   GLN B HE21 1 
ATOM   5436  H  HE22 . GLN B 1 43  ? -5.976  25.077 1.038   1.00 21.06  ? 43   GLN B HE22 1 
ATOM   5437  N  N    . GLU B 1 44  ? -9.395  27.870 2.051   1.00 23.34  ? 44   GLU B N    1 
ATOM   5438  C  CA   . GLU B 1 44  ? -9.487  29.118 2.852   1.00 45.63  ? 44   GLU B CA   1 
ATOM   5439  C  C    . GLU B 1 44  ? -8.604  30.290 2.502   1.00 38.00  ? 44   GLU B C    1 
ATOM   5440  O  O    . GLU B 1 44  ? -8.568  31.230 3.321   1.00 26.67  ? 44   GLU B O    1 
ATOM   5441  C  CB   . GLU B 1 44  ? -9.193  28.693 4.311   1.00 43.22  ? 44   GLU B CB   1 
ATOM   5442  C  CG   . GLU B 1 44  ? -7.979  27.773 4.410   1.00 41.12  ? 44   GLU B CG   1 
ATOM   5443  C  CD   . GLU B 1 44  ? -7.069  28.166 5.542   1.00 24.71  ? 44   GLU B CD   1 
ATOM   5444  O  OE1  . GLU B 1 44  ? -5.834  28.141 5.379   1.00 28.68  ? 44   GLU B OE1  1 
ATOM   5445  O  OE2  . GLU B 1 44  ? -7.616  28.539 6.604   1.00 46.04  ? 44   GLU B OE2  1 
ATOM   5446  H  H    . GLU B 1 44  ? -9.024  27.145 2.327   1.00 28.01  ? 44   GLU B H    1 
ATOM   5447  H  HA   . GLU B 1 44  ? -10.417 29.426 2.815   1.00 54.75  ? 44   GLU B HA   1 
ATOM   5448  H  HB2  . GLU B 1 44  ? -9.036  29.486 4.848   1.00 51.86  ? 44   GLU B HB2  1 
ATOM   5449  H  HB3  . GLU B 1 44  ? -9.969  28.237 4.673   1.00 51.86  ? 44   GLU B HB3  1 
ATOM   5450  H  HG2  . GLU B 1 44  ? -8.279  26.860 4.543   1.00 49.35  ? 44   GLU B HG2  1 
ATOM   5451  H  HG3  . GLU B 1 44  ? -7.484  27.805 3.576   1.00 49.35  ? 44   GLU B HG3  1 
ATOM   5452  N  N    . CYS B 1 45  ? -7.845  30.403 1.417   1.00 20.48  ? 45   CYS B N    1 
ATOM   5453  C  CA   . CYS B 1 45  ? -6.550  31.056 1.495   1.00 23.00  ? 45   CYS B CA   1 
ATOM   5454  C  C    . CYS B 1 45  ? -6.333  32.490 0.994   1.00 18.13  ? 45   CYS B C    1 
ATOM   5455  O  O    . CYS B 1 45  ? -6.856  32.806 -0.070  1.00 27.74  ? 45   CYS B O    1 
ATOM   5456  C  CB   . CYS B 1 45  ? -5.530  30.199 0.681   1.00 19.51  ? 45   CYS B CB   1 
ATOM   5457  S  SG   . CYS B 1 45  ? -5.341  28.537 1.354   1.00 24.03  ? 45   CYS B SG   1 
ATOM   5458  H  H    . CYS B 1 45  ? -8.121  30.088 0.666   1.00 24.58  ? 45   CYS B H    1 
ATOM   5459  H  HA   . CYS B 1 45  ? -6.268  31.030 2.434   1.00 27.60  ? 45   CYS B HA   1 
ATOM   5460  H  HB2  . CYS B 1 45  ? -5.830  30.137 -0.239  1.00 23.41  ? 45   CYS B HB2  1 
ATOM   5461  H  HB3  . CYS B 1 45  ? -4.668  30.643 0.684   1.00 23.41  ? 45   CYS B HB3  1 
ATOM   5462  N  N    . ASP B 1 46  ? -5.527  33.255 1.736   1.00 23.93  ? 46   ASP B N    1 
ATOM   5463  C  CA   . ASP B 1 46  ? -5.027  34.568 1.353   1.00 27.81  ? 46   ASP B CA   1 
ATOM   5464  C  C    . ASP B 1 46  ? -3.655  34.403 0.669   1.00 26.83  ? 46   ASP B C    1 
ATOM   5465  O  O    . ASP B 1 46  ? -2.630  34.290 1.363   1.00 21.14  ? 46   ASP B O    1 
ATOM   5466  C  CB   . ASP B 1 46  ? -4.899  35.527 2.525   1.00 37.03  ? 46   ASP B CB   1 
ATOM   5467  C  CG   . ASP B 1 46  ? -4.485  36.926 2.101   1.00 37.59  ? 46   ASP B CG   1 
ATOM   5468  O  OD1  . ASP B 1 46  ? -4.836  37.334 0.979   1.00 50.27  ? 46   ASP B OD1  1 
ATOM   5469  O  OD2  . ASP B 1 46  ? -3.805  37.607 2.890   1.00 39.41  ? 46   ASP B OD2  1 
ATOM   5470  H  H    . ASP B 1 46  ? -5.283  32.948 2.501   1.00 28.71  ? 46   ASP B H    1 
ATOM   5471  H  HA   . ASP B 1 46  ? -5.649  34.957 0.704   1.00 33.37  ? 46   ASP B HA   1 
ATOM   5472  H  HB2  . ASP B 1 46  ? -5.750  35.576 2.988   1.00 44.44  ? 46   ASP B HB2  1 
ATOM   5473  H  HB3  . ASP B 1 46  ? -4.243  35.178 3.149   1.00 44.44  ? 46   ASP B HB3  1 
ATOM   5474  N  N    . VAL B 1 47  ? -3.691  34.369 -0.655  1.00 24.88  ? 47   VAL B N    1 
ATOM   5475  C  CA   . VAL B 1 47  ? -2.605  34.178 -1.579  1.00 21.35  ? 47   VAL B CA   1 
ATOM   5476  C  C    . VAL B 1 47  ? -2.129  35.448 -2.291  1.00 25.76  ? 47   VAL B C    1 
ATOM   5477  O  O    . VAL B 1 47  ? -2.992  36.135 -2.829  1.00 30.32  ? 47   VAL B O    1 
ATOM   5478  C  CB   . VAL B 1 47  ? -2.985  33.284 -2.793  1.00 26.85  ? 47   VAL B CB   1 
ATOM   5479  C  CG1  . VAL B 1 47  ? -1.722  32.993 -3.581  1.00 28.53  ? 47   VAL B CG1  1 
ATOM   5480  C  CG2  . VAL B 1 47  ? -3.731  32.041 -2.362  1.00 26.38  ? 47   VAL B CG2  1 
ATOM   5481  H  H    . VAL B 1 47  ? -4.467  34.476 -1.010  1.00 29.86  ? 47   VAL B H    1 
ATOM   5482  H  HA   . VAL B 1 47  ? -1.849  33.772 -1.106  1.00 25.62  ? 47   VAL B HA   1 
ATOM   5483  H  HB   . VAL B 1 47  ? -3.583  33.805 -3.370  1.00 32.22  ? 47   VAL B HB   1 
ATOM   5484  H  HG11 . VAL B 1 47  ? -1.325  33.819 -3.867  1.00 42.80  ? 47   VAL B HG11 1 
ATOM   5485  H  HG12 . VAL B 1 47  ? -1.940  32.459 -4.349  1.00 42.80  ? 47   VAL B HG12 1 
ATOM   5486  H  HG13 . VAL B 1 47  ? -1.101  32.515 -3.026  1.00 42.80  ? 47   VAL B HG13 1 
ATOM   5487  H  HG21 . VAL B 1 47  ? -4.513  32.292 -1.865  1.00 39.57  ? 47   VAL B HG21 1 
ATOM   5488  H  HG22 . VAL B 1 47  ? -3.160  31.501 -1.809  1.00 39.57  ? 47   VAL B HG22 1 
ATOM   5489  H  HG23 . VAL B 1 47  ? -3.992  31.539 -3.138  1.00 39.57  ? 47   VAL B HG23 1 
ATOM   5490  N  N    . LYS B 1 48  ? -0.819  35.625 -2.276  1.00 16.88  ? 48   LYS B N    1 
ATOM   5491  C  CA   . LYS B 1 48  ? -0.166  36.688 -3.050  1.00 21.10  ? 48   LYS B CA   1 
ATOM   5492  C  C    . LYS B 1 48  ? 1.015   36.077 -3.791  1.00 19.30  ? 48   LYS B C    1 
ATOM   5493  O  O    . LYS B 1 48  ? 1.838   35.362 -3.239  1.00 21.64  ? 48   LYS B O    1 
ATOM   5494  C  CB   . LYS B 1 48  ? 0.231   37.852 -2.166  1.00 25.59  ? 48   LYS B CB   1 
ATOM   5495  C  CG   . LYS B 1 48  ? -0.937  38.573 -1.500  0.81 45.89  ? 48   LYS B CG   1 
ATOM   5496  C  CD   . LYS B 1 48  ? -1.983  39.099 -2.473  0.81 48.18  ? 48   LYS B CD   1 
ATOM   5497  C  CE   . LYS B 1 48  ? -3.227  39.629 -1.788  0.81 48.58  ? 48   LYS B CE   1 
ATOM   5498  N  NZ   . LYS B 1 48  ? -3.564  41.014 -2.229  0.81 57.51  ? 48   LYS B NZ   1 
ATOM   5499  H  H    . LYS B 1 48  ? -0.333  35.101 -1.797  1.00 20.25  ? 48   LYS B H    1 
ATOM   5500  H  HA   . LYS B 1 48  ? -0.806  37.017 -3.715  1.00 25.32  ? 48   LYS B HA   1 
ATOM   5501  H  HB2  . LYS B 1 48  ? 0.828   37.525 -1.475  1.00 30.71  ? 48   LYS B HB2  1 
ATOM   5502  H  HB3  . LYS B 1 48  ? 0.726   38.492 -2.701  1.00 30.71  ? 48   LYS B HB3  1 
ATOM   5503  H  HG2  . LYS B 1 48  ? -1.368  37.962 -0.881  0.81 55.07  ? 48   LYS B HG2  1 
ATOM   5504  H  HG3  . LYS B 1 48  ? -0.590  39.317 -0.984  0.81 55.07  ? 48   LYS B HG3  1 
ATOM   5505  H  HD2  . LYS B 1 48  ? -1.589  39.809 -3.004  0.81 57.81  ? 48   LYS B HD2  1 
ATOM   5506  H  HD3  . LYS B 1 48  ? -2.237  38.384 -3.078  0.81 57.81  ? 48   LYS B HD3  1 
ATOM   5507  H  HE2  . LYS B 1 48  ? -3.974  39.042 -1.983  0.81 58.30  ? 48   LYS B HE2  1 
ATOM   5508  H  HE3  . LYS B 1 48  ? -3.088  39.625 -0.828  0.81 58.30  ? 48   LYS B HE3  1 
ATOM   5509  H  HZ1  . LYS B 1 48  ? -4.240  41.324 -1.740  0.81 86.26  ? 48   LYS B HZ1  1 
ATOM   5510  H  HZ2  . LYS B 1 48  ? -3.799  41.003 -3.087  0.81 86.26  ? 48   LYS B HZ2  1 
ATOM   5511  H  HZ3  . LYS B 1 48  ? -2.855  41.540 -2.122  0.81 86.26  ? 48   LYS B HZ3  1 
ATOM   5512  N  N    . ASP B 1 49  ? 1.063   36.378 -5.077  1.00 21.94  ? 49   ASP B N    1 
ATOM   5513  C  CA   . ASP B 1 49  ? 2.048   35.893 -6.013  1.00 19.73  ? 49   ASP B CA   1 
ATOM   5514  C  C    . ASP B 1 49  ? 3.154   36.929 -6.186  1.00 28.96  ? 49   ASP B C    1 
ATOM   5515  O  O    . ASP B 1 49  ? 3.008   37.899 -6.928  1.00 33.12  ? 49   ASP B O    1 
ATOM   5516  C  CB   . ASP B 1 49  ? 1.389   35.599 -7.363  1.00 23.54  ? 49   ASP B CB   1 
ATOM   5517  C  CG   . ASP B 1 49  ? 2.258   34.785 -8.292  1.00 35.97  ? 49   ASP B CG   1 
ATOM   5518  O  OD1  . ASP B 1 49  ? 3.481   34.752 -8.042  1.00 24.98  ? 49   ASP B OD1  1 
ATOM   5519  O  OD2  . ASP B 1 49  ? 1.721   34.185 -9.247  1.00 36.82  ? 49   ASP B OD2  1 
ATOM   5520  H  H    . ASP B 1 49  ? 0.457   36.907 -5.381  1.00 26.33  ? 49   ASP B H    1 
ATOM   5521  H  HA   . ASP B 1 49  ? 2.439   35.066 -5.662  1.00 23.67  ? 49   ASP B HA   1 
ATOM   5522  H  HB2  . ASP B 1 49  ? 0.560   35.119 -7.210  1.00 28.25  ? 49   ASP B HB2  1 
ATOM   5523  H  HB3  . ASP B 1 49  ? 1.169   36.439 -7.795  1.00 28.25  ? 49   ASP B HB3  1 
ATOM   5524  N  N    . TYR B 1 50  ? 4.251   36.718 -5.489  1.00 24.02  ? 50   TYR B N    1 
ATOM   5525  C  CA   . TYR B 1 50  ? 5.463   37.518 -5.589  1.00 19.81  ? 50   TYR B CA   1 
ATOM   5526  C  C    . TYR B 1 50  ? 6.207   37.281 -6.906  1.00 19.00  ? 50   TYR B C    1 
ATOM   5527  O  O    . TYR B 1 50  ? 7.245   37.915 -7.119  1.00 22.07  ? 50   TYR B O    1 
ATOM   5528  C  CB   . TYR B 1 50  ? 6.398   37.219 -4.429  1.00 15.72  ? 50   TYR B CB   1 
ATOM   5529  C  CG   . TYR B 1 50  ? 5.914   37.808 -3.127  1.00 19.27  ? 50   TYR B CG   1 
ATOM   5530  C  CD1  . TYR B 1 50  ? 4.939   37.096 -2.414  1.00 18.93  ? 50   TYR B CD1  1 
ATOM   5531  C  CD2  . TYR B 1 50  ? 6.353   38.994 -2.581  1.00 26.74  ? 50   TYR B CD2  1 
ATOM   5532  C  CE1  . TYR B 1 50  ? 4.452   37.554 -1.236  1.00 19.73  ? 50   TYR B CE1  1 
ATOM   5533  C  CE2  . TYR B 1 50  ? 5.863   39.472 -1.373  1.00 35.38  ? 50   TYR B CE2  1 
ATOM   5534  C  CZ   . TYR B 1 50  ? 4.911   38.742 -0.704  1.00 18.86  ? 50   TYR B CZ   1 
ATOM   5535  O  OH   . TYR B 1 50  ? 4.375   39.151 0.490   1.00 37.04  ? 50   TYR B OH   1 
ATOM   5536  H  H    . TYR B 1 50  ? 4.251   36.060 -4.935  1.00 28.83  ? 50   TYR B H    1 
ATOM   5537  H  HA   . TYR B 1 50  ? 5.211   38.464 -5.544  1.00 23.77  ? 50   TYR B HA   1 
ATOM   5538  H  HB2  . TYR B 1 50  ? 6.483   36.258 -4.330  1.00 18.86  ? 50   TYR B HB2  1 
ATOM   5539  H  HB3  . TYR B 1 50  ? 7.277   37.576 -4.631  1.00 18.86  ? 50   TYR B HB3  1 
ATOM   5540  H  HD1  . TYR B 1 50  ? 4.620   36.293 -2.757  1.00 22.72  ? 50   TYR B HD1  1 
ATOM   5541  H  HD2  . TYR B 1 50  ? 6.996   39.489 -3.035  1.00 32.09  ? 50   TYR B HD2  1 
ATOM   5542  H  HE1  . TYR B 1 50  ? 3.803   37.065 -0.782  1.00 23.67  ? 50   TYR B HE1  1 
ATOM   5543  H  HE2  . TYR B 1 50  ? 6.175   40.275 -1.022  1.00 42.46  ? 50   TYR B HE2  1 
ATOM   5544  H  HH   . TYR B 1 50  ? 4.693   39.878 0.698   1.00 55.56  ? 50   TYR B HH   1 
ATOM   5545  N  N    . GLY B 1 51  ? 5.672   36.425 -7.733  1.00 30.23  ? 51   GLY B N    1 
ATOM   5546  C  CA   . GLY B 1 51  ? 6.107   36.161 -9.065  1.00 16.24  ? 51   GLY B CA   1 
ATOM   5547  C  C    . GLY B 1 51  ? 7.263   35.201 -9.192  1.00 23.71  ? 51   GLY B C    1 
ATOM   5548  O  O    . GLY B 1 51  ? 7.603   34.556 -8.207  1.00 29.08  ? 51   GLY B O    1 
ATOM   5549  H  H    . GLY B 1 51  ? 4.993   35.979 -7.448  1.00 36.28  ? 51   GLY B H    1 
ATOM   5550  H  HA2  . GLY B 1 51  ? 5.358   35.806 -9.568  1.00 19.49  ? 51   GLY B HA2  1 
ATOM   5551  H  HA3  . GLY B 1 51  ? 6.361   37.002 -9.476  1.00 19.49  ? 51   GLY B HA3  1 
ATOM   5552  N  N    . ASP B 1 52  ? 7.866   35.109 -10.374 1.00 23.35  ? 52   ASP B N    1 
ATOM   5553  C  CA   . ASP B 1 52  ? 9.034   34.249 -10.517 1.00 22.68  ? 52   ASP B CA   1 
ATOM   5554  C  C    . ASP B 1 52  ? 10.311  35.068 -10.483 1.00 23.70  ? 52   ASP B C    1 
ATOM   5555  O  O    . ASP B 1 52  ? 10.428  36.117 -11.126 1.00 30.67  ? 52   ASP B O    1 
ATOM   5556  C  CB   . ASP B 1 52  ? 8.956   33.441 -11.805 1.00 24.03  ? 52   ASP B CB   1 
ATOM   5557  C  CG   . ASP B 1 52  ? 7.658   32.684 -11.980 1.00 41.01  ? 52   ASP B CG   1 
ATOM   5558  O  OD1  . ASP B 1 52  ? 7.087   32.729 -13.094 1.00 51.15  ? 52   ASP B OD1  1 
ATOM   5559  O  OD2  . ASP B 1 52  ? 7.208   32.036 -11.014 1.00 28.59  ? 52   ASP B OD2  1 
ATOM   5560  H  H    . ASP B 1 52  ? 7.570   35.553 -11.048 1.00 28.02  ? 52   ASP B H    1 
ATOM   5561  H  HA   . ASP B 1 52  ? 9.050   33.624 -9.762  1.00 27.21  ? 52   ASP B HA   1 
ATOM   5562  H  HB2  . ASP B 1 52  ? 9.070   34.043 -12.557 1.00 28.84  ? 52   ASP B HB2  1 
ATOM   5563  H  HB3  . ASP B 1 52  ? 9.691   32.808 -11.820 1.00 28.84  ? 52   ASP B HB3  1 
ATOM   5564  N  N    . LEU B 1 53  ? 11.284  34.598 -9.718  1.00 23.44  ? 53   LEU B N    1 
ATOM   5565  C  CA   . LEU B 1 53  ? 12.592  35.200 -9.629  1.00 28.11  ? 53   LEU B CA   1 
ATOM   5566  C  C    . LEU B 1 53  ? 13.353  35.180 -10.951 1.00 25.95  ? 53   LEU B C    1 
ATOM   5567  O  O    . LEU B 1 53  ? 13.448  34.164 -11.651 1.00 21.78  ? 53   LEU B O    1 
ATOM   5568  C  CB   . LEU B 1 53  ? 13.459  34.460 -8.607  1.00 18.49  ? 53   LEU B CB   1 
ATOM   5569  C  CG   . LEU B 1 53  ? 13.033  34.672 -7.151  1.00 24.32  ? 53   LEU B CG   1 
ATOM   5570  C  CD1  . LEU B 1 53  ? 13.854  33.792 -6.225  1.00 19.73  ? 53   LEU B CD1  1 
ATOM   5571  C  CD2  . LEU B 1 53  ? 13.176  36.129 -6.736  1.00 28.27  ? 53   LEU B CD2  1 
ATOM   5572  H  H    . LEU B 1 53  ? 11.127  33.895 -9.248  1.00 28.13  ? 53   LEU B H    1 
ATOM   5573  H  HA   . LEU B 1 53  ? 12.490  36.130 -9.339  1.00 33.74  ? 53   LEU B HA   1 
ATOM   5574  H  HB2  . LEU B 1 53  ? 13.430  33.510 -8.804  1.00 22.18  ? 53   LEU B HB2  1 
ATOM   5575  H  HB3  . LEU B 1 53  ? 14.378  34.753 -8.708  1.00 22.18  ? 53   LEU B HB3  1 
ATOM   5576  H  HG   . LEU B 1 53  ? 12.091  34.418 -7.064  1.00 29.19  ? 53   LEU B HG   1 
ATOM   5577  H  HD11 . LEU B 1 53  ? 13.770  32.875 -6.497  1.00 29.60  ? 53   LEU B HD11 1 
ATOM   5578  H  HD12 . LEU B 1 53  ? 13.535  33.889 -5.325  1.00 29.60  ? 53   LEU B HD12 1 
ATOM   5579  H  HD13 . LEU B 1 53  ? 14.777  34.054 -6.267  1.00 29.60  ? 53   LEU B HD13 1 
ATOM   5580  H  HD21 . LEU B 1 53  ? 12.665  36.683 -7.331  1.00 42.41  ? 53   LEU B HD21 1 
ATOM   5581  H  HD22 . LEU B 1 53  ? 14.101  36.385 -6.777  1.00 42.41  ? 53   LEU B HD22 1 
ATOM   5582  H  HD23 . LEU B 1 53  ? 12.853  36.240 -5.839  1.00 42.41  ? 53   LEU B HD23 1 
ATOM   5583  N  N    . PRO B 1 54  ? 13.941  36.326 -11.279 1.00 25.98  ? 54   PRO B N    1 
ATOM   5584  C  CA   . PRO B 1 54  ? 14.835  36.379 -12.435 1.00 24.75  ? 54   PRO B CA   1 
ATOM   5585  C  C    . PRO B 1 54  ? 16.268  35.996 -12.089 1.00 17.93  ? 54   PRO B C    1 
ATOM   5586  O  O    . PRO B 1 54  ? 16.991  36.714 -11.403 1.00 25.21  ? 54   PRO B O    1 
ATOM   5587  C  CB   . PRO B 1 54  ? 14.791  37.869 -12.795 1.00 21.83  ? 54   PRO B CB   1 
ATOM   5588  C  CG   . PRO B 1 54  ? 14.721  38.527 -11.454 1.00 27.24  ? 54   PRO B CG   1 
ATOM   5589  C  CD   . PRO B 1 54  ? 13.847  37.630 -10.604 1.00 15.91  ? 54   PRO B CD   1 
ATOM   5590  H  HA   . PRO B 1 54  ? 14.493  35.829 -13.171 1.00 29.70  ? 54   PRO B HA   1 
ATOM   5591  H  HB2  . PRO B 1 54  ? 15.588  38.138 -13.278 1.00 26.19  ? 54   PRO B HB2  1 
ATOM   5592  H  HB3  . PRO B 1 54  ? 14.009  38.078 -13.331 1.00 26.19  ? 54   PRO B HB3  1 
ATOM   5593  H  HG2  . PRO B 1 54  ? 15.606  38.607 -11.066 1.00 32.69  ? 54   PRO B HG2  1 
ATOM   5594  H  HG3  . PRO B 1 54  ? 14.331  39.412 -11.527 1.00 32.69  ? 54   PRO B HG3  1 
ATOM   5595  H  HD2  . PRO B 1 54  ? 14.181  37.577 -9.695  1.00 19.10  ? 54   PRO B HD2  1 
ATOM   5596  H  HD3  . PRO B 1 54  ? 12.931  37.949 -10.587 1.00 19.10  ? 54   PRO B HD3  1 
ATOM   5597  N  N    . PHE B 1 55  ? 16.709  34.860 -12.585 1.00 21.60  ? 55   PHE B N    1 
ATOM   5598  C  CA   . PHE B 1 55  ? 18.061  34.344 -12.395 1.00 21.41  ? 55   PHE B CA   1 
ATOM   5599  C  C    . PHE B 1 55  ? 18.918  34.697 -13.609 1.00 24.95  ? 55   PHE B C    1 
ATOM   5600  O  O    . PHE B 1 55  ? 18.747  34.134 -14.693 1.00 24.88  ? 55   PHE B O    1 
ATOM   5601  C  CB   . PHE B 1 55  ? 18.023  32.829 -12.171 1.00 20.99  ? 55   PHE B CB   1 
ATOM   5602  C  CG   . PHE B 1 55  ? 17.200  32.471 -10.936 1.00 22.82  ? 55   PHE B CG   1 
ATOM   5603  C  CD1  . PHE B 1 55  ? 17.552  33.008 -9.704  1.00 16.95  ? 55   PHE B CD1  1 
ATOM   5604  C  CD2  . PHE B 1 55  ? 16.106  31.640 -11.022 1.00 22.27  ? 55   PHE B CD2  1 
ATOM   5605  C  CE1  . PHE B 1 55  ? 16.817  32.714 -8.567  1.00 22.89  ? 55   PHE B CE1  1 
ATOM   5606  C  CE2  . PHE B 1 55  ? 15.381  31.305 -9.877  1.00 17.71  ? 55   PHE B CE2  1 
ATOM   5607  C  CZ   . PHE B 1 55  ? 15.742  31.840 -8.660  1.00 17.77  ? 55   PHE B CZ   1 
ATOM   5608  H  H    . PHE B 1 55  ? 16.163  34.389 -13.053 1.00 25.92  ? 55   PHE B H    1 
ATOM   5609  H  HA   . PHE B 1 55  ? 18.450  34.768 -11.603 1.00 25.69  ? 55   PHE B HA   1 
ATOM   5610  H  HB2  . PHE B 1 55  ? 17.638  32.397 -12.950 1.00 25.19  ? 55   PHE B HB2  1 
ATOM   5611  H  HB3  . PHE B 1 55  ? 18.928  32.497 -12.061 1.00 25.19  ? 55   PHE B HB3  1 
ATOM   5612  H  HD1  . PHE B 1 55  ? 18.289  33.571 -9.641  1.00 20.34  ? 55   PHE B HD1  1 
ATOM   5613  H  HD2  . PHE B 1 55  ? 15.849  31.300 -11.848 1.00 26.72  ? 55   PHE B HD2  1 
ATOM   5614  H  HE1  . PHE B 1 55  ? 17.042  33.098 -7.750  1.00 27.46  ? 55   PHE B HE1  1 
ATOM   5615  H  HE2  . PHE B 1 55  ? 14.658  30.723 -9.936  1.00 21.25  ? 55   PHE B HE2  1 
ATOM   5616  H  HZ   . PHE B 1 55  ? 15.263  31.615 -7.896  1.00 21.33  ? 55   PHE B HZ   1 
ATOM   5617  N  N    . ALA B 1 56  ? 19.828  35.643 -13.413 1.00 28.67  ? 56   ALA B N    1 
ATOM   5618  C  CA   . ALA B 1 56  ? 20.733  36.047 -14.490 1.00 36.65  ? 56   ALA B CA   1 
ATOM   5619  C  C    . ALA B 1 56  ? 21.732  34.963 -14.846 1.00 34.85  ? 56   ALA B C    1 
ATOM   5620  O  O    . ALA B 1 56  ? 22.341  34.300 -14.004 1.00 20.76  ? 56   ALA B O    1 
ATOM   5621  C  CB   . ALA B 1 56  ? 21.448  37.329 -14.075 1.00 32.74  ? 56   ALA B CB   1 
ATOM   5622  H  H    . ALA B 1 56  ? 19.887  36.024 -12.644 1.00 34.41  ? 56   ALA B H    1 
ATOM   5623  H  HA   . ALA B 1 56  ? 20.195  36.240 -15.285 1.00 43.99  ? 56   ALA B HA   1 
ATOM   5624  H  HB1  . ALA B 1 56  ? 20.799  37.996 -13.841 1.00 49.11  ? 56   ALA B HB1  1 
ATOM   5625  H  HB2  . ALA B 1 56  ? 21.984  37.647 -14.806 1.00 49.11  ? 56   ALA B HB2  1 
ATOM   5626  H  HB3  . ALA B 1 56  ? 22.012  37.152 -13.319 1.00 49.11  ? 56   ALA B HB3  1 
ATOM   5627  N  N    . ASP B 1 57  ? 21.965  34.742 -16.146 1.00 26.29  ? 57   ASP B N    1 
ATOM   5628  C  CA   . ASP B 1 57  ? 22.967  33.773 -16.528 1.00 16.92  ? 57   ASP B CA   1 
ATOM   5629  C  C    . ASP B 1 57  ? 24.351  34.184 -16.031 1.00 18.73  ? 57   ASP B C    1 
ATOM   5630  O  O    . ASP B 1 57  ? 24.711  35.368 -16.076 1.00 27.04  ? 57   ASP B O    1 
ATOM   5631  C  CB   . ASP B 1 57  ? 23.009  33.608 -18.048 1.00 24.30  ? 57   ASP B CB   1 
ATOM   5632  C  CG   . ASP B 1 57  ? 23.882  32.467 -18.504 1.00 34.95  ? 57   ASP B CG   1 
ATOM   5633  O  OD1  . ASP B 1 57  ? 24.653  32.665 -19.470 1.00 51.53  ? 57   ASP B OD1  1 
ATOM   5634  O  OD2  . ASP B 1 57  ? 23.821  31.363 -17.934 1.00 30.87  ? 57   ASP B OD2  1 
ATOM   5635  H  H    . ASP B 1 57  ? 21.524  35.171 -16.747 1.00 31.55  ? 57   ASP B H    1 
ATOM   5636  H  HA   . ASP B 1 57  ? 22.735  32.909 -16.127 1.00 20.31  ? 57   ASP B HA   1 
ATOM   5637  H  HB2  . ASP B 1 57  ? 22.107  33.462 -18.373 1.00 29.16  ? 57   ASP B HB2  1 
ATOM   5638  H  HB3  . ASP B 1 57  ? 23.336  34.431 -18.444 1.00 29.16  ? 57   ASP B HB3  1 
ATOM   5639  N  N    . ILE B 1 58  ? 25.123  33.200 -15.569 1.00 22.45  ? 58   ILE B N    1 
ATOM   5640  C  CA   . ILE B 1 58  ? 26.532  33.392 -15.249 1.00 24.39  ? 58   ILE B CA   1 
ATOM   5641  C  C    . ILE B 1 58  ? 27.352  32.544 -16.209 1.00 20.67  ? 58   ILE B C    1 
ATOM   5642  O  O    . ILE B 1 58  ? 27.630  31.372 -16.005 1.00 21.30  ? 58   ILE B O    1 
ATOM   5643  C  CB   . ILE B 1 58  ? 26.892  33.034 -13.792 1.00 19.74  ? 58   ILE B CB   1 
ATOM   5644  C  CG1  . ILE B 1 58  ? 26.089  33.788 -12.758 1.00 22.54  ? 58   ILE B CG1  1 
ATOM   5645  C  CG2  . ILE B 1 58  ? 28.389  33.250 -13.603 1.00 32.30  ? 58   ILE B CG2  1 
ATOM   5646  C  CD1  . ILE B 1 58  ? 26.533  33.591 -11.312 1.00 19.95  ? 58   ILE B CD1  1 
ATOM   5647  H  H    . ILE B 1 58  ? 24.776  32.422 -15.455 1.00 26.94  ? 58   ILE B H    1 
ATOM   5648  H  HA   . ILE B 1 58  ? 26.758  34.333 -15.400 1.00 29.27  ? 58   ILE B HA   1 
ATOM   5649  H  HB   . ILE B 1 58  ? 26.713  32.079 -13.669 1.00 23.68  ? 58   ILE B HB   1 
ATOM   5650  H  HG12 . ILE B 1 58  ? 26.133  34.734 -12.965 1.00 27.04  ? 58   ILE B HG12 1 
ATOM   5651  H  HG13 . ILE B 1 58  ? 25.161  33.516 -12.833 1.00 27.04  ? 58   ILE B HG13 1 
ATOM   5652  H  HG21 . ILE B 1 58  ? 28.870  32.761 -14.275 1.00 48.45  ? 58   ILE B HG21 1 
ATOM   5653  H  HG22 . ILE B 1 58  ? 28.649  32.940 -12.733 1.00 48.45  ? 58   ILE B HG22 1 
ATOM   5654  H  HG23 . ILE B 1 58  ? 28.590  34.185 -13.684 1.00 48.45  ? 58   ILE B HG23 1 
ATOM   5655  H  HD11 . ILE B 1 58  ? 25.967  34.105 -10.731 1.00 29.92  ? 58   ILE B HD11 1 
ATOM   5656  H  HD12 . ILE B 1 58  ? 27.442  33.883 -11.213 1.00 29.92  ? 58   ILE B HD12 1 
ATOM   5657  H  HD13 . ILE B 1 58  ? 26.468  32.662 -11.081 1.00 29.92  ? 58   ILE B HD13 1 
ATOM   5658  N  N    . PRO B 1 59  ? 27.732  33.170 -17.334 1.00 23.47  ? 59   PRO B N    1 
ATOM   5659  C  CA   . PRO B 1 59  ? 28.324  32.421 -18.437 1.00 27.19  ? 59   PRO B CA   1 
ATOM   5660  C  C    . PRO B 1 59  ? 29.702  31.875 -18.103 1.00 20.88  ? 59   PRO B C    1 
ATOM   5661  O  O    . PRO B 1 59  ? 30.114  30.802 -18.561 1.00 36.50  ? 59   PRO B O    1 
ATOM   5662  C  CB   . PRO B 1 59  ? 28.385  33.472 -19.553 1.00 29.74  ? 59   PRO B CB   1 
ATOM   5663  C  CG   . PRO B 1 59  ? 28.398  34.797 -18.878 1.00 20.43  ? 59   PRO B CG   1 
ATOM   5664  C  CD   . PRO B 1 59  ? 27.612  34.620 -17.610 1.00 25.40  ? 59   PRO B CD   1 
ATOM   5665  H  HA   . PRO B 1 59  ? 27.729  31.688 -18.701 1.00 32.63  ? 59   PRO B HA   1 
ATOM   5666  H  HB2  . PRO B 1 59  ? 29.187  33.355 -20.086 1.00 35.69  ? 59   PRO B HB2  1 
ATOM   5667  H  HB3  . PRO B 1 59  ? 27.612  33.395 -20.134 1.00 35.69  ? 59   PRO B HB3  1 
ATOM   5668  H  HG2  . PRO B 1 59  ? 29.307  35.070 -18.681 1.00 24.52  ? 59   PRO B HG2  1 
ATOM   5669  H  HG3  . PRO B 1 59  ? 27.986  35.471 -19.442 1.00 24.52  ? 59   PRO B HG3  1 
ATOM   5670  H  HD2  . PRO B 1 59  ? 27.992  35.145 -16.888 1.00 30.48  ? 59   PRO B HD2  1 
ATOM   5671  H  HD3  . PRO B 1 59  ? 26.685  34.876 -17.734 1.00 30.48  ? 59   PRO B HD3  1 
ATOM   5672  N  N    . ASN B 1 60  ? 30.456  32.604 -17.282 1.00 21.62  ? 60   ASN B N    1 
ATOM   5673  C  CA   . ASN B 1 60  ? 31.732  32.082 -16.817 1.00 21.53  ? 60   ASN B CA   1 
ATOM   5674  C  C    . ASN B 1 60  ? 31.553  31.681 -15.356 1.00 23.64  ? 60   ASN B C    1 
ATOM   5675  O  O    . ASN B 1 60  ? 31.689  32.489 -14.452 1.00 25.60  ? 60   ASN B O    1 
ATOM   5676  C  CB   . ASN B 1 60  ? 32.825  33.128 -17.030 1.00 37.94  ? 60   ASN B CB   1 
ATOM   5677  C  CG   . ASN B 1 60  ? 34.228  32.563 -16.955 1.00 35.38  ? 60   ASN B CG   1 
ATOM   5678  O  OD1  . ASN B 1 60  ? 34.356  31.419 -16.516 1.00 29.62  ? 60   ASN B OD1  1 
ATOM   5679  N  ND2  . ASN B 1 60  ? 35.224  33.331 -17.392 1.00 20.77  ? 60   ASN B ND2  1 
ATOM   5680  H  H    . ASN B 1 60  ? 30.189  33.381 -17.027 1.00 25.95  ? 60   ASN B H    1 
ATOM   5681  H  HA   . ASN B 1 60  ? 31.954  31.283 -17.338 1.00 25.84  ? 60   ASN B HA   1 
ATOM   5682  H  HB2  . ASN B 1 60  ? 32.699  33.540 -17.899 1.00 45.53  ? 60   ASN B HB2  1 
ATOM   5683  H  HB3  . ASN B 1 60  ? 32.730  33.821 -16.358 1.00 45.53  ? 60   ASN B HB3  1 
ATOM   5684  H  HD21 . ASN B 1 60  ? 36.032  33.035 -17.380 1.00 24.93  ? 60   ASN B HD21 1 
ATOM   5685  H  HD22 . ASN B 1 60  ? 35.060  34.122 -17.685 1.00 24.93  ? 60   ASN B HD22 1 
ATOM   5686  N  N    . ASP B 1 61  ? 31.216  30.420 -15.163 1.00 23.66  ? 61   ASP B N    1 
ATOM   5687  C  CA   . ASP B 1 61  ? 31.009  29.822 -13.836 1.00 24.92  ? 61   ASP B CA   1 
ATOM   5688  C  C    . ASP B 1 61  ? 31.726  28.497 -13.797 1.00 20.88  ? 61   ASP B C    1 
ATOM   5689  O  O    . ASP B 1 61  ? 31.167  27.423 -14.050 1.00 24.93  ? 61   ASP B O    1 
ATOM   5690  C  CB   . ASP B 1 61  ? 29.499  29.760 -13.597 1.00 25.15  ? 61   ASP B CB   1 
ATOM   5691  C  CG   . ASP B 1 61  ? 29.137  29.259 -12.202 1.00 30.91  ? 61   ASP B CG   1 
ATOM   5692  O  OD1  . ASP B 1 61  ? 30.024  29.297 -11.329 1.00 18.64  ? 61   ASP B OD1  1 
ATOM   5693  O  OD2  . ASP B 1 61  ? 27.958  28.846 -12.072 1.00 18.31  ? 61   ASP B OD2  1 
ATOM   5694  H  H    . ASP B 1 61  ? 31.111  29.919 -15.854 1.00 28.39  ? 61   ASP B H    1 
ATOM   5695  H  HA   . ASP B 1 61  ? 31.407  30.412 -13.162 1.00 29.91  ? 61   ASP B HA   1 
ATOM   5696  H  HB2  . ASP B 1 61  ? 29.123  30.645 -13.722 1.00 30.18  ? 61   ASP B HB2  1 
ATOM   5697  H  HB3  . ASP B 1 61  ? 29.099  29.173 -14.257 1.00 30.18  ? 61   ASP B HB3  1 
ATOM   5698  N  N    . SER B 1 62  ? 33.031  28.508 -13.483 1.00 18.32  ? 62   SER B N    1 
ATOM   5699  C  CA   . SER B 1 62  ? 33.868  27.331 -13.491 1.00 19.97  ? 62   SER B CA   1 
ATOM   5700  C  C    . SER B 1 62  ? 33.720  26.437 -12.255 1.00 15.32  ? 62   SER B C    1 
ATOM   5701  O  O    . SER B 1 62  ? 33.458  26.961 -11.174 1.00 27.59  ? 62   SER B O    1 
ATOM   5702  C  CB   . SER B 1 62  ? 35.343  27.770 -13.578 1.00 27.77  ? 62   SER B CB   1 
ATOM   5703  O  OG   . SER B 1 62  ? 36.193  26.647 -13.465 1.00 39.80  ? 62   SER B OG   1 
ATOM   5704  H  H    . SER B 1 62  ? 33.389  29.259 -13.265 1.00 21.99  ? 62   SER B H    1 
ATOM   5705  H  HA   . SER B 1 62  ? 33.653  26.801 -14.286 1.00 23.96  ? 62   SER B HA   1 
ATOM   5706  H  HB2  . SER B 1 62  ? 35.501  28.215 -14.425 1.00 33.33  ? 62   SER B HB2  1 
ATOM   5707  H  HB3  . SER B 1 62  ? 35.538  28.399 -12.866 1.00 33.33  ? 62   SER B HB3  1 
ATOM   5708  H  HG   . SER B 1 62  ? 36.065  26.278 -12.744 1.00 59.70  ? 62   SER B HG   1 
ATOM   5709  N  N    . PRO B 1 63  ? 33.889  25.155 -12.421 1.00 19.74  ? 63   PRO B N    1 
ATOM   5710  C  CA   . PRO B 1 63  ? 33.600  24.241 -11.314 1.00 23.29  ? 63   PRO B CA   1 
ATOM   5711  C  C    . PRO B 1 63  ? 34.541  24.546 -10.150 1.00 25.43  ? 63   PRO B C    1 
ATOM   5712  O  O    . PRO B 1 63  ? 35.599  25.144 -10.317 1.00 24.89  ? 63   PRO B O    1 
ATOM   5713  C  CB   . PRO B 1 63  ? 33.878  22.869 -11.871 1.00 19.47  ? 63   PRO B CB   1 
ATOM   5714  C  CG   . PRO B 1 63  ? 34.142  23.002 -13.332 1.00 25.72  ? 63   PRO B CG   1 
ATOM   5715  C  CD   . PRO B 1 63  ? 34.372  24.441 -13.606 1.00 23.87  ? 63   PRO B CD   1 
ATOM   5716  H  HA   . PRO B 1 63  ? 32.664  24.320 -11.034 1.00 27.94  ? 63   PRO B HA   1 
ATOM   5717  H  HB2  . PRO B 1 63  ? 34.649  22.480 -11.428 1.00 23.36  ? 63   PRO B HB2  1 
ATOM   5718  H  HB3  . PRO B 1 63  ? 33.115  22.288 -11.722 1.00 23.36  ? 63   PRO B HB3  1 
ATOM   5719  H  HG2  . PRO B 1 63  ? 34.923  22.484 -13.581 1.00 30.86  ? 63   PRO B HG2  1 
ATOM   5720  H  HG3  . PRO B 1 63  ? 33.382  22.680 -13.842 1.00 30.86  ? 63   PRO B HG3  1 
ATOM   5721  H  HD2  . PRO B 1 63  ? 35.315  24.614 -13.748 1.00 28.64  ? 63   PRO B HD2  1 
ATOM   5722  H  HD3  . PRO B 1 63  ? 33.881  24.720 -14.395 1.00 28.64  ? 63   PRO B HD3  1 
ATOM   5723  N  N    . PHE B 1 64  ? 34.091  24.081 -8.998  1.00 21.04  ? 64   PHE B N    1 
ATOM   5724  C  CA   . PHE B 1 64  ? 34.883  24.000 -7.789  1.00 20.43  ? 64   PHE B CA   1 
ATOM   5725  C  C    . PHE B 1 64  ? 35.220  22.528 -7.564  1.00 21.90  ? 64   PHE B C    1 
ATOM   5726  O  O    . PHE B 1 64  ? 34.336  21.764 -7.161  1.00 20.97  ? 64   PHE B O    1 
ATOM   5727  C  CB   . PHE B 1 64  ? 34.131  24.511 -6.571  1.00 21.07  ? 64   PHE B CB   1 
ATOM   5728  C  CG   . PHE B 1 64  ? 34.830  24.177 -5.263  1.00 23.76  ? 64   PHE B CG   1 
ATOM   5729  C  CD1  . PHE B 1 64  ? 35.935  24.912 -4.888  1.00 28.31  ? 64   PHE B CD1  1 
ATOM   5730  C  CD2  . PHE B 1 64  ? 34.366  23.155 -4.448  1.00 28.98  ? 64   PHE B CD2  1 
ATOM   5731  C  CE1  . PHE B 1 64  ? 36.586  24.613 -3.697  1.00 32.21  ? 64   PHE B CE1  1 
ATOM   5732  C  CE2  . PHE B 1 64  ? 35.020  22.833 -3.274  1.00 36.60  ? 64   PHE B CE2  1 
ATOM   5733  C  CZ   . PHE B 1 64  ? 36.138  23.569 -2.907  1.00 30.53  ? 64   PHE B CZ   1 
ATOM   5734  H  H    . PHE B 1 64  ? 33.275  23.809 -8.964  1.00 25.25  ? 64   PHE B H    1 
ATOM   5735  H  HA   . PHE B 1 64  ? 35.710  24.513 -7.904  1.00 24.52  ? 64   PHE B HA   1 
ATOM   5736  H  HB2  . PHE B 1 64  ? 34.034  25.474 -6.640  1.00 25.28  ? 64   PHE B HB2  1 
ATOM   5737  H  HB3  . PHE B 1 64  ? 33.242  24.124 -6.562  1.00 25.28  ? 64   PHE B HB3  1 
ATOM   5738  H  HD1  . PHE B 1 64  ? 36.244  25.603 -5.429  1.00 33.98  ? 64   PHE B HD1  1 
ATOM   5739  H  HD2  . PHE B 1 64  ? 33.606  22.680 -4.695  1.00 34.78  ? 64   PHE B HD2  1 
ATOM   5740  H  HE1  . PHE B 1 64  ? 37.322  25.115 -3.431  1.00 38.66  ? 64   PHE B HE1  1 
ATOM   5741  H  HE2  . PHE B 1 64  ? 34.716  22.136 -2.739  1.00 43.92  ? 64   PHE B HE2  1 
ATOM   5742  H  HZ   . PHE B 1 64  ? 36.590  23.358 -2.122  1.00 36.63  ? 64   PHE B HZ   1 
ATOM   5743  N  N    . GLN B 1 65  ? 36.447  22.131 -7.841  1.00 18.29  ? 65   GLN B N    1 
ATOM   5744  C  CA   . GLN B 1 65  ? 36.762  20.735 -8.007  1.00 15.61  ? 65   GLN B CA   1 
ATOM   5745  C  C    . GLN B 1 65  ? 35.706  20.092 -8.906  1.00 25.21  ? 65   GLN B C    1 
ATOM   5746  O  O    . GLN B 1 65  ? 35.551  20.599 -10.027 1.00 28.62  ? 65   GLN B O    1 
ATOM   5747  C  CB   . GLN B 1 65  ? 36.858  20.087 -6.624  1.00 27.70  ? 65   GLN B CB   1 
ATOM   5748  C  CG   . GLN B 1 65  ? 37.691  20.874 -5.630  1.00 22.48  ? 65   GLN B CG   1 
ATOM   5749  C  CD   . GLN B 1 65  ? 37.877  20.201 -4.288  1.00 29.76  ? 65   GLN B CD   1 
ATOM   5750  O  OE1  . GLN B 1 65  ? 38.803  20.542 -3.546  1.00 49.33  ? 65   GLN B OE1  1 
ATOM   5751  N  NE2  . GLN B 1 65  ? 37.030  19.240 -3.935  1.00 43.63  ? 65   GLN B NE2  1 
ATOM   5752  H  H    . GLN B 1 65  ? 37.071  22.717 -7.925  1.00 21.94  ? 65   GLN B H    1 
ATOM   5753  H  HA   . GLN B 1 65  ? 37.634  20.662 -8.447  1.00 18.73  ? 65   GLN B HA   1 
ATOM   5754  H  HB2  . GLN B 1 65  ? 35.963  19.982 -6.266  1.00 33.24  ? 65   GLN B HB2  1 
ATOM   5755  H  HB3  . GLN B 1 65  ? 37.243  19.202 -6.720  1.00 33.24  ? 65   GLN B HB3  1 
ATOM   5756  H  HG2  . GLN B 1 65  ? 38.564  21.036 -6.019  1.00 26.97  ? 65   GLN B HG2  1 
ATOM   5757  H  HG3  . GLN B 1 65  ? 37.269  21.736 -5.488  1.00 26.97  ? 65   GLN B HG3  1 
ATOM   5758  H  HE21 . GLN B 1 65  ? 37.120  18.843 -3.177  1.00 52.36  ? 65   GLN B HE21 1 
ATOM   5759  H  HE22 . GLN B 1 65  ? 36.390  19.014 -4.464  1.00 52.36  ? 65   GLN B HE22 1 
ATOM   5760  N  N    . ILE B 1 66  ? 34.952  19.083 -8.511  1.00 20.59  ? 66   ILE B N    1 
ATOM   5761  C  CA   . ILE B 1 66  ? 33.942  18.452 -9.361  1.00 21.00  ? 66   ILE B CA   1 
ATOM   5762  C  C    . ILE B 1 66  ? 32.560  19.065 -9.186  1.00 18.08  ? 66   ILE B C    1 
ATOM   5763  O  O    . ILE B 1 66  ? 31.609  18.657 -9.860  1.00 24.73  ? 66   ILE B O    1 
ATOM   5764  C  CB   . ILE B 1 66  ? 33.887  16.934 -9.132  1.00 24.99  ? 66   ILE B CB   1 
ATOM   5765  C  CG1  . ILE B 1 66  ? 32.960  16.425 -8.014  1.00 23.81  ? 66   ILE B CG1  1 
ATOM   5766  C  CG2  . ILE B 1 66  ? 35.299  16.399 -8.909  1.00 42.12  ? 66   ILE B CG2  1 
ATOM   5767  C  CD1  . ILE B 1 66  ? 32.775  14.933 -7.993  1.00 25.11  ? 66   ILE B CD1  1 
ATOM   5768  H  H    . ILE B 1 66  ? 35.060  18.780 -7.713  1.00 24.71  ? 66   ILE B H    1 
ATOM   5769  H  HA   . ILE B 1 66  ? 34.210  18.599 -10.292 1.00 25.20  ? 66   ILE B HA   1 
ATOM   5770  H  HB   . ILE B 1 66  ? 33.565  16.536 -9.968  1.00 29.99  ? 66   ILE B HB   1 
ATOM   5771  H  HG12 . ILE B 1 66  ? 33.322  16.705 -7.159  1.00 28.57  ? 66   ILE B HG12 1 
ATOM   5772  H  HG13 . ILE B 1 66  ? 32.091  16.845 -8.116  1.00 28.57  ? 66   ILE B HG13 1 
ATOM   5773  H  HG21 . ILE B 1 66  ? 35.262  15.451 -8.762  1.00 63.19  ? 66   ILE B HG21 1 
ATOM   5774  H  HG22 . ILE B 1 66  ? 35.686  16.828 -8.142  1.00 63.19  ? 66   ILE B HG22 1 
ATOM   5775  H  HG23 . ILE B 1 66  ? 35.836  16.583 -9.683  1.00 63.19  ? 66   ILE B HG23 1 
ATOM   5776  H  HD11 . ILE B 1 66  ? 32.182  14.694 -7.276  1.00 37.66  ? 66   ILE B HD11 1 
ATOM   5777  H  HD12 . ILE B 1 66  ? 33.625  14.507 -7.861  1.00 37.66  ? 66   ILE B HD12 1 
ATOM   5778  H  HD13 . ILE B 1 66  ? 32.399  14.645 -8.828  1.00 37.66  ? 66   ILE B HD13 1 
ATOM   5779  N  N    . VAL B 1 67  ? 32.407  20.035 -8.312  1.00 20.11  ? 67   VAL B N    1 
ATOM   5780  C  CA   . VAL B 1 67  ? 31.145  20.729 -8.073  1.00 19.95  ? 67   VAL B CA   1 
ATOM   5781  C  C    . VAL B 1 67  ? 30.814  21.759 -9.139  1.00 18.65  ? 67   VAL B C    1 
ATOM   5782  O  O    . VAL B 1 67  ? 31.537  22.745 -9.359  1.00 21.05  ? 67   VAL B O    1 
ATOM   5783  C  CB   . VAL B 1 67  ? 31.145  21.454 -6.708  1.00 22.12  ? 67   VAL B CB   1 
ATOM   5784  C  CG1  . VAL B 1 67  ? 29.820  22.149 -6.435  1.00 20.04  ? 67   VAL B CG1  1 
ATOM   5785  C  CG2  . VAL B 1 67  ? 31.530  20.458 -5.616  1.00 19.40  ? 67   VAL B CG2  1 
ATOM   5786  H  H    . VAL B 1 67  ? 33.093  20.276 -7.853  1.00 24.13  ? 67   VAL B H    1 
ATOM   5787  H  HA   . VAL B 1 67  ? 30.428  20.061 -8.063  1.00 23.93  ? 67   VAL B HA   1 
ATOM   5788  H  HB   . VAL B 1 67  ? 31.840  22.144 -6.739  1.00 26.55  ? 67   VAL B HB   1 
ATOM   5789  H  HG11 . VAL B 1 67  ? 29.637  22.776 -7.139  1.00 30.05  ? 67   VAL B HG11 1 
ATOM   5790  H  HG12 . VAL B 1 67  ? 29.870  22.613 -5.597  1.00 30.05  ? 67   VAL B HG12 1 
ATOM   5791  H  HG13 . VAL B 1 67  ? 29.118  21.495 -6.398  1.00 30.05  ? 67   VAL B HG13 1 
ATOM   5792  H  HG21 . VAL B 1 67  ? 32.365  20.043 -5.841  1.00 29.10  ? 67   VAL B HG21 1 
ATOM   5793  H  HG22 . VAL B 1 67  ? 30.848  19.786 -5.541  1.00 29.10  ? 67   VAL B HG22 1 
ATOM   5794  H  HG23 . VAL B 1 67  ? 31.617  20.920 -4.779  1.00 29.10  ? 67   VAL B HG23 1 
ATOM   5795  N  N    . LYS B 1 68  ? 29.667  21.583 -9.789  1.00 18.65  ? 68   LYS B N    1 
ATOM   5796  C  CA   . LYS B 1 68  ? 29.246  22.302 -10.956 1.00 13.73  ? 68   LYS B CA   1 
ATOM   5797  C  C    . LYS B 1 68  ? 28.343  23.492 -10.749 1.00 15.90  ? 68   LYS B C    1 
ATOM   5798  O  O    . LYS B 1 68  ? 27.466  23.568 -9.886  1.00 21.23  ? 68   LYS B O    1 
ATOM   5799  C  CB   . LYS B 1 68  ? 28.603  21.287 -11.935 1.00 22.02  ? 68   LYS B CB   1 
ATOM   5800  C  CG   . LYS B 1 68  ? 29.611  20.174 -12.236 1.00 27.96  ? 68   LYS B CG   1 
ATOM   5801  C  CD   . LYS B 1 68  ? 29.008  19.094 -13.106 1.00 38.77  ? 68   LYS B CD   1 
ATOM   5802  C  CE   . LYS B 1 68  ? 28.634  17.847 -12.331 1.00 41.95  ? 68   LYS B CE   1 
ATOM   5803  N  NZ   . LYS B 1 68  ? 27.446  17.150 -12.906 1.00 47.56  ? 68   LYS B NZ   1 
ATOM   5804  H  H    . LYS B 1 68  ? 29.130  20.984 -9.483  1.00 22.37  ? 68   LYS B H    1 
ATOM   5805  H  HA   . LYS B 1 68  ? 30.059  22.636 -11.389 1.00 16.48  ? 68   LYS B HA   1 
ATOM   5806  H  HB2  . LYS B 1 68  ? 27.803  20.908 -11.539 1.00 26.42  ? 68   LYS B HB2  1 
ATOM   5807  H  HB3  . LYS B 1 68  ? 28.353  21.736 -12.758 1.00 26.42  ? 68   LYS B HB3  1 
ATOM   5808  H  HG2  . LYS B 1 68  ? 30.383  20.553 -12.685 1.00 33.55  ? 68   LYS B HG2  1 
ATOM   5809  H  HG3  . LYS B 1 68  ? 29.913  19.781 -11.402 1.00 33.55  ? 68   LYS B HG3  1 
ATOM   5810  H  HD2  . LYS B 1 68  ? 28.214  19.446 -13.539 1.00 46.52  ? 68   LYS B HD2  1 
ATOM   5811  H  HD3  . LYS B 1 68  ? 29.643  18.856 -13.799 1.00 46.52  ? 68   LYS B HD3  1 
ATOM   5812  H  HE2  . LYS B 1 68  ? 29.389  17.237 -12.329 1.00 50.34  ? 68   LYS B HE2  1 
ATOM   5813  H  HE3  . LYS B 1 68  ? 28.445  18.090 -11.411 1.00 50.34  ? 68   LYS B HE3  1 
ATOM   5814  H  HZ1  . LYS B 1 68  ? 27.168  16.522 -12.340 1.00 71.33  ? 68   LYS B HZ1  1 
ATOM   5815  H  HZ2  . LYS B 1 68  ? 27.669  16.774 -13.681 1.00 71.33  ? 68   LYS B HZ2  1 
ATOM   5816  H  HZ3  . LYS B 1 68  ? 26.792  17.739 -13.040 1.00 71.33  ? 68   LYS B HZ3  1 
ATOM   5817  N  N    . ASN B 1 69  ? 28.497  24.498 -11.604 1.00 14.15  ? 69   ASN B N    1 
ATOM   5818  C  CA   . ASN B 1 69  ? 27.754  25.742 -11.534 1.00 19.84  ? 69   ASN B CA   1 
ATOM   5819  C  C    . ASN B 1 69  ? 27.694  26.370 -10.145 1.00 16.65  ? 69   ASN B C    1 
ATOM   5820  O  O    . ASN B 1 69  ? 26.653  26.880 -9.726  1.00 15.28  ? 69   ASN B O    1 
ATOM   5821  C  CB   . ASN B 1 69  ? 26.352  25.538 -12.139 1.00 15.06  ? 69   ASN B CB   1 
ATOM   5822  C  CG   . ASN B 1 69  ? 26.457  24.718 -13.413 1.00 24.40  ? 69   ASN B CG   1 
ATOM   5823  O  OD1  . ASN B 1 69  ? 27.224  24.999 -14.342 1.00 20.99  ? 69   ASN B OD1  1 
ATOM   5824  N  ND2  . ASN B 1 69  ? 25.673  23.657 -13.524 1.00 18.10  ? 69   ASN B ND2  1 
ATOM   5825  H  H    . ASN B 1 69  ? 29.073  24.407 -12.236 1.00 16.98  ? 69   ASN B H    1 
ATOM   5826  H  HA   . ASN B 1 69  ? 28.220  26.382 -12.113 1.00 23.80  ? 69   ASN B HA   1 
ATOM   5827  H  HB2  . ASN B 1 69  ? 25.784  25.080 -11.501 1.00 18.07  ? 69   ASN B HB2  1 
ATOM   5828  H  HB3  . ASN B 1 69  ? 25.952  26.400 -12.337 1.00 18.07  ? 69   ASN B HB3  1 
ATOM   5829  H  HD21 . ASN B 1 69  ? 25.701  23.174 -14.235 1.00 21.72  ? 69   ASN B HD21 1 
ATOM   5830  H  HD22 . ASN B 1 69  ? 25.136  23.451 -12.884 1.00 21.72  ? 69   ASN B HD22 1 
ATOM   5831  N  N    . PRO B 1 70  ? 28.830  26.432 -9.431  1.00 18.73  ? 70   PRO B N    1 
ATOM   5832  C  CA   . PRO B 1 70  ? 28.746  26.921 -8.034  1.00 16.37  ? 70   PRO B CA   1 
ATOM   5833  C  C    . PRO B 1 70  ? 28.249  28.333 -7.927  1.00 17.02  ? 70   PRO B C    1 
ATOM   5834  O  O    . PRO B 1 70  ? 27.399  28.688 -7.090  1.00 17.90  ? 70   PRO B O    1 
ATOM   5835  C  CB   . PRO B 1 70  ? 30.183  26.750 -7.520  1.00 16.24  ? 70   PRO B CB   1 
ATOM   5836  C  CG   . PRO B 1 70  ? 31.047  26.798 -8.768  1.00 16.62  ? 70   PRO B CG   1 
ATOM   5837  C  CD   . PRO B 1 70  ? 30.200  26.111 -9.787  1.00 14.45  ? 70   PRO B CD   1 
ATOM   5838  H  HA   . PRO B 1 70  ? 28.151  26.332 -7.524  1.00 19.64  ? 70   PRO B HA   1 
ATOM   5839  H  HB2  . PRO B 1 70  ? 30.418  27.467 -6.911  1.00 19.49  ? 70   PRO B HB2  1 
ATOM   5840  H  HB3  . PRO B 1 70  ? 30.286  25.902 -7.062  1.00 19.49  ? 70   PRO B HB3  1 
ATOM   5841  H  HG2  . PRO B 1 70  ? 31.236  27.713 -9.029  1.00 19.95  ? 70   PRO B HG2  1 
ATOM   5842  H  HG3  . PRO B 1 70  ? 31.884  26.327 -8.633  1.00 19.95  ? 70   PRO B HG3  1 
ATOM   5843  H  HD2  . PRO B 1 70  ? 30.407  26.433 -10.678 1.00 17.34  ? 70   PRO B HD2  1 
ATOM   5844  H  HD3  . PRO B 1 70  ? 30.344  25.152 -9.761  1.00 17.34  ? 70   PRO B HD3  1 
ATOM   5845  N  N    . ARG B 1 71  ? 28.742  29.285 -8.734  1.00 14.90  ? 71   ARG B N    1 
ATOM   5846  C  CA   . ARG B 1 71  ? 28.320  30.675 -8.606  1.00 14.61  ? 71   ARG B CA   1 
ATOM   5847  C  C    . ARG B 1 71  ? 26.845  30.839 -8.947  1.00 13.31  ? 71   ARG B C    1 
ATOM   5848  O  O    . ARG B 1 71  ? 26.105  31.624 -8.370  1.00 17.33  ? 71   ARG B O    1 
ATOM   5849  C  CB   . ARG B 1 71  ? 29.211  31.557 -9.510  1.00 14.69  ? 71   ARG B CB   1 
ATOM   5850  C  CG   . ARG B 1 71  ? 30.687  31.475 -9.158  1.00 18.02  ? 71   ARG B CG   1 
ATOM   5851  C  CD   . ARG B 1 71  ? 31.588  32.052 -10.256 1.00 18.40  ? 71   ARG B CD   1 
ATOM   5852  N  NE   . ARG B 1 71  ? 32.985  31.674 -9.979  1.00 18.38  ? 71   ARG B NE   1 
ATOM   5853  C  CZ   . ARG B 1 71  ? 33.566  30.523 -10.211 1.00 14.84  ? 71   ARG B CZ   1 
ATOM   5854  N  NH1  . ARG B 1 71  ? 32.927  29.496 -10.751 1.00 17.72  ? 71   ARG B NH1  1 
ATOM   5855  N  NH2  . ARG B 1 71  ? 34.849  30.360 -9.885  1.00 22.46  ? 71   ARG B NH2  1 
ATOM   5856  H  H    . ARG B 1 71  ? 29.317  29.071 -9.337  1.00 17.87  ? 71   ARG B H    1 
ATOM   5857  H  HA   . ARG B 1 71  ? 28.454  30.954 -7.676  1.00 17.53  ? 71   ARG B HA   1 
ATOM   5858  H  HB2  . ARG B 1 71  ? 29.092  31.284 -10.433 1.00 17.63  ? 71   ARG B HB2  1 
ATOM   5859  H  HB3  . ARG B 1 71  ? 28.921  32.480 -9.435  1.00 17.63  ? 71   ARG B HB3  1 
ATOM   5860  H  HG2  . ARG B 1 71  ? 30.843  31.959 -8.332  1.00 21.63  ? 71   ARG B HG2  1 
ATOM   5861  H  HG3  . ARG B 1 71  ? 30.925  30.547 -9.008  1.00 21.63  ? 71   ARG B HG3  1 
ATOM   5862  H  HD2  . ARG B 1 71  ? 31.318  31.705 -11.120 1.00 22.08  ? 71   ARG B HD2  1 
ATOM   5863  H  HD3  . ARG B 1 71  ? 31.506  33.018 -10.276 1.00 22.08  ? 71   ARG B HD3  1 
ATOM   5864  H  HE   . ARG B 1 71  ? 33.478  32.282 -9.622  1.00 22.06  ? 71   ARG B HE   1 
ATOM   5865  H  HH11 . ARG B 1 71  ? 32.097  29.570 -10.965 1.00 21.26  ? 71   ARG B HH11 1 
ATOM   5866  H  HH12 . ARG B 1 71  ? 33.342  28.755 -10.889 1.00 21.26  ? 71   ARG B HH12 1 
ATOM   5867  H  HH21 . ARG B 1 71  ? 35.288  31.007 -9.526  1.00 26.96  ? 71   ARG B HH21 1 
ATOM   5868  H  HH22 . ARG B 1 71  ? 35.239  29.608 -10.034 1.00 26.96  ? 71   ARG B HH22 1 
ATOM   5869  N  N    . SER B 1 72  ? 26.384  30.045 -9.917  1.00 15.37  ? 72   SER B N    1 
ATOM   5870  C  CA   . SER B 1 72  ? 25.012  30.125 -10.385 1.00 16.88  ? 72   SER B CA   1 
ATOM   5871  C  C    . SER B 1 72  ? 24.046  29.669 -9.274  1.00 13.31  ? 72   SER B C    1 
ATOM   5872  O  O    . SER B 1 72  ? 23.070  30.361 -8.987  1.00 17.09  ? 72   SER B O    1 
ATOM   5873  C  CB   . SER B 1 72  ? 24.811  29.278 -11.631 1.00 15.77  ? 72   SER B CB   1 
ATOM   5874  O  OG   . SER B 1 72  ? 25.522  29.842 -12.749 1.00 23.62  ? 72   SER B OG   1 
ATOM   5875  H  H    . SER B 1 72  ? 26.915  29.471 -10.275 1.00 18.44  ? 72   SER B H    1 
ATOM   5876  H  HA   . SER B 1 72  ? 24.813  31.059 -10.607 1.00 20.26  ? 72   SER B HA   1 
ATOM   5877  H  HB2  . SER B 1 72  ? 25.130  28.377 -11.466 1.00 18.93  ? 72   SER B HB2  1 
ATOM   5878  H  HB3  . SER B 1 72  ? 23.865  29.229 -11.840 1.00 18.93  ? 72   SER B HB3  1 
ATOM   5879  H  HG   . SER B 1 72  ? 26.324  29.866 -12.579 1.00 35.43  ? 72   SER B HG   1 
ATOM   5880  N  N    . VAL B 1 73  ? 24.410  28.540 -8.705  1.00 16.00  ? 73   VAL B N    1 
ATOM   5881  C  CA   . VAL B 1 73  ? 23.599  27.925 -7.638  1.00 14.44  ? 73   VAL B CA   1 
ATOM   5882  C  C    . VAL B 1 73  ? 23.617  28.809 -6.410  1.00 13.27  ? 73   VAL B C    1 
ATOM   5883  O  O    . VAL B 1 73  ? 22.665  29.136 -5.711  1.00 15.51  ? 73   VAL B O    1 
ATOM   5884  C  CB   . VAL B 1 73  ? 24.146  26.540 -7.322  1.00 10.52  ? 73   VAL B CB   1 
ATOM   5885  C  CG1  . VAL B 1 73  ? 23.410  25.972 -6.084  1.00 13.81  ? 73   VAL B CG1  1 
ATOM   5886  C  CG2  . VAL B 1 73  ? 24.052  25.555 -8.472  1.00 18.55  ? 73   VAL B CG2  1 
ATOM   5887  H  H    . VAL B 1 73  ? 25.134  28.153 -8.961  1.00 19.20  ? 73   VAL B H    1 
ATOM   5888  H  HA   . VAL B 1 73  ? 22.675  27.837 -7.952  1.00 17.33  ? 73   VAL B HA   1 
ATOM   5889  H  HB   . VAL B 1 73  ? 25.093  26.639 -7.088  1.00 12.62  ? 73   VAL B HB   1 
ATOM   5890  H  HG11 . VAL B 1 73  ? 23.483  26.592 -5.355  1.00 20.72  ? 73   VAL B HG11 1 
ATOM   5891  H  HG12 . VAL B 1 73  ? 23.806  25.134 -5.832  1.00 20.72  ? 73   VAL B HG12 1 
ATOM   5892  H  HG13 . VAL B 1 73  ? 22.483  25.836 -6.297  1.00 20.72  ? 73   VAL B HG13 1 
ATOM   5893  H  HG21 . VAL B 1 73  ? 24.411  24.708 -8.198  1.00 27.83  ? 73   VAL B HG21 1 
ATOM   5894  H  HG22 . VAL B 1 73  ? 24.552  25.888 -9.220  1.00 27.83  ? 73   VAL B HG22 1 
ATOM   5895  H  HG23 . VAL B 1 73  ? 23.132  25.446 -8.725  1.00 27.83  ? 73   VAL B HG23 1 
ATOM   5896  N  N    . GLY B 1 74  ? 24.789  29.318 -6.045  1.00 17.78  ? 74   GLY B N    1 
ATOM   5897  C  CA   . GLY B 1 74  ? 24.956  30.182 -4.907  1.00 16.94  ? 74   GLY B CA   1 
ATOM   5898  C  C    . GLY B 1 74  ? 24.210  31.475 -5.011  1.00 14.98  ? 74   GLY B C    1 
ATOM   5899  O  O    . GLY B 1 74  ? 23.551  32.020 -4.119  1.00 14.59  ? 74   GLY B O    1 
ATOM   5900  H  H    . GLY B 1 74  ? 25.483  29.120 -6.513  1.00 21.34  ? 74   GLY B H    1 
ATOM   5901  H  HA2  . GLY B 1 74  ? 24.658  29.712 -4.112  1.00 20.33  ? 74   GLY B HA2  1 
ATOM   5902  H  HA3  . GLY B 1 74  ? 25.900  30.375 -4.798  1.00 20.33  ? 74   GLY B HA3  1 
ATOM   5903  N  N    . LYS B 1 75  ? 24.273  32.085 -6.223  1.00 17.77  ? 75   LYS B N    1 
ATOM   5904  C  CA   . LYS B 1 75  ? 23.539  33.338 -6.405  1.00 20.48  ? 75   LYS B CA   1 
ATOM   5905  C  C    . LYS B 1 75  ? 22.029  33.186 -6.400  1.00 14.35  ? 75   LYS B C    1 
ATOM   5906  O  O    . LYS B 1 75  ? 21.263  33.955 -5.829  1.00 18.10  ? 75   LYS B O    1 
ATOM   5907  C  CB   . LYS B 1 75  ? 23.988  33.961 -7.736  1.00 16.70  ? 75   LYS B CB   1 
ATOM   5908  C  CG   . LYS B 1 75  ? 23.302  35.282 -7.989  1.00 21.04  ? 75   LYS B CG   1 
ATOM   5909  C  CD   . LYS B 1 75  ? 23.611  36.355 -6.963  1.00 22.19  ? 75   LYS B CD   1 
ATOM   5910  C  CE   . LYS B 1 75  ? 22.984  37.677 -7.364  1.00 24.60  ? 75   LYS B CE   1 
ATOM   5911  N  NZ   . LYS B 1 75  ? 21.548  37.546 -7.728  1.00 56.03  ? 75   LYS B NZ   1 
ATOM   5912  H  H    . LYS B 1 75  ? 24.732  31.744 -6.866  1.00 21.32  ? 75   LYS B H    1 
ATOM   5913  H  HA   . LYS B 1 75  ? 23.789  33.948 -5.680  1.00 24.58  ? 75   LYS B HA   1 
ATOM   5914  H  HB2  . LYS B 1 75  ? 24.949  34.096 -7.719  1.00 20.04  ? 75   LYS B HB2  1 
ATOM   5915  H  HB3  . LYS B 1 75  ? 23.785  33.349 -8.461  1.00 20.04  ? 75   LYS B HB3  1 
ATOM   5916  H  HG2  . LYS B 1 75  ? 23.564  35.606 -8.865  1.00 25.25  ? 75   LYS B HG2  1 
ATOM   5917  H  HG3  . LYS B 1 75  ? 22.343  35.136 -8.005  1.00 25.25  ? 75   LYS B HG3  1 
ATOM   5918  H  HD2  . LYS B 1 75  ? 23.269  36.084 -6.097  1.00 26.62  ? 75   LYS B HD2  1 
ATOM   5919  H  HD3  . LYS B 1 75  ? 24.572  36.463 -6.886  1.00 26.62  ? 75   LYS B HD3  1 
ATOM   5920  H  HE2  . LYS B 1 75  ? 23.068  38.304 -6.628  1.00 29.52  ? 75   LYS B HE2  1 
ATOM   5921  H  HE3  . LYS B 1 75  ? 23.470  38.041 -8.121  1.00 29.52  ? 75   LYS B HE3  1 
ATOM   5922  H  HZ1  . LYS B 1 75  ? 21.228  38.342 -7.963  1.00 84.04  ? 75   LYS B HZ1  1 
ATOM   5923  H  HZ2  . LYS B 1 75  ? 21.092  37.238 -7.029  1.00 84.04  ? 75   LYS B HZ2  1 
ATOM   5924  H  HZ3  . LYS B 1 75  ? 21.465  36.980 -8.409  1.00 84.04  ? 75   LYS B HZ3  1 
ATOM   5925  N  N    . ALA B 1 76  ? 21.568  32.124 -7.034  1.00 16.42  ? 76   ALA B N    1 
ATOM   5926  C  CA   . ALA B 1 76  ? 20.119  31.897 -7.054  1.00 20.75  ? 76   ALA B CA   1 
ATOM   5927  C  C    . ALA B 1 76  ? 19.599  31.674 -5.635  1.00 14.61  ? 76   ALA B C    1 
ATOM   5928  O  O    . ALA B 1 76  ? 18.550  32.120 -5.225  1.00 15.35  ? 76   ALA B O    1 
ATOM   5929  C  CB   . ALA B 1 76  ? 19.840  30.738 -7.976  1.00 15.65  ? 76   ALA B CB   1 
ATOM   5930  H  H    . ALA B 1 76  ? 22.104  31.578 -7.426  1.00 19.71  ? 76   ALA B H    1 
ATOM   5931  H  HA   . ALA B 1 76  ? 19.686  32.696 -7.421  1.00 24.90  ? 76   ALA B HA   1 
ATOM   5932  H  HB1  . ALA B 1 76  ? 20.185  30.934 -8.850  1.00 23.48  ? 76   ALA B HB1  1 
ATOM   5933  H  HB2  . ALA B 1 76  ? 18.893  30.593 -8.030  1.00 23.48  ? 76   ALA B HB2  1 
ATOM   5934  H  HB3  . ALA B 1 76  ? 20.265  29.948 -7.634  1.00 23.48  ? 76   ALA B HB3  1 
ATOM   5935  N  N    . SER B 1 77  ? 20.423  30.998 -4.803  1.00 18.15  ? 77   SER B N    1 
ATOM   5936  C  CA   . SER B 1 77  ? 19.884  30.777 -3.440  1.00 14.73  ? 77   SER B CA   1 
ATOM   5937  C  C    . SER B 1 77  ? 19.960  32.059 -2.633  1.00 14.91  ? 77   SER B C    1 
ATOM   5938  O  O    . SER B 1 77  ? 19.072  32.370 -1.829  1.00 19.86  ? 77   SER B O    1 
ATOM   5939  C  CB   . SER B 1 77  ? 20.597  29.615 -2.768  1.00 15.36  ? 77   SER B CB   1 
ATOM   5940  O  OG   . SER B 1 77  ? 19.857  28.392 -2.940  1.00 15.52  ? 77   SER B OG   1 
ATOM   5941  H  H    . SER B 1 77  ? 21.199  30.718 -5.046  1.00 21.78  ? 77   SER B H    1 
ATOM   5942  H  HA   . SER B 1 77  ? 18.938  30.536 -3.528  1.00 17.68  ? 77   SER B HA   1 
ATOM   5943  H  HB2  . SER B 1 77  ? 21.482  29.514 -3.151  1.00 18.43  ? 77   SER B HB2  1 
ATOM   5944  H  HB3  . SER B 1 77  ? 20.698  29.801 -1.821  1.00 18.43  ? 77   SER B HB3  1 
ATOM   5945  H  HG   . SER B 1 77  ? 19.791  28.223 -3.740  1.00 23.28  ? 77   SER B HG   1 
ATOM   5946  N  N    . GLU B 1 78  ? 21.030  32.837 -2.800  1.00 15.53  ? 78   GLU B N    1 
ATOM   5947  C  CA   . GLU B 1 78  ? 21.147  34.173 -2.241  1.00 19.32  ? 78   GLU B CA   1 
ATOM   5948  C  C    . GLU B 1 78  ? 19.939  35.050 -2.545  1.00 14.43  ? 78   GLU B C    1 
ATOM   5949  O  O    . GLU B 1 78  ? 19.372  35.687 -1.655  1.00 18.42  ? 78   GLU B O    1 
ATOM   5950  C  CB   . GLU B 1 78  ? 22.414  34.879 -2.778  1.00 15.64  ? 78   GLU B CB   1 
ATOM   5951  C  CG   . GLU B 1 78  ? 22.624  36.174 -1.970  1.00 31.65  ? 78   GLU B CG   1 
ATOM   5952  C  CD   . GLU B 1 78  ? 24.047  36.680 -2.122  1.00 35.15  ? 78   GLU B CD   1 
ATOM   5953  O  OE1  . GLU B 1 78  ? 24.630  36.369 -3.189  1.00 27.38  ? 78   GLU B OE1  1 
ATOM   5954  O  OE2  . GLU B 1 78  ? 24.526  37.355 -1.196  1.00 34.20  ? 78   GLU B OE2  1 
ATOM   5955  H  H    . GLU B 1 78  ? 21.687  32.531 -3.265  1.00 18.64  ? 78   GLU B H    1 
ATOM   5956  H  HA   . GLU B 1 78  ? 21.230  34.092 -1.268  1.00 23.19  ? 78   GLU B HA   1 
ATOM   5957  H  HB2  . GLU B 1 78  ? 23.184  34.298 -2.681  1.00 18.77  ? 78   GLU B HB2  1 
ATOM   5958  H  HB3  . GLU B 1 78  ? 22.304  35.088 -3.718  1.00 18.77  ? 78   GLU B HB3  1 
ATOM   5959  H  HG2  . GLU B 1 78  ? 22.005  36.853 -2.281  1.00 37.98  ? 78   GLU B HG2  1 
ATOM   5960  H  HG3  . GLU B 1 78  ? 22.439  36.005 -1.033  1.00 37.98  ? 78   GLU B HG3  1 
ATOM   5961  N  N    . GLN B 1 79  ? 19.549  35.098 -3.822  1.00 18.20  ? 79   GLN B N    1 
ATOM   5962  C  CA   . GLN B 1 79  ? 18.356  35.811 -4.266  1.00 18.67  ? 79   GLN B CA   1 
ATOM   5963  C  C    . GLN B 1 79  ? 17.065  35.267 -3.669  1.00 16.81  ? 79   GLN B C    1 
ATOM   5964  O  O    . GLN B 1 79  ? 16.169  36.009 -3.250  1.00 21.85  ? 79   GLN B O    1 
ATOM   5965  C  CB   . GLN B 1 79  ? 18.334  35.709 -5.796  1.00 27.35  ? 79   GLN B CB   1 
ATOM   5966  C  CG   . GLN B 1 79  ? 17.616  36.820 -6.533  1.00 39.17  ? 79   GLN B CG   1 
ATOM   5967  C  CD   . GLN B 1 79  ? 17.556  36.579 -8.037  1.00 39.99  ? 79   GLN B CD   1 
ATOM   5968  O  OE1  . GLN B 1 79  ? 18.351  35.832 -8.609  1.00 39.57  ? 79   GLN B OE1  1 
ATOM   5969  N  NE2  . GLN B 1 79  ? 16.588  37.229 -8.675  1.00 30.25  ? 79   GLN B NE2  1 
ATOM   5970  H  H    . GLN B 1 79  ? 20.024  34.689 -4.411  1.00 21.84  ? 79   GLN B H    1 
ATOM   5971  H  HA   . GLN B 1 79  ? 18.443  36.754 -4.015  1.00 22.40  ? 79   GLN B HA   1 
ATOM   5972  H  HB2  . GLN B 1 79  ? 19.251  35.680 -6.111  1.00 32.81  ? 79   GLN B HB2  1 
ATOM   5973  H  HB3  . GLN B 1 79  ? 17.918  34.867 -6.038  1.00 32.81  ? 79   GLN B HB3  1 
ATOM   5974  H  HG2  . GLN B 1 79  ? 16.713  36.898 -6.188  1.00 47.00  ? 79   GLN B HG2  1 
ATOM   5975  H  HG3  . GLN B 1 79  ? 18.072  37.659 -6.364  1.00 47.00  ? 79   GLN B HG3  1 
ATOM   5976  H  HE21 . GLN B 1 79  ? 16.496  37.136 -9.525  1.00 36.30  ? 79   GLN B HE21 1 
ATOM   5977  H  HE22 . GLN B 1 79  ? 16.054  37.741 -8.238  1.00 36.30  ? 79   GLN B HE22 1 
ATOM   5978  N  N    . LEU B 1 80  ? 16.979  33.942 -3.605  1.00 19.01  ? 80   LEU B N    1 
ATOM   5979  C  CA   . LEU B 1 80  ? 15.815  33.274 -3.027  1.00 20.94  ? 80   LEU B CA   1 
ATOM   5980  C  C    . LEU B 1 80  ? 15.722  33.586 -1.550  1.00 14.16  ? 80   LEU B C    1 
ATOM   5981  O  O    . LEU B 1 80  ? 14.621  33.847 -1.059  1.00 16.61  ? 80   LEU B O    1 
ATOM   5982  C  CB   . LEU B 1 80  ? 15.871  31.765 -3.312  1.00 17.66  ? 80   LEU B CB   1 
ATOM   5983  C  CG   . LEU B 1 80  ? 14.669  30.991 -2.769  1.00 14.09  ? 80   LEU B CG   1 
ATOM   5984  C  CD1  . LEU B 1 80  ? 13.344  31.560 -3.273  1.00 18.54  ? 80   LEU B CD1  1 
ATOM   5985  C  CD2  . LEU B 1 80  ? 14.760  29.512 -3.142  1.00 15.14  ? 80   LEU B CD2  1 
ATOM   5986  H  H    . LEU B 1 80  ? 17.626  33.465 -3.911  1.00 22.81  ? 80   LEU B H    1 
ATOM   5987  H  HA   . LEU B 1 80  ? 15.014  33.634 -3.463  1.00 25.13  ? 80   LEU B HA   1 
ATOM   5988  H  HB2  . LEU B 1 80  ? 15.923  31.629 -4.271  1.00 21.20  ? 80   LEU B HB2  1 
ATOM   5989  H  HB3  . LEU B 1 80  ? 16.680  31.402 -2.918  1.00 21.20  ? 80   LEU B HB3  1 
ATOM   5990  H  HG   . LEU B 1 80  ? 14.678  31.061 -1.792  1.00 16.90  ? 80   LEU B HG   1 
ATOM   5991  H  HD11 . LEU B 1 80  ? 12.617  31.043 -2.916  1.00 27.81  ? 80   LEU B HD11 1 
ATOM   5992  H  HD12 . LEU B 1 80  ? 13.323  31.521 -4.232  1.00 27.81  ? 80   LEU B HD12 1 
ATOM   5993  H  HD13 . LEU B 1 80  ? 13.258  32.473 -2.988  1.00 27.81  ? 80   LEU B HD13 1 
ATOM   5994  H  HD21 . LEU B 1 80  ? 15.588  29.151 -2.817  1.00 22.71  ? 80   LEU B HD21 1 
ATOM   5995  H  HD22 . LEU B 1 80  ? 14.724  29.420 -4.097  1.00 22.71  ? 80   LEU B HD22 1 
ATOM   5996  H  HD23 . LEU B 1 80  ? 14.026  29.037 -2.746  1.00 22.71  ? 80   LEU B HD23 1 
ATOM   5997  N  N    . ALA B 1 81  ? 16.842  33.628 -0.845  1.00 15.93  ? 81   ALA B N    1 
ATOM   5998  C  CA   . ALA B 1 81  ? 16.856  33.892 0.593   1.00 13.77  ? 81   ALA B CA   1 
ATOM   5999  C  C    . ALA B 1 81  ? 16.292  35.281 0.878   1.00 20.96  ? 81   ALA B C    1 
ATOM   6000  O  O    . ALA B 1 81  ? 15.521  35.517 1.820   1.00 19.04  ? 81   ALA B O    1 
ATOM   6001  C  CB   . ALA B 1 81  ? 18.266  33.694 1.119   1.00 14.86  ? 81   ALA B CB   1 
ATOM   6002  H  H    . ALA B 1 81  ? 17.590  33.496 -1.248  1.00 19.11  ? 81   ALA B H    1 
ATOM   6003  H  HA   . ALA B 1 81  ? 16.274  33.233 1.027   1.00 16.53  ? 81   ALA B HA   1 
ATOM   6004  H  HB1  . ALA B 1 81  ? 18.566  32.807 0.905   1.00 22.30  ? 81   ALA B HB1  1 
ATOM   6005  H  HB2  . ALA B 1 81  ? 18.272  33.812 2.071   1.00 22.30  ? 81   ALA B HB2  1 
ATOM   6006  H  HB3  . ALA B 1 81  ? 18.852  34.337 0.713   1.00 22.30  ? 81   ALA B HB3  1 
ATOM   6007  N  N    . GLY B 1 82  ? 16.667  36.263 0.030   1.00 19.82  ? 82   GLY B N    1 
ATOM   6008  C  CA   . GLY B 1 82  ? 16.120  37.598 0.278   1.00 26.27  ? 82   GLY B CA   1 
ATOM   6009  C  C    . GLY B 1 82  ? 14.618  37.642 0.053   1.00 19.57  ? 82   GLY B C    1 
ATOM   6010  O  O    . GLY B 1 82  ? 13.910  38.377 0.753   1.00 23.83  ? 82   GLY B O    1 
ATOM   6011  H  H    . GLY B 1 82  ? 17.203  36.111 -0.626  1.00 23.78  ? 82   GLY B H    1 
ATOM   6012  H  HA2  . GLY B 1 82  ? 16.314  37.858 1.192   1.00 31.53  ? 82   GLY B HA2  1 
ATOM   6013  H  HA3  . GLY B 1 82  ? 16.551  38.235 -0.313  1.00 31.53  ? 82   GLY B HA3  1 
ATOM   6014  N  N    . LYS B 1 83  ? 14.137  36.902 -0.945  1.00 19.60  ? 83   LYS B N    1 
ATOM   6015  C  CA   . LYS B 1 83  ? 12.715  36.996 -1.268  1.00 23.41  ? 83   LYS B CA   1 
ATOM   6016  C  C    . LYS B 1 83  ? 11.868  36.296 -0.205  1.00 16.84  ? 83   LYS B C    1 
ATOM   6017  O  O    . LYS B 1 83  ? 10.896  36.804 0.357   1.00 18.83  ? 83   LYS B O    1 
ATOM   6018  C  CB   . LYS B 1 83  ? 12.483  36.408 -2.668  1.00 21.51  ? 83   LYS B CB   1 
ATOM   6019  C  CG   . LYS B 1 83  ? 11.161  36.887 -3.261  1.00 21.77  ? 83   LYS B CG   1 
ATOM   6020  C  CD   . LYS B 1 83  ? 11.430  38.073 -4.182  1.00 42.65  ? 83   LYS B CD   1 
ATOM   6021  C  CE   . LYS B 1 83  ? 10.272  39.044 -4.271  1.00 46.61  ? 83   LYS B CE   1 
ATOM   6022  N  NZ   . LYS B 1 83  ? 10.766  40.453 -4.276  1.00 33.02  ? 83   LYS B NZ   1 
ATOM   6023  H  H    . LYS B 1 83  ? 14.654  36.379 -1.391  1.00 23.52  ? 83   LYS B H    1 
ATOM   6024  H  HA   . LYS B 1 83  ? 12.465  37.943 -1.287  1.00 28.09  ? 83   LYS B HA   1 
ATOM   6025  H  HB2  . LYS B 1 83  ? 13.211  36.672 -3.252  1.00 25.81  ? 83   LYS B HB2  1 
ATOM   6026  H  HB3  . LYS B 1 83  ? 12.479  35.440 -2.614  1.00 25.81  ? 83   LYS B HB3  1 
ATOM   6027  H  HG2  . LYS B 1 83  ? 10.745  36.169 -3.761  1.00 26.12  ? 83   LYS B HG2  1 
ATOM   6028  H  HG3  . LYS B 1 83  ? 10.558  37.153 -2.549  1.00 26.12  ? 83   LYS B HG3  1 
ATOM   6029  H  HD2  . LYS B 1 83  ? 12.214  38.548 -3.863  1.00 51.18  ? 83   LYS B HD2  1 
ATOM   6030  H  HD3  . LYS B 1 83  ? 11.629  37.740 -5.072  1.00 51.18  ? 83   LYS B HD3  1 
ATOM   6031  H  HE2  . LYS B 1 83  ? 9.768   38.875 -5.082  1.00 55.93  ? 83   LYS B HE2  1 
ATOM   6032  H  HE3  . LYS B 1 83  ? 9.679   38.911 -3.515  1.00 55.93  ? 83   LYS B HE3  1 
ATOM   6033  H  HZ1  . LYS B 1 83  ? 10.080  41.009 -4.161  1.00 49.53  ? 83   LYS B HZ1  1 
ATOM   6034  H  HZ2  . LYS B 1 83  ? 11.161  40.626 -5.054  1.00 49.53  ? 83   LYS B HZ2  1 
ATOM   6035  H  HZ3  . LYS B 1 83  ? 11.351  40.565 -3.615  1.00 49.53  ? 83   LYS B HZ3  1 
ATOM   6036  N  N    . VAL B 1 84  ? 12.296  35.080 0.132   1.00 18.65  ? 84   VAL B N    1 
ATOM   6037  C  CA   . VAL B 1 84  ? 11.659  34.356 1.243   1.00 18.53  ? 84   VAL B CA   1 
ATOM   6038  C  C    . VAL B 1 84  ? 11.603  35.178 2.518   1.00 17.08  ? 84   VAL B C    1 
ATOM   6039  O  O    . VAL B 1 84  ? 10.567  35.303 3.189   1.00 19.41  ? 84   VAL B O    1 
ATOM   6040  C  CB   . VAL B 1 84  ? 12.374  33.012 1.491   1.00 18.64  ? 84   VAL B CB   1 
ATOM   6041  C  CG1  . VAL B 1 84  ? 11.841  32.348 2.753   1.00 21.63  ? 84   VAL B CG1  1 
ATOM   6042  C  CG2  . VAL B 1 84  ? 12.207  32.064 0.323   1.00 16.24  ? 84   VAL B CG2  1 
ATOM   6043  H  H    . VAL B 1 84  ? 12.945  34.718 -0.301  1.00 22.38  ? 84   VAL B H    1 
ATOM   6044  H  HA   . VAL B 1 84  ? 10.737  34.157 0.978   1.00 22.24  ? 84   VAL B HA   1 
ATOM   6045  H  HB   . VAL B 1 84  ? 13.330  33.187 1.614   1.00 22.37  ? 84   VAL B HB   1 
ATOM   6046  H  HG11 . VAL B 1 84  ? 11.950  32.944 3.498   1.00 32.44  ? 84   VAL B HG11 1 
ATOM   6047  H  HG12 . VAL B 1 84  ? 12.326  31.537 2.918   1.00 32.44  ? 84   VAL B HG12 1 
ATOM   6048  H  HG13 . VAL B 1 84  ? 10.909  32.146 2.639   1.00 32.44  ? 84   VAL B HG13 1 
ATOM   6049  H  HG21 . VAL B 1 84  ? 12.545  32.478 -0.475  1.00 24.37  ? 84   VAL B HG21 1 
ATOM   6050  H  HG22 . VAL B 1 84  ? 11.277  31.859 0.207   1.00 24.37  ? 84   VAL B HG22 1 
ATOM   6051  H  HG23 . VAL B 1 84  ? 12.694  31.255 0.495   1.00 24.37  ? 84   VAL B HG23 1 
ATOM   6052  N  N    . ALA B 1 85  ? 12.707  35.808 2.921   1.00 21.23  ? 85   ALA B N    1 
ATOM   6053  C  CA   . ALA B 1 85  ? 12.759  36.675 4.092   1.00 20.61  ? 85   ALA B CA   1 
ATOM   6054  C  C    . ALA B 1 85  ? 11.762  37.811 3.931   1.00 21.14  ? 85   ALA B C    1 
ATOM   6055  O  O    . ALA B 1 85  ? 11.134  38.153 4.931   1.00 23.28  ? 85   ALA B O    1 
ATOM   6056  C  CB   . ALA B 1 85  ? 14.150  37.205 4.377   1.00 18.74  ? 85   ALA B CB   1 
ATOM   6057  H  H    . ALA B 1 85  ? 13.427  35.697 2.464   1.00 25.48  ? 85   ALA B H    1 
ATOM   6058  H  HA   . ALA B 1 85  ? 12.481  36.144 4.866   1.00 24.73  ? 85   ALA B HA   1 
ATOM   6059  H  HB1  . ALA B 1 85  ? 14.758  36.469 4.477   1.00 28.11  ? 85   ALA B HB1  1 
ATOM   6060  H  HB2  . ALA B 1 85  ? 14.136  37.721 5.186   1.00 28.11  ? 85   ALA B HB2  1 
ATOM   6061  H  HB3  . ALA B 1 85  ? 14.436  37.760 3.648   1.00 28.11  ? 85   ALA B HB3  1 
ATOM   6062  N  N    . GLU B 1 86  ? 11.547  38.406 2.773   1.00 25.07  ? 86   GLU B N    1 
ATOM   6063  C  CA   . GLU B 1 86  ? 10.587  39.476 2.624   1.00 22.43  ? 86   GLU B CA   1 
ATOM   6064  C  C    . GLU B 1 86  ? 9.156   38.988 2.782   1.00 19.90  ? 86   GLU B C    1 
ATOM   6065  O  O    . GLU B 1 86  ? 8.291   39.638 3.369   1.00 24.07  ? 86   GLU B O    1 
ATOM   6066  C  CB   . GLU B 1 86  ? 10.700  40.139 1.230   1.00 20.90  ? 86   GLU B CB   1 
ATOM   6067  C  CG   . GLU B 1 86  ? 9.381   40.811 0.897   1.00 32.86  ? 86   GLU B CG   1 
ATOM   6068  C  CD   . GLU B 1 86  ? 9.407   41.947 -0.088  1.00 45.84  ? 86   GLU B CD   1 
ATOM   6069  O  OE1  . GLU B 1 86  ? 8.984   41.721 -1.245  1.00 36.46  ? 86   GLU B OE1  1 
ATOM   6070  O  OE2  . GLU B 1 86  ? 9.819   43.067 0.282   1.00 52.19  ? 86   GLU B OE2  1 
ATOM   6071  H  H    . GLU B 1 86  ? 11.992  38.148 2.084   1.00 30.08  ? 86   GLU B H    1 
ATOM   6072  H  HA   . GLU B 1 86  ? 10.765  40.154 3.309   1.00 26.91  ? 86   GLU B HA   1 
ATOM   6073  H  HB2  . GLU B 1 86  ? 11.414  40.797 1.235   1.00 25.08  ? 86   GLU B HB2  1 
ATOM   6074  H  HB3  . GLU B 1 86  ? 10.908  39.469 0.561   1.00 25.08  ? 86   GLU B HB3  1 
ATOM   6075  H  HG2  . GLU B 1 86  ? 8.779   40.133 0.553   1.00 39.43  ? 86   GLU B HG2  1 
ATOM   6076  H  HG3  . GLU B 1 86  ? 8.997   41.143 1.724   1.00 39.43  ? 86   GLU B HG3  1 
ATOM   6077  N  N    . VAL B 1 87  ? 8.889   37.795 2.229   1.00 17.51  ? 87   VAL B N    1 
ATOM   6078  C  CA   . VAL B 1 87  ? 7.551   37.226 2.381   1.00 19.70  ? 87   VAL B CA   1 
ATOM   6079  C  C    . VAL B 1 87  ? 7.368   36.887 3.853   1.00 22.39  ? 87   VAL B C    1 
ATOM   6080  O  O    . VAL B 1 87  ? 6.285   37.097 4.382   1.00 19.25  ? 87   VAL B O    1 
ATOM   6081  C  CB   . VAL B 1 87  ? 7.316   36.021 1.460   1.00 20.90  ? 87   VAL B CB   1 
ATOM   6082  C  CG1  . VAL B 1 87  ? 7.682   36.355 0.024   1.00 22.90  ? 87   VAL B CG1  1 
ATOM   6083  C  CG2  . VAL B 1 87  ? 8.125   34.844 1.912   1.00 52.46  ? 87   VAL B CG2  1 
ATOM   6084  H  H    . VAL B 1 87  ? 9.496   37.372 1.791   1.00 21.01  ? 87   VAL B H    1 
ATOM   6085  H  HA   . VAL B 1 87  ? 6.898   37.919 2.146   1.00 23.64  ? 87   VAL B HA   1 
ATOM   6086  H  HB   . VAL B 1 87  ? 6.366   35.780 1.494   1.00 25.08  ? 87   VAL B HB   1 
ATOM   6087  H  HG11 . VAL B 1 87  ? 7.150   37.094 -0.278  1.00 34.35  ? 87   VAL B HG11 1 
ATOM   6088  H  HG12 . VAL B 1 87  ? 7.516   35.592 -0.534  1.00 34.35  ? 87   VAL B HG12 1 
ATOM   6089  H  HG13 . VAL B 1 87  ? 8.612   36.589 -0.023  1.00 34.35  ? 87   VAL B HG13 1 
ATOM   6090  H  HG21 . VAL B 1 87  ? 7.909   34.637 2.824   1.00 78.69  ? 87   VAL B HG21 1 
ATOM   6091  H  HG22 . VAL B 1 87  ? 9.060   35.053 1.845   1.00 78.69  ? 87   VAL B HG22 1 
ATOM   6092  H  HG23 . VAL B 1 87  ? 7.926   34.086 1.357   1.00 78.69  ? 87   VAL B HG23 1 
ATOM   6093  N  N    . LYS B 1 88  ? 8.388   36.377 4.546   1.00 21.52  ? 88   LYS B N    1 
ATOM   6094  C  CA   . LYS B 1 88  ? 8.106   36.114 5.969   1.00 25.02  ? 88   LYS B CA   1 
ATOM   6095  C  C    . LYS B 1 88  ? 7.843   37.448 6.678   1.00 25.70  ? 88   LYS B C    1 
ATOM   6096  O  O    . LYS B 1 88  ? 6.995   37.529 7.561   1.00 28.59  ? 88   LYS B O    1 
ATOM   6097  C  CB   . LYS B 1 88  ? 9.212   35.291 6.599   1.00 22.42  ? 88   LYS B CB   1 
ATOM   6098  C  CG   . LYS B 1 88  ? 9.450   33.911 6.008   1.00 19.28  ? 88   LYS B CG   1 
ATOM   6099  C  CD   . LYS B 1 88  ? 8.208   33.049 6.009   1.00 19.65  ? 88   LYS B CD   1 
ATOM   6100  C  CE   . LYS B 1 88  ? 7.667   32.765 7.395   1.00 23.02  ? 88   LYS B CE   1 
ATOM   6101  N  NZ   . LYS B 1 88  ? 6.216   32.384 7.299   1.00 18.14  ? 88   LYS B NZ   1 
ATOM   6102  H  H    . LYS B 1 88  ? 9.153   36.214 4.189   1.00 25.82  ? 88   LYS B H    1 
ATOM   6103  H  HA   . LYS B 1 88  ? 7.281   35.587 6.015   1.00 30.02  ? 88   LYS B HA   1 
ATOM   6104  H  HB2  . LYS B 1 88  ? 10.039  35.794 6.533   1.00 26.91  ? 88   LYS B HB2  1 
ATOM   6105  H  HB3  . LYS B 1 88  ? 9.012   35.186 7.542   1.00 26.91  ? 88   LYS B HB3  1 
ATOM   6106  H  HG2  . LYS B 1 88  ? 9.766   34.008 5.096   1.00 23.14  ? 88   LYS B HG2  1 
ATOM   6107  H  HG3  . LYS B 1 88  ? 10.145  33.465 6.517   1.00 23.14  ? 88   LYS B HG3  1 
ATOM   6108  H  HD2  . LYS B 1 88  ? 7.519   33.491 5.489   1.00 23.58  ? 88   LYS B HD2  1 
ATOM   6109  H  HD3  . LYS B 1 88  ? 8.412   32.206 5.574   1.00 23.58  ? 88   LYS B HD3  1 
ATOM   6110  H  HE2  . LYS B 1 88  ? 8.170   32.042 7.801   1.00 27.62  ? 88   LYS B HE2  1 
ATOM   6111  H  HE3  . LYS B 1 88  ? 7.763   33.553 7.952   1.00 27.62  ? 88   LYS B HE3  1 
ATOM   6112  H  HZ1  . LYS B 1 88  ? 5.898   32.219 8.113   1.00 27.21  ? 88   LYS B HZ1  1 
ATOM   6113  H  HZ2  . LYS B 1 88  ? 6.134   31.655 6.795   1.00 27.21  ? 88   LYS B HZ2  1 
ATOM   6114  H  HZ3  . LYS B 1 88  ? 5.758   33.052 6.931   1.00 27.21  ? 88   LYS B HZ3  1 
ATOM   6115  N  N    . LYS B 1 89  ? 8.569   38.500 6.273   1.00 29.91  ? 89   LYS B N    1 
ATOM   6116  C  CA   . LYS B 1 89  ? 8.407   39.827 6.877   1.00 30.50  ? 89   LYS B CA   1 
ATOM   6117  C  C    . LYS B 1 89  ? 6.958   40.271 6.753   1.00 31.65  ? 89   LYS B C    1 
ATOM   6118  O  O    . LYS B 1 89  ? 6.343   40.850 7.652   1.00 46.46  ? 89   LYS B O    1 
ATOM   6119  C  CB   . LYS B 1 89  ? 9.344   40.844 6.231   1.00 31.03  ? 89   LYS B CB   1 
ATOM   6120  C  CG   . LYS B 1 89  ? 10.817  40.529 6.359   1.00 34.93  ? 89   LYS B CG   1 
ATOM   6121  C  CD   . LYS B 1 89  ? 11.663  41.720 6.772   1.00 33.32  ? 89   LYS B CD   1 
ATOM   6122  C  CE   . LYS B 1 89  ? 12.918  41.253 7.507   1.00 42.90  ? 89   LYS B CE   1 
ATOM   6123  N  NZ   . LYS B 1 89  ? 14.150  41.353 6.663   0.52 23.26  ? 89   LYS B NZ   1 
ATOM   6124  H  H    . LYS B 1 89  ? 9.145   38.394 5.644   1.00 35.89  ? 89   LYS B H    1 
ATOM   6125  H  HA   . LYS B 1 89  ? 8.630   39.762 7.829   1.00 36.60  ? 89   LYS B HA   1 
ATOM   6126  H  HB2  . LYS B 1 89  ? 9.124   40.911 5.289   1.00 37.24  ? 89   LYS B HB2  1 
ATOM   6127  H  HB3  . LYS B 1 89  ? 9.179   41.712 6.632   1.00 37.24  ? 89   LYS B HB3  1 
ATOM   6128  H  HG2  . LYS B 1 89  ? 10.930  39.823 7.013   1.00 41.92  ? 89   LYS B HG2  1 
ATOM   6129  H  HG3  . LYS B 1 89  ? 11.140  40.196 5.507   1.00 41.92  ? 89   LYS B HG3  1 
ATOM   6130  H  HD2  . LYS B 1 89  ? 11.917  42.226 5.985   1.00 39.99  ? 89   LYS B HD2  1 
ATOM   6131  H  HD3  . LYS B 1 89  ? 11.145  42.301 7.350   1.00 39.99  ? 89   LYS B HD3  1 
ATOM   6132  H  HE2  . LYS B 1 89  ? 13.036  41.792 8.306   1.00 51.49  ? 89   LYS B HE2  1 
ATOM   6133  H  HE3  . LYS B 1 89  ? 12.798  40.332 7.786   1.00 51.49  ? 89   LYS B HE3  1 
ATOM   6134  H  HZ1  . LYS B 1 89  ? 14.867  41.180 7.162   0.52 34.89  ? 89   LYS B HZ1  1 
ATOM   6135  H  HZ2  . LYS B 1 89  ? 14.214  42.175 6.327   0.52 34.89  ? 89   LYS B HZ2  1 
ATOM   6136  H  HZ3  . LYS B 1 89  ? 14.103  40.764 5.997   0.52 34.89  ? 89   LYS B HZ3  1 
ATOM   6137  N  N    . ASN B 1 90  ? 6.385   39.967 5.597   1.00 27.14  ? 90   ASN B N    1 
ATOM   6138  C  CA   . ASN B 1 90  ? 4.993   40.310 5.315   1.00 29.10  ? 90   ASN B CA   1 
ATOM   6139  C  C    . ASN B 1 90  ? 4.035   39.355 6.011   1.00 23.74  ? 90   ASN B C    1 
ATOM   6140  O  O    . ASN B 1 90  ? 2.826   39.389 5.771   1.00 31.94  ? 90   ASN B O    1 
ATOM   6141  C  CB   . ASN B 1 90  ? 4.782   40.355 3.805   1.00 31.07  ? 90   ASN B CB   1 
ATOM   6142  C  CG   . ASN B 1 90  ? 5.695   41.305 3.054   1.00 33.99  ? 90   ASN B CG   1 
ATOM   6143  O  OD1  . ASN B 1 90  ? 5.509   41.517 1.848   1.00 36.05  ? 90   ASN B OD1  1 
ATOM   6144  N  ND2  . ASN B 1 90  ? 6.678   41.890 3.724   1.00 45.57  ? 90   ASN B ND2  1 
ATOM   6145  H  H    . ASN B 1 90  ? 6.844   39.557 4.996   1.00 32.57  ? 90   ASN B H    1 
ATOM   6146  H  HA   . ASN B 1 90  ? 4.828   41.210 5.668   1.00 34.92  ? 90   ASN B HA   1 
ATOM   6147  H  HB2  . ASN B 1 90  ? 4.909   39.461 3.450   1.00 37.29  ? 90   ASN B HB2  1 
ATOM   6148  H  HB3  . ASN B 1 90  ? 3.862   40.609 3.630   1.00 37.29  ? 90   ASN B HB3  1 
ATOM   6149  H  HD21 . ASN B 1 90  ? 7.208   42.434 3.322   1.00 54.68  ? 90   ASN B HD21 1 
ATOM   6150  H  HD22 . ASN B 1 90  ? 6.785   41.725 4.561   1.00 54.68  ? 90   ASN B HD22 1 
ATOM   6151  N  N    . GLY B 1 91  ? 4.554   38.497 6.896   1.00 22.86  ? 91   GLY B N    1 
ATOM   6152  C  CA   . GLY B 1 91  ? 3.705   37.676 7.748   1.00 19.47  ? 91   GLY B CA   1 
ATOM   6153  C  C    . GLY B 1 91  ? 2.964   36.598 6.993   1.00 27.68  ? 91   GLY B C    1 
ATOM   6154  O  O    . GLY B 1 91  ? 1.835   36.198 7.262   1.00 28.71  ? 91   GLY B O    1 
ATOM   6155  H  H    . GLY B 1 91  ? 5.409   38.429 6.964   1.00 27.43  ? 91   GLY B H    1 
ATOM   6156  H  HA2  . GLY B 1 91  ? 4.253   37.261 8.432   1.00 23.36  ? 91   GLY B HA2  1 
ATOM   6157  H  HA3  . GLY B 1 91  ? 3.060   38.248 8.193   1.00 23.36  ? 91   GLY B HA3  1 
ATOM   6158  N  N    . ARG B 1 92  ? 3.613   36.052 5.960   1.00 20.65  ? 92   ARG B N    1 
ATOM   6159  C  CA   . ARG B 1 92  ? 2.968   35.009 5.191   1.00 21.29  ? 92   ARG B CA   1 
ATOM   6160  C  C    . ARG B 1 92  ? 3.847   33.771 5.128   1.00 18.65  ? 92   ARG B C    1 
ATOM   6161  O  O    . ARG B 1 92  ? 5.030   33.859 5.337   1.00 18.53  ? 92   ARG B O    1 
ATOM   6162  C  CB   . ARG B 1 92  ? 2.725   35.437 3.747   1.00 18.20  ? 92   ARG B CB   1 
ATOM   6163  C  CG   . ARG B 1 92  ? 1.867   36.685 3.629   1.00 17.43  ? 92   ARG B CG   1 
ATOM   6164  C  CD   . ARG B 1 92  ? 1.954   37.314 2.268   1.00 23.32  ? 92   ARG B CD   1 
ATOM   6165  N  NE   . ARG B 1 92  ? 0.870   38.229 1.968   1.00 31.95  ? 92   ARG B NE   1 
ATOM   6166  C  CZ   . ARG B 1 92  ? 0.314   39.225 2.610   1.00 42.79  ? 92   ARG B CZ   1 
ATOM   6167  N  NH1  . ARG B 1 92  ? 0.688   39.643 3.811   1.00 63.80  ? 92   ARG B NH1  1 
ATOM   6168  N  NH2  . ARG B 1 92  ? -0.698  39.880 2.038   1.00 38.97  ? 92   ARG B NH2  1 
ATOM   6169  H  H    . ARG B 1 92  ? 4.405   36.317 5.754   1.00 24.78  ? 92   ARG B H    1 
ATOM   6170  H  HA   . ARG B 1 92  ? 2.113   34.779 5.611   1.00 25.55  ? 92   ARG B HA   1 
ATOM   6171  H  HB2  . ARG B 1 92  ? 3.579   35.601 3.319   1.00 21.84  ? 92   ARG B HB2  1 
ATOM   6172  H  HB3  . ARG B 1 92  ? 2.291   34.711 3.272   1.00 21.84  ? 92   ARG B HB3  1 
ATOM   6173  H  HG2  . ARG B 1 92  ? 0.943   36.454 3.814   1.00 20.91  ? 92   ARG B HG2  1 
ATOM   6174  H  HG3  . ARG B 1 92  ? 2.151   37.330 4.296   1.00 20.91  ? 92   ARG B HG3  1 
ATOM   6175  H  HD2  . ARG B 1 92  ? 2.794   37.793 2.200   1.00 27.98  ? 92   ARG B HD2  1 
ATOM   6176  H  HD3  . ARG B 1 92  ? 1.962   36.610 1.600   1.00 27.98  ? 92   ARG B HD3  1 
ATOM   6177  H  HE   . ARG B 1 92  ? 0.513   38.086 1.198   1.00 38.34  ? 92   ARG B HE   1 
ATOM   6178  H  HH11 . ARG B 1 92  ? 1.336   39.254 4.219   1.00 76.56  ? 92   ARG B HH11 1 
ATOM   6179  H  HH12 . ARG B 1 92  ? 0.282   40.305 4.181   1.00 76.56  ? 92   ARG B HH12 1 
ATOM   6180  H  HH21 . ARG B 1 92  ? -0.976  39.646 1.258   1.00 46.77  ? 92   ARG B HH21 1 
ATOM   6181  H  HH22 . ARG B 1 92  ? -1.073  40.536 2.449   1.00 46.77  ? 92   ARG B HH22 1 
ATOM   6182  N  N    . ILE B 1 93  ? 3.158   32.688 4.793   1.00 23.49  ? 93   ILE B N    1 
ATOM   6183  C  CA   . ILE B 1 93  ? 3.834   31.433 4.567   1.00 19.77  ? 93   ILE B CA   1 
ATOM   6184  C  C    . ILE B 1 93  ? 4.424   31.449 3.151   1.00 16.50  ? 93   ILE B C    1 
ATOM   6185  O  O    . ILE B 1 93  ? 3.691   31.573 2.176   1.00 19.24  ? 93   ILE B O    1 
ATOM   6186  C  CB   . ILE B 1 93  ? 2.877   30.243 4.721   1.00 18.52  ? 93   ILE B CB   1 
ATOM   6187  C  CG1  . ILE B 1 93  ? 2.286   30.043 6.116   1.00 18.18  ? 93   ILE B CG1  1 
ATOM   6188  C  CG2  . ILE B 1 93  ? 3.571   28.960 4.295   1.00 14.80  ? 93   ILE B CG2  1 
ATOM   6189  C  CD1  . ILE B 1 93  ? 1.135   29.049 6.113   1.00 19.54  ? 93   ILE B CD1  1 
ATOM   6190  H  H    . ILE B 1 93  ? 2.303   32.735 4.710   1.00 28.18  ? 93   ILE B H    1 
ATOM   6191  H  HA   . ILE B 1 93  ? 4.563   31.342 5.216   1.00 23.72  ? 93   ILE B HA   1 
ATOM   6192  H  HB   . ILE B 1 93  ? 2.129   30.388 4.105   1.00 22.22  ? 93   ILE B HB   1 
ATOM   6193  H  HG12 . ILE B 1 93  ? 2.981   29.726 6.714   1.00 21.82  ? 93   ILE B HG12 1 
ATOM   6194  H  HG13 . ILE B 1 93  ? 1.970   30.896 6.453   1.00 21.82  ? 93   ILE B HG13 1 
ATOM   6195  H  HG21 . ILE B 1 93  ? 3.940   29.072 3.416   1.00 22.20  ? 93   ILE B HG21 1 
ATOM   6196  H  HG22 . ILE B 1 93  ? 2.936   28.240 4.286   1.00 22.20  ? 93   ILE B HG22 1 
ATOM   6197  H  HG23 . ILE B 1 93  ? 4.276   28.756 4.914   1.00 22.20  ? 93   ILE B HG23 1 
ATOM   6198  H  HD11 . ILE B 1 93  ? 0.784   28.964 7.003   1.00 29.32  ? 93   ILE B HD11 1 
ATOM   6199  H  HD12 . ILE B 1 93  ? 1.451   28.194 5.811   1.00 29.32  ? 93   ILE B HD12 1 
ATOM   6200  H  HD13 . ILE B 1 93  ? 0.444   29.360 5.525   1.00 29.32  ? 93   ILE B HD13 1 
ATOM   6201  N  N    . SER B 1 94  ? 5.736   31.299 3.097   1.00 16.86  ? 94   SER B N    1 
ATOM   6202  C  CA   . SER B 1 94  ? 6.490   31.213 1.844   1.00 17.01  ? 94   SER B CA   1 
ATOM   6203  C  C    . SER B 1 94  ? 6.269   29.887 1.132   1.00 26.38  ? 94   SER B C    1 
ATOM   6204  O  O    . SER B 1 94  ? 6.464   28.811 1.696   1.00 21.64  ? 94   SER B O    1 
ATOM   6205  C  CB   . SER B 1 94  ? 7.970   31.426 2.136   1.00 19.92  ? 94   SER B CB   1 
ATOM   6206  O  OG   . SER B 1 94  ? 8.544   30.549 3.075   1.00 21.41  ? 94   SER B OG   1 
ATOM   6207  H  H    . SER B 1 94  ? 6.171   31.249 3.837   1.00 20.24  ? 94   SER B H    1 
ATOM   6208  H  HA   . SER B 1 94  ? 6.187   31.933 1.253   1.00 20.41  ? 94   SER B HA   1 
ATOM   6209  H  HB2  . SER B 1 94  ? 8.460   31.344 1.303   1.00 23.90  ? 94   SER B HB2  1 
ATOM   6210  H  HB3  . SER B 1 94  ? 8.089   32.335 2.454   1.00 23.90  ? 94   SER B HB3  1 
ATOM   6211  H  HG   . SER B 1 94  ? 8.173   30.645 3.800   1.00 32.12  ? 94   SER B HG   1 
ATOM   6212  N  N    . LEU B 1 95  ? 5.852   29.969 -0.120  1.00 19.10  ? 95   LEU B N    1 
ATOM   6213  C  CA   . LEU B 1 95  ? 5.633   28.793 -0.950  1.00 17.03  ? 95   LEU B CA   1 
ATOM   6214  C  C    . LEU B 1 95  ? 6.571   28.918 -2.150  1.00 16.99  ? 95   LEU B C    1 
ATOM   6215  O  O    . LEU B 1 95  ? 6.233   29.726 -3.014  1.00 17.96  ? 95   LEU B O    1 
ATOM   6216  C  CB   . LEU B 1 95  ? 4.172   28.726 -1.344  1.00 18.53  ? 95   LEU B CB   1 
ATOM   6217  C  CG   . LEU B 1 95  ? 3.483   27.411 -1.622  1.00 27.51  ? 95   LEU B CG   1 
ATOM   6218  C  CD1  . LEU B 1 95  ? 2.094   27.569 -2.216  1.00 17.45  ? 95   LEU B CD1  1 
ATOM   6219  C  CD2  . LEU B 1 95  ? 4.313   26.556 -2.572  1.00 21.00  ? 95   LEU B CD2  1 
ATOM   6220  H  H    . LEU B 1 95  ? 5.704   30.747 -0.457  1.00 22.91  ? 95   LEU B H    1 
ATOM   6221  H  HA   . LEU B 1 95  ? 5.867   27.990 -0.440  1.00 20.43  ? 95   LEU B HA   1 
ATOM   6222  H  HB2  . LEU B 1 95  ? 3.670   29.164 -0.639  1.00 22.24  ? 95   LEU B HB2  1 
ATOM   6223  H  HB3  . LEU B 1 95  ? 4.069   29.272 -2.140  1.00 22.24  ? 95   LEU B HB3  1 
ATOM   6224  H  HG   . LEU B 1 95  ? 3.398   26.927 -0.774  1.00 33.01  ? 95   LEU B HG   1 
ATOM   6225  H  HD11 . LEU B 1 95  ? 1.709   26.702 -2.364  1.00 26.18  ? 95   LEU B HD11 1 
ATOM   6226  H  HD12 . LEU B 1 95  ? 2.155   28.039 -3.051  1.00 26.18  ? 95   LEU B HD12 1 
ATOM   6227  H  HD13 . LEU B 1 95  ? 1.541   28.066 -1.609  1.00 26.18  ? 95   LEU B HD13 1 
ATOM   6228  H  HD21 . LEU B 1 95  ? 3.867   25.719 -2.721  1.00 31.50  ? 95   LEU B HD21 1 
ATOM   6229  H  HD22 . LEU B 1 95  ? 5.176   26.395 -2.185  1.00 31.50  ? 95   LEU B HD22 1 
ATOM   6230  H  HD23 . LEU B 1 95  ? 4.417   27.016 -3.408  1.00 31.50  ? 95   LEU B HD23 1 
ATOM   6231  N  N    . VAL B 1 96  ? 7.657   28.156 -2.142  1.00 15.86  ? 96   VAL B N    1 
ATOM   6232  C  CA   . VAL B 1 96  ? 8.654   28.156 -3.219  1.00 13.69  ? 96   VAL B CA   1 
ATOM   6233  C  C    . VAL B 1 96  ? 8.345   27.059 -4.205  1.00 12.68  ? 96   VAL B C    1 
ATOM   6234  O  O    . VAL B 1 96  ? 8.313   25.849 -3.881  1.00 15.20  ? 96   VAL B O    1 
ATOM   6235  C  CB   . VAL B 1 96  ? 10.077  28.034 -2.627  1.00 14.34  ? 96   VAL B CB   1 
ATOM   6236  C  CG1  . VAL B 1 96  ? 11.134  28.018 -3.749  1.00 15.26  ? 96   VAL B CG1  1 
ATOM   6237  C  CG2  . VAL B 1 96  ? 10.383  29.115 -1.604  1.00 16.88  ? 96   VAL B CG2  1 
ATOM   6238  H  H    . VAL B 1 96  ? 7.783   27.634 -1.470  1.00 19.03  ? 96   VAL B H    1 
ATOM   6239  H  HA   . VAL B 1 96  ? 8.593   29.013 -3.690  1.00 16.43  ? 96   VAL B HA   1 
ATOM   6240  H  HB   . VAL B 1 96  ? 10.128  27.171 -2.165  1.00 17.20  ? 96   VAL B HB   1 
ATOM   6241  H  HG11 . VAL B 1 96  ? 10.922  27.325 -4.379  1.00 22.89  ? 96   VAL B HG11 1 
ATOM   6242  H  HG12 . VAL B 1 96  ? 12.000  27.851 -3.371  1.00 22.89  ? 96   VAL B HG12 1 
ATOM   6243  H  HG13 . VAL B 1 96  ? 11.139  28.867 -4.197  1.00 22.89  ? 96   VAL B HG13 1 
ATOM   6244  H  HG21 . VAL B 1 96  ? 9.712   29.104 -0.917  1.00 25.32  ? 96   VAL B HG21 1 
ATOM   6245  H  HG22 . VAL B 1 96  ? 10.386  29.972 -2.036  1.00 25.32  ? 96   VAL B HG22 1 
ATOM   6246  H  HG23 . VAL B 1 96  ? 11.244  28.950 -1.213  1.00 25.32  ? 96   VAL B HG23 1 
ATOM   6247  N  N    . LEU B 1 97  ? 8.072   27.409 -5.476  1.00 14.66  ? 97   LEU B N    1 
ATOM   6248  C  CA   . LEU B 1 97  ? 7.914   26.459 -6.545  1.00 13.63  ? 97   LEU B CA   1 
ATOM   6249  C  C    . LEU B 1 97  ? 9.234   26.255 -7.250  1.00 14.02  ? 97   LEU B C    1 
ATOM   6250  O  O    . LEU B 1 97  ? 9.794   27.216 -7.824  1.00 17.37  ? 97   LEU B O    1 
ATOM   6251  C  CB   . LEU B 1 97  ? 6.829   26.921 -7.542  1.00 12.53  ? 97   LEU B CB   1 
ATOM   6252  C  CG   . LEU B 1 97  ? 5.499   27.372 -6.944  1.00 12.81  ? 97   LEU B CG   1 
ATOM   6253  C  CD1  . LEU B 1 97  ? 4.596   27.954 -8.033  1.00 21.12  ? 97   LEU B CD1  1 
ATOM   6254  C  CD2  . LEU B 1 97  ? 4.811   26.235 -6.230  1.00 14.28  ? 97   LEU B CD2  1 
ATOM   6255  H  H    . LEU B 1 97  ? 7.988   28.245 -5.659  1.00 17.59  ? 97   LEU B H    1 
ATOM   6256  H  HA   . LEU B 1 97  ? 7.635   25.602 -6.159  1.00 16.36  ? 97   LEU B HA   1 
ATOM   6257  H  HB2  . LEU B 1 97  ? 7.190   27.655 -8.063  1.00 15.03  ? 97   LEU B HB2  1 
ATOM   6258  H  HB3  . LEU B 1 97  ? 6.652   26.191 -8.156  1.00 15.03  ? 97   LEU B HB3  1 
ATOM   6259  H  HG   . LEU B 1 97  ? 5.683   28.078 -6.289  1.00 15.37  ? 97   LEU B HG   1 
ATOM   6260  H  HD11 . LEU B 1 97  ? 5.051   28.676 -8.473  1.00 31.68  ? 97   LEU B HD11 1 
ATOM   6261  H  HD12 . LEU B 1 97  ? 3.786   28.282 -7.635  1.00 31.68  ? 97   LEU B HD12 1 
ATOM   6262  H  HD13 . LEU B 1 97  ? 4.385   27.271 -8.673  1.00 31.68  ? 97   LEU B HD13 1 
ATOM   6263  H  HD21 . LEU B 1 97  ? 5.393   25.883 -5.552  1.00 21.42  ? 97   LEU B HD21 1 
ATOM   6264  H  HD22 . LEU B 1 97  ? 4.599   25.542 -6.860  1.00 21.42  ? 97   LEU B HD22 1 
ATOM   6265  H  HD23 . LEU B 1 97  ? 4.003   26.555 -5.822  1.00 21.42  ? 97   LEU B HD23 1 
ATOM   6266  N  N    . GLY B 1 98  ? 9.792   25.061 -7.204  1.00 15.94  ? 98   GLY B N    1 
ATOM   6267  C  CA   . GLY B 1 98  ? 11.060  24.821 -7.862  1.00 13.95  ? 98   GLY B CA   1 
ATOM   6268  C  C    . GLY B 1 98  ? 10.850  24.239 -9.261  1.00 14.95  ? 98   GLY B C    1 
ATOM   6269  O  O    . GLY B 1 98  ? 9.678   24.032 -9.585  1.00 15.66  ? 98   GLY B O    1 
ATOM   6270  H  H    . GLY B 1 98  ? 9.401   24.422 -6.781  1.00 19.13  ? 98   GLY B H    1 
ATOM   6271  H  HA2  . GLY B 1 98  ? 11.551  25.655 -7.929  1.00 16.74  ? 98   GLY B HA2  1 
ATOM   6272  H  HA3  . GLY B 1 98  ? 11.587  24.204 -7.331  1.00 16.74  ? 98   GLY B HA3  1 
ATOM   6273  N  N    . GLY B 1 99  ? 11.909  23.984 -10.039 1.00 13.60  ? 99   GLY B N    1 
ATOM   6274  C  CA   . GLY B 1 99  ? 13.272  24.316 -9.615  1.00 13.76  ? 99   GLY B CA   1 
ATOM   6275  C  C    . GLY B 1 99  ? 13.940  23.139 -8.930  1.00 16.53  ? 99   GLY B C    1 
ATOM   6276  O  O    . GLY B 1 99  ? 13.222  22.339 -8.302  1.00 14.29  ? 99   GLY B O    1 
ATOM   6277  H  H    . GLY B 1 99  ? 11.787  23.616 -10.807 1.00 16.32  ? 99   GLY B H    1 
ATOM   6278  H  HA2  . GLY B 1 99  ? 13.795  24.577 -10.389 1.00 16.51  ? 99   GLY B HA2  1 
ATOM   6279  H  HA3  . GLY B 1 99  ? 13.244  25.069 -9.005  1.00 16.51  ? 99   GLY B HA3  1 
ATOM   6280  N  N    . ASP B 1 100 ? 15.248  22.953 -8.986  1.00 12.67  ? 100  ASP B N    1 
ATOM   6281  C  CA   . ASP B 1 100 ? 15.944  21.853 -8.327  1.00 11.42  ? 100  ASP B CA   1 
ATOM   6282  C  C    . ASP B 1 100 ? 16.137  22.123 -6.828  1.00 10.36  ? 100  ASP B C    1 
ATOM   6283  O  O    . ASP B 1 100 ? 16.085  23.234 -6.365  1.00 13.35  ? 100  ASP B O    1 
ATOM   6284  C  CB   . ASP B 1 100 ? 17.245  21.582 -9.055  1.00 16.97  ? 100  ASP B CB   1 
ATOM   6285  C  CG   . ASP B 1 100 ? 18.361  22.558 -8.899  1.00 22.34  ? 100  ASP B CG   1 
ATOM   6286  O  OD1  . ASP B 1 100 ? 18.862  22.695 -7.769  1.00 14.27  ? 100  ASP B OD1  1 
ATOM   6287  O  OD2  . ASP B 1 100 ? 18.816  23.171 -9.896  1.00 18.22  ? 100  ASP B OD2  1 
ATOM   6288  H  H    . ASP B 1 100 ? 15.717  23.515 -9.438  1.00 15.21  ? 100  ASP B H    1 
ATOM   6289  H  HA   . ASP B 1 100 ? 15.383  21.053 -8.414  1.00 13.71  ? 100  ASP B HA   1 
ATOM   6290  H  HB2  . ASP B 1 100 ? 17.569  20.714 -8.767  1.00 20.36  ? 100  ASP B HB2  1 
ATOM   6291  H  HB3  . ASP B 1 100 ? 17.044  21.512 -10.002 1.00 20.36  ? 100  ASP B HB3  1 
ATOM   6292  N  N    . HIS B 1 101 ? 16.393  21.014 -6.126  1.00 14.09  ? 101  HIS B N    1 
ATOM   6293  C  CA   . HIS B 1 101 ? 16.486  21.183 -4.681  1.00 13.47  ? 101  HIS B CA   1 
ATOM   6294  C  C    . HIS B 1 101 ? 17.680  21.956 -4.170  1.00 12.48  ? 101  HIS B C    1 
ATOM   6295  O  O    . HIS B 1 101 ? 17.738  22.206 -2.944  1.00 12.57  ? 101  HIS B O    1 
ATOM   6296  C  CB   . HIS B 1 101 ? 16.502  19.758 -4.065  1.00 13.64  ? 101  HIS B CB   1 
ATOM   6297  C  CG   . HIS B 1 101 ? 15.623  19.658 -2.833  1.00 11.03  ? 101  HIS B CG   1 
ATOM   6298  N  ND1  . HIS B 1 101 ? 15.177  18.447 -2.370  1.00 13.04  ? 101  HIS B ND1  1 
ATOM   6299  C  CD2  . HIS B 1 101 ? 15.095  20.618 -2.043  1.00 10.87  ? 101  HIS B CD2  1 
ATOM   6300  C  CE1  . HIS B 1 101 ? 14.398  18.668 -1.311  1.00 11.39  ? 101  HIS B CE1  1 
ATOM   6301  N  NE2  . HIS B 1 101 ? 14.345  19.952 -1.080  1.00 9.76   ? 101  HIS B NE2  1 
ATOM   6302  H  H    . HIS B 1 101 ? 16.496  20.248 -6.503  1.00 16.91  ? 101  HIS B H    1 
ATOM   6303  H  HA   . HIS B 1 101 ? 15.674  21.639 -4.375  1.00 16.17  ? 101  HIS B HA   1 
ATOM   6304  H  HB2  . HIS B 1 101 ? 16.194  19.121 -4.728  1.00 16.36  ? 101  HIS B HB2  1 
ATOM   6305  H  HB3  . HIS B 1 101 ? 17.412  19.525 -3.827  1.00 16.36  ? 101  HIS B HB3  1 
ATOM   6306  H  HD2  . HIS B 1 101 ? 15.210  21.537 -2.127  1.00 13.04  ? 101  HIS B HD2  1 
ATOM   6307  H  HE1  . HIS B 1 101 ? 13.963  18.012 -0.816  1.00 13.66  ? 101  HIS B HE1  1 
ATOM   6308  H  HE2  . HIS B 1 101 ? 13.915  20.326 -0.436  1.00 11.71  ? 101  HIS B HE2  1 
ATOM   6309  N  N    . SER B 1 102 ? 18.688  22.400 -4.918  1.00 11.88  ? 102  SER B N    1 
ATOM   6310  C  CA   . SER B 1 102 ? 19.667  23.304 -4.321  1.00 11.84  ? 102  SER B CA   1 
ATOM   6311  C  C    . SER B 1 102 ? 19.068  24.576 -3.769  1.00 18.48  ? 102  SER B C    1 
ATOM   6312  O  O    . SER B 1 102 ? 19.620  25.236 -2.883  1.00 14.63  ? 102  SER B O    1 
ATOM   6313  C  CB   . SER B 1 102 ? 20.766  23.655 -5.347  1.00 16.03  ? 102  SER B CB   1 
ATOM   6314  O  OG   . SER B 1 102 ? 20.288  24.511 -6.383  1.00 14.02  ? 102  SER B OG   1 
ATOM   6315  H  H    . SER B 1 102 ? 18.762  22.157 -5.740  1.00 14.25  ? 102  SER B H    1 
ATOM   6316  H  HA   . SER B 1 102 ? 20.095  22.830 -3.578  1.00 14.21  ? 102  SER B HA   1 
ATOM   6317  H  HB2  . SER B 1 102 ? 21.501  24.091 -4.889  1.00 19.24  ? 102  SER B HB2  1 
ATOM   6318  H  HB3  . SER B 1 102 ? 21.105  22.837 -5.743  1.00 19.24  ? 102  SER B HB3  1 
ATOM   6319  H  HG   . SER B 1 102 ? 19.663  24.149 -6.770  1.00 21.03  ? 102  SER B HG   1 
ATOM   6320  N  N    . LEU B 1 103 ? 17.933  25.029 -4.262  1.00 11.34  ? 103  LEU B N    1 
ATOM   6321  C  CA   . LEU B 1 103 ? 17.224  26.210 -3.825  1.00 12.44  ? 103  LEU B CA   1 
ATOM   6322  C  C    . LEU B 1 103 ? 16.856  26.140 -2.343  1.00 11.98  ? 103  LEU B C    1 
ATOM   6323  O  O    . LEU B 1 103 ? 16.547  27.181 -1.772  1.00 13.95  ? 103  LEU B O    1 
ATOM   6324  C  CB   . LEU B 1 103 ? 15.989  26.417 -4.695  1.00 13.70  ? 103  LEU B CB   1 
ATOM   6325  C  CG   . LEU B 1 103 ? 16.317  26.691 -6.176  1.00 14.03  ? 103  LEU B CG   1 
ATOM   6326  C  CD1  . LEU B 1 103 ? 15.113  26.418 -7.064  1.00 18.05  ? 103  LEU B CD1  1 
ATOM   6327  C  CD2  . LEU B 1 103 ? 16.829  28.113 -6.361  1.00 20.14  ? 103  LEU B CD2  1 
ATOM   6328  H  H    . LEU B 1 103 ? 17.581  24.579 -4.904  1.00 13.61  ? 103  LEU B H    1 
ATOM   6329  H  HA   . LEU B 1 103 ? 17.816  26.981 -3.953  1.00 14.93  ? 103  LEU B HA   1 
ATOM   6330  H  HB2  . LEU B 1 103 ? 15.431  25.626 -4.639  1.00 16.43  ? 103  LEU B HB2  1 
ATOM   6331  H  HB3  . LEU B 1 103 ? 15.480  27.163 -4.343  1.00 16.43  ? 103  LEU B HB3  1 
ATOM   6332  H  HG   . LEU B 1 103 ? 17.033  26.078 -6.444  1.00 16.84  ? 103  LEU B HG   1 
ATOM   6333  H  HD11 . LEU B 1 103 ? 14.810  25.518 -6.924  1.00 27.08  ? 103  LEU B HD11 1 
ATOM   6334  H  HD12 . LEU B 1 103 ? 15.361  26.533 -7.984  1.00 27.08  ? 103  LEU B HD12 1 
ATOM   6335  H  HD13 . LEU B 1 103 ? 14.407  27.031 -6.844  1.00 27.08  ? 103  LEU B HD13 1 
ATOM   6336  H  HD21 . LEU B 1 103 ? 17.579  28.261 -5.781  1.00 30.21  ? 103  LEU B HD21 1 
ATOM   6337  H  HD22 . LEU B 1 103 ? 16.130  28.735 -6.144  1.00 30.21  ? 103  LEU B HD22 1 
ATOM   6338  H  HD23 . LEU B 1 103 ? 17.099  28.240 -7.273  1.00 30.21  ? 103  LEU B HD23 1 
ATOM   6339  N  N    . ALA B 1 104 ? 16.883  24.927 -1.758  1.00 13.19  ? 104  ALA B N    1 
ATOM   6340  C  CA   . ALA B 1 104 ? 16.599  24.899 -0.307  1.00 12.89  ? 104  ALA B CA   1 
ATOM   6341  C  C    . ALA B 1 104 ? 17.640  25.618 0.510   1.00 12.54  ? 104  ALA B C    1 
ATOM   6342  O  O    . ALA B 1 104 ? 17.302  26.055 1.622   1.00 13.42  ? 104  ALA B O    1 
ATOM   6343  C  CB   . ALA B 1 104 ? 16.432  23.437 0.114   1.00 10.71  ? 104  ALA B CB   1 
ATOM   6344  H  H    . ALA B 1 104 ? 17.054  24.211 -2.202  1.00 15.82  ? 104  ALA B H    1 
ATOM   6345  H  HA   . ALA B 1 104 ? 15.742  25.351 -0.162  1.00 15.46  ? 104  ALA B HA   1 
ATOM   6346  H  HB1  . ALA B 1 104 ? 15.765  23.020 -0.437  1.00 16.06  ? 104  ALA B HB1  1 
ATOM   6347  H  HB2  . ALA B 1 104 ? 16.157  23.398 1.033   1.00 16.06  ? 104  ALA B HB2  1 
ATOM   6348  H  HB3  . ALA B 1 104 ? 17.267  22.976 0.010   1.00 16.06  ? 104  ALA B HB3  1 
ATOM   6349  N  N    . ILE B 1 105 ? 18.859  25.770 0.020   1.00 14.27  ? 105  ILE B N    1 
ATOM   6350  C  CA   . ILE B 1 105 ? 19.839  26.589 0.732   1.00 12.38  ? 105  ILE B CA   1 
ATOM   6351  C  C    . ILE B 1 105 ? 19.224  27.954 0.931   1.00 13.20  ? 105  ILE B C    1 
ATOM   6352  O  O    . ILE B 1 105 ? 19.159  28.549 1.998   1.00 18.08  ? 105  ILE B O    1 
ATOM   6353  C  CB   . ILE B 1 105 ? 21.191  26.644 -0.016  1.00 14.56  ? 105  ILE B CB   1 
ATOM   6354  C  CG1  . ILE B 1 105 ? 21.834  25.248 -0.204  1.00 14.57  ? 105  ILE B CG1  1 
ATOM   6355  C  CG2  . ILE B 1 105 ? 22.161  27.582 0.686   1.00 13.91  ? 105  ILE B CG2  1 
ATOM   6356  C  CD1  . ILE B 1 105 ? 23.029  25.295 -1.146  1.00 15.59  ? 105  ILE B CD1  1 
ATOM   6357  H  H    . ILE B 1 105 ? 19.076  25.386 -0.718  1.00 17.12  ? 105  ILE B H    1 
ATOM   6358  H  HA   . ILE B 1 105 ? 19.991  26.190 1.614   1.00 14.85  ? 105  ILE B HA   1 
ATOM   6359  H  HB   . ILE B 1 105 ? 21.019  27.012 -0.908  1.00 17.47  ? 105  ILE B HB   1 
ATOM   6360  H  HG12 . ILE B 1 105 ? 22.120  24.909 0.659   1.00 17.49  ? 105  ILE B HG12 1 
ATOM   6361  H  HG13 . ILE B 1 105 ? 21.170  24.636 -0.559  1.00 17.49  ? 105  ILE B HG13 1 
ATOM   6362  H  HG21 . ILE B 1 105 ? 22.992  27.599 0.207   1.00 20.86  ? 105  ILE B HG21 1 
ATOM   6363  H  HG22 . ILE B 1 105 ? 22.314  27.273 1.582   1.00 20.86  ? 105  ILE B HG22 1 
ATOM   6364  H  HG23 . ILE B 1 105 ? 21.788  28.466 0.712   1.00 20.86  ? 105  ILE B HG23 1 
ATOM   6365  H  HD11 . ILE B 1 105 ? 23.411  24.418 -1.223  1.00 23.38  ? 105  ILE B HD11 1 
ATOM   6366  H  HD12 . ILE B 1 105 ? 23.687  25.901 -0.797  1.00 23.38  ? 105  ILE B HD12 1 
ATOM   6367  H  HD13 . ILE B 1 105 ? 22.742  25.597 -2.011  1.00 23.38  ? 105  ILE B HD13 1 
ATOM   6368  N  N    . GLY B 1 106 ? 18.706  28.535 -0.163  1.00 19.37  ? 106  GLY B N    1 
ATOM   6369  C  CA   . GLY B 1 106 ? 18.153  29.888 -0.110  1.00 16.83  ? 106  GLY B CA   1 
ATOM   6370  C  C    . GLY B 1 106 ? 16.850  29.950 0.654   1.00 14.23  ? 106  GLY B C    1 
ATOM   6371  O  O    . GLY B 1 106 ? 16.560  30.816 1.491   1.00 14.62  ? 106  GLY B O    1 
ATOM   6372  H  H    . GLY B 1 106 ? 18.699  28.105 -0.908  1.00 23.24  ? 106  GLY B H    1 
ATOM   6373  H  HA2  . GLY B 1 106 ? 18.796  30.478 0.312   1.00 20.19  ? 106  GLY B HA2  1 
ATOM   6374  H  HA3  . GLY B 1 106 ? 18.006  30.207 -1.014  1.00 20.19  ? 106  GLY B HA3  1 
ATOM   6375  N  N    . SER B 1 107 ? 15.944  29.008 0.378   1.00 14.61  ? 107  SER B N    1 
ATOM   6376  C  CA   . SER B 1 107 ? 14.646  28.963 1.061   1.00 16.02  ? 107  SER B CA   1 
ATOM   6377  C  C    . SER B 1 107 ? 14.789  28.906 2.571   1.00 12.00  ? 107  SER B C    1 
ATOM   6378  O  O    . SER B 1 107 ? 14.274  29.739 3.324   1.00 14.72  ? 107  SER B O    1 
ATOM   6379  C  CB   . SER B 1 107 ? 13.838  27.789 0.502   1.00 15.15  ? 107  SER B CB   1 
ATOM   6380  O  OG   . SER B 1 107 ? 12.513  27.927 0.975   1.00 16.80  ? 107  SER B OG   1 
ATOM   6381  H  H    . SER B 1 107 ? 16.125  28.413 -0.215  1.00 17.53  ? 107  SER B H    1 
ATOM   6382  H  HA   . SER B 1 107 ? 14.165  29.788 0.839   1.00 19.23  ? 107  SER B HA   1 
ATOM   6383  H  HB2  . SER B 1 107 ? 13.852  27.803 -0.468  1.00 18.18  ? 107  SER B HB2  1 
ATOM   6384  H  HB3  . SER B 1 107 ? 14.216  26.948 0.803   1.00 18.18  ? 107  SER B HB3  1 
ATOM   6385  H  HG   . SER B 1 107 ? 12.056  27.308 0.691   1.00 25.20  ? 107  SER B HG   1 
ATOM   6386  N  N    . ILE B 1 108 ? 15.508  27.897 3.044   1.00 13.74  ? 108  ILE B N    1 
ATOM   6387  C  CA   . ILE B 1 108 ? 15.657  27.767 4.495   1.00 13.12  ? 108  ILE B CA   1 
ATOM   6388  C  C    . ILE B 1 108 ? 16.513  28.867 5.094   1.00 16.26  ? 108  ILE B C    1 
ATOM   6389  O  O    . ILE B 1 108 ? 16.183  29.335 6.195   1.00 16.91  ? 108  ILE B O    1 
ATOM   6390  C  CB   . ILE B 1 108 ? 16.203  26.358 4.777   1.00 12.28  ? 108  ILE B CB   1 
ATOM   6391  C  CG1  . ILE B 1 108 ? 15.212  25.296 4.309   1.00 12.80  ? 108  ILE B CG1  1 
ATOM   6392  C  CG2  . ILE B 1 108 ? 16.525  26.136 6.239   1.00 13.23  ? 108  ILE B CG2  1 
ATOM   6393  C  CD1  . ILE B 1 108 ? 15.680  23.881 4.387   1.00 12.38  ? 108  ILE B CD1  1 
ATOM   6394  H  H    . ILE B 1 108 ? 15.878  27.332 2.511   1.00 16.49  ? 108  ILE B H    1 
ATOM   6395  H  HA   . ILE B 1 108 ? 14.765  27.829 4.896   1.00 15.74  ? 108  ILE B HA   1 
ATOM   6396  H  HB   . ILE B 1 108 ? 17.031  26.246 4.265   1.00 14.73  ? 108  ILE B HB   1 
ATOM   6397  H  HG12 . ILE B 1 108 ? 14.405  25.378 4.840   1.00 15.36  ? 108  ILE B HG12 1 
ATOM   6398  H  HG13 . ILE B 1 108 ? 14.974  25.487 3.388   1.00 15.36  ? 108  ILE B HG13 1 
ATOM   6399  H  HG21 . ILE B 1 108 ? 17.148  26.804 6.534   1.00 19.84  ? 108  ILE B HG21 1 
ATOM   6400  H  HG22 . ILE B 1 108 ? 16.913  25.265 6.353   1.00 19.84  ? 108  ILE B HG22 1 
ATOM   6401  H  HG23 . ILE B 1 108 ? 15.720  26.198 6.757   1.00 19.84  ? 108  ILE B HG23 1 
ATOM   6402  H  HD11 . ILE B 1 108 ? 14.986  23.297 4.072   1.00 18.57  ? 108  ILE B HD11 1 
ATOM   6403  H  HD12 . ILE B 1 108 ? 15.893  23.664 5.297   1.00 18.57  ? 108  ILE B HD12 1 
ATOM   6404  H  HD13 . ILE B 1 108 ? 16.462  23.772 3.841   1.00 18.57  ? 108  ILE B HD13 1 
ATOM   6405  N  N    . SER B 1 109 ? 17.593  29.317 4.442   1.00 14.45  ? 109  SER B N    1 
ATOM   6406  C  CA   . SER B 1 109 ? 18.319  30.461 4.976   1.00 14.44  ? 109  SER B CA   1 
ATOM   6407  C  C    . SER B 1 109 ? 17.441  31.682 5.117   1.00 13.09  ? 109  SER B C    1 
ATOM   6408  O  O    . SER B 1 109 ? 17.501  32.344 6.168   1.00 18.51  ? 109  SER B O    1 
ATOM   6409  C  CB   . SER B 1 109 ? 19.507  30.866 4.097   1.00 16.10  ? 109  SER B CB   1 
ATOM   6410  O  OG   . SER B 1 109 ? 20.465  29.857 4.011   1.00 19.34  ? 109  SER B OG   1 
ATOM   6411  H  H    . SER B 1 109 ? 17.855  28.935 3.718   1.00 17.34  ? 109  SER B H    1 
ATOM   6412  H  HA   . SER B 1 109 ? 18.660  30.223 5.863   1.00 17.33  ? 109  SER B HA   1 
ATOM   6413  H  HB2  . SER B 1 109 ? 19.187  31.078 3.207   1.00 19.32  ? 109  SER B HB2  1 
ATOM   6414  H  HB3  . SER B 1 109 ? 19.917  31.664 4.464   1.00 19.32  ? 109  SER B HB3  1 
ATOM   6415  H  HG   . SER B 1 109 ? 20.130  29.191 3.669   1.00 29.01  ? 109  SER B HG   1 
ATOM   6416  N  N    . GLY B 1 110 ? 16.628  32.071 4.131   1.00 13.36  ? 110  GLY B N    1 
ATOM   6417  C  CA   . GLY B 1 110 ? 15.753  33.218 4.204   1.00 15.46  ? 110  GLY B CA   1 
ATOM   6418  C  C    . GLY B 1 110 ? 14.717  33.127 5.304   1.00 14.65  ? 110  GLY B C    1 
ATOM   6419  O  O    . GLY B 1 110 ? 14.418  34.060 6.044   1.00 20.92  ? 110  GLY B O    1 
ATOM   6420  H  H    . GLY B 1 110 ? 16.626  31.609 3.405   1.00 16.03  ? 110  GLY B H    1 
ATOM   6421  H  HA2  . GLY B 1 110 ? 16.291  34.013 4.347   1.00 18.56  ? 110  GLY B HA2  1 
ATOM   6422  H  HA3  . GLY B 1 110 ? 15.298  33.319 3.354   1.00 18.56  ? 110  GLY B HA3  1 
ATOM   6423  N  N    . HIS B 1 111 ? 14.134  31.933 5.398   1.00 14.51  ? 111  HIS B N    1 
ATOM   6424  C  CA   . HIS B 1 111 ? 13.160  31.701 6.450   1.00 15.16  ? 111  HIS B CA   1 
ATOM   6425  C  C    . HIS B 1 111 ? 13.810  31.868 7.828   1.00 12.25  ? 111  HIS B C    1 
ATOM   6426  O  O    . HIS B 1 111 ? 13.209  32.532 8.674   1.00 16.20  ? 111  HIS B O    1 
ATOM   6427  C  CB   . HIS B 1 111 ? 12.588  30.293 6.294   1.00 15.74  ? 111  HIS B CB   1 
ATOM   6428  C  CG   . HIS B 1 111 ? 11.402  30.058 7.165   1.00 12.48  ? 111  HIS B CG   1 
ATOM   6429  N  ND1  . HIS B 1 111 ? 10.806  28.831 7.256   1.00 23.78  ? 111  HIS B ND1  1 
ATOM   6430  C  CD2  . HIS B 1 111 ? 10.670  30.759 8.042   1.00 17.78  ? 111  HIS B CD2  1 
ATOM   6431  C  CE1  . HIS B 1 111 ? 9.779   28.739 8.044   1.00 22.22  ? 111  HIS B CE1  1 
ATOM   6432  N  NE2  . HIS B 1 111 ? 9.676   29.944 8.559   1.00 19.21  ? 111  HIS B NE2  1 
ATOM   6433  H  H    . HIS B 1 111 ? 14.332  31.308 4.843   1.00 17.41  ? 111  HIS B H    1 
ATOM   6434  H  HA   . HIS B 1 111 ? 12.433  32.352 6.361   1.00 18.19  ? 111  HIS B HA   1 
ATOM   6435  H  HB2  . HIS B 1 111 ? 12.334  30.155 5.368   1.00 18.88  ? 111  HIS B HB2  1 
ATOM   6436  H  HB3  . HIS B 1 111 ? 13.276  29.645 6.513   1.00 18.88  ? 111  HIS B HB3  1 
ATOM   6437  H  HD1  . HIS B 1 111 ? 11.098  28.154 6.813   1.00 28.54  ? 111  HIS B HD1  1 
ATOM   6438  H  HD2  . HIS B 1 111 ? 10.808  31.650 8.268   1.00 21.34  ? 111  HIS B HD2  1 
ATOM   6439  H  HE1  . HIS B 1 111 ? 9.242   27.996 8.206   1.00 26.67  ? 111  HIS B HE1  1 
ATOM   6440  N  N    . ALA B 1 112 ? 14.996  31.330 8.041   1.00 16.04  ? 112  ALA B N    1 
ATOM   6441  C  CA   . ALA B 1 112 ? 15.671  31.342 9.336   1.00 15.53  ? 112  ALA B CA   1 
ATOM   6442  C  C    . ALA B 1 112 ? 16.132  32.760 9.740   1.00 16.95  ? 112  ALA B C    1 
ATOM   6443  O  O    . ALA B 1 112 ? 16.366  33.019 10.922  1.00 19.85  ? 112  ALA B O    1 
ATOM   6444  C  CB   . ALA B 1 112 ? 16.858  30.412 9.367   1.00 19.54  ? 112  ALA B CB   1 
ATOM   6445  H  H    . ALA B 1 112 ? 15.394  30.951 7.380   1.00 19.24  ? 112  ALA B H    1 
ATOM   6446  H  HA   . ALA B 1 112 ? 15.030  31.032 10.010  1.00 18.64  ? 112  ALA B HA   1 
ATOM   6447  H  HB1  . ALA B 1 112 ? 16.579  29.529 9.115   1.00 29.31  ? 112  ALA B HB1  1 
ATOM   6448  H  HB2  . ALA B 1 112 ? 17.224  30.391 10.254  1.00 29.31  ? 112  ALA B HB2  1 
ATOM   6449  H  HB3  . ALA B 1 112 ? 17.525  30.725 8.752   1.00 29.31  ? 112  ALA B HB3  1 
ATOM   6450  N  N    . ARG B 1 113 ? 16.276  33.625 8.740   1.00 18.58  ? 113  ARG B N    1 
ATOM   6451  C  CA   . ARG B 1 113 ? 16.622  35.021 8.965   1.00 21.29  ? 113  ARG B CA   1 
ATOM   6452  C  C    . ARG B 1 113 ? 15.561  35.637 9.865   1.00 21.82  ? 113  ARG B C    1 
ATOM   6453  O  O    . ARG B 1 113 ? 15.871  36.438 10.746  1.00 24.61  ? 113  ARG B O    1 
ATOM   6454  C  CB   . ARG B 1 113 ? 16.729  35.789 7.653   1.00 23.46  ? 113  ARG B CB   1 
ATOM   6455  C  CG   . ARG B 1 113 ? 18.172  36.029 7.229   1.00 27.54  ? 113  ARG B CG   1 
ATOM   6456  C  CD   . ARG B 1 113 ? 18.250  36.667 5.840   1.00 22.48  ? 113  ARG B CD   1 
ATOM   6457  N  NE   . ARG B 1 113 ? 19.296  36.020 5.059   1.00 25.70  ? 113  ARG B NE   1 
ATOM   6458  C  CZ   . ARG B 1 113 ? 19.606  36.251 3.802   1.00 17.67  ? 113  ARG B CZ   1 
ATOM   6459  N  NH1  . ARG B 1 113 ? 18.912  37.159 3.142   1.00 25.85  ? 113  ARG B NH1  1 
ATOM   6460  N  NH2  . ARG B 1 113 ? 20.581  35.565 3.258   1.00 24.32  ? 113  ARG B NH2  1 
ATOM   6461  H  H    . ARG B 1 113 ? 16.161  33.350 7.934   1.00 22.30  ? 113  ARG B H    1 
ATOM   6462  H  HA   . ARG B 1 113 ? 17.486  35.061 9.424   1.00 25.55  ? 113  ARG B HA   1 
ATOM   6463  H  HB2  . ARG B 1 113 ? 16.272  35.292 6.956   1.00 28.16  ? 113  ARG B HB2  1 
ATOM   6464  H  HB3  . ARG B 1 113 ? 16.281  36.644 7.749   1.00 28.16  ? 113  ARG B HB3  1 
ATOM   6465  H  HG2  . ARG B 1 113 ? 18.604  36.611 7.874   1.00 33.05  ? 113  ARG B HG2  1 
ATOM   6466  H  HG3  . ARG B 1 113 ? 18.649  35.184 7.221   1.00 33.05  ? 113  ARG B HG3  1 
ATOM   6467  H  HD2  . ARG B 1 113 ? 17.397  36.572 5.387   1.00 26.98  ? 113  ARG B HD2  1 
ATOM   6468  H  HD3  . ARG B 1 113 ? 18.443  37.614 5.925   1.00 26.98  ? 113  ARG B HD3  1 
ATOM   6469  H  HE   . ARG B 1 113 ? 19.762  35.422 5.465   1.00 30.84  ? 113  ARG B HE   1 
ATOM   6470  H  HH11 . ARG B 1 113 ? 19.092  37.323 2.318   1.00 31.02  ? 113  ARG B HH11 1 
ATOM   6471  H  HH12 . ARG B 1 113 ? 18.279  37.588 3.537   1.00 31.02  ? 113  ARG B HH12 1 
ATOM   6472  H  HH21 . ARG B 1 113 ? 21.004  34.977 3.722   1.00 29.19  ? 113  ARG B HH21 1 
ATOM   6473  H  HH22 . ARG B 1 113 ? 20.798  35.702 2.437   1.00 29.19  ? 113  ARG B HH22 1 
ATOM   6474  N  N    . VAL B 1 114 ? 14.309  35.275 9.637   1.00 19.68  ? 114  VAL B N    1 
ATOM   6475  C  CA   . VAL B 1 114 ? 13.155  35.816 10.314  1.00 20.37  ? 114  VAL B CA   1 
ATOM   6476  C  C    . VAL B 1 114 ? 12.669  34.960 11.477  1.00 23.72  ? 114  VAL B C    1 
ATOM   6477  O  O    . VAL B 1 114 ? 12.142  35.500 12.453  1.00 22.10  ? 114  VAL B O    1 
ATOM   6478  C  CB   . VAL B 1 114 ? 11.965  35.999 9.353   1.00 28.13  ? 114  VAL B CB   1 
ATOM   6479  C  CG1  . VAL B 1 114 ? 10.763  36.471 10.160  1.00 24.82  ? 114  VAL B CG1  1 
ATOM   6480  C  CG2  . VAL B 1 114 ? 12.323  36.958 8.229   1.00 40.40  ? 114  VAL B CG2  1 
ATOM   6481  H  H    . VAL B 1 114 ? 14.173  34.670 9.041   1.00 23.62  ? 114  VAL B H    1 
ATOM   6482  H  HA   . VAL B 1 114 ? 13.397  36.698 10.667  1.00 24.44  ? 114  VAL B HA   1 
ATOM   6483  H  HB   . VAL B 1 114 ? 11.750  35.128 8.959   1.00 33.75  ? 114  VAL B HB   1 
ATOM   6484  H  HG11 . VAL B 1 114 ? 10.582  35.842 10.863  1.00 37.22  ? 114  VAL B HG11 1 
ATOM   6485  H  HG12 . VAL B 1 114 ? 9.997   36.537 9.585   1.00 37.22  ? 114  VAL B HG12 1 
ATOM   6486  H  HG13 . VAL B 1 114 ? 10.952  37.331 10.542  1.00 37.22  ? 114  VAL B HG13 1 
ATOM   6487  H  HG21 . VAL B 1 114 ? 13.077  36.616 7.743   1.00 60.59  ? 114  VAL B HG21 1 
ATOM   6488  H  HG22 . VAL B 1 114 ? 12.544  37.817 8.598   1.00 60.59  ? 114  VAL B HG22 1 
ATOM   6489  H  HG23 . VAL B 1 114 ? 11.574  37.049 7.635   1.00 60.59  ? 114  VAL B HG23 1 
ATOM   6490  N  N    . HIS B 1 115 ? 12.861  33.656 11.335  1.00 19.22  ? 115  HIS B N    1 
ATOM   6491  C  CA   . HIS B 1 115 ? 12.501  32.685 12.351  1.00 15.67  ? 115  HIS B CA   1 
ATOM   6492  C  C    . HIS B 1 115 ? 13.627  31.698 12.565  1.00 23.91  ? 115  HIS B C    1 
ATOM   6493  O  O    . HIS B 1 115 ? 13.609  30.597 12.014  1.00 20.42  ? 115  HIS B O    1 
ATOM   6494  C  CB   . HIS B 1 115 ? 11.243  31.925 11.887  1.00 17.45  ? 115  HIS B CB   1 
ATOM   6495  C  CG   . HIS B 1 115 ? 10.050  32.781 11.712  1.00 25.61  ? 115  HIS B CG   1 
ATOM   6496  N  ND1  . HIS B 1 115 ? 9.228   33.151 12.752  1.00 28.31  ? 115  HIS B ND1  1 
ATOM   6497  C  CD2  . HIS B 1 115 ? 9.546   33.365 10.611  1.00 20.64  ? 115  HIS B CD2  1 
ATOM   6498  C  CE1  . HIS B 1 115 ? 8.257   33.914 12.286  1.00 28.75  ? 115  HIS B CE1  1 
ATOM   6499  N  NE2  . HIS B 1 115 ? 8.423   34.059 10.985  1.00 22.64  ? 115  HIS B NE2  1 
ATOM   6500  H  H    . HIS B 1 115 ? 13.215  33.372 10.604  1.00 23.07  ? 115  HIS B H    1 
ATOM   6501  H  HA   . HIS B 1 115 ? 12.310  33.149 13.192  1.00 18.81  ? 115  HIS B HA   1 
ATOM   6502  H  HB2  . HIS B 1 115 ? 11.437  31.486 11.044  1.00 20.94  ? 115  HIS B HB2  1 
ATOM   6503  H  HB3  . HIS B 1 115 ? 11.039  31.235 12.537  1.00 20.94  ? 115  HIS B HB3  1 
ATOM   6504  H  HD1  . HIS B 1 115 ? 9.329   32.920 13.575  1.00 33.97  ? 115  HIS B HD1  1 
ATOM   6505  H  HD2  . HIS B 1 115 ? 9.895   33.308 9.750   1.00 24.76  ? 115  HIS B HD2  1 
ATOM   6506  H  HE1  . HIS B 1 115 ? 7.571   34.288 12.790  1.00 34.50  ? 115  HIS B HE1  1 
ATOM   6507  N  N    . PRO B 1 116 ? 14.614  32.104 13.355  1.00 16.81  ? 116  PRO B N    1 
ATOM   6508  C  CA   . PRO B 1 116 ? 15.803  31.296 13.575  1.00 19.30  ? 116  PRO B CA   1 
ATOM   6509  C  C    . PRO B 1 116 ? 15.567  30.031 14.398  1.00 12.73  ? 116  PRO B C    1 
ATOM   6510  O  O    . PRO B 1 116 ? 16.412  29.140 14.497  1.00 15.97  ? 116  PRO B O    1 
ATOM   6511  C  CB   . PRO B 1 116 ? 16.739  32.254 14.334  1.00 26.56  ? 116  PRO B CB   1 
ATOM   6512  C  CG   . PRO B 1 116 ? 15.951  33.441 14.731  1.00 28.01  ? 116  PRO B CG   1 
ATOM   6513  C  CD   . PRO B 1 116 ? 14.626  33.412 14.037  1.00 17.75  ? 116  PRO B CD   1 
ATOM   6514  H  HA   . PRO B 1 116 ? 16.203  31.058 12.712  1.00 23.16  ? 116  PRO B HA   1 
ATOM   6515  H  HB2  . PRO B 1 116 ? 17.099  31.815 15.121  1.00 31.87  ? 116  PRO B HB2  1 
ATOM   6516  H  HB3  . PRO B 1 116 ? 17.478  32.519 13.765  1.00 31.87  ? 116  PRO B HB3  1 
ATOM   6517  H  HG2  . PRO B 1 116 ? 15.818  33.441 15.692  1.00 33.62  ? 116  PRO B HG2  1 
ATOM   6518  H  HG3  . PRO B 1 116 ? 16.431  34.249 14.490  1.00 33.62  ? 116  PRO B HG3  1 
ATOM   6519  H  HD2  . PRO B 1 116 ? 13.898  33.479 14.674  1.00 21.30  ? 116  PRO B HD2  1 
ATOM   6520  H  HD3  . PRO B 1 116 ? 14.553  34.138 13.397  1.00 21.30  ? 116  PRO B HD3  1 
ATOM   6521  N  N    . ASP B 1 117 ? 14.394  29.902 15.017  1.00 17.97  ? 117  ASP B N    1 
ATOM   6522  C  CA   . ASP B 1 117 ? 13.969  28.774 15.810  1.00 18.09  ? 117  ASP B CA   1 
ATOM   6523  C  C    . ASP B 1 117 ? 13.276  27.696 14.957  1.00 21.01  ? 117  ASP B C    1 
ATOM   6524  O  O    . ASP B 1 117 ? 12.775  26.699 15.492  1.00 19.06  ? 117  ASP B O    1 
ATOM   6525  C  CB   . ASP B 1 117 ? 13.047  29.258 16.928  1.00 15.54  ? 117  ASP B CB   1 
ATOM   6526  C  CG   . ASP B 1 117 ? 11.778  29.959 16.556  1.00 21.42  ? 117  ASP B CG   1 
ATOM   6527  O  OD1  . ASP B 1 117 ? 11.633  30.577 15.482  1.00 26.21  ? 117  ASP B OD1  1 
ATOM   6528  O  OD2  . ASP B 1 117 ? 10.813  29.930 17.366  1.00 24.34  ? 117  ASP B OD2  1 
ATOM   6529  H  H    . ASP B 1 117 ? 13.838  30.553 14.936  1.00 21.56  ? 117  ASP B H    1 
ATOM   6530  H  HA   . ASP B 1 117 ? 14.763  28.373 16.221  1.00 21.70  ? 117  ASP B HA   1 
ATOM   6531  H  HB2  . ASP B 1 117 ? 12.810  28.488 17.468  1.00 18.65  ? 117  ASP B HB2  1 
ATOM   6532  H  HB3  . ASP B 1 117 ? 13.559  29.856 17.493  1.00 18.65  ? 117  ASP B HB3  1 
ATOM   6533  N  N    . LEU B 1 118 ? 13.219  27.853 13.644  1.00 15.56  ? 118  LEU B N    1 
ATOM   6534  C  CA   . LEU B 1 118 ? 12.479  26.912 12.771  1.00 13.60  ? 118  LEU B CA   1 
ATOM   6535  C  C    . LEU B 1 118 ? 13.046  25.501 12.844  1.00 11.94  ? 118  LEU B C    1 
ATOM   6536  O  O    . LEU B 1 118 ? 14.218  25.173 13.051  1.00 13.30  ? 118  LEU B O    1 
ATOM   6537  C  CB   . LEU B 1 118 ? 12.434  27.437 11.341  1.00 16.50  ? 118  LEU B CB   1 
ATOM   6538  C  CG   . LEU B 1 118 ? 13.643  27.369 10.410  1.00 19.36  ? 118  LEU B CG   1 
ATOM   6539  C  CD1  . LEU B 1 118 ? 13.851  26.035 9.707   1.00 59.60  ? 118  LEU B CD1  1 
ATOM   6540  C  CD2  . LEU B 1 118 ? 13.470  28.398 9.293   1.00 23.55  ? 118  LEU B CD2  1 
ATOM   6541  H  H    . LEU B 1 118 ? 13.623  28.523 13.287  1.00 18.67  ? 118  LEU B H    1 
ATOM   6542  H  HA   . LEU B 1 118 ? 11.556  26.874 13.098  1.00 16.32  ? 118  LEU B HA   1 
ATOM   6543  H  HB2  . LEU B 1 118 ? 11.710  26.970 10.895  1.00 19.80  ? 118  LEU B HB2  1 
ATOM   6544  H  HB3  . LEU B 1 118 ? 12.172  28.369 11.393  1.00 19.80  ? 118  LEU B HB3  1 
ATOM   6545  H  HG   . LEU B 1 118 ? 14.450  27.588 10.921  1.00 23.24  ? 118  LEU B HG   1 
ATOM   6546  H  HD11 . LEU B 1 118 ? 13.938  25.339 10.362  1.00 89.40  ? 118  LEU B HD11 1 
ATOM   6547  H  HD12 . LEU B 1 118 ? 14.648  26.075 9.175   1.00 89.40  ? 118  LEU B HD12 1 
ATOM   6548  H  HD13 . LEU B 1 118 ? 13.097  25.850 9.142   1.00 89.40  ? 118  LEU B HD13 1 
ATOM   6549  H  HD21 . LEU B 1 118 ? 13.357  29.271 9.676   1.00 35.32  ? 118  LEU B HD21 1 
ATOM   6550  H  HD22 . LEU B 1 118 ? 12.695  28.176 8.770   1.00 35.32  ? 118  LEU B HD22 1 
ATOM   6551  H  HD23 . LEU B 1 118 ? 14.247  28.394 8.730   1.00 35.32  ? 118  LEU B HD23 1 
ATOM   6552  N  N    . GLY B 1 119 ? 12.118  24.565 12.614  1.00 13.57  ? 119  GLY B N    1 
ATOM   6553  C  CA   . GLY B 1 119 ? 12.429  23.166 12.419  1.00 12.38  ? 119  GLY B CA   1 
ATOM   6554  C  C    . GLY B 1 119 ? 12.037  22.724 11.005  1.00 12.24  ? 119  GLY B C    1 
ATOM   6555  O  O    . GLY B 1 119 ? 11.090  23.244 10.433  1.00 17.65  ? 119  GLY B O    1 
ATOM   6556  H  H    . GLY B 1 119 ? 11.293  24.807 12.581  1.00 16.28  ? 119  GLY B H    1 
ATOM   6557  H  HA2  . GLY B 1 119 ? 13.379  23.023 12.552  1.00 14.85  ? 119  GLY B HA2  1 
ATOM   6558  H  HA3  . GLY B 1 119 ? 11.950  22.633 13.071  1.00 14.85  ? 119  GLY B HA3  1 
ATOM   6559  N  N    . VAL B 1 120 ? 12.801  21.769 10.517  1.00 12.56  ? 120  VAL B N    1 
ATOM   6560  C  CA   . VAL B 1 120 ? 12.667  21.327 9.135   1.00 10.02  ? 120  VAL B CA   1 
ATOM   6561  C  C    . VAL B 1 120 ? 12.194  19.885 8.998   1.00 9.92   ? 120  VAL B C    1 
ATOM   6562  O  O    . VAL B 1 120 ? 12.747  18.994 9.663   1.00 9.43   ? 120  VAL B O    1 
ATOM   6563  C  CB   . VAL B 1 120 ? 14.047  21.453 8.446   1.00 10.44  ? 120  VAL B CB   1 
ATOM   6564  C  CG1  . VAL B 1 120 ? 14.036  20.949 7.012   1.00 14.04  ? 120  VAL B CG1  1 
ATOM   6565  C  CG2  . VAL B 1 120 ? 14.580  22.886 8.498   1.00 14.77  ? 120  VAL B CG2  1 
ATOM   6566  H  H    . VAL B 1 120 ? 13.390  21.400 11.023  1.00 15.07  ? 120  VAL B H    1 
ATOM   6567  H  HA   . VAL B 1 120 ? 12.030  21.913 8.676   1.00 12.02  ? 120  VAL B HA   1 
ATOM   6568  H  HB   . VAL B 1 120 ? 14.675  20.892 8.946   1.00 12.53  ? 120  VAL B HB   1 
ATOM   6569  H  HG11 . VAL B 1 120 ? 13.706  20.048 6.992   1.00 21.05  ? 120  VAL B HG11 1 
ATOM   6570  H  HG12 . VAL B 1 120 ? 14.928  20.971 6.658   1.00 21.05  ? 120  VAL B HG12 1 
ATOM   6571  H  HG13 . VAL B 1 120 ? 13.467  21.510 6.479   1.00 21.05  ? 120  VAL B HG13 1 
ATOM   6572  H  HG21 . VAL B 1 120 ? 14.570  23.198 9.406   1.00 22.15  ? 120  VAL B HG21 1 
ATOM   6573  H  HG22 . VAL B 1 120 ? 14.025  23.454 7.958   1.00 22.15  ? 120  VAL B HG22 1 
ATOM   6574  H  HG23 . VAL B 1 120 ? 15.479  22.906 8.163   1.00 22.15  ? 120  VAL B HG23 1 
ATOM   6575  N  N    . ILE B 1 121 ? 11.229  19.655 8.112   1.00 9.82   ? 121  ILE B N    1 
ATOM   6576  C  CA   . ILE B 1 121 ? 10.811  18.328 7.674   1.00 10.08  ? 121  ILE B CA   1 
ATOM   6577  C  C    . ILE B 1 121 ? 11.225  18.180 6.190   1.00 9.22   ? 121  ILE B C    1 
ATOM   6578  O  O    . ILE B 1 121 ? 10.827  19.055 5.432   1.00 10.71  ? 121  ILE B O    1 
ATOM   6579  C  CB   . ILE B 1 121 ? 9.316   18.079 7.907   1.00 9.30   ? 121  ILE B CB   1 
ATOM   6580  C  CG1  . ILE B 1 121 ? 8.961   18.215 9.397   1.00 11.85  ? 121  ILE B CG1  1 
ATOM   6581  C  CG2  . ILE B 1 121 ? 8.888   16.728 7.400   1.00 10.41  ? 121  ILE B CG2  1 
ATOM   6582  C  CD1  . ILE B 1 121 ? 7.469   18.298 9.681   1.00 13.71  ? 121  ILE B CD1  1 
ATOM   6583  H  H    . ILE B 1 121 ? 10.824  20.335 7.775   1.00 11.78  ? 121  ILE B H    1 
ATOM   6584  H  HA   . ILE B 1 121 ? 11.312  17.666 8.195   1.00 12.09  ? 121  ILE B HA   1 
ATOM   6585  H  HB   . ILE B 1 121 ? 8.815   18.761 7.412   1.00 11.15  ? 121  ILE B HB   1 
ATOM   6586  H  HG12 . ILE B 1 121 ? 9.326   17.454 9.874   1.00 14.22  ? 121  ILE B HG12 1 
ATOM   6587  H  HG13 . ILE B 1 121 ? 9.388   19.013 9.747   1.00 14.22  ? 121  ILE B HG13 1 
ATOM   6588  H  HG21 . ILE B 1 121 ? 7.949   16.608 7.563   1.00 15.61  ? 121  ILE B HG21 1 
ATOM   6589  H  HG22 . ILE B 1 121 ? 9.382   16.043 7.856   1.00 15.61  ? 121  ILE B HG22 1 
ATOM   6590  H  HG23 . ILE B 1 121 ? 9.059   16.671 6.457   1.00 15.61  ? 121  ILE B HG23 1 
ATOM   6591  H  HD11 . ILE B 1 121 ? 7.327   18.385 10.626  1.00 20.57  ? 121  ILE B HD11 1 
ATOM   6592  H  HD12 . ILE B 1 121 ? 7.038   17.501 9.364   1.00 20.57  ? 121  ILE B HD12 1 
ATOM   6593  H  HD13 . ILE B 1 121 ? 7.100   19.061 9.230   1.00 20.57  ? 121  ILE B HD13 1 
ATOM   6594  N  N    . TRP B 1 122 ? 11.968  17.155 5.906   1.00 9.66   ? 122  TRP B N    1 
ATOM   6595  C  CA   . TRP B 1 122 ? 12.618  16.945 4.587   1.00 10.85  ? 122  TRP B CA   1 
ATOM   6596  C  C    . TRP B 1 122 ? 12.058  15.656 3.978   1.00 9.45   ? 122  TRP B C    1 
ATOM   6597  O  O    . TRP B 1 122 ? 12.459  14.603 4.464   1.00 10.65  ? 122  TRP B O    1 
ATOM   6598  C  CB   . TRP B 1 122 ? 14.124  16.965 4.753   1.00 11.00  ? 122  TRP B CB   1 
ATOM   6599  C  CG   . TRP B 1 122 ? 14.867  17.080 3.428   1.00 9.65   ? 122  TRP B CG   1 
ATOM   6600  C  CD1  . TRP B 1 122 ? 15.057  16.123 2.475   1.00 8.45   ? 122  TRP B CD1  1 
ATOM   6601  C  CD2  . TRP B 1 122 ? 15.493  18.283 2.959   1.00 9.53   ? 122  TRP B CD2  1 
ATOM   6602  N  NE1  . TRP B 1 122 ? 15.783  16.652 1.417   1.00 11.11  ? 122  TRP B NE1  1 
ATOM   6603  C  CE2  . TRP B 1 122 ? 16.054  17.965 1.712   1.00 14.04  ? 122  TRP B CE2  1 
ATOM   6604  C  CE3  . TRP B 1 122 ? 15.653  19.596 3.443   1.00 10.13  ? 122  TRP B CE3  1 
ATOM   6605  C  CZ2  . TRP B 1 122 ? 16.767  18.918 0.958   1.00 11.81  ? 122  TRP B CZ2  1 
ATOM   6606  C  CZ3  . TRP B 1 122 ? 16.356  20.522 2.687   1.00 11.83  ? 122  TRP B CZ3  1 
ATOM   6607  C  CH2  . TRP B 1 122 ? 16.903  20.170 1.442   1.00 11.22  ? 122  TRP B CH2  1 
ATOM   6608  H  H    . TRP B 1 122 ? 12.091  16.563 6.517   1.00 11.59  ? 122  TRP B H    1 
ATOM   6609  H  HA   . TRP B 1 122 ? 12.367  17.690 4.002   1.00 13.02  ? 122  TRP B HA   1 
ATOM   6610  H  HB2  . TRP B 1 122 ? 14.369  17.714 5.318   1.00 13.20  ? 122  TRP B HB2  1 
ATOM   6611  H  HB3  . TRP B 1 122 ? 14.403  16.152 5.202   1.00 13.20  ? 122  TRP B HB3  1 
ATOM   6612  H  HD1  . TRP B 1 122 ? 14.747  15.248 2.527   1.00 10.14  ? 122  TRP B HD1  1 
ATOM   6613  H  HE1  . TRP B 1 122 ? 16.020  16.233 0.704   1.00 13.33  ? 122  TRP B HE1  1 
ATOM   6614  H  HE3  . TRP B 1 122 ? 15.289  19.840 4.263   1.00 12.16  ? 122  TRP B HE3  1 
ATOM   6615  H  HZ2  . TRP B 1 122 ? 17.139  18.688 0.137   1.00 14.17  ? 122  TRP B HZ2  1 
ATOM   6616  H  HZ3  . TRP B 1 122 ? 16.466  21.387 3.009   1.00 14.19  ? 122  TRP B HZ3  1 
ATOM   6617  H  HH2  . TRP B 1 122 ? 17.364  20.807 0.946   1.00 13.47  ? 122  TRP B HH2  1 
ATOM   6618  N  N    . VAL B 1 123 ? 11.161  15.766 3.025   1.00 9.41   ? 123  VAL B N    1 
ATOM   6619  C  CA   . VAL B 1 123 ? 10.486  14.603 2.419   1.00 8.44   ? 123  VAL B CA   1 
ATOM   6620  C  C    . VAL B 1 123 ? 11.227  14.297 1.121   1.00 8.36   ? 123  VAL B C    1 
ATOM   6621  O  O    . VAL B 1 123 ? 11.193  15.198 0.245   1.00 10.76  ? 123  VAL B O    1 
ATOM   6622  C  CB   . VAL B 1 123 ? 8.982   14.824 2.234   1.00 8.54   ? 123  VAL B CB   1 
ATOM   6623  C  CG1  . VAL B 1 123 ? 8.361   13.603 1.600   1.00 10.85  ? 123  VAL B CG1  1 
ATOM   6624  C  CG2  . VAL B 1 123 ? 8.356   15.037 3.631   1.00 8.43   ? 123  VAL B CG2  1 
ATOM   6625  H  H    . VAL B 1 123 ? 10.958  16.552 2.742   1.00 11.30  ? 123  VAL B H    1 
ATOM   6626  H  HA   . VAL B 1 123 ? 10.606  13.838 3.020   1.00 10.13  ? 123  VAL B HA   1 
ATOM   6627  H  HB   . VAL B 1 123 ? 8.825   15.611 1.671   1.00 10.25  ? 123  VAL B HB   1 
ATOM   6628  H  HG11 . VAL B 1 123 ? 7.419   13.747 1.484   1.00 16.27  ? 123  VAL B HG11 1 
ATOM   6629  H  HG12 . VAL B 1 123 ? 8.501   12.842 2.168   1.00 16.27  ? 123  VAL B HG12 1 
ATOM   6630  H  HG13 . VAL B 1 123 ? 8.769   13.444 0.746   1.00 16.27  ? 123  VAL B HG13 1 
ATOM   6631  H  HG21 . VAL B 1 123 ? 8.751   15.808 4.045   1.00 12.64  ? 123  VAL B HG21 1 
ATOM   6632  H  HG22 . VAL B 1 123 ? 8.517   14.263 4.176   1.00 12.64  ? 123  VAL B HG22 1 
ATOM   6633  H  HG23 . VAL B 1 123 ? 7.410   15.172 3.540   1.00 12.64  ? 123  VAL B HG23 1 
ATOM   6634  N  N    . ASP B 1 124 ? 11.857  13.169 0.980   1.00 9.30   ? 124  ASP B N    1 
ATOM   6635  C  CA   . ASP B 1 124 ? 12.769  12.957 -0.177  1.00 9.13   ? 124  ASP B CA   1 
ATOM   6636  C  C    . ASP B 1 124 ? 13.173  11.509 -0.142  1.00 9.08   ? 124  ASP B C    1 
ATOM   6637  O  O    . ASP B 1 124 ? 13.285  10.883 0.920   1.00 10.73  ? 124  ASP B O    1 
ATOM   6638  C  CB   . ASP B 1 124 ? 13.883  13.930 0.011   1.00 11.24  ? 124  ASP B CB   1 
ATOM   6639  C  CG   . ASP B 1 124 ? 14.770  14.302 -1.169  1.00 8.37   ? 124  ASP B CG   1 
ATOM   6640  O  OD1  . ASP B 1 124 ? 14.959  13.383 -2.002  1.00 9.86   ? 124  ASP B OD1  1 
ATOM   6641  O  OD2  . ASP B 1 124 ? 15.191  15.452 -1.175  1.00 9.83   ? 124  ASP B OD2  1 
ATOM   6642  H  H    . ASP B 1 124 ? 11.747  12.543 1.559   1.00 11.17  ? 124  ASP B H    1 
ATOM   6643  H  HA   . ASP B 1 124 ? 12.296  13.150 -1.014  1.00 10.95  ? 124  ASP B HA   1 
ATOM   6644  H  HB2  . ASP B 1 124 ? 13.496  14.752 0.352   1.00 13.48  ? 124  ASP B HB2  1 
ATOM   6645  H  HB3  . ASP B 1 124 ? 14.460  13.579 0.708   1.00 13.48  ? 124  ASP B HB3  1 
ATOM   6646  N  N    . ALA B 1 125 ? 13.453  10.841 -1.267  1.00 8.59   ? 125  ALA B N    1 
ATOM   6647  C  CA   . ALA B 1 125 ? 14.164  9.605  -1.331  1.00 10.47  ? 125  ALA B CA   1 
ATOM   6648  C  C    . ALA B 1 125 ? 15.621  9.751  -0.892  1.00 9.05   ? 125  ALA B C    1 
ATOM   6649  O  O    . ALA B 1 125 ? 16.233  8.731  -0.568  1.00 10.15  ? 125  ALA B O    1 
ATOM   6650  C  CB   . ALA B 1 125 ? 14.122  9.003  -2.758  1.00 10.08  ? 125  ALA B CB   1 
ATOM   6651  H  H    . ALA B 1 125 ? 13.184  11.183 -2.008  1.00 10.31  ? 125  ALA B H    1 
ATOM   6652  H  HA   . ALA B 1 125 ? 13.726  8.972  -0.723  1.00 12.57  ? 125  ALA B HA   1 
ATOM   6653  H  HB1  . ALA B 1 125 ? 13.209  8.908  -3.039  1.00 15.12  ? 125  ALA B HB1  1 
ATOM   6654  H  HB2  . ALA B 1 125 ? 14.547  8.143  -2.755  1.00 15.12  ? 125  ALA B HB2  1 
ATOM   6655  H  HB3  . ALA B 1 125 ? 14.584  9.586  -3.364  1.00 15.12  ? 125  ALA B HB3  1 
ATOM   6656  N  N    . HIS B 1 126 ? 16.193  10.936 -0.889  1.00 11.62  ? 126  HIS B N    1 
ATOM   6657  C  CA   . HIS B 1 126 ? 17.586  11.278 -0.725  1.00 10.87  ? 126  HIS B CA   1 
ATOM   6658  C  C    . HIS B 1 126 ? 17.807  12.203 0.467   1.00 10.10  ? 126  HIS B C    1 
ATOM   6659  O  O    . HIS B 1 126 ? 16.895  12.980 0.744   1.00 11.54  ? 126  HIS B O    1 
ATOM   6660  C  CB   . HIS B 1 126 ? 18.093  12.015 -1.995  1.00 11.74  ? 126  HIS B CB   1 
ATOM   6661  C  CG   . HIS B 1 126 ? 17.753  11.232 -3.242  1.00 9.06   ? 126  HIS B CG   1 
ATOM   6662  N  ND1  . HIS B 1 126 ? 16.727  11.539 -4.099  1.00 11.04  ? 126  HIS B ND1  1 
ATOM   6663  C  CD2  . HIS B 1 126 ? 18.363  10.152 -3.756  1.00 10.94  ? 126  HIS B CD2  1 
ATOM   6664  C  CE1  . HIS B 1 126 ? 16.727  10.629 -5.066  1.00 9.99   ? 126  HIS B CE1  1 
ATOM   6665  N  NE2  . HIS B 1 126 ? 17.684  9.808  -4.916  1.00 13.65  ? 126  HIS B NE2  1 
ATOM   6666  H  H    . HIS B 1 126 ? 15.661  11.602 -1.002  1.00 13.94  ? 126  HIS B H    1 
ATOM   6667  H  HA   . HIS B 1 126 ? 18.107  10.458 -0.597  1.00 13.04  ? 126  HIS B HA   1 
ATOM   6668  H  HB2  . HIS B 1 126 ? 17.685  12.894 -2.044  1.00 14.09  ? 126  HIS B HB2  1 
ATOM   6669  H  HB3  . HIS B 1 126 ? 19.054  12.132 -1.939  1.00 14.09  ? 126  HIS B HB3  1 
ATOM   6670  H  HD2  . HIS B 1 126 ? 19.104  9.716  -3.400  1.00 13.13  ? 126  HIS B HD2  1 
ATOM   6671  H  HE1  . HIS B 1 126 ? 16.110  10.598 -5.760  1.00 11.99  ? 126  HIS B HE1  1 
ATOM   6672  H  HE2  . HIS B 1 126 ? 17.877  9.154  -5.441  1.00 16.38  ? 126  HIS B HE2  1 
ATOM   6673  N  N    . THR B 1 127 ? 18.961  12.112 1.113   1.00 7.83   ? 127  THR B N    1 
ATOM   6674  C  CA   . THR B 1 127 ? 19.307  13.039 2.201   1.00 11.56  ? 127  THR B CA   1 
ATOM   6675  C  C    . THR B 1 127 ? 19.836  14.385 1.774   1.00 11.83  ? 127  THR B C    1 
ATOM   6676  O  O    . THR B 1 127 ? 19.828  15.339 2.566   1.00 10.09  ? 127  THR B O    1 
ATOM   6677  C  CB   . THR B 1 127 ? 20.378  12.407 3.137   1.00 11.30  ? 127  THR B CB   1 
ATOM   6678  O  OG1  . THR B 1 127 ? 21.303  11.671 2.340   1.00 13.39  ? 127  THR B OG1  1 
ATOM   6679  C  CG2  . THR B 1 127 ? 19.743  11.414 4.094   1.00 10.70  ? 127  THR B CG2  1 
ATOM   6680  H  H    . THR B 1 127 ? 19.519  11.497 0.891   1.00 9.40   ? 127  THR B H    1 
ATOM   6681  H  HA   . THR B 1 127 ? 18.498  13.191 2.733   1.00 13.88  ? 127  THR B HA   1 
ATOM   6682  H  HB   . THR B 1 127 ? 20.846  13.108 3.638   1.00 13.56  ? 127  THR B HB   1 
ATOM   6683  H  HG1  . THR B 1 127 ? 21.667  12.177 1.806   1.00 20.08  ? 127  THR B HG1  1 
ATOM   6684  H  HG21 . THR B 1 127 ? 20.420  11.040 4.663   1.00 16.06  ? 127  THR B HG21 1 
ATOM   6685  H  HG22 . THR B 1 127 ? 19.322  10.711 3.593   1.00 16.06  ? 127  THR B HG22 1 
ATOM   6686  H  HG23 . THR B 1 127 ? 19.086  11.862 4.630   1.00 16.06  ? 127  THR B HG23 1 
ATOM   6687  N  N    . ASP B 1 128 ? 20.319  14.513 0.506   1.00 9.83   ? 128  ASP B N    1 
ATOM   6688  C  CA   . ASP B 1 128 ? 20.787  15.787 0.045   1.00 8.77   ? 128  ASP B CA   1 
ATOM   6689  C  C    . ASP B 1 128 ? 21.821  16.463 0.991   1.00 6.72   ? 128  ASP B C    1 
ATOM   6690  O  O    . ASP B 1 128 ? 21.813  17.693 1.097   1.00 10.71  ? 128  ASP B O    1 
ATOM   6691  C  CB   . ASP B 1 128 ? 19.614  16.718 -0.264  1.00 10.36  ? 128  ASP B CB   1 
ATOM   6692  C  CG   . ASP B 1 128 ? 18.687  16.210 -1.373  1.00 9.18   ? 128  ASP B CG   1 
ATOM   6693  O  OD1  . ASP B 1 128 ? 17.656  16.893 -1.595  1.00 10.12  ? 128  ASP B OD1  1 
ATOM   6694  O  OD2  . ASP B 1 128 ? 19.026  15.148 -1.963  1.00 10.75  ? 128  ASP B OD2  1 
ATOM   6695  H  H    . ASP B 1 128 ? 20.344  13.830 -0.017  1.00 11.80  ? 128  ASP B H    1 
ATOM   6696  H  HA   . ASP B 1 128 ? 21.248  15.626 -0.805  1.00 10.53  ? 128  ASP B HA   1 
ATOM   6697  H  HB2  . ASP B 1 128 ? 19.093  16.841 0.545   1.00 12.44  ? 128  ASP B HB2  1 
ATOM   6698  H  HB3  . ASP B 1 128 ? 19.964  17.585 -0.522  1.00 12.44  ? 128  ASP B HB3  1 
ATOM   6699  N  N    . ILE B 1 129 ? 22.678  15.624 1.582   1.00 11.15  ? 129  ILE B N    1 
ATOM   6700  C  CA   . ILE B 1 129 ? 23.583  16.088 2.620   1.00 12.08  ? 129  ILE B CA   1 
ATOM   6701  C  C    . ILE B 1 129 ? 25.038  15.818 2.326   1.00 16.18  ? 129  ILE B C    1 
ATOM   6702  O  O    . ILE B 1 129 ? 25.981  15.905 3.120   1.00 13.33  ? 129  ILE B O    1 
ATOM   6703  C  CB   . ILE B 1 129 ? 23.203  15.454 3.995   1.00 13.53  ? 129  ILE B CB   1 
ATOM   6704  C  CG1  . ILE B 1 129 ? 23.766  16.266 5.168   1.00 12.70  ? 129  ILE B CG1  1 
ATOM   6705  C  CG2  . ILE B 1 129 ? 23.608  13.992 4.098   1.00 17.83  ? 129  ILE B CG2  1 
ATOM   6706  C  CD1  . ILE B 1 129 ? 23.133  15.799 6.471   1.00 16.42  ? 129  ILE B CD1  1 
ATOM   6707  H  H    . ILE B 1 129 ? 22.694  14.798 1.344   1.00 13.38  ? 129  ILE B H    1 
ATOM   6708  H  HA   . ILE B 1 129 ? 23.471  17.058 2.700   1.00 14.49  ? 129  ILE B HA   1 
ATOM   6709  H  HB   . ILE B 1 129 ? 22.227  15.487 4.066   1.00 16.23  ? 129  ILE B HB   1 
ATOM   6710  H  HG12 . ILE B 1 129 ? 24.729  16.151 5.213   1.00 15.24  ? 129  ILE B HG12 1 
ATOM   6711  H  HG13 . ILE B 1 129 ? 23.580  17.208 5.033   1.00 15.24  ? 129  ILE B HG13 1 
ATOM   6712  H  HG21 . ILE B 1 129 ? 23.245  13.506 3.354   1.00 26.75  ? 129  ILE B HG21 1 
ATOM   6713  H  HG22 . ILE B 1 129 ? 23.268  13.624 4.917   1.00 26.75  ? 129  ILE B HG22 1 
ATOM   6714  H  HG23 . ILE B 1 129 ? 24.565  13.924 4.089   1.00 26.75  ? 129  ILE B HG23 1 
ATOM   6715  H  HD11 . ILE B 1 129 ? 23.491  16.309 7.201   1.00 24.63  ? 129  ILE B HD11 1 
ATOM   6716  H  HD12 . ILE B 1 129 ? 23.326  14.869 6.605   1.00 24.63  ? 129  ILE B HD12 1 
ATOM   6717  H  HD13 . ILE B 1 129 ? 22.182  15.926 6.427   1.00 24.63  ? 129  ILE B HD13 1 
ATOM   6718  N  N    . ASN B 1 130 ? 25.344  15.452 1.065   1.00 12.31  ? 130  ASN B N    1 
ATOM   6719  C  CA   . ASN B 1 130 ? 26.740  15.483 0.627   1.00 13.85  ? 130  ASN B CA   1 
ATOM   6720  C  C    . ASN B 1 130 ? 27.302  16.889 0.789   1.00 9.98   ? 130  ASN B C    1 
ATOM   6721  O  O    . ASN B 1 130 ? 26.679  17.937 0.704   1.00 12.77  ? 130  ASN B O    1 
ATOM   6722  C  CB   . ASN B 1 130 ? 26.864  15.040 -0.841  1.00 11.95  ? 130  ASN B CB   1 
ATOM   6723  C  CG   . ASN B 1 130 ? 26.926  13.545 -1.008  1.00 12.91  ? 130  ASN B CG   1 
ATOM   6724  O  OD1  . ASN B 1 130 ? 27.788  12.839 -0.453  1.00 17.49  ? 130  ASN B OD1  1 
ATOM   6725  N  ND2  . ASN B 1 130 ? 26.026  12.950 -1.786  1.00 14.56  ? 130  ASN B ND2  1 
ATOM   6726  H  H    . ASN B 1 130 ? 24.725  15.202 0.524   1.00 14.77  ? 130  ASN B H    1 
ATOM   6727  H  HA   . ASN B 1 130 ? 27.260  14.869 1.187   1.00 16.62  ? 130  ASN B HA   1 
ATOM   6728  H  HB2  . ASN B 1 130 ? 26.104  15.381 -1.338  1.00 14.33  ? 130  ASN B HB2  1 
ATOM   6729  H  HB3  . ASN B 1 130 ? 27.666  15.433 -1.221  1.00 14.33  ? 130  ASN B HB3  1 
ATOM   6730  H  HD21 . ASN B 1 130 ? 26.048  12.097 -1.895  1.00 17.47  ? 130  ASN B HD21 1 
ATOM   6731  H  HD22 . ASN B 1 130 ? 25.421  13.418 -2.179  1.00 17.47  ? 130  ASN B HD22 1 
ATOM   6732  N  N    . THR B 1 131 ? 28.624  16.911 1.088   1.00 14.83  ? 131  THR B N    1 
ATOM   6733  C  CA   . THR B 1 131 ? 29.337  18.162 1.130   1.00 11.36  ? 131  THR B CA   1 
ATOM   6734  C  C    . THR B 1 131 ? 30.043  18.372 -0.221  1.00 15.60  ? 131  THR B C    1 
ATOM   6735  O  O    . THR B 1 131 ? 30.154  17.408 -0.976  1.00 13.69  ? 131  THR B O    1 
ATOM   6736  C  CB   . THR B 1 131 ? 30.377  18.239 2.251   1.00 16.01  ? 131  THR B CB   1 
ATOM   6737  O  OG1  . THR B 1 131 ? 31.419  17.287 2.013   1.00 20.13  ? 131  THR B OG1  1 
ATOM   6738  C  CG2  . THR B 1 131 ? 29.861  17.790 3.605   1.00 15.82  ? 131  THR B CG2  1 
ATOM   6739  H  H    . THR B 1 131 ? 29.038  16.175 1.253   1.00 17.80  ? 131  THR B H    1 
ATOM   6740  H  HA   . THR B 1 131 ? 28.689  18.885 1.258   1.00 13.63  ? 131  THR B HA   1 
ATOM   6741  H  HB   . THR B 1 131 ? 30.748  19.144 2.310   1.00 19.21  ? 131  THR B HB   1 
ATOM   6742  H  HG1  . THR B 1 131 ? 31.775  17.445 1.291   1.00 30.19  ? 131  THR B HG1  1 
ATOM   6743  H  HG21 . THR B 1 131 ? 30.562  17.866 4.256   1.00 23.73  ? 131  THR B HG21 1 
ATOM   6744  H  HG22 . THR B 1 131 ? 29.573  16.875 3.551   1.00 23.73  ? 131  THR B HG22 1 
ATOM   6745  H  HG23 . THR B 1 131 ? 29.121  18.343 3.865   1.00 23.73  ? 131  THR B HG23 1 
ATOM   6746  N  N    . PRO B 1 132 ? 30.552  19.560 -0.503  1.00 16.50  ? 132  PRO B N    1 
ATOM   6747  C  CA   . PRO B 1 132 ? 31.336  19.714 -1.756  1.00 18.62  ? 132  PRO B CA   1 
ATOM   6748  C  C    . PRO B 1 132 ? 32.511  18.756 -1.886  1.00 23.72  ? 132  PRO B C    1 
ATOM   6749  O  O    . PRO B 1 132 ? 32.955  18.450 -3.002  1.00 24.55  ? 132  PRO B O    1 
ATOM   6750  C  CB   . PRO B 1 132 ? 31.751  21.181 -1.672  1.00 15.16  ? 132  PRO B CB   1 
ATOM   6751  C  CG   . PRO B 1 132 ? 30.723  21.852 -0.823  1.00 19.49  ? 132  PRO B CG   1 
ATOM   6752  C  CD   . PRO B 1 132 ? 30.393  20.820 0.221   1.00 18.00  ? 132  PRO B CD   1 
ATOM   6753  H  HA   . PRO B 1 132 ? 30.739  19.593 -2.524  1.00 22.34  ? 132  PRO B HA   1 
ATOM   6754  H  HB2  . PRO B 1 132 ? 32.630  21.264 -1.270  1.00 18.19  ? 132  PRO B HB2  1 
ATOM   6755  H  HB3  . PRO B 1 132 ? 31.774  21.580 -2.556  1.00 18.19  ? 132  PRO B HB3  1 
ATOM   6756  H  HG2  . PRO B 1 132 ? 31.080  22.657 -0.416  1.00 23.39  ? 132  PRO B HG2  1 
ATOM   6757  H  HG3  . PRO B 1 132 ? 29.938  22.083 -1.344  1.00 23.39  ? 132  PRO B HG3  1 
ATOM   6758  H  HD2  . PRO B 1 132 ? 31.006  20.873 0.972   1.00 21.60  ? 132  PRO B HD2  1 
ATOM   6759  H  HD3  . PRO B 1 132 ? 29.485  20.926 0.544   1.00 21.60  ? 132  PRO B HD3  1 
ATOM   6760  N  N    . LEU B 1 133 ? 33.107  18.203 -0.851  1.00 19.64  ? 133  LEU B N    1 
ATOM   6761  C  CA   . LEU B 1 133 ? 34.113  17.171 -0.754  1.00 21.00  ? 133  LEU B CA   1 
ATOM   6762  C  C    . LEU B 1 133 ? 33.708  15.720 -0.590  1.00 21.67  ? 133  LEU B C    1 
ATOM   6763  O  O    . LEU B 1 133 ? 34.576  14.826 -0.726  1.00 31.24  ? 133  LEU B O    1 
ATOM   6764  C  CB   . LEU B 1 133 ? 35.003  17.498 0.488   1.00 20.28  ? 133  LEU B CB   1 
ATOM   6765  C  CG   . LEU B 1 133 ? 35.498  18.922 0.570   1.00 16.58  ? 133  LEU B CG   1 
ATOM   6766  C  CD1  . LEU B 1 133 ? 36.430  19.154 1.769   1.00 19.01  ? 133  LEU B CD1  1 
ATOM   6767  C  CD2  . LEU B 1 133 ? 36.273  19.322 -0.688  1.00 22.59  ? 133  LEU B CD2  1 
ATOM   6768  H  H    . LEU B 1 133 ? 32.850  18.514 -0.092  1.00 23.57  ? 133  LEU B H    1 
ATOM   6769  H  HA   . LEU B 1 133 ? 34.680  17.233 -1.551  1.00 25.20  ? 133  LEU B HA   1 
ATOM   6770  H  HB2  . LEU B 1 133 ? 34.494  17.304 1.290   1.00 24.34  ? 133  LEU B HB2  1 
ATOM   6771  H  HB3  . LEU B 1 133 ? 35.771  16.906 0.479   1.00 24.34  ? 133  LEU B HB3  1 
ATOM   6772  H  HG   . LEU B 1 133 ? 34.723  19.515 0.659   1.00 19.89  ? 133  LEU B HG   1 
ATOM   6773  H  HD11 . LEU B 1 133 ? 36.731  20.066 1.769   1.00 28.52  ? 133  LEU B HD11 1 
ATOM   6774  H  HD12 . LEU B 1 133 ? 37.187  18.567 1.705   1.00 28.52  ? 133  LEU B HD12 1 
ATOM   6775  H  HD13 . LEU B 1 133 ? 35.954  18.974 2.583   1.00 28.52  ? 133  LEU B HD13 1 
ATOM   6776  H  HD21 . LEU B 1 133 ? 36.580  20.228 -0.600  1.00 33.88  ? 133  LEU B HD21 1 
ATOM   6777  H  HD22 . LEU B 1 133 ? 35.698  19.252 -1.454  1.00 33.88  ? 133  LEU B HD22 1 
ATOM   6778  H  HD23 . LEU B 1 133 ? 37.027  18.738 -0.799  1.00 33.88  ? 133  LEU B HD23 1 
ATOM   6779  N  N    . THR B 1 134 ? 32.465  15.334 -0.328  1.00 17.06  ? 134  THR B N    1 
ATOM   6780  C  CA   . THR B 1 134 ? 31.979  13.985 -0.298  1.00 15.39  ? 134  THR B CA   1 
ATOM   6781  C  C    . THR B 1 134 ? 31.217  13.647 -1.596  1.00 18.61  ? 134  THR B C    1 
ATOM   6782  O  O    . THR B 1 134 ? 31.141  12.467 -1.920  1.00 16.74  ? 134  THR B O    1 
ATOM   6783  C  CB   . THR B 1 134 ? 31.091  13.657 0.937   1.00 15.97  ? 134  THR B CB   1 
ATOM   6784  O  OG1  . THR B 1 134 ? 29.781  14.229 0.942   1.00 15.03  ? 134  THR B OG1  1 
ATOM   6785  C  CG2  . THR B 1 134 ? 31.783  14.194 2.188   1.00 29.61  ? 134  THR B CG2  1 
ATOM   6786  H  H    . THR B 1 134 ? 31.894  15.955 -0.159  1.00 20.48  ? 134  THR B H    1 
ATOM   6787  H  HA   . THR B 1 134 ? 32.761  13.396 -0.259  1.00 18.47  ? 134  THR B HA   1 
ATOM   6788  H  HB   . THR B 1 134 ? 31.010  12.684 1.016   1.00 19.16  ? 134  THR B HB   1 
ATOM   6789  H  HG1  . THR B 1 134 ? 29.357  13.946 0.299   1.00 22.54  ? 134  THR B HG1  1 
ATOM   6790  H  HG21 . THR B 1 134 ? 31.246  13.998 2.959   1.00 44.42  ? 134  THR B HG21 1 
ATOM   6791  H  HG22 . THR B 1 134 ? 31.896  15.144 2.109   1.00 44.42  ? 134  THR B HG22 1 
ATOM   6792  H  HG23 . THR B 1 134 ? 32.643  13.776 2.282   1.00 44.42  ? 134  THR B HG23 1 
ATOM   6793  N  N    . THR B 1 135 ? 30.715  14.673 -2.295  1.00 18.44  ? 135  THR B N    1 
ATOM   6794  C  CA   . THR B 1 135 ? 29.892  14.401 -3.483  1.00 12.95  ? 135  THR B CA   1 
ATOM   6795  C  C    . THR B 1 135 ? 30.652  13.623 -4.542  1.00 18.02  ? 135  THR B C    1 
ATOM   6796  O  O    . THR B 1 135 ? 31.832  13.958 -4.745  1.00 22.24  ? 135  THR B O    1 
ATOM   6797  C  CB   . THR B 1 135 ? 29.411  15.751 -4.063  1.00 14.09  ? 135  THR B CB   1 
ATOM   6798  O  OG1  . THR B 1 135 ? 28.593  15.501 -5.207  1.00 17.57  ? 135  THR B OG1  1 
ATOM   6799  C  CG2  . THR B 1 135 ? 30.555  16.630 -4.531  1.00 16.02  ? 135  THR B CG2  1 
ATOM   6800  H  H    . THR B 1 135 ? 30.872  15.482 -2.051  1.00 22.13  ? 135  THR B H    1 
ATOM   6801  H  HA   . THR B 1 135 ? 29.109  13.879 -3.211  1.00 15.54  ? 135  THR B HA   1 
ATOM   6802  H  HB   . THR B 1 135 ? 28.888  16.229 -3.386  1.00 16.91  ? 135  THR B HB   1 
ATOM   6803  H  HG1  . THR B 1 135 ? 27.958  15.029 -4.991  1.00 26.36  ? 135  THR B HG1  1 
ATOM   6804  H  HG21 . THR B 1 135 ? 30.204  17.452 -4.882  1.00 24.03  ? 135  THR B HG21 1 
ATOM   6805  H  HG22 . THR B 1 135 ? 31.049  16.174 -5.216  1.00 24.03  ? 135  THR B HG22 1 
ATOM   6806  H  HG23 . THR B 1 135 ? 31.136  16.820 -3.790  1.00 24.03  ? 135  THR B HG23 1 
ATOM   6807  N  N    . THR B 1 136 ? 30.035  12.664 -5.231  1.00 14.64  ? 136  THR B N    1 
ATOM   6808  C  CA   . THR B 1 136 ? 30.732  12.030 -6.379  1.00 17.26  ? 136  THR B CA   1 
ATOM   6809  C  C    . THR B 1 136 ? 30.159  12.560 -7.679  1.00 18.70  ? 136  THR B C    1 
ATOM   6810  O  O    . THR B 1 136 ? 30.777  12.572 -8.759  1.00 24.98  ? 136  THR B O    1 
ATOM   6811  C  CB   . THR B 1 136 ? 30.655  10.505 -6.322  1.00 25.51  ? 136  THR B CB   1 
ATOM   6812  O  OG1  . THR B 1 136 ? 29.316  10.031 -6.144  1.00 25.05  ? 136  THR B OG1  1 
ATOM   6813  C  CG2  . THR B 1 136 ? 31.472  9.980  -5.132  1.00 23.21  ? 136  THR B CG2  1 
ATOM   6814  H  H    . THR B 1 136 ? 29.241  12.415 -5.014  1.00 17.56  ? 136  THR B H    1 
ATOM   6815  H  HA   . THR B 1 136 ? 31.677  12.287 -6.338  1.00 20.72  ? 136  THR B HA   1 
ATOM   6816  H  HB   . THR B 1 136 ? 31.020  10.133 -7.151  1.00 30.61  ? 136  THR B HB   1 
ATOM   6817  H  HG1  . THR B 1 136 ? 28.804  10.669 -6.095  1.00 37.57  ? 136  THR B HG1  1 
ATOM   6818  H  HG21 . THR B 1 136 ? 31.410  9.022  -5.100  1.00 34.81  ? 136  THR B HG21 1 
ATOM   6819  H  HG22 . THR B 1 136 ? 31.125  10.350 -4.317  1.00 34.81  ? 136  THR B HG22 1 
ATOM   6820  H  HG23 . THR B 1 136 ? 32.390  10.238 -5.236  1.00 34.81  ? 136  THR B HG23 1 
ATOM   6821  N  N    . SER B 1 137 ? 28.923  13.055 -7.653  1.00 14.51  ? 137  SER B N    1 
ATOM   6822  C  CA   . SER B 1 137 ? 28.375  13.582 -8.896  1.00 13.51  ? 137  SER B CA   1 
ATOM   6823  C  C    . SER B 1 137 ? 28.743  15.026 -9.174  1.00 17.43  ? 137  SER B C    1 
ATOM   6824  O  O    . SER B 1 137 ? 28.723  15.371 -10.370 1.00 20.84  ? 137  SER B O    1 
ATOM   6825  C  CB   . SER B 1 137 ? 26.851  13.481 -8.900  1.00 15.54  ? 137  SER B CB   1 
ATOM   6826  O  OG   . SER B 1 137 ? 26.275  14.071 -7.771  1.00 19.33  ? 137  SER B OG   1 
ATOM   6827  H  H    . SER B 1 137 ? 28.463  13.064 -6.926  1.00 17.41  ? 137  SER B H    1 
ATOM   6828  H  HA   . SER B 1 137 ? 28.717  13.035 -9.634  1.00 16.21  ? 137  SER B HA   1 
ATOM   6829  H  HB2  . SER B 1 137 ? 26.506  13.915 -9.696  1.00 18.65  ? 137  SER B HB2  1 
ATOM   6830  H  HB3  . SER B 1 137 ? 26.594  12.546 -8.936  1.00 18.65  ? 137  SER B HB3  1 
ATOM   6831  H  HG   . SER B 1 137 ? 26.386  14.882 -7.800  1.00 29.00  ? 137  SER B HG   1 
ATOM   6832  N  N    . GLY B 1 138 ? 29.043  15.850 -8.197  1.00 17.56  ? 138  GLY B N    1 
ATOM   6833  C  CA   . GLY B 1 138 ? 29.195  17.270 -8.166  1.00 11.85  ? 138  GLY B CA   1 
ATOM   6834  C  C    . GLY B 1 138 ? 28.010  18.175 -8.411  1.00 17.07  ? 138  GLY B C    1 
ATOM   6835  O  O    . GLY B 1 138 ? 28.028  19.361 -8.706  1.00 19.23  ? 138  GLY B O    1 
ATOM   6836  H  H    . GLY B 1 138 ? 29.171  15.466 -7.439  1.00 21.07  ? 138  GLY B H    1 
ATOM   6837  H  HA2  . GLY B 1 138 ? 29.556  17.501 -7.296  1.00 14.21  ? 138  GLY B HA2  1 
ATOM   6838  H  HA3  . GLY B 1 138 ? 29.872  17.501 -8.821  1.00 14.21  ? 138  GLY B HA3  1 
ATOM   6839  N  N    . ASN B 1 139 ? 26.800  17.661 -8.270  1.00 15.69  ? 139  ASN B N    1 
ATOM   6840  C  CA   . ASN B 1 139 ? 25.490  18.212 -8.507  1.00 15.25  ? 139  ASN B CA   1 
ATOM   6841  C  C    . ASN B 1 139 ? 25.028  18.804 -7.162  1.00 11.89  ? 139  ASN B C    1 
ATOM   6842  O  O    . ASN B 1 139 ? 24.842  18.058 -6.162  1.00 13.40  ? 139  ASN B O    1 
ATOM   6843  C  CB   . ASN B 1 139 ? 24.510  17.188 -9.057  1.00 13.61  ? 139  ASN B CB   1 
ATOM   6844  C  CG   . ASN B 1 139 ? 24.877  16.617 -10.424 1.00 15.96  ? 139  ASN B CG   1 
ATOM   6845  O  OD1  . ASN B 1 139 ? 25.566  17.348 -11.146 1.00 19.62  ? 139  ASN B OD1  1 
ATOM   6846  N  ND2  . ASN B 1 139 ? 24.406  15.406 -10.694 1.00 13.66  ? 139  ASN B ND2  1 
ATOM   6847  H  H    . ASN B 1 139 ? 26.794  16.850 -7.985  1.00 18.83  ? 139  ASN B H    1 
ATOM   6848  H  HA   . ASN B 1 139 ? 25.573  18.942 -9.155  1.00 18.30  ? 139  ASN B HA   1 
ATOM   6849  H  HB2  . ASN B 1 139 ? 24.442  16.455 -8.425  1.00 16.33  ? 139  ASN B HB2  1 
ATOM   6850  H  HB3  . ASN B 1 139 ? 23.635  17.601 -9.120  1.00 16.33  ? 139  ASN B HB3  1 
ATOM   6851  H  HD21 . ASN B 1 139 ? 24.573  15.040 -11.454 1.00 16.39  ? 139  ASN B HD21 1 
ATOM   6852  H  HD22 . ASN B 1 139 ? 23.933  14.989 -10.110 1.00 16.39  ? 139  ASN B HD22 1 
ATOM   6853  N  N    . LEU B 1 140 ? 24.871  20.097 -7.096  1.00 13.73  ? 140  LEU B N    1 
ATOM   6854  C  CA   . LEU B 1 140 ? 24.626  20.779 -5.826  1.00 12.79  ? 140  LEU B CA   1 
ATOM   6855  C  C    . LEU B 1 140 ? 23.207  20.523 -5.302  1.00 13.38  ? 140  LEU B C    1 
ATOM   6856  O  O    . LEU B 1 140 ? 22.999  20.815 -4.090  1.00 12.58  ? 140  LEU B O    1 
ATOM   6857  C  CB   . LEU B 1 140 ? 24.921  22.253 -5.934  1.00 15.82  ? 140  LEU B CB   1 
ATOM   6858  C  CG   . LEU B 1 140 ? 26.378  22.689 -5.730  1.00 13.84  ? 140  LEU B CG   1 
ATOM   6859  C  CD1  . LEU B 1 140 ? 26.662  23.951 -6.525  1.00 15.55  ? 140  LEU B CD1  1 
ATOM   6860  C  CD2  . LEU B 1 140 ? 26.700  22.905 -4.255  1.00 14.82  ? 140  LEU B CD2  1 
ATOM   6861  H  H    . LEU B 1 140 ? 24.912  20.561 -7.819  1.00 16.47  ? 140  LEU B H    1 
ATOM   6862  H  HA   . LEU B 1 140 ? 25.251  20.405 -5.170  1.00 15.34  ? 140  LEU B HA   1 
ATOM   6863  H  HB2  . LEU B 1 140 ? 24.639  22.552 -6.813  1.00 18.99  ? 140  LEU B HB2  1 
ATOM   6864  H  HB3  . LEU B 1 140 ? 24.374  22.717 -5.282  1.00 18.99  ? 140  LEU B HB3  1 
ATOM   6865  H  HG   . LEU B 1 140 ? 26.960  21.977 -6.068  1.00 16.60  ? 140  LEU B HG   1 
ATOM   6866  H  HD11 . LEU B 1 140 ? 26.456  23.799 -7.450  1.00 23.33  ? 140  LEU B HD11 1 
ATOM   6867  H  HD12 . LEU B 1 140 ? 27.590  24.181 -6.438  1.00 23.33  ? 140  LEU B HD12 1 
ATOM   6868  H  HD13 . LEU B 1 140 ? 26.121  24.669 -6.190  1.00 23.33  ? 140  LEU B HD13 1 
ATOM   6869  H  HD21 . LEU B 1 140 ? 26.507  22.102 -3.765  1.00 22.24  ? 140  LEU B HD21 1 
ATOM   6870  H  HD22 . LEU B 1 140 ? 26.165  23.625 -3.912  1.00 22.24  ? 140  LEU B HD22 1 
ATOM   6871  H  HD23 . LEU B 1 140 ? 27.630  23.123 -4.159  1.00 22.24  ? 140  LEU B HD23 1 
ATOM   6872  N  N    . HIS B 1 141 ? 22.289  19.995 -6.097  1.00 14.85  ? 141  HIS B N    1 
ATOM   6873  C  CA   . HIS B 1 141 ? 20.959  19.658 -5.554  1.00 12.24  ? 141  HIS B CA   1 
ATOM   6874  C  C    . HIS B 1 141 ? 21.096  18.497 -4.558  1.00 14.21  ? 141  HIS B C    1 
ATOM   6875  O  O    . HIS B 1 141 ? 20.125  18.211 -3.829  1.00 11.69  ? 141  HIS B O    1 
ATOM   6876  C  CB   . HIS B 1 141 ? 19.951  19.380 -6.677  1.00 11.91  ? 141  HIS B CB   1 
ATOM   6877  C  CG   . HIS B 1 141 ? 20.126  18.075 -7.358  1.00 10.63  ? 141  HIS B CG   1 
ATOM   6878  N  ND1  . HIS B 1 141 ? 19.072  17.401 -7.964  1.00 16.01  ? 141  HIS B ND1  1 
ATOM   6879  C  CD2  . HIS B 1 141 ? 21.194  17.276 -7.590  1.00 12.91  ? 141  HIS B CD2  1 
ATOM   6880  C  CE1  . HIS B 1 141 ? 19.527  16.283 -8.493  1.00 12.30  ? 141  HIS B CE1  1 
ATOM   6881  N  NE2  . HIS B 1 141 ? 20.809  16.159 -8.283  1.00 12.68  ? 141  HIS B NE2  1 
ATOM   6882  H  H    . HIS B 1 141 ? 22.468  19.848 -6.926  1.00 17.82  ? 141  HIS B H    1 
ATOM   6883  H  HA   . HIS B 1 141 ? 20.638  20.438 -5.055  1.00 14.69  ? 141  HIS B HA   1 
ATOM   6884  H  HB2  . HIS B 1 141 ? 19.056  19.418 -6.306  1.00 14.29  ? 141  HIS B HB2  1 
ATOM   6885  H  HB3  . HIS B 1 141 ? 20.023  20.086 -7.339  1.00 14.29  ? 141  HIS B HB3  1 
ATOM   6886  H  HD1  . HIS B 1 141 ? 18.256  17.670 -7.990  1.00 19.21  ? 141  HIS B HD1  1 
ATOM   6887  H  HD2  . HIS B 1 141 ? 22.064  17.460 -7.318  1.00 15.49  ? 141  HIS B HD2  1 
ATOM   6888  H  HE1  . HIS B 1 141 ? 19.005  15.665 -8.953  1.00 14.76  ? 141  HIS B HE1  1 
ATOM   6889  H  HE2  . HIS B 1 141 ? 21.312  15.506 -8.530  1.00 15.22  ? 141  HIS B HE2  1 
ATOM   6890  N  N    . GLY B 1 142 ? 22.205  17.778 -4.500  1.00 12.09  ? 142  GLY B N    1 
ATOM   6891  C  CA   . GLY B 1 142 ? 22.449  16.722 -3.536  1.00 12.23  ? 142  GLY B CA   1 
ATOM   6892  C  C    . GLY B 1 142 ? 23.340  17.129 -2.363  1.00 11.41  ? 142  GLY B C    1 
ATOM   6893  O  O    . GLY B 1 142 ? 23.757  16.212 -1.635  1.00 12.25  ? 142  GLY B O    1 
ATOM   6894  H  H    . GLY B 1 142 ? 22.823  17.948 -5.072  1.00 14.51  ? 142  GLY B H    1 
ATOM   6895  H  HA2  . GLY B 1 142 ? 21.597  16.417 -3.187  1.00 14.67  ? 142  GLY B HA2  1 
ATOM   6896  H  HA3  . GLY B 1 142 ? 22.863  15.974 -3.995  1.00 14.67  ? 142  GLY B HA3  1 
ATOM   6897  N  N    . GLN B 1 143 ? 23.545  18.393 -2.216  1.00 12.54  ? 143  GLN B N    1 
ATOM   6898  C  CA   . GLN B 1 143 ? 24.313  19.017 -1.146  1.00 10.28  ? 143  GLN B CA   1 
ATOM   6899  C  C    . GLN B 1 143 ? 23.601  20.047 -0.297  1.00 10.67  ? 143  GLN B C    1 
ATOM   6900  O  O    . GLN B 1 143 ? 24.289  20.539 0.621   1.00 15.20  ? 143  GLN B O    1 
ATOM   6901  C  CB   . GLN B 1 143 ? 25.547  19.669 -1.823  1.00 13.66  ? 143  GLN B CB   1 
ATOM   6902  C  CG   . GLN B 1 143 ? 26.427  18.699 -2.553  1.00 12.96  ? 143  GLN B CG   1 
ATOM   6903  C  CD   . GLN B 1 143 ? 27.561  19.326 -3.333  1.00 16.33  ? 143  GLN B CD   1 
ATOM   6904  O  OE1  . GLN B 1 143 ? 28.285  20.144 -2.750  1.00 18.73  ? 143  GLN B OE1  1 
ATOM   6905  N  NE2  . GLN B 1 143 ? 27.638  18.951 -4.604  1.00 18.06  ? 143  GLN B NE2  1 
ATOM   6906  H  H    . GLN B 1 143 ? 23.198  18.915 -2.804  1.00 15.05  ? 143  GLN B H    1 
ATOM   6907  H  HA   . GLN B 1 143 ? 24.635  18.307 -0.552  1.00 12.34  ? 143  GLN B HA   1 
ATOM   6908  H  HB2  . GLN B 1 143 ? 25.239  20.343 -2.449  1.00 16.40  ? 143  GLN B HB2  1 
ATOM   6909  H  HB3  . GLN B 1 143 ? 26.074  20.118 -1.143  1.00 16.40  ? 143  GLN B HB3  1 
ATOM   6910  H  HG2  . GLN B 1 143 ? 26.802  18.078 -1.909  1.00 15.55  ? 143  GLN B HG2  1 
ATOM   6911  H  HG3  . GLN B 1 143 ? 25.877  18.186 -3.166  1.00 15.55  ? 143  GLN B HG3  1 
ATOM   6912  H  HE21 . GLN B 1 143 ? 28.242  19.288 -5.115  1.00 21.67  ? 143  GLN B HE21 1 
ATOM   6913  H  HE22 . GLN B 1 143 ? 27.085  18.372 -4.915  1.00 21.67  ? 143  GLN B HE22 1 
ATOM   6914  N  N    . PRO B 1 144 ? 22.380  20.525 -0.439  1.00 11.57  ? 144  PRO B N    1 
ATOM   6915  C  CA   . PRO B 1 144 ? 21.926  21.716 0.281   1.00 13.62  ? 144  PRO B CA   1 
ATOM   6916  C  C    . PRO B 1 144 ? 21.968  21.549 1.802   1.00 12.25  ? 144  PRO B C    1 
ATOM   6917  O  O    . PRO B 1 144 ? 22.328  22.560 2.412   1.00 13.11  ? 144  PRO B O    1 
ATOM   6918  C  CB   . PRO B 1 144 ? 20.467  21.972 -0.169  1.00 13.65  ? 144  PRO B CB   1 
ATOM   6919  C  CG   . PRO B 1 144 ? 20.028  20.641 -0.634  1.00 11.97  ? 144  PRO B CG   1 
ATOM   6920  C  CD   . PRO B 1 144 ? 21.255  20.050 -1.285  1.00 12.81  ? 144  PRO B CD   1 
ATOM   6921  H  HA   . PRO B 1 144 ? 22.483  22.480 0.024   1.00 16.34  ? 144  PRO B HA   1 
ATOM   6922  H  HB2  . PRO B 1 144 ? 19.921  22.283 0.570   1.00 16.37  ? 144  PRO B HB2  1 
ATOM   6923  H  HB3  . PRO B 1 144 ? 20.431  22.624 -0.887  1.00 16.37  ? 144  PRO B HB3  1 
ATOM   6924  H  HG2  . PRO B 1 144 ? 19.733  20.095 0.111   1.00 14.36  ? 144  PRO B HG2  1 
ATOM   6925  H  HG3  . PRO B 1 144 ? 19.302  20.720 -1.273  1.00 14.36  ? 144  PRO B HG3  1 
ATOM   6926  H  HD2  . PRO B 1 144 ? 21.212  19.081 -1.290  1.00 15.38  ? 144  PRO B HD2  1 
ATOM   6927  H  HD3  . PRO B 1 144 ? 21.351  20.366 -2.197  1.00 15.38  ? 144  PRO B HD3  1 
ATOM   6928  N  N    . VAL B 1 145 ? 21.658  20.390 2.363   1.00 14.45  ? 145  VAL B N    1 
ATOM   6929  C  CA   . VAL B 1 145 ? 21.606  20.302 3.842   1.00 11.74  ? 145  VAL B CA   1 
ATOM   6930  C  C    . VAL B 1 145 ? 23.004  20.470 4.411   1.00 14.66  ? 145  VAL B C    1 
ATOM   6931  O  O    . VAL B 1 145 ? 23.132  21.001 5.547   1.00 12.66  ? 145  VAL B O    1 
ATOM   6932  C  CB   . VAL B 1 145 ? 20.910  19.022 4.297   1.00 10.96  ? 145  VAL B CB   1 
ATOM   6933  C  CG1  . VAL B 1 145 ? 20.697  18.948 5.823   1.00 15.14  ? 145  VAL B CG1  1 
ATOM   6934  C  CG2  . VAL B 1 145 ? 19.547  18.855 3.625   1.00 14.01  ? 145  VAL B CG2  1 
ATOM   6935  H  H    . VAL B 1 145 ? 21.490  19.700 1.877   1.00 17.34  ? 145  VAL B H    1 
ATOM   6936  H  HA   . VAL B 1 145 ? 21.069  21.057 4.161   1.00 14.09  ? 145  VAL B HA   1 
ATOM   6937  H  HB   . VAL B 1 145 ? 21.472  18.263 4.034   1.00 13.15  ? 145  VAL B HB   1 
ATOM   6938  H  HG11 . VAL B 1 145 ? 20.262  18.122 6.046   1.00 22.71  ? 145  VAL B HG11 1 
ATOM   6939  H  HG12 . VAL B 1 145 ? 20.150  19.685 6.106   1.00 22.71  ? 145  VAL B HG12 1 
ATOM   6940  H  HG13 . VAL B 1 145 ? 21.547  18.992 6.267   1.00 22.71  ? 145  VAL B HG13 1 
ATOM   6941  H  HG21 . VAL B 1 145 ? 19.137  18.042 3.930   1.00 21.02  ? 145  VAL B HG21 1 
ATOM   6942  H  HG22 . VAL B 1 145 ? 19.662  18.817 2.673   1.00 21.02  ? 145  VAL B HG22 1 
ATOM   6943  H  HG23 . VAL B 1 145 ? 18.986  19.600 3.850   1.00 21.02  ? 145  VAL B HG23 1 
ATOM   6944  N  N    . SER B 1 146 ? 24.074  20.093 3.708   1.00 13.16  ? 146  SER B N    1 
ATOM   6945  C  CA   . SER B 1 146 ? 25.422  20.244 4.299   1.00 14.24  ? 146  SER B CA   1 
ATOM   6946  C  C    . SER B 1 146 ? 25.743  21.716 4.520   1.00 13.04  ? 146  SER B C    1 
ATOM   6947  O  O    . SER B 1 146 ? 26.371  22.089 5.519   1.00 15.13  ? 146  SER B O    1 
ATOM   6948  C  CB   . SER B 1 146 ? 26.475  19.577 3.426   1.00 16.12  ? 146  SER B CB   1 
ATOM   6949  O  OG   . SER B 1 146 ? 26.777  20.296 2.248   1.00 14.69  ? 146  SER B OG   1 
ATOM   6950  H  H    . SER B 1 146 ? 23.981  19.765 2.918   1.00 15.79  ? 146  SER B H    1 
ATOM   6951  H  HA   . SER B 1 146 ? 25.423  19.798 5.172   1.00 17.09  ? 146  SER B HA   1 
ATOM   6952  H  HB2  . SER B 1 146 ? 27.288  19.469 3.944   1.00 19.35  ? 146  SER B HB2  1 
ATOM   6953  H  HB3  . SER B 1 146 ? 26.163  18.692 3.181   1.00 19.35  ? 146  SER B HB3  1 
ATOM   6954  H  HG   . SER B 1 146 ? 26.098  20.376 1.795   1.00 22.04  ? 146  SER B HG   1 
ATOM   6955  N  N    . PHE B 1 147 ? 25.342  22.589 3.587   1.00 13.80  ? 147  PHE B N    1 
ATOM   6956  C  CA   . PHE B 1 147 ? 25.533  24.013 3.679   1.00 12.64  ? 147  PHE B CA   1 
ATOM   6957  C  C    . PHE B 1 147 ? 24.758  24.624 4.843   1.00 16.10  ? 147  PHE B C    1 
ATOM   6958  O  O    . PHE B 1 147 ? 25.167  25.677 5.361   1.00 17.98  ? 147  PHE B O    1 
ATOM   6959  C  CB   . PHE B 1 147 ? 25.102  24.706 2.346   1.00 14.48  ? 147  PHE B CB   1 
ATOM   6960  C  CG   . PHE B 1 147 ? 26.143  24.535 1.237   1.00 14.97  ? 147  PHE B CG   1 
ATOM   6961  C  CD1  . PHE B 1 147 ? 26.217  23.411 0.455   1.00 15.45  ? 147  PHE B CD1  1 
ATOM   6962  C  CD2  . PHE B 1 147 ? 27.080  25.538 0.988   1.00 23.97  ? 147  PHE B CD2  1 
ATOM   6963  C  CE1  . PHE B 1 147 ? 27.159  23.246 -0.533  1.00 21.02  ? 147  PHE B CE1  1 
ATOM   6964  C  CE2  . PHE B 1 147 ? 28.037  25.401 -0.013  1.00 16.97  ? 147  PHE B CE2  1 
ATOM   6965  C  CZ   . PHE B 1 147 ? 28.073  24.256 -0.773  1.00 17.61  ? 147  PHE B CZ   1 
ATOM   6966  H  H    . PHE B 1 147 ? 24.946  22.279 2.889   1.00 16.56  ? 147  PHE B H    1 
ATOM   6967  H  HA   . PHE B 1 147 ? 26.487  24.187 3.820   1.00 15.17  ? 147  PHE B HA   1 
ATOM   6968  H  HB2  . PHE B 1 147 ? 24.259  24.329 2.050   1.00 17.37  ? 147  PHE B HB2  1 
ATOM   6969  H  HB3  . PHE B 1 147 ? 24.964  25.652 2.509   1.00 17.37  ? 147  PHE B HB3  1 
ATOM   6970  H  HD1  . PHE B 1 147 ? 25.602  22.728 0.600   1.00 18.54  ? 147  PHE B HD1  1 
ATOM   6971  H  HD2  . PHE B 1 147 ? 27.065  26.314 1.501   1.00 28.76  ? 147  PHE B HD2  1 
ATOM   6972  H  HE1  . PHE B 1 147 ? 27.182  22.464 -1.036  1.00 25.22  ? 147  PHE B HE1  1 
ATOM   6973  H  HE2  . PHE B 1 147 ? 28.651  26.082 -0.167  1.00 20.37  ? 147  PHE B HE2  1 
ATOM   6974  H  HZ   . PHE B 1 147 ? 28.709  24.161 -1.445  1.00 21.14  ? 147  PHE B HZ   1 
ATOM   6975  N  N    . LEU B 1 148 ? 23.643  24.026 5.252   1.00 14.44  ? 148  LEU B N    1 
ATOM   6976  C  CA   . LEU B 1 148 ? 22.714  24.590 6.231   1.00 14.28  ? 148  LEU B CA   1 
ATOM   6977  C  C    . LEU B 1 148 ? 23.078  24.183 7.659   1.00 14.40  ? 148  LEU B C    1 
ATOM   6978  O  O    . LEU B 1 148 ? 22.691  24.897 8.586   1.00 14.81  ? 148  LEU B O    1 
ATOM   6979  C  CB   . LEU B 1 148 ? 21.272  24.164 5.888   1.00 14.74  ? 148  LEU B CB   1 
ATOM   6980  C  CG   . LEU B 1 148 ? 20.676  24.757 4.605   1.00 14.03  ? 148  LEU B CG   1 
ATOM   6981  C  CD1  . LEU B 1 148 ? 19.293  24.207 4.308   1.00 20.95  ? 148  LEU B CD1  1 
ATOM   6982  C  CD2  . LEU B 1 148 ? 20.637  26.265 4.649   1.00 19.53  ? 148  LEU B CD2  1 
ATOM   6983  H  H    . LEU B 1 148 ? 23.456  23.256 4.918   1.00 17.33  ? 148  LEU B H    1 
ATOM   6984  H  HA   . LEU B 1 148 ? 22.764  25.566 6.171   1.00 17.14  ? 148  LEU B HA   1 
ATOM   6985  H  HB2  . LEU B 1 148 ? 21.251  23.197 5.813   1.00 17.69  ? 148  LEU B HB2  1 
ATOM   6986  H  HB3  . LEU B 1 148 ? 20.698  24.409 6.631   1.00 17.69  ? 148  LEU B HB3  1 
ATOM   6987  H  HG   . LEU B 1 148 ? 21.261  24.499 3.862   1.00 16.83  ? 148  LEU B HG   1 
ATOM   6988  H  HD11 . LEU B 1 148 ? 19.335  23.250 4.251   1.00 31.43  ? 148  LEU B HD11 1 
ATOM   6989  H  HD12 . LEU B 1 148 ? 18.979  24.564 3.474   1.00 31.43  ? 148  LEU B HD12 1 
ATOM   6990  H  HD13 . LEU B 1 148 ? 18.691  24.460 5.011   1.00 31.43  ? 148  LEU B HD13 1 
ATOM   6991  H  HD21 . LEU B 1 148 ? 21.512  26.602 4.858   1.00 29.29  ? 148  LEU B HD21 1 
ATOM   6992  H  HD22 . LEU B 1 148 ? 20.016  26.550 5.323   1.00 29.29  ? 148  LEU B HD22 1 
ATOM   6993  H  HD23 . LEU B 1 148 ? 20.360  26.604 3.795   1.00 29.29  ? 148  LEU B HD23 1 
ATOM   6994  N  N    . LEU B 1 149 ? 23.755  23.058 7.836   1.00 17.67  ? 149  LEU B N    1 
ATOM   6995  C  CA   . LEU B 1 149 ? 23.932  22.500 9.187   1.00 13.94  ? 149  LEU B CA   1 
ATOM   6996  C  C    . LEU B 1 149 ? 25.106  23.099 9.945   1.00 15.19  ? 149  LEU B C    1 
ATOM   6997  O  O    . LEU B 1 149 ? 26.240  23.074 9.488   1.00 18.66  ? 149  LEU B O    1 
ATOM   6998  C  CB   . LEU B 1 149 ? 24.056  20.989 9.066   1.00 15.35  ? 149  LEU B CB   1 
ATOM   6999  C  CG   . LEU B 1 149 ? 22.822  20.156 8.784   1.00 23.94  ? 149  LEU B CG   1 
ATOM   7000  C  CD1  . LEU B 1 149 ? 23.207  18.708 8.484   1.00 23.52  ? 149  LEU B CD1  1 
ATOM   7001  C  CD2  . LEU B 1 149 ? 21.848  20.182 9.946   1.00 20.57  ? 149  LEU B CD2  1 
ATOM   7002  H  H    . LEU B 1 149 ? 24.093  22.652 7.158   1.00 21.20  ? 149  LEU B H    1 
ATOM   7003  H  HA   . LEU B 1 149 ? 23.118  22.692 9.698   1.00 16.72  ? 149  LEU B HA   1 
ATOM   7004  H  HB2  . LEU B 1 149 ? 24.697  20.806 8.362   1.00 18.42  ? 149  LEU B HB2  1 
ATOM   7005  H  HB3  . LEU B 1 149 ? 24.444  20.663 9.893   1.00 18.42  ? 149  LEU B HB3  1 
ATOM   7006  H  HG   . LEU B 1 149 ? 22.373  20.526 7.996   1.00 28.72  ? 149  LEU B HG   1 
ATOM   7007  H  HD11 . LEU B 1 149 ? 23.836  18.688 7.758   1.00 35.29  ? 149  LEU B HD11 1 
ATOM   7008  H  HD12 . LEU B 1 149 ? 22.422  18.211 8.241   1.00 35.29  ? 149  LEU B HD12 1 
ATOM   7009  H  HD13 . LEU B 1 149 ? 23.607  18.315 9.263   1.00 35.29  ? 149  LEU B HD13 1 
ATOM   7010  H  HD21 . LEU B 1 149 ? 21.080  19.647 9.732   1.00 30.86  ? 149  LEU B HD21 1 
ATOM   7011  H  HD22 . LEU B 1 149 ? 21.572  21.087 10.112  1.00 30.86  ? 149  LEU B HD22 1 
ATOM   7012  H  HD23 . LEU B 1 149 ? 22.275  19.829 10.730  1.00 30.86  ? 149  LEU B HD23 1 
ATOM   7013  N  N    . LYS B 1 150 ? 24.807  23.620 11.147  1.00 14.56  ? 150  LYS B N    1 
ATOM   7014  C  CA   . LYS B 1 150 ? 25.909  24.189 11.936  1.00 16.95  ? 150  LYS B CA   1 
ATOM   7015  C  C    . LYS B 1 150 ? 27.004  23.195 12.247  1.00 19.31  ? 150  LYS B C    1 
ATOM   7016  O  O    . LYS B 1 150 ? 28.198  23.532 12.242  1.00 18.89  ? 150  LYS B O    1 
ATOM   7017  C  CB   . LYS B 1 150 ? 25.332  24.774 13.224  1.00 21.08  ? 150  LYS B CB   1 
ATOM   7018  C  CG   . LYS B 1 150 ? 24.421  25.973 13.056  1.00 19.65  ? 150  LYS B CG   1 
ATOM   7019  C  CD   . LYS B 1 150 ? 23.710  26.336 14.372  1.00 19.96  ? 150  LYS B CD   1 
ATOM   7020  C  CE   . LYS B 1 150 ? 22.763  27.508 14.165  1.00 22.87  ? 150  LYS B CE   1 
ATOM   7021  N  NZ   . LYS B 1 150 ? 22.471  28.214 15.445  1.00 43.93  ? 150  LYS B NZ   1 
ATOM   7022  H  H    . LYS B 1 150 ? 24.001  23.620 11.445  1.00 17.47  ? 150  LYS B H    1 
ATOM   7023  H  HA   . LYS B 1 150 ? 26.304  24.923 11.420  1.00 20.34  ? 150  LYS B HA   1 
ATOM   7024  H  HB2  . LYS B 1 150 ? 24.836  24.076 13.681  1.00 25.30  ? 150  LYS B HB2  1 
ATOM   7025  H  HB3  . LYS B 1 150 ? 26.069  25.030 13.800  1.00 25.30  ? 150  LYS B HB3  1 
ATOM   7026  H  HG2  . LYS B 1 150 ? 24.943  26.733 12.753  1.00 23.58  ? 150  LYS B HG2  1 
ATOM   7027  H  HG3  . LYS B 1 150 ? 23.756  25.778 12.376  1.00 23.58  ? 150  LYS B HG3  1 
ATOM   7028  H  HD2  . LYS B 1 150 ? 23.211  25.569 14.694  1.00 23.95  ? 150  LYS B HD2  1 
ATOM   7029  H  HD3  . LYS B 1 150 ? 24.370  26.569 15.044  1.00 23.95  ? 150  LYS B HD3  1 
ATOM   7030  H  HE2  . LYS B 1 150 ? 23.159  28.133 13.537  1.00 27.44  ? 150  LYS B HE2  1 
ATOM   7031  H  HE3  . LYS B 1 150 ? 21.933  27.184 13.781  1.00 27.44  ? 150  LYS B HE3  1 
ATOM   7032  H  HZ1  . LYS B 1 150 ? 21.919  28.894 15.290  1.00 65.90  ? 150  LYS B HZ1  1 
ATOM   7033  H  HZ2  . LYS B 1 150 ? 23.230  28.522 15.794  1.00 65.90  ? 150  LYS B HZ2  1 
ATOM   7034  H  HZ3  . LYS B 1 150 ? 22.090  27.647 16.016  1.00 65.90  ? 150  LYS B HZ3  1 
ATOM   7035  N  N    . GLU B 1 151 ? 26.663  21.940 12.535  1.00 13.93  ? 151  GLU B N    1 
ATOM   7036  C  CA   . GLU B 1 151 ? 27.665  20.971 12.929  1.00 13.87  ? 151  GLU B CA   1 
ATOM   7037  C  C    . GLU B 1 151 ? 28.629  20.632 11.798  1.00 13.84  ? 151  GLU B C    1 
ATOM   7038  O  O    . GLU B 1 151 ? 29.666  20.003 12.007  1.00 21.51  ? 151  GLU B O    1 
ATOM   7039  C  CB   . GLU B 1 151 ? 26.978  19.669 13.360  1.00 17.81  ? 151  GLU B CB   1 
ATOM   7040  C  CG   . GLU B 1 151 ? 26.389  19.648 14.749  1.00 16.03  ? 151  GLU B CG   1 
ATOM   7041  C  CD   . GLU B 1 151 ? 25.020  20.264 14.812  1.00 18.30  ? 151  GLU B CD   1 
ATOM   7042  O  OE1  . GLU B 1 151 ? 24.456  20.707 13.790  1.00 15.99  ? 151  GLU B OE1  1 
ATOM   7043  O  OE2  . GLU B 1 151 ? 24.464  20.330 15.944  1.00 21.91  ? 151  GLU B OE2  1 
ATOM   7044  H  H    . GLU B 1 151 ? 25.838  21.703 12.488  1.00 16.72  ? 151  GLU B H    1 
ATOM   7045  H  HA   . GLU B 1 151 ? 28.175  21.329 13.686  1.00 16.64  ? 151  GLU B HA   1 
ATOM   7046  H  HB2  . GLU B 1 151 ? 26.268  19.477 12.727  1.00 21.37  ? 151  GLU B HB2  1 
ATOM   7047  H  HB3  . GLU B 1 151 ? 27.625  18.949 13.294  1.00 21.37  ? 151  GLU B HB3  1 
ATOM   7048  H  HG2  . GLU B 1 151 ? 26.337  18.729 15.056  1.00 19.24  ? 151  GLU B HG2  1 
ATOM   7049  H  HG3  . GLU B 1 151 ? 26.980  20.128 15.349  1.00 19.24  ? 151  GLU B HG3  1 
ATOM   7050  N  N    . LEU B 1 152 ? 28.305  21.067 10.563  1.00 17.03  ? 152  LEU B N    1 
ATOM   7051  C  CA   . LEU B 1 152 ? 29.228  20.738 9.475   1.00 16.34  ? 152  LEU B CA   1 
ATOM   7052  C  C    . LEU B 1 152 ? 30.119  21.898 9.053   1.00 25.05  ? 152  LEU B C    1 
ATOM   7053  O  O    . LEU B 1 152 ? 30.896  21.665 8.113   1.00 24.31  ? 152  LEU B O    1 
ATOM   7054  C  CB   . LEU B 1 152 ? 28.450  20.197 8.277   1.00 16.55  ? 152  LEU B CB   1 
ATOM   7055  C  CG   . LEU B 1 152 ? 27.929  18.769 8.377   1.00 17.61  ? 152  LEU B CG   1 
ATOM   7056  C  CD1  . LEU B 1 152 ? 27.085  18.362 7.165   1.00 23.55  ? 152  LEU B CD1  1 
ATOM   7057  C  CD2  . LEU B 1 152 ? 29.067  17.773 8.571   1.00 15.32  ? 152  LEU B CD2  1 
ATOM   7058  H  H    . LEU B 1 152 ? 27.587  21.518 10.420  1.00 20.43  ? 152  LEU B H    1 
ATOM   7059  H  HA   . LEU B 1 152 ? 29.813  20.019 9.793   1.00 19.61  ? 152  LEU B HA   1 
ATOM   7060  H  HB2  . LEU B 1 152 ? 27.692  20.783 8.122   1.00 19.86  ? 152  LEU B HB2  1 
ATOM   7061  H  HB3  . LEU B 1 152 ? 29.022  20.254 7.496   1.00 19.86  ? 152  LEU B HB3  1 
ATOM   7062  H  HG   . LEU B 1 152 ? 27.354  18.719 9.168   1.00 21.13  ? 152  LEU B HG   1 
ATOM   7063  H  HD11 . LEU B 1 152 ? 26.370  18.992 7.048   1.00 35.32  ? 152  LEU B HD11 1 
ATOM   7064  H  HD12 . LEU B 1 152 ? 26.720  17.486 7.310   1.00 35.32  ? 152  LEU B HD12 1 
ATOM   7065  H  HD13 . LEU B 1 152 ? 27.637  18.354 6.380   1.00 35.32  ? 152  LEU B HD13 1 
ATOM   7066  H  HD21 . LEU B 1 152 ? 28.708  16.885 8.634   1.00 22.98  ? 152  LEU B HD21 1 
ATOM   7067  H  HD22 . LEU B 1 152 ? 29.542  17.983 9.379   1.00 22.98  ? 152  LEU B HD22 1 
ATOM   7068  H  HD23 . LEU B 1 152 ? 29.668  17.823 7.824   1.00 22.98  ? 152  LEU B HD23 1 
ATOM   7069  N  N    . LYS B 1 153 ? 30.037  23.067 9.654   1.00 28.65  ? 153  LYS B N    1 
ATOM   7070  C  CA   . LYS B 1 153 ? 30.650  24.293 9.116   1.00 37.33  ? 153  LYS B CA   1 
ATOM   7071  C  C    . LYS B 1 153 ? 32.092  24.131 8.656   1.00 40.05  ? 153  LYS B C    1 
ATOM   7072  O  O    . LYS B 1 153 ? 32.439  24.463 7.511   1.00 40.52  ? 153  LYS B O    1 
ATOM   7073  C  CB   . LYS B 1 153 ? 30.547  25.428 10.149  1.00 39.75  ? 153  LYS B CB   1 
ATOM   7074  C  CG   . LYS B 1 153 ? 31.085  26.772 9.659   1.00 31.26  ? 153  LYS B CG   1 
ATOM   7075  C  CD   . LYS B 1 153 ? 30.431  27.932 10.387  1.00 33.87  ? 153  LYS B CD   1 
ATOM   7076  C  CE   . LYS B 1 153 ? 31.392  29.090 10.613  1.00 48.53  ? 153  LYS B CE   1 
ATOM   7077  N  NZ   . LYS B 1 153 ? 30.714  30.202 11.350  1.00 50.54  ? 153  LYS B NZ   1 
ATOM   7078  H  H    . LYS B 1 153 ? 29.604  23.117 10.396  1.00 34.38  ? 153  LYS B H    1 
ATOM   7079  H  HA   . LYS B 1 153 ? 30.124  24.562 8.335   1.00 44.80  ? 153  LYS B HA   1 
ATOM   7080  H  HB2  . LYS B 1 153 ? 29.617  25.538 10.399  1.00 47.70  ? 153  LYS B HB2  1 
ATOM   7081  H  HB3  . LYS B 1 153 ? 31.037  25.169 10.946  1.00 47.70  ? 153  LYS B HB3  1 
ATOM   7082  H  HG2  . LYS B 1 153 ? 32.044  26.804 9.800   1.00 37.51  ? 153  LYS B HG2  1 
ATOM   7083  H  HG3  . LYS B 1 153 ? 30.919  26.856 8.707   1.00 37.51  ? 153  LYS B HG3  1 
ATOM   7084  H  HD2  . LYS B 1 153 ? 29.673  28.244 9.870   1.00 40.65  ? 153  LYS B HD2  1 
ATOM   7085  H  HD3  . LYS B 1 153 ? 30.100  27.622 11.245  1.00 40.65  ? 153  LYS B HD3  1 
ATOM   7086  H  HE2  . LYS B 1 153 ? 32.157  28.782 11.124  1.00 58.23  ? 153  LYS B HE2  1 
ATOM   7087  H  HE3  . LYS B 1 153 ? 31.712  29.417 9.758   1.00 58.23  ? 153  LYS B HE3  1 
ATOM   7088  H  HZ1  . LYS B 1 153 ? 31.302  30.848 11.520  1.00 75.81  ? 153  LYS B HZ1  1 
ATOM   7089  H  HZ2  . LYS B 1 153 ? 30.384  29.893 12.117  1.00 75.81  ? 153  LYS B HZ2  1 
ATOM   7090  H  HZ3  . LYS B 1 153 ? 30.052  30.528 10.853  1.00 75.81  ? 153  LYS B HZ3  1 
ATOM   7091  N  N    . GLY B 1 154 ? 32.979  23.614 9.497   1.00 23.22  ? 154  GLY B N    1 
ATOM   7092  C  CA   . GLY B 1 154 ? 34.368  23.384 9.163   1.00 21.99  ? 154  GLY B CA   1 
ATOM   7093  C  C    . GLY B 1 154 ? 34.627  22.278 8.180   1.00 24.56  ? 154  GLY B C    1 
ATOM   7094  O  O    . GLY B 1 154 ? 35.760  21.912 7.862   1.00 23.37  ? 154  GLY B O    1 
ATOM   7095  H  H    . GLY B 1 154 ? 32.713  23.403 10.287  1.00 27.87  ? 154  GLY B H    1 
ATOM   7096  H  HA2  . GLY B 1 154 ? 34.736  24.206 8.803   1.00 26.38  ? 154  GLY B HA2  1 
ATOM   7097  H  HA3  . GLY B 1 154 ? 34.850  23.185 9.981   1.00 26.38  ? 154  GLY B HA3  1 
ATOM   7098  N  N    . LYS B 1 155 ? 33.540  21.716 7.640   1.00 23.18  ? 155  LYS B N    1 
ATOM   7099  C  CA   . LYS B 1 155 ? 33.625  20.646 6.673   1.00 19.95  ? 155  LYS B CA   1 
ATOM   7100  C  C    . LYS B 1 155 ? 33.244  21.134 5.271   1.00 17.98  ? 155  LYS B C    1 
ATOM   7101  O  O    . LYS B 1 155 ? 33.370  20.386 4.295   1.00 19.39  ? 155  LYS B O    1 
ATOM   7102  C  CB   . LYS B 1 155 ? 32.711  19.488 7.085   1.00 24.96  ? 155  LYS B CB   1 
ATOM   7103  C  CG   . LYS B 1 155 ? 33.192  18.553 8.168   1.00 31.08  ? 155  LYS B CG   1 
ATOM   7104  C  CD   . LYS B 1 155 ? 34.342  19.093 8.998   1.00 40.98  ? 155  LYS B CD   1 
ATOM   7105  C  CE   . LYS B 1 155 ? 34.197  18.823 10.485  1.00 47.53  ? 155  LYS B CE   1 
ATOM   7106  N  NZ   . LYS B 1 155 ? 34.608  19.961 11.359  1.00 29.81  ? 155  LYS B NZ   1 
ATOM   7107  H  H    . LYS B 1 155 ? 32.764  22.001 7.877   1.00 27.82  ? 155  LYS B H    1 
ATOM   7108  H  HA   . LYS B 1 155 ? 34.549  20.320 6.649   1.00 23.94  ? 155  LYS B HA   1 
ATOM   7109  H  HB2  . LYS B 1 155 ? 31.866  19.867 7.374   1.00 29.95  ? 155  LYS B HB2  1 
ATOM   7110  H  HB3  . LYS B 1 155 ? 32.531  18.957 6.294   1.00 29.95  ? 155  LYS B HB3  1 
ATOM   7111  H  HG2  . LYS B 1 155 ? 32.449  18.355 8.760   1.00 37.29  ? 155  LYS B HG2  1 
ATOM   7112  H  HG3  . LYS B 1 155 ? 33.470  17.720 7.758   1.00 37.29  ? 155  LYS B HG3  1 
ATOM   7113  H  HD2  . LYS B 1 155 ? 35.168  18.693 8.685   1.00 49.18  ? 155  LYS B HD2  1 
ATOM   7114  H  HD3  . LYS B 1 155 ? 34.406  20.051 8.858   1.00 49.18  ? 155  LYS B HD3  1 
ATOM   7115  H  HE2  . LYS B 1 155 ? 33.270  18.605 10.673  1.00 57.04  ? 155  LYS B HE2  1 
ATOM   7116  H  HE3  . LYS B 1 155 ? 34.732  18.046 10.714  1.00 57.04  ? 155  LYS B HE3  1 
ATOM   7117  H  HZ1  . LYS B 1 155 ? 34.470  19.745 12.212  1.00 44.72  ? 155  LYS B HZ1  1 
ATOM   7118  H  HZ2  . LYS B 1 155 ? 34.127  20.681 11.154  1.00 44.72  ? 155  LYS B HZ2  1 
ATOM   7119  H  HZ3  . LYS B 1 155 ? 35.471  20.135 11.233  1.00 44.72  ? 155  LYS B HZ3  1 
ATOM   7120  N  N    . ILE B 1 156 ? 32.780  22.353 5.210   1.00 16.26  ? 156  ILE B N    1 
ATOM   7121  C  CA   . ILE B 1 156 ? 32.335  22.998 3.966   1.00 16.38  ? 156  ILE B CA   1 
ATOM   7122  C  C    . ILE B 1 156 ? 33.456  23.929 3.517   1.00 16.28  ? 156  ILE B C    1 
ATOM   7123  O  O    . ILE B 1 156 ? 33.755  24.891 4.215   1.00 20.01  ? 156  ILE B O    1 
ATOM   7124  C  CB   . ILE B 1 156 ? 31.006  23.756 4.072   1.00 14.52  ? 156  ILE B CB   1 
ATOM   7125  C  CG1  . ILE B 1 156 ? 29.823  22.977 4.651   1.00 15.18  ? 156  ILE B CG1  1 
ATOM   7126  C  CG2  . ILE B 1 156 ? 30.575  24.321 2.713   1.00 20.12  ? 156  ILE B CG2  1 
ATOM   7127  C  CD1  . ILE B 1 156 ? 29.796  21.549 4.149   1.00 20.35  ? 156  ILE B CD1  1 
ATOM   7128  H  H    . ILE B 1 156 ? 32.731  22.805 5.941   1.00 19.51  ? 156  ILE B H    1 
ATOM   7129  H  HA   . ILE B 1 156 ? 32.231  22.301 3.285   1.00 19.65  ? 156  ILE B HA   1 
ATOM   7130  H  HB   . ILE B 1 156 ? 31.160  24.522 4.663   1.00 17.43  ? 156  ILE B HB   1 
ATOM   7131  H  HG12 . ILE B 1 156 ? 29.883  22.976 5.619   1.00 18.22  ? 156  ILE B HG12 1 
ATOM   7132  H  HG13 . ILE B 1 156 ? 28.995  23.420 4.404   1.00 18.22  ? 156  ILE B HG13 1 
ATOM   7133  H  HG21 . ILE B 1 156 ? 31.298  24.827 2.333   1.00 30.18  ? 156  ILE B HG21 1 
ATOM   7134  H  HG22 . ILE B 1 156 ? 29.813  24.892 2.831   1.00 30.18  ? 156  ILE B HG22 1 
ATOM   7135  H  HG23 . ILE B 1 156 ? 30.346  23.598 2.124   1.00 30.18  ? 156  ILE B HG23 1 
ATOM   7136  H  HD11 . ILE B 1 156 ? 29.041  21.092 4.527   1.00 30.53  ? 156  ILE B HD11 1 
ATOM   7137  H  HD12 . ILE B 1 156 ? 30.604  21.103 4.411   1.00 30.53  ? 156  ILE B HD12 1 
ATOM   7138  H  HD13 . ILE B 1 156 ? 29.725  21.548 3.192   1.00 30.53  ? 156  ILE B HD13 1 
ATOM   7139  N  N    . PRO B 1 157 ? 34.061  23.674 2.360   1.00 19.21  ? 157  PRO B N    1 
ATOM   7140  C  CA   . PRO B 1 157 ? 35.126  24.601 1.954   1.00 21.22  ? 157  PRO B CA   1 
ATOM   7141  C  C    . PRO B 1 157 ? 34.534  25.884 1.401   1.00 20.04  ? 157  PRO B C    1 
ATOM   7142  O  O    . PRO B 1 157 ? 33.326  26.026 1.207   1.00 22.95  ? 157  PRO B O    1 
ATOM   7143  C  CB   . PRO B 1 157 ? 35.853  23.815 0.864   1.00 18.33  ? 157  PRO B CB   1 
ATOM   7144  C  CG   . PRO B 1 157 ? 34.795  22.954 0.265   1.00 23.38  ? 157  PRO B CG   1 
ATOM   7145  C  CD   . PRO B 1 157 ? 33.831  22.611 1.382   1.00 22.73  ? 157  PRO B CD   1 
ATOM   7146  H  HA   . PRO B 1 157 ? 35.727  24.791 2.705   1.00 25.46  ? 157  PRO B HA   1 
ATOM   7147  H  HB2  . PRO B 1 157 ? 36.229  24.413 0.199   1.00 22.00  ? 157  PRO B HB2  1 
ATOM   7148  H  HB3  . PRO B 1 157 ? 36.566  23.276 1.242   1.00 22.00  ? 157  PRO B HB3  1 
ATOM   7149  H  HG2  . PRO B 1 157 ? 34.335  23.427 -0.445  1.00 28.06  ? 157  PRO B HG2  1 
ATOM   7150  H  HG3  . PRO B 1 157 ? 35.186  22.146 -0.103  1.00 28.06  ? 157  PRO B HG3  1 
ATOM   7151  H  HD2  . PRO B 1 157 ? 32.914  22.619 1.066   1.00 27.28  ? 157  PRO B HD2  1 
ATOM   7152  H  HD3  . PRO B 1 157 ? 34.029  21.740 1.760   1.00 27.28  ? 157  PRO B HD3  1 
ATOM   7153  N  N    . ASP B 1 158 ? 35.417  26.840 1.145   1.00 23.23  ? 158  ASP B N    1 
ATOM   7154  C  CA   . ASP B 1 158 ? 34.983  28.079 0.512   1.00 21.05  ? 158  ASP B CA   1 
ATOM   7155  C  C    . ASP B 1 158 ? 34.661  27.768 -0.942  1.00 25.76  ? 158  ASP B C    1 
ATOM   7156  O  O    . ASP B 1 158 ? 35.532  27.486 -1.756  1.00 32.73  ? 158  ASP B O    1 
ATOM   7157  C  CB   . ASP B 1 158 ? 36.110  29.104 0.677   1.00 21.90  ? 158  ASP B CB   1 
ATOM   7158  C  CG   . ASP B 1 158 ? 36.393  29.336 2.154   1.00 34.88  ? 158  ASP B CG   1 
ATOM   7159  O  OD1  . ASP B 1 158 ? 35.419  29.276 2.938   1.00 44.86  ? 158  ASP B OD1  1 
ATOM   7160  O  OD2  . ASP B 1 158 ? 37.562  29.573 2.502   1.00 39.49  ? 158  ASP B OD2  1 
ATOM   7161  H  H    . ASP B 1 158 ? 36.244  26.729 1.352   1.00 27.87  ? 158  ASP B H    1 
ATOM   7162  H  HA   . ASP B 1 158 ? 34.176  28.407 0.960   1.00 25.26  ? 158  ASP B HA   1 
ATOM   7163  H  HB2  . ASP B 1 158 ? 36.912  28.780 0.238   1.00 26.28  ? 158  ASP B HB2  1 
ATOM   7164  H  HB3  . ASP B 1 158 ? 35.853  29.941 0.259   1.00 26.28  ? 158  ASP B HB3  1 
ATOM   7165  N  N    . VAL B 1 159 ? 33.380  27.743 -1.260  1.00 20.17  ? 159  VAL B N    1 
ATOM   7166  C  CA   . VAL B 1 159 ? 32.924  27.526 -2.635  1.00 22.13  ? 159  VAL B CA   1 
ATOM   7167  C  C    . VAL B 1 159 ? 32.467  28.844 -3.216  1.00 19.82  ? 159  VAL B C    1 
ATOM   7168  O  O    . VAL B 1 159 ? 31.669  29.578 -2.611  1.00 19.94  ? 159  VAL B O    1 
ATOM   7169  C  CB   . VAL B 1 159 ? 31.792  26.481 -2.710  1.00 16.19  ? 159  VAL B CB   1 
ATOM   7170  C  CG1  . VAL B 1 159 ? 31.491  26.119 -4.156  1.00 20.58  ? 159  VAL B CG1  1 
ATOM   7171  C  CG2  . VAL B 1 159 ? 32.223  25.250 -1.956  1.00 18.58  ? 159  VAL B CG2  1 
ATOM   7172  H  H    . VAL B 1 159 ? 32.795  27.859 -0.640  1.00 24.20  ? 159  VAL B H    1 
ATOM   7173  H  HA   . VAL B 1 159 ? 33.681  27.201 -3.164  1.00 26.56  ? 159  VAL B HA   1 
ATOM   7174  H  HB   . VAL B 1 159 ? 30.985  26.849 -2.295  1.00 19.43  ? 159  VAL B HB   1 
ATOM   7175  H  HG11 . VAL B 1 159 ? 31.234  26.909 -4.637  1.00 30.87  ? 159  VAL B HG11 1 
ATOM   7176  H  HG12 . VAL B 1 159 ? 30.775  25.480 -4.183  1.00 30.87  ? 159  VAL B HG12 1 
ATOM   7177  H  HG13 . VAL B 1 159 ? 32.275  25.739 -4.560  1.00 30.87  ? 159  VAL B HG13 1 
ATOM   7178  H  HG21 . VAL B 1 159 ? 32.404  25.482 -1.042  1.00 27.88  ? 159  VAL B HG21 1 
ATOM   7179  H  HG22 . VAL B 1 159 ? 33.017  24.890 -2.358  1.00 27.88  ? 159  VAL B HG22 1 
ATOM   7180  H  HG23 . VAL B 1 159 ? 31.522  24.594 -1.988  1.00 27.88  ? 159  VAL B HG23 1 
ATOM   7181  N  N    . PRO B 1 160 ? 32.998  29.212 -4.389  1.00 24.01  ? 160  PRO B N    1 
ATOM   7182  C  CA   . PRO B 1 160 ? 32.576  30.476 -5.011  1.00 20.41  ? 160  PRO B CA   1 
ATOM   7183  C  C    . PRO B 1 160 ? 31.065  30.578 -5.146  1.00 17.78  ? 160  PRO B C    1 
ATOM   7184  O  O    . PRO B 1 160 ? 30.468  29.610 -5.616  1.00 21.82  ? 160  PRO B O    1 
ATOM   7185  C  CB   . PRO B 1 160 ? 33.213  30.392 -6.415  1.00 21.33  ? 160  PRO B CB   1 
ATOM   7186  C  CG   . PRO B 1 160 ? 34.422  29.570 -6.175  1.00 19.33  ? 160  PRO B CG   1 
ATOM   7187  C  CD   . PRO B 1 160 ? 34.009  28.510 -5.182  1.00 29.62  ? 160  PRO B CD   1 
ATOM   7188  H  HA   . PRO B 1 160 ? 32.932  31.242 -4.514  1.00 24.49  ? 160  PRO B HA   1 
ATOM   7189  H  HB2  . PRO B 1 160 ? 32.616  29.963 -7.047  1.00 25.60  ? 160  PRO B HB2  1 
ATOM   7190  H  HB3  . PRO B 1 160 ? 33.448  31.273 -6.747  1.00 25.60  ? 160  PRO B HB3  1 
ATOM   7191  H  HG2  . PRO B 1 160 ? 34.726  29.163 -7.001  1.00 23.20  ? 160  PRO B HG2  1 
ATOM   7192  H  HG3  . PRO B 1 160 ? 35.138  30.115 -5.814  1.00 23.20  ? 160  PRO B HG3  1 
ATOM   7193  H  HD2  . PRO B 1 160 ? 33.633  27.735 -5.628  1.00 35.54  ? 160  PRO B HD2  1 
ATOM   7194  H  HD3  . PRO B 1 160 ? 34.758  28.230 -4.633  1.00 35.54  ? 160  PRO B HD3  1 
ATOM   7195  N  N    . GLY B 1 161 ? 30.463  31.688 -4.731  1.00 19.41  ? 161  GLY B N    1 
ATOM   7196  C  CA   . GLY B 1 161 ? 29.052  31.926 -4.735  1.00 21.77  ? 161  GLY B CA   1 
ATOM   7197  C  C    . GLY B 1 161 ? 28.373  31.712 -3.393  1.00 18.20  ? 161  GLY B C    1 
ATOM   7198  O  O    . GLY B 1 161 ? 27.217  32.080 -3.335  1.00 18.48  ? 161  GLY B O    1 
ATOM   7199  H  H    . GLY B 1 161 ? 30.966  32.319 -4.433  1.00 23.30  ? 161  GLY B H    1 
ATOM   7200  H  HA2  . GLY B 1 161 ? 28.892  32.839 -5.021  1.00 26.12  ? 161  GLY B HA2  1 
ATOM   7201  H  HA3  . GLY B 1 161 ? 28.640  31.338 -5.388  1.00 26.12  ? 161  GLY B HA3  1 
ATOM   7202  N  N    . PHE B 1 162 ? 29.062  31.172 -2.395  1.00 17.52  ? 162  PHE B N    1 
ATOM   7203  C  CA   . PHE B 1 162 ? 28.358  30.802 -1.167  1.00 18.35  ? 162  PHE B CA   1 
ATOM   7204  C  C    . PHE B 1 162 ? 28.925  31.538 0.030   1.00 20.14  ? 162  PHE B C    1 
ATOM   7205  O  O    . PHE B 1 162 ? 28.643  31.224 1.198   1.00 20.02  ? 162  PHE B O    1 
ATOM   7206  C  CB   . PHE B 1 162 ? 28.427  29.294 -0.905  1.00 21.69  ? 162  PHE B CB   1 
ATOM   7207  C  CG   . PHE B 1 162 ? 27.677  28.453 -1.913  1.00 20.57  ? 162  PHE B CG   1 
ATOM   7208  C  CD1  . PHE B 1 162 ? 28.311  28.024 -3.068  1.00 17.02  ? 162  PHE B CD1  1 
ATOM   7209  C  CD2  . PHE B 1 162 ? 26.355  28.105 -1.716  1.00 20.61  ? 162  PHE B CD2  1 
ATOM   7210  C  CE1  . PHE B 1 162 ? 27.646  27.268 -4.000  1.00 23.39  ? 162  PHE B CE1  1 
ATOM   7211  C  CE2  . PHE B 1 162 ? 25.677  27.352 -2.654  1.00 16.00  ? 162  PHE B CE2  1 
ATOM   7212  C  CZ   . PHE B 1 162 ? 26.306  26.954 -3.819  1.00 23.30  ? 162  PHE B CZ   1 
ATOM   7213  H  H    . PHE B 1 162 ? 29.909  31.041 -2.470  1.00 21.03  ? 162  PHE B H    1 
ATOM   7214  H  HA   . PHE B 1 162 ? 27.416  31.055 -1.265  1.00 22.02  ? 162  PHE B HA   1 
ATOM   7215  H  HB2  . PHE B 1 162 ? 29.358  29.021 -0.903  1.00 26.02  ? 162  PHE B HB2  1 
ATOM   7216  H  HB3  . PHE B 1 162 ? 28.068  29.115 -0.022  1.00 26.02  ? 162  PHE B HB3  1 
ATOM   7217  H  HD1  . PHE B 1 162 ? 29.201  28.252 -3.214  1.00 20.42  ? 162  PHE B HD1  1 
ATOM   7218  H  HD2  . PHE B 1 162 ? 25.916  28.381 -0.944  1.00 24.73  ? 162  PHE B HD2  1 
ATOM   7219  H  HE1  . PHE B 1 162 ? 28.095  26.964 -4.756  1.00 28.06  ? 162  PHE B HE1  1 
ATOM   7220  H  HE2  . PHE B 1 162 ? 24.792  27.111 -2.501  1.00 19.20  ? 162  PHE B HE2  1 
ATOM   7221  H  HZ   . PHE B 1 162 ? 25.839  26.484 -4.472  1.00 27.96  ? 162  PHE B HZ   1 
ATOM   7222  N  N    . SER B 1 163 ? 29.704  32.594 -0.162  1.00 22.41  ? 163  SER B N    1 
ATOM   7223  C  CA   . SER B 1 163 ? 30.220  33.254 1.046   1.00 21.83  ? 163  SER B CA   1 
ATOM   7224  C  C    . SER B 1 163 ? 29.126  33.882 1.891   1.00 20.17  ? 163  SER B C    1 
ATOM   7225  O  O    . SER B 1 163 ? 29.355  34.084 3.079   1.00 22.85  ? 163  SER B O    1 
ATOM   7226  C  CB   . SER B 1 163 ? 31.279  34.308 0.707   1.00 26.84  ? 163  SER B CB   1 
ATOM   7227  O  OG   . SER B 1 163 ? 30.850  35.208 -0.293  1.00 39.61  ? 163  SER B OG   1 
ATOM   7228  H  H    . SER B 1 163 ? 29.896  32.878 -0.951  1.00 26.89  ? 163  SER B H    1 
ATOM   7229  H  HA   . SER B 1 163 ? 30.654  32.566 1.592   1.00 26.20  ? 163  SER B HA   1 
ATOM   7230  H  HB2  . SER B 1 163 ? 31.497  34.807 1.510   1.00 32.21  ? 163  SER B HB2  1 
ATOM   7231  H  HB3  . SER B 1 163 ? 32.086  33.861 0.407   1.00 32.21  ? 163  SER B HB3  1 
ATOM   7232  H  HG   . SER B 1 163 ? 30.735  34.801 -0.996  1.00 59.42  ? 163  SER B HG   1 
ATOM   7233  N  N    . TRP B 1 164 ? 27.955  34.169 1.335   1.00 21.29  ? 164  TRP B N    1 
ATOM   7234  C  CA   . TRP B 1 164 ? 26.845  34.781 2.032   1.00 18.38  ? 164  TRP B CA   1 
ATOM   7235  C  C    . TRP B 1 164 ? 26.171  33.807 2.999   1.00 15.22  ? 164  TRP B C    1 
ATOM   7236  O  O    . TRP B 1 164 ? 25.377  34.244 3.859   1.00 21.64  ? 164  TRP B O    1 
ATOM   7237  C  CB   . TRP B 1 164 ? 25.773  35.308 1.052   1.00 21.61  ? 164  TRP B CB   1 
ATOM   7238  C  CG   . TRP B 1 164 ? 25.186  34.145 0.310   1.00 22.36  ? 164  TRP B CG   1 
ATOM   7239  C  CD1  . TRP B 1 164 ? 25.763  33.539 -0.766  1.00 22.39  ? 164  TRP B CD1  1 
ATOM   7240  C  CD2  . TRP B 1 164 ? 23.962  33.444 0.579   1.00 19.70  ? 164  TRP B CD2  1 
ATOM   7241  N  NE1  . TRP B 1 164 ? 24.961  32.505 -1.194  1.00 22.20  ? 164  TRP B NE1  1 
ATOM   7242  C  CE2  . TRP B 1 164 ? 23.846  32.421 -0.385  1.00 19.45  ? 164  TRP B CE2  1 
ATOM   7243  C  CE3  . TRP B 1 164 ? 22.952  33.582 1.532   1.00 24.50  ? 164  TRP B CE3  1 
ATOM   7244  C  CZ2  . TRP B 1 164 ? 22.769  31.528 -0.444  1.00 19.88  ? 164  TRP B CZ2  1 
ATOM   7245  C  CZ3  . TRP B 1 164 ? 21.887  32.702 1.480   1.00 19.35  ? 164  TRP B CZ3  1 
ATOM   7246  C  CH2  . TRP B 1 164 ? 21.796  31.698 0.517   1.00 16.12  ? 164  TRP B CH2  1 
ATOM   7247  H  H    . TRP B 1 164 ? 27.849  33.978 0.504   1.00 25.55  ? 164  TRP B H    1 
ATOM   7248  H  HA   . TRP B 1 164 ? 27.187  35.539 2.549   1.00 22.06  ? 164  TRP B HA   1 
ATOM   7249  H  HB2  . TRP B 1 164 ? 25.078  35.774 1.541   1.00 25.93  ? 164  TRP B HB2  1 
ATOM   7250  H  HB3  . TRP B 1 164 ? 26.175  35.931 0.426   1.00 25.93  ? 164  TRP B HB3  1 
ATOM   7251  H  HD1  . TRP B 1 164 ? 26.573  33.786 -1.151  1.00 26.87  ? 164  TRP B HD1  1 
ATOM   7252  H  HE1  . TRP B 1 164 ? 25.128  31.991 -1.863  1.00 26.64  ? 164  TRP B HE1  1 
ATOM   7253  H  HE3  . TRP B 1 164 ? 22.994  34.245 2.183   1.00 29.41  ? 164  TRP B HE3  1 
ATOM   7254  H  HZ2  . TRP B 1 164 ? 22.714  30.862 -1.090  1.00 23.85  ? 164  TRP B HZ2  1 
ATOM   7255  H  HZ3  . TRP B 1 164 ? 21.206  32.783 2.109   1.00 23.22  ? 164  TRP B HZ3  1 
ATOM   7256  H  HH2  . TRP B 1 164 ? 21.061  31.129 0.523   1.00 19.35  ? 164  TRP B HH2  1 
ATOM   7257  N  N    . VAL B 1 165 ? 26.461  32.530 2.828   1.00 14.39  ? 165  VAL B N    1 
ATOM   7258  C  CA   . VAL B 1 165 ? 25.706  31.557 3.650   1.00 20.30  ? 165  VAL B CA   1 
ATOM   7259  C  C    . VAL B 1 165 ? 26.188  31.578 5.092   1.00 21.55  ? 165  VAL B C    1 
ATOM   7260  O  O    . VAL B 1 165 ? 27.371  31.698 5.380   1.00 30.06  ? 165  VAL B O    1 
ATOM   7261  C  CB   . VAL B 1 165 ? 25.841  30.124 3.123   1.00 16.60  ? 165  VAL B CB   1 
ATOM   7262  C  CG1  . VAL B 1 165 ? 24.908  29.170 3.868   1.00 17.87  ? 165  VAL B CG1  1 
ATOM   7263  C  CG2  . VAL B 1 165 ? 25.557  30.043 1.627   1.00 28.12  ? 165  VAL B CG2  1 
ATOM   7264  H  H    . VAL B 1 165 ? 27.061  32.276 2.266   1.00 17.27  ? 165  VAL B H    1 
ATOM   7265  H  HA   . VAL B 1 165 ? 24.758  31.806 3.636   1.00 24.37  ? 165  VAL B HA   1 
ATOM   7266  H  HB   . VAL B 1 165 ? 26.763  29.829 3.275   1.00 19.91  ? 165  VAL B HB   1 
ATOM   7267  H  HG11 . VAL B 1 165 ? 25.115  29.187 4.805   1.00 26.80  ? 165  VAL B HG11 1 
ATOM   7268  H  HG12 . VAL B 1 165 ? 25.026  28.279 3.530   1.00 26.80  ? 165  VAL B HG12 1 
ATOM   7269  H  HG13 . VAL B 1 165 ? 23.998  29.444 3.735   1.00 26.80  ? 165  VAL B HG13 1 
ATOM   7270  H  HG21 . VAL B 1 165 ? 26.135  30.650 1.158   1.00 42.18  ? 165  VAL B HG21 1 
ATOM   7271  H  HG22 . VAL B 1 165 ? 24.642  30.279 1.461   1.00 42.18  ? 165  VAL B HG22 1 
ATOM   7272  H  HG23 . VAL B 1 165 ? 25.717  29.148 1.319   1.00 42.18  ? 165  VAL B HG23 1 
ATOM   7273  N  N    . THR B 1 166 ? 25.218  31.436 6.002   1.00 20.45  ? 166  THR B N    1 
ATOM   7274  C  CA   . THR B 1 166 ? 25.576  31.145 7.380   1.00 21.63  ? 166  THR B CA   1 
ATOM   7275  C  C    . THR B 1 166 ? 24.740  29.945 7.815   1.00 19.57  ? 166  THR B C    1 
ATOM   7276  O  O    . THR B 1 166 ? 23.526  30.100 7.659   1.00 24.27  ? 166  THR B O    1 
ATOM   7277  C  CB   . THR B 1 166 ? 25.306  32.322 8.326   1.00 20.52  ? 166  THR B CB   1 
ATOM   7278  O  OG1  . THR B 1 166 ? 26.043  33.478 7.931   1.00 36.02  ? 166  THR B OG1  1 
ATOM   7279  C  CG2  . THR B 1 166 ? 25.784  31.930 9.722   1.00 26.64  ? 166  THR B CG2  1 
ATOM   7280  H  H    . THR B 1 166 ? 24.392  31.515 5.774   1.00 24.53  ? 166  THR B H    1 
ATOM   7281  H  HA   . THR B 1 166 ? 26.526  30.908 7.423   1.00 25.95  ? 166  THR B HA   1 
ATOM   7282  H  HB   . THR B 1 166 ? 24.347  32.525 8.344   1.00 24.62  ? 166  THR B HB   1 
ATOM   7283  H  HG1  . THR B 1 166 ? 25.806  33.710 7.181   1.00 54.03  ? 166  THR B HG1  1 
ATOM   7284  H  HG21 . THR B 1 166 ? 25.626  32.656 10.330  1.00 39.96  ? 166  THR B HG21 1 
ATOM   7285  H  HG22 . THR B 1 166 ? 26.724  31.735 9.695   1.00 39.96  ? 166  THR B HG22 1 
ATOM   7286  H  HG23 . THR B 1 166 ? 25.304  31.154 10.018  1.00 39.96  ? 166  THR B HG23 1 
ATOM   7287  N  N    . PRO B 1 167 ? 25.340  28.866 8.290   1.00 22.80  ? 167  PRO B N    1 
ATOM   7288  C  CA   . PRO B 1 167 ? 24.535  27.693 8.689   1.00 17.09  ? 167  PRO B CA   1 
ATOM   7289  C  C    . PRO B 1 167 ? 23.541  28.121 9.766   1.00 17.84  ? 167  PRO B C    1 
ATOM   7290  O  O    . PRO B 1 167 ? 23.900  28.844 10.692  1.00 20.66  ? 167  PRO B O    1 
ATOM   7291  C  CB   . PRO B 1 167 ? 25.537  26.705 9.251   1.00 25.68  ? 167  PRO B CB   1 
ATOM   7292  C  CG   . PRO B 1 167 ? 26.884  27.226 8.937   1.00 32.82  ? 167  PRO B CG   1 
ATOM   7293  C  CD   . PRO B 1 167 ? 26.775  28.644 8.500   1.00 26.73  ? 167  PRO B CD   1 
ATOM   7294  H  HA   . PRO B 1 167 ? 24.068  27.312 7.916   1.00 20.50  ? 167  PRO B HA   1 
ATOM   7295  H  HB2  . PRO B 1 167 ? 25.425  26.621 10.210  1.00 30.82  ? 167  PRO B HB2  1 
ATOM   7296  H  HB3  . PRO B 1 167 ? 25.412  25.832 8.847   1.00 30.82  ? 167  PRO B HB3  1 
ATOM   7297  H  HG2  . PRO B 1 167 ? 27.451  27.166 9.722   1.00 39.38  ? 167  PRO B HG2  1 
ATOM   7298  H  HG3  . PRO B 1 167 ? 27.286  26.694 8.231   1.00 39.38  ? 167  PRO B HG3  1 
ATOM   7299  H  HD2  . PRO B 1 167 ? 27.119  29.241 9.182   1.00 32.08  ? 167  PRO B HD2  1 
ATOM   7300  H  HD3  . PRO B 1 167 ? 27.269  28.790 7.678   1.00 32.08  ? 167  PRO B HD3  1 
ATOM   7301  N  N    . CYS B 1 168 ? 22.309  27.649 9.599   1.00 15.69  ? 168  CYS B N    1 
ATOM   7302  C  CA   . CYS B 1 168 ? 21.207  28.123 10.413  1.00 18.61  ? 168  CYS B CA   1 
ATOM   7303  C  C    . CYS B 1 168 ? 20.395  27.020 11.073  1.00 19.86  ? 168  CYS B C    1 
ATOM   7304  O  O    . CYS B 1 168 ? 19.519  27.319 11.894  1.00 27.78  ? 168  CYS B O    1 
ATOM   7305  C  CB   . CYS B 1 168 ? 20.288  29.010 9.567   1.00 18.33  ? 168  CYS B CB   1 
ATOM   7306  S  SG   . CYS B 1 168 ? 19.718  28.209 8.073   1.00 25.43  ? 168  CYS B SG   1 
ATOM   7307  H  H    . CYS B 1 168 ? 22.164  27.052 8.997   1.00 18.83  ? 168  CYS B H    1 
ATOM   7308  H  HA   . CYS B 1 168 ? 21.584  28.681 11.125  1.00 22.33  ? 168  CYS B HA   1 
ATOM   7309  H  HB2  . CYS B 1 168 ? 19.519  29.266 10.101  1.00 22.00  ? 168  CYS B HB2  1 
ATOM   7310  H  HB3  . CYS B 1 168 ? 20.765  29.821 9.328   1.00 22.00  ? 168  CYS B HB3  1 
ATOM   7311  N  N    . ILE B 1 169 ? 20.633  25.746 10.800  1.00 17.91  ? 169  ILE B N    1 
ATOM   7312  C  CA   . ILE B 1 169 ? 19.950  24.708 11.563  1.00 18.88  ? 169  ILE B CA   1 
ATOM   7313  C  C    . ILE B 1 169 ? 20.918  23.745 12.204  1.00 14.18  ? 169  ILE B C    1 
ATOM   7314  O  O    . ILE B 1 169 ? 21.973  23.425 11.613  1.00 17.29  ? 169  ILE B O    1 
ATOM   7315  C  CB   . ILE B 1 169 ? 19.032  23.891 10.619  1.00 16.75  ? 169  ILE B CB   1 
ATOM   7316  C  CG1  . ILE B 1 169 ? 19.841  23.249 9.507   1.00 18.91  ? 169  ILE B CG1  1 
ATOM   7317  C  CG2  . ILE B 1 169 ? 17.919  24.781 10.109  1.00 50.54  ? 169  ILE B CG2  1 
ATOM   7318  C  CD1  . ILE B 1 169 ? 19.266  21.994 8.899   1.00 43.78  ? 169  ILE B CD1  1 
ATOM   7319  H  H    . ILE B 1 169 ? 21.186  25.533 10.177  1.00 21.49  ? 169  ILE B H    1 
ATOM   7320  H  HA   . ILE B 1 169 ? 19.403  25.127 12.261  1.00 22.66  ? 169  ILE B HA   1 
ATOM   7321  H  HB   . ILE B 1 169 ? 18.623  23.172 11.146  1.00 20.11  ? 169  ILE B HB   1 
ATOM   7322  H  HG12 . ILE B 1 169 ? 19.956  23.903 8.800   1.00 22.70  ? 169  ILE B HG12 1 
ATOM   7323  H  HG13 . ILE B 1 169 ? 20.722  23.041 9.855   1.00 22.70  ? 169  ILE B HG13 1 
ATOM   7324  H  HG21 . ILE B 1 169 ? 17.533  25.263 10.844  1.00 75.81  ? 169  ILE B HG21 1 
ATOM   7325  H  HG22 . ILE B 1 169 ? 17.244  24.241 9.691   1.00 75.81  ? 169  ILE B HG22 1 
ATOM   7326  H  HG23 . ILE B 1 169 ? 18.273  25.402 9.469   1.00 75.81  ? 169  ILE B HG23 1 
ATOM   7327  H  HD11 . ILE B 1 169 ? 19.928  21.575 8.344   1.00 65.66  ? 169  ILE B HD11 1 
ATOM   7328  H  HD12 . ILE B 1 169 ? 18.499  22.218 8.367   1.00 65.66  ? 169  ILE B HD12 1 
ATOM   7329  H  HD13 . ILE B 1 169 ? 19.006  21.390 9.598   1.00 65.66  ? 169  ILE B HD13 1 
ATOM   7330  N  N    . SER B 1 170 ? 20.659  23.293 13.412  1.00 12.66  ? 170  SER B N    1 
ATOM   7331  C  CA   . SER B 1 170 ? 21.307  22.218 14.096  1.00 21.01  ? 170  SER B CA   1 
ATOM   7332  C  C    . SER B 1 170 ? 20.824  20.829 13.669  1.00 13.52  ? 170  SER B C    1 
ATOM   7333  O  O    . SER B 1 170 ? 19.687  20.721 13.194  1.00 14.74  ? 170  SER B O    1 
ATOM   7334  C  CB   . SER B 1 170 ? 20.943  22.346 15.603  1.00 22.83  ? 170  SER B CB   1 
ATOM   7335  O  OG   . SER B 1 170 ? 19.583  21.940 15.706  1.00 58.49  ? 170  SER B OG   1 
ATOM   7336  H  H    . SER B 1 170 ? 20.028  23.691 13.839  1.00 15.19  ? 170  SER B H    1 
ATOM   7337  H  HA   . SER B 1 170 ? 22.278  22.285 13.980  1.00 25.21  ? 170  SER B HA   1 
ATOM   7338  H  HB2  . SER B 1 170 ? 21.512  21.774 16.141  1.00 27.40  ? 170  SER B HB2  1 
ATOM   7339  H  HB3  . SER B 1 170 ? 21.050  23.262 15.903  1.00 27.40  ? 170  SER B HB3  1 
ATOM   7340  H  HG   . SER B 1 170 ? 19.507  21.167 15.442  1.00 87.74  ? 170  SER B HG   1 
ATOM   7341  N  N    . ALA B 1 171 ? 21.698  19.888 13.856  1.00 13.29  ? 171  ALA B N    1 
ATOM   7342  C  CA   . ALA B 1 171 ? 21.416  18.487 13.540  1.00 14.42  ? 171  ALA B CA   1 
ATOM   7343  C  C    . ALA B 1 171 ? 20.106  18.077 14.199  1.00 15.50  ? 171  ALA B C    1 
ATOM   7344  O  O    . ALA B 1 171 ? 19.341  17.303 13.620  1.00 12.61  ? 171  ALA B O    1 
ATOM   7345  C  CB   . ALA B 1 171 ? 22.558  17.594 13.961  1.00 19.85  ? 171  ALA B CB   1 
ATOM   7346  H  H    . ALA B 1 171 ? 22.468  20.094 14.177  1.00 15.95  ? 171  ALA B H    1 
ATOM   7347  H  HA   . ALA B 1 171 ? 21.308  18.408 12.569  1.00 17.30  ? 171  ALA B HA   1 
ATOM   7348  H  HB1  . ALA B 1 171 ? 23.367  17.886 13.535  1.00 29.78  ? 171  ALA B HB1  1 
ATOM   7349  H  HB2  . ALA B 1 171 ? 22.369  16.689 13.702  1.00 29.78  ? 171  ALA B HB2  1 
ATOM   7350  H  HB3  . ALA B 1 171 ? 22.664  17.638 14.914  1.00 29.78  ? 171  ALA B HB3  1 
ATOM   7351  N  N    . LYS B 1 172 ? 19.826  18.545 15.406  1.00 15.74  ? 172  LYS B N    1 
ATOM   7352  C  CA   . LYS B 1 172 ? 18.618  18.112 16.093  1.00 14.82  ? 172  LYS B CA   1 
ATOM   7353  C  C    . LYS B 1 172 ? 17.337  18.718 15.569  1.00 12.52  ? 172  LYS B C    1 
ATOM   7354  O  O    . LYS B 1 172 ? 16.266  18.341 16.057  1.00 15.57  ? 172  LYS B O    1 
ATOM   7355  C  CB   . LYS B 1 172 ? 18.721  18.434 17.606  1.00 18.43  ? 172  LYS B CB   1 
ATOM   7356  C  CG   . LYS B 1 172 ? 18.504  19.885 17.863  1.00 18.93  ? 172  LYS B CG   1 
ATOM   7357  C  CD   . LYS B 1 172 ? 18.363  20.249 19.337  1.00 26.84  ? 172  LYS B CD   1 
ATOM   7358  C  CE   . LYS B 1 172 ? 17.768  21.648 19.440  1.00 36.46  ? 172  LYS B CE   1 
ATOM   7359  N  NZ   . LYS B 1 172 ? 18.736  22.721 19.099  1.00 48.90  ? 172  LYS B NZ   1 
ATOM   7360  H  H    . LYS B 1 172 ? 20.359  19.105 15.785  1.00 18.89  ? 172  LYS B H    1 
ATOM   7361  H  HA   . LYS B 1 172 ? 18.551  17.139 15.997  1.00 17.78  ? 172  LYS B HA   1 
ATOM   7362  H  HB2  . LYS B 1 172 ? 18.059  17.917 18.091  1.00 22.11  ? 172  LYS B HB2  1 
ATOM   7363  H  HB3  . LYS B 1 172 ? 19.598  18.177 17.931  1.00 22.11  ? 172  LYS B HB3  1 
ATOM   7364  H  HG2  . LYS B 1 172 ? 19.249  20.381 17.490  1.00 22.72  ? 172  LYS B HG2  1 
ATOM   7365  H  HG3  . LYS B 1 172 ? 17.701  20.166 17.396  1.00 22.72  ? 172  LYS B HG3  1 
ATOM   7366  H  HD2  . LYS B 1 172 ? 17.786  19.610 19.782  1.00 32.21  ? 172  LYS B HD2  1 
ATOM   7367  H  HD3  . LYS B 1 172 ? 19.232  20.227 19.767  1.00 32.21  ? 172  LYS B HD3  1 
ATOM   7368  H  HE2  . LYS B 1 172 ? 17.005  21.711 18.844  1.00 43.75  ? 172  LYS B HE2  1 
ATOM   7369  H  HE3  . LYS B 1 172 ? 17.448  21.789 20.345  1.00 43.75  ? 172  LYS B HE3  1 
ATOM   7370  H  HZ1  . LYS B 1 172 ? 18.338  23.514 19.171  1.00 73.35  ? 172  LYS B HZ1  1 
ATOM   7371  H  HZ2  . LYS B 1 172 ? 19.021  22.608 18.264  1.00 73.35  ? 172  LYS B HZ2  1 
ATOM   7372  H  HZ3  . LYS B 1 172 ? 19.428  22.684 19.657  1.00 73.35  ? 172  LYS B HZ3  1 
ATOM   7373  N  N    . ASP B 1 173 ? 17.351  19.637 14.606  1.00 12.50  ? 173  ASP B N    1 
ATOM   7374  C  CA   . ASP B 1 173 ? 16.183  20.378 14.209  1.00 13.17  ? 173  ASP B CA   1 
ATOM   7375  C  C    . ASP B 1 173 ? 15.683  20.029 12.806  1.00 11.67  ? 173  ASP B C    1 
ATOM   7376  O  O    . ASP B 1 173 ? 14.953  20.819 12.249  1.00 13.89  ? 173  ASP B O    1 
ATOM   7377  C  CB   . ASP B 1 173 ? 16.533  21.870 14.350  1.00 19.02  ? 173  ASP B CB   1 
ATOM   7378  C  CG   . ASP B 1 173 ? 16.587  22.316 15.814  1.00 19.58  ? 173  ASP B CG   1 
ATOM   7379  O  OD1  . ASP B 1 173 ? 15.661  22.017 16.590  1.00 23.91  ? 173  ASP B OD1  1 
ATOM   7380  O  OD2  . ASP B 1 173 ? 17.585  22.974 16.166  1.00 27.99  ? 173  ASP B OD2  1 
ATOM   7381  H  H    . ASP B 1 173 ? 18.094  19.795 14.202  1.00 15.00  ? 173  ASP B H    1 
ATOM   7382  H  HA   . ASP B 1 173 ? 15.465  20.175 14.845  1.00 15.80  ? 173  ASP B HA   1 
ATOM   7383  H  HB2  . ASP B 1 173 ? 17.393  22.036 13.934  1.00 22.82  ? 173  ASP B HB2  1 
ATOM   7384  H  HB3  . ASP B 1 173 ? 15.868  22.398 13.880  1.00 22.82  ? 173  ASP B HB3  1 
ATOM   7385  N  N    . ILE B 1 174 ? 16.073  18.894 12.298  1.00 12.39  ? 174  ILE B N    1 
ATOM   7386  C  CA   . ILE B 1 174 ? 15.622  18.353 11.006  1.00 10.55  ? 174  ILE B CA   1 
ATOM   7387  C  C    . ILE B 1 174 ? 15.220  16.908 11.202  1.00 11.42  ? 174  ILE B C    1 
ATOM   7388  O  O    . ILE B 1 174 ? 15.848  16.141 11.932  1.00 12.24  ? 174  ILE B O    1 
ATOM   7389  C  CB   . ILE B 1 174 ? 16.706  18.548 9.930   1.00 16.81  ? 174  ILE B CB   1 
ATOM   7390  C  CG1  . ILE B 1 174 ? 16.339  17.934 8.563   1.00 15.35  ? 174  ILE B CG1  1 
ATOM   7391  C  CG2  . ILE B 1 174 ? 18.087  18.055 10.325  1.00 18.11  ? 174  ILE B CG2  1 
ATOM   7392  C  CD1  . ILE B 1 174 ? 17.051  18.507 7.353   1.00 17.04  ? 174  ILE B CD1  1 
ATOM   7393  H  H    . ILE B 1 174 ? 16.636  18.427 12.751  1.00 14.87  ? 174  ILE B H    1 
ATOM   7394  H  HA   . ILE B 1 174 ? 14.827  18.854 10.729  1.00 12.66  ? 174  ILE B HA   1 
ATOM   7395  H  HB   . ILE B 1 174 ? 16.786  19.514 9.788   1.00 20.17  ? 174  ILE B HB   1 
ATOM   7396  H  HG12 . ILE B 1 174 ? 16.523  16.982 8.599   1.00 18.42  ? 174  ILE B HG12 1 
ATOM   7397  H  HG13 . ILE B 1 174 ? 15.384  18.039 8.430   1.00 18.42  ? 174  ILE B HG13 1 
ATOM   7398  H  HG21 . ILE B 1 174 ? 18.700  18.208 9.602   1.00 27.17  ? 174  ILE B HG21 1 
ATOM   7399  H  HG22 . ILE B 1 174 ? 18.049  17.115 10.518  1.00 27.17  ? 174  ILE B HG22 1 
ATOM   7400  H  HG23 . ILE B 1 174 ? 18.386  18.530 11.104  1.00 27.17  ? 174  ILE B HG23 1 
ATOM   7401  H  HD11 . ILE B 1 174 ? 16.750  18.055 6.561   1.00 25.56  ? 174  ILE B HD11 1 
ATOM   7402  H  HD12 . ILE B 1 174 ? 17.998  18.385 7.452   1.00 25.56  ? 174  ILE B HD12 1 
ATOM   7403  H  HD13 . ILE B 1 174 ? 16.855  19.444 7.281   1.00 25.56  ? 174  ILE B HD13 1 
ATOM   7404  N  N    . VAL B 1 175 ? 14.135  16.584 10.459  1.00 9.59   ? 175  VAL B N    1 
ATOM   7405  C  CA   . VAL B 1 175 ? 13.672  15.216 10.320  1.00 9.26   ? 175  VAL B CA   1 
ATOM   7406  C  C    . VAL B 1 175 ? 13.474  14.839 8.832   1.00 7.22   ? 175  VAL B C    1 
ATOM   7407  O  O    . VAL B 1 175 ? 12.779  15.568 8.196   1.00 9.55   ? 175  VAL B O    1 
ATOM   7408  C  CB   . VAL B 1 175 ? 12.328  15.001 11.017  1.00 8.99   ? 175  VAL B CB   1 
ATOM   7409  C  CG1  . VAL B 1 175 ? 11.789  13.581 10.885  1.00 10.74  ? 175  VAL B CG1  1 
ATOM   7410  C  CG2  . VAL B 1 175 ? 12.376  15.302 12.529  1.00 10.93  ? 175  VAL B CG2  1 
ATOM   7411  H  H    . VAL B 1 175 ? 13.706  17.211 10.056  1.00 11.51  ? 175  VAL B H    1 
ATOM   7412  H  HA   . VAL B 1 175 ? 14.337  14.614 10.716  1.00 11.11  ? 175  VAL B HA   1 
ATOM   7413  H  HB   . VAL B 1 175 ? 11.676  15.609 10.610  1.00 10.79  ? 175  VAL B HB   1 
ATOM   7414  H  HG11 . VAL B 1 175 ? 10.950  13.512 11.347  1.00 16.10  ? 175  VAL B HG11 1 
ATOM   7415  H  HG12 . VAL B 1 175 ? 12.417  12.963 11.268  1.00 16.10  ? 175  VAL B HG12 1 
ATOM   7416  H  HG13 . VAL B 1 175 ? 11.662  13.372 9.957   1.00 16.10  ? 175  VAL B HG13 1 
ATOM   7417  H  HG21 . VAL B 1 175 ? 12.707  16.192 12.668  1.00 16.40  ? 175  VAL B HG21 1 
ATOM   7418  H  HG22 . VAL B 1 175 ? 12.957  14.673 12.963  1.00 16.40  ? 175  VAL B HG22 1 
ATOM   7419  H  HG23 . VAL B 1 175 ? 11.493  15.228 12.898  1.00 16.40  ? 175  VAL B HG23 1 
ATOM   7420  N  N    . TYR B 1 176 ? 14.062  13.733 8.464   1.00 9.13   ? 176  TYR B N    1 
ATOM   7421  C  CA   . TYR B 1 176 ? 13.881  13.165 7.126   1.00 8.68   ? 176  TYR B CA   1 
ATOM   7422  C  C    . TYR B 1 176 ? 12.758  12.154 7.117   1.00 9.33   ? 176  TYR B C    1 
ATOM   7423  O  O    . TYR B 1 176 ? 12.676  11.314 8.030   1.00 10.47  ? 176  TYR B O    1 
ATOM   7424  C  CB   . TYR B 1 176 ? 15.135  12.461 6.728   1.00 9.54   ? 176  TYR B CB   1 
ATOM   7425  C  CG   . TYR B 1 176 ? 16.314  13.290 6.321   1.00 11.92  ? 176  TYR B CG   1 
ATOM   7426  C  CD1  . TYR B 1 176 ? 16.304  14.013 5.121   1.00 8.40   ? 176  TYR B CD1  1 
ATOM   7427  C  CD2  . TYR B 1 176 ? 17.438  13.351 7.141   1.00 12.34  ? 176  TYR B CD2  1 
ATOM   7428  C  CE1  . TYR B 1 176 ? 17.400  14.773 4.756   1.00 10.19  ? 176  TYR B CE1  1 
ATOM   7429  C  CE2  . TYR B 1 176 ? 18.521  14.089 6.771   1.00 9.01   ? 176  TYR B CE2  1 
ATOM   7430  C  CZ   . TYR B 1 176 ? 18.498  14.810 5.583   1.00 11.48  ? 176  TYR B CZ   1 
ATOM   7431  O  OH   . TYR B 1 176 ? 19.620  15.538 5.239   1.00 14.06  ? 176  TYR B OH   1 
ATOM   7432  H  H    . TYR B 1 176 ? 14.571  13.325 9.024   1.00 10.95  ? 176  TYR B H    1 
ATOM   7433  H  HA   . TYR B 1 176 ? 13.687  13.881 6.486   1.00 10.41  ? 176  TYR B HA   1 
ATOM   7434  H  HB2  . TYR B 1 176 ? 15.410  11.902 7.472   1.00 11.44  ? 176  TYR B HB2  1 
ATOM   7435  H  HB3  . TYR B 1 176 ? 14.921  11.869 5.991   1.00 11.44  ? 176  TYR B HB3  1 
ATOM   7436  H  HD1  . TYR B 1 176 ? 15.558  13.982 4.568   1.00 10.08  ? 176  TYR B HD1  1 
ATOM   7437  H  HD2  . TYR B 1 176 ? 17.448  12.885 7.946   1.00 14.80  ? 176  TYR B HD2  1 
ATOM   7438  H  HE1  . TYR B 1 176 ? 17.394  15.254 3.960   1.00 12.23  ? 176  TYR B HE1  1 
ATOM   7439  H  HE2  . TYR B 1 176 ? 19.276  14.111 7.313   1.00 10.81  ? 176  TYR B HE2  1 
ATOM   7440  H  HH   . TYR B 1 176 ? 19.498  15.902 4.514   1.00 21.09  ? 176  TYR B HH   1 
ATOM   7441  N  N    . ILE B 1 177 ? 11.962  12.176 6.081   1.00 7.18   ? 177  ILE B N    1 
ATOM   7442  C  CA   . ILE B 1 177 ? 10.994  11.127 5.792   1.00 8.54   ? 177  ILE B CA   1 
ATOM   7443  C  C    . ILE B 1 177 ? 11.075  10.673 4.315   1.00 8.61   ? 177  ILE B C    1 
ATOM   7444  O  O    . ILE B 1 177 ? 10.978  11.563 3.444   1.00 9.90   ? 177  ILE B O    1 
ATOM   7445  C  CB   . ILE B 1 177 ? 9.545   11.557 6.116   1.00 9.27   ? 177  ILE B CB   1 
ATOM   7446  C  CG1  . ILE B 1 177 ? 9.404   12.110 7.541   1.00 8.80   ? 177  ILE B CG1  1 
ATOM   7447  C  CG2  . ILE B 1 177 ? 8.585   10.416 5.864   1.00 10.80  ? 177  ILE B CG2  1 
ATOM   7448  C  CD1  . ILE B 1 177 ? 8.077   12.780 7.835   1.00 12.92  ? 177  ILE B CD1  1 
ATOM   7449  H  H    . ILE B 1 177 ? 12.012  12.845 5.543   1.00 8.62   ? 177  ILE B H    1 
ATOM   7450  H  HA   . ILE B 1 177 ? 11.211  10.355 6.355   1.00 10.25  ? 177  ILE B HA   1 
ATOM   7451  H  HB   . ILE B 1 177 ? 9.309   12.280 5.498   1.00 11.13  ? 177  ILE B HB   1 
ATOM   7452  H  HG12 . ILE B 1 177 ? 9.528   11.381 8.169   1.00 10.56  ? 177  ILE B HG12 1 
ATOM   7453  H  HG13 . ILE B 1 177 ? 10.115  12.752 7.695   1.00 10.56  ? 177  ILE B HG13 1 
ATOM   7454  H  HG21 . ILE B 1 177 ? 8.688   10.105 4.962   1.00 16.20  ? 177  ILE B HG21 1 
ATOM   7455  H  HG22 . ILE B 1 177 ? 7.684   10.720 5.997   1.00 16.20  ? 177  ILE B HG22 1 
ATOM   7456  H  HG23 . ILE B 1 177 ? 8.773   9.698  6.473   1.00 16.20  ? 177  ILE B HG23 1 
ATOM   7457  H  HD11 . ILE B 1 177 ? 8.068   13.088 8.744   1.00 19.39  ? 177  ILE B HD11 1 
ATOM   7458  H  HD12 . ILE B 1 177 ? 7.364   12.149 7.704   1.00 19.39  ? 177  ILE B HD12 1 
ATOM   7459  H  HD13 . ILE B 1 177 ? 7.957   13.526 7.243   1.00 19.39  ? 177  ILE B HD13 1 
ATOM   7460  N  N    . GLY B 1 178 ? 11.203  9.371  4.143   1.00 8.44   ? 178  GLY B N    1 
ATOM   7461  C  CA   . GLY B 1 178 ? 11.149  8.889  2.758   1.00 8.14   ? 178  GLY B CA   1 
ATOM   7462  C  C    . GLY B 1 178 ? 12.401  8.270  2.263   1.00 10.21  ? 178  GLY B C    1 
ATOM   7463  O  O    . GLY B 1 178 ? 12.394  7.664  1.183   1.00 9.65   ? 178  GLY B O    1 
ATOM   7464  H  H    . GLY B 1 178 ? 11.312  8.834  4.806   1.00 10.12  ? 178  GLY B H    1 
ATOM   7465  H  HA2  . GLY B 1 178 ? 10.433  8.238  2.686   1.00 9.77   ? 178  GLY B HA2  1 
ATOM   7466  H  HA3  . GLY B 1 178 ? 10.924  9.635  2.181   1.00 9.77   ? 178  GLY B HA3  1 
ATOM   7467  N  N    . LEU B 1 179 ? 13.520  8.309  2.971   1.00 8.16   ? 179  LEU B N    1 
ATOM   7468  C  CA   . LEU B 1 179 ? 14.815  7.937  2.474   1.00 10.75  ? 179  LEU B CA   1 
ATOM   7469  C  C    . LEU B 1 179 ? 14.869  6.486  2.004   1.00 11.85  ? 179  LEU B C    1 
ATOM   7470  O  O    . LEU B 1 179 ? 14.424  5.545  2.643   1.00 9.86   ? 179  LEU B O    1 
ATOM   7471  C  CB   . LEU B 1 179 ? 15.886  8.109  3.565   1.00 9.02   ? 179  LEU B CB   1 
ATOM   7472  C  CG   . LEU B 1 179 ? 15.940  9.487  4.235   1.00 9.91   ? 179  LEU B CG   1 
ATOM   7473  C  CD1  . LEU B 1 179 ? 17.026  9.531  5.303   1.00 13.10  ? 179  LEU B CD1  1 
ATOM   7474  C  CD2  . LEU B 1 179 ? 16.140  10.551 3.165   1.00 11.34  ? 179  LEU B CD2  1 
ATOM   7475  H  H    . LEU B 1 179 ? 13.467  8.576  3.787   1.00 9.80   ? 179  LEU B H    1 
ATOM   7476  H  HA   . LEU B 1 179 ? 15.040  8.519  1.719   1.00 12.90  ? 179  LEU B HA   1 
ATOM   7477  H  HB2  . LEU B 1 179 ? 15.732  7.442  4.252   1.00 10.82  ? 179  LEU B HB2  1 
ATOM   7478  H  HB3  . LEU B 1 179 ? 16.754  7.926  3.172   1.00 10.82  ? 179  LEU B HB3  1 
ATOM   7479  H  HG   . LEU B 1 179 ? 15.077  9.649  4.670   1.00 11.90  ? 179  LEU B HG   1 
ATOM   7480  H  HD11 . LEU B 1 179 ? 16.864  8.844  5.953   1.00 19.65  ? 179  LEU B HD11 1 
ATOM   7481  H  HD12 . LEU B 1 179 ? 17.016  10.389 5.734   1.00 19.65  ? 179  LEU B HD12 1 
ATOM   7482  H  HD13 . LEU B 1 179 ? 17.883  9.389  4.894   1.00 19.65  ? 179  LEU B HD13 1 
ATOM   7483  H  HD21 . LEU B 1 179 ? 15.433  10.492 2.519   1.00 17.02  ? 179  LEU B HD21 1 
ATOM   7484  H  HD22 . LEU B 1 179 ? 16.984  10.411 2.729   1.00 17.02  ? 179  LEU B HD22 1 
ATOM   7485  H  HD23 . LEU B 1 179 ? 16.130  11.420 3.573   1.00 17.02  ? 179  LEU B HD23 1 
ATOM   7486  N  N    . ARG B 1 180 ? 15.482  6.309  0.828   1.00 11.17  ? 180  ARG B N    1 
ATOM   7487  C  CA   . ARG B 1 180 ? 15.804  4.982  0.275   1.00 10.86  ? 180  ARG B CA   1 
ATOM   7488  C  C    . ARG B 1 180 ? 16.968  4.983  -0.726  1.00 11.54  ? 180  ARG B C    1 
ATOM   7489  O  O    . ARG B 1 180 ? 17.150  3.911  -1.321  1.00 14.53  ? 180  ARG B O    1 
ATOM   7490  C  CB   . ARG B 1 180 ? 14.542  4.404  -0.383  1.00 9.13   ? 180  ARG B CB   1 
ATOM   7491  C  CG   . ARG B 1 180 ? 13.885  5.268  -1.411  1.00 7.42   ? 180  ARG B CG   1 
ATOM   7492  C  CD   . ARG B 1 180 ? 12.514  4.815  -1.794  1.00 12.34  ? 180  ARG B CD   1 
ATOM   7493  N  NE   . ARG B 1 180 ? 11.882  5.554  -2.851  1.00 10.36  ? 180  ARG B NE   1 
ATOM   7494  C  CZ   . ARG B 1 180 ? 11.281  6.711  -2.859  1.00 11.38  ? 180  ARG B CZ   1 
ATOM   7495  N  NH1  . ARG B 1 180 ? 10.706  7.247  -3.948  1.00 8.36   ? 180  ARG B NH1  1 
ATOM   7496  N  NH2  . ARG B 1 180 ? 11.200  7.410  -1.721  1.00 11.51  ? 180  ARG B NH2  1 
ATOM   7497  H  H    . ARG B 1 180 ? 15.700  7.004  0.372   1.00 13.41  ? 180  ARG B H    1 
ATOM   7498  H  HA   . ARG B 1 180 ? 16.050  4.396  1.021   1.00 13.03  ? 180  ARG B HA   1 
ATOM   7499  H  HB2  . ARG B 1 180 ? 14.775  3.559  -0.798  1.00 10.95  ? 180  ARG B HB2  1 
ATOM   7500  H  HB3  . ARG B 1 180 ? 13.895  4.215  0.315   1.00 10.95  ? 180  ARG B HB3  1 
ATOM   7501  H  HG2  . ARG B 1 180 ? 13.831  6.174  -1.069  1.00 8.90   ? 180  ARG B HG2  1 
ATOM   7502  H  HG3  . ARG B 1 180 ? 14.441  5.286  -2.206  1.00 8.90   ? 180  ARG B HG3  1 
ATOM   7503  H  HD2  . ARG B 1 180 ? 12.564  3.884  -2.061  1.00 14.81  ? 180  ARG B HD2  1 
ATOM   7504  H  HD3  . ARG B 1 180 ? 11.947  4.862  -1.009  1.00 14.81  ? 180  ARG B HD3  1 
ATOM   7505  H  HE   . ARG B 1 180 ? 11.904  5.162  -3.616  1.00 12.43  ? 180  ARG B HE   1 
ATOM   7506  H  HH11 . ARG B 1 180 ? 10.720  6.822  -4.695  1.00 10.03  ? 180  ARG B HH11 1 
ATOM   7507  H  HH12 . ARG B 1 180 ? 10.322  8.015  -3.897  1.00 10.03  ? 180  ARG B HH12 1 
ATOM   7508  H  HH21 . ARG B 1 180 ? 11.542  7.095  -0.997  1.00 13.82  ? 180  ARG B HH21 1 
ATOM   7509  H  HH22 . ARG B 1 180 ? 10.807  8.175  -1.713  1.00 13.82  ? 180  ARG B HH22 1 
ATOM   7510  N  N    . ASP B 1 181 ? 17.728  6.037  -0.939  1.00 12.60  ? 181  ASP B N    1 
ATOM   7511  C  CA   . ASP B 1 181 ? 18.869  6.085  -1.812  1.00 13.86  ? 181  ASP B CA   1 
ATOM   7512  C  C    . ASP B 1 181 ? 19.916  7.055  -1.272  1.00 10.35  ? 181  ASP B C    1 
ATOM   7513  O  O    . ASP B 1 181 ? 20.108  8.165  -1.743  1.00 11.92  ? 181  ASP B O    1 
ATOM   7514  C  CB   . ASP B 1 181 ? 18.435  6.518  -3.214  1.00 13.51  ? 181  ASP B CB   1 
ATOM   7515  C  CG   . ASP B 1 181 ? 19.491  6.198  -4.266  1.00 25.32  ? 181  ASP B CG   1 
ATOM   7516  O  OD1  . ASP B 1 181 ? 20.488  5.519  -3.962  1.00 21.62  ? 181  ASP B OD1  1 
ATOM   7517  O  OD2  . ASP B 1 181 ? 19.305  6.668  -5.413  1.00 57.20  ? 181  ASP B OD2  1 
ATOM   7518  H  H    . ASP B 1 181 ? 17.525  6.759  -0.518  1.00 15.12  ? 181  ASP B H    1 
ATOM   7519  H  HA   . ASP B 1 181 ? 19.264  5.190  -1.866  1.00 16.63  ? 181  ASP B HA   1 
ATOM   7520  H  HB2  . ASP B 1 181 ? 17.608  6.066  -3.445  1.00 16.22  ? 181  ASP B HB2  1 
ATOM   7521  H  HB3  . ASP B 1 181 ? 18.263  7.472  -3.215  1.00 16.22  ? 181  ASP B HB3  1 
ATOM   7522  N  N    . VAL B 1 182 ? 20.588  6.572  -0.227  1.00 10.70  ? 182  VAL B N    1 
ATOM   7523  C  CA   . VAL B 1 182 ? 21.516  7.349  0.607   1.00 10.53  ? 182  VAL B CA   1 
ATOM   7524  C  C    . VAL B 1 182 ? 22.942  6.925  0.289   1.00 13.17  ? 182  VAL B C    1 
ATOM   7525  O  O    . VAL B 1 182 ? 23.239  5.754  0.442   1.00 13.23  ? 182  VAL B O    1 
ATOM   7526  C  CB   . VAL B 1 182 ? 21.120  7.165  2.085   1.00 12.02  ? 182  VAL B CB   1 
ATOM   7527  C  CG1  . VAL B 1 182 ? 22.067  7.956  2.985   1.00 10.47  ? 182  VAL B CG1  1 
ATOM   7528  C  CG2  . VAL B 1 182 ? 19.650  7.543  2.308   1.00 12.44  ? 182  VAL B CG2  1 
ATOM   7529  H  H    . VAL B 1 182 ? 20.469  5.745  -0.025  1.00 12.85  ? 182  VAL B H    1 
ATOM   7530  H  HA   . VAL B 1 182 ? 21.418  8.297  0.377   1.00 12.64  ? 182  VAL B HA   1 
ATOM   7531  H  HB   . VAL B 1 182 ? 21.221  6.215  2.306   1.00 14.43  ? 182  VAL B HB   1 
ATOM   7532  H  HG11 . VAL B 1 182 ? 22.972  7.688  2.812   1.00 15.70  ? 182  VAL B HG11 1 
ATOM   7533  H  HG12 . VAL B 1 182 ? 21.853  7.784  3.905   1.00 15.70  ? 182  VAL B HG12 1 
ATOM   7534  H  HG13 . VAL B 1 182 ? 21.971  8.894  2.805   1.00 15.70  ? 182  VAL B HG13 1 
ATOM   7535  H  HG21 . VAL B 1 182 ? 19.093  7.019  1.727   1.00 18.66  ? 182  VAL B HG21 1 
ATOM   7536  H  HG22 . VAL B 1 182 ? 19.527  8.475  2.115   1.00 18.66  ? 182  VAL B HG22 1 
ATOM   7537  H  HG23 . VAL B 1 182 ? 19.411  7.370  3.222   1.00 18.66  ? 182  VAL B HG23 1 
ATOM   7538  N  N    . ASP B 1 183 ? 23.785  7.858  -0.146  1.00 10.86  ? 183  ASP B N    1 
ATOM   7539  C  CA   . ASP B 1 183 ? 25.203  7.550  -0.407  1.00 9.85   ? 183  ASP B CA   1 
ATOM   7540  C  C    . ASP B 1 183 ? 25.968  7.141  0.853   1.00 13.77  ? 183  ASP B C    1 
ATOM   7541  O  O    . ASP B 1 183 ? 25.596  7.561  1.969   1.00 12.03  ? 183  ASP B O    1 
ATOM   7542  C  CB   . ASP B 1 183 ? 25.912  8.732  -1.058  1.00 15.07  ? 183  ASP B CB   1 
ATOM   7543  C  CG   . ASP B 1 183 ? 25.371  9.178  -2.417  1.00 12.50  ? 183  ASP B CG   1 
ATOM   7544  O  OD1  . ASP B 1 183 ? 24.680  8.376  -3.051  1.00 20.63  ? 183  ASP B OD1  1 
ATOM   7545  O  OD2  . ASP B 1 183 ? 25.628  10.332 -2.797  1.00 15.68  ? 183  ASP B OD2  1 
ATOM   7546  H  H    . ASP B 1 183 ? 23.496  8.657  -0.279  1.00 13.03  ? 183  ASP B H    1 
ATOM   7547  H  HA   . ASP B 1 183 ? 25.235  6.799  -1.035  1.00 11.82  ? 183  ASP B HA   1 
ATOM   7548  H  HB2  . ASP B 1 183 ? 25.866  9.487  -0.450  1.00 18.09  ? 183  ASP B HB2  1 
ATOM   7549  H  HB3  . ASP B 1 183 ? 26.848  8.503  -1.164  1.00 18.09  ? 183  ASP B HB3  1 
ATOM   7550  N  N    . PRO B 1 184 ? 27.005  6.329  0.785   1.00 16.36  ? 184  PRO B N    1 
ATOM   7551  C  CA   . PRO B 1 184 ? 27.748  5.999  2.025   1.00 13.41  ? 184  PRO B CA   1 
ATOM   7552  C  C    . PRO B 1 184 ? 28.260  7.177  2.823   1.00 18.62  ? 184  PRO B C    1 
ATOM   7553  O  O    . PRO B 1 184 ? 28.120  7.125  4.082   1.00 14.66  ? 184  PRO B O    1 
ATOM   7554  C  CB   . PRO B 1 184 ? 28.937  5.168  1.510   1.00 18.04  ? 184  PRO B CB   1 
ATOM   7555  C  CG   . PRO B 1 184 ? 28.491  4.628  0.192   1.00 14.27  ? 184  PRO B CG   1 
ATOM   7556  C  CD   . PRO B 1 184 ? 27.504  5.589  -0.373  1.00 15.63  ? 184  PRO B CD   1 
ATOM   7557  H  HA   . PRO B 1 184 ? 27.186  5.438  2.599   1.00 16.09  ? 184  PRO B HA   1 
ATOM   7558  H  HB2  . PRO B 1 184 ? 29.725  5.724  1.404   1.00 21.64  ? 184  PRO B HB2  1 
ATOM   7559  H  HB3  . PRO B 1 184 ? 29.143  4.446  2.124   1.00 21.64  ? 184  PRO B HB3  1 
ATOM   7560  H  HG2  . PRO B 1 184 ? 29.248  4.535  -0.406  1.00 17.13  ? 184  PRO B HG2  1 
ATOM   7561  H  HG3  . PRO B 1 184 ? 28.081  3.756  0.308   1.00 17.13  ? 184  PRO B HG3  1 
ATOM   7562  H  HD2  . PRO B 1 184 ? 27.929  6.187  -1.008  1.00 18.76  ? 184  PRO B HD2  1 
ATOM   7563  H  HD3  . PRO B 1 184 ? 26.782  5.119  -0.820  1.00 18.76  ? 184  PRO B HD3  1 
ATOM   7564  N  N    . GLY B 1 185 ? 28.865  8.218  2.269   1.00 13.01  ? 185  GLY B N    1 
ATOM   7565  C  CA   . GLY B 1 185 ? 29.302  9.359  3.058   1.00 14.61  ? 185  GLY B CA   1 
ATOM   7566  C  C    . GLY B 1 185 ? 28.116  10.036 3.713   1.00 13.42  ? 185  GLY B C    1 
ATOM   7567  O  O    . GLY B 1 185 ? 28.188  10.601 4.812   1.00 13.84  ? 185  GLY B O    1 
ATOM   7568  H  H    . GLY B 1 185 ? 29.003  8.219  1.420   1.00 15.61  ? 185  GLY B H    1 
ATOM   7569  H  HA2  . GLY B 1 185 ? 29.925  9.063  3.741   1.00 17.54  ? 185  GLY B HA2  1 
ATOM   7570  H  HA3  . GLY B 1 185 ? 29.762  9.993  2.486   1.00 17.54  ? 185  GLY B HA3  1 
ATOM   7571  N  N    . GLU B 1 186 ? 26.962  9.970  3.045   1.00 13.50  ? 186  GLU B N    1 
ATOM   7572  C  CA   . GLU B 1 186 ? 25.771  10.560 3.601   1.00 11.31  ? 186  GLU B CA   1 
ATOM   7573  C  C    . GLU B 1 186 ? 25.290  9.788  4.834   1.00 11.19  ? 186  GLU B C    1 
ATOM   7574  O  O    . GLU B 1 186 ? 24.877  10.401 5.815   1.00 12.23  ? 186  GLU B O    1 
ATOM   7575  C  CB   . GLU B 1 186 ? 24.652  10.598 2.525   1.00 12.10  ? 186  GLU B CB   1 
ATOM   7576  C  CG   . GLU B 1 186 ? 24.853  11.664 1.474   1.00 12.70  ? 186  GLU B CG   1 
ATOM   7577  C  CD   . GLU B 1 186 ? 23.679  11.803 0.522   1.00 8.93   ? 186  GLU B CD   1 
ATOM   7578  O  OE1  . GLU B 1 186 ? 23.539  10.796 -0.228  1.00 14.98  ? 186  GLU B OE1  1 
ATOM   7579  O  OE2  . GLU B 1 186 ? 22.992  12.846 0.556   1.00 11.10  ? 186  GLU B OE2  1 
ATOM   7580  H  H    . GLU B 1 186 ? 26.930  9.576  2.281   1.00 16.20  ? 186  GLU B H    1 
ATOM   7581  H  HA   . GLU B 1 186 ? 25.975  11.480 3.870   1.00 13.58  ? 186  GLU B HA   1 
ATOM   7582  H  HB2  . GLU B 1 186 ? 24.609  9.733  2.089   1.00 14.52  ? 186  GLU B HB2  1 
ATOM   7583  H  HB3  . GLU B 1 186 ? 23.801  10.749 2.965   1.00 14.52  ? 186  GLU B HB3  1 
ATOM   7584  H  HG2  . GLU B 1 186 ? 25.002  12.515 1.915   1.00 15.24  ? 186  GLU B HG2  1 
ATOM   7585  H  HG3  . GLU B 1 186 ? 25.649  11.454 0.962   1.00 15.24  ? 186  GLU B HG3  1 
ATOM   7586  N  N    . HIS B 1 187 ? 25.347  8.477  4.754   1.00 13.31  ? 187  HIS B N    1 
ATOM   7587  C  CA   . HIS B 1 187 ? 24.904  7.586  5.819   1.00 8.65   ? 187  HIS B CA   1 
ATOM   7588  C  C    . HIS B 1 187 ? 25.844  7.835  7.006   1.00 14.98  ? 187  HIS B C    1 
ATOM   7589  O  O    . HIS B 1 187 ? 25.354  7.992  8.146   1.00 11.28  ? 187  HIS B O    1 
ATOM   7590  C  CB   . HIS B 1 187 ? 24.858  6.144  5.350   1.00 13.77  ? 187  HIS B CB   1 
ATOM   7591  C  CG   . HIS B 1 187 ? 24.267  5.226  6.392   1.00 11.17  ? 187  HIS B CG   1 
ATOM   7592  N  ND1  . HIS B 1 187 ? 24.976  4.201  6.981   1.00 16.56  ? 187  HIS B ND1  1 
ATOM   7593  C  CD2  . HIS B 1 187 ? 23.044  5.194  6.931   1.00 11.66  ? 187  HIS B CD2  1 
ATOM   7594  C  CE1  . HIS B 1 187 ? 24.236  3.585  7.848   1.00 10.72  ? 187  HIS B CE1  1 
ATOM   7595  N  NE2  . HIS B 1 187 ? 23.043  4.151  7.851   1.00 11.75  ? 187  HIS B NE2  1 
ATOM   7596  H  H    . HIS B 1 187 ? 25.662  8.126  4.035   1.00 15.97  ? 187  HIS B H    1 
ATOM   7597  H  HA   . HIS B 1 187 ? 23.999  7.852  6.084   1.00 10.38  ? 187  HIS B HA   1 
ATOM   7598  H  HB2  . HIS B 1 187 ? 24.327  6.089  4.540   1.00 16.52  ? 187  HIS B HB2  1 
ATOM   7599  H  HB3  . HIS B 1 187 ? 25.757  5.848  5.138   1.00 16.52  ? 187  HIS B HB3  1 
ATOM   7600  H  HD1  . HIS B 1 187 ? 25.792  4.000  6.799   1.00 19.87  ? 187  HIS B HD1  1 
ATOM   7601  H  HD2  . HIS B 1 187 ? 22.333  5.759  6.731   1.00 13.99  ? 187  HIS B HD2  1 
ATOM   7602  H  HE1  . HIS B 1 187 ? 24.500  2.867  8.378   1.00 12.87  ? 187  HIS B HE1  1 
ATOM   7603  N  N    . TYR B 1 188 ? 27.148  7.934  6.725   1.00 14.64  ? 188  TYR B N    1 
ATOM   7604  C  CA   . TYR B 1 188 ? 28.131  8.274  7.756   1.00 12.55  ? 188  TYR B CA   1 
ATOM   7605  C  C    . TYR B 1 188 ? 27.729  9.555  8.439   1.00 14.87  ? 188  TYR B C    1 
ATOM   7606  O  O    . TYR B 1 188 ? 27.717  9.593  9.686   1.00 13.01  ? 188  TYR B O    1 
ATOM   7607  C  CB   . TYR B 1 188 ? 29.552  8.374  7.176   1.00 13.33  ? 188  TYR B CB   1 
ATOM   7608  C  CG   . TYR B 1 188 ? 30.560  8.847  8.193   1.00 13.38  ? 188  TYR B CG   1 
ATOM   7609  C  CD1  . TYR B 1 188 ? 31.130  7.865  9.015   1.00 17.44  ? 188  TYR B CD1  1 
ATOM   7610  C  CD2  . TYR B 1 188 ? 30.945  10.171 8.354   1.00 12.47  ? 188  TYR B CD2  1 
ATOM   7611  C  CE1  . TYR B 1 188 ? 32.062  8.227  9.976   1.00 12.40  ? 188  TYR B CE1  1 
ATOM   7612  C  CE2  . TYR B 1 188 ? 31.873  10.518 9.328   1.00 15.44  ? 188  TYR B CE2  1 
ATOM   7613  C  CZ   . TYR B 1 188 ? 32.415  9.534  10.099  1.00 11.72  ? 188  TYR B CZ   1 
ATOM   7614  O  OH   . TYR B 1 188 ? 33.349  9.838  11.108  1.00 21.22  ? 188  TYR B OH   1 
ATOM   7615  H  H    . TYR B 1 188 ? 27.416  7.794  5.919   1.00 17.56  ? 188  TYR B H    1 
ATOM   7616  H  HA   . TYR B 1 188 ? 28.127  7.559  8.426   1.00 15.06  ? 188  TYR B HA   1 
ATOM   7617  H  HB2  . TYR B 1 188 ? 29.822  7.503  6.843   1.00 16.00  ? 188  TYR B HB2  1 
ATOM   7618  H  HB3  . TYR B 1 188 ? 29.546  8.989  6.426   1.00 16.00  ? 188  TYR B HB3  1 
ATOM   7619  H  HD1  . TYR B 1 188 ? 30.884  6.974  8.916   1.00 20.93  ? 188  TYR B HD1  1 
ATOM   7620  H  HD2  . TYR B 1 188 ? 30.580  10.829 7.807   1.00 14.96  ? 188  TYR B HD2  1 
ATOM   7621  H  HE1  . TYR B 1 188 ? 32.440  7.583  10.530  1.00 14.88  ? 188  TYR B HE1  1 
ATOM   7622  H  HE2  . TYR B 1 188 ? 32.119  11.406 9.453   1.00 18.52  ? 188  TYR B HE2  1 
ATOM   7623  H  HH   . TYR B 1 188 ? 33.499  10.644 11.107  1.00 31.83  ? 188  TYR B HH   1 
ATOM   7624  N  N    . ILE B 1 189 ? 27.413  10.639 7.772   1.00 12.78  ? 189  ILE B N    1 
ATOM   7625  C  CA   . ILE B 1 189 ? 27.029  11.911 8.355   1.00 9.16   ? 189  ILE B CA   1 
ATOM   7626  C  C    . ILE B 1 189 ? 25.742  11.757 9.157   1.00 13.83  ? 189  ILE B C    1 
ATOM   7627  O  O    . ILE B 1 189 ? 25.679  12.244 10.297  1.00 11.51  ? 189  ILE B O    1 
ATOM   7628  C  CB   . ILE B 1 189 ? 26.917  12.976 7.249   1.00 13.33  ? 189  ILE B CB   1 
ATOM   7629  C  CG1  . ILE B 1 189 ? 28.280  13.316 6.611   1.00 13.48  ? 189  ILE B CG1  1 
ATOM   7630  C  CG2  . ILE B 1 189 ? 26.211  14.226 7.734   1.00 15.36  ? 189  ILE B CG2  1 
ATOM   7631  C  CD1  . ILE B 1 189 ? 28.047  14.022 5.282   1.00 16.39  ? 189  ILE B CD1  1 
ATOM   7632  H  H    . ILE B 1 189 ? 27.436  10.592 6.914   1.00 15.34  ? 189  ILE B H    1 
ATOM   7633  H  HA   . ILE B 1 189 ? 27.739  12.189 8.971   1.00 10.99  ? 189  ILE B HA   1 
ATOM   7634  H  HB   . ILE B 1 189 ? 26.359  12.592 6.540   1.00 16.00  ? 189  ILE B HB   1 
ATOM   7635  H  HG12 . ILE B 1 189 ? 28.788  13.891 7.206   1.00 16.17  ? 189  ILE B HG12 1 
ATOM   7636  H  HG13 . ILE B 1 189 ? 28.789  12.502 6.468   1.00 16.17  ? 189  ILE B HG13 1 
ATOM   7637  H  HG21 . ILE B 1 189 ? 26.159  14.863 7.018   1.00 23.05  ? 189  ILE B HG21 1 
ATOM   7638  H  HG22 . ILE B 1 189 ? 26.701  14.606 8.467   1.00 23.05  ? 189  ILE B HG22 1 
ATOM   7639  H  HG23 . ILE B 1 189 ? 25.325  14.000 8.026   1.00 23.05  ? 189  ILE B HG23 1 
ATOM   7640  H  HD11 . ILE B 1 189 ? 28.893  14.236 4.882   1.00 24.59  ? 189  ILE B HD11 1 
ATOM   7641  H  HD12 . ILE B 1 189 ? 27.550  14.829 5.432   1.00 24.59  ? 189  ILE B HD12 1 
ATOM   7642  H  HD13 . ILE B 1 189 ? 27.552  13.445 4.696   1.00 24.59  ? 189  ILE B HD13 1 
ATOM   7643  N  N    . LEU B 1 190 ? 24.708  11.086 8.644   1.00 13.79  ? 190  LEU B N    1 
ATOM   7644  C  CA   . LEU B 1 190 ? 23.477  10.872 9.393   1.00 15.24  ? 190  LEU B CA   1 
ATOM   7645  C  C    . LEU B 1 190 ? 23.747  10.290 10.783  1.00 12.07  ? 190  LEU B C    1 
ATOM   7646  O  O    . LEU B 1 190 ? 23.237  10.800 11.781  1.00 13.69  ? 190  LEU B O    1 
ATOM   7647  C  CB   . LEU B 1 190 ? 22.560  9.903  8.666   1.00 17.33  ? 190  LEU B CB   1 
ATOM   7648  C  CG   . LEU B 1 190 ? 21.610  10.331 7.574   1.00 22.21  ? 190  LEU B CG   1 
ATOM   7649  C  CD1  . LEU B 1 190 ? 20.765  9.133  7.134   1.00 23.15  ? 190  LEU B CD1  1 
ATOM   7650  C  CD2  . LEU B 1 190 ? 20.729  11.457 8.040   1.00 18.04  ? 190  LEU B CD2  1 
ATOM   7651  H  H    . LEU B 1 190 ? 24.770  10.771 7.846   1.00 16.55  ? 190  LEU B H    1 
ATOM   7652  H  HA   . LEU B 1 190 ? 23.015  11.730 9.493   1.00 18.29  ? 190  LEU B HA   1 
ATOM   7653  H  HB2  . LEU B 1 190 ? 23.129  9.216  8.284   1.00 20.80  ? 190  LEU B HB2  1 
ATOM   7654  H  HB3  . LEU B 1 190 ? 22.021  9.469  9.346   1.00 20.80  ? 190  LEU B HB3  1 
ATOM   7655  H  HG   . LEU B 1 190 ? 22.135  10.642 6.807   1.00 26.66  ? 190  LEU B HG   1 
ATOM   7656  H  HD11 . LEU B 1 190 ? 21.343  8.423  6.846   1.00 34.73  ? 190  LEU B HD11 1 
ATOM   7657  H  HD12 . LEU B 1 190 ? 20.194  9.395  6.408   1.00 34.73  ? 190  LEU B HD12 1 
ATOM   7658  H  HD13 . LEU B 1 190 ? 20.229  8.832  7.871   1.00 34.73  ? 190  LEU B HD13 1 
ATOM   7659  H  HD21 . LEU B 1 190 ? 20.132  11.711 7.332   1.00 27.05  ? 190  LEU B HD21 1 
ATOM   7660  H  HD22 . LEU B 1 190 ? 21.274  12.209 8.284   1.00 27.05  ? 190  LEU B HD22 1 
ATOM   7661  H  HD23 . LEU B 1 190 ? 20.219  11.171 8.802   1.00 27.05  ? 190  LEU B HD23 1 
ATOM   7662  N  N    . LYS B 1 191 ? 24.498  9.231  10.829  1.00 11.19  ? 191  LYS B N    1 
ATOM   7663  C  CA   . LYS B 1 191 ? 24.770  8.454  12.027  1.00 13.51  ? 191  LYS B CA   1 
ATOM   7664  C  C    . LYS B 1 191 ? 25.746  9.171  12.935  1.00 13.00  ? 191  LYS B C    1 
ATOM   7665  O  O    . LYS B 1 191 ? 25.600  9.108  14.166  1.00 15.57  ? 191  LYS B O    1 
ATOM   7666  C  CB   . LYS B 1 191 ? 25.292  7.076  11.647  1.00 13.80  ? 191  LYS B CB   1 
ATOM   7667  C  CG   . LYS B 1 191 ? 24.390  6.161  10.830  1.00 14.43  ? 191  LYS B CG   1 
ATOM   7668  C  CD   . LYS B 1 191 ? 22.945  6.031  11.292  1.00 24.84  ? 191  LYS B CD   1 
ATOM   7669  C  CE   . LYS B 1 191 ? 22.727  4.794  12.150  1.00 35.61  ? 191  LYS B CE   1 
ATOM   7670  N  NZ   . LYS B 1 191 ? 22.016  5.141  13.418  1.00 53.27  ? 191  LYS B NZ   1 
ATOM   7671  H  H    . LYS B 1 191 ? 24.862  8.969  10.095  1.00 13.43  ? 191  LYS B H    1 
ATOM   7672  H  HA   . LYS B 1 191 ? 23.927  8.339  12.514  1.00 16.21  ? 191  LYS B HA   1 
ATOM   7673  H  HB2  . LYS B 1 191 ? 26.116  7.199  11.150  1.00 16.55  ? 191  LYS B HB2  1 
ATOM   7674  H  HB3  . LYS B 1 191 ? 25.520  6.610  12.467  1.00 16.55  ? 191  LYS B HB3  1 
ATOM   7675  H  HG2  . LYS B 1 191 ? 24.386  6.481  9.914   1.00 17.32  ? 191  LYS B HG2  1 
ATOM   7676  H  HG3  . LYS B 1 191 ? 24.785  5.275  10.824  1.00 17.32  ? 191  LYS B HG3  1 
ATOM   7677  H  HD2  . LYS B 1 191 ? 22.701  6.820  11.801  1.00 29.81  ? 191  LYS B HD2  1 
ATOM   7678  H  HD3  . LYS B 1 191 ? 22.365  5.987  10.515  1.00 29.81  ? 191  LYS B HD3  1 
ATOM   7679  H  HE2  . LYS B 1 191 ? 22.205  4.145  11.654  1.00 42.73  ? 191  LYS B HE2  1 
ATOM   7680  H  HE3  . LYS B 1 191 ? 23.584  4.392  12.361  1.00 42.73  ? 191  LYS B HE3  1 
ATOM   7681  H  HZ1  . LYS B 1 191 ? 21.897  4.404  13.903  1.00 79.91  ? 191  LYS B HZ1  1 
ATOM   7682  H  HZ2  . LYS B 1 191 ? 21.224  5.500  13.225  1.00 79.91  ? 191  LYS B HZ2  1 
ATOM   7683  H  HZ3  . LYS B 1 191 ? 22.502  5.726  13.880  1.00 79.91  ? 191  LYS B HZ3  1 
ATOM   7684  N  N    . THR B 1 192 ? 26.707  9.833  12.379  1.00 10.20  ? 192  THR B N    1 
ATOM   7685  C  CA   . THR B 1 192 ? 27.708  10.548 13.167  1.00 12.66  ? 192  THR B CA   1 
ATOM   7686  C  C    . THR B 1 192 ? 27.035  11.678 13.897  1.00 13.54  ? 192  THR B C    1 
ATOM   7687  O  O    . THR B 1 192 ? 27.334  11.904 15.108  1.00 13.93  ? 192  THR B O    1 
ATOM   7688  C  CB   . THR B 1 192 ? 28.855  11.094 12.280  1.00 11.27  ? 192  THR B CB   1 
ATOM   7689  O  OG1  . THR B 1 192 ? 29.578  9.942  11.818  1.00 16.16  ? 192  THR B OG1  1 
ATOM   7690  C  CG2  . THR B 1 192 ? 29.820  11.994 13.046  1.00 13.52  ? 192  THR B CG2  1 
ATOM   7691  H  H    . THR B 1 192 ? 26.759  9.852  11.521  1.00 12.24  ? 192  THR B H    1 
ATOM   7692  H  HA   . THR B 1 192 ? 28.088  9.930  13.826  1.00 15.19  ? 192  THR B HA   1 
ATOM   7693  H  HB   . THR B 1 192 ? 28.482  11.581 11.516  1.00 13.53  ? 192  THR B HB   1 
ATOM   7694  H  HG1  . THR B 1 192 ? 29.072  9.453  11.396  1.00 24.24  ? 192  THR B HG1  1 
ATOM   7695  H  HG21 . THR B 1 192 ? 30.507  12.305 12.451  1.00 20.27  ? 192  THR B HG21 1 
ATOM   7696  H  HG22 . THR B 1 192 ? 30.219  11.498 13.764  1.00 20.27  ? 192  THR B HG22 1 
ATOM   7697  H  HG23 . THR B 1 192 ? 29.341  12.746 13.403  1.00 20.27  ? 192  THR B HG23 1 
ATOM   7698  N  N    . LEU B 1 193 ? 26.184  12.441 13.219  1.00 12.06  ? 193  LEU B N    1 
ATOM   7699  C  CA   . LEU B 1 193 ? 25.569  13.640 13.766  1.00 15.67  ? 193  LEU B CA   1 
ATOM   7700  C  C    . LEU B 1 193 ? 24.285  13.345 14.531  1.00 12.40  ? 193  LEU B C    1 
ATOM   7701  O  O    . LEU B 1 193 ? 23.771  14.189 15.296  1.00 14.40  ? 193  LEU B O    1 
ATOM   7702  C  CB   . LEU B 1 193 ? 25.312  14.653 12.652  1.00 19.61  ? 193  LEU B CB   1 
ATOM   7703  C  CG   . LEU B 1 193 ? 26.235  15.855 12.455  1.00 28.58  ? 193  LEU B CG   1 
ATOM   7704  C  CD1  . LEU B 1 193 ? 27.681  15.564 12.818  1.00 30.29  ? 193  LEU B CD1  1 
ATOM   7705  C  CD2  . LEU B 1 193 ? 26.105  16.389 11.028  1.00 20.08  ? 193  LEU B CD2  1 
ATOM   7706  H  H    . LEU B 1 193 ? 25.987  12.214 12.413  1.00 14.48  ? 193  LEU B H    1 
ATOM   7707  H  HA   . LEU B 1 193 ? 26.204  14.042 14.394  1.00 18.80  ? 193  LEU B HA   1 
ATOM   7708  H  HB2  . LEU B 1 193 ? 25.302  14.161 11.816  1.00 23.53  ? 193  LEU B HB2  1 
ATOM   7709  H  HB3  . LEU B 1 193 ? 24.416  15.000 12.784  1.00 23.53  ? 193  LEU B HB3  1 
ATOM   7710  H  HG   . LEU B 1 193 ? 25.922  16.561 13.058  1.00 34.30  ? 193  LEU B HG   1 
ATOM   7711  H  HD11 . LEU B 1 193 ? 28.214  16.348 12.665  1.00 45.44  ? 193  LEU B HD11 1 
ATOM   7712  H  HD12 . LEU B 1 193 ? 28.009  14.844 12.275  1.00 45.44  ? 193  LEU B HD12 1 
ATOM   7713  H  HD13 . LEU B 1 193 ? 27.735  15.317 13.744  1.00 45.44  ? 193  LEU B HD13 1 
ATOM   7714  H  HD21 . LEU B 1 193 ? 25.178  16.536 10.824  1.00 30.12  ? 193  LEU B HD21 1 
ATOM   7715  H  HD22 . LEU B 1 193 ? 26.470  15.750 10.412  1.00 30.12  ? 193  LEU B HD22 1 
ATOM   7716  H  HD23 . LEU B 1 193 ? 26.584  17.217 10.951  1.00 30.12  ? 193  LEU B HD23 1 
ATOM   7717  N  N    . GLY B 1 194 ? 23.707  12.178 14.329  1.00 13.15  ? 194  GLY B N    1 
ATOM   7718  C  CA   . GLY B 1 194 ? 22.491  11.806 15.046  1.00 15.65  ? 194  GLY B CA   1 
ATOM   7719  C  C    . GLY B 1 194 ? 21.255  12.518 14.578  1.00 14.22  ? 194  GLY B C    1 
ATOM   7720  O  O    . GLY B 1 194 ? 20.349  12.858 15.334  1.00 15.02  ? 194  GLY B O    1 
ATOM   7721  H  H    . GLY B 1 194 ? 24.052  11.627 13.766  1.00 15.78  ? 194  GLY B H    1 
ATOM   7722  H  HA2  . GLY B 1 194 ? 22.354  10.850 14.950  1.00 18.78  ? 194  GLY B HA2  1 
ATOM   7723  H  HA3  . GLY B 1 194 ? 22.618  11.991 15.989  1.00 18.78  ? 194  GLY B HA3  1 
ATOM   7724  N  N    . ILE B 1 195 ? 21.203  12.776 13.245  1.00 13.43  ? 195  ILE B N    1 
ATOM   7725  C  CA   . ILE B 1 195 ? 19.993  13.362 12.711  1.00 12.60  ? 195  ILE B CA   1 
ATOM   7726  C  C    . ILE B 1 195 ? 18.825  12.397 12.679  1.00 12.67  ? 195  ILE B C    1 
ATOM   7727  O  O    . ILE B 1 195 ? 19.006  11.240 12.295  1.00 13.64  ? 195  ILE B O    1 
ATOM   7728  C  CB   . ILE B 1 195 ? 20.337  13.785 11.266  1.00 12.62  ? 195  ILE B CB   1 
ATOM   7729  C  CG1  . ILE B 1 195 ? 21.392  14.885 11.228  1.00 15.80  ? 195  ILE B CG1  1 
ATOM   7730  C  CG2  . ILE B 1 195 ? 19.040  14.114 10.536  1.00 15.67  ? 195  ILE B CG2  1 
ATOM   7731  C  CD1  . ILE B 1 195 ? 21.972  15.216 9.875   1.00 13.04  ? 195  ILE B CD1  1 
ATOM   7732  H  H    . ILE B 1 195 ? 21.870  12.596 12.733  1.00 16.11  ? 195  ILE B H    1 
ATOM   7733  H  HA   . ILE B 1 195 ? 19.751  14.153 13.236  1.00 15.12  ? 195  ILE B HA   1 
ATOM   7734  H  HB   . ILE B 1 195 ? 20.724  13.001 10.823  1.00 15.14  ? 195  ILE B HB   1 
ATOM   7735  H  HG12 . ILE B 1 195 ? 21.001  15.693 11.595  1.00 18.96  ? 195  ILE B HG12 1 
ATOM   7736  H  HG13 . ILE B 1 195 ? 22.121  14.626 11.813  1.00 18.96  ? 195  ILE B HG13 1 
ATOM   7737  H  HG21 . ILE B 1 195 ? 18.436  13.370 10.606  1.00 23.50  ? 195  ILE B HG21 1 
ATOM   7738  H  HG22 . ILE B 1 195 ? 19.228  14.287 9.611   1.00 23.50  ? 195  ILE B HG22 1 
ATOM   7739  H  HG23 . ILE B 1 195 ? 18.638  14.891 10.932  1.00 23.50  ? 195  ILE B HG23 1 
ATOM   7740  H  HD11 . ILE B 1 195 ? 22.617  15.921 9.967   1.00 19.55  ? 195  ILE B HD11 1 
ATOM   7741  H  HD12 . ILE B 1 195 ? 21.268  15.501 9.287   1.00 19.55  ? 195  ILE B HD12 1 
ATOM   7742  H  HD13 . ILE B 1 195 ? 22.398  14.437 9.511   1.00 19.55  ? 195  ILE B HD13 1 
ATOM   7743  N  N    . LYS B 1 196 ? 17.631  12.806 13.051  1.00 11.99  ? 196  LYS B N    1 
ATOM   7744  C  CA   . LYS B 1 196 ? 16.430  12.003 13.033  1.00 11.42  ? 196  LYS B CA   1 
ATOM   7745  C  C    . LYS B 1 196 ? 15.961  11.679 11.616  1.00 12.06  ? 196  LYS B C    1 
ATOM   7746  O  O    . LYS B 1 196 ? 15.814  12.553 10.777  1.00 10.79  ? 196  LYS B O    1 
ATOM   7747  C  CB   . LYS B 1 196 ? 15.339  12.735 13.811  1.00 13.67  ? 196  LYS B CB   1 
ATOM   7748  C  CG   . LYS B 1 196 ? 14.113  11.904 14.075  1.00 14.95  ? 196  LYS B CG   1 
ATOM   7749  C  CD   . LYS B 1 196 ? 14.383  10.622 14.801  1.00 16.83  ? 196  LYS B CD   1 
ATOM   7750  C  CE   . LYS B 1 196 ? 13.570  10.528 16.083  1.00 41.38  ? 196  LYS B CE   1 
ATOM   7751  N  NZ   . LYS B 1 196 ? 12.106  10.529 15.773  1.00 47.64  ? 196  LYS B NZ   1 
ATOM   7752  H  H    . LYS B 1 196 ? 17.560  13.617 13.328  1.00 14.38  ? 196  LYS B H    1 
ATOM   7753  H  HA   . LYS B 1 196 ? 16.620  11.159 13.493  1.00 13.71  ? 196  LYS B HA   1 
ATOM   7754  H  HB2  . LYS B 1 196 ? 15.705  13.029 14.660  1.00 16.41  ? 196  LYS B HB2  1 
ATOM   7755  H  HB3  . LYS B 1 196 ? 15.079  13.526 13.313  1.00 16.41  ? 196  LYS B HB3  1 
ATOM   7756  H  HG2  . LYS B 1 196 ? 13.487  12.430 14.597  1.00 17.94  ? 196  LYS B HG2  1 
ATOM   7757  H  HG3  . LYS B 1 196 ? 13.688  11.698 13.228  1.00 17.94  ? 196  LYS B HG3  1 
ATOM   7758  H  HD2  . LYS B 1 196 ? 14.162  9.874  14.224  1.00 20.20  ? 196  LYS B HD2  1 
ATOM   7759  H  HD3  . LYS B 1 196 ? 15.328  10.566 15.014  1.00 20.20  ? 196  LYS B HD3  1 
ATOM   7760  H  HE2  . LYS B 1 196 ? 13.802  9.713  16.555  1.00 49.65  ? 196  LYS B HE2  1 
ATOM   7761  H  HE3  . LYS B 1 196 ? 13.782  11.280 16.657  1.00 49.65  ? 196  LYS B HE3  1 
ATOM   7762  H  HZ1  . LYS B 1 196 ? 11.642  10.493 16.532  1.00 71.46  ? 196  LYS B HZ1  1 
ATOM   7763  H  HZ2  . LYS B 1 196 ? 11.908  9.822  15.271  1.00 71.46  ? 196  LYS B HZ2  1 
ATOM   7764  H  HZ3  . LYS B 1 196 ? 11.897  11.274 15.333  1.00 71.46  ? 196  LYS B HZ3  1 
ATOM   7765  N  N    . TYR B 1 197 ? 15.749  10.384 11.342  1.00 10.91  ? 197  TYR B N    1 
ATOM   7766  C  CA   . TYR B 1 197 ? 15.214  10.009 10.050  1.00 7.96   ? 197  TYR B CA   1 
ATOM   7767  C  C    . TYR B 1 197 ? 14.206  8.901  10.183  1.00 7.33   ? 197  TYR B C    1 
ATOM   7768  O  O    . TYR B 1 197 ? 14.309  8.000  11.040  1.00 11.15  ? 197  TYR B O    1 
ATOM   7769  C  CB   . TYR B 1 197 ? 16.383  9.594  9.113   1.00 8.37   ? 197  TYR B CB   1 
ATOM   7770  C  CG   . TYR B 1 197 ? 17.111  8.370  9.584   1.00 9.19   ? 197  TYR B CG   1 
ATOM   7771  C  CD1  . TYR B 1 197 ? 16.755  7.052  9.286   1.00 12.06  ? 197  TYR B CD1  1 
ATOM   7772  C  CD2  . TYR B 1 197 ? 18.230  8.544  10.402  1.00 10.62  ? 197  TYR B CD2  1 
ATOM   7773  C  CE1  . TYR B 1 197 ? 17.449  5.954  9.748   1.00 9.71   ? 197  TYR B CE1  1 
ATOM   7774  C  CE2  . TYR B 1 197 ? 18.912  7.457  10.857  1.00 13.29  ? 197  TYR B CE2  1 
ATOM   7775  C  CZ   . TYR B 1 197 ? 18.546  6.174  10.545  1.00 13.72  ? 197  TYR B CZ   1 
ATOM   7776  O  OH   . TYR B 1 197 ? 19.268  5.104  11.036  1.00 22.47  ? 197  TYR B OH   1 
ATOM   7777  H  H    . TYR B 1 197 ? 15.928  9.781  11.928  1.00 13.09  ? 197  TYR B H    1 
ATOM   7778  H  HA   . TYR B 1 197 ? 14.767  10.790 9.660   1.00 9.55   ? 197  TYR B HA   1 
ATOM   7779  H  HB2  . TYR B 1 197 ? 16.031  9.428  8.225   1.00 10.04  ? 197  TYR B HB2  1 
ATOM   7780  H  HB3  . TYR B 1 197 ? 17.012  10.329 9.050   1.00 10.04  ? 197  TYR B HB3  1 
ATOM   7781  H  HD1  . TYR B 1 197 ? 16.010  6.908  8.747   1.00 14.48  ? 197  TYR B HD1  1 
ATOM   7782  H  HD2  . TYR B 1 197 ? 18.509  9.400  10.636  1.00 12.75  ? 197  TYR B HD2  1 
ATOM   7783  H  HE1  . TYR B 1 197 ? 17.183  5.091  9.527   1.00 11.66  ? 197  TYR B HE1  1 
ATOM   7784  H  HE2  . TYR B 1 197 ? 19.655  7.591  11.401  1.00 15.95  ? 197  TYR B HE2  1 
ATOM   7785  H  HH   . TYR B 1 197 ? 18.939  4.404  10.763  1.00 33.70  ? 197  TYR B HH   1 
ATOM   7786  N  N    . PHE B 1 198 ? 13.233  8.912  9.284   1.00 9.95   ? 198  PHE B N    1 
ATOM   7787  C  CA   . PHE B 1 198 ? 12.328  7.822  8.966   1.00 8.89   ? 198  PHE B CA   1 
ATOM   7788  C  C    . PHE B 1 198 ? 12.601  7.363  7.512   1.00 9.95   ? 198  PHE B C    1 
ATOM   7789  O  O    . PHE B 1 198 ? 11.989  8.008  6.643   1.00 10.30  ? 198  PHE B O    1 
ATOM   7790  C  CB   . PHE B 1 198 ? 10.883  8.236  9.228   1.00 11.05  ? 198  PHE B CB   1 
ATOM   7791  C  CG   . PHE B 1 198 ? 10.658  8.638  10.674  1.00 10.74  ? 198  PHE B CG   1 
ATOM   7792  C  CD1  . PHE B 1 198 ? 10.836  9.935  11.107  1.00 8.12   ? 198  PHE B CD1  1 
ATOM   7793  C  CD2  . PHE B 1 198 ? 10.276  7.664  11.603  1.00 9.95   ? 198  PHE B CD2  1 
ATOM   7794  C  CE1  . PHE B 1 198 ? 10.674  10.276 12.432  1.00 8.98   ? 198  PHE B CE1  1 
ATOM   7795  C  CE2  . PHE B 1 198 ? 10.083  8.012  12.930  1.00 10.32  ? 198  PHE B CE2  1 
ATOM   7796  C  CZ   . PHE B 1 198 ? 10.269  9.331  13.337  1.00 9.70   ? 198  PHE B CZ   1 
ATOM   7797  H  H    . PHE B 1 198 ? 13.126  9.642  8.842   1.00 11.94  ? 198  PHE B H    1 
ATOM   7798  H  HA   . PHE B 1 198 ? 12.539  7.073  9.561   1.00 10.67  ? 198  PHE B HA   1 
ATOM   7799  H  HB2  . PHE B 1 198 ? 10.656  8.982  8.651   1.00 13.26  ? 198  PHE B HB2  1 
ATOM   7800  H  HB3  . PHE B 1 198 ? 10.295  7.497  9.007   1.00 13.26  ? 198  PHE B HB3  1 
ATOM   7801  H  HD1  . PHE B 1 198 ? 11.071  10.593 10.492  1.00 9.74   ? 198  PHE B HD1  1 
ATOM   7802  H  HD2  . PHE B 1 198 ? 10.153  6.783  11.330  1.00 11.94  ? 198  PHE B HD2  1 
ATOM   7803  H  HE1  . PHE B 1 198 ? 10.839  11.147 12.712  1.00 10.78  ? 198  PHE B HE1  1 
ATOM   7804  H  HE2  . PHE B 1 198 ? 9.829   7.366  13.549  1.00 12.39  ? 198  PHE B HE2  1 
ATOM   7805  H  HZ   . PHE B 1 198 ? 10.118  9.570  14.223  1.00 11.64  ? 198  PHE B HZ   1 
ATOM   7806  N  N    . SER B 1 199 ? 13.476  6.420  7.319   1.00 9.45   ? 199  SER B N    1 
ATOM   7807  C  CA   . SER B 1 199 ? 13.662  5.850  5.948   1.00 10.31  ? 199  SER B CA   1 
ATOM   7808  C  C    . SER B 1 199 ? 12.419  5.062  5.639   1.00 9.61   ? 199  SER B C    1 
ATOM   7809  O  O    . SER B 1 199 ? 11.554  4.829  6.481   1.00 8.41   ? 199  SER B O    1 
ATOM   7810  C  CB   . SER B 1 199 ? 14.913  5.005  5.872   1.00 11.24  ? 199  SER B CB   1 
ATOM   7811  O  OG   . SER B 1 199 ? 14.723  3.729  6.458   1.00 10.94  ? 199  SER B OG   1 
ATOM   7812  H  H    . SER B 1 199 ? 13.945  6.126  7.976   1.00 11.34  ? 199  SER B H    1 
ATOM   7813  H  HA   . SER B 1 199 ? 13.738  6.586  5.306   1.00 12.37  ? 199  SER B HA   1 
ATOM   7814  H  HB2  . SER B 1 199 ? 15.169  4.896  4.943   1.00 13.49  ? 199  SER B HB2  1 
ATOM   7815  H  HB3  . SER B 1 199 ? 15.636  5.462  6.330   1.00 13.49  ? 199  SER B HB3  1 
ATOM   7816  H  HG   . SER B 1 199 ? 14.517  3.818  7.246   1.00 16.41  ? 199  SER B HG   1 
ATOM   7817  N  N    . MET B 1 200 ? 12.313  4.571  4.380   1.00 8.10   ? 200  MET B N    1 
ATOM   7818  C  CA   . MET B 1 200 ? 11.197  3.694  4.080   1.00 11.50  ? 200  MET B CA   1 
ATOM   7819  C  C    . MET B 1 200 ? 11.064  2.490  4.984   1.00 9.56   ? 200  MET B C    1 
ATOM   7820  O  O    . MET B 1 200 ? 9.939   1.992  5.188   1.00 8.67   ? 200  MET B O    1 
ATOM   7821  C  CB   . MET B 1 200 ? 11.259  3.211  2.599   1.00 9.31   ? 200  MET B CB   1 
ATOM   7822  C  CG   . MET B 1 200 ? 11.069  4.341  1.595   1.00 9.18   ? 200  MET B CG   1 
ATOM   7823  S  SD   . MET B 1 200 ? 9.671   5.453  1.849   1.00 11.35  ? 200  MET B SD   1 
ATOM   7824  C  CE   . MET B 1 200 ? 8.292   4.320  1.750   1.00 15.09  ? 200  MET B CE   1 
ATOM   7825  H  H    . MET B 1 200 ? 12.890  4.774  3.777   1.00 9.72   ? 200  MET B H    1 
ATOM   7826  H  HA   . MET B 1 200 ? 10.378  4.223  4.179   1.00 13.79  ? 200  MET B HA   1 
ATOM   7827  H  HB2  . MET B 1 200 ? 12.118  2.789  2.441   1.00 11.18  ? 200  MET B HB2  1 
ATOM   7828  H  HB3  . MET B 1 200 ? 10.570  2.543  2.456   1.00 11.18  ? 200  MET B HB3  1 
ATOM   7829  H  HG2  . MET B 1 200 ? 11.879  4.875  1.590   1.00 11.02  ? 200  MET B HG2  1 
ATOM   7830  H  HG3  . MET B 1 200 ? 10.980  3.946  0.714   1.00 11.02  ? 200  MET B HG3  1 
ATOM   7831  H  HE1  . MET B 1 200 ? 7.472   4.803  1.872   1.00 22.63  ? 200  MET B HE1  1 
ATOM   7832  H  HE2  . MET B 1 200 ? 8.376   3.653  2.436   1.00 22.63  ? 200  MET B HE2  1 
ATOM   7833  H  HE3  . MET B 1 200 ? 8.289   3.895  0.890   1.00 22.63  ? 200  MET B HE3  1 
ATOM   7834  N  N    . THR B 1 201 ? 12.168  1.974  5.495   1.00 8.44   ? 201  THR B N    1 
ATOM   7835  C  CA   . THR B 1 201 ? 12.179  0.911  6.505   1.00 8.65   ? 201  THR B CA   1 
ATOM   7836  C  C    . THR B 1 201 ? 11.353  1.291  7.739   1.00 8.91   ? 201  THR B C    1 
ATOM   7837  O  O    . THR B 1 201 ? 10.533  0.499  8.218   1.00 8.99   ? 201  THR B O    1 
ATOM   7838  C  CB   . THR B 1 201 ? 13.636  0.607  6.915   1.00 9.33   ? 201  THR B CB   1 
ATOM   7839  O  OG1  . THR B 1 201 ? 14.337  0.200  5.720   1.00 9.90   ? 201  THR B OG1  1 
ATOM   7840  C  CG2  . THR B 1 201 ? 13.737  -0.506 7.948   1.00 10.42  ? 201  THR B CG2  1 
ATOM   7841  H  H    . THR B 1 201 ? 12.923  2.279  5.219   1.00 10.13  ? 201  THR B H    1 
ATOM   7842  H  HA   . THR B 1 201 ? 11.792  0.103  6.110   1.00 10.38  ? 201  THR B HA   1 
ATOM   7843  H  HB   . THR B 1 201 ? 14.049  1.420  7.273   1.00 11.19  ? 201  THR B HB   1 
ATOM   7844  H  HG1  . THR B 1 201 ? 14.647  -0.551 5.827   1.00 14.85  ? 201  THR B HG1  1 
ATOM   7845  H  HG21 . THR B 1 201 ? 14.660  -0.655 8.169   1.00 15.62  ? 201  THR B HG21 1 
ATOM   7846  H  HG22 . THR B 1 201 ? 13.360  -1.312 7.589   1.00 15.62  ? 201  THR B HG22 1 
ATOM   7847  H  HG23 . THR B 1 201 ? 13.256  -0.252 8.739   1.00 15.62  ? 201  THR B HG23 1 
ATOM   7848  N  N    . GLU B 1 202 ? 11.588  2.483  8.293   1.00 10.18  ? 202  GLU B N    1 
ATOM   7849  C  CA   . GLU B 1 202 ? 10.794  2.945  9.431   1.00 9.54   ? 202  GLU B CA   1 
ATOM   7850  C  C    . GLU B 1 202 ? 9.353   3.213  9.058   1.00 8.30   ? 202  GLU B C    1 
ATOM   7851  O  O    . GLU B 1 202 ? 8.427   2.920  9.833   1.00 9.82   ? 202  GLU B O    1 
ATOM   7852  C  CB   . GLU B 1 202 ? 11.417  4.214  10.018  1.00 11.03  ? 202  GLU B CB   1 
ATOM   7853  C  CG   . GLU B 1 202 ? 12.708  4.020  10.762  1.00 9.94   ? 202  GLU B CG   1 
ATOM   7854  C  CD   . GLU B 1 202 ? 13.925  3.563  9.976   1.00 12.19  ? 202  GLU B CD   1 
ATOM   7855  O  OE1  . GLU B 1 202 ? 14.200  4.268  8.966   1.00 12.19  ? 202  GLU B OE1  1 
ATOM   7856  O  OE2  . GLU B 1 202 ? 14.566  2.566  10.360  1.00 14.16  ? 202  GLU B OE2  1 
ATOM   7857  H  H    . GLU B 1 202 ? 12.212  2.984  7.978   1.00 12.21  ? 202  GLU B H    1 
ATOM   7858  H  HA   . GLU B 1 202 ? 10.809  2.248  10.119  1.00 11.44  ? 202  GLU B HA   1 
ATOM   7859  H  HB2  . GLU B 1 202 ? 11.573  4.841  9.294   1.00 13.24  ? 202  GLU B HB2  1 
ATOM   7860  H  HB3  . GLU B 1 202 ? 10.775  4.620  10.620  1.00 13.24  ? 202  GLU B HB3  1 
ATOM   7861  H  HG2  . GLU B 1 202 ? 12.931  4.860  11.192  1.00 11.93  ? 202  GLU B HG2  1 
ATOM   7862  H  HG3  . GLU B 1 202 ? 12.549  3.372  11.466  1.00 11.93  ? 202  GLU B HG3  1 
ATOM   7863  N  N    . VAL B 1 203 ? 9.118   3.760  7.866   1.00 8.47   ? 203  VAL B N    1 
ATOM   7864  C  CA   . VAL B 1 203 ? 7.727   3.947  7.413   1.00 10.22  ? 203  VAL B CA   1 
ATOM   7865  C  C    . VAL B 1 203 ? 7.032   2.592  7.327   1.00 7.70   ? 203  VAL B C    1 
ATOM   7866  O  O    . VAL B 1 203 ? 5.905   2.461  7.802   1.00 8.00   ? 203  VAL B O    1 
ATOM   7867  C  CB   . VAL B 1 203 ? 7.615   4.692  6.077   1.00 11.22  ? 203  VAL B CB   1 
ATOM   7868  C  CG1  . VAL B 1 203 ? 6.157   4.876  5.760   1.00 7.94   ? 203  VAL B CG1  1 
ATOM   7869  C  CG2  . VAL B 1 203 ? 8.381   6.011  6.098   1.00 10.93  ? 203  VAL B CG2  1 
ATOM   7870  H  H    . VAL B 1 203 ? 9.773   4.003  7.364   1.00 10.16  ? 203  VAL B H    1 
ATOM   7871  H  HA   . VAL B 1 203 ? 7.261   4.479  8.092   1.00 12.26  ? 203  VAL B HA   1 
ATOM   7872  H  HB   . VAL B 1 203 ? 8.008   4.125  5.381   1.00 13.46  ? 203  VAL B HB   1 
ATOM   7873  H  HG11 . VAL B 1 203 ? 5.719   4.022  5.763   1.00 11.90  ? 203  VAL B HG11 1 
ATOM   7874  H  HG12 . VAL B 1 203 ? 6.067   5.279  4.893   1.00 11.90  ? 203  VAL B HG12 1 
ATOM   7875  H  HG13 . VAL B 1 203 ? 5.755   5.444  6.421   1.00 11.90  ? 203  VAL B HG13 1 
ATOM   7876  H  HG21 . VAL B 1 203 ? 9.303   5.842  6.309   1.00 16.40  ? 203  VAL B HG21 1 
ATOM   7877  H  HG22 . VAL B 1 203 ? 8.002   6.590  6.763   1.00 16.40  ? 203  VAL B HG22 1 
ATOM   7878  H  HG23 . VAL B 1 203 ? 8.321   6.429  5.237   1.00 16.40  ? 203  VAL B HG23 1 
ATOM   7879  N  N    . ASP B 1 204 ? 7.694   1.540  6.835   1.00 7.97   ? 204  ASP B N    1 
ATOM   7880  C  CA   . ASP B 1 204 ? 7.127   0.216  6.776   1.00 10.15  ? 204  ASP B CA   1 
ATOM   7881  C  C    . ASP B 1 204 ? 6.898   -0.365 8.187   1.00 9.49   ? 204  ASP B C    1 
ATOM   7882  O  O    . ASP B 1 204 ? 5.887   -0.993 8.465   1.00 10.41  ? 204  ASP B O    1 
ATOM   7883  C  CB   . ASP B 1 204 ? 7.995   -0.740 5.964   1.00 8.42   ? 204  ASP B CB   1 
ATOM   7884  C  CG   . ASP B 1 204 ? 8.084   -0.443 4.471   1.00 7.79   ? 204  ASP B CG   1 
ATOM   7885  O  OD1  . ASP B 1 204 ? 7.181   0.241  3.980   1.00 10.47  ? 204  ASP B OD1  1 
ATOM   7886  O  OD2  . ASP B 1 204 ? 9.097   -0.922 3.898   1.00 10.18  ? 204  ASP B OD2  1 
ATOM   7887  H  H    . ASP B 1 204 ? 8.493   1.658  6.541   1.00 9.57   ? 204  ASP B H    1 
ATOM   7888  H  HA   . ASP B 1 204 ? 6.256   0.281  6.333   1.00 12.18  ? 204  ASP B HA   1 
ATOM   7889  H  HB2  . ASP B 1 204 ? 8.892   -0.726 6.332   1.00 10.10  ? 204  ASP B HB2  1 
ATOM   7890  H  HB3  . ASP B 1 204 ? 7.648   -1.639 6.077   1.00 10.10  ? 204  ASP B HB3  1 
ATOM   7891  N  N    . ARG B 1 205 ? 7.836   -0.102 9.076   1.00 9.03   ? 205  ARG B N    1 
ATOM   7892  C  CA   . ARG B 1 205 ? 7.772   -0.647 10.433  1.00 12.17  ? 205  ARG B CA   1 
ATOM   7893  C  C    . ARG B 1 205 ? 6.620   -0.048 11.204  1.00 7.38   ? 205  ARG B C    1 
ATOM   7894  O  O    . ARG B 1 205 ? 5.831   -0.752 11.880  1.00 9.64   ? 205  ARG B O    1 
ATOM   7895  C  CB   . ARG B 1 205 ? 9.063   -0.335 11.164  1.00 9.04   ? 205  ARG B CB   1 
ATOM   7896  C  CG   . ARG B 1 205 ? 9.059   -0.780 12.621  1.00 10.12  ? 205  ARG B CG   1 
ATOM   7897  C  CD   . ARG B 1 205 ? 10.375  -0.486 13.316  1.00 9.74   ? 205  ARG B CD   1 
ATOM   7898  N  NE   . ARG B 1 205 ? 11.467  -1.124 12.586  1.00 11.64  ? 205  ARG B NE   1 
ATOM   7899  C  CZ   . ARG B 1 205 ? 12.594  -0.594 12.126  1.00 12.30  ? 205  ARG B CZ   1 
ATOM   7900  N  NH1  . ARG B 1 205 ? 12.914  0.671  12.327  1.00 15.66  ? 205  ARG B NH1  1 
ATOM   7901  N  NH2  . ARG B 1 205 ? 13.447  -1.349 11.454  1.00 13.24  ? 205  ARG B NH2  1 
ATOM   7902  H  H    . ARG B 1 205 ? 8.499   0.400  8.854   1.00 10.83  ? 205  ARG B H    1 
ATOM   7903  H  HA   . ARG B 1 205 ? 7.656   -1.619 10.384  1.00 14.61  ? 205  ARG B HA   1 
ATOM   7904  H  HB2  . ARG B 1 205 ? 9.797   -0.772 10.704  1.00 10.84  ? 205  ARG B HB2  1 
ATOM   7905  H  HB3  . ARG B 1 205 ? 9.221   0.622  11.128  1.00 10.84  ? 205  ARG B HB3  1 
ATOM   7906  H  HG2  . ARG B 1 205 ? 8.343   -0.325 13.090  1.00 12.14  ? 205  ARG B HG2  1 
ATOM   7907  H  HG3  . ARG B 1 205 ? 8.884   -1.733 12.662  1.00 12.14  ? 205  ARG B HG3  1 
ATOM   7908  H  HD2  . ARG B 1 205 ? 10.520  0.472  13.352  1.00 11.68  ? 205  ARG B HD2  1 
ATOM   7909  H  HD3  . ARG B 1 205 ? 10.348  -0.823 14.226  1.00 11.68  ? 205  ARG B HD3  1 
ATOM   7910  H  HE   . ARG B 1 205 ? 11.365  -1.964 12.431  1.00 13.97  ? 205  ARG B HE   1 
ATOM   7911  H  HH11 . ARG B 1 205 ? 13.657  0.980  12.024  1.00 18.79  ? 205  ARG B HH11 1 
ATOM   7912  H  HH12 . ARG B 1 205 ? 12.379  1.186  12.760  1.00 18.79  ? 205  ARG B HH12 1 
ATOM   7913  H  HH21 . ARG B 1 205 ? 14.183  -1.012 11.164  1.00 15.89  ? 205  ARG B HH21 1 
ATOM   7914  H  HH22 . ARG B 1 205 ? 13.266  -2.177 11.308  1.00 15.89  ? 205  ARG B HH22 1 
ATOM   7915  N  N    . LEU B 1 206 ? 6.535   1.273  11.167  1.00 7.15   ? 206  LEU B N    1 
ATOM   7916  C  CA   . LEU B 1 206 ? 5.664   2.034  12.031  1.00 9.20   ? 206  LEU B CA   1 
ATOM   7917  C  C    . LEU B 1 206 ? 4.285   2.353  11.482  1.00 10.05  ? 206  LEU B C    1 
ATOM   7918  O  O    . LEU B 1 206 ? 3.337   2.529  12.265  1.00 11.17  ? 206  LEU B O    1 
ATOM   7919  C  CB   . LEU B 1 206 ? 6.319   3.389  12.412  1.00 8.00   ? 206  LEU B CB   1 
ATOM   7920  C  CG   . LEU B 1 206 ? 7.671   3.316  13.130  1.00 11.21  ? 206  LEU B CG   1 
ATOM   7921  C  CD1  . LEU B 1 206 ? 8.267   4.710  13.291  1.00 13.57  ? 206  LEU B CD1  1 
ATOM   7922  C  CD2  . LEU B 1 206 ? 7.580   2.584  14.467  1.00 17.83  ? 206  LEU B CD2  1 
ATOM   7923  H  H    . LEU B 1 206 ? 7.022   1.699  10.600  1.00 8.58   ? 206  LEU B H    1 
ATOM   7924  H  HA   . LEU B 1 206 ? 5.544   1.520  12.857  1.00 11.04  ? 206  LEU B HA   1 
ATOM   7925  H  HB2  . LEU B 1 206 ? 6.435   3.907  11.601  1.00 9.60   ? 206  LEU B HB2  1 
ATOM   7926  H  HB3  . LEU B 1 206 ? 5.701   3.875  12.980  1.00 9.60   ? 206  LEU B HB3  1 
ATOM   7927  H  HG   . LEU B 1 206 ? 8.278   2.803  12.557  1.00 13.45  ? 206  LEU B HG   1 
ATOM   7928  H  HD11 . LEU B 1 206 ? 8.303   5.143  12.435  1.00 20.35  ? 206  LEU B HD11 1 
ATOM   7929  H  HD12 . LEU B 1 206 ? 9.154   4.638  13.651  1.00 20.35  ? 206  LEU B HD12 1 
ATOM   7930  H  HD13 . LEU B 1 206 ? 7.720   5.225  13.888  1.00 20.35  ? 206  LEU B HD13 1 
ATOM   7931  H  HD21 . LEU B 1 206 ? 7.214   1.707  14.327  1.00 26.74  ? 206  LEU B HD21 1 
ATOM   7932  H  HD22 . LEU B 1 206 ? 7.012   3.076  15.064  1.00 26.74  ? 206  LEU B HD22 1 
ATOM   7933  H  HD23 . LEU B 1 206 ? 8.457   2.507  14.850  1.00 26.74  ? 206  LEU B HD23 1 
ATOM   7934  N  N    . GLY B 1 207 ? 4.190   2.510  10.171  1.00 10.19  ? 207  GLY B N    1 
ATOM   7935  C  CA   . GLY B 1 207 ? 3.088   3.158  9.454   1.00 8.55   ? 207  GLY B CA   1 
ATOM   7936  C  C    . GLY B 1 207 ? 3.218   4.651  9.498   1.00 8.99   ? 207  GLY B C    1 
ATOM   7937  O  O    . GLY B 1 207 ? 3.810   5.270  10.412  1.00 9.38   ? 207  GLY B O    1 
ATOM   7938  H  H    . GLY B 1 207 ? 4.837   2.204  9.694   1.00 12.23  ? 207  GLY B H    1 
ATOM   7939  H  HA2  . GLY B 1 207 ? 3.086   2.862  8.531   1.00 10.26  ? 207  GLY B HA2  1 
ATOM   7940  H  HA3  . GLY B 1 207 ? 2.245   2.896  9.855   1.00 10.26  ? 207  GLY B HA3  1 
ATOM   7941  N  N    . ILE B 1 208 ? 2.665   5.339  8.488   1.00 8.65   ? 208  ILE B N    1 
ATOM   7942  C  CA   . ILE B 1 208 ? 2.824   6.773  8.405   1.00 9.16   ? 208  ILE B CA   1 
ATOM   7943  C  C    . ILE B 1 208 ? 2.164   7.496  9.558   1.00 7.53   ? 208  ILE B C    1 
ATOM   7944  O  O    . ILE B 1 208 ? 2.573   8.629  9.877   1.00 8.34   ? 208  ILE B O    1 
ATOM   7945  C  CB   . ILE B 1 208 ? 2.346   7.251  6.996   1.00 8.30   ? 208  ILE B CB   1 
ATOM   7946  C  CG1  . ILE B 1 208 ? 2.924   8.597  6.620   1.00 8.67   ? 208  ILE B CG1  1 
ATOM   7947  C  CG2  . ILE B 1 208 ? 0.847   7.090  6.953   1.00 11.93  ? 208  ILE B CG2  1 
ATOM   7948  C  CD1  . ILE B 1 208 ? 4.422   8.557  6.335   1.00 12.25  ? 208  ILE B CD1  1 
ATOM   7949  H  H    . ILE B 1 208 ? 2.213   4.924  7.885   1.00 10.38  ? 208  ILE B H    1 
ATOM   7950  H  HA   . ILE B 1 208 ? 3.785   6.959  8.461   1.00 10.99  ? 208  ILE B HA   1 
ATOM   7951  H  HB   . ILE B 1 208 ? 2.709   6.608  6.351   1.00 9.96   ? 208  ILE B HB   1 
ATOM   7952  H  HG12 . ILE B 1 208 ? 2.463   8.927  5.833   1.00 10.40  ? 208  ILE B HG12 1 
ATOM   7953  H  HG13 . ILE B 1 208 ? 2.759   9.222  7.343   1.00 10.40  ? 208  ILE B HG13 1 
ATOM   7954  H  HG21 . ILE B 1 208 ? 0.613   6.196  7.212   1.00 17.90  ? 208  ILE B HG21 1 
ATOM   7955  H  HG22 . ILE B 1 208 ? 0.533   7.258  6.062   1.00 17.90  ? 208  ILE B HG22 1 
ATOM   7956  H  HG23 . ILE B 1 208 ? 0.441   7.715  7.559   1.00 17.90  ? 208  ILE B HG23 1 
ATOM   7957  H  HD11 . ILE B 1 208 ? 4.728   9.437  6.103   1.00 18.38  ? 208  ILE B HD11 1 
ATOM   7958  H  HD12 . ILE B 1 208 ? 4.593   7.957  5.605   1.00 18.38  ? 208  ILE B HD12 1 
ATOM   7959  H  HD13 . ILE B 1 208 ? 4.889   8.251  7.116   1.00 18.38  ? 208  ILE B HD13 1 
ATOM   7960  N  N    . GLY B 1 209 ? 1.153   6.875  10.169  1.00 6.94   ? 209  GLY B N    1 
ATOM   7961  C  CA   . GLY B 1 209 ? 0.524   7.552  11.314  1.00 10.03  ? 209  GLY B CA   1 
ATOM   7962  C  C    . GLY B 1 209 ? 1.523   7.752  12.446  1.00 8.97   ? 209  GLY B C    1 
ATOM   7963  O  O    . GLY B 1 209 ? 1.705   8.897  12.898  1.00 9.35   ? 209  GLY B O    1 
ATOM   7964  H  H    . GLY B 1 209 ? 0.878   6.104  9.903   1.00 8.32   ? 209  GLY B H    1 
ATOM   7965  H  HA2  . GLY B 1 209 ? 0.181   8.414  11.030  1.00 12.03  ? 209  GLY B HA2  1 
ATOM   7966  H  HA3  . GLY B 1 209 ? -0.223  7.021  11.632  1.00 12.03  ? 209  GLY B HA3  1 
ATOM   7967  N  N    . LYS B 1 210 ? 2.163   6.670  12.866  1.00 8.39   ? 210  LYS B N    1 
ATOM   7968  C  CA   . LYS B 1 210 ? 3.177   6.841  13.922  1.00 7.90   ? 210  LYS B CA   1 
ATOM   7969  C  C    . LYS B 1 210 ? 4.391   7.589  13.436  1.00 9.46   ? 210  LYS B C    1 
ATOM   7970  O  O    . LYS B 1 210 ? 5.024   8.309  14.223  1.00 9.68   ? 210  LYS B O    1 
ATOM   7971  C  CB   . LYS B 1 210 ? 3.504   5.464  14.529  1.00 9.23   ? 210  LYS B CB   1 
ATOM   7972  C  CG   . LYS B 1 210 ? 4.417   5.629  15.747  1.00 16.68  ? 210  LYS B CG   1 
ATOM   7973  C  CD   . LYS B 1 210 ? 3.757   6.503  16.795  1.00 31.02  ? 210  LYS B CD   1 
ATOM   7974  C  CE   . LYS B 1 210 ? 3.868   5.983  18.210  1.00 45.10  ? 210  LYS B CE   1 
ATOM   7975  N  NZ   . LYS B 1 210 ? 5.253   6.012  18.763  1.00 37.23  ? 210  LYS B NZ   1 
ATOM   7976  H  H    . LYS B 1 210 ? 1.992   5.895  12.534  1.00 10.06  ? 210  LYS B H    1 
ATOM   7977  H  HA   . LYS B 1 210 ? 2.770   7.381  14.630  1.00 9.48   ? 210  LYS B HA   1 
ATOM   7978  H  HB2  . LYS B 1 210 ? 2.683   5.022  14.795  1.00 11.08  ? 210  LYS B HB2  1 
ATOM   7979  H  HB3  . LYS B 1 210 ? 3.944   4.911  13.865  1.00 11.08  ? 210  LYS B HB3  1 
ATOM   7980  H  HG2  . LYS B 1 210 ? 4.612   4.758  16.127  1.00 20.02  ? 210  LYS B HG2  1 
ATOM   7981  H  HG3  . LYS B 1 210 ? 5.256   6.031  15.472  1.00 20.02  ? 210  LYS B HG3  1 
ATOM   7982  H  HD2  . LYS B 1 210 ? 4.155   7.386  16.757  1.00 37.23  ? 210  LYS B HD2  1 
ATOM   7983  H  HD3  . LYS B 1 210 ? 2.817   6.596  16.573  1.00 37.23  ? 210  LYS B HD3  1 
ATOM   7984  H  HE2  . LYS B 1 210 ? 3.293   6.514  18.783  1.00 54.13  ? 210  LYS B HE2  1 
ATOM   7985  H  HE3  . LYS B 1 210 ? 3.543   5.070  18.233  1.00 54.13  ? 210  LYS B HE3  1 
ATOM   7986  H  HZ1  . LYS B 1 210 ? 5.247   5.693  19.593  1.00 55.84  ? 210  LYS B HZ1  1 
ATOM   7987  H  HZ2  . LYS B 1 210 ? 5.553   6.850  18.769  1.00 55.84  ? 210  LYS B HZ2  1 
ATOM   7988  H  HZ3  . LYS B 1 210 ? 5.785   5.510  18.256  1.00 55.84  ? 210  LYS B HZ3  1 
ATOM   7989  N  N    . VAL B 1 211 ? 4.777   7.511  12.131  1.00 8.11   ? 211  VAL B N    1 
ATOM   7990  C  CA   . VAL B 1 211 ? 5.848   8.393  11.668  1.00 9.77   ? 211  VAL B CA   1 
ATOM   7991  C  C    . VAL B 1 211 ? 5.543   9.837  11.944  1.00 8.89   ? 211  VAL B C    1 
ATOM   7992  O  O    . VAL B 1 211 ? 6.400   10.597 12.444  1.00 9.00   ? 211  VAL B O    1 
ATOM   7993  C  CB   . VAL B 1 211 ? 6.123   8.176  10.164  1.00 9.93   ? 211  VAL B CB   1 
ATOM   7994  C  CG1  . VAL B 1 211 ? 7.004   9.286  9.579   1.00 10.68  ? 211  VAL B CG1  1 
ATOM   7995  C  CG2  . VAL B 1 211 ? 6.751   6.791  9.938   1.00 9.57   ? 211  VAL B CG2  1 
ATOM   7996  H  H    . VAL B 1 211 ? 4.399   6.957  11.593  1.00 9.73   ? 211  VAL B H    1 
ATOM   7997  H  HA   . VAL B 1 211 ? 6.663   8.159  12.160  1.00 11.72  ? 211  VAL B HA   1 
ATOM   7998  H  HB   . VAL B 1 211 ? 5.263   8.197  9.695   1.00 11.92  ? 211  VAL B HB   1 
ATOM   7999  H  HG11 . VAL B 1 211 ? 6.592   10.138 9.737   1.00 16.01  ? 211  VAL B HG11 1 
ATOM   8000  H  HG12 . VAL B 1 211 ? 7.105   9.149  8.634   1.00 16.01  ? 211  VAL B HG12 1 
ATOM   8001  H  HG13 . VAL B 1 211 ? 7.867   9.265  9.999   1.00 16.01  ? 211  VAL B HG13 1 
ATOM   8002  H  HG21 . VAL B 1 211 ? 6.178   6.116  10.310  1.00 14.36  ? 211  VAL B HG21 1 
ATOM   8003  H  HG22 . VAL B 1 211 ? 7.608   6.754  10.368  1.00 14.36  ? 211  VAL B HG22 1 
ATOM   8004  H  HG23 . VAL B 1 211 ? 6.857   6.637  8.997   1.00 14.36  ? 211  VAL B HG23 1 
ATOM   8005  N  N    . MET B 1 212 ? 4.353   10.285 11.618  1.00 8.85   ? 212  MET B N    1 
ATOM   8006  C  CA   . MET B 1 212 ? 4.036   11.701 11.796  1.00 11.16  ? 212  MET B CA   1 
ATOM   8007  C  C    . MET B 1 212 ? 3.903   12.058 13.285  1.00 9.57   ? 212  MET B C    1 
ATOM   8008  O  O    . MET B 1 212 ? 4.314   13.150 13.692  1.00 10.78  ? 212  MET B O    1 
ATOM   8009  C  CB   . MET B 1 212 ? 2.783   12.076 11.037  1.00 9.56   ? 212  MET B CB   1 
ATOM   8010  C  CG   . MET B 1 212 ? 2.979   12.106 9.511   1.00 9.48   ? 212  MET B CG   1 
ATOM   8011  S  SD   . MET B 1 212 ? 4.483   12.994 9.015   1.00 11.04  ? 212  MET B SD   1 
ATOM   8012  C  CE   . MET B 1 212 ? 4.083   14.665 9.518   1.00 15.24  ? 212  MET B CE   1 
ATOM   8013  H  H    . MET B 1 212 ? 3.762   9.747  11.301  1.00 10.62  ? 212  MET B H    1 
ATOM   8014  H  HA   . MET B 1 212 ? 4.778   12.224 11.426  1.00 13.39  ? 212  MET B HA   1 
ATOM   8015  H  HB2  . MET B 1 212 ? 2.084   11.438 11.251  1.00 11.47  ? 212  MET B HB2  1 
ATOM   8016  H  HB3  . MET B 1 212 ? 2.486   12.950 11.333  1.00 11.47  ? 212  MET B HB3  1 
ATOM   8017  H  HG2  . MET B 1 212 ? 3.025   11.196 9.179   1.00 11.37  ? 212  MET B HG2  1 
ATOM   8018  H  HG3  . MET B 1 212 ? 2.210   12.533 9.102   1.00 11.37  ? 212  MET B HG3  1 
ATOM   8019  H  HE1  . MET B 1 212 ? 4.816   15.247 9.306   1.00 22.86  ? 212  MET B HE1  1 
ATOM   8020  H  HE2  . MET B 1 212 ? 3.921   14.684 10.464  1.00 22.86  ? 212  MET B HE2  1 
ATOM   8021  H  HE3  . MET B 1 212 ? 3.296   14.959 9.053   1.00 22.86  ? 212  MET B HE3  1 
ATOM   8022  N  N    . GLU B 1 213 ? 3.347   11.162 14.054  1.00 8.81   ? 213  GLU B N    1 
ATOM   8023  C  CA   . GLU B 1 213 ? 3.211   11.372 15.501  1.00 10.54  ? 213  GLU B CA   1 
ATOM   8024  C  C    . GLU B 1 213 ? 4.608   11.572 16.086  1.00 11.12  ? 213  GLU B C    1 
ATOM   8025  O  O    . GLU B 1 213 ? 4.865   12.544 16.845  1.00 12.01  ? 213  GLU B O    1 
ATOM   8026  C  CB   . GLU B 1 213 ? 2.477   10.228 16.213  1.00 11.00  ? 213  GLU B CB   1 
ATOM   8027  C  CG   . GLU B 1 213 ? 2.019   10.722 17.601  1.00 15.34  ? 213  GLU B CG   1 
ATOM   8028  C  CD   . GLU B 1 213 ? 1.062   9.790  18.312  1.00 38.23  ? 213  GLU B CD   1 
ATOM   8029  O  OE1  . GLU B 1 213 ? 0.757   8.689  17.798  1.00 30.86  ? 213  GLU B OE1  1 
ATOM   8030  O  OE2  . GLU B 1 213 ? 0.607   10.178 19.415  1.00 44.03  ? 213  GLU B OE2  1 
ATOM   8031  H  H    . GLU B 1 213 ? 3.052   10.433 13.706  1.00 10.57  ? 213  GLU B H    1 
ATOM   8032  H  HA   . GLU B 1 213 ? 2.700   12.197 15.643  1.00 12.65  ? 213  GLU B HA   1 
ATOM   8033  H  HB2  . GLU B 1 213 ? 1.709   9.951  15.690  1.00 13.20  ? 213  GLU B HB2  1 
ATOM   8034  H  HB3  . GLU B 1 213 ? 3.070   9.466  16.312  1.00 13.20  ? 213  GLU B HB3  1 
ATOM   8035  H  HG2  . GLU B 1 213 ? 2.802   10.848 18.160  1.00 18.40  ? 213  GLU B HG2  1 
ATOM   8036  H  HG3  . GLU B 1 213 ? 1.591   11.587 17.497  1.00 18.40  ? 213  GLU B HG3  1 
ATOM   8037  N  N    . GLU B 1 214 ? 5.526   10.684 15.752  1.00 9.62   ? 214  GLU B N    1 
ATOM   8038  C  CA   . GLU B 1 214 ? 6.873   10.749 16.293  1.00 9.52   ? 214  GLU B CA   1 
ATOM   8039  C  C    . GLU B 1 214 ? 7.654   11.928 15.755  1.00 12.56  ? 214  GLU B C    1 
ATOM   8040  O  O    . GLU B 1 214 ? 8.432   12.584 16.463  1.00 13.52  ? 214  GLU B O    1 
ATOM   8041  C  CB   . GLU B 1 214 ? 7.561   9.426  15.977  1.00 8.96   ? 214  GLU B CB   1 
ATOM   8042  C  CG   . GLU B 1 214 ? 7.042   8.287  16.882  1.00 10.56  ? 214  GLU B CG   1 
ATOM   8043  C  CD   . GLU B 1 214 ? 7.948   7.055  16.798  1.00 18.98  ? 214  GLU B CD   1 
ATOM   8044  O  OE1  . GLU B 1 214 ? 9.101   7.156  16.366  1.00 16.30  ? 214  GLU B OE1  1 
ATOM   8045  O  OE2  . GLU B 1 214 ? 7.461   5.944  17.191  1.00 22.35  ? 214  GLU B OE2  1 
ATOM   8046  H  H    . GLU B 1 214 ? 5.323   10.055 15.202  1.00 11.54  ? 214  GLU B H    1 
ATOM   8047  H  HA   . GLU B 1 214 ? 6.811   10.839 17.267  1.00 11.42  ? 214  GLU B HA   1 
ATOM   8048  H  HB2  . GLU B 1 214 ? 7.402   9.195  15.048  1.00 10.75  ? 214  GLU B HB2  1 
ATOM   8049  H  HB3  . GLU B 1 214 ? 8.518   9.523  16.101  1.00 10.75  ? 214  GLU B HB3  1 
ATOM   8050  H  HG2  . GLU B 1 214 ? 7.004   8.597  17.801  1.00 12.67  ? 214  GLU B HG2  1 
ATOM   8051  H  HG3  . GLU B 1 214 ? 6.143   8.044  16.611  1.00 12.67  ? 214  GLU B HG3  1 
ATOM   8052  N  N    . THR B 1 215 ? 7.464   12.263 14.468  1.00 10.36  ? 215  THR B N    1 
ATOM   8053  C  CA   . THR B 1 215 ? 8.113   13.415 13.890  1.00 10.67  ? 215  THR B CA   1 
ATOM   8054  C  C    . THR B 1 215 ? 7.735   14.745 14.546  1.00 10.80  ? 215  THR B C    1 
ATOM   8055  O  O    . THR B 1 215 ? 8.597   15.566 14.870  1.00 10.77  ? 215  THR B O    1 
ATOM   8056  C  CB   . THR B 1 215 ? 7.752   13.557 12.382  1.00 8.19   ? 215  THR B CB   1 
ATOM   8057  O  OG1  . THR B 1 215 ? 8.360   12.504 11.634  1.00 10.27  ? 215  THR B OG1  1 
ATOM   8058  C  CG2  . THR B 1 215 ? 8.317   14.841 11.860  1.00 10.28  ? 215  THR B CG2  1 
ATOM   8059  H  H    . THR B 1 215 ? 6.947   11.781 13.979  1.00 12.43  ? 215  THR B H    1 
ATOM   8060  H  HA   . THR B 1 215 ? 9.083   13.296 13.967  1.00 12.80  ? 215  THR B HA   1 
ATOM   8061  H  HB   . THR B 1 215 ? 6.779   13.540 12.263  1.00 9.82   ? 215  THR B HB   1 
ATOM   8062  H  HG1  . THR B 1 215 ? 8.073   11.781 11.896  1.00 15.41  ? 215  THR B HG1  1 
ATOM   8063  H  HG21 . THR B 1 215 ? 8.094   14.935 10.931  1.00 15.42  ? 215  THR B HG21 1 
ATOM   8064  H  HG22 . THR B 1 215 ? 9.272   14.834 11.960  1.00 15.42  ? 215  THR B HG22 1 
ATOM   8065  H  HG23 . THR B 1 215 ? 7.949   15.577 12.353  1.00 15.42  ? 215  THR B HG23 1 
ATOM   8066  N  N    . LEU B 1 216 ? 6.428   14.955 14.744  1.00 8.46   ? 216  LEU B N    1 
ATOM   8067  C  CA   . LEU B 1 216 ? 5.950   16.249 15.265  1.00 8.17   ? 216  LEU B CA   1 
ATOM   8068  C  C    . LEU B 1 216 ? 6.258   16.280 16.768  1.00 13.83  ? 216  LEU B C    1 
ATOM   8069  O  O    . LEU B 1 216 ? 6.594   17.343 17.279  1.00 14.72  ? 216  LEU B O    1 
ATOM   8070  C  CB   . LEU B 1 216 ? 4.499   16.512 14.960  1.00 13.69  ? 216  LEU B CB   1 
ATOM   8071  C  CG   . LEU B 1 216 ? 4.116   16.538 13.476  1.00 13.15  ? 216  LEU B CG   1 
ATOM   8072  C  CD1  . LEU B 1 216 ? 2.618   16.614 13.272  1.00 14.21  ? 216  LEU B CD1  1 
ATOM   8073  C  CD2  . LEU B 1 216 ? 4.846   17.696 12.787  1.00 15.55  ? 216  LEU B CD2  1 
ATOM   8074  H  H    . LEU B 1 216 ? 5.863   14.331 14.567  1.00 10.15  ? 216  LEU B H    1 
ATOM   8075  H  HA   . LEU B 1 216 ? 6.478   16.956 14.837  1.00 9.80   ? 216  LEU B HA   1 
ATOM   8076  H  HB2  . LEU B 1 216 ? 3.968   15.830 15.400  1.00 16.43  ? 216  LEU B HB2  1 
ATOM   8077  H  HB3  . LEU B 1 216 ? 4.256   17.366 15.352  1.00 16.43  ? 216  LEU B HB3  1 
ATOM   8078  H  HG   . LEU B 1 216 ? 4.431   15.703 13.072  1.00 15.78  ? 216  LEU B HG   1 
ATOM   8079  H  HD11 . LEU B 1 216 ? 2.196   15.876 13.718  1.00 21.32  ? 216  LEU B HD11 1 
ATOM   8080  H  HD12 . LEU B 1 216 ? 2.420   16.577 12.334  1.00 21.32  ? 216  LEU B HD12 1 
ATOM   8081  H  HD13 . LEU B 1 216 ? 2.287   17.439 13.637  1.00 21.32  ? 216  LEU B HD13 1 
ATOM   8082  H  HD21 . LEU B 1 216 ? 5.791   17.613 12.936  1.00 23.32  ? 216  LEU B HD21 1 
ATOM   8083  H  HD22 . LEU B 1 216 ? 4.537   18.530 13.149  1.00 23.32  ? 216  LEU B HD22 1 
ATOM   8084  H  HD23 . LEU B 1 216 ? 4.668   17.671 11.844  1.00 23.32  ? 216  LEU B HD23 1 
ATOM   8085  N  N    . SER B 1 217 ? 6.214   15.203 17.519  1.00 10.10  ? 217  SER B N    1 
ATOM   8086  C  CA   . SER B 1 217 ? 6.603   15.192 18.956  1.00 12.08  ? 217  SER B CA   1 
ATOM   8087  C  C    . SER B 1 217 ? 8.079   15.534 19.056  1.00 15.37  ? 217  SER B C    1 
ATOM   8088  O  O    . SER B 1 217 ? 8.457   16.315 19.970  1.00 18.55  ? 217  SER B O    1 
ATOM   8089  C  CB   . SER B 1 217 ? 6.306   13.881 19.636  1.00 13.90  ? 217  SER B CB   1 
ATOM   8090  O  OG   A SER B 1 217 ? 7.078   12.779 19.294  0.44 18.04  ? 217  SER B OG   1 
ATOM   8091  O  OG   B SER B 1 217 ? 7.035   13.747 20.856  0.56 14.84  ? 217  SER B OG   1 
ATOM   8092  H  H    . SER B 1 217 ? 5.947   14.468 17.162  1.00 12.12  ? 217  SER B H    1 
ATOM   8093  H  HA   . SER B 1 217 ? 6.095   15.894 19.414  1.00 14.49  ? 217  SER B HA   1 
ATOM   8094  N  N    . TYR B 1 218 ? 8.914   15.024 18.154  1.00 12.45  ? 218  TYR B N    1 
ATOM   8095  C  CA   . TYR B 1 218 ? 10.351  15.272 18.174  1.00 11.34  ? 218  TYR B CA   1 
ATOM   8096  C  C    . TYR B 1 218 ? 10.627  16.745 17.880  1.00 13.39  ? 218  TYR B C    1 
ATOM   8097  O  O    . TYR B 1 218 ? 11.495  17.360 18.542  1.00 17.95  ? 218  TYR B O    1 
ATOM   8098  C  CB   . TYR B 1 218 ? 11.043  14.339 17.194  1.00 13.22  ? 218  TYR B CB   1 
ATOM   8099  C  CG   . TYR B 1 218 ? 12.521  14.528 16.998  1.00 17.39  ? 218  TYR B CG   1 
ATOM   8100  C  CD1  . TYR B 1 218 ? 13.447  13.844 17.769  1.00 19.31  ? 218  TYR B CD1  1 
ATOM   8101  C  CD2  . TYR B 1 218 ? 12.991  15.402 16.025  1.00 10.21  ? 218  TYR B CD2  1 
ATOM   8102  C  CE1  . TYR B 1 218 ? 14.813  14.017 17.596  1.00 15.30  ? 218  TYR B CE1  1 
ATOM   8103  C  CE2  . TYR B 1 218 ? 14.345  15.553 15.864  1.00 11.07  ? 218  TYR B CE2  1 
ATOM   8104  C  CZ   . TYR B 1 218 ? 15.264  14.892 16.612  1.00 11.93  ? 218  TYR B CZ   1 
ATOM   8105  O  OH   . TYR B 1 218 ? 16.623  14.957 16.540  1.00 13.27  ? 218  TYR B OH   1 
ATOM   8106  H  H    . TYR B 1 218 ? 8.592   14.527 17.531  1.00 14.94  ? 218  TYR B H    1 
ATOM   8107  H  HA   . TYR B 1 218 ? 10.683  15.072 19.074  1.00 13.60  ? 218  TYR B HA   1 
ATOM   8108  H  HB2  . TYR B 1 218 ? 10.893  13.428 17.491  1.00 15.87  ? 218  TYR B HB2  1 
ATOM   8109  H  HB3  . TYR B 1 218 ? 10.611  14.436 16.331  1.00 15.87  ? 218  TYR B HB3  1 
ATOM   8110  H  HD1  . TYR B 1 218 ? 13.145  13.253 18.420  1.00 23.18  ? 218  TYR B HD1  1 
ATOM   8111  H  HD2  . TYR B 1 218 ? 12.396  15.877 15.491  1.00 12.26  ? 218  TYR B HD2  1 
ATOM   8112  H  HE1  . TYR B 1 218 ? 15.419  13.556 18.130  1.00 18.36  ? 218  TYR B HE1  1 
ATOM   8113  H  HE2  . TYR B 1 218 ? 14.648  16.139 15.208  1.00 13.29  ? 218  TYR B HE2  1 
ATOM   8114  H  HH   . TYR B 1 218 ? 16.840  15.486 15.952  1.00 19.90  ? 218  TYR B HH   1 
ATOM   8115  N  N    . LEU B 1 219 ? 9.963   17.372 16.928  1.00 13.25  ? 219  LEU B N    1 
ATOM   8116  C  CA   . LEU B 1 219 ? 10.225  18.752 16.567  1.00 15.74  ? 219  LEU B CA   1 
ATOM   8117  C  C    . LEU B 1 219 ? 9.495   19.768 17.432  1.00 17.16  ? 219  LEU B C    1 
ATOM   8118  O  O    . LEU B 1 219 ? 10.024  20.888 17.607  1.00 16.90  ? 219  LEU B O    1 
ATOM   8119  C  CB   . LEU B 1 219 ? 9.852   18.970 15.072  1.00 11.20  ? 219  LEU B CB   1 
ATOM   8120  C  CG   . LEU B 1 219 ? 10.814  18.314 14.105  1.00 12.71  ? 219  LEU B CG   1 
ATOM   8121  C  CD1  . LEU B 1 219 ? 10.251  18.393 12.696  1.00 19.01  ? 219  LEU B CD1  1 
ATOM   8122  C  CD2  . LEU B 1 219 ? 12.185  18.985 14.127  1.00 17.41  ? 219  LEU B CD2  1 
ATOM   8123  H  H    . LEU B 1 219 ? 9.349   16.944 16.505  1.00 15.90  ? 219  LEU B H    1 
ATOM   8124  H  HA   . LEU B 1 219 ? 11.188  18.911 16.663  1.00 18.89  ? 219  LEU B HA   1 
ATOM   8125  H  HB2  . LEU B 1 219 ? 8.962   18.616 14.917  1.00 13.44  ? 219  LEU B HB2  1 
ATOM   8126  H  HB3  . LEU B 1 219 ? 9.826   19.922 14.891  1.00 13.44  ? 219  LEU B HB3  1 
ATOM   8127  H  HG   . LEU B 1 219 ? 10.919  17.372 14.352  1.00 15.25  ? 219  LEU B HG   1 
ATOM   8128  H  HD11 . LEU B 1 219 ? 10.859  17.969 12.085  1.00 28.51  ? 219  LEU B HD11 1 
ATOM   8129  H  HD12 . LEU B 1 219 ? 10.138  19.313 12.448  1.00 28.51  ? 219  LEU B HD12 1 
ATOM   8130  H  HD13 . LEU B 1 219 ? 9.403   17.945 12.666  1.00 28.51  ? 219  LEU B HD13 1 
ATOM   8131  H  HD21 . LEU B 1 219 ? 12.769  18.541 13.508  1.00 26.11  ? 219  LEU B HD21 1 
ATOM   8132  H  HD22 . LEU B 1 219 ? 12.554  18.929 15.012  1.00 26.11  ? 219  LEU B HD22 1 
ATOM   8133  H  HD23 . LEU B 1 219 ? 12.094  19.908 13.876  1.00 26.11  ? 219  LEU B HD23 1 
ATOM   8134  N  N    . LEU B 1 220 ? 8.331   19.465 17.980  1.00 15.57  ? 220  LEU B N    1 
ATOM   8135  C  CA   . LEU B 1 220 ? 7.451   20.407 18.658  1.00 15.08  ? 220  LEU B CA   1 
ATOM   8136  C  C    . LEU B 1 220 ? 7.199   20.063 20.127  1.00 21.60  ? 220  LEU B C    1 
ATOM   8137  O  O    . LEU B 1 220 ? 6.529   20.877 20.782  1.00 23.59  ? 220  LEU B O    1 
ATOM   8138  C  CB   . LEU B 1 220 ? 6.069   20.515 17.989  1.00 17.65  ? 220  LEU B CB   1 
ATOM   8139  C  CG   . LEU B 1 220 ? 6.097   20.904 16.505  1.00 17.07  ? 220  LEU B CG   1 
ATOM   8140  C  CD1  . LEU B 1 220 ? 4.781   20.677 15.806  1.00 20.88  ? 220  LEU B CD1  1 
ATOM   8141  C  CD2  . LEU B 1 220 ? 6.574   22.340 16.403  1.00 22.47  ? 220  LEU B CD2  1 
ATOM   8142  H  H    . LEU B 1 220 ? 8.073   18.646 17.932  1.00 18.68  ? 220  LEU B H    1 
ATOM   8143  H  HA   . LEU B 1 220 ? 7.872   21.291 18.624  1.00 18.09  ? 220  LEU B HA   1 
ATOM   8144  H  HB2  . LEU B 1 220 ? 5.617   19.660 18.075  1.00 21.18  ? 220  LEU B HB2  1 
ATOM   8145  H  HB3  . LEU B 1 220 ? 5.543   21.173 18.470  1.00 21.18  ? 220  LEU B HB3  1 
ATOM   8146  H  HG   . LEU B 1 220 ? 6.766   20.339 16.065  1.00 20.49  ? 220  LEU B HG   1 
ATOM   8147  H  HD11 . LEU B 1 220 ? 4.527   19.756 15.894  1.00 31.32  ? 220  LEU B HD11 1 
ATOM   8148  H  HD12 . LEU B 1 220 ? 4.872   20.896 14.876  1.00 31.32  ? 220  LEU B HD12 1 
ATOM   8149  H  HD13 . LEU B 1 220 ? 4.108   21.235 16.202  1.00 31.32  ? 220  LEU B HD13 1 
ATOM   8150  H  HD21 . LEU B 1 220 ? 7.398   22.438 16.886  1.00 33.70  ? 220  LEU B HD21 1 
ATOM   8151  H  HD22 . LEU B 1 220 ? 5.912   22.924 16.779  1.00 33.70  ? 220  LEU B HD22 1 
ATOM   8152  H  HD23 . LEU B 1 220 ? 6.714   22.566 15.481  1.00 33.70  ? 220  LEU B HD23 1 
ATOM   8153  N  N    . GLY B 1 221 ? 7.682   18.941 20.611  1.00 16.28  ? 221  GLY B N    1 
ATOM   8154  C  CA   . GLY B 1 221 ? 7.238   18.499 21.940  1.00 19.99  ? 221  GLY B CA   1 
ATOM   8155  C  C    . GLY B 1 221 ? 7.679   19.550 22.945  1.00 27.77  ? 221  GLY B C    1 
ATOM   8156  O  O    . GLY B 1 221 ? 6.905   19.897 23.832  1.00 62.78  ? 221  GLY B O    1 
ATOM   8157  H  H    . GLY B 1 221 ? 8.246   18.474 20.159  1.00 19.54  ? 221  GLY B H    1 
ATOM   8158  H  HA2  . GLY B 1 221 ? 6.273   18.404 21.957  1.00 23.99  ? 221  GLY B HA2  1 
ATOM   8159  H  HA3  . GLY B 1 221 ? 7.635   17.641 22.158  1.00 23.99  ? 221  GLY B HA3  1 
ATOM   8160  N  N    . ARG B 1 222 ? 8.925   20.016 22.811  1.00 30.95  ? 222  ARG B N    1 
ATOM   8161  C  CA   . ARG B 1 222 ? 9.529   20.939 23.769  1.00 45.27  ? 222  ARG B CA   1 
ATOM   8162  C  C    . ARG B 1 222 ? 9.073   22.394 23.675  1.00 44.44  ? 222  ARG B C    1 
ATOM   8163  O  O    . ARG B 1 222 ? 8.707   22.970 24.688  1.00 66.91  ? 222  ARG B O    1 
ATOM   8164  C  CB   . ARG B 1 222 ? 11.026  20.809 23.650  1.00 48.40  ? 222  ARG B CB   1 
ATOM   8165  C  CG   . ARG B 1 222 ? 11.528  19.626 24.438  0.75 52.29  ? 222  ARG B CG   1 
ATOM   8166  C  CD   . ARG B 1 222 ? 12.679  20.069 25.342  0.75 56.31  ? 222  ARG B CD   1 
ATOM   8167  N  NE   . ARG B 1 222 ? 13.943  19.894 24.640  0.75 57.37  ? 222  ARG B NE   1 
ATOM   8168  C  CZ   . ARG B 1 222 ? 15.023  20.644 24.686  0.75 56.77  ? 222  ARG B CZ   1 
ATOM   8169  N  NH1  . ARG B 1 222 ? 15.068  21.726 25.452  0.75 40.49  ? 222  ARG B NH1  1 
ATOM   8170  N  NH2  . ARG B 1 222 ? 16.087  20.314 23.963  0.75 60.80  ? 222  ARG B NH2  1 
ATOM   8171  H  H    . ARG B 1 222 ? 9.340   19.840 22.075  1.00 37.14  ? 222  ARG B H    1 
ATOM   8172  H  HA   . ARG B 1 222 ? 9.246   20.613 24.658  1.00 54.32  ? 222  ARG B HA   1 
ATOM   8173  H  HB2  . ARG B 1 222 ? 11.276  20.751 22.718  1.00 58.08  ? 222  ARG B HB2  1 
ATOM   8174  H  HB3  . ARG B 1 222 ? 11.434  21.648 23.998  1.00 58.08  ? 222  ARG B HB3  1 
ATOM   8175  H  HG2  . ARG B 1 222 ? 10.806  19.263 24.974  0.75 62.75  ? 222  ARG B HG2  1 
ATOM   8176  H  HG3  . ARG B 1 222 ? 11.825  18.937 23.823  0.75 62.75  ? 222  ARG B HG3  1 
ATOM   8177  H  HD2  . ARG B 1 222 ? 12.563  20.961 25.617  0.75 67.58  ? 222  ARG B HD2  1 
ATOM   8178  H  HD3  . ARG B 1 222 ? 12.683  19.483 26.137  0.75 67.58  ? 222  ARG B HD3  1 
ATOM   8179  H  HE   . ARG B 1 222 ? 13.992  19.215 24.114  0.75 68.85  ? 222  ARG B HE   1 
ATOM   8180  H  HH11 . ARG B 1 222 ? 14.428  21.956 25.939  0.75 48.58  ? 222  ARG B HH11 1 
ATOM   8181  H  HH12 . ARG B 1 222 ? 15.818  22.197 25.462  0.75 48.58  ? 222  ARG B HH12 1 
ATOM   8182  H  HH21 . ARG B 1 222 ? 16.002  19.582 23.438  0.75 72.97  ? 222  ARG B HH21 1 
ATOM   8183  H  HH22 . ARG B 1 222 ? 16.777  20.751 23.938  0.75 72.97  ? 222  ARG B HH22 1 
ATOM   8184  N  N    . LYS B 1 223 ? 9.078   22.997 22.496  1.00 27.68  ? 223  LYS B N    1 
ATOM   8185  C  CA   . LYS B 1 223 ? 8.572   24.337 22.269  1.00 42.00  ? 223  LYS B CA   1 
ATOM   8186  C  C    . LYS B 1 223 ? 7.769   24.352 20.967  1.00 32.58  ? 223  LYS B C    1 
ATOM   8187  O  O    . LYS B 1 223 ? 8.212   23.679 20.038  1.00 29.51  ? 223  LYS B O    1 
ATOM   8188  C  CB   . LYS B 1 223 ? 9.689   25.376 22.155  1.00 48.84  ? 223  LYS B CB   1 
ATOM   8189  C  CG   . LYS B 1 223 ? 10.643  25.514 23.319  1.00 53.20  ? 223  LYS B CG   1 
ATOM   8190  C  CD   . LYS B 1 223 ? 10.880  26.964 23.712  1.00 50.93  ? 223  LYS B CD   1 
ATOM   8191  C  CE   . LYS B 1 223 ? 11.645  27.107 25.015  1.00 43.02  ? 223  LYS B CE   1 
ATOM   8192  N  NZ   . LYS B 1 223 ? 10.983  26.455 26.182  1.00 29.53  ? 223  LYS B NZ   1 
ATOM   8193  H  H    . LYS B 1 223 ? 9.401   22.569 21.824  1.00 33.22  ? 223  LYS B H    1 
ATOM   8194  H  HA   . LYS B 1 223 ? 7.981   24.585 23.011  1.00 50.40  ? 223  LYS B HA   1 
ATOM   8195  H  HB2  . LYS B 1 223 ? 10.212  25.165 21.365  1.00 58.61  ? 223  LYS B HB2  1 
ATOM   8196  H  HB3  . LYS B 1 223 ? 9.277   26.240 22.003  1.00 58.61  ? 223  LYS B HB3  1 
ATOM   8197  H  HG2  . LYS B 1 223 ? 10.284  25.033 24.082  1.00 63.84  ? 223  LYS B HG2  1 
ATOM   8198  H  HG3  . LYS B 1 223 ? 11.491  25.107 23.084  1.00 63.84  ? 223  LYS B HG3  1 
ATOM   8199  H  HD2  . LYS B 1 223 ? 11.375  27.406 23.005  1.00 61.12  ? 223  LYS B HD2  1 
ATOM   8200  H  HD3  . LYS B 1 223 ? 10.023  27.412 23.799  1.00 61.12  ? 223  LYS B HD3  1 
ATOM   8201  H  HE2  . LYS B 1 223 ? 12.528  26.721 24.901  1.00 51.63  ? 223  LYS B HE2  1 
ATOM   8202  H  HE3  . LYS B 1 223 ? 11.759  28.050 25.208  1.00 51.63  ? 223  LYS B HE3  1 
ATOM   8203  H  HZ1  . LYS B 1 223 ? 11.489  26.560 26.907  1.00 44.29  ? 223  LYS B HZ1  1 
ATOM   8204  H  HZ2  . LYS B 1 223 ? 10.878  25.587 26.017  1.00 44.29  ? 223  LYS B HZ2  1 
ATOM   8205  H  HZ3  . LYS B 1 223 ? 10.187  26.829 26.319  1.00 44.29  ? 223  LYS B HZ3  1 
ATOM   8206  N  N    . LYS B 1 224 ? 6.663   25.083 20.881  1.00 26.54  ? 224  LYS B N    1 
ATOM   8207  C  CA   . LYS B 1 224 ? 6.110   25.339 19.547  1.00 27.27  ? 224  LYS B CA   1 
ATOM   8208  C  C    . LYS B 1 224 ? 7.101   26.190 18.758  1.00 27.42  ? 224  LYS B C    1 
ATOM   8209  O  O    . LYS B 1 224 ? 7.701   27.130 19.288  1.00 26.08  ? 224  LYS B O    1 
ATOM   8210  C  CB   . LYS B 1 224 ? 4.766   26.063 19.575  1.00 26.34  ? 224  LYS B CB   1 
ATOM   8211  C  CG   . LYS B 1 224 ? 3.611   25.219 20.105  0.89 27.62  ? 224  LYS B CG   1 
ATOM   8212  C  CD   . LYS B 1 224 ? 2.309   26.011 19.975  0.89 38.02  ? 224  LYS B CD   1 
ATOM   8213  C  CE   . LYS B 1 224 ? 1.904   26.544 21.342  0.89 51.03  ? 224  LYS B CE   1 
ATOM   8214  N  NZ   . LYS B 1 224 ? 3.033   27.372 21.986  0.89 59.05  ? 224  LYS B NZ   1 
ATOM   8215  H  H    . LYS B 1 224 ? 6.284   25.397 21.586  1.00 31.85  ? 224  LYS B H    1 
ATOM   8216  H  HA   . LYS B 1 224 ? 5.995   24.482 19.086  1.00 32.72  ? 224  LYS B HA   1 
ATOM   8217  H  HB2  . LYS B 1 224 ? 4.852   26.855 20.128  1.00 31.60  ? 224  LYS B HB2  1 
ATOM   8218  H  HB3  . LYS B 1 224 ? 4.552   26.355 18.676  1.00 31.60  ? 224  LYS B HB3  1 
ATOM   8219  H  HG2  . LYS B 1 224 ? 3.546   24.395 19.598  0.89 33.14  ? 224  LYS B HG2  1 
ATOM   8220  H  HG3  . LYS B 1 224 ? 3.767   24.993 21.035  0.89 33.14  ? 224  LYS B HG3  1 
ATOM   8221  H  HD2  . LYS B 1 224 ? 2.433   26.750 19.359  0.89 45.62  ? 224  LYS B HD2  1 
ATOM   8222  H  HD3  . LYS B 1 224 ? 1.609   25.438 19.625  0.89 45.62  ? 224  LYS B HD3  1 
ATOM   8223  H  HE2  . LYS B 1 224 ? 1.113   27.097 21.249  0.89 61.24  ? 224  LYS B HE2  1 
ATOM   8224  H  HE3  . LYS B 1 224 ? 1.682   25.799 21.922  0.89 61.24  ? 224  LYS B HE3  1 
ATOM   8225  H  HZ1  . LYS B 1 224 ? 2.870   27.469 22.856  0.89 88.57  ? 224  LYS B HZ1  1 
ATOM   8226  H  HZ2  . LYS B 1 224 ? 3.070   28.173 21.600  0.89 88.57  ? 224  LYS B HZ2  1 
ATOM   8227  H  HZ3  . LYS B 1 224 ? 3.809   26.952 21.874  0.89 88.57  ? 224  LYS B HZ3  1 
ATOM   8228  N  N    . ARG B 1 225 ? 7.308   25.895 17.483  1.00 20.33  ? 225  ARG B N    1 
ATOM   8229  C  CA   . ARG B 1 225 ? 8.166   26.764 16.668  1.00 18.07  ? 225  ARG B CA   1 
ATOM   8230  C  C    . ARG B 1 225 ? 7.774   26.525 15.217  1.00 18.40  ? 225  ARG B C    1 
ATOM   8231  O  O    . ARG B 1 225 ? 7.071   25.559 14.908  1.00 18.60  ? 225  ARG B O    1 
ATOM   8232  C  CB   . ARG B 1 225 ? 9.635   26.556 16.974  1.00 22.27  ? 225  ARG B CB   1 
ATOM   8233  C  CG   . ARG B 1 225 ? 10.150  25.168 17.184  1.00 19.39  ? 225  ARG B CG   1 
ATOM   8234  C  CD   . ARG B 1 225 ? 10.202  24.316 15.894  1.00 24.92  ? 225  ARG B CD   1 
ATOM   8235  N  NE   . ARG B 1 225 ? 10.962  23.151 16.330  1.00 21.22  ? 225  ARG B NE   1 
ATOM   8236  C  CZ   . ARG B 1 225 ? 12.287  23.026 16.350  1.00 15.94  ? 225  ARG B CZ   1 
ATOM   8237  N  NH1  . ARG B 1 225 ? 13.057  24.008 15.931  1.00 29.65  ? 225  ARG B NH1  1 
ATOM   8238  N  NH2  . ARG B 1 225 ? 12.783  21.885 16.802  1.00 14.48  ? 225  ARG B NH2  1 
ATOM   8239  H  H    . ARG B 1 225 ? 6.943   25.199 17.135  1.00 24.40  ? 225  ARG B H    1 
ATOM   8240  H  HA   . ARG B 1 225 ? 7.944   27.693 16.888  1.00 21.68  ? 225  ARG B HA   1 
ATOM   8241  H  HB2  . ARG B 1 225 ? 10.142  26.948 16.245  1.00 26.73  ? 225  ARG B HB2  1 
ATOM   8242  H  HB3  . ARG B 1 225 ? 9.842   27.069 17.771  1.00 26.73  ? 225  ARG B HB3  1 
ATOM   8243  H  HG2  . ARG B 1 225 ? 11.043  25.220 17.560  1.00 23.27  ? 225  ARG B HG2  1 
ATOM   8244  H  HG3  . ARG B 1 225 ? 9.584   24.720 17.832  1.00 23.27  ? 225  ARG B HG3  1 
ATOM   8245  H  HD2  . ARG B 1 225 ? 9.312   24.067 15.599  1.00 29.90  ? 225  ARG B HD2  1 
ATOM   8246  H  HD3  . ARG B 1 225 ? 10.657  24.786 15.178  1.00 29.90  ? 225  ARG B HD3  1 
ATOM   8247  H  HE   . ARG B 1 225 ? 10.507  22.474 16.602  1.00 25.46  ? 225  ARG B HE   1 
ATOM   8248  H  HH11 . ARG B 1 225 ? 13.912  23.919 15.944  1.00 35.58  ? 225  ARG B HH11 1 
ATOM   8249  H  HH12 . ARG B 1 225 ? 12.705  24.738 15.643  1.00 35.58  ? 225  ARG B HH12 1 
ATOM   8250  H  HH21 . ARG B 1 225 ? 13.634  21.766 16.827  1.00 17.37  ? 225  ARG B HH21 1 
ATOM   8251  H  HH22 . ARG B 1 225 ? 12.253  21.262 17.069  1.00 17.37  ? 225  ARG B HH22 1 
ATOM   8252  N  N    . PRO B 1 226 ? 8.113   27.418 14.322  1.00 15.12  ? 226  PRO B N    1 
ATOM   8253  C  CA   . PRO B 1 226 ? 7.726   27.320 12.926  1.00 14.63  ? 226  PRO B CA   1 
ATOM   8254  C  C    . PRO B 1 226 ? 8.337   26.106 12.217  1.00 10.81  ? 226  PRO B C    1 
ATOM   8255  O  O    . PRO B 1 226 ? 9.450   25.721 12.472  1.00 14.38  ? 226  PRO B O    1 
ATOM   8256  C  CB   . PRO B 1 226 ? 8.289   28.582 12.294  1.00 17.80  ? 226  PRO B CB   1 
ATOM   8257  C  CG   . PRO B 1 226 ? 8.432   29.549 13.431  1.00 19.70  ? 226  PRO B CG   1 
ATOM   8258  C  CD   . PRO B 1 226 ? 8.843   28.681 14.589  1.00 15.03  ? 226  PRO B CD   1 
ATOM   8259  H  HA   . PRO B 1 226 ? 6.749   27.305 12.845  1.00 17.56  ? 226  PRO B HA   1 
ATOM   8260  H  HB2  . PRO B 1 226 ? 9.149   28.407 11.881  1.00 21.36  ? 226  PRO B HB2  1 
ATOM   8261  H  HB3  . PRO B 1 226 ? 7.683   28.930 11.621  1.00 21.36  ? 226  PRO B HB3  1 
ATOM   8262  H  HG2  . PRO B 1 226 ? 9.110   30.215 13.237  1.00 23.64  ? 226  PRO B HG2  1 
ATOM   8263  H  HG3  . PRO B 1 226 ? 7.592   29.998 13.614  1.00 23.64  ? 226  PRO B HG3  1 
ATOM   8264  H  HD2  . PRO B 1 226 ? 9.803   28.537 14.597  1.00 18.04  ? 226  PRO B HD2  1 
ATOM   8265  H  HD3  . PRO B 1 226 ? 8.573   29.072 15.434  1.00 18.04  ? 226  PRO B HD3  1 
ATOM   8266  N  N    . ILE B 1 227 ? 7.491   25.589 11.334  1.00 13.16  ? 227  ILE B N    1 
ATOM   8267  C  CA   . ILE B 1 227 ? 7.890   24.440 10.522  1.00 13.37  ? 227  ILE B CA   1 
ATOM   8268  C  C    . ILE B 1 227 ? 8.159   24.834 9.077   1.00 10.96  ? 227  ILE B C    1 
ATOM   8269  O  O    . ILE B 1 227 ? 7.392   25.529 8.407   1.00 13.66  ? 227  ILE B O    1 
ATOM   8270  C  CB   . ILE B 1 227 ? 6.833   23.314 10.592  1.00 15.65  ? 227  ILE B CB   1 
ATOM   8271  C  CG1  . ILE B 1 227 ? 6.596   22.778 12.007  1.00 14.25  ? 227  ILE B CG1  1 
ATOM   8272  C  CG2  . ILE B 1 227 ? 7.186   22.169 9.640   1.00 15.20  ? 227  ILE B CG2  1 
ATOM   8273  C  CD1  . ILE B 1 227 ? 7.848   22.189 12.650  1.00 18.03  ? 227  ILE B CD1  1 
ATOM   8274  H  H    . ILE B 1 227 ? 6.707   25.930 11.239  1.00 15.80  ? 227  ILE B H    1 
ATOM   8275  H  HA   . ILE B 1 227 ? 8.726   24.088 10.895  1.00 16.04  ? 227  ILE B HA   1 
ATOM   8276  H  HB   . ILE B 1 227 ? 5.985   23.695 10.283  1.00 18.78  ? 227  ILE B HB   1 
ATOM   8277  H  HG12 . ILE B 1 227 ? 6.266   23.499 12.565  1.00 17.10  ? 227  ILE B HG12 1 
ATOM   8278  H  HG13 . ILE B 1 227 ? 5.910   22.093 11.972  1.00 17.10  ? 227  ILE B HG13 1 
ATOM   8279  H  HG21 . ILE B 1 227 ? 7.322   22.518 8.756   1.00 22.79  ? 227  ILE B HG21 1 
ATOM   8280  H  HG22 . ILE B 1 227 ? 6.469   21.531 9.626   1.00 22.79  ? 227  ILE B HG22 1 
ATOM   8281  H  HG23 . ILE B 1 227 ? 7.991   21.740 9.941   1.00 22.79  ? 227  ILE B HG23 1 
ATOM   8282  H  HD11 . ILE B 1 227 ? 7.637   21.879 13.534  1.00 27.05  ? 227  ILE B HD11 1 
ATOM   8283  H  HD12 . ILE B 1 227 ? 8.529   22.863 12.701  1.00 27.05  ? 227  ILE B HD12 1 
ATOM   8284  H  HD13 . ILE B 1 227 ? 8.164   21.454 12.121  1.00 27.05  ? 227  ILE B HD13 1 
ATOM   8285  N  N    . HIS B 1 228 ? 9.297   24.341 8.584   1.00 13.41  ? 228  HIS B N    1 
ATOM   8286  C  CA   . HIS B 1 228 ? 9.674   24.410 7.184   1.00 11.76  ? 228  HIS B CA   1 
ATOM   8287  C  C    . HIS B 1 228 ? 9.573   22.993 6.582   1.00 10.73  ? 228  HIS B C    1 
ATOM   8288  O  O    . HIS B 1 228 ? 10.294  22.121 7.014   1.00 11.46  ? 228  HIS B O    1 
ATOM   8289  C  CB   . HIS B 1 228 ? 11.074  24.980 6.954   1.00 11.66  ? 228  HIS B CB   1 
ATOM   8290  C  CG   . HIS B 1 228 ? 11.416  25.181 5.490   1.00 12.04  ? 228  HIS B CG   1 
ATOM   8291  N  ND1  . HIS B 1 228 ? 11.391  26.335 4.770   1.00 20.11  ? 228  HIS B ND1  1 
ATOM   8292  C  CD2  . HIS B 1 228 ? 11.752  24.306 4.510   1.00 12.37  ? 228  HIS B CD2  1 
ATOM   8293  C  CE1  . HIS B 1 228 ? 11.699  26.267 3.515   1.00 18.05  ? 228  HIS B CE1  1 
ATOM   8294  N  NE2  . HIS B 1 228 ? 11.932  24.998 3.321   1.00 15.07  ? 228  HIS B NE2  1 
ATOM   8295  H  H    . HIS B 1 228 ? 9.840   23.958 9.130   1.00 16.09  ? 228  HIS B H    1 
ATOM   8296  H  HA   . HIS B 1 228 ? 9.030   24.986 6.722   1.00 14.11  ? 228  HIS B HA   1 
ATOM   8297  H  HB2  . HIS B 1 228 ? 11.144  25.833 7.411   1.00 13.99  ? 228  HIS B HB2  1 
ATOM   8298  H  HB3  . HIS B 1 228 ? 11.725  24.380 7.349   1.00 13.99  ? 228  HIS B HB3  1 
ATOM   8299  H  HD1  . HIS B 1 228 ? 11.177  27.083 5.136   1.00 24.14  ? 228  HIS B HD1  1 
ATOM   8300  H  HD2  . HIS B 1 228 ? 11.846  23.387 4.618   1.00 14.84  ? 228  HIS B HD2  1 
ATOM   8301  H  HE1  . HIS B 1 228 ? 11.744  26.960 2.897   1.00 21.66  ? 228  HIS B HE1  1 
ATOM   8302  N  N    . LEU B 1 229 ? 8.686   22.807 5.643   1.00 12.78  ? 229  LEU B N    1 
ATOM   8303  C  CA   . LEU B 1 229 ? 8.569   21.561 4.876   1.00 12.07  ? 229  LEU B CA   1 
ATOM   8304  C  C    . LEU B 1 229 ? 9.284   21.709 3.530   1.00 9.58   ? 229  LEU B C    1 
ATOM   8305  O  O    . LEU B 1 229 ? 8.815   22.498 2.692   1.00 12.30  ? 229  LEU B O    1 
ATOM   8306  C  CB   . LEU B 1 229 ? 7.095   21.142 4.763   1.00 11.63  ? 229  LEU B CB   1 
ATOM   8307  C  CG   . LEU B 1 229 ? 6.820   19.958 3.821   1.00 10.11  ? 229  LEU B CG   1 
ATOM   8308  C  CD1  . LEU B 1 229 ? 7.527   18.695 4.326   1.00 11.60  ? 229  LEU B CD1  1 
ATOM   8309  C  CD2  . LEU B 1 229 ? 5.337   19.717 3.654   1.00 13.91  ? 229  LEU B CD2  1 
ATOM   8310  H  H    . LEU B 1 229 ? 8.141   23.449 5.463   1.00 15.34  ? 229  LEU B H    1 
ATOM   8311  H  HA   . LEU B 1 229 ? 9.035   20.862 5.381   1.00 14.48  ? 229  LEU B HA   1 
ATOM   8312  H  HB2  . LEU B 1 229 ? 6.771   20.912 5.648   1.00 13.95  ? 229  LEU B HB2  1 
ATOM   8313  H  HB3  . LEU B 1 229 ? 6.581   21.905 4.454   1.00 13.95  ? 229  LEU B HB3  1 
ATOM   8314  H  HG   . LEU B 1 229 ? 7.191   20.180 2.941   1.00 12.13  ? 229  LEU B HG   1 
ATOM   8315  H  HD11 . LEU B 1 229 ? 8.465   18.871 4.424   1.00 17.40  ? 229  LEU B HD11 1 
ATOM   8316  H  HD12 . LEU B 1 229 ? 7.399   17.982 3.695   1.00 17.40  ? 229  LEU B HD12 1 
ATOM   8317  H  HD13 . LEU B 1 229 ? 7.158   18.440 5.175   1.00 17.40  ? 229  LEU B HD13 1 
ATOM   8318  H  HD21 . LEU B 1 229 ? 4.915   20.522 3.344   1.00 20.87  ? 229  LEU B HD21 1 
ATOM   8319  H  HD22 . LEU B 1 229 ? 4.958   19.461 4.497   1.00 20.87  ? 229  LEU B HD22 1 
ATOM   8320  H  HD23 . LEU B 1 229 ? 5.197   19.016 3.013   1.00 20.87  ? 229  LEU B HD23 1 
ATOM   8321  N  N    . SER B 1 230 ? 10.354  20.930 3.320   1.00 10.68  ? 230  SER B N    1 
ATOM   8322  C  CA   . SER B 1 230 ? 10.985  20.872 1.983   1.00 11.65  ? 230  SER B CA   1 
ATOM   8323  C  C    . SER B 1 230 ? 10.645  19.535 1.365   1.00 10.81  ? 230  SER B C    1 
ATOM   8324  O  O    . SER B 1 230 ? 11.085  18.443 1.743   1.00 10.97  ? 230  SER B O    1 
ATOM   8325  C  CB   . SER B 1 230 ? 12.485  21.063 2.110   1.00 13.90  ? 230  SER B CB   1 
ATOM   8326  O  OG   . SER B 1 230 ? 13.044  21.485 0.853   1.00 12.73  ? 230  SER B OG   1 
ATOM   8327  H  H    . SER B 1 230 ? 10.674  20.461 3.966   1.00 12.82  ? 230  SER B H    1 
ATOM   8328  H  HA   . SER B 1 230 ? 10.617  21.587 1.423   1.00 13.99  ? 230  SER B HA   1 
ATOM   8329  H  HB2  . SER B 1 230 ? 12.672  21.730 2.789   1.00 16.68  ? 230  SER B HB2  1 
ATOM   8330  H  HB3  . SER B 1 230 ? 12.897  20.229 2.385   1.00 16.68  ? 230  SER B HB3  1 
ATOM   8331  H  HG   . SER B 1 230 ? 12.705  22.197 0.629   1.00 19.10  ? 230  SER B HG   1 
ATOM   8332  N  N    . PHE B 1 231 ? 9.770   19.584 0.360   1.00 12.61  ? 231  PHE B N    1 
ATOM   8333  C  CA   . PHE B 1 231 ? 9.233   18.403 -0.277  1.00 12.13  ? 231  PHE B CA   1 
ATOM   8334  C  C    . PHE B 1 231 ? 9.818   18.185 -1.674  1.00 10.10  ? 231  PHE B C    1 
ATOM   8335  O  O    . PHE B 1 231 ? 9.507   19.039 -2.547  1.00 12.58  ? 231  PHE B O    1 
ATOM   8336  C  CB   . PHE B 1 231 ? 7.716   18.581 -0.368  1.00 13.70  ? 231  PHE B CB   1 
ATOM   8337  C  CG   . PHE B 1 231 ? 6.913   17.321 -0.506  1.00 18.11  ? 231  PHE B CG   1 
ATOM   8338  C  CD1  . PHE B 1 231 ? 6.924   16.579 -1.672  1.00 25.18  ? 231  PHE B CD1  1 
ATOM   8339  C  CD2  . PHE B 1 231 ? 6.128   16.892 0.567   1.00 13.99  ? 231  PHE B CD2  1 
ATOM   8340  C  CE1  . PHE B 1 231 ? 6.191   15.417 -1.808  1.00 23.88  ? 231  PHE B CE1  1 
ATOM   8341  C  CE2  . PHE B 1 231 ? 5.419   15.715 0.450   1.00 17.25  ? 231  PHE B CE2  1 
ATOM   8342  C  CZ   . PHE B 1 231 ? 5.459   14.978 -0.711  1.00 15.38  ? 231  PHE B CZ   1 
ATOM   8343  H  H    . PHE B 1 231 ? 9.513   20.355 0.077   1.00 15.13  ? 231  PHE B H    1 
ATOM   8344  H  HA   . PHE B 1 231 ? 9.431   17.621 0.280   1.00 14.56  ? 231  PHE B HA   1 
ATOM   8345  H  HB2  . PHE B 1 231 ? 7.416   19.048 0.428   1.00 16.44  ? 231  PHE B HB2  1 
ATOM   8346  H  HB3  . PHE B 1 231 ? 7.521   19.151 -1.128  1.00 16.44  ? 231  PHE B HB3  1 
ATOM   8347  H  HD1  . PHE B 1 231 ? 7.442   16.871 -2.387  1.00 30.22  ? 231  PHE B HD1  1 
ATOM   8348  H  HD2  . PHE B 1 231 ? 6.083   17.393 1.349   1.00 16.79  ? 231  PHE B HD2  1 
ATOM   8349  H  HE1  . PHE B 1 231 ? 6.187   14.944 -2.609  1.00 28.66  ? 231  PHE B HE1  1 
ATOM   8350  H  HE2  . PHE B 1 231 ? 4.907   15.416 1.166   1.00 20.70  ? 231  PHE B HE2  1 
ATOM   8351  H  HZ   . PHE B 1 231 ? 4.990   14.176 -0.762  1.00 18.45  ? 231  PHE B HZ   1 
ATOM   8352  N  N    . ASP B 1 232 ? 10.611  17.176 -1.848  1.00 9.51   ? 232  ASP B N    1 
ATOM   8353  C  CA   . ASP B 1 232 ? 11.129  16.708 -3.148  1.00 9.97   ? 232  ASP B CA   1 
ATOM   8354  C  C    . ASP B 1 232 ? 10.085  15.731 -3.634  1.00 12.68  ? 232  ASP B C    1 
ATOM   8355  O  O    . ASP B 1 232 ? 9.761   14.752 -2.943  1.00 10.83  ? 232  ASP B O    1 
ATOM   8356  C  CB   . ASP B 1 232 ? 12.498  16.114 -2.936  1.00 12.92  ? 232  ASP B CB   1 
ATOM   8357  C  CG   . ASP B 1 232 ? 13.202  15.613 -4.186  1.00 13.60  ? 232  ASP B CG   1 
ATOM   8358  O  OD1  . ASP B 1 232 ? 12.486  15.282 -5.167  1.00 12.66  ? 232  ASP B OD1  1 
ATOM   8359  O  OD2  . ASP B 1 232 ? 14.447  15.518 -4.162  1.00 10.69  ? 232  ASP B OD2  1 
ATOM   8360  H  H    . ASP B 1 232 ? 10.857  16.742 -1.148  1.00 11.41  ? 232  ASP B H    1 
ATOM   8361  H  HA   . ASP B 1 232 ? 11.189  17.462 -3.770  1.00 11.96  ? 232  ASP B HA   1 
ATOM   8362  H  HB2  . ASP B 1 232 ? 13.060  16.785 -2.517  1.00 15.50  ? 232  ASP B HB2  1 
ATOM   8363  H  HB3  . ASP B 1 232 ? 12.417  15.375 -2.314  1.00 15.50  ? 232  ASP B HB3  1 
ATOM   8364  N  N    . VAL B 1 233 ? 9.510   15.914 -4.831  1.00 9.55   ? 233  VAL B N    1 
ATOM   8365  C  CA   . VAL B 1 233 ? 8.502   14.984 -5.326  1.00 12.03  ? 233  VAL B CA   1 
ATOM   8366  C  C    . VAL B 1 233 ? 8.994   13.569 -5.521  1.00 8.74   ? 233  VAL B C    1 
ATOM   8367  O  O    . VAL B 1 233 ? 8.209   12.625 -5.583  1.00 9.89   ? 233  VAL B O    1 
ATOM   8368  C  CB   . VAL B 1 233 ? 7.818   15.502 -6.637  1.00 11.41  ? 233  VAL B CB   1 
ATOM   8369  C  CG1  . VAL B 1 233 ? 7.084   16.782 -6.356  1.00 15.14  ? 233  VAL B CG1  1 
ATOM   8370  C  CG2  . VAL B 1 233 ? 8.841   15.683 -7.750  1.00 15.40  ? 233  VAL B CG2  1 
ATOM   8371  H  H    . VAL B 1 233 ? 9.739   16.588 -5.313  1.00 11.46  ? 233  VAL B H    1 
ATOM   8372  H  HA   . VAL B 1 233 ? 7.800   14.943 -4.643  1.00 14.44  ? 233  VAL B HA   1 
ATOM   8373  H  HB   . VAL B 1 233 ? 7.165   14.832 -6.928  1.00 13.69  ? 233  VAL B HB   1 
ATOM   8374  H  HG11 . VAL B 1 233 ? 6.448   16.637 -5.651  1.00 22.70  ? 233  VAL B HG11 1 
ATOM   8375  H  HG12 . VAL B 1 233 ? 6.625   17.068 -7.148  1.00 22.70  ? 233  VAL B HG12 1 
ATOM   8376  H  HG13 . VAL B 1 233 ? 7.711   17.458 -6.087  1.00 22.70  ? 233  VAL B HG13 1 
ATOM   8377  H  HG21 . VAL B 1 233 ? 9.287   14.849 -7.914  1.00 23.10  ? 233  VAL B HG21 1 
ATOM   8378  H  HG22 . VAL B 1 233 ? 9.486   16.344 -7.488  1.00 23.10  ? 233  VAL B HG22 1 
ATOM   8379  H  HG23 . VAL B 1 233 ? 8.396   15.971 -8.550  1.00 23.10  ? 233  VAL B HG23 1 
ATOM   8380  N  N    . ASP B 1 234 ? 10.313  13.365 -5.581  1.00 10.26  ? 234  ASP B N    1 
ATOM   8381  C  CA   . ASP B 1 234 ? 10.860  12.015 -5.701  1.00 9.16   ? 234  ASP B CA   1 
ATOM   8382  C  C    . ASP B 1 234 ? 10.777  11.291 -4.347  1.00 8.53   ? 234  ASP B C    1 
ATOM   8383  O  O    . ASP B 1 234 ? 11.118  10.113 -4.277  1.00 10.45  ? 234  ASP B O    1 
ATOM   8384  C  CB   . ASP B 1 234 ? 12.273  12.014 -6.298  1.00 8.99   ? 234  ASP B CB   1 
ATOM   8385  C  CG   . ASP B 1 234 ? 13.371  12.591 -5.422  1.00 14.26  ? 234  ASP B CG   1 
ATOM   8386  O  OD1  . ASP B 1 234 ? 13.127  12.773 -4.216  1.00 12.71  ? 234  ASP B OD1  1 
ATOM   8387  O  OD2  . ASP B 1 234 ? 14.486  12.842 -5.949  1.00 11.96  ? 234  ASP B OD2  1 
ATOM   8388  H  H    . ASP B 1 234 ? 10.848  14.038 -5.549  1.00 12.31  ? 234  ASP B H    1 
ATOM   8389  H  HA   . ASP B 1 234 ? 10.267  11.530 -6.312  1.00 10.99  ? 234  ASP B HA   1 
ATOM   8390  H  HB2  . ASP B 1 234 ? 12.474  11.061 -6.518  1.00 10.79  ? 234  ASP B HB2  1 
ATOM   8391  H  HB3  . ASP B 1 234 ? 12.207  12.455 -7.176  1.00 10.79  ? 234  ASP B HB3  1 
ATOM   8392  N  N    . GLY B 1 235 ? 10.325  11.963 -3.283  1.00 10.62  ? 235  GLY B N    1 
ATOM   8393  C  CA   . GLY B 1 235 ? 9.966   11.175 -2.077  1.00 10.42  ? 235  GLY B CA   1 
ATOM   8394  C  C    . GLY B 1 235 ? 8.817   10.223 -2.292  1.00 8.86   ? 235  GLY B C    1 
ATOM   8395  O  O    . GLY B 1 235 ? 8.818   9.146  -1.706  1.00 10.66  ? 235  GLY B O    1 
ATOM   8396  H  H    . GLY B 1 235 ? 10.246  12.819 -3.296  1.00 12.74  ? 235  GLY B H    1 
ATOM   8397  H  HA2  . GLY B 1 235 ? 10.742  10.669 -1.791  1.00 12.51  ? 235  GLY B HA2  1 
ATOM   8398  H  HA3  . GLY B 1 235 ? 9.734   11.787 -1.361  1.00 12.51  ? 235  GLY B HA3  1 
ATOM   8399  N  N    . LEU B 1 236 ? 7.866   10.537 -3.202  1.00 9.19   ? 236  LEU B N    1 
ATOM   8400  C  CA   . LEU B 1 236 ? 6.759   9.662  -3.522  1.00 9.30   ? 236  LEU B CA   1 
ATOM   8401  C  C    . LEU B 1 236 ? 7.228   8.680  -4.596  1.00 11.43  ? 236  LEU B C    1 
ATOM   8402  O  O    . LEU B 1 236 ? 8.177   8.923  -5.352  1.00 11.01  ? 236  LEU B O    1 
ATOM   8403  C  CB   . LEU B 1 236 ? 5.538   10.428 -4.009  1.00 13.76  ? 236  LEU B CB   1 
ATOM   8404  C  CG   . LEU B 1 236 ? 5.053   11.584 -3.128  1.00 16.28  ? 236  LEU B CG   1 
ATOM   8405  C  CD1  . LEU B 1 236 ? 3.719   12.113 -3.665  1.00 21.52  ? 236  LEU B CD1  1 
ATOM   8406  C  CD2  . LEU B 1 236 ? 4.962   11.161 -1.676  1.00 20.70  ? 236  LEU B CD2  1 
ATOM   8407  H  H    . LEU B 1 236 ? 7.922   11.292 -3.609  1.00 11.03  ? 236  LEU B H    1 
ATOM   8408  H  HA   . LEU B 1 236 ? 6.514   9.157  -2.718  1.00 11.16  ? 236  LEU B HA   1 
ATOM   8409  H  HB2  . LEU B 1 236 ? 5.736   10.782 -4.890  1.00 16.52  ? 236  LEU B HB2  1 
ATOM   8410  H  HB3  . LEU B 1 236 ? 4.807   9.798  -4.109  1.00 16.52  ? 236  LEU B HB3  1 
ATOM   8411  H  HG   . LEU B 1 236 ? 5.711   12.307 -3.190  1.00 19.53  ? 236  LEU B HG   1 
ATOM   8412  H  HD11 . LEU B 1 236 ? 3.821   12.360 -4.587  1.00 32.28  ? 236  LEU B HD11 1 
ATOM   8413  H  HD12 . LEU B 1 236 ? 3.451   12.882 -3.156  1.00 32.28  ? 236  LEU B HD12 1 
ATOM   8414  H  HD13 . LEU B 1 236 ? 3.049   11.429 -3.588  1.00 32.28  ? 236  LEU B HD13 1 
ATOM   8415  H  HD21 . LEU B 1 236 ? 4.642   11.896 -1.148  1.00 31.05  ? 236  LEU B HD21 1 
ATOM   8416  H  HD22 . LEU B 1 236 ? 5.832   10.898 -1.365  1.00 31.05  ? 236  LEU B HD22 1 
ATOM   8417  H  HD23 . LEU B 1 236 ? 4.356   10.421 -1.595  1.00 31.05  ? 236  LEU B HD23 1 
ATOM   8418  N  N    . ASP B 1 237 ? 6.638   7.511  -4.618  1.00 13.99  ? 237  ASP B N    1 
ATOM   8419  C  CA   . ASP B 1 237 ? 6.986   6.503  -5.630  1.00 11.48  ? 237  ASP B CA   1 
ATOM   8420  C  C    . ASP B 1 237 ? 6.812   7.057  -7.049  1.00 10.24  ? 237  ASP B C    1 
ATOM   8421  O  O    . ASP B 1 237 ? 5.905   7.835  -7.339  1.00 13.13  ? 237  ASP B O    1 
ATOM   8422  C  CB   . ASP B 1 237 ? 6.108   5.277  -5.415  1.00 14.00  ? 237  ASP B CB   1 
ATOM   8423  C  CG   . ASP B 1 237 ? 6.620   4.045  -6.130  1.00 16.50  ? 237  ASP B CG   1 
ATOM   8424  O  OD1  . ASP B 1 237 ? 6.013   3.764  -7.211  1.00 21.50  ? 237  ASP B OD1  1 
ATOM   8425  O  OD2  . ASP B 1 237 ? 7.579   3.392  -5.684  1.00 14.34  ? 237  ASP B OD2  1 
ATOM   8426  H  H    . ASP B 1 237 ? 6.037   7.330  -4.031  1.00 16.79  ? 237  ASP B H    1 
ATOM   8427  H  HA   . ASP B 1 237 ? 7.924   6.245  -5.507  1.00 13.77  ? 237  ASP B HA   1 
ATOM   8428  H  HB2  . ASP B 1 237 ? 6.055   5.091  -4.465  1.00 16.80  ? 237  ASP B HB2  1 
ATOM   8429  H  HB3  . ASP B 1 237 ? 5.212   5.474  -5.729  1.00 16.80  ? 237  ASP B HB3  1 
ATOM   8430  N  N    . PRO B 1 238 ? 7.738   6.627  -7.912  1.00 13.43  ? 238  PRO B N    1 
ATOM   8431  C  CA   . PRO B 1 238 ? 7.630   7.025  -9.319  1.00 15.01  ? 238  PRO B CA   1 
ATOM   8432  C  C    . PRO B 1 238 ? 6.312   6.660  -10.000 1.00 15.61  ? 238  PRO B C    1 
ATOM   8433  O  O    . PRO B 1 238 ? 6.012   7.295  -11.036 1.00 16.19  ? 238  PRO B O    1 
ATOM   8434  C  CB   . PRO B 1 238 ? 8.741   6.212  -9.988  1.00 14.99  ? 238  PRO B CB   1 
ATOM   8435  C  CG   . PRO B 1 238 ? 9.704   5.830  -8.947  1.00 14.93  ? 238  PRO B CG   1 
ATOM   8436  C  CD   . PRO B 1 238 ? 8.929   5.831  -7.657  1.00 13.72  ? 238  PRO B CD   1 
ATOM   8437  H  HA   . PRO B 1 238 ? 7.807   7.985  -9.415  1.00 18.01  ? 238  PRO B HA   1 
ATOM   8438  H  HB2  . PRO B 1 238 ? 8.369   5.420  -10.406 1.00 17.99  ? 238  PRO B HB2  1 
ATOM   8439  H  HB3  . PRO B 1 238 ? 9.179   6.744  -10.670 1.00 17.99  ? 238  PRO B HB3  1 
ATOM   8440  H  HG2  . PRO B 1 238 ? 10.069  4.950  -9.126  1.00 17.92  ? 238  PRO B HG2  1 
ATOM   8441  H  HG3  . PRO B 1 238 ? 10.434  6.468  -8.906  1.00 17.92  ? 238  PRO B HG3  1 
ATOM   8442  H  HD2  . PRO B 1 238 ? 8.686   4.926  -7.405  1.00 16.46  ? 238  PRO B HD2  1 
ATOM   8443  H  HD3  . PRO B 1 238 ? 9.455   6.223  -6.943  1.00 16.46  ? 238  PRO B HD3  1 
ATOM   8444  N  N    . SER B 1 239 ? 5.538   5.719  -9.488  1.00 13.78  ? 239  SER B N    1 
ATOM   8445  C  CA   . SER B 1 239 ? 4.206   5.483  -10.004 1.00 14.93  ? 239  SER B CA   1 
ATOM   8446  C  C    . SER B 1 239 ? 3.261   6.632  -9.723  1.00 13.99  ? 239  SER B C    1 
ATOM   8447  O  O    . SER B 1 239 ? 2.176   6.649  -10.339 1.00 17.83  ? 239  SER B O    1 
ATOM   8448  C  CB   . SER B 1 239 ? 3.617   4.186  -9.439  1.00 14.83  ? 239  SER B CB   1 
ATOM   8449  O  OG   . SER B 1 239 ? 3.611   4.123  -8.020  1.00 21.89  ? 239  SER B OG   1 
ATOM   8450  H  H    . SER B 1 239 ? 5.830   5.240  -8.837  1.00 16.53  ? 239  SER B H    1 
ATOM   8451  H  HA   . SER B 1 239 ? 4.275   5.382  -10.977 1.00 17.92  ? 239  SER B HA   1 
ATOM   8452  H  HB2  . SER B 1 239 ? 2.706   4.092  -9.758  1.00 17.80  ? 239  SER B HB2  1 
ATOM   8453  H  HB3  . SER B 1 239 ? 4.127   3.436  -9.782  1.00 17.80  ? 239  SER B HB3  1 
ATOM   8454  H  HG   . SER B 1 239 ? 4.378   4.195  -7.740  1.00 32.84  ? 239  SER B HG   1 
ATOM   8455  N  N    . PHE B 1 240 ? 3.555   7.538  -8.809  1.00 13.00  ? 240  PHE B N    1 
ATOM   8456  C  CA   . PHE B 1 240 ? 2.792   8.730  -8.515  1.00 12.98  ? 240  PHE B CA   1 
ATOM   8457  C  C    . PHE B 1 240 ? 3.449   9.974  -9.105  1.00 12.00  ? 240  PHE B C    1 
ATOM   8458  O  O    . PHE B 1 240 ? 2.732   10.777 -9.690  1.00 15.40  ? 240  PHE B O    1 
ATOM   8459  C  CB   . PHE B 1 240 ? 2.554   8.859  -6.997  1.00 12.61  ? 240  PHE B CB   1 
ATOM   8460  C  CG   . PHE B 1 240 ? 1.864   7.629  -6.463  1.00 14.74  ? 240  PHE B CG   1 
ATOM   8461  C  CD1  . PHE B 1 240 ? 0.523   7.384  -6.720  1.00 17.07  ? 240  PHE B CD1  1 
ATOM   8462  C  CD2  . PHE B 1 240 ? 2.624   6.763  -5.721  1.00 13.50  ? 240  PHE B CD2  1 
ATOM   8463  C  CE1  . PHE B 1 240 ? -0.045  6.220  -6.189  1.00 14.28  ? 240  PHE B CE1  1 
ATOM   8464  C  CE2  . PHE B 1 240 ? 2.067   5.574  -5.233  1.00 15.24  ? 240  PHE B CE2  1 
ATOM   8465  C  CZ   . PHE B 1 240 ? 0.759   5.315  -5.531  1.00 21.42  ? 240  PHE B CZ   1 
ATOM   8466  H  H    . PHE B 1 240 ? 4.267   7.406  -8.345  1.00 15.60  ? 240  PHE B H    1 
ATOM   8467  H  HA   . PHE B 1 240 ? 1.915   8.630  -8.943  1.00 15.58  ? 240  PHE B HA   1 
ATOM   8468  H  HB2  . PHE B 1 240 ? 3.404   8.977  -6.545  1.00 15.14  ? 240  PHE B HB2  1 
ATOM   8469  H  HB3  . PHE B 1 240 ? 2.007   9.641  -6.820  1.00 15.14  ? 240  PHE B HB3  1 
ATOM   8470  H  HD1  . PHE B 1 240 ? 0.017   7.975  -7.229  1.00 20.49  ? 240  PHE B HD1  1 
ATOM   8471  H  HD2  . PHE B 1 240 ? 3.514   6.966  -5.539  1.00 16.20  ? 240  PHE B HD2  1 
ATOM   8472  H  HE1  . PHE B 1 240 ? -0.957  6.058  -6.280  1.00 17.13  ? 240  PHE B HE1  1 
ATOM   8473  H  HE2  . PHE B 1 240 ? 2.570   4.980  -4.725  1.00 18.29  ? 240  PHE B HE2  1 
ATOM   8474  H  HZ   . PHE B 1 240 ? 0.397   4.497  -5.279  1.00 25.70  ? 240  PHE B HZ   1 
ATOM   8475  N  N    . THR B 1 241 ? 4.757   10.146 -9.008  1.00 11.78  ? 241  THR B N    1 
ATOM   8476  C  CA   . THR B 1 241 ? 5.507   11.281 -9.525  1.00 10.76  ? 241  THR B CA   1 
ATOM   8477  C  C    . THR B 1 241 ? 6.628   10.877 -10.471 1.00 14.90  ? 241  THR B C    1 
ATOM   8478  O  O    . THR B 1 241 ? 7.802   11.118 -10.200 1.00 12.85  ? 241  THR B O    1 
ATOM   8479  C  CB   . THR B 1 241 ? 6.039   12.130 -8.338  1.00 13.14  ? 241  THR B CB   1 
ATOM   8480  O  OG1  . THR B 1 241 ? 6.667   11.284 -7.376  1.00 16.29  ? 241  THR B OG1  1 
ATOM   8481  C  CG2  . THR B 1 241 ? 4.860   12.827 -7.676  1.00 13.11  ? 241  THR B CG2  1 
ATOM   8482  H  H    . THR B 1 241 ? 5.205   9.532  -8.604  1.00 14.14  ? 241  THR B H    1 
ATOM   8483  H  HA   . THR B 1 241 ? 4.882   11.841 -10.031 1.00 12.91  ? 241  THR B HA   1 
ATOM   8484  H  HB   . THR B 1 241 ? 6.679   12.796 -8.665  1.00 15.77  ? 241  THR B HB   1 
ATOM   8485  H  HG1  . THR B 1 241 ? 7.306   10.904 -7.722  1.00 24.44  ? 241  THR B HG1  1 
ATOM   8486  H  HG21 . THR B 1 241 ? 5.173   13.357 -6.940  1.00 19.67  ? 241  THR B HG21 1 
ATOM   8487  H  HG22 . THR B 1 241 ? 4.239   12.169 -7.355  1.00 19.67  ? 241  THR B HG22 1 
ATOM   8488  H  HG23 . THR B 1 241 ? 4.422   13.393 -8.316  1.00 19.67  ? 241  THR B HG23 1 
ATOM   8489  N  N    . PRO B 1 242 ? 6.303   10.312 -11.656 1.00 12.64  ? 242  PRO B N    1 
ATOM   8490  C  CA   . PRO B 1 242 ? 7.369   9.918  -12.597 1.00 13.51  ? 242  PRO B CA   1 
ATOM   8491  C  C    . PRO B 1 242 ? 8.188   11.060 -13.191 1.00 10.63  ? 242  PRO B C    1 
ATOM   8492  O  O    . PRO B 1 242 ? 9.364   10.794 -13.539 1.00 15.31  ? 242  PRO B O    1 
ATOM   8493  C  CB   . PRO B 1 242 ? 6.574   9.240  -13.736 1.00 12.10  ? 242  PRO B CB   1 
ATOM   8494  C  CG   . PRO B 1 242 ? 5.201   9.752  -13.626 1.00 13.97  ? 242  PRO B CG   1 
ATOM   8495  C  CD   . PRO B 1 242 ? 4.954   9.997  -12.160 1.00 9.57   ? 242  PRO B CD   1 
ATOM   8496  H  HA   . PRO B 1 242 ? 7.965   9.266  -12.172 1.00 16.21  ? 242  PRO B HA   1 
ATOM   8497  H  HB2  . PRO B 1 242 ? 6.955   9.468  -14.599 1.00 14.52  ? 242  PRO B HB2  1 
ATOM   8498  H  HB3  . PRO B 1 242 ? 6.588   8.276  -13.634 1.00 14.52  ? 242  PRO B HB3  1 
ATOM   8499  H  HG2  . PRO B 1 242 ? 5.106   10.577 -14.128 1.00 16.76  ? 242  PRO B HG2  1 
ATOM   8500  H  HG3  . PRO B 1 242 ? 4.569   9.103  -13.972 1.00 16.76  ? 242  PRO B HG3  1 
ATOM   8501  H  HD2  . PRO B 1 242 ? 4.346   10.741 -12.025 1.00 11.49  ? 242  PRO B HD2  1 
ATOM   8502  H  HD3  . PRO B 1 242 ? 4.592   9.208  -11.727 1.00 11.49  ? 242  PRO B HD3  1 
ATOM   8503  N  N    . ALA B 1 243 ? 7.689   12.263 -13.362 1.00 10.91  ? 243  ALA B N    1 
ATOM   8504  C  CA   . ALA B 1 243 ? 8.336   13.408 -14.027 1.00 11.27  ? 243  ALA B CA   1 
ATOM   8505  C  C    . ALA B 1 243 ? 9.255   14.180 -13.073 1.00 8.23   ? 243  ALA B C    1 
ATOM   8506  O  O    . ALA B 1 243 ? 8.962   15.285 -12.688 1.00 11.85  ? 243  ALA B O    1 
ATOM   8507  C  CB   . ALA B 1 243 ? 7.335   14.362 -14.654 1.00 14.86  ? 243  ALA B CB   1 
ATOM   8508  H  H    . ALA B 1 243 ? 6.899   12.397 -13.052 1.00 13.09  ? 243  ALA B H    1 
ATOM   8509  H  HA   . ALA B 1 243 ? 8.895   13.051 -14.749 1.00 13.52  ? 243  ALA B HA   1 
ATOM   8510  H  HB1  . ALA B 1 243 ? 6.761   13.876 -15.251 1.00 22.29  ? 243  ALA B HB1  1 
ATOM   8511  H  HB2  . ALA B 1 243 ? 7.804   15.042 -15.144 1.00 22.29  ? 243  ALA B HB2  1 
ATOM   8512  H  HB3  . ALA B 1 243 ? 6.807   14.771 -13.965 1.00 22.29  ? 243  ALA B HB3  1 
ATOM   8513  N  N    . THR B 1 244 ? 10.340  13.495 -12.780 1.00 11.45  ? 244  THR B N    1 
ATOM   8514  C  CA   . THR B 1 244 ? 11.414  13.912 -11.888 1.00 11.92  ? 244  THR B CA   1 
ATOM   8515  C  C    . THR B 1 244 ? 12.727  13.249 -12.277 1.00 11.07  ? 244  THR B C    1 
ATOM   8516  O  O    . THR B 1 244 ? 12.747  12.161 -12.846 1.00 13.16  ? 244  THR B O    1 
ATOM   8517  C  CB   . THR B 1 244 ? 10.946  13.595 -10.444 1.00 12.51  ? 244  THR B CB   1 
ATOM   8518  O  OG1  . THR B 1 244 ? 11.702  14.432 -9.523  1.00 15.36  ? 244  THR B OG1  1 
ATOM   8519  C  CG2  . THR B 1 244 ? 11.114  12.130 -10.085 1.00 15.30  ? 244  THR B CG2  1 
ATOM   8520  H  H    . THR B 1 244 ? 10.422  12.723 -13.151 1.00 13.75  ? 244  THR B H    1 
ATOM   8521  H  HA   . THR B 1 244 ? 11.523  14.882 -11.971 1.00 14.30  ? 244  THR B HA   1 
ATOM   8522  H  HB   . THR B 1 244 ? 9.997   13.827 -10.367 1.00 15.01  ? 244  THR B HB   1 
ATOM   8523  H  HG1  . THR B 1 244 ? 11.607  15.220 -9.729  1.00 23.04  ? 244  THR B HG1  1 
ATOM   8524  H  HG21 . THR B 1 244 ? 10.808  11.983 -9.187  1.00 22.96  ? 244  THR B HG21 1 
ATOM   8525  H  HG22 . THR B 1 244 ? 12.041  11.889 -10.150 1.00 22.96  ? 244  THR B HG22 1 
ATOM   8526  H  HG23 . THR B 1 244 ? 10.601  11.591 -10.691 1.00 22.96  ? 244  THR B HG23 1 
ATOM   8527  N  N    . GLY B 1 245 ? 13.812  13.964 -11.969 1.00 13.18  ? 245  GLY B N    1 
ATOM   8528  C  CA   . GLY B 1 245 ? 15.188  13.716 -12.328 1.00 14.21  ? 245  GLY B CA   1 
ATOM   8529  C  C    . GLY B 1 245 ? 15.786  12.443 -11.798 1.00 12.58  ? 245  GLY B C    1 
ATOM   8530  O  O    . GLY B 1 245 ? 16.557  11.729 -12.464 1.00 18.59  ? 245  GLY B O    1 
ATOM   8531  H  H    . GLY B 1 245 ? 13.673  14.666 -11.493 1.00 15.81  ? 245  GLY B H    1 
ATOM   8532  H  HA2  . GLY B 1 245 ? 15.252  13.703 -13.296 1.00 17.05  ? 245  GLY B HA2  1 
ATOM   8533  H  HA3  . GLY B 1 245 ? 15.724  14.460 -12.011 1.00 17.05  ? 245  GLY B HA3  1 
ATOM   8534  N  N    . THR B 1 246 ? 15.484  12.016 -10.559 1.00 13.10  ? 246  THR B N    1 
ATOM   8535  C  CA   . THR B 1 246 ? 16.094  10.909 -9.862  1.00 15.63  ? 246  THR B CA   1 
ATOM   8536  C  C    . THR B 1 246 ? 15.077  10.003 -9.195  1.00 16.37  ? 246  THR B C    1 
ATOM   8537  O  O    . THR B 1 246 ? 15.056  9.853  -7.956  1.00 15.57  ? 246  THR B O    1 
ATOM   8538  C  CB   . THR B 1 246 ? 17.113  11.436 -8.813  1.00 14.59  ? 246  THR B CB   1 
ATOM   8539  O  OG1  . THR B 1 246 ? 17.972  12.388 -9.422  1.00 14.06  ? 246  THR B OG1  1 
ATOM   8540  C  CG2  . THR B 1 246 ? 18.000  10.293 -8.342  1.00 17.09  ? 246  THR B CG2  1 
ATOM   8541  H  H    . THR B 1 246 ? 14.867  12.445 -10.141 1.00 15.72  ? 246  THR B H    1 
ATOM   8542  H  HA   . THR B 1 246 ? 16.587  10.375 -10.519 1.00 18.76  ? 246  THR B HA   1 
ATOM   8543  H  HB   . THR B 1 246 ? 16.642  11.839 -8.053  1.00 17.51  ? 246  THR B HB   1 
ATOM   8544  H  HG1  . THR B 1 246 ? 18.747  12.124 -9.379  1.00 21.09  ? 246  THR B HG1  1 
ATOM   8545  H  HG21 . THR B 1 246 ? 18.628  10.622 -7.695  1.00 25.64  ? 246  THR B HG21 1 
ATOM   8546  H  HG22 . THR B 1 246 ? 18.475  9.927  -9.092  1.00 25.64  ? 246  THR B HG22 1 
ATOM   8547  H  HG23 . THR B 1 246 ? 17.457  9.610  -7.943  1.00 25.64  ? 246  THR B HG23 1 
ATOM   8548  N  N    . PRO B 1 247 ? 14.207  9.332  -9.925  1.00 13.57  ? 247  PRO B N    1 
ATOM   8549  C  CA   . PRO B 1 247 ? 13.194  8.432  -9.360  1.00 12.77  ? 247  PRO B CA   1 
ATOM   8550  C  C    . PRO B 1 247 ? 13.821  7.224  -8.727  1.00 12.49  ? 247  PRO B C    1 
ATOM   8551  O  O    . PRO B 1 247 ? 14.790  6.612  -9.203  1.00 14.70  ? 247  PRO B O    1 
ATOM   8552  C  CB   . PRO B 1 247 ? 12.361  8.039  -10.603 1.00 14.97  ? 247  PRO B CB   1 
ATOM   8553  C  CG   . PRO B 1 247 ? 13.437  8.018  -11.661 1.00 16.83  ? 247  PRO B CG   1 
ATOM   8554  C  CD   . PRO B 1 247 ? 14.093  9.356  -11.419 1.00 12.75  ? 247  PRO B CD   1 
ATOM   8555  H  HA   . PRO B 1 247 ? 12.636  8.909  -8.710  1.00 15.32  ? 247  PRO B HA   1 
ATOM   8556  H  HB2  . PRO B 1 247 ? 11.946  7.169  -10.496 1.00 17.96  ? 247  PRO B HB2  1 
ATOM   8557  H  HB3  . PRO B 1 247 ? 11.678  8.700  -10.800 1.00 17.96  ? 247  PRO B HB3  1 
ATOM   8558  H  HG2  . PRO B 1 247 ? 14.058  7.285  -11.525 1.00 20.19  ? 247  PRO B HG2  1 
ATOM   8559  H  HG3  . PRO B 1 247 ? 13.061  7.961  -12.553 1.00 20.19  ? 247  PRO B HG3  1 
ATOM   8560  H  HD2  . PRO B 1 247 ? 14.964  9.411  -11.844 1.00 15.30  ? 247  PRO B HD2  1 
ATOM   8561  H  HD3  . PRO B 1 247 ? 13.537  10.089 -11.725 1.00 15.30  ? 247  PRO B HD3  1 
ATOM   8562  N  N    . VAL B 1 248 ? 13.234  6.792  -7.587  1.00 12.89  ? 248  VAL B N    1 
ATOM   8563  C  CA   . VAL B 1 248 ? 13.658  5.563  -6.891  1.00 10.45  ? 248  VAL B CA   1 
ATOM   8564  C  C    . VAL B 1 248 ? 12.465  4.716  -6.489  1.00 11.86  ? 248  VAL B C    1 
ATOM   8565  O  O    . VAL B 1 248 ? 11.522  5.233  -5.833  1.00 13.03  ? 248  VAL B O    1 
ATOM   8566  C  CB   . VAL B 1 248 ? 14.448  5.900  -5.608  1.00 11.97  ? 248  VAL B CB   1 
ATOM   8567  C  CG1  . VAL B 1 248 ? 15.038  4.665  -4.921  1.00 10.90  ? 248  VAL B CG1  1 
ATOM   8568  C  CG2  . VAL B 1 248 ? 15.515  6.948  -5.871  1.00 12.90  ? 248  VAL B CG2  1 
ATOM   8569  H  H    . VAL B 1 248 ? 12.589  7.254  -7.255  1.00 15.47  ? 248  VAL B H    1 
ATOM   8570  H  HA   . VAL B 1 248 ? 14.231  5.040  -7.489  1.00 12.55  ? 248  VAL B HA   1 
ATOM   8571  H  HB   . VAL B 1 248 ? 13.810  6.298  -4.978  1.00 14.37  ? 248  VAL B HB   1 
ATOM   8572  H  HG11 . VAL B 1 248 ? 14.341  4.025  -4.760  1.00 16.35  ? 248  VAL B HG11 1 
ATOM   8573  H  HG12 . VAL B 1 248 ? 15.434  4.922  -4.085  1.00 16.35  ? 248  VAL B HG12 1 
ATOM   8574  H  HG13 . VAL B 1 248 ? 15.708  4.274  -5.486  1.00 16.35  ? 248  VAL B HG13 1 
ATOM   8575  H  HG21 . VAL B 1 248 ? 15.117  7.710  -6.299  1.00 19.35  ? 248  VAL B HG21 1 
ATOM   8576  H  HG22 . VAL B 1 248 ? 16.192  6.578  -6.442  1.00 19.35  ? 248  VAL B HG22 1 
ATOM   8577  H  HG23 . VAL B 1 248 ? 15.910  7.218  -5.039  1.00 19.35  ? 248  VAL B HG23 1 
ATOM   8578  N  N    . VAL B 1 249 ? 12.418  3.465  -6.871  1.00 12.70  ? 249  VAL B N    1 
ATOM   8579  C  CA   . VAL B 1 249 ? 11.336  2.539  -6.582  1.00 13.75  ? 249  VAL B CA   1 
ATOM   8580  C  C    . VAL B 1 249 ? 11.078  2.390  -5.093  1.00 11.60  ? 249  VAL B C    1 
ATOM   8581  O  O    . VAL B 1 249 ? 12.008  2.629  -4.310  1.00 12.81  ? 249  VAL B O    1 
ATOM   8582  C  CB   . VAL B 1 249 ? 11.614  1.145  -7.189  1.00 20.59  ? 249  VAL B CB   1 
ATOM   8583  C  CG1  . VAL B 1 249 ? 11.675  1.313  -8.713  1.00 21.47  ? 249  VAL B CG1  1 
ATOM   8584  C  CG2  . VAL B 1 249 ? 12.885  0.513  -6.627  1.00 15.38  ? 249  VAL B CG2  1 
ATOM   8585  H  H    . VAL B 1 249 ? 13.082  3.167  -7.330  1.00 15.24  ? 249  VAL B H    1 
ATOM   8586  H  HA   . VAL B 1 249 ? 10.520  2.891  -6.995  1.00 16.50  ? 249  VAL B HA   1 
ATOM   8587  H  HB   . VAL B 1 249 ? 10.858  0.560  -6.974  1.00 24.71  ? 249  VAL B HB   1 
ATOM   8588  H  HG11 . VAL B 1 249 ? 10.857  1.709  -9.024  1.00 32.21  ? 249  VAL B HG11 1 
ATOM   8589  H  HG12 . VAL B 1 249 ? 11.792  0.454  -9.125  1.00 32.21  ? 249  VAL B HG12 1 
ATOM   8590  H  HG13 . VAL B 1 249 ? 12.413  1.882  -8.943  1.00 32.21  ? 249  VAL B HG13 1 
ATOM   8591  H  HG21 . VAL B 1 249 ? 12.806  0.427  -5.674  1.00 23.07  ? 249  VAL B HG21 1 
ATOM   8592  H  HG22 . VAL B 1 249 ? 13.639  1.070  -6.836  1.00 23.07  ? 249  VAL B HG22 1 
ATOM   8593  H  HG23 . VAL B 1 249 ? 13.011  -0.354 -7.017  1.00 23.07  ? 249  VAL B HG23 1 
ATOM   8594  N  N    . GLY B 1 250 ? 9.883   1.964  -4.730  1.00 12.06  ? 250  GLY B N    1 
ATOM   8595  C  CA   . GLY B 1 250 ? 9.612   1.640  -3.354  1.00 11.69  ? 250  GLY B CA   1 
ATOM   8596  C  C    . GLY B 1 250 ? 9.321   2.859  -2.519  1.00 9.82   ? 250  GLY B C    1 
ATOM   8597  O  O    . GLY B 1 250 ? 9.632   2.819  -1.313  1.00 12.65  ? 250  GLY B O    1 
ATOM   8598  H  H    . GLY B 1 250 ? 9.262   1.880  -5.319  1.00 14.47  ? 250  GLY B H    1 
ATOM   8599  H  HA2  . GLY B 1 250 ? 8.852   1.039  -3.313  1.00 14.02  ? 250  GLY B HA2  1 
ATOM   8600  H  HA3  . GLY B 1 250 ? 10.378  1.176  -2.981  1.00 14.02  ? 250  GLY B HA3  1 
ATOM   8601  N  N    . GLY B 1 251 ? 8.754   3.908  -3.044  1.00 11.69  ? 251  GLY B N    1 
ATOM   8602  C  CA   . GLY B 1 251 ? 8.486   5.118  -2.323  1.00 7.74   ? 251  GLY B CA   1 
ATOM   8603  C  C    . GLY B 1 251 ? 7.197   5.260  -1.616  1.00 7.60   ? 251  GLY B C    1 
ATOM   8604  O  O    . GLY B 1 251 ? 6.396   4.364  -1.533  1.00 10.84  ? 251  GLY B O    1 
ATOM   8605  H  H    . GLY B 1 251 ? 8.526   3.873  -3.872  1.00 14.03  ? 251  GLY B H    1 
ATOM   8606  H  HA2  . GLY B 1 251 ? 9.193   5.231  -1.669  1.00 9.28   ? 251  GLY B HA2  1 
ATOM   8607  H  HA3  . GLY B 1 251 ? 8.558   5.854  -2.950  1.00 9.28   ? 251  GLY B HA3  1 
ATOM   8608  N  N    . LEU B 1 252 ? 7.021   6.482  -1.073  1.00 8.43   ? 252  LEU B N    1 
ATOM   8609  C  CA   . LEU B 1 252 ? 5.797   6.852  -0.368  1.00 6.84   ? 252  LEU B CA   1 
ATOM   8610  C  C    . LEU B 1 252 ? 4.610   6.797  -1.320  1.00 11.77  ? 252  LEU B C    1 
ATOM   8611  O  O    . LEU B 1 252 ? 4.770   7.166  -2.497  1.00 11.73  ? 252  LEU B O    1 
ATOM   8612  C  CB   . LEU B 1 252 ? 5.931   8.226  0.281   1.00 12.24  ? 252  LEU B CB   1 
ATOM   8613  C  CG   . LEU B 1 252 ? 6.981   8.411  1.373   1.00 11.89  ? 252  LEU B CG   1 
ATOM   8614  C  CD1  . LEU B 1 252 ? 7.263   9.908  1.568   1.00 10.93  ? 252  LEU B CD1  1 
ATOM   8615  C  CD2  . LEU B 1 252 ? 6.576   7.768  2.709   1.00 11.88  ? 252  LEU B CD2  1 
ATOM   8616  H  H    . LEU B 1 252 ? 7.650   7.063  -1.146  1.00 10.11  ? 252  LEU B H    1 
ATOM   8617  H  HA   . LEU B 1 252 ? 5.646   6.195  0.344   1.00 8.20   ? 252  LEU B HA   1 
ATOM   8618  H  HB2  . LEU B 1 252 ? 6.120   8.868  -0.422  1.00 14.69  ? 252  LEU B HB2  1 
ATOM   8619  H  HB3  . LEU B 1 252 ? 5.068   8.461  0.657   1.00 14.69  ? 252  LEU B HB3  1 
ATOM   8620  H  HG   . LEU B 1 252 ? 7.810   7.984  1.071   1.00 14.27  ? 252  LEU B HG   1 
ATOM   8621  H  HD11 . LEU B 1 252 ? 7.921   10.023 2.258   1.00 16.40  ? 252  LEU B HD11 1 
ATOM   8622  H  HD12 . LEU B 1 252 ? 6.453   10.356 1.822   1.00 16.40  ? 252  LEU B HD12 1 
ATOM   8623  H  HD13 . LEU B 1 252 ? 7.591   10.282 0.747   1.00 16.40  ? 252  LEU B HD13 1 
ATOM   8624  H  HD21 . LEU B 1 252 ? 7.271   7.912  3.357   1.00 17.82  ? 252  LEU B HD21 1 
ATOM   8625  H  HD22 . LEU B 1 252 ? 6.445   6.826  2.584   1.00 17.82  ? 252  LEU B HD22 1 
ATOM   8626  H  HD23 . LEU B 1 252 ? 5.761   8.167  3.022   1.00 17.82  ? 252  LEU B HD23 1 
ATOM   8627  N  N    . THR B 1 253 ? 3.464   6.368  -0.856  1.00 7.79   ? 253  THR B N    1 
ATOM   8628  C  CA   . THR B 1 253 ? 2.270   6.329  -1.711  1.00 9.00   ? 253  THR B CA   1 
ATOM   8629  C  C    . THR B 1 253 ? 1.665   7.720  -1.755  1.00 13.51  ? 253  THR B C    1 
ATOM   8630  O  O    . THR B 1 253 ? 1.956   8.661  -1.010  1.00 9.17   ? 253  THR B O    1 
ATOM   8631  C  CB   . THR B 1 253 ? 1.248   5.306  -1.225  1.00 9.75   ? 253  THR B CB   1 
ATOM   8632  O  OG1  . THR B 1 253 ? 0.810   5.772  0.076   1.00 9.45   ? 253  THR B OG1  1 
ATOM   8633  C  CG2  . THR B 1 253 ? 1.761   3.891  -1.064  1.00 11.06  ? 253  THR B CG2  1 
ATOM   8634  H  H    . THR B 1 253 ? 3.409   6.105  -0.040  1.00 9.35   ? 253  THR B H    1 
ATOM   8635  H  HA   . THR B 1 253 ? 2.547   6.083  -2.618  1.00 10.81  ? 253  THR B HA   1 
ATOM   8636  H  HB   . THR B 1 253 ? 0.483   5.301  -1.838  1.00 11.69  ? 253  THR B HB   1 
ATOM   8637  H  HG1  . THR B 1 253 ? 0.923   5.179  0.631   1.00 14.17  ? 253  THR B HG1  1 
ATOM   8638  H  HG21 . THR B 1 253 ? 1.049   3.326  -0.754  1.00 16.58  ? 253  THR B HG21 1 
ATOM   8639  H  HG22 . THR B 1 253 ? 2.478   3.881  -0.426  1.00 16.58  ? 253  THR B HG22 1 
ATOM   8640  H  HG23 . THR B 1 253 ? 2.081   3.568  -1.910  1.00 16.58  ? 253  THR B HG23 1 
ATOM   8641  N  N    . TYR B 1 254 ? 0.723   7.870  -2.701  1.00 10.29  ? 254  TYR B N    1 
ATOM   8642  C  CA   . TYR B 1 254 ? -0.090  9.053  -2.782  1.00 10.65  ? 254  TYR B CA   1 
ATOM   8643  C  C    . TYR B 1 254 ? -0.801  9.356  -1.444  1.00 7.10   ? 254  TYR B C    1 
ATOM   8644  O  O    . TYR B 1 254 ? -0.751  10.483 -0.981  1.00 9.49   ? 254  TYR B O    1 
ATOM   8645  C  CB   . TYR B 1 254 ? -1.081  8.901  -3.946  1.00 11.11  ? 254  TYR B CB   1 
ATOM   8646  C  CG   . TYR B 1 254 ? -1.955  10.062 -4.297  1.00 13.72  ? 254  TYR B CG   1 
ATOM   8647  C  CD1  . TYR B 1 254 ? -1.610  10.960 -5.306  1.00 14.17  ? 254  TYR B CD1  1 
ATOM   8648  C  CD2  . TYR B 1 254 ? -3.153  10.302 -3.663  1.00 15.73  ? 254  TYR B CD2  1 
ATOM   8649  C  CE1  . TYR B 1 254 ? -2.406  12.041 -5.655  1.00 16.72  ? 254  TYR B CE1  1 
ATOM   8650  C  CE2  . TYR B 1 254 ? -3.981  11.374 -3.980  1.00 17.67  ? 254  TYR B CE2  1 
ATOM   8651  C  CZ   . TYR B 1 254 ? -3.591  12.224 -4.969  1.00 17.41  ? 254  TYR B CZ   1 
ATOM   8652  O  OH   . TYR B 1 254 ? -4.365  13.314 -5.335  1.00 24.47  ? 254  TYR B OH   1 
ATOM   8653  H  H    . TYR B 1 254 ? 0.604   7.240  -3.275  1.00 12.35  ? 254  TYR B H    1 
ATOM   8654  H  HA   . TYR B 1 254 ? 0.499   9.809  -2.986  1.00 12.78  ? 254  TYR B HA   1 
ATOM   8655  H  HB2  . TYR B 1 254 ? -0.572  8.666  -4.737  1.00 13.33  ? 254  TYR B HB2  1 
ATOM   8656  H  HB3  . TYR B 1 254 ? -1.659  8.148  -3.744  1.00 13.33  ? 254  TYR B HB3  1 
ATOM   8657  H  HD1  . TYR B 1 254 ? -0.812  10.829 -5.764  1.00 17.01  ? 254  TYR B HD1  1 
ATOM   8658  H  HD2  . TYR B 1 254 ? -3.422  9.720  -2.990  1.00 18.88  ? 254  TYR B HD2  1 
ATOM   8659  H  HE1  . TYR B 1 254 ? -2.148  12.626 -6.330  1.00 20.07  ? 254  TYR B HE1  1 
ATOM   8660  H  HE2  . TYR B 1 254 ? -4.782  11.507 -3.527  1.00 21.21  ? 254  TYR B HE2  1 
ATOM   8661  H  HH   . TYR B 1 254 ? -5.048  13.328 -4.882  1.00 36.71  ? 254  TYR B HH   1 
ATOM   8662  N  N    . ARG B 1 255 ? -1.439  8.345  -0.904  1.00 10.26  ? 255  ARG B N    1 
ATOM   8663  C  CA   . ARG B 1 255 ? -2.081  8.485  0.441   1.00 8.52   ? 255  ARG B CA   1 
ATOM   8664  C  C    . ARG B 1 255 ? -1.085  8.935  1.494   1.00 10.29  ? 255  ARG B C    1 
ATOM   8665  O  O    . ARG B 1 255 ? -1.400  9.846  2.295   1.00 10.01  ? 255  ARG B O    1 
ATOM   8666  C  CB   . ARG B 1 255 ? -2.741  7.171  0.838   1.00 8.34   ? 255  ARG B CB   1 
ATOM   8667  C  CG   . ARG B 1 255 ? -4.017  6.879  0.097   1.00 8.80   ? 255  ARG B CG   1 
ATOM   8668  C  CD   . ARG B 1 255 ? -4.496  5.431  0.169   1.00 11.60  ? 255  ARG B CD   1 
ATOM   8669  N  NE   . ARG B 1 255 ? -4.520  4.916  1.549   1.00 10.24  ? 255  ARG B NE   1 
ATOM   8670  C  CZ   . ARG B 1 255 ? -4.869  3.708  1.912   1.00 10.45  ? 255  ARG B CZ   1 
ATOM   8671  N  NH1  . ARG B 1 255 ? -5.250  2.792  1.042   1.00 9.84   ? 255  ARG B NH1  1 
ATOM   8672  N  NH2  . ARG B 1 255 ? -4.853  3.356  3.199   1.00 11.28  ? 255  ARG B NH2  1 
ATOM   8673  H  H    . ARG B 1 255 ? -1.488  7.597  -1.325  1.00 12.32  ? 255  ARG B H    1 
ATOM   8674  H  HA   . ARG B 1 255 ? -2.781  9.168  0.373   1.00 10.22  ? 255  ARG B HA   1 
ATOM   8675  H  HB2  . ARG B 1 255 ? -2.115  6.447  0.679   1.00 10.00  ? 255  ARG B HB2  1 
ATOM   8676  H  HB3  . ARG B 1 255 ? -2.930  7.192  1.789   1.00 10.00  ? 255  ARG B HB3  1 
ATOM   8677  H  HG2  . ARG B 1 255 ? -4.716  7.451  0.451   1.00 10.56  ? 255  ARG B HG2  1 
ATOM   8678  H  HG3  . ARG B 1 255 ? -3.892  7.115  -0.836  1.00 10.56  ? 255  ARG B HG3  1 
ATOM   8679  H  HD2  . ARG B 1 255 ? -5.388  5.372  -0.207  1.00 13.92  ? 255  ARG B HD2  1 
ATOM   8680  H  HD3  . ARG B 1 255 ? -3.910  4.875  -0.367  1.00 13.92  ? 255  ARG B HD3  1 
ATOM   8681  H  HE   . ARG B 1 255 ? -4.282  5.458  2.173   1.00 12.29  ? 255  ARG B HE   1 
ATOM   8682  H  HH11 . ARG B 1 255 ? -5.275  2.980  0.203   1.00 11.81  ? 255  ARG B HH11 1 
ATOM   8683  H  HH12 . ARG B 1 255 ? -5.474  2.007  1.313   1.00 11.81  ? 255  ARG B HH12 1 
ATOM   8684  H  HH21 . ARG B 1 255 ? -4.611  3.925  3.797   1.00 13.53  ? 255  ARG B HH21 1 
ATOM   8685  H  HH22 . ARG B 1 255 ? -5.083  2.561  3.431   1.00 13.53  ? 255  ARG B HH22 1 
ATOM   8686  N  N    . GLU B 1 256 ? 0.111   8.353  1.561   1.00 7.24   ? 256  GLU B N    1 
ATOM   8687  C  CA   . GLU B 1 256 ? 1.084   8.723  2.572   1.00 10.39  ? 256  GLU B CA   1 
ATOM   8688  C  C    . GLU B 1 256 ? 1.525   10.157 2.412   1.00 11.04  ? 256  GLU B C    1 
ATOM   8689  O  O    . GLU B 1 256 ? 1.682   10.898 3.377   1.00 9.51   ? 256  GLU B O    1 
ATOM   8690  C  CB   . GLU B 1 256 ? 2.295   7.800  2.582   1.00 7.38   ? 256  GLU B CB   1 
ATOM   8691  C  CG   . GLU B 1 256 ? 1.988   6.424  3.150   1.00 9.37   ? 256  GLU B CG   1 
ATOM   8692  C  CD   . GLU B 1 256 ? 3.009   5.353  2.890   1.00 10.76  ? 256  GLU B CD   1 
ATOM   8693  O  OE1  . GLU B 1 256 ? 3.793   5.466  1.897   1.00 11.41  ? 256  GLU B OE1  1 
ATOM   8694  O  OE2  . GLU B 1 256 ? 3.108   4.385  3.704   1.00 9.99   ? 256  GLU B OE2  1 
ATOM   8695  H  H    . GLU B 1 256 ? 0.312   7.742  0.990   1.00 8.68   ? 256  GLU B H    1 
ATOM   8696  H  HA   . GLU B 1 256 ? 0.646   8.644  3.445   1.00 12.46  ? 256  GLU B HA   1 
ATOM   8697  H  HB2  . GLU B 1 256 ? 2.625   7.702  1.675   1.00 8.86   ? 256  GLU B HB2  1 
ATOM   8698  H  HB3  . GLU B 1 256 ? 2.999   8.209  3.110   1.00 8.86   ? 256  GLU B HB3  1 
ATOM   8699  H  HG2  . GLU B 1 256 ? 1.875   6.510  4.109   1.00 11.25  ? 256  GLU B HG2  1 
ATOM   8700  H  HG3  . GLU B 1 256 ? 1.139   6.128  2.785   1.00 11.25  ? 256  GLU B HG3  1 
ATOM   8701  N  N    . GLY B 1 257 ? 1.722   10.623 1.168   1.00 9.39   ? 257  GLY B N    1 
ATOM   8702  C  CA   . GLY B 1 257 ? 2.039   12.031 0.938   1.00 10.55  ? 257  GLY B CA   1 
ATOM   8703  C  C    . GLY B 1 257 ? 0.953   12.983 1.389   1.00 10.45  ? 257  GLY B C    1 
ATOM   8704  O  O    . GLY B 1 257 ? 1.270   14.027 1.996   1.00 11.60  ? 257  GLY B O    1 
ATOM   8705  H  H    . GLY B 1 257 ? 1.660   10.087 0.498   1.00 11.27  ? 257  GLY B H    1 
ATOM   8706  H  HA2  . GLY B 1 257 ? 2.859   12.247 1.409   1.00 12.66  ? 257  GLY B HA2  1 
ATOM   8707  H  HA3  . GLY B 1 257 ? 2.199   12.165 -0.009  1.00 12.66  ? 257  GLY B HA3  1 
ATOM   8708  N  N    . LEU B 1 258 ? -0.319  12.653 1.102   1.00 9.37   ? 258  LEU B N    1 
ATOM   8709  C  CA   . LEU B 1 258 ? -1.389  13.498 1.664   1.00 8.59   ? 258  LEU B CA   1 
ATOM   8710  C  C    . LEU B 1 258 ? -1.449  13.386 3.188   1.00 8.91   ? 258  LEU B C    1 
ATOM   8711  O  O    . LEU B 1 258 ? -1.768  14.415 3.826   1.00 9.88   ? 258  LEU B O    1 
ATOM   8712  C  CB   . LEU B 1 258 ? -2.726  13.128 1.036   1.00 10.63  ? 258  LEU B CB   1 
ATOM   8713  C  CG   . LEU B 1 258 ? -2.887  13.417 -0.459  1.00 10.63  ? 258  LEU B CG   1 
ATOM   8714  C  CD1  . LEU B 1 258 ? -4.258  12.987 -0.951  1.00 17.28  ? 258  LEU B CD1  1 
ATOM   8715  C  CD2  . LEU B 1 258 ? -2.686  14.899 -0.726  1.00 17.00  ? 258  LEU B CD2  1 
ATOM   8716  H  H    . LEU B 1 258 ? -0.501  11.973 0.609   1.00 11.24  ? 258  LEU B H    1 
ATOM   8717  H  HA   . LEU B 1 258 ? -1.193  14.430 1.435   1.00 10.31  ? 258  LEU B HA   1 
ATOM   8718  H  HB2  . LEU B 1 258 ? -2.875  12.180 1.177   1.00 12.76  ? 258  LEU B HB2  1 
ATOM   8719  H  HB3  . LEU B 1 258 ? -3.425  13.604 1.511   1.00 12.76  ? 258  LEU B HB3  1 
ATOM   8720  H  HG   . LEU B 1 258 ? -2.204  12.915 -0.951  1.00 12.75  ? 258  LEU B HG   1 
ATOM   8721  H  HD11 . LEU B 1 258 ? -4.384  12.053 -0.770  1.00 25.92  ? 258  LEU B HD11 1 
ATOM   8722  H  HD12 . LEU B 1 258 ? -4.322  13.141 -1.897  1.00 25.92  ? 258  LEU B HD12 1 
ATOM   8723  H  HD13 . LEU B 1 258 ? -4.935  13.495 -0.498  1.00 25.92  ? 258  LEU B HD13 1 
ATOM   8724  H  HD21 . LEU B 1 258 ? -1.816  15.165 -0.420  1.00 25.50  ? 258  LEU B HD21 1 
ATOM   8725  H  HD22 . LEU B 1 258 ? -3.357  15.402 -0.258  1.00 25.50  ? 258  LEU B HD22 1 
ATOM   8726  H  HD23 . LEU B 1 258 ? -2.759  15.067 -1.668  1.00 25.50  ? 258  LEU B HD23 1 
ATOM   8727  N  N    . TYR B 1 259 ? -1.182  12.238 3.762   1.00 8.26   ? 259  TYR B N    1 
ATOM   8728  C  CA   . TYR B 1 259 ? -1.199  12.098 5.239   1.00 9.28   ? 259  TYR B CA   1 
ATOM   8729  C  C    . TYR B 1 259 ? -0.160  13.004 5.886   1.00 11.98  ? 259  TYR B C    1 
ATOM   8730  O  O    . TYR B 1 259 ? -0.452  13.764 6.836   1.00 11.76  ? 259  TYR B O    1 
ATOM   8731  C  CB   . TYR B 1 259 ? -1.104  10.633 5.695   1.00 9.92   ? 259  TYR B CB   1 
ATOM   8732  C  CG   . TYR B 1 259 ? -1.341  10.637 7.214   1.00 7.93   ? 259  TYR B CG   1 
ATOM   8733  C  CD1  . TYR B 1 259 ? -2.658  10.748 7.652   1.00 9.39   ? 259  TYR B CD1  1 
ATOM   8734  C  CD2  . TYR B 1 259 ? -0.303  10.538 8.090   1.00 10.39  ? 259  TYR B CD2  1 
ATOM   8735  C  CE1  . TYR B 1 259 ? -2.918  10.753 9.022   1.00 10.22  ? 259  TYR B CE1  1 
ATOM   8736  C  CE2  . TYR B 1 259 ? -0.535  10.560 9.472   1.00 11.29  ? 259  TYR B CE2  1 
ATOM   8737  C  CZ   . TYR B 1 259 ? -1.853  10.661 9.881   1.00 8.92   ? 259  TYR B CZ   1 
ATOM   8738  O  OH   . TYR B 1 259 ? -2.190  10.704 11.224  1.00 13.75  ? 259  TYR B OH   1 
ATOM   8739  H  H    . TYR B 1 259 ? -0.994  11.555 3.275   1.00 9.92   ? 259  TYR B H    1 
ATOM   8740  H  HA   . TYR B 1 259 ? -2.073  12.424 5.537   1.00 11.14  ? 259  TYR B HA   1 
ATOM   8741  H  HB2  . TYR B 1 259 ? -1.776  10.095 5.248   1.00 11.90  ? 259  TYR B HB2  1 
ATOM   8742  H  HB3  . TYR B 1 259 ? -0.229  10.270 5.489   1.00 11.90  ? 259  TYR B HB3  1 
ATOM   8743  H  HD1  . TYR B 1 259 ? -3.354  10.819 7.039   1.00 11.27  ? 259  TYR B HD1  1 
ATOM   8744  H  HD2  . TYR B 1 259 ? 0.566   10.456 7.770   1.00 12.47  ? 259  TYR B HD2  1 
ATOM   8745  H  HE1  . TYR B 1 259 ? -3.788  10.817 9.344   1.00 12.27  ? 259  TYR B HE1  1 
ATOM   8746  H  HE2  . TYR B 1 259 ? 0.163   10.509 10.085  1.00 13.55  ? 259  TYR B HE2  1 
ATOM   8747  H  HH   . TYR B 1 259 ? -1.510  10.645 11.678  1.00 20.63  ? 259  TYR B HH   1 
ATOM   8748  N  N    . ILE B 1 260 ? 1.070   13.025 5.394   1.00 10.30  ? 260  ILE B N    1 
ATOM   8749  C  CA   . ILE B 1 260 ? 2.138   13.869 5.884   1.00 9.60   ? 260  ILE B CA   1 
ATOM   8750  C  C    . ILE B 1 260 ? 1.712   15.308 5.894   1.00 10.72  ? 260  ILE B C    1 
ATOM   8751  O  O    . ILE B 1 260 ? 1.830   15.995 6.895   1.00 9.63   ? 260  ILE B O    1 
ATOM   8752  C  CB   . ILE B 1 260 ? 3.413   13.675 5.041   1.00 11.15  ? 260  ILE B CB   1 
ATOM   8753  C  CG1  . ILE B 1 260 ? 3.959   12.235 5.132   1.00 11.19  ? 260  ILE B CG1  1 
ATOM   8754  C  CG2  . ILE B 1 260 ? 4.512   14.687 5.366   1.00 9.87   ? 260  ILE B CG2  1 
ATOM   8755  C  CD1  . ILE B 1 260 ? 5.029   11.939 4.113   1.00 9.63   ? 260  ILE B CD1  1 
ATOM   8756  H  H    . ILE B 1 260 ? 1.246   12.499 4.737   1.00 12.35  ? 260  ILE B H    1 
ATOM   8757  H  HA   . ILE B 1 260 ? 2.338   13.604 6.806   1.00 11.52  ? 260  ILE B HA   1 
ATOM   8758  H  HB   . ILE B 1 260 ? 3.160   13.824 4.106   1.00 13.38  ? 260  ILE B HB   1 
ATOM   8759  H  HG12 . ILE B 1 260 ? 4.322   12.091 6.020   1.00 13.42  ? 260  ILE B HG12 1 
ATOM   8760  H  HG13 . ILE B 1 260 ? 3.226   11.612 5.008   1.00 13.42  ? 260  ILE B HG13 1 
ATOM   8761  H  HG21 . ILE B 1 260 ? 4.155   15.576 5.309   1.00 14.81  ? 260  ILE B HG21 1 
ATOM   8762  H  HG22 . ILE B 1 260 ? 5.232   14.590 4.739   1.00 14.81  ? 260  ILE B HG22 1 
ATOM   8763  H  HG23 . ILE B 1 260 ? 4.838   14.529 6.255   1.00 14.81  ? 260  ILE B HG23 1 
ATOM   8764  H  HD11 . ILE B 1 260 ? 5.328   11.032 4.217   1.00 14.45  ? 260  ILE B HD11 1 
ATOM   8765  H  HD12 . ILE B 1 260 ? 5.770   12.536 4.244   1.00 14.45  ? 260  ILE B HD12 1 
ATOM   8766  H  HD13 . ILE B 1 260 ? 4.673   12.059 3.230   1.00 14.45  ? 260  ILE B HD13 1 
ATOM   8767  N  N    . THR B 1 261 ? 1.191   15.786 4.770   1.00 10.09  ? 261  THR B N    1 
ATOM   8768  C  CA   . THR B 1 261 ? 0.875   17.218 4.618   1.00 9.23   ? 261  THR B CA   1 
ATOM   8769  C  C    . THR B 1 261 ? -0.395  17.624 5.348   1.00 11.23  ? 261  THR B C    1 
ATOM   8770  O  O    . THR B 1 261 ? -0.468  18.732 5.906   1.00 11.15  ? 261  THR B O    1 
ATOM   8771  C  CB   . THR B 1 261 ? 0.840   17.561 3.096   1.00 9.99   ? 261  THR B CB   1 
ATOM   8772  O  OG1  . THR B 1 261 ? 0.028   16.615 2.376   1.00 10.99  ? 261  THR B OG1  1 
ATOM   8773  C  CG2  . THR B 1 261 ? 2.244   17.598 2.506   1.00 14.36  ? 261  THR B CG2  1 
ATOM   8774  H  H    . THR B 1 261 ? 1.036   15.249 4.117   1.00 12.11  ? 261  THR B H    1 
ATOM   8775  H  HA   . THR B 1 261 ? 1.614   17.724 5.014   1.00 11.07  ? 261  THR B HA   1 
ATOM   8776  H  HB   . THR B 1 261 ? 0.440   18.450 2.991   1.00 11.99  ? 261  THR B HB   1 
ATOM   8777  H  HG1  . THR B 1 261 ? 0.474   16.269 1.782   1.00 16.48  ? 261  THR B HG1  1 
ATOM   8778  H  HG21 . THR B 1 261 ? 2.194   17.816 1.573   1.00 21.54  ? 261  THR B HG21 1 
ATOM   8779  H  HG22 . THR B 1 261 ? 2.659   16.739 2.612   1.00 21.54  ? 261  THR B HG22 1 
ATOM   8780  H  HG23 . THR B 1 261 ? 2.765   18.263 2.963   1.00 21.54  ? 261  THR B HG23 1 
ATOM   8781  N  N    . GLU B 1 262 ? -1.433  16.806 5.391   1.00 10.78  ? 262  GLU B N    1 
ATOM   8782  C  CA   . GLU B 1 262 ? -2.619  17.056 6.209   1.00 11.62  ? 262  GLU B CA   1 
ATOM   8783  C  C    . GLU B 1 262 ? -2.226  17.186 7.691   1.00 12.19  ? 262  GLU B C    1 
ATOM   8784  O  O    . GLU B 1 262 ? -2.747  18.014 8.400   1.00 12.96  ? 262  GLU B O    1 
ATOM   8785  C  CB   . GLU B 1 262 ? -3.623  15.936 6.100   1.00 10.72  ? 262  GLU B CB   1 
ATOM   8786  C  CG   . GLU B 1 262 ? -4.446  15.914 4.842   1.00 9.86   ? 262  GLU B CG   1 
ATOM   8787  C  CD   . GLU B 1 262 ? -5.220  14.652 4.592   1.00 10.13  ? 262  GLU B CD   1 
ATOM   8788  O  OE1  . GLU B 1 262 ? -4.989  13.592 5.255   1.00 12.06  ? 262  GLU B OE1  1 
ATOM   8789  O  OE2  . GLU B 1 262 ? -6.139  14.676 3.716   1.00 12.78  ? 262  GLU B OE2  1 
ATOM   8790  H  H    . GLU B 1 262 ? -1.410  16.091 4.913   1.00 12.94  ? 262  GLU B H    1 
ATOM   8791  H  HA   . GLU B 1 262 ? -3.039  17.891 5.916   1.00 13.94  ? 262  GLU B HA   1 
ATOM   8792  H  HB2  . GLU B 1 262 ? -3.148  15.093 6.168   1.00 12.87  ? 262  GLU B HB2  1 
ATOM   8793  H  HB3  . GLU B 1 262 ? -4.226  15.992 6.857   1.00 12.87  ? 262  GLU B HB3  1 
ATOM   8794  H  HG2  . GLU B 1 262 ? -5.071  16.655 4.873   1.00 11.83  ? 262  GLU B HG2  1 
ATOM   8795  H  HG3  . GLU B 1 262 ? -3.855  16.064 4.088   1.00 11.83  ? 262  GLU B HG3  1 
ATOM   8796  N  N    . GLU B 1 263 ? -1.324  16.363 8.161   1.00 10.54  ? 263  GLU B N    1 
ATOM   8797  C  CA   . GLU B 1 263 ? -0.933  16.447 9.585   1.00 10.07  ? 263  GLU B CA   1 
ATOM   8798  C  C    . GLU B 1 263 ? -0.093  17.689 9.826   1.00 11.83  ? 263  GLU B C    1 
ATOM   8799  O  O    . GLU B 1 263 ? -0.200  18.354 10.872  1.00 13.74  ? 263  GLU B O    1 
ATOM   8800  C  CB   . GLU B 1 263 ? -0.171  15.191 9.994   1.00 9.92   ? 263  GLU B CB   1 
ATOM   8801  C  CG   . GLU B 1 263 ? -1.012  13.917 10.059  1.00 12.30  ? 263  GLU B CG   1 
ATOM   8802  C  CD   . GLU B 1 263 ? -2.179  14.090 11.033  1.00 14.67  ? 263  GLU B CD   1 
ATOM   8803  O  OE1  . GLU B 1 263 ? -1.944  14.529 12.176  1.00 12.20  ? 263  GLU B OE1  1 
ATOM   8804  O  OE2  . GLU B 1 263 ? -3.338  13.800 10.694  1.00 16.11  ? 263  GLU B OE2  1 
ATOM   8805  H  H    . GLU B 1 263 ? -0.961  15.777 7.646   1.00 12.65  ? 263  GLU B H    1 
ATOM   8806  H  HA   . GLU B 1 263 ? -1.746  16.510 10.128  1.00 12.09  ? 263  GLU B HA   1 
ATOM   8807  H  HB2  . GLU B 1 263 ? 0.553   15.051 9.363   1.00 11.90  ? 263  GLU B HB2  1 
ATOM   8808  H  HB3  . GLU B 1 263 ? 0.227   15.343 10.866  1.00 11.90  ? 263  GLU B HB3  1 
ATOM   8809  H  HG2  . GLU B 1 263 ? -1.354  13.709 9.176   1.00 14.76  ? 263  GLU B HG2  1 
ATOM   8810  H  HG3  . GLU B 1 263 ? -0.456  13.177 10.349  1.00 14.76  ? 263  GLU B HG3  1 
ATOM   8811  N  N    . ILE B 1 264 ? 0.814   18.075 8.920   1.00 10.41  ? 264  ILE B N    1 
ATOM   8812  C  CA   . ILE B 1 264 ? 1.558   19.295 9.182   1.00 9.69   ? 264  ILE B CA   1 
ATOM   8813  C  C    . ILE B 1 264 ? 0.619   20.496 9.163   1.00 11.79  ? 264  ILE B C    1 
ATOM   8814  O  O    . ILE B 1 264 ? 0.785   21.415 9.983   1.00 13.68  ? 264  ILE B O    1 
ATOM   8815  C  CB   . ILE B 1 264 ? 2.666   19.370 8.114   1.00 12.63  ? 264  ILE B CB   1 
ATOM   8816  C  CG1  . ILE B 1 264 ? 3.790   18.370 8.350   1.00 13.13  ? 264  ILE B CG1  1 
ATOM   8817  C  CG2  . ILE B 1 264 ? 3.184   20.789 7.995   1.00 14.89  ? 264  ILE B CG2  1 
ATOM   8818  C  CD1  . ILE B 1 264 ? 4.779   18.091 7.249   1.00 10.88  ? 264  ILE B CD1  1 
ATOM   8819  H  H    . ILE B 1 264 ? 0.952   17.615 8.207   1.00 12.49  ? 264  ILE B H    1 
ATOM   8820  H  HA   . ILE B 1 264 ? 1.973   19.230 10.068  1.00 11.63  ? 264  ILE B HA   1 
ATOM   8821  H  HB   . ILE B 1 264 ? 2.253   19.142 7.255   1.00 15.15  ? 264  ILE B HB   1 
ATOM   8822  H  HG12 . ILE B 1 264 ? 4.292   18.673 9.122   1.00 15.75  ? 264  ILE B HG12 1 
ATOM   8823  H  HG13 . ILE B 1 264 ? 3.381   17.525 8.594   1.00 15.75  ? 264  ILE B HG13 1 
ATOM   8824  H  HG21 . ILE B 1 264 ? 2.449   21.387 7.842   1.00 22.34  ? 264  ILE B HG21 1 
ATOM   8825  H  HG22 . ILE B 1 264 ? 3.800   20.844 7.260   1.00 22.34  ? 264  ILE B HG22 1 
ATOM   8826  H  HG23 . ILE B 1 264 ? 3.633   21.035 8.807   1.00 22.34  ? 264  ILE B HG23 1 
ATOM   8827  H  HD11 . ILE B 1 264 ? 5.428   17.454 7.556   1.00 16.32  ? 264  ILE B HD11 1 
ATOM   8828  H  HD12 . ILE B 1 264 ? 5.223   18.906 7.004   1.00 16.32  ? 264  ILE B HD12 1 
ATOM   8829  H  HD13 . ILE B 1 264 ? 4.317   17.736 6.487   1.00 16.32  ? 264  ILE B HD13 1 
ATOM   8830  N  N    . TYR B 1 265 ? -0.362  20.578 8.265   1.00 12.26  ? 265  TYR B N    1 
ATOM   8831  C  CA   . TYR B 1 265 ? -1.352  21.646 8.272   1.00 12.00  ? 265  TYR B CA   1 
ATOM   8832  C  C    . TYR B 1 265 ? -1.976  21.815 9.671   1.00 14.76  ? 265  TYR B C    1 
ATOM   8833  O  O    . TYR B 1 265 ? -2.061  22.932 10.198  1.00 13.54  ? 265  TYR B O    1 
ATOM   8834  C  CB   . TYR B 1 265 ? -2.483  21.451 7.258   1.00 11.96  ? 265  TYR B CB   1 
ATOM   8835  C  CG   . TYR B 1 265 ? -3.656  22.394 7.480   1.00 13.81  ? 265  TYR B CG   1 
ATOM   8836  C  CD1  . TYR B 1 265 ? -3.508  23.742 7.135   1.00 16.66  ? 265  TYR B CD1  1 
ATOM   8837  C  CD2  . TYR B 1 265 ? -4.866  22.006 8.031   1.00 12.55  ? 265  TYR B CD2  1 
ATOM   8838  C  CE1  . TYR B 1 265 ? -4.544  24.649 7.328   1.00 12.18  ? 265  TYR B CE1  1 
ATOM   8839  C  CE2  . TYR B 1 265 ? -5.919  22.873 8.227   1.00 13.63  ? 265  TYR B CE2  1 
ATOM   8840  C  CZ   . TYR B 1 265 ? -5.731  24.196 7.869   1.00 19.35  ? 265  TYR B CZ   1 
ATOM   8841  O  OH   . TYR B 1 265 ? -6.736  25.106 8.039   1.00 23.04  ? 265  TYR B OH   1 
ATOM   8842  H  H    . TYR B 1 265 ? -0.413  19.973 7.656   1.00 14.71  ? 265  TYR B H    1 
ATOM   8843  H  HA   . TYR B 1 265 ? -0.891  22.482 8.047   1.00 14.40  ? 265  TYR B HA   1 
ATOM   8844  H  HB2  . TYR B 1 265 ? -2.132  21.590 6.365   1.00 14.36  ? 265  TYR B HB2  1 
ATOM   8845  H  HB3  . TYR B 1 265 ? -2.800  20.536 7.313   1.00 14.36  ? 265  TYR B HB3  1 
ATOM   8846  H  HD1  . TYR B 1 265 ? -2.704  24.036 6.771   1.00 19.99  ? 265  TYR B HD1  1 
ATOM   8847  H  HD2  . TYR B 1 265 ? -4.972  21.116 8.282   1.00 15.06  ? 265  TYR B HD2  1 
ATOM   8848  H  HE1  . TYR B 1 265 ? -4.440  25.543 7.098   1.00 14.61  ? 265  TYR B HE1  1 
ATOM   8849  H  HE2  . TYR B 1 265 ? -6.726  22.580 8.587   1.00 16.36  ? 265  TYR B HE2  1 
ATOM   8850  H  HH   . TYR B 1 265 ? -7.390  24.733 8.364   1.00 34.56  ? 265  TYR B HH   1 
ATOM   8851  N  N    . LYS B 1 266 ? -2.357  20.721 10.296  1.00 12.05  ? 266  LYS B N    1 
ATOM   8852  C  CA   . LYS B 1 266 ? -3.193  20.774 11.503  1.00 10.93  ? 266  LYS B CA   1 
ATOM   8853  C  C    . LYS B 1 266 ? -2.361  21.238 12.683  1.00 16.00  ? 266  LYS B C    1 
ATOM   8854  O  O    . LYS B 1 266 ? -2.961  21.645 13.689  1.00 17.90  ? 266  LYS B O    1 
ATOM   8855  C  CB   . LYS B 1 266 ? -3.866  19.436 11.730  1.00 16.99  ? 266  LYS B CB   1 
ATOM   8856  C  CG   . LYS B 1 266 ? -5.077  19.217 10.831  1.00 17.75  ? 266  LYS B CG   1 
ATOM   8857  C  CD   . LYS B 1 266 ? -5.756  17.875 11.040  1.00 18.86  ? 266  LYS B CD   1 
ATOM   8858  C  CE   . LYS B 1 266 ? -5.862  17.500 12.511  1.00 27.27  ? 266  LYS B CE   1 
ATOM   8859  N  NZ   . LYS B 1 266 ? -6.534  16.202 12.788  1.00 42.30  ? 266  LYS B NZ   1 
ATOM   8860  H  H    . LYS B 1 266 ? -2.111  19.955 9.990   1.00 14.47  ? 266  LYS B H    1 
ATOM   8861  H  HA   . LYS B 1 266 ? -3.895  21.441 11.351  1.00 13.11  ? 266  LYS B HA   1 
ATOM   8862  H  HB2  . LYS B 1 266 ? -3.222  18.729 11.570  1.00 20.39  ? 266  LYS B HB2  1 
ATOM   8863  H  HB3  . LYS B 1 266 ? -4.146  19.378 12.657  1.00 20.39  ? 266  LYS B HB3  1 
ATOM   8864  H  HG2  . LYS B 1 266 ? -5.722  19.923 10.997  1.00 21.30  ? 266  LYS B HG2  1 
ATOM   8865  H  HG3  . LYS B 1 266 ? -4.796  19.285 9.905   1.00 21.30  ? 266  LYS B HG3  1 
ATOM   8866  H  HD2  . LYS B 1 266 ? -6.646  17.906 10.655  1.00 22.63  ? 266  LYS B HD2  1 
ATOM   8867  H  HD3  . LYS B 1 266 ? -5.254  17.189 10.573  1.00 22.63  ? 266  LYS B HD3  1 
ATOM   8868  H  HE2  . LYS B 1 266 ? -4.968  17.470 12.885  1.00 32.72  ? 266  LYS B HE2  1 
ATOM   8869  H  HE3  . LYS B 1 266 ? -6.348  18.202 12.972  1.00 32.72  ? 266  LYS B HE3  1 
ATOM   8870  H  HZ1  . LYS B 1 266 ? -6.483  16.021 13.658  1.00 63.45  ? 266  LYS B HZ1  1 
ATOM   8871  H  HZ2  . LYS B 1 266 ? -6.132  15.555 12.327  1.00 63.45  ? 266  LYS B HZ2  1 
ATOM   8872  H  HZ3  . LYS B 1 266 ? -7.389  16.252 12.545  1.00 63.45  ? 266  LYS B HZ3  1 
ATOM   8873  N  N    . THR B 1 267 ? -1.040  21.177 12.643  1.00 11.79  ? 267  THR B N    1 
ATOM   8874  C  CA   . THR B 1 267 ? -0.197  21.753 13.672  1.00 14.68  ? 267  THR B CA   1 
ATOM   8875  C  C    . THR B 1 267 ? -0.419  23.269 13.702  1.00 18.74  ? 267  THR B C    1 
ATOM   8876  O  O    . THR B 1 267 ? -0.216  23.884 14.764  1.00 19.51  ? 267  THR B O    1 
ATOM   8877  C  CB   . THR B 1 267 ? 1.291   21.424 13.502  1.00 19.45  ? 267  THR B CB   1 
ATOM   8878  O  OG1  . THR B 1 267 ? 1.751   22.121 12.344  1.00 15.01  ? 267  THR B OG1  1 
ATOM   8879  C  CG2  . THR B 1 267 ? 1.635   19.985 13.178  1.00 20.28  ? 267  THR B CG2  1 
ATOM   8880  H  H    . THR B 1 267 ? -0.666  20.779 11.979  1.00 14.15  ? 267  THR B H    1 
ATOM   8881  H  HA   . THR B 1 267 ? -0.487  21.391 14.535  1.00 17.62  ? 267  THR B HA   1 
ATOM   8882  H  HB   . THR B 1 267 ? 1.792   21.719 14.291  1.00 23.34  ? 267  THR B HB   1 
ATOM   8883  H  HG1  . THR B 1 267 ? 1.610   22.924 12.435  1.00 22.52  ? 267  THR B HG1  1 
ATOM   8884  H  HG21 . THR B 1 267 ? 2.587   19.893 13.098  1.00 30.41  ? 267  THR B HG21 1 
ATOM   8885  H  HG22 . THR B 1 267 ? 1.219   19.735 12.350  1.00 30.41  ? 267  THR B HG22 1 
ATOM   8886  H  HG23 . THR B 1 267 ? 1.316   19.414 13.881  1.00 30.41  ? 267  THR B HG23 1 
ATOM   8887  N  N    . GLY B 1 268 ? -0.845  23.961 12.656  1.00 15.28  ? 268  GLY B N    1 
ATOM   8888  C  CA   . GLY B 1 268 ? -1.019  25.428 12.733  1.00 17.38  ? 268  GLY B CA   1 
ATOM   8889  C  C    . GLY B 1 268 ? 0.235   26.239 12.471  1.00 19.48  ? 268  GLY B C    1 
ATOM   8890  O  O    . GLY B 1 268 ? 0.243   27.475 12.431  1.00 23.27  ? 268  GLY B O    1 
ATOM   8891  H  H    . GLY B 1 268 ? -1.022  23.551 11.921  1.00 18.33  ? 268  GLY B H    1 
ATOM   8892  H  HA2  . GLY B 1 268 ? -1.696  25.692 12.090  1.00 20.85  ? 268  GLY B HA2  1 
ATOM   8893  H  HA3  . GLY B 1 268 ? -1.351  25.653 13.616  1.00 20.85  ? 268  GLY B HA3  1 
ATOM   8894  N  N    . LEU B 1 269 ? 1.374   25.637 12.249  1.00 16.26  ? 269  LEU B N    1 
ATOM   8895  C  CA   . LEU B 1 269 ? 2.750   26.002 12.405  1.00 13.44  ? 269  LEU B CA   1 
ATOM   8896  C  C    . LEU B 1 269 ? 3.521   25.896 11.103  1.00 15.07  ? 269  LEU B C    1 
ATOM   8897  O  O    . LEU B 1 269 ? 4.704   26.238 11.115  1.00 16.89  ? 269  LEU B O    1 
ATOM   8898  C  CB   . LEU B 1 269 ? 3.474   25.189 13.494  1.00 17.00  ? 269  LEU B CB   1 
ATOM   8899  C  CG   . LEU B 1 269 ? 2.954   25.468 14.913  1.00 17.91  ? 269  LEU B CG   1 
ATOM   8900  C  CD1  . LEU B 1 269 ? 3.568   24.531 15.918  1.00 19.04  ? 269  LEU B CD1  1 
ATOM   8901  C  CD2  . LEU B 1 269 ? 3.250   26.904 15.331  1.00 22.21  ? 269  LEU B CD2  1 
ATOM   8902  H  H    . LEU B 1 269 ? 1.275   24.842 11.938  1.00 19.51  ? 269  LEU B H    1 
ATOM   8903  H  HA   . LEU B 1 269 ? 2.772   26.942 12.681  1.00 16.12  ? 269  LEU B HA   1 
ATOM   8904  H  HB2  . LEU B 1 269 ? 3.371   24.244 13.302  1.00 20.40  ? 269  LEU B HB2  1 
ATOM   8905  H  HB3  . LEU B 1 269 ? 4.422   25.395 13.461  1.00 20.40  ? 269  LEU B HB3  1 
ATOM   8906  H  HG   . LEU B 1 269 ? 1.983   25.337 14.919  1.00 21.49  ? 269  LEU B HG   1 
ATOM   8907  H  HD11 . LEU B 1 269 ? 3.380   23.624 15.667  1.00 28.56  ? 269  LEU B HD11 1 
ATOM   8908  H  HD12 . LEU B 1 269 ? 3.196   24.705 16.786  1.00 28.56  ? 269  LEU B HD12 1 
ATOM   8909  H  HD13 . LEU B 1 269 ? 4.518   24.666 15.944  1.00 28.56  ? 269  LEU B HD13 1 
ATOM   8910  H  HD21 . LEU B 1 269 ? 2.860   27.509 14.695  1.00 33.31  ? 269  LEU B HD21 1 
ATOM   8911  H  HD22 . LEU B 1 269 ? 4.200   27.039 15.360  1.00 33.31  ? 269  LEU B HD22 1 
ATOM   8912  H  HD23 . LEU B 1 269 ? 2.877   27.068 16.200  1.00 33.31  ? 269  LEU B HD23 1 
ATOM   8913  N  N    . LEU B 1 270 ? 2.885   25.489 10.010  1.00 16.59  ? 270  LEU B N    1 
ATOM   8914  C  CA   . LEU B 1 270 ? 3.630   25.518 8.755   1.00 15.04  ? 270  LEU B CA   1 
ATOM   8915  C  C    . LEU B 1 270 ? 3.999   26.967 8.443   1.00 16.45  ? 270  LEU B C    1 
ATOM   8916  O  O    . LEU B 1 270 ? 3.142   27.837 8.468   1.00 15.15  ? 270  LEU B O    1 
ATOM   8917  C  CB   . LEU B 1 270 ? 2.839   24.971 7.597   1.00 14.15  ? 270  LEU B CB   1 
ATOM   8918  C  CG   . LEU B 1 270 ? 3.517   24.888 6.225   1.00 12.31  ? 270  LEU B CG   1 
ATOM   8919  C  CD1  . LEU B 1 270 ? 4.736   24.001 6.273   1.00 14.60  ? 270  LEU B CD1  1 
ATOM   8920  C  CD2  . LEU B 1 270 ? 2.494   24.453 5.188   1.00 14.79  ? 270  LEU B CD2  1 
ATOM   8921  H  H    . LEU B 1 270 ? 2.069   25.220 10.041  1.00 19.91  ? 270  LEU B H    1 
ATOM   8922  H  HA   . LEU B 1 270 ? 4.451   24.993 8.857   1.00 18.04  ? 270  LEU B HA   1 
ATOM   8923  H  HB2  . LEU B 1 270 ? 2.546   24.077 7.836   1.00 16.98  ? 270  LEU B HB2  1 
ATOM   8924  H  HB3  . LEU B 1 270 ? 2.042   25.516 7.500   1.00 16.98  ? 270  LEU B HB3  1 
ATOM   8925  H  HG   . LEU B 1 270 ? 3.815   25.791 5.987   1.00 14.78  ? 270  LEU B HG   1 
ATOM   8926  H  HD11 . LEU B 1 270 ? 5.344   24.329 6.939   1.00 21.91  ? 270  LEU B HD11 1 
ATOM   8927  H  HD12 . LEU B 1 270 ? 5.168   24.005 5.416   1.00 21.91  ? 270  LEU B HD12 1 
ATOM   8928  H  HD13 . LEU B 1 270 ? 4.471   23.105 6.493   1.00 21.91  ? 270  LEU B HD13 1 
ATOM   8929  H  HD21 . LEU B 1 270 ? 1.745   25.054 5.205   1.00 22.18  ? 270  LEU B HD21 1 
ATOM   8930  H  HD22 . LEU B 1 270 ? 2.195   23.563 5.387   1.00 22.18  ? 270  LEU B HD22 1 
ATOM   8931  H  HD23 . LEU B 1 270 ? 2.896   24.468 4.316   1.00 22.18  ? 270  LEU B HD23 1 
ATOM   8932  N  N    . SER B 1 271 ? 5.278   27.163 8.163   1.00 13.93  ? 271  SER B N    1 
ATOM   8933  C  CA   . SER B 1 271 ? 5.767   28.546 7.980   1.00 14.32  ? 271  SER B CA   1 
ATOM   8934  C  C    . SER B 1 271 ? 6.462   28.722 6.651   1.00 13.04  ? 271  SER B C    1 
ATOM   8935  O  O    . SER B 1 271 ? 6.530   29.860 6.107   1.00 17.17  ? 271  SER B O    1 
ATOM   8936  C  CB   . SER B 1 271 ? 6.625   28.830 9.213   1.00 15.29  ? 271  SER B CB   1 
ATOM   8937  O  OG   . SER B 1 271 ? 7.253   30.097 9.207   1.00 21.77  ? 271  SER B OG   1 
ATOM   8938  H  H    . SER B 1 271 ? 5.816   26.497 8.088   1.00 16.72  ? 271  SER B H    1 
ATOM   8939  H  HA   . SER B 1 271 ? 4.994   29.148 8.001   1.00 17.19  ? 271  SER B HA   1 
ATOM   8940  H  HB2  . SER B 1 271 ? 6.065   28.765 10.003  1.00 18.35  ? 271  SER B HB2  1 
ATOM   8941  H  HB3  . SER B 1 271 ? 7.308   28.145 9.281   1.00 18.35  ? 271  SER B HB3  1 
ATOM   8942  H  HG   . SER B 1 271 ? 7.777   30.139 8.577   1.00 32.66  ? 271  SER B HG   1 
ATOM   8943  N  N    . GLY B 1 272 ? 7.012   27.679 6.057   1.00 14.15  ? 272  GLY B N    1 
ATOM   8944  C  CA   . GLY B 1 272 ? 7.576   27.722 4.750   1.00 11.68  ? 272  GLY B CA   1 
ATOM   8945  C  C    . GLY B 1 272 ? 7.446   26.384 4.060   1.00 15.92  ? 272  GLY B C    1 
ATOM   8946  O  O    . GLY B 1 272 ? 7.466   25.359 4.771   1.00 15.90  ? 272  GLY B O    1 
ATOM   8947  H  H    . GLY B 1 272 ? 7.031   26.932 6.483   1.00 16.97  ? 272  GLY B H    1 
ATOM   8948  H  HA2  . GLY B 1 272 ? 7.123   28.401 4.226   1.00 14.02  ? 272  GLY B HA2  1 
ATOM   8949  H  HA3  . GLY B 1 272 ? 8.513   27.964 4.811   1.00 14.02  ? 272  GLY B HA3  1 
ATOM   8950  N  N    . LEU B 1 273 ? 7.322   26.403 2.743   1.00 15.75  ? 273  LEU B N    1 
ATOM   8951  C  CA   . LEU B 1 273 ? 7.103   25.173 1.952   1.00 10.67  ? 273  LEU B CA   1 
ATOM   8952  C  C    . LEU B 1 273 ? 7.904   25.214 0.667   1.00 13.72  ? 273  LEU B C    1 
ATOM   8953  O  O    . LEU B 1 273 ? 7.902   26.300 0.051   1.00 20.34  ? 273  LEU B O    1 
ATOM   8954  C  CB   . LEU B 1 273 ? 5.619   24.992 1.667   1.00 13.47  ? 273  LEU B CB   1 
ATOM   8955  C  CG   . LEU B 1 273 ? 5.244   23.853 0.706   1.00 13.31  ? 273  LEU B CG   1 
ATOM   8956  C  CD1  . LEU B 1 273 ? 5.538   22.481 1.251   1.00 13.81  ? 273  LEU B CD1  1 
ATOM   8957  C  CD2  . LEU B 1 273 ? 3.767   23.986 0.326   1.00 25.67  ? 273  LEU B CD2  1 
ATOM   8958  H  H    . LEU B 1 273 ? 7.370   27.157 2.332   1.00 18.90  ? 273  LEU B H    1 
ATOM   8959  H  HA   . LEU B 1 273 ? 7.410   24.408 2.482   1.00 12.80  ? 273  LEU B HA   1 
ATOM   8960  H  HB2  . LEU B 1 273 ? 5.164   24.839 2.510   1.00 16.17  ? 273  LEU B HB2  1 
ATOM   8961  H  HB3  . LEU B 1 273 ? 5.277   25.822 1.300   1.00 16.17  ? 273  LEU B HB3  1 
ATOM   8962  H  HG   . LEU B 1 273 ? 5.773   23.967 -0.111  1.00 15.97  ? 273  LEU B HG   1 
ATOM   8963  H  HD11 . LEU B 1 273 ? 6.471   22.415 1.466   1.00 20.71  ? 273  LEU B HD11 1 
ATOM   8964  H  HD12 . LEU B 1 273 ? 5.314   21.820 0.591   1.00 20.71  ? 273  LEU B HD12 1 
ATOM   8965  H  HD13 . LEU B 1 273 ? 5.015   22.333 2.042   1.00 20.71  ? 273  LEU B HD13 1 
ATOM   8966  H  HD21 . LEU B 1 273 ? 3.603   24.869 -0.014  1.00 38.51  ? 273  LEU B HD21 1 
ATOM   8967  H  HD22 . LEU B 1 273 ? 3.222   23.836 1.102   1.00 38.51  ? 273  LEU B HD22 1 
ATOM   8968  H  HD23 . LEU B 1 273 ? 3.550   23.338 -0.348  1.00 38.51  ? 273  LEU B HD23 1 
ATOM   8969  N  N    . ASP B 1 274 ? 8.530   24.132 0.263   1.00 12.35  ? 274  ASP B N    1 
ATOM   8970  C  CA   . ASP B 1 274 ? 9.241   23.999 -0.985  1.00 11.04  ? 274  ASP B CA   1 
ATOM   8971  C  C    . ASP B 1 274 ? 8.593   22.846 -1.748  1.00 10.96  ? 274  ASP B C    1 
ATOM   8972  O  O    . ASP B 1 274 ? 8.447   21.768 -1.158  1.00 12.51  ? 274  ASP B O    1 
ATOM   8973  C  CB   . ASP B 1 274 ? 10.730  23.713 -0.806  1.00 11.90  ? 274  ASP B CB   1 
ATOM   8974  C  CG   . ASP B 1 274 ? 11.454  24.693 0.082   1.00 13.04  ? 274  ASP B CG   1 
ATOM   8975  O  OD1  . ASP B 1 274 ? 11.132  25.902 0.077   1.00 15.09  ? 274  ASP B OD1  1 
ATOM   8976  O  OD2  . ASP B 1 274 ? 12.338  24.182 0.813   1.00 13.90  ? 274  ASP B OD2  1 
ATOM   8977  H  H    . ASP B 1 274 ? 8.516   23.448 0.785   1.00 14.82  ? 274  ASP B H    1 
ATOM   8978  H  HA   . ASP B 1 274 ? 9.134   24.825 -1.502  1.00 13.25  ? 274  ASP B HA   1 
ATOM   8979  H  HB2  . ASP B 1 274 ? 10.831  22.824 -0.433  1.00 14.28  ? 274  ASP B HB2  1 
ATOM   8980  H  HB3  . ASP B 1 274 ? 11.152  23.716 -1.679  1.00 14.28  ? 274  ASP B HB3  1 
ATOM   8981  N  N    . ILE B 1 275 ? 8.239   23.041 -3.010  1.00 13.26  ? 275  ILE B N    1 
ATOM   8982  C  CA   . ILE B 1 275 ? 7.740   21.965 -3.865  1.00 12.72  ? 275  ILE B CA   1 
ATOM   8983  C  C    . ILE B 1 275 ? 8.788   21.858 -4.984  1.00 10.85  ? 275  ILE B C    1 
ATOM   8984  O  O    . ILE B 1 275 ? 8.753   22.789 -5.803  1.00 15.84  ? 275  ILE B O    1 
ATOM   8985  C  CB   . ILE B 1 275 ? 6.373   22.292 -4.430  1.00 13.60  ? 275  ILE B CB   1 
ATOM   8986  C  CG1  . ILE B 1 275 ? 5.280   22.486 -3.367  1.00 14.58  ? 275  ILE B CG1  1 
ATOM   8987  C  CG2  . ILE B 1 275 ? 5.943   21.265 -5.475  1.00 19.50  ? 275  ILE B CG2  1 
ATOM   8988  C  CD1  . ILE B 1 275 ? 4.275   23.509 -3.871  1.00 58.95  ? 275  ILE B CD1  1 
ATOM   8989  H  H    . ILE B 1 275 ? 8.306   23.832 -3.339  1.00 15.91  ? 275  ILE B H    1 
ATOM   8990  H  HA   . ILE B 1 275 ? 7.701   21.126 -3.360  1.00 15.27  ? 275  ILE B HA   1 
ATOM   8991  H  HB   . ILE B 1 275 ? 6.462   23.148 -4.899  1.00 16.31  ? 275  ILE B HB   1 
ATOM   8992  H  HG12 . ILE B 1 275 ? 4.834   21.642 -3.196  1.00 17.50  ? 275  ILE B HG12 1 
ATOM   8993  H  HG13 . ILE B 1 275 ? 5.677   22.795 -2.538  1.00 17.50  ? 275  ILE B HG13 1 
ATOM   8994  H  HG21 . ILE B 1 275 ? 5.076   21.499 -5.815  1.00 29.25  ? 275  ILE B HG21 1 
ATOM   8995  H  HG22 . ILE B 1 275 ? 5.904   20.395 -5.071  1.00 29.25  ? 275  ILE B HG22 1 
ATOM   8996  H  HG23 . ILE B 1 275 ? 6.577   21.256 -6.195  1.00 29.25  ? 275  ILE B HG23 1 
ATOM   8997  H  HD11 . ILE B 1 275 ? 3.594   23.643 -3.207  1.00 88.42  ? 275  ILE B HD11 1 
ATOM   8998  H  HD12 . ILE B 1 275 ? 3.872   23.190 -4.682  1.00 88.42  ? 275  ILE B HD12 1 
ATOM   8999  H  HD13 . ILE B 1 275 ? 4.723   24.341 -4.042  1.00 88.42  ? 275  ILE B HD13 1 
ATOM   9000  N  N    . MET B 1 276 ? 9.639   20.868 -4.948  1.00 10.01  ? 276  MET B N    1 
ATOM   9001  C  CA   . MET B 1 276 ? 10.864  20.784 -5.709  1.00 12.46  ? 276  MET B CA   1 
ATOM   9002  C  C    . MET B 1 276 ? 10.958  19.557 -6.597  1.00 10.65  ? 276  MET B C    1 
ATOM   9003  O  O    . MET B 1 276 ? 10.380  18.494 -6.333  1.00 11.77  ? 276  MET B O    1 
ATOM   9004  C  CB   . MET B 1 276 ? 12.049  20.743 -4.721  1.00 15.12  ? 276  MET B CB   1 
ATOM   9005  C  CG   . MET B 1 276 ? 11.966  21.828 -3.671  1.00 12.86  ? 276  MET B CG   1 
ATOM   9006  S  SD   . MET B 1 276 ? 11.707  23.480 -4.331  1.00 27.32  ? 276  MET B SD   1 
ATOM   9007  C  CE   . MET B 1 276 ? 13.359  23.644 -4.950  1.00 13.26  ? 276  MET B CE   1 
ATOM   9008  H  H    . MET B 1 276 ? 9.455   20.210 -4.425  1.00 12.01  ? 276  MET B H    1 
ATOM   9009  H  HA   . MET B 1 276 ? 10.945  21.585 -6.267  1.00 14.96  ? 276  MET B HA   1 
ATOM   9010  H  HB2  . MET B 1 276 ? 12.067  19.878 -4.282  1.00 18.15  ? 276  MET B HB2  1 
ATOM   9011  H  HB3  . MET B 1 276 ? 12.878  20.842 -5.215  1.00 18.15  ? 276  MET B HB3  1 
ATOM   9012  H  HG2  . MET B 1 276 ? 11.238  21.619 -3.065  1.00 15.44  ? 276  MET B HG2  1 
ATOM   9013  H  HG3  . MET B 1 276 ? 12.787  21.825 -3.155  1.00 15.44  ? 276  MET B HG3  1 
ATOM   9014  H  HE1  . MET B 1 276 ? 13.461  24.504 -5.365  1.00 19.89  ? 276  MET B HE1  1 
ATOM   9015  H  HE2  . MET B 1 276 ? 13.529  22.955 -5.596  1.00 19.89  ? 276  MET B HE2  1 
ATOM   9016  H  HE3  . MET B 1 276 ? 13.982  23.563 -4.224  1.00 19.89  ? 276  MET B HE3  1 
ATOM   9017  N  N    . GLU B 1 277 ? 11.759  19.703 -7.680  1.00 12.49  ? 277  GLU B N    1 
ATOM   9018  C  CA   . GLU B 1 277 ? 12.191  18.687 -8.619  1.00 11.13  ? 277  GLU B CA   1 
ATOM   9019  C  C    . GLU B 1 277 ? 11.117  18.182 -9.582  1.00 11.86  ? 277  GLU B C    1 
ATOM   9020  O  O    . GLU B 1 277 ? 11.285  17.185 -10.279 1.00 12.02  ? 277  GLU B O    1 
ATOM   9021  C  CB   . GLU B 1 277 ? 12.884  17.463 -7.941  1.00 11.51  ? 277  GLU B CB   1 
ATOM   9022  C  CG   . GLU B 1 277 ? 14.157  17.883 -7.186  1.00 13.61  ? 277  GLU B CG   1 
ATOM   9023  C  CD   . GLU B 1 277 ? 15.397  18.151 -8.003  1.00 17.26  ? 277  GLU B CD   1 
ATOM   9024  O  OE1  . GLU B 1 277 ? 15.365  18.027 -9.244  1.00 18.26  ? 277  GLU B OE1  1 
ATOM   9025  O  OE2  . GLU B 1 277 ? 16.475  18.474 -7.416  1.00 14.48  ? 277  GLU B OE2  1 
ATOM   9026  H  H    . GLU B 1 277 ? 12.048  20.500 -7.829  1.00 14.98  ? 277  GLU B H    1 
ATOM   9027  H  HA   . GLU B 1 277 ? 12.877  19.109 -9.177  1.00 13.35  ? 277  GLU B HA   1 
ATOM   9028  H  HB2  . GLU B 1 277 ? 12.266  17.047 -7.321  1.00 13.81  ? 277  GLU B HB2  1 
ATOM   9029  H  HB3  . GLU B 1 277 ? 13.114  16.809 -8.619  1.00 13.81  ? 277  GLU B HB3  1 
ATOM   9030  H  HG2  . GLU B 1 277 ? 13.953  18.686 -6.681  1.00 16.33  ? 277  GLU B HG2  1 
ATOM   9031  H  HG3  . GLU B 1 277 ? 14.367  17.187 -6.545  1.00 16.33  ? 277  GLU B HG3  1 
ATOM   9032  N  N    . VAL B 1 278 ? 10.006  18.879 -9.716  1.00 11.89  ? 278  VAL B N    1 
ATOM   9033  C  CA   . VAL B 1 278 ? 9.086   18.566 -10.823 1.00 12.49  ? 278  VAL B CA   1 
ATOM   9034  C  C    . VAL B 1 278 ? 9.775   18.926 -12.162 1.00 14.53  ? 278  VAL B C    1 
ATOM   9035  O  O    . VAL B 1 278 ? 10.132  20.090 -12.324 1.00 16.28  ? 278  VAL B O    1 
ATOM   9036  C  CB   . VAL B 1 278 ? 7.768   19.324 -10.685 1.00 11.27  ? 278  VAL B CB   1 
ATOM   9037  C  CG1  . VAL B 1 278 ? 6.899   19.072 -11.910 1.00 16.17  ? 278  VAL B CG1  1 
ATOM   9038  C  CG2  . VAL B 1 278 ? 7.004   18.989 -9.393  1.00 14.14  ? 278  VAL B CG2  1 
ATOM   9039  H  H    . VAL B 1 278 ? 9.820   19.510 -9.162  1.00 14.27  ? 278  VAL B H    1 
ATOM   9040  H  HA   . VAL B 1 278 ? 8.898   17.605 -10.814 1.00 14.98  ? 278  VAL B HA   1 
ATOM   9041  H  HB   . VAL B 1 278 ? 7.978   20.281 -10.663 1.00 13.53  ? 278  VAL B HB   1 
ATOM   9042  H  HG11 . VAL B 1 278 ? 6.074   19.554 -11.822 1.00 24.26  ? 278  VAL B HG11 1 
ATOM   9043  H  HG12 . VAL B 1 278 ? 6.715   18.133 -11.983 1.00 24.26  ? 278  VAL B HG12 1 
ATOM   9044  H  HG13 . VAL B 1 278 ? 7.362   19.370 -12.697 1.00 24.26  ? 278  VAL B HG13 1 
ATOM   9045  H  HG21 . VAL B 1 278 ? 7.573   19.143 -8.635  1.00 21.20  ? 278  VAL B HG21 1 
ATOM   9046  H  HG22 . VAL B 1 278 ? 6.736   18.067 -9.410  1.00 21.20  ? 278  VAL B HG22 1 
ATOM   9047  H  HG23 . VAL B 1 278 ? 6.226   19.547 -9.327  1.00 21.20  ? 278  VAL B HG23 1 
ATOM   9048  N  N    . ASN B 1 279 ? 9.929   17.942 -13.026 1.00 12.43  ? 279  ASN B N    1 
ATOM   9049  C  CA   . ASN B 1 279 ? 10.491  18.168 -14.367 1.00 11.23  ? 279  ASN B CA   1 
ATOM   9050  C  C    . ASN B 1 279 ? 9.542   17.604 -15.446 1.00 13.43  ? 279  ASN B C    1 
ATOM   9051  O  O    . ASN B 1 279 ? 9.758   16.452 -15.800 1.00 12.94  ? 279  ASN B O    1 
ATOM   9052  C  CB   . ASN B 1 279 ? 11.880  17.542 -14.347 1.00 12.29  ? 279  ASN B CB   1 
ATOM   9053  C  CG   . ASN B 1 279 ? 12.781  17.970 -15.493 1.00 13.03  ? 279  ASN B CG   1 
ATOM   9054  O  OD1  . ASN B 1 279 ? 13.979  17.765 -15.540 1.00 18.93  ? 279  ASN B OD1  1 
ATOM   9055  N  ND2  . ASN B 1 279 ? 12.110  18.538 -16.493 1.00 13.91  ? 279  ASN B ND2  1 
ATOM   9056  H  H    . ASN B 1 279 ? 9.694   17.146 -12.800 1.00 14.92  ? 279  ASN B H    1 
ATOM   9057  H  HA   . ASN B 1 279 ? 10.585  19.134 -14.507 1.00 13.48  ? 279  ASN B HA   1 
ATOM   9058  H  HB2  . ASN B 1 279 ? 12.312  17.773 -13.510 1.00 14.74  ? 279  ASN B HB2  1 
ATOM   9059  H  HB3  . ASN B 1 279 ? 11.785  16.577 -14.371 1.00 14.74  ? 279  ASN B HB3  1 
ATOM   9060  H  HD21 . ASN B 1 279 ? 12.524  18.777 -17.208 1.00 16.70  ? 279  ASN B HD21 1 
ATOM   9061  H  HD22 . ASN B 1 279 ? 11.262  18.667 -16.424 1.00 16.70  ? 279  ASN B HD22 1 
ATOM   9062  N  N    . PRO B 1 280 ? 8.669   18.460 -15.959 1.00 12.42  ? 280  PRO B N    1 
ATOM   9063  C  CA   . PRO B 1 280 ? 7.722   17.978 -16.973 1.00 18.09  ? 280  PRO B CA   1 
ATOM   9064  C  C    . PRO B 1 280 ? 8.418   17.404 -18.203 1.00 15.31  ? 280  PRO B C    1 
ATOM   9065  O  O    . PRO B 1 280 ? 7.893   16.414 -18.729 1.00 12.89  ? 280  PRO B O    1 
ATOM   9066  C  CB   . PRO B 1 280 ? 6.898   19.227 -17.312 1.00 14.04  ? 280  PRO B CB   1 
ATOM   9067  C  CG   . PRO B 1 280 ? 7.030   20.104 -16.118 1.00 16.57  ? 280  PRO B CG   1 
ATOM   9068  C  CD   . PRO B 1 280 ? 8.442   19.861 -15.615 1.00 16.59  ? 280  PRO B CD   1 
ATOM   9069  H  HA   . PRO B 1 280 ? 7.138   17.297 -16.579 1.00 21.71  ? 280  PRO B HA   1 
ATOM   9070  H  HB2  . PRO B 1 280 ? 7.249   19.667 -18.103 1.00 16.84  ? 280  PRO B HB2  1 
ATOM   9071  H  HB3  . PRO B 1 280 ? 5.969   18.995 -17.468 1.00 16.84  ? 280  PRO B HB3  1 
ATOM   9072  H  HG2  . PRO B 1 280 ? 6.906   21.036 -16.359 1.00 19.88  ? 280  PRO B HG2  1 
ATOM   9073  H  HG3  . PRO B 1 280 ? 6.378   19.866 -15.442 1.00 19.88  ? 280  PRO B HG3  1 
ATOM   9074  H  HD2  . PRO B 1 280 ? 9.079   20.440 -16.062 1.00 19.91  ? 280  PRO B HD2  1 
ATOM   9075  H  HD3  . PRO B 1 280 ? 8.503   20.002 -14.657 1.00 19.91  ? 280  PRO B HD3  1 
ATOM   9076  N  N    . SER B 1 281 ? 9.566   17.965 -18.587 1.00 14.40  ? 281  SER B N    1 
ATOM   9077  C  CA   . SER B 1 281 ? 10.221  17.506 -19.797 1.00 15.84  ? 281  SER B CA   1 
ATOM   9078  C  C    . SER B 1 281 ? 10.696  16.061 -19.720 1.00 15.84  ? 281  SER B C    1 
ATOM   9079  O  O    . SER B 1 281 ? 11.006  15.418 -20.722 1.00 16.23  ? 281  SER B O    1 
ATOM   9080  C  CB   . SER B 1 281 ? 11.443  18.364 -20.100 1.00 19.46  ? 281  SER B CB   1 
ATOM   9081  O  OG   . SER B 1 281 ? 12.511  17.558 -19.577 1.00 27.77  ? 281  SER B OG   1 
ATOM   9082  H  H    . SER B 1 281 ? 9.915   18.597 -18.120 1.00 17.28  ? 281  SER B H    1 
ATOM   9083  H  HA   . SER B 1 281 ? 9.591   17.587 -20.543 1.00 19.01  ? 281  SER B HA   1 
ATOM   9084  H  HB2  . SER B 1 281 ? 11.545  18.510 -21.054 1.00 23.36  ? 281  SER B HB2  1 
ATOM   9085  H  HB3  . SER B 1 281 ? 11.394  19.221 -19.649 1.00 23.36  ? 281  SER B HB3  1 
ATOM   9086  H  HG   . SER B 1 281 ? 12.398  17.442 -18.773 1.00 41.66  ? 281  SER B HG   1 
ATOM   9087  N  N    . LEU B 1 282 ? 10.758  15.462 -18.522 1.00 17.36  ? 282  LEU B N    1 
ATOM   9088  C  CA   . LEU B 1 282 ? 11.102  14.072 -18.380 1.00 16.73  ? 282  LEU B CA   1 
ATOM   9089  C  C    . LEU B 1 282 ? 9.923   13.115 -18.346 1.00 13.23  ? 282  LEU B C    1 
ATOM   9090  O  O    . LEU B 1 282 ? 10.160  11.895 -18.394 1.00 17.67  ? 282  LEU B O    1 
ATOM   9091  C  CB   . LEU B 1 282 ? 11.928  13.850 -17.092 1.00 13.82  ? 282  LEU B CB   1 
ATOM   9092  C  CG   . LEU B 1 282 ? 13.128  14.784 -16.942 1.00 16.53  ? 282  LEU B CG   1 
ATOM   9093  C  CD1  . LEU B 1 282 ? 13.790  14.488 -15.590 1.00 16.28  ? 282  LEU B CD1  1 
ATOM   9094  C  CD2  . LEU B 1 282 ? 14.094  14.612 -18.101 1.00 19.73  ? 282  LEU B CD2  1 
ATOM   9095  H  H    . LEU B 1 282 ? 10.586  15.923 -17.817 1.00 20.83  ? 282  LEU B H    1 
ATOM   9096  H  HA   . LEU B 1 282 ? 11.665  13.824 -19.142 1.00 20.07  ? 282  LEU B HA   1 
ATOM   9097  H  HB2  . LEU B 1 282 ? 11.345  13.967 -16.325 1.00 16.58  ? 282  LEU B HB2  1 
ATOM   9098  H  HB3  . LEU B 1 282 ? 12.245  12.933 -17.081 1.00 16.58  ? 282  LEU B HB3  1 
ATOM   9099  H  HG   . LEU B 1 282 ? 12.805  15.710 -16.937 1.00 19.84  ? 282  LEU B HG   1 
ATOM   9100  H  HD11 . LEU B 1 282 ? 13.149  14.608 -14.886 1.00 24.42  ? 282  LEU B HD11 1 
ATOM   9101  H  HD12 . LEU B 1 282 ? 14.528  15.089 -15.457 1.00 24.42  ? 282  LEU B HD12 1 
ATOM   9102  H  HD13 . LEU B 1 282 ? 14.109  13.583 -15.582 1.00 24.42  ? 282  LEU B HD13 1 
ATOM   9103  H  HD21 . LEU B 1 282 ? 14.837  15.210 -17.990 1.00 29.59  ? 282  LEU B HD21 1 
ATOM   9104  H  HD22 . LEU B 1 282 ? 13.645  14.811 -18.926 1.00 29.59  ? 282  LEU B HD22 1 
ATOM   9105  H  HD23 . LEU B 1 282 ? 14.412  13.707 -18.121 1.00 29.59  ? 282  LEU B HD23 1 
ATOM   9106  N  N    . GLY B 1 283 ? 8.675   13.577 -18.281 1.00 15.87  ? 283  GLY B N    1 
ATOM   9107  C  CA   . GLY B 1 283 ? 7.579   12.627 -18.422 1.00 17.35  ? 283  GLY B CA   1 
ATOM   9108  C  C    . GLY B 1 283 ? 7.612   11.902 -19.755 1.00 22.51  ? 283  GLY B C    1 
ATOM   9109  O  O    . GLY B 1 283 ? 7.927   12.547 -20.748 1.00 18.81  ? 283  GLY B O    1 
ATOM   9110  H  H    . GLY B 1 283 ? 8.521   14.414 -18.159 1.00 19.04  ? 283  GLY B H    1 
ATOM   9111  H  HA2  . GLY B 1 283 ? 7.628   11.977 -17.705 1.00 20.82  ? 283  GLY B HA2  1 
ATOM   9112  H  HA3  . GLY B 1 283 ? 6.737   13.100 -18.338 1.00 20.82  ? 283  GLY B HA3  1 
ATOM   9113  N  N    . LYS B 1 284 ? 7.316   10.618 -19.795 1.00 20.09  ? 284  LYS B N    1 
ATOM   9114  C  CA   . LYS B 1 284 ? 7.388   9.826  -21.013 1.00 21.28  ? 284  LYS B CA   1 
ATOM   9115  C  C    . LYS B 1 284 ? 6.176   10.130 -21.896 1.00 25.51  ? 284  LYS B C    1 
ATOM   9116  O  O    . LYS B 1 284 ? 6.270   9.988  -23.116 1.00 21.43  ? 284  LYS B O    1 
ATOM   9117  C  CB   . LYS B 1 284 ? 7.468   8.325  -20.748 1.00 18.17  ? 284  LYS B CB   1 
ATOM   9118  C  CG   . LYS B 1 284 ? 6.128   7.661  -20.531 1.00 37.46  ? 284  LYS B CG   1 
ATOM   9119  C  CD   . LYS B 1 284 ? 6.067   6.294  -19.907 1.00 51.23  ? 284  LYS B CD   1 
ATOM   9120  C  CE   . LYS B 1 284 ? 7.318   5.863  -19.167 1.00 56.76  ? 284  LYS B CE   1 
ATOM   9121  N  NZ   . LYS B 1 284 ? 7.256   4.432  -18.746 1.00 54.86  ? 284  LYS B NZ   1 
ATOM   9122  H  H    . LYS B 1 284 ? 7.069   10.231 -19.068 1.00 24.10  ? 284  LYS B H    1 
ATOM   9123  H  HA   . LYS B 1 284 ? 8.194   10.092 -21.501 1.00 25.54  ? 284  LYS B HA   1 
ATOM   9124  H  HB2  . LYS B 1 284 ? 7.907   7.899  -21.501 1.00 21.80  ? 284  LYS B HB2  1 
ATOM   9125  H  HB3  . LYS B 1 284 ? 8.019   8.176  -19.964 1.00 21.80  ? 284  LYS B HB3  1 
ATOM   9126  H  HG2  . LYS B 1 284 ? 5.595   8.255  -19.981 1.00 44.95  ? 284  LYS B HG2  1 
ATOM   9127  H  HG3  . LYS B 1 284 ? 5.689   7.605  -21.395 1.00 44.95  ? 284  LYS B HG3  1 
ATOM   9128  H  HD2  . LYS B 1 284 ? 5.321   6.273  -19.287 1.00 61.48  ? 284  LYS B HD2  1 
ATOM   9129  H  HD3  . LYS B 1 284 ? 5.884   5.645  -20.604 1.00 61.48  ? 284  LYS B HD3  1 
ATOM   9130  H  HE2  . LYS B 1 284 ? 8.089   5.993  -19.741 1.00 68.12  ? 284  LYS B HE2  1 
ATOM   9131  H  HE3  . LYS B 1 284 ? 7.433   6.421  -18.382 1.00 68.12  ? 284  LYS B HE3  1 
ATOM   9132  H  HZ1  . LYS B 1 284 ? 7.942   4.251  -18.209 1.00 82.28  ? 284  LYS B HZ1  1 
ATOM   9133  H  HZ2  . LYS B 1 284 ? 7.295   3.909  -19.465 1.00 82.28  ? 284  LYS B HZ2  1 
ATOM   9134  H  HZ3  . LYS B 1 284 ? 6.493   4.283  -18.312 1.00 82.28  ? 284  LYS B HZ3  1 
ATOM   9135  N  N    . THR B 1 285 ? 5.057   10.522 -21.299 1.00 18.12  ? 285  THR B N    1 
ATOM   9136  C  CA   . THR B 1 285 ? 3.850   10.848 -22.053 1.00 21.76  ? 285  THR B CA   1 
ATOM   9137  C  C    . THR B 1 285 ? 3.217   12.081 -21.430 1.00 23.09  ? 285  THR B C    1 
ATOM   9138  O  O    . THR B 1 285 ? 3.584   12.386 -20.304 1.00 18.70  ? 285  THR B O    1 
ATOM   9139  C  CB   . THR B 1 285 ? 2.763   9.766  -22.104 1.00 28.35  ? 285  THR B CB   1 
ATOM   9140  O  OG1  . THR B 1 285 ? 2.444   9.254  -20.801 1.00 29.99  ? 285  THR B OG1  1 
ATOM   9141  C  CG2  . THR B 1 285 ? 3.235   8.562  -22.914 1.00 66.81  ? 285  THR B CG2  1 
ATOM   9142  H  H    . THR B 1 285 ? 5.042   10.587 -20.441 1.00 21.75  ? 285  THR B H    1 
ATOM   9143  H  HA   . THR B 1 285 ? 4.110   11.066 -22.973 1.00 26.11  ? 285  THR B HA   1 
ATOM   9144  H  HB   . THR B 1 285 ? 1.954   10.136 -22.514 1.00 34.02  ? 285  THR B HB   1 
ATOM   9145  H  HG1  . THR B 1 285 ? 2.104   9.847  -20.350 1.00 44.98  ? 285  THR B HG1  1 
ATOM   9146  H  HG21 . THR B 1 285 ? 2.569   7.872  -22.880 1.00 100.22 ? 285  THR B HG21 1 
ATOM   9147  H  HG22 . THR B 1 285 ? 4.058   8.231  -22.546 1.00 100.22 ? 285  THR B HG22 1 
ATOM   9148  H  HG23 . THR B 1 285 ? 3.376   8.826  -23.826 1.00 100.22 ? 285  THR B HG23 1 
ATOM   9149  N  N    . PRO B 1 286 ? 2.295   12.760 -22.084 1.00 16.33  ? 286  PRO B N    1 
ATOM   9150  C  CA   . PRO B 1 286 ? 1.567   13.805 -21.401 1.00 15.09  ? 286  PRO B CA   1 
ATOM   9151  C  C    . PRO B 1 286 ? 0.884   13.348 -20.114 1.00 17.26  ? 286  PRO B C    1 
ATOM   9152  O  O    . PRO B 1 286 ? 0.807   14.227 -19.249 1.00 20.78  ? 286  PRO B O    1 
ATOM   9153  C  CB   . PRO B 1 286 ? 0.517   14.235 -22.449 1.00 22.37  ? 286  PRO B CB   1 
ATOM   9154  C  CG   . PRO B 1 286 ? 1.227   13.943 -23.747 1.00 23.40  ? 286  PRO B CG   1 
ATOM   9155  C  CD   . PRO B 1 286 ? 1.877   12.614 -23.511 1.00 16.03  ? 286  PRO B CD   1 
ATOM   9156  H  HA   . PRO B 1 286 ? 2.168   14.555 -21.208 1.00 18.10  ? 286  PRO B HA   1 
ATOM   9157  H  HB2  . PRO B 1 286 ? -0.298  13.714 -22.366 1.00 26.85  ? 286  PRO B HB2  1 
ATOM   9158  H  HB3  . PRO B 1 286 ? 0.303   15.178 -22.368 1.00 26.85  ? 286  PRO B HB3  1 
ATOM   9159  H  HG2  . PRO B 1 286 ? 0.597   13.895 -24.484 1.00 28.08  ? 286  PRO B HG2  1 
ATOM   9160  H  HG3  . PRO B 1 286 ? 1.889   14.624 -23.941 1.00 28.08  ? 286  PRO B HG3  1 
ATOM   9161  H  HD2  . PRO B 1 286 ? 1.249   11.883 -23.627 1.00 19.24  ? 286  PRO B HD2  1 
ATOM   9162  H  HD3  . PRO B 1 286 ? 2.639   12.480 -24.095 1.00 19.24  ? 286  PRO B HD3  1 
ATOM   9163  N  N    . GLU B 1 287 ? 0.411   12.117 -19.992 1.00 17.14  ? 287  GLU B N    1 
ATOM   9164  C  CA   . GLU B 1 287 ? -0.255  11.702 -18.749 1.00 19.27  ? 287  GLU B CA   1 
ATOM   9165  C  C    . GLU B 1 287 ? 0.766   11.588 -17.602 1.00 22.34  ? 287  GLU B C    1 
ATOM   9166  O  O    . GLU B 1 287 ? 0.377   11.823 -16.436 1.00 15.78  ? 287  GLU B O    1 
ATOM   9167  C  CB   . GLU B 1 287 ? -1.012  10.404 -18.974 1.00 18.48  ? 287  GLU B CB   1 
ATOM   9168  C  CG   . GLU B 1 287 ? -1.751  9.848  -17.764 1.00 23.08  ? 287  GLU B CG   1 
ATOM   9169  C  CD   . GLU B 1 287 ? -1.007  8.970  -16.773 1.00 21.96  ? 287  GLU B CD   1 
ATOM   9170  O  OE1  . GLU B 1 287 ? -1.308  9.126  -15.552 1.00 18.10  ? 287  GLU B OE1  1 
ATOM   9171  O  OE2  . GLU B 1 287 ? -0.135  8.167  -17.145 1.00 29.28  ? 287  GLU B OE2  1 
ATOM   9172  H  H    . GLU B 1 287 ? 0.493   11.559 -20.642 1.00 20.57  ? 287  GLU B H    1 
ATOM   9173  H  HA   . GLU B 1 287 ? -0.905  12.394 -18.507 1.00 23.12  ? 287  GLU B HA   1 
ATOM   9174  H  HB2  . GLU B 1 287 ? -1.656  10.547 -19.685 1.00 22.18  ? 287  GLU B HB2  1 
ATOM   9175  H  HB3  . GLU B 1 287 ? -0.383  9.733  -19.282 1.00 22.18  ? 287  GLU B HB3  1 
ATOM   9176  H  HG2  . GLU B 1 287 ? -2.112  10.601 -17.271 1.00 27.69  ? 287  GLU B HG2  1 
ATOM   9177  H  HG3  . GLU B 1 287 ? -2.507  9.337  -18.094 1.00 27.69  ? 287  GLU B HG3  1 
ATOM   9178  N  N    . GLU B 1 288 ? 2.023   11.218 -17.819 1.00 16.33  ? 288  GLU B N    1 
ATOM   9179  C  CA   . GLU B 1 288 ? 3.052   11.229 -16.776 1.00 13.19  ? 288  GLU B CA   1 
ATOM   9180  C  C    . GLU B 1 288 ? 3.265   12.624 -16.238 1.00 17.13  ? 288  GLU B C    1 
ATOM   9181  O  O    . GLU B 1 288 ? 3.470   12.819 -15.031 1.00 16.81  ? 288  GLU B O    1 
ATOM   9182  C  CB   . GLU B 1 288 ? 4.347   10.624 -17.312 1.00 17.20  ? 288  GLU B CB   1 
ATOM   9183  C  CG   . GLU B 1 288 ? 4.322   9.122  -17.413 1.00 13.83  ? 288  GLU B CG   1 
ATOM   9184  C  CD   . GLU B 1 288 ? 5.703   8.480  -17.370 1.00 22.98  ? 288  GLU B CD   1 
ATOM   9185  O  OE1  . GLU B 1 288 ? 6.731   9.189  -17.420 1.00 17.85  ? 288  GLU B OE1  1 
ATOM   9186  O  OE2  . GLU B 1 288 ? 5.760   7.234  -17.289 1.00 27.35  ? 288  GLU B OE2  1 
ATOM   9187  H  H    . GLU B 1 288 ? 2.243   10.959 -18.609 1.00 19.60  ? 288  GLU B H    1 
ATOM   9188  H  HA   . GLU B 1 288 ? 2.739   10.666 -16.038 1.00 15.83  ? 288  GLU B HA   1 
ATOM   9189  H  HB2  . GLU B 1 288 ? 4.524   10.993 -18.192 1.00 20.64  ? 288  GLU B HB2  1 
ATOM   9190  H  HB3  . GLU B 1 288 ? 5.078   10.886 -16.731 1.00 20.64  ? 288  GLU B HB3  1 
ATOM   9191  H  HG2  . GLU B 1 288 ? 3.790   8.768  -16.683 1.00 16.60  ? 288  GLU B HG2  1 
ATOM   9192  H  HG3  . GLU B 1 288 ? 3.886   8.871  -18.243 1.00 16.60  ? 288  GLU B HG3  1 
ATOM   9193  N  N    . VAL B 1 289 ? 3.208   13.680 -17.031 1.00 15.67  ? 289  VAL B N    1 
ATOM   9194  C  CA   . VAL B 1 289 ? 3.257   15.063 -16.668 1.00 12.98  ? 289  VAL B CA   1 
ATOM   9195  C  C    . VAL B 1 289 ? 2.041   15.443 -15.839 1.00 16.70  ? 289  VAL B C    1 
ATOM   9196  O  O    . VAL B 1 289 ? 2.226   16.031 -14.766 1.00 14.20  ? 289  VAL B O    1 
ATOM   9197  C  CB   . VAL B 1 289 ? 3.377   16.005 -17.898 1.00 13.25  ? 289  VAL B CB   1 
ATOM   9198  C  CG1  . VAL B 1 289 ? 3.483   17.460 -17.500 1.00 14.60  ? 289  VAL B CG1  1 
ATOM   9199  C  CG2  . VAL B 1 289 ? 4.556   15.586 -18.780 1.00 19.24  ? 289  VAL B CG2  1 
ATOM   9200  H  H    . VAL B 1 289 ? 3.133   13.514 -17.872 1.00 18.80  ? 289  VAL B H    1 
ATOM   9201  H  HA   . VAL B 1 289 ? 4.052   15.198 -16.111 1.00 15.58  ? 289  VAL B HA   1 
ATOM   9202  H  HB   . VAL B 1 289 ? 2.560   15.903 -18.429 1.00 15.91  ? 289  VAL B HB   1 
ATOM   9203  H  HG11 . VAL B 1 289 ? 2.731   17.698 -16.953 1.00 21.90  ? 289  VAL B HG11 1 
ATOM   9204  H  HG12 . VAL B 1 289 ? 3.491   18.008 -18.289 1.00 21.90  ? 289  VAL B HG12 1 
ATOM   9205  H  HG13 . VAL B 1 289 ? 4.295   17.599 -17.007 1.00 21.90  ? 289  VAL B HG13 1 
ATOM   9206  H  HG21 . VAL B 1 289 ? 4.463   14.662 -19.021 1.00 28.86  ? 289  VAL B HG21 1 
ATOM   9207  H  HG22 . VAL B 1 289 ? 5.377   15.710 -18.297 1.00 28.86  ? 289  VAL B HG22 1 
ATOM   9208  H  HG23 . VAL B 1 289 ? 4.568   16.124 -19.575 1.00 28.86  ? 289  VAL B HG23 1 
ATOM   9209  N  N    . THR B 1 290 ? 0.818   15.209 -16.302 1.00 15.75  ? 290  THR B N    1 
ATOM   9210  C  CA   . THR B 1 290 ? -0.358  15.585 -15.527 1.00 18.21  ? 290  THR B CA   1 
ATOM   9211  C  C    . THR B 1 290 ? -0.401  14.799 -14.225 1.00 11.65  ? 290  THR B C    1 
ATOM   9212  O  O    . THR B 1 290 ? -0.822  15.362 -13.222 1.00 15.39  ? 290  THR B O    1 
ATOM   9213  C  CB   . THR B 1 290 ? -1.687  15.430 -16.310 1.00 16.35  ? 290  THR B CB   1 
ATOM   9214  O  OG1  . THR B 1 290 ? -1.914  14.115 -16.732 1.00 19.96  ? 290  THR B OG1  1 
ATOM   9215  C  CG2  . THR B 1 290 ? -1.615  16.316 -17.567 1.00 19.28  ? 290  THR B CG2  1 
ATOM   9216  H  H    . THR B 1 290 ? 0.719   14.831 -17.068 1.00 18.90  ? 290  THR B H    1 
ATOM   9217  H  HA   . THR B 1 290 ? -0.265  16.532 -15.294 1.00 21.86  ? 290  THR B HA   1 
ATOM   9218  H  HB   . THR B 1 290 ? -2.433  15.724 -15.747 1.00 19.62  ? 290  THR B HB   1 
ATOM   9219  H  HG1  . THR B 1 290 ? -1.963  14.095 -17.551 1.00 29.94  ? 290  THR B HG1  1 
ATOM   9220  H  HG21 . THR B 1 290 ? -2.429  16.227 -18.069 1.00 28.91  ? 290  THR B HG21 1 
ATOM   9221  H  HG22 . THR B 1 290 ? -0.873  16.040 -18.111 1.00 28.91  ? 290  THR B HG22 1 
ATOM   9222  H  HG23 . THR B 1 290 ? -1.497  17.232 -17.307 1.00 28.91  ? 290  THR B HG23 1 
ATOM   9223  N  N    . ARG B 1 291 ? -0.004  13.569 -14.216 1.00 12.61  ? 291  ARG B N    1 
ATOM   9224  C  CA   . ARG B 1 291 ? 0.007   12.785 -12.986 1.00 11.86  ? 291  ARG B CA   1 
ATOM   9225  C  C    . ARG B 1 291 ? 0.954   13.424 -11.991 1.00 14.09  ? 291  ARG B C    1 
ATOM   9226  O  O    . ARG B 1 291 ? 0.553   13.600 -10.841 1.00 13.24  ? 291  ARG B O    1 
ATOM   9227  C  CB   . ARG B 1 291 ? 0.454   11.371 -13.288 1.00 12.48  ? 291  ARG B CB   1 
ATOM   9228  C  CG   . ARG B 1 291 ? 0.064   10.384 -12.187 1.00 15.63  ? 291  ARG B CG   1 
ATOM   9229  C  CD   . ARG B 1 291 ? 0.707   9.045  -12.314 1.00 17.96  ? 291  ARG B CD   1 
ATOM   9230  N  NE   . ARG B 1 291 ? 0.747   8.494  -13.686 1.00 18.58  ? 291  ARG B NE   1 
ATOM   9231  C  CZ   . ARG B 1 291 ? 1.574   7.553  -14.082 1.00 17.68  ? 291  ARG B CZ   1 
ATOM   9232  N  NH1  . ARG B 1 291 ? 2.450   6.989  -13.264 1.00 17.48  ? 291  ARG B NH1  1 
ATOM   9233  N  NH2  . ARG B 1 291 ? 1.562   7.098  -15.339 1.00 28.90  ? 291  ARG B NH2  1 
ATOM   9234  H  H    . ARG B 1 291 ? 0.258   13.205 -14.950 1.00 15.13  ? 291  ARG B H    1 
ATOM   9235  H  HA   . ARG B 1 291 ? -0.896  12.765 -12.606 1.00 14.23  ? 291  ARG B HA   1 
ATOM   9236  H  HB2  . ARG B 1 291 ? 0.057   11.085 -14.125 1.00 14.97  ? 291  ARG B HB2  1 
ATOM   9237  H  HB3  . ARG B 1 291 ? 1.418   11.359 -13.397 1.00 14.97  ? 291  ARG B HB3  1 
ATOM   9238  H  HG2  . ARG B 1 291 ? 0.305   10.764 -11.328 1.00 18.75  ? 291  ARG B HG2  1 
ATOM   9239  H  HG3  . ARG B 1 291 ? -0.899  10.269 -12.198 1.00 18.75  ? 291  ARG B HG3  1 
ATOM   9240  H  HD2  . ARG B 1 291 ? 1.616   9.107  -11.981 1.00 21.55  ? 291  ARG B HD2  1 
ATOM   9241  H  HD3  . ARG B 1 291 ? 0.230   8.420  -11.745 1.00 21.55  ? 291  ARG B HD3  1 
ATOM   9242  H  HE   . ARG B 1 291 ? 0.193   8.810  -14.262 1.00 22.29  ? 291  ARG B HE   1 
ATOM   9243  H  HH11 . ARG B 1 291 ? 2.491   7.237  -12.441 1.00 20.98  ? 291  ARG B HH11 1 
ATOM   9244  H  HH12 . ARG B 1 291 ? 2.977   6.376  -13.555 1.00 20.98  ? 291  ARG B HH12 1 
ATOM   9245  H  HH21 . ARG B 1 291 ? 1.004   7.422  -15.909 1.00 34.68  ? 291  ARG B HH21 1 
ATOM   9246  H  HH22 . ARG B 1 291 ? 2.111   6.482  -15.579 1.00 34.68  ? 291  ARG B HH22 1 
ATOM   9247  N  N    . THR B 1 292 ? 2.165   13.752 -12.426 1.00 14.08  ? 292  THR B N    1 
ATOM   9248  C  CA   . THR B 1 292 ? 3.161   14.356 -11.540 1.00 10.62  ? 292  THR B CA   1 
ATOM   9249  C  C    . THR B 1 292 ? 2.718   15.697 -11.017 1.00 17.38  ? 292  THR B C    1 
ATOM   9250  O  O    . THR B 1 292 ? 2.723   15.954 -9.803  1.00 16.48  ? 292  THR B O    1 
ATOM   9251  C  CB   . THR B 1 292 ? 4.511   14.444 -12.298 1.00 13.57  ? 292  THR B CB   1 
ATOM   9252  O  OG1  . THR B 1 292 ? 4.886   13.132 -12.623 1.00 14.46  ? 292  THR B OG1  1 
ATOM   9253  C  CG2  . THR B 1 292 ? 5.625   14.964 -11.406 1.00 17.26  ? 292  THR B CG2  1 
ATOM   9254  H  H    . THR B 1 292 ? 2.370   13.605 -13.248 1.00 16.90  ? 292  THR B H    1 
ATOM   9255  H  HA   . THR B 1 292 ? 3.284   13.759 -10.773 1.00 12.74  ? 292  THR B HA   1 
ATOM   9256  H  HB   . THR B 1 292 ? 4.424   14.993 -13.105 1.00 16.29  ? 292  THR B HB   1 
ATOM   9257  H  HG1  . THR B 1 292 ? 4.317   12.797 -13.109 1.00 21.69  ? 292  THR B HG1  1 
ATOM   9258  H  HG21 . THR B 1 292 ? 6.443   15.006 -11.908 1.00 25.89  ? 292  THR B HG21 1 
ATOM   9259  H  HG22 . THR B 1 292 ? 5.739   14.372 -10.659 1.00 25.89  ? 292  THR B HG22 1 
ATOM   9260  H  HG23 . THR B 1 292 ? 5.399   15.841 -11.088 1.00 25.89  ? 292  THR B HG23 1 
ATOM   9261  N  N    . VAL B 1 293 ? 2.288   16.597 -11.888 1.00 11.34  ? 293  VAL B N    1 
ATOM   9262  C  CA   . VAL B 1 293 ? 1.851   17.921 -11.522 1.00 13.93  ? 293  VAL B CA   1 
ATOM   9263  C  C    . VAL B 1 293 ? 0.625   17.882 -10.626 1.00 13.38  ? 293  VAL B C    1 
ATOM   9264  O  O    . VAL B 1 293 ? 0.584   18.626 -9.633  1.00 13.17  ? 293  VAL B O    1 
ATOM   9265  C  CB   . VAL B 1 293 ? 1.583   18.715 -12.828 1.00 13.87  ? 293  VAL B CB   1 
ATOM   9266  C  CG1  . VAL B 1 293 ? 0.985   20.059 -12.522 1.00 19.49  ? 293  VAL B CG1  1 
ATOM   9267  C  CG2  . VAL B 1 293 ? 2.906   18.852 -13.583 1.00 18.08  ? 293  VAL B CG2  1 
ATOM   9268  H  H    . VAL B 1 293 ? 2.269   16.379 -12.720 1.00 13.61  ? 293  VAL B H    1 
ATOM   9269  H  HA   . VAL B 1 293 ? 2.578   18.363 -11.035 1.00 16.72  ? 293  VAL B HA   1 
ATOM   9270  H  HB   . VAL B 1 293 ? 0.953   18.208 -13.383 1.00 16.65  ? 293  VAL B HB   1 
ATOM   9271  H  HG11 . VAL B 1 293 ? 0.171   19.942 -12.026 1.00 29.24  ? 293  VAL B HG11 1 
ATOM   9272  H  HG12 . VAL B 1 293 ? 0.795   20.519 -13.343 1.00 29.24  ? 293  VAL B HG12 1 
ATOM   9273  H  HG13 . VAL B 1 293 ? 1.605   20.574 -12.002 1.00 29.24  ? 293  VAL B HG13 1 
ATOM   9274  H  HG21 . VAL B 1 293 ? 3.260   17.980 -13.771 1.00 27.12  ? 293  VAL B HG21 1 
ATOM   9275  H  HG22 . VAL B 1 293 ? 3.532   19.342 -13.045 1.00 27.12  ? 293  VAL B HG22 1 
ATOM   9276  H  HG23 . VAL B 1 293 ? 2.757   19.321 -14.407 1.00 27.12  ? 293  VAL B HG23 1 
ATOM   9277  N  N    . ASN B 1 294 ? -0.348  17.055 -10.970 1.00 15.11  ? 294  ASN B N    1 
ATOM   9278  C  CA   . ASN B 1 294 ? -1.603  17.029 -10.202 1.00 13.87  ? 294  ASN B CA   1 
ATOM   9279  C  C    . ASN B 1 294 ? -1.293  16.458 -8.808  1.00 14.30  ? 294  ASN B C    1 
ATOM   9280  O  O    . ASN B 1 294 ? -1.913  16.983 -7.862  1.00 15.68  ? 294  ASN B O    1 
ATOM   9281  C  CB   . ASN B 1 294 ? -2.666  16.289 -10.992 1.00 14.67  ? 294  ASN B CB   1 
ATOM   9282  C  CG   . ASN B 1 294 ? -3.204  17.008 -12.218 1.00 12.96  ? 294  ASN B CG   1 
ATOM   9283  O  OD1  . ASN B 1 294 ? -3.073  18.221 -12.353 1.00 18.70  ? 294  ASN B OD1  1 
ATOM   9284  N  ND2  . ASN B 1 294 ? -3.805  16.218 -13.098 1.00 27.44  ? 294  ASN B ND2  1 
ATOM   9285  H  H    . ASN B 1 294 ? -0.248  16.532 -11.645 1.00 18.13  ? 294  ASN B H    1 
ATOM   9286  H  HA   . ASN B 1 294 ? -1.904  17.955 -10.087 1.00 16.65  ? 294  ASN B HA   1 
ATOM   9287  H  HB2  . ASN B 1 294 ? -2.297  15.438 -11.276 1.00 17.61  ? 294  ASN B HB2  1 
ATOM   9288  H  HB3  . ASN B 1 294 ? -3.410  16.100 -10.399 1.00 17.61  ? 294  ASN B HB3  1 
ATOM   9289  H  HD21 . ASN B 1 294 ? -4.133  16.551 -13.820 1.00 32.93  ? 294  ASN B HD21 1 
ATOM   9290  H  HD22 . ASN B 1 294 ? -3.866  15.374 -12.947 1.00 32.93  ? 294  ASN B HD22 1 
ATOM   9291  N  N    . THR B 1 295 ? -0.403  15.511 -8.692  1.00 12.80  ? 295  THR B N    1 
ATOM   9292  C  CA   . THR B 1 295 ? 0.027   14.998 -7.377  1.00 13.73  ? 295  THR B CA   1 
ATOM   9293  C  C    . THR B 1 295 ? 0.719   16.095 -6.587  1.00 14.27  ? 295  THR B C    1 
ATOM   9294  O  O    . THR B 1 295 ? 0.369   16.284 -5.402  1.00 13.47  ? 295  THR B O    1 
ATOM   9295  C  CB   . THR B 1 295 ? 0.910   13.762 -7.523  1.00 12.13  ? 295  THR B CB   1 
ATOM   9296  O  OG1  . THR B 1 295 ? 0.148   12.704 -8.126  1.00 18.94  ? 295  THR B OG1  1 
ATOM   9297  C  CG2  . THR B 1 295 ? 1.427   13.212 -6.188  1.00 13.36  ? 295  THR B CG2  1 
ATOM   9298  H  H    . THR B 1 295 ? -0.057  15.174 -9.404  1.00 15.36  ? 295  THR B H    1 
ATOM   9299  H  HA   . THR B 1 295 ? -0.776  14.735 -6.881  1.00 16.48  ? 295  THR B HA   1 
ATOM   9300  H  HB   . THR B 1 295 ? 1.672   13.977 -8.100  1.00 14.55  ? 295  THR B HB   1 
ATOM   9301  H  HG1  . THR B 1 295 ? -0.617  12.964 -8.266  1.00 28.41  ? 295  THR B HG1  1 
ATOM   9302  H  HG21 . THR B 1 295 ? 1.971   12.438 -6.349  1.00 20.04  ? 295  THR B HG21 1 
ATOM   9303  H  HG22 . THR B 1 295 ? 0.683   12.970 -5.631  1.00 20.04  ? 295  THR B HG22 1 
ATOM   9304  H  HG23 . THR B 1 295 ? 1.951   13.885 -5.747  1.00 20.04  ? 295  THR B HG23 1 
ATOM   9305  N  N    . ALA B 1 296 ? 1.668   16.834 -7.171  1.00 11.56  ? 296  ALA B N    1 
ATOM   9306  C  CA   . ALA B 1 296 ? 2.273   17.975 -6.484  1.00 9.31   ? 296  ALA B CA   1 
ATOM   9307  C  C    . ALA B 1 296 ? 1.256   19.037 -6.059  1.00 10.26  ? 296  ALA B C    1 
ATOM   9308  O  O    . ALA B 1 296 ? 1.365   19.597 -4.940  1.00 14.78  ? 296  ALA B O    1 
ATOM   9309  C  CB   . ALA B 1 296 ? 3.333   18.619 -7.352  1.00 14.89  ? 296  ALA B CB   1 
ATOM   9310  H  H    . ALA B 1 296 ? 1.928   16.635 -7.966  1.00 13.87  ? 296  ALA B H    1 
ATOM   9311  H  HA   . ALA B 1 296 ? 2.712   17.639 -5.674  1.00 11.17  ? 296  ALA B HA   1 
ATOM   9312  H  HB1  . ALA B 1 296 ? 3.976   17.957 -7.616  1.00 22.33  ? 296  ALA B HB1  1 
ATOM   9313  H  HB2  . ALA B 1 296 ? 3.773   19.314 -6.857  1.00 22.33  ? 296  ALA B HB2  1 
ATOM   9314  H  HB3  . ALA B 1 296 ? 2.921   18.994 -8.134  1.00 22.33  ? 296  ALA B HB3  1 
ATOM   9315  N  N    . VAL B 1 297 ? 0.253   19.346 -6.892  1.00 12.92  ? 297  VAL B N    1 
ATOM   9316  C  CA   . VAL B 1 297 ? -0.803  20.299 -6.534  1.00 15.78  ? 297  VAL B CA   1 
ATOM   9317  C  C    . VAL B 1 297 ? -1.566  19.740 -5.326  1.00 12.48  ? 297  VAL B C    1 
ATOM   9318  O  O    . VAL B 1 297 ? -1.783  20.524 -4.365  1.00 13.98  ? 297  VAL B O    1 
ATOM   9319  C  CB   . VAL B 1 297 ? -1.755  20.628 -7.693  1.00 13.65  ? 297  VAL B CB   1 
ATOM   9320  C  CG1  . VAL B 1 297 ? -2.970  21.394 -7.219  1.00 14.61  ? 297  VAL B CG1  1 
ATOM   9321  C  CG2  . VAL B 1 297 ? -1.040  21.438 -8.779  1.00 15.64  ? 297  VAL B CG2  1 
ATOM   9322  H  H    . VAL B 1 297 ? 0.228   18.972 -7.666  1.00 15.51  ? 297  VAL B H    1 
ATOM   9323  H  HA   . VAL B 1 297 ? -0.371  21.134 -6.255  1.00 18.93  ? 297  VAL B HA   1 
ATOM   9324  H  HB   . VAL B 1 297 ? -2.059  19.785 -8.089  1.00 16.38  ? 297  VAL B HB   1 
ATOM   9325  H  HG11 . VAL B 1 297 ? -3.423  20.888 -6.541  1.00 21.92  ? 297  VAL B HG11 1 
ATOM   9326  H  HG12 . VAL B 1 297 ? -3.564  21.541 -7.959  1.00 21.92  ? 297  VAL B HG12 1 
ATOM   9327  H  HG13 . VAL B 1 297 ? -2.694  22.240 -6.858  1.00 21.92  ? 297  VAL B HG13 1 
ATOM   9328  H  HG21 . VAL B 1 297 ? -0.270  20.953 -9.085  1.00 23.46  ? 297  VAL B HG21 1 
ATOM   9329  H  HG22 . VAL B 1 297 ? -0.763  22.283 -8.418  1.00 23.46  ? 297  VAL B HG22 1 
ATOM   9330  H  HG23 . VAL B 1 297 ? -1.639  21.584 -9.515  1.00 23.46  ? 297  VAL B HG23 1 
ATOM   9331  N  N    . ALA B 1 298 ? -1.943  18.483 -5.334  1.00 11.80  ? 298  ALA B N    1 
ATOM   9332  C  CA   . ALA B 1 298 ? -2.733  17.931 -4.232  1.00 10.95  ? 298  ALA B CA   1 
ATOM   9333  C  C    . ALA B 1 298 ? -1.978  17.998 -2.902  1.00 13.69  ? 298  ALA B C    1 
ATOM   9334  O  O    . ALA B 1 298 ? -2.557  18.325 -1.844  1.00 14.61  ? 298  ALA B O    1 
ATOM   9335  C  CB   . ALA B 1 298 ? -3.068  16.485 -4.486  1.00 11.89  ? 298  ALA B CB   1 
ATOM   9336  H  H    . ALA B 1 298 ? -1.724  17.978 -5.994  1.00 14.16  ? 298  ALA B H    1 
ATOM   9337  H  HA   . ALA B 1 298 ? -3.566  18.440 -4.151  1.00 13.14  ? 298  ALA B HA   1 
ATOM   9338  H  HB1  . ALA B 1 298 ? -3.540  16.407 -5.318  1.00 17.84  ? 298  ALA B HB1  1 
ATOM   9339  H  HB2  . ALA B 1 298 ? -3.620  16.154 -3.773  1.00 17.84  ? 298  ALA B HB2  1 
ATOM   9340  H  HB3  . ALA B 1 298 ? -2.258  15.971 -4.528  1.00 17.84  ? 298  ALA B HB3  1 
ATOM   9341  N  N    . ILE B 1 299 ? -0.697  17.698 -2.889  1.00 12.03  ? 299  ILE B N    1 
ATOM   9342  C  CA   . ILE B 1 299 ? 0.196   17.726 -1.719  1.00 13.39  ? 299  ILE B CA   1 
ATOM   9343  C  C    . ILE B 1 299 ? 0.214   19.120 -1.194  1.00 10.09  ? 299  ILE B C    1 
ATOM   9344  O  O    . ILE B 1 299 ? 0.105   19.470 0.001   1.00 14.35  ? 299  ILE B O    1 
ATOM   9345  C  CB   . ILE B 1 299 ? 1.591   17.200 -2.155  1.00 16.83  ? 299  ILE B CB   1 
ATOM   9346  C  CG1  . ILE B 1 299 ? 1.585   15.677 -2.324  1.00 22.94  ? 299  ILE B CG1  1 
ATOM   9347  C  CG2  . ILE B 1 299 ? 2.728   17.673 -1.277  1.00 21.07  ? 299  ILE B CG2  1 
ATOM   9348  C  CD1  . ILE B 1 299 ? 2.091   14.830 -1.205  1.00 25.87  ? 299  ILE B CD1  1 
ATOM   9349  H  H    . ILE B 1 299 ? -0.347  17.462 -3.638  1.00 14.43  ? 299  ILE B H    1 
ATOM   9350  H  HA   . ILE B 1 299 ? -0.166  17.132 -1.029  1.00 16.06  ? 299  ILE B HA   1 
ATOM   9351  H  HB   . ILE B 1 299 ? 1.759   17.573 -3.046  1.00 20.19  ? 299  ILE B HB   1 
ATOM   9352  H  HG12 . ILE B 1 299 ? 0.673   15.405 -2.509  1.00 27.52  ? 299  ILE B HG12 1 
ATOM   9353  H  HG13 . ILE B 1 299 ? 2.110   15.467 -3.112  1.00 27.52  ? 299  ILE B HG13 1 
ATOM   9354  H  HG21 . ILE B 1 299 ? 2.706   18.630 -1.213  1.00 31.60  ? 299  ILE B HG21 1 
ATOM   9355  H  HG22 . ILE B 1 299 ? 3.564   17.396 -1.659  1.00 31.60  ? 299  ILE B HG22 1 
ATOM   9356  H  HG23 . ILE B 1 299 ? 2.636   17.292 -0.401  1.00 31.60  ? 299  ILE B HG23 1 
ATOM   9357  H  HD11 . ILE B 1 299 ? 1.997   13.903 -1.437  1.00 38.81  ? 299  ILE B HD11 1 
ATOM   9358  H  HD12 . ILE B 1 299 ? 1.585   15.014 -0.410  1.00 38.81  ? 299  ILE B HD12 1 
ATOM   9359  H  HD13 . ILE B 1 299 ? 3.018   15.027 -1.047  1.00 38.81  ? 299  ILE B HD13 1 
ATOM   9360  N  N    . THR B 1 300 ? 0.336   20.082 -2.128  1.00 15.14  ? 300  THR B N    1 
ATOM   9361  C  CA   . THR B 1 300 ? 0.405   21.491 -1.787  1.00 17.83  ? 300  THR B CA   1 
ATOM   9362  C  C    . THR B 1 300 ? -0.915  21.930 -1.158  1.00 11.67  ? 300  THR B C    1 
ATOM   9363  O  O    . THR B 1 300 ? -0.915  22.605 -0.131  1.00 12.10  ? 300  THR B O    1 
ATOM   9364  C  CB   . THR B 1 300 ? 0.733   22.372 -3.019  1.00 16.38  ? 300  THR B CB   1 
ATOM   9365  O  OG1  . THR B 1 300 ? 1.988   21.940 -3.544  1.00 15.30  ? 300  THR B OG1  1 
ATOM   9366  C  CG2  . THR B 1 300 ? 0.912   23.821 -2.589  1.00 14.25  ? 300  THR B CG2  1 
ATOM   9367  H  H    . THR B 1 300 ? 0.375   19.853 -2.957  1.00 18.16  ? 300  THR B H    1 
ATOM   9368  H  HA   . THR B 1 300 ? 1.117   21.613 -1.124  1.00 21.40  ? 300  THR B HA   1 
ATOM   9369  H  HB   . THR B 1 300 ? 0.029   22.296 -3.696  1.00 19.66  ? 300  THR B HB   1 
ATOM   9370  H  HG1  . THR B 1 300 ? 1.930   21.157 -3.782  1.00 22.96  ? 300  THR B HG1  1 
ATOM   9371  H  HG21 . THR B 1 300 ? 1.113   24.360 -3.357  1.00 21.38  ? 300  THR B HG21 1 
ATOM   9372  H  HG22 . THR B 1 300 ? 1.634   23.881 -1.958  1.00 21.38  ? 300  THR B HG22 1 
ATOM   9373  H  HG23 . THR B 1 300 ? 0.103   24.136 -2.180  1.00 21.38  ? 300  THR B HG23 1 
ATOM   9374  N  N    . LEU B 1 301 ? -2.058  21.570 -1.776  1.00 12.29  ? 301  LEU B N    1 
ATOM   9375  C  CA   . LEU B 1 301 ? -3.352  22.016 -1.260  1.00 10.01  ? 301  LEU B CA   1 
ATOM   9376  C  C    . LEU B 1 301 ? -3.596  21.483 0.159   1.00 11.96  ? 301  LEU B C    1 
ATOM   9377  O  O    . LEU B 1 301 ? -4.177  22.145 1.048   1.00 13.65  ? 301  LEU B O    1 
ATOM   9378  C  CB   . LEU B 1 301 ? -4.487  21.572 -2.202  1.00 12.59  ? 301  LEU B CB   1 
ATOM   9379  C  CG   . LEU B 1 301 ? -4.463  22.154 -3.626  1.00 15.83  ? 301  LEU B CG   1 
ATOM   9380  C  CD1  . LEU B 1 301 ? -5.633  21.644 -4.465  1.00 18.09  ? 301  LEU B CD1  1 
ATOM   9381  C  CD2  . LEU B 1 301 ? -4.495  23.657 -3.561  1.00 16.97  ? 301  LEU B CD2  1 
ATOM   9382  H  H    . LEU B 1 301 ? -2.026  21.075 -2.479  1.00 14.74  ? 301  LEU B H    1 
ATOM   9383  H  HA   . LEU B 1 301 ? -3.348  22.996 -1.224  1.00 12.01  ? 301  LEU B HA   1 
ATOM   9384  H  HB2  . LEU B 1 301 ? -4.463  20.605 -2.269  1.00 15.11  ? 301  LEU B HB2  1 
ATOM   9385  H  HB3  . LEU B 1 301 ? -5.332  21.812 -1.791  1.00 15.11  ? 301  LEU B HB3  1 
ATOM   9386  H  HG   . LEU B 1 301 ? -3.628  21.880 -4.059  1.00 19.00  ? 301  LEU B HG   1 
ATOM   9387  H  HD11 . LEU B 1 301 ? -5.602  20.685 -4.508  1.00 27.14  ? 301  LEU B HD11 1 
ATOM   9388  H  HD12 . LEU B 1 301 ? -5.572  22.006 -5.352  1.00 27.14  ? 301  LEU B HD12 1 
ATOM   9389  H  HD13 . LEU B 1 301 ? -6.460  21.920 -4.063  1.00 27.14  ? 301  LEU B HD13 1 
ATOM   9390  H  HD21 . LEU B 1 301 ? -3.753  23.970 -3.038  1.00 25.45  ? 301  LEU B HD21 1 
ATOM   9391  H  HD22 . LEU B 1 301 ? -5.316  23.943 -3.153  1.00 25.45  ? 301  LEU B HD22 1 
ATOM   9392  H  HD23 . LEU B 1 301 ? -4.436  24.017 -4.449  1.00 25.45  ? 301  LEU B HD23 1 
ATOM   9393  N  N    . ALA B 1 302 ? -3.104  20.269 0.426   1.00 12.20  ? 302  ALA B N    1 
ATOM   9394  C  CA   . ALA B 1 302 ? -3.206  19.657 1.763   1.00 10.10  ? 302  ALA B CA   1 
ATOM   9395  C  C    . ALA B 1 302 ? -2.436  20.419 2.796   1.00 9.70   ? 302  ALA B C    1 
ATOM   9396  O  O    . ALA B 1 302 ? -2.833  20.577 3.990   1.00 10.95  ? 302  ALA B O    1 
ATOM   9397  C  CB   . ALA B 1 302 ? -2.729  18.217 1.701   1.00 11.19  ? 302  ALA B CB   1 
ATOM   9398  H  H    . ALA B 1 302 ? -2.715  19.831 -0.203  1.00 14.64  ? 302  ALA B H    1 
ATOM   9399  H  HA   . ALA B 1 302 ? -4.150  19.655 2.026   1.00 12.12  ? 302  ALA B HA   1 
ATOM   9400  H  HB1  . ALA B 1 302 ? -3.233  17.742 1.036   1.00 16.78  ? 302  ALA B HB1  1 
ATOM   9401  H  HB2  . ALA B 1 302 ? -2.856  17.801 2.556   1.00 16.78  ? 302  ALA B HB2  1 
ATOM   9402  H  HB3  . ALA B 1 302 ? -1.798  18.198 1.470   1.00 16.78  ? 302  ALA B HB3  1 
ATOM   9403  N  N    . CYS B 1 303 ? -1.282  20.976 2.394   1.00 12.83  ? 303  CYS B N    1 
ATOM   9404  C  CA   . CYS B 1 303 ? -0.514  21.831 3.273   1.00 14.09  ? 303  CYS B CA   1 
ATOM   9405  C  C    . CYS B 1 303 ? -1.289  23.086 3.716   1.00 12.76  ? 303  CYS B C    1 
ATOM   9406  O  O    . CYS B 1 303 ? -0.861  23.620 4.742   1.00 13.21  ? 303  CYS B O    1 
ATOM   9407  C  CB   . CYS B 1 303 ? 0.813   22.296 2.666   1.00 12.97  ? 303  CYS B CB   1 
ATOM   9408  S  SG   . CYS B 1 303 ? 2.004   20.986 2.407   1.00 13.68  ? 303  CYS B SG   1 
ATOM   9409  H  H    . CYS B 1 303 ? -0.993  20.822 1.598   1.00 15.40  ? 303  CYS B H    1 
ATOM   9410  H  HA   . CYS B 1 303 ? -0.305  21.314 4.078   1.00 16.90  ? 303  CYS B HA   1 
ATOM   9411  H  HB2  . CYS B 1 303 ? 0.633   22.725 1.815   1.00 15.56  ? 303  CYS B HB2  1 
ATOM   9412  H  HB3  . CYS B 1 303 ? 1.206   22.962 3.253   1.00 15.56  ? 303  CYS B HB3  1 
ATOM   9413  N  N    . PHE B 1 304 ? -2.327  23.506 3.040   1.00 12.92  ? 304  PHE B N    1 
ATOM   9414  C  CA   . PHE B 1 304 ? -3.080  24.712 3.377   1.00 12.59  ? 304  PHE B CA   1 
ATOM   9415  C  C    . PHE B 1 304 ? -4.548  24.404 3.648   1.00 15.37  ? 304  PHE B C    1 
ATOM   9416  O  O    . PHE B 1 304 ? -5.403  25.273 3.539   1.00 16.27  ? 304  PHE B O    1 
ATOM   9417  C  CB   . PHE B 1 304 ? -2.897  25.773 2.281   1.00 14.54  ? 304  PHE B CB   1 
ATOM   9418  C  CG   . PHE B 1 304 ? -1.433  26.125 2.095   1.00 16.35  ? 304  PHE B CG   1 
ATOM   9419  C  CD1  . PHE B 1 304 ? -0.848  26.999 3.007   1.00 17.90  ? 304  PHE B CD1  1 
ATOM   9420  C  CD2  . PHE B 1 304 ? -0.658  25.644 1.066   1.00 13.41  ? 304  PHE B CD2  1 
ATOM   9421  C  CE1  . PHE B 1 304 ? 0.468   27.368 2.921   1.00 15.69  ? 304  PHE B CE1  1 
ATOM   9422  C  CE2  . PHE B 1 304 ? 0.676   25.983 1.001   1.00 14.43  ? 304  PHE B CE2  1 
ATOM   9423  C  CZ   . PHE B 1 304 ? 1.247   26.858 1.904   1.00 17.69  ? 304  PHE B CZ   1 
ATOM   9424  H  H    . PHE B 1 304 ? -2.580  23.047 2.359   1.00 15.51  ? 304  PHE B H    1 
ATOM   9425  H  HA   . PHE B 1 304 ? -2.698  25.075 4.204   1.00 15.11  ? 304  PHE B HA   1 
ATOM   9426  H  HB2  . PHE B 1 304 ? -3.256  25.437 1.445   1.00 17.45  ? 304  PHE B HB2  1 
ATOM   9427  H  HB3  . PHE B 1 304 ? -3.392  26.572 2.521   1.00 17.45  ? 304  PHE B HB3  1 
ATOM   9428  H  HD1  . PHE B 1 304 ? -1.368  27.343 3.697   1.00 21.48  ? 304  PHE B HD1  1 
ATOM   9429  H  HD2  . PHE B 1 304 ? -1.031  25.091 0.418   1.00 16.09  ? 304  PHE B HD2  1 
ATOM   9430  H  HE1  . PHE B 1 304 ? 0.833   27.956 3.542   1.00 18.83  ? 304  PHE B HE1  1 
ATOM   9431  H  HE2  . PHE B 1 304 ? 1.205   25.614 0.331   1.00 17.31  ? 304  PHE B HE2  1 
ATOM   9432  H  HZ   . PHE B 1 304 ? 2.142   27.099 1.827   1.00 21.23  ? 304  PHE B HZ   1 
ATOM   9433  N  N    . GLY B 1 305 ? -4.837  23.146 3.998   1.00 17.08  ? 305  GLY B N    1 
ATOM   9434  C  CA   . GLY B 1 305 ? -6.056  22.799 4.688   1.00 13.38  ? 305  GLY B CA   1 
ATOM   9435  C  C    . GLY B 1 305 ? -7.043  21.948 3.952   1.00 15.63  ? 305  GLY B C    1 
ATOM   9436  O  O    . GLY B 1 305 ? -8.125  21.592 4.475   1.00 13.76  ? 305  GLY B O    1 
ATOM   9437  H  H    . GLY B 1 305 ? -4.277  22.522 3.805   1.00 20.50  ? 305  GLY B H    1 
ATOM   9438  H  HA2  . GLY B 1 305 ? -5.816  22.339 5.507   1.00 16.06  ? 305  GLY B HA2  1 
ATOM   9439  H  HA3  . GLY B 1 305 ? -6.501  23.623 4.941   1.00 16.06  ? 305  GLY B HA3  1 
ATOM   9440  N  N    . LEU B 1 306 ? -6.774  21.555 2.694   1.00 12.66  ? 306  LEU B N    1 
ATOM   9441  C  CA   . LEU B 1 306 ? -7.676  20.648 2.014   1.00 11.35  ? 306  LEU B CA   1 
ATOM   9442  C  C    . LEU B 1 306 ? -7.541  19.282 2.713   1.00 12.53  ? 306  LEU B C    1 
ATOM   9443  O  O    . LEU B 1 306 ? -6.470  18.700 2.815   1.00 13.34  ? 306  LEU B O    1 
ATOM   9444  C  CB   . LEU B 1 306 ? -7.385  20.544 0.530   1.00 13.84  ? 306  LEU B CB   1 
ATOM   9445  C  CG   . LEU B 1 306 ? -8.465  20.049 -0.425  1.00 24.27  ? 306  LEU B CG   1 
ATOM   9446  C  CD1  . LEU B 1 306 ? -7.801  19.886 -1.803  1.00 22.77  ? 306  LEU B CD1  1 
ATOM   9447  C  CD2  . LEU B 1 306 ? -9.181  18.762 -0.076  1.00 53.89  ? 306  LEU B CD2  1 
ATOM   9448  H  H    . LEU B 1 306 ? -6.069  21.842 2.294   1.00 15.19  ? 306  LEU B H    1 
ATOM   9449  H  HA   . LEU B 1 306 ? -8.594  20.972 2.132   1.00 13.62  ? 306  LEU B HA   1 
ATOM   9450  H  HB2  . LEU B 1 306 ? -7.112  21.423 0.226   1.00 16.61  ? 306  LEU B HB2  1 
ATOM   9451  H  HB3  . LEU B 1 306 ? -6.618  19.959 0.426   1.00 16.61  ? 306  LEU B HB3  1 
ATOM   9452  H  HG   . LEU B 1 306 ? -9.141  20.755 -0.501  1.00 29.12  ? 306  LEU B HG   1 
ATOM   9453  H  HD11 . LEU B 1 306 ? -7.318  20.687 -2.022  1.00 34.16  ? 306  LEU B HD11 1 
ATOM   9454  H  HD12 . LEU B 1 306 ? -8.476  19.728 -2.467  1.00 34.16  ? 306  LEU B HD12 1 
ATOM   9455  H  HD13 . LEU B 1 306 ? -7.194  19.143 -1.780  1.00 34.16  ? 306  LEU B HD13 1 
ATOM   9456  H  HD21 . LEU B 1 306 ? -9.830  18.563 -0.755  1.00 80.83  ? 306  LEU B HD21 1 
ATOM   9457  H  HD22 . LEU B 1 306 ? -9.623  18.860 0.770   1.00 80.83  ? 306  LEU B HD22 1 
ATOM   9458  H  HD23 . LEU B 1 306 ? -8.543  18.046 -0.023  1.00 80.83  ? 306  LEU B HD23 1 
ATOM   9459  N  N    . ALA B 1 307 ? -8.686  18.812 3.161   1.00 12.95  ? 307  ALA B N    1 
ATOM   9460  C  CA   . ALA B 1 307 ? -8.780  17.585 3.929   1.00 9.27   ? 307  ALA B CA   1 
ATOM   9461  C  C    . ALA B 1 307 ? -9.626  16.537 3.267   1.00 10.66  ? 307  ALA B C    1 
ATOM   9462  O  O    . ALA B 1 307 ? -10.700 16.907 2.728   1.00 12.63  ? 307  ALA B O    1 
ATOM   9463  C  CB   . ALA B 1 307 ? -9.431  17.947 5.277   1.00 11.74  ? 307  ALA B CB   1 
ATOM   9464  H  H    . ALA B 1 307 ? -9.406  19.250 2.992   1.00 15.54  ? 307  ALA B H    1 
ATOM   9465  H  HA   . ALA B 1 307 ? -7.881  17.228 4.086   1.00 11.13  ? 307  ALA B HA   1 
ATOM   9466  H  HB1  . ALA B 1 307 ? -8.905  18.619 5.717   1.00 17.61  ? 307  ALA B HB1  1 
ATOM   9467  H  HB2  . ALA B 1 307 ? -9.477  17.164 5.831   1.00 17.61  ? 307  ALA B HB2  1 
ATOM   9468  H  HB3  . ALA B 1 307 ? -10.317 18.283 5.125   1.00 17.61  ? 307  ALA B HB3  1 
ATOM   9469  N  N    . ARG B 1 308 ? -9.223  15.269 3.266   1.00 9.57   ? 308  ARG B N    1 
ATOM   9470  C  CA   . ARG B 1 308 ? -9.949  14.210 2.635   1.00 10.02  ? 308  ARG B CA   1 
ATOM   9471  C  C    . ARG B 1 308 ? -11.279 13.954 3.317   1.00 12.34  ? 308  ARG B C    1 
ATOM   9472  O  O    . ARG B 1 308 ? -12.198 13.462 2.656   1.00 11.34  ? 308  ARG B O    1 
ATOM   9473  C  CB   . ARG B 1 308 ? -9.140  12.908 2.538   1.00 10.11  ? 308  ARG B CB   1 
ATOM   9474  C  CG   . ARG B 1 308 ? -8.115  13.031 1.392   1.00 11.20  ? 308  ARG B CG   1 
ATOM   9475  C  CD   . ARG B 1 308 ? -7.082  11.964 1.366   1.00 11.36  ? 308  ARG B CD   1 
ATOM   9476  N  NE   . ARG B 1 308 ? -6.149  11.999 2.494   1.00 9.79   ? 308  ARG B NE   1 
ATOM   9477  C  CZ   . ARG B 1 308 ? -5.373  10.997 2.832   1.00 8.41   ? 308  ARG B CZ   1 
ATOM   9478  N  NH1  . ARG B 1 308 ? -5.331  9.854  2.156   1.00 11.01  ? 308  ARG B NH1  1 
ATOM   9479  N  NH2  . ARG B 1 308 ? -4.571  11.135 3.868   1.00 9.16   ? 308  ARG B NH2  1 
ATOM   9480  H  H    . ARG B 1 308 ? -8.487  15.075 3.667   1.00 11.48  ? 308  ARG B H    1 
ATOM   9481  H  HA   . ARG B 1 308 ? -10.144 14.499 1.719   1.00 12.02  ? 308  ARG B HA   1 
ATOM   9482  H  HB2  . ARG B 1 308 ? -8.680  12.744 3.376   1.00 12.13  ? 308  ARG B HB2  1 
ATOM   9483  H  HB3  . ARG B 1 308 ? -9.737  12.162 2.368   1.00 12.13  ? 308  ARG B HB3  1 
ATOM   9484  H  HG2  . ARG B 1 308 ? -8.592  13.020 0.548   1.00 13.44  ? 308  ARG B HG2  1 
ATOM   9485  H  HG3  . ARG B 1 308 ? -7.670  13.890 1.466   1.00 13.44  ? 308  ARG B HG3  1 
ATOM   9486  H  HD2  . ARG B 1 308 ? -7.527  11.102 1.357   1.00 13.63  ? 308  ARG B HD2  1 
ATOM   9487  H  HD3  . ARG B 1 308 ? -6.577  12.042 0.541   1.00 13.63  ? 308  ARG B HD3  1 
ATOM   9488  H  HE   . ARG B 1 308 ? -6.107  12.720 2.961   1.00 11.74  ? 308  ARG B HE   1 
ATOM   9489  H  HH11 . ARG B 1 308 ? -5.827  9.747  1.462   1.00 13.21  ? 308  ARG B HH11 1 
ATOM   9490  H  HH12 . ARG B 1 308 ? -4.808  9.222  2.413   1.00 13.21  ? 308  ARG B HH12 1 
ATOM   9491  H  HH21 . ARG B 1 308 ? -4.561  11.873 4.309   1.00 11.00  ? 308  ARG B HH21 1 
ATOM   9492  H  HH22 . ARG B 1 308 ? -4.056  10.487 4.102   1.00 11.00  ? 308  ARG B HH22 1 
ATOM   9493  N  N    . GLU B 1 309 ? -11.417 14.269 4.620   1.00 13.41  ? 309  GLU B N    1 
ATOM   9494  C  CA   . GLU B 1 309 ? -12.702 14.090 5.279   1.00 11.07  ? 309  GLU B CA   1 
ATOM   9495  C  C    . GLU B 1 309 ? -13.759 15.099 4.805   1.00 9.13   ? 309  GLU B C    1 
ATOM   9496  O  O    . GLU B 1 309 ? -14.958 14.933 5.036   1.00 11.02  ? 309  GLU B O    1 
ATOM   9497  C  CB   . GLU B 1 309 ? -12.620 14.160 6.811   1.00 13.00  ? 309  GLU B CB   1 
ATOM   9498  C  CG   . GLU B 1 309 ? -12.246 15.519 7.362   1.00 11.55  ? 309  GLU B CG   1 
ATOM   9499  C  CD   . GLU B 1 309 ? -12.466 15.651 8.856   1.00 13.52  ? 309  GLU B CD   1 
ATOM   9500  O  OE1  . GLU B 1 309 ? -11.845 14.865 9.594   1.00 15.14  ? 309  GLU B OE1  1 
ATOM   9501  O  OE2  . GLU B 1 309 ? -13.239 16.544 9.272   1.00 16.59  ? 309  GLU B OE2  1 
ATOM   9502  H  H    . GLU B 1 309 ? -10.747 14.577 5.061   1.00 16.10  ? 309  GLU B H    1 
ATOM   9503  H  HA   . GLU B 1 309 ? -13.028 13.195 5.045   1.00 13.28  ? 309  GLU B HA   1 
ATOM   9504  H  HB2  . GLU B 1 309 ? -13.479 13.902 7.180   1.00 15.60  ? 309  GLU B HB2  1 
ATOM   9505  H  HB3  . GLU B 1 309 ? -11.965 13.512 7.116   1.00 15.60  ? 309  GLU B HB3  1 
ATOM   9506  H  HG2  . GLU B 1 309 ? -11.311 15.690 7.167   1.00 13.86  ? 309  GLU B HG2  1 
ATOM   9507  H  HG3  . GLU B 1 309 ? -12.770 16.197 6.908   1.00 13.86  ? 309  GLU B HG3  1 
ATOM   9508  N  N    . GLY B 1 310 ? -13.300 16.171 4.144   1.00 10.58  ? 310  GLY B N    1 
ATOM   9509  C  CA   . GLY B 1 310 ? -14.107 17.289 3.700   1.00 12.22  ? 310  GLY B CA   1 
ATOM   9510  C  C    . GLY B 1 310 ? -13.810 18.584 4.392   1.00 12.32  ? 310  GLY B C    1 
ATOM   9511  O  O    . GLY B 1 310 ? -13.039 18.640 5.340   1.00 13.19  ? 310  GLY B O    1 
ATOM   9512  H  H    . GLY B 1 310 ? -12.458 16.197 3.969   1.00 12.70  ? 310  GLY B H    1 
ATOM   9513  H  HA2  . GLY B 1 310 ? -13.973 17.409 2.747   1.00 14.67  ? 310  GLY B HA2  1 
ATOM   9514  H  HA3  . GLY B 1 310 ? -15.042 17.071 3.839   1.00 14.67  ? 310  GLY B HA3  1 
ATOM   9515  N  N    . ASN B 1 311 ? -14.382 19.657 3.876   1.00 15.57  ? 311  ASN B N    1 
ATOM   9516  C  CA   . ASN B 1 311 ? -14.163 21.036 4.260   1.00 16.92  ? 311  ASN B CA   1 
ATOM   9517  C  C    . ASN B 1 311 ? -15.460 21.819 4.150   1.00 16.90  ? 311  ASN B C    1 
ATOM   9518  O  O    . ASN B 1 311 ? -16.209 21.523 3.213   1.00 18.00  ? 311  ASN B O    1 
ATOM   9519  C  CB   . ASN B 1 311 ? -13.138 21.627 3.284   1.00 17.90  ? 311  ASN B CB   1 
ATOM   9520  C  CG   . ASN B 1 311 ? -11.705 21.261 3.556   1.00 17.18  ? 311  ASN B CG   1 
ATOM   9521  O  OD1  . ASN B 1 311 ? -11.222 20.290 3.018   1.00 17.01  ? 311  ASN B OD1  1 
ATOM   9522  N  ND2  . ASN B 1 311 ? -11.010 22.029 4.387   1.00 37.16  ? 311  ASN B ND2  1 
ATOM   9523  H  H    . ASN B 1 311 ? -14.947 19.521 3.241   1.00 18.68  ? 311  ASN B H    1 
ATOM   9524  H  HA   . ASN B 1 311 ? -13.819 21.080 5.177   1.00 20.31  ? 311  ASN B HA   1 
ATOM   9525  H  HB2  . ASN B 1 311 ? -13.365 21.334 2.387   1.00 21.48  ? 311  ASN B HB2  1 
ATOM   9526  H  HB3  . ASN B 1 311 ? -13.217 22.594 3.303   1.00 21.48  ? 311  ASN B HB3  1 
ATOM   9527  H  HD21 . ASN B 1 311 ? -10.188 21.844 4.557   1.00 44.59  ? 311  ASN B HD21 1 
ATOM   9528  H  HD22 . ASN B 1 311 ? -11.382 22.713 4.754   1.00 44.59  ? 311  ASN B HD22 1 
ATOM   9529  N  N    . HIS B 1 312 ? -15.763 22.753 5.044   1.00 21.54  ? 312  HIS B N    1 
ATOM   9530  C  CA   . HIS B 1 312 ? -16.940 23.619 4.871   1.00 16.94  ? 312  HIS B CA   1 
ATOM   9531  C  C    . HIS B 1 312 ? -16.613 25.008 5.420   1.00 19.33  ? 312  HIS B C    1 
ATOM   9532  O  O    . HIS B 1 312 ? -15.772 25.160 6.287   1.00 18.55  ? 312  HIS B O    1 
ATOM   9533  C  CB   . HIS B 1 312 ? -18.194 23.066 5.499   1.00 15.06  ? 312  HIS B CB   1 
ATOM   9534  C  CG   . HIS B 1 312 ? -18.220 22.939 6.981   1.00 20.73  ? 312  HIS B CG   1 
ATOM   9535  N  ND1  . HIS B 1 312 ? -18.332 23.995 7.868   1.00 24.97  ? 312  HIS B ND1  1 
ATOM   9536  C  CD2  . HIS B 1 312 ? -18.200 21.854 7.788   1.00 27.35  ? 312  HIS B CD2  1 
ATOM   9537  C  CE1  . HIS B 1 312 ? -18.331 23.519 9.104   1.00 18.83  ? 312  HIS B CE1  1 
ATOM   9538  N  NE2  . HIS B 1 312 ? -18.238 22.216 9.102   1.00 29.13  ? 312  HIS B NE2  1 
ATOM   9539  H  H    . HIS B 1 312 ? -15.263 22.853 5.736   1.00 25.84  ? 312  HIS B H    1 
ATOM   9540  H  HA   . HIS B 1 312 ? -17.104 23.710 3.909   1.00 20.33  ? 312  HIS B HA   1 
ATOM   9541  H  HB2  . HIS B 1 312 ? -18.935 23.633 5.235   1.00 18.07  ? 312  HIS B HB2  1 
ATOM   9542  H  HB3  . HIS B 1 312 ? -18.355 22.188 5.121   1.00 18.07  ? 312  HIS B HB3  1 
ATOM   9543  H  HD1  . HIS B 1 312 ? -18.393 24.825 7.652   1.00 29.96  ? 312  HIS B HD1  1 
ATOM   9544  H  HD2  . HIS B 1 312 ? -18.166 20.976 7.485   1.00 32.82  ? 312  HIS B HD2  1 
ATOM   9545  H  HE1  . HIS B 1 312 ? -18.388 24.043 9.870   1.00 22.59  ? 312  HIS B HE1  1 
ATOM   9546  N  N    . LYS B 1 313 ? -17.305 26.017 4.872   1.00 24.67  ? 313  LYS B N    1 
ATOM   9547  C  CA   . LYS B 1 313 ? -17.074 27.351 5.449   1.00 28.33  ? 313  LYS B CA   1 
ATOM   9548  C  C    . LYS B 1 313 ? -18.054 27.576 6.590   1.00 24.17  ? 313  LYS B C    1 
ATOM   9549  O  O    . LYS B 1 313 ? -19.016 26.828 6.802   1.00 24.33  ? 313  LYS B O    1 
ATOM   9550  C  CB   . LYS B 1 313 ? -17.181 28.430 4.384   1.00 28.97  ? 313  LYS B CB   1 
ATOM   9551  C  CG   . LYS B 1 313 ? -16.330 28.226 3.143   1.00 30.83  ? 313  LYS B CG   1 
ATOM   9552  C  CD   . LYS B 1 313 ? -16.661 29.278 2.093   1.00 39.28  ? 313  LYS B CD   1 
ATOM   9553  C  CE   . LYS B 1 313 ? -15.544 30.316 2.037   1.00 45.19  ? 313  LYS B CE   1 
ATOM   9554  N  NZ   . LYS B 1 313 ? -14.247 29.718 1.572   1.00 69.21  ? 313  LYS B NZ   1 
ATOM   9555  H  H    . LYS B 1 313 ? -17.853 25.892 4.222   1.00 29.60  ? 313  LYS B H    1 
ATOM   9556  H  HA   . LYS B 1 313 ? -16.166 27.373 5.817   1.00 34.00  ? 313  LYS B HA   1 
ATOM   9557  H  HB2  . LYS B 1 313 ? -18.109 28.495 4.109   1.00 34.76  ? 313  LYS B HB2  1 
ATOM   9558  H  HB3  . LYS B 1 313 ? -16.938 29.279 4.785   1.00 34.76  ? 313  LYS B HB3  1 
ATOM   9559  H  HG2  . LYS B 1 313 ? -15.391 28.288 3.379   1.00 37.00  ? 313  LYS B HG2  1 
ATOM   9560  H  HG3  . LYS B 1 313 ? -16.492 27.342 2.779   1.00 37.00  ? 313  LYS B HG3  1 
ATOM   9561  H  HD2  . LYS B 1 313 ? -16.760 28.855 1.225   1.00 47.14  ? 313  LYS B HD2  1 
ATOM   9562  H  HD3  . LYS B 1 313 ? -17.500 29.711 2.316   1.00 47.14  ? 313  LYS B HD3  1 
ATOM   9563  H  HE2  . LYS B 1 313 ? -15.801 31.030 1.433   1.00 54.23  ? 313  LYS B HE2  1 
ATOM   9564  H  HE3  . LYS B 1 313 ? -15.421 30.701 2.918   1.00 54.23  ? 313  LYS B HE3  1 
ATOM   9565  H  HZ1  . LYS B 1 313 ? -13.682 30.369 1.351   1.00 103.81 ? 313  LYS B HZ1  1 
ATOM   9566  H  HZ2  . LYS B 1 313 ? -14.395 29.201 0.863   1.00 103.81 ? 313  LYS B HZ2  1 
ATOM   9567  H  HZ3  . LYS B 1 313 ? -13.894 29.228 2.226   1.00 103.81 ? 313  LYS B HZ3  1 
HETATM 9568  MN MN   . MN  C 2 .   ? 64.004  17.694 30.790  1.00 7.69   ? 2362 MN  A MN   1 
HETATM 9569  MN MN   . MN  D 2 .   ? 67.047  18.369 31.954  1.00 7.90   ? 2363 MN  A MN   1 
HETATM 9570  N  N    . ABH E 3 .   ? 65.442  9.929  31.111  1.00 16.15  ? 551  ABH A N    1 
HETATM 9571  C  CA   . ABH E 3 .   ? 65.532  10.109 29.636  1.00 14.25  ? 551  ABH A CA   1 
HETATM 9572  C  C    . ABH E 3 .   ? 66.981  9.721  29.213  1.00 16.25  ? 551  ABH A C    1 
HETATM 9573  O  O    . ABH E 3 .   ? 67.372  9.713  28.085  1.00 18.26  ? 551  ABH A O    1 
HETATM 9574  O  OT   . ABH E 3 .   ? 67.796  9.345  30.198  1.00 14.30  ? 551  ABH A OT   1 
HETATM 9575  C  CB   . ABH E 3 .   ? 65.272  11.576 29.240  1.00 21.86  ? 551  ABH A CB   1 
HETATM 9576  C  CG   . ABH E 3 .   ? 66.261  12.664 29.509  1.00 20.02  ? 551  ABH A CG   1 
HETATM 9577  C  CD   . ABH E 3 .   ? 65.895  14.080 29.114  1.00 16.77  ? 551  ABH A CD   1 
HETATM 9578  C  CE   . ABH E 3 .   ? 66.997  15.047 29.529  1.00 14.14  ? 551  ABH A CE   1 
HETATM 9579  B  B    . ABH E 3 .   ? 66.668  16.541 29.841  1.00 10.93  ? 551  ABH A B    1 
HETATM 9580  O  O2   . ABH E 3 .   ? 67.837  17.376 30.088  1.00 12.17  ? 551  ABH A O2   1 
HETATM 9581  O  O1   . ABH E 3 .   ? 65.880  16.708 31.039  1.00 11.81  ? 551  ABH A O1   1 
HETATM 9582  O  O3   . ABH E 3 .   ? 65.904  17.233 28.792  1.00 13.72  ? 551  ABH A O3   1 
HETATM 9583  H  HN1  . ABH E 3 .   ? 64.628  10.159 31.389  1.00 24.22  ? 551  ABH A HN1  1 
HETATM 9584  H  HN2  . ABH E 3 .   ? 66.049  10.444 31.510  1.00 24.22  ? 551  ABH A HN2  1 
HETATM 9585  H  HCA  . ABH E 3 .   ? 64.886  9.523  29.189  1.00 17.10  ? 551  ABH A HCA  1 
HETATM 9586  H  HCB1 . ABH E 3 .   ? 65.103  11.582 28.285  1.00 26.23  ? 551  ABH A HCB1 1 
HETATM 9587  H  HCB2 . ABH E 3 .   ? 64.443  11.839 29.670  1.00 26.23  ? 551  ABH A HCB2 1 
HETATM 9588  H  HCG1 . ABH E 3 .   ? 67.085  12.433 29.053  1.00 24.02  ? 551  ABH A HCG1 1 
HETATM 9589  H  HCG2 . ABH E 3 .   ? 66.451  12.662 30.460  1.00 24.02  ? 551  ABH A HCG2 1 
HETATM 9590  H  HCD1 . ABH E 3 .   ? 65.062  14.332 29.543  1.00 20.12  ? 551  ABH A HCD1 1 
HETATM 9591  H  HCD2 . ABH E 3 .   ? 65.766  14.127 28.154  1.00 20.12  ? 551  ABH A HCD2 1 
HETATM 9592  H  HCE1 . ABH E 3 .   ? 67.663  15.042 28.824  1.00 16.97  ? 551  ABH A HCE1 1 
HETATM 9593  H  HCE2 . ABH E 3 .   ? 67.421  14.676 30.319  1.00 16.97  ? 551  ABH A HCE2 1 
HETATM 9594  H  HO2  . ABH E 3 .   ? 68.480  16.930 30.230  1.00 18.25  ? 551  ABH A HO2  1 
HETATM 9595  H  HO1  . ABH E 3 .   ? 66.120  16.210 31.630  1.00 17.71  ? 551  ABH A HO1  1 
HETATM 9596  H  HO3  . ABH E 3 .   ? 66.050  16.890 28.020  1.00 20.58  ? 551  ABH A HO3  1 
HETATM 9597  H  H0A  . ABH E 3 .   ? 65.595  9.077  31.316  1.00 24.22  ? 551  ABH A H0A  1 
HETATM 9598  MN MN   . MN  F 2 .   ? 15.430  13.418 -4.165  1.00 10.56  ? 1362 MN  B MN   1 
HETATM 9599  MN MN   . MN  G 2 .   ? 16.025  16.447 -2.889  1.00 11.18  ? 1363 MN  B MN   1 
HETATM 9600  N  N    . ABH H 3 .   ? 23.008  11.627 -3.677  1.00 19.19  ? 552  ABH B N    1 
HETATM 9601  C  CA   . ABH H 3 .   ? 22.949  11.771 -5.151  1.00 18.28  ? 552  ABH B CA   1 
HETATM 9602  C  C    . ABH H 3 .   ? 23.867  12.955 -5.682  1.00 26.70  ? 552  ABH B C    1 
HETATM 9603  O  O    . ABH H 3 .   ? 24.056  13.238 -6.800  1.00 18.57  ? 552  ABH B O    1 
HETATM 9604  O  OT   . ABH H 3 .   ? 24.582  13.540 -4.689  1.00 14.90  ? 552  ABH B OT   1 
HETATM 9605  C  CB   . ABH H 3 .   ? 21.475  12.024 -5.583  1.00 18.84  ? 552  ABH B CB   1 
HETATM 9606  C  CG   . ABH H 3 .   ? 20.995  13.449 -5.414  1.00 17.92  ? 552  ABH B CG   1 
HETATM 9607  C  CD   . ABH H 3 .   ? 19.524  13.682 -5.533  1.00 17.76  ? 552  ABH B CD   1 
HETATM 9608  C  CE   . ABH H 3 .   ? 19.096  15.108 -5.223  1.00 18.77  ? 552  ABH B CE   1 
HETATM 9609  B  B    . ABH H 3 .   ? 17.593  15.449 -4.999  1.00 15.71  ? 552  ABH B B    1 
HETATM 9610  O  O2   . ABH H 3 .   ? 17.286  16.824 -4.735  1.00 15.41  ? 552  ABH B O2   1 
HETATM 9611  O  O1   . ABH H 3 .   ? 17.082  14.837 -3.791  1.00 10.89  ? 552  ABH B O1   1 
HETATM 9612  O  O3   . ABH H 3 .   ? 16.746  14.920 -6.042  1.00 15.20  ? 552  ABH B O3   1 
HETATM 9613  H  HN1  . ABH H 3 .   ? 22.501  10.940 -3.426  1.00 28.78  ? 552  ABH B HN1  1 
HETATM 9614  H  HN2  . ABH H 3 .   ? 22.708  12.372 -3.294  1.00 28.78  ? 552  ABH B HN2  1 
HETATM 9615  H  HCA  . ABH H 3 .   ? 23.254  10.933 -5.558  1.00 21.94  ? 552  ABH B HCA  1 
HETATM 9616  H  HCB1 . ABH H 3 .   ? 21.380  11.776 -6.516  1.00 22.61  ? 552  ABH B HCB1 1 
HETATM 9617  H  HCB2 . ABH H 3 .   ? 20.898  11.441 -5.065  1.00 22.61  ? 552  ABH B HCB2 1 
HETATM 9618  H  HCG1 . ABH H 3 .   ? 21.280  13.762 -4.541  1.00 21.50  ? 552  ABH B HCG1 1 
HETATM 9619  H  HCG2 . ABH H 3 .   ? 21.442  13.998 -6.077  1.00 21.50  ? 552  ABH B HCG2 1 
HETATM 9620  H  HCD1 . ABH H 3 .   ? 19.063  13.080 -4.928  1.00 21.31  ? 552  ABH B HCD1 1 
HETATM 9621  H  HCD2 . ABH H 3 .   ? 19.246  13.462 -6.436  1.00 21.31  ? 552  ABH B HCD2 1 
HETATM 9622  H  HCE1 . ABH H 3 .   ? 19.412  15.667 -5.950  1.00 22.52  ? 552  ABH B HCE1 1 
HETATM 9623  H  HCE2 . ABH H 3 .   ? 19.575  15.385 -4.426  1.00 22.52  ? 552  ABH B HCE2 1 
HETATM 9624  H  HO2  . ABH H 3 .   ? 17.950  17.300 -4.480  1.00 23.12  ? 552  ABH B HO2  1 
HETATM 9625  H  HO1  . ABH H 3 .   ? 17.660  14.930 -3.200  1.00 16.33  ? 552  ABH B HO1  1 
HETATM 9626  H  HO3  . ABH H 3 .   ? 17.090  14.960 -6.780  1.00 22.80  ? 552  ABH B HO3  1 
HETATM 9627  H  H0A  . ABH H 3 .   ? 23.850  11.482 -3.427  1.00 28.78  ? 552  ABH B H0A  1 
HETATM 9628  O  O    . HOH I 4 .   ? 45.384  22.077 45.237  1.00 12.77  ? 2364 HOH A O    1 
HETATM 9629  O  O    . HOH I 4 .   ? 82.762  31.441 19.911  1.00 33.78  ? 2365 HOH A O    1 
HETATM 9630  O  O    . HOH I 4 .   ? 48.450  25.693 37.965  1.00 11.97  ? 2366 HOH A O    1 
HETATM 9631  O  O    . HOH I 4 .   ? 49.921  26.104 41.540  1.00 11.17  ? 2367 HOH A O    1 
HETATM 9632  O  O    . HOH I 4 .   ? 57.345  9.731  35.832  1.00 12.09  ? 2368 HOH A O    1 
HETATM 9633  O  O    . HOH I 4 .   ? 62.475  9.818  31.270  1.00 16.14  ? 2369 HOH A O    1 
HETATM 9634  O  O    . HOH I 4 .   ? 78.858  10.635 41.648  1.00 14.55  ? 2370 HOH A O    1 
HETATM 9635  O  O    . HOH I 4 .   ? 58.147  38.474 36.697  1.00 14.31  ? 2371 HOH A O    1 
HETATM 9636  O  O    . HOH I 4 .   ? 70.539  9.125  29.952  1.00 11.69  ? 2372 HOH A O    1 
HETATM 9637  O  O    . HOH I 4 .   ? 61.581  38.987 40.104  1.00 11.95  ? 2373 HOH A O    1 
HETATM 9638  O  O    . HOH I 4 .   ? 57.812  22.029 27.120  1.00 10.93  ? 2374 HOH A O    1 
HETATM 9639  O  O    . HOH I 4 .   ? 50.848  9.710  42.995  1.00 22.47  ? 2375 HOH A O    1 
HETATM 9640  O  O    . HOH I 4 .   ? 49.950  29.538 39.222  1.00 12.59  ? 2376 HOH A O    1 
HETATM 9641  O  O    . HOH I 4 .   ? 53.956  11.891 44.119  1.00 13.25  ? 2377 HOH A O    1 
HETATM 9642  O  O    . HOH I 4 .   ? 61.103  34.506 48.257  1.00 17.52  ? 2378 HOH A O    1 
HETATM 9643  O  O    . HOH I 4 .   ? 47.567  29.583 33.470  1.00 11.86  ? 2379 HOH A O    1 
HETATM 9644  O  O    . HOH I 4 .   ? 66.211  20.522 23.658  1.00 11.19  ? 2380 HOH A O    1 
HETATM 9645  O  O    . HOH I 4 .   ? 76.806  22.224 48.986  1.00 16.99  ? 2381 HOH A O    1 
HETATM 9646  O  O    . HOH I 4 .   ? 46.215  22.493 41.737  1.00 12.83  ? 2382 HOH A O    1 
HETATM 9647  O  O    . HOH I 4 .   ? 55.737  30.962 48.195  1.00 10.69  ? 2383 HOH A O    1 
HETATM 9648  O  O    . HOH I 4 .   ? 51.998  14.678 32.896  1.00 13.57  ? 2384 HOH A O    1 
HETATM 9649  O  O    . HOH I 4 .   ? 87.501  16.273 29.421  1.00 16.66  ? 2385 HOH A O    1 
HETATM 9650  O  O    . HOH I 4 .   ? 75.485  12.098 24.944  1.00 11.79  ? 2386 HOH A O    1 
HETATM 9651  O  O    . HOH I 4 .   ? 63.694  44.259 31.609  1.00 16.37  ? 2387 HOH A O    1 
HETATM 9652  O  O    . HOH I 4 .   ? 77.733  20.619 20.080  1.00 17.05  ? 2388 HOH A O    1 
HETATM 9653  O  O    . HOH I 4 .   ? 44.064  22.197 47.717  1.00 13.49  ? 2389 HOH A O    1 
HETATM 9654  O  O    . HOH I 4 .   ? 79.704  8.284  20.773  1.00 15.40  ? 2390 HOH A O    1 
HETATM 9655  O  O    . HOH I 4 .   ? 65.580  17.050 26.224  1.00 15.19  ? 2391 HOH A O    1 
HETATM 9656  O  O    . HOH I 4 .   ? 75.584  29.081 36.063  1.00 15.09  ? 2392 HOH A O    1 
HETATM 9657  O  O    . HOH I 4 .   ? 71.442  1.009  46.356  1.00 20.51  ? 2393 HOH A O    1 
HETATM 9658  O  O    . HOH I 4 .   ? 67.719  6.565  29.442  1.00 14.76  ? 2394 HOH A O    1 
HETATM 9659  O  O    . HOH I 4 .   ? 90.001  12.914 17.536  1.00 19.91  ? 2395 HOH A O    1 
HETATM 9660  O  O    . HOH I 4 .   ? 67.383  11.432 25.950  1.00 14.17  ? 2396 HOH A O    1 
HETATM 9661  O  O    . HOH I 4 .   ? 75.397  2.959  38.192  1.00 14.93  ? 2397 HOH A O    1 
HETATM 9662  O  O    . HOH I 4 .   ? 58.941  5.297  36.187  1.00 16.97  ? 2398 HOH A O    1 
HETATM 9663  O  O    . HOH I 4 .   ? 71.142  40.353 24.000  1.00 18.16  ? 2399 HOH A O    1 
HETATM 9664  O  O    . HOH I 4 .   ? 59.479  38.385 33.505  1.00 21.62  ? 2400 HOH A O    1 
HETATM 9665  O  O    . HOH I 4 .   ? 61.655  43.358 42.051  1.00 18.71  ? 2401 HOH A O    1 
HETATM 9666  O  O    . HOH I 4 .   ? 67.151  11.210 32.954  1.00 14.79  ? 2402 HOH A O    1 
HETATM 9667  O  O    . HOH I 4 .   ? 50.030  22.707 32.150  1.00 13.90  ? 2403 HOH A O    1 
HETATM 9668  O  O    . HOH I 4 .   ? 87.514  22.753 34.725  1.00 20.05  ? 2404 HOH A O    1 
HETATM 9669  O  O    . HOH I 4 .   ? 49.356  31.914 30.640  1.00 17.04  ? 2405 HOH A O    1 
HETATM 9670  O  O    . HOH I 4 .   ? 82.684  16.776 19.250  1.00 20.98  ? 2406 HOH A O    1 
HETATM 9671  O  O    . HOH I 4 .   ? 67.776  25.343 16.446  1.00 18.31  ? 2407 HOH A O    1 
HETATM 9672  O  O    . HOH I 4 .   ? 58.517  31.337 48.519  1.00 12.26  ? 2408 HOH A O    1 
HETATM 9673  O  O    . HOH I 4 .   ? 53.808  13.823 26.760  1.00 18.88  ? 2409 HOH A O    1 
HETATM 9674  O  O    . HOH I 4 .   ? 62.206  13.235 22.622  1.00 24.42  ? 2410 HOH A O    1 
HETATM 9675  O  O    . HOH I 4 .   ? 69.187  37.276 41.504  1.00 12.90  ? 2411 HOH A O    1 
HETATM 9676  O  O    . HOH I 4 .   ? 61.403  25.764 13.577  1.00 25.10  ? 2412 HOH A O    1 
HETATM 9677  O  O    . HOH I 4 .   ? 55.491  33.266 25.218  1.00 21.75  ? 2413 HOH A O    1 
HETATM 9678  O  O    . HOH I 4 .   ? 57.075  20.377 20.947  1.00 22.45  ? 2414 HOH A O    1 
HETATM 9679  O  O    . HOH I 4 .   ? 67.350  16.769 48.700  1.00 12.02  ? 2415 HOH A O    1 
HETATM 9680  O  O    . HOH I 4 .   ? 88.531  29.165 36.181  1.00 20.33  ? 2416 HOH A O    1 
HETATM 9681  O  O    . HOH I 4 .   ? 81.208  11.604 39.464  1.00 23.47  ? 2417 HOH A O    1 
HETATM 9682  O  O    . HOH I 4 .   ? 47.341  24.304 35.915  1.00 9.88   ? 2418 HOH A O    1 
HETATM 9683  O  O    . HOH I 4 .   ? 51.301  16.515 34.979  1.00 13.92  ? 2419 HOH A O    1 
HETATM 9684  O  O    . HOH I 4 .   ? 60.970  5.548  31.454  1.00 29.97  ? 2420 HOH A O    1 
HETATM 9685  O  O    . HOH I 4 .   ? 68.643  36.569 44.204  1.00 13.93  ? 2421 HOH A O    1 
HETATM 9686  O  O    . HOH I 4 .   ? 83.389  19.503 23.446  1.00 18.27  ? 2422 HOH A O    1 
HETATM 9687  O  O    . HOH I 4 .   ? 48.263  26.025 28.050  1.00 29.52  ? 2423 HOH A O    1 
HETATM 9688  O  O    . HOH I 4 .   ? 60.314  29.590 52.914  1.00 16.42  ? 2424 HOH A O    1 
HETATM 9689  O  O    . HOH I 4 .   ? 84.560  8.037  16.619  1.00 15.92  ? 2425 HOH A O    1 
HETATM 9690  O  O    . HOH I 4 .   ? 66.875  19.050 21.330  1.00 12.61  ? 2426 HOH A O    1 
HETATM 9691  O  O    . HOH I 4 .   ? 80.905  34.846 43.807  1.00 30.03  ? 2427 HOH A O    1 
HETATM 9692  O  O    . HOH I 4 .   ? 60.908  48.049 42.304  1.00 19.95  ? 2428 HOH A O    1 
HETATM 9693  O  O    . HOH I 4 .   ? 83.463  20.982 41.803  1.00 25.31  ? 2429 HOH A O    1 
HETATM 9694  O  O    . HOH I 4 .   ? 59.322  30.005 55.439  1.00 29.17  ? 2430 HOH A O    1 
HETATM 9695  O  O    . HOH I 4 .   ? 84.776  4.419  23.689  1.00 24.06  ? 2431 HOH A O    1 
HETATM 9696  O  O    . HOH I 4 .   ? 66.858  17.201 23.653  1.00 18.19  ? 2432 HOH A O    1 
HETATM 9697  O  O    . HOH I 4 .   ? 77.427  45.477 40.543  1.00 26.88  ? 2433 HOH A O    1 
HETATM 9698  O  O    . HOH I 4 .   ? 80.638  21.242 47.297  1.00 21.23  ? 2434 HOH A O    1 
HETATM 9699  O  O    . HOH I 4 .   ? 79.806  30.364 49.758  1.00 26.64  ? 2435 HOH A O    1 
HETATM 9700  O  O    . HOH I 4 .   ? 62.342  6.985  50.734  1.00 23.24  ? 2436 HOH A O    1 
HETATM 9701  O  O    . HOH I 4 .   ? 73.461  11.768 22.694  1.00 14.78  ? 2437 HOH A O    1 
HETATM 9702  O  O    . HOH I 4 .   ? 57.841  52.718 47.037  1.00 34.11  ? 2438 HOH A O    1 
HETATM 9703  O  O    . HOH I 4 .   ? 56.357  35.650 26.649  1.00 23.69  ? 2439 HOH A O    1 
HETATM 9704  O  O    . HOH I 4 .   ? 65.246  35.562 18.891  1.00 22.17  ? 2440 HOH A O    1 
HETATM 9705  O  O    . HOH I 4 .   ? 88.432  26.795 38.180  1.00 22.33  ? 2441 HOH A O    1 
HETATM 9706  O  O    . HOH I 4 .   ? 88.547  14.160 40.070  1.00 44.41  ? 2442 HOH A O    1 
HETATM 9707  O  O    . HOH I 4 .   ? 59.482  45.556 42.233  1.00 19.26  ? 2443 HOH A O    1 
HETATM 9708  O  O    . HOH I 4 .   ? 64.573  12.430 24.749  1.00 32.76  ? 2444 HOH A O    1 
HETATM 9709  O  O    . HOH I 4 .   ? 68.221  0.478  33.099  1.00 34.41  ? 2445 HOH A O    1 
HETATM 9710  O  O    . HOH I 4 .   ? 78.714  19.013 28.902  1.00 13.11  ? 2446 HOH A O    1 
HETATM 9711  O  O    . HOH I 4 .   ? 72.736  14.406 51.934  1.00 27.35  ? 2447 HOH A O    1 
HETATM 9712  O  O    . HOH I 4 .   ? 72.429  36.471 19.100  1.00 39.33  ? 2448 HOH A O    1 
HETATM 9713  O  O    . HOH I 4 .   ? 50.368  31.929 21.168  1.00 25.79  ? 2449 HOH A O    1 
HETATM 9714  O  O    . HOH I 4 .   ? 63.002  10.908 48.074  1.00 16.46  ? 2450 HOH A O    1 
HETATM 9715  O  O    . HOH I 4 .   ? 73.987  16.406 18.956  1.00 28.43  ? 2451 HOH A O    1 
HETATM 9716  O  O    . HOH I 4 .   ? 81.366  26.239 19.942  1.00 29.91  ? 2452 HOH A O    1 
HETATM 9717  O  O    . HOH I 4 .   ? 79.806  42.907 28.068  1.00 30.71  ? 2453 HOH A O    1 
HETATM 9718  O  O    . HOH I 4 .   ? 80.925  47.021 37.281  1.00 46.81  ? 2454 HOH A O    1 
HETATM 9719  O  O    . HOH I 4 .   ? 55.329  39.462 46.162  1.00 26.58  ? 2455 HOH A O    1 
HETATM 9720  O  O    . HOH I 4 .   ? 88.449  31.229 28.442  1.00 37.53  ? 2456 HOH A O    1 
HETATM 9721  O  O    . HOH I 4 .   ? 48.776  23.619 41.554  1.00 20.04  ? 2457 HOH A O    1 
HETATM 9722  O  O    . HOH I 4 .   ? 63.969  44.534 43.283  1.00 25.25  ? 2458 HOH A O    1 
HETATM 9723  O  O    . HOH I 4 .   ? 53.766  11.975 32.790  1.00 37.47  ? 2459 HOH A O    1 
HETATM 9724  O  O    . HOH I 4 .   ? 68.053  -1.973 47.206  1.00 26.20  ? 2460 HOH A O    1 
HETATM 9725  O  O    . HOH I 4 .   ? 49.078  28.256 37.059  1.00 9.78   ? 2461 HOH A O    1 
HETATM 9726  O  O    . HOH I 4 .   ? 57.821  19.666 28.481  1.00 9.68   ? 2462 HOH A O    1 
HETATM 9727  O  O    . HOH I 4 .   ? 53.111  11.111 41.654  1.00 11.89  ? 2463 HOH A O    1 
HETATM 9728  O  O    . HOH I 4 .   ? 50.275  30.433 32.791  1.00 10.80  ? 2464 HOH A O    1 
HETATM 9729  O  O    . HOH I 4 .   ? 63.607  18.940 26.359  1.00 9.39   ? 2465 HOH A O    1 
HETATM 9730  O  O    . HOH I 4 .   ? 63.860  11.657 34.065  1.00 11.70  ? 2466 HOH A O    1 
HETATM 9731  O  O    . HOH I 4 .   ? 68.560  26.803 26.234  1.00 14.67  ? 2467 HOH A O    1 
HETATM 9732  O  O    . HOH I 4 .   ? 62.164  46.541 32.197  1.00 24.65  ? 2468 HOH A O    1 
HETATM 9733  O  O    . HOH I 4 .   ? 60.791  41.470 43.840  1.00 17.87  ? 2469 HOH A O    1 
HETATM 9734  O  O    . HOH I 4 .   ? 73.383  -0.977 45.603  1.00 17.82  ? 2470 HOH A O    1 
HETATM 9735  O  O    . HOH I 4 .   ? 57.706  16.907 48.692  1.00 25.54  ? 2471 HOH A O    1 
HETATM 9736  O  O    . HOH I 4 .   ? 60.345  39.163 42.370  1.00 16.52  ? 2472 HOH A O    1 
HETATM 9737  O  O    . HOH I 4 .   ? 83.299  9.055  14.408  1.00 19.00  ? 2473 HOH A O    1 
HETATM 9738  O  O    . HOH I 4 .   ? 62.962  30.364 53.499  1.00 21.91  ? 2474 HOH A O    1 
HETATM 9739  O  O    . HOH I 4 .   ? 61.960  54.266 35.785  1.00 22.33  ? 2475 HOH A O    1 
HETATM 9740  O  O    . HOH I 4 .   ? 91.875  14.382 16.107  1.00 16.20  ? 2476 HOH A O    1 
HETATM 9741  O  O    . HOH I 4 .   ? 60.606  32.562 14.760  1.00 25.25  ? 2477 HOH A O    1 
HETATM 9742  O  O    . HOH I 4 .   ? 55.461  38.297 31.120  1.00 27.55  ? 2478 HOH A O    1 
HETATM 9743  O  O    . HOH I 4 .   ? 80.684  20.382 19.733  1.00 34.88  ? 2479 HOH A O    1 
HETATM 9744  O  O    . HOH I 4 .   ? 53.672  30.904 13.065  1.00 24.57  ? 2480 HOH A O    1 
HETATM 9745  O  O    . HOH I 4 .   ? 86.809  7.002  19.903  1.00 18.95  ? 2481 HOH A O    1 
HETATM 9746  O  O    . HOH I 4 .   ? 75.513  2.140  46.513  1.00 35.69  ? 2482 HOH A O    1 
HETATM 9747  O  O    . HOH I 4 .   ? 65.625  2.361  34.681  1.00 21.88  ? 2483 HOH A O    1 
HETATM 9748  O  O    . HOH I 4 .   ? 75.093  0.337  38.786  1.00 20.47  ? 2484 HOH A O    1 
HETATM 9749  O  O    . HOH I 4 .   ? 53.011  16.637 49.359  1.00 20.76  ? 2485 HOH A O    1 
HETATM 9750  O  O    . HOH I 4 .   ? 82.306  19.065 20.686  1.00 21.85  ? 2486 HOH A O    1 
HETATM 9751  O  O    . HOH I 4 .   ? 62.061  10.351 28.555  1.00 21.71  ? 2487 HOH A O    1 
HETATM 9752  O  O    . HOH I 4 .   ? 66.704  4.321  32.235  1.00 30.61  ? 2488 HOH A O    1 
HETATM 9753  O  O    . HOH I 4 .   ? 74.474  33.961 46.972  1.00 20.02  ? 2489 HOH A O    1 
HETATM 9754  O  O    . HOH I 4 .   ? 75.283  48.600 40.285  1.00 43.76  ? 2490 HOH A O    1 
HETATM 9755  O  O    . HOH I 4 .   ? 61.695  38.148 24.302  1.00 24.27  ? 2491 HOH A O    1 
HETATM 9756  O  O    . HOH I 4 .   ? 57.307  39.151 34.440  1.00 21.91  ? 2492 HOH A O    1 
HETATM 9757  O  O    . HOH I 4 .   ? 66.231  1.795  48.455  1.00 25.60  ? 2493 HOH A O    1 
HETATM 9758  O  O    . HOH I 4 .   ? 69.414  24.781 14.097  1.00 25.41  ? 2494 HOH A O    1 
HETATM 9759  O  O    . HOH I 4 .   ? 76.897  2.020  29.911  1.00 22.50  ? 2495 HOH A O    1 
HETATM 9760  O  O    . HOH I 4 .   ? 83.481  18.731 39.344  1.00 29.21  ? 2496 HOH A O    1 
HETATM 9761  O  O    . HOH I 4 .   ? 69.283  21.244 52.547  1.00 25.75  ? 2497 HOH A O    1 
HETATM 9762  O  O    . HOH I 4 .   ? 71.801  39.855 47.751  1.00 25.94  ? 2498 HOH A O    1 
HETATM 9763  O  O    . HOH I 4 .   ? 74.120  11.499 19.866  1.00 22.44  ? 2499 HOH A O    1 
HETATM 9764  O  O    . HOH I 4 .   ? 65.389  30.304 14.870  0.50 19.58  ? 2500 HOH A O    1 
HETATM 9765  O  O    . HOH I 4 .   ? 63.073  34.177 19.019  1.00 20.74  ? 2501 HOH A O    1 
HETATM 9766  O  O    . HOH I 4 .   ? 87.252  37.639 33.649  1.00 32.69  ? 2502 HOH A O    1 
HETATM 9767  O  O    . HOH I 4 .   ? 89.276  5.746  25.423  1.00 46.18  ? 2503 HOH A O    1 
HETATM 9768  O  O    . HOH I 4 .   ? 74.926  5.843  47.756  1.00 25.89  ? 2504 HOH A O    1 
HETATM 9769  O  O    . HOH I 4 .   ? 86.910  33.144 30.185  1.00 25.87  ? 2505 HOH A O    1 
HETATM 9770  O  O    . HOH I 4 .   ? 51.991  28.511 15.990  1.00 18.53  ? 2506 HOH A O    1 
HETATM 9771  O  O    . HOH I 4 .   ? 85.320  35.286 28.462  1.00 29.47  ? 2507 HOH A O    1 
HETATM 9772  O  O    . HOH I 4 .   ? 60.397  14.624 48.721  1.00 23.93  ? 2508 HOH A O    1 
HETATM 9773  O  O    . HOH I 4 .   ? 54.783  33.810 20.222  1.00 26.68  ? 2509 HOH A O    1 
HETATM 9774  O  O    . HOH I 4 .   ? 76.376  22.007 51.826  1.00 37.43  ? 2510 HOH A O    1 
HETATM 9775  O  O    . HOH I 4 .   ? 62.417  10.563 51.271  1.00 30.89  ? 2511 HOH A O    1 
HETATM 9776  O  O    . HOH I 4 .   ? 58.117  42.161 44.324  1.00 23.55  ? 2512 HOH A O    1 
HETATM 9777  O  O    . HOH I 4 .   ? 45.972  24.592 44.462  1.00 31.67  ? 2513 HOH A O    1 
HETATM 9778  O  O    . HOH I 4 .   ? 60.447  22.213 53.663  1.00 24.48  ? 2514 HOH A O    1 
HETATM 9779  O  O    . HOH I 4 .   ? 59.952  18.652 20.202  1.00 25.23  ? 2515 HOH A O    1 
HETATM 9780  O  O    . HOH I 4 .   ? 66.839  40.239 45.853  1.00 26.11  ? 2516 HOH A O    1 
HETATM 9781  O  O    . HOH I 4 .   ? 86.497  22.323 23.267  1.00 38.62  ? 2517 HOH A O    1 
HETATM 9782  O  O    . HOH I 4 .   ? 45.711  26.391 35.003  0.33 10.91  ? 2518 HOH A O    1 
HETATM 9783  O  O    . HOH I 4 .   ? 67.674  9.192  21.797  1.00 18.60  ? 2519 HOH A O    1 
HETATM 9784  O  O    . HOH I 4 .   ? 81.915  6.952  16.583  1.00 26.55  ? 2520 HOH A O    1 
HETATM 9785  O  O    . HOH I 4 .   ? 48.422  23.870 49.972  1.00 22.99  ? 2521 HOH A O    1 
HETATM 9786  O  O    . HOH I 4 .   ? 87.163  6.798  17.076  1.00 25.93  ? 2522 HOH A O    1 
HETATM 9787  O  O    . HOH I 4 .   ? 60.064  64.856 41.981  1.00 19.75  ? 2523 HOH A O    1 
HETATM 9788  O  O    . HOH I 4 .   ? 82.739  0.870  25.541  1.00 29.00  ? 2524 HOH A O    1 
HETATM 9789  O  O    . HOH I 4 .   ? 74.390  -1.094 32.009  1.00 29.79  ? 2525 HOH A O    1 
HETATM 9790  O  O    . HOH I 4 .   ? 60.540  7.840  30.810  1.00 33.01  ? 2526 HOH A O    1 
HETATM 9791  O  O    . HOH I 4 .   ? 60.835  64.375 46.393  1.00 40.58  ? 2527 HOH A O    1 
HETATM 9792  O  O    . HOH I 4 .   ? 75.770  46.628 32.709  1.00 27.89  ? 2528 HOH A O    1 
HETATM 9793  O  O    . HOH I 4 .   ? 55.665  17.741 49.659  1.00 42.38  ? 2529 HOH A O    1 
HETATM 9794  O  O    . HOH I 4 .   ? 61.587  43.766 29.606  1.00 28.43  ? 2530 HOH A O    1 
HETATM 9795  O  O    . HOH I 4 .   ? 63.506  61.696 43.881  1.00 25.19  ? 2531 HOH A O    1 
HETATM 9796  O  O    . HOH I 4 .   ? 55.283  34.815 23.010  1.00 22.77  ? 2532 HOH A O    1 
HETATM 9797  O  O    . HOH I 4 .   ? 57.361  60.379 36.508  1.00 24.01  ? 2533 HOH A O    1 
HETATM 9798  O  O    . HOH I 4 .   ? 66.540  34.676 16.126  1.00 25.31  ? 2534 HOH A O    1 
HETATM 9799  O  O    . HOH I 4 .   ? 83.679  14.593 46.176  1.00 27.50  ? 2535 HOH A O    1 
HETATM 9800  O  O    . HOH I 4 .   ? 89.476  11.307 21.149  1.00 27.49  ? 2536 HOH A O    1 
HETATM 9801  O  O    . HOH I 4 .   ? 82.009  34.908 22.023  1.00 34.54  ? 2537 HOH A O    1 
HETATM 9802  O  O    . HOH I 4 .   ? 85.351  2.760  25.815  1.00 33.79  ? 2538 HOH A O    1 
HETATM 9803  O  O    . HOH I 4 .   ? 89.430  14.614 32.160  1.00 26.71  ? 2539 HOH A O    1 
HETATM 9804  O  O    . HOH I 4 .   ? 63.905  32.252 51.862  1.00 26.50  ? 2540 HOH A O    1 
HETATM 9805  O  O    . HOH I 4 .   ? 69.440  8.520  19.329  1.00 24.53  ? 2541 HOH A O    1 
HETATM 9806  O  O    . HOH I 4 .   ? 64.471  14.834 51.641  1.00 24.65  ? 2542 HOH A O    1 
HETATM 9807  O  O    . HOH I 4 .   ? 56.862  43.959 35.262  1.00 23.60  ? 2543 HOH A O    1 
HETATM 9808  O  O    . HOH I 4 .   ? 86.283  19.416 38.965  1.00 28.13  ? 2544 HOH A O    1 
HETATM 9809  O  O    . HOH I 4 .   ? 85.114  2.163  36.296  1.00 34.66  ? 2545 HOH A O    1 
HETATM 9810  O  O    . HOH I 4 .   ? 66.911  15.366 54.019  1.00 31.21  ? 2546 HOH A O    1 
HETATM 9811  O  O    . HOH I 4 .   ? 57.858  39.007 31.540  1.00 30.47  ? 2547 HOH A O    1 
HETATM 9812  O  O    . HOH I 4 .   ? 76.820  38.834 42.185  1.00 21.23  ? 2548 HOH A O    1 
HETATM 9813  O  O    . HOH I 4 .   ? 64.717  32.990 15.289  1.00 25.70  ? 2549 HOH A O    1 
HETATM 9814  O  O    . HOH I 4 .   ? 88.744  11.093 31.432  1.00 23.13  ? 2550 HOH A O    1 
HETATM 9815  O  O    . HOH I 4 .   ? 89.539  13.147 23.384  1.00 31.33  ? 2551 HOH A O    1 
HETATM 9816  O  O    . HOH I 4 .   ? 62.185  36.495 16.065  1.00 30.44  ? 2552 HOH A O    1 
HETATM 9817  O  O    . HOH I 4 .   ? 61.893  65.771 39.621  1.00 23.18  ? 2553 HOH A O    1 
HETATM 9818  O  O    . HOH I 4 .   ? 57.103  38.931 48.430  1.00 28.35  ? 2554 HOH A O    1 
HETATM 9819  O  O    . HOH I 4 .   ? 62.392  33.709 16.302  1.00 33.55  ? 2555 HOH A O    1 
HETATM 9820  O  O    . HOH I 4 .   ? 68.951  5.661  19.536  1.00 28.18  ? 2556 HOH A O    1 
HETATM 9821  O  O    . HOH I 4 .   ? 57.484  65.786 42.930  1.00 28.97  ? 2557 HOH A O    1 
HETATM 9822  O  O    . HOH I 4 .   ? 64.494  65.347 37.964  1.00 24.45  ? 2558 HOH A O    1 
HETATM 9823  O  O    . HOH I 4 .   ? 77.970  36.685 21.527  1.00 39.41  ? 2559 HOH A O    1 
HETATM 9824  O  O    . HOH I 4 .   ? 59.622  54.110 46.641  1.00 31.29  ? 2560 HOH A O    1 
HETATM 9825  O  O    . HOH I 4 .   ? 88.519  27.983 40.664  1.00 29.72  ? 2561 HOH A O    1 
HETATM 9826  O  O    . HOH I 4 .   ? 61.342  35.908 20.075  1.00 30.33  ? 2562 HOH A O    1 
HETATM 9827  O  O    . HOH I 4 .   ? 74.324  29.792 19.501  1.00 25.67  ? 2563 HOH A O    1 
HETATM 9828  O  O    . HOH I 4 .   ? 62.344  39.025 19.794  1.00 26.46  ? 2564 HOH A O    1 
HETATM 9829  O  O    . HOH I 4 .   ? 79.561  32.939 50.207  1.00 30.85  ? 2565 HOH A O    1 
HETATM 9830  O  O    . HOH I 4 .   ? 76.819  36.162 43.391  1.00 33.53  ? 2566 HOH A O    1 
HETATM 9831  O  O    . HOH I 4 .   ? 78.035  31.498 52.024  1.00 42.34  ? 2567 HOH A O    1 
HETATM 9832  O  O    . HOH I 4 .   ? 78.144  17.925 50.627  1.00 30.14  ? 2568 HOH A O    1 
HETATM 9833  O  O    . HOH I 4 .   ? 72.960  -0.198 38.034  1.00 39.27  ? 2569 HOH A O    1 
HETATM 9834  O  O    . HOH I 4 .   ? 89.002  22.765 29.608  1.00 29.87  ? 2570 HOH A O    1 
HETATM 9835  O  O    . HOH I 4 .   ? 78.800  -0.329 40.060  0.50 42.65  ? 2571 HOH A O    1 
HETATM 9836  O  O    . HOH I 4 .   ? 47.320  27.382 31.687  1.00 28.66  ? 2572 HOH A O    1 
HETATM 9837  O  O    . HOH I 4 .   ? 87.489  15.009 26.546  1.00 20.18  ? 2573 HOH A O    1 
HETATM 9838  O  O    . HOH I 4 .   ? 78.897  3.199  45.500  1.00 22.19  ? 2574 HOH A O    1 
HETATM 9839  O  O    . HOH I 4 .   ? 81.101  9.606  41.115  1.00 25.35  ? 2575 HOH A O    1 
HETATM 9840  O  O    . HOH I 4 .   ? 76.430  4.285  46.239  1.00 24.13  ? 2576 HOH A O    1 
HETATM 9841  O  O    . HOH I 4 .   ? 62.571  42.567 46.166  1.00 29.03  ? 2577 HOH A O    1 
HETATM 9842  O  O    . HOH I 4 .   ? 84.026  7.637  38.236  1.00 32.90  ? 2578 HOH A O    1 
HETATM 9843  O  O    . HOH I 4 .   ? 66.499  28.353 13.723  1.00 34.09  ? 2579 HOH A O    1 
HETATM 9844  O  O    . HOH I 4 .   ? 54.279  31.364 50.572  1.00 29.01  ? 2580 HOH A O    1 
HETATM 9845  O  O    . HOH I 4 .   ? 71.960  42.061 46.282  1.00 32.01  ? 2581 HOH A O    1 
HETATM 9846  O  O    . HOH J 4 .   ? 29.232  10.435 16.377  1.00 12.27  ? 1364 HOH B O    1 
HETATM 9847  O  O    . HOH J 4 .   ? 17.357  15.541 14.030  1.00 11.86  ? 1365 HOH B O    1 
HETATM 9848  O  O    . HOH J 4 .   ? -0.304  3.868  1.661   1.00 11.38  ? 1366 HOH B O    1 
HETATM 9849  O  O    . HOH J 4 .   ? 1.001   4.089  12.308  1.00 12.10  ? 1367 HOH B O    1 
HETATM 9850  O  O    . HOH J 4 .   ? -1.855  1.864  0.410   1.00 12.20  ? 1368 HOH B O    1 
HETATM 9851  O  O    . HOH J 4 .   ? 3.729   -1.928 9.766   1.00 10.72  ? 1369 HOH B O    1 
HETATM 9852  O  O    . HOH J 4 .   ? 11.218  8.584  -6.686  1.00 12.31  ? 1370 HOH B O    1 
HETATM 9853  O  O    . HOH J 4 .   ? 15.573  16.956 -13.478 1.00 15.16  ? 1371 HOH B O    1 
HETATM 9854  O  O    . HOH J 4 .   ? 1.731   2.238  2.525   1.00 12.97  ? 1372 HOH B O    1 
HETATM 9855  O  O    . HOH J 4 .   ? 11.420  1.012  -0.336  1.00 16.50  ? 1373 HOH B O    1 
HETATM 9856  O  O    . HOH J 4 .   ? 3.829   -1.125 6.418   1.00 12.49  ? 1374 HOH B O    1 
HETATM 9857  O  O    . HOH J 4 .   ? 34.383  35.891 -18.635 1.00 15.31  ? 1375 HOH B O    1 
HETATM 9858  O  O    . HOH J 4 .   ? 16.473  1.638  8.946   1.00 13.28  ? 1376 HOH B O    1 
HETATM 9859  O  O    . HOH J 4 .   ? 0.405   13.398 13.500  1.00 14.60  ? 1377 HOH B O    1 
HETATM 9860  O  O    . HOH J 4 .   ? 8.987   9.725  -8.014  1.00 15.04  ? 1378 HOH B O    1 
HETATM 9861  O  O    . HOH J 4 .   ? 9.119   21.536 -8.589  1.00 15.82  ? 1379 HOH B O    1 
HETATM 9862  O  O    . HOH J 4 .   ? -0.140  25.140 9.322   1.00 16.39  ? 1380 HOH B O    1 
HETATM 9863  O  O    . HOH J 4 .   ? 13.898  16.700 -11.145 1.00 14.11  ? 1381 HOH B O    1 
HETATM 9864  O  O    . HOH J 4 .   ? 17.431  -1.854 7.987   1.00 15.92  ? 1382 HOH B O    1 
HETATM 9865  O  O    . HOH J 4 .   ? 14.274  13.667 -8.569  1.00 12.86  ? 1383 HOH B O    1 
HETATM 9866  O  O    . HOH J 4 .   ? 15.030  18.266 -18.423 1.00 14.89  ? 1384 HOH B O    1 
HETATM 9867  O  O    . HOH J 4 .   ? 13.314  0.982  -2.324  1.00 15.44  ? 1385 HOH B O    1 
HETATM 9868  O  O    . HOH J 4 .   ? 16.299  26.279 14.681  1.00 17.26  ? 1386 HOH B O    1 
HETATM 9869  O  O    . HOH J 4 .   ? 2.656   14.303 17.779  1.00 13.79  ? 1387 HOH B O    1 
HETATM 9870  O  O    . HOH J 4 .   ? 25.332  21.821 -9.640  1.00 19.12  ? 1388 HOH B O    1 
HETATM 9871  O  O    . HOH J 4 .   ? -5.217  19.505 5.107   1.00 11.78  ? 1389 HOH B O    1 
HETATM 9872  O  O    . HOH J 4 .   ? 22.016  8.889  -3.683  1.00 16.75  ? 1390 HOH B O    1 
HETATM 9873  O  O    . HOH J 4 .   ? 7.188   15.209 -21.342 1.00 19.30  ? 1391 HOH B O    1 
HETATM 9874  O  O    . HOH J 4 .   ? 20.833  10.651 -0.833  1.00 13.87  ? 1392 HOH B O    1 
HETATM 9875  O  O    . HOH J 4 .   ? -4.717  3.236  -3.143  1.00 16.70  ? 1393 HOH B O    1 
HETATM 9876  O  O    . HOH J 4 .   ? 4.597   15.773 -22.400 1.00 25.70  ? 1394 HOH B O    1 
HETATM 9877  O  O    . HOH J 4 .   ? 25.994  16.122 -4.696  1.00 17.33  ? 1395 HOH B O    1 
HETATM 9878  O  O    . HOH J 4 .   ? -5.971  16.321 1.499   1.00 13.59  ? 1396 HOH B O    1 
HETATM 9879  O  O    . HOH J 4 .   ? 10.992  8.703  17.403  1.00 19.23  ? 1397 HOH B O    1 
HETATM 9880  O  O    . HOH J 4 .   ? -11.875 20.395 7.214   1.00 19.36  ? 1398 HOH B O    1 
HETATM 9881  O  O    . HOH J 4 .   ? 33.413  17.794 3.712   1.00 16.10  ? 1399 HOH B O    1 
HETATM 9882  O  O    . HOH J 4 .   ? 27.644  23.955 7.193   1.00 17.77  ? 1400 HOH B O    1 
HETATM 9883  O  O    . HOH J 4 .   ? 32.851  31.842 -20.031 1.00 24.99  ? 1401 HOH B O    1 
HETATM 9884  O  O    . HOH J 4 .   ? 18.831  27.525 -14.401 1.00 22.42  ? 1402 HOH B O    1 
HETATM 9885  O  O    . HOH J 4 .   ? 22.409  14.055 -8.937  1.00 19.05  ? 1403 HOH B O    1 
HETATM 9886  O  O    . HOH J 4 .   ? -9.213  21.440 7.079   1.00 17.66  ? 1404 HOH B O    1 
HETATM 9887  O  O    . HOH J 4 .   ? -1.294  17.079 13.123  1.00 16.13  ? 1405 HOH B O    1 
HETATM 9888  O  O    . HOH J 4 .   ? 18.635  29.548 12.860  1.00 22.80  ? 1406 HOH B O    1 
HETATM 9889  O  O    . HOH J 4 .   ? 9.811   28.388 1.480   1.00 17.04  ? 1407 HOH B O    1 
HETATM 9890  O  O    . HOH J 4 .   ? -3.753  5.713  -4.600  1.00 19.91  ? 1408 HOH B O    1 
HETATM 9891  O  O    . HOH J 4 .   ? 0.539   16.988 -20.185 1.00 25.58  ? 1409 HOH B O    1 
HETATM 9892  O  O    . HOH J 4 .   ? 1.049   7.413  -19.341 1.00 22.21  ? 1410 HOH B O    1 
HETATM 9893  O  O    . HOH J 4 .   ? -2.374  29.343 -10.854 1.00 22.03  ? 1411 HOH B O    1 
HETATM 9894  O  O    . HOH J 4 .   ? 20.268  27.206 -5.605  1.00 19.77  ? 1412 HOH B O    1 
HETATM 9895  O  O    . HOH J 4 .   ? -0.482  25.696 6.715   1.00 17.96  ? 1413 HOH B O    1 
HETATM 9896  O  O    . HOH J 4 .   ? 1.455   33.250 7.879   1.00 30.48  ? 1414 HOH B O    1 
HETATM 9897  O  O    . HOH J 4 .   ? -7.637  14.128 10.917  1.00 21.15  ? 1415 HOH B O    1 
HETATM 9898  O  O    . HOH J 4 .   ? 22.664  13.590 -2.048  1.00 19.33  ? 1416 HOH B O    1 
HETATM 9899  O  O    . HOH J 4 .   ? 22.100  19.539 17.142  1.00 19.03  ? 1417 HOH B O    1 
HETATM 9900  O  O    . HOH J 4 .   ? 19.905  4.006  0.720   1.00 14.98  ? 1418 HOH B O    1 
HETATM 9901  O  O    . HOH J 4 .   ? -11.922 24.443 5.749   1.00 28.49  ? 1419 HOH B O    1 
HETATM 9902  O  O    . HOH J 4 .   ? 24.974  19.934 -11.829 1.00 17.30  ? 1420 HOH B O    1 
HETATM 9903  O  O    . HOH J 4 .   ? 30.047  7.737  13.462  1.00 31.32  ? 1421 HOH B O    1 
HETATM 9904  O  O    . HOH J 4 .   ? -5.192  17.267 -1.545  1.00 27.45  ? 1422 HOH B O    1 
HETATM 9905  O  O    . HOH J 4 .   ? -15.320 19.405 1.263   1.00 24.46  ? 1423 HOH B O    1 
HETATM 9906  O  O    . HOH J 4 .   ? 31.133  27.546 1.026   1.00 32.01  ? 1424 HOH B O    1 
HETATM 9907  O  O    . HOH J 4 .   ? -2.034  18.751 -14.802 1.00 29.94  ? 1425 HOH B O    1 
HETATM 9908  O  O    . HOH J 4 .   ? 9.564   11.100 18.553  1.00 21.22  ? 1426 HOH B O    1 
HETATM 9909  O  O    . HOH J 4 .   ? 1.273   20.440 5.944   1.00 31.52  ? 1427 HOH B O    1 
HETATM 9910  O  O    . HOH J 4 .   ? 21.320  8.330  -6.550  1.00 32.01  ? 1428 HOH B O    1 
HETATM 9911  O  O    . HOH J 4 .   ? 17.835  28.057 10.516  1.00 71.70  ? 1429 HOH B O    1 
HETATM 9912  O  O    . HOH J 4 .   ? 30.732  23.855 -13.523 1.00 24.80  ? 1430 HOH B O    1 
HETATM 9913  O  O    . HOH J 4 .   ? 15.476  40.524 2.594   1.00 29.96  ? 1431 HOH B O    1 
HETATM 9914  O  O    . HOH J 4 .   ? 20.303  36.971 0.796   1.00 25.04  ? 1432 HOH B O    1 
HETATM 9915  O  O    . HOH J 4 .   ? 35.129  17.724 -5.292  1.00 31.07  ? 1433 HOH B O    1 
HETATM 9916  O  O    . HOH J 4 .   ? 13.147  10.463 -14.788 1.00 27.58  ? 1434 HOH B O    1 
HETATM 9917  O  O    . HOH J 4 .   ? 20.639  22.392 -15.794 1.00 19.59  ? 1435 HOH B O    1 
HETATM 9918  O  O    . HOH J 4 .   ? 33.495  12.604 11.439  1.00 17.32  ? 1436 HOH B O    1 
HETATM 9919  O  O    . HOH J 4 .   ? 16.232  1.995  -2.491  1.00 32.11  ? 1437 HOH B O    1 
HETATM 9920  O  O    . HOH J 4 .   ? 20.664  36.025 -10.806 1.00 30.63  ? 1438 HOH B O    1 
HETATM 9921  O  O    . HOH J 4 .   ? 4.998   -1.534 3.926   1.00 14.92  ? 1439 HOH B O    1 
HETATM 9922  O  O    . HOH J 4 .   ? -0.768  6.726  14.265  1.00 23.51  ? 1440 HOH B O    1 
HETATM 9923  O  O    . HOH J 4 .   ? 20.347  15.157 17.140  1.00 16.79  ? 1441 HOH B O    1 
HETATM 9924  O  O    . HOH J 4 .   ? 30.424  35.379 -16.285 1.00 31.68  ? 1442 HOH B O    1 
HETATM 9925  O  O    . HOH J 4 .   ? 13.586  18.844 17.409  1.00 22.29  ? 1443 HOH B O    1 
HETATM 9926  O  O    . HOH J 4 .   ? -3.848  29.705 4.879   1.00 25.59  ? 1444 HOH B O    1 
HETATM 9927  O  O    . HOH J 4 .   ? -2.360  12.441 -9.809  1.00 33.66  ? 1445 HOH B O    1 
HETATM 9928  O  O    . HOH J 4 .   ? -1.790  5.845  -2.461  1.00 11.26  ? 1446 HOH B O    1 
HETATM 9929  O  O    . HOH J 4 .   ? -2.232  3.051  -1.936  1.00 13.27  ? 1447 HOH B O    1 
HETATM 9930  O  O    . HOH J 4 .   ? 1.868   3.723  6.169   1.00 11.01  ? 1448 HOH B O    1 
HETATM 9931  O  O    . HOH J 4 .   ? 16.847  0.518  6.533   1.00 12.75  ? 1449 HOH B O    1 
HETATM 9932  O  O    . HOH J 4 .   ? -0.216  10.803 13.096  1.00 10.92  ? 1450 HOH B O    1 
HETATM 9933  O  O    . HOH J 4 .   ? -7.773  19.833 8.907   1.00 22.41  ? 1451 HOH B O    1 
HETATM 9934  O  O    . HOH J 4 .   ? -0.244  17.106 15.813  1.00 20.54  ? 1452 HOH B O    1 
HETATM 9935  O  O    . HOH J 4 .   ? 16.772  14.662 -8.701  1.00 18.60  ? 1453 HOH B O    1 
HETATM 9936  O  O    . HOH J 4 .   ? 0.323   19.212 -18.527 1.00 21.56  ? 1454 HOH B O    1 
HETATM 9937  O  O    . HOH J 4 .   ? -2.313  27.994 6.221   1.00 20.42  ? 1455 HOH B O    1 
HETATM 9938  O  O    . HOH J 4 .   ? 31.661  36.395 -18.904 1.00 21.93  ? 1456 HOH B O    1 
HETATM 9939  O  O    . HOH J 4 .   ? 3.182   16.913 18.441  1.00 24.67  ? 1457 HOH B O    1 
HETATM 9940  O  O    . HOH J 4 .   ? 10.290  32.517 15.296  1.00 25.98  ? 1458 HOH B O    1 
HETATM 9941  O  O    . HOH J 4 .   ? 21.009  7.288  14.164  1.00 27.99  ? 1459 HOH B O    1 
HETATM 9942  O  O    . HOH J 4 .   ? 22.393  16.766 17.836  1.00 25.41  ? 1460 HOH B O    1 
HETATM 9943  O  O    . HOH J 4 .   ? -5.776  18.433 7.390   1.00 16.14  ? 1461 HOH B O    1 
HETATM 9944  O  O    . HOH J 4 .   ? 18.617  24.688 14.916  1.00 21.51  ? 1462 HOH B O    1 
HETATM 9945  O  O    . HOH J 4 .   ? -13.545 22.712 7.008   1.00 18.99  ? 1463 HOH B O    1 
HETATM 9946  O  O    . HOH J 4 .   ? 0.763   27.907 10.046  1.00 31.61  ? 1464 HOH B O    1 
HETATM 9947  O  O    . HOH J 4 .   ? 1.911   13.200 20.184  1.00 34.11  ? 1465 HOH B O    1 
HETATM 9948  O  O    . HOH J 4 .   ? 27.969  26.301 5.334   1.00 26.19  ? 1466 HOH B O    1 
HETATM 9949  O  O    . HOH J 4 .   ? 25.373  20.193 -14.396 1.00 28.62  ? 1467 HOH B O    1 
HETATM 9950  O  O    . HOH J 4 .   ? 6.547   35.663 9.911   1.00 35.03  ? 1468 HOH B O    1 
HETATM 9951  O  O    . HOH J 4 .   ? 20.983  9.483  12.693  1.00 22.10  ? 1469 HOH B O    1 
HETATM 9952  O  O    . HOH J 4 .   ? 0.280   19.668 -16.018 1.00 22.59  ? 1470 HOH B O    1 
HETATM 9953  O  O    . HOH J 4 .   ? 2.655   17.659 -21.734 1.00 30.50  ? 1471 HOH B O    1 
HETATM 9954  O  O    . HOH J 4 .   ? 35.706  16.663 4.433   1.00 24.18  ? 1472 HOH B O    1 
HETATM 9955  O  O    . HOH J 4 .   ? -0.608  10.390 -22.168 1.00 27.65  ? 1473 HOH B O    1 
HETATM 9956  O  O    . HOH J 4 .   ? 26.253  34.388 -4.789  1.00 24.46  ? 1474 HOH B O    1 
HETATM 9957  O  O    . HOH J 4 .   ? 5.149   9.911  -25.600 1.00 32.24  ? 1475 HOH B O    1 
HETATM 9958  O  O    . HOH J 4 .   ? 16.874  7.623  -10.445 1.00 27.59  ? 1476 HOH B O    1 
HETATM 9959  O  O    . HOH J 4 .   ? 7.275   2.225  -8.518  1.00 37.06  ? 1477 HOH B O    1 
HETATM 9960  O  O    . HOH J 4 .   ? 27.268  12.388 -5.069  1.00 18.48  ? 1478 HOH B O    1 
HETATM 9961  O  O    . HOH J 4 .   ? -2.386  20.036 16.303  1.00 29.99  ? 1479 HOH B O    1 
HETATM 9962  O  O    . HOH J 4 .   ? 20.522  11.953 -10.160 1.00 29.89  ? 1480 HOH B O    1 
HETATM 9963  O  O    . HOH J 4 .   ? 24.371  23.168 16.581  1.00 28.14  ? 1481 HOH B O    1 
HETATM 9964  O  O    . HOH J 4 .   ? 6.175   29.422 17.004  1.00 35.90  ? 1482 HOH B O    1 
HETATM 9965  O  O    . HOH J 4 .   ? -3.623  12.966 -12.480 1.00 28.42  ? 1483 HOH B O    1 
HETATM 9966  O  O    . HOH J 4 .   ? -9.015  23.716 -3.243  1.00 21.08  ? 1484 HOH B O    1 
HETATM 9967  O  O    . HOH J 4 .   ? 35.861  27.690 -9.067  1.00 37.69  ? 1485 HOH B O    1 
HETATM 9968  O  O    . HOH J 4 .   ? -3.412  9.970  -14.561 1.00 25.62  ? 1486 HOH B O    1 
HETATM 9969  O  O    . HOH J 4 .   ? 17.387  39.217 3.703   1.00 28.37  ? 1487 HOH B O    1 
HETATM 9970  O  O    . HOH J 4 .   ? 37.034  15.914 -1.688  1.00 30.23  ? 1488 HOH B O    1 
HETATM 9971  O  O    . HOH J 4 .   ? -6.667  13.585 -4.009  1.00 26.54  ? 1489 HOH B O    1 
HETATM 9972  O  O    . HOH J 4 .   ? 24.785  15.755 17.174  1.00 22.60  ? 1490 HOH B O    1 
HETATM 9973  O  O    . HOH J 4 .   ? 9.909   7.980  -14.058 1.00 29.66  ? 1491 HOH B O    1 
HETATM 9974  O  O    . HOH J 4 .   ? 24.394  35.270 -20.592 1.00 31.07  ? 1492 HOH B O    1 
HETATM 9975  O  O    . HOH J 4 .   ? 17.466  15.665 -11.165 1.00 22.43  ? 1493 HOH B O    1 
HETATM 9976  O  O    . HOH J 4 .   ? 11.300  19.464 20.252  1.00 30.88  ? 1494 HOH B O    1 
HETATM 9977  O  O    . HOH J 4 .   ? 3.870   1.564  6.321   1.00 20.74  ? 1495 HOH B O    1 
HETATM 9978  O  O    . HOH J 4 .   ? 16.714  8.379  13.635  1.00 19.60  ? 1496 HOH B O    1 
HETATM 9979  O  O    . HOH J 4 .   ? -19.844 25.563 3.222   1.00 23.78  ? 1497 HOH B O    1 
HETATM 9980  O  O    . HOH J 4 .   ? 14.722  2.609  -8.371  1.00 22.70  ? 1498 HOH B O    1 
HETATM 9981  O  O    . HOH J 4 .   ? 35.433  10.911 8.913   1.00 25.31  ? 1499 HOH B O    1 
HETATM 9982  O  O    . HOH J 4 .   ? 36.106  14.426 6.462   1.00 27.00  ? 1500 HOH B O    1 
HETATM 9983  O  O    . HOH J 4 .   ? -6.513  12.279 -11.316 1.00 32.63  ? 1501 HOH B O    1 
HETATM 9984  O  O    . HOH J 4 .   ? 1.959   18.607 16.531  1.00 22.69  ? 1502 HOH B O    1 
HETATM 9985  O  O    . HOH J 4 .   ? 21.688  31.319 -13.397 1.00 24.26  ? 1503 HOH B O    1 
HETATM 9986  O  O    . HOH J 4 .   ? 4.874   13.974 -24.519 1.00 30.23  ? 1504 HOH B O    1 
HETATM 9987  O  O    . HOH J 4 .   ? -9.233  17.589 9.739   1.00 31.27  ? 1505 HOH B O    1 
HETATM 9988  O  O    . HOH J 4 .   ? 29.821  8.234  -0.451  1.00 21.20  ? 1506 HOH B O    1 
HETATM 9989  O  O    . HOH J 4 .   ? 6.492   30.672 -18.491 1.00 31.01  ? 1507 HOH B O    1 
HETATM 9990  O  O    . HOH J 4 .   ? -2.791  13.801 -19.509 1.00 35.19  ? 1508 HOH B O    1 
HETATM 9991  O  O    . HOH J 4 .   ? -9.624  23.962 7.808   1.00 26.81  ? 1509 HOH B O    1 
HETATM 9992  O  O    . HOH J 4 .   ? -9.363  21.579 -4.904  1.00 33.03  ? 1510 HOH B O    1 
HETATM 9993  O  O    . HOH J 4 .   ? -11.635 23.445 -2.496  1.00 22.19  ? 1511 HOH B O    1 
HETATM 9994  O  O    . HOH J 4 .   ? 19.921  32.585 7.458   1.00 28.93  ? 1512 HOH B O    1 
HETATM 9995  O  O    . HOH J 4 .   ? -21.972 24.553 5.105   1.00 19.19  ? 1513 HOH B O    1 
HETATM 9996  O  O    . HOH J 4 .   ? 34.017  11.323 4.616   1.00 27.87  ? 1514 HOH B O    1 
HETATM 9997  O  O    . HOH J 4 .   ? 36.352  9.440  6.185   1.00 29.51  ? 1515 HOH B O    1 
HETATM 9998  O  O    . HOH J 4 .   ? 27.238  34.112 -7.731  1.00 32.04  ? 1516 HOH B O    1 
HETATM 9999  O  O    . HOH J 4 .   ? 22.632  34.947 -11.308 1.00 25.41  ? 1517 HOH B O    1 
HETATM 10000 O  O    . HOH J 4 .   ? -8.055  21.190 11.202  1.00 23.93  ? 1518 HOH B O    1 
HETATM 10001 O  O    . HOH J 4 .   ? -4.717  17.914 -7.966  1.00 42.22  ? 1519 HOH B O    1 
HETATM 10002 O  O    . HOH J 4 .   ? -1.535  28.786 13.059  1.00 24.71  ? 1520 HOH B O    1 
HETATM 10003 O  O    . HOH J 4 .   ? 33.942  10.805 1.455   1.00 35.19  ? 1521 HOH B O    1 
HETATM 10004 O  O    . HOH J 4 .   ? 22.071  32.181 -10.796 1.00 23.24  ? 1522 HOH B O    1 
HETATM 10005 O  O    . HOH J 4 .   ? 0.000   0.000  -0.334  0.33 12.30  ? 1523 HOH B O    1 
HETATM 10006 O  O    . HOH J 4 .   ? 9.187   8.084  -16.398 1.00 29.84  ? 1524 HOH B O    1 
HETATM 10007 O  O    . HOH J 4 .   ? 12.087  11.509 19.735  1.00 23.97  ? 1525 HOH B O    1 
HETATM 10008 O  O    . HOH J 4 .   ? -6.873  15.678 -1.002  1.00 27.17  ? 1526 HOH B O    1 
HETATM 10009 O  O    . HOH J 4 .   ? 10.688  22.105 20.258  1.00 25.76  ? 1527 HOH B O    1 
HETATM 10010 O  O    . HOH J 4 .   ? 29.824  25.705 6.745   1.00 29.70  ? 1528 HOH B O    1 
HETATM 10011 O  O    . HOH J 4 .   ? 12.696  23.829 20.267  1.00 30.64  ? 1529 HOH B O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
621  S  SG . CYS A 45  ? 0.2680 0.2296 0.2521 -0.0188 -0.0258 0.0087  45   CYS A SG 
2479 S  SG . CYS A 168 ? 0.3751 0.3010 0.1967 -0.0673 -0.1349 0.0098  168  CYS A SG 
2996 S  SD . MET A 200 ? 0.1231 0.1464 0.0874 0.0011  -0.0196 0.0167  200  MET A SD 
3184 S  SD . MET A 212 ? 0.2075 0.1751 0.0672 -0.0037 -0.0004 0.0083  212  MET A SD 
4181 S  SD . MET A 276 ? 0.2286 0.2796 0.1924 0.0065  -0.0249 0.0077  276  MET A SD 
4583 S  SG . CYS A 303 ? 0.1388 0.1759 0.1446 -0.0023 0.0103  -0.0179 303  CYS A SG 
5457 S  SG . CYS B 45  ? 0.3570 0.2436 0.3123 0.0631  0.0245  0.0427  45   CYS B SG 
7306 S  SG . CYS B 168 ? 0.3942 0.3436 0.2283 0.0192  -0.0349 -0.0406 168  CYS B SG 
7823 S  SD . MET B 200 ? 0.1890 0.1696 0.0728 -0.0367 -0.0119 -0.0084 200  MET B SD 
8011 S  SD . MET B 212 ? 0.1788 0.1712 0.0696 -0.0164 0.0122  0.0096  212  MET B SD 
9006 S  SD . MET B 276 ? 0.4600 0.3438 0.2343 -0.0848 -0.0862 0.0265  276  MET B SD 
9408 S  SG . CYS B 303 ? 0.1766 0.1879 0.1554 -0.0101 0.0307  0.0209  303  CYS B SG 
9568 MN MN . MN  C .   ? 0.1200 0.1293 0.0430 -0.0022 -0.0024 -0.0120 2362 MN  A MN 
9569 MN MN . MN  D .   ? 0.1143 0.1423 0.0437 -0.0064 0.0017  -0.0116 2363 MN  A MN 
9598 MN MN . MN  F .   ? 0.1513 0.1894 0.0605 -0.0206 0.0167  0.0056  1362 MN  B MN 
9599 MN MN . MN  G .   ? 0.1695 0.2013 0.0539 -0.0298 0.0145  0.0150  1363 MN  B MN 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   SER 2   2   ?   ?   ?   A . n 
A 1 3   ALA 3   3   ?   ?   ?   A . n 
A 1 4   LYS 4   4   ?   ?   ?   A . n 
A 1 5   SER 5   5   5   SER SER A . n 
A 1 6   ARG 6   6   6   ARG ARG A . n 
A 1 7   THR 7   7   7   THR THR A . n 
A 1 8   ILE 8   8   8   ILE ILE A . n 
A 1 9   GLY 9   9   9   GLY GLY A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ILE 11  11  11  ILE ILE A . n 
A 1 12  GLY 12  12  12  GLY GLY A . n 
A 1 13  ALA 13  13  13  ALA ALA A . n 
A 1 14  PRO 14  14  14  PRO PRO A . n 
A 1 15  PHE 15  15  15  PHE PHE A . n 
A 1 16  SER 16  16  16  SER SER A . n 
A 1 17  LYS 17  17  17  LYS LYS A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  GLN 19  19  19  GLN GLN A . n 
A 1 20  PRO 20  20  20  PRO PRO A . n 
A 1 21  ARG 21  21  21  ARG ARG A . n 
A 1 22  GLY 22  22  22  GLY GLY A . n 
A 1 23  GLY 23  23  23  GLY GLY A . n 
A 1 24  VAL 24  24  24  VAL VAL A . n 
A 1 25  GLU 25  25  25  GLU GLU A . n 
A 1 26  GLU 26  26  26  GLU GLU A . n 
A 1 27  GLY 27  27  27  GLY GLY A . n 
A 1 28  PRO 28  28  28  PRO PRO A . n 
A 1 29  THR 29  29  29  THR THR A . n 
A 1 30  VAL 30  30  30  VAL VAL A . n 
A 1 31  LEU 31  31  31  LEU LEU A . n 
A 1 32  ARG 32  32  32  ARG ARG A . n 
A 1 33  LYS 33  33  33  LYS LYS A . n 
A 1 34  ALA 34  34  34  ALA ALA A . n 
A 1 35  GLY 35  35  35  GLY GLY A . n 
A 1 36  LEU 36  36  36  LEU LEU A . n 
A 1 37  LEU 37  37  37  LEU LEU A . n 
A 1 38  GLU 38  38  38  GLU GLU A . n 
A 1 39  LYS 39  39  39  LYS LYS A . n 
A 1 40  LEU 40  40  40  LEU LEU A . n 
A 1 41  LYS 41  41  41  LYS LYS A . n 
A 1 42  GLU 42  42  42  GLU GLU A . n 
A 1 43  GLN 43  43  43  GLN GLN A . n 
A 1 44  GLU 44  44  44  GLU GLU A . n 
A 1 45  CYS 45  45  45  CYS CYS A . n 
A 1 46  ASP 46  46  46  ASP ASP A . n 
A 1 47  VAL 47  47  47  VAL VAL A . n 
A 1 48  LYS 48  48  48  LYS LYS A . n 
A 1 49  ASP 49  49  49  ASP ASP A . n 
A 1 50  TYR 50  50  50  TYR TYR A . n 
A 1 51  GLY 51  51  51  GLY GLY A . n 
A 1 52  ASP 52  52  52  ASP ASP A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  PRO 54  54  54  PRO PRO A . n 
A 1 55  PHE 55  55  55  PHE PHE A . n 
A 1 56  ALA 56  56  56  ALA ALA A . n 
A 1 57  ASP 57  57  57  ASP ASP A . n 
A 1 58  ILE 58  58  58  ILE ILE A . n 
A 1 59  PRO 59  59  59  PRO PRO A . n 
A 1 60  ASN 60  60  60  ASN ASN A . n 
A 1 61  ASP 61  61  61  ASP ASP A . n 
A 1 62  SER 62  62  62  SER SER A . n 
A 1 63  PRO 63  63  63  PRO PRO A . n 
A 1 64  PHE 64  64  64  PHE PHE A . n 
A 1 65  GLN 65  65  65  GLN GLN A . n 
A 1 66  ILE 66  66  66  ILE ILE A . n 
A 1 67  VAL 67  67  67  VAL VAL A . n 
A 1 68  LYS 68  68  68  LYS LYS A . n 
A 1 69  ASN 69  69  69  ASN ASN A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  ARG 71  71  71  ARG ARG A . n 
A 1 72  SER 72  72  72  SER SER A . n 
A 1 73  VAL 73  73  73  VAL VAL A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  LYS 75  75  75  LYS LYS A . n 
A 1 76  ALA 76  76  76  ALA ALA A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  GLU 78  78  78  GLU GLU A . n 
A 1 79  GLN 79  79  79  GLN GLN A . n 
A 1 80  LEU 80  80  80  LEU LEU A . n 
A 1 81  ALA 81  81  81  ALA ALA A . n 
A 1 82  GLY 82  82  82  GLY GLY A . n 
A 1 83  LYS 83  83  83  LYS LYS A . n 
A 1 84  VAL 84  84  84  VAL VAL A . n 
A 1 85  ALA 85  85  85  ALA ALA A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  VAL 87  87  87  VAL VAL A . n 
A 1 88  LYS 88  88  88  LYS LYS A . n 
A 1 89  LYS 89  89  89  LYS LYS A . n 
A 1 90  ASN 90  90  90  ASN ASN A . n 
A 1 91  GLY 91  91  91  GLY GLY A . n 
A 1 92  ARG 92  92  92  ARG ARG A . n 
A 1 93  ILE 93  93  93  ILE ILE A . n 
A 1 94  SER 94  94  94  SER SER A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  VAL 96  96  96  VAL VAL A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  GLY 98  98  98  GLY GLY A . n 
A 1 99  GLY 99  99  99  GLY GLY A . n 
A 1 100 ASP 100 100 100 ASP ASP A . n 
A 1 101 HIS 101 101 101 HIS HIS A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 LEU 103 103 103 LEU LEU A . n 
A 1 104 ALA 104 104 104 ALA ALA A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 GLY 106 106 106 GLY GLY A . n 
A 1 107 SER 107 107 107 SER SER A . n 
A 1 108 ILE 108 108 108 ILE ILE A . n 
A 1 109 SER 109 109 109 SER SER A . n 
A 1 110 GLY 110 110 110 GLY GLY A . n 
A 1 111 HIS 111 111 111 HIS HIS A . n 
A 1 112 ALA 112 112 112 ALA ALA A . n 
A 1 113 ARG 113 113 113 ARG ARG A . n 
A 1 114 VAL 114 114 114 VAL VAL A . n 
A 1 115 HIS 115 115 115 HIS HIS A . n 
A 1 116 PRO 116 116 116 PRO PRO A . n 
A 1 117 ASP 117 117 117 ASP ASP A . n 
A 1 118 LEU 118 118 118 LEU LEU A . n 
A 1 119 GLY 119 119 119 GLY GLY A . n 
A 1 120 VAL 120 120 120 VAL VAL A . n 
A 1 121 ILE 121 121 121 ILE ILE A . n 
A 1 122 TRP 122 122 122 TRP TRP A . n 
A 1 123 VAL 123 123 123 VAL VAL A . n 
A 1 124 ASP 124 124 124 ASP ASP A . n 
A 1 125 ALA 125 125 125 ALA ALA A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 THR 127 127 127 THR THR A . n 
A 1 128 ASP 128 128 128 ASP ASP A . n 
A 1 129 ILE 129 129 129 ILE ILE A . n 
A 1 130 ASN 130 130 130 ASN ASN A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 PRO 132 132 132 PRO PRO A . n 
A 1 133 LEU 133 133 133 LEU LEU A . n 
A 1 134 THR 134 134 134 THR THR A . n 
A 1 135 THR 135 135 135 THR THR A . n 
A 1 136 THR 136 136 136 THR THR A . n 
A 1 137 SER 137 137 137 SER SER A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ASN 139 139 139 ASN ASN A . n 
A 1 140 LEU 140 140 140 LEU LEU A . n 
A 1 141 HIS 141 141 141 HIS HIS A . n 
A 1 142 GLY 142 142 142 GLY GLY A . n 
A 1 143 GLN 143 143 143 GLN GLN A . n 
A 1 144 PRO 144 144 144 PRO PRO A . n 
A 1 145 VAL 145 145 145 VAL VAL A . n 
A 1 146 SER 146 146 146 SER SER A . n 
A 1 147 PHE 147 147 147 PHE PHE A . n 
A 1 148 LEU 148 148 148 LEU LEU A . n 
A 1 149 LEU 149 149 149 LEU LEU A . n 
A 1 150 LYS 150 150 150 LYS LYS A . n 
A 1 151 GLU 151 151 151 GLU GLU A . n 
A 1 152 LEU 152 152 152 LEU LEU A . n 
A 1 153 LYS 153 153 153 LYS LYS A . n 
A 1 154 GLY 154 154 154 GLY GLY A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 PRO 157 157 157 PRO PRO A . n 
A 1 158 ASP 158 158 158 ASP ASP A . n 
A 1 159 VAL 159 159 159 VAL VAL A . n 
A 1 160 PRO 160 160 160 PRO PRO A . n 
A 1 161 GLY 161 161 161 GLY GLY A . n 
A 1 162 PHE 162 162 162 PHE PHE A . n 
A 1 163 SER 163 163 163 SER SER A . n 
A 1 164 TRP 164 164 164 TRP TRP A . n 
A 1 165 VAL 165 165 165 VAL VAL A . n 
A 1 166 THR 166 166 166 THR THR A . n 
A 1 167 PRO 167 167 167 PRO PRO A . n 
A 1 168 CYS 168 168 168 CYS CYS A . n 
A 1 169 ILE 169 169 169 ILE ILE A . n 
A 1 170 SER 170 170 170 SER SER A . n 
A 1 171 ALA 171 171 171 ALA ALA A . n 
A 1 172 LYS 172 172 172 LYS LYS A . n 
A 1 173 ASP 173 173 173 ASP ASP A . n 
A 1 174 ILE 174 174 174 ILE ILE A . n 
A 1 175 VAL 175 175 175 VAL VAL A . n 
A 1 176 TYR 176 176 176 TYR TYR A . n 
A 1 177 ILE 177 177 177 ILE ILE A . n 
A 1 178 GLY 178 178 178 GLY GLY A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ARG 180 180 180 ARG ARG A . n 
A 1 181 ASP 181 181 181 ASP ASP A . n 
A 1 182 VAL 182 182 182 VAL VAL A . n 
A 1 183 ASP 183 183 183 ASP ASP A . n 
A 1 184 PRO 184 184 184 PRO PRO A . n 
A 1 185 GLY 185 185 185 GLY GLY A . n 
A 1 186 GLU 186 186 186 GLU GLU A . n 
A 1 187 HIS 187 187 187 HIS HIS A . n 
A 1 188 TYR 188 188 188 TYR TYR A . n 
A 1 189 ILE 189 189 189 ILE ILE A . n 
A 1 190 LEU 190 190 190 LEU LEU A . n 
A 1 191 LYS 191 191 191 LYS LYS A . n 
A 1 192 THR 192 192 192 THR THR A . n 
A 1 193 LEU 193 193 193 LEU LEU A . n 
A 1 194 GLY 194 194 194 GLY GLY A . n 
A 1 195 ILE 195 195 195 ILE ILE A . n 
A 1 196 LYS 196 196 196 LYS LYS A . n 
A 1 197 TYR 197 197 197 TYR TYR A . n 
A 1 198 PHE 198 198 198 PHE PHE A . n 
A 1 199 SER 199 199 199 SER SER A . n 
A 1 200 MET 200 200 200 MET MET A . n 
A 1 201 THR 201 201 201 THR THR A . n 
A 1 202 GLU 202 202 202 GLU GLU A . n 
A 1 203 VAL 203 203 203 VAL VAL A . n 
A 1 204 ASP 204 204 204 ASP ASP A . n 
A 1 205 ARG 205 205 205 ARG ARG A . n 
A 1 206 LEU 206 206 206 LEU LEU A . n 
A 1 207 GLY 207 207 207 GLY GLY A . n 
A 1 208 ILE 208 208 208 ILE ILE A . n 
A 1 209 GLY 209 209 209 GLY GLY A . n 
A 1 210 LYS 210 210 210 LYS LYS A . n 
A 1 211 VAL 211 211 211 VAL VAL A . n 
A 1 212 MET 212 212 212 MET MET A . n 
A 1 213 GLU 213 213 213 GLU GLU A . n 
A 1 214 GLU 214 214 214 GLU GLU A . n 
A 1 215 THR 215 215 215 THR THR A . n 
A 1 216 LEU 216 216 216 LEU LEU A . n 
A 1 217 SER 217 217 217 SER SER A . n 
A 1 218 TYR 218 218 218 TYR TYR A . n 
A 1 219 LEU 219 219 219 LEU LEU A . n 
A 1 220 LEU 220 220 220 LEU LEU A . n 
A 1 221 GLY 221 221 221 GLY GLY A . n 
A 1 222 ARG 222 222 222 ARG ARG A . n 
A 1 223 LYS 223 223 223 LYS LYS A . n 
A 1 224 LYS 224 224 224 LYS LYS A . n 
A 1 225 ARG 225 225 225 ARG ARG A . n 
A 1 226 PRO 226 226 226 PRO PRO A . n 
A 1 227 ILE 227 227 227 ILE ILE A . n 
A 1 228 HIS 228 228 228 HIS HIS A . n 
A 1 229 LEU 229 229 229 LEU LEU A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 PHE 231 231 231 PHE PHE A . n 
A 1 232 ASP 232 232 232 ASP ASP A . n 
A 1 233 VAL 233 233 233 VAL VAL A . n 
A 1 234 ASP 234 234 234 ASP ASP A . n 
A 1 235 GLY 235 235 235 GLY GLY A . n 
A 1 236 LEU 236 236 236 LEU LEU A . n 
A 1 237 ASP 237 237 237 ASP ASP A . n 
A 1 238 PRO 238 238 238 PRO PRO A . n 
A 1 239 SER 239 239 239 SER SER A . n 
A 1 240 PHE 240 240 240 PHE PHE A . n 
A 1 241 THR 241 241 241 THR THR A . n 
A 1 242 PRO 242 242 242 PRO PRO A . n 
A 1 243 ALA 243 243 243 ALA ALA A . n 
A 1 244 THR 244 244 244 THR THR A . n 
A 1 245 GLY 245 245 245 GLY GLY A . n 
A 1 246 THR 246 246 246 THR THR A . n 
A 1 247 PRO 247 247 247 PRO PRO A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 VAL 249 249 249 VAL VAL A . n 
A 1 250 GLY 250 250 250 GLY GLY A . n 
A 1 251 GLY 251 251 251 GLY GLY A . n 
A 1 252 LEU 252 252 252 LEU LEU A . n 
A 1 253 THR 253 253 253 THR THR A . n 
A 1 254 TYR 254 254 254 TYR TYR A . n 
A 1 255 ARG 255 255 255 ARG ARG A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 GLY 257 257 257 GLY GLY A . n 
A 1 258 LEU 258 258 258 LEU LEU A . n 
A 1 259 TYR 259 259 259 TYR TYR A . n 
A 1 260 ILE 260 260 260 ILE ILE A . n 
A 1 261 THR 261 261 261 THR THR A . n 
A 1 262 GLU 262 262 262 GLU GLU A . n 
A 1 263 GLU 263 263 263 GLU GLU A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 TYR 265 265 265 TYR TYR A . n 
A 1 266 LYS 266 266 266 LYS LYS A . n 
A 1 267 THR 267 267 267 THR THR A . n 
A 1 268 GLY 268 268 268 GLY GLY A . n 
A 1 269 LEU 269 269 269 LEU LEU A . n 
A 1 270 LEU 270 270 270 LEU LEU A . n 
A 1 271 SER 271 271 271 SER SER A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 LEU 273 273 273 LEU LEU A . n 
A 1 274 ASP 274 274 274 ASP ASP A . n 
A 1 275 ILE 275 275 275 ILE ILE A . n 
A 1 276 MET 276 276 276 MET MET A . n 
A 1 277 GLU 277 277 277 GLU GLU A . n 
A 1 278 VAL 278 278 278 VAL VAL A . n 
A 1 279 ASN 279 279 279 ASN ASN A . n 
A 1 280 PRO 280 280 280 PRO PRO A . n 
A 1 281 SER 281 281 281 SER SER A . n 
A 1 282 LEU 282 282 282 LEU LEU A . n 
A 1 283 GLY 283 283 283 GLY GLY A . n 
A 1 284 LYS 284 284 284 LYS LYS A . n 
A 1 285 THR 285 285 285 THR THR A . n 
A 1 286 PRO 286 286 286 PRO PRO A . n 
A 1 287 GLU 287 287 287 GLU GLU A . n 
A 1 288 GLU 288 288 288 GLU GLU A . n 
A 1 289 VAL 289 289 289 VAL VAL A . n 
A 1 290 THR 290 290 290 THR THR A . n 
A 1 291 ARG 291 291 291 ARG ARG A . n 
A 1 292 THR 292 292 292 THR THR A . n 
A 1 293 VAL 293 293 293 VAL VAL A . n 
A 1 294 ASN 294 294 294 ASN ASN A . n 
A 1 295 THR 295 295 295 THR THR A . n 
A 1 296 ALA 296 296 296 ALA ALA A . n 
A 1 297 VAL 297 297 297 VAL VAL A . n 
A 1 298 ALA 298 298 298 ALA ALA A . n 
A 1 299 ILE 299 299 299 ILE ILE A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 LEU 301 301 301 LEU LEU A . n 
A 1 302 ALA 302 302 302 ALA ALA A . n 
A 1 303 CYS 303 303 303 CYS CYS A . n 
A 1 304 PHE 304 304 304 PHE PHE A . n 
A 1 305 GLY 305 305 305 GLY GLY A . n 
A 1 306 LEU 306 306 306 LEU LEU A . n 
A 1 307 ALA 307 307 307 ALA ALA A . n 
A 1 308 ARG 308 308 308 ARG ARG A . n 
A 1 309 GLU 309 309 309 GLU GLU A . n 
A 1 310 GLY 310 310 310 GLY GLY A . n 
A 1 311 ASN 311 311 311 ASN ASN A . n 
A 1 312 HIS 312 312 312 HIS HIS A . n 
A 1 313 LYS 313 313 313 LYS LYS A . n 
A 1 314 PRO 314 314 314 PRO PRO A . n 
A 1 315 ILE 315 315 315 ILE ILE A . n 
A 1 316 ASP 316 316 316 ASP ASP A . n 
A 1 317 TYR 317 317 317 TYR TYR A . n 
A 1 318 LEU 318 318 318 LEU LEU A . n 
A 1 319 ASN 319 319 ?   ?   ?   A . n 
A 1 320 PRO 320 320 ?   ?   ?   A . n 
A 1 321 PRO 321 321 ?   ?   ?   A . n 
A 1 322 LYS 322 322 ?   ?   ?   A . n 
B 1 1   MET 1   1   ?   ?   ?   B . n 
B 1 2   SER 2   2   ?   ?   ?   B . n 
B 1 3   ALA 3   3   ?   ?   ?   B . n 
B 1 4   LYS 4   4   ?   ?   ?   B . n 
B 1 5   SER 5   5   5   SER SER B . n 
B 1 6   ARG 6   6   6   ARG ARG B . n 
B 1 7   THR 7   7   7   THR THR B . n 
B 1 8   ILE 8   8   8   ILE ILE B . n 
B 1 9   GLY 9   9   9   GLY GLY B . n 
B 1 10  ILE 10  10  10  ILE ILE B . n 
B 1 11  ILE 11  11  11  ILE ILE B . n 
B 1 12  GLY 12  12  12  GLY GLY B . n 
B 1 13  ALA 13  13  13  ALA ALA B . n 
B 1 14  PRO 14  14  14  PRO PRO B . n 
B 1 15  PHE 15  15  15  PHE PHE B . n 
B 1 16  SER 16  16  16  SER SER B . n 
B 1 17  LYS 17  17  17  LYS LYS B . n 
B 1 18  GLY 18  18  18  GLY GLY B . n 
B 1 19  GLN 19  19  19  GLN GLN B . n 
B 1 20  PRO 20  20  20  PRO PRO B . n 
B 1 21  ARG 21  21  21  ARG ARG B . n 
B 1 22  GLY 22  22  22  GLY GLY B . n 
B 1 23  GLY 23  23  23  GLY GLY B . n 
B 1 24  VAL 24  24  24  VAL VAL B . n 
B 1 25  GLU 25  25  25  GLU GLU B . n 
B 1 26  GLU 26  26  26  GLU GLU B . n 
B 1 27  GLY 27  27  27  GLY GLY B . n 
B 1 28  PRO 28  28  28  PRO PRO B . n 
B 1 29  THR 29  29  29  THR THR B . n 
B 1 30  VAL 30  30  30  VAL VAL B . n 
B 1 31  LEU 31  31  31  LEU LEU B . n 
B 1 32  ARG 32  32  32  ARG ARG B . n 
B 1 33  LYS 33  33  33  LYS LYS B . n 
B 1 34  ALA 34  34  34  ALA ALA B . n 
B 1 35  GLY 35  35  35  GLY GLY B . n 
B 1 36  LEU 36  36  36  LEU LEU B . n 
B 1 37  LEU 37  37  37  LEU LEU B . n 
B 1 38  GLU 38  38  38  GLU GLU B . n 
B 1 39  LYS 39  39  39  LYS LYS B . n 
B 1 40  LEU 40  40  40  LEU LEU B . n 
B 1 41  LYS 41  41  41  LYS LYS B . n 
B 1 42  GLU 42  42  42  GLU GLU B . n 
B 1 43  GLN 43  43  43  GLN GLN B . n 
B 1 44  GLU 44  44  44  GLU GLU B . n 
B 1 45  CYS 45  45  45  CYS CYS B . n 
B 1 46  ASP 46  46  46  ASP ASP B . n 
B 1 47  VAL 47  47  47  VAL VAL B . n 
B 1 48  LYS 48  48  48  LYS LYS B . n 
B 1 49  ASP 49  49  49  ASP ASP B . n 
B 1 50  TYR 50  50  50  TYR TYR B . n 
B 1 51  GLY 51  51  51  GLY GLY B . n 
B 1 52  ASP 52  52  52  ASP ASP B . n 
B 1 53  LEU 53  53  53  LEU LEU B . n 
B 1 54  PRO 54  54  54  PRO PRO B . n 
B 1 55  PHE 55  55  55  PHE PHE B . n 
B 1 56  ALA 56  56  56  ALA ALA B . n 
B 1 57  ASP 57  57  57  ASP ASP B . n 
B 1 58  ILE 58  58  58  ILE ILE B . n 
B 1 59  PRO 59  59  59  PRO PRO B . n 
B 1 60  ASN 60  60  60  ASN ASN B . n 
B 1 61  ASP 61  61  61  ASP ASP B . n 
B 1 62  SER 62  62  62  SER SER B . n 
B 1 63  PRO 63  63  63  PRO PRO B . n 
B 1 64  PHE 64  64  64  PHE PHE B . n 
B 1 65  GLN 65  65  65  GLN GLN B . n 
B 1 66  ILE 66  66  66  ILE ILE B . n 
B 1 67  VAL 67  67  67  VAL VAL B . n 
B 1 68  LYS 68  68  68  LYS LYS B . n 
B 1 69  ASN 69  69  69  ASN ASN B . n 
B 1 70  PRO 70  70  70  PRO PRO B . n 
B 1 71  ARG 71  71  71  ARG ARG B . n 
B 1 72  SER 72  72  72  SER SER B . n 
B 1 73  VAL 73  73  73  VAL VAL B . n 
B 1 74  GLY 74  74  74  GLY GLY B . n 
B 1 75  LYS 75  75  75  LYS LYS B . n 
B 1 76  ALA 76  76  76  ALA ALA B . n 
B 1 77  SER 77  77  77  SER SER B . n 
B 1 78  GLU 78  78  78  GLU GLU B . n 
B 1 79  GLN 79  79  79  GLN GLN B . n 
B 1 80  LEU 80  80  80  LEU LEU B . n 
B 1 81  ALA 81  81  81  ALA ALA B . n 
B 1 82  GLY 82  82  82  GLY GLY B . n 
B 1 83  LYS 83  83  83  LYS LYS B . n 
B 1 84  VAL 84  84  84  VAL VAL B . n 
B 1 85  ALA 85  85  85  ALA ALA B . n 
B 1 86  GLU 86  86  86  GLU GLU B . n 
B 1 87  VAL 87  87  87  VAL VAL B . n 
B 1 88  LYS 88  88  88  LYS LYS B . n 
B 1 89  LYS 89  89  89  LYS LYS B . n 
B 1 90  ASN 90  90  90  ASN ASN B . n 
B 1 91  GLY 91  91  91  GLY GLY B . n 
B 1 92  ARG 92  92  92  ARG ARG B . n 
B 1 93  ILE 93  93  93  ILE ILE B . n 
B 1 94  SER 94  94  94  SER SER B . n 
B 1 95  LEU 95  95  95  LEU LEU B . n 
B 1 96  VAL 96  96  96  VAL VAL B . n 
B 1 97  LEU 97  97  97  LEU LEU B . n 
B 1 98  GLY 98  98  98  GLY GLY B . n 
B 1 99  GLY 99  99  99  GLY GLY B . n 
B 1 100 ASP 100 100 100 ASP ASP B . n 
B 1 101 HIS 101 101 101 HIS HIS B . n 
B 1 102 SER 102 102 102 SER SER B . n 
B 1 103 LEU 103 103 103 LEU LEU B . n 
B 1 104 ALA 104 104 104 ALA ALA B . n 
B 1 105 ILE 105 105 105 ILE ILE B . n 
B 1 106 GLY 106 106 106 GLY GLY B . n 
B 1 107 SER 107 107 107 SER SER B . n 
B 1 108 ILE 108 108 108 ILE ILE B . n 
B 1 109 SER 109 109 109 SER SER B . n 
B 1 110 GLY 110 110 110 GLY GLY B . n 
B 1 111 HIS 111 111 111 HIS HIS B . n 
B 1 112 ALA 112 112 112 ALA ALA B . n 
B 1 113 ARG 113 113 113 ARG ARG B . n 
B 1 114 VAL 114 114 114 VAL VAL B . n 
B 1 115 HIS 115 115 115 HIS HIS B . n 
B 1 116 PRO 116 116 116 PRO PRO B . n 
B 1 117 ASP 117 117 117 ASP ASP B . n 
B 1 118 LEU 118 118 118 LEU LEU B . n 
B 1 119 GLY 119 119 119 GLY GLY B . n 
B 1 120 VAL 120 120 120 VAL VAL B . n 
B 1 121 ILE 121 121 121 ILE ILE B . n 
B 1 122 TRP 122 122 122 TRP TRP B . n 
B 1 123 VAL 123 123 123 VAL VAL B . n 
B 1 124 ASP 124 124 124 ASP ASP B . n 
B 1 125 ALA 125 125 125 ALA ALA B . n 
B 1 126 HIS 126 126 126 HIS HIS B . n 
B 1 127 THR 127 127 127 THR THR B . n 
B 1 128 ASP 128 128 128 ASP ASP B . n 
B 1 129 ILE 129 129 129 ILE ILE B . n 
B 1 130 ASN 130 130 130 ASN ASN B . n 
B 1 131 THR 131 131 131 THR THR B . n 
B 1 132 PRO 132 132 132 PRO PRO B . n 
B 1 133 LEU 133 133 133 LEU LEU B . n 
B 1 134 THR 134 134 134 THR THR B . n 
B 1 135 THR 135 135 135 THR THR B . n 
B 1 136 THR 136 136 136 THR THR B . n 
B 1 137 SER 137 137 137 SER SER B . n 
B 1 138 GLY 138 138 138 GLY GLY B . n 
B 1 139 ASN 139 139 139 ASN ASN B . n 
B 1 140 LEU 140 140 140 LEU LEU B . n 
B 1 141 HIS 141 141 141 HIS HIS B . n 
B 1 142 GLY 142 142 142 GLY GLY B . n 
B 1 143 GLN 143 143 143 GLN GLN B . n 
B 1 144 PRO 144 144 144 PRO PRO B . n 
B 1 145 VAL 145 145 145 VAL VAL B . n 
B 1 146 SER 146 146 146 SER SER B . n 
B 1 147 PHE 147 147 147 PHE PHE B . n 
B 1 148 LEU 148 148 148 LEU LEU B . n 
B 1 149 LEU 149 149 149 LEU LEU B . n 
B 1 150 LYS 150 150 150 LYS LYS B . n 
B 1 151 GLU 151 151 151 GLU GLU B . n 
B 1 152 LEU 152 152 152 LEU LEU B . n 
B 1 153 LYS 153 153 153 LYS LYS B . n 
B 1 154 GLY 154 154 154 GLY GLY B . n 
B 1 155 LYS 155 155 155 LYS LYS B . n 
B 1 156 ILE 156 156 156 ILE ILE B . n 
B 1 157 PRO 157 157 157 PRO PRO B . n 
B 1 158 ASP 158 158 158 ASP ASP B . n 
B 1 159 VAL 159 159 159 VAL VAL B . n 
B 1 160 PRO 160 160 160 PRO PRO B . n 
B 1 161 GLY 161 161 161 GLY GLY B . n 
B 1 162 PHE 162 162 162 PHE PHE B . n 
B 1 163 SER 163 163 163 SER SER B . n 
B 1 164 TRP 164 164 164 TRP TRP B . n 
B 1 165 VAL 165 165 165 VAL VAL B . n 
B 1 166 THR 166 166 166 THR THR B . n 
B 1 167 PRO 167 167 167 PRO PRO B . n 
B 1 168 CYS 168 168 168 CYS CYS B . n 
B 1 169 ILE 169 169 169 ILE ILE B . n 
B 1 170 SER 170 170 170 SER SER B . n 
B 1 171 ALA 171 171 171 ALA ALA B . n 
B 1 172 LYS 172 172 172 LYS LYS B . n 
B 1 173 ASP 173 173 173 ASP ASP B . n 
B 1 174 ILE 174 174 174 ILE ILE B . n 
B 1 175 VAL 175 175 175 VAL VAL B . n 
B 1 176 TYR 176 176 176 TYR TYR B . n 
B 1 177 ILE 177 177 177 ILE ILE B . n 
B 1 178 GLY 178 178 178 GLY GLY B . n 
B 1 179 LEU 179 179 179 LEU LEU B . n 
B 1 180 ARG 180 180 180 ARG ARG B . n 
B 1 181 ASP 181 181 181 ASP ASP B . n 
B 1 182 VAL 182 182 182 VAL VAL B . n 
B 1 183 ASP 183 183 183 ASP ASP B . n 
B 1 184 PRO 184 184 184 PRO PRO B . n 
B 1 185 GLY 185 185 185 GLY GLY B . n 
B 1 186 GLU 186 186 186 GLU GLU B . n 
B 1 187 HIS 187 187 187 HIS HIS B . n 
B 1 188 TYR 188 188 188 TYR TYR B . n 
B 1 189 ILE 189 189 189 ILE ILE B . n 
B 1 190 LEU 190 190 190 LEU LEU B . n 
B 1 191 LYS 191 191 191 LYS LYS B . n 
B 1 192 THR 192 192 192 THR THR B . n 
B 1 193 LEU 193 193 193 LEU LEU B . n 
B 1 194 GLY 194 194 194 GLY GLY B . n 
B 1 195 ILE 195 195 195 ILE ILE B . n 
B 1 196 LYS 196 196 196 LYS LYS B . n 
B 1 197 TYR 197 197 197 TYR TYR B . n 
B 1 198 PHE 198 198 198 PHE PHE B . n 
B 1 199 SER 199 199 199 SER SER B . n 
B 1 200 MET 200 200 200 MET MET B . n 
B 1 201 THR 201 201 201 THR THR B . n 
B 1 202 GLU 202 202 202 GLU GLU B . n 
B 1 203 VAL 203 203 203 VAL VAL B . n 
B 1 204 ASP 204 204 204 ASP ASP B . n 
B 1 205 ARG 205 205 205 ARG ARG B . n 
B 1 206 LEU 206 206 206 LEU LEU B . n 
B 1 207 GLY 207 207 207 GLY GLY B . n 
B 1 208 ILE 208 208 208 ILE ILE B . n 
B 1 209 GLY 209 209 209 GLY GLY B . n 
B 1 210 LYS 210 210 210 LYS LYS B . n 
B 1 211 VAL 211 211 211 VAL VAL B . n 
B 1 212 MET 212 212 212 MET MET B . n 
B 1 213 GLU 213 213 213 GLU GLU B . n 
B 1 214 GLU 214 214 214 GLU GLU B . n 
B 1 215 THR 215 215 215 THR THR B . n 
B 1 216 LEU 216 216 216 LEU LEU B . n 
B 1 217 SER 217 217 217 SER SER B . n 
B 1 218 TYR 218 218 218 TYR TYR B . n 
B 1 219 LEU 219 219 219 LEU LEU B . n 
B 1 220 LEU 220 220 220 LEU LEU B . n 
B 1 221 GLY 221 221 221 GLY GLY B . n 
B 1 222 ARG 222 222 222 ARG ARG B . n 
B 1 223 LYS 223 223 223 LYS LYS B . n 
B 1 224 LYS 224 224 224 LYS LYS B . n 
B 1 225 ARG 225 225 225 ARG ARG B . n 
B 1 226 PRO 226 226 226 PRO PRO B . n 
B 1 227 ILE 227 227 227 ILE ILE B . n 
B 1 228 HIS 228 228 228 HIS HIS B . n 
B 1 229 LEU 229 229 229 LEU LEU B . n 
B 1 230 SER 230 230 230 SER SER B . n 
B 1 231 PHE 231 231 231 PHE PHE B . n 
B 1 232 ASP 232 232 232 ASP ASP B . n 
B 1 233 VAL 233 233 233 VAL VAL B . n 
B 1 234 ASP 234 234 234 ASP ASP B . n 
B 1 235 GLY 235 235 235 GLY GLY B . n 
B 1 236 LEU 236 236 236 LEU LEU B . n 
B 1 237 ASP 237 237 237 ASP ASP B . n 
B 1 238 PRO 238 238 238 PRO PRO B . n 
B 1 239 SER 239 239 239 SER SER B . n 
B 1 240 PHE 240 240 240 PHE PHE B . n 
B 1 241 THR 241 241 241 THR THR B . n 
B 1 242 PRO 242 242 242 PRO PRO B . n 
B 1 243 ALA 243 243 243 ALA ALA B . n 
B 1 244 THR 244 244 244 THR THR B . n 
B 1 245 GLY 245 245 245 GLY GLY B . n 
B 1 246 THR 246 246 246 THR THR B . n 
B 1 247 PRO 247 247 247 PRO PRO B . n 
B 1 248 VAL 248 248 248 VAL VAL B . n 
B 1 249 VAL 249 249 249 VAL VAL B . n 
B 1 250 GLY 250 250 250 GLY GLY B . n 
B 1 251 GLY 251 251 251 GLY GLY B . n 
B 1 252 LEU 252 252 252 LEU LEU B . n 
B 1 253 THR 253 253 253 THR THR B . n 
B 1 254 TYR 254 254 254 TYR TYR B . n 
B 1 255 ARG 255 255 255 ARG ARG B . n 
B 1 256 GLU 256 256 256 GLU GLU B . n 
B 1 257 GLY 257 257 257 GLY GLY B . n 
B 1 258 LEU 258 258 258 LEU LEU B . n 
B 1 259 TYR 259 259 259 TYR TYR B . n 
B 1 260 ILE 260 260 260 ILE ILE B . n 
B 1 261 THR 261 261 261 THR THR B . n 
B 1 262 GLU 262 262 262 GLU GLU B . n 
B 1 263 GLU 263 263 263 GLU GLU B . n 
B 1 264 ILE 264 264 264 ILE ILE B . n 
B 1 265 TYR 265 265 265 TYR TYR B . n 
B 1 266 LYS 266 266 266 LYS LYS B . n 
B 1 267 THR 267 267 267 THR THR B . n 
B 1 268 GLY 268 268 268 GLY GLY B . n 
B 1 269 LEU 269 269 269 LEU LEU B . n 
B 1 270 LEU 270 270 270 LEU LEU B . n 
B 1 271 SER 271 271 271 SER SER B . n 
B 1 272 GLY 272 272 272 GLY GLY B . n 
B 1 273 LEU 273 273 273 LEU LEU B . n 
B 1 274 ASP 274 274 274 ASP ASP B . n 
B 1 275 ILE 275 275 275 ILE ILE B . n 
B 1 276 MET 276 276 276 MET MET B . n 
B 1 277 GLU 277 277 277 GLU GLU B . n 
B 1 278 VAL 278 278 278 VAL VAL B . n 
B 1 279 ASN 279 279 279 ASN ASN B . n 
B 1 280 PRO 280 280 280 PRO PRO B . n 
B 1 281 SER 281 281 281 SER SER B . n 
B 1 282 LEU 282 282 282 LEU LEU B . n 
B 1 283 GLY 283 283 283 GLY GLY B . n 
B 1 284 LYS 284 284 284 LYS LYS B . n 
B 1 285 THR 285 285 285 THR THR B . n 
B 1 286 PRO 286 286 286 PRO PRO B . n 
B 1 287 GLU 287 287 287 GLU GLU B . n 
B 1 288 GLU 288 288 288 GLU GLU B . n 
B 1 289 VAL 289 289 289 VAL VAL B . n 
B 1 290 THR 290 290 290 THR THR B . n 
B 1 291 ARG 291 291 291 ARG ARG B . n 
B 1 292 THR 292 292 292 THR THR B . n 
B 1 293 VAL 293 293 293 VAL VAL B . n 
B 1 294 ASN 294 294 294 ASN ASN B . n 
B 1 295 THR 295 295 295 THR THR B . n 
B 1 296 ALA 296 296 296 ALA ALA B . n 
B 1 297 VAL 297 297 297 VAL VAL B . n 
B 1 298 ALA 298 298 298 ALA ALA B . n 
B 1 299 ILE 299 299 299 ILE ILE B . n 
B 1 300 THR 300 300 300 THR THR B . n 
B 1 301 LEU 301 301 301 LEU LEU B . n 
B 1 302 ALA 302 302 302 ALA ALA B . n 
B 1 303 CYS 303 303 303 CYS CYS B . n 
B 1 304 PHE 304 304 304 PHE PHE B . n 
B 1 305 GLY 305 305 305 GLY GLY B . n 
B 1 306 LEU 306 306 306 LEU LEU B . n 
B 1 307 ALA 307 307 307 ALA ALA B . n 
B 1 308 ARG 308 308 308 ARG ARG B . n 
B 1 309 GLU 309 309 309 GLU GLU B . n 
B 1 310 GLY 310 310 310 GLY GLY B . n 
B 1 311 ASN 311 311 311 ASN ASN B . n 
B 1 312 HIS 312 312 312 HIS HIS B . n 
B 1 313 LYS 313 313 313 LYS LYS B . n 
B 1 314 PRO 314 314 ?   ?   ?   B . n 
B 1 315 ILE 315 315 ?   ?   ?   B . n 
B 1 316 ASP 316 316 ?   ?   ?   B . n 
B 1 317 TYR 317 317 ?   ?   ?   B . n 
B 1 318 LEU 318 318 ?   ?   ?   B . n 
B 1 319 ASN 319 319 ?   ?   ?   B . n 
B 1 320 PRO 320 320 ?   ?   ?   B . n 
B 1 321 PRO 321 321 ?   ?   ?   B . n 
B 1 322 LYS 322 322 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 MN  1   2362 2362 MN  MN  A . 
D 2 MN  1   2363 2363 MN  MN  A . 
E 3 ABH 1   551  551  ABH ABH A . 
F 2 MN  1   1362 1362 MN  MN  B . 
G 2 MN  1   1363 1363 MN  MN  B . 
H 3 ABH 1   552  552  ABH ABH B . 
I 4 HOH 1   2364 1    HOH HOH A . 
I 4 HOH 2   2365 5    HOH HOH A . 
I 4 HOH 3   2366 7    HOH HOH A . 
I 4 HOH 4   2367 8    HOH HOH A . 
I 4 HOH 5   2368 9    HOH HOH A . 
I 4 HOH 6   2369 11   HOH HOH A . 
I 4 HOH 7   2370 12   HOH HOH A . 
I 4 HOH 8   2371 13   HOH HOH A . 
I 4 HOH 9   2372 14   HOH HOH A . 
I 4 HOH 10  2373 15   HOH HOH A . 
I 4 HOH 11  2374 16   HOH HOH A . 
I 4 HOH 12  2375 18   HOH HOH A . 
I 4 HOH 13  2376 21   HOH HOH A . 
I 4 HOH 14  2377 22   HOH HOH A . 
I 4 HOH 15  2378 23   HOH HOH A . 
I 4 HOH 16  2379 24   HOH HOH A . 
I 4 HOH 17  2380 29   HOH HOH A . 
I 4 HOH 18  2381 30   HOH HOH A . 
I 4 HOH 19  2382 32   HOH HOH A . 
I 4 HOH 20  2383 33   HOH HOH A . 
I 4 HOH 21  2384 34   HOH HOH A . 
I 4 HOH 22  2385 37   HOH HOH A . 
I 4 HOH 23  2386 40   HOH HOH A . 
I 4 HOH 24  2387 45   HOH HOH A . 
I 4 HOH 25  2388 49   HOH HOH A . 
I 4 HOH 26  2389 50   HOH HOH A . 
I 4 HOH 27  2390 54   HOH HOH A . 
I 4 HOH 28  2391 55   HOH HOH A . 
I 4 HOH 29  2392 58   HOH HOH A . 
I 4 HOH 30  2393 61   HOH HOH A . 
I 4 HOH 31  2394 63   HOH HOH A . 
I 4 HOH 32  2395 64   HOH HOH A . 
I 4 HOH 33  2396 70   HOH HOH A . 
I 4 HOH 34  2397 71   HOH HOH A . 
I 4 HOH 35  2398 72   HOH HOH A . 
I 4 HOH 36  2399 73   HOH HOH A . 
I 4 HOH 37  2400 75   HOH HOH A . 
I 4 HOH 38  2401 77   HOH HOH A . 
I 4 HOH 39  2402 78   HOH HOH A . 
I 4 HOH 40  2403 79   HOH HOH A . 
I 4 HOH 41  2404 81   HOH HOH A . 
I 4 HOH 42  2405 82   HOH HOH A . 
I 4 HOH 43  2406 85   HOH HOH A . 
I 4 HOH 44  2407 86   HOH HOH A . 
I 4 HOH 45  2408 87   HOH HOH A . 
I 4 HOH 46  2409 88   HOH HOH A . 
I 4 HOH 47  2410 89   HOH HOH A . 
I 4 HOH 48  2411 90   HOH HOH A . 
I 4 HOH 49  2412 91   HOH HOH A . 
I 4 HOH 50  2413 92   HOH HOH A . 
I 4 HOH 51  2414 93   HOH HOH A . 
I 4 HOH 52  2415 94   HOH HOH A . 
I 4 HOH 53  2416 95   HOH HOH A . 
I 4 HOH 54  2417 100  HOH HOH A . 
I 4 HOH 55  2418 101  HOH HOH A . 
I 4 HOH 56  2419 102  HOH HOH A . 
I 4 HOH 57  2420 104  HOH HOH A . 
I 4 HOH 58  2421 105  HOH HOH A . 
I 4 HOH 59  2422 106  HOH HOH A . 
I 4 HOH 60  2423 107  HOH HOH A . 
I 4 HOH 61  2424 109  HOH HOH A . 
I 4 HOH 62  2425 110  HOH HOH A . 
I 4 HOH 63  2426 111  HOH HOH A . 
I 4 HOH 64  2427 112  HOH HOH A . 
I 4 HOH 65  2428 115  HOH HOH A . 
I 4 HOH 66  2429 118  HOH HOH A . 
I 4 HOH 67  2430 122  HOH HOH A . 
I 4 HOH 68  2431 123  HOH HOH A . 
I 4 HOH 69  2432 124  HOH HOH A . 
I 4 HOH 70  2433 125  HOH HOH A . 
I 4 HOH 71  2434 126  HOH HOH A . 
I 4 HOH 72  2435 127  HOH HOH A . 
I 4 HOH 73  2436 128  HOH HOH A . 
I 4 HOH 74  2437 130  HOH HOH A . 
I 4 HOH 75  2438 131  HOH HOH A . 
I 4 HOH 76  2439 132  HOH HOH A . 
I 4 HOH 77  2440 134  HOH HOH A . 
I 4 HOH 78  2441 135  HOH HOH A . 
I 4 HOH 79  2442 136  HOH HOH A . 
I 4 HOH 80  2443 138  HOH HOH A . 
I 4 HOH 81  2444 139  HOH HOH A . 
I 4 HOH 82  2445 140  HOH HOH A . 
I 4 HOH 83  2446 144  HOH HOH A . 
I 4 HOH 84  2447 149  HOH HOH A . 
I 4 HOH 85  2448 152  HOH HOH A . 
I 4 HOH 86  2449 153  HOH HOH A . 
I 4 HOH 87  2450 156  HOH HOH A . 
I 4 HOH 88  2451 158  HOH HOH A . 
I 4 HOH 89  2452 160  HOH HOH A . 
I 4 HOH 90  2453 161  HOH HOH A . 
I 4 HOH 91  2454 168  HOH HOH A . 
I 4 HOH 92  2455 169  HOH HOH A . 
I 4 HOH 93  2456 170  HOH HOH A . 
I 4 HOH 94  2457 173  HOH HOH A . 
I 4 HOH 95  2458 175  HOH HOH A . 
I 4 HOH 96  2459 176  HOH HOH A . 
I 4 HOH 97  2460 179  HOH HOH A . 
I 4 HOH 98  2461 180  HOH HOH A . 
I 4 HOH 99  2462 183  HOH HOH A . 
I 4 HOH 100 2463 187  HOH HOH A . 
I 4 HOH 101 2464 188  HOH HOH A . 
I 4 HOH 102 2465 189  HOH HOH A . 
I 4 HOH 103 2466 190  HOH HOH A . 
I 4 HOH 104 2467 191  HOH HOH A . 
I 4 HOH 105 2468 192  HOH HOH A . 
I 4 HOH 106 2469 193  HOH HOH A . 
I 4 HOH 107 2470 195  HOH HOH A . 
I 4 HOH 108 2471 196  HOH HOH A . 
I 4 HOH 109 2472 197  HOH HOH A . 
I 4 HOH 110 2473 199  HOH HOH A . 
I 4 HOH 111 2474 201  HOH HOH A . 
I 4 HOH 112 2475 206  HOH HOH A . 
I 4 HOH 113 2476 207  HOH HOH A . 
I 4 HOH 114 2477 208  HOH HOH A . 
I 4 HOH 115 2478 209  HOH HOH A . 
I 4 HOH 116 2479 213  HOH HOH A . 
I 4 HOH 117 2480 214  HOH HOH A . 
I 4 HOH 118 2481 215  HOH HOH A . 
I 4 HOH 119 2482 217  HOH HOH A . 
I 4 HOH 120 2483 219  HOH HOH A . 
I 4 HOH 121 2484 220  HOH HOH A . 
I 4 HOH 122 2485 222  HOH HOH A . 
I 4 HOH 123 2486 226  HOH HOH A . 
I 4 HOH 124 2487 228  HOH HOH A . 
I 4 HOH 125 2488 230  HOH HOH A . 
I 4 HOH 126 2489 231  HOH HOH A . 
I 4 HOH 127 2490 232  HOH HOH A . 
I 4 HOH 128 2491 234  HOH HOH A . 
I 4 HOH 129 2492 237  HOH HOH A . 
I 4 HOH 130 2493 240  HOH HOH A . 
I 4 HOH 131 2494 243  HOH HOH A . 
I 4 HOH 132 2495 244  HOH HOH A . 
I 4 HOH 133 2496 245  HOH HOH A . 
I 4 HOH 134 2497 246  HOH HOH A . 
I 4 HOH 135 2498 249  HOH HOH A . 
I 4 HOH 136 2499 251  HOH HOH A . 
I 4 HOH 137 2500 253  HOH HOH A . 
I 4 HOH 138 2501 254  HOH HOH A . 
I 4 HOH 139 2502 256  HOH HOH A . 
I 4 HOH 140 2503 261  HOH HOH A . 
I 4 HOH 141 2504 262  HOH HOH A . 
I 4 HOH 142 2505 263  HOH HOH A . 
I 4 HOH 143 2506 265  HOH HOH A . 
I 4 HOH 144 2507 268  HOH HOH A . 
I 4 HOH 145 2508 270  HOH HOH A . 
I 4 HOH 146 2509 272  HOH HOH A . 
I 4 HOH 147 2510 274  HOH HOH A . 
I 4 HOH 148 2511 275  HOH HOH A . 
I 4 HOH 149 2512 276  HOH HOH A . 
I 4 HOH 150 2513 278  HOH HOH A . 
I 4 HOH 151 2514 281  HOH HOH A . 
I 4 HOH 152 2515 282  HOH HOH A . 
I 4 HOH 153 2516 284  HOH HOH A . 
I 4 HOH 154 2517 285  HOH HOH A . 
I 4 HOH 155 2518 287  HOH HOH A . 
I 4 HOH 156 2519 289  HOH HOH A . 
I 4 HOH 157 2520 294  HOH HOH A . 
I 4 HOH 158 2521 297  HOH HOH A . 
I 4 HOH 159 2522 298  HOH HOH A . 
I 4 HOH 160 2523 299  HOH HOH A . 
I 4 HOH 161 2524 300  HOH HOH A . 
I 4 HOH 162 2525 301  HOH HOH A . 
I 4 HOH 163 2526 303  HOH HOH A . 
I 4 HOH 164 2527 304  HOH HOH A . 
I 4 HOH 165 2528 306  HOH HOH A . 
I 4 HOH 166 2529 307  HOH HOH A . 
I 4 HOH 167 2530 308  HOH HOH A . 
I 4 HOH 168 2531 309  HOH HOH A . 
I 4 HOH 169 2532 310  HOH HOH A . 
I 4 HOH 170 2533 311  HOH HOH A . 
I 4 HOH 171 2534 312  HOH HOH A . 
I 4 HOH 172 2535 314  HOH HOH A . 
I 4 HOH 173 2536 315  HOH HOH A . 
I 4 HOH 174 2537 316  HOH HOH A . 
I 4 HOH 175 2538 318  HOH HOH A . 
I 4 HOH 176 2539 321  HOH HOH A . 
I 4 HOH 177 2540 324  HOH HOH A . 
I 4 HOH 178 2541 325  HOH HOH A . 
I 4 HOH 179 2542 326  HOH HOH A . 
I 4 HOH 180 2543 327  HOH HOH A . 
I 4 HOH 181 2544 328  HOH HOH A . 
I 4 HOH 182 2545 329  HOH HOH A . 
I 4 HOH 183 2546 331  HOH HOH A . 
I 4 HOH 184 2547 333  HOH HOH A . 
I 4 HOH 185 2548 334  HOH HOH A . 
I 4 HOH 186 2549 337  HOH HOH A . 
I 4 HOH 187 2550 339  HOH HOH A . 
I 4 HOH 188 2551 340  HOH HOH A . 
I 4 HOH 189 2552 342  HOH HOH A . 
I 4 HOH 190 2553 343  HOH HOH A . 
I 4 HOH 191 2554 344  HOH HOH A . 
I 4 HOH 192 2555 346  HOH HOH A . 
I 4 HOH 193 2556 347  HOH HOH A . 
I 4 HOH 194 2557 349  HOH HOH A . 
I 4 HOH 195 2558 352  HOH HOH A . 
I 4 HOH 196 2559 353  HOH HOH A . 
I 4 HOH 197 2560 355  HOH HOH A . 
I 4 HOH 198 2561 356  HOH HOH A . 
I 4 HOH 199 2562 357  HOH HOH A . 
I 4 HOH 200 2563 359  HOH HOH A . 
I 4 HOH 201 2564 361  HOH HOH A . 
I 4 HOH 202 2565 362  HOH HOH A . 
I 4 HOH 203 2566 363  HOH HOH A . 
I 4 HOH 204 2567 364  HOH HOH A . 
I 4 HOH 205 2568 367  HOH HOH A . 
I 4 HOH 206 2569 368  HOH HOH A . 
I 4 HOH 207 2570 369  HOH HOH A . 
I 4 HOH 208 2571 371  HOH HOH A . 
I 4 HOH 209 2572 372  HOH HOH A . 
I 4 HOH 210 2573 373  HOH HOH A . 
I 4 HOH 211 2574 374  HOH HOH A . 
I 4 HOH 212 2575 376  HOH HOH A . 
I 4 HOH 213 2576 378  HOH HOH A . 
I 4 HOH 214 2577 379  HOH HOH A . 
I 4 HOH 215 2578 380  HOH HOH A . 
I 4 HOH 216 2579 382  HOH HOH A . 
I 4 HOH 217 2580 383  HOH HOH A . 
I 4 HOH 218 2581 384  HOH HOH A . 
J 4 HOH 1   1364 2    HOH HOH B . 
J 4 HOH 2   1365 3    HOH HOH B . 
J 4 HOH 3   1366 4    HOH HOH B . 
J 4 HOH 4   1367 6    HOH HOH B . 
J 4 HOH 5   1368 10   HOH HOH B . 
J 4 HOH 6   1369 17   HOH HOH B . 
J 4 HOH 7   1370 19   HOH HOH B . 
J 4 HOH 8   1371 20   HOH HOH B . 
J 4 HOH 9   1372 25   HOH HOH B . 
J 4 HOH 10  1373 26   HOH HOH B . 
J 4 HOH 11  1374 27   HOH HOH B . 
J 4 HOH 12  1375 28   HOH HOH B . 
J 4 HOH 13  1376 31   HOH HOH B . 
J 4 HOH 14  1377 35   HOH HOH B . 
J 4 HOH 15  1378 36   HOH HOH B . 
J 4 HOH 16  1379 38   HOH HOH B . 
J 4 HOH 17  1380 39   HOH HOH B . 
J 4 HOH 18  1381 41   HOH HOH B . 
J 4 HOH 19  1382 42   HOH HOH B . 
J 4 HOH 20  1383 43   HOH HOH B . 
J 4 HOH 21  1384 44   HOH HOH B . 
J 4 HOH 22  1385 46   HOH HOH B . 
J 4 HOH 23  1386 47   HOH HOH B . 
J 4 HOH 24  1387 48   HOH HOH B . 
J 4 HOH 25  1388 51   HOH HOH B . 
J 4 HOH 26  1389 52   HOH HOH B . 
J 4 HOH 27  1390 53   HOH HOH B . 
J 4 HOH 28  1391 56   HOH HOH B . 
J 4 HOH 29  1392 57   HOH HOH B . 
J 4 HOH 30  1393 59   HOH HOH B . 
J 4 HOH 31  1394 60   HOH HOH B . 
J 4 HOH 32  1395 62   HOH HOH B . 
J 4 HOH 33  1396 65   HOH HOH B . 
J 4 HOH 34  1397 66   HOH HOH B . 
J 4 HOH 35  1398 67   HOH HOH B . 
J 4 HOH 36  1399 68   HOH HOH B . 
J 4 HOH 37  1400 69   HOH HOH B . 
J 4 HOH 38  1401 74   HOH HOH B . 
J 4 HOH 39  1402 76   HOH HOH B . 
J 4 HOH 40  1403 80   HOH HOH B . 
J 4 HOH 41  1404 83   HOH HOH B . 
J 4 HOH 42  1405 84   HOH HOH B . 
J 4 HOH 43  1406 96   HOH HOH B . 
J 4 HOH 44  1407 97   HOH HOH B . 
J 4 HOH 45  1408 98   HOH HOH B . 
J 4 HOH 46  1409 99   HOH HOH B . 
J 4 HOH 47  1410 103  HOH HOH B . 
J 4 HOH 48  1411 108  HOH HOH B . 
J 4 HOH 49  1412 113  HOH HOH B . 
J 4 HOH 50  1413 114  HOH HOH B . 
J 4 HOH 51  1414 116  HOH HOH B . 
J 4 HOH 52  1415 117  HOH HOH B . 
J 4 HOH 53  1416 119  HOH HOH B . 
J 4 HOH 54  1417 120  HOH HOH B . 
J 4 HOH 55  1418 121  HOH HOH B . 
J 4 HOH 56  1419 129  HOH HOH B . 
J 4 HOH 57  1420 133  HOH HOH B . 
J 4 HOH 58  1421 137  HOH HOH B . 
J 4 HOH 59  1422 141  HOH HOH B . 
J 4 HOH 60  1423 142  HOH HOH B . 
J 4 HOH 61  1424 143  HOH HOH B . 
J 4 HOH 62  1425 145  HOH HOH B . 
J 4 HOH 63  1426 146  HOH HOH B . 
J 4 HOH 64  1427 147  HOH HOH B . 
J 4 HOH 65  1428 148  HOH HOH B . 
J 4 HOH 66  1429 150  HOH HOH B . 
J 4 HOH 67  1430 151  HOH HOH B . 
J 4 HOH 68  1431 154  HOH HOH B . 
J 4 HOH 69  1432 155  HOH HOH B . 
J 4 HOH 70  1433 157  HOH HOH B . 
J 4 HOH 71  1434 159  HOH HOH B . 
J 4 HOH 72  1435 162  HOH HOH B . 
J 4 HOH 73  1436 163  HOH HOH B . 
J 4 HOH 74  1437 164  HOH HOH B . 
J 4 HOH 75  1438 165  HOH HOH B . 
J 4 HOH 76  1439 166  HOH HOH B . 
J 4 HOH 77  1440 167  HOH HOH B . 
J 4 HOH 78  1441 171  HOH HOH B . 
J 4 HOH 79  1442 172  HOH HOH B . 
J 4 HOH 80  1443 174  HOH HOH B . 
J 4 HOH 81  1444 177  HOH HOH B . 
J 4 HOH 82  1445 178  HOH HOH B . 
J 4 HOH 83  1446 181  HOH HOH B . 
J 4 HOH 84  1447 182  HOH HOH B . 
J 4 HOH 85  1448 184  HOH HOH B . 
J 4 HOH 86  1449 185  HOH HOH B . 
J 4 HOH 87  1450 186  HOH HOH B . 
J 4 HOH 88  1451 194  HOH HOH B . 
J 4 HOH 89  1452 198  HOH HOH B . 
J 4 HOH 90  1453 200  HOH HOH B . 
J 4 HOH 91  1454 202  HOH HOH B . 
J 4 HOH 92  1455 203  HOH HOH B . 
J 4 HOH 93  1456 204  HOH HOH B . 
J 4 HOH 94  1457 205  HOH HOH B . 
J 4 HOH 95  1458 210  HOH HOH B . 
J 4 HOH 96  1459 211  HOH HOH B . 
J 4 HOH 97  1460 212  HOH HOH B . 
J 4 HOH 98  1461 216  HOH HOH B . 
J 4 HOH 99  1462 218  HOH HOH B . 
J 4 HOH 100 1463 221  HOH HOH B . 
J 4 HOH 101 1464 223  HOH HOH B . 
J 4 HOH 102 1465 224  HOH HOH B . 
J 4 HOH 103 1466 225  HOH HOH B . 
J 4 HOH 104 1467 227  HOH HOH B . 
J 4 HOH 105 1468 229  HOH HOH B . 
J 4 HOH 106 1469 233  HOH HOH B . 
J 4 HOH 107 1470 235  HOH HOH B . 
J 4 HOH 108 1471 236  HOH HOH B . 
J 4 HOH 109 1472 238  HOH HOH B . 
J 4 HOH 110 1473 239  HOH HOH B . 
J 4 HOH 111 1474 241  HOH HOH B . 
J 4 HOH 112 1475 242  HOH HOH B . 
J 4 HOH 113 1476 247  HOH HOH B . 
J 4 HOH 114 1477 248  HOH HOH B . 
J 4 HOH 115 1478 250  HOH HOH B . 
J 4 HOH 116 1479 252  HOH HOH B . 
J 4 HOH 117 1480 255  HOH HOH B . 
J 4 HOH 118 1481 257  HOH HOH B . 
J 4 HOH 119 1482 258  HOH HOH B . 
J 4 HOH 120 1483 259  HOH HOH B . 
J 4 HOH 121 1484 260  HOH HOH B . 
J 4 HOH 122 1485 264  HOH HOH B . 
J 4 HOH 123 1486 266  HOH HOH B . 
J 4 HOH 124 1487 267  HOH HOH B . 
J 4 HOH 125 1488 269  HOH HOH B . 
J 4 HOH 126 1489 271  HOH HOH B . 
J 4 HOH 127 1490 273  HOH HOH B . 
J 4 HOH 128 1491 277  HOH HOH B . 
J 4 HOH 129 1492 279  HOH HOH B . 
J 4 HOH 130 1493 280  HOH HOH B . 
J 4 HOH 131 1494 283  HOH HOH B . 
J 4 HOH 132 1495 286  HOH HOH B . 
J 4 HOH 133 1496 288  HOH HOH B . 
J 4 HOH 134 1497 290  HOH HOH B . 
J 4 HOH 135 1498 291  HOH HOH B . 
J 4 HOH 136 1499 292  HOH HOH B . 
J 4 HOH 137 1500 293  HOH HOH B . 
J 4 HOH 138 1501 295  HOH HOH B . 
J 4 HOH 139 1502 296  HOH HOH B . 
J 4 HOH 140 1503 302  HOH HOH B . 
J 4 HOH 141 1504 305  HOH HOH B . 
J 4 HOH 142 1505 313  HOH HOH B . 
J 4 HOH 143 1506 317  HOH HOH B . 
J 4 HOH 144 1507 319  HOH HOH B . 
J 4 HOH 145 1508 320  HOH HOH B . 
J 4 HOH 146 1509 322  HOH HOH B . 
J 4 HOH 147 1510 323  HOH HOH B . 
J 4 HOH 148 1511 330  HOH HOH B . 
J 4 HOH 149 1512 332  HOH HOH B . 
J 4 HOH 150 1513 335  HOH HOH B . 
J 4 HOH 151 1514 336  HOH HOH B . 
J 4 HOH 152 1515 338  HOH HOH B . 
J 4 HOH 153 1516 341  HOH HOH B . 
J 4 HOH 154 1517 345  HOH HOH B . 
J 4 HOH 155 1518 348  HOH HOH B . 
J 4 HOH 156 1519 350  HOH HOH B . 
J 4 HOH 157 1520 351  HOH HOH B . 
J 4 HOH 158 1521 354  HOH HOH B . 
J 4 HOH 159 1522 358  HOH HOH B . 
J 4 HOH 160 1523 360  HOH HOH B . 
J 4 HOH 161 1524 365  HOH HOH B . 
J 4 HOH 162 1525 366  HOH HOH B . 
J 4 HOH 163 1526 370  HOH HOH B . 
J 4 HOH 164 1527 375  HOH HOH B . 
J 4 HOH 165 1528 377  HOH HOH B . 
J 4 HOH 166 1529 381  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2,3 A,C,D,E,I 
2 1,4,5 B,F,G,H,J 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z         1.0000000000  0.0000000000  0.0000000000 0.0000000000  0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_655 -y+1,x-y,z    -0.5000000000 -0.8660254038 0.0000000000 91.4220000000 0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038  0.0000000000 45.7110000000 -0.8660254038 
-0.5000000000 0.0000000000 79.1737744648 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 2_555 -y,x-y,z      -0.5000000000 -0.8660254038 0.0000000000 0.0000000000  0.8660254038  
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
5 'crystal symmetry operation' 3_555 -x+y,-x,z     -0.5000000000 0.8660254038  0.0000000000 0.0000000000  -0.8660254038 
-0.5000000000 0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 2518 ? I HOH . 
2 1 B HOH 1523 ? J HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD1 ? A ASP 234 ? A ASP 234 ? 1_555 91.6  ? 
2  ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD1 ? A ASP 124 ? A ASP 124 ? 1_555 93.9  ? 
3  OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD1 ? A ASP 124 ? A ASP 124 ? 1_555 135.1 ? 
4  ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 96.8  ? 
5  OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 55.7  ? 
6  OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 79.5  ? 
7  ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O1  ? E ABH .   ? A ABH 551 ? 1_555 94.6  ? 
8  OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O1  ? E ABH .   ? A ABH 551 ? 1_555 130.3 ? 
9  OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O1  ? E ABH .   ? A ABH 551 ? 1_555 93.5  ? 
10 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O1  ? E ABH .   ? A ABH 551 ? 1_555 167.0 ? 
11 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 172.2 ? 
12 OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 93.5  ? 
13 OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 86.6  ? 
14 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 90.9  ? 
15 O1  ? E ABH .   ? A ABH 551 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 77.6  ? 
16 ND1 ? A HIS 126 ? A HIS 126 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O3  ? E ABH .   ? A ABH 551 ? 1_555 104.4 ? 
17 OD1 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O3  ? E ABH .   ? A ABH 551 ? 1_555 76.9  ? 
18 OD1 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O3  ? E ABH .   ? A ABH 551 ? 1_555 143.1 ? 
19 OD2 ? A ASP 234 ? A ASP 234 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O3  ? E ABH .   ? A ABH 551 ? 1_555 128.3 ? 
20 O1  ? E ABH .   ? A ABH 551 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O3  ? E ABH .   ? A ABH 551 ? 1_555 53.8  ? 
21 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 MN ? C MN . ? A MN 2362 ? 1_555 O3  ? E ABH .   ? A ABH 551 ? 1_555 71.2  ? 
22 O2  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 O1  ? E ABH .   ? A ABH 551 ? 1_555 61.0  ? 
23 O2  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 159.1 ? 
24 O1  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 98.2  ? 
25 O2  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 90.7  ? 
26 O1  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 93.1  ? 
27 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 87.7  ? 
28 O2  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 90.9  ? 
29 O1  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 76.8  ? 
30 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 86.4  ? 
31 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 167.5 ? 
32 O2  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 105.8 ? 
33 O1  ? E ABH .   ? A ABH 551 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 166.7 ? 
34 OD2 ? A ASP 124 ? A ASP 124 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 95.0  ? 
35 OD2 ? A ASP 128 ? A ASP 128 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 88.0  ? 
36 OD2 ? A ASP 232 ? A ASP 232 ? 1_555 MN ? D MN . ? A MN 2363 ? 1_555 ND1 ? A HIS 101 ? A HIS 101 ? 1_555 103.5 ? 
37 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 109.0 ? 
38 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O3  ? H ABH .   ? B ABH 552 ? 1_555 101.4 ? 
39 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O3  ? H ABH .   ? B ABH 552 ? 1_555 126.5 ? 
40 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 94.6  ? 
41 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 79.1  ? 
42 O3  ? H ABH .   ? B ABH 552 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 141.3 ? 
43 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 170.3 ? 
44 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 80.6  ? 
45 O3  ? H ABH .   ? B ABH 552 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 73.0  ? 
46 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 85.6  ? 
47 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 95.7  ? 
48 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 153.7 ? 
49 O3  ? H ABH .   ? B ABH 552 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 53.5  ? 
50 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 90.2  ? 
51 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 74.6  ? 
52 ND1 ? B HIS 126 ? B HIS 126 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 93.1  ? 
53 OD1 ? B ASP 234 ? B ASP 234 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 58.3  ? 
54 O3  ? H ABH .   ? B ABH 552 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 77.5  ? 
55 OD1 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 136.9 ? 
56 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 93.4  ? 
57 O1  ? H ABH .   ? B ABH 552 ? 1_555 MN ? F MN . ? B MN 1362 ? 1_555 OD2 ? B ASP 234 ? B ASP 234 ? 1_555 131.0 ? 
58 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 89.3  ? 
59 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 O2  ? H ABH .   ? B ABH 552 ? 1_555 160.3 ? 
60 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 O2  ? H ABH .   ? B ABH 552 ? 1_555 89.9  ? 
61 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 84.8  ? 
62 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 167.5 ? 
63 O2  ? H ABH .   ? B ABH 552 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 91.9  ? 
64 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 100.4 ? 
65 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 78.1  ? 
66 O2  ? H ABH .   ? B ABH 552 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 60.3  ? 
67 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 O1  ? H ABH .   ? B ABH 552 ? 1_555 92.0  ? 
68 OD2 ? B ASP 124 ? B ASP 124 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 94.7  ? 
69 OD2 ? B ASP 232 ? B ASP 232 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 103.7 ? 
70 O2  ? H ABH .   ? B ABH 552 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 104.6 ? 
71 OD1 ? B ASP 128 ? B ASP 128 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 87.8  ? 
72 O1  ? H ABH .   ? B ABH 552 ? 1_555 MN ? G MN . ? B MN 1363 ? 1_555 ND1 ? B HIS 101 ? B HIS 101 ? 1_555 164.8 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2005-09-06 
2 'Structure model' 1 1 2008-04-30 
3 'Structure model' 1 2 2011-07-13 
4 'Structure model' 1 3 2011-07-27 
5 'Structure model' 1 4 2013-04-03 
6 'Structure model' 1 5 2018-03-07 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Non-polymer description'   
3 3 'Structure model' 'Version format compliance' 
4 4 'Structure model' 'Version format compliance' 
5 5 'Structure model' Other                       
6 6 'Structure model' 'Experimental preparation'  
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    6 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            exptl_crystal_grow 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 6 'Structure model' '_exptl_crystal_grow.method'       
2 6 'Structure model' '_exptl_crystal_grow.pdbx_details' 
3 6 'Structure model' '_exptl_crystal_grow.temp'         
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
_software.date 
_software.type 
_software.location 
_software.language 
HKL-2000  'data collection' . ? 1 ? ? ? ? 
SCALEPACK 'data scaling'    . ? 2 ? ? ? ? 
CNS       refinement        . ? 3 ? ? ? ? 
SHELXL-97 refinement        . ? 4 ? ? ? ? 
HKL-2000  'data reduction'  . ? 5 ? ? ? ? 
CNS       phasing           . ? 6 ? ? ? ? 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 CD  A ARG 6   ? ? NE  A ARG 6   ? ? CZ  A ARG 6   ? ? 133.70 123.60 10.10 1.40 N 
2  1 CD  A ARG 92  ? ? NE  A ARG 92  ? ? CZ  A ARG 92  ? ? 135.52 123.60 11.92 1.40 N 
3  1 NE  A ARG 92  ? ? CZ  A ARG 92  ? ? NH1 A ARG 92  ? ? 124.36 120.30 4.06  0.50 N 
4  1 CB  A HIS 111 ? ? CG  A HIS 111 ? ? CD2 A HIS 111 ? ? 140.20 131.40 8.80  1.20 N 
5  1 CG  A HIS 111 ? ? ND1 A HIS 111 ? ? CE1 A HIS 111 ? ? 118.71 109.00 9.71  1.00 N 
6  1 C   A SER 137 ? ? N   A GLY 138 ? ? CA  A GLY 138 ? ? 136.34 122.30 14.04 2.10 Y 
7  1 N   A LYS 153 ? ? CA  A LYS 153 ? ? CB  A LYS 153 ? B 121.62 110.60 11.02 1.80 N 
8  1 CG  A HIS 187 ? ? ND1 A HIS 187 ? ? CE1 A HIS 187 ? ? 115.02 109.00 6.02  1.00 N 
9  1 CD  A ARG 205 ? ? NE  A ARG 205 ? ? CZ  A ARG 205 ? ? 134.23 123.60 10.63 1.40 N 
10 1 NE  A ARG 222 ? ? CZ  A ARG 222 ? ? NH1 A ARG 222 ? ? 123.50 120.30 3.20  0.50 N 
11 1 CD  A ARG 225 ? ? NE  A ARG 225 ? ? CZ  A ARG 225 ? ? 133.53 123.60 9.93  1.40 N 
12 1 NE  A ARG 225 ? ? CZ  A ARG 225 ? ? NH1 A ARG 225 ? ? 123.46 120.30 3.16  0.50 N 
13 1 NE  A ARG 225 ? ? CZ  A ARG 225 ? ? NH2 A ARG 225 ? ? 115.67 120.30 -4.63 0.50 N 
14 1 CG  A HIS 228 ? ? ND1 A HIS 228 ? ? CE1 A HIS 228 ? ? 119.80 109.00 10.80 1.00 N 
15 1 ND1 A HIS 228 ? ? CE1 A HIS 228 ? ? NE2 A HIS 228 ? ? 100.93 108.50 -7.57 1.10 N 
16 1 CB  A ASP 234 ? ? CG  A ASP 234 ? ? OD1 A ASP 234 ? ? 124.76 118.30 6.46  0.90 N 
17 1 CB  A PHE 240 ? ? CG  A PHE 240 ? ? CD1 A PHE 240 ? ? 116.31 120.80 -4.49 0.70 N 
18 1 NE  A ARG 255 ? ? CZ  A ARG 255 ? ? NH1 A ARG 255 ? ? 126.86 120.30 6.56  0.50 N 
19 1 NE  A ARG 291 ? ? CZ  A ARG 291 ? ? NH1 A ARG 291 ? ? 125.52 120.30 5.22  0.50 N 
20 1 CG  A HIS 312 ? ? ND1 A HIS 312 ? ? CE1 A HIS 312 ? ? 117.97 109.00 8.97  1.00 N 
21 1 NE  B ARG 21  ? ? CZ  B ARG 21  ? ? NH1 B ARG 21  ? ? 124.22 120.30 3.92  0.50 N 
22 1 CB  B TYR 50  ? ? CG  B TYR 50  ? ? CD2 B TYR 50  ? ? 125.17 121.00 4.17  0.60 N 
23 1 CD  B ARG 92  ? ? NE  B ARG 92  ? ? CZ  B ARG 92  ? ? 134.13 123.60 10.53 1.40 N 
24 1 NE  B ARG 92  ? ? CZ  B ARG 92  ? ? NH1 B ARG 92  ? ? 124.37 120.30 4.07  0.50 N 
25 1 CG  B HIS 111 ? ? ND1 B HIS 111 ? ? CE1 B HIS 111 ? ? 116.68 109.00 7.68  1.00 N 
26 1 NE  B ARG 180 ? ? CZ  B ARG 180 ? ? NH1 B ARG 180 ? ? 123.81 120.30 3.51  0.50 N 
27 1 CB  B TYR 188 ? ? CG  B TYR 188 ? ? CD1 B TYR 188 ? ? 116.59 121.00 -4.41 0.60 N 
28 1 CB  B TYR 197 ? ? CG  B TYR 197 ? ? CD1 B TYR 197 ? ? 125.38 121.00 4.38  0.60 N 
29 1 CG  B HIS 228 ? ? ND1 B HIS 228 ? ? CE1 B HIS 228 ? ? 117.67 109.00 8.67  1.00 N 
30 1 CB  B TYR 259 ? ? CG  B TYR 259 ? ? CD1 B TYR 259 ? ? 117.18 121.00 -3.82 0.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 61  ? ? -153.39 65.15   
2  1 GLN A 65  ? ? 51.10   -118.26 
3  1 ASP A 124 ? ? -171.65 148.03  
4  1 ARG A 180 ? ? -156.88 8.63    
5  1 ASP A 181 ? ? -151.20 78.05   
6  1 ARG B 6   ? ? -150.17 85.09   
7  1 GLN B 43  ? ? -100.61 -151.82 
8  1 GLN B 65  ? ? 46.07   -120.67 
9  1 ASP B 124 ? ? -172.30 149.38  
10 1 ARG B 180 ? ? -155.80 8.63    
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 GLU A 44 ? ? CYS A 45 ? ? -141.39 
2 1 GLU B 44 ? ? CYS B 45 ? ? -143.62 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 1   ? A MET 1   
2  1 Y 1 A SER 2   ? A SER 2   
3  1 Y 1 A ALA 3   ? A ALA 3   
4  1 Y 1 A LYS 4   ? A LYS 4   
5  1 Y 1 A ASN 319 ? A ASN 319 
6  1 Y 1 A PRO 320 ? A PRO 320 
7  1 Y 1 A PRO 321 ? A PRO 321 
8  1 Y 1 A LYS 322 ? A LYS 322 
9  1 Y 1 B MET 1   ? B MET 1   
10 1 Y 1 B SER 2   ? B SER 2   
11 1 Y 1 B ALA 3   ? B ALA 3   
12 1 Y 1 B LYS 4   ? B LYS 4   
13 1 Y 1 B PRO 314 ? B PRO 314 
14 1 Y 1 B ILE 315 ? B ILE 315 
15 1 Y 1 B ASP 316 ? B ASP 316 
16 1 Y 1 B TYR 317 ? B TYR 317 
17 1 Y 1 B LEU 318 ? B LEU 318 
18 1 Y 1 B ASN 319 ? B ASN 319 
19 1 Y 1 B PRO 320 ? B PRO 320 
20 1 Y 1 B PRO 321 ? B PRO 321 
21 1 Y 1 B LYS 322 ? B LYS 322 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'MANGANESE (II) ION'               MN  
3 '2(S)-AMINO-6-BORONOHEXANOIC ACID' ABH 
4 water                              HOH 
#